4LOLA

Crystal structure of msting in complex with dmxaa
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
178
Chain Sequence
VAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDSFSLSQEVLRHIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stimulator of interferon genes protein
publication title Structure-Function Analysis of STING Activation by c[G(2',5')pA(3',5')p] and Targeting by Antiviral DMXAA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 178
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lolA02
5CFMA 5CFPA 4F5YA 4QXRA 5BQXA 4JC5A 4KC0A 5CFLA 5CFRA 4QXPA 4F5EA 4EMUA 4LOIA 4LOJA 4QXQA 4F9GA 4LOHA 4F5DA 5CFQA 4KSYA 4LOKA 4F5WA 5CFOA 4EF5A 4YP1A 5CFNA 4F9EA 4EF4A 4LOLA 4EMTA 4QXOA 4KBYA
chains in the Genus database with same CATH superfamily
1SKQA 4Q02A 3PKIA 4J0HA 3O8QA 3TL2A 1S3IA 2QXTA 3U40A 5JQGA 1QHSA 3GYBA 4DCJA 5JYCA 3V55A 4WJZA 4AZVA 1ESNA 2HREA 2X1LA 4XD2A 3IFSA 3K96A 4BEBA 1T4CB 3U4CA 1JYFA 2DQSA 5B3LA 1I7SB 4NNOA 4BFLA 2A5JA 3EJWA 3D4OA 2XYRA 1XEXA 4GYKA 3EPRA 4LNUB 4B4DA 4DMUB 1SXQA 1SG9A 3I6QA 1F17A 1JQBA 4YR7A 1AQYA 2ASEA 2D8AA 4CV3A 5F2KA 3JYNA 4TWJA 3A1DA 1HF3A 1VJ0A 4YJ3A 4QGSA 2Z6AA 2UXCB 1LDNA 1XMSA 3PQEA 2P4UA 3PFKA 5E8RA 4DKXA 5EIEA 3OQOA 1Z5NA 1UBOS 4C6HA 5F4ZA 1BEUB 3ORRA 3PV0A 4EHKA 2Z0MA 1OZFA 2I33A 4PNPA 2R7LA 2VO1A 4GSKA 1PI3A 3EDYA 1AE1A 3V4ZA 5EPOA 3OJWA 5JXJA 2OHOA 2W4IA 1AZSC 3K6KA 5L3SB 3DVSX 3QEMA 2YN2A 3CZQA 1LPPA 4HWOA 1OC2A 3WNVA 2H1HA 1DAPA 4CN8A 1HWYA 4DUYB 2PLWA 1XKQA 1MR3F 1RYNA 3HFSA 1V2HE 1R0SA 1FFSA 1JXMA 2Y1WA 3OA0A 4G81A 1YBFA 4GPD1 3C4VA 4QO8A 2PKEA 2GH1A 1LDYA 1FX0B 2GN9A 1XRQA 2NZ2A 3AYXB 3D6FA 3NIDB 2QMQA 3B48A 3UWMA 1JG4A 4CTOA 2W2OA 3RAGA 2PRIA 3KPVA 4KQIA 3QV2A 2I66A 4X6UA 4KZKA 3ZTTA 4N48A 1G8YA 5E6SA 3DOIA 2VF5X 1A7JA 2PR2A 4NBTA 3KSRA 4C4OA 3VH2A 5B30A 4DLXA 4MV0A 3OQBA 1EDZA 3Q0IA 3B78A 2Z2KA 1ZH8A 3JD3A 5K2OA 4BO6A 1DDIA 1T2UA 2TYSB 1W47A 3E27A 5DHFA 4M1EA 4NR0A 3K8YA 1RBZA 2CLHB 1G19A 3K1AB 1RJDA 3C3BA 1OYYA 3NV9A 2QAGA 2PIDA 2QZJA 4IVNA 2YVQA 2PJDA 3OIVA 4NQRA 3H5VA 5FBQB 5HGXA 2FN4A 5TIIA 2V97A 3SHQA 2WHXA 3OLQA 5TF4A 1M3SA 5LLDA 2IX3A 2JHPA 3WR5A 3N0TA 5KMGB 4MQFA 2G1JA 3HDGA 3HBJA 2HPZA 4CV0A 4KE6A 4OLJA 3KT0A 1L4KA 1PJAA 4EI7A 4KBFA 1QOQB 3T38A 1JHDA 2OUIA 1UJ2A 5J5CA 3CWZA 3O9VA 4X6LA 1UBLS 3OKPA 3E4CA 1D6SA 1EVKA 1NP7A 2CNDA 2GPAA 2POCA 3ADPA 3I2FA 4HP8A 1SKUA 4QATA 3TRJA 5A3SA 1K3FA 1SIWA 2XA2A 2YMLA 1OFHA 3F9RA 3LPLA 4LZWA 1WVIA 5D3KA 4J16C 4LCEA 4X93A 4ZKDA 4JYAB 2Q07A 1HT3A 3S2IA 1KMNA 1T9GR 1ZK4A 3O2QB 1ESDA 3FWNA 4DDHA 4OUDB 4J4BA 2H0RA 1JYSA 4KH0A 4GPIB 1JEQA 1O5TA 4FZRA 5FOSA 1H65A 3RTCA 5HZMA 4G24A 2DPGA 2VQSA 2ZSIA 1WZUA 1KXJA 2VT6A 3T3PB 4G2TA 4ZI3A 5KKCA 3O6VA 2XD9A 3GPIA 4RCVA 4V0SA 1C8LA 4FZ3A 4ARZA 2GS9A 2YWJA 2Z4RA 3MTAA 2ZIZA 4XGNA 3D9QX 5CB0A 5HMMA 3TJZA 4I1OA 3FTQA 3WIDA 3UT5B 4O4JB 5JTUA 2P2LA 1LLQA 4IQ4A 1NVFA 2NQ8A 1T43A 3EGCA 4D42A 2ZCJA 1Z33A 4IIJA 1MQ8B 3K5HA 1Z18A 2HPHA 3OQMA 4FOLA 2AMYA 2YZ7A 2G0NA 3FA2A 1OFIA 2XT9A 4V1CA 2JATA 5J63A 1NRIA 1V9LA 2HC9A 1D3AA 3JQ8B 1L2TA 3P9PA 2GYVA 3QLUC 3GVXA 3CEMA 4F11A 4K1LA 4TXLA 3HA5A 4YIKA 5LP6B 1DKUA 3FHOA 3ZDBA 3Q9LA 1OBCA 3FOAA 4TYNA 2F1OA 5D84A 4M89A 4ME6A 5FLYA 4TV9F 1BDHA 4XB1A 4F04A 1J9GA 3RBXA 2WJGA 2HWUA 3WQBA 1C9NA 1NVVQ 1ZWLA 4G8JA 3K8QA 3RVDA 4C1NA 3EYWA 1XXHA 5TNXA 1X9HA 2VQFB 1EBUA 1QHFA 2PN1A 3GJ3A 3ILYA 3VPGA 2OHVA 5JPCA 3F74A 1ULHA 3FB1A 3IA2A 4HGYA 3TQIA 4LN1A 1XKXA 3S7ZA 4E3WA 1VCIA 3F73A 2IUTA 3O8OB 5D01A 3KKZA 4UD6A 1KI7A 5HX7A 1UFOA 1JR6A 2L18A 4BLVA 2B2XA 3BMQA 3DE7X 5BQPA 1B76A 4WESB 4Q9IA 4TRJA 1I51A 1SOVA 2C5AA 1BHO1 4UMFA 5KO2A 3SP1A 1GVHA 3IRUA 4BBAA 1NLFA 1OUMA 4F2WA 2WUEA 2RGNA 3W34A 1KMHA 3C7DB 2Y66A 1W4ZA 2B5OA 3G68A 3L4EA 4QOSA 1ZH6A 3V3TA 4FGWA 4Q4AA 4XYMA 3GRRA 1DKMA 5BNTA 4BO7A 3FYTA 1LKZA 4PWZA 1S96A 4TQ9A 1KJQA 1WY7A 2KYRA 4PSCA 2BMWA 1CS0A 1JIIA 1NPDA 1X3LA 1XFDA 1PQYA 2JFQA 1W0JA 3EOZA 4BV2A 1X92A 4I99A 1AKYA 1C7JA 1S8NA 3KEGA 1FQKA 4M8KA 1A8QA 4EY3A 2BCEA 3AJDA 2I03A 1OLSB 4JKIA 5FI3A 4WBNF 3W06A 1XYYA 1I1NA 3KXLA 1EFCA 3KHKA 4WLVA 1P29A 3DYIA 4KP7A 2QM7A 5KJ1A 1ZNXA 4CI9A 1SUBA 3LCVB 3EX7C 3GXBA 4RF2A 1ISSA 1LNZA 2J9FA 1IZZA 2WAOA 1RHUA 5DHRA 2IKSA 3DV0A 3DMTA 3FWZA 3OCXA 2VUUA 1O97C 2VDLB 3GA5A 4JA0A 4Q7EA 3BIFA 4JENA 1A2BA 4BE9A 4P86A 3K2BA 2QU7A 2IYEA 4NFHA 3IBGA 2A3NA 3GY0A 1J0DA 2IHYA 2DHRA 1QVAA 1WMFA 2WFZA 5U9CA 1K92A 1V71A 2JJMA 4FFWA 2WJ6A 3LGXA 3TOVA 1XXHE 1QFMA 2UZAA 2G70A 4H1WA 3V4RA 3T1QA 3V4FA 2O5VA 3BICA 2FDCA 4QPDA 3ZHUA 2SKCA 3I39X 4NMHA 4OP1A 5K20A 7MHTA 5JAQA 3VNBA 4TLAA 1FNCA 4K87A 1LV8A 2JGJA 3FFXA 1CQZA 4K5QA 2AH5A 1PF7E 1AV6A 4KFSA 2W4MA 4X91A 1U9IA 5C53B 1O4WA 4L72A 1D2MA 1PR9A 2XY4A 3E53A 4L28A 2QTTA 4MKHA 2YY5A 1XEWX 2B20A 2HLNA 2HF8A 1W0JD 4BNLA 4YRZA 6LDHA 4R83A 4I81A 4LOHA 1N5RA 1T9GS 1YIOA 3K4QA 4C0HA 1KEZA 3UO8B 3AY6A 1SU6A 4PY2A 3OQNA 2DPHA 2H92A 3ZWPA 4TVKA 1HTBA 4YAKA 2HRQA 4V3BA 4P4SA 3W5DA 1C3EA 1FQWA 2F8MA 3FBTA 4G97A 4EG7A 2VLIA 3R76A 4BO5A 3A1TA 1PYDA 3T3DA 4WOCA 2HU7A 4QBKA 4FW8A 2PH1A 3D2AA 