2RCYA

Crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
b'GMENIKLGFMGLGQMGSALAHGIANANIIKKENLFYYGPSKKNTTLNYMSSNEELARHCDIIVCAVKPDIAGSVLNNIKPYLSSKLLISICGGLNIGKLEEMVGSENKIVWVMPNTPCLVGEGSFIYCSNKNVNSTDKKYVNDIFNSCGIIHEIKEKDMDIATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGSVEMVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYTVMNAVEAACEKSKAMGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrroline carboxylate reductase
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title Crystal structure of Plasmodium falciparum pyrroline carboxylate reductase (MAL13P1.284) with NADP bound.
rcsb
total genus 80
structure length 262
sequence length 262
chains with identical sequence B, C, D, E
ec nomenclature ec 1.5.1.2: Pyrroline-5-carboxylate reductase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 2rcyA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rcyA01
5G2OA 4RZIA 2DKNA 3I3OA 2EV9A 3VDQA 1V3UA 2C54A 4J4TA 4RVUA 4I5DA 4MO2A 2VCYA 5JCJA 1XDWA 1E3EA 2VTEA 5ILGA 4CQMD 2FPPA 3GEGA 5EMHA 3RJ5A 4TZTA 4M54A 1J5PA 3RUAA 3IS3A 2VRCD 1UAGA 2VZ8A 3JTMA 4DIBA 1MUUA 3JQBA 1FMCA 1W6UA 4FQ8A 3UXYA 3KHUA 3OQ1A 4MP8A 1O95A 3DBRB 4XIJA 4ALLA 3FWNA 1PZFA 4MVJH 3ETEA 5G4KA 1MX3A 4W9NC 1M2WA 2AQKA 4CLOA 2EGHA 1GTMA 2NUAA 5U4QA 4D3DA 3PYLA 1YBMA 1U7TA 1SPXA 1L1FA 4FOOA 3E8XA 4CMIA 1RM4A 1B8VA 1PR9A 3NDRA 3TF5A 3PXXA 5U1PA 1TVEA 5AVOA 4MVJD 4HUJA 2JFGA 5THKA 1EVJA 2X7HA 3SLGA 2BGMA 5CDTA 4J4HA 2PZMA 1Y8QB 3I4FA 4N5LA 2PZKA 1ZW1A 4R9SA 4NZ9A 3ZNOA 2EJWA 1EEHA 4Z9YA 4M87A 3R6DA 4A03A 3I23A 3GEMA 3PHLA 5CHEA 3H3JA 3G0OA 4OSOA 1I36A 4HNHA 4FBGA 5KJEA 1P44A 4LMRA 4PLWA 1CQJA 3PFWO 1I3MA 1RM0A 2E82A 4XDZA 1R12A 4E2XA 4LVCA 2ZQZA 1PL6A 3PQFA 4N54A 1I10A 1E6WA 4YXFA 2WE7A 4A27A 3BIOA 1UP6A 1DIHA 5IAAA 3IUPA 2Y1DA 2FWMX 3ITKA 4RPGA 1UXIA 1HRDA 3WGGA 2ILTA 4IDDA 3RQSA 3HE3A 3GPIA 4YAJA 3EC7A 1E5QA 4GGPA 3EHEA 4JNKA 3KYDA 1N9GB 1LQUA 4IGFA 1BW9A 1P33A 2X58A 4ZRNA 1RJWA 4CR7A 4MVJM 2NACA 2JCXA 4ALKA 2NQTA 4XB2A 3TL3A 3VH3A 4PIVA 1XU9A 4TRRA 1VJ1A 4BUCA 1PWXA 1DOHA 2CDBA 3RROA 3FI9A 5JDIC 3DZIA 1C1XB 3HG7A 3FPLA 3PK0A 3D4NA 2Z5LA 3Q6IA 1NR1A 3K8ZA 1ENOA 2HMVA 3UF0A 1WMAA 4JROA 4J9UE 5ENVA 4E12A 2FPGA 3I9LA 2DAPA 4WKGA 2POQX 5DDIP 5H82A 5KJ6A 1IYZA 4BKRA 1ZFNA 3JYLA 3IKTA 3E5MA 4DBZA 2GN9A 4BL5A 3F46A 4U7WA 1AE1A 5ITWA 2GYYA 1AUPA 2YQ5A 3CEAA 5JW6A 3E9NA 2Y1EA 1Z6ZA 4M1QA 4NH4A 4JJIA 5TS3A 4J1NA 3FBGA 5KOIA 1OC4A 1Q0LA 2UDPA 3C85A 4D79A 1G0NA 3WTCA 2BHLA 1A5ZA 3D4PA 3WYBA 3ZV6A 3UICA 3WGZA 1A71A 3C7CB 3RD5A 1KY5A 3G1TA 3TZKA 2V7PA 5CDSA 4HP8A 4MP6A 2EERA 1KIFA 3GN1A 4XB1A 3ZHBA 1EUCA 1DIAA 3NJ8A 5JPIA 3HQ4O 1ARZA 1B8PA 3AY3A 1ZJYA 3PZBA 3A14A 3NDJA 3JQ9C 5BNFA 3KSUA 5C7OO 1DC5A 4YAKA 4PG8A 4I5GA 4CR6A 3WGIA 3IC5A 4JP2A 1UXGA 3OICA 4KUEA 4CM5A 3AI1A 3G17A 2XXJA 3WWZA 3DOJA 4KOAA 2PLAA 2B5WA 1XGKA 4JQCA 1JQBA 3FR7A 1N1GA 1AHIA 3AI3A 2O3SA 1LNQA 2GF2A 5JDIA 3B70A 1LI4A 3GY0A 2GZ1A 3MOIA 3DMTA 3ZV3A 1RM5A 1HZZA 1ZJZA 2DTEA 5HWSA 2GN8A 4J1QA 2B4TO 3F5SA 1GUFA 2OL4A 1NHWA 1ZZEA 4HXYA 2BFOA 3GLQA 4U5QA 1R0LA 4BNNA 2VNAA 4YBZA 4XA8A 5JDCA 3K5PA 2JFFA 1K6IA 3WQQA 2VUSA 2OO5A 1WP4A 1XEAA 1GYQA 4NBTA 4C7JA 1I33A 3VH4A 2VOEA 1BSVA 1PIWA 1OMOA 2JAPA 3R3SA 4KTVE 4R9RA 3ROMA 3L6EA 3IMFA 3KUXA 5DBFA 1NPTO 1DHRA 5ER6A 4YJFA 1QRRA 4YAEA 5L95A 3C1OA 4ZD6A 1VL8A 3TN7A 2JCVA 7MDHA 4KQWA 4A73A 1PEDA 3SC6A 2B35A 1GQ2A 1R37A 1JKFA 3DBHB 4ZQBA 1FDWA 3MEQA 4RVFA 1GDHA 5CPFA 1VJ0A 1Y8RA 1K6XA 2IE0A 1BMDA 5ICSA 2G5CA 4MKZA 1QLJA 2NM0A 5IZCC 3PDUA 3H9QA 4IDFA 4CMHA 2GGSA 4FC6A 3S1LA 3GZ4A 4BNLA 3F9IA 4D0RA 4CLRA 1HDOA 4CMAA 1KS9A 1RWBA 1CRWG 5AOVA 4OXKA 1CEQA 1CDOA 1P9LA 1T25A 2VHVA 5DP1A 2VYVD 3Q0EA 1Z45A 3AUSA 1FK8A 3ITDA 3P7MA 3W4KA 2PFGA 1PL8A 1DIBA 2YYYA 3JYNA 3GUYA 1KYQA 1NAHA 4Q9NA 4IDEA 1HDGO 3PTZA 4XGIA 1U8FO 4N5MA 4MKRA 2VHYA 5F1KA 5IN4A 1E3WA 1FDUA 5JSFA 1WDMA 3FF4A 4W7HA 3NAQA 2PH5A 4R54A 4INAA 3JYPA 3U9LA 2C82A 1CYDA 1WPQA 1DFGA 1B14A 2EW8A 4IGEA 3X2FA 4URFA 3NT4A 3JQGA 4CM6A 2C2XA 3E48A 1GYRA 5EIOA 3ZDFA 5C7LO 2GUGA 5MGBA 4B3HA 1E92A 4L0QA 1DXYA 1N5DA 5HS6A 4WE3A 1BG6A 3H6KA 4TRMA 4ROSA 4CLHA 3ONFA 4HADA 1KEUA 3DTYA 2Y1GA 1Y6JA 2D5CA 3LZ6A 1P31A 1R6DA 4PG5A 1K5HA 1ZH8A 5H81A 3RC7A 5I8WA 3QW2A 9LDBA 2Y05A 4NFYA 5BSEA 1QYCA 2IZ0A 3KBOA 3MJTA 2EKLA 3ETDA 3SJUA 3MWEB 2DUUA 4IJWA 1DIRA 3K73O 5TX7A 1Y8QA 1EK6A 3PHGA 3TZ6A 1UAYA 4FS3A 3ZWCA 4WLUA 3KSZO 4QT0A 4PFJA 4XKJA 1BXZA 3ROQA 4CMCA 2FPIA 4TVOA 4ZN6A 3KB6A 1GUZA 3ICCA 4NQZA 2X1HA 1MA0A 2ZTLA 3VOSA 4FGSA 1JTVA 4QUKA 3PHIA 1VKNA 2DTDA 1LLQA 3WNVA 2YFQA 3VC7A 1LEHA 3LDHA 2P9GA 1HYEA 3WGYA 4UUNA 2X86A 2IDZA 3HJAA 5L7WA 2W2KA 1GQQA 3EVNA 2H6EA 4KDFA 4EUEA 3S2EA 1UR5A 4E5YA 4J91A 2VZ9A 4QXMA 2VTDA 2D3TA 2OP1A 4ZJUA 3KYDB 4OXYA 4BO8A 2NVUA 3Q2KA 1NFFA 1D4FA 2EKPA 2O3QA 3U09A 4HFNA 4QECA 3KRTA 3DB2A 4DPMA 3L0DA 1EDOA 3UAGA 1E7QA 1QSGA 4XJTA 4EDFA 2CSUA 3O8QB 1PZHA 3OQBA 4MIEA 4MIYA 3U4HA 2CDCA 2XXBA 5G4KB 3BTSA 5JAIA 3ROPA 1VSVA 1YH3A 1LSSA 4CM8A 3WSVA 4Q3NA 3PRJA 1G6KA 2X5OA 4MOWA 1ULUA 4IIUA 1I8TA 1XYGA 4BNXA 3IP1A 5KJCA 1XU7A 2EF1A 1I3NA 3WLFA 1DJQA 