2RCYA

Crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
b'GMENIKLGFMGLGQMGSALAHGIANANIIKKENLFYYGPSKKNTTLNYMSSNEELARHCDIIVCAVKPDIAGSVLNNIKPYLSSKLLISICGGLNIGKLEEMVGSENKIVWVMPNTPCLVGEGSFIYCSNKNVNSTDKKYVNDIFNSCGIIHEIKEKDMDIATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGSVEMVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYTVMNAVEAACEKSKAMGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrroline carboxylate reductase
publication title Crystal structure of Plasmodium falciparum pyrroline carboxylate reductase (MAL13P1.284) with NADP bound.
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 80
structure length 262
sequence length 262
chains with identical sequence B, C, D, E
ec nomenclature ec 1.5.1.2: Pyrroline-5-carboxylate reductase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 2rcyA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rcyA01
3WGQA 4W6ZA 3NJ8A 1DRVA 5A05A 1HLPA 2D2IA 1SC6A 3BA1A 4DYDA 4ZA2A 1GV1A 3UOGA 3ROPA 3FPLA 3V1TC 2YFHA 5EMHA 4NK4A 4OXYA 4MVJI 5IN5A 3I1JA 1LSSA 2DPGA 4U0KA 3JQGA 1YWGO 3RUEA 2O2YA 2B0JA 2ZK7A 1G0OA 2ZQZA 3DZGA 3T7CA 3CMCO 1E5QA 4BNLA 1J49A 3DL2A 1PQUA 3AOEC 4S3MA 1XR3A 1YB1A 1P3DA 4BO5A 3HHPA 1BXGB 4OL9A 6LDHA 2PZLA 3U49A 3TZCA 4CLRA 1H6DA 3GA0A 1V3UA 3DZIA 2O4UX 1LDGA 2IEDA 4CMBA 1YH3A 1E1MA 1U3VA 3WIEA 5A9SA 4TZTA 3AY7A 4TWRA 1NQOA 2F00A 5A02A 3E18A 2QW8A 2IRWA 4PLYA 2X4GA 5TIIA 2LDBA 1KEUA 3ROMA 1BDBA 2JD0A 3OIFA 1GQ2A 1P31A 5C3MA 4L9RA 2Q3EA 1EUDA 3CKYA 3RFVA 4M1QA 7MDHA 4INAA 1PGJA 3ZNPA 3DBHA 4B4VA 1EVIA 1OMOA 3INGA 3KSUA 4NG5A 4PFJA 1A27A 4HFJA 3RVDA 2EEZA 5DNAA 3QA9A 3GH3A 3GDOA 1R4NA 4BNFA 1XHLA 1BXKA 1YO6A 5A9TA 3RJ5A 2ZCVA 1E7MA 4YJGA 3FCOA 2OXIA 3FNFA 1ZCJA 3NDIA 4I1IA 4LRTB 1PZEA 1TT5A 4PLTA 2GO1A 1GR0A 2AW5A 2O48X 2VN8A 3PJFA 4HADA 4URFA 4XB1A 5T6BA 1CEQA 2W98A 2DKNA 2VYNA 3OECA 3V1UA 2NWQA 4Q3DA 3PJDA 3HN7A 2YV3A 3ORFA 4ZQEA 1Z7BA 2SCUA 4CMAA 4J3FA 4GAEA 1LSJA 3MJSA 2EJWA 1CDOA 2C2XA 1UXIA 2E6UX 1BRMA 1IHYA 3KBOA 3NT4A 1E0DA 2D4AA 3TL2A 4E5YA 4GWKA 2Y05A 1ORRA 4H3VA 1V8BA 5JDIA 2V6BA 1C1XB 4PLVA 3PDJA 3KVOA 1UXKA 1BDMA 5CDYA 1Y8QB 1HWYA 5L40A 1F14A 1ZEMA 1Y8RB 1VRWA 1SB9A 4JBGA 4KTTE 1P1JA 3QHAA 2Y99A 3W6ZA 3AUUA 4J90A 2GZ2A 1I0ZA 2Z1NA 5KVSA 2PK3A 1X1EA 4GX1A 1JQBA 3I9LA 1N9GB 1LSUA 3WB9A 1TB4A 4Q3AA 4EEZA 1PZGA 3MJEA 1PL6A 2QRKA 1O94A 3QWHA 3QRWA 3QVXA 1E3JA 2ZTUA 2J6IA 4UVGA 1XIVA 2ZATA 3JYNA 3O38A 1KVTA 1OC4A 3AM3A 2I66A 4K6FA 4QECA 4TKLA 1B8PA 4NPCA 2C2YA 3AI2A 1KEWA 1MXFA 5TLSA 5IXYA 4LRSB 4RDIA 2JAPA 2WJPA 2YUTA 3I23A 4KUEA 1P44A 2BI7A 3FR8A 1LRKA 3HJAA 5F21A 5CDSA 1UZNA 1N2SA 4GMFA 1XU7A 4J2OA 4NIMA 3WNVA 5C7OO 2VZ0A 3CPSA 4UUMA 4D79A 3UHAA 2OBNA 2NVBA 3LDHA 2OHXA 1F0YA 5JW6A 5DF1A 3N74A 3ZWXA 4E5KA 4NBUA 3KSZO 5ER9A 4Y9DA 3WMWA 5KVCA 5A06A 2OP0A 4W9NA 5HA5A 1MG0A 4WOKA 3TPCA 4DPMA 3HSKA 3DBRA 5BSFA 1KC1A 4B79A 2X7HA 2ZJ1A 1LDYA 4EUHA 3JQAD 2BLLA 4N7RA 2AMFA 1GL3A 3H4VA 1ID1A 3GF4A 1F17A 1I33A 1P1RA 4Z0TA 4M49A 4A2CA 4I5DA 1U8XX 2D3TA 3GGPA 1ISIA 2PNFA 2X86A 4B4OA 1Y8QA 3UCEA 2WM3A 1LJ8A 4OMUA 4R01A 1ZJYA 5COAA 3EDMA 4RF2A 3JCZA 1ZXBA 3HNPA 4E3ZA 5FFFA 4A03A 2EG9A 1UR5A 1U28A 1JKJA 1ONPA 2YYYA 2Y1GA 4J6FA 3F9IA 1ULSA 4CODB 4BGUA 1UH5A 4PN3A 5IG2A 2TMGA 3P5SA 4LVCA 1YRLA 2NSDA 3W8DA 4F6LA 4NFYA 4LISA 1UXHA 4N5NA 3QP9A 4AJJA 2VT2A 1PGOA 2C59A 3I6QA 4HFNA 4ND4A 4BV8A 3QWIA 5LDGA 2RIRA 2ZKLA 2GD1O 4I9NA 5IDYA 4BNKA 1ZJZA 3AOEA 3VPSA 4JQCA 3GG2A 2XPCA 3WWYA 1EVZA 4PG8A 2CVOA 3RAJA 1O5IA 4IQ0A 4ND2A 5T57A 2NTNA 1LLCA 2W2KA 1N1GA 4E5MA 5COQA 1YB5A 2IODA 1R16A 3ROQA 4BHTA 2EGGA 3FPCA 3ZV5A 1XGKA 4QEDA 4R69A 3G1UA 2FWMX 5HTOA 3TOZA 4N5MA 5L7WA 1L7DA 4CMJA 1MGOA 3DBLB 4PZDA 4CUKA 4IJKA 4J1NA 5C7LO 1ZSYA 2HDHA 1ADBA 1C1DB 2EKLA 2WYWA 2X0JA 3OMLA 1NAHA 4FQ8A 5DBGA 1TT7A 2GN8A 5ENVA 1B3BA 6ADHA 1IL0A 3IOYA 1YBAA 2WWRA 4GX5A 3ZGYA 1LNQA 2PH3A 2VTDA 3RC1A 1G1AA 2NU6A 1H0KA 2OFPA 3PRJA 1BTOA 2Y0DA 2CFCA 3F5SA 2C7GA 2FPGA 2ZYDA 1BXZA 5G2OA 4ZGWA 2BI8A 3KEQA 1VL8A 2NUAA 1ZO8A 4FFMA 5I7SA 2Q99A 3MTGA 3E5MA 2V6FA 4YA6A 3SBOA 1U7TA 4GSKA 3ZHZA 3DOCA 4WLEA 5U4QA 3IP3A 4BNXA 3MTJA 2YDXA 3RD5A 4BB6A 4NDNE 1A4IA 5G4KA 3ASVA 2JCVA 3JQ9A 4FIZA 3DHEA 1UDCA 3RKUA 4IUYA 4CV1A 4D3SA 1B3RA 4B3JA 4DRYA 1VL6A 1DPGA 2FR0A 4MJLA 5MGBA 3GRKA 2IDZA 2PD6A 3WQRA 2VT3A 3FTPA 3W4KA 4Q3BA 1A9ZA 5LCXA 1KOLA 4BO2A 4L75A 5DCWA 4GPD1 4PG6A 5EJ2A 2DT5A 4IIVA 4B8WA 5KTKA 4I9UA 1F8FA 1WDKA 2W4QA 1ISMA 3H9UA 4U7WA 4B7XA 4CMGA 4D44A 5C5IA 1FDVA 3Q9NA 4CV3A 1JKFA 4GX2A 4BVAA 4IIUA 1QXSA 2VRBA 3GVIA 3BIOA 4FFOA 3VZPA 1EE9A 4K26A 4D7AA 1SB8A 1WXDA 4XQCA 2O3QA 4Q3EA 3DOJA 4ZHSA 1JA9A 4R51A 1R6DA 5H82A 2GGSA 3U4HA 2JD2A 4E30A 3KYBA 4XQ9A 3VHRA 5KJCA 3JQDA 3U3XA 4AJNA 4QFDA 1IHXA 4BMNA 1U8FO 3NDRA 3JQBC 4II3A 4HKTA 1I2BA 2X1HA 1Q0HA 4CQLB 1R0LA 4CM8A 3VPHA 1GV0A 2FZEA 3GEDA 3EGOA 4I9HA 4CLOA 1QP8A 4IDAA 2G17A 3R3SA 2C29D 3CIFA 2NQ8A 2WYUA 3A14A 2E4AA 4GVLA 3SEFA 3GGOA 1VI2A 2R2GA 4E6PA 2FMUA 1BVUA 3WSWA 1RWBA 1NVTA 2PD4A 4HWKA 4UVIA 5THKA 4DUPA 1NQ5A 2X9VA 1EDOA 4ND1A 3M1AA 1HYGA 1GYPA 2X5OA 3L9XA 2OP1A 3TFQA 3EZYA 4BO7A 3D7LA 3QQPA 