1TM3E 4QYMA 1KMCA 2CB0A 3AGPA 4LAFA 2JHFA 4C0QC 3GJXC 3QGMA 1JJIA 1YB1A 2CVHA 2ID8A 4N4AA 5FL7A 3UGJA 3ZNQA 1K9SA 1T4CA 2OBFA 1CEXA 1KBZA 1TM1E 1Z5GA 4LNUA 4TKUB 5JDIC 1E2FA 1MNAA 2R79A 2BY4A 4PS0A 4CWAA 5AW7A 3LHDA 4EJSB 2B94A 2CJPA 5EUQB 3T5TA 1ZNZA 2QL6A 3DP9A 4N8DA 3CR3C 1DHRA 1HKHA 2Q4EA 3EXHC 2GERA 2HT1A 4XVHA 2FLKA 5JADA 1M72A 3ASYA 5C8YF 1SBZA 2CVPA 4R01A 4ZDIA 1D04A 4MROA 5J59A 4RA6B 1QIFA 1B8OA 1UM8A 3NU1A 5L3SA 5KOIA 1Y3DE 1ZVMA 5KHOC 4X0EA 2ETXA 1ZKDA 5KYTA 3K0BA 3M5CA 1J25A 2A3RA 5IM4A 3I4CA 4R1QA 1WUKS 4LDJA 6PFKA 1NXXA 5H9VA 1EBFA 1VJTA 3EGEA 3IP6A 3LPAA 5I7EA 1V8OA 4Q93A 4S1TA 4JX9A 1YE8A 1M74A 2Q9BA 3EDMA 3TSYA 1G8HA 4YRSA 3D4NA 4XGQA 1FX0A 2BP7B 5GGXA 1UKAA 1Y1TA 2JGKA 3WRYC 5KWSA 5FL7D 4Y2TA 5HIKA 4NBSA 4UVDA 3U7GA 2JF0A 3BDIA 1EWKA 1FUKA 3TTXA 2BEVB 1RKQA 5HDQA 3CX3A 3E9RA 4XE5A 2PDAA 1MQAA 4PCUA 4K0KB 1G0OA 2J6HA 3QXSA 4WJKB 5F5LA 3ZHXA 2O57A 5IAEA 3VOSA 3RUPA 4DAEA 2A9VA 2BMAA 4M0PA 4P4TA 1JKIA 1ENOA 1GYQA 1WAMA 1V3UA 2HOQA 2I4NA 2XODA 4HATA 1CE8B 1MT0A 1TLTA 4AY4A 4CHGA 3L7YA 4G65A 4C6RA 4OKIA 3IH5A 1W76A 1XJQA 1GPDG 1LNSA 1JDUA 2FSVA 3FTDA 5LDHA 2CLCX 1VSVA 4JLOA 3KQSA 4Q24A 3H1BA 1CUWA 1NZFA 4ZXFA 3RKUA 1VA4A 2H2FA 3EGWA 4GMFA 4YALA 3X1KA 4YIHA 2W6JD 1XMJA 4MW0A 1SEPA 4QDJA 3TLXA 4NXNB 1QR2A 3ELDA 4TMZA 1Q95A 2F1HA 2X1VA 3LL4A 4DUPA 1Z13A 2V9CA 3COVA 5AHOA 3CRZA 3WQRA 1PG0A 3H1PA 3CT6A 5AJVB 3BF8A 3RK0A 3TFWA 5BNIA 2Q9UA 4PF1A 1OX4A 5CDUA 1B0ZA 3D4PA 1G8GA 1JZQA 3T9FA 4ALMA 3HVKA 3AJRA 3GF4A 4EG1A 1QAOA 2KS6A 1HSZA 2QLMA 4OUDA 3COYA 1OYVA 4H7DA 5I7VA 3KVNA 5H4HA 3RRNA 2XA1A 4C1BA 1PU2A 2XKJE 4TYMA 3H5NA 5F12A 3UN1A 3PDIB 1RAEA 2X5KO 5ALWA 3T41A 2D4AA 3MXTA 1M10A 1RADA 1MG5A 2C8JA 2R8XA 3KR9A 2BFOA 1W44A 2X3YA 3AF3A 3PIRA 3AEQA 4GGMX 1PDOA 2O23A 2PLFA 4LVCA 3IIKA 5KYKA 4BGIA 4P08A 3UT5A 4O4JA 1XWWA 2YY6A 1BYUA 3H1GA 4LHZA 3W9UA 3PWSA 1HLFA 3LRXA 1RYHA 3F67A 4MW2A 1K7EB 4JQOA 2HV9A 4F5WA 3BMOB 2V1XA 2JJ8A 1H2YA 5IN5A 2PUEA 7MDHA 2I67A 4BUZA 4DUGA 5IM5A 3JQ8A 1EAMA 3HXKA 1YS2X 2ZYRA 1H2XA 2MJLA 5LP6A 1R0BA 4URWR 2R7KA 3FHTA 1IWPB 4DIFA 3HG7A 2WZCA 3RTDA 3T1TA 4R2LA 2QQFA 2EVWX 4NS4A 4Z0HO 3S55A 3TFQA 4A3SA 3BGDA 3F1KA 1CUVA 3QF7A 3VUEA 1U80A 2Q6KA 1G18A 4L0MA 1CEYA 3TKLA 1V8DA 1YVDA 4MTCA 3H6HA 5HIJA 4HVCA 3GFVA 3ZQ6A 4PPGA 2B0CA 3R8FA 1D0SA 1C81A 1ETHA 2P1ZA 3IP1A 3EF1A 3L7KA 3ONEA 1E7YA 3O8OA 4FNOA 3S7TA 1OFUX 4B34A 4H0NA 4BX9A 1E58A 4HQLA 4CMIB 2XMBA 3LKDA 2I9PA 4MQLA 1Z4QA 1RC8A 1PX2A 3VU9B 3GJ5A 3M6XA 1SPBS 2N1MA 3RS3A 4WESA 1XF1A 1QE0A 4NOMA 1GPUA 1HG1A 1LW6E 1N1MA 2CMGA 2H4JA 3CM0A 4N3CA 4OSPA 4Z3DA 4PC3A 4E03A 2XOEA 2MHCA 4HS4A 1REQB 2NN3C 1KI8A 4D9NA 5K3OA 3VYTB 1L7XA 4HC4A 1XD2B 4RGQA 2D7JA 2J5RA 3JD0A 4X8HA 1KJZA 1PJCA 5FX2A 1LUAA 2C5LA 1XHEA 1JIVA 2Q29A 3E7PA 3N6RA 4KX3A 4KYIB 4TWAA 2C92A 2OK7A 3KM0A 5CBKA 5EESA 2PO5A 1YDGA 1CJVC 2GBIA 4DUGD 3MJFA 3RG2A 1JG6A 1P91A 2Y9MB 4OGLA 4S12A 1LPNA 1RZUA 2AI3A 2QR2A 4GVPA 3VC1A 4FYVA 4OLFA 1NNSA 1OLSA 2HA5A 5DBOA 3REOA 1DRUA 5C34B 1C9MA 1V95A 1Z5OA 4IXNA 1OT5A 2Y6VA 1CY4A 4RMNA 2AG1A 1RAHA 1SVWA 5ALKA 1SC4A 3PJFA 4GRDA 3STHA 1QH1B 4BNNA 1KEEB 4UAVA 1IXZA 2DSTA 3QP9A 5C8XA 2QRKA 2IUUA 4PNHA 1ZOOA 3A70A 2CJWA 2BGRA 2VDWB 4GO1A 3B3GA 1UBHS 2JZOA 2HCFA 2ZYDA 4HH3C 4B9AA 5AUOB 2D5IA 1WXEA 2IPXA 1QCCA 3WOHA 1FTYA 1U7WA 3LWZA 4X8MA 4QRHA 3FETA 5KS2A 4UNSA 3ZKWA 3H9CA 4OQYA 1T8WA 2NOAA 4CTKA 1D2HA 1ZNYA 1YI1A 2KE5A 4FLEA 2Q0SA 2SCUB 4M6WB 4W7HA 1WCYA 4JVMA 4IGIA 1JHXA 2BHNA 1YS1X 4WZBE 1Q20A 4PLZA 1M7HA 1UPTA 3D8RA 4N6OA 4NULA 1HETA 1Z88A 2WFAA 4G1FA 1NJ5A 2B8WA 3L6DA 4MZDA 2J59A 4UM5A 2DCMA 5F3WB 1XGKA 1KA9H 3EWSA 4L73A 4PX2A 1CNMA 121PA 1J5XA 4DHWA 4LY0A 3A6GA 4G5XA 4JT9A 3KQHA 2DWOA 1UJBA 2FSUA 4B7AA 2WJAA 1AMUA 2OFWA 1VLLA 2OORA 3IMGA 3V4VB 4MUGA 3RC7A 3I0NA 4NK5A 2EFHB 2D59A 2YWEA 1PFUA 2O5RA 2O4UX 1SBIA 3SC3A 4M53A 2YWGA 4XWWA 1DJQA 5KDLA 3QUAA 3R9WA 1QO9A 1MB4A 4OY3A 3PGKA 1LA2A 4N76A 1J00A 1DX9A 4B32A 2C5EA 5IKXA 4YDRA 1C29B 2BFWA 2QKYA 2WPNA 3DFFA 3PFHA 5FFNA 3PNPA 1LWOA 4R8KA 3WL7A 9ABPA 2UUCB 3AM3A 1XZPA 3B9QA 4PLYA 4RVFA 2EJWA 4O25A 5AI4A 2BBTA 2V5AA 3MRVA 2IEBA 4NE2A 3GI1A 3EXG2 1FYEA 3C3YA 1MO6A 1GPBA 4M9XA 4ND8A 4US2R 3OICA 3TTUA 4DRXB 1W30A 1SBHA 4GKJB 3F96A 1KERA 2FWNA 4B47A 1ADGA 1I33A 4JC5A 2ZYTX 2XB8A 4EJSA 2P4SA 4NMWA 3SIRA 5IS2A 1B1AA 4IIUA 3ZY2A 1CULC 4EW6A 1IAVA 1NDUA 3KCNA 3MRTA 3OIWA 1UZUA 3W4JA 3GNTA 1KP2A 2PLRA 1JIKA 2XRFA 3G2PA 4WN3A 1YCDA 3ITKA 4BV8A 4N1AA 1N25A 1QZUA 1I2CA 1VCHA 5GM1A 1VSBA 2OWEA 4W9NA 4DQDA 1EK6A 1A9OA 2A86A 3UB4A 3VJLA 3BL6A 3H1TA 1FZQA 4N7JA 2P9HA 2DPYA 1JA9A 3A1EA 3ELYA 1Q0UA 5IBPA 5JV5A 4CMJA 1TCVA 1NSFA 4DIUA 2QX8A 4HWKA 5IJ0A 5CAEB 1PZGA 1ID1A 4A8PA 2NPOA 4C7KA 1WDLA 2P2NA 1K4YA 3AERA 1UDAA 2QNIA 4G0PA 3T1VA 1P80A 1Z25A 2QLTA 2XDQA 3ACCA 2BP7A 1MN6A 5EJFA 3GW8A 3V8VA 3UAZA 1CR0A 1PW7A 2GBGA 1KR5A 4IH9A 2O2ZA 2NUAB 3M8KA 4CL8A 4MI1A 5AK0A 2HQSA 2BEVA 5E4JA 4BGVA 3KETA 3KU1A 4EY7A 2I4RA 3GOQA 2J48A 5DTIA 2Q49A 4B35A 2QF7A 1VSTA 3KWJA 2MIIA 1DTEA 4ARIA 2Q5LA 1JEAA 2O54A 4PGGA 8OHMA 1PZNA 1ZXBA 1O77A 3OURA 4CKCA 2MSDB 