2NTVA 4GQAA 2OXIA 3C7AA 1K2WA 4X54A 1BDMA 1PJ4A 1UXKA 4BQPA 5F1PA 2H5LA 2DC1A 2I99A 3ZWNA 1XLTA 3F1LA 2P68A 4XZ3A 1ADBA 3F5QA 4CMGA 4RF3A 4OOFA 1T2FA 3E1KA 1BRMA 1GZ3A 3H4VA 1S6YA 2J3KA 3HWRA 1WNTA 4J1SA 4J7XA 2TMDA 1KY4A 4R68A 4W99A 1TA4A 3WBFA 4HX5A 5L40A 3LT2A 3ZNNA 1QMGA 1VE9A 4K6CA 4EI2A 2IEDA 4AICA 1WZEA 1E7MA 5A5FA 1JWAB 3STHA 2PD4A 3NYWA 1LX6A 1Q7GA 1HE3A 2P5YA 3ZWPA 3C24A 4XQEA 2DBZA 3AOEA 2X5KO 1ZCJA 1RPNA 4EEZA 3OECA 4H7PA 2HMWA 4GWGA 5IDQA 3DZHA 4AFNA 3NRCA 3B1JA 2PY6A 3U5TA 1U1IA 2WDZA 3H8VA 3ZWMA 2JFHA 4B3JA 1ISFA 2QZ9A 3QE3A 5TQVA 4CLOB 2X8LA 3KTDA 1R4NB 5F21A 2Z1MA 2NTJA 4BB6A 4GI2A 1QV7A 3HN2A 3UUWA 1HF3A 3NT2A 4WEOA 1LDYA 1U5CA 1VM6A 2B0JA 3GDFA 1NVMB 3OEWA 3FPCA 1ISIA 4WLFA 2JJYA 4IQ0A 1J0XO 3FNEA 4BV9A 4YVFA 4UUPA 1JVBA 3MJ4A 3JD3A 1HT0A 5IDXA 1F8FA 5IXSA 3WIEA 4C7KA 4XQCA 3WR5A 5BSGA 4CUJA 4KWHA 2FY8A 2VWPA 2PKRA 3JQCA 4YJFB 2P91A 2ZB7A 3I9MA 1XHLA 2TMGA 4ALMA 4GLLA 2W90A 4HFRA 4NJMA 2VHZA 2VRCA 3F6YA 1GZ6A 4D3SA 4PG7A 1C1DB 1PSDA 4A10A 2VOJA 2Z95A 1Y5MA 3GH3A 4HBGA 4DTIA 2D5AA 1NNUA 4Z3KA 4EZBA 5COAA 1BVRA 3ONEA 2FSSA 2BGKA 1Y8RB 3F4LA 2GN6A 4RPLA 1NVTA 2AQ8A 3S8MA 6ADHA 2Q45A 1GCUA 4MIOA 3ULKA 5JCXA 1LBEA 4UVDA 1LUAA 4BMSA 4P4GA 4M89A 4OO3A 4ESOA 3LC1O 1VRWA 3HDQA 4I9HA 4DRYA 4P8RA 4NFSA 4E6PA 2HAEA 4UULA 1CF2O 1KVQA 1P1FA 2IYOA 1RM3A 5A9SB 1UDAA 2RH8A 2C2YA 2BFMA 3RKRA 5DOZA 1Q7BA 3BMOA 3AUUA 2X9NA 3TOXA 4GSLA 5JFOA 1KEWA 4XWYA 4BKPA 4OYRA 2BD0A 1NQAO 5BR7A 5A04A 4BNYA 1SEVA 1E7YA 2QRLA 3TL2A 1V9LA 1NQOA 5CAEA 5DZSA 5HS4A 1MFPA 1A72A 3ETGA 3F4BA 3IKVA 5L4NA 2WD7A 4MDHA 5CEEA 5KJ1A 3INTA 1M75A 4GKVA 3V1TC 1HSOA 3FCOA 5I7EA 4JIGA 3GA0A 4E0BA 5CDGA 1WLYA 1T2AA 1YRLA 3UVEA 4DQVA 1DIGA 1JAXA 1NVGA 5TC4A 1CQIA 4FFOA 1A7KA 1KVTA 4A7PA 2SCUA 3GMDA 3B6ZA 3OJ0A 4AG3A 1PGPA 1UP4A 3Q11A 4J6FA 2PK3A 3BMNB 4UEJA 2A92A 3S2IA 1PGJA 4ALNA 4F6CA 1I5RA 1O8CA 1N2SA 1DLJA 1HZJA 3VTFA 3SLKA 4KZPA 2W2LA 1PR3A 3GDGA 4Z3DA 2X9VA 4UUMA 2EG9A 1HE2A 3ZU2A 4JX8A 4CUZA 4ZQHA 5EN4A 3HSKA 5A9RA 1EFKA 4CQMB 3LF2A 3JQAA 1PTJA 3EVTA 4PVCA 4RZHA 4BGEA 1U3WA 3ZWVA 2W2LD 1KC1A 3LQFA 2OBNA 1E3SA 2ZKLA 3JQ8B 4NU6A 1CERA 4E32A 2PZJA 5CG2A 3I1JA 3V2UA 3KVOA 1A7AA 5G4LA 4DUPA 2DTXA 1SEPA 2HDHA 1NM5A 3QRWA 1QP8A 1PJTA 5L51A 2QRKA 4J7UA 5F5NA 3U4IA 1SNYA 1YB5A 5A06A 2YV3A 3QWIA 1ZSYA 1X0XA 2C5AA 3DFUA 2J3HA 3K2BA 3MJCA 4WUVA 4CUKA 1JN0A 3BTOA 1PJBA 5A5EA 1HWYA 1H2BA 4XYMA 1YB4A 4DIFA 4L73A 4UVHA 4F46A 2CUKA 3UN1A 3RVDA 4W82A 3WGOA 1IUKA 1UXHA 3GOHA 3IQDB 4TMFA 1E3IA 4TRJA 5AXBA 4U8GA 1O89A 3AOEC 4B3IA 2ZYGA 1J4AA 1NFRA 1LRKA 4MVJP 2G0TA 4I9UA 4NBUA 4CJXA 1E1KA 3B20A 3INRA 3HDJA 2RIRA 2BFPA 3DFZA 1DJNA 3AJRA 4DXHA 4KUGA 4L4SA 1H6DA 1SO8A 3K9QO 4EJ0A 2Y66A 4P38A 1GQYA 4Y98A 3C8MA 1N92A 3E9MA 3GHHA 3RAJA 3CZMA 1AXGA 1K3TA 3K2EA 4DC1A 2NTNA 3MJVA 4EEXA 1CETA 4JGBA 3DXFA 3AK4A 3WIDA 1BXKA 3AFNA 4U0KA 3DQPA 1IL0A 2EP7A 4IJKA 4CM7A 4IDCA 4A0SA 3TZCA 1SZJG 1WWKA 4UUOA 1V0JA 5I9MA 2D8AA 2I3GA 4BNHA 3OIGA 2AEFA 4D44A 1Z73A 5AYVA 2RCYA 4IINA 1KC3A 3E18A 4M49A 4FC7A 5THQA 1V3VA 1I24A 4Y6SA 1X7GA 4RDHA 5TJHA 4XGNA 4RF2A 4W9NA 4I5EA 1Z74A 2HO5A 3C1AA 3GVHA 4I9NA 4E2YA 4YAGA 2AQIA 3VH2A 3DR3A 4N18A 2ZB3A 4A5OA 2OUIA 5J23A 3VPFA 5TJ9A 3GRKA 1DB3A 1SC6A 1W4ZA 4BNVA 2J5RA 3PGJA 3D64A 1BDBA 4ZGWA 2NQ8A 3RC9A 4CL8A 1DEHA 1ZSVA 4S3MA 1HDRA 3GT0A 3JQ9A 1PQWA 3OJFA 4H15A 4N7RA 4DBVO 5B4UA 1X13A 5KIAA 1NTOA 1QXSA 1N8KA 1SB9A 1WDKA 3H9EO 4AJEA 2EGGA 3PWZA 4PRLA 2J5QA 5BSHA 1UZNA 4BKUA 3RKUA 4RPJA 4YT2A 1VI2A 3I4CA 4OMUA 4ONEA 5JE8A 4PGFA 3ZHZA 5CG1A 4GSKA 1GV0A 2IXAA 1TT5A 1R4MA 1QYWA 3I6QA 4PLGA 4TKLA 1JKJA 3LVFO 1OC2A 2Q4EA 1AXEA 1C14A 2W2KB 1YQDA 3QVXA 4XX0A 4R5HA 1A4UA 3DZBA 4E21A 5L53A 4J3FA 1CWUA 5FI3A 2Y1CA 3ENKA 4LSWA 4WNIA 3H5RA 1LDEA 3FBTA 4NK4A 1E7WA 4R4JA 3DL2A 3KEOA 5A4DA 2NV6A 4WLNA 4DLBA 4XD2A 5K9ZA 4NJOA 1U2GA 4J90A 5U9CA 1Y9AA 1XA0A 4WCFA 4DWVA 3JQ7A 3JV7A 1DAPA 2BFAA 2JKVA 4OHUA 3VPSA 2V6BA 4Y8VA 3LU1A 4B8WA 3DAFA 2OMEA 3R1IA 1E1NA 1T4DA 2CFCA 2X9GA 1IE3A 3K92A 1KOLA 4AJIA 4RLHA 3V2GA 2ZIZA 2O2SA 3QY9A 4R5MA 1GEGA 1W8DA 4IZIA 3VKUA 1A27A 2QYSA 4O1MA 2YHUA 5KWEA 1XR3A 1DRWA 1DC6A 3HN7A 1EE2A 1B3RA 1C1DA 1SB8A 4FFNA 1C3VA 4Z9FA 3OMLA 4DMLA 4KUHA 3IIEA 3JQBC 2NNLD 2HJRA 3LT0A 3MCVA 4RF4A 4FIZA 3DMYA 4J0FA 4MPDA 5T5QA 4CM4A 4UEKA 1LDGA 3I52A 3NTRA 2GNAA 5EJ2A 3D7LA 4JJGA 4ZQGA 5AXAA 1GEEA 1FXSA 3B1KA 3I9NA 1QYVA 4IMRA 1KETA 2BF7A 3ZWXA 1MC4A 1R4MB 1KEPA 3DBVO 3QWHA 4FR5A 1D3AA 2VYNA 4GX2A 2V6FA 3B1FA 2G82A 3U4DA 3N58A 1O6ZA 3GUCA 2PGJA 3BMOB 2I6TA 3ZWWA 1ZK1A 1XQ6A 2FOIA 2HU2A 4D45A 4BGIA 4LRSB 2B4QA 4FSHA 2JL1A 4GKBA 1DC4A 3ADPA 3QVSA 3V1YA 1YOVB 3CTMA 5DCWA 1ONOA 2XOXA 1PS8A 2BGLA 5HM8A 3UCXA 4U6QA 4BIIA 2I76A 3H9GA 3K96A 2GCGA 3ON5A 3FTNA 4XCVA 3GAZA 2OBYA 1C0IA 2VHXA 1XKQA 3QIVA 1MB4A 1O9BA 1PJ3A 1YOVA 5EL0A 3ZHYA 2ZTMA 2R6JA 2YV2A 1ONNA 5JAQA 3RIHA 4GGOA 4XEHA 3FSRA 3HB4X 5G0WA 5T67A 5I9LA 4MVJG 2J5KA 1HDCA 3DAPA 3Q2IA 1T26A 4PZCA 2NSDA 3DAGA 1EVIA 1F14A 3K30A 1BTOA 5FF9A 5KCZA 1Y9EA 1GADO 4DIOA 1LLCA 3TQHA 3IL2A 3KLMX 4L74A 1VSUA 2X0NA 1E7SA 2NLOA 1U9JA 3FTPA 4BV8A 4PLZA 2O7QA 4CLDA 2VRBA 2VYVA 