4LOLA

Crystal structure of msting in complex with dmxaa
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
178
Chain Sequence
VAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDSFSLSQEVLRHIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analysis of STING Activation by c[G(2',5')pA(3',5')p] and Targeting by Antiviral DMXAA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Stimulator of interferon genes protein
total genus 50
structure length 178
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lolA02
4EMUA 5CFQA 5CFMA 5BQXA 4QXQA 4EF4A 4F5EA 4LOLA 4KBYA 4LOHA 4F5DA 5CFPA 4LOKA 5CFNA 4QXOA 4JC5A 4EF5A 5CFLA 4KSYA 4YP1A 4EMTA 4F5WA 5CFRA 4LOIA 4QXRA 4F5YA 4KC0A 4LOJA 4QXPA 4F9EA 5CFOA 4F9GA
chains in the Genus database with same CATH superfamily
1V39A 3OMLA 4KDFA 3LUHA 1IB6A 5MN4A 1RLTA 1UK7A 4IICA 1XQVA 2J0EA 2W90A 4HZIA 3U9SA 1VKJA 3DEZA 1C41A 3HCDA 3GRFA 1NXXA 3NO4A 2IUTA 1JL3A 1H3NA 3GLTA 3I0NA 4HB2A 3UKJA 4AKTA 2OAGA 5JRDS 3U1BA 1RZRD 5DM0A 1PKXA 3WOVA 4Y1EA 2NVWA 4P4TA 2DR3A 4K5QA 1EBBA 3A25A 4L5IA 4I4IA 1UBNA 2R8ZA 3SKYA 4OK3A 1L7BA 4N0EA 5LQMA 5A0TA 3V7WA 2W8BB 5HR5A 3E1SA 3OZ7A 3D7RA 5IC4A 1VKRA 4Z0TA 2JFNA 4XQEA 1C1HA 2DY1A 4CM4A 5KWVA 1NVMB 1CR6A 1JQDA 5HHTA 2I6SA 4WKCA 5J4HA 2GQ0A 2HL6A 4NQRA 4I55B 4TMVA 5BNZA 3DPIA 1AQIA 1WHTA 4LWZA 2BBSA 2LR0A 3GRZA 1EGAA 2UUAB 2ISQA 4TM7A 5FL3A 4WNAA 3QW2A 5FPHA 3T99A 1X2EA 5CA0B 3D2BA 2OBBA 3RBZA 4RV9A 2PD3A 1CQPA 1XIVA 1HDEA 2YV3A 3KQYA 2B1JA 3EXIA 4G24A 1XC7A 4DPKA 3GI1A 4MEBA 1LW7A 4D56A 4AP5A 3VVBA 2JKVA 3H8SA 3K8YA 1NSTA 3OM9A 3WO0A 3Q98A 4FD3A 1IUOA 4RA9B 4X1OA 5T7BA 3KX2A 3M6UA 2WMYA 1FNMA 5GTDA 1XZGA 4H6VA 1YL6A 1Y4AE 1QE3A 2UKDA 4A10A 3DKIA 1Q19A 4V0NA 4LJRA 1XNJA 4OHPA 3WTCA 1L7RA 2BDEA 2DBZA 2IF0A 5K0SA 2I2XB 1SVIA 1IZ0A 1FYEA 2DUJA 2ZR0A 3FCSB 1GG2A 3FW1A 4CLOB 3T1TA 3QLVC 1ZG3A 3ZY4A 3GEBA 5G2OA 3ETCA 1ZC4A 1GKIA 4AG3A 2WY2D 4R1SA 2DHCA 1TK2A 3V42A 1ST3A 2REQA 2A86A 4I1YA 1PNVA 5LZ4A 1GGNA 1D2GA 2G25A 2QN2A 3F96A 3P0HA 5E7IA 3B2EA 4ZAFA 1Z6ZA 1R5NA 3A6JA 4TWAA 5B3LA 2J08A 4FBMA 2HRDA 2O5RA 4KUHA 3HBJA 5LOVF 3EXHA 3H11A 1CXZA 5CTAA 1LFDB 3AEKB 3H9GA 3QLJA 2WQ6A 1IHOA 3UATA 1BJRE 1E69A 3SWWA 3M1YA 3VHRA 5LU9A 1UUFA 1FJ2A 5ALYA 5IP5A 5LP6B 4R05A 5AKHA 1KDVA 4H6PA 1N25A 3I2HA 3MT7A 2PE5A 2G9VA 5IKOA 3WIDA 1BW9A 1FU4A 1E3TA 4GGPA 4TUYA 1OY1A 1U0SY 3H1TA 5E7JA 3NC0C 5TPWB 1YZQA 4M1ZA 4D26A 4N12A 1Y63A 2P91A 3W9UA 1T2AA 3OTIA 3MJFA 4XIYA 1W4BA 3KUUA 3OTGA 8AT1A 4OQZA 1QV6A 3CR7A 5EWMB 3VNQA 1TEZA 5F9FA 1M8JA 3FY4A 1ZUD1 1C3OB 4Q1VA 4QPDA 1BD3A 1M2OB 5IARA 3SBEA 2XMRA 4K0RA 4QBKA 4EJFA 3QE9Y 3QKSA 3B1KA 4RA9A 4IJQA 3VR3D 4E07A 4AY6A 3G9TA 3QX7A 3U81A 3AOEC 3C1OA 1G5PA 3BWYA 3TDMA 3ZWDA 1BEUB 2JEZA 4FLEA 4M8NE 1JSRA 3MFQA 2XQIA 1BE8A 1GAXA 2VXYA 3Q6IA 4QHTA 3KKLA 3HL0A 1AO0A 1PZFA 4IDPA 9GPBA 4DILA 3LBYA 2JVJA 1JTVA 2O8EA 5E3IA 1BWPA 1RYBA 1A7JA 1R4MB 1RZ3A 1U0FA 2WOJA 3EGVA 3HFRA 3COPA 4IDOA 5SZIA 3W8FA 1E3QA 4FMBB 2QXUA 1XPUA 2BC9A 2Y1EA 1XV5A 4JBXA 1QIFA 2X1LA 3H2IA 1Z8FA 3SEQA 4Q4JB 3WYEA 4JP2A 5JV5A 1M8FA 1VP9A 2QDKA 3AIIA 1SXPA 1XGKA 2G9NA 3FNGA 1IQ0A 4DPLA 5EIFA 1FSGA 3EH1A 5BOSB 1KDRA 5AUQA 1ZRSA 1QG6A 2OGWA 2PIAA 1KI6A 2XMBA 3IKMB 2OBMA 4RTQA 5LXTA 1E3JA 3MM4A 3M6VA 1DJLA 1PGPA 1M72A 4MNTA 4CG1A 2YKGA 2ZUTA 1J23A 2Y05A 1UKCA 3EEBA 4HQNA 5EIHA 4EG6A 1DOHA 2ECQA 4B4VA 1U99A 3FWZA 3GGOA 3OFKA 1H6CA 3AVPA 4PQFA 4CIVA 3H13A 5IK2A 2D8MA 1ZCFA 1GDHA 3ZLVA 4CGYA 4K81B 2BELA 1FMTA 5HUHA 1N77A 1GXSA 1T1JA 2OHFA 1R6AA 4NAVA 2COEA 2VT6A 4F7DA 5BV0A 4MEJA 4NYJR 1IAQA 2OLJA 4RJIA 5AM0A 1U2RA 4X84A 1M74A 1DQNA 4Y3UA 4X6LA 2LDBA 2RGDA 1U2GC 2ZUVA 3L0PA 3R7WB 1GTL1 3ZU6A 1Q3KA 5DNVA 1QHHB 1OW3B 1LI5A 1OT5A 1MFPA 3WIVA 4NABA 4BOYA 3N76A 3AEZA 4H7HA 5DP1A 3WRYA 2BGUA 1R4AA 1Z37A 5DHUA 1MXHA 4X91A 2BOVA 4HGOA 3R76A 2LCQA 4U02A 2ZT5A 1JH9A 4LV8B 4J1TC 3ONVA 3P2JA 3HDJA 5BXQC 1T0HB 1MEEA 4X65B 2D2FA 2GPAA 3RBXA 1WB5A 2DCMA 2R6HA 4NJMB 3ZLBA 4BN5A 1MO4A 3N07A 4NCIA 1A5BB 3T7CA 5E3JA 3G2OA 1NQUA 5G3YA 3CWQA 5FWXB 4FEYA 2XTMA 3SQMA 4M22A 3RLIA 2CHVA 3RTGA 3KUKA 1J5XA 4PYNA 3L8HA 4LHVA 4R4JA 1UWCA 2G40A 3I01M 3PWSA 4JSYA 5CVEA 3WLAA 3FYSA 2J07A 4BO1A 1E4VA 3E1KA 3UB4A 5JQGA 4ZVVA 1E5VA 1WUTA 3EDRA 4FFNA 5KTPA 5JISA 2R1TB 1XEFA 4P4NA 3NBXX 3V4LA 3EIUA 5TPZD 4G5XA 2JLAA 2YASA 1IQRA 1HG0A 2HB6A 1ZN2A 2XGSA 1JILA 3HA7A 4DSNA 1QC5A 3DG9A 3TD9A 3EN0A 5DGHA 4OIFA 2KE5A 5G4LA 3ZZ0A 4H1TA 4Q3KA 1GXSB 4GLOA 4F85A 1EXVA 4RLSA 2X7HA 4M0CA 4Y2YA 1IY8A 4DYVA 4PPNA 4DIMA 5BNIA 1I2ZA 1I2MA 2TMGA 4HN2A 2VDNB 2FW0A 2XOKD 1E9BA 1MTZA 1WPRA 1XF1A 4QGFA 5C8YF 5I7UA 2PUCA 2JFXA 2WLSA 3EWAA 3F5DA 1SBZA 4BVAA 2DX7A 3I9V6 4LHWA 4WW0A 4Y2HA 3E7DA 4A91A 3WKDA 3EZYA 4MV9A 1RP1A 3SC3A 4I1UA 3RLFA 2RGCA 1THZA 1KO8A 2HDHA 2XNKA 1CEQA 3P45A 1KI8A 4QDOA 4ZQFA 4DBZA 1RYMA 5B1HA 3ZE1B 4E70A 2YICA 1XU9A 4M0EA 5AK5A 1B41A 2CSUA 2PXCA 4G63A 3EEQA 5ENZA 3QY0A 4MTCA 3PQ7A 5IMBA 4F71A 1L1FA 4JIMA 2V7TA 3CCBA 4X71A 4AO6A 1L7DA 3WGVA 4O08A 5EJFA 3WDLA 2UUOA 3W8NA 1W73A 2I65A 1II9A 2IYOA 2O0JA 2SNIE 2ZI5A 3Q1LA 2X15A 