2RCYA

Crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
GMENIKLGFMGLGQMGSALAHGIANANIIKKENLFYYGPSKKNTTLNYMSSNEELARHCDIIVCAVKPDIAGSVLNNIKPYLSSKLLISICGGLNIGKLEEMVGSENKIVWVMPNTPCLVGEGSFIYCSNKNVNSTDKKYVNDIFNSCGIIHEIKEKDMDIATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGSVEMVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYTVMNAVEAACEKSKAMGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrroline carboxylate reductase
publication title Crystal structure of Plasmodium falciparum pyrroline carboxylate reductase (MAL13P1.284) with NADP bound.
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 80
structure length 262
sequence length 262
chains with identical sequence B, C, D, E
ec nomenclature ec 1.5.1.2: Pyrroline-5-carboxylate reductase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 2rcyA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rcyA01
4QO8A 3T7CA 2I76A 2OBYA 6ADHA 5KOIA 5CDGA 4L4SA 3EZYA 2QG4A 3NGXA 3WGYA 1FDTA 2E37A 4E31A 4Y98A 4UREA 2F1KA 1Y81A 5T6BA 1HDYA 2XXBA 1XU9A 2VTEA 1R6DA 4YJFB 1E3JA 3E8XA 4R16A 1PWXA 5IJZA 4CLDA 4R51A 1DPGA 2ZYDA 3JQBA 3ZNNA 2DBZA 2J8ZA 2O3QA 3F4BA 3IIEA 4KUHA 3HADA 1ENZA 2J5QA 2POQX 4EDFA 3KYDA 5IZ4A 2GRAA 1HE5A 5IDWA 4PRKA 4AJ2A 3LC1O 1X7HA 3DZHA 2PGJA 5IZCA 4FC7A 3I83A 1NHGA 2DU8A 3HDYA 4QFDA 1NX6A 4TQGA 3H6KA 4DTIA 2X8LA 1J0XO 1OMOA 1HZJA 3PVZA 3PK0A 4PCVA 3DQPA 3H9UA 2EJVA 3MZ0A 3QHAA 4L74A 1EVIA 2HMWA 2JL1A 4DC1A 1PS8A 4IXWA 4EEZA 4M89A 3KBOA 5BNIA 4E5NA 9LDBA 2Q46A 1XG5A 3LC7O 4PLGA 5EJ2A 4BNIA 2YV3A 2EKLA 4PG7A 3ZV6A 4A26A 5BSHA 2AQIA 4I9UA 2GPTA 2V6BA 2XOXA 2W4QA 3FNGA 1GQQA 1IY8A 3F1LA 1IZ0A 2ZB4A 1UP7A 1E7YA 3JQDA 3IDSA 1ZMTA 1GU7A 1H6AA 3A06A 3VKUA 3WB9A 4GH5A 1UAGA 1N7GA 4ZN6A 3DBHA 4O5OA 1I8TA 1S7CA 4L9RA 1BG6A 1NYTA 1I32A 2CD9A 1GTMA 4YAEA 4DPMA 3LT1A 1F0YA 1QXSA 3KV3O 2VHZA 3I9KA 3HHPA 3NT4A 4AL4A 1CF2O 3IP3A 5A05A 4WCFA 4BO3A 2AG5A 3EUWA 5CEJA 1D1TA 4BNLA 4C7JA 3BMCA 4J7XA 4WECA 5LDGA 3RVDA 1P0CA 5BT9A 5KVSA 2NU9A 2VT3A 5G0UA 3ZWNA 3EW7A 3ONFA 3WYBA 2HKIA 3JYNA 1C0IA 1NR1A 2FSVA 5JDIC 3RKRA 5CP8A 4Q3AA 3H5RA 3PP8A 3RC1A 3GHHA 2NSDA 1CYDA 3D4OA 3VTZA 5CPFA 4A10A 4OSPA 1YB1A 3WLFA 4CR8A 4CMIB 1CEQA 2NADA 1BTOA 1Z74A 2GNAA 4XCVA 4RF3A 3PPIA 5JNLA 3H3JA 4OQYA 4PLVA 4R5HA 4Q3DA 1LSOA 3E18A 3WICA 3OA0A 3NT5A 2CF6A 3DHYA 4XRGA 5FEUA 3F1KA 4HBGA 4WPGA 2X23A 4J1NA 1V6AA 4XGNA 2G5CA 4TZTA 2OHXA 3EC7A 3TFOA 2X22A 5EESA 3GEMA 4R3NA 1ZVMA 4L4RA 5JC1A 3OICA 3W4JA 4G81A 4DLLA 1R4MB 3RFTA 2OZPA 3ABIA 4HP8A 5F1OA 1GYQA 3WWYA 2IYOA 1IPEA 4XJSA 1UJMA 2B5VA 5H81A 4CM4B 4N5NA 4JIGA 1XIVA 2ILTA 1IUKA 3LC2O 4EW6A 3JQGB 2GR9A 2UYYA 3DWFA 1ZSVA 4RDHA 3PIIA 2DLDA 3GR6A 1F12A 3I6QA 4PZEA 3ETDA 4AJKA 1XHLA 2HJSA 3AFMA 1Q7BA 1KEUA 1ZK4A 5T64A 1QYXA 3U9LA 2PNFA 4BHTA 2VZ0A 1ADCA 3ADPA 3RCBA 5DCYA 1HLDA 4P22A 5KNLA 1ZIDA 4BMSA 1LEHA 3DFZA 2NVUB 1B26A 5L40A 5L7TA 3U4DA 2YZ7A 3W8EA 4B4UA 3QJ5A 4W6ZA 5HRUA 2VYND 4DPLA 1VJ0A 5IDYA 4E2WA 1QR6A 4P8RA 4J4BA 1T1RA 3QV1A 4RORA 3OIGA 4NBVA 1HYEA 4BGEA 2P9GA 2QYTA 1VLLA 1LDBA 1H9AA 2NM0A 5ENVA 3S55A 1OAAA 3PIDA 4L76A 1BHSA 2EF1A 4GKVA 4BO1A 4ZICA 3L77A 4Q3EA 1E6UA 2HMUA 4IZHA 2FMUA 4FJ0A 1PZHA 3LQFA 1H94A 1HETA 4LISA 1Q0QA 3O26A 1MB4A 3VPHA 2PGLA 4FB5A 4E6PA 2O7QA 4ND1A 4CLRB 2HU2A 3C24A 3OHSX 4E5KA 4G5HA 2CZCA 1DDOA 2C7VA 2VTDA 2YJZA 3BTUA 5TC4A 4IJUA 3JQCA 5FYDA 2FRDA 3GAFA 3DEYX 5AQ1A 3AI1A 3LT4A 1K6JA 2OUIA 4KQWA 3JD3A 1PL6A 5KCZA 4EUHA 3CZRA 3EZLA 1U2DA 4JX8A 3G3EA 4CMEA 1EUDA 2DTXA 1U5CA 1E7SA 5A3JA 3I1JA 1LRKA 1V9LA 3U0BA 1E1LA 4YAGA 3PYMA 1E7MA 4N5MA 4EITA 1VKOA 3KHUA 2O7SA 3KYDB 4R5MA 3I3OA 2WD8A 4PZDA 3RC7A 1WXDA 5C7LO 3FNHA 4R41A 2Q1SA 4TROA 2AXQA 2CVQA 1GCUA 1VL6A 2Q99A 4JBIA 3ZWMA 5KIAA 2CDAA 4Q9NA 5ENDA 4R1TA 4QX6A 2AQHA 4OH1A 4YRAA 3ZWOA 1FDUA 4BGVA 3H9GA 4D43A 5HWSA 4LMRA 4AJJA 1C0KA 4XGKA 4OO3A 1DSSG 2EGGA 3JQFC 4NK5A 2X9NA 1M6HA 3MOGA 3FPLA 3ZWVA 4JGBA 1I10A 4PG5A 2C54A 1T4BA 2FHSA 3HJAA 4MVJA 4RPLA 1V3TA 3SX2A 3AWDA 3GN2A 1M6WA 2XF8A 4BNYA 4HKTA 4XYEA 1E5QA 2D8AA 1HDRA 3FWZA 4XJTA 3ZV3A 3M1AA 5B37A 3C3XA 2CVZA 2DT5A 3ONDA 5JE8A 2XXJA 4KWIA 1UDBA 2FR8A 2OGUA 2FZWA 3L6EA 1T24A 1SAYA 2HRBA 3DBHB 1AXEA 2DTDA 4LCEA 3ZWAA 4Z9XA 1BXKA 1XYGA 1U3TA 4CM6A 4J6FA 4FD3A 4E5PA 4NHEA 4FIZA 4IY1A 3NTRA 4BNVA 1XWFA 1YDWA 4WCFB 5KJCA 3KZVA 3OECA 4ID9A 3Q11A 2H1SA 3BMCB 3RFXA 3STHA 3OJ0A 1PIWA 3D0OA 2O4UX 4LVUA 5ITWA 3CKYA 3PWKA 4FQ8A 4W9NA 1EMDA 4OKIA 2C2YA 1YBMA 3AFNA 3HQ4O 1SOWA 1TB4A 3BMQA 3WJ7A 4K9DA 1GYPA 3BYZA 3WGZA 5JFOA 3ONEA 4PLCA 4BKPA 2DC1A 4BVAA 4M1QA 1PQWA 3JD0A 4KP7A 2GN6A 3M1LA 4BS9A 4D45A 3R6DA 4D46A 5I9NA 1H2HA 4M87A 3AK4A 4MOWA 3WGOA 3GQVA 1PQPA 1LLQA 2TMDA 3TZHA 4B8ZA 2EIHA 2GGSA 4YAIA 3T4EA 3FRJA 2UV8A 1FDSA 3V1YA 2AQ8A 2GZ3A 5F1KA 4R3WA 2P5YA 3RJ5A 1V3UA 4TWRA 1PU2A 2PZJA 2VRBA 4FGWA 3IL2A 5DP1A 3FR8A 4AICA 4DYVA 4FC6A 4CV2A 4CPDA 4YT4A 1FXSA 1ZK1A 2IYPA 1X7GA 3BMOA 2DUUA 4RVSA 2WE7A 1CETA 3OSUA 1HT0A 3ANLA 1Z7BA 3PRJA 4UVIA 3JQ9C 4BB5A 1LJ8A 3E9NA 5CAEA 2GYYA 4K28A 4MP3A 3VC7A 4XZ3A 2Y66A 3I23A 4RDIA 4JQCA 4YEDA 3RKUA 3UHAA 1VL8A 3AJRA 3C8MA 4J0EA 3WNQA 