2RCYA

Crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
GMENIKLGFMGLGQMGSALAHGIANANIIKKENLFYYGPSKKNTTLNYMSSNEELARHCDIIVCAVKPDIAGSVLNNIKPYLSSKLLISICGGLNIGKLEEMVGSENKIVWVMPNTPCLVGEGSFIYCSNKNVNSTDKKYVNDIFNSCGIIHEIKEKDMDIATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGSVEMVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYTVMNAVEAACEKSKAMGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pyrroline carboxylate reductase
publication title Crystal structure of Plasmodium falciparum pyrroline carboxylate reductase (MAL13P1.284) with NADP bound.
rcsb
source organism Plasmodium falciparum
total genus 80
structure length 262
sequence length 262
chains with identical sequence B, C, D, E
ec nomenclature ec 1.5.1.2: Pyrroline-5-carboxylate reductase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 2rcyA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rcyA01
1ISIA 1GYRA 3FNEA 4Q3CA 4GX0A 1NFRA 1PX0A 2Y1DA 1CETA 3UUWA 5DULA 2AG5A 4NMHA 2PZKA 1MP0A 4B7UA 2CVZA 1I2BA 3R1IA 4ND1A 5AXCA 2DUUA 1Y8RB 3RQSA 3GNSA 1JN0A 5FI3A 4GAEA 4AFNA 1D3AA 4U6QA 3WJAA 3JD0A 3SEFA 1EDZA 4JBHA 3PQEA 2ZCVA 4MOWA 2F1KA 1B14A 3U5TA 1YWGO 3IUPA 1XHLA 4OL9A 4RPKA 5CFZA 2GO1A 1NXQA 3NKLA 5B1YA 1P33A 2VNSA 1QXSA 3BMCB 3PQDA 5L7YA 3V2UA 4M1QA 4WLVA 4P8RA 1UUFA 3ANNA 5B12A 3GEMA 1X14A 1AXGA 4NBRA 3H5AA 3ZV4A 3ZHBA 3VKUA 1N1EA 4QECA 1Q0LA 4GGOA 4CM3A 3PIIA 4K9DA 1V3TA 2V6BA 1AGNA 2H5LA 4PLCA 2PKRA 5JS6A 2Q4BA 1LDEA 2NVBA 1DJQA 3I9KA 4WCFC 4CQLA 5DBFA 4B4WA 1N9GA 1QR6A 1J6UA 2Y1CA 1MFPA 3HDQA 3U4HA 1R0LA 4PZEA 3GUYA 3NJ8A 1PU2A 3ZV6A 1KYQA 1KEPA 4MKZA 4GMGA 2GYYA 4CMEC 4YR9A 2JFGA 3AM5A 5KJ1A 2BFOA 4M54A 2OBNA 1HDGO 1R4MA 1H93A 2QZ9A 1CQIA 1LNQA 1I8TA 3S8MA 1HDCA 1A4IA 4KDFA 4AJ4A 3FR8A 1BW9B 3IUSA 1FDTA 3N58A 1SOVA 2X9NA 2FPIA 3JQFC 4KTVE 3ZWMA 1DC6A 4I8XA 1H2BA 4NBVA 5JAZA 1PEDA 4D7AA 5EERA 2RBEA 3S55A 3DBLA 3JYQA 4O0LA 4BNUA 1O6ZA 1P1RA 2C59A 4ZGWA 2VN8A 5IDQA 1BDBA 3DL2A 4JGBA 4WCDA 4R16A 1LDMA 4U6SA 2QRJA 3L4BC 3UCFA 3JQDA 4IPTA 1EMDA 3HUDA 1MB4A 2QW8A 2GF2A 4WLFA 3WNVA 1UZMA 1Z6ZA 2DBQA 1DIAA 1PGOA 3D5QA 3UF0A 1YB4A 1JKFA 4D45A 4BNZA 3QWAA 2VNAA 4TMFA 3DB2A 1H0KA 3VDQA 1ISMA 4WKGA 1M66A 2UDPA 1WP4A 1Y8QA 4KQXA 2CDBA 5AXBA 4CM6A 3T7EA 4ZQHA 1Y9EA 3WXBA 1GPJA 1DRVA 3Q1LA 4CMAA 3BMQB 1B3RA 3FPLA 1U7TA 4L4RA 4CQMD 1YXMA 1P77A 2X4GA 3IC5A 1CJCA 4E2YA 2FOIA 3GT0A 1TI7A 1OOEA 1V9LA 1AN9A 1YQXA 3I4FA 2QQ5A 1W4ZA 3K6JA 2A35A 3AY7A 4WE3A 2TMDA 3O38A 1K3TA 2ZK7A 3RC2A 1HLPA 2VTEA 5B4UA 3D3EA 1YB5A 1ZMTA 2AQKA 4MP8A 3KVOA 4J9UE 4UEOA 3A28A 4KDEA 3NTRA 4OMUA 3BHJA 1WDKA 1IZ9A 1UXHA 1EVYA 2PR2A 1X7DA 4PLVA 2ILTA 6ADHA 1DRWA 4A03A 1HE5A 2CDAA 1C1XB 8LDHA 1GTMA 1JTVA 4L76A 1Z74A 3SC4A 1HRDA 5BQFA 4MIYA 4RGBA 2XXBA 5HA5A 4UVIA 5C7IO 3UAGA 3H2ZA 5EESA 3WFJA 4EGFA 3K9QO 1KEWA 1VLLA 1SMKA 3SXPA 3VH4A 4YVFA 2FWMX 4YAGA 3MOGA 4G5HA 5KKCA 3WS7A 2ZCUA 2OP1A 3L9XA 2H1SA 3Q2KA 1Q7CA 5U4QA 3BMNB 3WGOA 2DU8A 1RKXA 3ZNQA 1ZCJA 1EUZA 4AVYA 3QRWA 1X15A 3WICA 4CM4A 1ZSNA 4XYGA 5T67A 3RJ9A 1EVIA 5JXWA 1P1HA 3B70A 3ZWBA 1UXKA 2D1YA 4TVOA 1E92A 5K6AC 2OOSA 3PLRA 4KOAA 2Y67A 4IDGA 3R3JA 2FP4A 4QO7A 4R41A 2B36A 2BFPA 1UXGA 4KWIA 1YL7A 3WQQA 3DOJA 4XJTA 4CMHA 2ZJ0A 1D4FA 4EBFA 1GEEA 2YHIB 3H7AA 3MCVA 3WGQA 4BNXA 4W9NC 3WMXA 4IGEA 4CLXA 4JN6B 1E6EA 3EK2A 1UAGA 1HSZA 1LXCA 5EIOA 1BXGB 1NX6A 4CMKA 4NFYA 1NPYA 5EL0A 1ZEJA 3ZCXA 4CM9D 1X0VA 4F3YA 3BZUA 3PZRA 3HDYA 3GA0A 4N7RA 5JO9A 3T4EA 1C14A 3INRA 4DPKA 1DC4A 1F14A 3DR3A 3O8QB 3V8BA 2ZB4A 2XF8A 5IXSA 4YT2A 4XQ9A 2I76A 1HDOA 4RPLA 4XYBA 4KZPA 5JDCC 3LLSA 3SLGA 4DUPA 4JP2A 1HZJA 4YWJA 4ZJUA 1DB3A 4WLEA 3H6KA 4ALLA 3JQ9A 2BGLA 4YEDA 1E1MA 1RYEA 2GUGA 4B3HA 2FR0A 1JWAB 3I4CA 3TSCA 3GLQA 3H3FA 1VPDA 2NTVA 1GZ3A 1U4OA 3PJEA 1E1NA 1GV0A 4M49A 3P2YA 3PHJA 4J6FA 2GZ2A 5L7TA 2YJZA 3IMFA 1MLDA 2BFAA 2DTXA 1F17A 4B8WA 1NHGA 4RF3A 2DUWA 1X1TA 1F06A 1Y5MA 3CH6A 1N1GA 2ZATA 1U5CA 1OMOA 4WEQA 5ITWA 1T2FA 3PEFA 4P4LA 5KJFA 4GX5A 3ZZNA 1T1RA 1G0OA 1NQOA 1ONPA 3B6ZA 2PY6A 4J0FA 1I0ZA 4LCEA 4QEDA 1O8CA 3QVWA 4B7CA 5IJZA 4HADA 2YFQA 4O63O 3PK0A 4DC0A 4XR9A 3PZBA 4KUGA 4UVHA 1KC3A 4BIIA 4RVUA 4PN3A 3U4DA 5GZ1A 1YOVB 5DDIP 2YW9A 1EZ4A 2B4QA 3C3XA 4CM8A 4Z6KA 3KYDA 1DAPA 4HFNA 3UW3A 3QVOA 1KIFA 5G2OA 2C07A 2X7HA 4FN4A 4D0RA 5JCXA 1UDAA 3OJFA 3ONFA 2NQ8A 4PRLA 4RDHA 3W4JA 5EINA 4JJIA 1MX3A 4EUFA 2VUUA 4CM5A 1ID1A 3WFIA 2FRDA 3A9WA 3JD2A 4ZRNA 3VH3A 5GZ6A 4OQYA 3OJLA 1GYQA 4OXYA 4FFMA 4NK5A 3JQAD 3ROPA 2JKVA 5AXDA 4NJMA 2GN6A 3CEAA 2ZYDA 2I67A 1UP6A 5AQ1A 4OSPA 4BNWA 1WDMA 2VYND 5CDTA 3DHNA 1SNYA 5TJ9A 3D0OA 2C2YA 4WECA 4HNHA 3KXDA 4XD2A 1ZMOA 5JLAA 1L7DA 1NHWA 2NVUA 1O95A 2BMAA 2FSVA 4J0EA 4UREA 1T2AA 3JYNA 4YAKA 3WIDA 3BTUA 4ILKA 1HDZA 4E2XA 1B15A 4G2NA 2PFGA 3JQ7B 4YJHB 3HHPA 1ZO8A 3FCOA 1HDRA 3G1UA 1YQGA 2WEKA 1YS4A 4FGSA 1I10A 1PR9A 2CSUA 5FFFA 3WG9A 1NPTO 2GERA 2VYNA 5FEUA 1PGQA 2GASA 1RM5A 4XB2A 1YBVA 2IDZA 3OIDA 5TIIA 2PD3A 2BH9A 1N7HA 4XQGA 4CMIA 4IZIA 5JAMA 1TXGA 1M6WA 5T8KC 4JX8A 1VKNA 1DRUA 4XYLA 4J43A 3QLJA 5ITVA 1Y9AA 1LDNA 3FNFA 4IJKA 5B37A 3VPGA 1MUUA 1HLDA 4D44A 1N92A 3DQPA 3EVNA 