1YS4A 3OH8A 2NU6A 4O6VA 2NVBA 3AM3A 1L7DA 3AUAA 5BSFA 1N7GA 2PKQP 2VZ0A 4BNJA 2DBQA 4TWRA 4ITUA 3AU8A 1DBVO 3QWAA 4IDGA 3OHSX 2WE8A 2ZB8A 3UFXA 2FZWA 5BT9A 2CVOA 5H83A 1UH5A 2C59A 4NI5A 1I32A 3WDSA 2O3JA 3L4BC 1EQUA 2BELA 2X23A 3FR8A 3IP3A 1YKFA 4CMEC 1HYGA 4N5NA 4JCOA 3U0BA 4RCVA 5T64A 3JD1A 5A9SA 3GVPA 1SAYA 1ENZA 5KVVA 3OIFA 1JLLA 2Q50A 1U2DA 4FDAA 5I9NA 4YACA 2IEBA 4HV4A 3RUEA 1R15A 4D7AA 3LLVA 2VWHA 2YY7A 1QYXA 1YJQA 4I8XA 2R2GA 4IQGA 3DBLA 2A9FA 1IPEA 1E6UA 4NR0A 5TF4A 4G65A 5B4VA 5B37A 4CR8A 3SXPA 3RASA 3WGQA 2YDXA 4FN4A 3HDYA 2GZ2A 3FNHA 2BRUA 3UCFA 4S1VA 4IMPA 4E2ZA 4G81A 1O5IA 1VKOA 2GERA 3V5NA 4BMVA 1HL3A 2B5VA 1C1XA 1XIVA 3ICPA 1ZEMA 4DLLA 3PVZA 4RQTA 1GR0A 1ZEJA 3EDMA 1TB4A 2Q99A 1P1IA 4YR9A 2YV1A 3AOGA 2CDAA 4CV0A 3P2OA 2E37A 3F1KA 4QFDA 4JJFA 4LCJA 1C0LA 1HEUA 5HTOA 5DOVA 1PS0A 2Y67A 4Z6KA 1Q2XA 3AUTA 3W4JA 1MG0A 4JBIA 4YCAA 2PKQO 3G79A 4M8SA 5FYDA 1LRJA 5TIIA 2YHIB 4GWKA 3RUHA 1EBUA 1UZMA 2OFPA 4YWJA 4MVJI 4IIVA 3QQPA 5KTKA 2Q2WA 1V8BA 1S7CA 1KVUA 3A06A 4FFMA 4FOSA 3IUSA 4OOEA 4RGBA 4IJUA 1X0VA 1NX6A 4BKQA 1PS9A 1YE3A 2PD6A 4U0JA 2DLDA 1GAEO 4CQMA 2WWRA 4GVXA 5TNXA 1EFLA 3HDHA 3H9UA 2HLPA 2ZYDA 1OFGA 3U4CA 1PJCA 4KTTE 2FHSA 1YBVA 2UVDA 4BNGA 3O38A 1TEHA 3O4RA 1X14A 2FRDA 4JBGA 3H5AA 1EUZA 4R51A 4PLTA 1LRLA 1YXMA 5GZ3A 2IZZA 3GGOA 1P45A 2AW5A 3H7AA 1WDLA 4EJMA 4IM7A 5CP8A 4R3WA 3ANNA 3LT4A 2Q49A 2O2YA 2ZCVA 2EJVA 5IN5A 3WBBA 3DHNA 3HNPA 4GH5A 4HNGA 5BQFA 1OOEA 3OIDA 3NGXA 1G0OA 5C37A 4AJHA 3CMCO 3BA1A 4JN6B 4RLSA 3ZGYA 4DPLA 1LDBA 1B16A 1F12A 1NWCA 4NHEA 5ADHA 5JS6A 4MKXA 3H2SA 4J16A 1B8UA 3IOYA 4NMHA 3T4XA 4J2HA 3RBVA 1KEVA 5TGDA 4K26A 3PLRA 4OXNA 5ITVA 3SX2A 5KKCA 4YJHB 1P1JA 2CD9A 2JD1A 4NG5A 4RQUA 3CKYA 3EUWA 5ER9A 3WB9A 3BTVA 3I9KA 1X1TA 3JQGB 2DT5A 3R3JA 4KQXA 2EXXA 4EITA 4DYDA 5EQDA 1PGNA 4ID9A 2VHWA 4UAGA 2HKIA 2IXBA 3L9XA 1LA2A 3EAGA 3UCEA 4PG6A 3CMMA 4Q3CA 4CPDA 1IB6A 3LC7O 3SJ7A 3TNLA 3JD2A 1T2DA 4OAQA 4PZDA 1Y81A 1YJ8A 3PHJA 4GX5A 3PYMA 4BGUA 1C0KA 4YA6A 4BO0A 1T2CA 3D3WB 3KYCB 3MJSA 3N74A 1KBZA 3G49A 1KVRA 5CDYA 3LSYA 3DBHA 4IQ8A 5CEJA 1NPDA 2OP0A 4EW6A 5JYEA 4E3ZA 3ONDA 1I2CA 1X7DA 3WQRA 3VTZA 3DMTC 5I7SA 3EK2A 5K6AC 3D3WA 3KYCA 5EPOA 4YJGA 1D7OA 1U5AA 3JD4A 1IHXA 5EESA 5JXWA 1Q7CA 3ZU3A 4CV1A 1ZUD1 3C1TA 5JDCC 1Y1PA 1T2EA 3QHAA 4CQLA 1J6UA 1LDNA 5HBRA 1R0KA 4DYVA 4CODB 4PLPA 1ZBQA 3QVTA 1Y7TA 4WLOA 3W8EA 2O4CA 1WXDA 1EUDA 2I9PA 4XR4A 3QWFA 1PQUA 2DM6A 1LSJA 2HRZA 2O23A 3WMWA 3OA0A 3Q9NA 2D4AA 5IJZA 1LU9A 3DDNA 2Y93A 3WG9A 2EP5A 2GPTA 2DFVA 3L07A 2OORA 1ENPA 1IZ9A 4OGWA 1O0SA 3BXXA 5L7YA 1HDYA 5LDHA 3W4IA 2HK7A 3ZWOA 1L7EA 4RL6A 3RC2A 5A02A 2Q2VA 3OP4A 5ILOA 4B4OA 4CV2A 1E5LA 2RAFA 3P19A 4QFCA 1H6AA 1CJCA 5CPBA 1JKIA 3CUKA 3KSDO 4MINA 3AM5A 5JAZA 1ZXLA 3V8BA 3W8DA 2QYTA 4F6LA 3BHMA 3QV1A 4WK6A 4TVBA 1HLPA 1I01A 3FHLA 4M55A 5KNLA 4B4WA 3ZWAA 5IZCA 4XRRA 4D0SA 3W6ZA 1G1AA 4DQUA 4EGFA 1YL7A 3D3EA 2O3RA 2X0RA 4BHTA 4YB8A 4ZA2A 4DMMA 4AVYA 5T8KC 3Q3CA 1FDTA 3RBXA 3ZHXA 1JVSA 3ENNA 1J49A 3UH1A 2Y0CA 1VPDA 2Z1NA 1HE4A 1LC3A 4XYGA 2FR0A 1ORRA 3PZRA 3BMCB 1MP0A 2NU7A 4MVJF 4Q3DA 3H2ZA 4UEOA 3TWOA 4J7CA 3NX4A 5FI5A 3H9JA 4PLHA 4DC0A 5MDHA 2GN4A 1KVSA 2VYND 1HDZA 2CNBA 2J3IA 4WECA 1D1TA 3F3SA 3ZN2A 1QLHA 2GZ3A 2R00C 4XDYA 2JHFA 2F00A 1AN9A 2D0IA 2UAGA 1ZMOA 5DN9A 1OZAA 3TFOA 1NWHA 2ZTUA 4E5MA 1B26A 1PJLA 1PJ2A 4CLEA 4NK5A 1QG6A 4KWIA 1PL7A 4FFPA 4RVDA 3MTGA 4YTEA 3TDKA 4OQZA 1U4SA 3RBZA 4XGKA 1M6HA 5JAMA 1F8GA 1I2BA 3ZU5A 4D3FA 3GZNA 4UVEA 1MGOA 2GO1A 2PA3A 2I66A 1BW9B 3PGXA 4KMSA 4B7CA 5DNAA 1F17A 4I08A 3VPXA 3EMKA 3NGLA 2DUWA 3PJFA 4Z0TA 3GC6A 3E82A 2NVWA 4HFJA 2AMFA 3VZPA 3QVOA 4PLVA 5GZ6A 2VWGA 1U8XX 3JQ7B 3UKOA 1BHSA 3VVCA 1LSOA 2ZCUA 3JQ6A 1R4NA 3JSAA 3KEQA 3P2YA 1F06A 4J49A 1EVZA 1HSZA 4YQZA 3LT1A 3DBRA 3E9QA 2O48X 1OBFO 3EZYA 3M2PA 4TROA 5T57A 3ST7A 3IJRA 5IDYA 5JY1A 3EW7A 4XYLA 2V65A 4R1SA 3TPCA 5A3JA 1DO8A 2Q2QA 4QEDA 5C5IA 1ZMTA 1EQ2A 3ZV4A 5L45A 1I3KA 2AEMA 1ML3A 1AHHA 3K31A 3QJ5A 5A9TA 4WLEA 2O4UX 3GAFA 4R1NA 3E03A 5ENDA 4D42A 2EKQA 4R41A 1LDMA 3VPGA 3DO5A 1UXJA 3BMCA 3RUDA 2X0IA 5G0TA 1NR7A 3OF2A 3ROKA 3HUDA 1U4OA 3GGGA 4ZQFA 4NBRA 2FMUA 3VHRA 1IHYA 1LLDA 1K89A 1B2LA 1YDEA 3ANMA 4PVDA 1SOVA 1A4IA 2HMTA 4WJZA 1QR6A 5BNTA 4AJPA 4BNUA 1XELA 4JP3A 3W8FA 4ND3A 2Y1OA 3VVBA 3FNFA 3C7DB 1VLLA 3T4EA 2P9EA 4FJ0A 2A4KA 5F5LA 5JC8A 3LYLA 4GPD1 3UHAA 3ABIA 3PEFA 1WW8A 4YT8A 3DZJA 3CZRA 1YWGO 2ZYAA 4IS3A 4Q3AA 1ZK4A 2C5EA 2PH3A 3MWDB 2W8ZA 4QSMA 2GASA 3CE6A 3HB5X 2I5PO 4FCCA 1QORA 3ZWBA 2E48A 5L4SA 2B37A 2GSDA 2XAAA 3GK3A 1U3UA 3PIIA 3I5MA 4BNKA 3DHEA 3PFFA 1YL6A 1N9GA 4RJTA 1KERA 8LDHA 3GN2A 4ND1A 4Y6PA 1DRUA 3R0IA 1ADFA 5G0UA 1H9BA 1HTBA 3RJ9A 4JK3A 4J9VA 1OI7A 3AI2A 3BZUA 3H65A 3DOOA 4L75A 5K6AA 3PJGA 4CM9A 3A4VA 2P2SA 4O63O 3VDRA 5DF1A 4C4OA 4ZVVA 3G1UA 3DZFA 1H93A 1UP7A 2JHGA 2A94A 4GBJA 1M6WA 4GLOA 4TSKA 1MXFA 5LCXA 3ZNQA 2HMSA 4MP3A 2ZK7A 5KVQA 3KZVA 3CSDA 1TXGA 4LSMA 4K1LA 1PGQA 2E49A 1JW9B 4YAIA 4GMGA 3WYEA 1UDCA 3TZQA 4BKOA 1UZLA 5HA5A 1ZKMA 2FR1A 1DRVA 4B4VA 3ZH2A 4ALIA 4ND4A 5BNIA 3GVIA 3OM9A 2Y99A 4DVJA 3PP8A 4IPTA 3E6AA 3KM0A 3OJOA 