1O87A 3PU6A 4LY6A 3ZWAA 2EFJA 4HPXB 3Q7TA 1WUYA 1U9JA 4MPJA 2SKEA 5M7EA 4C3ZA 4WCVA 4FDLA 4U63A 2ANCA 2XDWA 2V0CA 3L7OA 5BT9A 5T67A 1E32A 3VVMA 2DETA 1CF4A 4TWJA 3IKTA 4OD0A 4AKIA 1P2DA 3AW8A 1OBVA 1WXIA 2EX4A 3B6KA 5DBGA 2W2NA 3ZKWA 2VYFA 5FLEX 1A8SA 2P4UA 1W59A 1XT6A 2PN1A 1UH5A 1YK0A 2IHUA 1I5RA 1MPTA 3IIEA 1X8JA 5DM2A 1L5GB 3RUCA 1PDWA 1TIKA 4NYIR 2R1VA 5EL0A 3F6RA 1G3RA 4GAEA 2WABA 3TSYA 2AFHB 3DHWC 5BRAA 5K0FA 2VF7A 1P2FA 4U7FA 3UK7A 5AH0A 4BMZA 3V97A 3PXXA 4OBXA 4MQBA 3FCXA 2CMFA 2J3KA 3GXOA 1RBMA 1RJFA 1Y5LA 3R7BA 1WB9A 1BH2A 4KYUA 5I4BA 2WWVD 3JD2A 4DLLA 3VPBA 5JU6A 1WCIA 4ZMBA 4NWIA 2QG9A 2OZLB 1D4AA 3DQZA 3HRIA 4EYEA 3WV5A 2AUMA 1P33A 3CN9A 3SJAA 4CLRB 4F1KA 4QWMA 3D4NA 1OZ0A 1H94A 2IS6A 2YY6A 5CYFA 2I2WA 3GH1A 1G20A 3TGLA 4B3DA 3H2SA 3TI7A 1UWVA 2F59A 4H7KA 2RGYA 3PR3A 4ZI7B 3DKVA 4XVUA 3L4JA 4LJ4A 4JZKA 1M5UA 4RDXA 2WVHA 4TQ9A 4DV4B 2ZWIA 2QNRA 4Z4IA 1SZJG 3WLKX 4F2PA 1KFEB 4C0XA 1SUAA 1G2IA 1U8TA 5CVTA 4S1VA 4FFOA 2XGOA 1SCDA 3UHAA 2SECE 3QNMA 2ZBVA 2OYSA 3K4PA 4EJ2A 4PNZA 4GLJA 3IDAA 1V5GA 1J0CA 1URPA 3LL7A 3MLAA 1Q44A 2VJMA 3EZ6A 3VC7A 2N0SA 1EA7A 1M34B 2XAAA 4KJZA 4P5PA 4IMPA 3NAQA 4EPVA 5JNWA 3BVPA 2W6ID 4X7RA 2C3UA 3ZU5A 1YS4A 4WTOA 2C2GA 3NIFB 1Q1BA 2UVDA 3ACBA 1JG3A 4QYSA 1KP2A 1GGEA 3LC7O 4FYYA 4RKYA 4V38A 5AKXA 3HY4A 4GWGA 2X8WA 5JMOA 5JI3E 3UKOA 5EJ8A 2Q6TA 5JFGA 2M9MA 4L27A 2NO9A 4PX9A 5KPDA 4FEGA 1KZHA 2Y27A 1MOZA 5KKCA 3TR5A 2W2LD 1RW4A 4M9CA 4WNIA 5GJCA 2X0DA 4XGKA 4WA8A 2QUHA 2F1HA 3PUWA 5FPTA 4X8HA 4BNLA 4EA9A 1ZD9A 2KBEA 5CYGA 2H2GA 2ZUBA 3FVVA 1D0IA 5IT4A 4G6ZA 1AQLA 1E6UA 1T1GA 4KTVE 4DQXA 1FSSA 4UU7A 4BP8A 2AEFA 5EXEA 3ER8A 1KNQA 5C52B 2OECA 2QAGA 3IJRA 4KXQA 4QSHA 2ZPTX 3H5VA 3V1NA 4CL0A 4ES6A 3HVKA 3DDOA 1KAEA 1QVWA 4FNAA 4OXQA 3CR3C 1Q0UA 1IXZA 2QUIA 4PE5B 4BX2A 4QUDA 1ZM3A 5LL6P 3O2NA 3NVDA 3TBKA 3FLEA 3MJEA 4UTVA 3S2EA 4CMIB 2P9JA 5AK0A 4DMKA 1F06A 3T7DA 3U3OA 5CBPB 1KZGB 1TTPB 1Z17A 3BK2A 1VHWA 4XEHA 4OB8A 2ZIZA 1VSUA 4KVFA 3KOYA 3THWA 5KJ1A 2E4AA 3B82A 1N4DA 5F33A 3S1AB 1ZNZA 3PNVA 1RKVA 4RK1A 5K0LA 5JSKA 4O3FA 4Z0HO 4DLXA 5CG2A 1M2VB 4BV8A 1LUAA 3IEMA 4UVIA 3IMEA 1Y5RA 3DR3A 4BE4A 4D9BA 2QVCA 5JPDA 3BE5A 3RIHA 2RJNA 1O3YA 1WNTA 4OQLA 2IYPA 3AY0A 1EE1A 3HA2A 3KP1A 5E4JA 3U17A 1R64A 1YR3A 1SBYA 4EYGA 1EVQA 4AZ0B 4BZZA 1HA3A 1QK5A 1US8B 2EBWA 3BB1A 3D3JA 3NHWA 3GBVA 4OLJA 1WOMA 5JUWA 4BNFA 1YB6A 1XTSA 2NU6B 5D7BA 5BSUA 1JDPA 1FSFA 1XRMA 4IHJB 3RAFC 5BYJA 3W3AA 1ZH4A 2GEKA 2B37A 1SELA 3VJMA 2B34A 1GPLA 4XVCA 2ZQYA 3FDZB 1KS9A 2O3JA 4Y9RA 3N87A 4AM8A 5K99A 2EL9A 1BA3A 1MOSA 2VRCA 3A27A 3ANLA 5FKJA 2IYAA 3R3SA 2Q2OA 1NJ1A 2FFJA 2AFIB 3J7TA 4LC1A 3ZR4B 1KWKA 1W4LA 5BVGA 5DWVA 4H4EA 4AZSA 3HLYA 2QAGB 5EE0A 3QFTA 1L7EA 1RAEA 4PW0A 2RHGB 2A0XA 3DTYA 3PC3A 3FTFA 1G2PA 4P0QB 4FLFA 3WB1A 2WDZA 3DLTA 4AS3A 1CJCA 4IO0A 3IURA 1AZSC 1UT8A 4EHBA 5CM8B 5BSMA 3OP1A 1VL2A 4BBPA 5E95A 3QVXA 4X00A 3ZQ6A 5FUQA 4WY5A 1P6QA 2PXHA 3MCVA 1V41E 1UPBA 4HH0A 4X95A 3DEYX 5EAIA 1IVSA 4BKRA 3FH0A 3FROA 4D41A 1AF7A 4RQAA 4BRSA 1T5DX 2ZI9A 1G7SA 3B1WA 5JASA 1T5SA 1ZINA 2ZJAA 2IU4A 5KDDA 2Z04A 1XP8A 1XZLA 4HX5A 4ON9A 3B85A 3REFA 2Q5IA 4LZJA 2VBIA 3PA8A 4MWDA 5AI8A 4CG0A 2AXQA 4PHCA 1YQQA 1D4ZA 4FBGA 1TVMA 2P2ZA 3EVZA 3GJQA 3PGLA 5KQLA 5HF9A 4O2BB 4YUWA 4C4ZA 1NR5A 4M8KA 3AG5A 4QGHA 2OY0A 4X93A 1J97A 2P8JA 3W9YA 3MWDB 2B9EA 1M1YE 2BBTA 5DPMA 3WZLA 3DMGA 1KQOA 3FOBA 4M1YA 1D8TA 2V1UA 2Z09A 2VQ6A 3C3BA 4MOWA 4YMGA 1LX6A 1CUZA 5ECWA 1YS2X 3FCAA 4PONA 3ND8A 2NTEA 2QP3A 1U8AA 3EVAA 1Z2AA 4IQGA 3NM5A 2NU7A 1MAAA 1KDTA 3OY7A 4DG8A 5DYWA 4ZC8A 1QH8B 4TQAA 3SF8B 1UMCA 4MHTA 3NAZA 4W1RA 5AXBA 3DL2A 3VHXA 3SF0A 3ZE8A 2Z1MA 5AXAA 4DVGA 3B9RA 3A7DA 1C2YA 2AFIA 3KTAA 1N6RA 1V9LA 1GAWA 1YZUA 2WUDA 4A6DA 1FUUA 2V9ZA 3GJ8A 4J3NA 4B79A 1QHYA 4E30A 3OEHD 4IGKA 5CGQB 3I62A 1RWWA 5A2GA 2BTEA 1YQDA 4LBYA 1BHSA 1PEYA 1DRVA 4R9VA 4FYXA 1EX9A 1NLUA 2BCGY 3MRXA 3N2EA 3RVKA 1PK9A 4YO7A 5HRAA 2QJOA 2G07A 5CVVA 3AFIA 4J3JA 2JI6A 4J1QA 1GFSA 4YDRA 4A73A 2GNPA 3ICEA 3CRRA 1KZ7B 2Q7XA 1TRKA 3K9HA 4LRYA 4XZ3A 3FUWA 4OHBA 3E3OA 3GJ0A 4HVLA 1ZZGA 2QRQA 3VJLA 3QBJA 1DFHA 4BHTA 2W93A 2XOKA 5BQOA 2AZMA 2IPMA 2JARA 5EQTA 1EFUA 3VR4H 3K0HA 2ZSEA 2KS6A 4WUTA 4YCDA 2YX1A 2PMBA 2IZ7A 1CKEA 1VSBA 2GYVA 4Q3DA 4ZI5A 3LSTA 4ZVUA 4ZRMA 1M5RA 1M1ZA 1LNQA 2FPGB 3ZWNA 4A6XA 3U6KA 1QB8A 1USWA 2WHRA 4XFDA 2DPGA 1DZ3A 1H5UA 4HEQA 4WBNF 1GR0A 2XUGA 2G8LA 3KXKA 1X3SA 3NWBA 4JBGA 2GNAA 1DKPA 1XTZA 4GL4A 1LS6A 4K6MA 4PVDA 5JVDA 1EQAA 3DF9A 2Y4OA 1X92A 3DFMA 3F46A 3PQFA 4P93A 3UMVA 1FVFA 4FI3C 3BBLA 4D7AA 3AOEA 5JYEA 3K1ZA 3Q8MA 1G7RA 3U9LA 1AS3A 3LKVA 2PKQP 4BNMA 2IP4A 2J6IA 1GZ6A 3EA5A 2PGNA 3ETNA 4TXJA 3CUTA 3VDNB 3W6OA 4F3CA 3SGLA 4OCZA 2I6GA 2QZSA 1E63A 2CCJA 3WNQA 4E5DA 2JGMA 3P2OA 3Q0TA 3T3PB 4DDUA 2D0OB 3IBFA 1QJCA 1T6NA 3PLRA 2YN2A 2XUDA 3F6PA 3MTJA 2I62A 4CW7A 5BORA 1ENPA 4S24A 4BQEA 4BV2A 1JECA 3LHIA 4E2XA 4OGKA 3WLNA 3V8VA 4ITRC 1HQYE 5FPPA 4CV3A 4EENA 3DV0B 2YBDA 5MGNA 4CU5A 1JKJB 1XEXB 3I04M 4X6XA 2AK2A 1CFJA 4M1EA 4AFNA 4B31A 4BGDA 2OTCA 2HLPA 3O8QB 2P69A 4JQYA 4MAMA 2V3CC 