1ZI9A

Crystal structure analysis of the dienelactone hydrolase (e36d, c123s) mutant- 1.5 a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 80
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi9A00
4QLAA 4N5HX 3SX4A 1R88A 3W9UA 1JJBA 4MYDA 4AZ3A 5AKXA 4X71A 3BF8A 1DX4A 4Y9SA 3HC7A 3WL7A 1UKBA 2V97A 5AIAA 4WJLA 1QIKA 3ZLTA 5E2IA 5I9IA 1CRLA 4P92A 3K2IA 3NUZA 2WFMA 3WL5A 5LIPA 5AM3A 3EBLA 1VXOA 2XUJA 5A62A 1GKKA 4N5IX 3HZOA 1EA5A 2EDCA 1J2EA 5LZ5A 1YS2X 2V96A 1P0PA 4FOLA 3QM1A 5JAHA 4BVKA 2CUTA 3H04A 3KD2A 3OTQA 4AXBA 5EIEA 1YCDA 4J0CA 3DD5A 4KRXA 4M0FA 2CEKA 1MNQA 4X90A 1MTZA 2GYWA 5JZSA 3FCYA 2I03A 1LPMA 3B5EA 5CT9A 5IH7A 4QLOA 3F8SA 5AKEA 3G9XA 1ZD2P 1EDEA 4U2DA 5CT6A 2OCIA 2ZYIA 2JGLA 4J0JA 4FBMA 4H7IA 4B82A 2GZSA 3NOXA 4KE7A 2VAVA 4Q3OA 3N2ZB 4B6GA 3AIKA 3DDUA 2ES4A 1VXRA 1S8OA 4A5SA 3FYUC 1QOZA 3STVA 4CI9A 1FFEA 2WTMA 5ALDA 2G5TA 4CCYB 3V1LA 4NZZA 1QIDA 2O2HA 3WJ2A 1MPXA 1EVEA 4W1RA 1CUHA 4LXGA 3IA2A 2QR5A 3G8YA 5AM0A 5IKXA 4DMKA 3AJAA 3KXPA 1EK2A 2BFNA 1OILA 3L1IA 3FVTA 4EZIA 3O4HA 4QEKA 3G0IA 4Y2TA 5K3DA 2ACEA 1E8DA 5FXMA 5D7BA 2DQZA 4ETWA 4AX4A 1MAAA 5JZBA 1Q83A 3RKSA 5CXUA 1CQWA 3W06A 4PW0A 4CIBA 1CUAA 1N8SA 2J4CA 4G9EA 3WK4A 4ROTA 4I3FA 3ZV7A 2JEYA 2OQVA 2Q0XA 4X6XA 1DWQA 5ALJA 4C01A 5HFNA 4DMCA 3W05A 4Y2YA 4FLEA 1L7AA 4W9RA 2HFJA 2GBCA 3T52A 5A7GA 2WU4A 4UHDA 1EXWA 4DNPA 1CUWA 3WK9A 5HF5A 3S8YA 1W52X 3G0BA 3DNMA 1XZCA 3F67A 5AI9A 4X7BA 4XJVA 2BKLA 3QBJA 4BDSA 4DMHA 5KWJA 3D3NA 1T2NA 3DKKA 4FBLA 4KAAA 1CUVA 4KR0A 3VDXA 3IURA 4F0JA 3SWWA 4BCCA 1UT6A 4YX9A 4Y2VA 1HQDA 2XUKA 5JAUA 1UKCA 4BTVA 4OPMA 3M83A 2X5XA 2BGRA 2QZPA 1GGVA 1FFDA 5FUMA 2QOEA 2FX5A 2J4FA 5K3AA 3EIOA 1HL7A 3G9TA 4UBNA 1CUFA 2WM2A 1DT3A 3ZWQA 3C70A 3I2KA 1AZWA 2BUBA 5FDFA 2XUIA 2WQZA 3DL7A 1XKLA 5JATA 5JASA 4MEBA 2XLCA 5AKHA 3VJKA 3STTA 3R3ZA 1NX9A 2XQJA 2Z8XA 4EA6A 5LZ9A 2DHCA 1K6EA 2Y2VA 5EHQA 4XVCA 3DL4A 5EHNA 3BWXA 2JGMA 2W22A 5HCUA 4G8CA 5HK9A 5AKLA 3BIWA 1MT3A 2O2GA 4WFIA 4HVTA 2HM7A 1LPOA 4XWGA 1EDDA 5DTIA 4LXHA 5BWBA 3V48A 3I6YA 2O7VA 1AX9A 3I2HA 3MGAA 4U2BA 1EB9A 2WU3A 1BROA 1EB8A 4RE6A 1W4LA 2G63A 1XZLA 1H23A 3H2JA 5J3JA 2WSLA 1MN6A 5C8XA 5E4YA 5ALGA 2RONA 3V9AA 2C5FA 2QJWA 2WHQA 2D5LA 3F97A 1LPAB 5CT5A 2H7XA 3JYHA 1THTA 5DYWA 3F96A 3O95A 4Q3KA 3ZPXA 3LIPA 1IZ8A 5HKBA 2JGKA 4H7EA 1AKNA 3AILA 2OCGA 2WFLB 1EX9A 5EFZA 4UHBA 1SCQA 4UFPA 5JD4A 4LKOA 4H77A 1ODCA 4B0PA 5ALFA 3E0XA 5JD6A 1BU8A 4JUIA 1AUOA 4LXIA 4HAIA 1RYYA 2R8BA 4B7ZA 1A8QA 4AN1A 5EIAA 4DTCA 4U2EA 1XZDA 1YA4A 2GBGA 3WL8A 3H2HA 1EH5A 5ALWA 4JYMA 3DJYA 4HXEB 1CLEA 1XQVA 1EINA 2BJHA 3QVMA 2VSQA 3C6ZA 3LP5A 2VATA 2VJCA 4MYSA 4W63A 2NW6A 4Y7DA 5AKGA 1USWA 5JAOA 1UK9A 3G9UA 4HXFB 1SCIA 1CQZA 3EQ8A 3WKAA 3FYUA 2HU8A 4C4YA 3A2MA 4K2AA 1WB6A 2WKWA 5YASA 4GLBA 4WFKA 2HADA 1QJ4A 2HA7A 2WFLA 4ZI5A 1LPNA 4H7FA 2I78A 2J3QA 2ORYA 1AC5A 4FTWA 2WJ6A 3DYIA 3LS2A 4Q34A 4OU4A 3PF9A 4G4JA 1ZGBA 1QFSA 1WPXA 2XUDA 1M33A 1MU0A 1WB5A 4AN0A 5AM4A 3WMRA 1DWOA 1XRQA 1XZEA 5DNWA 2K2QB 1ISPA 2XUHA 4B80A 2HU5A 5ALOA 1B6GA 4W1SA 4FMPA 1OCEA 1WB4A 3O4IA 2HFKA 3G0GA 4BRZA 1VA4A 2JBWA 1RP1A 3OG9A 4OB7A 5AKIA 1BEEA 1EVQA 1H2WA 1A8SA 1XZHA 5BWCA 5ALKA 1QO7A 1ZJ5A 4YK7A 5FPQA 1WPRA 3C6YA 5ALLA 3UUFA 4WDQA 2E3JA 1CPYA 4HZGA 3D2AA 4Y2QA 1QZ3A 3B3QA 1YAJA 3BJMA 4EY5A 5DWDA 5JD5A 4H7KA 4CCWA 4N8SA 2PKYX 1QO9A 2WG2A 4BP9A 2HA0A 3T4UA 3TGLA 4IH1A 4MWTA 5JIBA 5AOCA 2QRUA 2C4HA 2IX9A 4QDUA 3W04A 3YASA 2JGIA 5DTJA 1E66A 1XROA 4EBBA 1VLQA 1MAHA 3WK5A 1QONA 5I8PA 1XRLA 1YR2A 2Y6VA 4KE6A 4C88A 3E4DA 1XZGA 5ALQA 2C58A 3WYNA 2OAGA 3A2LA 1DQZA 4BCBA 3D2BA 1YAHA 5DJ5A 3JW8A 5FP0A 5D6OA 4AMZA 2AJCA 2BGNA 2XMZA 5AJHA 5C8ZA 4X95A 3W9BA 4YASA 1BCRA 4G4GA 2HRQA 1QTRA 2HDWA 5AI4A 2DHEA 5A7HA 3TRDA 4DNOA 4C4XA 2B9VA 4P08A 2Z3WA 4AB1A 4GEGA 4G9GA 3W2TA 3OURA 2UZ0A 1LGYA 4H35A 1SFRA 2XUOA 3R3UA 2DQYA 1LNSA 2RHWA 3B12A 2WFZA 1XQYA 2XDWA 4DNQA 4AO8A 1CUEA 1CR6A 2GYVA 5T4FA 4BE4A 2ONCA 3FLAA 1QIEA 1F0PA 3STWA 1XRMA 2PM8A 5K3BA 2BAGA 1OXMA 4W1QA 4GBGA 2WIKA 3QPCA 1GT6A 2PSJA 1ZI8A 3GUUA 1IZ7A 4B0OA 2PUJA 3QMWA 1JKMA 1JU4A 2OCKA 1SCKA 2J3DA 1ODTC 2CJPA 3C43A 5IVIA 1K63A 4G4IA 3MUNA 1DU4A 3IDAA 2V9ZA 2QKYA 4N8EA 3QMVA 4QWWA 3H1BA 4J3JA 1GXSA 3VVLA 1MO2A 4WY5A 1C4XA 5JANA 4C4ZA 1Q84A 1PFQA 3R3WA 5ALPA 1CUZA 5HKAA 1DT5A 1VJ5A 2XMCA 5AH0A 5E4JA 4BB0A 5ISMA 1ZOIA 2VJBA 3I2GA 1YB7A 3HLKA 4QDTA 4PO3X 1CUUA 3U0VA 4I4CA 1JT2A 4ZXFA 1F8UA 2QUAA 3IUNA 4RE5A 5AK6A 1E5TA 2YH2A 5AICA 3H2IA 4OU5A 2OAEA 1NU6A 3Q0TA 2ZYRA 1O6FA 4QA9A 2XMQA 3O0DA 5A71A 2C7BA 3IIIA 4BAUA 2CB9A 3QPDA 5HF6A 1VA5A 5HF9A 1RWQA 1ZD4A 2XB6A 1T4MA 2VF2A 5ALTA 3D59A 1GPNA 1Y7IA 5EI5A 4EY6A 4MQMA 1QTIA 3WA7A 1LBSA 4Y2XA 3ANTA 2WUDA 5LZ4A 1MJ5A 1IMJA 3WKBA 3ZLVA 1QIMA 4NVRA 3K6KA 3DQZA 3LLCA 2QXUA 1ZIXA 3GBSA 4X6YA 3QH4A 3DCNA 4ITVA 3UUEA 2WUFA 1HDEA 2OLEA 1H22A 3G02A 4PF1A 2YYSA 1W75A 1HBJA 1ZICA 1KU6A 3BDIA 4RPCA 2VT6A 3R3YA 2QXTA 1A7UA 2O2IA 3WKEA 4X94A 4RNCA 3E1GA 2JF0A 3A2NA 5AKJA 1UOQA 2Y2UA 2IITA 4BZZA 4V2IA 5LZ8A 5FV4A 1K8QA 3SC2A 2HA4A 