1ZVMA 4BNTA 2YZ7A 3MTJA 4PG4A 5LC1A 2PR2A 3PWKA 2C7VA 3I9OA 1LXCA 3FD8A 3DHYA 1BGVA 3HFGA 4GAEA 2BMAA 3U3XA 4AJJA 4R01A 4BO3A 3ZCXA 4XYBA 3QWBA 2WM3A 3CPSA 1HLDA 4BNWA 1MFZA 4ND5A 2RH4A 1V6AA 4ZICA 3JQAB 3AM4A 4XQ9A 4J2OA 1N1EA 4DGSA 4HY3A 4QO8A 4WGGA 5GZ1A 2BLLA 3ADOA 3KXDA 2FR8A 4HWKA 3ORFA 1U3VA 4FD3A 3GVXA 1D8AA 4HFMA 2PNFA 3DBLB 4L4RA 5K0ZA 3PJDA 3HZZA 4RV9A 4OH1A 1NQTA 1YO6A 1B0AA 3LLSA 2EEZA 3FNGA 4CMBA 2H1SA 2BI7A 2Y0EA 3WX0A 5A1TA 3GHYA 1TI7A 3CXRA 2OHXA 5JC1A 4EYEA 2CVQA 4RVGA 3RC1A 3WYCA 4AJOA 4CLRB 1Y5RA 4L8VA 1U7HA 4K28A 5IDWA 3JQDA 3AY6A 4RVHA 4Z0PA 5FWNA 3BMNA 3AY7A 1PQPA 4YRDA 2IODA 2Q3EA 4PRKA 3TFQA 4E31A 1MV8A 1JAYA 2JD0A 3WGTA 1LC0A 5JO0A 3QSGA 3M6IA 4HKTA 2CF6A 2PWZA 3PPIA 3GNSA 3BHIA 4OM8A 1E1LA 2AQHA 3I6IA 3WFIA 2VNSA 4G2NA 4LRTB 3ZV5A 3RWBA 1PJQA 3DWFA 3DONA 5G0VA 3NJ4A 1DDOA 3PYXA 4RORA 3RFVA 3OETA 2YFHA 1XQ1A 4WCDA 2HUNA 3JYQA 4J43A 4J4BA 2E4AA 2J8ZA 2WTBA 2P5UA 4II3A 2I67A 4BO5A 3TJRA 2AG8A 4H3VA 3OSUA 2QW8A 3S2FA 3U62A 5FEUA 1NASA 5B1YA 3PDJA 3V1UA 4XR9A 1NP3A 1P1HA 3LF1A 2FN7A 3PWSA 1YL5A 4FJ1A 1E3LA 3COSA 1BVUA 1YGYA 1K0UA 4IDBA 3KOUA 4W4TA 7ADHA 2C20A 3HFSA 1V35A 4IZHA 4L9RA 1E7RA 1GD1O 4NBVA 1YQXA 1LJ8A 4GVLA 4XYEA 5B4TA 4JXKA 4F3YA 4UVIA 3RUCA 1IULA 2UV8A 3TRIA 1N7HA 2Q1SA 5TSDA 4AJ1A 3RU7A 4RO0A 2DPGA 2LDBA 1PX0A 3BMQA 4B8ZA 4CV3A 1ZO8A 4F45A 3LC2O 3DZKA 4BNZA 4AJ4A 1HE5A 3WS7A 1IZ0A 2GLXA 1I30A 4EJ6A 4BO6A 3FN4A 2AE2A 5KJFA 1DPGA 1GY8A 3JQEA 2VUTA 5DCYA 5GMOA 1YDWA 4K9DA 2NU8A 1H9AA 3A1NA 3W1VA 4P4NA 3PI7A 1P3DA 4YJHA 3HADA 2XPCA 1TT5B 4MVJE 1H2HA 2VT2A 5L9AA 4WASA 5DP2A 5TT0A 3O26A 1JWBB 2AXQA 1X15A 1ZK0A 4W6ZA 2AHRA 1H0KA 2YDYA 3DOCA 3D5TA 1BXGB 4B79A 4PLCA 1UDBA 1NPYA 1V3TA 2G1UA 4DL9A 2QIOA 2Y0DA 4OIMA 1ZK2A 1NFQA 4U6SA 1NBOA 4NPCA 2F1KA 1VL0A 4XIYA 1R66A 3RUFA 2NADA 3QA9A 3RCBA 2O50A 1WMBA 1GYPA 1I3LA 4P4LA 4QTZA 4OKIA 1EMDA 2ZJ1A 4CM8B 1EVYA 1RYEA 4RDIA 2X6TA 1T24A 3FRJA 1ULSA 2IYPA 4R3NA 3S55A 5CDUA 2PGLA 5JNLA 1RYDA 2G17A 2I65A 1P1KA 1RKXA 5JMPA 1ADCA 3U49A 4DQXA 2XF8A 2JAHA 3EYWA 4OKNA 5JO9A 3RI3A 1VC2A 5KKAA 4BNIA 1K6JA 3RFXA 1P74A 4FPXA 4E33A 1AGNA 2PD3A 5FFFA 5IZ4A 4E30A 2JD2A 1Z7EA 5TLSA 2WEKA 3IDSA 2YUTA 1TT7A 2DQ4A 2ZTVA 1DC3A 3VZRA 2FZEA 1E1MA 2VQ3A 1MLDA 4UVGA 3QVWA 3X2EA 4I5FA 5F3RA 4EUFA 3Q9UA 4AJKA 2ET6A 4Q3BA 4XJSA 5JMWA 1Z7BA 4CMKA 3WTBA 1M76A 5G0SA 2AG5A 1E3JA 4D41A 1M66A 4AJLA 4TRNA 4IXWA 1ISGA 1Z82A 3RUIA 4BO4A 3C3XA 4YQYA 4II2A 2Q1UA 3UOGA 4A26A 1YBAA 4LISA 3WMXA 8ADHA 1I2ZA 1H94A 3K6JA 3F47A 1GU7A 1LTHR 4PLFA 3FWZA 1ZK3A 3GG2A 4LCEA 3OQ6A 4YRAA 1DFHA 4R1UA 1H6CA 1XWFA 1JA9A 4FJ2A 1LLUA 2NVUB 4NFHA 1R16A 2ZB4A 5C7IO 3RSHA 3L6DA 2AE1A 4MJLA 3MZ0A 4PN3A 4P22A 3BYZA 4RPHA 3GG9A 1IPFA 4PLYA 2GR9A 4RPKA 4E5KA 1HKUA 4BO9A 4RF5A 4BMNA 5TT1A 2X0JA 4W7IA 4YPOA 1NHGA 4QO7A 3OJLA 4IJVA 3INGA 3WNQA 1EDZA 2UUPA 1LQTA 4E2WA 3PQEA 3OA2A 4R69A 2D2IA 1A9ZA 4G5HA 3MJEA 1DAOA 3O9ZA 3H3FA 4BNFA 4BVAA 2OZPA 1FF9A 2H9IA 4E5NA 1OAAA 1H5QA 4CM3A 1IY8A 4UREA 1Q0HA 4DA9A 1MG5A 1YB1A 2ZJ0A 3P5SA 2CY0A 1ENYA 1YONA 2G76A 2BI8A 3M1AA 4TQGA 1W73A 3L9WA 3ASVA 5I7FA 3GFGA 3L6OO 4WLVA 2WD8A 4QX6A 4Q3EA 4CM9D 2EIHA 4GL4A 4FFLA 5AXDA 4LK3A 5CEFA 3EY4A 3LK7A 4R16A 2ZATA 2P4HX 4OQYA 4JLWA 3KV3O 5L4LA 4YDRA 3BAZA 2JCYA 1ZSNA 2DPHA 3GZNB 2Q4BA 3OEYA 3L4BA 3OJEA 1GV1A 2HK8A 4YRBA 4CM4B 3NTOA 2X4GA 2HQ1A 2RBEA 4GX0A 3OFSA 4D46A 4WOKA 4AJNA 2B4RO 3GFBA 1ZNQO 2CMDA 5COQA 4GMFA 4ZQEA 4NBWA 5IG2A 1EZ4A 5DT9A 4FB5A 4LW8A 3DEYX 4Z9XA 4O5OA 1YVEI 4MVJA 3D1LA 4LGVA 3L4SO 2OGUA 2I3AA 3UGKA 3AWDA 3CIFA 5HRUA 4D43A 1ID1A 2GDZA 2GD1O 3ZZNA 3NT5A 4GX1A 2WD7B 5IFLA 4O0LA 3RFTA 1P77A 3M2TA 4JBHA 5DCUA 2O7SA 4FW8A 3GDOA 4WOJA 5L3ZA 1CIVA 3D5QA 1FJHA 1ISMA 1B3BA 1B7GO 4XRGA 4OSPA 3WQSB 3KETA 2QZZA 1Q1NA 4BGVA 1SCUA 4IS2A 1NQ5A 4PCVA 3WXBA 3EZLA 5COBA 2YW9A 4CLXA 1GL3A 4DLAA 1HDXA 4YEDA 3KLPX 3GR6A 3PQDA 1ADGA 2CVZA 2DBVO 3NEPX 2OOSA 2UYYA 3GRPA 3JD0A 1BWSA 3T7CA 5A03A 4LVUA 3BHJA 4K6FA 2Q1WA 1UUFA 3ZI0A 2CZCA 1YQGA 5TRTA 2B69A 4NJMB 2Y1FA 1R0SA 2HJSA 1HXHA 3WICA 2W4QA 3OBBA 1NYTA 2YHIA 4TKMA 3JQAD 4NU5A 1MC5A 1ONPA 2WYUA 3EGOA 3WSWA 3WJAA 1DHTA 2YQ4A 4B7UA 3KO8A 4LN1A 4E13A 3I9JA 3ZWYA 2NU9A 2C07A 2BH9A 3D0OA 4BB5A 5T6BA 4M86A 4YJDA 2X22A 4ILKA 4EUHA 4YT4A 3Q1LA 4WCFC 2H63A 3JQFC 5T8KA 4Y6RA 2V6GA 2CF5A 1GUYA 4L4XA 3W6UA 4YYZA 3WOHA 1P0FA 5AQ1A 3WGHA 3WJ7A 1IOLA 1XG5A 2AEJA 1MXHA 2FP4A 4IY1A 3PHHA 5JCJD 3N7UA 1E77A 2HCTA 3AW9A 3GF4A 3M1LA 4E4YA 1PJSA 1I0ZA 2NWQA 1DLIA 3NDIA 5ICMA 5DBGA 4BOYA 1T1RA 3JQ8A 1Z75A 2QRJA 5EQFA 2V6MA 2J6IA 1SMKA 5A05A 4CL3A 1GFSA 1GZ4A 4TZKA 3IJPA 3ZW9A 3E5RA 3NKLA 4Y67A 3T7EA 1SBYA 4E5PA 1SOWA 4BO1A 1W0CA 3L77A 4WEQA 5DBIA 3TSCA 5EINA 4RVSA 2DFDA 1BXGA 5JY6A 2YJZA 4B4UA 4EBFA 2RHCA 3GQVA 4R1TA 2PGDA 2C0CA 2WMDA 4FFRA 3WLEA 4Y9DA 5I8ZA 2B36A 2IRWA 3CINA 4BO7A 1FDSA 5AXCA 4LMPA 2O3TA 2PZLA 1JDJA 1LSUA 2LDXA 3VKVA 3PLNA 1H6BA 4O59O 1XCBA 1HETA 4J0EA 5EERA 3KYBA 2QQ5A 2J3JA 2C29D 1P1RA 3DC2A 3G3EA 1T4BA 2QG4A 5LDGA 4I1IA 4J1TA 3RU9A 5C3MA 3GNTA 3ANLA 2Q46A 4ZHSA 1VL6A 1WAMA 3SEFA 1WVGA 4DREA 3I83A 3SC4A 4Q39A 3QP9A 3ZU4A 3NUGA 1PZEA 2VN8A 