2ZE6A 4MW7A 2A9PA 1Y3BE 1BGWA 4ZU3A 1WF6A 1NLFA 3T35A 2IT1A 1NYRA 1MZVA 4EJ6A 1SUSA 5C8ZA 3ELDA 3FFWA 3FJYA 4G97A 3RE1A 4TS4A 3VSEA 1CJVC 3VR4D 4QREA 1YZ3A 3CG4A 2V0NA 3B8EA 1TD9A 3MCUA 1WD5A 3NV7A 4EWLA 3JYQA 1RXSA 2YY5A 1XRSB 4TWBA 5FNZA 1D6NA 1Z8NA 3NRJA 3PI6A 3FUXA 4KACA 1L6RA 1P3Y1 4FR2A 4GBED 4QECA 4IS3A 3UICA 3IAS6 3M33A 1DPGA 1R50A 2ZROA 3MUFA 2VHJA 3TKAA 2YZ7A 1KGDA 4J0CA 1I80A 2FMIA 2VQDA 2NTNA 4P0TA 3BGOS 4RHEA 3UOGA 1CNEA 3HACA 4JJAA 5ES3A 3FPJA 3V6MA 3R0ZA 3WGHA 1H8EA 4ZVNA 3MJTA 5CLGA 2EGUA 2EYQA 3K16A 4M1SA 3SLGA 3OOJA 1LDYA 3FKSA 5SY6A 4F91B 1ZXLA 3VH2A 2JI8A 3L7BA 4B6PA 4YMUA 1TX4B 1U3TA 4HL6A 1NMYA 1NW5A 4FJ2A 4ND8B 1A97A 2ZUEA 3IESA 5IVHA 5FWAA 3H1GA 4UTNA 1BCRA 1XHEA 1MAVA 3FGPA 5K4GA 2ZSAA 4KQFA 2PZEA 3TMYA 3P32A 4UTXA 2QUKA 4ZHQF 4KQIA 4IUYA 1EXNA 1K7XB 3LC1O 2H1FA 3Q7SA 3LXXA 3CPEA 1WKVA 3R09A 4HDMB 4XRRA 3K9NA 3FSRA 4HJXA 1WHSA 5D6NA 4BNYA 2OCDA 3PENA 2Q29A 4KOAA 1PVDA 4TTVA 5A7GA 4C5CA 1Y4UA 1Z6YA 3IP9A 1RVV1 3PT5A 1S5PA 1SHJA 2IYEA 3KKZA 4RQBA 4Y98A 5HZGA 2HJVA 3ZJTA 5C34B 4D9KA 3W8RA 4U2KA 2Q0SA 3DUFB 4K9SA 1F17A 4YLEA 2E37A 2VH1A 3Q41A 1MC4A 3QE3A 1OIWA 4MLZA 4B3BA 4L15A 3QXXA 3ZGZA 4NOLA 4K9QA 3HP7A 1CUGA 1UIRA 1G42A 1YU6A 1JAXA 3AOGA 5KYNA 2WIDA 3GBSA 3WMRA 4NHEA 3GUCA 3ZW9A 1UBEA 3PJFA 2YJ3A 4BVGA 3FCYA 1N5OX 3DMTA 3UXHA 4LMRA 2ZRGA 1W52X 3QWAA 2I6UA 5DSZA 3E70C 2O20A 3H4IA 4GECA 1N5KA 4WJZA 1FDSA 3Q9NA 3RGWS 2XNHA 4PZLA 1JEEA 2PFGA 4Y6RA 3GELA 4CF4A 3B6MA 4UOQA 2Z2ZA 3CLUC 5KMGA 3V8EA 4PPQA 1TAGA 4MARA 1I1OA 3VKGA 2DTDA 4M0PA 4A5SA 5F7XA 1CIJA 1SK8A 3G0IA 5EIEA 1WU7A 3TE7A 4NV1A 2PH7A 4Q3NA 3EGXA 3NWEA 1A5AB 4Z4FA 4DYDA 1XCLA 4KN8A 4B7ZA 3FWNA 1QRDA 4KQ6A 3EFHA 1DIRA 3FTQA 3EMBA 1UPUA 4NE2A 1JFFB 4N76A 1TCBA 1DEHA 2B2NA 1YR1A 3A1VA 4C4TA 1GKKA 1Z07A 3C3CA 1E1QD 1T4MA 2BZSA 3MZ0A 3HV0A 3TM4A 1DQYA 1XRJA 2BW0A 3ME5A 5IVDA 2IP2A 4OEHA 5IUNC 3DP7A 4MYCA 3GP5A 1BVYF 5ES4B 2WOOA 4KU4A 2CNWA 3BFJA 1C9YA 1TMOA 1YNSA 1YONA 1KAGA 3F5FA 3RUIA 3SU8A 2G70A 1CNMA 3SIWA 1Z7GA 2BVNA 2PX5A 3N8GA 5G40A 2BFWA 3QWFA 4UZFA 3I6BA 2RAVA 1PK8A 4HBZA 2WBLC 2H1CA 1JE0A 3GYGA 5TDHA 2BGNA 3PFBA 3FWPA 1PTJA 2PSHA 3H8JA 5E6RB 1DNPA 3VBEA 5HYVA 3I34X 1MOQA 4S12A 4EO4A 5CAEA 3KXLA 3PHIA 2ISSD 1QYCA 4C4SA 1FIUA 3ROPA 3A3NA 4RM3A 3BCSA 1UKBA 2NG1A 5GJVC 1QF6A 4EZBA 1QGAA 1XCOA 4YONB 2YS6A 2X4IA 4J94A 4D8WA 2GCNA 4OKNA 1RLMA 1ZO8A 3G0DA 1NVWQ 2WM9B 3C6MA 3L7MA 4HWRA 4R6XA 1JNXX 4LHSA 4BFCA 4C1BA 2VWPA 2R86A 2AJDA 1E2NA 2F9LA 3H42B 4GPIB 4G5FA 2R6R1 3SZLA 1X19A 5E8RA 1M5TA 2HMAA 1PNTA 3KHKA 4RVNA 4OI0A 2PL5A 2DFTA 3N8HA 4L8YA 1HPLA 4DARA 4IWNA 2KMLA 2V8BA 1TZBA 3C7KA 5F7ZA 1XMJA 1AKUA 3UJ3X 1JA9A 1HL3A 3W6ZA 2QKYA 3U19A 2AF4C 1K3TA 4C0LA 4IR7A 1IHYA 4HMOA 3UG6A 2HLNA 3IAFA 2OBXA 3BTSA 1M9NA 2J5BA 2YWCA 4ENUA 2REOA 1CQIB 1J06A 1N2XA 1J9GA 3PHHA 4HLCA 1Q11A 3D43A 3JZAA 4ZWNA 2VS1A 3CO5A 4IF6A 4E5UA 1MUUA 3EXEB 2K2WA 2WJ3A 3OQPA 2NYUA 3V4FA 2J87A 1B74A 3DFUA 1TK9A 5E3HA 2XUAA 3GFTA 2C4WA 2PUTA 3E9EA 4QWWA 4L57A 3KWLA 4Z1OA 5AESA 4TZ6A 2OM6A 1FZTA 5B7QA 3M5CA 5AQ1A 2CVPA 1JZSA 3E8XA 1PI3A 3MMPA 5DK6A 1GCUA 1XZAA 5DHRA 3WIUA 4DLBA 3GDFA 1APBA 1C7ZA 4BLUA 1VIYA 5CDFA 5CG1A 2OESA 3WRXA 4KAAA 2D2EA 1E2PA 4TSKA 1VL8A 4BNTA 2X13A 2ZRJA 1Y3FE 3UHPA 1B8NA 4PZ9A 1RU3A 3GGGA 4BO3A 1U8FO 4CDMA 2CFOA 5HKAA 2A7QA 3MIZA 1I01A 1RWOA 1TYEB 4FNGA 4CQMB 2I91A 3ODGA 3PGMA 5CPBA 3SZMA 5AHKA 4ZZIA 1USIA 5IBPA 3N0RA 3UCEA 1OWOA 4AUMA 5KCMA 3K0SA 2C5BA 1U1FA 2ZITA 4ESOA 4RMHA 4DBLE 4NPAA 1GTZA 4B09A 3LAWA 4ZEXA 5LXTF 4YRGA 1FX0B 1YBMA 1IG3A 3UA4A 2HA2A 2QR5A 3SICE 3V8MA 1I0IA 3DMPA 3DZCA 3SE7A 4AMVA 1LZLA 2CBZA 4P33A 4X7PA 3S2GA 2QL9A 5NLLA 2OYRA 4GLFA 3HWWA 3IAM6 5JPCA 1EJ2A 4O4LB 3U0BA 4BQIA 2XUFA 3KQQA 1TQ4A 1ZRMA 5JXWA 1KY5A 5KNCA 2HKIA 4RK6A 3CNEA 1R8SA 3LBIA 2C7BA 4JKYA 3EJ6A 4DUPA 1I6WA 2W00A 3R41A 1E8NA 3OJ0A 4I14A 4I7EA 2AXPA 4UAJA 5EZYF 3IUMA 2SCUB 3RYHB 2QN7A 4GP7A 1EEXB 4YLYA 3UJNA 4MWZA 4B4DA 3LQKA 1PWEA 3QKRA 3AYZB 1Q7TA 2CMGA 3SIRA 4AUEA 3COSA 1L5RA 3GCDA 4AX8A 1TCCA 2WSIA 1SKMA 3PS9A 1EVIA 4M83A 4IFBA 1LV8A 2FG6C 4I4NA 3RUPA 5F3RA 1UZMA 2QTCA 4QHYA 5KTTA 1JYFA 1WXGA 4CEHB 3B52X 1N33B 1R3UA 1KOJA 2JAPA 4CCYA 1ZJ4A 1O4VA 3L1VA 4FC7A 4HUQB 5F1YA 2VK1A 3UAOA 1EWYA 3GVCA 5C5IA 2G1AA 3CISA 3WP0A 4Y2VA 4UNQA 2HH9A 1DBPA 4MKZA 1CUYA 2HAEA 3KPUA 2YQ4A 5KOHA 1C2TA 1JB1A 4W7IA 4HWTA 2FW6A 5IBQA 4CR6A 1NAIA 1PHPA 3KYDB 1EFHA 4CTNA 1MNAA 1H65A 3EZ9A 3L93A 4MZXA 1WQ3A 3V3KA 1KTIA 2HU2A 4ENSA 3K71B 1CR1A 1I1HA 1U4SA 1XMIA 2FK7A 2NQ8A 3EVFA 1ABFA 3BXFA 3W5DA 10MHA 5DN9A 3OETA 3EF3A 3ZV6A 3BHJA 2LD4A 1MHTA 1JG2A 3HWSA 3HSKA 3D1VA 4Q4HA 1RRPA 2AMLA 4FQ7A 3HSYA 2W6CX 1CV2A 3WGIA 5AIAA 3KR2A 3LOUA 1KF0A 3RGGA 3RVBA 5I7HA 1IUNA 2QROA 2OXTA 2O52A 3H5RA 2JI9A 3HXQA 1C9NA 3E18A 1QFMA 4LA4A 1YXMA 2XECA 2IDMA 1XLVA 3QVUA 4PRYA 3SCZA 4JV5B 1PO7A 4A0GA 3JD1A 3F8WA 1Z73A 5DDIP 1CUBA 4BMCA 2QD2A 1PT6A 2XCSB 3AI1A 5L7WA 1EVLA 1YQUA 5LFAA 4G09A 3E35A 1QLHA 4BUZA 1UXOA 1Y9AA 2Y68A 2GVZC 4H15A 3VNAA 1YVUA 3V7NA 1L4EA 1ZJ5A 2E9SA 5FO0A 2V4ZA 3IXQA 4TVOA 3QKRB 1IE3A 4YJHA 2H7VA 