1ZI9A

Crystal structure analysis of the dienelactone hydrolase (e36d, c123s) mutant- 1.5 a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 80
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi9A00
3EBLA 1ODCA 2WIFA 1WB5A 4FFVA 3IUNA 5D3ZA 5ALVA 3A6ZA 4RE6A 1VLQA 5FV4A 4B85A 5YASA 4X95A 2EDCA 4C4YA 4LIPD 4A23A 4ZI5A 2HRQA 3WL6A 3QZUA 3VVMA 1HL7A 4IH4A 3R3VA 2WFLB 1R88A 3CN9A 3A2LA 2PU5A 1CQWA 1LPNA 4EUSA 1SCKA 2OCKA 3K6KA 2QM0A 4UHFA 2QOEA 4HXEB 6YASA 2XUOA 3A2MA 2O2IA 2BUBA 2GZSA 5CH5A 5AKKA 3YASA 2OLEA 5A6VA 4QLOA 1MX5A 2AXEA 1BCSA 5AI4A 2WHRA 1EHYA 1AC5A 1EA5A 3IBTA 1EH5A 3AINA 3IUMA 3JWEA 3IDAA 1GPKA 1CV2A 4IO0A 3DCNA 1QO7A 2XUPA 1H2YA 4PV7A 1IUPA 3U0VA 2QUBA 3PF8A 4TVKA 4UFNA 5SYMA 1R4ZA 1FFCA 2GBIA 1A8UA 3HLKA 4OCZA 2XMQA 4OB7A 1Q84A 5DTJA 3LIIA 5LIPA 4BE9A 4LYEA 3DKKA 1H2ZA 1CUVA 1GQRA 4G8CA 1VOTA 5ALPA 3WWPA 3H04A 1QIIA 5HKAA 5ALYA 4QDUA 3I1IA 1YAHA 5JATA 1I6WA 4EHBA 5CRIA 3HSSA 5JZ9A 4KR0A 5DNUA 4UBJA 2QZPA 4BAGA 4UBOA 4UPDA 1R9NA 3HABA 3C70A 1CUFA 2AJBA 2PSJA 1E89A 5JANA 1XRPA 4FDMA 1QIMA 5ALTA 3FBWA 1HLGA 4XWGA 1QJ4A 1EB8A 2OQVA 5C7YA 2HIHA 5JAPA 3G8YA 4H77A 3DEAA 5E4JA 5C8ZA 1GPLA 1WB6A 3STXA 3AIOA 4PQEA 3WJ2A 3UUEA 4Y9SA 2RI6A 1E66A 5ALUA 3WK7A 1TIBA 5HF6A 3A2NA 3W05A 5C8XA 1JT2A 4PSDA 4RNCA 5IVHA 2WG0A 3QVMA 3F97A 4MYDA 3E0XA 2XMBA 2WUGA 2G5TA 1G66A 4BC1A 5FOQA 2WQZA 1LNSA 1QIDA 5KWIA 4X3CA 4P92A 1QIJA 1IMJA 4GI1A 3OURA 1DTEA 4MJ3A 4M0MA 4H7HA 3G0DA 5AM4A 4B84A 3BDIA 1E8MA 2I3ZA 1C4XA 4J0IA 2QT9A 5AI5A 3VJLA 4J0CA 3BXPA 4GWLA 4I3FA 4DNQA 2GBFA 2XB6A 1YS1X 3TJMA 1AQLA 3FWHA 1XRMA 1G4HA 3NWOA 4BDSA 3ICWA 3WL8A 3LP5A 1C7JA 2HHAA 5AIBA 2OCLA 1XRNA 2JGKA 1S8OA 4IH1A 3QITA 1QIHA 5LKRA 2ZJ7A 1AX9A 4C88A 4ZXFA 4BTLA 2VT7A 2VA9A 2BUAA 2Z8XA 2C58A 4G4IA 2XUJA 1EK1A 3ZWQA 1Y37A 3V1KA 1UK7A 2WG1A 4MQMA 5K3FA 2GYUA 4ZV7A 2ES4A 3MUNA 1GKLA 2CZQA 3BJMA 5FPQA 3AJAA 2FUKA 3KD2A 2OGSA 1XRRA 2WFMA 1QOZA 3WKAA 3BDVA 3VXKA 3FYUA 1VZ2A 2QS9A 5LZ2A 3DS8A 4Y2PA 1QIFA 3HJUA 3STYA 1SC9A 1GGVA 5JARA 1H2WA 2XUIA 1A8QA 5LLSA 4E15A 4EA6A 2H7XA 2VSQA 4OU5A 5SYNA 5AKYA 4BAZA 5JYCA 5ALKA 1FFBA 4QDZA 4QWWA 3H2IA 1ZGBA 1AUOA 3HZOA 2ZYIA 1CR6A 5AKJA 4H7EA 4X92A 5HKBA 1XZMA 1RWQA 4W1SA 2JGEA 4AXBA 5HFAA 2XQIA 2WG2A 4CFSA 3QMVA 5K3AA 3BE8A 5ESRA 