3I6ZA 2VJAA 2P8SA 2FJPA 4BYMA 1R1DA 2W6CX 4X91A 2WIDA 1XZAA 1EDBA 3HSSA 2XUAA 1XZFA 1TCAA 4UBKA 4FDMA 2ACKA 1P0IA 5CBKA 3CCBA 3HYSA 1UK8A 5AKYA 3RLIA 3NWOA 5A6VA 3IVMA 5HQ3A 3WJ1A 5IVHA 2XUGA 4LHEA 4P9NA 7YASA 1TCBA 2H9YA 3FBWA 5CURA 2PUHA 1E89A 2WJ4A 2XQFA 1TAHA 5ALUA 3QZUA 1G5FA 4UHHA 1X70A 1ZI9A 5JADA 1JJIA 1ZGCA 3M82A 5DYTA 5HK8A 4BC0A 4J0IA 3WZLA 2C0QA 3WIOA 4DSZA 2H7CA 1GZ7A 4EB0A 1CV2A 3WA6A 5ALNA 5SYMA 4A23A 5ALVA 2WUGA 4DIUA 1AMNA 3R3XA 2PVSA 1C7JA 1LPSA 4H7HA 3FYUB 3GA7A 3R40A 2Z5GA 1N5MA 1F0NA 1GQSA 1MX5A 4X00A 3BF7A 3WQHA 1QIJA 1BEZA 1R3DA 1IUOA 3WIBA 4J0GA 4ARAA 2I3ZA 2GYUA 3WYDA 5JARA 4HRXA 2RGUA 4UHFA 2Z8ZA 1XZMA 5AIBA 2IIVA 4M0EA 2B61A 4G8DA 3PE6A 3HI4A 5HF8A 2BUCA 1CUDA 4EUSA 4JH0A 1XZBA 1CUXA 1UOOA 1WCYA 2WIJA 4MEAA 4WDRA 3DOHA 3PF8A 4Y2RA 2HA6A 1BS9A 2BCEA 2XI4A 3C8DA 2WUEA 1PV1A 2ZSHA 4BVLA 4WCVA 4MQLA 3I2FA 1JI3A 4BAZA 4G5XA 2XUPA 3IULA 1CUJA 1LLFA 1YSCA 4UBIA 2WHPA 2XMDA 2WILA 4UUQA 4KAFA 4E15A 3UMJA 4AZ0A 1IUPA 1JJFA 1H2XA 5E4TA 4NS4A 3D4LA 4PSUA 2OGTA 4J0DA 6YASA 5AHXA 4QNNA 4RGYA 1TCCA 1VKHA 4OYYA 3L1JA 1CUSA 2HRRA 3PUIA 5FOQA 3ESCA 1E8NA 2YXPX 3I1IA 3QMMA 2PSDA 1AURA 4D9JA 1QE3A 2EEPA 2PSFA 1UOPA 5K3EA 1XFDA 4FLMA 4BDTA 4W1PA 3OC0A 2XLBA 1GPKA 3DEAA 4HRYA 4I19A 3WWDA 5LKAA 5ALHA 1G66A 3BDVA 3FWHA 2B4KA 4U2CA 2YASA 1LBTA 4C87A 3FNBA 4E46A 5A2GA 4GWLA 1CIJA 3JWEA 1YB6A 3D2CA 3H2GA 4FWBA 4J03A 3I28A 4KYVA 3O4GA 3WWOA 1EI9A 1HKHA 3CXUA 1XZIA 1W6RA 3KSRA 1B41A 3R3VA 4E11A 1LZLA 2VJDA 5CRIA 3RARA 1L7QA 4F60A 5IVKA 4OYLA 3DYVA 3VJMA 4HS9A 3BIXA 3G0DA 2QMQA 1ZIYA 3ANSA 3A6ZA 3KWFA 3WL6A 2ZSIA 1JMYA 1CUYA 1R9NA 1THGA 1R4ZA 1SOMA 3IBTA 1KU0A 1F6WA 2CBGA 2VTVA 2CZQA 3L1HA 3ED1A 2DHDA 1NU8A 3G7NA 5D3KA 5AI6A 3FVRA 4LYDA 3F9CA 4GXNA 2VEOA 1E8MA 4KJXA 3CCCA 3H2KA 1ODSA 4X3CA 4K6HA 2FUKA 2PL5A 4Q82A 1N1MA 2Z3ZA 3IB3A 5C81A 2WLSA 2R11A 4KACA 4PNZA 2QJRA 2AJBA 4INZA 5KREA 4M0MA 3WLAA 1DQYA 1W1IA 4B83A 3AUKA 5FKJA 1GQRA 5LKRA 2QT9A 2OXEA 2OGSA 1QIHA 2HU7A 2I3DA 4K6GA 1SC9A 5FPPA 1H2ZA 4Q3LA 5JYCA 5IVDA 1DINA 2GBFA 3RM3A 2JGEA 3HACA 4Y2PA 1U4NA 4FFVA 2GBIA 1CEXA 2ECFA 3VISA 3N0TA 1G42A 1FFBA 1QIGA 1UK6A 2CKMA 2ZJ7A 4OCZA 4G8BA 4AQDA 4CG3A 2VA9A 1XLVA 5C8VA 4OUKX 2DR0A 5LZ7A 5HZGA 1QIFA 4DMFA 3PFBA 3F98A 1BE0A 4Q1VA 4Y2SA 4ZV9A 2D0DA 5CTAA 4UBJA 5LP1A 4MJ3A 2O7RA 3IUQA 1ZI6A 3GELA 4H7DA 3BXPA 3R0VA 1K5PA 2C5GA 2H1IA 1Q0ZA 1QLWA 3EQ7A 3H1AA 1H2YA 3AFIA 2LIPA 1XLUA 1A88A 3ZLUA 4J7AA 5LZ2A 4IQ4A 5CH3A 1MNAA 3ESDA 3GFFA 2VT7A 4DGQA 3WWPA 1BCSA 2AJ8A 1QIIA 1UWCA 1AGYA 1ZD3A 1C7IA 3C6XA 2PX6A 2RI6A 4MXDA 5KBYA 1XKTA 1XQXA 1Z68A 1JFRA 2XMSA 3E3AA 5AM1A 1ZJ4A 4AO7A 2JEZA 4DSAA 4H18A 4IH9A 3ICWA 3X3HA 2WG0A 1ACJA 2OPHA 5A7FA 4BVJA 5JALA 3V1MA 3AIOA 2OGZA 1CUCA 1IUNA 4L72A 3PFCA 4OD0A 5C7YA 1Q0RA 3MVEA 3QITA 3WZMA 4CG1A 5EGNA 4F21A 3AIMA 3Q8WA 1HPLA 3U1TA 3P2MA 3IUMA 3NGMA 3QYJA 1ACLA 1QGED 2FJ0A 2RHTA 4KRYA 4QDOA 4CIAA 3C5VA 5AI8A 3SK0A 3FOBA 3FLEA 5K3CA 3O4JA 2X8BA 2ZJ6A 3ILSA 3A70A 1Y7HA 2B20A 4UHEA 3I1YA 4TPKA 3AZOA 4CFSA 4GDMA 1CUIA 1LPPA 5ALIA 3WKDA 5ALMA 5AI5A 2HA5A 1E3QA 3S2ZA 4B9EA 4EY8A 3VJLA 4X85A 2WG1A 2ZVDA 3ESBA 3DKRA 4OSEA 2DFPA 4BCDA 3C87A 2JIDA 2VAXA 4DNFA 2QS9A 3I2JA 2ZYHA 2PSHA 4HXGA 5EIHA 3ZI7A 2Y6UA 2QUBA 4WY8A 4BE9A 3HJUA 4BC1A 1VE6A 1TIBA 3HRHA 3H0CA 3OPMA 5HFAA 4KE8A 1XRRA 1IVYA 3G0CA 3O9VA 3PDCA 4BZWA 4CCYA 2WJ3A 4CG2A 5AO9A 2RAUA 5HQ3B 4FKBA 4ZV7A 4B9AA 2Y1KA 3VXKA 1J1IA 5JZ9A 4J0KA 2PU7A 1ZD5A 4Y2UA 5ALRA 4ZRDA 1DTEA 3O9MA 2WHRA 4QDZA 4B81A 3RK4A 4PSCA 4PQEA 2OG1A 5FLKA 1XZJA 4UFOA 5DNVA 2DSNA 4WFJA 4B84A 5BOVA 4E14A 2X76A 1XZKA 1J06A 1CUGA 2ZYSA 1X2EA 1JU3A 4QE3A 3D5EA 1O6GA 3PI6A 5CW2A 1KEZA 1L7RA 1YA8A 3H19A 3ICVA 4EY7A 1N5RA 2ROQA 3FSGA 5T4HA 2CMFA 3M81A 5CH5A 4BRSA 1R9MA 4C89A 4EHBA 4KE9A 2H7YA 2XQKA 4EY4A 1FFAA 1UZAA 4FHZA 1XQWA 4Z49A 3M3DA 4GW3A 4KEAA 1BRTA 3TEJA 4XIIA 5ESRA 1XRNA 1GPLA 3HXKA 4L0CA 2XT0A 4N8DA 2V98A 2DCMA 2VQ6A 3DLTA 3TJMA 4BP8A 1FJ2A 4JYPA 2BUAA 3I6MA 4H0CA 3WWCA 4LIPD 2G4LA 3LCRA 3DOIA 4L3WA 3BE8A 2AJLI 4FNMA 2HL6A 3K9BA 4K5QA 5DYYA 4Y2JA 3WI7A 1CFJA 4U2FA 3WK6A 1LPBB 4ZREA 3V1KA 4F5ZA 1I6WA 4FNGA 3FSGD 4LYEA 4S0XA 1WM1A 5D3ZA 1J07A 1D07A 4BTLA 2WIFA 5EHZA 5KWIA 2WHPB 3I2IA 3DS8A 1QFMA 4IO0A 1CUBA 3FCXA 1P0QA 2XE4A 2XUFA 4JNCA 1VOTA 4UFNA 4MWSA 2PPLA 3IUJA 3C5WP 2AXEA 3FAKA 3BL8A 4BATA 1W76A 4FFWA 3FYTA 2XMRA 1UXOA 2PSEA 1U65A 5ALZA 5T4EA 4Q05A 2XQGA 4P93A 4A16A 4ARBA 5AM2A 4X92A 4AO6A 1K4YA 4GHWA 5I7UA 1P0MA 1XLWA 4FLFA 1XRPA 1FFCA 5CH8A 1VE7A 5EHXA 2QVBA 3KDAA 1MX9A 1VZ2A 5DNUA 3KOOA 4TGLA 3CN9A 1UFOA 5AM5A 4DYHA 4UHCA 3H17A 4B85A 1GKLA 3MUOA 1UK7A 1AQLA 4PV7A 3STXA 1PJAA 5CMLA 1G4HA 4AMYA 5CXXA 5K3FB 3AINA 2XUQA 3KWJA 2XQIA 3H18A 3STYA 1YASA 3AZPA 2C0PA 4H7JA 4ZGBA 2RIPA 3HABA 1ORWA 2G5PA 1DX6A 5CT4A 2XMGA 4UPDA 3OM8A 3C8HA 3WWEA 1WHTA 3HEAA 3EQ9A 1WHSA 4G1FA 3R41A 1LZKA 4IH4A 3WK7A 4C6HA 4GECA 4QDXA 1TRHA 1JMKC 4UBOA 2HA2A 4YPVA 1FSSA 5SYNA 1BN6A 4PSDA 4BAGA 4K6KA 1EHYA 4QWMA 1YS1X 4JEIA 1X2BA 3EF3A 2JGJA 1TQHA 1VZ3A 4L9AA 4XX1A 5DLPA 1BN7A 3LIIA 2QM0A 2GZRA 3CN7A 4GI1A 4OB6A 5K3FA 5ALXA 1TK3A 3OOSA 1U2EA 5FRDA 1WOMA 2OQIA 1TKRA 3ESAA 4TVKA 3QPAA 1MX1A 1CVLA 5LLSA 4NMWA 5AI0A 3C6BA 2HIHA 5ALEA 2PBLA 1R50A 2AJDA 3VVMA 1A8UA 1HLGA 1ORVA 5LYYA 5BV7A 4ZWNA 4O08A 2JGFA 5H3HA 2XMBA 3V1NA 3GROA 4OB8A 5ALYA 3G9ZA 3STUA 2HHAA 4DM7A 4UBMA 3VKFA 4IHAA 5AK4A 2OCLA 5T4BA 5AOAA 3FLBA 4HTAA 4X97A 3BJRA 4BBZA 5JAPA 1EK1A 5AKZA 1U8EA 3D7RA 2QTBA 3C45A 5CT8A 5AKKA 2WTNA 3D0KA 3AZQA 4QZVA 2HA3A 1ETHA 2PU5A 2ZJFA 4X6UA 5F4ZA 1Y37A 3PUHA 2WIGA 5K5EA 5AK5A 5AP9A 4U2GA 2EDAA 4X93A 5AK3A 5AOBA 3GZJA 4UBLA 3WKCA 1DWPA 4KAJA 4DLNA 5ALSA 4J0HA 3PICA 1UKAA 3WK8A