4JWKA 4WY8A 1E5LA 2CMHA 3AR7A 1B2LA 2IHVA 3PRHA 5KUTA 3KFXA 2CHGA 2EEZA 2GN0A 4ZMRA 4MVJM 2J3LA 4Q19A 1PQ4A 1SCQA 1PBNA 5EKSA 3D3WB 4FGUA 3UY4A 2C7RA 2BL4A 1P17A 4OQLA 2HWWA 1DAHA 1UZMA 4ZVUA 3QH4A 4G89A 4LI3X 3AEUB 3MMPA 4DV2B 1YS7A 4REMA 1VBKA 2YRFA 1AKWA 1FYXA 1W4RA 4M4SA 1S1CA 1Z28A 1FFYA 2QXYA 1IWBB 4NU8X 3LP6A 2GEUA 2FETA 4H3KB 4IIHA 3WL8A 3AV3A 5AQ1A 2VXCA 1QVRA 1EVJA 3JD4A 4WY2A 4Y0VA 3B8HA 3ELWA 4BAGA 1RD4A 2IYVA 3VKHA 1NR5A 1I30A 1J99A 4J1QA 3NH9A 2G72A 5GM2A 2GAOA 3QKRB 2WP0A 4BFSA 3DZJA 4TMWA 1Y6QA 2IZ7A 3V2HA 1SHZA 3RRYA 4OXYA 2OBXA 3MGBA 1EQ2A 4QPCA 1MVLA 5AKKA 3ZU5A 1GU0A 2C99A 1KRXA 2N3ZA 2ZSKA 4EUEA 5ALTA 3HYLA 3EW9A 4JUDX 4XQ0A 3U3RA 2ZSHA 5ES4B 1WD7A 4DV1B 3QBVA 3RTAA 1ZSYA 1PEAA 4G4JA 5AKHA 3O8NA 1V48A 3KUDA 2OBBA 1BAPA 1NHWA 1XLUA 3B6IA 4V39A 2O1EA 5B1DA 1O9GA 3WYAA 3HXOA 2B1GA 4ENVA 4RQTA 3NONA 3CPEA 4Y6GB 3ERCA 1NZJA 1FXWA 2GF0A 2YR0A 3HXPA 3A0RB 3QUTA 1G8MA 4YRCA 1J2UA 1L7AA 4RETA 3NKVA 4L3VA 3RFXA 4EMUA 4NENB 3AY3A 3BXOA 3SFTA 4ARAA 1JIJA 3TLBA 3BMOA 3ILHA 1FLAA 4CKWB 4GRIA 1JHOA 1U4OA 1V5FA 3R4CA 4NECA 5K03A 5LYJB 3S27A 5FR2A 4Y98A 1RWKA 3WVNA 3V4PB 4OU4A 3QPBA 4G8BA 2DTDA 1GG2A 3WNCA 2PS0A 2X2EA 4ZT5A 2UUOA 5B4UA 4A03A 2H7XA 5E1OA 1DWQA 1FNMA 2X1MA 4TWIA 2GSDA 1KPIA 1YDEA 2J67A 4JNKA 1H8ED 1P60A 2UYHA 4BO9A 2EIHA 4X24A 2ZIUB 3HHPA 2QEQA 3PNSA 3QKTA 4YVFA 3EZ9A 4L0QA 1EYZA 2B0JA 2COKA 1T8RA 2OVFA 4R2XA 3PVSA 4Q6WA 1TYCA 1KDPA 1T1SA 2I2WA 1MC4A 2RBKA 3DLCA 3L7CA 4G5RA 3V8NA 1Z07A 1QFSA 4CMIA 1Q44A 3ZXYA 5TX7A 4TRMA 4YRKA 5K3BA 2PTHA 1SZCA 2QS9A 3VU9A 2OKCA 3IBFA 3NWJA 4QEKA 4BN5A 3FNEA 2AXNA 1TECE 1ISGA 2O1XA 3FZYA 3PYLA 4KLNA 1BG6A 1REQA 3PQ4A 2HR1A 3FPCA 1WKBA 2YC2C 2YICA 2ZJZA 2OD7A 1XD2A 3GMIA 3BIXA 3FJ1A 4PAWA 4BASA 3I37X 4RSRA 4FFVA 4V0MA 1TQ4A 1VKOA 4IWXA 5BSUA 5K8LA 2IGBA 4C04A 4GM1A 4G0MA 2TMDA 3KIPA 3AVUA 4F1JA 2OEPA 4R0NA 4OHYA 4J2TA 1GT6A 2GPYA 1QHHA 1K6EA 1DNPA 2J3EA 4KODA 1AV7A 3CLRD 4H1TA 5EYPB 1OYOA 2AR0A 2O3UA 2VPQA 4OAOA 1HURA 3ZDXB 2YIJA 2JFHA 1V8FA 2CCGA 2P5UA 2PVPA 3KKKA 5IBQA 4EI8A 3LW7A 4HGPA 2ZUFA 3E3MA 1W1IA 3MGCA 5ADWA 5DW0A 5EIHA 2WU3A 1KEEA 2AMFA 2UVDA 4RTSA 3IO3A 1O95A 1PR2A 1GEEA 1ZM9A 3BDVA 4LZAA 5I9SA 2VDWA 1DLIA 4DIKA 3F6SA 2A0KA 4QFCA 2OV8A 1C1DB 2GLXA 1Y4AE 1E2IA 4A2PA 1CRPA 2GOYA 1DIGA 1RZ3A 2OHJA 1CEQA 1B8UA 3I2KA 1NBMA 4KH1A 4OBXA 4ZT4A 2AXPA 2H8GA 2Q7DA 1C2TA 4J43A 3U7FB 3SF8B 2FK7A 4J1TC 1QDEA 2SCUA 3FYCA 3OU2A 3HUUA 1I24A 1QKKA 2C3PA 4ZRDA 1RYBA 2I34A 3JZMA 1ZRHA 1FOEB 5CK4A 3K70C 2Q2VA 3AVXA 4XDYA 2D5BA 2PYIA 3WGMA 1EB8A 1V7CA 1Z82A 3AJ9A 5EZYF 3G5MA 1MA0A 4LA4A 3K0HA 2NTJA 4DG8A 1NIPA 2GVZC 4O1IA 4JI7B 3O4IA 4POOA 1MZVA 1A9TA 4JBGA 3EZXA 1GNSA 5CHYA 4E13A 1ZHOA 3Q9NA 1M8PA 2XE7A 3E7XA 4WH0A 4EECA 4LCJA 2ZLBA 5ADVA 1XG5A 2VBCA 1WABA 2O0KA 2IW1A 2ZJ8A 3AY7A 3WL5A 1RP7A 4MB2A 2OXRA 3CXRA 3DHVA 4FP9A 1WP4A 2Z2YA 3N1UA 4AJ4A 3GBSA 1P1BA 4V0ME 1V5GA 2NU6B 4UDOA 3WB1A 1PSDA 3F4KA 2ADOA 3T3MB 3W7AA 3OFVA 1XMOB 1ZJWA 2COUA 2I6GA 1O95D 3FGNA 1U02A 2WD7B 4F92B 4A26A 4XVUA 3U7JA 2B30A 3QVMA 1WUHS 4RZQA 1YK0A 4R1UA 4BMZA 4X1OA 4RDXA 4N3GA 1XQYA 2W48A 3L8YA 5ALEA 1JB1A 1NBMD 1MHPA 3KXPA 1V6CA 4DRXA 3AM4A 3T95A 4NY1A 4YP7A 1CPYA 4N0QA 3BHNA 1E62A 3O82A 2J8ZA 4RMHA 1Z7YA 2A4KA 2ZSAA 5KYXB 1D07A 4BQFA 3NPMA 1DFGA 2MINA 2ZBVA 3IVRA 1IN8A 1NJGA 1E7QA 1EXMA 3GFOA 4AJNA 2CKMA 3PENA 1NBME 1T6YA 2D06A 4FSHA 4JVOA 3E8MA 2R4UA 5DYIA 3RANA 4W5NA 1A97A 5B1IA 3CV3A 5LNK1 2P2GA 4YY3B 3CZ9A 3GWZA 5HIIA 3TUZC 4LWOA 4DA4A 4PR0A 2H00A 1KAEA 2RK6A 1LQTA 1BVRA 1V25A 1IN5A 2A9QA 4LRUA 4OFXA 4OHPA 3S1AA 2QTHA 3GH1A 3UXEA 3WSVA 4K40A 1N5DA 2PX4A 2VPXA 3OTQA 4LK3A 4PFKA 4AM8A 3DONA 2PKXA 1AF7A 5CAEA 3CNEA 1ZRNA 4HO1X 4OL9A 5LQKA 1QLHA 3S29A 3ZU2A 3ZY6A 2JFUA 2EATA 4H08A 1NVGA 4WAUA 3H5WA 1WR8A 3CC8A 3N2LA 4ZAZA 4Y1GA 1FUEA 5HKBA 2E5LB 2NUAA 3FDJA 1U7XA 4WXRA 2WHPB 5EG5A 4A8JA 1MC1A 1OAOA 4RZ3A 4ANFA 4D3FA 3FMGA 3MQ2A 4CT0A 4RBNA 2BELA 1TAGA 1VE7A 4J0CA 1Z8HA 2JDIA 3IRVA 5HG0A 3SSOA 4QM6A 1KY4A 3BRSA 4HNAA 3HB0A 1X1DA 1XNQB 3UG6A 4OQEA 1C1XB 1GGEA 1NVAA 4DMHA 3OOYA 1DO2A 1K2VN 5JARA 4JL5A 4Y67A 1S8OA 1UJNA 3G5TA 3N8DA 2C7BA 3OC0A 2D8MA 1R4MB 1W48A 2ZUBA 5JCZA 3C5CA 1U5CA 1DLJA 2H85A 5C7LO 1QDUA 3QWHA 1TT5B 3D3WA 5KKAA 4W7SA 1GHTA 1QR6A 1Y33E 3DQQA 4YUYA 4BVBA 3I52A 1ZX1A 3VNQA 3PEWA 1MBZA 3QI2A 4JP1A 1TM4E 3AEUA 4JKYA 3KD2A 2JEOA 4RPLA 1DOZA 5EMKA 3QXCA 1HOXA 5C1BA 4EJFA 3R0IA 1F3OA 3DZHA 5CNIA 2B7CA 2ROQA 4Y2RA 2F8SA 2XZLA 1CDZA 3SDZA 1N5MA 1S2NA 2PL9A 1SO8A 1H4QA 3PC4A 3PXDA 2IKQA 2G08A 5EIWA 5J4VA 4A5SA 2RSLA 1U2EA 2ZRJA 3QKRA 5ALRA 3AF2A 4HZGA 1E1QA 1CERA 1F8XA 1H4VB 2IOHA 4RYLA 2Y1KA 3N2EA 5BPHA 1FX1A 3GVCA 4M7WA 4ZVSA 1DCFA 1ZUWA 4A2WA 5IDQA 5KNBA 1UFQA 2A5YB 4CU2A 3PHJA 1UM9B 1VI6A 3R20A 2JDID 3I1YA 4MVYA 2IP4A 1WU8A 2AFIB 3QZUA 6GPBA 1U1DA 4PC1A 4OQMA 5CYOA 2EFJA 5DV9A 5JWOA 1YB4A 3HBMA 1TGVA 2R60A 1ULUA 4U63A 1WW8A 4L8FA 3IHKA 4I4CA 3AIOA 4BNKA 3AVPA 3DYBA 3QLEA 5DBHX 1I9CA 4BVEA 3WWOA 2C31A 2GARA 2HLPA 2QROA 3MB8A 2LBPA 4NENA 2E5FA 1QGUA 5DO9A 4IF4A 4NU0A 5MDHA 1FFEA 1BS2A 2QTBA 2V6BA 4D9CA 