2XMZA 4U2BA 4BVLA 3EQ7A 2Z3ZA 4J0DA 4N8SA 5DJ5A 5BV7A 4B82A 1MNAA 2RHTA 5ALFA 5JZBA 2G5PA 2XMDA 4FFWA 3W06A 2GYWA 1YA8A 4KACA 3PE6A 3F8SA 5JZSA 1EX9A 2WM2A 4XJVA 3C8HA 1ZI8A 1XZFA 5BOVA 4AO8A 1QFMA 1CUBA 2OCGA 4EY4A 4QA9A 3OOSA 4BC0A 4Y7DA 2HADA 4G8DA 4C4XA 4D9JA 4NZZA 4L72A 1XZCA 5JAOA 4Y2QA 1PV1A 1KU6A 1BEEA 1JMYA 1TQHA 1RYYA 4A16A 5ALQA 5BWCA 4JYPA 5LZ9A 3T4UA 1DU4A 3KOOA 5CBKA 2DR0A 3V1LA 1FFEA 4CG3A 1VA4A 5ALJA 4S0XA 2H9YA 4ARBA 2HA6A 5CT6A 3HC7A 4GEGA 1EK2A 2CUTA 5AOCA 1TKRA 1JU4A 3P2MA 1ZD5A 3LLCA 1JMKC 3NUZA 1L7AA 3EF3A 1HPLA 1DWOA 3E1GA 4B0OA 1XKTA 1CUEA 2J3DA 4Y2JA 1UXOA 4GW3A 1EXWA 5JIBA 1AURA 4HRYA 2BCEA 4X91A 3ZPXA 4KRYA 2PX6A 4ZV9A 1XZJA 2ZVDA 1MTZA 3D59A 5DYWA 3M82A 2PSHA 2WHPA 3KDAA 1ZD3A 1U65A 2RONA 3CXUA 1YSCA 3DJYA 5A71A 3F96A 1QIEA 4DYHA 4PNZA 3D2BA 1CRLA 1K63A 5K5EA 2QJWA 2HU7A 3ESBA 3DKRA 4Z49A 3FVRA 1KU0A 1XRQA 5HZGA 3HEAA 1W52X 2HA7A 3ZLUA 5FLKA 4BVKA 2OG1A 4YASA 1Q83A 4UHCA 3H0CA 2GYVA 1ZICA 4Q3LA 4QLAA 5AJHA 3FSGD 1N8SA 5LZ4A 5ALDA 3AFIA 3QM1A 3OTQA 1JU3A 1W6RA 3H2HA 1NU8A 5ALEA 4Y2SA 5K3CA 3WJ1A 2O7RA 4G8BA 4UHHA 4AN1A 5AK6A 1U2EA 5ALXA 4QEKA 4KE7A 3WKCA 5AK3A 7YASA 4CG2A 3CCBA 3WLAA 2Z3WA 3C43A 3T52A 3GBSA 4HZGA 3O95A 2XI4A 3I2IA 1TRHA 3F67A 1N5MA 4KAFA 4QDXA 4V2IA 4RPCA 3KWJA 4Y2TA 2V97A 4H18A 2HFJA 3WIBA 4AB1A 3TGLA 4FLMA 3IB3A 4GHWA 4ITVA 2XQGA 4UUQA 3PUHA 1XZEA 4C6HA 4DSAA 3IA2A 1ZD2P 1QIGA 4Y2YA 4DLNA 3PI6A 4N5HX 2R8BA 2XQKA 4B0PA 5AH0A 3R3XA 1F6WA 1EDBA 1GZ7A 5EHQA 1CFJA 5T4HA 1QE3A 3BL8A 1PJAA 3MUOA 4HXGA 1CIJA 3DL7A 3W2TA 1LBSA 2O2HA 2FJ0A 2D5LA 4DM7A 1JFRA 3PFBA 4G1FA 5E2IA 4FTWA 1NX9A 3IIIA 1QTRA 4PSUA 1IZ8A 4X85A 4OYLA 3G02A 2PUHA 4MEBA 2PPLA 4PW0A 1D07A 4JNCA 2WTMA 1EVQA 4F5ZA 1N1MA 5A7HA 5A62A 2QXUA 4HAIA 4GDMA 4CG1A 1MX1A 3KWFA 2ACKA 2JGLA 5LKAA 5LZ8A 3RLIA 3V9AA 2QRUA 4F0JA 4J03A 1A7UA 3GROA 4X94A 3QMWA 4AO6A 3EIOA 1K8QA 5T4EA 3WWEA 4F60A 4CCYB 2WJ6A 2B20A 4WDQA 4BAUA 2HA3A 3WMRA 4DIUA 2WLSA 3AILA 2RGUA 1GPNA 2QTBA 4X97A 1K6EA 3HI4A 4WFIA 3PDCA 3LS2A 3L1JA 1J07A 5HF5A 4J0KA 5IKXA 1CVLA 1GXSA 4IH9A 2X76A 1DQZA 4Q3OA 3SK0A 1E8NA 2Y6UA 4KE8A 4DMKA 5HCUA 4EY6A 3G9ZA 4C01A 1JJIA 4DMFA 5CMLA 4WDRA 5EGNA 3QH4A 3HACA 3JW8A 1RP1A 4J0HA 3R3ZA 1Y7IA 4ZREA 4CIBA 3STTA 4OPMA 1P0IA 4G4JA 3RKSA 4UFOA 