4L02A 3H7IA 4JUIA 4D3SA 4CLOA 2H1LA 4MUAA 4HNUA 3B6IA 1K97A 2CJYA 4TYPA 5SY9A 2WT8A 3MBIA 4XLTA 4WZAB 3L49A 5ALTA 2VKTA 2VRNA 2C7QA 2ZTSA 1HMPA 1RAAA 3MRVA 3ZV5A 1N2CE 2VNKA 3PX2A 4FZ5A 3VOTA 1J7JA 4BFXA 4F3KA 4H35A 2PR2A 3KR1A 2HT6A 3ZK8A 4JHXA 3HXMA 4TM8A 3ZDZB 3ICOA 1QH1A 1EFCA 1QUFA 1Z0FA 5IANA 1I7QB 4E4RA 2HZ7A 5JTTA 2XWPA 3WWOA 2VJQA 5CM2Z 2WZCA 1DPFA 1JSZA 4KMRA 2DLNA 4RZ2A 4B2PA 3JV7A 5JZSA 3ZN2A 3T9DA 5THXA 3TQQA 3RYCA 2ZBGA 5HE9A 2A59A 1CR4A 1DAEA 1H2EA 1I4DD 4EHKA 2MSNA 2NUPB 3BL8A 3NYIA 4C76A 4BNKA 4EMSA 4KPEC 2ZBUA 4IHAA 3I9LA 1RJGA 3G8CA 4FYHA 5JBIA 2X0EA 1W96A 4PPGA 1OTXA 3FZYA 4QIHA 3UJPA 3OQIB 3LY7A 1TXGA 2RSLA 3Q2IA 4DNQA 1C50A 2UYCA 1E9EA 1Y9ZA 4Q1AA 1EGMB 4PZUA 5JTUA 2HNKA 2GK6A 1SB9A 2F3RA 3FMPB 3DE2X 3KETA 3FWHA 1HQDA 4UDYX 1VCOA 5AW1A 1HDGO 3SDSA 3DCNA 2VDVE 3GFQA 3HB1A 3KELA 4FI3F 4NQZA 3LSYA 5EJMA 5AVTA 2Q27A 1PT7A 3TL2A 3O93A 4XPIB 3H5LA 1UANA 4HAVA 1UJ5A 2CXOA 5AKEA 3OX4A 1Z25A 4IIFA 4TWIA 1H4VB 2W6MA 2YV5A 1YRBA 3INYA 3VSCA 1E7YA 2WA1A 4HZUB 4GI2A 4Y2UA 2JFOA 1LVUA 3ESCA 2WB2A 2Q4RA 5I5GA 2R6AA 3BYZA 1XHLA 4CCAA 1JMKC 2IUFA 1ONOA 1TW2A 1GEEA 2PD4A 3EUFA 3JRXA 3NT2A 3O4IA 3JQAD 5EHNA 1DO0A 4Q4JA 4XM1A 1JP7A 2NVUA 3CRZA 7ABPA 5IKEA 3HU2A 5AICA 1UFOA 3PVSA 4JUDX 3N75A 4QUKA 4RWZA 4TZ0A 4NBWA 4MS3A 1X39A 3CSUA 5IUJC 5ARBA 4BDTA 1R0BA 4DVJA 2L42A 2BSXA 2QM3A 2QNBA 4OJYA 4UHCA 4Q9KA 3LOQA 3PKJA 3TOXA 1ZN8A 1NWCA 4CKBB 3GVIA 4PC3A 3L6CA 3AKDA 3PEFA 4M3NA 5B3JA 2ZI3A 2Z6VA 5B1YA 2R96A 1TTQB 1P8JA 5GVSA 4IIUA 2QJWA 4BZQA 3I30X 1OX4B 1XLTA 4MUEA 4IIXA 3MCWA 4DLSA 2FGJA 3ZNQA 1QYXA 2PS0A 2EHDA 1L0BA 3LBHA 4YVFA 1O2DA 2BFFA 4J4BA 3R3ZA 4G4IA 1J2JA 4LY9A 4WPGA 4B43A 5ICCA 3H7AA 2ZBEA 3K2BA 4AUKA 1V4BA 4LZNA 4CT5A 2YTZA 4FCVA 2WD9A 2JJ1D 2W6JA 5AJZA 1I4OA 2ID7A 4EH1A 5KQGA 3ZGNA 3I3SR 5EJ6A 1IZYA 3EZNA 5JFTA 4UM5A 3FMFA 5CXXA 2QY6A 2E82A 5L45A 4QOIA 2QQ0A 4W5JA 3FPKA 3KEOA 3OG9A 4PC2A 1Q92A 1BFKA 4BZPA 3GWGA 1COWD 4G3XA 4LNHA 1P0FA 1W0CA 2MYPA 4PCVA 2HGSA 1FDOA 1ISMA 1G8HA 2Q6KA 4ZKEA 1C9MA 2AS0A 1STOA 1UBSB 2AW3A 4Z3DA 4K9NA 5HWSA 5IKPA 1I10A 2JLWA 2JASA 3CO0S 3NIWA 4IVPA 2IOYA 2I3ZA 2HQSA 1AZTA 3DBLB 4EZIA 2CLDX 1E5QA 1LD3A 4CM1A 1JJBA 4FMCF 5A1JA 2DR2A 2EZ8A 3QTLA 3SZRA 4ZCIA 1IWOA 4LI3X 3LNTA 2WWXA 1Z4OA 3I9FA 3AJAA 3ZDEA 5HQTA 4BNDA 1RPZA 1NMXA 4M76B 1M83A 4RXMA 3A1TA 5FUVA 3EDQA 3K0FB 3QY9A 1CZHA 3HBAA 4E15A 3BWXA 3BRWD 3A6HA 1YA8A 3RIEA 4EPWA 4ITUA 3R9WA 1KMMA 3G9UA 1WJGA 1ECFA 1L8LA 1RCFA 1ELOA 1SUPA 3WAJA 2OCXA 2PBZA 2LXNA 2FWBA 3M3PA 4IKEA 4MW1A 5BY2A 5KWIA 2O8BA 2HK9A 5FUYA 4F9EA 1N1EA 4RTRA 3T1YB 3QLUC 4IG4A 4ZDJA 1JB9A 2W70A 4JC4A 1GJRA 5E1OA 2Z0MA 3AR3A 2JHAA 1ISJA 4TL6A 1J1ZA 3J81A 3KQLA 3N2IA 1LVGA 4Y2QA 2YZNA 4HXEB 4KZPA 2C2YA 3BULA 3QHPA 1VFPA 4NULA 1QDLB 5EUCA 2M6LA 5KNDD 2GLUA 2DP4E 1WZCA 1KYVA 3ENVA 3KQHA 1U8EA 4KODA 2B9VA 3WIEA 3JZMA 2OV8A 2XZLA 4UE6A 3RJTA 3ITDA 1VSVA 3JVUA 4LC0A 4UE3S 3S2YA 3ZGYA 2DM6A 1JQAA 5TQ0A 3KT6A 1NPTO 4M6WA 1PR3A 3IEUA 3EPHA 1U3FA 2QVZX 4PLGA 1IEVA 4XIIA 2FAXA 2PPLA 4H7PA 3FYHA 4ZTZB 5H4HA 2W2LA 5JC1A 3PEWA 5HIKA 3G5UA 3A4VA 5AYVA 2FLWA 3CZRA 4DV6B 3EAFA 1AUVA 5H02A 4HQFA 3GIDA 3LDFA 6REQA 1MC5A 3BB3A 3HP1A 3LDAA 3ZIUA 3C15C 4CEJB 2WSSA 4YRAA 2XI4A 3VJRA 1U1CA 3P0JA 1NC1A 1RI5A 2JHPA 4K88A 3K4HA 3TB4A 2VF2A 4KDCA 1PLLA 2WHPA 2BUBA 5HQ3A 2QE7A 1FB5A 2XT6A 4FYWA 5EP3A 2FX2A 2HSDA 3WSTA 2D74A 1W4CA 1JXOA 1KDPA 2PX3A 1GIAA 1SHKA 5GZ3A 3LO8A 3H65A 3ZHOA 1SOWA 4RFSB 5J5VA 5EOVA 5KJ6A 1K7YA 3ZV3A 3PKIA 4BBZA 5KU7A 1QU3A 4S0ZA 3T8YA 2Z8YA 3UK6A 3O21A 2Z3WA 3FAKA 3PYLA 2J9FA 2YQZA 4Q19A 4QARA 1E99A 3B2QA 3K9GA 4UMFA 1TJ3A 1LLQA 1QRAA 2HA7A 4C3OB 4N0MA 1R8XA 3M82A 4OTZA 1O1YA 1JNYA 1X1RA 2K7ZA 1E2MA 3FUTA 4FFVA 5CPFA 4F4DA 1UXHA 4Y2SA 4C4PA 3NHBA 4ONEA 1M2EA 3MVEA 2N1BA 5DMHA 1IN1A 2QQEA 1KAQA 3DEHA 5D3ZA 4QJ5A 4K8RB 5L6LB 3BE8A 3IT2A 1ADFA 5LZ9A 1MR3F 3A9SA 5JNSA 4ZRDA 5C37A 2JNWA 1W4RA 2FK8A 2OD9A 1J8DA 4D0SA 3HMQA 4HUQA 4GRAA 3GHYA 4YMVA 4NHOA 4RLHA 4YXFA 4ABTA 4LYHA 2X3YA 4EK9A 2NSDA 4RA6B 3PE3A 5AI9A 3IUJA 5DNCA 1NFFA 2ECFA 5JT1A 1PSDA 2JRLA 4RCYA 1T6YA 2C2KA 2FEWB 1E2HA 1KMNA 3N2KB 1F2TB 4P86A 5BSWA 1PR0A 1JEQA 3GLIB 1MB2A 3L7KA 3VI4B 3VR5A 3BD6A 1CP3A 1JKFA 1RQLA 2Z98A 1JMVA 3T7IA 3UY4A 1VI2A 3QF7A 3VSBA 2FSPA 4LQCA 1E2KA 4PYLA 1MX1A 4Q47A 2RKBA 3ODPA 2WQZA 4ZO6A 3TJRA 2PGLA 3VPCA 3DKPA 4AD8A 1W75A 2G7MC 2WKRA 3RJ5A 5JS7A 3SE0A 1UBMS 4YT4A 2YJTD 3Q12A 3L6UA 4IX9A 4JS0A 3OE4A 3B9BA 4MVXA 2FUNB 1KGSA 4D9HA 4PTYA 1XMVA 2JIRA 2BT4A 3P9KA 3FJ1A 5I7EA 2R8PA 4C6RA 2XMGA 3K05A 3EWIA 3EXFB 1YB1A 1U2ZA 1Y5NA 2I67A 5JYDA 3VKWA 3FYTA 1AGXA 2CBXA 4CQLA 2WA2A 4DCUA 1RJ9A 1ORDA 1Z6PA 2EERA 3CLKA 2D1FA 2QB5A 4C3UA 2IV3A 3BFVA 1N6HA 4IDAA 2R4TA 3ST7A 1QJ4A 2QUZA 2OP0A 4E3WA 2PBRA 1CUAA 3ZDQA 2LV8A 1GUZA 2OBLA 2JIOA 4CMGA 2ID4A 4HFRA 4BB0A 1JJVA 4GR9A 2CHUA 4MP6A 1EIZA 2PZFA 1A50B 5LBIA 2RGGA 4BMYA 4D25A 1YRYE 5DHAA 1YULA 3QYFA 3UJAA 4DXAA 1SVUA 1Q91A 2J9RA 1ZIPA 1TJ5A 1JF8A 5CXSA 3A4LA 1MJHA 4YT8A 1KRHA 2XODA 4IDDA 3QQ5A 1J6UA 1FFBA 3GUHA 1CUWA 5BSEA 4WKGA 1CR0A 3G8AA 2OPHA 4KRGA 1WTCA 