3JQFA 4NNJA 4OJNA 4DPKA 3VPHA 5JYDA 1E0DA 2EW2A 5A3VA 3AU9A 1ZXBA 2D1YA 1NXQA 3S2GA 4ZU3A 2D59A 1HYHA 4YJGB 3MOGA 4CM1A 2E6UX 2WYVA 4ZRMA 4BNMA 3O03A 2UUOA 2HSDA 1NAIA 3DTTA 1ZIDA 1EE9A 5GY7A 4KDEA 2WYWA 3SBOA 5B12A 3ZW8A 1ISHA 3VZSA 1PGOA 1C0PA 1PWZA 3GVCA 2FSVA 1GPJA 3BMQB 3GEDA 2HK9A 2EHDA 1UJMA 3GPDG 3NV9A 2C7GA 1U28A 2Q1TA 5F1OA 5KVSA 1E3WB 4A2CA 4AJ2A 4FGWA 5JBIA 2X5JO 1JU9A 4B7XA 4H16A 2PV7A 3GGPA 3UW3A 2P9CA 5CFZA 5KVCA 2RHRA 3TOZA 2A35A 1PZGA 2B83A 2IZ1A 1B15A 2DVMA 4PZEA 2DBRA 2PTGA 1F0YA 3VAZA 4XQGA 3VZQA 2QHXA 1ISJA 2VWQA 4WNCA 2O3UA 2EWMA 1D1SA 5DULA 4KP7A 3IAHA 3A9WA 1P0CA 2QX7A 1QYDA 2VUUA 4NIMA 4ALJA 6LDHA 5IXYA 4BO2A 3NTQA 2HRBA 1TLTA 4WCFB 5ES3A 3ZNPA 5L7TA 5IF3A 3PIDA 3JCZA 4IUYA 1EK5A 4CMJA 3HHPA 4CMEA 3CH6A 1GCOA 4YT5A 1Q0QA 3SVTA 3PJEA 1A9YA 3JYOA 1QV6A 3ASUA 2DU8A 3WWYA 1U3TA 1VJTA 4BQRA 1T1SA 2VT3A 3V2HA 3H5NA 2W98A 2WJPA 3O8QA 4NDNE 3D4OA 4IDAA 4Z0HO 4CMIB 2WSBA 5JLAA 3TZHA 4OL9A 1QKIA 1FDVA 2P4QA 3QLJA 3GMSA 2ZQYA 4IXTA 3VH1A 4AL4A 1GPDG 1WZIA 2HMUA 1DFIA 1M67A 3DZGA 1E6EA 4QQRA 1XSEA 1O94A 4IBOA 3A28A 2GRAA 2Y68A 2BKAA 3AFMA 1X1EA 4ND2A 4BS9A 4WPGA 3BTUA 1PU2A 9LDTA 4L76A 3GNQA 1X7HA 3WFJA 4CQLB 2R00A 1DSSG 5I7VA 1EBFA 2AA3A
chains in the Genus database with same CATH superfamily
3WLNA 1U1CA 4A5SA 2DKNA 5JH7A 1CSEE 1XRJA 1AS3A 2EHJA 3O4GA 5H59A 1JMVA 3VYTB 1G5HA 3M7IA 3PPYA 1CK4A 3CCFA 1XPJA 1SUAA 5J5AA 5F9FA 2QV0A 4L6IA 1QDLB 2HFKA 3ZCVA 2WR8A 4JDUA 4FFSA 1XDWA 2JAOA 2XTZA 4RIHA 5ILGA 3HJBA 4ZCIA 2IEGA 2XUDA 2J48A 3A7DA 1G6OA 1KYWA 3LS2A 1M5UA 3G2JA 4QPCA 5LBTA 2UXBB 3P9QA 3CHYA 3IS3A 3WGLA 2VZ8A 2ES4A 3JTMA 2D0DA 4OPMA 3SXUB 4DIBA 5FPKA 2B2NA 1K0FA 2XUZA 3VC3A 4JI4B 3HNRA 5HP4A 4FQ8A 2NO0A 4LXIA 1HDIA 1JVNA 1O95A 3DBRB 4RKRA 3FWNA 3H42B 4MVJH 1WD5A 3FFBA 1J0BA 1MX3A 1XNHA 4B3BA 4W9NC 4EI8A 2QTZA 1NXPA 4DNXA 1F8YA 5BWBA 1GTMA 4JB3A 4IV5A 3LAWA 1NKVA 1U7TA 1YBMA 3D3QA 2BW0A 5K3AA 1H42A 5C7YA 4EFMA 5AJXA 3AG5A 4BCBA 1YU9A 4CMIA 1STOA 2W6QA 4DCTA 2EZ9A 3DS8A 4ETMA 1B8VA 4B40A 4YR7A 3OIYA 4WFJA 2JH9A 4URZR 3WWPA 2VH2A 2WTAA 4K81B 3TF5A 5U1PA 1TVEA 3BD9A 2JFGA 3MRTA 5A5VA 2GJ4A 4XDGA 5GONF 3ADBA 4CZ2A 4RXUA 4EF6A 1C29B 3Q7IA 4ENSA 2FN4A 3FPSA 3G8BA 3V32A 1Y8QB 4BN0A 2OHOA 4KRFA 2PZKA 2FTKE 3STVA 1A9XB 4NZ9A 1EEHA 2VAXA 1P1BA 3BXFA 4NDAA 5HF9A 3EF1A 3UTDA 5JCXA 4KQMA 3H3JA 5FPQA 2XF2A 2VA8A 2A1TS 2PQ0A 3OD5A 3G2OA 1PG5A 5FBZA 3WYAA 4D6YA 5GADl 1A9RA 4IWXA 4L6CA 2FZ5A 3UB3A 1A9XA 2FQXA 2GJSA 2XKBA 3PFWO 1DADA 4S2UA 8GPBA 2LCIA 4US1R 1YZQA 4Z8XA 4E2XA 4LVCA 2EX4A 2ZQZA 3A6ZA 4NJEA 4N54A 3O2QB 1I10A 1ZL0A 1GZ5A 1Q19A 2FZGA 3ESQA 4ZAGA 3W90A 2Y1DA 5A3QA 1XPOA 3JARB 2NZVG 2UVQA 1HRDA 2W43A 3WGGA 4W5NA 1D4OA 3ECSA 2XHZA 1XCGB 5KYGA 1U2QA 2FDRA 1P7YA 4KZKA 2IH2A 3L4EA 3D6MA 1G18A 2FH5B 3OCVA 1ACMA 1YZTA 2RG7A 2DGDA 4ARCA 2ZWOA 4HPJB 3PBKA 2X58A 4LHWA 1RJWA 4ZRNA 4HAOA 5LYYA 2IOHA 4CCSA 4RTOA 4P84A 1JEOA 3H2YA 1XU9A 4PIVA 4YJ2F 1VIYA 2HWYA 1AS0A 4ZFNA 5JDIC 3MG9A 3FPLA 5DO9A 5H3CA 3R9IA 2Z5LA 3Q6IA 3UWPA 2JGAA 1SPBS 1ENOA 4L8LA 3SQLA 2XI4A 3UF0A 3BCHA 1LWOA 5ENVA 2XV1A 3ZJ4A 2FKNA 2C4KA 5KJ6A 3A1SA 4A3SA 5IKXA 4DYHA 4BX9A 4A23A 4BKRA 5IKPA 1RWWA 3ZUGA 1V9CA 3IKTA 3PUWA 2Y1KA 4MWBA 3E23A 4QIHA 3LZDA 1K88A 5ITWA 1XVTA 4TPKA 2YQ5A 3CEAA 2XVZA 2QP4A 5AVRA 2IIPA 4QKQA 3CLUC 3KJIA 1T13A 2WNHA 3E3MA 3QXHA 4Q19A 5KOIA 2XGGA 3PWTA 2PHZA 4XTRA 3VBEA 4M0KA 1G0NA 3RM3A 4JV5B 3WTCA 5FWYA 3D4PA 4QPDA 3KJQA 1ZW6A 3KTAA 2YS6A 4KGDA 5DTMA 3T3MB 4X60A 3QM1A 4YRTA 3G1TA 4ZV4A 3FLMA 4S1PA 1RJ9A 1NF2A 4MP6A 4PQGA 2D13A 2QE7A 5KSYA 4LFBB 1KIFA 3HB0A 1SK8A 4LDJA 4HN4B 1L5HA 5EPUA 1DIAA 5JPIA 4EHBA 1AOXA 1LK0A 2Y6UA 1ZJYA 3FYUB 4N3BA 2WJWA 3IQEA 1QK4A 2HU8A 3NDJA 1CCWA 2F9FA 4LKRA 3UOWA 2BEUA 2JJ8A 1Z4QA 1TF5A 3ORQA 3HRKA 3P97A 4PTZA 1U5BB 1H4TA 5F78A 4B48A 5H68A 1TQDA 1Q0PA 1UBEA 2E6KA 1W5AA 2HADA 2NT4A 4DJAA 4KUEA 5CFOA 2I4OA 1XN4A 4QUHA 2DFTA 4WL0A 5AKKA 5ECGC 4EG3A 3WWZA 4JHXA 1OU0A 1L7RA 4M1EA 3C7TA 3U40A 2I87A 4LV6A 4BLOA 3ETHA 1JQBA 3FR7A 1N1GA 3T9EA 2ZYWX 5HW0A 1AHIA 5GJVC 5IJWA 1TJ3A 1E1YA 1VE3A 4FHCA 2J67A 4JMLA 3QPAA 1WOYA 3F7MA 4YJ3F 3SC3A 4C2TA 2NTEA 2AFIE 2GZ1A 3ZV3A 1WCIB 1RM5A 2OZVA 1M1ZA 1ZHFA 1ZJZA 3GD7A 1OLOA 4UDYX 4A8PA 1SK9A 3V4SA 2GN8A 2YIDA 1F1BA 1KYXA 2BVNA 4J1QA 3F5SA 3Q7TA 3OQMA 2I91A 3I04M 3OZUA 2DPXA 1L4EA 1TAGA 4FKZA 3H5VA 1SIBE 1K6IA 3PNOA 4CTMA 1TMYA 1UPUA 1WP4A 1XEAA 2OO5A 2VNHA 4G41A 4MLZA 1GYQA 3OPYB 4N0PA 3T4PA 5AOAA 4D5GA 2IIQA 4BMZA 1VRVA 2YJNA 3FVRA 4R8VA 5B1IA 3QY0A 2VOEA 2QLJA 4ES6A 2UVPB 3OX2A 4H3HB 3QTLA 1NBHA 3IMFA 3EFHA 2X8WA 3CXUA 3KUXA 3LHFA 3UYLA 5DM60 4ZYUA 1BFUA 3MK31 1RVDA 3LX6A 2R8XA 3U39A 1QRRA 3C1OA 4B6GA 1CW2B 1N6LA 4G9EA 3EPJA 2V9PA 2RJOA 3BQMB 3DDCA 1WR8A 4G0VA 2PZEA 4XSHA 4KQWA 4A73A 3E4CA 2ODTX 2XBLA 3FDZA 1MAVA 4R9NA 5AM1A 3T4UA 1R37A 1JKFA 3VTAA 1FDWA 5FBWB 1K63A 4RVFA 1GDHA 3O8CA 1G7SA 4JASB 3IKJA 4AD8A 4I3HA 3RSSA 1K6XA 2AI3A 1BMDA 2IE0A 2WG1A 5D7BA 3SIWA 5ICSA 3PUVA 1RRGA 1PEYA 1CR4A 1G20B 1QLJA 2NM0A 3D1JA 5JNTA 1OH8A 2Z2KA 4CDMA 3PDUA 4A91A 3CISA 1ACLA 3AHEA 2ONKA 3HFJA 2H1FA 2GGSA 1NJ6A 4FC6A 2J0UB 4Q1CA 5BPHA 2CYAA 