2WWRA 5C7OO 2DQ4A 4LSWA 4B7XA 1P9LA 3ADPA 5HS4A 1N5DA 1AXEA 4TWRA 3L0DA 5L3ZA 3UN1A 2GPTA 4EJ0A 3ETEA 3P5SA 4OGWA 3U49A 4WOJA 5TJHA 3RC9A 4MP3A 4W7HA 2AW5A 3PGXA 3WOHA 1UR5A 3RKRA 1H9BA 2E49A 2ZQYA 4BKRA 2AXQA 1OBFO 1JW9B 1C1DB 2JHFA 1PZEA 3LF1A 4PG6A 4CLEA 1EFLA 3IDSA 5T6BA 2BFMA 2HJSA 1YL6A 3ZU5A 5I7EA 1IE3A 2NU7A 4D43A 4DBZA 3DFZA 2J5QA 5COQA 5JCJD 3N74A 4GVXA 2NSDA 2Q49A 1YRLA 4I9UA 4ZD6A 3FNGA 4BKPA 4DL9A 4NIMA 1NPDA 4XQCA 1EVZA 2I65A 3DEYX 2NU6A 2JL1A 1VC2A 3F4LA 3NAQA 2W2KA 3HFGA 2CY0A 3I52A 5G4KB 1ZJZA 1Y7TA 5IN4A 4GWKA 4UEJA 2GN4A 3KZVA 3HDJA 2ZIZA 4H3VA 2D59A 5A9SB 3ONEA 3PHHA 4D3DA 2OP0A 4WUVA 3UXYA 4C7JA 5C5IA 4HWKA 4BO4A 3WYEA 4NR0A 3PHIA 3ST7A 3K73O 4D3SA 4ALJA 3I9JA 5A1TA 5DOVA 1GEGA 5JFOA 3JQ8B 3AI2A 1R0KA 1E7QA 4JK3A 1LUAA 4ZHSA 3C1TA 3FBGA 4CV1A 4BNFA 4BO0A 4CV0A 4E5YA 3OA0A 5IAAA 2FPPA 2X0RA 1EE2A 1PTJA 2P5YA 3EVTA 4DMMA 5DF1A 3WLEA 3IP3A 1LRJA 3ANMA 4ZVVA 4BB6A 4XYEA 3QVSA 3KRTA 2ZB8A 1KERA 3JYPA 2HAEA 1XA0A 5IXYA 1LSSA 4IUYA 4XDYA 1XEAA 3RU9A 2OUIA 1XU7A 1VL8A 4OQZA 3W4IA 3G1TA 2HU2A 3A1NA 2VOEA 1H2HA 1C0IA 4RPHA 5L9AA 1QSGA 1JVSA 1PSDA 3BA1A 3AUUA 1GZ4A 4K6CA 2GR9A 2FR8A 5CDUA 3G49A 3WGIA 3CTMA 3GGGA 1CERA 3TRIA 2VWHA 4Q3EA 3ON5A 4YCAA 1SAYA 1XQ6A 4JJFA 4B4OA 4YPOA 3AI3A 3ZWPA 3RKUA 3OEWA 5L40A 4CJXA 4CM1A 4E31A 1EQUA 4WLNA 1WPQA 3E5RA 3MWEB 4PIVA 1A72A 1GDHA 2HSDA 3HN2A 4R4JA 3ZNNA 3GVHA 2POQX 2OFPA 3GY0A 1Q7BA 2ZTUA 3BIOA 1ZK4A 2YZ7A 3I23A 4HNGA 1DPGA 3VPSA 3I9LA 4FR5A 4RVDA 3NYWA 3WYBA 4CV2A 3B1FA 3CZMA 4N5NA 1HEUA 2X5OA 3DC2A 1PQUA 3WBBA 4RZHA 1BXZA 3ZV3A 1YJQA 1U1IA 2X86A 3GG9A 4Z9FA 1R37A 1PR3A 2PV7A 3FI9A 1NR7A 5A05A 4YJGA 3OQ6A 3DTTA 2VRCD 4MVJI 2HMTA 2DC1A 3C8MA 3E1KA 4J7XA 2LDXA 1UDCA 1XQ1A 3NDJA 2GGSA 2EKLA 2BGKA 3JQBA 2Q2VA 4AICA 3TNLA 3VTFA 3ZDFA 4WOKA 1PZHA 4ZQFA 1H6BA 3PP8A 2HCTA 4J16A 3GFBA 3IL2A 3F5SA 1ULUA 4AJNA 3IOYA 4RDIA 3RJ5A 3MZ0A 3GFGA 4BKUA 1XELA 3RBVA 1WW8A 4RQUA 4CUKA 3DFUA 4MVJM 2J3JA 3C7DB 1PZFA 4WPGA 4FFRA 5DN9A 4TRMA 4J9VA 2VZ9A 3ZGYA 4EZBA 3FHLA 2EHDA 2AHRA 2VT2A 2WD7A 3DBLB 3F3SA 3IKVA 4I1IA 3ROMA 4E33A 1MXFA 3WX0A 2C2XA 2J3HA 2FZWA 1VJ0A 3ABIA 4JBIA 4NBWA 2O7QA 1S6YA 4BQRA 4W82A 4ALKA 4DYDA 4NJOA 2CUKA 4IDAA 5DT9A 5TT1A 5F3RA 1AHIA 4URFA 3FR7A 2EW8A 1PGJA 5A06A 2P68A 5CEJA 3LC2O 3RUFA 4Z9XA 5L53A 1WMAA 5A5EA 1E3JA 1SB8A 3C24A 3E9MA 5ILGA 4MJLA 3PWKA 3PDUA 4MVJH 4A10A 5JAIA 1UH5A 2Y68A 5G0VA 1CWUA 4KUEA 1P31A 2WMDA 1N8KA 4EUEA 1CRWG 2IZ0A 4D0SA 5EN4A 5L4LA 4DREA 3GZNB 3GF4A 3WLFA 3ZHZA 3H8VA 4FCCA 4WCFB 3SBOA 1O94A 4R51A 3MJSA 1VL6A 2O23A 3D7LA 5H81A 2WD8A 2CF5A 4HUJA 3MTGA 3S2GA 2IEBA 1BDMA 4BO1A 4Z0PA 3ZNPA 2EERA 1I32A 1JU9A 1NWCA 3OSUA 4YT5A 5KJCA 1A9ZA 4WNCA 3S2EA 3DZKA 4L0QA 3F4BA 5I9LA 1CQJA 3JQ6A 4XIYA 4YAEA 3TZQA 1Y1PA 4YTEA 5HBRA 4BO7A 3AM3A 2OBYA 4PLHA 3K92A 1E7RA 2C82A 4CQMB 3ITKA 3E03A 1DAOA 2EJWA 4KMSA 4BGVA 1SOWA 3PFWO 3VH1A 1E6UA 4LVUA 1P1IA 3IJRA 4GX2A 5JE8A 1I33A 3VPFA 2B83A 4S3MA 3DBRA 1ENYA 1GZ6A 4LGVA 1Q7GA 4FB5A 1DC3A 3RWBA 5KWEA 3WTBA 4FBGA 3NRCA 3PPIA 3PHLA 1F8GA 4ROSA 5DBGA 5BT9A 3U0BA 1IPFA 4O59O 1P44A 4CUZA 1DHRA 3KTDA 1GYPA 3KM0A 3KHUA 5BSGA 4LRTB 4FFNA 1ISGA 1TA4A 1E6WA 3CPSA 4IJVA 3FF4A 4Q39A 1WLYA 2PD6A 4UUOA 1GUFA 3S1LA 2NUAA 3EYWA 1FMCA 2VZ8A 2J8ZA 4OKNA 2EV9A 3FTNA 5I8ZA 1XG5A 4EJMA 3GQVA 4NFSA 5TQVA 1IL0A 3TL2A 1PJLA 4XRGA 5KIAA 4PLWA 3HNPA 4BNNA 1I5RA 3COSA 3FN4A 3I83A 4UUMA 1N7GA 2YV1A 2OZPA 1NQTA 1UP7A 2ZKLA 2EF1A 2ZJ1A 2JD0A 1OC2A 1GU7A 2QIOA 4BNHA 3H9JA 2RHCA 2ZB3A 1E77A 2P5UA 5A02A 4IGFA 5TLSA 5BR7A 1U2DA 2X22A 3E82A 1Y6JA 3H9QA 5CHEA 4A73A 4R1NA 3ZWNA 3JD3A 2PNFA 3B1KA 3T4XA 3RUHA 3FWNA 1QMGA 2B5VA 3W6UA 4IQGA 2E37A 1BWSA 4HP8A 1ML3A 1QYVA 3AW9A 3ZWAA 4Q3BA 4Q3NA 5KJEA 2HK7A 3WSVA 3HB4X 5KTKA 1YBMA 5IDWA 1C0KA 4ONEA 1DHTA 1E5QA 5A3VA 4MKRA 4MVJA 1ZJYA 2GDZA 2GN9A 2VHVA 2ZTLA 4K1LA 4S1VA 2PZLA 2E4AA 3WGYA 2BI7A 5CPBA 4O6VA 1W8DA 5F1OA 1OC4A 1Z7BA 4L74A 3RCBA 2JHGA 1E1LA 5F5LA 5THKA 5LDGA 2EP7A 1LSJA 1TB4A 5B4TA 4U8GA 1R15A 1J5PA 1IPEA 3M2TA 3OEYA 3U9LA 4YT4A 1MC4A 5AXAA 1LX6A 3KYBA 1TT7A 3OQBA 2NADA 1IHXA 2UVDA 4QX6A 4R3NA 5L45A 3RUEA 1PL8A 4RVFA 2IXAA 1A71A 1HDYA 5EQFA 3ZW9A 5JYDA 4QFCA 3KO8A 3X2EA 4EW6A 1YJ8A 1E3WA 2XPCA 1LC3A 5GMOA 1KY5A 4ALIA 3D3WA 2Y1GA 4CLOB 2HQ1A 4RVHA 4YQYA 1XKQA 1Y5RA 2YDXA 4OXNA 3PFFA 4XA8A 5G0UA 2BF7A 3I9OA 2Y93A 3INGA 3U4IA 1NNUA 3OHSX 4YJFB 2TMGA 5ICMA 1L1FA 3DBHB 1QYWA 4NBUA 4XB1A 2X0IA 4H15A 4GSLA 2QYTA 1BMDA 3ULKA 3E6AA 3LC7O 3EGOA 4BKOA 1KETA 2I6TA 2QYSA 4NZ9A 2I66A 4FOSA 4W7IA 1H6AA 2RH8A 1HDXA 2A9FA 3SVTA 3OQ1A 2PH5A 3P2OA 4JNKA 2Q46A 4YACA 2C5EA 1QLJA 3HJAA 4PLYA 1O89A 5LDHA 1SCUA 4WLOA 5LC1A 1ISJA 3F5QA 3FBTA 3LT1A 3KETA 5KCZA 3RUDA 4BHTA 2WTBA 3WWYA 4BKQA 4DIFA 3JQAB 2Y0CA 2V65A 1A5ZA 1SPXA 2HMSA 5HS6A 4CR7A 2J5KA 1CDOA 2Q99A 2QG4A 1GY8A 4NQZA 1U4SA 1L7EA 3OJ0A 3HDHA 4PVDA 3QWBA 2Q2WA 4A2CA 1NVGA 3UH1A 1EDOA 3RUIA 1B8VA 1XDWA 5EPOA 3GNQA 4FJ0A 3L07A 3TF5A 3D4PA 1E7YA 1XLTA 1PS8A 4K6FA 4Q9NA 2O4UX 1Z75A 3VTZA 3QA9A 1M76A 4NNJA 1SC6A 1AUPA 4BNMA 4FQ8A 1ENZA 2A4KA 2QRLA 2HMWA 1YGYA 3JYLA 4RF4A 5JMWA 1EVJA 1NVMB 3L4BA 3FNHA 1PJ4A 1G1AA 