3CLHA 4UULA 4C7MA 3QENA 2DTXA 1YR9A 3IBCA 4KR3A 1EFVB 1VKOA 1I3KA 3BXOA 3ISTA 4HAWA 2CNBA 5ADHA 3E5HA 1Z63A 2H3EA 1A7KA 2P30A 3ANMA 3NWJA 3UJCA 3ZBTA 5K01A 1ATZA 3IUPA 3TOZA 1AQ6A 2XUKA 1E7QA 3EDCA 5A9TA 3VZRA 1MQ9A 1COZA 1RWBA 4GXRA 5DW3A 4KK4A 1XUOA 2PBFA 3ZIAA 2RD2A 2V5UA 4UXHA 2J30A 4KV9A 1C3VA 3NPAA 1D4OA 3CWZA 5DULA 2QVLA 4LX0A 3VU8A 1JHQA 2BHTA 4LYYA 2HF2A 4L3VA 4UREA 1UFKA 1BG6A 3II6X 4NPCA 1FLDA 3ROMA 2Y9PB 1JQEA 2JAUA 3AI7A 3C6ZA 5FI5A 4JLBA 3GRUA 2X22A 4MWGA 4MUNA 3OIFA 3WNZA 4MGHA 4ZYZA 2FZCA 3RC7A 1JXQA 1TZMA 4AWXA 2ILTA 5CCBA 2IYNA 2GPJA 2PMDA 4ERNA 5FULA 2JEYA 2WSMA 3BZUA 4CI9A 4E5KA 4BFLA 1ZCZA 5AO9A 4UM9D 4B71A 4BNGA 3H84A 2JHGA 1DIGA 1GADO 1XZIA 3WJ1A 4BNJA 2H08A 2D54A 2I7TA 3BJEA 2WNSA 2Y0BA 4RPGA 5CBKA 5LMZA 3D2AA 2O2XA 1YC5A 2OXFA 5IVPA 2JVIA 2XQFA 5GIOE 2GB4A 3VZSA 3V48A 3C7CB 3A6KA 1V7CA 2C3MA 2EZ4A 5DLEA 3DUWA 1NXQA 1TJNA 1KK3A 4LGVA 5UKDA 4CIBA 4PU0A 2RONA 4IIJF 5K1ZA 1BZYA 1LNSA 4NESA 1Y37A 2C00A 2PUEA 4ALJA 4PZZA 3I9NA 1DCKA 4RVDA 1QIDA 1DG1G 2HJ9A 1VPLA 3LQQA 3PEYA 3RF6A 4E13A 3DQQA 3S7TA 3BDAA 4EMTA 4FGJA 1R8QA 1W2GA 1NI4B 4KLAA 3LT4A 4DR7B 3TNDA 1SH7A 4O4JF 1XMXA 2EFYA 4QXRA 4AIIA 1QE5A 1PVVA 2FYTA 4A8JC 2VZ8A 1WL8A 2QVBA 4G1BA 2DC1A 1TKBA 1L5MA 3FZNA 4NFHA 2FKNA 1GA4A 5J1SB 1Z6AA 4L0CA 5K7SA 1AKTA 3JD0A 5ECDA 1NR1A 5ITSA 1OVGA 2AZTA 3BUSA 3WXBA 2IZZA 4R0VA 3OQVA 1VDZA 1WDTA 1T4DA 4M0LA 3AL2A 4D79A 1YCFA 3ASZA 3AF0A 1N8SA 4LKOA 4TL7A 2WTUA 1YT5A 1CUHA 1WD7A 5F52A 5AM3A 1M3SA 1G19A 1AKWA 3NFRA 1U7WA 1SG6A 1VHLA 1TJ4A 2VVTA 1FJXA 3HB5X 4DC9A 1PX2A 3D6UA 1E77A 3EMKA 5ESRA 3ASUA 4KVAA 1Y1PA 4JUFA 2CNOA 4P0PB 4EGSA 2SHKA 1PUJA 5C5EA 4LPSA 5JEEA 3OLWA 4UCWA 3ESBA 1MIHA 3H1BA 1G8AA 3T4UA 2QXTA 3ESYA 4XRGA 1JGTA 5KWSA 3W7BA 4TXNA 4K28A 4LJ7A 1UBOS 3RRJA 1G6OA 3OE5A 4AF7A 3AILA 1GNRA 3BN3A 2RJOA 5REQB 4YJ3F 3B89A 4QTUB 2VT7A 2AE2A 5BNTA 3O8CA 3SDZA 2R85A 2XUJA 4IDBA 1ORTA 1PFWA 2R65A 4O2AB 2WG1A 3AU9A 5INTA 4IJUA 5LP6F 1XXHB 1GILA 1R88A 3ER6A 3PRKE 2V6GA 1NVAA 2VH5R 3G23A 4MQFB 3TVYA 2ZS9A 1HY3A 1EXDA 2X6RA 4C2TA 2VSFA 1YDHA 1YVEI 3RQSA 2MU1A 3M5WA 2ZVDA 8ATCA 2ZDHA 4MR9A 1MGOA 4AXBA 5BSTA 1W48A 2VUSA 3MERA 2XBUA 4ZVLA 1UAGA 1RKUA 2WK1A 5DT2A 4RD1A 2JFVA 4A8TA 1KVUA 3AW9A 4P7FA 3VPGA 1WUHS 5I47A 3REGA 1TQ8A 2C2ZA 1HK7A 3KUXA 4QYWA 3EGDA 3IH5A 4FYIA 1SKQA 4BJ1A 2HA3A 2XYQA 1YE5A 1U3UA 2JPDA 4O4IF 3TW0A 3NIGB 3PJRA 1OTYA 5HIAA 4ZQGA 1L7AA 3FRHA 1OBHA 2W2KB 3KKPA 2ZSHA 3SYRA 1H85A 1C9JA 4E2YA 2I4TA 1QVZA 1MORA 2Q4TA 2JKYA 3HFSA 4HDCA 3ENZA 4ZAGA 4ASUA 1DDGA 2HJRA 4MKXA 1CE8B 1SA0B 1T1SA 2OKGA 1FFXA 5K0NA 4YYZA 4ZYUA 2P9TA 2DB3A 4Y1RB 1ZUHA 4BNWA 4D45A 3ZVKA 1XCJA 1P8AA 3BPSA 4TZKA 4DXHA 2E5FA 3PBKA 1U7OA 3SC6A 2FRXA 2PS3A 2VNHA 3FYCA 4BMOB 4DCVA 3CUSA 2G1UA 4FFWA 4XIFA 3SFVA 4R81A 4OFWA 3T1VA 1E2GA 3CEMA 4R1TA 1QGUA 3IT1A 1HO3A 3EZGA 3GRRA 1PG5A 3SBXA 4ZHSA 2B98A 3PSAA 3AFMA 4JMLA 5E9JA 5JYCA 2RGAA 5LDDC 5ADVA 4GGMX 4L07A 3BM5A 2PZLA 1EDDA 5J2UA 3KYCB 2WHPB 4JELA 5DTRA 1XALA 2WUEA 1HM5A 2C2HA 2WU0A 2FEOA 4HP8A 1LXCA 2WJYA 4EUSA 4XD7D 4LJ8A 4ZYLA 4KQHA 5B64A 1PRYA 1I7DA 3RANA 2HSJA 3BH0A 3VDXA 1ZLYA 1T0BA 1ZD8A 3U3MA 1QTRA 3LPDA 1SOAA 1PEKE 5A3VA 5IF9A 2FP4A 5BRJA 2J0SA 3FD8A 3U09A 2BMEA 2IEAA 3DKKA 2E55A 4LVOA 5JCPA 4LI0A 1SC1A 4UC0A 5GM1A 3KSBC 2G0TA 3Q6MA 1B00A 3VAYA 4AN0A 1NFQA 3IRUA 3QFFA 2FMXA 3D4BA 4LXQA 5GZ1A 3OZDA 4WAUA 1SUBA 1Z47A 3OLYA 4J4TA 3Q5GA 4HNAB 4QX6A 5D3MB 4F8EA 2NYRA 1R00A 3GT0A 4IGAA 3GMSA 3TEFA 2IEIA 4DL9A 1WX1A 2TMDA 1HUQA 3GPDG 3OCZA 3IP1A 2ODPA 3TSOA 2AOUB 4RMNA 1XBTA 1L4FA 521PA 1Z3IX 1DKOA 2PO7A 2W6NA 4MUJA 1II0A 2EKZA 2CJXA 4QOEA 4PYIA 3I61A 1ZHHA 2H2DA 3GUVA 1FFDA 2QM0A 4JODA 5BXYA 4G07A 2OG1A 1YC2A 2F67A 1QTIA 4TXMA 4CHGA 3CONA 1CDDA 3RD5A 3S7ZA 3ACDA 1KPGA 1S96A 1T3LA 3M6IA 4G8CA 3QXHA 2OO5C 1NIPA 2GZDA 2MSWA 2JBHA 4UEQA 1D8AA 5CXUA 5DZSA 5HPYB 1EUQA 2A0UA 1E2IA 2PRYA 3IQWA 3VKFA 5F2NA 4WLNA 1FYFA 4NZZA 5JNVA 1VCHA 1WUJS 1Z62A 3ESXA 4EY8A 3VPXA 4MIOA 1L5SA 4DC0A 1PG2A 2CYBA 1LBQA 1OYWA 1VM6A 3PK0A 4DCJA 2QI9F 4E33A 1C8VB 2ZAGA 2BKLA 4U4AA 2HDOA 4X45A 1WB4A 2F55A 4WLOA 4TLEA 4NY1A 1OLSB 4A8PA 3H5AA 3QXGA 4G89A 5A6VA 1P9RA 2J0UA 5EZYB 3SXUA 3LY5A 5JC8A 5DB4A 2BP7A 1OYVA 2AFHA 4UPDA 1E1RA 1AUOA 3OOSA 1T0JB 2CGEA 1XZJA 2DFNA 2QVYX 4PYMA 3R8XA 2DHRA 3ZWYA 3IJEB 4LFBB 3N28A 4N5LA 1CQZA 4F6RA 2B4AA 4DQ0A 2GHTA 2RHLA 4R2KA 1DHTA 4MW6A 3DOHA 1JDNA 3GD7A 5L3SB 1ZGZA 1U8YA 3H0CA 2WTBA 2F43B 1DOZA 2XUOA 4B34A 4Y2GA 1GCOA 1NZDA 1VPDA 3B70A 3CHYA 4HNAA 5D3MA 1S2DA 3OQOA 1JN0A 1JR3E 5GP1A 3RKSA 5C4MA 1QQBA 5CH5A 2WKQA 1MD9A 4P3YA 1DC8A 2YWJA 4HS4A 1GP2A 4U3JA 3SHTA 3ZIDA 2I6FA 3KZMA 4K8OA 4XDHA 3A14A 3NHZA 3PHGA 1NJSA 3PRJA 5D5PA 4BCBA 3DL0A 2OXCA 4BTEA 2Z4TA 4CM4B 1EWTA 3ILXA 1OYYA 3HB0A 3M4ZA 4Q3BA 3FOWA 3L6OO 3TTVA 3FOAA 2EZTA 4KEAA 3L41A 1MKYA 1E4EA 2F1RA 1OBOA 3GAMA 2QXYA 3UWPA 5HZMA 4XYLA 3O1IC 2R7MA 2XVMA 4YJ3B 2XJ9A 5LQDA 3B48A 3NHMA 5C0OE 4WDRA 4ROTA 1VJGA 2EFHB 3LDHA 2GPSA 1QO9A 1OLUB 3M5PA 3AKCA 1TA4A 1TF7A 3ETLA 3HDQA 4MICA 1IXKA 1DTWA 3DXXA 2ATXA 3JWGA 1YO6A 3ORRA 4OHUA 4R69A 4ZVTA 