2PKQO 3KYBA 4GI2A 5IAAA 5KTKA 1NQAO 3IKVA 1IULA 1P1KA 1YBAA 5B4UA 1RWBA 2RIRA 1Q0LA 3ICPA 3P2OA 4FOOA 4Y67A 5IF3A 4FFNA 1E3IA 1T2DA 3QSGA 4IZIA 3JYLA 3K9QO 1PZFA 2OOSA 1C1DA 3GFBA 4MIEA 1YQXA 4FR5A 3V5NA 2TMGA 2W98A 2DFDA 3FHLA 3VPXA 4GVLA 2IEBA 1E3LA 5EN4A 5TQVA 1CJCA 2B0JA 4HX5A 1K2WA 4DQUA 1LDGA 4IDCA 2Y1GA 4TSKA 4RVGA 1GPDG 3JV7A 4LRSB 4DIOA 2YDYA 5JMPA 2X5OA 1DAOA 2JHFA 4W7IA 5KJEA 3ITKA 4FFPA 2VQ3A 1E5LA 3AUUA 3MCVA 4J2HA 3V2UA 1ML3A 1NWCA 2ZQZA 3HUDA 3WYEA 3E5RA 3U4HA 3ZWXA 1CDOA 1YONA 1L7EA 4GAEA 1N1GA 4I9HA 4LSMA 1ONPA 3U3XA 5JSFA 2QIOA 5I8WA 5HS6A 5C5IA 1EEHA 4WOKA 3TPCA 1GDHA 2PZMA 4I1IA 3GEGA 3WWZA 2GO1A 3TZCA 3L4SO 1ZNQO 5JCJA 1P44A 1CRWG 1HKUA 2Q1TA 4CQMD 3KB6A 3ZNQA 1OFGA 2BI8A 4DREA 2PK3A 4CLXA 7MDHA 1A7KA 1E3WA 3ROPA 1XEAA 2EXXA 2OL4A 3EDMA 1MXFA 3ENKA 2Y1DA 3FPCA 4DYDA 3MWEB 4FJ2A 4RVHA 1T2FA 1M67A 4K6FA 4MVJH 3D4PA 1DBVO 1NR7A 3ITDA 5A03A 1IZ9A 5DCWA 1P1IA 2PD4A 1A71A 3I9NA 2BMAA 4NQZA 2B4QA 1PGNA 1MP0A 5L4LA 9LDTA 3GGOA 4R1UA 3GT0A 4IMPA 5COAA 1ZK2A 4CUZA 1A9YA 1SB8A 4ITUA 4QUKA 1E0DA 1QRRA 1TA4A 3QVTA 4YA6A 3C85A 3PJGA 3ZZNA 5JAMA 1XELA 3RWBA 1O95A 2BFOA 3GVIA 3UW3A 5C3MA 3QE3A 2J3IA 2BF7A 3H65A 5ES3A 2EWMA 2R2GA 2NVBA 4A5OA 3EK2A 3B6ZA 3OJEA 3Q2KA 3C1OA 1GYRA 3EMKA 3QA9A 3Q3CA 4MVJP 3WMXA 1FF9A 3D7LA 1JAYA 4JP2A 1O89A 4NFYA 4AFNA 5LC1A 1B8UA 2C5EA 1J49A 1NBOA 2CY0A 5K0ZA 2FR1A 3EHEA 1LDMA 4JLWA 5F1PA 4EYEA 1A9ZA 3BMNA 3C7AA 5IXSA 4DL9A 2DM6A 3MJVA 5T8KA 5MGBA 4WK6A 2FOIA 4BO7A 2D4AA 3DC2A 1Z75A 3NTOA 1UR5A 1YJ8A 4CM5A 2I9PA 5KJFA 4CMGA 2OBNA 1GV1A 3I4CA 4FPXA 1OC4A 4D3SA 1AE1A 1PJ2A 4FCCA 3VTFA 1WDLA 5I7VA 4XYBA 1ID1A 5TGDA 4BO6A 2R00C 1D7OA 4FDAA 4YT2A 4QQRA 1ORRA 1Q7CA 1LTHR 1X15A 1DLJA 4E2XA 4B3IA 2YV2A 1E6WA 1UZLA 1P9LA 1F8FA 3BTSA 5CHEA 3WGHA 1KEVA 1RM5A 3KSZO 4IGEA 1KEWA 2PD6A 4RPHA 5KVQA 4DC0A 4ZQGA 1ZFNA 3AUSA 5I7FA 1Y5RA 3WDSA 2JD1A 2J6IA 3HN7A 1C0PA 3GVHA 1B8PA 3ZHZA 1YL6A 3Q9UA 3BMQB 2X6TA 3DAFA 3LF2A 1E1MA 3JYPA 4FSHA 3I9MA 3FI9A 2BHLA 1EE2A 4J1TA 1T1SA 3VZRA 2NTJA 2CSUA 1KC1A 2DAPA 4J9VA 4GLLA 4QO7A 3JQAD 2ZTUA 3DZJA 5FFFA 4J7CA 3ZWCA 4HFNA 1I30A 1YWGO 3RI3A 3ORFA 1IB6A 1C3VA 1V35A 2QHXA 3KETA 3QIVA 2O3SA 2X58A 4D0RA 4RLSA 4D42A 2DFVA 2GLXA 1SPXA 4TVOA 4LGVA 4GGOA 1LBEA 5FI3A 1W6UA 3BMOB 1SO8A 4Q3NA 3OJLA 3W6UA 4ALMA 2IDZA 2PGDA 1LDEA 5JO9A 4ZQBA 3EYWA 1SEVA 3KSUA 2NVWA 4RLHA 2VNAA 4UVGA 3ROKA 1NFFA 1ZK3A 3GMSA 3ZN2A 1C14A 3SLKA 3UCFA 4R1SA 3S2GA 1DB3A 1HLPA 2JAHA 2PZLA 5FWNA 1DC5A 3DBLA 2FP4A 1RKXA 4IJKA 3INTA 2ZTLA 3K30A 4O59O 3SC4A 5A1TA 1MG0A 4E21A 3QW2A 4OMUA 2X9VA 3CMCO 4J16A 4LVCA 1C1DB 1YS4A 2C07A 2E4AA 1JKFA 4K6CA 5C7OO 1UZNA 4KOAA 4IXTA 2V6GA 2NNLD 3B1KA 1BVUA 1MFZA 1Y1PA 1OBFO 1E3EA 3IKTA 4WLOA 1X7DA 1G1AA 4LSWA 2G76A 3KYCA 1EDZA 1V8BA 1ZO8A 5TSDA 2AQKA 5EIOA 4DMMA 1VRWA 1PGOA 1B7GO 3GC6A 1EBUA 3H3FA 3DZFA 7ADHA 4YPOA 1WAMA 1IPFA 4JROA 5B12A 5F5NA 5TF4A 5L3ZA 1XLTA 3WGQA 4CMBA 1BXGA 2H9IA 4B4OA 5EQFA 4NR0A 2JHGA 4TZKA 2VRCD 1U3UA 1WW8A 2WTBA 4BO9A 2YFHA 3RAJA 2NQTA 3R0IA 2BELA 3MWDB 1ZBQA 3D3WA 3O4RA 4E2YA 1GZ4A 4XD2A 1U2GA 3TZQA 4MIOA 1T4DA 3FF4A 2UVDA 4ZGWA 4XQEA 1O5IA 4II2A 1W0CA 2W8ZA 3MJSA 1CWUA 2HUNA 4I5DA 4BQPA 1DC3A 1W73A 1HE2A 1E3WB 5K6AA 3G49A 3HB4X 5LDHA 3LSYA 2EJWA 2BGKA 4KTVE 5G0WA 1LI4A 3CSDA 3JD4A 4ALIA 1LUAA 3I9OA 3ZHYA 1T2AA 3U4CA 1MC5A 2X0IA 3LT2A 2B4RO 4Q3BA 2IZ1A 4BKQA 2ZTMA 1QYVA 3HFGA 1VI2A 2NLOA 1G6KA 1LU9A 3WS7A 1P77A 2Y05A 5TT1A 1ZEMA 1HYGA 1K6IA 2JFFA 2NWQA 1NQTA 4CMHA 3ROMA 1HZZA 4WNCA 1Q2XA 1QP8A 2UAGA 3A28A 2QW8A 3W8DA 1YXMA 3DOJA 5AXDA 1UDCA 4CM7A 5CEEA 1LNQA 5B4VA 2RCYA 3K2EA 1XQ6A 1Y9AA 4U6QA 1PGPA 1ISJA 4E32A 5DZSA 4PIVA 4MVJF 3AM5A 4YACA 3L4BA 2G1UA 2AE2A 4HY3A 3UFXA 3V8BA 4OXYA 2O48X 1U5AA 3IAHA 4DGSA 1H5QA 1PGQA 3WTBA 1BVRA 3BMNB 3RJ9A 1BW9A 1NXQA 2J5KA 3PHGA 1GZ3A 3RUEA 1QLHA 1TLTA 1RM4A 4Q3CA 4JBGA 5I7EA 1ISFA 4LK3A 3PFWO 2Y0EA 3PLRA 1XKQA 2JJYA 3ZWPA 1UH5A 4B3HA 3A14A 2JAPA 4ALKA 1BDBA 2Y67A 3D4NA 3DFUA 4MVJI 1O9BA 4TRRA 3HZZA 5H83A 4ZVVA 4I5FA 3PXXA 3UKOA 1R15A 2NUAA 4O6VA 3WFIA 4IPTA 2Q4BA 4OKNA 3OFSA 4II3A 1SBYA 2GN9A 5JPIA 2NU6A 5EERA 5G4KA 3B1FA 5GZ6A 3I6IA 4E4YA 2X4GA 3BHIA 1KETA 2CDCA 5DNAA 1Y8RA 2HSDA 4BGIA 5C37A 1WDMA 5AXAA 3H5NA 1UAYA 2YHIA 1F06A 2A92A 1MA0A 5A9SA 4CUJA 2GZ2A 4WLVA 1ULSA 2W2KA 3ENNA 4A0SA 2I67A 4CMJA 2CDBA 5BSEA 1QG6A 4KZPA 4YT8A 3A4VA 4AJIA 2RHRA 5DBIA 5F3RA 1BSVA 2Q49A 1EUCA 3NV9A 3NYWA 3E82A 1D4FA 4CV0A 3P2YA 3W4IA 4JN6B 3NX4A 1T2EA 1ZSYA 4FGSA 4J9UE 3H2ZA 3WFJA 2Q1WA 3AW9A 4PFJA 3HDQA 5JY1A 4N54A 3DBRA 3RC2A 1QV6A 1HSOA 4B7UA 3LK7A 4YQYA 3G1TA 2X0RA 2BFAA 3G0OA 3GGPA 3V2HA 5JMWA 3GY0A 1A72A 1SZJG 1SMKA 2P5UA 4FFMA 3AOEC 3Q9NA 4YJGA 1DAPA 3PJFA 1RJWA 2JFGA 1HF3A 5AXBA 3ZDFA 4UAGA 2AA3A 2B35A 3W1VA 1UP4A 2B83A 4CL8A 4D0SA 2Y68A 3KLPX 2OORA 1QMGA 4AJPA 4U6SA 1LX6A 1FK8A 2EV9A 4NNJA 1HEUA 4A7PA 3MOIA 4XQ9A 2O3RA 3CPSA 3HWRA 4YAJA 4IJWA 4LN1A 4YVFA 4KDEA 3P5SA 5DOVA 1GFSA 5DBFA 4RF5A 3DBLB 4FW8A 2E6UX 1PL7A 3UF0A 3F3SA 4AJEA 2XAAA 1E77A 1BDMA 5B1YA 3SVTA 1LSSA 5A06A 3H2SA 4DMLA 3L6OO 2OFPA 1PWZA 1H6CA 3PJEA 4WOJA 2I5PO 2E82A 4GMGA 4ZA2A 5HS4A 1NASA 3IMFA 