chains in the Genus database with same CATH superfamily
4TKVA 5DKFA 3N3AC 5C1IA 3JQRA 3MG9A 3REQA 1I3CA 1GR1A 4MYDA 1XTKA 3KKQA 2OM2A 3FJOA 3P1JA 2Q6IA 1KI6B 2I1LA 1VC2A 2OV2A 4GC5A 5AKXA 3TDMA 1WCIB 3FB1A 4I14A 3IUSA 4I4TF 4F93B 2BGJA 1JFFB 3QE3A 4GC9A 1JSCA 4V0QA 1GAWA 1U2TA 1ZJYA 1C3OB 2F8SA 2PH1A 2O0KA 4C6SA 2JIPA 4NK4A 1E3LA 2Z1MA 2YFKA 3M2PA 5DHPA 1QIKA 2WPDD 1XNGA 2PTGA 3ZLTA 5CDFA 3HJCA 4AQ7A 1T2CA 3OBIA 4HGPA 4L9WA 3QPUA 4G0NA 1Z0ZA 3JQBA 5E2IA 4RD4A 1CRLA 1VBFA 4O02B 4N47A 3U7EB 1UJ2A 1X1BA 5A6SB 3W4IA 3WFJA 5KINB 4KPGA 3B8EA 3THXB 1FX0B 5T7BA 3P32A 1HL3A 3OESA 4ND8B 2MYTA 1MDFA 1RCTE 3EBLA 2ZTUA 3K5HA 5CYOA 3LY8A 1UBMS 3ETDA 5JRJA 2C7QA 2XUJA 3H2YA 1U3VA 2I99A 3OIDA 4Q7EA 4YJ2F 4YP5A 5A62A 3R76A 1GKKA 5JDIC 3DZGA 3EMKA 3CNLA 5FNZA 4ALIA 4JXJA 1OGYA 1DSSG 1J2EA 1T5IA 1A2KC 1SB9A 3OLYA 3B3GA 3PNSA 1CJKC 5JCXA 4FOLA 8ABPA 1EUDA 4C0AC 1LX6A 5E7IA 2ZJ4A 3QHQA 3EDQA 1K4MA 3KV1A 3ZGVA 1Z08A 3KUUA 4UREA 2CUTA 2ZRLA 4QRHA 4IRMA 4E7PA 2GS9A 4TRRA 4XWKA 5EIOA 5JPIA 1JG4A 1QCCA 1Z6ZA 4LI3X 2K5UA 2G3YA 1EWVA 3AEYA 3CNQS 3GNTA 1F3LA 5CVDA 3WWZA 2IS4A 4GPD1 5J58A 3O8BA 2G4CA 1A97A 3UGKA 1Y7TA 4C20A 3W5BA 2CEKA 1VE3A 1MNQA 3VV3A 2JFNA 4RWZA 1MTZA 4X90A 1YFJA 4ZTUB 2EATA 2DE0X 2ZAGA 5FBRB 3VZPA 2RAPA 3COSA 3R6WA 5JZSA 1D2NA 3UMRA 4YHBA 2UYCA 4BFYA 2R9VA 1YB4A 2PWAA 2ZRIA 4BBJA 4C3UA 5LQJA 3GEHA 2CVOA 2HBQA 3A4NA 2RHMA 5AKEA 3HO6A 2FZLA 3QWBA 2DWCA 4YIKA 3VR4A 2F55A 1Z5GA 1EUCA 5B7GA 1L5GB 4F9FA 5IEBA 3JVEA 3TMAA 2MSNA 1JSZA 2ZJ3A 1SXJE 1YMUA 2L2QA 4H7IA 3RVRA 3RRJA 3ZDYB 5F64A 1G3UA 4B82A 1KFCB 3IALA 4ARZB 4LRYA 4Z0TA 4XWTA 1YZVA 3DGEC 3FOWA 1BX1A 3FF4A 1OAOC 1T91A 4G6ZA 2A6PA 2JBAA 2BTQB 4YCLA 2HV8A 2ZJ0A 4MK4A 3N2ZB 1R0XA 4NZOA 2J7PA 1QVAA 3U3JA 3UQZA 3VTKA 4B6GA 5CNMA 2ES4A 4NFSA 1QOZA 1V71A 3WRVA 3STVA 4P22A 3W9YA 5HUHA 3VNAA 2WTMA 3BKXA 5DB4A 5DP2A 4BX8A 1ZESA 5B7QA 4CCYB 3RSCA 1QXSA 2A14A 5D3QA 3R7BA 2XNDA 1L5FA 1FCJA 1MKYA 1QIDA 1WXQA 2O2HA 3SEFA 4F8EA 2AFVA 4GNRA 2FPSA 1X7YB 1C9KA 2WYHA 2Y92A 3O4VA 1MA3A 2R7KA 4TMXA 3LLVA 4PYLA 5F3DA 4MRRA 3CWZA 4Y67A 1NLMA 1FL9A 3GT0A 3PPYA 4OFBA 2HBZA 4Q1CA 4B3CA 1R0WA 4B8ZA 3G8YA 1ZY2A 5D5QA 3T06B 1KHHA 3TBHA 10MHA 1OA1A 2IL1A 1F8YA 3FRJA 1U98A 1X1EA 5BV0A 1B26A 2IEAA 5GJBA 1VMAA 1KO7A 3B1XA 3IOYA 3KDSE 4H16A 1I01A 2Q1XA 3KXPA 2BFNA 4CHGA 1OILA 3PKIA 3ANMA 2CLFB 3AYXB 2ZG6A 1EX6A 3K0BA 3L1IA 3LUGA 1XVAA 3NNDA 4Z9BA 4LWOA 5JS2A 5CG2A 1KAMA 5BSKA 2PCJA 3LGAA 1DLIA 1RIIA 3NMUF 3G0IA 3OJOA 3VGPA 2H1OA 1GP2A 3UXYA 1F1JA 3N75A 2ZRKA 1L5ZA 1LVHA 1Y8QB 2CHQA 2O9JA 4HLDA 3W1WA 2D59A 5F7XA 5KC8A 2QNIA 2ZRFA 1OX6A 2IFTA 2LV8A 3F4LA 4AX4A 3BWYA 4WBNA 1SZCA 4MKGA 4EA9A 4DR3B 1J25A 4BQNA 2F62A 4HH3C 2P11A 5CIYA 3NOQA 5KAMA 3AY0A 4GZMA 2DLDA 1RWVA 3RKSA 2MWMA 4HDAA 3SM9A 4QTZA 2WMNB 4RL6A 1HURA 4LJSA 4TTIA 4KWCA 1V6AA 3KTFA 2A2ZA 3BG5A 3G1UA 4EYSA 5KYYB 3BMOA 2NMVA 1S3GA 1JLRA 3RJ5A 3IEVA 3EE6A 3MWEB 2G76A 1Q1BA 1L3IA 4M7OA 1W96A 3KS9A 4R0VA 1K08A 4XYBA 4CF4A 5FUWA 5IJ0A 5T64A 4PINA 4I3FA 3P5BA 1WF3A 5ERXA 5FWYA 1E5XA 3UMFA 5HZMA 2HDNB 2F3UA 5DNDA 1E69A 3GEGA 3HPRA 1WVMA 2HF9A 3LOPA 4RJKA 1BFKA 4F84A 4G5RA 3DE0X 3U3MA 2QMOA 4F7WA 4JA0A 2P5UA 1W5EA 3IQIX 5ELMA 5A4FS 2IEIA 4DMCA 1MV8A 1GQYA 1R8JA 2AFIB 1U0GA 1DIHA 2XF8A 2YY7A 4RZ2A 2NXCA 4GUDA 4WQMA 1IVNA 4PQFA 4XLLA 4W9RA 1FJXA 2H4FA 2J5XA 1XCBA 2O3SA 5A7GA 1X7GA 1EFLA 3CG4A 2WU4A 4WX2B 3RYCB 4KIFA 3I1FA 3TZQA 4OX9B 1F7UA 2F4NA 4HDNB 3ZDCA 1OWPA 3PG5A 1I7SB 5HF5A 2A35A 1U7OA 3AONB 4OQEA 1MIHA 9LDBA 1BMTA 2C57A 3F5FA 4RZQA 1FUUA 2C9ZA 2H2DA 2YQ5A 1ZZGA 3M1AA 1KWKA 1Z8DA 1OTXA 1PYDA 3CT6A 1HO3A 3IAM6 3KQMA 3OVMA 4MARA 4LZJA 2VCYA 5FEMA 4ARUA 2BKLA 3AETA 3DZCA 4CUZA 2NU8A 4EF6A 4OFWA 3QVXA 3B5IA 4CL0A 3PX7A 1CUVA 1X15A 1DXQA 4KR0A 3KQNA 1ZBDA 2CJWB 3R8CA 1I5RA 1L8XA 1QQ6A 1U0JA 1YR9A 3ADKA 4O33A 5DBEX 4ZU3A 2ORIA 5BN1A 4Q9IA 4B75A 1RNLA 1J8YF 1V3QE 2MYPA 1Q0QA 4JI4B 4DVGA 4F2PA 5TGDA 4C0KA 4IHJF 4HWOA 1NC1A 3LC1O 1EZ4A 2Q1TA 3A14A 4HP8A 1ULZA 2KPOA 4FHCA 4OPMA 3UT5B 2VWHA 1UDRA 3HA7A 2GN1A 4BNUA 1W9HA 3NXSA 4ESOA 5CJ2A 5FLXA 3LNTA 2BGRA 2VVTA 3ILYA 1Z62A 2DWUA 1H6BA 4KQ9A 4X60A 2AWNA 4ZARA 1T6ZA 3COPA 4WOJA 2WSYB 3MUFA 1FFDA 1E96A 1Z4QA 2FX5A 5DTMA 1XTZA 1HT2E 1B16A 3E9RA 3KCNA 4AROA 5L45A 4E4RA 1HMYA 3CA8A 4EJSC 2KS6A 2PIDA 5LUBA 1BVUA 1QR2A 2K2WA 2Q9BA 1CF2O 4NOJA 1DV2A 1PT5A 3NNSA 3HV2A 3Q3JB 2R6GA 1I6LA 2AXPA 3MWJA 