1CVRA 1CY2A 2H4WA 1N3LA 1DT3A 2PD3A 1F8GA 1GN9A 1PW5A 3QJGA 2I65A 4NCJA 4YJHB 3ZYZA 4BCBA 5LYJA 2DXIA 1CRQA 2BI8A 1R66A 3A6ZA 3DL2A 5YASA 5A9TA 1IG3A 1BZYA 3G17A 4RK4A 2FR8C 5DM4A 3ETGA 1CX9B 1PLLA 3B3QA 5D1NA 5K0CA 3EQ6A 1QV7A 4HT3B 2LW7A 3IIMA 1E1QD 2GEFA 4ZO4A 1BC5A 1OVMA 3EE6A 4ZANA 4CHTA 2NZUG 2PG3A 3EXEB 3MJ4A 1M9NA 4P7FA 1JHAA 3UXHA 1RXYA 2HSEA 2RJNA 3EGXB 3ADKA 2H65A 1PT8A 3ZI7A 4HFJA 2IK8A 3GD7A 4BFXA 4E5MA 1KY3A 3WLLA 4B40A 1R5JA 3EMVA 2PA3A 2C5GA 4GGPA 4DLZA 2ZZMA 3VOAA 2AIRA 3KZXA 2XZOA 3KQNA 3TXAA 2XCTB 2AUTA 5TVGA 4WN9B 2EOAA 2ZGVA 2ZQZA 4NU5A 3QELA 4LOKA 3WLMA 2ALJA 2XJ9A 1N0UA 1WCWA 3Q10A 1R3UA 2IX9A 1NW5A 3L1HA 2II6A 5KNLA 3UATA 1D03A 1DFIA 5AW5A 4JCCA 4UEQA 2A4MA 3IUNA 4FD3A 3R4VA 4BFTA 4WBNB 1IHUA 1PNQA 1MKYA 3U37A 5JZMA 3FOFC 4P0QB 4NYMR 1RP1A 4Q7JB 4GPEA 4AJHA 4LX0A 1P7YA 1OB2A 1T5DX 1GNQA 2QHXA 3BKWA 3EH2A 2VQ6A 3FTEA 221PA 2F59A 3NORA 2YVLA 3MTGA 3P0JA 5EUBA 2IPLA 2VN8A 1EA7A 4RNCA 2C9OA 5FPQA 2M1ZA 3CINA 3MSXA 2ANCA 4LSGA 3OZBA 5EP3A 3HK2A 2RK3A 1SQGA 1XZNA 1SUFA 3C3JA 5EJ2A 4JT4A 2AJDA 2XA9A 4IXDA 4ENRA 2P3QA 2DWQA 1QTIA 1XVTA 1ZUD1 4PQFA 5G3ZA 4L3WA 4Q3LA 3UJAA 1UOQA 3H4VA 1KH3A 1LBTA 1LLDA 4FCTA 3A36A 1TE2A 5LZ8A 2VEDA 2X22A 3P9NA 3EVEA 3SF8A 1YRQA 4H7HA 3TVTA 4JLMA 4XYLA 1SU8A 1UZAA 3JYPA 3ZQUA 3N0VA 7REQB 1IZ7A 2P35A 4NCNA 4Z7OB 4FYXA 1NF9A 3LZCA 3SEAA 5K6AC 3JQDA 4ZXPA 1L7BA 4PRKA 1TZCA 4ZZ1A 1WE2A 1YA4A 2I5PO 2X5NA 3ED5A 4WSOA 3EQ8A 5LQMA 1HDZA 3U44B 1S02A 1X7HA 2OSBA 4II2A 4XX1A 2REQB 1D4FA 4JFRA 4KX5A 4EFDA 2XECA 3LDUA 4FD2A 4CIDA 1MW8X 2XXAB 1AGXA 2OCPA 5AW6A 5B1SA 2JGRA 4Q05A 3GRUA 1FQOA 2PWZA 2PNJA 2FPGB 2WYVA 4ND2A 2UYOA 3INNA 3R7BA 3L6RA 1PUJA 2QY9A 1BE0A 1KVTA 3JQAA 4NQZA 4ZTBA 5KNDA 2DQYA 3JQ6A 2V4MA 1JDBC 4BZXA 3KVVA 3ZBPA 3FVQA 4KBYA 1JVBA 5BR1A 4L4XA 2X0DA 2NU6A 4BMXA 4Q3CA 1TT7A 2CLKB 4PFSA 4DZZA 1WMAA 2JAPA 2FEAA 2FZ4A 4R1LA 1E3EA 4CT5A 4DGQA 2GB4A 5JNLA 1PN3A 2WD7A 4WJLA 4OATA 1JECA 2CLSA 2HIAA 2HADA 1FVHA 3L46A 3NEPX 4I9UA 2ECPA 3A06A 4HDRB 4HEJA 1YFKA 4A0HA 2ZU6A 5JSUA 2PSJA 2O8NA 4HEA6 4Z8XA 1GDTA 1H69A 4ZAGA 5CFOA 3ECSA 1FIUA 4FIZA 3H0CA 2PKWA 4PSUA 2FF7A 3E2IA 5C8YB 3K6RA 4Z3KA 2R62A 2JGAA 3CF4G 4F9EA 5CFNA 5KYXA 4BXOB 1FEZA 1R8XA 3AHFA 3SYRA 1BE8A 2Q21A 2NAFA 3DEJA 1B93A 2ECFA 4PPQA 5JDCC 4GE0A 3SPXA 1LQUA 3BFKA 2XE8A 4EMSA 4RZSA 5AVXA 2KLBA 1WSWA 3DKIA 3FG9A 2KM1A 3AR5A 1FL9A 1P77A 2EZ8A 2IY7A 4U7FA 3WAKA 2WE7A 3C6QA 3R3SA 1QBKC 4OBBA 4JGGA 4RIFA 4BNJA 5DP1A 5LJIA 3NFRA 4YRPA 2RD2A 2XRZA 4JS0A 5CVCA 5UKDA 3U13A 5KNDD 5HRUA 2AR7A 3FPGA 3VVLA 5EGSA 1FCJA 5THKA 1U8UA 1U1IA 1ULTA 2G5PA 4MDHA 1GWNA 4DYHA 1X1BA 1E7SA 1FU4A 1JWLA 1NPTO 4ZCSA 5BNZA 4AMGA 2NZYA 2XBLA 5J4KA 2GJ4A 4TROA 3O94A 4J0QA 1R00A 3T35A 4F7WA 2XUZA 4BQEA 3CVVA 2B2CA 1QXSA 1NFFA 4MRRA 2RGBA 4CU5A 1G8JA 2O50A 2WHPA 1J8VA 4DGSA 3UPDA 1MOQA 2DBRA 1BQ4A 2QN3A 1YNSA 2WG0A 2F1JA 4X1KB 3MUFA 1K08A 1R9MA 3DBLB 4FX2A 2HGZA 5JZVA 4MCJA 3EIHA 4DA7A 2WIKA 1EVYA 2R87A 3C74A 3EHDA 5JXWA 4G86A 4F3TA 1M54A 1MZPA 2BONA 3DVAB 1YBVA 4FS8A 1TQ6A 1R4MA 3AONB 3DEZA 1T10A 3DOEA 1DQPA 1KO1A 3F5SA 1JLSA 1V2GA 3C15C 4LV5B 4BV3A 2XZTA 3NOVA 4WW0A 4XVCA 3TQQA 1G5RA 3OZDA 1E1DA 3AR6A 2QQ5A 2DFLA 4HPWA 2BTOA 5ALGA 4JN6B 1FZTA 2WF6A 3SNHA 1KZ1A 3EWNA 3NUZA 1DJPA 2WWXA 4IGEA 5DGHA 2VTBA 5DK6A 3OCCA 3BN3A 1L4EA 3ZJTA 4RLHA 2QLNA 3HO8A 4I1SA 4Y2HA 5C31A 3EBOA 3JS5A 2HHHB 1N5JA 1O7JA 1PZHA 2O2EA 1I3OA 2IGTA 2P68A 4C08A 2FY8A 2JLZA 2ZANA 4QOIA 2PU7A 3ZW7A 4RD6A 2JI8A 1BJRE 5T7BA 1ZMXA 3TI7A 2W2XA 4HCJA 2WVJA 2OSVA 3EF0A 3Q11A 1C0KA 1I3KA 1UOEA 2PUHA 3TJRA 2B5VA 1XTSA 1GD1O 4TZ0A 3TQFA 4IG4A 5F21A 2EC5A 1L7EA 3H5IA 4A1FA 5HXAA 4I5DA 5H59A 1UM9A 1MEJA 3MERA 4P31A 1IDN1 1ODIA 3EFOA 3SZUA 4JJFA 1QQBA 3PT9A 1U7DA 2AFIA 2W6QA 2C82A 3I23A 1G5HA 4JOBA 4U6QA 1USVA 2JAXA 1C5KA 3L6CA 1ZMRA 5DU2A 1IN4A 4M9SA 5JSZB 2E49A 1EIWA 1HDGO 1O03A 2VKQA 1DBSA 2W2VA 2FJ0A 5JTTA 1FF9A 1QK3A 1HZZA 1PSZA 1AU9A 2E4ZA 1I1HA 2A14A 2G0TA 2O7RA 3DDOA 4JELA 4XCQA 2LCQA 4BRZA 3WICA 1VL0A 4Q4CA 5JEEA 3BMCB 1U28C 3WWZA 1FDTA 1CDEA 1T0UA 2D2IA 2ZYWX 1X7XB 1JLHA 1J2YA 3KP1A 1RU3A 4TV9A 3TNYA 3GZTB 3T1HB 4I9GA 3V1LA 3FOEC 1ECBA 2NU8A 4TTAA 4FMDF 2GPWA 3CCFA 1W19A 1G20B 3OZSA 4BP1A 3QRWA 4H2DA 3ND9A 4PXSA 4YJHA 3SEZA 4Y2PA 3UT6A 4BMYA 4MMZB 3A9VA 3KG2A 1AUVA 5JXIA 1K5HA 1KZ9A 3QUSA 1AKRA 2E6KA 4IHJF 2Q46A 3KDPA 4LJ8A 2XVAA 4ARVA 4D7AA 3A04A 4MI9A 4IIBA 1EUQA 2J9YB 1N9KA 1IM5A 1EE2A 4DT1B 4U2GA 1OXUA 3P5SA 3VZRA 3LA6A 4DXHA 2YV5A 1MAHA 1ULBA 5BR7A 3EXEA 1MRSA 3ZV7A 2C0QA 1JG1A 2ZDGA 3O31A 1QRDA 1ONBA 2C8VA 1YCHA 4DQLA 3HJAA 1GGJA 3RW9A 1N6OA 3EGXA 5NLLA 4Q3NA 4YACA 4E7OA 1MV5A 3M4YA 2QR5A 3E9DA 3WK5A 4OREX 4XQGA 2Z30A 2NU9A 3TBHA 1QOZA 3BBLA 4ZAXA 1JEYB 3L7OA 3CO5A 1JMYA 2NT3A 3UMJA 2O4CA 1FTGA 3I9KA 1NMYA 3QKUA 3ROTA 4GAEA 1PR1A 4DC9A 4WN9A 3TSCA 2QR3A 3OUUA 3Q8LA 1NXQA 4NMXB 5F3DA 1QVVA 2HW8A 4IDEA 1QV6A 1YASA 2X6QA 4RFLA 3H1EA 2IU6A 2CF6A 4HDCA 5HJ2A 1KAGA 1GAEO 4H7FA 1W34A 3BOSA 4BMSA 2R8BA 1U9YA 3FCXA 2JD0A 3WX0A 5IT0A 2A8YA 4OX9Y 3BL8A 3T5GA 1ZICA 4WBNA 3MILA 2R11A 2WAMA 4YAWA 3DEIA 