4XIIA 4LXHA 2VAXA 3H19A 5IVIA 5JD4A 4X00A 5DNVA 3STUA 1YB6A 3STWA 3TEJA 2VQ6A 1ZOIA 1CUHA 4Y2UA 1DX4A 5EIAA 4OSEA 4MEAA 2PUJA 4JEIA 1P0PA 1CLEA 4G9GA 3OPMA 3W04A 1UK9A 3VDXA 1IZ7A 1LPOA 2VT6A 4NMWA 3LIPA 1EINA 4EBBA 1XZBA 4H7JA 4JYMA 4OB6A 1W76A 2XLCA 4K6KA 2OQIA 4W1RA 1VE7A 3GA7A 2DFPA 2QR5A 4W63A 5ALMA 2WUFA 3FYTA 1K5PA 1L7RA 2YASA 1CPYA 1THGA 4Y2RA 3QPCA 1J2EA 3PUIA 2UZ0A 4I19A 2OGZA 2XQFA 1DWQA 3DD5A 5K3DA 5A7FA 3ZV7A 1BN6A 1ACJA 4X7BA 4O08A 4LXGA 5A7GA 3PF9A 4JH0A 4G5XA 4B81A 5CURA 3WK8A 3ICVA 4LYDA 1Z68A 1CUSA 5AM3A 1UFOA 3M81A 4BZZA 4MQLA 2OAGA 4E11A 2XMSA 4U2CA 1NU6A 3W9BA 2PU7A 1A88A 4E14A 2RHWA 1IUOA 2HL6A 4WFKA 2BFNA 1XZHA 1XQVA 1Q0ZA 4K6HA 2ONCA 4L0CA 3H18A 1E3QA 3O4GA 2P8SA 1ZGCA 3TRDA 2XMGA 5K3FB 2VJCA 4KJXA 2VATA 2ORYA 5FXMA 3C45A 3O4IA 2Y1KA 2WJ3A 5AKLA 4E46A 1XQYA 2WIGA 4C87A 5FUMA 2J4FA 4LXIA 2D0DA 4OD0A 3BF7A 5AKHA 3ZLTA 2OAEA 2PKYX 3I2GA 3O4HA 1CUIA 2LIPA 1XZDA 2DCMA 4ROTA 2BGRA 1OXMA 1VA5A 4Q3KA 4XVCA 3ZLVA 3AZOA 2ECFA 1LPSA 5EHXA 4N5IX 2WTNA 4ZGBA 1MX9A 5EHNA 1G42A 3AZQA 5JD5A 5D7BA 3G0IA 4YK7A 2AJDA 1QFSA 2ZJ6A 2VJAA 1ISPA 1XZKA 1QIKA 5HQ3A 1CUAA 3OM8A 1E8DA 3DNMA 3RK4A 3Q8WA 2YH2A 2JF0A 1ODSA 3U1TA 3I2KA 5DLPA 2QVBA 4U2FA 2IIVA 3HYSA 2BGNA 1N5RA 4ETWA 1ACLA 3ED1A 5KWJA 3FCXA 3E3AA 2QKYA 5AI0A 3L1IA 4FBLA 1U8EA 1YCDA 2CBGA 4L3WA 5ALRA 5CW2A 1GT6A 3ESAA 3O9MA 3VKFA 2C0QA 2DHCA 1GKKA 2HA0A 2JGMA 1CUWA 3WKBA 3BIXA 1DINA 3O4JA 2DQZA 4PF1A 4FWBA 2XUGA 1XKLA 3BIWA 4K5QA 3C6XA 4MWSA 5LYYA 2O2GA 4X6YA 4AZ0A 5CH3A 4P93A 2J4CA 1HBJA 2YYSA 3C5VA 3IUJA 3VJKA 3G0GA 2PM8A 4ZRDA 4RE5A 3F98A 2DSNA 5T4BA 4EY7A 4K6GA 3WQHA 3C87A 1TAHA 2WU4A 2AJCA 3FYUC 4UBNA 3W9UA 1MAAA 1TCBA 4WCVA 1OCEA 1VKHA 5ALNA 2I3DA 1WHSA 1VJ5A 5CT5A 1DX6A 3CCCA 3D4LA 4MYSA 1J06A 1CUUA 1DQYA 4AO7A 3AZPA 3C5WP 5AI6A 3FLAA 3IULA 2XDWA 2CMFA 2HU5A 4FLEA 2WHPB 4BZWA 4RGYA 5HK9A 3C8DA 1XZLA 2AJLI 5KREA 3NGMA 4TGLA 4QE3A 3FSGA 4BTVA 2ZYRA 2QMQA 2PSEA 4FNGA 2NW6A 2BUCA 2EEPA 4UHBA 2ZSHA 3B12A 5JD6A 4QDTA 4U2GA 5K3EA 3B5EA 4C4ZA 4X6XA 1AGYA 1BEZA 1FJ2A 3PICA 2HDWA 1J1IA 1R1DA 1ORVA 1XLUA 4WFJA 3DYIA 3STVA 1ZJ4A 4C89A 5FP0A 4F21A 2E3JA 2YXPX 4Q82A 3UMJA 1P0QA 3H17A 4KE6A 3QPDA 5AK4A 3O9VA 5AI8A 4UBIA 5LZ5A 3O0DA 4FLFA 3V48A 5ALZA 1LPPA 1G5FA 5LZ7A 2K2QB 1F8UA 1F0PA 