2DF8A 3OETA 4MAAA 1QV9A 2PMFA 3C70A 3FPJA 1OFUX 4G0QA 5REQB 3UMCA 2EV9A 2BUBA 2IQ5A 2UVQA 4WZZA 4N01A 2I9KA 2NVBA 3WFZA 4D8WA 5IANA 3AERA 5CTJA 4BO3A 1KK0A 3PNLA 4AJHA 1E0JA 1AV6A 4DPLA 3QKWA 4NPHA 4O59O 2JLUA 4IWNA 4NBNA 3R3ZA 1YONA 2D5IA 1U9ZA 1PWXA 4FU0A 3L7MA 5LZ9A 1TO1E 1RJ9B 2UKDA 3EW9A 4JL8A 4XWAA 2R5WA 4MCAA 4IJVA 3OHSX 2Y2VA 3N8IA 1M9NA 3N0XA 5BOSA 2OQRA 4GPEA 1MIOA 4Y0AA 5DI3A 2HPVA 1QF6A 1RLTA 4XVCA 4S3MA 2Z1DA 3KEOA 3PRJA 3HN7A 1VGQA 3E9DA 1GGHA 1Z7WA 3BHJA 2QT1A 3BWXA 3GJYA 3GMDA 2A88A 3P9PA 3UF0A 1SUEA 4RD0A 3PUKA 3OZCA 4PZZA 4F9GA 2JGMA 4ND3A 4G8CA 4RTNA 5AKLA 1OH7A 4DVJA 2ZWOA 4ACAA 1F38A 1R6UA 3AP3A 3CXRA 5K3SA 4WFIA 3BD8A 2HKIA 4HVTA 3C8ZA 5DNYB 4R2MA 2KSQA 1HE1C 2GPAA 4M0UA 1I2DA 1GPAA 5IDYA 3SSMA 1C3EA 3KYCB 1QTQA 8LDHA 1J33A 1S3IA 1RYBA 3SU8A 2EVWX 1WXXA 1EDDA 5A9TA 4LXHA 1WXGA 4PHCA 5BWBA 2PLFA 1JVSA 3BHMA 1SZDA 3PQDA 5H8WA 2NXEA 3I6YA 2FPRA 3RF6A 4XWOA 1E1QD 2VBFA 4F86A 2FZWA 3I2HA 4EG5A 2ORVA 5BQXA 3CLSD 3OEHD 2PGJA 4BHTA 4RE6A 2YWGA 3BFPA 2BFMA 4OKSA 1LK7A 5LQDA 3VNBA 2WSLA 1E0DA 2VHYA 2Q4EA 2GHRA 2OCXA 1RRCA 4DMGA 3W5HA 3KCQA 2IZ0A 4TM8A 4EAAA 3WC4A 2HLPA 1EWKA 1YOVB 1PYOA 1W4AA 2FUNB 2WHQA 1LV7A 4YMGA 4UNSA 2EG9A 5LB2A 3VR6H 1LPAB 5CT5A 3ZVMA 1SHLA 2QAJA 3THYA 2O19A 1GRVA 3G2MA 3JYHA 4MV0A 4HXYA 4YBRA 5BNIA 5DYWA 1T34A 4ZVQA 1MC8A 4CKEA 3S44A 3O95A 4EJ0A 1WHTB 4JJGA 3LIPA 3QWFA 4YP7A 5HQTA 2GKOA 1BVHA 5TSDA 1KY2A 1VKZA 3JAKA 3AKYA 4RGVA 3U81A 4DIDA 2CDNA 2JGKA 1FBTA 3G3EA 4H7EA 4MYRA 2TMGA 5KSPA 3IT1A 5IAAA 1WR8A 3RRNA 2GESA 3TVYA 4EIWA 4Z86A 1YZNA 3GRCA 2YQZA 3U4IA 4QBGB 1V4VA 1CY2A 3F5MA 1Y3DE 5JD4A 3DO8A 1MQSA 4H77A 3ZWAA 1ODCA 4GEKA 4MAMA 2C9OA 4LGYA 3TSWA 2WMDA 1W5AA 4A92A 2OYCA 2ON6A 3X0DA 3OX1A 4C9BA 5K8CA 4L8VA 1AZTA 4QJBA 3WGKA 3LGSA 4LXIA 3TD6A 2I54A 3M5DA 4G0VA 3G0HA 1RYYA 2R8BA 4B7ZA 1A8QA 2NSYA 4X1OA 4MS4B 5DRYA 5JSQA 5TVKA 4AN1A 3ZHVA 4DTCA 2J5BA 4U2EA 4ENPA 1WZNA 1T9CA 5I3ZA 1YA4A 4R8KA 1YACA 2EZ9A 3UHAA 4B3JA 3GZNB 1RRFA 1YHYA 1MP0A 3OX3A 5ALWA 1XLTC 1E3DA 4FD3A 5LXTA 3BK7A 4YLYA 3SHOA 5I8WA 4MVJA 3P2IA 2GD1O 4K6FA 3OE4A 1XPJA 2A5LA 2DR3A 3NWPA 4HXEB 5LM3A 1OYYA 3QKTA 3E8MA 1ZA1A 1ZNWA 4LDZA 2J5KA 2BHRA 3D3WA 1NRJB 2EBHX 2W7TA 2VDRB 1T9BA 1F8FA 3C6ZA 4QXAA 1DGQA 4QJ4A 3AP2A 3IDZA 4GZLA 2Q5EA 4UXJA 4BLVA 2BDTA 4EEZA 5IS2A 3K6SA 2QLLA 1N2IA 1TLTA 1ADJA 3P9QA 2O0MA 4LPKA 1MHPA 3A7DA 3B2EA 5FFMA 4C07A 1OVMA 1IULA 2NW6A 3DHWC 2GRUA 1IHOA 3TK1A 4MV8A 4PRLA 2Q45A 3EUWA 1NBWB 1BDJA 5K0SA 1OFTA 1QBKC 3T5BA 2NTEA 2SHKA 3K0KA 3ZV5A 4HLCA 4ZQGA 2HJWA 3FOFC 4TSFA 2CDBA 4F45A 4MLCA 1RI3A 4L7QA 4Q4CA 5KMGB 2GUGA 4C4YA 1XQ9A 2AC4A 2YYZA 2R6CA 3E3MA 4NH0A 4K2AA 1SBCA 1C3LA 2ZI9A 3ISJA 5G1NA 5TARA 4HG2A 3AR4A 3FOZA 3CZ4A 4ZK6A 5GJWC 5ILOA 1Z7YA 3W5JA 2QVYX 1CHDA 4GOJA 6REQB 1QJ4A 1YJBA 1A77A 1SCUA 1GLGA 3OX2A 4FHEA 4XFJA 4XAQA 5ILQA 2GCNA 1ZL0A 5KDOA 5KHLB 3FR8A 3R9XB 3N2LA 4DY4A 2WFLA 1XAJA 5CIQA 5M2QA 4LRWA 5JSZA 4BLQA 2P41A 1FTQA 2R751 3OKPA 2IUFA 4BV8A 1VBMA 3DJFA 1T9ZA 4H7FA 3ZVKA 1KETA 1X19A 6ADHA 2CXSA 2WJ6A 1NY5A 2V7BA 3CE9A 1NQOA 1CZUA 2RJOA 3OSUA 1IRXA 3OFND 2XZLA 1E7MA 2I62A 1SCDA 3EC1A 4OU4A 1BD4A 1EHIA 1SIWA 4G25A 4YDHB 3RTDA 3T3DA 4BKOA 2FZ5A 4CF3A 4K9DA 3V4OA 1EAYA 3G85A 3FHCB 1QFSA 4PNHA 2HJSA 4PPFA 5TS2A 1RZRA 1FTWA 2FN3A 4LY6A 3NXKA 1H2AS 1HC7A 1JJVA 3I73A 4LMPA 4BVEA 5TF4A 2H4HA 1GARA 4IDNA 3PK0A 2K2QB 2EAUA 1KP2A 1TRKA 1FW8A 2RE8A 1RLOA 2EBFX 2I80A 2HU5A 2DECA 3FPAA 5CVCA 3BL5A 5ALOA 3RG8A 3NYQA 2HJVA 4IICA 3SQOA 4EKNB 4RYLA 1OV4A 4GR9A 1WB4A 1QQ7A 3UCEA 1IOVA 4A26A 3LQQA 4ZAVA 1QYXA 3O4IA 2LPMA 4JDPA 5CD1A 2MJLA 2OCBA 4BFLA 2HFKA 1RAIA 2PMKA 3CF4G 1Z63A 1H4VB 3N8NA 4JN6B 4FGLA 1FS6A 4ZQFA 3ZWKA 2FX2A 2EKBA 4G67A 1H0SA 5ESDA 2WV9A 3X44A 3WGTA 2FSSA 4BRZA 1L4YA 3T4PA 4FYJA 4DV3B 4EL0A 1RP1A 4OUDA 1L3CA 1GU0A 2HHLA 1BEEA 1KJNA 1P3DA 3G5AA 2ZRBA 4RVDA 1FRNA 5JFOA 1LDGA 2KHZA 5BWCA 5F5NA 3ZY4A 2CNNA 3N2NA 5T57A 5ALKA 4DCNA 1C30A 2WE8A 4PGGA 1DBWA 3L0YA 4F4UA 2RJNA 1NC3A 3L7NA 1ZJ5A 4BLPA 3EDYA 3OIVA 5L3QA 2E18A 3H0KA 1RABA 5E7QA 3RKUA 2RIRA 3HYCA 5DIZA 4BZQA 4HBGA 3LT0A 4EMUA 1WPRA 2O6HA 4MI9A 3C6YA 5DNCA 1AA6A 2HK8A 1RQRA 4QTTB 5HBGA 4RZXA 3UUFA 2P90A 2PUDA 1XNRB 4WDQA 4I1IA 4G0UA 1X1CA 1CPYA 2PVCA 4HZGA 3HJRA 3AY7A 3D2AA 2FR0A 3BWDD 4AZ3B 1ZRHA 3BQ9A 4GKBA 3MK31 3B3QA 4Y2QA 4ZT2A 3QEBZ 1HGXA 1IXYA 4FCWA 2GPSA 1NYRA 4GZ5A 4PXYA 4UTRA 3T4EA 3J7AC 1LQTA 5ADWA 3EEFA 4Q9JA 3FTFA 3WB9A 2BIFA 2J0UA 1KSJA 2IY8A 2ECOA 5K03A 1NMYA 4DCOA 5FUXA 2WRZA 5EWLB 5B58T 3LI2A 3QVUA 1PU2A 1CIPA 1V39A 3QE4A 2XD9A 1GN9A 4YXWD 2W2OA 4RMGA 3MOIA 3MT0A 1WNFA 4IMRA 2P9TA 2R87A 4GM1A 4Q9NA 1AY0A 1XI2A 5ECWA 2ACVA 4Q48A 4GLLA 3BMCA 5I5GA 3PEYA 4KRFA 4HWSA 1OXVA 2RAFA 2V0NA 4IH1A 2E4VA 4MWTA 2FWJA 2O3QA 1KO8A 1YC5A 2HMAA 1WKCA 5AOCA 4QREA 4RW0A 3RVSA 3D5QA 3TD9A 8ADHA 1F7VA 1OZHA 3TG2A 1Q7TA 3B36A 1A1SA 1Z3IX 4LJKA 4QPPA 4OFZA 4PQYA 2FUG1 4URZR 1M2FA 5C9ZA 1PJ4A 2O4CA 1BS1A 2IX9A 2PGOA 1RC0A 3UAOA 4QDUA 3YASA 3RASA 4G23A 4JEHA 1NVWQ 4ZJYA 1E66A 1EHCA 4YMSA 3H8SA 1XROA 4I55F 