1KYQA 2VCYA 2O3UA 4TVBA 2YW9A 5AOVA 3W4JA 5JY6A 2PKQO 3WGGA 5L4NA 1PWXA 1EVJA 1T4DA 4YXFA 1V35A 3NV9A 4WEQA 1T1RA 2GDZA 2JCYA 2P9EA 1H93A 4R1SA 4J16A 4YT8A 3WYCA 3ICCA 4GGOA 4RF4A 1WZIA 3DZJA 3GMDA 1WNTA 3W8FA 3D3WA 2VYVA 5I8ZA 4IMPA 1X1TA 3KYCA 2X0RA 2PV7A 3NT5A 3D4OA 3JQ6A 4OJNA 5DOVA 2CDAA 2J5KA 3PWZA 4CL8A 1PTJA 1PGNA 3AUAA 4IS3A 2HRBA 4RF5A 3ANNA 3GDGA 5DOZA 1DDOA 1CETA 4UREA 3DDNA 4NFSA 4EEXA 1GUYA 4WASA 1RM0A 3TOXA 3DTYA 3FRJA 3UAGA 3PLNA 1FDUA 4PCVA 4AVYA 4WEOA 4OH1A 1CYDA 1DSSG 1UAYA 1IZ0A 3F47A 1HDOA 1YJ8A 4XWYA 3S55A 3PTZA 4A27A 2C20A 3OQBA 4NJMA 4WLNA 2QQ5A 3L4SO 3ZWAA 5JO0A 4S1VA 2AXQA 4DMLA 3AY3A 4UVHA 3PXXA 3AM4A 2EJVA 3HG7A 3GLQA 4CUZA 3L0DA 3ZWNA 5EQFA 1GTMA 4YVFA 2HSDA 4D46A 4YAKA 5KJ1A 3AW9A 1Z73A 4D0SA 3INTA 4YT4A 4BO6A 1WLYA 4EITA 1QG6A 3GAFA 4BMSA 1AHIA 2PFGA 3ONFA 2PA3A 2DLDA 3EK2A 4RPLA 4TZKA 1PJCA 3HQ4O 4TQGA 3OFSA 4M8SA 4JN6B 5EN4A 3KETA 1D7OA 1K0UA 4NK5A 3ZWPA 4L4RA 4BO1A 5IFLA 2CUKA 2X58A 4L0QA 3GFGA 2FR1A 3GNTA 3F1LA 4Z9XA 5L51A 3VKVA 2HO5A 1CERA 1U3WA 2GN4A 3BHJA 1NM5A 1ML3A 1J6UA 3PZRA 4B3IA 1X14A 3DMTC 1UP6A 3LZ6A 3U0BA 3VH4A 5L3ZA 3LF2A 1LC3A 1LX6A 2CVQA 3LC7O 1ULUA 1TLTA 4W7HA 4FFLA 1JKIA 2YZ7A 1PS8A 1XCBA 3HE3A 2AE2A 4W99A 3NEPX 2HLPA 1UUFA 2WD8A 3JD2A 1ZK2A 1HSZA 3JQ8B 3EY4A 3F6YA 4WNIA 4F3YA 1I32A 1SPXA 3QVOA 4PZCA 2I99A 3G3EA 3TZ6A 3TN7A 2IE0A 3QVSA 3G1TA 3ZNNA 3ZH2A 4WLOA 4XA8A 2QHXA 4YR9A 2FHSA 5IJZA 4TRNA 2AQHA 1B8VA 1HZZA 4YACA 3ZHXA 1E3IA 3RUAA 2FRDA 3WBFA 1VSUA 3QVTA 5KJFA 1LLQA 4WCDA 4RZHA 3UN1A 4IM7A 3ANLA 2BFAA 2OORA 4DIFA 1E7YA 4QTZA 2VHXA 3HDQA 1LRJA 3M1LA 1ZVMA 4YJHB 1EFKA 5KVQA 4E33A 3FI9A 3ZHBA 1YL6A 3FN4A 4Q3CA 4GSLA 3PIDA 3Q0EA 5F1KA 2FOIA 2BRUA 5JDIC 1V9LA 4XDZA 1P1FA 3OEWA 1V3TA 2Q1TA 2J3JA 2FN7A 5A3VA 3ZWCA 2ZTVA 1ZW1A 3HUDA 3K6JA 2PY6A 2A94A 4L4SA 3Q2KA 2GRAA 4ND5A 2D1YA 4EJMA 3JQBA 1QKIA 3JQEA 4CUJA 3NJ4A 4OOEA 1Q0QA 3GZNB 4PG7A 1XG5A 2P9GA 4WECA 3O8QB 4J4HA 4HV4A 1LTHR 4CL3A 2F1KA 2BGKA 2Z1MA 3VVCA 3OJ0A 4PRKA 2O3RA 4M89A 4D45A 3JYQA 3ZWVA 4ID9A 3UICA 1JWBB 4DVJA 1DIHA 5FYDA 5J23A 1LDBA 1R0KA 3AK4A 4WUVA 3ZV4A 3LC2O 3OM9A 4BNYA 4M87A 4R54A 2QYTA 4TSKA 3INRA 5A4DA 3WR5A 2BF7A 2ZJ0A 4BNHA 1JTVA 3RC2A 1D1SA 1C0KA 2DAPA 2DQ4A 1WW8A 4RLHA 4YEDA 2EW2A 4J1QA 4W4TA 4XYMA 4CLHA 5CAEA 4KWHA 1NWHA 3OQ6A 2NLOA 1PJLA 4Q3NA 1J0XO 2GERA 4W9NC 1HDCA 4NH4A 4XRGA 5H83A 3FTNA 1NXQA 1PEDA 1HT0A 3CEAA 3JYLA 4AJOA 4DMMA 4BGVA 2DU8A 3L6EA 4XYBA 5JPIA 4M86A 4YT2A 4CM1A 1U7HA 4R4JA 2YJZA 3JD3A 4MVJF 4XQGA 1VJTA 1JAXA 2RHRA 4QT0A 2FZWA 1DJNA 5BNFA 4E2ZA 2UUOA 1NX6A 3EC7A 4KDEA 3GN2A 5CPBA 3WMXA 2O7SA 2YY7A 5DULA 4EJ6A 4OM8A 4AG3A 1BMDA 1VM6A 4BNNA 5A5FA 4XGNA 4FGWA 1LEHA 3JSAA 3PYMA 4EUFA 4J91A 4WPGA 3OBBA 1BHSA 3BTSA 4YRDA 1I24A 1P1HA 2Z5LA 2Y93A 3K2BA 3C1TA 1N5DA 4RVDA 1HDXA 1JWAB 4Z9FA 1VPDA 1PR9A 3NYWA 4BNZA 1D3AA 5I8WA 2NQTA 5L9AA 2PH5A 3BMQB 2GF2A 4FR5A 5LC1A 3E03A 4HNHA 3ZWYA 5COBA 4UEKA 5DP2A 4HNGA 1WAMA 4E4YA 5ITWA 3GAZA 4P4NA 3PGXA 1RM5A 3BYZA 2C5EA 4IDFA 2AEMA 4I5EA 1LC0A 3AU9A 4J9UE 1YQGA 1OAAA 5I7VA 2ZB8A 4C4OA 1LRLA 3BTUA 4XCVA 1GPJA 5JAMA 2Q2QA 4B3HA 3F5QA 4MP8A 1OZAA 3DMTA 3EMKA 4XYGA 3TL3A 5TNXA 1YOVB 1LU9A 3R3JA 3PYLA 3S2IA 4DPLA 5JMPA 2H1SA 2I67A 5DT9A 3ADOA 2EERA 5F1OA 1D4FA 3ITKA 4U5QA 4ZQFA 3AOGA 4ZRNA 3ZU5A 2I3GA 4J43A 4M55A 3BHIA 5CDGA 2EWMA 4JNKA 4Z3KA 1ZFNA 3JQAA 2C5AA 2JD1A 1GCUA 1P0CA 4XR9A 1SOWA 1KIFA 2EP5A 1BGVA 3GUYA 4FC7A 4FJ1A 4RCVA 3P2YA 4FC6A 1ISJA 3DAGA 3RU9A 1GY8A 4KWIA 3ZV6A 5JSFA 1KVQA 2R00C 3IP1A 3OJOA 3CE6A 4JP2A 3D5QA 4AL4A 1FDTA 1DOHA 3FWZA 3IMFA 5DCUA 5DN9A 5JCJD 4BKPA 3WIDA 1I01A 2C07A 3SJUA 5B1YA 5FI5A 1PL8A 3KOUA 4RLSA 2DM6A 3L6OO 5JNLA 3JQ9C 1W0CA 2CD9A 2UDPA 3M2PA 1YVEI 3HFSA 4EW6A 4MINA 4DWVA 1DRUA 4XEHA 1E5LA 2Q49A 3BMQA 4BKRA 4DLLA 2J8ZA 3VTFA 2VUUA 4BO0A 3OP4A 4DBVO 3C1AA 1NFFA 2H63A 2J5QA 1EBUA 3HWRA 1U3TA 1C3VA 1BXGA 3KM0A 1FXSA 5CFZA 1CIVA 3NKLA 4MOWA 4Y67A 3ZU2A 1JVSA 2BMAA 4UVEA 4AJHA 2XXJA 2O7QA 3MZ0A 3C24A 2VRCD 3MJVA 2PZKA 3K30A 4ALNA 2EV9A 2DUUA 4CR6A 2Q1UA 3PEFA 3VAZA 4BNIA 1MP0A 1E1NA 2JCXA 4WKGA 2XF8A 1N7HA 4RL6A 5THQA 3GY0A 4DC0A 1WP4A 3C85A 2VZ8A 2IXAA 1AXEA 1U2GA 1PS9A 2P9CA 1NR7A 3ZI0A 2OBYA 4BKOA 3U62A 5I7FA 4FGSA 2NVUB 3PFWO 3CZMA 1QORA 1XLTA 5I9NA 2O4CA 1IB6A 1ZUD1 2HMUA 1NASA 2A9FA 1YBVA 5GY7A 3EZLA 1LQUA 3IJRA 4RVGA 1SOVA 4JGBA 1HETA 2JAHA 2ZB3A 2D5CA 3ZWWA 4FOSA 4BQPA 4QO7A 4OGWA 4JBHA 2AEJA 2BFPA 2OOSA 3R0IA 4K28A 3WS7A 2YHIB 2DPHA 3H5AA 4E31A 1YS4A 2WDZA 1YDWA 3IUSA 1RYDA 4PG4A 3V1YA 5A04A 5FF9A 4GH5A 4O0LA 4RVUA 1M76A 2RHCA 4R5HA 1GDHA 4YAEA 5ADHA 2IZ0A 3WLEA 3RU7A 1O9BA 2D8AA 3MJTA 1EDZA 1QYCA 3GC6A 4YJDA 3ZU4A 4TRMA 3NRCA 4YAJA 4CMIB 2XXBA 5K6AC 4KTVE 3H9JA 2J3HA 1EQUA 2NV6A 4IZHA 4BL5A 1I3KA 3TZKA 3PHJA 1C1XA 1NPDA 3EVTA 3LF1A 4P4GA 3LT4A 5B4UA 1Y5MA 1DJQA 4F6CA 2Q4EA 3RBVA 3N7UA 3GFBA 1Y8RA 3PK0A 5TQVA 5JAIA 5KWEA 1SO8A 1E7WA 5EL0A 4D3DA 3LT1A 4E2XA 2I5PO 1QYWA 1N92A 3GVXA 1T2AA 5IAAA 1N9GA 2AHRA 5KCZA 2NM0A 2ZB4A 1O0SA 4WLVA 3K31A 5T5QA 1H6CA 5A1TA 3UCFA 4NU6A 5L4SA 4MP6A 2Q45A 5AXDA 2XOXA 3D4NA 4P22A 5EPOA 2FP4A 2PZJA 1KERA 3I4CA 4E2YA 4EDFA 4XD2A 