1XLWA 4UBMA 1MNQA 3ANSA 3GFFA 4N8DA 4Y2XA 4DNFA 3RM3A 3C6YA 3MVEA 5E4YA 5EIHA 5LP1A 4KE9A 4QNNA 4J0JA 1UKBA 5EIEA 2WU3A 3I6MA 1UWCA 3VVLA 5ALIA 1XZIA 1P0MA 1XZGA 2WJ4A 4HXFB 4NVRA 1MJ5A 1UK6A 2Y2VA 2XE4A 3M3DA 1T2NA 2WUEA 4DNOA 4LKOA 2JEYA 3KXPA 3N2ZB 4G4GA 4X71A 3WWOA 2WUDA 2ZYHA 4PO3X 3G9TA 3WYDA 4BB0A 1ZIYA 4W1QA 1LZLA 5JALA 5CXXA 3G0BA 2AJ8A 4UHDA 3ANTA 5AO9A 3Q0TA 1W4LA 1WHTA 2V9ZA 4OB8A 4IQ4A 3SC2A 1WCYA 2DHDA 2X5XA 5D3KA 4P08A 2I78A 2Q0XA 4WY8A 5ALGA 1GQSA 1R9MA 4BCBA 2Y6VA 2HA4A 5E4TA 4AX4A 1LLFA 3EQ9A 2Z5GA 3WK4A 3NOXA 1UOQA 3C6ZA 2XUAA 5H3HA 1QONA 5EFZA 3D2CA 4FKBA 3HXKA 3IVMA 5HFNA 2W6CX 3I2FA 5DTIA 3M83A 1BE0A 4BRSA 2ROQA 4DTCA 1QO9A 4BE4A 4EZIA 2WFLA 5I7UA 3IUQA 3I2HA 4MWTA 3QMMA 3AIKA 5AKIA 2JGJA 3DOIA 5CH8A 4WJLA 4H7KA 4CI9A 5CTAA 2O7VA 2BAGA 1MAHA 3HRHA 1YA4A 1AMNA 5DYTA 2B61A 3KSRA 4I4CA 1CUZA 2WHQA 4QWMA 4CCWA 2JIDA 3WZLA 1W1IA 5CXUA 2EDAA 3ZI7A 4DNPA 2QJRA 5AM0A 1USWA 2V96A 1MPXA 1ODTC 3R3UA 1R50A 4CCYA 4M0EA 1IUNA 1R3DA 1SCQA 1WM1A 5AKEA 3V1NA 1TCAA 3GUUA 3WIOA 1BN7A 4B9AA 5FDFA 1C7IA 1IVYA 4KEAA 3WK9A 4K2AA 4AZ3A 4Q05A 4DGQA 3AUKA 4X93A 1H23A 1QTIA 1XROA 5ALLA 5DNWA 1JI3A 4MXDA 3FNBA 3DDUA 5HK8A 2WIDA 1THTA 3WI7A 4B9EA 5AOBA 1MU0A 3BF8A 5JAUA 2CJPA 4A5SA 5ALSA 1DWPA 4INZA 4UHEA 1O6GA 4J7AA 3EQ8A 1BRTA 2H1IA 1CUDA 4AQDA 2C4HA 1M33A 1CUGA 5ALOA 3R40A 3DOHA 5K3BA 2HA5A 2OPHA 3V1MA 2B9VA 4OU4A 2XMRA 3A70A 1MN6A 5FRDA 5FKJA 3G7NA 1Q0RA 1LPMA 4W1PA 3FAKA 2XUQA 4BATA 1OILA 1AZWA 5IVKA 3R3WA 1YB7A 5FPPA 2CEKA 1AKNA 1TCCA 4GLBA 3QYJA 2I03A 2ACEA 4H7DA 4FNMA 5HF8A 3RARA 1UOOA 3ESDA 3I28A 2WFZA 4B83A 4U2EA 1VXOA 4KAJA 2HFKA 2JGFA 4B6GA 1ZJ5A 1WOMA 1CEXA 2PL5A 5AICA 4BP9A 1A8SA 2C0PA 3FLEA 3R0VA 2XUHA 3DQZA 1EB9A 5AHXA 1ORWA 2XQJA 2CB9A 2PBLA 2OGTA 1YASA 3H1AA 4UBLA 2JBWA 2HM7A 1JKMA 4QZVA 3WL7A 3I1YA 4DMHA 2X8BA 1WPRA 2PVSA 2VJDA 4X6UA 2H7YA 1PFQA 4EY5A 4JUIA 3CN7A 2RIPA 1WB4A 4P9NA 1BS9A 3D0KA 3I6YA 5AK5A 3WK5A 4W9RA 2XMCA 3LCRA 3FYUB 2OXEA 5AKXA 3OG9A 4BP8A 2ZSIA 1UOPA 2CKMA 1K4YA 4AMZA 4BRZA 1QLWA 1CUXA 1HQDA 3GELA 1XFDA 3FCYA 3D3NA 3WWDA 3WA6A 5HQ3B 1XQWA 1FSSA 1ZI9A 2WILA 5CT9A 3GZJA 1SOMA 1BROA 2QXTA 4GECA 4B7ZA 1W75A 5D6OA 5HF9A 4M0FA 4AMYA 3H2KA 4BYMA 2XT0A 3SX4A 2QUAA 3DLTA 2C5FA 5AIAA 2GZRA 5JASA 4H0CA 4EB0A 