4AP6A 3Q7RA 1YRAA 3O74A 5IULC 8ABPA 4RO0A 4F96A 1A95A 2WAYA 2UYCA 2QN2A 2CHQA 2Q4OA 421PA 5AKEA 1TZMA 3RK4A 5AD1A 1T0IA 3CZPA 3L04A 2GCNA 1ECJA 3E9MA 1XC7A 2FMFA 4JBLA 9ATCA 5KYVA 3WKDA 3ZQJA 1QCDA 3NBYC 4LFBB 1NI4B 1TNDA 4OB8A 5EVJA 2FRVA 5AKLA 3QEAZ 3FLEA 4IFEA 4NHEA 3R44A 1V47A 3DHYA 2ORIA 3MJHA 4BB5A 3KJEA 3A6DA 4MPPA 1BVHA 1XDGA 1Y9EA 4KMOA 1DG9A 2YJ4A 3NHUA 1AHHA 3R8CA 2O1SA 4TV8F 4K9SA 1J8MF 4Y6RA 4ZO6A 5JRJA 2CXOA 4UZEA 2NAPA 1UQTA 1KQNA 1O2DA 4O8CA 1EKXA 4EHLA 4CNQA 1SUIA 3VSCA 1PK8A 1IDOA 4GUDA 1UDXA 3VPFA 4B6RA 4EW2A 3DEFA 4TXHA 5C5IA 2ADMA 3AKZA 3ZDCA 1N5OX 2XKAA 2C78A 3FBWA 3WMXA 3KZNA 3VNUA 4Z0NA 1I3LA 4OAQA 2PWBA 2REQA 3KFVA 3Q7EA 1DWOA 2Q5QA 1GQFA 3KLMX 4Y6PA 3A6KA 3L0PA 4FVTA 3EB9A 1VP9A 4DL9A 4HNHA 3I5UA 1T2FA 1CY8A 3LLSA 2BFEB 3A1SA 5C3UA 3W0LB 1LPSA 1Y4DE 3E9QA 3EF3A 2KWIA 1G7RA 2FPGA 4YS6A 5KEIA 2VEOA 2XCQA 4IKEA 4ZOCA 3TR5A 1YZVA 3U26A 1BE1A 1YUMA 2GXUA 5CJ2A 3FKSD 2FZGA 5A5EA 2F9LA 2A0FA 3UENA 2ZATA 4JBNA 3ZLTA 3RVBA 1LV7A 2VPTA 2AN5A 3E2PA 4CEIA 1T1IA 2V5VA 3FTNA 1CRZA 1GGNA 3BDAA 4P2GA 5T6BA 3Q3CA 3RSFA 4RZUA 3FOZA 3DAYA 1PS8A 1T91A 3VDXA 4F06A 4AS1A 4BRWA 5AW3A 1VL6A 3DQPA 5C4GB 2J7KA 5C5DA 4YMSA 3VZDA 2Z4TA 1GVNB 1MX5A 1CR4A 2O3SA 4K88A 4WEOA 3V00A 1N78A 5T6MA 1XEWY 3LL7A 1QGDA 2CXHA 4JYZA 1X1EA 2HRRA 3QW2A 3T7TA 3C3MA 1PJBA 4OFWA 2XMQA 5GY7A 5C8YA 4MDEA 1QMGA 4UJ3A 4DJ5X 3IAEA 1YXMA 1SULA 3AZOA 4FUTA 5CT4A 3W6NA 1ZVVA 3Q7IA 3KXDA 4NPHA 5L7YA 3ZWOA 3WL3A 4B3DA 4AY2A 2QN1A 4IM7A 1NQXA 3LX5A 1ENPA 2Q6OA 2WI8A 1E4OA 1O08A 2XMDA 5JAOA 3ZDDA 1E5XA 2V7XA 2VBFA 2QRGA 3ZCPA 4QTTB 1CUDA 3CA8A 1TUBB 1U1CA 1HTTA 1XD8A 4UHBA 3W7BA 5FPKA 2Q3HA 1N6RA 2CL7X 3F9IA 1MA3A 4M7RA 2QDXA 5E4TA 1T9ZA 3RUHA 4F46A 5T3YA 4YDHB 5HCUA 2PBZA 4F91B 3DBRB 1AO0A 2BMDA 5SYNA 4RA9A 2ZJ1A 1ZCJA 4QOFA 4AUNA 4AUEA 1NQVA 1KI4A 1ZD9A 2FZ5A 1O6GA 2BKAA 3OZVA 3AH8A 2I29A 2QLBA 3FZEA 3QJYA 2WSSA 1PSWA 3PP8A 4M2LA 2JFNA 3E82A 3GZJA 1FRZA 3ZE0B 3M6WA 2FPIB 2ZULA 2NXJA 3N5CA 3NTQA 2QVCA 2ZRAA 2ZITA 4NZMA 2MSLA 2HQOA 4ON9A 1PVOA 3DUWA 5FCDA 4BBJA 2ZETA 4ACAA 3PJDA 3BB4A 4KFRA 3DCIA 1JJBA 3SJZA 4MO9A 4X1KA 4YCMA 2QLLA 1TVMA 4XFJA 5HJ7A 4HD8A 3VZBA 4C21A 1QB7A 3C3WA 3C8ZA 4TSRA 2JGMA 4L5AA 1S5PA 2AEFA 1K6JA 2P78A 1OF1A 4OHOA 3DVAA 5I9NA 2I0FA 1Q6YA 2W5UA 1NUPA 2G5CA 3IYLW 3KSUA 3AB8A 1M2OB 3HZHA 3P9KA 4FMPA 3HR7A 1J7JA 4URHA 1NQWA 2QYOA 1T35A 1RFLA 4PAOA 3W5BA 1T5SA 4FDTA 3N8GA 5E7IA 2FZWA 2OCDA 5MGBA 5C52B 3I8XA 4AS3A 3LRTA 2HFKA 2FMUA 4EKGA 2A9FA 4TYYA 1E18A 4INAA 4Z9AA 4HQOA 5G0TA 4LXTA 4ITUA 3GU3A 3H5RA 2BF4A 4Z1MD 3EVDA 3R5KA 4QLBA 4RNDB 2E6UX 1VJ1A 4XDHA 3N0XA 2W2PA 3KQYA 3PLAE 2WSSD 3DH0A 1M2NA 3FLAA 3CO0S 4ENPA 3LT5A 4QEZA 2R86A 3HCWA 2VHZA 7YASA 4XXHA 1V1JA 3MT9A 1SIBE 3NBMA 1L5LA 4D4JA 4UOEA 3MMZA 3LDFA 5KYUB 1I94B 1O97D 1P2VA 5FFFA 1P5JA 1DBQA 1L7DA 1VPLA 3GT0A 2WMOB 1G9TA 2WSLA 4GLLA 2G8NA 4KE9A 3TPCA 5A9SB 1N6IA 4MV1A 3KYDB 3QENA 4NONA 4E15A 5IHXA 4HBZA 1BMQA 3IC5A 3NHFA 2G6TA 4GNRA 1KK1A 5DN6A 3FPBA 3WRVA 3FHJA 2FG5A 1YRWA 3IDQA 2F48A 2J46A 4C4TA 1G6Q1 1Z15A 2E21A 4G0WA 1ZO8A 1DDOA 3GK3A 2E89A 3B7WA 3PNMA 4M86A 4LXHA 1T3TA 5I9LA 3ETCA 4Y6OA 2PUBA 1E3JA 3NXSA 4EEZA 3ZCSA 3GRKA 2ERXA 2O7NA 4YPFA 2BEJA 5SY9A 1B6SA 3QVKA 1MPTA 5KJFA 5LZ2A 3RIEA 3HRHA 1UT5A 1GT91 1KFBB 2P91A 2ZIEA 3LGAA 3P2OA 3I04A 4W99A 4ZOAA 4OHUA 1I80A 1NR1A 4DMMA 3TLGB 3ML1A 3D02A 4V0RA 1J4AA 1QE3A 3L6BA 4MUAA 1G20A 3ER9A 3R5XA 3NWBA 4BVLA 3ED1A 2YXPX 1L8LA 4YJGB 4IQGA 5DWDA 4CN9A 1WXDA 3EFHA 5AVUA 1OU4A 5K0BA 3JYHA 2GZ2A 4FZVA 1M8FA 4OYHA 4BZWA 2FUG6 5ESRA 4CM4A 1PHRA 4DT1A 4RFSA 4X20B 3HEBA 1JR4A 2QK4A 1MO2A 3KUCA 1HFJA 1VRWA 4LOJA 4WCFA 2FF5A 4E5YA 5B7NA 3HBLA 5AM1A 4E5KA 4KB5A 4DLBA 2X3FA 4UBKA 3IXMA 3TIIA 2IYTA 3VJMA 3LYUA 4IV0A 4F8JA 1XVAA 1P18A 4MKFA 1IM8A 1F5NA 3L7BA 4PIVA 2BSQA 1SVMA 1ZDMA 2ZROA 3LCUA 4R16A 1J5EB 2FZEA 2QPTA 2XB2A 1YR6A 4YP5A 5FBWB 4ZEXA 2X2PA 1B00A 1QPGA 3LG2A 3Q8XB 2ZBGA 2JAUA 1SCIA 1YGPA 4LJ4A 5KYGA 3SVLA 3IQIX 2V45A 2H5JA 3ZS9A 4D6PA 2P2CA 2OB2A 4PTLA 4RV9A 4J0DA 1E9AA 3LUJA 3IQXA 1IAQA 2J0SA 2DU8A 4LV6A 3TZ6A 1RAGA 1U2SA 2RI6A 4J07A 1DC4A 4W63A 3IOEA 3F7NA 4KXNA 4UBNA 4J7XA 3WJ2A 5C35A 4HK4A 3MT0A 1IB6A 1PYOA 4RXUA 2WOJA 2AV6A 2UZ3A 4ABTA 2FWJA 5PNTA 1UJ6A 1QIJA 3L05A 1QH9A 5BR8B 1S01A 4UW9A 2PZLA 3WWDA 3AR8A 2EDAA 3R77A 1O87A 4WT7A 1X14A 5JMOA 2G3YA 3PDCA 4I8IA 3S28A 2WSMA 1J8DA 2ORVA 3FCCA 3X1XA 4E2YA 2PYZA 3GH3A 4G3XA 1NI4A 3PFNA 1KRHA 3E0QA 4HZUB 2X8JB 4TPKA 1G20E 2M9MA 3K73O 4X1IB 2C8KA 5HCIA 3K9WA 2PS3A 5ELLA 2IEGA 3O0DA 3T3EA 1CY1A 2CN1A 5A3VA 4I1VA 1TAUA 3PXBA 3KKNA 4BJHB 4YR9A 4BJ6A 4F93B 1K88A 4QYWA 1A7UA 1U9JA 3CNLA 3S2YA 2PCJA 4V2IA 4GPBA 3PNVA 3ZGXA 3OZUA 3P27A 4D0GA 2IL1A 3RFFA 3BB1A 3FCEA 3UH0A 1N36B 1ABFA 1F60A 2P9ZA 1YL7A 3CF4A 4DJAA 4NEQA 4QDUA 4ZVOA 4E33A 5I8WA 5I4IA 4MGIR 4PQEA 1ZY2A 3HJBA 3PD7A 1OE0A 4JJ6A 5LDGA 1H9BA 1BS1A 2FZKA 4Q7MB 4PX5A 4IUYA 5IF9A 4AMVA 2ZJAA 3L8CA 3TTWA 3ADOA 2HBZA 3EVGA 1ZI8A 4WZZA 3UCEA 4N5MA 4FKBA 1U1FA 3CE6A 1DB3A 2XUOA 5EIOA 1NQ5A 5FTMA 4DIEA 5ITVA 5EMHA 2BFEA 2PXCA 2H1SA 4FOPA 1ES9A 3UPTA 1ZLXA 