3E15A 3L6BA 1ENZA 3T3MB 1L7PA 2CGEA 2A9KA 1VLQA 3INYA 5K4AA 3O82A 3C48A 2AKYA 3C1AA 2V4ZA 9GPBA 2X1VA 4K9PA 1ZCAA 3UEOA 1S8NA 3S70A 2ZAOA 3UAXA 1YR2A 2B21A 2XA9A 4Z4CA 3MILA 5DCWA 3E0QA 3DT8A 1XMQB 4IAOA 5CUQA 1G16A 2IYPA 3P2EA 2NVWA 3UG7A 3N8GA 1DQZA 3QWAA 3HO8A 3ZGLA 5B36A 3L4KA 4I9GA 4MGEA 3MJFA 1Z33A 3OTGA 3TM5A 4UVHA 2GCEA 3HXOA 4KBGA 1CZLA 2HO5A 1LSSA 3JW8A 4R8MA 4RVSA 3JYPA 4HWKA 4YWHA 5BSUA 4U3JA 1FDVA 1JV2B 1KI2A 5EJMA 4R68A 5D6OA 2WV7A 5EJ8A 1D3AA 2FWMX 4W9MC 5A3VA 3CSSA 2Q5HA 4QPCA 2DPHA 4CDMA 2ZBDA 1CJSA 4MDEA 4L5JA 5HWSA 2XMZA 5AJHA 1GSIA 3OPXA 4YASA 4G4GA 1KYYA 3H87A 2JD0A 3RIXA 4X20B 4F4CA 5ELXA 2NTNA 2WYVA 4C08A 4MYTA 1Z35A 1QTRA 4M8IA 1ZNYA 1VE5A 4H0NA 5AI4A 5LMCA 5AW7A 2RGRA 1XSEA 4GLJA 1LX7A 3RNLA 2HB6A 3NAZA 3N6XA 1LSUA 1CQPA 4TXLA 1Z4PX 4DNOA 4C4XA 3KLMX 1ICIA 2GPYA 5L3SA 1U3WA 1D2GA 1VPVA 1I9GA 1IZ9A 1GXSB 2YY5A 3PIDA 2B2XA 1A9SA 1LI5A 1CERA 2I2FA 2PGIA 5IYZF 4OHMA 3HHEA 1B23P 4GEGA 4G9GA 1LTHR 3UN1A 3TE6A 1SZPA 4KQ2A 5FO1A 1U0FA 1Y6RA 4KXFB 5IWCA 2UZ0A 1LGYA 4E5UA 4MR9A 2FMTA 4J9VA 4AP9A 1V2GA 3V6MA 4QG3A 2YWXA 4D0LB 5BWOA 4TT3A 5BW5A 2F90A 3I23A 4B3DA 4EW2A 4W8OA 1DOHA 3L4EA 4KK3A 5D3MA 4PQRA 3NZEA 5IXSA 4PHFA 2QP3A 2C29D 1M2GA 2FW9A 3HY3A 4ZC1A 4MYHA 4AICA 2RHWA 4JJIA 3FUVA 2OV1A 4J2TA 2ZVQX 3ZR4B 5K09A 4O2BB 1WEHA 1RJDA 1S2NA 1XQYA 1F0KA 4F9TA 4CV1A 1QFXA 5MDHA 4KHZA 4NQZA 1KOGA 3IE1A 2YFYA 1GUZA 4Q1FA 3VSEA 4AO8A 4D9GA 3KKLA 3NW9A 2DEUA 2QTFA 2WW8A 3IVRA 2PR7A 1LK5A 1YE3A 2VYND 3GUYA 3VAZA 2ZBQA 2FP4A 4N41A 1O95C 1WULS 3LBIA 2Z2JA 3MYYA 1KC1A 3PNKA 2YY6A 3HKEB 1SQ5A 4ZO7A 3A6KA 4ZZ2A 4ZAWA 4E33A 1SVIA 1EJ0A 2PM8A 1Z4JA 1RE0A 5K3BA 2OL4A 1TM3E 4JKOA 1IIRA 3F6SA 4W1QA 2LR0A 2YHIB 3WNDA 3AUXA 4GBGA 4UU1A 4IDPA 1Y7PA 2OWDA 3EUEA 4K86A 2ST1A 3AEQA 2R6JA 3ASZA 1PWYE 4B0OA 2PUWA 3ZKWA 3B38A 2PUJA 1JU4A 3AEUA 2WOJA 1GNVA 4LX8A 4DQVA 1V7QA 2GXQA 5BYJA 4ECAA 3F4BA 4JI8B 1QRDA 2CJPA 4TTSA 2NP6A 3MZ0A 1YS9A 2WZCA 5IVIA 4V1CB 1SVOA 3SQNA 1T9KA 2DH6A 3ITDA 1ISGA 3SJUA 2WR8A 2PZFA 3IDAA 3MJDA 4NSNA 1DMSA 5DX8A 1XK6A 3Q41A 5JV5A 5K99A 2OZKA 4N8EA 4Z4HA 3ZDEA 3QMVA 4BO9A 4YRAA 4OHPA 4LHZA 1VRVA 3ONVA 4R40A 3WIEA 4E2XA 1U3FA 1FTGA 2IZ6A 2BT4A 3O8OA 4HQRA 3MB5A 3TLZA 1EAMA 1N0UA 3G8DA 2D5AA 4WKBA 3VVLA 1Z5ZA 1E63A 2P9EA 4WWHA 3OLXA 5EYPA 5JANA 4YEDA 5KX5F 4AQYB 1DIGA 2YRWA 2FAXA 1HRKA 2M32A 2DB3A 3T7KA 1ISJA 2FMXA 1QHHA 5F4BA 4D43A 1D2MA 3Q3CA 3BHNA 1H69A 1CY6A 3W2EA 2F67A 1XG5A 1CUZA 5HKAA 2YIJA 2PS1A 1DT5A 1ZMBA 4NXNB 1FDUA 4CRWB 1SBHA 1X94A 2RH5A 2Y0BA 1XMIA 4I50A 3C2QA 4WKCA 2CL0X 2ZWVA 1TU3A 1SOVA 3DW1X 3ETNA 3UW1A 3KSBC 3VKHA 3TXAA 4OMDA 3S5UA 5E4JA 4BB0A 3GPDG 2YC4C 3TPZA 2CMDA 2FFHA 4Z6KA 1W5TA 5INTA 2QBYA 4M46A 3S2FA 3VTAA 1UJBA 3PT5A 1EX7A 2C5BA 3I2GA 3UT6A 4YXFA 1IXZA 2GTHA 1KC3A 1A9XB 4GBMA 4PO3X 1DC7A 3NHSA 4U7WA 4V0MA 4RDXA 1TGVA 2R96A 2RGDA 3JQEA 3ONWA 1Z2EA 3OD1A 1CUUA 4A15A 1PJRA 1QP0A 5CX4A 3U0VA 1Z5PA 4XYGA 3N2KA 1FVXA 1OE0A 1ZLYA 2RCYA 4OY3A 4NAUA 4XQ9A 4LY9A 1VG8A 4MUYA 2HY7A 4XQCA 4FYYA 4L7VA 3S68A 1G0OA 2PGLA 4RS4A 4QYIB 2OAEA 2ZYRA 4OHFA 2AK2A 2PYZA 5CR9A 2LKDA 1DRUA 1F3OA 2P75A 3O73A 3OM1A 3KQHA 4C7MA 4F3CA 3A0UA 4DR5B 1GZ6A 1K3TA 4H3VA 2IS1A 3TNDA 4CMHA 2C7BA 2O8CA 2QVLA 1JSRA 4WIAA 1JDJA 1VA5A 3C16C 4GE0A 5HF9A 1KYXA 2P62A 4JAVC 1J0EA 4W99A 2V0GA 4WXHA 4KVFA 4UU0A 5CEJA 5JJIA 4Q0MA 3BH7A 3T35A 3FMPB 2VF2A 2I4OA 2DC1A 3UY4A 2VQFB 4YJ3A 1RWNA 2EL9A 2NX2A 3PYLA 4Y9UA 2CFRA 2AIRA 3RREA 3IKJA 3PU6A 4RXTA 4I4TB 5ALTA 1GPNA 2WJVA 1C3XA 1SKAA 4I08A 2FK8A 5EI5A 4BNZA 4EY6A 1O94A 1M54A 2P2GA 4ND7A 1F06A 1V3UA 1CK4A 3Q2KA 3OT1A 2EIHA 1QTIA 4OOFA 4I3HA 3D3KA 4LVCA 1PR0A 1XU9A 4P5PA 3TD2A 3JQGA 1V48A 3IQDB 3ANTA 5K8JB 1G64A 4DWJA 2Y1LA 3KKEA 3ND6A 3GLFE 1WWKA 2J9FB 1IMJA 3WKBA 1XP5A 2CHVA 3ZLVA 1QC5A 4ZVKA 4HK4A 1ZIPA 4FEYA 1HZJA 4WK2B 3ZS9A 2BE9A 4NVRA 4RY2A 3Q0EA 3T61A 1NWHA 4EX6A 3LLCA 4D99A 3R0JA 5H16A 4YDSA 3C39A 1Q7CA 1XC7A 2NU6A 3D8UA 4YJ2B 3CE6A 3LL7A 2O2ZA 3L92A 1K4KA 2NSJA 3MMNA 3P71T 2ZPUA 1F60A 3A25A 3I3SR 4KX3A 1QGZA 3TRJA 4M36A 2O1EA 4ITVA 3UV6A 1YS4A 1HDEA 5I7WA 16PKA 1ZGHA 4F4HA 4BTEA 1T3HA 5EERA 1BNCA 3TVDA 4JQOA 1HBJA 5DTRA 1JDPA 4D2IA 1KU6A 4MVJP 2JAQA 3RTAA 1Q0TA 4J1NA 2QV0A 2QXTA 2X8AA 1R5JA 1ORDA 4H3KB 4WNCA 2O2IA 4X61A 4X94A 1J0AA 5M29A 3E1GA 1VLHA 3I9MA 1E3EA 1V5WA 1MW8X 3O8NA 3P7MA 3BB4A 1CB0A 3WR5A 2NZJA 1LF0A 3CZRA 4GQIA 1UOQA 2VHVA 4B6FA 3I5UA 2Y2UA 3RS0A 4D80A 2ZJ2A 3HI6A 3MS4A 2PMBA 1ZUHA 3BBPA 1XRSB 3F5QA 3O8LA 5LZ8A 1X92A 4A3SA 4D0NA 2GBPA 2IJGX 3EWAA 2DKFA 3K09A 3S7TA 4PQGA 4D6PA 1CJTC 2HJRA 2ZBUA 4N12A 5DHFA 2NN3C 4UEKA 1SU6A 2HA4A 1Z0DA 1QYDA 3GRFA 2EHDA 2OZVA 1U0BB 3CO5A 5BN4A 3ZTWA 3GJ3A 4A2CA 2AZDA 4TS4A 5JVDF 2FJPA 3P2OA 1JDZA 1K2VN 1S6YA 2B36A 1U1EA 2W6CX 2XRYA 1EDBA 4MULA 1M2VA 3UCFA 3PPXA 1ULUA 2AG0A 3T3OA 1QQTA 3CGWA 4AF6A 3A6JA 1F4VA 1FXSA 1Y6QA 3DNFA 4O0LA 4X1YB 2W5UA 3GDGA 2B9EA 3TCKA 2QNBA 1J8MF 3PWSA 1TM4E 4ZZ0A 1UXKA 2D4AA 2V5AA 5EPEA 4FYIA 3U62A 3ROQA 5LQRA 3ONEA 2AFHE 1II0A 4LV5B 4Q1EA 1YZGA 2ACKA 3OIGA 5CB8A 4P4GA 