3C6BA 4LHEA 3FOBA 5CT8A 3WWCA 4FOLA 1JJBA 3S8YA 3DL4A 1XRLA 2W22A 2XUKA 3FLBA 4DSZA 4AN0A 4WY5A 1XZAA 2Z8ZA 4L9AA 4FBMA 3DYVA 4H7FA 3D5EA 1L7QA 3VISA 1XQXA 2XLBA 4J0GA 4BCDA 5EI5A 1UKCA 2JGIA 3OC0A 3N0TA 2OCIA 2XUDA 4BVJA 2HU8A 2FX5A 2JEZA 4X90A 4NS4A 1WPXA 1HKHA 1EDEA 5C8VA 3BWXA 1F0NA 4BDTA 1KEZA 1LPBB 2C7BA 3H2JA 1ZIXA 5ALWA 5AOAA 1QZ3A 5KBYA 2VAVA 2G4LA 3E4DA 5DYYA 4TPKA 2VJBA 1UT6A 3VJMA 4KYVA 3D7RA 1BCRA 2WKWA 4HVTA 1LPAB 1EI9A 3X3HA 4J3JA 1H22A 3WA7A 2V98A 3B3QA 3F9CA 4Q34A 1SCIA 5AKGA 3ESCA 5AP9A 4QDOA 4HRXA 1YS2X 2HRRA 2WIJA 2VTVA 2C5GA 5IH7A 2Y2UA 2DHEA 1SFRA 4PSCA 5JAHA 3L1HA 4OYYA 4IHAA 1FFAA 1UKAA 4G9EA 3G0CA 2VEOA 1LZKA 1DT5A 2WSLA 2WIKA 1O6FA 4CIAA 3R3YA 4GBGA 1VE6A 2IITA 5DWDA 3S2ZA 1X2EA 3WK6A 3WKDA 3UUFA 2GBGA 5A2GA 1U4NA 4UBKA 2DQYA 1CUJA 4KRXA 3FVTA 1E5TA 5C81A 1LBTA 1UK8A 3D2AA 5I9IA 4YPVA 1ETHA 2B4KA 3K9BA 3WYNA 1YR2A 1FFDA 3R41A 4KAAA 3WZMA 4Q1VA 3QBJA 1CUYA 5I8PA 1X70A 3MGAA 2IX9A 2PSDA 4BCCA 1Y7HA 1LGYA 5AM2A 3JYHA 3ILSA 4H7IA 1H2XA 4HTAA 1MT3A 4Y2VA 4B80A 2VF2A 5CT4A 2BKLA 3SWWA 1VXRA 5JADA 3WKEA 5AM5A 5AM1A 5AKZA 4HS9A 3IURA 4XX1A 4ZWNA 1MO2A 5ALHA 4FHZA 3WL5A 2GBCA 2HA2A 2ZJFA 4DMCA 4GXNA 3G9UA 2G63A 3H1BA 2XUFA 4OUKX 1CUCA 1DT3A 1VZ3A 1B41A 1EDDA 1UZAA 1YAJA 1ZD4A 2BJHA 1B6GA 3AIMA 1QGED 3I6ZA 1CQZA 3PFCA 2R11A 1BU8A 1JJFA 4ARAA 1ZI6A 4N8EA 2FJPA 2H7CA 2J3QA 3BJRA 4U2DA 4H35A 1X2BA 1T4MA 5ISMA 1EVEA 5T4FA 5F4ZA 3QPAA 1HDEA 5EHZA 4UFPA 4BBZA 4FMPA 3G9XA 3H2GA 3I2JA 5AI9A 5J3JA 5IVDA 4EY8A 4YX9A 2PSFA 2ZYSA 5BWBA 1TK3A 2RAUA 3K2IA 1XLVA
chains in the Genus database with same CATH superfamily
3EBLA 3PQFA 1L8XA 4F4FA 1KVQA 1Z2PX 2CZCA 3VMFA 2QZJA 1SMKA 1V8ZA 3CV3A 1ZXLA 3VYUB 4ALLA 4CQMB 3TBHA 3QVUA 2MT9A 1IN6A 2WT9A 4FZVA 2CLEB 2DKOA 4EITA 4FPXA 1TCVA 2KM1A 4HQRA 2FRDA 3DT6A 3W90A 5LWHA 2B6HA 2XGGA 5TQ0B 4B85A 5HBGA 2DFTA 5G4KB 4IHJF 3AI1A 3TTWA 4A2QA 4BE7B 2PO7A 5FQNA 4EQZA 2QRPA 2WA2A 3F9RA 3IQEA 2W70A 3VNQA 3IIMA 3HVJA 4AZVA 4C4YA 4A23A 2EAUA 2Y1CA 3DSRA 3MD0A 4YQZA 2PUDA 4PZAA 1DE0A 2EX4A 1BWPA 1UBUS 1EVYA 2IYXA 2R8PA 3S29A 1GTVA 1G8KA 4XJSA 3WO1A 1F1JA 4TT3D 4AUMA 4BMVA 4B75A 4ZT6A 2FWJA 3SBOA 1W87A 3CEAA 1NW5A 4MP8A 2GI4A 1REQA 5T5QA 4B4KA 4JI7B 1MR3F 1ICEA 2QM7A 1CQWA 1LPNA 2YTZA 3OCUA 4MQEA 3UWMA 