4RDHA 4PLCA 1IPHA 1TKRA 3E1SA 1XRLA 3BPSA 4D9EA 2BC9A 2F17A 3CPJB 2FN9A 3KJNA 3LZ6A 3MMXA 3KR0A 3QOXA 5GMOA 3WGZA 1ANKA 1PQWA 1H6AA 4NFYA 2QYTA 1H3EA 2VSQA 3IP5A 1BQEA 3UFBA 4IICA 5EIBD 3MTBA 4N49A 3VVCA 1PJLA 4E4YA 4CUKA 3TSWA 2NUPA 3LIPA 2BW0A 3IUJA 4HDNB 5DHPA 5KYUA 4UM9B 1D6JA 4A92A 1DRKA 1GZ5A 2JGFA 1F06A 4Y2UA 1YACA 2CXTA 1JHUA 1SOWA 1C9DB 1GV1A 1K75A 4GWKA 4WQMA 1CHDA 3WG9A 4DCOA 1FNDA 4S0ZA 4P3KA 3UWSA 5SZHB 4BWFB 2CBXA 2P7IA 5I7HA 2WWVD 3O03A 1Z38A 3PLRA 2BEWB 3F97A 4PFQA 1U2DA 3N8KA 3AP2A 4TMYA 2GCEA 2CLIB 3D3QA 2JLSA 3JTEA 2K2QB 5D6OA 2FRDC 2HZ7A 1PJ4A 2Y77A 1MMFB 2X0NA 2F00A 5TEWA 4HNRA 6YASA 2BI7A 1HKUA 1NXOA 2DBYA 4DADA 5JD4A 5SYAA 3O38A 4O5OA 4IIDA 4BWGA 4DV7B 1MEEA 2NZ8A 3PYXA 1UKYA 2DBVO 4C0KA 2BMFA 4HXFB 4U39A 3V7UA 3DBRA 2NXEA 4NBRA 3ZVKA 3C45A 1IYZA 2CUNA 4GRAA 3V7YA 2PLAA 5KC8A 1AKVA 4UASA 2NTNA 2I2AA 5B4TA 2O8DB 4NRDA 3EG9A 1DKNA 3KYCB 3Q40A 1Z6TA 4OKNA 3NHJA 3I1IA 1RIFA 4KCGA 4MW5A 1EK2A 2FPIA 1K6MA 1LS6A 1FC0A 2BM0A 2LR0A 3T0GA 1I2ZA 5DOVA 3I2IA 2P6RA 2R47A 4HFMA 2Q3MA 4D1YA 1PG5A 1PTKA 4FR0A 1DKRA 4F1KA 1IEQA 2Y0DA 4CIYA 3PEEA 3KX2A 5NULA 4RHXA 2VT3A 4AG3A 5F1KA 1Y1PA 2GAFA 2EYQA 5EJAA 3WFIA 4MVJP 1YL5A 1BMTA 2EARA 2JAHA 2XBMA 3QUCA 3UJ7A 4OF4A 5BVHA 1JE0A 4B71A 1EHCA 3Q0TA 2HMTA 1NW7A 1SXJE 4XKJA 5C81A 3HUDA 4II3A 1A1SA 1M2OA 2ODBA 1G5IA 4EJ2A 1YFLA 4NAVA 3EPJA 1VL8A 1E6CA 5JC8A 4B82A 2FOIA 3J7TA 5E6UB 2JIDA 3R7FA 1ZQ9A 3JQCA 1RIIA 5L9AA 1GOTA 4E3ZA 4IXMA 4R9VA 4WD3A 3AUYA 3FDZA 2G07A 3EWAA 4IV5A 2IRWA 4GR4A 4WERA 3WL4A 5K4GA 4AO8A 1UXIA 1NFRA 2ZT7A 5CB4F 3TR6A 4E30A 1N2XA 1OWPA 2WG2A 2IY9A 4CODB 3ITEA 4DNXA 3JQ7B 5DM60 1G59A 4EFKA 3A31A 2NQ2C 3KEFA 3R0VA 1TF5A 4MUFA 3Q72A 4ZHSA 4ZYVA 3W5AA 3VU0A 4D57A 3L02A 1R5NA 4N12A 1IUNA 3L9WA 2C2XA 1WSAA 1ZEJA 3KZOA 5FHRA 1YBAA 4KXVA 2HWKA 2Q45A 3B5EA 3KEMA 4GDFA 5JFOA 3MNFA 1IHDA 1MT3A 4J8PA 1PFQA 4QREA 2YHSA 4YRTA 4AIIA 1YJCA 4INZA 1OJLA 2RHLA 4C88A 3FF4A 3KYDA 3N74A 3OTHA 4MV8A 3VYWA 1JT9A 5AM2A 1BDJA 2AVDA 3ENKA 5FP0A 2OQIA 1NV8A 2W93A 3W5IA 3CLTC 3SD7A 3ZVRA 5FAKA 4BB6A 5A3QA 4H3SA 1C3VA 3HU2A 4G26A 2VJYA 3BS4A 1A50B 1GDDA 3LBNA 2P7HA 4DWWA 1JAIA 1VZ2A 4UU0A 4H3HB 2DECA 1HE4A 5F51A 5J47A 1ZMTA 1AKMA 1GPH1 1GUBA 1X7DA 2QMYA 3GMTA 3FPAA 3NC0C 3NTOA 4M1KA 1VJGA 3C4JA 3KZVA 4GEGA 4KDFA 2XEDA 5BN1A 5AI5A 5EZ6B 2H06A 3HV2A 5K8UA 2C2GA 3ZJVA 2VG8A 2Q99A 4MS4B 3RU2A 2GNPA 3AP1A 3T9BA 4BX8A 2HY7A 1QPZA 1TKCA 2W83A 3DHNA 3IAAA 1QHGA 5ALFA 1FSSA 1OWNA 3TCXB 3UMVA 3MFQA 2E4VA 4GXRA 4YJGA 4BOYA 1X0VA 3FJYA 4U7TB 2NSHA 4ZCMA 5CVEA 1RXIA 5CDHA 3VHXA 2Q3FA 4X20A 3MIIA 2BUCA 2ZUEA 3WGHA 3NYWA 1ODCA 2I4TA 3D2LA 3EBPA 1WX1A 4U0JA 1HE3A 2WIFA 4CIWA 2FEPA 4YP6A 4LCBA 1IXSB 1P0QA 2E2WA 1JEYA 1OILA 4OB6A 1DQNA 4RWZA 5FBRB 3ROXA 4UHKA 1ULSA 1Y5IA 3BWYA 3ANLA 1I36A 3GUHA 4ROSA 1GSAA 3FF1A 1ZMOA 2WTAA 4MR8B 3P0FA 1T0HB 3TIXB 1COWD 2FK8A 2CEAA 2ZWIA 3PHHA 2BGJA 1M0TA 2G71A 4QSHA 2JFFA 1Z62A 1VMEA 3CN9A 1FRQA 2XQKA 1O0SA 1Z7BA 3VU1A 1C9YA 2ATCA 1T8PA 4YT5A 4F9FA 5KOJA 1M6VA 2GDZA 1XE3A 1U9CA 4RY9A 5EY5B 5K9ZA 4MP3A 2AHRA 1DJNA 1K86A 1G64A 1KJ8A 5KSOA 1UP4A 3LOQA 3OEEA 2QM8A 4U00A 2AFHA 1ZL0A 3L79A 1UMKA 3QF4B 3TEFA 1YE3A 7GPBA 1OYWA 1EB9A 3ZNPA 4NNPA 4X84A 4U9IS 4YPVA 4TYWA 4KYTA 3LK7A 3VR4D 2GFIA 2P3SA 2SNIE 1BEZA 1BKSB 1PTJA 2Q4TA 3SC2B 2IPMA 3CGGA 3KKLA 4HZUA 4C0WA 1MB2A 2X8JA 1SUCA 1OPRA 2B34A 2NXCA 3GYGA 5IWCA 2C7QA 4LOLA 1T26A 3EODA 1QH8A 3ASUA 2YS6A 4X1IA 4J3NA 3VSDA 2JBWA 4ZVPA 4DJEC 1Y1KE 1M6WA 3PR1A 4KQXA 4EY6A 2IDKA 2PXHA 2JNWA 3CMCO 4KIWA 2J31A 5I4CA 1T24A 5EZYA 4PC6A 1T1RA 3IILA 1YZFA 4G84A 1LDBA 1F0YA 1WS6A 4YECA 2ZWPA 5J2UF 3O1LA 1R6BX 1N5KA 2ZT6A 2UUBB 1XZHA 5CB6A 3HPRA 3JARA 1NXVA 3IELA 3DNPA 1A0OA 4EHBA 4D4IA 4YA6A 5BSEA 1ECFA 4KN5A 2EG5A 4GSYA 4CDNA 4EAAA 4GQBA 1J42A 1DT5A 1SB9A 3JATB 2Q6IA 5FRDA 5M04A 1P4GA 5U1PA 4GOKA 4KR9A 3KQKA 3RU9A 4V0OA 1CUIA 3DXYA 3LVBA 1P2FA 4PG4A 5DN9A 3VQTA 2RGYA 2QSZA 3OEED 3WYEA 4EELA 4R41A 3B1FA 1OIXA 1HL3A 3FLBA 3VPCA 4DDMA 3UF0A 5G40A 3T7SA 1KY5A 2IBTA 3UTCA 1DHTA 5FHQA 1UC5B 4I55F 3ISVA 2CB9A 1GU1A 4LRXA 3DFIA 1V5IA 2XW6A 1D4OA 2ZBUA 3F49S 5CX1B 1EZ1A 3D64A 2QUZA 5FUXA 1E1LA 4HDNA 2AFHE 3QU5A 4OUKX 2J85A 1ST2A 3UWPA 4XSGA 3GD5A 3ABZA 2OUKA 4K6HA 3UT0A 1JI3A 5AHKA 4P81A 2IIQA 4JR1A 1FRNA 1UXHA 3CR8A 2VSXA 4HUQB 1N2SA 2OQVA 2DE0X 4G41A 3TR0A 4DSNA 1Y6GA 2YHBA 2OP0A 3AHJA 4LS3A 4P82A 3WYFA 5CPBA 5CFMA 4NPCA 3V8PA 5EJ5A 4N0DA 3BQ9A 1GO2A 2IYNA 2XYGA 2BEWA 3TSAA 4F2HA 1UPCA 3RE1A 1JA1A 1I13A 1JHVA 1UT8A 5K2MA 2GM4A 4RK6A 4KU4A 2XNDD 3B6JA 3EARA 4MGYR 4X60A 3SVZA 4BKMA 4Q34A 4P3NA 1NC3A 2H7VA 1X77A 3BXZA 3MD9A 4AULA 2ZOSA 4DMLA 2XWBF 4RQAA 1Y5RA 4RXTA 5FKJA 3UQZA 1KQGA 4DSUA 1T6ZA 3WI7A 3W5JA 3QIAA 4ZEMA 3JYLA 2R5NA 2HSJA 1H9AA 3IAHA 3KR1A 2FCRA 3N2NA 3K0SA 4NP6A 1WLSA 3OCJA 1UOOA 4KV9A 4Y2XA 2A88A 5DMHA 4BUCA 2FSPA 3JQBC 3NPAA 3ANYB 2IXGA 5FT9A 1GPLA 1IEWA 2WNIA 4CXMA 2O8DA 1GGFA 1WJGA 1O5IA 1U2ZA 1W85A 1Q14A 3KOXA 2ZVDA 2CUZA 1M5TA 2XF8A 1BFKA 4U3JB 1HLDA 1MB9A 1KS9A 1UEJA 1Z34A 2VAXA 4OK5A 4QDXA 3CBQA 5KI6A 2FN8A 1X7GA 5JAPA 2P9FA 3VRHA 