4HFMA 3EOZA 4JBNA 3VU1A 4EENA 1XV5A 5EVJA 3TCNA 1UK8A 1TM1E 4F71A 3G5LA 5IZCC 3NWOA 2WD8A 4Y9RA 2ARKA 2QPTA 2PUTA 5A6VA 1SZJG 3M4XA 1LXCA 5C8YB 3MXTA 4WVLA 3V97A 2SCUB 5KIAA 3BWMA 1RRPA 4F1WA 3I45A 2VT3A 4MHSA 2EJUA 2H31A 3WJ1A 3PHCA 3WLOA 4CYMA 3EVDA 3AKZA 5HRCA 3CKKA 3FYHA 3VBEA 1UDCA 5CVTA 2G83A 2H9YA 4C4AA 3IODA 1X0VA 1ZEMA 2AEMA 3OLWA 1SHZA 3FIJA 4TMZA 4HT3B 4XDYA 1ZG3A 3NWBA 3ZXSA 1MJGM 2YICA 3WJAA 4N18A 3SSOA 1BXKA 3L6DA 2V4MA 1JAIA 3KR2A 4X54A 3HCFA 3WY9A 4JI0B 3O8QB 3PUZA 4PG7A 4O2AB 4U00A 3EVTA 4YMLA 4UHHA 2H1RA 4G41A 4E3ZA 4RVFA 5KQRA 5HTOA 4WRRA 4Q1DA 2B5VA 1ZGCA 3T3IA 5CYFA 3EEOA 4C30A 5DYTA 2JGDA 5HK8A 3GLRA 3AHFA 2LCIA 2VK1A 2Y67A 1Z4NA 5CA1F 1EGQA 1XP8A 3RCBA 5E0OA 1VLJA 2XD4A 2B6NA 2H7CA 2O4UX 2PZBA 1XCPA 2HLNA 2BI4A 4A23A 4MUHA 3SOPA 1HFEL 2YWCA 1VDMA 2HNAA 1U0NA 1JLHA 3HBNA 1OIXA 5FNVF 4JBXA 4QBKA 2ET6A 1JKJA 4PGAA 1DEXA 5ITVA 3DEJA 1SWWA 2PLWA 5TLSA 4ARCA 3QXJA 3U9LA 5L3RA 2X7XA 1L9XA 2WJYA 1NUTA 1F0NA 1QANA 3SXPA 1PKEA 4EG7A 3JQPA 4Q12A 2J85A 2CHGA 4L8LA 1Y8AA 2E48A 4XD2A 3K2QA 3N07A 1QIJA 1BEZA 3SEAA 4NF2A 1Q91A 2CMKA 2QX8A 4A0HA 1IB6A 1ZYUA 2ONZA 4IIJF 4J16A 4CM6A 5CBPB 4C2UA 5A0TA 1R7RA 4G07A 1FSPA 2YHBA 3DXYA 2MDTA 4I8DA 4R31A 3WYDA 4HRXA 3TAUA 4MWGA 1IXSB 1K8XB 4PPNA 3THOA 3W8FA 4CLOA 2HBRA 5CK5A 1P7YA 1ZM4A 5D2CA 1SULA 2G25A 3MW8A 3L7OA 3OJEA 5EJ2A 4AD8A 2I33A 3O31A 3LPNA 3QEOA 4JB8A 5BURA 1TKCA 4XUDA 1FVFA 4U9UA 4M1KA 4QNRA 2G06A 1QBGA 2YXEA 3X1KA 4A27A 3E2PA 1MOPA 2IX3A 2GAAA 2HZBA 3WADA 4TYWA 3KOWA 1SEPA 4D8XA 1S7GA 2APJA 1EP1B 4HQKA 4PANA 4IINA 1ZD9A 2P3SA 4KXLA 1JIIA 5BN3B 4MVWA 5A0FA 1CUXA 1UOOA 4MEAA 5EA2A 1I0LA 4X1KB 5LSAA 3NBFA 5FWAA 4EPXA 3F6EX 3IT2A 3PF8A 1W93A 2WF8A 2D1TA 4KR3A 5IC4A 5FF9A 1P1JA 2PO5A 3WMXA 1BS9A 4NZ9A 3RB8A 3FCCA 3C8DA 3DUWA 4IEFB 3BGIA 2JIRA 5CHEA 1G8SA 1DIOB 3EXFB 4BVLA 3JASA 1OREA 4FC6A 3KJFA 2JDID 2ZDQA 2FFBA 3RS7A 3QIAA 2W6PA 3QY0A 1T2DA 2F3SA 1T9GR 3I2FA 4CKWA 4BAZA 1XL1A 2D8MA 3EA5A 5HKKA 2OHIA 4IHJB 1TA9A 4MKIA 4W9NA 3V1UA 3PEFA 1MQAA 4CT5A 5HVNA 2I8AA 4B33A 1HDCA 4IQFA 1E1DA 4KOAA 2YIMA 2Q7DA 3MF4A 3VGJA 4F85A 3MCWA 3RW9A 6GPBA 1FJHA 5GAJA 4HDRB 1JLLB 4TTAA 4UNRA 4RULA 1MF7A 2VPYA 2XMDA 3PYMA 4HYTA 4G56A 1OKKA 2WKPA 5KJ1A 1XMXA 1OY1A 1JEDA 2OV4A 1YC2A 1YMQA 1KZYC 4AZ0A 3AEXA 4MUMA 3IKVA 3UMGA 4TQAA 4CM8B 4CQNA 2PTHA 1PNTA 1W59A 1U94A 4ZHQA 5JHGB 4HB3A 1H9CA 4NS4A 1KGSA 1J22A 3P96A 4BY9E 4RY8A 1JT9A 3DAFA 2D54A 2W93A 1Q1QA 4HPXB 3UA4A 3CYFA 1T3TA 1PNVA 2E82A 2QTGA 2ZB3A 1FDSA 1VJTA 1WDLA 4WLUA 4BGEA 3DF9A 1LKZA 6YASA 3H75A 1UP7A 5E2BA 3RIYA 4BPRA 4NAHA 1MH1A 4QNNA 3IAXA 4CEHB 3O74A 2JS7A 4RGYA 4V3CA 4KLCA 1RXVA 1R4NA 4HY3A 1G9TA 4GG1A 4JQCA 1EDOA 5A9SA 5KNDA 1CUSA 4X7MA 2P6RA 1TK2A 4X1IB 2JAUA 2HRRA 3B9PA 3QBDA 1FP2A 3QVGB 3LX8A 2EJWA 2EKLA 3KLPX 4TLAA 4TV8A 2E2WA 5AQEA 1I30A 3JD4A 3T95A 1OJ7A 3JZIA 5TMEA 4FPXA 1RRMA 2YV3A 2VJQA 3WLTA 5B1SA 3HN6A 3FHTA 3GLQA 4RA6A 4MGKR 1JQJC 3GGJA 2ZJAA 4G65A 4GI2A 2EEPA 4A91A 2R4QA 5E1MA 5P21A 4RIIA 4LXUA 4TWBA 4U1RA 4KXNA 2WYUA 3F71A 1M7BA 3F46A 2XNJA 4YAIA 2DBYA 3RR2A 3O03A 3PGXA 4NCJA 2QVCA 2G9ZA 1WMEA 3A28A 3A4LA 2IYQA 2JRLA 4DV4B 1MLDA 3D9QX 4INPA 2GDJA 2DTEA 4G5SA 3L01A 3GVCA 4S1TA 3HVHA 1ONNA 3BUSA 2QYSA 5J2UB 1W5FA 4PBTA 4TV9A 3ZEAA 4HRYA 1QHFA 1AKUA 5M34A 2JZOA 3DCIA 5ALHA 3HNPA 1RTKA 1U0EA 3LU1A 1G66A 4M60A 3DEZA 5E3IA 1F1BA 4CFYA 1CDDA 4EJSB 2H1HA 3KJGA 1U90A 2PV7A 1LBTA 1Y1LA 3EULA 3FX2A 3HR7A 3IHLA 3L82B 4G0XA 4Q93A 4WKOA 3AHCA 3U7HB 4FR0A 1PFGA 3ME5A 4ZOLA 3DGFC 3FFBA 2YS6A 4Q6BA 1CJVC 1RKQA 2H5JA 6Q21A 3CINA 5EHGA 4GWLA 2X4DA 1VI6A 4MA4A 4WJKB 3C97A 5HOEA 1B74A 5GM2A 1W1UA 3DQPA 3H2GA 3HDYA 4FWBA 4HDMB 2NSDA 3SS7X 4EKIA 3PUYA 4MWEA 2QTZA 2H2HA 3CRVA 1ISRA 3O4GA 4GPIB 2AX4A 3ZE1B 4BFCA 5IJ9A 1EI9A 4MB0A 3EXEA 1LA2A 5LR6A 5EJAA 1YZUA 3ZWOA 3CXUA 4JLBA 1XZIA 4GI5A 1XTBA 2G7MC 3TIIA 3Q8LA 3VR5H 3KSRA 4EO4A 2GAJA 2EGUA 3CLKA 4E11A 4WOKA 2P69A 3ZX5A 1M66A 1NL3A 4U4AA 3ZHUA 2UZAA 1L7QA 3ZE6A 1V6SA 1C9JA 4L3OA 1QH1B 2FRDA 2NADA 4LQ4A 5FTMA 1LNQA 1E2BA 2ZWPA 3JQ7A 1RM0A 1V1JA 2O0LA 4KGVA 1FS4A 2UVPB 3JWGA 3KZVA 4TZTA 2XAAA 3JYNA 3PD1A 5DK6A 3TLEA 3E03A 4HS9A 4MW7A 4ARIA 3DAPA 3COJA 1U7DA 1RAEA 2OP1A 2ZKIA 4H08A 2WNSA 3G0DA 3TB6A 4RAQA 4E1BA 2ZJOA 3GWGA 1FFSA 2CY0A 4EI8A 3QEMB 3Q7TA 1EX1A 4CLDA 3HMKA 2DKNA 2QMQA 1ZIYA 5HOQA 1Z75A 1OUMA 4GMGA 4BNJA 3FTQA 4J0QA 1VIMA 1B4DA 2OO3A 2WWWA 4WJZA 4US1R 1DCTA 2H48A 4BNFA 2BKXA 3A6ZA 1W19A 1G55A 1CUYA 1L5VA 2JLSA 3CWQA 4IEEA 4NK5A 1WPGA 3AF1A 3MS7A 1SOMA 2W4MA 2JLCA 3OEEA 4KO2S 4WCFC 2JAHA 3IHKA 5FT9A 3VAYA 3NASA 3HCRA 4GWKA 2X14A 4JT2A 4ASUD 4G8JA 4EHDA 5BRJA 2VYVA 1M5TA 4D5EA 2CBGA 1GRCA 3ABQB 4C21A 5JBQA 1U2DC 1GNTA 1DUVG 4RQUA 1NU8A 1QHNA 5SZIA 3G7NA 3UFXB 1PFWA 4XQEA 5HM6A 3FVRA 1E6MA 1JKFA 3ACCA 1P77A 3GN1A 4EGFA 3F9CA 2V1XA 4R01A 1I7PA 4GBJA 5TQ2A 1LJLA 1BO6A 1QYIA 2Z95A 1KFJB 5JH7F 1WEKA 4Q18A 2VN8A 3KKKA 4X3CA 4CN9A 2D2IA 3A1FA 2VUUA 3PD7A 3QP9A 1Z6PA 4GD3Q 4ZQCB 3M6LA 3RBAA 3RQSA 1Q7RA 2OOSA 3JAWB 3BCHA 2GD0A 4NBLA 4CL2A 3TSYA 1UBSB 