4JT9A 2M6SA 4WVLA 3SS9X 4ANFA 5A3JA 2UXCB 4A2CA 1T5LA 2C7RA 2AT1A 4UHFA 1VPLA 2QOEA 3FZNA 1HM5A 1IG0A 2XUOA 3A2MA 5FLEX 3IEMA 3BB3A 4W5WA 2BFFA 3DLBA 2HF7A 3LHKA 4LWOA 1QKJA 3PGVA 3R5FA 4XLTA 3ZKWA 1CQIB 5JHGB 4B09A 3DZ8A 2LR0A 3VNAA 4X8MA 5A6VA 3C48A 4QLOA 3QOWA 2D2FA 1KZ1A 5FBHA 5IKPA 1KMQA 5HE9A 2C5HA 1K2WA 3ETGA 3PQ6A 4JB8A 5LA6F 1AC5A 1GHTA 2QMEA 1QSGA 1C9EA 2P69A 2BZ1A 2BGUA 3N8DA 2X2FA 3LK6A 4RKQA 5KYYB 1KVSA 3CZPA 3R0QA 1DAKA 2RBGA 3F6YA 3UW3A 4IO0A 2Q6OA 3LPCA 2C4UA 3ETDA 3W4IA 5A4FS 1Y3CE 5KTRA 3FX2A 1PGNA 3DCNA 3AU9A 1D6JA 1QO7A 2H9AA 2ZI6A 1TF2A 3HU5A 4WKOA 3VZPA 1N9GA 3EFHA 3R9KA 2ACVA 4IJKA 3PF8A 4UFNA 3WQRA 3UWPA 3D8RA 1VMIA 1JEAA 1PK9A 2GBIA 2ZGVA 4BEBA 4DA4A 1XV5A 2W4QA 3RCBA 3L9XA 3QU9A 4I0WB 4B33A 3ZUGA 3B78A 3R20A 1V9LA 2XMQA 3W2FA 5CEEA 1S9DA 1Q84A 4YROA 2ZAGA 3CBQA 2C61A 4NOKA 3LHFA 1U90A 4KR3A 1I1OA 3SM3A 4Q4DA 4JLWA 4F3KA 5LBUA 1VOTA 3IL2A 3ORRA 2OBFA 2FVXA 2GETA 1Y0BA 4UJ5A 3GWZA 3SX0A 3KE9A 4FGLA 1JX6A 4X1OA 2PKEA 2ZSEA 3HGMA 4MGYR 4WXEA 4G5FA 4NKRA 4D9CA 1KI1A 1C3LA 3CLSC 4JI1B 4EGSA 5HKAA 4LMAA 4QDUA 1OU0A 3GCZA 1Y34E 1KKUA 3U4GA 3HN6A 2YJ3A 3IKLA 1R5NA 4DAEA 4JYZA 3QE3A 3L92A 3Q9SA 3I1JA 1UM8A 1E0KA 1I6WA 4EHBA 1NE2A 4AZWA 3N2EA 4H4CA 2BRUA 2X77A 2PYIA 3AF0A 2PH5A 1PQWA 5LUAA 1E0AA 2W71A 4LRUA 4UUAA 3V4LA 4MROA 4DLVA 1AZLA 2WTAA 3PNBA 4Z9BA 3VYWA 4OMFG 3DBRB 1VE5A 5I8WA 2J3IA 4HNAA 4TQUS 4XR9A 3ZHXA 5EUBA 4EO4A 4GX5A 3MERA 2KWIA 1T4CA 2AJBA 1D4AA 3FSEA 4LWPA 2WZQA 4YAJA 1XA3A 4KHZA 3W9SA 3I8XA 4NR0A 2FAXA 2NM0A 1YBVA 3IQDB 1WNFA 3WY9A 4F45A 2QDKA 3GMDA 3ND8A 1T5SA 4EL0A 3AL3A 1OGJA 3HXOA 4K9QA 2YRFA 1IM8A 1QIMA 1XN4A 1XRSB 1Z4QA 1ICIA 2FSFA 2P4EA 2PZEA 3DT9A 3FBWA 5FORA 1HLGA 3L4BA 4XWGA 3WLNA 3LCUA 2WPNA 4OQEA 3LF2A 2H4FA 4AP6A 3U39A 4US2R 1JXQA 3F5SA 5C7YA 1F48A 2FPUA 1F8GA 2HIHA 4Z8YA 3S27A 3WXBA 2B78A 3P9KA 1XDUA 4X7MA 4WMLA 2BFCB 1GPLA 4HH4A 1DOZA 3IHWA 1Z29A 4ZZ2A 3R6LA 1OI7A 2OXIA 1Q3TA 3TOCA 2PNJA 1CB0A 1SRRA 3SEAA 3AIOA 4PQEA 4TLLB 3GLSA 1IXYA 3NWPA 3SXUB 2REXB 3NT5A 4D9FA 4Y9SA 2P9TA 2Y1WA 1K86A 3EEIA 1P8AA 4WZ6A 4KR2A 2XYHA 2ZRFA 2GPSA 3GH1A 5E2AA 2Y4NA 1JDBB 4BO2A 4B6EA 5BY2A 5K0BA 5FLYA 1WU8A 4MUJA 1EXDA 4QBGB 1V11A 1LQ2A 4D3DA 1T5IA 1VI5A 4J2HA 1YNOA 5JISA 2FR8C 2HRDA 1U9ZA 2OG2A 1JT2A 