3WNVA 4WLUA 5JDCA 2YDXA 3E5MA 3WOHA 4P4LA 4CM9D 1YL7A 5JCXA 3VH4A 2P68A 1I2CA 2F00A 3KYCB 3PEFA 4F45A 4XYMA 1TEHA 1A7AA 1Y8QA 1T2CA 4FFRA 4ND5A 5EQDA 3VH1A 3DOOA 2VYVA 1BXGB 2B37A 2W2LD 5L9AA 3JYQA 4W7HA 2PH5A 2A35A 4L4XA 2R6JA 3ZWWA 4IJVA 3C1TA 1R0KA 4E5MA 5A04A 3PYLA 1JN0A 1GR0A 1K89A 1AN9A 5KKAA 3GG9A 3TNLA 3VZSA 1KY5A 5AVOA 5L7YA 3KOUA 4RGBA 3QWBA 3D3WB 2X7HA 3SJUA 4MPDA 4NBRA 4WEOA 1ISIA 2PKQP 4BV9A 4QFCA 4E12A 5COQA 1NM5A 3DMTC 3LLSA 1MG5A 2O3JA 1NTOA 4U0KA 1LRJA 3CINA 3D1LA 3MJ4A 5BQFA 4WE3A 3IUPA 4N7RA 4D3DA 4W4TA 2FR0A 4WNIA 1N92A 2UDPA 3G1UA 1G0NA 1DIAA 2VHVA 3I52A 2WYWA 4ND4A 1UXKA 2Q45A 1E7WA 4FN4A 1WWKA 3UCEA 3JTMA 1DHTA 3H9EO 4QXMA 4J49A 4I8XA 3AY6A 5BNTA 3ZV5A 1PJBA 1A27A 3DOCA 2O2YA 2W90A 3UAGA 1JTVA 3GVXA 1WZIA 4PVCA 2GN4A 2Y93A 3RUFA 1PS9A 1T26A 1ZZEA 3VVBA 4NFSA 1DRWA 1PZEA 2I6TA 3ASUA 4P4GA 3CTMA 1LQUA 1ENPA 3RUCA 3ULKA 3IJPA 2LDBA 3GDOA 2ZYAA 2BGMA 3C1AA 3U4IA 2Q1UA 1NPDA 4NDNE 4H15A 4RF4A 3VOSA 4F46A 1I5RA 3E48A 1PX0A 3HE3A 1DFIA 1I2BA 4GGPA 4R54A 5TLSA 2LDXA 4U5QA 3W6ZA 5L95A 4RQUA 1AUPA 4O0LA 1AHHA 1U8FO 4OIMA 1L7DA 5L51A 3K5PA 4R68A 1DIGA 3BZUA 4BNTA 2B69A 1LC3A 3HDJA 4NIMA 4YYZA 1GADO 1ISGA 3KTDA 5IDQA 1GD1O 1YO6A 4MVJE 2I3GA 3JYOA 1BW9B 2VWHA 1LLDA 4JNKA 3LVFO 1DOHA 1QYDA 5L4SA 2VT2A 3OBBA 5JDIA 4GSKA 1HRDA 2ZQYA 2DUWA 2VOJA 4ALJA 3QVWA 4H7PA 3ICCA 1QV7A 5JYDA 2ZB7A 4HADA 4PLFA 3QVOA 2JFHA 1PEDA 3KLMX 4Z3DA 3HG7A 2Y0DA 3GDFA 3DL2A 1X0XA 3RQSA 5THKA 3QVXA 3ZHBA 3JD1A 4JBHA 1HE4A 4XB2A 1MX3A 4W82A 1F17A 3AU8A 5G4KB 2YUTA 2WMDA 1ADGA 1DEHA 1M66A 3EVTA 3M6IA 3R3SA 3SXPA 3PHHA 1Y8RB 2C20A 4DIFA 4BNJA 3JQBC 3OJOA 4IINA 4B4WA 1N1EA 2YHIB 1WZEA 4BKRA 5A9SB 1XCBA 4GMFA 2B5WA 3DO5A 2W2KB 2VZ9A 4YQZA 4QSMA 3RUAA 1GCOA 3D3EA 4E30A 1YL5A 2WWRA 4TKMA 4PLWA 5IZCC 3CIFA 2QYSA 1P31A 4EJ6A 4W99A 2VUUA 3SBOA 5EINA 4GX2A 1J5PA 1NNUA 2X9GA 3OETA 4CV1A 2BRUA 3TRIA 2SCUA 2ZYGA 3GEDA 4ROSA 4UVHA 4YJFA 1V3VA 3ZNOA 5CEFA 1PS0A 2WYVA 1SNYA 2BH9A 1E3SA 3PDJA 4RV9A 3F5QA 3Q6IA 3DBRB 4IDAA 2D59A 2EW8A 1DIHA 3WQRA 1PJTA 4YJGB 1J6UA 1EVYA 2PR2A 4EUFA 3DDNA 1R66A 3ZHXA 5HTOA 4PGFA 4BUCA 1ONOA 3PQFA 1PGJA 5KJ1A 1DO8A 4XQGA 4E5YA 3B1JA 5TS3A 3TZKA 4MO2A 1R4NA 1JQBA 4XQCA 4A27A 3O8QA 2FPGA 4NZ9A 3I9JA 4UEOA 4ZD6A 4NK4A 1AGNA 3GVCA 3CEAA 1PJLA 1B2LA 4M8SA 2WE8A 3CH6A 5U9CA 4R9RA 2ZCVA 1GV0A 4J0FA 1X1EA 1DJNA 1LSJA 2V65A 3ZU3A 2CF5A 2B36A 5CPBA 5JXWA 3UICA 4YRBA 2BLLA 3S2FA 2Y1EA 4XDZA 1GPJA 5IDXA 1O0SA 1IHYA 5CG1A 1W8DA 4Y6PA 4WCFC 3RBZA 4R1NA 3PQDA 1JLLA 4E33A 2C59A 3M2TA 2V6MA 2FWMX 1X13A 3OQ6A 3QP9A 2IXAA 4XDYA 1IYZA 3GVPA 5DULA 1VPDA 1D1SA 4J1QA 1ENYA 3F4LA 1NQ5A 1K6XA 3LT0A 1GEGA 1Y8QB 1B15A 3Q0EA 3WIDA 1I3KA 5DOZA 4UEKA 4PLZA 4NH4A 5DN9A 2Q50A 2RAFA 1B16A 3HFSA 3U09A 4IUYA 3CUKA 2OO5A 1ZXBA 1P45A 1VC2A 1JA9A 1Y9EA 4JK3A 3OEWA 5CDUA 3KVOA 2VHYA 3GF4A 4RZHA 3NDRA 4S1VA 3RSHA 4DLAA 3PHIA 2HMVA 3ZWYA 2BGLA 4H3VA 5U1PA 4ESOA 4GBJA 4CV3A 3C7DB 4TKLA 1DC6A 3H5AA 3FD8A 3DAGA 2YW9A 4FFOA 3T4XA 1B0AA 1G0OA 4OL9A 3RASA 2C7GA 1P1RA 5KKCA 3WQQA 2VYNA 4BNWA 1ADBA 2YY7A 2PFGA 4TVBA 4GKBA 3NUGA 1LLUA 3DHEA 4IIVA 3V1TC 4Z6KA 1PJCA 2VWQA 4XRRA 4M55A 1R12A 3JQFA 1NPTO 3H9JA 2V6FA 4YAKA 5KJ6A 2VWGA 1GY8A 3AUAA 3UN1A 3E03A 2CFCA 2DBQA 3QWIA 4E13A 3ST7A 4XX0A 1PJ4A 3O9ZA 4B7CA 1ZSNA 5T57A 4NU5A 2QRLA 2P9CA 3TDKA 3L9XA 4AJNA 4IDGA 1K0UA 1ISMA 2EW2A 5JLAA 4DLBA 3JQ7A 5CDYA 2NTNA 4NJMA 4NJOA 4OYRA 1NPYA 4MIYA 6LDHA 1JW9B 2ZJ0A 3QRWA 4BIIA 1ZUD1 2HO5A 4CJXA 2D5AA 4DA9A 1PJ3A 2FZEA 1MGOA 1E7QA 3OM9A 4IDFA 5J23A 2G17A 3ZW8A 2IRWA 3KSDO 4HUJA 3UVEA 3ZWBA 5G0TA 1ZH8A 3BHMA 4IIUA 3RBVA 4OXKA 4HXYA 1XQ1A 3COSA 4ONEA 3GGGA 2P9EA 4HV4A 3FWNA 5BNFA 1K3TA 2Y99A 1H2BA 2VWPA 3DMYA 1MC4A 4KWHA 4H16A 4D41A 1QLJA 5JC8A 1CQJA 4MVJD 2ZTVA 4BO8A 4NFHA 3IQDB 4DIBA 1ARZA 1I33A 1YB5A 1PR9A 3GAZA 1U7TA 4DVJA 2W2LA 1H93A 1VJTA 5JW6A 2WJPA 1TT7A 1PQUA 5A4DA 2CVOA 4MKXA 3FCOA 2GCGA 5DP2A 2HAEA 4EZBA 1V0JA 5BSGA 3AY3A 3PQEA 5COBA 1EFLA 2FPPA 4XR9A 2GERA 2C29D 3PHJA 3LZ6A 4GLOA 1GEEA 4INAA 3RC9A 4AJOA 4YR9A 1I2ZA 2X0JA 3DHNA 5K9ZA 3H4VA 5U4QA 3BHJA 4U8GA 4KUGA 4PRLA 2J3JA 4CMEC 2HK7A 3B20A 2VUTA 4RCVA 1FMCA 4RPKA 5TJ9A 4PZCA 1AHIA 3S2IA 3OQ1A 3DTTA 5TNXA 3FN4A 4D44A 3JSAA 3ROQA 1OI7A 4CLRA 1KYQA 2EKPA 4JJIA 3JQ9A 2QRJA 3G17A 4NMHA 4DRYA 4ALLA 1DRVA 2YQ4A 2O3UA 4J43A 4IGFA 1UUFA 5G4LA 3PZBA 4IS2A 3WGGA 3TWOA 3RFVA 3GMDA 3Q1LA 4BNNA 1Q0HA 4UUNA 1WDKA 2Y1OA 2VOEA 4YDRA 4L0QA 2ZCUA 5ILGA 4UUOA 1RYEA 3HB5X 1MXHA 3WYCA 2PY6A 4ZRNA 3PZRA 1XA0A 3CE6A 5JYEA 4HWKA 4PLPA 2PTGA 3GG2A 1DFGA 3WBFA 3L9WA 5JBIA 4ZHSA 4UULA 5I9MA 2JD0A 3QWFA 4NI5A 1N7HA 1R4NB 4ZQEA 3E9MA 3O8QB 4YB8A 5HM8A 4PLHA 5TIIA 4FFLA 1FDVA 1ZJZA 1ZJYA 1EE9A 5AYVA 1VKNA 2JCXA 1GL3A 2X5KO 4CLEA 5EMHA 1JU9A 5EL0A 5EPOA 4FBGA 3TJRA 4F6LA 5TX7A 1UXGA 4RL6A 4IDEA 1NWHA 4XEHA 2E48A 2PZKA 3BAZA 5TJHA 4ND3A 2NQ8A 4MDHA 4BO2A 4PLYA 3MJCA 3TFQA 2HMSA 2GZ1A 4Z0HO 4CMKA 4URFA 1DIBA 1P0FA 2Z1MA 5JO0A 1NQOA 1PSDA 3M2PA 4CM3A 1NP3A 2O4CA 1P1FA 4L8VA 4LW8A 4XYGA 2G0TA 4D7AA 1Z73A 2QZ9A 3FTPA 2JKVA 1L1FA 2D5CA 1H6BA 3L07A 1A5ZA 1KERA 2DBVO 4CUKA 2EGHA 4DXHA 4W9NC 1LLCA 1U3WA 3VDRA 2FY8A 