3NTUA 2ZG6A 3VO1A 3WLEA 5TLSA 2I9KA 3VU9A 2AYZA 5U9CA 3TSZA 5ALVA 3Q7RA 1ZCBA 2B4YA 1HNNA 2C77A 4OQDA 1EFKA 2Z5LA 5IJ0A 3ZJVA 1MB9A 1L5HA 4IRMA 1YKSA 1GEGA 4DKJA 1ISIA 1X7HA 5AW9A 1K3UB 3SD7A 2X23A 1YVDA 1KEEA 1QHNA 1F60A 5JECA 3S0JA 3TKYA 1K92A 2HEGA 4K1XA 3WOHA 1XA3A 1IU9A 2PWBA 5ERYA 1IEQA 3KDAA 4YO8A 3SY8A 4NJEB 1K66A 1N8KA 3BKXA 2BLNA 3CQ9A 4GI7A 4B6JA 2PKYX 3C6XA 2OD2A 4LF7B 2B1RA 1V6CA 4B7CA 3E9MA 4CV1A 4YPFA 1XJWA 1OC4A 4TLCA 5FL7A 2P3OA 3VPDA 1FMFA 5EXPA 3LV8A 1TLLA 1G8GA 3MD0A 1VKNA 1YB5A 4GM1A 5HF6A 3UM9A 3GC6A 3E5MA 2BZ0A 1E6CA 1T5OA 2W98A 4LZZA 1Z68A 4EG0A 2J3DA 3PCXA 5A3JA 4LTNA 2BZ1A 1KDOA 2C3PA 3QEKA 3FG9A 1SCIA 2WWHA 4B85A 3FZEA 4D96A 4RNDB 4M99A 3IELA 1DAIA 1EP9A 1N7IA 3F78A 1PQWA 4DGSA 5LP6A 5JADA 1MW8X 2PD6A 4J9UE 1OH6A 4R5MA 4UVEA 4R6WA 4BMPB 5A4FS 5HGXA 5H7XA 1T4CB 4DIBA 4M21A 1NVEA 1ZMBA 1ACJA 3KIPA 1TIBA 4ZGBA 2AQ8A 1TA0A 4V0RA 5KYUA 1YCDA 1ONBA 1VP3A 2ZPAA 4URVR 4EKIA 5B2FA 1V5FA 1NE7A 4QAJA 3HA3A 1RXWA 2XYVA 2PZKA 1YI0A 3AWIA 2C88A 4KV7A 3GNLA 1VMIA 4GMKA 1XD9A 2JLUA 3UTDA 2B78A 1AMUA 3H5NA 4UNPA 5AVJA 2C4HA 4ZCMA 4HNQA 5TE9A 5KYXA 4F2GA 2IUEA 3WK8A 1SIUA 4J7XA 4L5JA 5IAEA 1DAMA 1KAMA 1FXSA 1B6SA 3CVUA 3BL6A 3FI0A 3FB1A 2H0AA 3DYIA 1E2UA 4CT0A 2EP7A 3FNIA 2HRRA 4UEOA 2CDCA 4N5DA 1AS0A 1Y7TA 1P19A 1X7GA 3OI7A 3K0AB 3G0OA 3PD7A 2IITA 2WRZA 2YMQA 3FHCB 3K32A 3H4TA 4HQRA 5K0ZA 1KI1A 2POQX 1J25A 1Q50A 4OXXA 3I5XA 1O94D 4JK3A 2NYAA 4N47A 1KQNA 1PHRA 3B5JA 1GZSA 3NHFA 1Q0LA 1X1QA 4S05A 1E9CA 4TQUS 3ZUPA 1YVPA 1XZEA 2GDZA 4JD5A 1E60A 2CZCA 2WIFA 2C5GA 1JQLB 4LDZA 1LA2A 5FBLB 4FYVA 1CULC 4BVLA 4MRMB 4AVYA 3KALA 4Q82A 5H9WA 3DBLA 3HLTA 2UZ1B 2O5CA 2UZAA 3B6EA 3EGDB 2SKDA 5GAJA 1TMYA 4GICA 5LWQA 4BXOA 2JRCA 1KHTA 3OWHA 4OXYA 4M0DA 1IPEA 3BMNB 2B25A 3QSGA 1YL5A 4RZQA 3SK0A 1E1CA 1CDZA 3GUZA 3K0FA 4OQQA 4XA8A 4MUIA 2XUIA 3KEMA 4IHKA 5FADA 2I7DA 3LZ6A 5M5BA 2QMZA 3MA0A 4E2FA 2NV2B 3DZJA 1GA1A 4UBIA 1VPWA 2H11A 1OB2A 2BKXA 1P60A 3L2OB 3R7WA 3UAYA 2AIRA 4QM7A 1U63A 2NIPA 3C3YA 3A6LA 1ETUA 5E1MA 2Y76A 2R8YA 2GJ8A 5F98A 1GNPA 1MT3A 4FFDA 4Q21A 4BAUA 3HUDA 3WZMA 1XAIA 1OWLA 1A2BA 1P80A 4KQCA 5BSGA 1RI4A 3L0YA 1NDUA 3UGQA 3DP9A 2ROQA 4FZRA 2R1ZA 4JT4A 2ZJ7A 2JZOA 3C3DA 3K1AA 5G4KA 2NU8A 3H4VA 5KNLA 4XR9A 4IH9A 4NJMA 3WQBA 2A4KA 5L6MB 5DNUA 1QDUA 3GWZA 4B2IA 1U3GA 2OZKA 1PD0A 3AUUA 5DI9A 2I6TA 4UPVA 4ACAA 4MUYA 1LLUA 1RI3A 1YH3A 3IQFA 4W5OA 1X1SA 5IRCD 2X77A 4U6NA 2X0JA 3I73A 2TS1A 3HXKA 1MJGA 3PYXA 4PZ0A 4DAEA 2CL6X 2G9UA 1V7PC 1GG9A 4ISBA 4XYBA 5TV2A 2C07A 2GF9A 1XQXA 4ND3A 1LBTA 2I7XA 3Q7QA 4ZXFA 4D46A 3V8NA 2BJWA 4AJ1A 1XVVA 3KKKA 1V25A 1I1NA 5EGSA 4MR8B 2QAGC 3T5TA 4ZI7A 3LLVA 2HWUA 3QUCA 2XKJE 2RB5A 3C97A 4V24A 3IGFA 2VKQA 1V1MB 2IYRA 2NO5A 2I2CA 4YJGA 3JQ9A 1QPBA 4G2TA 5GPBA 1QZ3A 5ITWA 2IOFK 1LFAA 2IL1A 1T8UA 1GKLA 2HU7A 4NDAA 4GOXA 5I4CA 3QVJA 1LPPA 3SOZA 1NAHA 13PKA 1BE6A 1VYUA 1ZK3A 1C9EA 2ZVQX 4UD6A 4YQEA 3Q0IA 4Z9XA 4CN8A 4X63A 3EEOA 2J7KA 2BJHA 2D59A 2D5AA 4EHAA 4RTOA 2L17A 3TNYA 1N0VC 2X1MA 2R2AA 2HQOA 1I2CA 1A5SB 4I9GA 2WYUA 1E2BA 3IAUA 4I19A 1PL8A 4RAQA 1CJKC 2CHQA 2VHVA 2C98A 4X20B 4ZCRA 3USES 3E9YA 3OJEA 2XNJA 4RJKA 5AJUA 3KLNA 3KSUA 1P6XA 1F4LA 4ZAWA 2EU8A 4MCJA 1RR6A 4ZOEA 1EM8A 1WSDA 5DKFA 4AMYA 1V16A 4TTJA 4FDVA 1X0VA 7REQA 2VJPA 4KAFA 1ZUIA 4TLDA 4X54A 2H5LA 5DGDA 7ADHA 5HFJA 2FPPB 2ATCA 3LQ1A 4RCVA 4RM2A 3Q1KA 1A9TA 1AGPA 2UZ0A 3AR2A 3GOQA 3MOSA 2NXCA 2C99A 2OUIA 3O38A 1SCKA 5G0UA 5BWCA 4CKWA 4YIHA 1E79A 3U7IA 1NVTA 1IRIA 4IXMA 3UPTA 4S1NA 5EKSA 4YAUA 1Y8QA 3SJ7A 5GINE 4RDHA 1FLVA 4X1KA 2J3LA 4Q9IA 5HZHA 4GZ5A 1EGQA 1BQEA 1QFZA 4URHA 2A78A 3LC0A 2EBHX 1EB8A 4IINA 3FPSA 1YE8A 3PUZA 3CYFA 4QBIA 1V1JA 1JHMA 1CC1S 1GPMA 1RAGA 2GBLC 3A3OA 3A9UA 4GQBA 3TZEA 5I7WA 3SQNA 5BSFA 3QOFA 1PAUA 2GUGA 4MO2A 4EQ6A 4HOYA 3GBPA 3UPUA 3LY9A 2NNWB 1KFBB 2CNNA 2DOKA 4L6IA 4L8FA 2QTRA 4QU5A 4RD2A 1UFVA 3RVQA 3TO5A 1FQWA 4GX1A 3PUKA 2IXBA 2BRUA 3MHPA 1NOKA 2VZLA 3RV4A 3QTTA 2REBA 4AJKA 1SAYA 1LCIA 3ICCA 4IXWA 3AF4A 3MXTA 1JIIA 1XDUA 3A32A 2JIPA 2DT5A 1NRXA 2Q0QA 3IUSA 4LOJA 2H2FA 4ZU1X 2VDKB 2AHRA 4NZ9A 2Z4SA 2QN9A 3GRPA 5LQUA 4EFLA 1G9TA 3X1DA 4TTQA 3RT7A 3AUSA 1XNQB 4HMPA 3K92A 3D5EA 3MJDA 4KYVA 4RTLA 5BNWA 1F9EA 3EOBI 1IBSA 3MW8A 2VPXA 2Z9DA 4R0NA 4DIUA 3K1TA 3AM1A 3AEUB 4PIPA 1M33A 2FN7A 1R8JA 2QTBA 3AEYA 3WLIA 4YJ3A 5BMOA 2WJ6A 1YDFA 2GN6A 2XB4A 2AVDA 3MWEA 1DAFA 4EF5A 4EVIA 2V9PA 3M7IA 1N8TA 2NVUB 2VWQA 3IPRA 1QGED 1SKUA 1TQHA 4Q1EA 3V2UA 4CYMA 3WWYA 4W9MC 5H80A 3NB0A 3ND5A 2H1SA 3PR2B 3PT9A 3RB8A 3TTUA 2VTBB 4JP5A 1EUDB 5JOQA 1BCRB 2HV9A 4UTOA 3TK1A 1PUIA 1F51E 2B5VA 3UT6A 3AI2A 3DHVA 4RZXA 1AHNA 1Y8QB 4X97A 3BMCB 1KY4A 3Q3CA 1FL9A 4RACA 4RQUA 4X1KB 2ZAYA 3K5WA 2HLDD 4MP8A 4M1MA 3K8QA 1R6DA 1VE1A 3ORFA 4LNAA 5TEVA 1MJGM 2DRIA 4RKRA 4Y6QA 4RLFA 5KWJA 4MLCA 5FPYA 3I32A 5BN5A 1GZ3A 2JD1A 2BLLA 2C95A 1N36B 3BJMA 3OLVA 3QPWA 1F8XA 3JWJA 5EMMA 1XEAA 2ZM6B 2XAUA 1I33A 2XRFA 3PNYA 1M1NB 1P1JA 3MAJA 4REMA 1ACMA 2CJWB 5AT1A 1WXEA 2D1TA 1GTMA 3QH4A 1NUPA 2Q5FA 1R5OA 1NA5A 4E7OA 3P4XA 2DHQA 1JHDA 4D99A 3B7PA 4J1TA 3B1JA 4G1VA 