3A0RB 4GPZA 1OY1A 2O1XA 3H5RA 4DPMA 4PSDA 4RNCA 3RADC 1FZQA 5J4VA 1H93A 4ZCTA 4HOYA 1ZRMA 1O03A 3FF4A 4TKVA 4H4DA 1XU4A 4TYYA 4TMFA 2OMKA 4LSZA 2M1ZA 2FQYA 5BOSB 3UENA 4UMEA 2XMBA 4MCHA 1F7UA 1HNNA 4QFBA 2CMDA 3QKRB 5KQSA 3OPYA 1EKXA 1G66A 1L4MA 1U04A 4AN4A 1XD2B 3ZYCA 1F06A 4MCJA 3W3ZB 1QHHB 2RG1A 3BJEA 4GP7A 2P41A 4KO1S 4BC1A 4BVFA 3R8FA 3DTNA 4TTSA 1SIBE 1U1DA 4KO4S 3GQBA 4PPNA 3W8EA 5FNVA 1WPQA 4U9HS 4X3CA 2BSXA 3DZKA 3PNKA 4CF4A 3HKEB 1IMJA 3Q87B 5D51S 2JS7A 1ENYA 4Y1RA 2A1UB 3LUBA 4TKLA 3VBCA 3CR8A 2HBZA 2WT8A 3G0DA 3I83A 4KTTE 1Y3IA 4MVJH 5T8KA 3EDQA 5DM70 1TQ4A 4NYJQ 3WNCA 521PA 3UBTA 4ZMSA 1NW9B 3GIWA 5LOVA 4GZ3A 1C7RA 1DXQA 1DJNA 2NN3C 5BR7A 4J0IA 4TUYA 2QT9A 1Q19A 3VJLA 1OLXB 6ADHA 2IDJA 1VL2A 4NY1A 3ADPA 1BH6A 2GAJA 3GJQA 3HCOA 1NXWA 1DC8A 1U94A 3MFQA 4MNTA 4CDRA 2JDIA 3PK0A 3C5EA 4LC1A 2NPIA 3EVZA 3KB2A 4FFNA 2QTRA 1T1RA 4MB6A 3GLFA 2XW6A 4KRFA 2XB6A 4JC8A 2L17A 3ZY2A 1Q20A 2IRWA 3CLVA 3EZGA 1I30A 1WL8A 2ZWIA 1D2CA 3HEBA 2FOLA 1JF8A 3HS3A 4NBVA 1EFHA 1IAQA 1HFEL 3FWHA 2P30A 1G4HA 4BDSA 4D4MA 5I01A 3CR7A 2FPIB 3FTDA 2IEYA 1ISSA 3WL8A 4MHTA 4ON9A 4I1RA 4RAOA 1XPJA 3BSSA 3KPVA 4JMPA 4E3WA 2OCLA 4OI0A 5CLQA 3BRCA 1RSZA 2D8AA 2D2XA 4O6VA 3VTFA 1AGXA 3GDGA 1NTOA 1P72A 1PWZA 2IOHA 2JGKA 2VZLA 1K98A 2XBUA 4LYFA 4OK6A 4JJ4A 4CMKA 3OJWA 1YBFA 2VPIA 2GTPA 3T9BA 4C88A 2HBYA 3PGMA 1ODLA 2QX9A 3F4LA 2XRFA 5EJEA 1B16A 2R751 4NDZA 2E4VA 1MDFA 2VA9A 1Y6RA 4CM3A 4RTRA 5KC8A 4N40A 1GCOA 5KJ6A 3A28A 1XTQA 1I3OA 3O7MA 2ZIUB 4L4YA 2NO9A 5AHWA 4KRGA 4KNYA 4NCBA 5TGZA 4QOIA 2R1TA 3EVEA 2OV6A 1RABA 1IQUA 1SCJA 3K70B 5JNVA 3VPAA 4TV8B 2O8EB 1THZA 2W00A 2OMEA 2P5UA 3D6VA 3V4VB 3VR0A 1U5BB 3MMXA 2N75A 4KWEA 5LQKA 1XN1A 3QXJA 3LVRE 2WAOA 5CJ2A 3T5TA 4MTLA 5JQGB 1M2WA 3HVIA 1ZQ1A 3K2BA 2QZ9A 4PTZA 4QQFA 2AXPA 2I7TA 4DUGA 7MHTA 2O4UX 2J41A 3HCEA 2JFPA 4FT4A 1A76A 5CFMA 1QRDA 1O6CA 1BGXT 3CVXA 2GYUA 4ZV7A 3LT1A 1SC1A 4MULA 5EQTA 2A0YA 1BJKA 1QUFA 3RFCA 1WXDA 2XITA 1G8FA 3EARA 1OXSC 1SRQA 1MH1A 2ORVA 3Q1LA 2PQ0A 5G0SA 3QVVA 1M2OA 1FLAA 1FJHA 4PE5B 1T1IA 4OJTA 2FUKA 3KD2A 4LTDA 4K40A 3TRIA 3DBLA 1XAJA 1XRRA 2B34A 3KFVA 3LA8A 3F6PA 1PW5A 4LZJA 4XD7A 4DJTA 1FVHA 4CT5A 4A03A 3A9WA 1ZS9A 4MP6A 1RWOA 1D4FA 3KSDO 1XTKA 1L5QA 4BQRA 3ZS8A 1P19A 4RPIA 3RSLA 3UMFA 