1E7RA 4XWYA 1RPNA 3GRPA 5GMOA 4I08A 2Z5LA 4QEDA 4DWVA 4A2CA 3W4KA 4K1LA 5CFZA 4ILKA 4CLHA 4HFMA 1HWYA 4MINA 2AG8A 4DQVA 3VPSA 2IZ0A 4GPD1 3VPGA 4DPKA 3B70A 2VUSA 2EP7A 1YOVA 1BXZA 1YKFA 2AEFA 2GD1O 3X2EA 4AJ4A 4DQXA 3A9WA 3S2EA 4D3FA 1I0ZA 4RPJA 3PI7A 3D5QA 2ZKLA 5DT9A 8ADHA 4Z9YA 3ZU5A 2DKNA 4J3FA 5G0SA 1R0LA 3RUIA 4CR6A 1KY4A 2D2IA 3OMLA 1GUFA 4K26A 3VHRA 3WTCA 2Z95A 1U4OA 3AY7A 4BB6A 3P7MA 2NU8A 4CLOA 2PV7A 4CQLA 5B4TA 1I3MA 4J1SA 3K31A 2GSDA 1UXIA 3IJRA 1NFQA 1RM3A 2A9FA 3PWZA 3Q2IA 3AOGA 1WLYA 2IZZA 3UGKA 2VZ8A 3PGXA 3RBXA 3KM0A 4BL5A 3GOHA 2VHXA 1N2SA 3CMMA 2Q2WA 1LDNA 1O8CA 3EAGA 3S8MA 3LDHA 4GX5A 3ANNA 2EP5A 1CQIA 4EJMA 2HK8A 2O23A 1CERA 4P4NA 4JP3A 4BNFA 3PJDA 2A4KA 3S1LA 5JCJD 1EQ2A 4RO0A 4IQ8A 4BOYA 2PWZA 4XA8A 3NJ4A 5A9RA 5KVVA 1X0VA 4NG5A 1HDGO 4RZIA 3WSVA 2C82A 1DLIA 1QORA 1U4SA 1YH3A 4B4VA 4J4HA 3SLGA 3JQ7B 3N58A 4MVJG 2GUGA 4CQMA 4NJMB 3IOYA 4WEQA 1ULUA 4L75A 3GUCA 4A73A 4I5EA 1TT5A 1LC0A 2VCYA 4Y6RA 3TOZA 4D79A 3NDJA 1GZ6A 1H0KA 4G2NA 5I7SA 1LXCA 4I5GA 1HDOA 1ZW1A 2AMFA 4KUEA 1BMDA 1EZ4A 4LCJA 1UP6A 1YBVA 3AM4A 4IM7A 2R00A 3WMWA 1GUZA 2WSBA 3IC5A 4AJLA 3GK3A 4WASA 4J90A 4C7KA 3NDIA 1HE3A 1TI7A 1YB4A 2C2XA 2E49A 1OOEA 3TL2A 4AVYA 2AEMA 4EBFA 2X1HA 2BI7A 4C4OA 2WYUA 4YJHA 1DRUA 3CZMA 3IUSA 4HNHA 4UVDA 5KWEA 5HA5A 4JCOA 2HDHA 3GA0A 3EGOA 3G79A 4Z9FA 1C1XA 1SCUA 3W8FA 4MVJM 4ZQFA 2B4TO 5F21A 1B14A 2HK9A 3OP4A 3OA2A 4X54A 3GNTA 3SC6A 3DXFA 4U0JA 2PD3A 1R0SA 3UXYA 3H9QA 1SC6A 4M86A 3MTGA 2A94A 3GZNA 2WD7A 1IE3A 1ZMOA 1PZGA 2P91A 3GH3A 3KEQA 5DCUA 4IQ0A 1PL8A 2EG9A 4QECA 3VPFA 3DAPA 1IL0A 1P74A 3C7CB 4KMSA 3OH8A 3R3JA 4Q39A 4FOSA 1R16A 1EVJA 2Z1NA 5A02A 5ILOA 5JAQA 2PA3A 3TQHA 4NBWA 3ZU2A 4U7WA 3HNPA 4MJLA 2Q2QA 2IE0A 3GPDG 3QWHA 3KRTA 2NU7A 3O38A 4OOEA 4WLFA 3GRKA 1LQTA 1JAXA 1E1KA 2RH4A 1YRLA 1QKIA 3PGJA 3CXRA 3WR5A 2Y0CA 1JKIA 5A5FA 2D1YA 3WSWA 1T25A 1EUZA 3DZBA 1QSGA 3ZU4A 4J7UA 1ZK0A 5C7IO 1JWAB 5GZ3A 3HDHA 1AXGA 3QWAA 2J5RA 4CM8A 4UUPA 3K8ZA 4OQZA 2DPGA 2ZATA 3H8VA 3AI3A 2GDZA 4EEXA 4WUVA 2IODA 3WX0A 4XGIA 1Q1NA 1X14A 3ETGA 2FSSA 2YV1A 4NU6A 2FN7A 3NKLA 3E1KA 4E3ZA 1ENOA 1KVRA 3IS3A 4XIYA 1GQYA 5T8KC 3GDGA 2YYYA 3GNQA 2ET6A 4B7XA 2V7PA 4S3MA 4YT5A 3JQAA 2ZK7A 2YHUA 4OXNA 5BSFA 3ZV4A 3QQPA 4IBOA 4N18A 1TVEA 1IHXA 1NVGA 3BA1A 1B3BA 1Z7EA 3LU1A 3ZGYA 1QYCA 4LRTB 3VZQA 5L45A 3ADOA 1NFRA 1ZCJA 5T67A 3ZH2A 4FS3A 3KXDA 2NV6A 4OAQA 4CMAA 4B79A 2IXBA 4PG6A 1S6YA 1KC3A 3GLQA 5DBGA 5L4NA 4KQXA 1X1TA 2D0IA 4TRMA 1VSUA 1EFKA 1HXHA 2BKAA 4GWGA 3DTYA 3VVCA 3E9QA 4TRJA 1J4AA 1I3NA 1M76A 3NRCA 5FF9A 5AOVA 4NBUA 3INGA 3JQ8A 4YWJA 4NPCA 4CR7A 1M2WA 4RPGA 2CUKA 1E1NA 1N5DA 2EEZA 3OQBA 3RROA 4ALNA 5JAIA 1JWBB 3FBGA 2HMTA 3RU7A 4BGUA 1YVEI 5AXCA 3L6DA 4F6CA 5ADHA 3OIFA 2PLAA 4TMFA 4BO0A 3WQSB 2D3TA 1YOVB 1EK5A 1JDJA 1KS9A 1JKJA 3TOXA 3A1NA 4MP8A 3RUDA 1MLDA 3MJTA 1JVSA 4GX1A 1D8AA 3TZ6A 4PG8A 4UEJA 3U62A 2X0NA 2DTEA 3V1UA 2OMEA 3GPIA 4O63O 4CODB 4LMPA 3MTJA 1HDCA 1C0LA 3DZKA 4A03A 3PYXA 1UDAA 1BWSA 4JJGA 4BV8A 4CLOB 4CQLB 3HN2A 1I36A 4WGGA 1K5HA 3TSCA 4IS3A 1NVMB 1O6ZA 3PLNA 2I65A 3OF2A 1MFPA 2VHWA 3VH2A 1Z45A 4JXKA 5JAZA 2BFMA 4OJNA 4PVDA 4GSLA 2C5AA 2IEDA 3ZNPA 2P2SA 3TF5A 2AHRA 1D3AA 3LYLA 5I9LA 1HL3A 3JCZA 1DFHA 2YFQA 4J4TA 4Y9DA 1UXHA 2NTVA 3NGLA 3LF1A 1P3DA 3DBVO 4R01A 5IG2A 2VRCA 4XYLA 3GHYA 2O2SA 4FJ1A 1F8GA 1XR3A 3I5MA 1KOLA 1GQ2A 1VM6A 5JY6A 1MUUA 5F5LA 1JVBA 1DHRA 2DVMA 3NT2A 3VDQA 4BKUA 2QQ5A 4Z0PA 4YRDA 4P38A 3BTOA 1A4IA 3FNFA 4B8WA 3I9LA 3OIDA 1N8KA 1N9GA 2WEKA 4MP6A 2QZZA 2DBRA 3PFFA 5IN4A 1ZKMA 4UUMA 4ZRMA 4BO5A 2EKQA 4XIJA 3N74A 4G65A 4WJZA 4CQMB 1WP4A 3SEFA 4WCDA 1TT5B 3WG9A 1HYHA 1LSUA 3PDUA 4MKZA 1HDXA 4GVXA 5ER9A 4R4JA 4Z0TA 1YJQA 2Q2VA 4Z3KA 3KEOA 1LA2A 1NAIA 3BIOA 3HSKA 1KVUA 3FR7A 3QLJA 1BRMA 3RIHA 3LLVA 3P19A 1OC2A 1U3VA 1ISHA 1KEPA 3IP1A 4GWKA 2I99A 4YBZA 4J91A 4MKRA 1ZXLA 5KVCA 5G0VA 1SOVA 3U49A 3NAQA 4AJHA 1BGVA 2X86A 3UUWA 2O3TA 4YJHB 1WPQA 4GL4A 2VN8A 1HSZA 1QYWA 1NHWA 4AG3A 4BNMA 3U5TA 4RVDA 1SEPA 4YJDA 4O1MA 2FPIA 3RU9A 2H6EA 2AE1A 1YGYA 1U8XX 3WGTA 1C1XB 1U7HA 1KIFA 1ZEJA 2EERA 2H63A 5I8ZA 3TN7A 4AJ1A 2ZJ1A 5H82A 1M75A 4BNUA 1FDWA 5T5QA 3GFGA 1VJ1A 3ASVA 4OM8A 3N7UA 5IXYA 1XSEA 2G82A 4GX0A 2Q4EA 3GUYA 3GZNB 5ICSA 2WD7B 4BMNA 2J3KA 1I3LA 3ANMA 3R1IA 4HNGA 4OOFA 3L0DA 2OP0A 4J2OA 4L73A 1DXYA 2X5JO 2Q3EA 2QX7A 5K6AC 1E92A 1YE3A 1U9JA 1Q7GA 8LDHA 3BXXA 3FTNA 4BMVA 4E2ZA 4GQAA 4DBZA 5FI5A 2ZB3A 1Y5MA 3KUXA 1O94A 4EJ0A 5JS6A 3AOEA 1GAEO 3INRA 3JQEA 4KDFA 3ETEA 3K6JA 1B3RA 3JD2A 1DC4A 2BD0A 3UH1A 4KTTE 4IDBA 4HFRA 1NVTA 2AEJA 1WNTA 3AU9A 4RVFA 3WIEA 1RYDA 2C0CA 3ON5A 1H6DA 3UOGA 3WJAA 1XGKA 1UXJA 5CDSA 3E6AA 1Z6ZA 3WGIA 2DQ4A 1U28A 1PR3A 3EY4A 2UUPA 1A4UA 3K96A 3WXBA 4PN3A 1P1HA 5ICMA 1LDYA 1I01A 3FBTA 5DF1A 5GY7A 1DIRA 3VH3A 4F3YA 3PWSA 2P4HX 5G2OA 1EVZA 2I3AA 4HFJA 3ZCXA 3WBBA 3FSRA 4CM8B 2QRKA 3L4BC 1PTJA 4QT0A 1KBZA 1EK6A 3RUHA 2WDZA 5L53A 3X2FA 1DJQA 4IQGA 2YQ5A 2Y1CA 3PHLA 4BQRA 3I4FA 5CDTA 2ZIZA 4RQTA 4RJTA 2OXIA 1VSVA 2AW5A 5IN5A 3GZ4A 3D5TA 3AUTA 4NBTA 3GNSA 2RH8A 4Y8VA 3DONA 4XR4A 3F9IA 1EQUA 1ADFA 3JQAB 2OP1A 4M49A 4IMRA 3ZI0A 5CG2A 