3I8SA 1J2EA 4IUCS 3FWKA 4NG4A 4U6QA 1TA9A 3M4XA 4B75A 1YAHA 4OL0A 2X2PA 5I5EA 4DR2B 4J43A 2FR8C 3RREA 1MX9A 1CLUA 1F14A 4IO1A 5SZHB 3U4HA 4Q02A 1SXJE 1Q7CA 1ZESA 3MGBA 3GX1A 3H4MA 2FEAA 3PA6A 3MCZA 4FS3A 1OTHA 1SM4A 3KRTA 1F5NA 3TGWA 1XL0A 4TTAA 4DLKA 5JXHA 2MSKA 1S2MA 1KQGA 5TVGA 1SK9A 5A4KA 5BW8A 3IEPA 2CLMB 4JJFA 3EHDA 4KXVA 2QT0A 4A0HA 1I3CA 1Y6RA 1UP4A 1JLHA 3L0ZA 4EUEA 4EJMA 2FQWA 3D8HA 2V98A 1L7MA 1BQ4A 1EFDN 1VJ5A 1ZKDA 2QSZA 2COUA 1V37A 2C2XA 4LDJA 3BFXA 3HH8A 4Z9AA 2P9GA 3EZXA 4G36A 4IRXA 4GT1A 1THTA 3UGKA 6ABPA 3DLCA 1K3FA 3ELWA 2C9OA 4NP6A 4QODA 5J1TB 1BKYA 2C5LA 2ZBRA 1P4GA 4BVEA 2UYGA 2C0CA 2ZJ0A 3JXEA 5I45A 1PV2A 2KJQA 2IX9A 3GRKA 1A8UA 3EC1A 2FDRA 2O8VA 4GOMD 2Q5JA 3AT1A 2H2IA 4NFSA 4NENB 3ROXA 5DCLA 3WFJA 2O8CB 1X7WB 4OFZA 2ONCA 6Q21A 3S8YA 2F1OA 3IJPA 2P9CA 2GESA 3G1WA 4ZVMA 4DAOA 4TYNA 4Z3OA 1X13A 5KSOA 2QYTA 3TXAA 1PSZA 1ESZA 1KERA 1W85A 2O14A 1OYOA 4BMSA 5HA5A 3MUOA 2QOEA 2PWZA 3EZLA 3L8CA 3TX6A 5AI6A 2DPHA 2NU6A 1K5PA 1PP4A 1T25A 3SQLA 1YBHA 3LX8A 2GA8A 1E66A 3DOJA 4KO2S 4EM6A 4HB3A 1P2UA 2I6XA 4L8LA 4Q24A 5FWNA 3IVGA 1QRRA 3MC1A 3N3BC 6REQB 4ZANA 4LF6B 5L4SA 3OPYA 3TVDA 3ABRB 3HCAA 3I9KA 3ZZMA 2ZIVB 3JQCA 3T3NA 4TRMA 1NF3A 1PR4A 2DJ5A 2PFKA 2Z08A 4NF2A 4PC7A 4TV8B 5BVGB 2Q49A 4XCVA 4YN3A 3OUTA 1P45A 4Y9SA 5KNCD 2LW7A 1JIKA 4UXIA 3OH8A 5D8DA 4YV0A 1OFVA 2H1WA 1PZEA 1RXCA 2CXXA 2XQKA 2ID8A 2DZDA 1LQUA 3DHNA 3JQBA 4G0YA 4IZ6A 4PHGA 2ZJOA 5AKYA 5DCUA 1FYXA 1OOEA 3QZUA 2DKFA 4M7OA 5K3BA 2V7BA 1FVHA 3U31A 3INTA 4HYYA 1E0SA 1GTSA 1HLGA 2GCIA 4AMZA 1E58A 1RLIA 1G98A 5A5DA 2W37A 1MDFA 1UDAA 2JS7A 3O3OB 1PFQA 2HCJB 3DTNA 2EF0A 1JHRA 4B9AA 5IAOA 2I34A 2HHHB 4KB5A 4ZODA 3MN1A 5LA6F 3TLEA 3OURA 3GJ3A 1RQNA 2PWYA 4QEZA 5A04A 1JH8A 1W2HA 4NV0A 4JLMA 4GOLD 1EWVA 5DBFA 4I9UA 1EFRD 2ZVJA 4H60A 3MB8A 2OUKA 2XR1A 3BFKA 4DSUA 1LY1A 2V96A 4PO3X 1SQSA 1VPTA 3DE4X 4MAFA 1S8NA 2YWRA 3B8HA 3CH4B 4CMHA 4KO4S 2H4YA 2GLTA 5IJ9A 4JL8A 2D4AA 4RK4A 3WGQA 3DAYA 5DLQC 5IG2A 3F6EX 3P2KA 2QTGA 4KPUB 4YHBA 2QLLA 5EXDA 5J9FA 1XWWA 1SA0A 2J31A 2MT9A 4N9WA 4BVJA 5MF6A 5JAHA 1MAUA 1GYPA 1V8FA 5D7NA 4BBAA 1Q1QA 4YALA 2YIJA 3E6AA 3GDWA 2BGLA 2J5RA 3A8TA 3EVTA 4OGFA 5FP0A 4ENRA 2XLBA 3MMNA 4HBGA 1KETA 4RETA 2IY8A 3VM6A 4AZTA 5L3ZA 2ZANA 4ZQBA 2PQ0A 2AC7A 4DDMA 1G16A 3JQDA 5HRUA 4FNOA 4J7AA 3MGAA 3IVRA 3MQFA 4GLBA 1JW9B 1ILEA 3QUAA 2FPRA 3LGXA 1NNEA 3JQEA 4Q5IA 2WYIA 4Q9LA 1SBNE 1KVRA 1FQKA 1Y1LA 3C5CA 3KWFA 1SCBA 1SUCA 1VBMA 4MJLA 4MPDA 3JAMA 1RC8A 2VCYA 3KOZA 2GUWA 3TLJA 1WKCA 1D7AA 1VBNA 1Q1GA 3DBHA 4H7IA 4DJDC 1ZFNA 4E2ZA 1KMHA 1OILA 3O83A 3GVHA 2OB2A 1HYQA 2PSFA 1K8ZB 1KYYA 5F78A 5DTEA 3BJIC 2Q62A 2VJBA 1U1GA 3EJWA 4LWPA 4GRDA 4ZOLF 5FTNA 2CV1A 6ADHA 4WXYB 2CWDA 1GL9B 3QPVA 4UUMA 3H9JA 4A6PA 5HG0A 1Z5UA 1XF9A 1CRZA 1PNOA 2JCYA 3RUFA 1QANA 2IP1A 4AT1A 5LQRA 4MV6A 1JKXA 3G2JA 4HS9A 1PV4A 4XH9B 1T3TA 2Z1NA 3UKDA 1M7GA 1U0OC 4Q4LA 2O06A 1ECJA 4TV9B 3E2PA 5CW1A 4WJKB 2DLDA 4N6GA 4ENQA 1JIJA 1JVNA 3ADKA 4RPLA 1JHYA 5K03A 3E8MA 4JX9A 5F35A 5FUXA 4LF9B 2QMQA 5JBQA 4C4XA 2B3DA 4BLQA 2VOJA 2ZUDA 1RXUA 3OTHA 4DBVO 4CKWB 5ILOA 5ILQA 5BMVB 4LRQA 1ZR4A 3LUAA 3WWDA 2PVCA 1D6MA 1VRVA 2RAUA 2GLXA 3N7TA 4MYDA 4J07A 3V8BA 4I55A 2PU5A 1N2OA 3GZTB 5CVUA 3FHOA 2HA6A 2ACEA 2QNIA 3LVFO 1WHTB 5LZ5A 2IV7A 2FWAA 4BO5A 4ZO8A 3CNNA 1C8KA 4W8GA 4BO7A 4FYMA 3B7WA 2NZVG 2YMMA 2CLSA 1E94E 2VAWA 1E1KA 4HDKA 4JR1A 4ZZ1A 2PRIA 2H6EA 2Q2NA 2WJGA 1F2VA 2ZJ2A 3JQRA 4NE7A 2IBSA 2JK1A 5FA5A 3CW8X 1BRMA 2VRBA 4FMDB 3ZBPA 1VXRA 4OJMX 1SC6A 2OHVA 1ULSA 1OGIA 3ZE0B 2FRDA 3T4XA 4DDVA 3MJVA 1ARZA 1Z0SA 3DR5A 1EZZA 3TLCA 1D6JA 1RC0A 2ZI7A 4PG6A 4ALNA 1I8TA 1SKYB 1KKMA 4CR8A 2YYSA 2IHNA 4X3PA 3C8MA 6PFKA 3TDKA 1FA9A 4DZZA 4MW4A 3AB3A 3HCBA 4DIEA 2QT9A 3BXEA 2XY4A 4PFJA 1U3CA 1DCFA 1MQ8B 3PDIA 1RC1A 2HMVA 4OQFA 5EQDA 4KQGA 1SPBS 4RFVA 3MYYA 3RW9A 3KDSE 5A03A 1T3SA 5BYKA 3P52A 5ED4A 1N5DA 4JLDA 1EXWA 3KQSA 3E03A 1G8PA 4GZ6A 4ZDIA 5ILGA 5CEJA 3B3QA 4MRAA 4YAKA 2IHYA 2II6A 2JAHA 3MS4A 4C14A 4WN9A 4F96A 2A3NA 3ZHCA 4JDPA 5EZ5A 4MQUA 4TKMA 1K6MA 2G1KA 4Q1CA 1FFSA 3HDYA 5TARA 4XJSA 1UOEA 1YFKA 2IZ0A 2MYNA 3T15A 1WE2A 1EUCA 1L5KA 3T7AA 3ZNOA 3TL6A 2HBQA 5IVIA 3VR1A 5CLJA 2IYWA 4L51A 1K4MA 4NCBA 1X80A 1RI2A 1U28A 5G1NA 1KO7A 1DIOB 4L6CA 1TU3A 3M3HA 4L73A 1U7XA 2G83A 2ISCA 2VWGA 4BNIA 4IMIB 2QLJA 1QXSA 3CIOA 4V0LA 5LQCA 4S04A 3ICVA 4ND8A 3SLKA 3HVUA 3JD4A 4MI3A 1A8HA 2NTJA 3MWFA 1KNXA 4J0GA 3QK7A 3KOMA 2AQKA 3CGGA 5TPWA 2Z57A 3RHFA 3JARA 2YWBA 4XPIA 4JLOA 4X92A 4JROA 1FP1D 3GJRA 1V3VA 4ID9A 4LXHA 2Q3MA 3LM8A 1S1CA 3WX0A 4E11A 2D5LA 3RF7A 1OWNA 3JQ7A 1YA4A 1NI5A 2IXTA 1FRQA 5ABPA 2C4MA 4O4IA 2PSSA 1Z8HA 3O95A 3WB9A 2QTHA 2QU8A 3RSFA 4IV5A 5ICSA 1W0KA 4P84A 4K40A 5HRCA 2P9YA 2PT7A 1NN5A 3E61A 2HSWA 4ND4A 3JATB 4LY3A 2V7EA 4M8IA 5U4QA 5B7NA 3SG0A 4MDEA 3QF4A 3P9PA 1WAMA 4CKCA 2QX4A 5FL7D 3BHNA 1P9OA 2E3JA 4LRUA 5BQPA 3GGPA 3HK2A 1FF9A 1X42A 4ZJUA 2EEPA 5CX1A 1RHJA 3R8CA 1R4MA 1W5FA 1T2CA 2ZRMA 2B4QA 2NSYA 3HE3A 3WA7A 3CPSA 5GADl 3AHGA 3DOOA 2QPTA 2HHJA 2OP1A 5BN1A 5LQKA 4HHEA 3U44A 5F2OA 3QP9A 1DINA 1WXDA 2FN4A 