5JC1A 3RCBA 2P4QA 3VDQA 3LT2A 2YHUA 1TXGA 4R5MA 1WPQA 3I9JA 2IEBA 2DBQA 1WWKA 4YPOA 1ZMTA 5CHEA 4DXHA 4MVJE 3AWDA 3MEQA 1PIWA 1A72A 3VH2A 4E2WA 4NR0A 3W8EA 1LDNA 3WQSB 2YDYA 7ADHA 2FY8A 4IJUA 3C3XA 1V3VA 1ONNA 3FF4A 3UCXA 1B2LA 4YAGA 4DLAA 3GK3A 1P74A 2GPTA 1QSGA 3GG9A 3NTOA 4QUKA 4FW8A 5FI3A 4EGFA 4YWJA 5CG1A 3PI7A 3JYOA 4FJ0A 4KP7A 3KLMX 4B7UA 3K5PA 1E1KA 1BSVA 5I9MA 1B7GO 3VVBA 4DTIA 1GD1O 2HU2A 1VJ0A 4L4XA 1UZMA 2NU8A 2IYPA 5CP8A 3BMOB 2WYVA 4GKVA 1ARZA 1MXHA 1F12A 5B37A 3UW3A 4YDRA 5EERA 4CM4B 3ASUA 5G4LA 3OEYA 3QIVA 4IJVA 2DTDA 2R00A 2ZYAA 4CM9D 1EUZA 1EE2A 1DAPA 3PDUA 3WG9A 2B83A 1R12A 4NNJA 3VTZA 3M6IA 5C37A 3DB2A 1I30A 3EAGA 5T64A 5L53A 1QLJA 1L7EA 3LU1A 2CZCA 3HADA 4BGEA 5T8KA 1ZXLA 4GX0A 2C82A 5GZ1A 2GUGA 3TZQA 2VOJA 2O3JA 2HMTA 5GZ6A 1EQ2A 4C7KA 1YB4A 2V6GA 3UVEA 2NTVA 3HZZA 2DUWA 1HDZA 4NI5A 3SC4A 5IF3A 2Q1WA 3JD4A 3CINA 1DRWA 1X7HA 3VH3A 4UULA 2NTJA 4FSHA 3RFTA 3PHIA 2I3AA 4G5HA 4DIBA 3SC6A 3OJLA 3AI1A 1E6WA 4BO4A 4J7CA 1LI4A 1GZ3A 4CM5A 3HN2A 2OO5A 4PVCA 1M66A 2ET6A 1AGNA 4R16A 2EF1A 4GVXA 3VH1A 1CWUA 3H7AA 1QR6A 1MB4A 2Q2WA 4RF3A 5LDHA 4XYLA 4XRRA 4IY1A 1VE9A 1FDSA 4J2HA 4JJFA 2Y67A 3DBLA 3LSYA 1ENPA 3QWAA 4R41A 1C1DA 4JJIA 3EW7A 1Z75A 5JO9A 1PZHA 5AXAA 3NTQA 4HFMA 2G5CA 3DFUA 2GASA 2A92A 2EXXA 3DTTA 4UAGA 3WTBA 3LQFA 1DAOA 1FDWA 1S7CA 2AEFA 1PGQA 4CLXA 4ZN6A 5KJ6A 2HQ1A 2QG4A 3KYDB 3TDKA 1T2CA 3NTRA 2AG8A 1JU9A 3ETDA 4JBIA 4R1NA 4YJFB 3RROA 2CY0A 4K1LA 4ROSA 2ZIZA 3WWZA 1PSDA 4HFRA 1C14A 2IZ1A 4KUGA 5L95A 4OHUA 2P4HX 4D0RA 4O59O 9LDBA 4G65A 3LC1O 1RM3A 1PL7A 3ICPA 2VOEA 4J9VA 2Y0EA 1DIGA 3H9QA 3MWEB 1CQIA 2DBVO 3KB6A 2NU7A 3L4BA 3I6IA 2WEKA 4FB5A 1UDAA 1YQXA 4BV9A 2DFVA 1G6KA 3V2GA 4HXYA 4JXKA 5L7YA 3K73O 3WGHA 4XJSA 5K6AA 3C8MA 2OGUA 1QYDA 4W82A 5G0WA 1GYQA 2WD7B 2OZPA 3R6DA 5ES3A 2P5UA 1EEHA 3HB5X 1I2ZA 4L74A 2G1UA 1NTOA 2B4TO 1NNUA 4QFCA 5HWSA 4ALKA 5JBIA 5ENDA 3SVTA 4J7UA 1DXYA 3VPGA 3UF0A 4IBOA 3DONA 2GN6A 4IDDA 4UEJA 1NAIA 3I9KA 1S6YA 1UXJA 4WCFB 2VQ3A 1JW9B 2E37A 3DMYA 4LCEA 2Y66A 3E9MA 3T7EA 3W1VA 4DYVA 2W2LA 3BXXA 1U9JA 4KZPA 3I52A 5I7EA 2GCGA 4FFRA 1NPTO 3EUWA 1UZLA 4CQLA 1NFQA 3B70A 3QY9A 1C0LA 1P1IA 3JV7A 4Y6RA 3K92A 1QYXA 1ZH8A 3FBGA 3KTDA 5CDUA 1ZMOA 2BH9A 5KKCA 2VHZA 1GUFA 3H3JA 1NP3A 4YTEA 1SZJG 1L1FA 2DBRA 3KYDA 3WYBA 2TMDA 1CJCA 3IS3A 4CV0A 2WTBA 1GYRA 2H6EA 1HZJA 1LUAA 1PU2A 5GMOA 2RAFA 1B0AA 3U9LA 2JHFA 2PZMA 1NQAO 4ND3A 3OIDA 3VOSA 3D3EA 4TVOA 4BQRA 4YRBA 3PP8A 1Y81A 3EHEA 4ZQHA 4E13A 3KLPX 4RORA 4WOJA 3H2SA 2UVDA 2X0NA 3DFZA 1I10A 2J5RA 2Y1EA 4FD3A 4MIOA 4O6VA 2B69A 5CPFA 3BZUA 4IGFA 5AYVA 1ENYA 2QRLA 1KVRA 3DHNA 3DXFA 1UJMA 3BMNB 3OA2A 1LDEA 3AUSA 4IS2A 2OL4A 3U09A 1DLIA 3T4EA 1QRRA 8ADHA 4GGPA 4DBZA 3UFXA 4P4LA 1WDLA 1UP4A 3COSA 3A9WA 1MC5A 1ZSVA 5KKAA 2NACA 3H6KA 3ZDFA 1U1IA 4CMCA 4CM7A 4YQZA 4MKRA 3WGIA 2VWPA 2Z95A 1O89A 4LK3A 3TRIA 1GAEO 3G17A 4FOOA 1GQYA 5B12A 4LSWA 5JCXA 1MV8A 3MJ4A 3U4DA 2HMWA 3ZHYA 5DCYA 1YL7A 2G82A 3T4XA 3A06A 3RUHA 4A26A 5TJ9A 3UXYA 2XAAA 4NJOA 4XGKA 3IKVA 4LCJA 4TROA 3PJEA 4PLPA 4DGSA 2X22A 4XB2A 3P2OA 4MIYA 1MX3A 2FPIA 4U0JA 3ZW8A 1LSOA 1PJ2A 3JD1A 2V6MA 4WE3A 3BTVA 3I9NA 1HF3A 3UGKA 3QWFA 4JJGA 1P0FA 4F46A 4KQXA 3I83A 1LLDA 3AI3A 3H5NA 2BFOA 3B1JA 3I9MA 4YRAA 5IZ4A 5KJEA 2ILTA 4D42A 4GL4A 2UAGA 1EMDA 3IC5A 1LLUA 3BTOA 2RCYA 4IDCA 4A73A 2JKVA 4ALIA 5BNIA 3DAFA 1AUPA 2X23A 1NWCA 4CPDA 2CNBA 2W2LD 3A28A 1YJQA 2E82A 3HB4X 1IZ9A 3E9NA 3PWSA 4J4TA 5KOIA 2ZYGA 3KEOA 1RJWA 3ROKA 3VPXA 4D43A 2ZCUA 4L76A 3K2EA 3AUTA 5EESA 1M75A 1IPFA 5L45A 1CQJA 5TF4A 3CH6A 1T4BA 4OQYA 3A1NA 1NQTA 2Y0CA 1E1LA 3B1FA 2DC1A 1X13A 2I9PA 3DZHA 1BW9B 4CM3A 3SX2A 3JQ7B 3GUCA 2HJSA 2UYYA 3DBVO 3R1IA 3ZNOA 4AFNA 3JQ8A 4GBJA 2LDXA 3V2HA 4U6QA 1E3WB 2DVMA 1KEPA 4II2A 4FBGA 4IXWA 4LW8A 5FEUA 3OA0A 4ONEA 3GEMA 4JROA 4Z0HO 1ISGA 4NHEA 1P77A 4F45A 3E1KA 1HXHA 4I5GA 1Z74A 5JC8A 2GZ1A 1EVYA 1N7GA 3OQ1A 3L77A 1V6AA 4CV2A 1EUCA 1Z45A 2Q4BA 1KEVA 5JCJA 1KVUA 3IIEA 3JQGB 1GADO 1SMKA 4O1MA 5U1PA 2HK9A 3OJFA 1PQWA 4MKZA 4DQXA 2BHLA 1KY5A 3LLVA 4E32A 4YJHA 2JHGA 4UUNA 2JFFA 3WTCA 5EIOA 1PJ3A 1DHRA 3QVWA 3TSCA 4CLRB 3DZKA 3GPIA 4GI2A 3TJRA 4BUCA 3Q2IA 3RKRA 1PJBA 5A3JA 5IDWA 1OC2A 5A9SB 4PG5A 1EK5A 1IE3A 5CEJA 4GQAA 1AHHA 3WICA 5F3RA 4WLUA 3FSRA 3VZSA 3DAPA 3E8XA 1XWFA 1T2EA 2CDCA 2HRZA 3BHMA 4N5LA 1ADCA 3GZNA 1Y5RA 2D59A 2VRCA 3RIHA 1ADGA 4G81A 3PPIA 1P9LA 3O8QA 5F1PA 2EKQA 5BT9A 3UH1A 3DEYX 2D5AA 4BKUA 4IMRA 3RUIA 2YFQA 2BELA 1R4NB 3KO8A 4ITUA 4BNVA 1VC2A 2X9GA 4J0FA 1PJTA 1D1TA 1KBZA 1MFPA 1NHGA 4YJGB 4I8XA 3G79A 1TT5B 3WXBA 3HDJA 3KXDA 3NT2A 3OICA 1ZKMA 5A9RA 1P45A 2WMDA 2ZTMA 4YQYA 1UAGA 2GLXA 1NR1A 5T67A 1HDRA 1AN9A 2E49A 3O03A 4LGVA 5TX7A 5CEEA 3GEGA 1IULA 3JYPA 2VHVA 2PWZA 5C7IO 1X15A 1HL3A 1EZ4A 4YBZA 1IOLA 1PWZA 5JXWA 2E48A 4BIIA 4CLEA 3B20A 3RI3A 4D41A 2G0TA 3W4IA 3Q6IA 3WBBA 1E7RA 2X5KO 4YYZA 1P33A 4X54A 1I8TA 3H9EO 5G0UA 1I5RA 3VC7A 4RPGA 1FK8A 4Z0PA 1X0VA 3UUWA 1QMGA 2R6JA 2CMDA 3WOHA 1WZEA 3JQCA 1P1KA 3ENKA 4OOFA 1IYZA 1DBVO 4FCCA 1K6JA 4B8ZA 1XQ6A 3RSHA 2BD0A 3VZQA 5IN4A 4RQTA 3CTMA 4N18A 5JY1A 1D8AA 1MUUA 1O95A 5TSDA 1WDMA 4BNTA 