4X54A 5ENDA 5K0ZA 1ENOA 3QE3A 4W6ZA 3V1UA 3UCEA 5JDIA 5JC8A 3KUXA 4J3FA 4AJOA 3G3EA 1P74A 3DBVO 4QXMA 1Z73A 4MVJG 2X5JO 5JY6A 3ZU3A 4Y9DA 5IN5A 1ONNA 2Q45A 1U3UA 3WIEA 1R4NB 3GH3A 4C7KA 5A5FA 1QYDA 1NVTA 4FJ1A 2W2KB 3QWFA 3KYCB 5T57A 5CEFA 1P1FA 3VZQA 3K31A 1LA2A 2YYYA 1GCUA 2O2YA 2FZEA 1E3LA 5DP1A 4DLAA 4E5PA 1R12A 2X0JA 3DMTC 3ORFA 3VZRA 5MDHA 1E0DA 2NM0A 5JPIA 3IQDB 3G17A 1VJTA 1OZAA 4ZA2A 4CMJA 4L8VA 1GCOA 4A0SA 4RLHA 3U3XA 2LDBA 1V3UA 4BNYA 4YYZA 1GQ2A 1WDLA 2X8LA 3CSDA 4DQUA 4FFLA 1DSSG 3W8FA 1ZXBA 4GQAA 5BNFA 1EE9A 4XYMA 1BW9A 4AJEA 3WR5A 3G0OA 4BO6A 1ARZA 1YE3A 4PLFA 4YRAA 2UUPA 2X9VA 1GUYA 1DIHA 3OA2A 1DIRA 4O5OA 1T24A 4G65A 1XIVA 2O3RA 4EEZA 4AJJA 5HM8A 4MP6A 4F6CA 3PYXA 3W8DA 1B8UA 1GUZA 5DCUA 4L9RA 4D46A 4PZCA 1GD1O 3BTOA 4R68A 4E32A 1QP8A 3GHHA 1MG5A 1I30A 5BSHA 2UUOA 1EQ2A 4J1SA 5G0SA 4YXFA 4I9NA 1BVUA 1DO8A 4FC6A 5BSFA 3UOGA 7ADHA 5A3JA 4Z3DA 1T4BA 1CF2O 3TZCA 5A04A 5KJ6A 4BGIA 3NJ4A 3ASVA 3BMQA 4GI2A 2G1UA 4CR8A 9LDBA 1E3IA 4W9NA 3KEOA 4NI5A 4Z0TA 2VHWA 2DPHA 4ND4A 5ES3A 2O2SA 2RHRA 1HKUA 3A06A 3GZ4A 1E1KA 3WTCA 1YDWA 4PG4A 4PG8A 4GH5A 3SJ7A 1ZH8A 5TNXA 3TN7A 2NVWA 1U2GA 4CM7A 4Z0HO 3PVZA 1ZFNA 1ZUD1 2EJVA 3JYOA 3JQGB 5JDCA 1HYHA 4UAGA 2VWGA 4HKTA 1YL5A 2EG9A 3PRJA 2J5RA 3I6QA 1HYEA 4M8SA 3EZYA 2Q1WA 1RWBA 1LU9A 2WE7A 4HY3A 2QRKA 1C1XA 1HZZA 4I5FA 3VH2A 4R9SA 3AI1A 1P45A 3JCZA 3F9IA 5JW6A 3OIFA 4Y6PA 3NTQA 3GPIA 2PWZA 3QIVA 1VL0A 2FY8A 4HXYA 2D8AA 2CMDA 5I9MA 5G4LA 2HLPA 4FGWA 3OH8A 3TOXA 4LK3A 2X23A 3BMNA 1Q2XA 1DFHA 3TFOA 2J3KA 1DFIA 1JAYA 3GNTA 2YQ5A 1A27A 1JVBA 4DPMA 2GZ3A 3C7AA 4XGIA 2X6TA 4J1QA 1LJ8A 5C3MA 3RFXA 2YHUA 4IDBA 2WDZA 2VCYA 4XEHA 1DLJA 3UCXA 2O3UA 2WD7B 4CLRB 1I36A 2BGMA 1P3DA 1DEHA 2D2IA 2Q4EA 1S7CA 2YHIA 2AA3A 4F45A 1V35A 3SC6A 4WASA 3NDRA 1HYGA 5KVSA 5JC1A 1BXGA 1UZNA 4I9HA 2QZZA 5A4DA 4Z3KA 4XDZA 2VHZA 1SEPA 1CIVA 3ICCA 2O50A 4R54A 4P22A 1C3VA 2XAAA 3S2FA 4DRYA 2PGLA 3OETA 2RAFA 1Z45A 3OJEA 3O8QA 3V5NA 4E0BA 4YB8A 4E5NA 3KV3O 1N2SA 1K6JA 3DAPA 3O03A 3Q0EA 1U28A 3EY4A 2BKAA 3AM4A 4RCVA 1B8PA 1F12A 5DNAA 4F6LA 5IZCC 3QQPA 2OMEA 5ENVA 3SJUA 4RF2A 4EITA 4IJWA 2GRAA 1Y81A 4U0KA 5EJ2A 4D42A 2Q50A 1MC5A 5JNLA 1GPDG 1K5HA 1HL3A 1RM0A 2J3IA 1GR0A 2I9PA 4L4SA 4ESOA 1BTOA 1QORA 1PJTA 1YO6A 4O1MA 1XGKA 3DONA 2D5CA 1QRRA 3GOHA 4PG7A 4CV3A 3TWOA 4B79A 2GNAA 3I9NA 4HFRA 1BXKA 1O9BA 2X9GA 5T8KA 3AOEA 2DBVO 4HBGA 2C7VA 1EFKA 4D41A 1NTOA 1I3KA 1LQUA 1NWHA 2UYYA 4BO3A 4N54A 3UVEA 3U62A 3ZWCA 2PKQO 2QX7A 2DT5A 2P4QA 5LCXA 3VZPA 1ZBQA 3DZIA 2OO5A 2O3TA 2VHXA 2VWQA 4N5MA 1U9JA 2ZYAA 3MJEA 4RLSA 3KOUA 3U09A 3IP1A 1I2CA 4BGEA 5TF4A 2IYOA 2PGDA 1QYXA 5FYDA 1DDOA 1DFGA 3PIDA 3A4VA 3LLVA 4J1NA 2ZYGA 1YH3A 2W4QA 5L51A 2NWQA 2JCVA 3C1AA 1FXSA 1KC1A 4IM7A 1H6CA 2SCUA 2HMVA 4RF5A 3LT0A 4DVJA 1U8XX 1Z7EA 4EEXA 4XIJA 4PLZA 1KVQA 1GQQA 1ULSA 1VKOA 3ZU4A 3AY6A 4H7PA 3ZWWA 3F47A 3QJ5A 2IXBA 2B35A 5ILOA 1ISHA 4CMCA 1ADCA 3CUKA 1NAIA 3RIHA 3H5NA 2CF6A 3B1JA 1LI4A 4CQLB 1UZLA 1N9GB 4I08A 1NFQA 2C0CA 3LSYA 1A4UA 4IMPA 4E13A 4YRBA 3Q6IA 5F21A 4BO8A 1U3TA 2EGGA 4HFMA 4YJHA 1A7AA 2G5CA 1SO8A 3GVPA 3LQFA 5BSEA 2AQ8A 4YT8A 1ZW1A 2B37A 4AJIA 2GN8A 1GQYA 4M89A 3ZWOA 3CMMA 3KLPX 3TQHA 3AJRA 3VOSA 1MFZA 1BHSA 1E7SA 4CMGA 1R4MB 4BQPA 2C20A 4DPLA 1D7OA 1EK6A 4CODB 3WWZA 4DQXA 1H5QA 5GY7A 4QT0A 3RAJA 4Y98A 1WZEA 2WE8A 4HX5A 4DLLA 4ZQEA 4M87A 2CNBA 1I3MA 1HE3A 1B2LA 1LQTA 3WGZA 1IB6A 2NV6A 4ALNA 3AU9A 3PHGA 3BAZA 4I5DA 2HDHA 2RCYA 1X13A 4EDFA 1KVTA 2R00A 4XCVA 4DBVO 4MVJE 1JA9A 3HADA 1ZSVA 2P9CA 1LDBA 2Z5LA 1LBEA 1HETA 4BNKA 4BNGA 4CMBA 3NUGA 3LF2A 1TLTA 2IZZA 3VVBA 4INAA 3RFTA 3W6ZA 1VI2A 5DP2A 2O7SA 1C1DA 2VT3A 3B20A 2IEDA 4BO5A 4LMRA 2GZ1A 1M67A 3BMOA 2YFHA 1ZKMA 5TT0A 2JFHA 2V6MA 3EUWA 3PDJA 4A26A 1GV1A 3K2EA 3ADOA 3GGOA 3NT2A 2H9IA 1E3EA 2YV2A 3V1YA 4BNJA 3WGTA 3HZZA 1Y8QB 2DFDA 3O4RA 5CEEA 5H83A 3JV7A 1X1EA 2JD1A 1U8FO 2VHYA 2V7PA 4L73A 3GDFA 4NH4A 4NK4A 2IODA 1ZEMA 4FOOA 4CLDA 5I8WA 3UFXA 3CINA 1B0AA 3QV1A 4NPCA 1B26A 4GGPA 4BNVA 1J4AA 1H94A 1PIWA 2JCXA 3RC1A 1NBOA 4ZRMA 4K26A 3TOZA 4C4OA 4AJ2A 5G4KA 4EYEA 4GBJA 4GLOA 3JTMA 3OMLA 4RORA 4TQGA 3X2FA 1FDWA 1KS9A 1LLQA 3FPCA 1OI7A 4ND2A 4YJDA 1NR1A 3ZH2A 1I01A 1PL7A 2JFFA 2IZ1A 5CPFA 4F46A 3OF2A 1ZSYA 1P1JA 3ITDA 4ZQBA 4BO9A 3K96A 4DXHA 1M75A 2VRBA 2VYVA 2BELA 3LC1O 3JQ8A 2FMUA 3BYZA 2I3AA 3AK4A 2JJYA 3TPCA 3H9EO 1KVUA 2HUNA 1QG6A 1A9YA 5ER9A 3RFVA 4E5KA 4IXTA 2RH4A 1UP4A 3MJ4A 2DVMA 2PA3A 4CL3A 1T4DA 3PYLA 4OAQA 3QW2A 1MXHA 2ZB7A 3FTPA 4QTZA 4K28A 5FWNA 1ADBA 1UJMA 3IJPA 1GAEO 4G81A 4OYRA 4PLPA 1RYDA 3MJVA 3D4NA 4QQRA 1LDGA 4NU6A 4B4VA 5IDYA 1RJWA 2X5KO 3GG2A 3HSKA 4XRRA 3RROA 4ZN6A 1HWYA 3KSDO 2WSBA 2R6JA 4CM4B 2C29D 3AFNA 4QO8A 3EC7A 4BL5A 3EDMA 4PVCA 5TX7A 4Q3DA 3W4KA 5THQA 2PLAA 5I7VA 3VDRA 3AWDA 4PGFA 2O3JA 3WQSB 4BB5A 1IYZA 4YAIA 3FRJA 3QHAA 2C7GA 4BV9A 3K30A 2PKQP 4UVEA 4AJHA 8ADHA 1DIGA 4J2OA 2XXJA 1HE2A 4TZKA 4XJSA 1BG6A 4GKBA 4MVJD 1PWZA 2DBZA 3E48A 2PTGA 2BRUA 2C5AA 1T1SA 3DHYA 4IZHA 4FS3A 1FK8A 1ZK1A 2DBRA 3RD5A 2DTEA 3V1TC 2I5PO 3E5MA 4KWHA 3RC7A 3OJOA 2HO5A 1E7MA 2IYPA 2ZQZA 4LW8A 2AE1A 4R69A 2AEMA 5A9RA 2Z1MA 