1O7JA 2F3QA 5ALLA 2I6UA 3UMRA 2IC5A 3WLQA 1I7DA 4WZAA 3QTBA 2F64A 2I7TA 5B2EA 4FGJA 4CLRA 3BXPA 4B76A 3QPBA 2OVBA 2K87A 1OFHA 3HA5A 1U98A 4CMAA 3LXUX 2PPVA 1P9OA 4D8TA 1CEQA 2W6CX 3FAZA 1T25A 5BYKA 2ZIAA 5EJGA 3KSRA 3AUSA 3W5HA 1FK8A 2J85A 5EYPB 4LFAB 4IIBA 4EPWA 4RWEA 3K4HA 4RJJA 1F8XA 4A8JB 2ZJ6A 2XXAB 2R68A 1GQOA 2VP5A 1JHOA 3LQ4A 4LGMA 1KYQA 4Q9NA 5F9MA 4CKWB 4YUAA 3U7FB 1HDGO 1QOZA 3KQVA 3PTZA 1E9DA 1UODA 4BVHA 3CRVA 1VSTA 2CMFA 2IITA 3NVAA 5I47A 4MLCA 1L1RA 4Q00A 3KZXA 4FN5A 5IN4A 1D2MA 3BIJA 4JELA 2E5WA 2YASA 2FPSA 3MWJA 2XZTA 3O84A 3EARA 4RQBA 1YNSA 1UFVA 2XADA 3AJEA 3B7PA 3DUFB 4CTKA 4OQQA 2WY2D 2C99A 3O90A 3R0JA 4ZJYA 1WPQA 2L17A 3VZCA 2IP4A 4AMBA 2KPOA 4LBZA 5LFAA 3U61B 3G7SA 2VSQA 3MGKA 4C06A 1B14A 1R74A 3N8KA 3HWSA 2C4VA 3KXPA 2G88A 3NT4A 3BJEA 1TFUA 4PZAA 3DUFA 4RMIA 1OXUA 3T61A 1UPAA 2X0EA 1Q12A 4RETA 1ZGGA 2XMDA 2JIOA 4YO7A 4HQKA 1Y9DA 4ZGBA 1ZD4A 1B1CA 1PR6A 1N5DA 1T0PA 2REXB 3PQ7A 4WE3A 1CLUA 2CFIA 1KJWA 3KXKA 4ROSA 4CLHA 2GCEA 4BC0A 4HADA 4NCXA 5H80A 4MHTA 2HA4A 4MW2A 1LWNA 2I3BA 4YMVA 1AUOA 2XQVA 2NYAA 3LBAA 3LZ6A 1P31A 1CF4A 1BX1A 5I8WA 1FFYA 2GM3A 1FS5A 9LDBA 4G1UC 1K98A 3RVQA 2YWGA 3U2QA 3QE2A 4NFYA 1MIOB 5JCOA 4B4DA 4C9BA 1MC1A 4XW2A 3W8NA 3WL3A 3SJUA 1XXHA 4KGVA 2DUUA 4TWAA 4YAFA 3X1KA 2IA5A 1K06A 4PSUA 1U0GA 5TX7A 2H8KA 1M0WA 1GKYA 1OPXA 1EK6A 1XJWA 3AR4A 2F8SA 2Q21A 2W0SA 1XZCA 1XJ5A 2Q6LA 2C2MA 3F6SA 1YMUA 5EJEA 4LOLA 2NU8B 1QIFA 3JWGA 4DA0A 1BXZA 3R77A 2FPIA 3KHSA 4A6DA 2HRQA 3OM1A 1VMDA 2O07A 3F2VA 1R27A 2X1HA 1MA0A 3OURA 4GZ6A 1XRLA 4K9KA 4G1MB 4C0JA 1BDHA 1O9GA 2BZGA 2DTDA 3UWMA 3X3HA 3DWIA 1LLQA 2WKQA 4BFSA 3NHMA 3DF7A 4Q21A 2JI8A 4BPRA 3S8YA 3WB1A 5JSZB 1H2EA 3GJZA 5E6SA 4X62B 1OX6A 2WMOB 3S28A 1YUNA 1HYEA 2ZSKA 4YP5A 3ZDBA 2H08A 2RGNC 1ZX1A 2I8LA 1MJFA 3WWCA 2PAFA 3K0EA 1GTJ1 2G80A 1TZ2A 4KDFA 4YXWD 3FHOA 2XGJA 4G0MA 2QMHA 4QXMA 3UH0A 2VTDA 1FYXA 5CFLA 1DQSA 1YS2X 2NAFA 1F7VA 1K27A 4JI0B 4ZJUA 3KYDB 3BOSA 4OXYA 3B82A 2HZ7A 3UV6A 2I7VA 2IHBA 1NFFA 3EODA 4FYKA 4RZXA 3UHPA 2EKPA 3N87A 2QW0X 4HFNA 4LQLA 5EVJA 2GXSA 3WKDA 1GZUA 5I4KA 1EWRA 3C3KA 3KRTA 1EGQA 3GARA 4DPMA 2WKWA 3IP9A 4MW7A 4AZ0A 1RIFA 3DMFA 5ALDA 4CKCA 1E7QA 2JIZA 3UOAB 1VOTA 2CSUA 3II6X 5JXGA 1XFDA 4DR1B 2QROA 2CL6X 3O8QB 4C0QC 4UAUA 1KNQA 4ZYTA 5JQGF 4MLPA 2BM9A 2NXCA 3FKQA 3OCWA 2CDCA 4HQLA 3BTSA 4CF7A 2QXUA 1KE1A 1VSVA 2DKFA 2FPUA 2GMWA 5HEKA 1X1RA 3OZAA 1AKYA 4TKZA 5DTEA 3PRJA 2X5OA 3DDSA 2QT1A 5EQJB 2H65A 4AT1A 1YE5A 1LK5A 4G37A 1GTRA 5CXXA 1I8TA 1O94C 1XYGA 3AEZA 1VG0B 2W6JA 4LV5B 5KJCA 3ZCSA 2B8EA 3TZBA 5K3BA 5FTKA 5TGTA 1O6BA 1T34A 2OAP1 4ZI7B 4X7RA 5CA0F 4KQHA 2HWXA 1B43A 1SUIA 1UXKA 2POCA 2V4MA 2DC1A 2I99A 3ZWNA 2OLEA 2X4IA 3RS0A 2WP0A 2P68A 2IYYA 3WKCA 2Q3HA 3R5SA 5FWDA 5L8VA 4RF3A 4JWKA 2LD4A 1K7FB 1T2FA 4E14A 3LO8A 4Q9IA 2GPWA 4W1PA 2P5TB 1S6YA 2X9LA 3VBCA 2WV7A 2J3KA 3QBTA 1JAHA 3DMDA 4HUQA 4M7RA 3VR5H 1AKRA 4J7XA 1QIDA 3PC7A 4HLQB 5JZBA 2QSZA 3P0EA 3NHBA 1P61B 2QU7A 2ZFUA 4IXNA 4HX5A 2XW6A 2VBFA 5CVDA 2N42A 1PEKE 1ABBA 3BCSA 4O33A 4EI2A 5IYZA 2IEDA 4AICA 3FOAA 1E7MA 3CYFA 4M76B 5DTIA 3WL4A 2PD4A 3KQMA 4JWTA 3NYWA 3K5IA 4LF7B 1HE3A 1SURA 1SG0A 3C3MA 3HDTA 2DETA 4XWTA 1WQ4A 1Z33A 4ZCMA 4DJTA 1ESEA 3WIUA 2SICE 4KI0A 8OHMA 2A58A 4WFQA 5AW8A 1MEJA 3M49A 4H7PA 2HMWA 4TS1A 5IDQA 3DZHA 3H8VA 3ZWMA 2JFHA 1KDPA 4B3JA 2IT1A 4TM7A 4XPIA 3QE3A 5E7QA 1NLYA 2WW8A 5AK6A 5DYWA 2ZJ4A 5TQVA 1YQTA 3TSOA 1E2BA 2OCLA 1UDXA 2I1LA 2ID4A 3LCCA 4R8MA 2VYCA 5HM6A 4KPUB 1KZ7B 4BB6A 2OM6A 2ERYA 2Z6VA 4GI2A 4N1AA 4F84A 1LDYA 1P3Y1 2Z4RA 2ZAOA 1U5CA 3VX4A 1MC8A 2B0JA 4K9PA 4WQMA 4WLFA 4FHFA 3WK5A 2JJYA 3OFVA 1J0XO 3FNEA 4JC5A 4DLZA 4HTAA 1USGA 4UUPA 4L85A 4RHXA 1AQNA 2XCQA 3WAJA 4GZLA 4KVFA 3JD3A 3EXEB 4UATA 2PU7A 1HNNA 3WIEA 3RQIA 4C7KA 3CH5A 1D9ZA 3D7MA 4XQCA 4B84A 1N2JA 2A33A 3F5DA 4DCCA 1Q1GA 1Y0BA 2QZPA 2VWPA 4YJFB 5AJWA 2VPXA 1YRWA 4NULA 3I9MA 3L7LA 3DFFA 4D9MA 2SCUB 4HB2A 2ILVA 4PCAA 2SHKA 2TMGA 2PDAA 1YDFA 3DDHA 4Q93A 4WERA 4L9WA 3BC1A 3EF3A 4V0MA 2VRCA 3U44A 1GZ6A 1KAMA 3N2GA 3G9XA 5EKXA 3AV3A 2Y1XA 2WF6A 4HBGA 4Z3KA 4PFSA 4EZBA 3RVRA 1XVUA 2YY5A 2VT6A 2H29A 2W48A 2F3TA 1W1IA 4NS4A 4TVSA 4MIOA 4ZCTA 3REQA 3T52A 1JFFB 3ERCA 3P9IA 4EY8A 5ALTA 4UAVA 1Y3BE 4M89A 3RFFA 4ESOA 3LC1O 1VRWA 3HDQA 4UTNA 2VK1A 3CZAA 5LA6F 4DRYA 4ZKEA 1H22A 3MUNA 4Q9KA 4E6PA 2NOAA 1BQEA 2OWDA 1E58A 2XUPA 1QQ5A 1P1FA 2IYOA 1C3OA 3F5MA 3OZFA 1VPTA 2QTAA 2JFXA 2C2YA 1U5BA 2C4HA 2ZUVA 3N05A 1AB5A 3FNBA 2CE2X 2PTHA 3IB6A 5DOZA 3EXAA 1Q22A 2AI2A 2BEVA 1EA5A 2X9NA 3AUUA 3MFQA 3MUOA 1YZVA 3PS9A 4GF5A 3JS5A 4GSLA 3T0FA 4H0FA 1E61A 1WUYA 2R8ZA 2FZ4A 3TVDA 4P3KA 3KT0A 1VJDA 1GO2A 1H0HA 3KE9A 1SEVA 5ELXA 4DMFA 4NQRA 3TL2A 1V9LA 2IU0A 2ZTHA 3N6XA 5DZSA 5I45A 1J5EB 1MFPA 3S7ZA 3F4BA 1MA3A 4NL4H 1MQAA 4JLDA 1K5DA 5CVEA 4X65B 1YD7A 2YFYA 3C0KA 1JEQB 2C3YA 1ZPDA 2Q3FA 4NMWA 1PWYE 4FZ3A 1UAAA 3DOEA 4LOJA 3GV0A 2R1UA 1MENA 1KEZA 4E0BA 5CB4B 2W2MA 2OCAA 4KX5A 3BCUA 1YACA 2W6JD 3TKLA 5CDGA 1T2AA 2XKKA 1FU8A 1YJCA 2YV4A 1ZUIA 3FLBA 1Z2PX 1DIGA 1JAXA 4IO0A 3UVEA 1JHYA 2QRUA 2QJOA 4L8WB 4Q03A 2H4HA 2XJ9A 4QLAA 1A7KA 1OBOA 1KVTA 