3WIBA 2BKAA 1U90A 1SU7A 2B35A 2FV8A 2V8OA 5ICMA 3HZZA 4HGQA 3TW4A 2ZDQA 5IPFA 1MB4A 3LYHA 1SBQA 1YRHA 3R0QA 4KX5A 4BLPA 2CF6A 3EGCA 1RYFA 4YECA 2JH8A 3O47A 1GFIA 3F67A 3LUGA 4B3MB 1C29B 2E1PA 4PS0A 1ST2A 2EL7A 2IU6A 4HH1A 5DXAA 1J24A 3KT3A 3GOHA 3DA8A 3QVGA 4JVMA 4EJSA 5B3KA 5EFZA 1LBHA 2J1LA 4U5QA 2B8WA 4HWKA 3P8ZA 3KJXA 4E94A 3ZUGA 1X7WA 5JRZA 5TGZA 3LW8A 2JATA 5LNK1 2YDXA 4HG2A 3L0SA 1WV0A 1OKKD 1ZCAA 2P41A 3FDFA 5DHQA 2GO7A 3UJHA 3KSMA 1UJ4A 2JLYA 2FMHA 1AKYA 2YL2A 1LI7A 1JEJA 3CCCA 1THGA 4EAAA 2IHVA 1OFIA 3KLPX 2QUAA 2PTHA 3M2PA 4FCTA 2YWHA 2YCLA 3DAFA 3IEVA 2HYIC 4PZAA 3TNLA 2GD6A 3FTNA 3Q8WA 1TJPB 4QGGA 5C5CA 2LWIA 3HCEA 5ECYA 3NRBA 1CZKA 2Z2YA 5KTOA 5BQ3A 1Z08A 1RWNA 1T4GA 5T3UA 3QKUA 5H3HA 1OXMA 1Z2EA 1UZAA 2WHXA 2R9VA 1A8PA 4QXMA 5DYIA 1XN4A 2J9ZB 1BGXT 2HQ1A 4DWWA 3VH3A 3RIMA 2NU7B 4DT1A 4HLNA 3CRNA 3IVAA 1F20A 3HU1A 4JJ6A 1IJEA 1RXIA 1NC3A 5FTWA 1WY5A 4BB9A 2CLOB 3WRWA 3COWA 3FSGA 1ECBA 2G1JA 4FN4A 3CB2A 2Y92A 2ZSIA 4HXYA 4FZJA 3SHQA 1WS6A 1C3EA 2EX1A 4P3NA 3FHTA 2OAEA 4KXNA 4C03A 1P9NA 4LRTB 1M76A 2BFBA 1GRNA 2JLSA 5C31A 2PO5A 2J3HA 2PRJA 1ODKA 2YQ5A 2CL5A 4I4LA 4LNUB 1Q12A 4RD0A 4ACBA 4IS2A 5HJ7A 4P9NA 3VAAA 2FP4B 5F9MA 2R1TA 1WCV1 2XVZA 3DE3X 2FQ1A 3HEMA 3NLLA 4FIZA 1XEWX 1FP4A 4LBVA 4D74A 2ZRLA 5CLHA 4S0XA 3B1ZA 3S28A 4LDPA 2MINB 2P9HA 5F1PA 2JLZA 1BIFA 3OICA 3PFIA 2AR9A 3O26A 1E5XA 2EWWA 2JJ1A 4GW3A 4LISA 3EQZA 1FTQA 5B4TA 2PX4A 1NLZA 1YR6A 4ER7A 4JI2B 1WSBA 4GVXA 1T9KA 3AHEA 3GR6A 2EZ9A 4R1MA 5A9SA 1NLYA 3UCFA 4Z4EA 4ARVA 3UNXA 3OHMA 1G60A 3THXA 1FLNA 3EUWA 1H42A 4MVJM 5IN5A 2P7IA 1CSEE 2P5YA 4XCXA 1ZIOA 4C0QC 4YASA 4G41A 4OSEA 4IIEA 4QL3A 3HFGA 1QAOA 3JZFA 4OATA 1ZU4A 2IXAA 4L0QA 4R9RA 5COBA 4AAYA 1K88A 3ETEA 2CZQA 4YB8A 2G09A 4RSMA 1ID1A 4J0JA 4ZV7A 5LIRA 2WWFA 2YW9A 3FAZA 3T7JA 1R0LA 3P1JA 5CFLA 4MSUA 3U3ZA 1RQPA 3W3AH 2FI1A 4L2IA 3E3AA 2BEVA 4JOCA 4Y30A 1MDBA 1SCNE 2OPBA 1KSFX 1FYDA 1R0YA 2FVXA 2QZJA 3K9QO 4KI0A 1GT91 3BL5A 1FXWA 5IN4A 1A2KC 3THSA 1NIJA 1CEEA 4HTFA 1NQXA 1XDGA 3TAXA 3EF1A 2DPMA 3E53A 3RVSA 2QY9A 1JJAA 3TNJA 1NURA 3TTTA 3KQNA 4WOJA 3D31A 3HYSA 3VKVA 3GJ7A 2J0UB 3OQBA 5EZYA 3TINA 1SWVA 1W4AA 4KXFB 3QA9A 1IY1A 3ZDXB 4DUGA 4WHMA 3SC2B 2DMRA 1XLTC 1Y8AA 2NUTB 3CH6A 3V2HA 4CGZA 1NVGA 2XT0A 3OCWA 4MGYR 4MS4B 1V8ZA 1MN6A 1KEWA 3NPMA 1NKSA 2ZBFA 3BIFA 3E3NA 4JQZA 4P7KA 3WFZA 4GKKB 3X2FA 2P68A 2UUCB 3NMUF 2XMQA 5L3SA 1R0ZA 4NSNA 3ML1A 2QMUA 3TRFA 3KNZA 2YIDA 3KVYA 2ZE8A 2OXIA 4CMBA 2GBFA 3RS2A 1E3SA 1RYYA 1CUJA 4CIYA 1O7JA 3DAGA 5AVSA 2PUWA 2Q7OE 5AWFC 3OF5A 5T3YA 5G0VA 1CUCA 1JQ5A 4V0QA 3V32A 3ZWXA 4Z6KA 5JJCA 4M7WA 4OOEA 4N49A 2F1JA 3EMVA 3CURA 3I6MA 5JD6A 1VLVA 2WP0A 3DPSA 3ZV4A 1ZD4A 2LZ0A 1UJ6A 2GM5A 3HGQA 3RRMA 4FGSA 4BMVA 1KI3A 2PGDA 2BGMA 3EK2A 4OI1A 1KYZA 2WAAA 2FUCA 1ATIA 3RABA 4RY0A 2QR3A 4NYMQ 5DOVA 3SQWA 3VPFA 4YBRA 4IFEA 4UTPA 4A0QA 1ID8A 2OE2A 3TQFA 1UK8A 3TF5A 4UCFA 1RI1A 4PSAA 3WL3A 4XIGS 3DWEX 1I5OA 1M1XB 1WPQA 1EWQA 1ZL0A 1QAQA 5WRFA 3AHCA 2HRCA 3EEYA 4UD2A 2GCGA 4RS4A 4AS1A 3I9V1 5D51S 4B7AA 3K2EA 3E81A 5G0SA 2JLQA 4PTZA 3UOWA 1GZDA 5AK3A 5AJYA 3I2JA 1RYEA 1EI9A 1MC8A 5JCOA 4W7HA 1S7CA 3S44A 4PGFA 3K6SA 3BHIA 3LPCA 1E0DA 1M1UA 2P65A 3FIJA 1QHFA 1USVA 4YQYA 4B80A 1X94A 2D5BA 4M1WA 3MGGA 3QUTA 3ABSB 4YRJA 1W0JA 2BV3A 2ZK7A 1O89A 1CJSA 4QDXA 3FNBA 4OH1A 1CHNA 1ZNQO 4LBWA 1NPDA 1Z0ZA 2FNAA 1OMOA 1P9WA 4RF4A 1USGA 1OPXA 1AU9A 4WLVA 5AK4A 4HAOA 3WGUA 4KXUA 5DISB 2D7CA 4N0QA 2WKSA 1OAAA 3CZMA 3V6LA 2M1XA 2FHPA 3P9NA 4I81A 4MUXA 4NYIQ 1NOIA 3NNDA 4KBFA 4YRQA 2VWHA 5AI5A 4YAJA 4JI4B 3ZKWB 2HI0A 2PS1A 3A28A 2PYZA 4U7JA 4ILEA 5CCEA 4HAYA 2BHSA 2X76A 3U2QA 2RHRA 3O5AA 2GBGA 3DC7A 3F97A 4ND6A 5H68A 4OJTA 4H0NA 1GV0A 4AYXA 4IF4A 2R1VB 5ALSA 2NLOA 3WLOA 2JFYA 1EB9A 2QRJA 3ZHZA 2H0QA 5BR4A 4U6SA 2ARKA 4Y2JA 3DBRA 3IR6A 4F86A 4EUNA 2XTZA 3ZQ4A 3CNLA 3MT0A 2P2SA 2QZ4A 2R6CA 2NUPA 2OGUA 3OZWA 1LS1A 2XW6A 4B40A 5JAIA 1J33A 1TVKB 3HBNA 5JO0A 5K8IA 2H06A 2FY8A 5L3QB 2XOXA 1SOVA 2VTBA 4BWVA 1G55A 1XQYA 1N0HA 2WUFA 3NAMA 4ZOAA 4IDGA 2PMFA 3UENA 5M04A 5IM4A 1YIAA 4N5HX 2QJFA 3OSUA 3QXJA 2EOAA 3C4JA 4BFSA 4DTCA 1QHIA 1T4BA 1ZH0A 4CMEA 3WISA 4J29A 5JZ9A 4LF4B 1QS0B 3QXSA 4OPMA 4UM8B 4HF7A 1HMYA 4D4GA 1QCZA 5HEKA 3THWB 4ZAYA 1I94B 1GQFA 1W30A 1LLCA 3OOHA 2AXNA 2Q6OA 3K31A 4YWHA 4DJTA 2C96A 3GFRA 1PN3A 2QPOA 1QZXA 3OPYI 1WETA 4IGFA 5CAEB 1T5TA 1UOOA 1JQKA 2BWJA 2Q46A 4QKQA 3KSAC 2W8ZA 3AV0B 4PXAA 1SD5A 3RSZA 4BMXA 4E03A 5E2AA 2PCJA 4OO3A 5DM1A 2PJUA 1A5ZA 1OXSC 3AERA 3L5KA 3Q7EA 4XJTA 1KFJB 5AJVB 2GAAA 2YZ2A 3GY0A 5DP2A 4L5BA 4Z0NA 1ODLA 4ZVOA 3KB6A 2HGZA 2JZCA 3ZWOA 1DOAA 5JQWA 4N03A 5KZMB 4KR9A 1G41A 4JLSA 5ITZB 2R751 3V1LA 3JQBC 5JQGB 2VBCA 2Q3HA 1U9YA 4DE5A 3RVLA 2P78A 2EW1A 5AW2A 2LP4Y 2XA2A 2HLDA 1P4AA 2OT3B 4Q1FA 3SR4A 2NO7A 4D3FA 3UCXA 4R8KA 1FVXA 1Q95A 2QF7A 4RPIA 3TS1A 3WBJA 5I7AA 2HC9A 2AJBA 1L4LA 3O8BA 1XELA 4BN0A 2VHWA 3AESA 5EI5A 5NULA 4QULA 3FTCA 2J6CA 1WW8A 2Z8YM 5AUPB 2EHJA 3I0ZA 3PHBE 4Q48A 4XGRA 4XW2A 1XU4A 3IE0A 4YRMA 5BUSA 4GE0A 4HAXA 2HK8A 4ZHQA 1BNCA 3V8QA 1IULA 3EOAI 4MCHA 3ZU2A 3CKLA