3D4OA 5B4VA 5I7SA 1VSVA 1UAYA 4Z9YA 5DCYA 1V6AA 5KNLA 4N5LA 1CEQA 1LLDA 3OFSA 4WGGA 3U4CA 1EUDA 4ZQGA 1FF9A 3GGPA 1EEHA 4JXKA 4AL4A 2O3QA 4TSKA 1PJ2A 1ZK0A 2VUTA 1ZNQO 4BNLA 4YA6A 2IRWA 2NTJA 1X7GA 2Q1UA 1SBYA 4GL4A 1Q0HA 2GSDA 4DIOA 2DLDA 1TVEA 1XR3A 2D3TA 3JSAA 3ASUA 3K5PA 4BO2A 3RUAA 1VSUA 3I6IA 4E6PA 1FJHA 4OSOA 5A03A 2G76A 1K89A 1O5IA 3QY9A 3ZW8A 4E5MA 2HJRA 1EBUA 1KEUA 4MIEA 4CM8B 1M2WA 3KYDB 2JAHA 3Q9NA 4OJNA 2Y66A 1ZK3A 2YV3A 3Q11A 2OGUA 1E5LA 4W4TA 2P2SA 4BVAA 3BHMA 3ZWYA 1T25A 1NQ5A 5CP8A 3TZHA 3ZWVA 4OIMA 4J1TA 4XGKA 4Y8VA 3CXRA 5JDIC 4JQCA 1R66A 4B4UA 4IY1A 4GX1A 4NJMB 3PWSA 2IE0A 3P7MA 1RPNA 2A92A 3IIEA 3NT4A 5L4SA 4R5HA 4TRJA 1XWFA 2E82A 3WGHA 5TSDA 4J7CA 4KQWA 3H3JA 3GAZA 3GZNA 5BNIA 4NFHA 2R2GA 1HE4A 1GFSA 4IIUA 4WCFA 5KKAA 4DQVA 1W0CA 3ETDA 2ET6A 2NVUB 3JQ9C 2Q1TA 3RU7A 4OOEA 3RUCA 5J23A 1TT5A 2W8ZA 3GEDA 4IS3A 1LLCA 2CD9A 1U7HA 2QHXA 5KVVA 1PWXA 1A7KA 3DAGA 4FD3A 1O0SA 3RSHA 2O3SA 1LLUA 4CMEA 3PJGA 5CAEA 1JLLA 3H5RA 4LISA 3ZHXA 2OHXA 4OM8A 5KOIA 3INTA 2P4HX 3VVCA 4FFOA 4UEKA 4CQMA 4CMIB 3WDSA 4YAJA 4RVGA 4AJ1A 4R9RA 4Y6RA 1NP3A 2B69A 1WWKA 3UKOA 2P9EA 1DLIA 2DM6A 3FD8A 4PCVA 4ZU3A 1NASA 2EIHA 2J6IA 3JQFA 9LDTA 1NFFA 3LU1A 3NT5A 3WGGA 1F0YA 4RQTA 3ROKA 4OO3A 1K0UA 5DBIA 3DTYA 1DXYA 2YDYA 1B3BA 1Y8RA 3ANLA 2AE2A 3DZHA 3KLMX 3RBXA 4J91A 2I99A 3VZSA 1JAXA 1YB1A 2EWMA 2O4CA 4RL6A 3M1AA 5I9NA 1YVEI 2OL4A 5DOZA 1NM5A 4JROA 1JQBA 1H9AA 4TROA 1KOLA 3F6YA 3GRKA 3WNQA 4DGSA 3BMCA 4EI2A 1OAAA 5JBIA 1YKFA 2Y05A 1P0CA 2Y1FA 4RO0A 1JKJA 1WVGA 1ZVMA 4DIBA 3PI7A 4Y6SA 4YQZA 3RI3A 5C7LO 1DJNA 1PJSA 2H63A 2HK8A 3RASA 3WSWA 3QP9A 4L75A 1WNTA 2NNLD 3ETGA 3CMCO 1MV8A 3I3OA 3NGLA 5AOVA 1J49A 2VQ3A 1U3WA 5KVQA 4AJLA 3GPDG 2BD0A 4IIVA 1I2ZA 2FN7A 4MO2A 4B8ZA 3VPHA 4NG5A 3PYMA 1U5AA 2P91A 5JMPA 2BLLA 2NU9A 3DHEA 4YDRA 5HWSA 3C85A 3K2BA 3NEPX 4GKVA 3M2PA 1W6UA 4D79A 3CKYA 3D5TA 2W98A 3Q3CA 3STHA 4CUJA 3VAZA 3GHYA 3VC7A 3W1VA 4BS9A 1H6DA 3EAGA 4OOFA 4UUNA 1SEVA 4GLLA 1R6DA 4R1SA 4FPXA 2X58A 4DMLA 1I24A 3GDGA 1RM4A 4BNTA 1QV7A 2YY7A 4RPJA 3OM9A 3H4VA 1DBVO 3E8XA 3LT2A 2PZJA 3ZWXA 2UAGA 3TZKA 4CM9A 4LMPA 1LSOA 4D3FA 3DXFA 4UVDA 5ICSA 1MGOA 3TFQA 3D1LA 1BRMA 4FSHA 1I3LA 6LDHA 3E9QA 1AHHA 4XQEA 4BNIA 3WBFA 1EUCA 3WB9A 1J0XO 4LN1A 5COBA 3QVXA 4MIOA 4DTIA 3UICA 2E48A 3ZN2A 1MA0A 3F1KA 3C1OA 3QWIA 2V6GA 1V0JA 2D0IA 3HFSA 3LYLA 4BUCA 4LCJA 2AMFA 4FIZA 5CDSA 4R3WA 4XR4A 4XX0A 5COAA 1V8BA 3AUSA 3GVCA 1IOLA 3DAFA 1R16A 4NDNE 4E21A 3W8EA 5K6AA 3PTZA 4XKJA 3TJRA 3GEGA 4PRKA 4CLOA 3TDKA 2VUSA 5FF9A 3Q2IA 4E12A 2C54A 2EKPA 2Y1OA 1DC5A 4JP3A 5L7WA 3VPXA 1T2EA 4FFPA 5EMHA 4E2ZA 5IZ4A 4U7WA 4YJFA 3NGXA 4NHEA 4RZIA 2EGHA 5G0TA 2ZTVA 1Z82A 3DBHA 1CYDA 3QWHA 2PH3A 4E4YA 4RVSA 4DWVA 2HKIA 3PGJA 2Y0DA 2X0NA 1SB9A 3L4SO 1QKIA 2NU8A 4ND5A 1PGNA 5T5QA 1ZIDA 2GLXA 1D1TA 3H9UA 1HSOA 2Q3EA 3FSRA 3GAFA 1NYTA 1YQDA 4UUPA 3WYCA 5F5NA 3DZFA 2W2LD 4U0JA 2WJPA 1ISFA 4GMFA 3PLNA 4WEOA 1PJBA 1TEHA 4PFJA 4NBTA 3WMWA 1OFGA 2VTDA 1ADFA 3IKTA 5U9CA 2GD1O 1PS0A 5C37A 3JQEA 3DMTA 2PGJA 3JQAA 2JCYA 1HTBA 4YJGB 1LDYA 2Q1SA 1NQAO 2XOXA 5A9TA 2AG8A 3DOOA 4R5MA 5FI5A 5ER6A 4ZICA 5IDXA 5I7FA 4TRRA 3PXXA 2NLOA 4IBOA 4II2A 2CZCA 2B0JA 4P38A 4TKLA 1BSVA 3LVFO 5JSFA 1XYGA 1IULA 4W99A 3AOEC 4FW8A 4P4NA 3DDNA 1GL3A 2W2LA 2RIRA 4JJGA 4A5OA 2HRBA 5JAQA 3HQ4O 3M1LA 4R01A 3ROQA 2JAPA 3ZNOA 3HB5X 4U5QA 2F00A 4TZTA 3I9MA 1JKIA 4II3A 1LRKA 2G0TA 3GN2A 4GPD1 3DWFA 4J4HA 2EW2A 2H6EA 3ENNA 4OHUA 3NDIA 3BTVA 1WZIA 4ITUA 4J4TA 3FWZA 5JO0A 3GUCA 3JD1A 1M6HA 3G79A 2BHLA 3OICA 4BV8A 2AEJA 3KSUA 3GVXA 2CVOA 4UVGA 3ZV5A 4Q3AA 4ID9A 3E18A 1PJ3A 5TGDA 3BMOB 1W73A 2NTNA 3T7CA 4B3IA 5EQDA 1ZK2A 5CDYA 1UDBA 1HXHA 5IFLA 1D8AA 2UV8A 4YBZA 4E30A 5DZSA 4BMVA 3F1LA 1SZJG 3E9NA 4GWGA 2A94A 1C0PA 3R3SA 1C0LA 4JLWA 4M86A 3AOGA 1UXJA 2DPGA 4IXWA 5CG2A 3D64A 4OKIA 1R4NA 3EZLA 3MEQA 2X1HA 4KUHA 4MDHA 3NTOA 3L77A 3K8ZA 4IQ8A 2DFVA 4I5GA 1K6XA 4MVJP 4RPGA 1DOHA 3L6DA 3KYCA 3PJFA 3RVDA 1BGVA 5L95A 1MG0A 3OBBA 5HTOA 1AE1A 4OXKA 4IINA 5G0WA 4GVLA 1ENPA 3MJCA 1U3VA 4ND3A 4MKXA 5H82A 1IZ0A 3EHEA 4DA9A 5JCJA 3IAHA 4HV4A 2WYWA 3JQCA 3ICPA 3NV9A 1KEVA 3JQBC 3O9ZA 4P4GA 3GDOA 2NQTA 7MDHA 3V2HA 4I5EA 3DOCA 4QSMA 1ONOA 2ZTMA 5JY1A 2WM3A 1Q0QA 3KB6A 3KBOA 3R0IA 4LVCA 3BHIA 3SLKA 1FDUA 3MOIA 4RJTA 4H16A 4TKMA 1XCBA 4WK6A 2Z1NA 5AYVA 3CZRA 3DBRB 3DZBA 3ZHYA 3L6OO 1HT0A 1YONA 5JYEA 1G6KA 1QYCA 1YOVA 3RBZA 4DLBA 1G0NA 2DKNA 1UXIA 2R00C 1E3SA 2CDCA 1VE9A 2FR1A 2VWPA 4BMSA 4WNIA 4IQ0A 4PLTA 1IY8A 2V6FA 1I3NA 2OORA 1PJQA 3VHRA 2Q2QA 1PJCA 3H9GA 4AJKA 1PS9A 2CFCA 3GR6A 2NACA 4IMRA 2I3GA 2P9GA 3Q9UA 2AQIA 2AQHA 3M6IA 3AUTA 1QV6A 5TRTA 4GSKA 4E3ZA 3CIFA 4WLUA 1R0SA 2EXXA 2VZ0A 4NU5A 2YUTA 4R1UA 3I1JA 5U1PA 4IDDA 2PZMA 5F1PA 3O26A 1E7WA 1X7HA 3PQFA 4XGNA 3AY3A 3EMKA 4TVBA 5F1KA 2G82A 3HWRA 3ZI0A 5IF3A 1WXDA 3NX4A 4AJPA 2EP5A 2Y99A 4EUHA 3UHAA 4FC7A 1F8FA 3I5MA 3GRPA 4CPDA 3PJDA 4E2WA 1KY4A 4OH1A 1P0FA 3JQ7A 3GVIA 4JCOA 3DO5A 3KEQA 4J2HA 3JQGA 1GADO 5DCWA 2D4AA 2WYUA 2YQ4A 3SX2A 1JDJA 3IS3A 3QVTA 3GMDA 1XU9A 3DZGA 4JBGA 1B16A 4PLGA 3LDHA 5IZCA 4PG5A 3HG7A 1KVRA 2DAPA 3L9WA 4J90A 1FDSA 4CL8A 