3K71B 1T4BA 1POWA 2IZ6A 3C1OA 4UM9D 4YRRA 5JPIA 2RC6A 2NUBA 4PO8A 3F5QA 4YP9A 4F6RB 2IZ5A 3BSWA 3Q5GA 1Y3HA 4M9ZA 2L19A 4OCZA 1X0XA 2BGTA 5BT9A 3L0ZA 3GNLA 2WFMA 2HU2A 3WGQA 5A4AA 4QDOA 4YMWA 10MHA 1B1CA 1FTWA 3E81A 3KO8A 1ISIA 4CDRA 5AXAA 1LS1A 2Z5FA 3IP8A 2D0DA 3ZN2A 3P2YA 2MYUA 4MUIA 4I3GA 1EAYA 2XR1A 4TKMA 1PDVA 5HKOA 2X6TA 2IZ0A 1XLWA 5FWDA 4CLXA 1X8LA 1Z0JA 5JECA 5TQ2B 1E79D 3A2NA 4GGOA 4Q9AA 1KGSA 1CYDA 4P98A 5E6UA 5ENDA 4F5ZA 3JAMA 4QYXA 2VSOA 4R6WA 2XUJA 1N1GA 2A1UB 4TTTS 1WNFA 1SKYE 2MYTA 2ZR9A 3AEXA 1A82A 1JE1A 4EWLA 2ZCVA 4YWJA 4IKPA 5JI3E 4KDRA 3W4IA 3KCQA 3LSTA 3OFND 1L7QA 3DM5A 1BTOA 3JQ7A 3ZE8A 2IYLD 2ZUDA 4HYYA 3W5UA 1KH1A 5HQTA 5FPPA 2VDVE 5E7MA 1XI2A 2RKWA 4XGKA 4PANA 2CV0A 4EMTA 3WQQA 2QD2A 1C9KA 1NOKA 5DGCA 5ANRB 3JQ9A 2MSWA 2NO0A 2FW8A 4WLFA 4AF8A 2OP1A 3P52A 5FYDA 4LUCA 4N9WA 3TRDA 2VPYA 3T3NA 4LQLA 4TLMB 2CXNA 3NRCA 3P9SA 3R7AA 4DCTA 1J2EA 4PBTA 2GA8A 3DBHA 4X62B 3OD5A 1MF7A 2PEZA 3MWKA 4XJVA 3W2IA 2NV6A 4ZDKA 1CF2O 1P33A 1DU4A 2OE2A 3GGGA 3M5PA 2ZRKA 4NH4A 3QM1A 3G13A 4LVNA 5AHXA 2G9VA 1KC3A 1K3UB 1D6MA 1TQ8A 2IEDA 3IEPA 3M6AA 4JLKA 5FUWA 4RENA 1P7CA 2D0OB 4WLNA 1YRHA 1TTTA 3I92A 1OX6A 4FYHA 2MMGA 3LQKA 4MAMA 4MK4A 2VCEA 4XUGB 2O6HA 1SEVA 2FPUA 3FWHA 3QVSA 3MAAC 4U6NA 1RPNA 3QUQA 4GX2A 4JBYA 4LZZA 4W5JA 3WK9A 4A15A 3ITNA 2VWPA 1U3FA 4IHJB 3WMGA 5KNCD 4BLPA 3UQYS 4MS4A 1MH9A 5CD1A 5K45A 1JSCA 1FNNA 3HWRA 1AGRA 4LOAA 1FYVA 2OBLA 2XCOA 1OH6A 2R00C 2HPAA 4U5QA 1HFEL 1Q7EA 2HCBA 1ILWA 1P3DA 1Y0BA 2YXEA 3AW8A 5ALMA 3JZDA 3OI7A 1EDOA 3IAXA 1FVOA 3FFTA 3IQGX 2G0AA 3C1UA 3STWA 1UDCA 3FTCA 3I6BA 2DKFA 2V7EA 4Y30A 1QRRA 1IEXA 1T29A 4LY6A 1LLCA 3B70A 4WADA 3L4BA 2GPNA 5TS3A 2IIBA 3OP4A 4WKCA 1YOVB 4KJXA 4NESA 3IP7A 2XHEA 2MTBA 2A33A 1QS0A 1EGHA 2I4OA 3H7AA 1R0WA 2VOJA 2XUPA 3A37A 5A5GA 1ZUHA 2Y92A 1KC1A 3HBNA 1BGWA 2OYCA 4DRYA 3WGTA 4IX9A 2V0GA 2H1LA 5HHTA 3QVTA 5EIFA 4HLQB 3CG0A 2D1QA 4BNGA 2A5GA 1XU7A 3LWNA 4HG2A 4G2NA 2JFVA 3AFOA 5KTOA 2O3JA 2IXDA 3O4FA 2ODEA 1I2BA 4P7JA 1VFNA 1GPKA 4H7PA 4JKOA 5AM4A 3RG8A 3RNLA 1TMKA 4MUEA 1ZUNB 3I2JA 4Q37A 5JANA 4K05A 1IFXA 4UTRA 1DMSA 4B3TB 3MLAA 1KRWA 1P61B 1W87A 4BMNA 3ADBA 1Q7GA 3GVHA 2W58A 3CEHA 3DTTA 4OMUA 1JFTA 4O3FA 3VR1A 4C2AA 1EH5A 3WRXC 1JHZA 3R6DA 5L40A 3PPIA 4FMCF 1DX4A 1E94E 4BJ5A 3P94A 2FFRA 4IW3B 2HLHA 3F9CA 2ZK7A 2RHCA 1N6HA 2XWQA 2XXBA 3P8ZA 1IMOA 1KL7A 1YZNA 1ZJ6A 2YOGA 4KSBA 4Q1CA 3TIFA 1ZVKA 4QG3A 5GGYA 5TE9A 4HWSA 1I4OA 4G5OA 4NH0A 3PUXA 2RAPA 4ID3A 1BX1A 2HJWA 1TJPB 4LXYA 3IUEA 4P53A 4KG7A 2D5LA 1UH5A 4NBNA 1WZIA 4D3XA 4EY4A 4OQDA 3QBTA 3G89A 2C59A 5IJAA 3VPHA 1YHYA 4LQDA 1WD5A 1PL8A 5KVSA 4H3VA 1Z56C 5DVZA 2GETA 1K27A 1L5ZA 1NM5A 2Q6LA 4N7RA 2WY2D 2XZPA 1TJ5A 2OK8A 4U2KA 1KYVA 3MPUA 4KREA 3C48A 2PMKA 4YT8A 2Z1NA 1JLMA 2WABA 3E03A 1U99A 3ET5A 4RJ2A 1RABA 5HRCA 4FGKA 2OAGA 2VNIA 3VKVA 3QITA 3JATA 2ENUA 3S81A 4DDTA 1CQXA 3DZGA 4PTZA 3PT5A 1KJNA 2C29D 2AZXA 1QIKA 2H52A 3G2OA 4R2JA 3HWX1 1QIDA 4XASA 4Z54A 5EJ7A 2VP2A 3SLRA 4NI5A 3F6CA 2OOKA 3EIQA 4U5XA 2XPCA 4KW7A 3LVRE 1U2RA 3A4TA 4TXNA 3UWDA 2C2BA 3BC1A 5I45A 3S2GA 2X0FA 4L2IB 3SSNA 1F2TA 2C2HA 3FNIA 4K1XA 4Q3BA 4DLSA 5CX1A 2G80A 4Q5IA 2O2CA 2ZU0C 3OZAA 4DIBA 1WVMA 2WQZA 5DM0A 3LXMA 3V8MA 2Z6UA 5A5DA 2DJ5A 4ZKEA 1EXDA 4J0KA 3CRQA 1YQWA 1AK2A 1NP6A 3GFPA 2KLHA 4IFIA 3BCRA 1NWHA 1Z0SA 3HKCB 5JWHA 1G5TA 1LSOA 4QUGA 1IJBA 1WUYA 3OA2A 4HUQA 5CB8A 4CEHB 3AVWA 5KIAA 3COSA 1GQSA 2E55A 5FWYA 1CSEE 2NP6A 2V9PA 2XJ4A 4FN5A 3L4SO 1SK8A 4MI6A 4RTJA 3L49A 3DDCA 1VXOA 3L7JA 1YVUA 4KMSA 1R18A 4QTXA 1F20A 1A8SA 5TT0A 3OU6A 1U2GA 1ADFA 2YTZA 3VYSB 5AUPB 2QAGC 2GHTA 2O5CA 3HGTA 1MGPA 5DHQA 3TM4A 4JQZA 4K6MA 3LYHA 3DAOA 1DARA 3GELA 2GVNA 4OA8A 4C78A 3EMDA 3I5MA 3WGOA 3Q7SA 1LDGA 4RSHA 4LK2A 4FSDA 3PEUA 4I1PA 3OWHA 2UU9B 3HCAA 1N7HA 2EKBA 2O3TA 3P71T 3HL4A 3BGIA 4PYQA 4AJIA 4U3JA 2VXBA 4YAOA 2HQ1A 3SZ3A 2Q3LA 4HX9A 4BNUA 3F4LA 3ONWA 3DDUA 1RHQA 1ZCZA 2VF7A 2RMKA 3WLAA 4OQ4A 2IXTA 3KV1A 1PAUA 4F6RA 5DI3B 2YJTD 4C4YA 5AXBA 4F3NA 4RM3A 4OG2A 4XLLA 2B92A 4J4HA 4KQEA 4M87A 3HU1A 3TAHA 4A6XA 2GYUA 5BV7A 2AFVA 4OM8A 5ED4A 4DVJA 2FH5B 1DP4A 2I3DA 4EI9A 5F9MA 2JJYA 2YVAA 3NH6A 4U2DA 3T1OA 4R9NA 1HYGA 5ICFA 4QOHA 2IP2A 1CR6A 1HRKA 3B20A 5E1DA 2BFCB 3AL3A 2R85A 4J6FA 5TQ2A 2PIAA 4BFWA 1TFRA 3O26A 2D00A 3AQ4A 2YWBA 4MYDA 2AWOA 3U39A 3MCUA 3NNDA 1G2IA 3HGMA 1B16A 2J07A 1DADA 2A1UA 1LW7A 2GNOA 2ZTLA 2YW2A 4Q03A 2VK8A 3TH5A 3B2EA 3EZGA 4M98A 2RGDA 4DM3A 4N18A 1YBMA 1XTPA 4Q1EA 4S35A 4XEUA 3C7KA 3ZHTA 1U7TA 4Z7JA 3IERA 4EZEA 3A10A 3SR4A 4FCVA 3TW0A 3SJ7A 4Q3OA 4E7PA 1L4LA 2B1QA 2B35A 2FSIA 2I80A 2OFXA 4FPXA 3VXKA 3H3XA 5BOSB 5JJIA 1BHSA 1ZITA 2E18A 1TEVA 2VZLA 4XQCA 1OHHA 3VVMA 3OQJA 2ZIVB 4UAJA 5CCXA 1VCMA 1CZNA 3JCZA 2IXAA 3EGVA 3TNFA 2XXAA 1R10A 3QOFA 3G2LA 3KOMA 3DO6A 1ULZA 4XQ9A 1SK9A 2ACEA 2HHCA 1T13A 1G21B 1QIEA 2QTFA 3QBDA 5IWAB 4F4UA 1ARZA 5EXSA 1TRKA 1Z2PX 2PZMA 2ZRIA 3CTMA 3O3NB 2QL5A 4I5GA 2IHJA 3TF5A 2PKQP 3OPMA 1Q7RA 2D54A 3B7GA 3CG4A 3IIIA 4JJ7A 4RACA 4RCZA 2CJYA 2V7QD 3REQB 3IE2A 3TIVA 3PEYA 1EXNA 3SHFA 3H2SA 1EM8B 4HOYA 2D4HA 