2ZQYA 2O3SA 4MDHA 4MVJG 1M6WA 3IL2A 2AG5A 1PS0A 5T8KC 5JFOA 4P8RA 1K3TA 4A0SA 2HK7A 1HE4A 1Q0LA 3TFOA 1A5ZA 4ZRMA 1Y7TA 3F46A 3C1OA 4H15A 1M2WA 4PGFA 1VL0A 1KC3A 1WVGA 3ETGA 5JDCC 3GT0A 4JIGA 1CF2O 1ZK4A 2PR2A 2Y1FA 1B8UA 4DPKA 1A71A 3V8BA 4GWGA 1T25A 3GMSA 3I9OA 4MPDA 3SLGA 4A7PA 4CMKA 4DLBA 3MCVA 3RBZA 4WNCA 3PVZA 3DBRB 3FNEA 4MO2A 5ER6A 3MOGA 2POQX 3AFNA 1Q1NA 3SLKA 3VKUA 3PHLA 4IZIA 4EUEA 5AQ1A 1DFGA 3FHLA 2PGDA 1ZEJA 1H6BA 4OXKA 2EP7A 1YOVA 4BMVA 4Y98A 3D1LA 2HKIA 1E92A 1AE1A 1E6EA 4OYRA 4EZBA 2D0IA 3CUKA 3GNQA 3WFJA 5ICMA 1NVMB 3WJ7A 3GVHA 1GFSA 4L8VA 1GEGA 2ZB7A 2VTEA 4DIOA 4OO3A 4GLOA 3WDSA 3ZNQA 1WMAA 4FFPA 5BSHA 2J3KA 2FPPA 4IDBA 1T2FA 4BO8A 4YAIA 4OKIA 1ENOA 4CM9A 3D0OA 4BGIA 2AQKA 3ZWMA 3Q11A 4R3WA 1X7GA 1ZIDA 2WSBA 3D5TA 1E3EA 5HS6A 2H5LA 3NX4A 1E77A 2I76A 4IDGA 3Q3CA 1K6IA 2IYOA 4WLFA 2PGLA 4DL9A 1R66A 4NBTA 1U5CA 4RZIA 1NPYA 3L4BC 1W8DA 1A9YA 2O2SA 2B4QA 4P38A 1I2CA 3U4CA 1J4AA 4BO9A 3NGLA 2P2SA 3U4IA 1OI7A 1A7KA 1XKQA 3H3FA 4LN1A 3CZRA 3NUGA 2W2KB 3WX0A 2O23A 3ANMA 4RVSA 5JLAA 1C0PA 2H9IA 3H8VA 3PQFA 1GQQA 3BAZA 5TRTA 3PGJA 1DFHA 2B35A 3IQDB 1OBFO 2VHWA 3L07A 4RPHA 1BG6A 4KQWA 1LBEA 5IDXA 1T1SA 3KUXA 4OSPA 4QX6A 3MWDB 3QV1A 5IZCC 3LK7A 4FS3A 5L4LA 1HTBA 3AU8A 5JYEA 1HDYA 1XDWA 1PGPA 1DHTA 3WGYA 3TF5A 4ZU3A 2B5WA 5ICSA 1X0XA 2X6TA 4HP8A 2GN9A 3GHYA 5TJHA 4E21A 1TEHA 3AY6A 1W4ZA 1ZNQO 4UVDA 3ST7A 4PLWA 3OH8A 1TA4A 4XQEA 4BNJA 2NVUA 4QO8A 1O6ZA 1YGYA 5HM8A 1MA0A 2VYND 3P7MA 5TS3A 3WGOA 2RBEA 3I4FA 4YT5A 2UV8A 2GYYA 1XSEA 2BKAA 2QZZA 3KZVA 3K8ZA 3JQFC 1G0NA 1E3SA 1ZK3A 1PZFA 4FN4A 5G4KB 4Y8VA 4XIYA 4J1TA 2CDBA 2Q2VA 3PQEA 3WGZA 5JE8A 2VUTA 3S8MA 2YHIA 4IGEA 5BSGA 4R3NA 1DC4A 2O3TA 1H6AA 3QLJA 2VUSA 4BS9A 3D4PA 2GR9A 1ADFA 1PR3A 1VSVA 4KDFA 3AM5A 2Y1DA 3PWKA 8LDHA 4AJPA 2EHDA 3AFMA 3PYXA 3ENNA 3GZ4A 4FPXA 2PD3A 4JCOA 1JDJA 4CMIA 4ALJA 3OSUA 4CJXA 5TT1A 5JAZA 1I3NA 4BNGA 4RV9A 3K9QO 2VNSA 1IUKA 1E6UA 3GVCA 4TMFA 3GOHA 2QRJA 3O4RA 2NU9A 4HBGA 3ONDA 1Y1PA 4K6CA 1U4SA 1YE3A 3ON5A 3FD8A 4UUOA 4OKNA 5DDIP 1W6UA 4WCFC 1R4MB 1U2DA 4XGIA 1DC3A 2JL1A 4CM8B 4PIVA 1HE5A 3ONEA 4QSMA 4CQMB 4CLOB 3ZWOA 1E7QA 4ZQGA 4AJLA 4BNMA 1ENZA 1IY8A 3B1KA 2HMSA 2PLAA 1ISFA 3KHUA 4M54A 4MVJA 3W6UA 4IQGA 4RVFA 5JDCA 2QIOA 3WYEA 1NYTA 3ABIA 4J4BA 4O63O 4R9SA 3TNLA 1DIAA 2OUIA 1LA2A 4OAQA 1GPDG 1ZBQA 3TZHA 2VHYA 5BNTA 4DREA 4NMHA 1EBFA 3GHHA 1YL5A 4GMGA 3IJPA 3X2FA 4BB5A 5DBIA 4AJIA 3LT0A 4NFHA 1XA0A 3H65A 1TI7A 1QV7A 2HK8A 1F8GA 4NZ9A 1K89A 2ZTLA 1HE3A 3D64A 2AE1A 2NNLD 3QE3A 4IXTA 5DZSA 2Q46A 3D3WB 2UUPA 3DO5A 4MVJM 3E82A 3DR3A 1GCOA 3P19A 4MVJH 1ZK1A 3KYCB 1KETA 4IDEA 4JP3A 2RH8A 4B4UA 1H5QA 1X7DA 1UXGA 1CRWG 1PJQA 3GQVA 1SEPA 3PLRA 3LYLA 4E5NA 2OMEA 3BMOA 4GLLA 3ZWBA 1FJHA 2B36A 4ZD6A 2VWGA 3WJAA 4FDAA 2FR8A 2I65A 3OETA 1DB3A 2FSVA 2AQIA 4EBFA 1MG5A 4YCAA 4CM4A 1GZ4A 5JYDA 3RWBA 2B5VA 1H94A 2VWQA 4HY3A 4DC1A 2BFMA 1ZSNA 1A4UA 3GVPA 3HDHA 4KUHA 3S2FA 3H5RA 2HCTA 2G76A 1EK6A 5BR7A 2DFDA 3IKTA 1V0JA 4PLCA 4ZJUA 3I5MA 3B6ZA 4I5FA 4CMEC 1RPNA 4N54A 1R4MA 4U6SA 1E7SA 5IXSA 1HEUA 4NJMB 4ESOA 3RQSA 4UUPA 4RPJA 4CQMA 1N1EA 3FWNA 3AJRA 4AJKA 4XYEA 1U3UA 4CMHA 4OIMA 3ZN2A 2PGJA 4RGBA 3IUPA 4BOYA 3F4LA 5B4TA 3H2ZA 3VPFA 5K9ZA 4RJTA 4E0BA 4LSMA 1HDGO 2Y68A 2AQ8A 5HRUA 1Q2XA 1KY4A 3FR7A 1T26A 2X5JO 2EW8A 3H9GA 1DIBA 5EQDA 2GZ3A 3Q1LA 1YDEA 4XDYA 1SCUA 3GNSA 3NAQA 3PHGA 3QW2A 4PLFA 2CSUA 1XYGA 3IAHA 2P68A 3M2TA 5IZCA 4IINA 1I36A 4GKBA 4O5OA 4OSOA 4WK6A 1YKFA 4PVDA 4C7JA 4BNWA 4U8GA 1K5HA 3ZZNA 3QSGA 1ZZEA 2NADA 2V7PA 3G0OA 4J0EA 2DBZA 3PJGA 5A03A 5JS6A 3L9WA 1Z7EA 2P91A 4MVJD 4NQZA 3NGXA 3Q9UA 1H9BA 3MOIA 2CF6A 3QJ5A 4J1SA 1XU9A 2V65A 3QWBA 3ZCXA 2W90A 5BSEA 4AICA 2IXBA 3RUFA 4R9RA 3JD0A 1Y6JA 2AA3A 2B37A 1H2BA 3F1KA 2C54A 4WGGA 5BQFA 3WSVA 4B7CA 1LQTA 4RVHA 4XKJA 2RH4A 4DA9A 1DC5A 1B14A 1OOEA 1Z82A 3JQFA 1BWSA 3ULKA 3C7AA 2YQ5A 1NVGA 3V5NA 2Q50A 4YB8A 2I6TA 5CEFA 4YJFA 1YONA 5K0ZA 1W73A 2Y1CA 1GZ6A 4MP3A 1DLJA 1HSOA 1JLLA 4NBVA 4Z9YA 4R1TA 2O50A 2X0IA 1DO8A 2PKQP 4MIEA 5AVOA 3GR6A 1U4OA 4XR4A 4XZ3A 5G0VA 4IQ8A 3C7CB 3DC2A 3V2UA 1Q7CA 2HMVA 4QQRA 5TC4A 2VZ9A 4Z6KA 1A7AA 1YQDA 4D3FA 1MLDA 3C7DB 1KVSA 1Z6ZA 4G2NA 3LLSA 4UEOA 2WD7A 4Y6PA 5HBRA 1C0IA 2HJRA 4CR8A 5KNLA 4LVUA 3WLFA 2BGLA 4J49A 3S2GA 5H81A 3RJ9A 2Q1SA 5JAQA 4JK3A 1OFGA 4Y6SA 2WE7A 4ALMA 5IDQA 4H16A 4I08A 3O26A 3F4BA 5F5LA 1FMCA 4EYEA 3PIIA 1HE2A 4NU5A 1SEVA 3CSDA 5AXCA 3GGGA 3ADPA 4Q39A 1B16A 2QX7A 4PLHA 4WCFA 5A5EA 4CQMD 1BVRA 2FSSA 1JN0A 4PZEA 5CDTA 3BMCB 4HX5A 5L7TA 3STHA 2QYSA 4DQVA 3DWFA 3CMMA 3K96A 1R0SA 1SBYA 2QZ9A 3F3SA 3RFXA 3PZBA 1B15A 4TRRA 3WGTA 5G0SA 4OQZA 1T24A 3U5TA 2Y1OA 1O8CA 3ZU3A 5B4VA 1U5AA 1MC4A 5GZ3A 3RC9A 1RM4A 1VKOA 1NHWA 1WMBA 3FBTA 3ITDA 1QV6A 5ILGA 1GU7A 1JAYA 2EKPA 3E9QA 1QLHA 3SJ7A 4ALLA 3L6DA 4LMRA 1HYHA 1TVEA 3WFIA 1GUZA 1PJ4A 3GRPA 1SNYA 3I3OA 4QXMA 5MDHA 4ZICA 1LXCA 2VYVD 3GPDG 1DIRA 1Y9EA 3DZFA 3RUCA 2X8LA 1M6HA 4AJ1A 1H2HA 1N8KA 3SXPA 4K9DA 4BO3A 4ILKA 4NBRA 5CG2A 3LVFO 2PTGA 4FFNA 1Y9AA 1ISHA 1JVBA 1HKUA 3RBXA 1DEHA 2J3IA 1RYEA 2WE8A 5KIAA 5HS4A 1YXMA 3WNQA 2CF5A 1I3MA 2YV1A 3DHYA 3DZBA 4WJZA 1DFIA 1LDMA 