2B4RO 4M55A 3AUAA 3VKVA 5BNTA 2Z95A 2BI8A 3PWZA 1EK5A 4J49A 5K9ZA 3F46A 1LC0A 3H65A 2Y0EA 1PZGA 1ADGA 2CVQA 5IG2A 3KSZO 4LSMA 3MWDB 3OECA 4N18A 3MJTA 3LZ6A 4HFJA 4RV9A 3A14A 1WAMA 1LEHA 3GC6A 3TL3A 1T2DA 5CG1A 4A7PA 5HRUA 2E6UX 4FDAA 4R1TA 3V2GA 3LK7A 1JWBB 3ENKA 1EBFA 4B3JA 4L4XA 1VRWA 3N7UA 2FPGA 2HRZA 2W90A 4CLHA 4YRDA 3MTJA 4IDEA 1HF3A 1E3WB 3OP4A 5TC4A 2VRCA 3UGKA 1LTHR 3D3WB 3AFMA 4TRNA 3GMSA 5CDGA 4CLRA 4ALMA 2EKQA 4EJ6A 5MGBA 4PZDA 1ORRA 1DIBA 1PGPA 2FSSA 1K2WA 3ONDA 4IDFA 2OXIA 4MPDA 1KVSA 2VYVD 3WQRA 1VM6A 4J7UA 5GZ3A 1XSEA 3EW7A 3QSGA 2HK9A 1PQWA 3P19A 2HMUA 3AU8A 4KP7A 2D5AA 1Q1NA 3ZU2A 5A9SA 1VJ1A 1YBAA 1YDEA 1T26A 3LT4A 4AG3A 4MINA 4IS2A 1IHYA 1NAHA 1RM3A 4BGUA 5L4NA 2DTDA 3GK3A 1X0XA 2JD2A 4XWYA 1IUKA 4BOYA 3DMYA 3OIGA 5AVOA 1T2CA 2O48X 3WJ7A 3H2SA 3R6DA 3GN1A 4QFDA 4CR6A 4J4BA 1V3VA 4JIGA 1WMBA 4WJZA 4DC1A 1TT5B 2FHSA 3C7CB 2PK3A 5TS3A 2WYVA 4Y67A 2EEZA 3HN7A 2GCGA 3BTSA 4MVJF 2PD4A 1FDVA 1LRLA 2AEFA 5T64A 1PL6A 4A27A 1K6IA 4XZ3A 3L6EA 2B4TO 1PQPA 3CE6A 1QLHA 4FJ2A 4BMNA 4DYVA 3S2IA 5KVCA 2G17A 1KBZA 1LSUA 1ZZEA 4QUKA 1P1KA 3BXXA 2B5WA 4LRSB 4IJUA 5ADHA 2Y1EA 1B7GO 4IDCA 3JD4A 3DZJA 3HE3A 1D1SA 1ZXLA 2VOJA 1BVRA 4UULA 3TZ6A 4KTTE
chains in the Genus database with same CATH superfamily
1GLGA 1D6SA 2QRZA 3CKMA 1HO3A 3FNEA 4QATA 5EMNA 1KMHA 1K66A 1KYYA 2H85A 1QHGA 1Z0ZA 1SH7A 1KWGA 1DX9A 2AEEA 2B82A 4NMHA 4DLNA 2CVZA 5K51A 7REQB 1QTQA 1N4DA 4DNQA 2DUUA 4C7VA 2Q29A 3RQSA 1JN0A 4IAOA 3FZYA 1Z18A 5FI3A 4IKEA 1N5KA 1UMCA 3JD0A 3SEFA 3HZRA 5CW2A 1EDZA 1XRMA 4XJXA 4OK6A 2W2QA 1YC5A 5JS1A 1ZISA 5L3RA 3GAMA 1DWOA 1B14A 1CS0B 3DMGA 3FTDA 1XHLA 1PX2A 4IKOA 3M3DA 4MVCA 1EFUA 3NKLA 1Z0SA 3C1UA 1XNJA 4AKHA 1UUFA 1WMFA 3O4JA 2P9JA 3D4BA 3UMVA 4ZU1X 4HLDA 4OQPA 4GGOA 1Z4QA 2ZE8A 4PHFA 4R7GA 3SHVA 3PIIA 3IAEA 4QDTA 4PLCA 2WILA 1P6XA 1Q1QA 2Q4BA 1M8KA 4TXNA 3EISA 3RS9A 5IJ0A 3TR6A 4CQLA 3ZBPA 1FSGA 3DFIA 3PS9A 3BXEA 1E61A 3U4HA 1R0LA 3Q7EA 4NWIA 1P72A 1YDMA 4IX9A 4XQ0A 3I62A 5E9QA 4YJ2A 5BSWA 4BN0A 4B47A 3RREA 4MKZA 2GYYA 4W1QA 2JFGA 2FI1A 5KJ1A 1E59A 1Z15A 2JGNA 1Y1QA 3GARA 3EIUA 1HDGO 3EVDA 2QTLA 5KX5F 4XIGS 2PX0A 3NI2A 4U3JA 1CQIA 2WWGA 4A3SA 3UQYS 5KDOA 1U2QA 1I8TA 5E8JA 2AF3C 3FJOA 1HDCA 4G84A 4GNRA 1U8TA 1JR3D 2Z2ZA 4KDFA 5BVGB 3FR8A 1BW9B 3I53A 5AW1A 1FDTA 2ESRA 3N58A 3P94A 4LQCA 1MDFA 3NALA 2BM8A 4KMRA 2MOKA 4CKXA 3ZWMA 3BK2A 4I8XA 3OI7A 3RGWS 3MT0A 3Q7RA 3A1UA 4FM9A 3MLAA 2P27A 3T3OA 5AVJA 5EMLA 4B3GA 4OL0A 1CF9A 5EWMB 1FYDA 3S55A 3C97A 4L85A 2BONA 5JD5A 1QBGA 2HOQA 3PVCA 4O0LA 4WRRA 4L02A 4BNUA 1P4HA 1WM1A 4KFSA 4ZGWA 3VTAA 5IDQA 2VP3A 1OVMA 5AMXA 3A6ZA 3T35A 3GJ0A 1IVSA 3LO5A 7AT1A 2IPNA 4U6SA 1Z88A 2B2NA 3JQDA 3D6UA 1IB0A 4IIJB 3RT1A 2A1TS 1UZMA 3DV0A 2DBQA 4IFIA 5F52A 3TNFA 1YB4A 4M0UA 1FTQA 4D45A 2A5JA 2IUFA 4YDSA 2HDOA 1K4KA 2AWNA 5GADl 1Z36A 4TMFA 3QUQA 3DB2A 2G9QA 3AB3A 5SZJA 3EXHA 1WP4A 2YKGA 2CDBA 5CW1A 3T7EA 3STYA 2VLBA 4C4ZA 4DMHA 1PWHA 4WOBA 3WXBA 2OE2A 3VAAA 3BMQB 1B3RA 1JNYA 2ZBDA 3FPLA 3OTGA 3QNUA 4MGYR 4K88A 4OM7A 3E5HA 4PW0A 2JAQA 4UU1A 5CXXA 1TKBA 1VYTA 1Y3DE 1IBRA 3LWBA 3PX3A 2X4GA 1TECE 3H18A 1CJCA 3QLEA 2FOIA 3GT0A 1TI7A 1UJNA 2DPXA 1OOEA 1EFPB 1FFWA 3I4FA 2ZS9A 1L5NA 1EKXA 3NM4A 2BZGA 1IZZA 1R3DA 1NMQA 1W4ZA 3K6JA 3AY7A 4XLTA 4FQ5A 3VNRA 2B78A 1BNCA 2KX7A 4ZVQA 2PL1A 3E0XA 4LBZA 1JX6A 4M7PA 1TKCA 2IV2X 3SYNA 4MP8A 3K0SA 3KVOA 4UEOA 4KDEA 2XKAA 1XEXA 3QNWA 5BWNA 2HA3A 4RU1A 1GAWA 1VPEA 1XDGA 2V96A 3R4CA 4GC9A 1EVYA 1NLYA 1USUA 2PJDA 3ISTA 4GZLA 5DI3A 1X7DA 3O83A 5GJVC 2ILTA 4Q93A 6ADHA 3OOHA 3L2OB 4A03A 8LDHA 2QTVA 4BWFB 1ZJJA 4L76A 2RHOA 1ESEA 4MPJA 1W4LA 2F3RA 4IHQA 4H17A 4P7FA 2UZ1B 3G7SA 3K0FA 5BQFA 3LUJA 2XXBA 3G8CA 1S8NA 2ZJ5A 5HA5A 2NOAA 3LA8A 1NRXA 2CFOA 2J07A 3AB8A 1YR8A 3UAGA 2JFZA 5EKDA 4UEWA 3WGVA 1XCPA 4EGFA 2I91A 1KEWA 1URPA 3MTBA 3TKAA 5FL7A 5KX5A 3K0BA 5AVRA 4DV5B 1E89A 4ZEWA 1XPUA 1OBHA 1A8HA 1VG9B 1W581 1YS2X 1ZHHA 3L1JA 3SXPA 4GOXA 4YAGA 1AZTA 1D07A 3WS7A 1QAMA 3L01A 1J8QA 4U4AA 4GKJB 1Q7CA 3N53A 2GD2A 1XQYA 4ETIA 2CEAA 1FDIA 2ENUA 1W8IA 3UJNA 3KKPA 3NR2A 5ESRA 3SS7X 4DV7B 2OCXA 4LYJA 5HR5A 1X15A 5KYXB 1WHSB 3O9VA 4FKZA 3KX2A 1KYZA 4YV0A 3BQ9A 3QBDA 4XD7D 4FGLA 3MN1A 1YR7A 1QIFA 3ZWBA 4GM1A 5EPEA 2RB5A 4ZU6X 5TB5A 5A4JA 2BW0A 5K6AC 2BKEA 4QO7A 2Y67A 1FSPA 1DV2A 1QKKA 1V6CA 2B36A 4MQEA 2BFPA 1UT6A 4G5QA 4JVNA 5LBUA 3RT9A 1XZJA 3TTTA 4YRZA 4TS3A 1D4FA 3QXJA 1GEEA 3WWEA 3DCNA 3H7AA 5I4BA 4JVOA 5AJWA 2ZJ3A 3QBEA 4W9NC 3ZUPA 3WMXA 1JDNA 4IGEA 4ESVA 4CLXA 4JN6B 1X86B 1E6EA 2QN7A 3A36A 3LD9A 1TUBA 2NYRA 4HEQA 4UTPA 1NX6A 1TO1E 4YASA 4MMYB 2P69A 3KKLA 1NPYA 2C8JA 1GTVA 1XP5A 4QUJA 4F3YA 1KTVA 3Q5GA 4LXIA 4QBTA 2AR7A 1SKAA 3CNLA 4AUNA 4BLQA 3PUKA 5K09A 3MMPA 3REOA 3GA0A 3W6NA 3ILXA 2W6OA 2NT4A 1G7SA 1TKAA 1F14A 1QO7A 2WIJA 4H4EA 3DR3A 3W3AD 2JIMA 3G1WA 3IEXA 1E64A 2YNMC 1JQDA 3V8BA 4ZVLA 3ZBUA 3ZHZA 2HWUA 2I76A 1HDOA 1ZD8A 2QR5A 13PKA 5H8WA 1JLKA 3CVYA 4ZAWA 5HPYB 2FX3A 4C0BA 1T9HA 3M1IA 3DOUA 1HZJA 2ZUWA 1RYMA 2HREA 5LDDC 5AJVB 2GJ9A 2CNDA 3JQ9A 1C7ZA 5CA1B 3I8SA 3PC7A 1G7RA 5BOSA 1OX4A 4DR3B 3N07A 2UYQA 4RMIA 4X71A 3TSCA 5B1EA 