2PX8A 1SD1A 2R66A 3QX3A 2DH5A 2WLSA 4CIYA 4JR2A 2GF9A 1JEQA 4MVJG 4PNZA 3PP8A 4IV8A 4W8HA 2Z6UA 1Y5RA 2FQXA 4QL3A 2AJBA 3RGGA 4INZA 1ZZEA 1NBMA 2JAPA 3GLVA 3SJCA 3V4VB 3VVCA 5KREA 1KYIA 2ODQA 3IUEA 3FVVA 3W90A 3WLAA 1DQYA 1NP7A 8OHMA 4LJ6A 2B5WA 4B83A 4DT1A 1CEQA 3FTDA 2YW2A 1J9ZA 4LJ8A 4PONA 1AE1A 3A9VA 5C7LO 1LI4A 2RKWA 4PS1A 2I6UA 1Z4OA 4GVPA 4HQFA 3SKYA 2UVDA 2OXEA 1SUAA 2Q1UA 3KUKA 1L6RA 1EA7A 3KJEA 5T8KA 3OQNA 1ISMA 521PA 4B73A 4IQ8A 1H42A 2O3RA 1H2ZA 5DN6A 3ICOA 3WDLA 4R9VA 3DOEA 1FYEA 4QVKA 2XWBF 4OI0A 4I1YA 3W3AD 1U8TA 4J9UE 1DINA 3BSFA 3DV2A 3RM3A 4RETA 4B43A 3F7TA 3HACA 1U4NA 3MQ4A 1EFRA 3BK2A 3ACDA 4QRIA 1HTBA 4NKRA 1UP4A 1L7OA 2QN1A 4JQYA 4M22A 4YMHA 3A6HA 2REQB 1C5KA 1LLDA 1A2BA 1AS2A 2R8ZA 1XD8A 2FEAA 3E82A 1QIGA 2G9QA 2G0AA 2CKMA 2ZJ7A 3CSUA 3QELA 4FINA 5CLLA 5D00A 3TSZA 3K4PA 3V7WA 3A3OA 4TWIA 1XLVA 4NCHA 3U9SA 3U7QB 3HKDB 5FBZA 3V00A 4HGOA 4EKDA 4EW1A 2DR0A 5LZ7A 3T6KA 4DSUA 2RGXA 5DXAA 2BP7B 3MTBA 4WOPA 2C4VA 2JFWA 1D4FA 1GPWB 2IYYA 1EXNA 3KYDB 3PWTA 4MUJA 1YHNA 3PFBA 4XIJA 3F98A 2HK6A 1BE0A 4Q1VA 5AVWA 5IU6A 4GKKB 2PWPA 3G2KA 3IO5A 2D0DA 4OQXA 5FO0A 1EE2A 1PT6A 2O8EB 3ZIUA 4QM7A 1M3SA 3AMVA 3N6RA 1U1FA 3CW2A 1GLVA 4MJ3A 3U09A 1ST2A 4UTXA 3HYLA 4HLUA 4D3DA 3R0VA 4PCLA 2QQGA 1K5PA 4BB9A 1SU8A 4UC0A 2ZUFA 1AHNA 2H1IA 1HM5A 2HZ7A 1FOEB 3GR6A 3GEMA 4D4MA 1LLUA 3PGKA 4Y18A 2AG5A 1U2ZA 3EQ7A 3VBCA 4ZCMA 3CZCA 4PZ9A 2ZFUA 3P4YA 4ZAZA 2ZJ5A 1VSBA 4IGEA 4NJOA 3FKSD 5KSWB 3D7KA 1A88A 1KI9A 4HUQB 3TW4A 3NEJA 3M6MD 2CCKA 4J7AA 4ZDIA 4IQ4A 2HLHA 3AOGA 4QOHA 4W82A 1CLUA 2AFIE 2I34A 4Z3KA 3GFFA 2W2NA 1BJTA 2AJ8A 2MSEB 2QUIA 1Q7GA 4ZVMA 2SICE 1M2HA 3IDQA 3DBIA 3O1IC 5DN9A 3I01M 5H70A 5HGJA 4DFDA 2ZTMA 1AGYA 5GZ1A 1U6IA 2MMCA 2R79A 3EAFA 2WWYA 3WYAA 1GO2A 5DU2A 4FN4A 4OA8A 4QYMA 2ECKA 2X1MA 1OC2A 1YRAA 4ZJUA 1IJFA 2NO6A 4GOKA 4ZJZA 2JLBA 4PCUA 3TIVA 5L6LB 2JGAA 1XQXA 1Z68A 2ZQYA 2XMSA 2Y9MB 2EQBA 1Q2UA 2RHRA 3HZRA 3K31A 4DYVA 2DCUA 3ER6A 3HY4A 3AX6A 5FLYA 3HGMA 2QPOA 1M1YA 3NVKI 621PA 2GEVA 4AO7A 1AKMA 3SF0A 3MIZA 4JLNA 5FA6A 4DSAA 1AH2A 2AH5A 1U8AA 4JJAA 3R8FA 3SQWA 5KB3A 5E9WA 4JI5B 3QBTA 4GVXA 2PH3A 3AIOA 1JSLA 2Z2KA 2Q7XA 1OLUA 3PFCA 4L72A 4OD0A 4IIEA 3RPEA 2BEKA 2OZPA 3QITA 4ALJA 1KDVA 1A76A 1CE8B 1KIAA 3AIMA 3H9EO 4I2NA 4QXMA 4BMXA 3CZ9A 5K8TA 1TMOA 3S28A 5B1YA 2HWWA 2CV0A 1KZ4A 2J33A 3U1TA 1UL1X 4GL4A 2NVOA 3ZXYA 4ALMA 2V74B 3LPAA 3RRBA 4W7HA 4WEQA 1HDZA 3OOJA 3NGMA 5EXPA 3P0EA 1WMFA 4FP9A 3LQRA 5AHWA 2GPJA 4D9HA 1ACLA 4WFQA 1QGED 3RAPR 4LA4A 2GCOB 1CXZA 4RTOA 3HFGA 3NR2A 4DCVA 5MFZA 3SQMA 1DRVA 4CIAA 1PT7A 2JAXA 4ZIRA 4ZYUA 1PFYA 3QFSA 3TLKA 2OORA 4MVCA 1S2DA 4QQKA 1M1UA 1HFWA 4F11A 5HMLA 1J8FA 1HYEA 2Q3MA 2I6QA 4I55B 4GM0A 3CZMA 2YN4A 4RHCA 4H3SA 5IUJC 2C8LA 3G8AA 4TXMA 2ODEA 3A70A 4AM8A 4D0RA 3NEAA 1G3IA 3H11A 4KQEA 4WI1A 4UHEA 1E1RA 1E9SA 1OXUA 2I2XB 4TPKA 4FFRA 2I6FA 4R2HA 2AE1A 2OBNA 4HH1A 3DZKA 1J24A 1T2VA 2CDRA 4N0QA 3I6QA 1Q74A 3TEFA 4LYGA 2O48X 4AMVA 1LPPA 1QV7A 1U5CA 3L0CA 3NBMA 4JJZA 5GV7A 3E2IA 1IQUA 1YI1A 3AOEA 3HKCB 4YP6A 2ZP1A 4RENA 3FA2A 1R0KA 4OI2A 4CGYA 5CB4B 5KVCA 3GP3A 2BM0A 3WKDA 1HORA 4U2KA 2OECA 3O8DA 3Q0IA 5B5SA 1VJGA 2HA5A 1E3QA 2VAPA 3S2ZA 4B9EA 3GLKA 2BEWB 3IMCA 4JQSA 3SC2B 2AF3C 2ZI5A 2YRXA 3GFGA 4QO7A 5LIRA 3VX3A 3LV8A 1SU7A 2OILA 3PFIA 2GWHA 2P5YA 4OQNA 2CSUA 4MW6A 4DNFA 4COKA 1ZU5A 4NBRA 3UJ8A 4QECA 2P1DA 1TTQB 1YRWA 2C3YA 2QS9A 4NFLA 3I2JA 1A5AB 4QOIA 3DW3X 4HXGA 4AN4A 2V5VA 3GVIA 2GXSA 4IUYA 2VNIA 3D7MA 4OHVA 2C2GA 1N2HA 4WY8A 3LO8A 3S8MA 4PLHA 4BMSA 2MT9A 3HJUA 5J47A 1KVTA 3OAAA 5LC1A 4B35A 4D98A 5C53B 5EXSA 1PVOA 3ZVNA 1GRQA 2ZYVX 1RYZA 1ZUWA 4IXDA 4GXTA 4LY3A 5IYZB 1TNDA 4RKRA 3N2YA 1IVYA 2A57A 4MUBA 4QOSA 3IP8A 4FOPA 1L5KA 3CKYA 3PDCA 3TSOA 1UWKA 1HQCA 2VTBB 1L7DA 3G9QA 3IP1A 2YOHA 5AO9A 4BMYA 2QVXX 1RQ7A 2X8JB 2WWGA 1P9OA 2Z2YA 1EE9A 4FKBA 4JGIA 5EZYA 1T1GA 2EKZA 4NH4A 3RVQA 3VXKA 2ID8A 4EL5A 1EFPB 1UBGA 5JZ9A 3MOGA 1ZD5A 4KVGA 3RC3A 4I66A 1G3MA 3CUKA 4AUNA 4PLFA 2XDQB 4EYQA 1NFQA 3DVQX 3GVPA 4CF6A 3O9MA 2HD4A 1XMSA 1BXGA 3K53A 3OU2A 5JAIA 1SUIA 3B3JA 2IXBA 3WRYC 1GPYA 4MKHA 3ZV4A 4KITB 1SGWA 2B92A 4J07A 2JFGA 3ECCA 1MFZA 4E2ZA 1NQVA 2P40A 3QYFA 4XGNA 2VP2A 2XYQA 4KQ6A 5FLKA 1XZJA 2HNKA 4J0FA 1E3WA 2Q1SA 4DNXA 4YAKA 5M7EA 2XBUA 3ZEIA 2XYPA 1ZONA 4TZKA 5DNVA 2DSNA 1Q5PA 1VKOA 4ZVPA 3WRXC 2HLDA 3OZWA 4B84A 5GZ3A 1NXSA 2HBYA 1ECFA 1XZKA 3V80A 1U9YA 4DJDC 2PY6A 5CFLA 2ZYSA 3ILXA 3PC8C 3NALA 1FMFA 4GL2A 5GV8A 1C4KA 2YN2A 3HYRA 4BVFA 3IMKA 2Y1EA 1JU3A 3W5CA 4G1UC 3HL4A 3FUTA 1MO3A 4J0EA 4LXQA 2Z57A 3CZAA 3PI6A 5CW2A 1KEZA 1L7RA 1YA8A 1UJMA 1CHNA 2I87A 2JLZA 4LHSA 3H19A 1ZNQO 4EY7A 3L0ZA 4M7RA 3FSGA 5T4HA 2OHGA 3BJIC 4RCYA 2AOUB 4LOJA 3S1AB 1XEFA 3FPGA 3G2NA 2NUPA 5EL0A 1T3GA 1G2QA 1F51E 4IOKA 3S2UA 5CH5A 1YFKA 2WSSD 4BRSA 4F2WA 4KXYA 1XD2A 4KE9A 4H17A 3O21A 2XQKA 4I0WB 4PU0A 4B4DA 4CR6A 2Q4BA 3DBHB 3L8DA 1UZAA 2ZRGA 3U13A 5LNK6 2NQ8A 3A1EA 3AUTA 3CRNA 1BIFA 3EIXA 3BFXA 3M3DA 5K0ZA 3SR3A 3FW1A 3K0SA 1OXTA 3VDNB 1RPNA 1ZRNA 3I0MA 1E5VA 5TPZA 1B6RA 