3BMNA 3OF2A 3S1LA 4EI2A 5ITVA 3RUDA 4H7PA 3E5RA 4JLWA 4W7IA 2JFGA 4CR7A 1B26A 3PHHA 4PLZA 3UKOA 1YBMA 1R15A 2YV2A 2DTXA 1XEAA 3JTMA 1ONOA 1XELA 3HDYA 1DC6A 2B4RO 4RDHA 1J5PA 1F06A 1E3LA 3ETEA 1PJSA 4JX8A 4IPTA 4TKMA 2HAEA 4CMEA 1QYVA 5JMWA 3NDJA 1NBOA 1VLLA 1PX0A 4EJ0A 4MKXA 4ZVVA 5FWNA 3BMCA 5G0TA 3VDRA 4AJEA 3GDFA 4IJWA 2BGMA 1HRDA 1KS9A 4Q9NA 4XIJA 2IZZA 2VWHA 2W8ZA 4XX0A 5F5NA 4FJ2A 3G49A 1UP7A 4R1UA 2GNAA 3ZW9A 4B4WA 5ILOA 3KRTA 4MVJP 3OIGA 4R68A 1HYEA 4KOAA 1I3LA 5AXBA 1IPEA 1T2DA 5DP1A 3E6AA 3O9ZA 4RPKA 4NBWA 2P5YA 2GSDA 2VNAA 1VJ1A 5TT0A 5U9CA 4CLDA 2CVZA 2HUNA 4Z3DA 4DQUA 1HLDA 5DBFA 3GN1A 4BNUA 4PRLA 4LMPA 4J7XA 1SAYA 3A4VA 1Q7GA 4HUJA 4PLGA 3N58A 4OXNA 2DTEA 4L73A 3VZRA 1K6XA 2NVWA 1EFLA 2A35A 3IDSA 5KVVA 1GEEA 2EIHA 3EYWA 1K2WA 2YQ4A 3OJEA 4BKQA 1NFRA 3KV3O 5I9LA 1VKNA 1RKXA 4A5OA 2A4KA 2JJYA 3DQPA 5TGDA 1H9AA 4A10A 4TRJA 4XJTA 1ZK0A 3CXRA 1R37A 4AJ4A 1MFZA 1PQPA 3JQAB 4KMSA 3E48A 4AJ2A 3DOOA 3RASA 1XQ1A 9LDTA 2JFHA 3DBHB 3KSDO 1Q7BA 3TQHA 3WQQA 4E5PA 3X2EA 3OHSX 3FNHA 1FF9A 2C0CA 2EGHA 4RO0A 3PQDA 4RQUA 3S2EA 3EVNA 3ZV3A 1UDBA 1BW9A 3JQ7A 3HFGA 2C7VA 3FNGA 3TWOA 2PKRA 4E12A 3RC7A 4ZQBA 3MJCA 1M67A 4CM6A 1AXGA 1E3WA 2X9NA 5EINA 3PFFA
chains in the Genus database with same CATH superfamily
4EI8A 3ZQJA 2QMEA 3QG5A 3RT9A 2NT4A 5B7QA 1TMOA 2ZR9A 5A05A 2D2IA 1NC3A 1E4OA 2TSYB 5KTOA 2OZKA 3ROPA 4IVQA 1V2HE 3T61A 3V1TC 4C0KA 3EX7C 5EMHA 3L8HA 3BD8A 1PEAA 2GEUA 1A9XA 1CZUA 3M5CA 4TWJA 4NK4A 2YOHA 1NUPA 2W6QA 2QZJA 4OXYA 4AN0A 3GLFA 3AL2A 2FXVA 4F9GA 4H7DA 3EY9A 4DMKA 2R66A 1LSSA 3K0AB 3OZUA 3ORSA 3JQGA 3VX4A 2X1VA 1R5NA 4FFWA 3P8ZA 1QIGA 3IR7A 3BBLA 2GH1A 1VBKA 4NV0A 4WZBE 5ECGC 5BV1A 1TUBA 1H2YA 4K7JA 1E5QA 4RIGA 5AHKA 1NW3A 2D74A 3D8TA 3R76A 3Q7IA 1P3DA 1Z26A 1XMOB 3HHPA 2P0YA 1F60A 3ESXA 3HY6A 2ILVA 3VR4D 5HKKD 3KTFA 2QAIA 1GAXA 5ALEA 4PFSA 4CIYA 3LHFA 3DZIA 2ZIUB 1HOTA 2VJLA 4EG0A 1I13A 2PS0A 6REQB 2QRQA 1KEZA 3EZ2A 1S2MA 5LFAA 4KYIB 3K1YA 1NMXA 2A3RA 4MR7A 4TZTA 1TEZA 2B6HA 3MD0A 5LVAA 1UT5A 3INYA 4P5EA 2ROQA 2NAPA 1WJGA 3WHIA 1E61A 2QW8A 2IRWA 1MVNA 2X4GA 5TIIA 3ROMA 1GQ2A 2QTTA 3WHLA 3N8NA 4ZDKA 1Y6FA 1S8OA 4FS8A 1N77A 1CE8A 2A5FA 2CXUA 4L9RA 1WPGA 1I6LA 4YDHB 4CF6A 7ABPA 3O95A 4INAA 3I61A 4UM7A 4JI3B 4C4SA 3Q9SA 2H11A 4MUAA 1BHJA 3P71T 4NG5A 3KSUA 2R84A 5DI9A 4EP1A 1UPCA 3GH3A 2NPIA 3GDOA 1XTJA 4BNFA 2FVYA 4QBGB 1N9KA 1QHEA 3D5EA 3VJLA 4YQFA 3HKCA 3OLQA 3UANA 1OLSA 3UJAA 3WBJA 2RG1A 3ESAA 3FCOA 2OXIA 3NBKA 2P2ZA 4TV8B 1TT5A 3BRCA 2GO1A 2O48X 2AW5A 2AVDA 3PJFA 3L4EA 3R3UA 4XB1A 1OFUA 2W9XA 3MAAC 3UXYA 4ZZ1A 1KTVA 1T5OA 3QVGA 1NV8A 2NWQA 4Y18A 4XGQA 2YV3A 5IBQA 4FOPA 3ORFA 5EEHA 1YUMA 4CMAA 2R0QC 2C5GA 4ENPA 1ESMA 1BGXT 4QGGA 2C2XA 3JRXA 4XEUA 2JATA 3WGNA 4BPRA 2GXAA 3C5HA 1I5OA 2Q5HA 2N42A 3VVLA 2D4AA 2I29A 3MF4A 4HN2A 2K6GA 4KQGA 4AG5A 1Z2NX 3VSEA 3Q3HA 3RFFA 4H3VA 1V8BA 1W93A 1SUBA 2V6BA 1JHPA 5DM4A 2WFLB 2WRZA 3KVNA 3PDJA 4MROA 2A1TR 3OPYA 1FZTA 2QTZA 5CDYA 1HWYA 1QO0A 5DK4A 4DCTA 1Y8RB 3ZK9A 2WTUA 1RBYA 3OOHA 4DXDA 1G5HA 2R4QA 1OI3A 3AUUA 2Z9BA 4J90A 5JUWA 2OAQ1 1Z0IA 1C9YA 1OAOA 1ZX1A 2OGSA 4E6EA 5DISB 4NCAA 3KAPA 2GRJA 4GX1A 4F4FA 1LSUA 2P2CA 1OVGA 4XASA 2PCLA 4Q3AA 4KE9A 3CVJA 2KWIA 3VHXB 3W2GA 5AM5A 1PL6A 2QRKA 2ZJBA 1QO7A 3SCZA 2CZQA 2GTIA 1E3JA 1NNLA 1C9NA 4X7MA 3O74A 1F4PA 2FP4B 2ZATA 1RP7A 3JYNA 2C4HA 2HOQA 3O38A 2J9GA 2VPTA 4IIEA 4YONB 1OC4A 3AM3A 2I66A 1QS0B 2JDID 4PXAA 4Y2GA 5A0FA 1W46A 2OAEA 4NPCA 3C98A 1GZHB 5SV2A 3ZLBA 4DDHA 5KU1A 1RC1A 3AI2A 2BLNA 4YUAA 1K8RA 1MXFA 1OZHA 1PT9A 3LX6A 2VHEA 4CN9A 3TQOA 4D4GA 5TLSA 3RSZA 1CUSA 1G5IA 2WJPA 1UKAA 3I6BA 3HJAA 2LGJA 3D81A 3SNHA 1UZNA 3LRXA 1XAIA 1T2UA 1I6KA 4GMFA 4RXTA 1NVVR 3VR6H 1NLMA 5BMVB 1A69A 1XU7A 3MTEA 4NIMA 4XI9A 2MSCB 2VO1A 2HDOA 1ZRSA 3CPSA 4N0EA 2XUOA 3V97A 3DV2A 4BMZA 2OBNA 2COEA 5EUCA 2ZIGA 1F0YA 2GZAA 2OV1A 4MWDA 3ZI4A 4ZAGA 5JW6A 1USUA 1CJSA 3ZWXA 3FKJA 2Z2YA 4Y9DA 3WMWA 5KVCA 1EA5A 1G8FA 2FUKA 2WAOA 5B7GA 2GK4A 2BMVA 1QH1B 4W9NA 3H16A 4DCUA 3HSKA 4MR9A 4C30A 4F4CA 3PU6A 5KWIA 3U1VA 1OLUB 3B38A 3K9FC 2IYRA 2X7HA 2O8EA 1KR5A 3AT1A 4M9UA 5TDHA 2RAVA 1O8BA 1WCIB 4PSDA 1E4YA 1ND5A 3PUWA 2VDRB 3D0RA 2NU8B 4ENQA 2PUFA 1NRIA 2X13A 4C05A 3ORYA 4LFCB 2NSJA 1FYDA 2VYQA 3A6ZA 4M49A 3LPCA 1THZA 3QKTA 1U8XX 5AI5A 5IXJA 2RK6A 2N1BA 3V6LA 1U6JA 3K0SA 3UCEA 2WM3A 1Z6GA 4MV6A 2BHTA 4BZPA 4UFOA 5CXUA 4OMUA 2CFIA 2C3MA 1J0DA 3G23A 3QTLA 1ECLA 1EK1A 1CDDA 5FFFA 2WBLC 2FG5A 2F3QA 2Q0SA 3GGSA 3F9IA 1S96A 3OKFA 1GA4A 1FJGB 4NCBA 3D6JA 4BGUA 5AVYA 2GDJA 1Y6ZA 3UT5B 1E3TA 1XXHE 4UNPA 4TM7A 2VBFA 1EFDN 1URPA 4UUAA 4FFBB 2OZLB 3O2SB 4Y2JA 4LISA 3C8ZA 1UXHA 2YJ5A 2V7EA 4LHXA 3WLMA 3OLCX 4MRVA 1PR0A 2EKZA 1US8A 2BKXA 2I1VB 3M6AA 1PGOA 3THWA 1Y1KE 4L3OA 3O92A 4JUIA 5JWOA 3UHFA 3G5TA 4ND4A 4ZVPA 1I7LA 3CZQA 1YRAA 4FYMA 3QWIA 5B58T 1QO0D 5C8YA 3GMIA 1C3JA 1M10A 3KZMA 3AF2A 4I9NA 1QAQA 2QLMA 4LE2A 1C3OA 4QTYA 1RPAA 2VK4A 3HSSA 3VPSA 1FLDA 1GQFA 4QZVA 4FR2A 1F7VA 1KBQA 5REQB 3WA7A 4ND2A 4UBOA 5KUTA 1LLCA 3C14C 4G01B 4E5MA 3OURA 2IV7A 3HUEA 1F6WA 1IY2A 5C34B 2QGZA 2ZDHA 3G5MA 3ROQA 3FPCA 4X1KB 4ZCTA 1CIPA 3G1UA 