3H3FA 1S8AA 2ODQA 4TVKA 3GO4A 1JHOA 2K7FA 1N2CE 1UF9A 4XAQA 2V7EA 2G4CA 4U7PB 4JI7B 3IMFA 1MLDA 2Q4RA 1GTG1 1KIMA 2AL7A 2HJVA 2QX4A 3H83A 3MYYA 3R5JA 1NHGA 4TM8A 4HH1A 4RF3A 2BZ1A 4JCCA 3IXMA 3KQPA 1OMOA 4H6PA 5FKJA 2DPMA 5BWMA 1PNRA 1G9XA 1LWOA 1B42A 4GT1A 4GX5A 3ZZNA 1Q0RA 4K5QA 4J0FA 1G0OA 1NQOA 1ONPA 2PY6A 4NMXB 4LCEA 1AKNA 1O8CA 1Q15A 2ZAIA 3QBJA 2EDCA 4JBLA 5ALWA 1WO8A 1X1BA 1IY2A 2P90A 4HADA 2I4OA 1A1SA 2L0XA 1UBFA 2YFQA 3BGWA 3R9WA 1W5EA 4KUGA 5LMNB 4TYPA 1YOVB 1SIOA 3B51X 3T1YB 3I2FA 1SBIA 4ZQIA 2BV3A 2V9CA 3ERCA 5HZKA 3PITA 2YNMD 1O6GA 1UADA 2FX2A 3D4LA 3MD0A 2HIHA 1H1DA 4D0RA 1KIFA 3M34A 2B1QA 3W1WA 1UDAA 3OJFA 2WF8A 3KVRA 1O87A 4JJIA 2FWIA 2IQ5A 2PUHA 2FPRA 1XTIA 4EUFA 4X1YA 1TYEB 1Z4NA 2VUUA 4DLZA 1WVIA 3WFIA 3A9WA 3P9CA 3JD2A 1WTAA 3GZTB 3VH3A 4S0ZA 1GKYA 4OQYA 2VQ6A 3BT7A 3SS9X 1GZDA 4P93A 4FFVA 2RGDA 2AI3A 1QGZA 3JQAD 3NFYA 4NK5A 3ROPA 1Z37A 3R8FA 3DM9B 3DTVA 1N8SA 5AXDA 4NJMA 3BXFA 4BBZA 1WU8A 3CF0A 2PWAA 4NICA 5E7QA 4DRXA 1CUUA 1UP6A 2MIIA 4BNWA 5AQ1A 2O5RA 1AV6A 4DCGA 2D3WA 3ESYA 2H8KA 4L78A 5CDTA 3JWPA 3R6GA 1EP1B 5D3MB 3INYA 2WTEA 5FNZA 5TJ9A 4CFSA 1H9CA 3JS5A 4HNHA 4I4LA 4A6PA 4ETNA 4D97A 3COYA 4WADA 1M1ZA 3F5DA 3WC4A 1THZA 3LCRA 1XTVA 3UJPA 5JLAA 1QIJA 4NCBA 2NVUA 1AM4D 2ICAA 3VO9A 1O95A 2BMAA 4M1EA 1LKZA 3THXA 5TMEA 3SK0A 1H85A 1WCWA 4G0OA 4E2XA 1B15A 1L7RA 5CA1F 3JQ7B 1RADA 1JHAA 3HHPA 4C1BA 3G1UA 2TS1A 4RMGA 1YS4A 2Z9BA 1I10A 1DBIA 1PR9A 1ZKDA 2CXSA 3KXKA 4Y0NA 5ALMA 3WG9A 2GERA 3LQRA 2VYNA 3DYIA 4HXGA 1W5SA 4AIRA 4P53A 4IICA 2AHOA 4JLDA 2IDZA 3OKPA 2P2NA 2GQ0A 3IDAA 3C3JA 1C9NA 3ESXA 2BH9A 4QEKA 4Y2RA 4CMIA 4EHHA 1OYVA 1TXGA 1M6WA 1L5SA 1L4EA 1VKNA 4JX8A 1DRUA 5HE9A 3ZEIA 1L5OA 3SX0A 1Y9AA 2Q0SA 2WIDA 4J0GA 4HEA1 2Z3ZA 1MUUA 2Y9MB 3DQPA 5REQA 5L6MB 2C9CA 1Y5NA 1ZN9A 3EVNA 3IDQA 5KVAA 2WWRA 4S12A 3JQRA 3EIEA 2AKAB 3F6SA 2DQ4A 4LSWA 3DLBA 1R64A 1VLHA 1JDTA 2JFWA 3IX7A 1XTKA 1K8YB 4TWRA 1AXEA 5L3ZA 4AB1A 3EQ2A 2GPTA 2Z57A 4EJ0A 3ER9A 4OGWA 4TM7A 3EFHA 3U49A 4QLBA 5LQAA 3KPVA 2JIQA 2ZIUB 1XE3A 2AW5A 3PGXA 4I50F 4MRRA 3R3VA 1J0EA 3IO3A 1Z22A 4G25A 2WF6A 1TJYA 2P35A 4M9RA 1H66A 2LIVA 2QJOA 2RJNA 3LF1A 4CLEA 2FOLA 4TPKA 2JJQA 2CL6X 4C2AA 1L2TA 2ZVJA 1NRWA 3COWA 3MS7A 1T1IA 1JG7A 4P36A 1KZ7B 4X1IA 4WA8A 4C0QC 1IM5A 1CFZA 3KQSA 4C4YA 1NZFA 5HKAA 1FMJA 1QDEA 3TIVA 3SYTA 3VBCA 2FZ4A 2LCFA 3P4YA 3DFZA 1R8XA 5AKEA 5JCJD 4LHXA 5KB3A 3EXIA 4IFBA 3K7EA 4WZZA 1Z4JA 5DHAA 2Z30A 4I99A 1R0XA 1XTPA 2FUNB 2ZFUA 2VHEA 4KAJA 1B23P 2IS2A 3IQIX 1AY0A 1G5TA 1VCMA 4C4RA 1TUEA 3DUFA 4EM6A 1T4GA 3IELA 1POXA 4F9FA 3P9NA 3LOPA 2ORWA 4XQCA 3FZEA 4KJZA 5BQXA 3DEYX 1VC2A 2F90A 2ZSAA 3F4LA 3O2SB 4NZOA 3UAOA 4RK0A 3R7BA 3WWDA 2J0SA 9MHTA 1QP0A 3HKBA 5IN4A 4GWKA 3AFIA 1UWKA 3CVUA 5G1PA 4H3VA 421PA 3LXRA 2F1HA 3BULA 3UXYA 2AUTA 4HWKA 4BO4A 3P2KA 2CV1A 5AKIA 1C2YA 3O31A 1U2PA 2A67A 3K73O 5D51S 4XJVA 4EJFA 4AP5A 2QPOA 5ALHA 3GJ7A 3ADBA 1LI5A 5JFOA 1KJWA 3R0VA 4D8XA 5EUBA 3DLIA 2WW8A 3FFAA 2G0AA 3OO0A 5K0BA 1ZJWA 4R40A 1I6MA 3R6TA 1QX4A 4C9BA 4JK3A 5JWHA 2A0XA 1RYZA 3IVXA 3W2HA 1A76A 2ODAA 3A1SA 3O4HA 4OU5A 2ID4A 4BNFA 4QJ5A 1KBOA 3OA0A 2HJ9A 5HHTA 5JG7A 2YASA 2YS6A 2DKOA 2P5YA 3MW8A 1HKHA 4AYWA 1Q11A 1V5FA 5DF1A 5KWIA 4YP0A 1TTQB 4B83A 3CISA 5DFAA 2XUAA 4OYYA 1GGHA 1I1OA 1M6VB 1ZL2A 5BYBA 2ZB8A 3B5IA 1KERA 4EG4A 3JYPA 4QVKA 3RSSA 2XQVA 2XCTB 3DDCA 4JS0A 5CJJA 5KYNA 3NDBB 4B80A 1RQGA 5E4FA 1QJ4A 4CL2A 1FNMA 3STUA 4XDYA 1BCRA 1OXSC 2B8TA 3QEKA 3RU9A 4KGXA 4EG5A 2J08A 3STXA 1AB6A 1SCIA 5DGTA 3RSZA 3QG5A 3W4IA 2BGJA 3K8QA 5G02A 4EA7A 2MTBA 4PZLA 4B45A 2C4TA 3F73A 2Z5VA 4GPAA 1DOAA 2VOEA 1NOJA 2FG6C 4P4SA 4UZEA 4I50A 3CM0A 3ROTA 2QBYA 4J29A 5G3ZA 3SXJA 1OFVA 2QTCA 1RRGA 4K6CA 3QPDA 4LXYA 4OHBA 4PC7A 5D5PA 2XRZA 4AY6A 2ZRNA 3LQ1A 1MIHA 4PHCA 1X7XB 1H2WA 3W5AA 4G0WA 1KRXA 3CNEA 1JFFB 3NPAA 4PO3X 3WDLA 3ZLUA 3D0KA 4NPHA 1XVIA 1KQGA 1U0JA 2XWJI 4PC3A 1MGPA 4QPCA 3O8RA 4S04A 5ALDA 3C3DA 3KJIA 3RKUA 4ZVTA 3OC0A 2ZUUA 3E5RA 4G4JA 5HIMA 3KE9A 1CVIA 3M3PA 3UMGA 3PNMA 3ZQJA 1XHEA 5KI6A 4EPWA 2M2IA 3HN2A 1E1DA 4R4JA 2POQX 3GY0A 2XRMA 3FHCB 3BIOA 3RG2A 4M9ZA 4MI9A 5TPWA 3UJBA 1YA8A 2CSXA 1N2GA 1LZLA 3I9LA 1X6VA 3B6KA 4RVDA 1A5BB 4CV2A 2PX2A 2Q6LA 5H70A 4OJQA 1G7CA 1AZWA 1HEUA 1SBQA 1XTJA 1ZCAA 2X5OA 2YWEA 1KQOA 2B98A 1QH8A 1YI8A 4RZHA 1YJQA 4XPZA 4DDMA 3GG9A 4DCTA 4Z9FA 4PQYA 4GM0A 3EWNA 2X6RA 4JR2A 2C31A 5A05A 1R0RE 1NI5A 2YVKA 1MW8X 2VRCD 3C8MA 1E2LA 1XQ1A 4G09A 1AVTA 1XD2B 3PPVA 4RQBA 2X3FA 2JA1A 1XA4A 3BFVA 1K5PA 2WKSA 1ZU4A 1NDQA 2B21A 3G82C 3LIIA 3R77A 4WOKA 1KZ6A 1WUKS 5KAMA 4QPDA 4EYGA 2ZRIA 3EMVA 4ZQFA 4B6GA 3LY5A 1YJCA 3VDXA 5FPTA 1NC1A 3L02A 1I2DA 4AJNA 1QP4A 4LV6A 3RJ5A 1XELA 4FMPA 3RS8A 2XDQA 1USIA 1HEIA 3DFUA 5C53B 4B3FX 5KTOA 1JZSA 2ERYA 1PJRA 4RC9A 3U1TA 3U0VA 1UIMA 2WT8A 1Z4IA 1R3UA 2OCAA 2KW5A 5B6JA 2ODNA 5AM1A 3BFXA 3PQ5A 3DZDA 3RRZA 1NZDA 2VZ9A 1DAHA 1C8LA 4M53A 3DL4A 2AHRA 1ACLA 2AUNA 3KZNA 4I1IA 4MHSA 2CCGA 4G5RA 2XYGA 5DISB 1MA3A 1KPHA 1P3JA 2R8XA 3QTTA 1EFRA 1LVUA 4JBIA 2O7QA 4JT8A 1S6YA 4N4AA 4R8RA 1DX4A 2CUKA 4IDAA 3GJXC 3PQ2A 5JZOA 3ZDEA 1AHIA 2DGDA 4RTMA 4JDPA 4PNPA 