2ZB8A 1EDOA 4ND2A 3DB2A 4BNXA 4RF2A 4WLNA 2PH3A 1PJQA 1WMBA 2HQ1A 1CIVA 4IDDA 4OGWA 4M54A 3WLEA 2RHCA 2JCVA 4BNGA 4Y6SA 4WKGA 1ONNA 4R9SA 2DPHA 5ER6A 4CMIA 3DZGA 4QTZA 3VZPA 4EUEA 3F5SA 2UUOA 4ZJUA 1NAHA 1XU7A 1GUYA 1P1JA 4PG4A 3JQ8B 4CMCA 1Z82A 3JQ6A 3DR3A 4DBVO 1B8VA 3DMTA 3UCXA 1PJSA 3BTVA 4CM1A 2GASA 3K92A 2GF2A 4BO4A 3F46A 1YQGA 4YXFA 1WVGA 5A5EA 3VAZA 1XDWA 3KO8A 4WLEA 1YDEA 5IFLA 3V2GA 2CNBA 4OSOA 5LCXA 1RM0A 2HLPA 4BKOA 5HBRA 1OZAA 3D64A 1HTBA 3K2BA 4UVEA 3TL3A 1Y7TA 5L7WA 3OJFA 4N5LA 2JD2A 1R4MA 1UZMA 2HJRA 2JCYA 1KVTA 1E6EA 2O50A 4TRNA 2Y1FA 3AM3A 4RVUA 4CM4A 1Y6JA 2VNSA 5TT0A 2J3HA 4BNZA 3JQGA 5DDIP 1IOLA 3NEPX 4CM9A 1EBFA 2VYVD 3AI2A 2PKRA 2RBEA 5MDHA 5BR7A 3OEYA 1HDZA 2I66A 3DZIA 2WM3A 4OHUA 4R69A 5A9TA 2CMDA 3K73O 2H5LA 3NTQA 4PLTA 4E0BA 3QVSA 1W4ZA 1MV8A 4XKJA 3MEQA 3QY9A 1WMAA 4BNKA 4B3JA 5GZ1A 1VE9A 1VL0A 1KVSA 2NACA 2NVUA 3MJEA 5A3VA 1KVQA 3PTZA 5TRTA 4ZU3A 1FJHA 2EHDA 3F6YA 4BNHA 4YTEA 5ITVA 3F47A 4EGFA 3H7AA 3NJ8A 2XPCA 3FNEA 3VKVA 3RD5A 1LRLA 1N9GB 4YCAA 2HCTA 4EI2A 3O03A 4DUPA 1R37A 1YQDA 1I24A 4CL3A 1P33A 3EVNA 4ZQHA 3T7EA 1TXGA 4XB1A 2HRZA 4I9NA 5JDCC 2P4QA 1U1IA 3GN1A 4JJFA 1F14A 2GN8A 1H9BA 3SJ7A 5THQA 1SB9A 2BFPA 3ZW9A
chains in the Genus database with same CATH superfamily
5ADWA 1ECCA 4UTNA 1UKEA 2OBYA 2OGSA 3TAXA 4N4AA 2HN9A 1PT9A 5KOIA 5CDGA 2WTEA 4UHDA 3EZYA 2H7CA 2X3YA 1TIPA 3NBAA 3K8OE 4UNRA 3OG9A 2ATVA 2ON6A 3TIXB 4Y98A 2PGIA 3CURA 2ZBEA 1SK8A 1ZUNB 3F9RA 4ON9A 2V74B 1DQPA 3J80A 1XU9A 2VTEA 1R6DA 2W93A 3L8YA 2YS6A 3TZBA 4GZLA 4DMCA 4QC2A 3H0EA 4HJRA 4B2YA 1PWXA 1J07A 4MYRA 4NE7A 2MIIA 2PKCA 3IALA 4R51A 3EFEA 2BEVB 3JQBA 4CKCB 2WJIA 3T34A 3ZCTA 2J8ZA 1RLMA 4KLRA 4GR4A 3IIEA 1ENZA 5FD8A 3IQXA 3DV0B 2POQX 3THXB 4MA4A 1NUAA 2QLBA 5D51S 1NM5C 5AUNB 3IV6A 2Q4OA 2GZAA 5CFQA 1L8AA 2DWPA 3I5AA 2R6ZA 4AJ2A 1F48A 2WAAA 1OXTA 3KD2A 3DZHA 4IH9A 3W79A 3ZD9A 3TOSA 2PGJA 3QG1A 1W1IA 4LQCA 1WV0A 3NHAA 3I83A 3TGWA 4WNAB 3DLCA 4C2TA 1NX6A 1OJLA 3UYLA 4KR2A 3H6KA 4DTIA 1UMKA 3R4VA 5BYJA 3PUJA 1ZUWA 3F7TA 1EFTA 1HZJA 2GM3A 1Y37A 2QRGA 3PK0A 4N5HX 3FPKA 5FA6A 5K8JB 2XUFA 5J63A 1YFJA 1FLAA 3H9UA 4C2UA 2FF5A 3O2NA 1V71A 4IIYA 3PKJA 4LF4B 4YMHA 3PUZA 4TYNA 1JB1A 1ESMA 1DG1G 2QWXA 4M89A 5D1NA 1V95A 2VS1A 2M6SA 2Q46A 1CHDA 2Z57A 4PLGA 2ZTSA 3C3EA 2YV3A 3SZMA 2PX5A 2XUDA 4O4JF 2D54A 3A1VA 4PG7A 5ALUA 4DARA 3IMKA 1SUPA 2JEYA 2X1VA 2IS6A 2GPTA 3G5TA 2W4QA 4XUEA 1IBKB 3OIYA 1IY8A 1ZD8A 4Z9BA 3B2NA 3WJ1A 5JD4A 3P4XA 2OAP1 2FLWA 4M8LA 1CRPA 3CSUA 2ZJYA 3IDSA 3EWNA 1FX0B 2CVHA 5NULA 4RFVA 4GH5A 1ZNXA 3R3WA 2YMQA 3DNFA 3TLGA 1OH6A 3G8BA 1JFVA 3EWIA 2G1AA 4ZN6A 1CS0B 1S7CA 4L9RA 2WHXA 5E4YA 1BWQA 1RMQA 2HNKA 3EXHA 4Q93A 2XSZD 4WN9B 5FKJA 5K1ZA 2CD9A 3CB4A 1JF8A 4NYJQ 1XE3A 5IEBA 3W9BA 4DPMA 1C7ZA 1F0YA 3F6SA 4OK5A 1QXSA 3DO8A 3KV3O 1Z33A 5EMLA 1VPVA 5IJXA 4WK4B 1A7UA 4J76A 2VJKA 4G09A 3EUWA 2M1XA 2HCRA 4BNLA 2O8CB 2V54A 4CHGA 1JEAA 4WECA 1YE5A 3RU3A 5J2UF 2FETA 3UBMA 3L0YA 2PN1A 3KWLA 2VT3A 3ONFA 2CNOA 3OZAA 2C5BA 4RMJA 5SYNA 3ZEIA 1WR8A 1DCKA 1P4HA 5JDIC 2GETA 3UHJA 3HS3A 3HUEA 2OCYC 4YRMA 2FEMA 3UY4A 4ZGBA 1EG2A 2H1RA 3FOEC 4QDXA 3RC1A 4DBLC 4OHFA 4A6EA 3D4OA 3KOOA 1E8NA 1W5EA 2DF8A 4ACBA 1OXKB 3G0IA 4X97A 2DX7A 3EHDA 4LBZA 2OKGA 1R64A 4OV6B 3ZQKA 3CVOA 3K1ZA 2HA6A 4KQHA 2OK8A 1X39A 1Z74A 1PF7E 4MEBA 1NJ1A 4RF3A 3L3BA 4DJEC 4J0KA 1SCIA 2PMFA 4F1KA 3LPMA 4PLVA 3BE8A 5HQTA 4R5HA 1YR6A 3PTAA 3QUQA 1LSOA 3ODPA 1K97A 3HJGA 4OQNA 3OA0A 1KH1A 2ERYA 3DHYA 1Q1QA 3CCCA 4KXLA 5FEUA 1W8IA 3A1CA 3F1KA 2H65A 2XLBA 1B43A 2QT1A 4A0QA 1M2KA 3IQFA 2IH2A 4LZNA 4GIBA 1EM8B 4LX8A 3P45A 4XGNA 4XSVA 4ZO9A 2OHFA 2OHXA 4YWHA 4C0KA 1Z62A 2X22A 4EVQA 1UZUA 2GKGA 1XWWA 1AGRA 4FEAA 4L4RA 1P73A 1UJCA 3OICA 3W4JA 4G81A 1U04A 4FUTA 2WZBA 4MS1A 1V8ZA 2ZI3A 1Z5WA 4HP8A 3FUTA 4J6EA 3MTEA 4JC4A 3HP4A 3V6MA 4BVHA 3V46A 4S04A 1E62A 1ACJA 2NXEA 2BYTA 1UJMA 4MV6A 4B80A 4CM4B 4I14A 4N5NA 4WZZA 5IK2A 4RZ3A 1FTWA 4EW6A 1SCQA 2ILTA 1IUKA 3ERCA 16PKA 3JQGB 1P2DA 1U8ZA 1AKYA 1REQB 2WUWE 4RPJA 1ZD1A 1ZSVA 5JD5A 2J9YB 3PIIA 4G5SA 2BEUA 2H85A 2NOAA 1ZIXA 3OHPA 4MUNA 5ECYA 3B1YA 1RACA 4X60A 4B8YA 2VK4A 4OJQA 4WSOA 1RYYA 3O3OB 4IFEA 1TPYA 1Q7BA 1QNLA 2G77B 2ZRGA 3F67A 4L6IA 2E85A 2PNFA 4YCMA 2JAQA 3ADPA 3KQUA 2ERXA 2HWYA 4IHJA 3S29A 3BXZA 3LXUX 5K01A 1P0PA 2VNJA 4MR7B 2ORWA 3IV7A 2DXIA 2R66A 2QLTA 3OQJA 3ZLTA 4JLAA 1PD1A 1LEHA 4I7EA 3F6RA 2QM8A 1UBSB 1EUQA 5L40A 2YZ7A 1PQYA 1L9XA 3DM9B 4S2UA 5HRUA 1SBNE 1JA0A 2QN2A 1T5TA 2PQMA 1GUBA 2QLFA 1O87A 1NW7A 1AC5A 3RIMA 3F74A 4J4BA 4N0QA 1JDUA 2WVAA 4NBVA 1HYEA 4ATNA 1YR7A 2VPXA 3NO4A 3IB6A 2RJOA 2NM0A 5ENVA 1YDFA 2ZU0C 1OAAA 2IXFA 3LZCA 4M1ZA 1FP6A 1BHSA 3E8SA 1XQVA 1OT3A 3IAM1 1EGVB 1EHIA 2JFOA 4LRYA 3UT0A 4MH0R 1PZHA 1SQFA 1I1HA 1K86A 1QPBA 1NXVA 1ZC3A 4LXQA 4ZK6A 3LO5A 2DCUA 1X2EA 1M5UA 2ZI5A 4MQFB 2RGWA 4D96A 5KWJA 2B20A 1IHOA 1M2NA 2XCTB 1KH2A 2YJ5A 4HZGA 5HIIA 4CLRB 2HU2A 4YV0A 3PGMA 4B6OA 1JU3A 3JRXA 4R83A 3UG7A 4E5KA 4G5HA 2IH4A 3KSRA 2QRQA 4RH1A 4M9CA 2C7VA 3C4QA 5TC4A 3FMOB 1GNTA 3JQCA 4HLUC 4X7MA 1XA3A 4ZT5A 5FYDA 5LIPA 3GAFA 5E7IA 2IW1A 1CYEA 3LT4A 3AIMA 1DKNA 