2D3WA 4F8JA 3TOZA 2OFWA 1YV9A 1GUBA 1K7CA 1L7DA 4R1PA 4C4TA 2MYUA 4Z4GA 1U7UA 4J1NA 1VECA 1KMNA 1BE0A 4JLKA 5GIPE 4MUKA 4WIAA 1ADBA 1C1DB 2G9RA 3GA7A 3O8OA 4HNSA 5ABPA 4DLUA 1O4WA 5KNCD 4CKYA 1BJTA 3TLYA 3PEVA 3S8EA 1USGA 4G4SO 1IL0A 3ZCRA 6ADHA 2WWRA 2GFQA 3SIWA 3ZGYA 5BN1A 1LNQA 2VTDA 2AJDA 3ZDZB 2C58A 2VVTA 4MWSA 4EL5A 1K06A 2NU6A 2ORYA 5EMMA 4UM9B 2Y0DA 3RODA 2FDCA 3OE7A 3F5SA 3W5UA 2YMQA 2FPGA 3UMRA 3ELUA 1BXZA 5G2OA 3KEQA 1OD6A 1ZC3A 1ZO8A 4GI5A 2GB4A 2Q99A 4M0KA 6GPBA 1DL5A 2P9JA 3AHHA 3HO6A 3NALA 3D6HA 3VKWA 1GXSB 3BD9A 3ZHZA 1DUVG 1ESNA 2K4MA 2XD4A 3RGGA 4C03A 2PL9A 2Q3CA 4EY4A 4JUFA 1FSSA 4NDNE 2DY1A 3L8GA 2PBFA 2Z98A 2PSSA 3OPVA 3JWPA 4X64B 2O52A 4ERNA 3EEOA 1NTRA 1GDTA 5DM1A 2P2LA 2WWWA 2FR0A 3AR6A 4EG5A 5MGBA 3GRKA 4ZVOA 1PVDA 5EJIA 3BDAA 3FTPA 3W4KA 1A9ZA 4AM8A 1OAKA 5LCXA 1GVNB 4L75A 4GPD1 4DRXB 4Y2TA 3A1CA 1TJ5A 3I2IA 2BEJA 2Y4NA 2EYQA 3JASB 2JGJA 5KTKA 1F8FA 1JZSA 1NX9A 4P5PA 4B7XA 1P80A 5C5IA 2R86A 221PA 4CV3A 1JKFA 4HATA 3CPJB 4D2IA 1B0PA 3PX2A 4DHWA 3PPXA 5TPWB 3TTSA 2XT6A 3NJRA 4IF4A 4RS3A 1P4SA 4BEWA 4D7AA 4I50F 1SB8A 2V45A 1CUFA 2BZ1A 2XZOA 2QTWB 1DZ3A 4ZHSA 1R6DA 1EHIA 1NDHA 3EJWA 1L9XA 2R6CA 5FV7A 3W6PA 5BYAA 4OU5A 4XAQA 5DXJA 3S1AB 4K8RB 1AIPA 3SC3A 3VHRA 2G5PA 1DE0A 3EODA 1L3CA 5IC6A 3OPMA 5CYGA 4QFDA 2ZSAA 4BMNA 2OV6A 4E51A 3RYIA 1XVAA 5D3KA 4HF7A 4AWAA 5ALQA 2HSGA 5FOWA 3NTXA 1R0LA 3LUCA 3Q2OA 3A2KA 3VPHA 1TGVA 1OPXA 1GV0A 5LP1A 3NIBA 3J80A 2ZBQA 3I6ZA 1ZU5A 5H4HA 3UT0A 2Q21A 2CL0X 5IVKA 2WYUA 3I9FA 2W2MA 3OQIA 4WADA 4J0JA 4DWJA 3HK2A 2O8DB 2JIZA 2Z4RA 4AKTA 1MVLA 1C8VB 3CNEA 2PX3A 3RVQA 4TL8A 4HWKA 3S28A 4MYHA 5THKA 4DUPA 2X9VA 1EDOA 3PUHA 4MAAA 3I58A 1UBTS 1GYPA 2FDXA 4NDAA 3EZYA 2GILA 3D7LA 1UMBB 5AOVA 3RF6A 4XVCA 2YW9A 3W4JA 2O20A 4DB4A 2P9BA 1IN7A 1PWXA 3G8DA 3HV2A 4JZKA 4DY4A 2FDRA 3NV9A 4UCQA 4RZUA 5K5EA 1M1XB 2P9EA 4X8LA 5IS2A 5ALDA 2ZT7A 5C8XA 3A32A 4KN5A 1KJ9A 1XMXA 3F49S 1DBWA 4BVGA 1E2PA 2KJQA 3D3WA 2SBTA 3O8RA 1FTYA 2WYIA 1SVUA 2VDNB 3KVYA 5DHPA 3TIGA 4Z5XA 4HDSA 2PV7A 1T9GR 1YFZA 2VP6A 3P9ZA 2WAAA 4TQ9A 5CURA 3H5TA 1GL6A 5H9WA 3PXBA 2WTEA 4I1PA 1X80A 2C4WA 2GFHA 4NPAA 5DK6A 1N2OA 5F2OA 2I4OA 5JMOA 3PGLA 4RF5A 1L4UA 1EE1A 1G64A 4MQUA 3GUVA 4YFYA 3DDCA 4D02A 1QO9A 3ISVA 4N7JA 2Z30A 1CETA 4JL6A 1YZHA 3DDNA 2E4VA 4DSOA 4NFSA 4G5XA 3R24A 3S68A 2Y76A 2ZS7A 1OA1A 3MCZA 1COWA 4GXRA 2L19A 1L4NA 2R44A 4K46A 3FRJA 4C21A 2CD7A 2WHXA 3DC7A 1FDUA 2ECOA 3STTA 1DSSG 1H42A 3WMFA 2CB9A 1YHNA 2H9AA 3BILA 3VU9A 1KOFA 3BRSA 4JD5A 2GCEA 1HDOA 1KS2A 2W8BB 4XWYA 4J0IA 1XPRA 1EAYA 2R7KA 2XWJI 2PZEA 2QQ5A 3B5JA 3L4SO 4KV7A 4NJMA 2WVHA 1E9BA 1SHUX 2IHKA 2AXQA 3PRYA 4V0LA 1XN1A 4JVLA 2HRQA 4UVHA 4IICA 4G9GA 4NNOA 3RJMA 4G5QA 1V6CA 1E9RA 2O8FA 1RYBA 4H7IA 3D59A 1FP1D 1Y8ZA 2GPNA 3G8BA 4LTNA 4OG2A 3OZIA 4F97A 1J0EA 1Z73A 4B4DA 2YZGA 5FL7D 1BFUA 1Z28A 3INTA 1JT9A 1WLYA 5CX1B 1VHJA 2WHQA 2IYQA 3GAFA 3IO5A 2DBYA 3UMYA 2PFGA 1FL9A 2D4HA 3HL0A 4RPLA 1A95A 1TM5E 2B8JA 2NSLA 3HS3A 3OFSA 1QJCA 4M8SA 4P92A 5DEIA 5BXQC 2PAFA 2VSXA 3GBSA 1Y3BE 2G0NA 3PR3A 4NK5A 4JSRA 4ETIA 3FPJA 3QE4A 1IZZA 4ARZB 4BO1A 5IFLA 4QPZA 5BYKA 1OXKB 2AJBA 1NDQA 4WZAE 1T10A 3AJEA 3IVRA 4L0QA 3F1LA 1V96A 3IMKA 2W5UA 1LS1A 2NUTB 1NXPA 4JMLA 3UK7A 3VI3B 4LK2A 1UDXA 3WZLA 1CERA 1HH4A 1ST3A 2W00A 4EG4A 3D3JA 4O2BA 5JRDS 5FJIA 4I1SA 3B51X 4RWEA 1UP6A 3LZ6A 4N12A 3IQZA 1F5SA 1K4KA 5GV8A 5IULC 4MITA 5L3ZA 4AQYB 3V7YA 3LC7O 1IN5A 1DT3A 1FU8A 1TLTA 1TVCA 1UKYA 1SUAA 2IPOA 3FLEA 4RETA 2PSFA 4W7HA 4W8GA 3TTTA 2J9RA 4FFLA 4LJKA 2YZ7A 1PS8A 2PMWB 3W04A 3WV4A 5JIBA 3EIEA 4K9PA 4W99A 3FOAA 2PXHA 3NEPX 4MH0R 2VPIA 1UUFA 4P7FA 3W3ZB 2H1OA 4AKIA 4ND6A 1PZNA 1SVWA 1EFVA 1ZK2A 5DYYA 3MK31 2VL7A 3P9QA 1HSZA 2HF8A 2XUFA 3F6YA 2OXRA 1SPXA 2ZR0A 2R1VB 5F76A 4PZCA 2I99A 3U13A 2QOEA 3G3EA 3W9SA 2F3PA 2X2OA 2G72A 3TN7A 3MPUA 5AM2A 1WB4A 1K7XB 1YZUA 4D8UA 2ZZKA 3AR3A 1X9GA 4BX9A 4ME6A 3ZH2A 2PX0A 3ZNNA 2VF5X 3DDOA 5F3DA 3ITEA 2QHXA 4F4HA 1GPWB 4V3CA 4A0RA 1RU3A 2ERYA 2XLCA 4IIDA 3L7DA 1T5LA 1Y48E 5DSTA 4QLOA 1OH7A 1NUHA 1Q20A 3WBFA 3QVTA 5KJFA 1LLQA 2J85A 4WCDA 2O0LA 1P2VA 4BZWA 3ASYA 2X3FA 3DS8A 1Z68A 4QQFA 3ANLA 3TQSA 2OORA 4DV7B 4QTZA 2FXIA 3SDBA 1YIDA 1ZI8A 4MW1A 3UJ6A 3R3VA 3FCUB 4JLPA 3OZEA 2X1LA 1DKQA 1YL6A 3ZHBA 3AFGA 4Q3CA 1U1DA 1W5BA 3I9V6 2WHEA 4MS3A 2HCRA 3R2JA 1W76A 5F1KA 2FQWA 4RTPA 1GZDA 1COWD 1P0IA 1V9LA 5HQ3A 4R2LA 5JDIC 1BCSB 5HQTA 3D6UA 5C51B 1QG4A 1N5OX 1P91A 2AOTA 4TSFA 5A5DA 2AMYA 4RTQA 3VI4B 2FN7A 1KI2A 4ECEA 3ZWCA 5CITA 2ZTVA 3IH5A 1ZW1A 4E15A 3R3WA 2C9MA 3K6JA 3SU8A 2OFOA 2GZDA 1HT2E 1K8YB 2ODNA 5KYUA 5K3AA 2JNWA 2GRAA 4EJMA 3OQOA 1RZUA 4TYPA 5C0OE 2ZYIA 1BRTA 1M1YB 3D2BA 3G89A 1NVBA 3KSMA 4P4UA 5CCBA 2A1TS 4EB6B 3IEMA 2FUNB 1J42A 4OQMA 2OQVA 1Q0RA 1ZOIA 4K6OA 2EWWA 4LQLA 2ASVA 2WF5A 4KVFA 5I3ZA 5B2EA 3FDZB 3WLPA 4B6PA 4HWTA 5K2OA 4J0CA 5AI0A 2R11A 3ODPA 3OJ0A 13PKA 2EGUA 3BWDD 3LCJA 1UC4B 2FEWB 3DLAA 1G4AE 3G0BA 4DVJA 3GT7A 1D6SA 4IDQA 5FYDA 1XLTC 3HYSA 3AK4A 4FINA 4QEZA 4WUVA 1WD5A 2QG9A 3LC2O 3QG1A 3OM9A 3TKLA 3P4YA 2L42A 1QQBA 5L3RA 2JK0A 2W6MA 3T3OA 2CGEA 4M87A 1T9KA 2EAUA 3B6IA 3WR5A 