1PGJA 2QDXA 3NO4A 1WXQA 4FZVA 2CLEB 1MJNA 2FPSA 2JLUA 1N3YA 1SB8A 3O4GA 3C24A 4KXQA 4PC1A 2G83A 1VGVA 3A27A 4YAWA 5BSRA 2DX7A 1PP4A 4GOJA 5JAIA 4FEEA 2GN0A 1NI4B 2WBLC 2Y68A 2Y4NA 3DMDA 3EXAA 4XEUA 4MX8A 2AKEA 3GELA 3B9RA 1N8KA 3HGQA 1RRVA 2IZ0A 4UAVA 5EKTA 5L4LA 3TRJA 3VMFA 3KG2A 2ZJYA 1KP3A 4LF7B 5FWXB 2I54A 3UMFA 3M9WA 2R47A 4JB0A 1O94A 4R51A 2O23A 2ZI9A 3H3XA 2WD8A 1CDDA 2DHDA 1H8HD 2CF5A 2LW7A 3BORA 2IEBA 5EHQA 4BO1A 1BD3A 5GJBA 1BJRE 4Z0PA 4MPPA 1MTOA 4N65A 5CA0B 1AX9A 5B2ZA 3PDIA 3QM1A 3VR5A 2Z5GA 1SWVA 3CHYA 4N40A 4URXR 4P0PB 2IHTA 2W2TA 4MYDA 2PS3A 1A9ZA 2I4RA 1SUPA 5FQNA 1QZXA 3DZKA 1PG5A 5FOVA 3K16A 3TVTA 3IIMA 4YR7A 4YAEA 1RAFA 4CEIA 4BO7A 2WVAA 1W0KD 3HYLA 3BJMA 2GD6A 2XE6A 3ITKA 3E03A 1FY2A 3EWAA 2EJWA 1EIZA 2PA0A 1SOWA 3E9CA 4LDNA 6REQB 2QA5A 1E6UA 2BMVA 1P1IA 3D3NA 4GX2A 4JLNA 5JE8A 3SC2B 1SA0B 4DABA 1ITZA 3FMGA 1CBUA 4DFDA 3NIDB 2PLRA 1PR6A 3N59A 5E1MA 2K2QB 2IKSA 1VXOA 3GAAA 4CL0A 4LRXA 1G64A 1YZKA 3FGOA 1B8NA 3KWMA 3CLKA 1F8GA 3LQQA 3PHLA 1Z8FA 2G5TA 2CVFA 1FDOA 3A58B 4QUAA 3U0BA 4F4DA 4OLBA 2RAVA 1XDDA 3CLHA 4M0CA 2LKCA 3KTDA 1GYPA 4Z2AA 4IDPA 3L18A 3E05A 3OMXA 3CY6A 3OCZA 1RP1A 2PD6A 2EIXA 2CK3A 2NUAA 4G24A 5CK4A 4TT8A 1BGXT 1FMCA 3STTA 1NLUA 4OKNA 4ISBA 4AD8A 1WEHA 3EXG1 3FTNA 3GJ6A 3UXEA 4L5AA 3KL4A 4EELA 3H1FA 3T9AA 4GYKA 1DBRA 3WLOA 3DL0A 1XOIA 1OGIA 2Y8EA 4EJMA 4Y2GA 1XCOA 4FYYA 4RZSA 2AOUA 2BR3A 5TQVA 2AJBA 5LP6C 2LNDA 3COSA 3FN4A 1VBKA 2IPAB 3AERA 3IKJA 4X5OA 1NQTA 1TU3A 5CJPA 2ZRCA 3MTIA 3L0PA 2OGTA 3PXDA 1S4MA 1W0JD 4L7VA 3L7LA 3UWPA 1XZLA 1YZUA 1IXZA 2Z04A 2N1BA 4J0IA 4KIJA 1PUIA 2P5UA 4AZVA 2BSAA 5A02A 3NG1A 2FX5A 2JC3A 2PM8A 5CX4A 2ZCJA 3KTOA 4A73A 3H9QA 3NP7A 2QT0A 4R1NA 3UANA 3N39C 2GZMA 1MVNA 1N6OA 1ZGZA 3LFHA 3A1FA 4AMZA 4A8PA 4BFWA 3PUJA 2NXEA 1J0AA 4K6HA 3NPMA 1QMGA 3NQ41 3V33A 3W6UA 4IIFA 5KYWB 1QH9A 3H6HA 2C1XA 4RHTA 1TM2A 2NTYC 4FGZA 2EU8A 3QV2A 1U8AA 3M70A 2VDOB 2VF4X 3TLBA 1YZTA 1WCIB 5KJEA 3THSA 5LA6B 5EVJA 3WI7A 4PYJA 2H51A 5KTKA 2MINB 2WABA 2X19A 1C0KA 4M1KA 4ONEA 1RVDA 5A3VA 4MKRA 2WAYA 4X41A 1I9GA 4PYQA 4S1VA 2J3QA 2ZTLA 3DFKA 3L8DA 4HXFB 2E4AA 1KH3A 2O7NA 2RGBA 2AOTB 3NNNA 5F1OA 1OC4A 1QZ3A 4L74A 1AGYA 2MDTA 3RCBA 2QD1A 3BILA 4ZV7A 4XVUA 1LPSA 3MWDA 5THKA 1TAQA 1VSTA 2DSTA 2XH8A 1LSJA 2PKXA 1SJ9A 2CW5A 3N2YA 1WPRA 5B4TA 1TC2A 5JRZA 2PVCA 1IPEA 1E1QA 1PFUA 2I78A 4GOOD 5E9JA 3M2TA 2J32A 3OLWA 2KSQA 4RIIA 1AO0A 3PLAE 2FEOA 1LX6A 1CU1A 2PMBA 2A8YA 1TT7A 3T9FA 3VBEA 1IHXA 1ZN7A 4IEFB 1QHHA 2WIFA 4HAUA 5LBIA 1GKKA 1CZKA 2R11A 1QGED 4NX2A 5D7NA 1PL8A 1X1QA 3ZI4A 3I2IA 2QXTA 5EQFA 1JH9A 4QFCA 1NUUA 3X2EA 3ZXXA 1CUCA 3H8WA 1YJ8A 2XPCA 2QSJA 2QUHA 1UAAA 2XUIA 3TXAA 1SULA 4E3WA 1DE0A 1X7WA 2PWPA 2Q28A 4ZCPA 2BMDA 3F71A 4RVHA 4RYLA 3AEKB 4WXHA 2RH5A 1W88B 1CXZA 3CGWA 1XKQA 4H0FA 2YDXA 1IG3A 2Z8YM 5BRNA 5B36A 1GSHA 2J5BA 5G0UA 2IYEA 4RVOA 2CYBA 4C4PA 1NNUA 5LZ4A 4J6EA 2G88A 2TMGA 4QJIA 2V59A 2WVGA 1L1FA 3FROA 4NBUA 4UU7A 3W8NA 2GCIA 3F7OA 3T7IA 4KREA 3AEXA 1Z5OA 3H6GA 4W6QA 4L0DA 3ZS9A 2QYTA 5FLEX 8GPBA 1BMDA 3OQMA 4M1ZA 3D8NA 3E6AA 3LC7O 3TNLA 2BL4A 3PF9A 3QPAA 3HGMA 4YGXB 4BKOA 1H3NA 3PGKA 1L1RA 2XNDA 3E7DA 3X1ZA 1L5ZA 4L07A 1R8YA 1UFRA 1T29A 5JXHA 5K1ZA 1WHTB 1QU3A 4IGAA 1V48A 2XRYA 4K9MA 4W7IA 1H6AA 2RH8A 2ZUCA 4HEHA 5TXGA 2FW6A 3DDZX 4U7GA 1WDWB 3EXEB 1SC4A 3DAHA 3EN0A 1SVUA 4OCZA 2YOGA 3MS4A 1JA0A 3IDZA 4YACA 1CZOA 4E22A 3HJAA 1FP2A 2ZIFA 1ZA2A 2EX4A 4R3UC 4WFKA 5G3YA 3DT6A 3PPXA 2G06A 4WLOA 3WDMA 1P5FA 2IS6A 3NIFB 5LA6F 5TR9A 3M82A 2ZU6A 2GJAA 3KETA 4I9FA 5F1YA 1SXQA 3RUDA 3ND9A 4PZ0A 3CEPB 3W0LB 2CT8A 4FUTA 2IUYA 2WTXA 3JQAB 3K0CC 1AH2A 1A5ZA 1M72A 2WF9A 4N6GA 4CR7A 2Q99A 3L1UA 4FGKA 3ZY5A 3HBFA 4TLCA 1PT8A 4MNTA 2RKBA 2EOAA 2IU0A 1JR4A 4LJ5A 1RRPA 2N47A 3C45A 3HDHA 2Q2WA 1EHYA 3SXUB 1DQZA 2BFDB 3OX2A 4JNCA 4X9XA 2VXOA 1B8VA 1Y4DE 3A1WA 4DIMA 4UDYX 2LXNA 3Q12A 1REQA 2PZEA 4PAMA 1UEJA 2V3VA 1HNZB 2PSDA 4KGDA 3THYB 1EFAA 4KN8A 4OB7A 3BWBA 3BQNB 3W6PA 1Z75A 3AW8A 5AHOA 1H2FA 2FDRA 2JFVA 3FDZB 3OQIA 3CQ9A 2BFNA 4A0RA 4LIPD 4FQ8A 1ENZA 2CYCA 2I62A 4OGGA 1RYBA 1EK1A 4YCMA 3H16A 1FS4A 1YAJA 1XALA 2C7BA 1OAOC 3JQQA 3EZ7A 4OH7A 4DCSA 4L5BA 2JRCA 1G1AA 1YE8A 1XL0A 3UUGA 3MERA 1YTUA 3UATA 2PUFA 4Y2PA 1QKJA 1ORIA 1GN8A 1N2EA 1BQ4A 5AJUA 3SDSA 3BBPA 4J3FA 1F1BA 2ST1A 1UKBA 2O0JA 3B9QA 3G3EA 2DY0A 3DBVO 1W5TA 2C3PA 1SUBA 5DHUA 1J0CA 1NBEA 3D54D 3ZY6A 5JY6A 4Y9DA 1JT2A 1SOMA 3G89A 3QYPA 5DT2A 4DMFA 1OHHD 2P40A 4O4HB 1TYCA 2R1VA 3DFFA 4OQXA 4OK3A 3GGDA 1H3EA 4X60A 4JSYA 4F7WA 1QYDA 3L7IA 4UARA 2PU5A 1ZZGA 3UNXA 3WRVA 1H0RA 2W2KB 3OE4A 3QWFA 4QNMA 1DMRA 5D1HA 5EJFA 5CEFA 1K5DA 2YYYA 2O2YA 2ZTSA 1E3LA 1I0IA 4DT1A 3N9IA 2XXAA 3WLIA 4YMLA 2QP9X 1R12A 3HR4A 2IHVA 4LZNA 3GRAA 3VZRA 3AONB 1G9TA 1E0DA 5AI5A 3HDTA 2ZBRA 4U6NA 1N2IA 3V8PA 1OZAA 1LPNA 3A6HA 1J5EB 3EPRA 4G0UA 2WKWA 4RLHA 3WNDA 2H9YA 2LDBA 3O91A 3U3XA 4QVIA 1GT91 3M4XA 4IXMA 1BFDA 4MW9A 1UINA 2EJUA 1L3CA 2YWXA 3QLTA 2QPTA 3QTBA 3BGIA 4ZT2A 3VQTA 2W42A 4G9GA 5CFRA 3HXLA 2ORYA 2Z09A 4KFUA 3S2ZA 4PCAA 1QQAA 1DJOA 2ZUBA 2CB0A 5JSUA 4DR2B 4X97A 1V4NA 4MARA 1YT5A 2QL5A 1ARZA 1YE3A 5AK5A 