3U4QA 2ID7A 1H66A 4A7PA 5D1NA 5JASA 4Z0NA 4C3ZA 5ARDA 3FAKA 3DE5X 2XYHA 3OJ0A 4B3GA 4HMPA 1Z4JA 2VBIA 1ZN2A 3BZWA 4UEJA 1BHQ1 2A92A 3HSSA 3RYTC 2DHRA 4D02A 3CPEA 4F6CA 5CFMA 1KSGA 4HEA1 3RIGA 1DLJA 4P86A 3UJ8A 3NHRA 5ECWA 3NAGA 1HQYE 1AN0A 1JX6A 2GPYA 3WLRA 2Z56A 3NLLA 4UUMA 3LKVA 2Q9BA 3G82C 4P33A 4ZQHA 5EN4A 1EFKA 4CQMB 3LF2A 1PTJA 2YJ4A 3EVTA 5AJZA 4DBLE 1Z8DA 2VFAA 5KZMB 2W2LD 1KC1A 3B78A 2ZKLA 3JQ8B 1ZJ5A 3G88A 4E32A 1B6RA 4KLAA 4MUFA 5CG2A 3KVOA 1A7AA 4MHSA 3JR7A 4DUPA 3UM9A 1OBCA 5H16A 4AQDA 2IHNA 3QRWA 3B48A 3Q3EA 1OLUB 4BFVA 3ROTA 3LUHA 3WC4A 3QPDA 1KY3A 3TNJA 3ZGXA 3C98A 3N0TA 4J7UA 5DGXA 4MVXA 1U2EA 1WKCA 4WZAB 4Z5XA 4M37A 5DWVA 3TAXA 4TWIA 2C9OA 5H9WA 1ZRNA 3FIUA 4HNSA 4X44A 1XP8A 2J3HA 3K2BA 3MJCA 4WUVA 1ISRA 1X3LA 3BTOA 3INNA 4KN5A 4EAQA 2WB2A 1PJBA 4KCGA 5IANA 1I4OA 1QV9A 1P7PA 4UVHA 3UWOA 2OENG 4HEA6 3WGKA 3TLJA 1P9WA 1FFXB 3GOHA 4KRXA 1D1PA 4PSVA 2MYUA 2FWRA 4U02A 5AXBA 2PJUA 2VLBA 5IM4A 1JYSA 1O89A 1EXWA 1AM4D 1CUFA 1LRKA 4MVJP 3HR7A 1U31A 2OV8A 2G0TA 4C87A 3MRVA 4I9UA 1GAWA 2NT3A 5CMLA 3INRA 1XTBA 3VU9B 4QOGA 5LZ9A 2SKEA 1QO9A 2WHPB 1KEEB 2RIRA 3AJRA 3FVQA 3NBKA 3RYFB 4Q4AA 5P8WA 4BB9A 2LVBA 3Q12A 3ZCQA 1RQPA 2BFNA 3LL4A 4KE6A 3B5IA 3OESA 4Y98A 1U8ZA 1N92A 4QZVA 1ZRSA 3E9MA 3GHHA 4Q4JB 3CZMA 5JATA 4FD2A 1SUFA 4Q15A 1WZ2A 4U7HA 1IJKA 1ISSA 2ZYIA 3T5BA 2DZDA 3QEJA 4R7ZA 4C6RA 2WWFA 4U0KA 3AF0A 1FTYA 1BE6A 3DQPA 2ZREA 1C8KA 4IDCA 4X85A 5E6UB 1SZJG 4UUOA 4KR6A 2G40A 2MSNA 4ZIRB 5I9MA 1FMJA 2D8AA 3BE8A 4C21A 4BNHA 4I4TA 1O58A 2AEFA 5FHQA 4AKIA 4HK4A 1VPEA 3E18A 3B5JA 4FMDB 4FC7A 2I0FA 5THQA 1NKTA 3EQZA 3NTLA 1GLVA 3UJHA 1I24A 4OLJA 4A1OA 4Y6SA 1D2NA 1GTL1 1OLSA 4RDHA 5A5DA 2XCRB 4E2YA 1QZUA 4I9NA 1U9IC 2AQIA 5D2CA 2NUTB 3IX7A 4YJ2B 4HGQA 4N18A 1NRJB 4N41A 3GX1A 4Z4IA 2OFXA 3TGWA 1XXHB 1YFKA 2F8MA 3H1EA 4XDHA 5IHPA 2DY1A 3EDRA 2PWBA 3OFND 1DB3A 1W4ZA 1WW2A 2OM2A 4BNVA 2RMKA 3CUYA 1EM8A 4C5BA 3A4LA 3U7JA 3D64A 1GZSA 3PC2A 3F6PA 4IXDA 3RC9A 2O1XA 1WNFA 2NO5A 4CL8A 4DGQA 1VZ3A 2QAGB 4X1IA 4P0TA 2WU1A 4D82A 5C8YB 2JJQA 1GXSA 1YS7A 1EUDB 2ZSBA 3H05A 4KWEA 5C4GB 5JJ5A 1ZVJA 1D2CA 1X13A 1Q1ZA 1EQAA 2QYOA 1NTOA 4JKOA 1N8KA 1WDKA 4D4GA 3RSCA 3EZFA 3H9EO 5LU9A 3ZGOA 3RHFA 4ZZ3A 5GM1A 1T0JB 2EGGA 3PWZA 1Y5NA 3EGCA 4OX9B 3HY4A 3D6TB 2J5QA 3DLCA 5BSHA 4K05A 4WFKA 1L6RA 4YT2A 5F4ZA 1VI2A 1J1UA 4EW3A 1SU8A 4ONEA 3B3QA 4GSKA 5KAPA 2PCJA 4WOPA 4KE7A 4ESEA 1QYWA 2RFLA 1Q5PA 1JQDA 2JARA 4GXRA 3I2GA 1A4RA 2W2OA 3CQ9A 3LVFO 1I1HA 1AXEA 1C14A 4TLMB 3WLOA 1B6TA 4KREA 2NP7A 5L3SB 3DZBA 3OKCA 4LY3A 4E21A 3GL9A 4JYMA 4M9SA 2FPXA 1N2ZA 3KQKA 1DX4A 1ZN8A 4LSWA 4YASA 2F17A 1T6YA 3NHAA 4KQIA 1R5OA 3WP0A 3OZCA 4L08A 1MTZA 3OCXA 3R4CA 1KZGB 2Q3BA 4PBRA 4R4JA 3VYSB 1PHRA 4KN8A 1ULZA 4XX0B 4QQ8A 4LJ7A 2PGOA 3A3KA 4J90A 4MRNA 1Y9AA 4TZ6A 4UM8B 3C3YA 1DGQA 2AT1A 2XVXA 3JV7A 4OF4A 1DAPA 2KLBA 3RYCB 4K6KA 4LHSA 1HY3A 2C5FA 4BJ6A 3FGNA 3NWEA 2WT9A 1IXYA 2ZZMA 1EX9A 4RC9A 4YPVA 1UFOA 2VA9A 3R6WA 3VV2A 3DAFA 4NRDA 3WWDA 4B8WA 5K01A 3WRXC 1T4DA 1P0MA 1BMTA 1QVRA 4Q7LA 5DISB 1YR2A 4R7TA 1KOLA 4RLHA 4PR3A 1B8NA 4WXPA 2LCQA 1E96A 2O2SA 4OB6A 2XWQA 3D0KA 1E1QA 1GEGA 2PL9A 2P35A 3VR1A 2OFWA 4LYFA 3G2PA 4TTAA 3ULKA 3IOEA 4O1MA 1GSIA 5ISMA 2GAJA 1R0YA 4WN9B 3KOWA 2C9BA 3UMGA 1DRWA 1C1DA 1SB8A 4ZVLA 1NJ8A 4WNAA 2NNLD 3UJCA 3LSTA 2WWVD 4KRGA 3VYWA 2D1TA 1GWNA 1O57A 3KB8A 3LT0A 1Y5LA 4G24A 3DEHA 4RFSB 3KQYA 4J0FA 4UTXA 4ZCRA 4AY5A 1C80A 1DCKA 1LDGA 2C3OA 3G6WA 3I52A 3D7LA 4JJGA 3X1WA 5BVGB 3AHHA 1FXSA 3B1KA 1N0IA 4BVBA 3RLIA 2IEZA 2ORVA 3ZWXA 2BF7A 1RPZA 4G8CA 1R4MB 3CF6R 1KAEA 1SBTA 1QHFA 3KVRA 1R6XA 3BB1A 4GX2A 5CX1B 1QPZA 1AQIA 1NJ1A 1CJVC 3GUCA 4AAYA 2VH5R 4HOYA 3ZWWA 1ZK1A 4L5CA 3Q8KA 1P4SA 1D4ZA 2HU2A 3L92A 5FUWA 5JNRA 4GFDA 4LPKA 4MRVA 2DP4E 2GA8A 1TPZA 2VG8A 4UTOA 1J22A 4GKBA 3QU9A 1KJNA 4KHZA 4YO8A 2BMJA 5NULA 4LDRA 1F6DA 3PG5A 5K0NA 3VQTA 3A6JA 2I76A 1ORVA 1AUQA 3H9GA 1R8YA 4G84A 4HZUB 1PYGA 1YVDA 4MWGA 3AILA 5BQPA 3FTNA 3SPXA 3EVCA 2E2WA 3GAZA 5K0FA 3UENA 5ADVA 1VFPA 1H8ED 3QIVA 1DPFA 4MCIA 1CFZA 3VGPA 3IVCA 2A0XA 2XNHA 4H7FA 1YKGA 3EXIB 1DO0A 4QHSA 4ZVMA 4ERNA 2JFNA 5TGZA 2VDLB 5EJ4A 1PQYA 2RARA 5HRAA 4MA4A 4XEHA 3FNRA 5D5PA 1QAMA 1R9MA 2FW6A 1UM9B 2KYRA 3GJTA 1VBFA 3GRFA 5JZ9A 3LQ2A 5G0WA 5I9LA 4F2GA 4BWVA 3OVMA 1FEZA 2BFDA 3DAPA 4ID3A 1T26A 2CLHB 1L4LA 4G4IA 2C2WA 5DGCA 3PIRA 1VBNA 5IAOA 1EVIA 3K30A 5KQGA 2CLCX 3A2MA 3L7MA 2ZI6A 3IRVA 1NXTA 2A1UA 3LO5A 1CUIA 1QNFA 4FMDF 3TQHA 1UBRS 4L74A 2H11A 1TO6A 5F12A 2X0NA 3D31A 5FCDA 1QRUA 3SXJA 4N0EA 3DAHA 1T3HA 2VRBA 1U02A 4EPXA 1XVIA 4LEIA 3AUAA 4BGDA 1E60A 4DCMA 1XMSA 1DBVO 2H18A 1TA0A 3O31A 3OHSX 4IDGA 2W58A 5DH9A 4KN6A 3FM9A 3FVWA 3HJCA 1QG2A 4IHQA 1UH5A 2C59A 4R0VA 1I32A 5H83A 3REQB 3UYKA 4CF4A 1Z4KA 2O3JA 2P9FA 3GELA 1YRYE 2XNJA 4DMKA 5IVKA 2GKOA 2BELA 2IXGA 3P9SA 4J0JA 4PS1A 3WIVA 2E7ZA 3UT5A 3IILA 5BOSB 2AN1A 1K4MA 3EIQA 5CITA 1EFVB 2HQRA 1KJJA 1XT6A 4G0OA 5T64A 4PGMA 4LTNA 1JS1X 2H5JA 2MJLA 1JLLA 2Q50A 4KIJA 3HCEA 4HV4A 5JUWA 3PXDA 4Y2TA 2OHHA 1YJQA 2XIJA 5IJ0A 1KO4A 3B3AA 3HP1A 3MJHA 3DTNA 1E63A 3THWA 3HUTA 3DBLA 4Z53A 1QHYA 4MR8B 3KXIA 