1GPH1 4NLLA 4ZT4A 2QHXA 1CY1A 1QHXA 3TR6A 1OH8A 3A9WA 3I0NA 2H2GA 2ZM6B 1M6VB 3E9NA 4EZBA 1CRPA 4KRGA 3TOCA 1I7QB 1PS0A 2Q8QA 1EVZA 4LE0A 4G97A 1JIQA 1WSAA 1XRNA 3FUWA 5KX5B 3B7GA 3SJBA 1WOYA 3EDMA 5FPYA 2CK3A 4G2TA 3TWOA 3CZ5A 2H6EA 4J2HA 4JWTA 3U3OA 2JFXA 5BT8A 5BWNA 5SZKB 3PNBA 4WXRA 5CU7A 2POQX 4AYWA 3Q72A 2DCMA 2OCYC 4CM5A 1IHDA 3ESRA 1YTUA 1ZQ1A 1HE4A 5J2TF 4DMLA 1D0VA 4BP8A 5KCMA 2N1MA 2FWRA 1ADYA 2PKRA 3CEMA 4HAZA 1E9AA 1YB1A 2F1OA 2KLBA 2QTCA 4Y0NA 3KAKA 4QGGA 4ZCLA 3SZMA 3PJDA 5JJBA 1TJ4A 2C9BA 2R85A 1Q21A 1RRKA 2YJNA 4HTFA 2X23A 1E3SA 5TQ0B 4CKZA 4XH9B 3FOCA 4Z7QB 3LCRA 1CDEA 1P4JA 1WDMA 3RHFA 1YH3A 4AMGA 3IERA 1KO1A 3HCBA 2AJLI 2ZIXB 2WDPA 4MCIA 3PXAA 1QX4A 1VL8A 1MEJA 4P53A 4ZI7A 1DKUA 2FG6C 2Y3IA 2Z9BA 3FFTA 3K9BA 2WZQA 3PGLA 3OPYA 4TKZA 2PZ8A 5GADl 2KW5A 3HA3A 1CFJA 3WI7A 1LPBB 1TW3A 4Y0VA 3V1KA 5K0GA 3R7AA 2RHHA 3NBUA 1BU5A 2I76A 2OFWA 2SKEA 3JQBC 5H02A 3ZJ4A 3NTRA 3WQSB 3MT7A 5EIBC 4J7UA 1WM1A 2OHVA 5I9BA 4J4HA 4A9AA 1D07A 3CLVA 1ITZA 3RIGA 2GF0A 8GPBA 3EPRA 4ZQEA 5HS6A 4BUJA 5EHZA 5IT9A 3OE1A 3GHHA 4KODA 2H5EA 3I2IA 1EXDA 4QUKA 2YMQA 4XVHA 2A9RA 5DXFA 1YBMA 1R37A 1DKNA 1WO8A 1XL0A 1QK4A 1E7YA 1DDOA 5L4LA 4DWWA 2R1VA 2MSWA 1CUBA 1P0QA 3QW4B 4XDZA 4QJ3A 3NQ41 3L1UA 2J5RA 3NEPX 2V6GA 3QLUA 5BNFA 5JNLA 2GWRA 1VOTA 3IELA 5MN5A 2PGAA 4WK0B 1ESCA 2O1SA 3EW7A 1PJBA 2OHFA 2L18A 2YC2C 5C80A 3LGXA 4EGJA 3MAGA 3WYBA 1UMBA 4BATA 1KEUA 2JJ2D 3VR3D 3KUCA 2XMRA 1EU1A 1ND6A 4XGIA 2NO7A 3A26A 5K2MA 5T4EA 4ZV4A 4Q05A 4RKYA 3T5AA 1RHMA 1G60A 2C99A 3BD6A 3M6FA 3PHIA 4P7GA 1WQ4A 3A4IA 3ELDA 5I7AA 4DDWA 1N2SA 1U0TA 5KTKA 4JB2A 1GTG1 3C15C 2DR2A 3ZD6A 5BUCA 3U80A 3W5DA 4AO6A 4ZVVA 1ZD8A 2EKPA 3NV7A 5AW8A 4RZ3A 4YGYA 4FLFA 1XRPA 2FMIA 2PWYA 5D86A 3WISA 4Z4IA 5CH8A 2AKEA 4PPQA 4PXSA 5IVPA 5B1IA 2F1KA 5B58C 3ND5A 1M2OA 5JE8A 5JJLA 2VWPA 4HPWA 1USUA 3B51X 1VE7A 3S2EA 2AEEA 3ZGZA 5EHXA 3DZHA 3PHLA 4LF6B 3GGOA 4GT1A 5HRUA 5B4TA 1BTOA 1ENPA 2HJGA 1E2EA 2HN9A 5DF1A 1ACMA 1H5QA 1GG5A 4AQDA 1TYAE 3KOOA 5AK0A 1P4RA 1P9NA 1IC6A 1PJTA 3IR6A 3Q9NA 3NYRA 1NIPA 4RJ2A 1SVSA 4OBWA 3K0FA 1N4DA 3N28A 1YUNA 3LK6A 3ROGA 4EQ6A 1KH3A 1WIWA 3TYXA 1KXJA 5H4HA 3D6MA 1PE0A 4UHCA 1N6RA 1SM4A 2BR3A 3QWIA 5DZSA 4QG7A 3OOYA 1NPYA 1UK7A 1AQLA 4LCJA 1ZPDA 4H4CA 4YWJA 4CR7A 3V4RA 1PJAA 1UAGA 2V7UA 3P0RA 4KFTA 5J63A 4GYJA 1JQKA 1HYGA 4L4RA 3TTSA 3N59A 4NV0A 3F6BX 3H4VA 2GLTA 1V26A 3BSYA 3JR7A 5CXXA 4AMYA 2N42A 4G09A 1CQIB 1BMDA 1JN0A 3EEYA 5ERYA 3ZWVA 3STYA 4OLFA 4FOSA 4LFCB 4B71A 5DCLA 2QGFA 1OT5A 1EFDN 3UMVA 4G9BA 1N6HA 3IKTA 2XB2A 1ZR4A 1SRQA 4UW9A 3VPHA 4RHTA 1G21B 3E61A 5DO9A 2GXAA 3M4ZA 1GTRA 5IDXA 2C0PA 4U9HS 3BRWD 4F5DA 1UFRA 4B79A 5F9HA 3PQ2A 3HABA 2RC6A 1IQRA 1NQAO 1YQWA 2QAGA 1UC9A 2QE7D 3B82A 3DXZA 2XEXA 4KN5A 5D87A 4BX2A 4ER6A 2IIBA 3DFFA 4N3BA 4OHOA 2IXAA 4D25A 1Z6TA 1S2IA 2Z2ZA 4R2LA 1C14A 4HN9A 3UWKA 4A6XA 2G80A 4BNYA 2AN4A 1CNFA 3GNQA 4LZOA 1RJWA 3FRHA 2XB8A 2VIIA 1R5NA 5KOHA 121PA 2IPAB 3HEAA 1FNMA 1L3BA 1CT9A 3RRZA 3TX6A 2OD7A 4D8UA 2EKQA 2FUG6 4C7OA 3DAOA 2YTZA 2ZYWX 1YRBA 3LKBA 3IRVA 3MRVA 3BRCA 1NJFA 1XXLA 4K8RB 2PNJA 4EPRA 5G40A 1I1OA 1GUDA 5CIWA 1O4VA 1YR8A 1JLKA 4G4SP 4QBIA 3KALA 2ZZKA 3EISA 4I6EA 2GPNA 1E1MA 2A86A 3N7UA 3UWMA 5BYAA 4FFLA 3FDXA 2J9RA 3KOYA 2RK3A 3U56A 1JMKC 5KOJB 1U2SA 1B42A 4XA8A 3WWYA 4DLVA 3SJAA 1XK7A 2E6KA 1FSSA 1ZXXA 4AWXA 2X5OA 4RIEA 2WNHA 1LTQA 2C77A 4BAGA 1GN8A 4PBRA 5SICE 5DHAA 2W6ZA 4JIGA 1XAGA 2C2BA 1E6WA 4BQOA 1TTPB 1X9IA 1N2EA 3QBVA 1AQ6A 3AUAA 2YXDA 4LK2A 2HHHB 1F8XA 2YW9A 4KXVA 1NI4B 1NNLA 4PLTA 5FFFA 1N2BA 1QAOA 4O4HB 1RDFA 2GNAA 1X2BA 1PP4A 1C0LA 3AESB 2IEZA 3JYLA 1TQHA 1YE5A 1KAOA 1US8B 4L9AA 4XX1A 5DISB 2ZUTA 4PTYA 3AV0B 4J76A 4LWZA 1O6BA 2CLHB 2WHEA 4I4IA 4MVJI 4QBFA 4TS1A 5ANRB 3TQSA 3CN7A 3ZNNA 1INLA 2BFFA 2WEKA 4PC7A 5JQGA 2CC2A 4RZUA 1Y8RB 5K3FA 2VRBA 3RC9A 5H59A 1N2JA 2DUJA 3NHWA 5LP6C 4EJ2A 1XQ1A 4JENA 3QU9A 1KAHA 3P9YA 2BEUA 1EM8A 4RCVA 2DAPA 5CCBA 4IG9A 1EP9A 4EZEA 1J8DA 5FRDA 1Y4AE 2ODAA 1V95A 2Q1YA 4KWHA 4R83A 3LYLA 3LCUA 5K0TA 1Y81A 4TYNA 1JAXA 2AYXA 2D2FA 3GZ4A 3SIPA 4HNGA 5C0OE 3ESAA 1SUBA 4IVQA 3K1ZA 4ZODA 1E1LA 3EC7A 2ADOA 1IN6A 1X1TA 3KBOA 1UBRS 4RH1A 1VE1A 4JJ8A 2WK1A 5LBTA 4YP9A 1UM8A 4NMWA 3G7UA 3WGQA 3IE2A 3CX7A 1PEDA 4YJKA 2C7OA 2FNAA 5U4QA 1JHRA 1Q44A 2CZCA 4OKIA 3TMKA 3TPCA 2DFTA 5KNLA 5COAA 1KQNA 5JXHA 1JHDA 3DP7A 5LD2C 4RM2A 2MOKA 4K9OA 4MW4A 1NFRA 3PC3A 1ORVA 5BV7A 1Z18A 3O7WA 1V35A 3KB8A 1ZM2A 3FTPA 4D3FA 1MTOA 4WKGA 3V1NA 4DIOA 1X7ZB 4G1BA 3M1LA 5CJJA 4D9BA 3UGJA 2Y1GA 1H8EA 3OY7A 3T1QA 1E77A 1M6WA 2W8BB 4FKZA 5J4YA 4YRSA 1ENYA 1KS2A 4CETA 2HHAA 4DM7A 3KE8A 3KZMA 1VRCA 2V6IA 3QHPA 3KT3A 3EQZA 4LY0A 4OREX 4P7JA 2WTAA 4U39A 4M8SA 1W85B 1WW3A 4YO7A 2R60A 4KLZA 5EMMA 3HJTA 5TEVA 1VYUA 4XM0A 3O2SB 4OGFA 5LP6F 3ZZ0A 2R8OA 3L4BA 3GT4A 1HT1E 1G20A 3N39C 4BBZA 4JR1A 2NO4A 2V5UA 2PFGA 3I9JA 1EK1A 3PNPA 5AD1A 4U7TB 2VNJA 2AKAB 3SY8A 3B7WA 2QTBA 3KM0A 5K0BA 4LYJA 3DCYA 4OBBA 2JH8A 3C45A 5CT8A 3K1AA 3QFFA 4QOEA 3GGDA 4YLGA 4O4JF 1H1DA 1GILA 5FOWA 1PUIA