3GRRA 2ZJ0A 5E6RB 4FDTA 4JHXA 1ES9A 4BNHA 2P3OA 3ZDCA 3VR0A 5CDHA 5K03A 1C2YA 4U02A 1JG1A 1GRNA 5HQJA 2AFIE 2EW2A 1V7CA 2JJ1D 4UDOA 2NLOA 4IQFA 5K09A 2AZXA 1PJLA 1ZBDA 1AKQA 2GERA 3OJWA 5DM60 1NLUA 1YC2A 3CKKA 4B33A 2WU1A 3GLHE 3IEXA 2R6GA 3C3YA 4NH4A 5H83A 2A30A 3HJUA 2G8LA 1P62B 2HSJA 2MINA 3O4HA 4N0PA 4MHOA 1RZVA 4DMMA 2PRSA 2DU8A 3N2KB 3QI7A 4XYBA 4DIDA 4IV0A 4M86A 1AQNA 4YT2A 4HG2A 3H75A 3DTNA 5SZJA 1U7HA 3GH1A 2C0PA 3MJHA 4A92A 2YJZA 1C7JA 2NUPA 4XQGA 1N1MA 3TPZA 3IMCA 1FY2A 5FORA 1JAXA 4ZI7A 1Z36A 2RHRA 1BMQA 1RQPA 1VKHA 4IZ6A 1BVHA 2DKOA 1AZLA 2UUOA 3V4FA 2GEKA 3A1VA 5IJ0A 2FEPA 1YZFA 1ELOA 4Q00A 3EC7A 3K8QA 2PXXA 4V0MA 5CPBA 3WMXA 2JIDA 3PUKA 1GO2A 5DULA 4X94A 2H9YA 4NNPA 1VM6A 3BPSA 4BNNA 2GKOA 1K5DA 1CNMA 4FGWA 1Q0PA 4HAOA 4YO8A 1IK6A 5IP5A 4URWR 4FQ5A 3ZZUA 5HJ5A 4YMGA 4EJFA 1BHSA 1ECGA 2N47A 1ATZA 4O3FA 1QP7A 4Z49A 3K2BA 1K97A 3C1TA 4N0QA 4XB6B 4X6LA 3RAPR 3LOPA 4E1BA 3KQUA 3OX4A 4BX8A 4FHZA 5J63A 4JYPA 4LXIA 5MN4A 1KMMA 5KO2A 3GJTA 1NLYA 2D0DA 4G8JA 5L9AA 2PH5A 3BMQB 2GF2A 1HK7A 2O2HA 4V38A 2YXDA 4W7SA 5HF5A 5LC1A 3TD2A 3WLRA 3O3CA 3E03A 4HNHA 2BV3A 2ZRFA 4UEKA 1SUDA 3P45A 3ZJYA 1KY3A 4E4YA 4XSVA 5ITWA 3ESQA 5EIBC 2XDQA 2C5EA 4IDFA 1NBMD 4X6UA 3EEBA 4XCQA 4TYMA 1KFJB 2WM9B 4I5EA 2EQBA 1LC0A 2A4MA 3AU9A 1GTJ1 2ANCA 3RFCA 5I7VA 1U0HC 2M9MA 5FQNA 2AYXA 5BQPA 4HEA6 3KZXA 1LRLA 3BTUA 4XCVA 4TL6A 1GPJA 1PHPA 1BD4A 3ER6A 3F97A 4C0XA 1S2IA 4E07A 3JR3A 1DINA 3ZY3A 5KI6A 2KB0A 2JGDA 4XYGA 3FPSA 1WE2A 4HRAA 4UU7A 1KDVA 4TT3A 2H1SA 1Z5UA 2I67A 1YZQA 3MB8A 3FCYA 4FLEA 5NLLA 1D4FA 3ITKA 4E09A 3HVRA 3VKGA 4ZRNA 3ZU5A 1NUTA 2W0SA 4J43A 3IVAA 1WXFA 3S2SA 3KJFA 1SXJB 2LUOA 3RC3A 3JQAA 3PQCA 3OTQA 3HTXA 2VJOA 1GCUA 2IEAA 2JLZA 2XNHA 3U7HB 3URMA 4PFQA 4JP1A 5DGIA 2IDMA 2BVNA 3JWEA 2REOA 4FC6A 2VNJA 1XVVA 4DLVA 1YCGA 4RJJA 1UOQA 4FKZA 4KXQA 5DTEA 3R09A 2R00C 3B2EA 1A50B 2Q9CA 3QKSB 4Z0NA 5L3SB 4B76A 3M5PA 4EPVA 4JP2A 5LQMA 5DVZA 3T7SA 1DOHA 2BZ0A 2J0EA 3K6RA 3FWZA 2BBTA 1H1DA 3H04A 3ZGNA 2ECKA 3MS2A 3NG1A 5DN9A 1AS0A 3PDIB 3TO5A 2A0XA 2NZ8A 1P8AA 5B1YA 4AWBA 4CCYA 3KOUA 3MBOA 2DM6A 4GEKA 4QICA 4WACA 5JNLA 2WU3A 5JZVA 2FFJA 3M2PA 3QFRA 5ALGA 2OV3A 3HFSA 5FNZA 2JJ2A 5CB4F 1NG9A 1QG2A 4MINA 1GWNA 4DWVA 5AVZA 1FFEA 3RVKA 2PUGA 3JAKA 2I22A 1PAUA 2H2GA 2Q49A 3UWOA 4DLLA 4IOLA 1JNXX 5D5PA 3ZDXB 4NBNA 1E9DA 4TMVA 1F6DA 2VUUA 4WY2A 3DDZX 3U16A 4BAZA 5DTRA 3L1VA 4M8LA 3SZOA 3DV9A 1H65A 3VHLB 2Z6QA 4ZCRA 4NXNB 2NXCA 1QHIA 1C3VA 1YQQA 1FXSA 3KCNA 5CFZA 1CIVA 1E2DA 1FB5A 3QELB 3FJYA 3OTGA 3PTLA 5JS2A 4F92B 3ZU2A 2BMAA 2VSNA 3BDVA 2W6OA 3EIOA 3NETA 2O7QA 3I5UA 5JPDA 1C80A 4KNWA 3K30A 3ZLTA 4FM9A 2XUIA 4QYIA 4ZV4A 4H7FA 3SMQA 1JEOA 2AVNA 1Z5OA 2Q6IA 3VNAA 8AT1A 1RKUA 3EQ6A 3RR2A 1JHQA 5FFNA 1KOGA 3N2YA 3TLZA 2B4KA 3WMGA 3T7JA 1Z0SA 1Q0UA 2AGVA 1M34E 1WP4A 3R0XA 4IGIA 2IXAA 1AXEA 2ST1A 5I7FA 2HBQA 3KB8A 3L8EA 2OBYA 1VZ3A 1IRIA 4BKOA 1L8QA 4EG7A 3QEOA 4FGSA 1L7VC 3DAYA 1T36A 1UXOA 2C3OA 3H83A 1F8YA 1ZH4A 1XLTA 4ZEOA 2HRDA 4FYVA 3K6SB 1Z5PA 1E99A 4ZPXA 3TSAA 4K0KB 1IBSA 1R0CA 1WQ4A 4AMBA 4JQSA 1YBVA 5AKJA 2I2AA 5FD8A 3D7SA 2XDWA 4GF5A 1LQUA 4RVGA 1XX6A 2A0UA 4HB2A 3MB5A 5ALXA 1JEYA 4ZOLF 2X0EA 4U7PB 1WXXA 4LRYA 2ZB3A 1F2UA 3L8YA 2YY6A 4QO7A 1OTYA 2BFPA 1K88A 1KXZA 1NC1A 2CUNA 2YHIB 2DPHA 4WXPA 5DGCA 3V9AA 3QXXA 2KYRA 4XWKA 4RD2A 2HIHA 4PG4A 5CIWA 3V1YA 4TT3D 5A04A 2JVJA 5C5DA 1VTKA 3EF3A 4YAEA 1UKVY 3BMXA 4H17A 5GJCA 3R7SA 3WLEA 5LOVA 2X0DA 4I55B 4LXXA 2ODEA 1DOZA 3GC6A 2Q4RA 3I1IA 3MYRA 4YJDA 2C7BA 4KLAA 3ZU4A 5C32A 2F4NA 4CKWA 4Y2HA 4WK2B 2Z9CA 2KX7A 5DIZA 3PC6A 4YAJA 4A8TA 4CMIB 2FAXA 4YXWD 5JS8A 3A11A 1W5SA 3OG9A 3H9JA 4HAUA 5J59A 2R96A 5KNDH 4BL5A 2NAFA 4C07A 4EATA 4W9MC 2WQ6A 1NP7A 4CDMA 5FUYA 2QAGB 5KYXB 3TZKA 2AI3A 3EVTA 4MWCA 3F3KA 2TMYA 3H7IA 3ANTA 1DJQA 3K35A 1F0PA 4ARAA 4B81A 1GJRA 5IM4A 4O4LB 2NGRA 3QPUA 1GG2A 5CT9A 4U9HS 1PTJC 4FZ3A 1E7WA 5DXFA 5EL0A 1UKEA 2QT9A 3FPAA 1NONA 1Y1TA 2BFDB 4EKEA 2XCIA 3OKCA 1BH2A 4KNVA 2I5PO 3ECCA 1T9GS 3GVXA 1FS5A 1T2AA 4YJ3A 5IAAA 2YVAA 2C2KA 3E9RA 2QM0A 2B2NA 4AXXA 3RDPA 4MP6A 4YP1A 4HCJA 2Z8XA 1DEKA 4G3XA 4P22A 3EGEA 3KE8A 4O4IA 3CO5A 4R1OA 2V6JA 4YRMA 3T9FA 3LLUA 1LTQA 1P60A 1S8FA 3PFNA 1TDJA 3K5WA 1KERA 4U9UA 4OFWA 4EYKA 5LKRA 5HNKA 3TIIA 3TXYA 3B6KA 4L5IA 1JV2B 3WV5A 2VAPA 3E4DA 3N5CA 4D8VA 4OL0A 1TXGA 4V0KA 1XEWX 2ODWA 1WPQA 3I9JA 4TXLA 1JZQA 1KZHA 4DMCA 2LE0A 1TEVA 3O7MA 1USKA 5GONF 4YPOA 3JATB 3BCSA 1F1JA 3KU1A 3ETCA 4EGQA 1TKCA 3S7TA 2EWVA 3AWDA 2H06A 4BXOA 1PIWA 5FO0A 4DJDC 3A6LA 1EKXA 1QCDA 4RA9B 3PUYA 5DNWA 3NOOA 6Q21A 2CXTA 4BAUA 1AMUA 3V7WA 2NYUA 4C6TB 2OHHA 3OPQA 4U7FA 1KI6A 3FWYA 1E1RA 1Z5NA 4KVGA 1IG3A 4KPUA 4MMYB 1B2LA 4YAGA 4OI4A 2BGTA 4YROA 4EF6A 5LQAA 2GPTA 3NTOA 4QUKA 2ZT5A 4D56A 3HY4A 1UMDA 2Q5FA 5FBQB 2EFCB 3NHYA 3K5PA 3VDXA 5FT9A 2QV7A 4DTIA 4EHFA 4AUMA 4EF4A 4UMFA 2O5EA 3BMOB 2WYVA 2HTFA 3B52X 1N36B 4GKVA 1MXHA 5B37A 1F12A 3I04M 2D1FA 3DE6X 3ICQB 1H22A 2FZVA 2WZDA 3GXOA 1Z6AA 4YDRA 2JFWA 2ODPA 1DIOB 2P6RA 4WA7A 4H35A 1AQUA 5G4LA 2FWNA 3BCUA 3HKEB 2BGWA 5B7PA 2P9FA 5DCWA 2R00A 4WN3A 1OY1A 1OCEA 4NL4H 3QOYA 5D5QA 5FIUA 