1ML4A 1T34A 4UDOA 5E6UA 3AF4A 2JLVA 3FE2A 4PZYA 3X1XA 1SPBS 3OA2A 1X9IA 2HBZA 3R41A 4O5OA 5HMLA 4JOQA 4G65A 5AW4A 3B3QA 1XIVA 4GICA 5HM8A 1IEQA 3V8RA 1E94E 2L18A 1CQZA 3G59A 2QL6A 1B8UA 5DCUA 2QLTA 4CF6A 2JZCA 1TVKB 2G71A 1GD1O 4R68A 4QL3A 2QSYA 2WMOB 4MLCA 4PO1A 4UASA 5ALTA 2XYRA 1I30A 3B53X 5KOJB 1ZIPA 4MUMA 3DHWC 2HLDD 4EDHA 1NVWQ 3K9GA 1YNOA 4FCTA 5CT4A 1A1VA 4OA5A 3LWDA 2ZYWX 3FDFA 3K9CA 4O1HA 1UMBB 2AOWA 1OA0A 4J0JA 1D0VA 2F3QA 2ZRLA 4F04A 1N6PA 1CF2O 3D1VA 4ZVUA 3SMVA 2ZETA 3TZCA 1Y5LA 1UOQA 3H9BA 3L8MA 2BFBB 4GI2A 2BBTA 3OQJA 2G1UA 3RIGA 5F7XA 1XZFA 4TWAA 4W9NA 3WYFA 4NI5A 4WINA 5EE3A 5ES3A 4PHTA 3ZJTA 2WHRA 2BMJA 3G8YA 1FLNA 1HKUA 1QCDA 1XVUA 3A06A 3OHMA 4RM3A 4JJEA 4Q7QA 3EX7C 1YDFA 2TSYB 4JBXA 1NG9A 2A5YB 3KB8A 3DCIA 3LMKA 5A4MS 5LU9A 4EY5A 3ADDA 2JB9A 4PG4A 4ZZ2A 1R6TA 3OCVA 5FBVB 3DYVA 2YJGA 5A3SA 1XVVA 1EUQA 3O7WA 4I55A 4OEHA 4DCJA 3TQOA 3P4XA 1Z5GA 5ILQA 3BRWA 1QYIA 1ZFNA 2IYAA 4NTZA 4EBBA 2NO7A 1OXBB 3O8OA 2RHDA 1DUIA 2AR0A 1U9IC 2DPLA 1XA3A 3KAKA 2OO7A 1GM5A 1J70A 2VHUA 1YKSA 1U31A 3LUPA 1LU9A 1Z62A 2WE7A 3SOPA 4H31A 1GUAA 2QRKA 3BB4A 1HZZA 3ELYA 1HG1A 2N3ZA 1I51A 2GD0A 2R1TB 5CM9C 4BX8A 5BVHA 2FFJA 3RQIA 4UCQA 3X1YA 2A3NA 4AZ3A 3SFVA 3A6JA 1I2AA 2N1MA 2PUTA 3KR2A 5DMHA 1VL0A 3KSAC 2QZSA 1XJCA 3SR0A 1IBLB 2I6QA 4ISCA 2A0YA 3UWOA 1PFVA 2C61A 5I9MA 1KH1A 4XVCA 1ZCBA 4OP2A 4MICA 3SPXA 5JS6A 4FGWA 1Z2DA 4AJ9A 4PAQA 2XHEA 3OLVA 4LK3A 4URZR 2HXGA 1Q2XA 3BWMA 5F9MA 2VSYA 1KZGB 3GNTA 5GONA 4ZRDA 4FHEA 3FGPA 4YAUA 3I34X 1D5WA 4EWLA 1BFUA 3VYWA 1YRWA 2TMYA 2O8CB 5C3MA 1UDXA 5DBEX 1P75A 4O2AA 1T9CA 2P7IA 2XWBF 4N7JA 1SXJE 4NCXA 3RHFA 1RXYA 4F9GA 4NS4A 3G6WA 4XEHA 2VCYA 1DLJA 4WDRA 3QU2A 2O3UA 2WD7B 4WIAA 2EL7A 2RARA 2BGMA 1IHPA 3CA8A 1NUTA 1N0UA 1T36B 4RSGA 1P3DA 1O96A 2FR8C 2IEZA 5GQSA 1DEHA 4MPRA 2AA3A 1NXOA 3TLGA 5JWOA 1SXIA 3A31A 3SZLA 4ENPA 1RE1A 3SC6A 4I0WB 1V39A 2W2XA 5JAHA 5GM1A 3LHIA 5GWXA 2WF5A 4I9HA 3M7IA 2QZZA 2B4YA 1TJ5A 3GROA 4Z3KA 1DGQA 3ROFA 4AMUA 1CIVA 2W00A 4NBLA 3T99A 2J3DA 3GDWA 4TYMA 4P22A 2CUZA 2OUKA 5FULA 2IP2A 3E84A 3ENZA 3O1LA 1EFCA 2PGLA 5DIZA 2AMJA 5JCZA 3O5AA 5FLXA 3O8QA 3QKSB 3W5BA 5G53C 1QC5A 4E5NA 3MCZA 3AV0B 3ZHCA 4DR4B 1XZAA 2JFQA 3BIFA 3H0CA 4UBNA 4H3SA 2BKAA 3S0JA 1B8PA 1N3LA 1YDGA 3AEZA 2R5NA 3E15A 1WKCA 3DF9A 3IUBA 4PO8A 4B31A 2X8JB 5IZCC 3QQPA 4LJYA 2X9QA 5H02A 2FG5A 2HNAA 5E7JA 3SJUA 3MGKA 1NLMA 4RF2A 4EITA 2A57A 2PR7A 3D6AA 2DULA 4BU1A 4U0KA 5MN4A 5HIAA 4ZWNA 3TR5A 4IWNA 3FOBA 5BN3A 5BR8B 1NJ5A 3VSEA 1SC3A 4WKCA 4FYPA 2WAMA 1GPDG 1RM0A 1HL3A 1SCAA 3D8TA 3H7IA 4D9KA 4L4SA 4ESOA 5EFOA 1EESA 1BD4A 1S7GA 5I5EA 1QORA 1ID8A 3WHPA 2D5CA 4KRXA 1QRRA 1N2ZA 5FL3A 2IHYA 5CLJA 3ZX4A 1GWNA 5FR1A 3F9CA 3IAXA 2FZCA 3TTXA 1DO0A 3ZK7A 3I5XA 2X8WA 5LQNA 4YCNA 1Y4SA 4PZ9A 3SJAA 2X2EA 3S44A 1I3KA 4NAVA 1DT3A 2HFKA 3OT5A 2A78A 3G5TA 2X76A 2X15A 3EE6A 3QUBA 2XADA 4FOLA 2FPLA 3QLUC 3OT4A 2ZT7A 4HVAA 5KREA 2DT5A 2O0HA 2FN8A 3MS2A 1G2PA 1FFGA 5BT8A 1ZBQA 3DZIA 3R3WA 2O3TA 2VHXA 4N5MA 1FX0B 5FPQA 2FEWB 3KOUA 2PEYA 3NHKA 2L42A 3IP1A 5LLDA 1WU7A 4NARA 3OE7A 4Q15A 1Y4UA 3N3BC 4DIUA 1X19A 2C9MA 4GPBA 5F23A 1QYXA 4TLMB 2PLWA 4IEIA 2B2CA 2Y92A 2QAJA 3PSAA 3RYIB 5BWBA 2IHNA 1DDOA 3PIDA 3AO0B 3LLVA 4FQ7A 4V0OA 5M2QA 2ZYGA 4LV8B 3DDHA 1Z4MA 2W4QA 4LRWA 1T4CB 4HN9A 4OXQA 1VJRA 1E9DA 4YRSA 1UXOA 4QBHA 2CNNA 2SCUA 4FGJA 1F0KA 2QE6A 1S2IA 1JU3A 2COKA 1WBJB 1MC1A 5EJGA 4P92A 4HRXA 1GR1A 2YIJA 3C6KA 2QLLA 4REMA 1Z7EA 1RYYA 1WD5A 4KH0A 1VJ5A 3K5HA 1MO3A 4OBBA 4ZCLA 3V1KA 1AA9A 2WR8A 1VECA 5K3FA 3HS3A 4ZODA 1XZCA 3ZCQA 3ZWWA 2VKQA 1KJZA 3F47A 3QJ5A 4C21A 2I9KA 2B35A 5ILOA 1ISHA 1CLUA 5I4KA 4MW1A 4BPRA 1L7PA 4XM1A 1ADCA 2GH1A 4BVJA 3CUKA 2UUBB 4AS1A 3PA8A 1KOJA 4GE3A 3ND8A 5IRCD 3TD2A 3UOWA 1GZSA 4Y9UA 1N9GB 2XJ9A 2CUNA 4K03A 2QNBA 3QF4B 2J0QA 1P9NA 2C98A 4PR3A 1GVNB 4CT5A 1A4UA 5EIBC 1Z17A 5F21A 2Y1WA 4K2AA 4BZPA 1A7AA 4EFNA 2QM0A 1GQYA 3GLHA 1KZ9A 5K6RA 2XWQA 3F90A 4FLFA 4D9MA 721PA 3DSRA 1QU2A 3TQHA 1AGPA 3AJRA 2BHSA 4QRIA 2E4WA 3CSUA 3WMRA 3AXTA 3GFQA 4JMPA 2W37A 5JMOA 2C20A 2ZPTX 3HNRA 1EK6A 2HCBA 3WWZA 5L3SB 2PCLA 2LRHA 1PYDA 1TJNA 4KBFA 1H5QA 4EI8A 2OQIA 3X1MA 1Z34A 4OY3A 5AM5A 4CEJB 4RJLA 4DLLA 2V4UA 5CLGA 4TSFD 1AQUA 2NV6A 4YHHB 2FPIB 5F9HA 4NMLA 2W6JD 4UMDA 2DETA 4ARCA 4PY2A 5J5AA 1SBZA 1N9KA 1QRAA 4UTOA 1KVTA 4BZWA 4EDFA 4RVCA 4ZC8A 4DBVO 3IBYA 1TU4A 3ZCSA 3W78A 4LHVA 3UGQA 4EG6A 1HETA 1KY2A 4BNKA 5IU6A 3TECE 2FAXA 3AR3A 2NO9A 3BSYA 3VVBA 4C0LA 1Z7YA 2PZGA 4INAA 2NPFA 4U8HA 2F3UA 1C1DA 1G6HA 2E4ZA 2P67A 5DP2A 1Y0BA 4BO5A 3WKCA 4TL8A 1M67A 4RA6B 1K86A 5TT0A 2XHZA 4ARZA 2VNJA 3A7EA 3PDJA 4A26A 4JVLA 4J76A 2PSSA 1E3EA 4UQPA 5LP6B 1UFVA 5CLFA 3HJCA 1AG9A 3O4RA 4EGAA 5CEEA 4MRMA 4TKUB 5EXTA 4IHKA 4L73A 1FLDA 1U8FO 1ZUNB 2V7PA 3HNOA 3K8YA 5ICCA 5EQTA 1CF4A 1ZEMA 3EHDA 1ZITA 1PSWA 4FOOA 3UFXA 3BPSA 1B26A 4NPCA 1N1DA 4BNVA 5KNBH 2JCXA 2FW8A 4OTZA 2J4FA 4ZRMA 2I3BA 2QAIA 5JOQA 1ECFA 1GFIA 5G4KA 5TPZD 4TMZA 2YL2A 1SURA 1QHEA 3HACA 4M1TA 3OMLA 1ZRHA 1ESDA 3I39X 2W6ZA 1AIPA 4TQGA 2WB4A 1E2FA 1R9MA 3X2FA 1U1EA 4AUEA 1IHOA 1OI7A 1X94A 3UUEA 1NR1A 4CN9A 3OLZA 4DSAA 4DLRA