2H7YA 3MFYA 5AKHA 5B4VA 1A8IA 2X2EA 1OW3B 1WE2A 3ONNA 4ZVOA 1IZ8A 3IIIA 3R7SA 4DSZA 4WJLA 2GKGA 2YDXA 3HDYA 3A4IA 3IT2A 3SR3A 5D84A 2UZAA 4YRZA 5BSWA 2VTBA 3JATA 4LCBA 4Q82A 3NBXX 1XP5A 3OJWA 1JR3E 4N65A 1WMFA 2A8YA 1HL3A 2OUKA 1FP7A 2PUTA 3RTGA 4HZIA 1XIVA 4CG0A 3MUFA 4EYKA 1W4CA 4BKMA 5CYOA 5KC9A 1GR0A 3S81A 1G21B 1F4VA 2FEWB 3SFZA 2PUDA 2Q99A 1P1IA 1XZPA 3KVNA 4YR9A 2WIBA 1FZTA 4QTUB 2QE6A 5EHGA 2CDAA 4JOBA 1H1TA 3A36A 4Y1FA 3HVRA 3FH0A 3X0DA 3U4QB 2D1QA 1HEUA 1FDRA 4MQUA 5HTOA 3VKGA 2QTRA 4MDFA 2HJVA 1KJQA 2RCNA 2XCOA 4EG1A 4DUGA 1PS0A 2RC6A 4PIPA 5KOHA 1W49A 4QM7A 1AKQA 3ZEAA 1MG0A 2IUTA 2PLFA 2PKQO 3G79A 2GETA 3Q5EA 5EKSA 1Z17A 3FF1A 3ROZA 1RQ7A 1UT6A 1GR1A 3O4JA 2H3EA 2ZVPX 1KSJA 1V8BA 3WHKA 5ITSA 2OE2A 4FOSA 4OOEA 4N39A 3BN3A 4LY9A 1MDBA 3EBLA 3PGA1 2IY7A 2H2GA 4U0JA 4KQGA 1TYCA 1QZ3A 3D8HA 3T7RA 4CQMA 2PX4A 5D3KA 3R7FA 3DCYA 1Z35A 3HUFA 5TNXA 4DIDA 1EFLA 3H9UA 2HLPA 2ZYDA 3DO8A 2ZJZA 1IN4A 3SYLA 4NECA 2GOYA 4G5YA 1J8DA 1NP7A 1A1SA 3D02A 1YBVA 3DEFA 4QYXA 1H2ZA 3O38A 2BJHA 1VJGA 3LCUA 2Y92A 3OHPA 4JP5A 2QZSA 3QYPA 1T2VA 4JBGA 4KYUA 1EUZA 1IU9A 4R51A 3GLGB 1YXMA 1DG9A 3IV6A 3DB1A 3ITNA 3H7AA 4GPTA 4Y9SA 3SMQA 1W36C 1FXWA 1X7WA 2COUA 4LYAA 2O2YA 5M3BA 1T9GS 5C8DA 4CEHB 4L72A 4MS4B 2NPFA 1B0UA 2ODQA 3DHNA 3R2JA 2HA7A 1QU3A 2ZUDA 2CL5A 1OOEA 4RZQA 3V7YA 3OIDA 2CCGA 3L0IB 3NGXA 3NBUA 4QHYA 5ALFA 3GCDA 4C5AA 3RF7A 4AJHA 3CMCO 4OFXA 5FR2A 1E1RA 3L84A 3NWOA 3ZGYA 4HNVA 3UK1A 3WJ2A 4N0DA 2KLHA 3ZY6A 4DPLA 2YNMA 3TPZA 3UXHA 5L53A 3A1DA 4B6QA 5DBEX 1NWCA 4NHEA 3MS4A 4OHWA 4BWFB 3H2SA 1BQ3A 5EZ5A 4J16A 4JJZA 1B8UA 3TNDA 4NMHA 4MW5A 2HY7A 3ZDCA 3NPMA 5TGDA 4OXNA 5IU6A 1U9ZA 2O1SA 1RWXA 2CZQA 3SX2A 3KKMA 3QVGB 4RQUA 3EUWA 6Q21A 4MRSA 3F96A 3PSAA 2JLWA 3G5TA 3STYA 3JQGB 2DT5A 4KQXA 2VSOA 4Q4AB 3S0JA 1HK7A 2YJGA 2F8LA 5F7XA 4EITA 3HMQA 5EQDA 3V7NA 2Z9DA 4JUAA 1J70A 2VR1A 4MQEA 4ZTZB 1WETA 2REQA 4DR6B 1X7XB 5IRCD 3Q41A 3QUCA 4RX1A 3UCEA 5MFZA 4CPDA 1IB6A 2N1MA 2VF4X 1VCNA 5CGQB 5BSKA 2WKPA 3JD2A 4ZAFA 1JHAA 4GX5A 4PZDA 2IHTA 2V7UA 4WZBB 1C0KA 4YA6A 2I2XB 1QAQA 4I50A 1T2CA 4JD5A 3PUZA 3ASYA 3SEQA 2X42A 1NQVA 2GAFA 3LY8A 5HMLA 2B3DA 3EGDA 3G49A 4MARA 2X2FA 3LSYA 3DL0A 5AO9A 2WU8A 3HLYA 3DBHA 3QOFA 4IQ8A 3L40A 5F2OA 4DR3B 3WK6A 4EW6A 4ZT4A 1KYZA 2XB6A 1ST3A 4QBIA 1I2CA 1X7DA 3VDNB 5CUQA 3VTZA 4EY4A 1JSRA 2CJXA 2XE4A 1L5FA 4B3RB 3QJGA 5EPOA 2BGRA 3I09A 3R3YA 4HX2A 1D7OA 4C30A 3KQQA 2BOVA 3K0BA 4RE6A 4DA6A 1UINA 4B6EA 4RTPA 4ITRC 3UMFA 2PVSA 3THRA 4XB6B 3DV2A 2R65A 2Q2OA 5EESA 1REQA 5BORA 2D2FA 3C1TA 1YRQA 4JJ8A 5GTDA 3AEYA 4OU4A 1V8DA 4KX3A 1SXJE 3QHAA 4DG9A 2C94A 2RGXA 4CQLA 4PHTA 3VUFA 3DHVA 2W42A 3MRXA 1DZ3A 1TMGE 2ZAGA 4PM4A 5DM1A 1JDVA 1TLLA 2PGIA 2YZMA 5EQTA 2Z98A 1WHTA 2OHGA 1R0KA 2ASVA 2APJA 4LWOA 4CODB 3IEMA 3WSTA 3K3PA 3MQFA 3QVTA 3P9ZA 2GB4A 4JLJA 4ZAVA 4CVNA 3PTAA 3H7IA 2O4CA 1EUDA 2I9PA 4XR4A 2ACEA 3QWFA 1DEXA 1ULBA 5JARA 1CDEA 2O23A 1SKBA 1E2MA 3OLZA 4HS4A 5IJZA 3V4LA 1UC5B 1GIAA 3JASB 1O87A 3L07A 3TB4A 1KYIA 2OORA 2CEAA 4W1SA 5KYWB 1MQSA 4BJHB 1ENPA 1IZ9A 4GLBA 5EGNA 5DMXA 5DX8A 1OWOA 4BYMA 5LDHA 3ORRA 4RL6A 2PUFA 3CFYA 1T1GA 4MVWA 4J03A 5FV7A 4B4OA 4BXOA 1YASA 2RAFA 4YFYA 3WWOA 3CRNA 1XDGA 3FFWA 5CPBA 1CUXA 2RDMA 1CJUC 2PNJA 5KYWA 3DM5A 1FTSA 1YA4A 4MS1B 3ZGLA 1NMQA 2QYTA 3DE1X 4F6LA 3BHMA 3QV1A 4WK6A 1QHNA 4ZTUB 1FQOA 3RIEA 4BTLA 1I01A 1NVVR 1TIKA 2VTKA 1ONBA 3K6KA 1L7NA 2AB0A 1DMRA 5P21A 3ZWAA 3AHJA 2FR8C 3H84A 3UAVA 3WA6A 1IDOA 4D0SA 5IZCA 1WUIS 2FG7C 4AQYB 4HAIA 5AM5A 2O8VA 1L6IA 4XLZA 2O3RA 1RC0A 1ZAYA 5T6MA 3F7TA 1KMIY 3B60A 3K7EA 4ZA2A 3V8NA 2QL9A 1MH1A 4AVYA 3Q3CA 3F3YA 2I03A 2NU7B 4NPHA 1FDTA 1VPWA 1A8SA 2ZYSA 4MQ5A 4B34A 4EB0A 1KRWA 3ZHXA 3AR8A 4ZHQB 1JVSA 3MCUA 1J49A 1Q21A 1OQAA 3PCXA 1AMOA 2RGGA 3LUCA 1JAZA 1HE4A 1VKRA 3H5LA 3GYBA 4XYGA 2W71A 2R79A 1Z7YA 3MPOA 3E7FA 1OWPA 2PFSA 2NU7A 3OM0A 4MVJF 3SSNA 1GTG1 4AKTA 4UEOA 1QQ7A 1V3QE 4ETWA 4RTNA 2YC4C 1DQNA 1KY2A 1UK8A 2OYRA 621PA 1ETHA 3FKJA 4F93B 5K2OA 2VPYA 4JQSA 4M0MA 3M9LA 1M7HA 1Q91A 4UPDA 1D1TA 1SCQA 3N0RA 1V1MB 3F3SA 1Q95A 1P60A 3LW8A 1UKAA 4PHGA 3ZOKA 3KCNA 3OSZA 1TUGA 2ZS9A 2GZ3A 3HLTA 2R00C 4B32A 2PJZA 3S2UA 3ZX5A 3L2OB 5DN9A 4AJ9A 1WZUA 1FBNA 1QHIA 3O8OB 2NSJA 6CHYA 3QFSA 4HYTA 5HQ3A 3DMHA 3O0TA 1M5RA 3JAWA 1PJ2A 4H6WA 4ZOBA 4MWEA 4TMVA 4EHHA 4Q9HA 4KWIA 5KQLA 1HYBA 4MYRA 1ECFA 3ZHOA 1H3NA 1DEKA 2YHSA 3TDKA 5LOVF 5DYGA 3LHIA 3TJMA 3EC1A 4XGKA 1NLUA 4V3BA 1JEEA 5JAMA 4I50F 4KOEC 1F8GA 1W581 3AF3A 4OP3A 4EG5A 4D3FA 3RRYA 4KMSA 5JSUA 1SVNA 1YHYA 1BW9B 2I66A 3PGXA 5DX1A 2I6FA 4B7ZA 3TLGB 3RF6A 2UYCA 3HBLA 1HLGA 4MSUA 3NGLA 1J0EA 5BSTA 4O2AA 4DAEA 3GC6A 3LQRA 3QF4B 2QX9A 2OD7A 2XUGA 5IAKA 4D9EA 2V0NA 4U3JB 2J3QA 3ENVA 3V6LA 1U8XX 3JQ7B 4LZZA 2IU4A 4WY5A 1BHSA 2AKYA 1LSOA 3P2YA 3KEQA 3TQCA 5KYYA 1F06A 4LXQA 1EVZA 3I6ZA 1CY0A 1OZGA 1ZGAA 3LT1A 4HDOB 3EZYA 4YUVA 2A9VA 1OBFO 2OGTA 2YOGA 4TROA 5T57A 2B6HA 3DAOA 3IJRA 3QA3E 4ARZB 2AJ8A 5IDYA 3HXTA 3MWYW 5JY1A 2I3ZA 4XYLA 2V65A 1FNMA 3AB8A 3QFTA 2B9EA 3N0XA 3BH7A 4RKEA 1JG1A 1MO2A 3WK7A 2LIPA 3B12A 4AKGA 4WGFA 1RACA 4GMXA 2NO6A 1TUEA 1T8TA 3QJ5A 3P32A 2AJBA