3MMSA 4O4HF 4ZVTA 3TS1A 1BVYF 4WNAB 2OECA 5E9QA 3OIDA 3NHBA 1A9QA 1THMA 3EEBA 2NYUA 4BNDB 2W6CX 3WXBA 3ZZUA 1WBJB 1X94A 3NRJA 2FSFA 4L4UA 3H6KA 3SX4A 3BUSA 1OXMA 3UHOA 1FP7A 2LKDA 1BW9B 1SBQA 2DYKA 3LUAA 1OV6A 1NUAA 1XA0A 3CUYA 4AKIA 1L5RA 2VNKA 4G23A 3IV9A 2Q5FA 1KMQA 3QKSB 4IMJB 3KB6A 4IHJA 5JSQA 2B36A 2R4TA 1NATA 1QANA 3E23A 4NFSA 1DAGA 1L8XA 2X0IA 3WIEA 4MJXA 3RABA 1YR7A 4KXLA 1JHYA 1Z47A 4MTLA 2QX4A 3F8SA 1B0PA 4XSHA 1E99A 2CYCA 2VYCA 3FOBA 3H11A 3ICPA 3WGJA 1KEUA 2CW5A 1UBRS 3GIDA 3H4IA 2OYSA 2P1RA 3KRTA 2ODQA 4D5GA 1Y7LA 3WKCA 3Q3EA 5CCEA 3RBZA 1ZH2A 5WRFA 4MUNA 5TMDA 1U0RA 4BVKA 2YZKA 5EIXA 1TK9A 2GZMA 2C9DA 4IDHA 3NC4A 3CRRA 5LXTF 4KR3A 1TOAA 3D6MA 4FHEA 1CVLA 5LC1A 4E11A 1MIOB 1I5RA 2PAFA 3MCZA 5IAKA 3UB3A 3DBVO 2F3QA 1YS4A 3DMTC 2OC9A 4KQWA 4GNKA 5K8CA 3DZ8A 3AUTA 4Y6SA 3VISA 4OGKA 4L0DA 4LXXA 4FEAA 2FLWA 1BVUA 2WD9A 3K15A 1TDJA 4KBGA 3HA7A 1YDFA 3WB0A 2ZDHA 3E9ZA 4QXPA 4BKOA 4G63A 2ZVPX 4RVDA 1CTQA 4MEBA 4Y2QA 5I9IA 4YQFA 3OIYA 4U7DA 2XTJA 4U2BA 3T3HA 3QA3E 4ZREA 2VKTA 4G56A 3S68A 1WUJS 2DTXA 4QD3A 3BK1A 3C8HA 2IODA 4UQPA 1ZUNA 2B98A 1P0CA 2HM7A 3H2YA 5FWXB 6ADHA 1QK4A 4ZT7A 1F4PA 4G5QA 4I4TF 1LRKA 4ZQCB 1U9IC 3M1IA 3NR2A 4OQNA 4BNHA 4F86A 2CLFB 1XZKA 3IAM6 4M1QA 4U7PB 1NVEA 2O48X 4UCFA 1N2EA 4WK4B 5KOYA 3HYTA 1AB6A 1IH8A 4P5EA 4RC9A 5ALUA 2H9YA 1NMQA 3T5CA 1KK0A 1Q6ZA 4W8OA 4BFZA 3ZPXA 1QP7A 4YX9A 2FE1A 5IKMA 1JLKA 4N5NA 1PGNA 2HJVA 4PRZA 1LPMA 1T0JB 1JDSA 1ZIDA 3B53X 4KWHA 4D6YA 2BE7A 1CUGA 1JIUA 2QMHA 3I04M 3DF7A 4TV8A 3I9JA 1L6RA 1A71A 2Q6VA 3CX8A 1VOTA 2I7VA 5C46F 5M2QA 4DJTA 1CV2A 3H2IA 1KAOA 1R0KA 3B52X 4EY5A 1U1EA 3PIIA 3OFSA 2I3BA 2P9YA 4QUAA 4GFDA 3KJXA 3W5HA 5F9HA 4FLFA 1N0HA 2OGZA 2IVZA 1GTG1 1YZQA 2JI6A 3TI9A 3TINA 5FBHA 2WOOA 1LI7A 5D6NA 5HMLA 1V3QE 3FKQA 4DLPA 3ZIDA 1D2RA 3QA9A 5HKKA 1E1RA 2JFOA 4WE3A 2OMEA 5AXCA 2ZUCA 3CKYA 3EA0A 4HGZA 4ZAVA 1ZNQO 3G02A 4X65B 3VDQA 1RE0A 1VA5A 1JH9A 1EDDA 1USKA 3RFUA 1U6IA 3RT1A 5I01A 1O94A 4EP1A 5B5SA 2YXLA 3D1LA 4W5WA 1Y9AA 4WX2B 1GITA 5T5QA 4H31A 5JSFA 3FTFA 1NKSA 1K7YA 3BFJA 2E1PA 4KPYA 3LUPA 3CZ5A 2ZB7A 1TJNA 1I0LA 1U98A 2Q28A 5ED0A 2ZTMA 4QPJC 4C7BA 2RI1A 2HT6A 5DLPA 2GZRA 4BTEA 2OO7A 3UMGA 1UWLA 1T4DA 2IP1A 4D0SA 1T9HA 2O5EA 4X8LA 1RJWA 4LZOA 1MAVA 1XJ0A 2LCFA 2OA0A 4D8WA 1R0CA 5K09A 2KHZA 3KC2A 4L4SA 4NWIA 4ZO8A 1VIVA 3RRZA 2PKCA 5JZBA 1XSEA 4L2IA 5BSHA 3FMOB 2FEMA 3OEHA 3PUIA 4HEA1 1W5FA 2VDOB 1Y1RA 4UU1A 2EWMA 1RCTE 2X8BA 3KTFA 4KQMA 1G5FA 3PGMA 4NV0A 4FCWA 3W2EA 3C5WP 3IOCA 2DCUA 3DAPA 2Y1DA 4B76A 1VECA 4G0VA 1SU4A 1WTAA 2WKRA 1IJFA 1Z2EA 5BSVA 1DAEA 4JD5A 5EXPA 1J90A 1OFTA 5AJYA 2X3UA 1OTXA 1KVUA 1T3ZA 1E2BA 4R8RA 4CEHA 3C3EA 1B42A 1W4BA 5DX8A 2ZTVA 4RM2A 1YL6A 3IEMA 4B3IA 5F23A 4WINA 5LYYA 4BKRA 4MQ5A 5AW0A 3GRCA 4ENQA 1E8MA 3ONVA 1JFRA 4BO4A 2EF1A 1E1RD 4DDUA 5HKKD 5JBQA 1UUFA 3BF7A 1VYVA 2XNHA 1NU8A 4DQXA 4HLUA 1CJKC 2VZ9A 4UOQA 2V9ZA 1YI8A 1X70A 5FFMA 4AVYA 1VKNA 1GQ2A 3DOFA 4UJ5A 1C4WA 5E3JA 3WYCA 4DLYA 4K46A 2FSVC 4X5OA 2ZTUA 4FONA 4CMEA 4GPAA 2FG7C 2W6ZA 3C6YA 1OKKA 4S1OA 1XPRA 1B73A 3ZGOA 2RDMA 2CD7A 5IZ4A 1I5EA 5CJPA 3UC9A 2C0PA 2XZDA 1A04A 1P74A 1IOVA 2VSYA 4HXGA 4PHHA 4QGAA 5CVTA 4DDKA 3COJA 2V6JA 2XMZA 4D56A 5BT8A 1Y81A 1JUDA 3NWEA 1IPFA 4BEVA 3ZTWA 3GLFE 4EVRA 4IOJA 3TKYA 3AQIA 3KKEA 5JT1A 2QA5A 3A2KA 3E9NA 1EE1A 1ZHHA 2CVQA 2VBIA 3ROQA 3SSAA 3U6KA 4IMPA 1Y6FA 1Q91A 2YMQA 3EFBA 4KE7A 4WPGA 1I1OA 3IMKA 4QXRA 4MW4A 4RZIA 5FEMA 3STXA 2GK4A 4JT8A 3WK7A 4A6PA 1LJLA 4V24A 2P6NA 3HB5X 1ZOLA 4YYEA 5C18A 5K01A 1KFJB 1YA8A 1DKLA 4IDGA 4QULA 3RM3A 2YOHA 2YXNA 4IDCA 2OV1A 4LY9A 4QYSA 1N57A 4MJ3A 5CB4B 5ITSA 1X6VA 3HDHA 4FLMA 2ZEJA 5AFSA 3RYFB 3PTAA 4K9OA 2V55B 3K1TA 3RVMA 4PIMA 1NXPA 1EP9A 2GXSA 3KB8A 2ONKA 3NG1A 2H5LA 3Q7QA 2I8AA 1Z6PA 2XNKA 3OJ0A 4IJVA 4ID9A 4TL9A 4Y18A 2DOKA 5LQNA 1X2BA 2HCJB 1S89A 4B33A 4JZYA 3D2BA 2HMSA 1VP3A 3ILXA 4E07A 2WU8A 4OO3A 4C0XA 3U81A 4RLFA 5JI2E 1DTSA 1PJSA 3DDNA 5HNKA 4PHTA 3MTDA 1LBEA 3RVSA 1SH7A 2WP8J 1RRPA 2J32A 3ER8A 3RSHA 1LSUA 5BOSA 3ICQB 1ZH4A 3D6UA 3SYLA 5LP6C 3GMSA 1N2CB 4PZ0A 3TBKA 1NF8A 2WWGA 2DAPA 4QBGB 1C30B 1XOIA 1J07A 3KTOA 1EEHA 3SXJA 1ELOA 1FTNA 2IEYA 5CT5A 4KVGA 4CG2A 4QJ5A 3BGVA 4AECA 4GT1A 4ND7A 3LBYA 1E2HA 1W1UA 4P4NA 2OWDA 1U4NA 2FLVA 3JQGB 5EHGA 3REQA 3WYNA 1FFBA 1NDQA 1R6AA 3BTSA 1VB3A 3IQFA 1MQ9A 4TVOA 1C4XA 4FHGA 2JI7A 1JEDA 3EY4A 4WNAA 4A27A 4LFCB 1Z0KA 1SOUA 3QPCA 3RTBA 4BNDA 3IBTA 3KKMA 4Q6BA 1QWSA 1RJEA 1LTHR 3TGWA 4G0UA 1JHRA 1YRLA 3QHAA 3N70A 2NACA 4CL0A 5GADl 1BW9A 2A30A 4HGNA 2EBUA 3WWPA 1SU7A 2NTVA 2C9MA 5FJIA 2G1AA 4L50A 1AIPA 1AY0A 1BD3A 3H6GA 2Q8PA 3QKSA 1H8HA 2VF8A 1BFUA 1SN7A 2GRJA 2QRHA 3HVRA 2IH4A 4OI4A 5HUJA 4AZ0A 3R3WA 3ADCA 2VQDA 5CT9A 4ZYXA 5KJ6A 3ZH2A 2M98A 4PZYA 1GTSA 4LVUA 1WNTA 4JLBA 1RPTA 1WXWA 5L6MB 5FLKA 1CETA 2WTMA 2BTQB 3DPIA 5G53C 3PZBA 3ZZ1A 1B8PA 4BQOA 4HZIA 1UOPA 5HOQA 1CFZA 3UK2A 3WRWA 1SIUA 2P9TA 3G6WA 2FOLA 2FVYA 4RJKA 4IRMA 4JIMA 2GBPA 1Y7IA 3O95A 1SXIA 1VSQA 1OY1A 1RQ2A 3NEYA 3WLIA 3N28A 4PYMA 2J9ZB 1ORRA 1MIOA 4LNAA 1KO5A 1JXQA 4GXTA 4JODA 1MOSA 1U3VA 4Y9TA 1T6XA