4CM9D 4WFJA 4EX7A 1EE2A 1T15A 4OP1A 1KFCB 1V5GA 5D6NA 2B83A 3WG9A 2ZBFA 4ZZ3A 4ZO8A 3M6IA 1HL7A 2VPPA 5C37A 3EAGA 1P73A 4DDKA 5L53A 4ZXPA 1D2HA 4IVRA 1RAEA 1CUYA 2MYPA 1EJBA 2I1QA 1R6UA 2XA9A 3IUQA 3OO0A 4YP0A 5FNVF 4BGEA 4W1QA 1ZXLA 421PA 5PGMA 1E9FA 1XP5A 2GUGA 1K1EA 3GLKA 4DLXA 4NZPA 3X1KA 4BFWA 1TQ8A 5LBIA 2O3JA 4ND7A 5G1OA 5GZ6A 1EQ2A 3T06B 4A6DA 4DJAA 4C7KA 5LYJF 1Z8DA 2BFFA 3C3AA 1AM4D 3EXFA 1SCJA 1WTCA 4RXMA 5EY5B 2C1ZA 2N9UA 3SBXA 3ICEA 4E7OA 1SFRA 3OD1A 3OIWA 2ADMA 5IVIA 5I9IA 4XJXA 1OFTA 2ZJ3A 4AQDA 3DOIA 1SHTX 4AC9A 5A6SA 1U3DA 2AR0A 1DKNA 3C15C 4ZQCB 3ZDQA 4X7BA 2QN7A 4Q93A 4ASUD 2PH7A 1GA1A 2B8WA 2W11A 4YAUA 2IS2A 1DNPA 3PHIA 4BFUA 4OHZA 3CNQS 1ODJA 1UBEA 1WX1A 4OHCA 2ATCA 4WV3A 4Q4JA 4ZOEA 3EC1A 3V8MA 2Q07A 2O05A 3UK0A 4QG3A 5ERGB 2EF1A 2G09A 4L2IB 4QKQA 4M2LA 1ABBA 3DBIA 5M2QA 2UYHA 1PR5A 2XMRA 1NSTA 3H7AA 5AP9A 1QR6A 2Q7OE 5B3JC 2GYVA 2Q2WA 2QR2A 4HVCA 2I1WA 3HVIA 5EE3A 1FDSA 3WQHA 3QEBZ 3KUCA 1VB5A 1IPHA 4IHQA 5CLGA 3KOXA 4PR3A 3N2ZB 1HM5A 4UU0A 3KKMA 4JJIA 1RKVA 3EW7A 1D9ZA 4CDNA 5P21A 2ZJOA 2QSUA 4NU8X 4NCJA 3NTQA 4R9VA 1VJDA 5AXAA 4R7GA 3ANSA 2WHYA 3C3KA 5F7XA 1Z4NA 4O08A 2ESRA 1ETHA 4GP6A 3DLCA 2FWJA 3BD7A 4UAGA 3AXSA 1E9AA 1DAOA 4P33A 4RVNA 1K86A 1PGQA 2J9FB 5EJGA 4CLXA 1N5JA 4C4YA 4G84A 5KYGA 4DABA 1O6CA 2GF9A 3EQZA 5HJ2A 1E1YA 4HH0A 2H08A 1M1NA 4JBIA 3B60A 5GJWC 1E1RD 1M2VB 2PRZA 3HCAA 1C14A 4KUGA 5L95A 4OHUA 9LDBA 4IWYA 4O59O 2UXBB 4G65A 4KWTA 4LWPA 1PL7A 2XMQA 3ICPA 1MB0A 4MI9A 4QPDA 2WB2A 1USVA 1E2IA 1H3NA 1CQIA 2MSKA 3BE6A 3QPVA 4GSYA 4TKUA 5IAOA 3Q88A 2UZ4A 4GYKA 3I6IA 5D7BA 4BWYA 1NJ2A 3PEWA 2BIFA 2GZHA 3DEZA 1PR4A 2P8JA 2OXTA 1Q7EA 3N3AC 2APJA 1Y89A 3KTOA 4JXKA 4LEIA 2EBFX 1VSQA 1I1QB 1ZS9A 2QQ0A 4XJSA 1XWWA 4HOYA 2ZXUA 2DETA 3TQFA 4D6XA 4K86A 1QYDA 3TB6A 1YDFA 3H42B 3FWKA 3DOUA 1GYQA 1U3FA 3NIWA 5EZYA 4KPFC 1Z2OX 4JC8A 5DLQC 10MHA 1PR2A 4IWXA 2M98A 1RHKA 2VHCA 1I2ZA 2B1JA 2DMRA 2WKRA 4KRXA 1O5OA 4Q1VA 2BTQA 4EFMA 1YRHA 1DPFA 2A6PA 3VMFA 1NTOA 4PSAA 5DWQA 2B4TO 1NNUA 2CXPA 3K8OE 4DMGA 4RPCA 2XRFA 5JBIA 5FO1A 3W8RA 4H77A 5LJLA 1AKMA 4LJ4A 4QRDA 5TMPA 2XKAA 3NQ41 4UEJA 1NAIA 2HMYB 5F77A 4LCEA 1NXSA 2GAIA 2GJ9A 1D0IA 1HDEA 4WL0A 3T7EA 2Q4OA 2ZI7A 1A9RA 3JTEA 4OXRA 2GM3A 4Q47A 3U31A 1XFDA 5LLSA 3EA4A 4XPIA 2ZBUA 2PUBA 1M72A 5AW7A 2ZJFA 1CY2A 5DLPA 3TJZA 3ZGVA 3L46A 1A8UA 3R7LA 2OYCA 5I7EA 5F3WB 3IT0A 1IWPB 1KYYA 3EUWA 5EJMA 2AR7A 4CQLA 1NFQA 3QY9A 2XUAA 4RMGA 4UTOA 5D85A 3U2QA 1XQXA 1P1IA 4CQJA 2OGTA 3HPQA 4HNRA 1QYXA 4IMJB 1L5RA 2Q8NA 2V58A 1FMJA 2C96A 3ZD9A 2VF2A 1AURA 4IFTA 2PU7A 1ZMOA 4XVQA 1SG0A 3DSRA 5KKCA 2JEYA 2X4DA 3RSOA 1NP3A 1R5JA 1SZJG 1YR7A 1SXGA 2DBRA 5C8ZA 1QFZA 2QUKA 2WU4A 3QVKA 1CJCA 1KOJA 1Q0TA 1YJCA 1EXNA 1C9JA 1PT5A 1BYUA 3EQ9A 4H27A 5JH7B 1XCMA 2IZOA 1R74A 5GMOA 3WL7A 3B8HA 3LOUA 3LXUX 4GE3A 3RIYA 3T3IA 2C9CA 3L6UA 1R4ZA 4C6HA 1IWBB 1F2TA 5K2MA 4BQRA 3O91A 1ZN7A 3UGQA 1V1MB 4JT2A 2P5SA 3GJXC 4RORA 1GVHA 1FPMA 4DZZA 3ZHUA 1CZKA 3PF8A 1ZOSA 2B69A 2ZRIA 2F90A 1TK9A 5AYVA 5DNYB 5JQGA 1DCFA 2XUHA 1J7JA 4YCSA 4U2GA 1N2ZA 5C2JB 1UJMA 3M6LA 1YI0A 1LDEA 1JDSA 1BN7A 1LF5A 1TC2A 4GKKB 4BWGA 3MCTA 3G13A 1H23A 1ZGBA 4GGPA 4DBZA 3UFXA 2LP4Y 4P4LA 1CQJB 1GTG1 4EHLA 3O90A 1WDLA 1UP4A 5FLXA 1BCRA 3COSA 1HE1C 1NLZA 1TCAA 4V24A 2ZWMA 2WYHA 2NACA 4XM0A 3EDQA 3QMMA 2IOHA 3PJRA 1JSZA 1QGUA 2VJYA 2OPHA 3TSWA 4B3RB 2H65A 1U0BB 1TMGE 4QPJC 4JJKA 2Z95A 5DWDA 4P35A 1Q19A 1AK2A 1YE5A 4LS3A 4TUYB 2XB9A 2X2FA 4FOOA 3HRIA 3QPDA 1GQYA 3PGKA 5B12A 3E9YA 2VTVA 3FOWA 4C29A 2JLRA 1MV8A 1P17A 3K1AA 5HBGA 3AEUA 1JRLA 1LFDB 2VK9A 5DCYA 3I28A 5FBKA 4DNXA 1I7SB 1SBHA 1YL7A 2G82A 2NO6A 3D2LA 3JPWA 3T4XA 5TJ9A 2QN2A 5DFAA 1VCOA 4NJOA 4A1OA 4HNUA 3DXYA 1ESZA 3O3NB 1WZCA 3HJRA 5F78A 1XKXA 3SBDA 1L5VA 1HA3A 2ZKIA 3PJEA 1CZOA 1D1PA 3QOFA 4WBXC 3T0IA 2CNLA 2J33A 1OX5A 2FPIA 4CFYA 4WD3A 1JR3E 1DBPA 4BVLA 3JD1A 3CVXA 4MUIA 4BN0A 2CJWB 2QJFA 3R9IA 1AQIA 5IKXA 4F46A 1VMIA 4JJGA 2P3LA 3TD9A 1QH0A 4KQXA 3RV3A 1VGQA 1UPUA 3I83A 1G1MA 1W4BA 4N6GA 3AEZA 2WP0A 4OFXA 1ZOLA 1BAPA 4WBSA 4D42A 1GKUB 3DLBA 1PI3A 4UXJA 1E8NA 3VVMA 3GMTA 4Y3UA 2YHAA 5AK4A 4BB0A 5BNIA 4MRPA 1YC5A 1CB0A 5CM8B 1W85B 3RS8A 1NWCA 2CNBA 1TIKA 2PSHA 4RK4A 5J40A 3X1WA 4EJSC 2FH5B 2WIFA 5FI0B 4TYWA 2OCXA 3WFZA 1IZ9A 2JGKA 3E9NA 3H2HA 3MMSA 4R2KA 2V4ZA 2WWFA 1VMEA 3HDGA 5JARA 3C4VA 2FW1A 2ZYGA 2GHIA 2H5IA 1ZUNB 3KEOA 5KMGB 1RJWA 1A3CA 3G5UA 4JSTA 4J29A 4BNDB 4FIDA 4C04A 4L76A 4EKDA 3L8CA 3OX3A 4KODA 5EESA 5H8WA 2BBSA 4A6PA 4N8DA 1A2OA 3FKSA 4EVIA 2DCMA 3DV0A 4KH1A 1XTRA 3CO0S 4XXHA 2J4CA 3K9WA 4ZP1A 4B9EA 4E03A 2D7CA 2I2XB 2YNMA 3CH6A 3EOZA 3E8MA 3IHTA 2W48A 1CVLA 1CR4A 3FRIA 3A1NA 1ZHFA 5A7HA 1NQTA 3PFBA 2B1GA 3B1FA 1PVVA 4CM3A 5TGZA 4PYKA 4TS9A 2YIVX 3K70D 3JQ7B 1L7QA 4ZTBA 4OH7A 2Q27A 2DWUA 4UU8A 3T0GA 2LDXA 2DVMA 2QLNA 4IXWA 4PS0A 4LW8A 2BKEA 4MUJA 1OWPA 5EZ5A 1SKAA 5K3BA 3FUWA 3U4MA 3LL4A 1ZQ1A 2ES4A 2ERXA 3DMPA 2DYKA 3PUJA 3QQ5A 2WA2A 2RARA 5A6VA 2D2XA 1AA9A 4KU4A 4TYNA 2GZ1A 3AR5A 2VHJA 3JZIA 4IP0A 3OQ1A 1A9XB 4ZI5A 5GM1A 5U4XA 1RLJA 3CLKA 3WP1B 1V6AA 5KWJA 1E58A 3IXMA 3K5IA 4NYIR 4CV2A 1G20B 2WMOB 3CRRA