3BERA 3PC4A 3FWPA 2VDKB 1ABEA 2BP7A 4KQWA 2ZZMA 1PL6A 3EZLA 1U0RA 1D2RA 2GX6A 3CFYA 3K15A 3PV0A 2QPAA 2IYEA 1U5CA 3E9CA 5FOXA 2R11A 3I1JA 4RH3A 1LRKA 1V9LA 2HDWA 2P9TA 1THZA 2JJMA 2Q9AA 4W5RA 2Q5CA 3IBCA 3K1YA 2ZITA 1E7MA 4XX1A 3REOA 4DRZA 1N6KA 1W49A 4LWOA 3U9TA 5BWOA 1AUOA 4PZDA 1S2NA 4WOBA 2AXQA 2XODA 2HU5A 4BUZA 2F67A 3RWOA 4F3RA 1APBA 1ZNYA 4Q7MB 1YASA 4Q9NA 2WU3A 5F3WB 4QX6A 5DVZA 2Q4RA 2ZAOA 3PNLA 8ABPA 1LK7A 4YCBA 5COBA 4MA0A 1EFDN 5TQ2A 4BGVA 2YRFA 4LMRA 1R6BX 1H0RA 4AJJA 5IM4F 5CT6A 4FLFA 4IO1A 3B36A 4NCHA 2Q3DA 4OO3A 2X9NA 2B6NA 1G21E 2YOHA 3FPLA 3ZWVA 3NIBA 2VXBA 1C3LA 2LCQA 1I10A 4PG5A 4OHWA 4Q02A 3K3PA 3FW1A 3NBMA 1BE0A 2OB1A 3DNPA 1T3GA 1AQUA 4LFAB 3AG6A 1TUIA 5CT9A 3IE0A 1KZ1A 2PH7A 3NLLA 2QUZA 4L4ZA 4HZIA 4HKTA 4X6UA 2I2FA 3QFSA 4DCMA 4RK5A 2GN2A 4RESA 1CJTC 4ZI2A 1FTYA 3DKVA 8GPBA 2FVYA 2VTBA 1GM5A 4UBIA 3VI4B 1Y7LA 2VF5X 3K9NA 4GVPA 1L7AA 1H2RS 5ESRA 2DT5A 3ONDA 5INTA 4EHFA 1M0TA 4G0XA 2FR8A 4F2GA 3SN6A 1RI1A 3B3GA 5EJ9A 3VPCA 4DKJA 2FZWA 2HJHA 4HH1A 1K9SA 5KX5B 1JEYB 4R2MA 2ZJ8A 2E1RA 2HRBA 2FSGA 2VAMA 1AXEA 5IJWA 3KKZA 4LE0A 1Z5VA 3Q7RA 4BZZA 1RQNA 1YULA 4Z9XA 1XYGA 3VHXB 1E58A 1U3TA 2RGEA 4KE8A 4JT9A 4FD3A 2A0KA 4IY1A 1JHAA 4RELA 3NTRA 4Q6BA 2AFIA 1IEVA 4RYDA 5FXMA 1O6GA 3FTFA 4EA6A 5J2TA 1MF7A 3RS7A 1THGA 3KQSA 1U11A 3KZVA 3L1KA 3D8BA 3PVSA 4Q0MA 3WDLA 4ENPA 4S05A 4DV3B 4A82A 1JEQA 1VDZA 1VKZA 2OK7A 3I01A 3U7EB 2HNBA 3T9BA 2NU9B 2O4UX 2Q7DA 1HEYA 1Y33E 2I78A 2GH1A 2P2YA 2GHRA 3GIWA 4WAUA 2DFNA 4W1PA 3G02A 2M32A 1UIMA 4OKIA 2GBCA 5FPQA 2V6JA 2Z2YA 3BK7A 3HQ4O 3DSRA 5CVEA 3BMQA 2OCXA 3TMYA 1IRXA 4ZXFA 3MMNA 3T5GA 1GYPA 3BYZA 4JUFA 3WGZA 5JFOA 4KVAA 2QG6A 1IOZA 2DC1A 4O2BA 1D2MA 1XNRB 3DVLA 3I6MA 4GZ3A 3S2ZA 1PQWA 3HEBA 1ZNZA 4KP7A 3S5UA 1KQFA 1N6IA 4KLAA 4BFXA 5FPKA 1YNOA 5DK4A 3AK4A 3T3IA 1BO6A 3WGOA 1OWLA 3NHLA 3TZHA 2TMDA 4B8ZA 5CA1A 4N76A 3GA5A 4HNQA 1HUQA 1RFLA 1W19A 4I81A 1VG1A 1JILA 5F7JA 5D3MB 2Q4TA 5K3BA 1SVUA 3KU4A 1DQSA 2J4FA 2P5YA 4WBNB 1V3UA 3KJQA 1PU2A 2PZJA 4FGWA 4J2TA 5FAXA 3UMJA 4N0MA 4ZCRA 2ATIA 3JWEA 3KJGA 1PO7A 1QWSA 1UZAA 1Q16A 2GK6A 2QMOA 3PC8C 5E7JA 3E7FA 4DEVA 4Q4LA 4W1RA 2WE7A 1NI3A 3QGMA 1L4EA 3VUFA 1CETA 5BVGB 3QNMA 3T5AA 1HT0A 3ZX4A 1QNFA 1QHIA 2CLSA 5AI6A 3PRJA 4RPCA 2J41A 2Q0XA 4UVIA 5IAGA 3N2EA 3NW9A 1LJ8A 3E9NA 3WRXC 4BB5A 4B2LA 5CAEA 4JR1A 1IJEA 2D1FA 1K7XB 3LXXA 5EWLA 1DARA 2WQ7A 1L4GA 1YRBA 2OBXA 3AJRA 4OH7A 1JJAA 4TLLB 4RMNA 2XR1A 3O3MB 1ZN8A 1Q11A 3O5AA 4C6SA 1AHNA 1OHHA 4D3FA 3BSSA 1RWBA 2VF8A 4LUCA 1KJJA 3LY9A 4FOOA 4Y67A 1E3IA 2AFIE 1EWQA 3NBQA 1OD6A 4MRPA 3VSBA 2CV0A 1A8IA 4MZDA 3TJMA 1PZFA 3ZE9A 1MX1A 4IIJB 1ZH6A 3W5SA 2W98A 1JIKA 1MAWA 2CLHB 4AZ3A 2WSYB 1V41E 1H3EA 4I6EA 3I5YA 1E3LA 1CJCA 3LZDA 3NHYA 4G1VA 3OCWA 1ZGBA 4IDCA 2AJTA 2H2AA 2JRLA 3D3KA 3G59A 4QE3A 3ZD8A 1KO7A 4AKEA 3BD8A 3R9WA 1GGFA 5EMMA 4A9AA 4GRIA 1E1RD 2BM1A 4M1SA 1ICIA 4ZI5A 3ZCRA 4F4CA 2J3LA 2X5OA 2ISSD 1L1EA 4YXWA 2XT6A 4W7IA 1JX6A 2JHFA 4BWGA 4QWWA 1IOVA 2OXTA 3WGVA 4FFPA 1KIAA 2VQ3A 3E2MA 1E5LA 1DAIA 3KCNA 1E89A 4MMYB 3GFPA 4XM2A 3MCVA 4OGKA 5G3YA 3TX2A 2WYIA 1PN3A 3TNYA 4U1RA 1ZN7A 3RE1A 3WFZA 1QMPA 2ZQZA 1PUJA 3WYEA 3BPSA 1UBGA 5SY6A 2ATEA 3D2LA 4OEHA 4JR0A 2PBZA 2X4DA 2R8XA 2PL1A 3D31A 2P0YA 2XMQA 2LUOA 4BPBA 5I8WA 4FNOA 4I55B 4NS1A 3VTAA 2QSJA 5FORA 3TPCA 4AS2A 1L7MA 4LAFA 1IB0A 3R3HA 5BN5B 2PZMA 5TMDA 4BQEA 4F86A 5DM0A 4ZCPA 5DHSA 2BGWA 4QKQA 3QJGA 1CEYA 1Z6XA 2Q1TA 2W6MA 4CQMD 3KB6A 4DNQA 2YINC 3ZNQA 1ZKDA 3GUVA 1OFGA 1N3YA 2PK3A 3S70A 3OTQA 3QLUA 4OYYA 3ZH9B 4UZSA 1E3WA 1ZUHA 1SA0A 1GITA 4PYJA 1XZHA 4I1VA 4P3KA 1RXWA 1T2FA 1HE8B 2CYAA 2PL5A 3GYGA 3N2YA 3PI6A 3VU1A 4KK4A 2HHLA 2W58A 4K6FA 4CT0A 1TOAA 3TW0A 3IELA 1DBVO 4BQFA 5LP6B 1JG3A 3OQIB 2A2ZA 4G5YA 4CF6A 3MT8A 4NQZA 1T8TA 3GEEA 1PGNA 1RAFA 4R1UA 2AN5A 4C3VA 5DI9A 4MUKA 5COAA 3EGCA 1HBJA 4H0FA 4ITUA 3LKVA 3L6BA 3O2QB 1ANKA 4INPA 1QRRA 1TA4A 1VCHA 2P1DA 4OL0A 4YIKA 3PJGA 3HPQA 3R3VA 1XXHA 3SZRA 3ZZNA 4NYMR 2WIDA 4HAXA 3UW3A 5C3MA 1GGEA 3QE3A 2DHRA 2WU0A 4B2IA 3KTFA 1WUIS 5ES3A 1BMQA 1C8KA 5JI3E 2P78A 2EWMA 2O2HA 1U31A 3OJEA 5DHAA 1SH7A 2NO6A 3DUFB 1GRRA 2A88A 1IAVA 3WMXA 3F6EX 3GJ5A 1L5LA 5KVAA 1WXQA 3D7LA 1U0BB 1H85A 1Y89A 3L1UA 5K5EA 1U6KA 2VJCA 2C1EA 2C5EA 2EZ8A 3KVNA 3P32A 2A9JA 1QC5B 2WABA 2FR1A 1X7WA 1LDMA 1ZINA 4JLWA 5F1PA 3ZGNA 4BX9A 3B6EA 5GJBA 1XRJA 1SULA 1YA4A 2DM6A 5T8KA 3R2JA 3F3YA 2QE7A 4WK6A 3UJ7A 3HMQA 4DL9A 5LMCA 1C9EA 2G08A 4BO7A 5LOVA 1WNFA 3BBPA 3DC2A 3OPQA 4LNHA 1KAGA 4C3ZA 2RBKA 1NF8A 1YR2A 4CM5A 4CW7A 1RI5A 1CZOA 4I5IA 3DMRA 4ZHQB 4XI9A 5BWMA 4FWTA 1GV1A 2GBIA 1QFZA 5KX5F 1SU7A 1BU5A 2BWJA 3GQBB 3IMCA 5JRDS 1PJ2A 1J8VA 2ECKA 1SUIA 3FFBA 1WDLA 3T5MA 4XYBA 1WSAA 4DUGA 1RPAA 4M99A 2J9RA 5TGDA 3HY4A 2XKKA 4EL5A 1D7OA 2CK3D 1X7YB 3MINA 3PR3A 2YYSA 1H1LA 1GLGA 4E6EA 2DY0A 5DK6A 3TVDA 4E2XA 5AQEA 1SQ0A 1L5MA 3UB3A 1E6WA 1C4WA 1UKCA 4FWBA 4G85A 4P93A 3D2AA 5FWDA 2COEA 4DV5B 2X1MA 5CHEA 2HD4A 2YBDA 1XTJA 3A6DA 4Y7DA 3IDOA 1JHOA 3UPTA 3KSZO 1KEWA 1T6YA 2ODNA 3AUSA 3MAGA 4ZQGA 2JD1A 5CBPB 3I62A 3WKBA 1GGNA 1E9FA 2RH9B 3U3OA 3C14C 2GHTA 2G8LA 1YL6A 5CW2A 2XZTA 4PONA 3DAFA 3F90A 5KPDA 1FRFS 1XTQA 3OE7A 1XZPA 2KJQA 3C3KA 3RJTA 5KAMA 3JYPA 4MV7A 1AURA 4OLFA 4HQ0A 4FSHA 1NJSA 1AQJA 1XXHE 3FI9A 3MLAA 2ZOSA 5AM2A 1EE2A 1NLYA 4HZUA 4Q7KA 2OGTA 3OU7A 3HY6A 2AMYA 3PNKA 4J9VA 1EGAA 4ZFNA 4P4UA 1SQ5A 5P21A 4D80A 2RJ3A 4OXRA 2ZTUA 3DZJA 5FFFA 5LB4A 4ZKDA 4HDMB 2PJUA 3ZHQA 1IB6A 2YICA 5DWVA 4W5TA 1V35A 3HDGA 3QIVA 1NG9A 2GEFA 1J2YA 1VTKA 3DO6A 4ZWNA 4WBNF 1JMKC 5DM60 1F0NA 2GLXA 2LZ0A 4FMPA 2WWVD 3N6VA 2QN7A 3W2GA 3RTDA 2J3EA 4P5PA 5K05A 5AJYA 4GXQA 2B8TA 1GAJA 1LBSA 2KE5A 1EAYA 4WZAA 5JPDA 1SO8A 3AEZA 2MCFA 4EARA 1OKKA 2DSTA 1FLNA 2ZI9A 4E5UA 1PG5A 1LDEA 4PQFA 3DYBA 4FMBB 5IUJC 4ZQBA 2GYUA 3HRIA 2CLEB 1R7RA 1Q50A 2JIQA 5D3ZA 4EQ6A 1MQSA 3EH1A 4XFKA 2FWBA 4HGRA 4HQLA 4D3ZA 5KYVA 2ZIVB 3S2GA 3DUWA 1L5FA 4RKYA 3FKSA 1HLPA 1VMDA 3BJRA 3GPCA 2PZLA 4ZO8A 1XEXB 2FP4A 1Z6AA 3K30A 1KI6B 3L06A 1ND6A 4O59O 4FGLA 4PYMA 3SYMA 4CNQA 1GZ7A 1J2UA 3IIIA 2X9VA 2Z2JA 3DYIA 4GO1A 4OMUA 4RSHA 5E4TA 1VIDA 1RBYA 3O9VA 3PSHA 4E7OA 2GFQA 5IHPA 4IIJF 4J0DA 4X64B 4FEGA 4HYEA 3ZXYA 1BKYA 4UUBA 3B1KA 2DBYA 1XDSA 4IXNA 4REOA 3RVKA 1SELA 1LWNA 1XCPA 1B2RA 4WLOA 1X1BA 2XYHA 1X7DA 3ZY4A 5AUPB 1UAAA 4TT8A 4ZYUA 4ZYLA 4AIRA 1EDZA 1RJ9A 4RQAA 4RIHA 4KV9A 1EZZA 4DMMA 4BP1A 3Q8WA 1NBAA 4Z86A 1I7PA 4JIMA 4PZPA 2YVLA 3TVYA 5K0ZA 2WWIA 3PDIB 2GEKA 3EAQA 4E70A 2XOKA 4HWRA 3WJ2A 1IN8A 4JROA 1LBTA 2ENWA 5DE3A 5F5NA 1MD9A 5L3ZA 5KWIA 2Q6TA 4G41A 1FFWA 4TV9A 3ZXSA 1BXGA 4B4OA 2IYZA 1FSGA 5DJ5A 2VAWA 4HN2A 3OZEA 1R6AA 4C03A 2G9NA 6REQA 5JCZA 2P77A 4HEJA 2WTBA 3SJAA 4ZEWA 1VGRA 2QENA 5LQUA 4D02A 1OFUA 1SVIA 1VG0B 2F90A 2AFHB 4JVNA 4L2IA 4ZVUA 2BELA 1MO6A 4UNSA 1ZBQA 5HYVA 2GA9A 4YJ3B 5AUQA 5JEDA 3QUBA 4I55F 4CF4A 1G20A 1MA3A 2FYTA 3TZQA 3KAKA 4WZAE 1YK0A 2FA9A 4TTAA 4UCWA 2PJZA 3JU3A 4Y2TA 3FF4A 4AZWA 3EPKA 5E4FA 4IAOA 3VR5A 3EY9A 3KR2A 4ZGWA 2QSYA 5K0NA 3V3TA 4MUIA 1T4MA 4HUTA 1TUEA 1QGUA 1TD1A 1H2FA 1Z37A 3HVJA 2HUNA 2ZIEA 4I5DA 1EFPA 4KI7A 5AJUA 3R7WA 4BC1A 4CEHB 3CWCA 2HQBA 3IAUA 1NIPA 5DPMA 4KPEC 4WOPA 3ANXA 3G49A 4Y2VA 1AQIA 4LJYA 5LDHA 2G36A 2IZ5A 4N5DA 3LL4A 1NUSA 2IFTA 1EX9A 3LQRA 3LSYA 1SOUA 3QE0A 1L7BA 2BGKA 4JNCA 3ZY2A 4C4XA 1LUAA 5HVNA 5LP6F 4BVLA 4MAAA 1MC5A 2VJYA 2X0IA 1E79A 2C88A 4MW4A 4Q3BA 3RR2A 4P83A 4MSUA 3SC2A 4F38A 4H3HB 2DFPA 5BMVF 3GLGA 1VI2A 2PMCA 1RBQA 1U0JA 3DBOB 1XTBA 4BDSA 1P77A 4L8YA 4KU4A 3WKCA 2H06A 2XUPA 4D8WA 1L3BA 1JQ3A 1PJAA 5TT1A 4ARZA 1EFVB 3QFHA 5L3QB 2CBZA 3ZU6A 3GP5A 5ALRA 2JFFA 2BL4A 3VYWA 3ROMA 2HA5A 1GA4A 3T7SA 5FT9A 3A28A 2QW8A 3DE1X 2YUIA 3OZ7A 1JLSA 5AXDA 1UPBA 3ZYCA 2DOKA 3QELA 2G9VA 4C6TB 2HYIC 2RC6A 3PD1A 4NYIQ 3SQMA 1ORTA 3RUPA 1A50B 2B21A 1V1MB 4U6QA 1RSZA 3TAHA 3BVPA 1R5JA 4PIVA 1FNSA 1S3SA 2AT1A 4MVJF 3K0FB 4YJ2B 4HY3A 4CKXA 1KWGA 3Q5GA 1XVTA 4RY8A 1UMCA 1R9MA 2O48X 3P9XA 4OQQA 2AR7A 2ZU6A 2FMTA 4BO0A 1QH1A 2YZNA 1TFUA 3CKMA 4KO8A 1WEHA 1KXZA 1BVRA 2C0QA 2VT7A 2B1GA 3M6XA 2WJHA 5D5PA 3NASA 4HRXA 3BG5A 5FDFA 5L8VA 2C4UA 4Q4HA 2CCKA 2P3OA 1QGED 2OPBA 1E3QA 1Q77A 3SM3A 2JH9A 2FEPA 2IPLA 1QR2A 3HKDB 4ZHQF 1T5SA 2Y0EA 3OKCA 1ZOLA 3IV9A 4LG1A 2VQSA 3B3AA 4ALKA 1BDBA 3DFUA 3KVYA 3RS3A 5C8ZA 5FA5A 3IEMA 3A36A 3Q0IA 5CLHA 5H83A 4ZVVA 4MO9A 4XWAA 4HAZA 2OV4A 1BCSB 2GLTA 3PXXA 4UBLA 3GLFB 1IU9A 1R15A 1UADA 1D2EA 2C96A 3A05A 3AB3A 4GPTA 4IPTA 3UNXA 1ZRHA 3W9YA 3WFIA 4COOA 3QZUA 2IOFA 2QZPA 2R8RA 2H5IA 4R2HA 3RW9A 5JPIA 2BISA 2NU6A 4P7JA 2D2EA 4P3XA 5EERA 2P30A 3K70B 1QRAA 3BHIA 3I42A 1KETA 1ML4A 2CDCA 1KZ6A 1XZ8A 1Y8RA 1JEEA 4KFUA 5C37A 5KS2A 2XIJA 3I0MA 4UXJA 1N1MA 4RW0A 3A0RB 4DLUA 4E1BA 1E5VA 3C8HA 2YHIA 1PW5A 3OCUA 2D5LA 3IUNA 4HNVA 3R9IA 2FRVA 3N70A 3M83A 2GZ2A 3QYAA 4ESHA 3BT7A 3ENNA 1TW2A 1JHPA 2CWDA 2CXXA 2PGAA 2VDQB 3OU2A 4PO8A 3LH5A 1KSGA 1Y6FA 1G2PA 3CCFA 3ODGA 2MOKA 3A4VA 2HHAA 1C8LA 3KX2A 4KZPA 3ZE7A 4AJIA 1XK7A 2YX1A 1EUCA 4Z1MA 3EVZA 3NV9A 1G8KA 3HXMA 4QYWA 3P2YA 5D7BA 3FPSA 3FFAA 3HKCB 2FZVA 2A1UB 4J9UE 3OFKA 4QHYA 3USCS 1FYWA 3WFJA 4C21A 4QG3A 3I2HA 5JY1A 2XE7A 3KQLA 4CN9A 4N54A 4B7UA 1QV6A 3I0ZA 4HNTA 1CT9A 1X8JA 2QB5A 3G1TA 3LK7A 1BWRA 4QJ4A 1CQZA 5HF9A 3SX4A 1II9A 3GY0A 1BC5A 1Q21A 3PC7A 3V2HA 1U9IC 2P5UA 4YJGA 1ODKA 2PX8A 2B9VA 5B3JA 2HLDD 1XVAA 2PUWA 3ZDFA 1ACLA 4XOUA 1G2IA 2B35A 2IP2A 4WK2B 4KFCA 1NZFA 4Q05A 4V1CB 5BSRA 2MMGA 3QXHA 2UZIR 1ONSA 3OZIA 1QVZA 2OORA 4MS3A 4AJPA 4NNJA 5H8WA 3ZCUA 3NIWA 3KS9A 2IKSA 2RHMA 2LIVA 2O3RA 4O4HA 3LWZA 2CV2A 1GZHB 5IAJA 3KQPA 2JHPA 3L93A 1NSFA 1YI8A 4YVFA 1WOYA 3IBTA 4C7OA 3JSXA 3PEWA 5HCNA 5DOVA 2Z4SA 3R0VA 4RWZA 4WXYB 3AT1A 4PSCA 3WDKA 1E3TA 2FTKE 1TTQB 2CXRA 1MJFA 3GRAA 1AQLA 3UF0A 2GOYA 2FQQA 3WIVA 4MTLA 1BDMA 4P7BA 3MA0A 1MOZA 2QI9F 1Z25A 5HF5A 1LSSA 2JA2A 3DMFA 2ZWAA 5B1EA 3SVTA 3QXCA 4I2NA 4UE2A 1Y4DE 3HM2A 4A8JC 3JQPA 1VA4A 4LKOA 5CA0A 4RK0A 2GXQA 4OGFA 2UUAB 3NHMA 1MIOB 2B4AA 3IMFA 4CL0A 4I6JA 4OA8A 5JDCA 3E5MA 5BQXA 5JCXA 1I2CA 3KYCB 3HCCA 3C6QA 2GQ0A 3FMGA 4HPJB 4LZAA 4RH0A 2W2NA 1L7OA 4P7GA 2LKCA 3N5CA 2JATA 3PRHA 2YXDA 4BP8A 4QGAA 4W8GA 4XYMA 5AJTA 2G7ZA 2VXYA 1Y8QA 1AK2A 1NW6A 4BJ5A 2AK2A 5DASA 4BCBA 4PC6A 5H9WA 5LSAA 1GU0A 4RIFA 2AUNA 3N2IA 5B64A 4QPNA 1JAZA 4PHHA 3CVVA 1TO6A 1CUXA 2AFRA 5B3AA 2BFBA 5L9AA 1GTG1 4W7HA 5JSZA 3W2IA 3CUUA 4IJVA 3RG8A 1GAQA 5EIHA 3PYLA 5EKDA 4TKUA 1QZXA 4MLZA 5AVOA 4DWWA 3H7IA 1NLFA 1FW8A 2IHYA 3QWBA 3D3WB 2X7HA 3C3MA 7REQB 1VE6A 2J1LA 3NHPA 5M7EA 2AYZA 2PKQP 3IRVA 1F4LA 4JHXA 3VR4A 3PL1A 3MJFA 4BV9A 1NM5A 2VPZA 2UZAA 3DAYA 3AONB 3LLSA 2NO4A 4O4IA 1ORDA 1MU0A 2ZEJA 1YRQA 4DV4B 3SR0A 3R8CA 1H65A 3PUVA 3R5TA 1UJNA 3K0HA 2PWBA 4N7RA 4WE3A 2L18A 1T5OA 3T3HA 5K0SA 4PPNA 4WNIA 5E0KB 2GXAA 1RHMA 1XMXA 3D6NB 1G0NA 1DIAA 3I52A 4ZCLA 5LQAA 6ABPA 1LGYA 4I1UA 1MO2A 1KXJA 1Q5PA 4WESB 1UXKA 1H8HA 5ALEA 3EN0A 3THRA 2W6CX 1XTPA 3QQ5A 4QXMA 1SXQA 3WWCA 4UHJA 4KR0A 2GWRA 3AF1A 5EHQA 2JH8A 5HFAA 2CNWD 1N0VC 1JP7A 3AY6A 1NBEA 5TDHA 4FN5A 5B2EA 3RVSA 4V0RA 5C4GB 3AR2A 3ENZA 3N7TA 3OTWA 4QUEA 2PRKA 2FMXA 1PZEA 2CJWB 5DYWA 1QOQB 1VLMA 1HI9A 4QQFA 4AY6A 4BZQA 3U7RA 2IWHA 5DBHX 3FOBA 4CEJA 2LDBA 3AW8A 3JVIA 4EBBA 4HB3A 4QBTA 1QO9A 3PFBA 3PNBA 4NDNE 4QREA 2Z9DA 1RWVA 3I76A 4H15A 3ZIDA 4RF4A 4ZQCB 3E48A 4YRSA 3MBOA 4OM7A 4DS3A 2WZCA 1PDWA 3W06A 2UYGA 3M1YA 1I2BA 4W63A 1N34B 5HK9A 2ZI6A 1E60A 2E5WA 4LV6A 4BXOA 1U8FO 3FFTA 4R1PA 1L7DA 1DUIA 1PV1A 2Q62A 3A4YA 3TQFA 3VHLB 4D4MA 4R68A 4EUKA 3GJ6A 1CDDA 2LWIA 5BUZA 3NATA 1QIGA 2RHJA 4WL0A 3VU8A 3ZGOA 1N77A 1XZIA 3WGLA 1K4KA 1LC3A 4FOTA 4QHTA 3I45A 4YYZA 1GADO 4X24A 4DMGA 4ZTZB 2Z3WA 5IDQA 3T1TA 1YO6A 2OZKA 3QNUA 4Q7QA 1BW9B 1M2FA 1LLDA 4YP1A 1DOHA 1QYDA 2EJUA 1YC2A 4KI0A 5C53B 3O2JA 3OBBA 5JDIA 2ZBFA 4OI2A 5BSVA 1HRDA 2ZQYA 1YI0A 4DHWA 3P9YA 4B6SA 2A14A 3LUAA 4PCAA 1PG0A 2ZB7A 3QI2A 3H1AA 4JY7A 2ZJZA 2V45A 3WLIA 2HZBA 1FFEA 4F0JA 1JSZA 3BE5A 2LNDA 3ZKAA 2VK2A 4Z3DA 2GVZC 3W9SA 1RWXA 4FDMA 2NUAB 3RQSA 3ZZUA 3N0RA 2NUPB 2B7LA 4D0GA 1NURA 3EF1A 3EOBI 3WHIA 4MUGA 1GQFA 1MAHA 2IJGX 3F6BX 4PYLA 2YWEA 3QMPA 5JJBA 3E3MA 1U1GA 2HV8A 5CDHA 1KL7A 2YUTA 2GF0A 1ADGA 1DEHA 3AZOA 3EVTA 1XLUA 3KL4A 8MHTA 2C20A 4A0RA 5HKKD 3Q5DA 5CLGA 4OB6A 3MYRA 4MCAA 3HYRA 1H0HA 3OLWA 4KPFC 1WZEA 5FOTA 4BKRA 4CGYA 3ZVKA 3L49A 4C4AA 3GJYA 2Z2IA 4N49A 4DQDA 1Q6ZA 2W2KB 2FAXA 4MW6A 2R2AA 3KQOA 4NG4A 1LF0A 3F3MA 4YS6A 4BAUA 1MJGM 4ZPJA 2XSZA 2FPLA 3EWSA 1DQRA 1ZMXA 3HA2A 4E7PA 3H4MA 3KUUA 4JLNA 3AMVA 4GX2A 4MQ4A 1L4HA 2ZS9A 1MZPA 2XTZA 4CV1A 3S1AB 1GRNA 3TRIA 2ZYGA 2JB9A 3IX7A 3KSMA 4PHTA 4B43A 1V3VA 2HDOA 1E3SA 4E4RA 3DBRB 2FFRA 1K3UB 1CEEA 4G8JA 1FU8A 3BSYA 5EXPA 1OTXA 3RT7A 2AUMA 1PJTA 1SIBE 4HD8A 4US0R 2C3PA 4L50A 3ZHSA 1J6UA 1P2SA 3CW2A 4EUFA 2YL2A 1R66A 3DDNA 3FPHA 1BVHA 5HTOA 4YP0A 3T94A 3I04M 5TY0A 2G0AA 1KAHA 2IXDA 3JWPA 3PQFA 1ELOA 1FBNA 4PTYA 4ZQIA 4F5YA 5KAPA 4L7VA 2NXCA 1QFJA 4MO2A 4DDHA 4EELA 4EUSA 5KREA 3H86A 3Q5EA 1GO2A 3ZDRA 4JS0A 2VJNA 4GYWA 4FMCB 4UEOA 1AGNA 1KJ9A 2PDAA 3BK2A 2GK3A 3PFCA 2CV1A 5AI0A 2VF2A 4FZJA 4DBLE 4L3VA 4R71A 2AK3A 1Z0ZA 2WE8A 1Z6PA 3MGKA 4AK9A 2D4HA 1QIEA 1QGAA 4R9RA 2JFYA 2VP3A 2GA8A 4WCVA 4RD0A 1X1EA 1DJNA 3MN1A 4XGQA 4MB2A 3L01A 3SOZA 4YRBA 4HGYA 4NECA 2KSQA 3QF4B 4X93A 1W4BA 1O0SA 4I1RA 5IC6A 5BO5A 4HQFA 2PU7A 3LIIA 5A3QA 2JASA 1QRTA 4Y6PA 1I4DD 3GJ3A 1JLLA 1IXZA 3ZBTA 3OZSA 4J0CA 2JLYA 2V6MA 3RYHA 1L7VC 4KEAA 1UMDA 3Q3VA 1XRLA 3ZWQA 3ESCA 1LV7A 4V0LA 2VSQA 3F4LA 3M6MD 3HCEA 3TMAA 4OBXA 1FP4A 1Q0TA 1HLGA 1EM6A 3QEKA 5EJ5A 4QZVA 3A2KA 3OUTA 4LC0A 4UEKA 4PLZA 4HLUA 3WB1A 2Q50A 2NZ2A 1PR1A 1B16A 2RAFA 3R9KA 3B6KA 4ZCTA 4LHSA 3CUKA 5BRJA 1ZXBA 3AHCA 3O1HB 1JA9A 1DBRA 3SQNA 2ZRKA 3GF4A 3ZXXA 5IBRA 4DAEA 3RSHA 3U3KA 1GNLA 2IHBA 2GYWA 4EENA 2HMVA 4X3CA 2BGLA 4H3VA 3FYTA 4F5DA 5CFRA 3SMVA 3EFHA 2YXEA 1A76A 3S27A 4TKLA 3ZPXA 2VJDA 3H5AA 2HWXA 1GPNA 3AR3A 2YVKA 3II6X 1W25A 1E66A 4RTOA 2PX3A 1FC0A 2V1XA 2GI4A 5AW4A 2R62A 1A4RA 4RK1A 3WNZA 4U6NA 5CJJA 4ZO7A 5HZKA 1G0OA 2F48A 1P1RA 2X4IA 4K81B 5IZ4A 1W44A 3IYLW 3K72B 4O1IA 3N8KA 4I1OA 4KNYA 1V4NA 1M2HA 4X9XA 4PAQA 2NUBA 2WWYA 4R31A 4TVBA 4GKBA 1S2OA 3NUGA 4QELA 5LBIA 3V1TC 1Y3HA 2C2ZA 2FSUA 4QDZA 4RMIA 4BJ1A 4OHKA 2F8LA 5KYNA 1H22A 3L0BA 3A6PC 1LVUA 2ZIGA 2C2BA 2Z1DA 1N6RA 2O52A 2W4IA 3CNHA 3H9JA 3KT0A 4Q1DA 2F4NA 2YY5A 4MWCA 4MNTA 5KQGA 1HMYA 4FKZA 2QL9A 4WXMA 4HDKB 5AP9A 1USIA 3U17A 4P33A 3H6GA 1IATA 1FDOA 1D04A 1OPRA 1SHJA 2CFCA 3WOVA 4UFPA 2ZDHA 5F52A 5JZ9A 1UQTA 1WVIA 3O9ZA 3KDPA 1TF7A 4YRKA 3UC9A 1J8DA 3TS1A 1TUGA 3RFUA 4BLPA 4NU5A 3HCFA 4Q7JB 3TDKA 3L9XA 2F3PA 1SVWA 5DHUA 4ZVPA 3F8TA 1XC7A 2HRQA 3OZTA 3H8WA 4IDGA 2EW2A 2ZWPA 1ECPA 3NYIA 4UD2A 1H05A 4DLBA 4ZVSA 2ODBA 2OECA 2NTNA 2JFXA 4YQFA 3DE4X 3ZJUA 1DADA 1M6VA 3ZC3A 1BX1A 4F2DA 2ZJ0A 3QRWA 3GJQA 1SKYE 1BH6A 1B6SA 3QLEA 3FKJA 3NBYC 2IYWA 1MGOA 4ZANA 3MCUA 3HLTA 3KDAA 2BGIA 4NDZA 4RHCA 4IDFA 1XNHA 1L8LA 3GARA 2PT6A 3IP7A 3T35A 3QYJA 4HUJA 3UVEA 3ZWBA 5G0TA 5E6SA 2JG3A 4YRJA 1T9AA 3F8SA 3GLRA 4WKBA 3SIRA 4GOLD 4JU8A 2ZR8A 4MROA 2DKFA 2AWNA 3COSA 1JA1A 2HIHA 3GGGA 4JOQA 2R7LA 2ZUDA 4ONEA 5BNFA 1K3TA 2SKCA 5EXEA 2Y99A 2ZIXA 5FOVA 3K0BA 5ES4B 5K99A 2XZOA 3DMYA 1AXRA 3PX7A 2RGNC 2EBWA 2ZYHA 3VYUB 3WWPA 1OH7A 4IF4A 2BONA 2HX1A 1CDEA 1S2IA 2ZIUB 1W46A 4LOJA 4MVJD 5HCUA 2O0LA 5DMHA 3T9FA 2OENG 5I9BA 3TSOA 1VMEA 3IQDB 1V8PA 3CRVA 5FNVB 1PR9A 1KEEA 1GRQA 3EZGA 3GAZA 1WJGA 2W2LA 4M3NA 4DVJA