5C5EA 4RLHA 1RM4A 3EQ2A 3HCBA 5L4NA 2H3HA 2QL6A 4XZ3A 1FW6A 3STYA 3TL3A 2D5BA 3E9MA 1NW3A 1SC9A 3LGXA 1DG9A 3LK7A 5IAGA 5IWCA 2CLKB 1CJUC 1YI8A 5T7BA 1KH2A 1A8QA 2JLBA 2SICE 3K0FB 5AW9A 4IGIA 1YJAA 4BV2A 3AF5A 2CJXA 3WYCA 2VSQA 3TXXA 4EYQA 5AKYA 5TQJA 3VVBA 2Z83A 1FFBA 3MHTA 4I5GA 4MIKA 3HP1A 4PBRA 3V2GA 1MG0A 1GFWA 3H0EA 4QWWA 3ZCSA 1ZGBA 1AUOA 1UEIA 2Q1YA 3ELUA 3NXKA 4ITRC 3M89A 1KJZA 4QGGA 1Z7BA 3TW4A 1X92A 2PKQP 4C0WA 3CRQA 3QFSA 1VL1A 4OUDB 1Q3KA 4ALMA 3SGLA 5ANRB 4B3BA 1KY5A 1TZCA 4H7EA 4M2LA 3ZY4A 3KQHA 2OFPA 3KYCA 1VM6A 4XLLA 3TPZA 5B1HA 4Q18A 3MNFA 1G9TA 3IDOA 3GHHA 3LX5A 1OTHA 4GRDA 5EZQA 3S2SA 2Z6UA 2MYTA 3VR6D 3LX6A 1XZMA 4MV4A 1YZFA 3PQDA 5BUCA 3EEQA 1N9KA 3L49A 1NVBA 4C30A 2D0IA 4M54A 3CISA 3BGSA 3M1LA 4LJ5A 2Q4BA 1RIIA 1ATIA 1E5LA 5F5NA 4CFSA 4X3OA 1T1JA 2CCGA 5FFFA 4ZEVA 2CLLB 2QW0X 3CE9A 5K3AA 4DCTA 4EI2A 1VL8A 1AN9A 3ESXA 1J2JA 2ODWA 5ESRA 4LSGA 2XMZA 5L4LA 1ISJA 1JFVA 2IU0A 2O05A 4P34A 1AK2A 1VTKA 1R74A 4HYQA 1PS8A 3OP4A 4Q12A 1YBHA 5DJ5A 1X9IA 5TEVA 5KB3A 1OFVA 3D0OA 4FGWA 3BIOA 1C7EA 3HDVA 3KOWA 3OF5A 2F43A 5CIQA 1WD7A 4E6PA 3ZW7A 4E2ZA 3I39X 2C77A 2XOXA 3W1WA 2IDKA 1G291 2FWMX 121PA 2WJVA 1AUPA 1C9KA 2GWRA 2RCNA 2YWFA 3B6ZA 1NHGA 3FZEA 3JY6A 4NFYA 4J1NA 5DGXA 5E6UB 2XGMA 4KACA 1U9CA 2WTUA 3R4VA 4CM7A 2Q50A 4C7OB 4GWGA 1E3JA 4TRNA 1Y8AA 4IIVA 4UVIA 5MN6A 4IP0A 3BC1A 2B92A 1OWOA 3WLEA 4DQDA 5JCZA 3K0CA 2JAPA 3R5JA 2OGUA 1N2ZA 4IR7A 5EEGA 3DEFA 1DIAA 3FBGA 3GUVA 1DEAA 1FP7A 3P2JA 1FRZA 2FW6A 4QGAA 2IU3A 4G25A 3HDJA 2X0DA 2IP4A 1DDOA 5BVHB 5BT8A 3GVHA 5DIZA 5B3KA 1KI6B 3I9V1 4D0RA 2HHCA 821PA 2ASVA 2O8VA 3OOSA 1KSGA 1B00A 1V26A 1X7YB 1I7PA 4C5BA 2EW2A 4MV9A 5DTEA 2YVLA 2IZ6A 4NZZA 3DV2A 4L72A 4CIYA 4QUEA 5KYUB 1NQWA 1GQFA 2VWGA 3FKSD 1PV1A 4FFMA 1J8FA 1G3IA 1BEEA 4IRMA 1YRWA 4ENQA 2ZWAA 5DLEA 1TQHA 5H80A 5EHGA 4P58A 1XCBA 2HJVA 1BKDR 4FINA 2OBMA 2QAGA 1VLZA 3MWJA 4REMA 2JFUA 2P67A 4UM9B 3UPUA 4PZUA 4LEIA 1XPOA 3G3EA 1HMYA 1DU4A 1WDKA 3IBFA 3KOOA 1GZUA 5CVCA 4R9RA 5LQSA 1RWBA 1JE1A 1UBTS 2HMYB 3CPHA 2DSTA 4HFJA 1G64A 4K9PA 2A84A 3R24A 2C03A 3V1LA 4ND8A 3SJZA 4JU9A 1MVNA 2R6CA 1NVVQ 4H1UA 1Z88A 2YIJA 4RJ2A 4S0XA 4R1TA 2MYUA 4X7PA 3U1BA 2XCSB 3IH5A 4NZPA 2GKGA 1Z4NA 4KSYA 1Y82A 2JLUA 3ER8A 3TLYA 3PIRA 5TS3A 3CF2A 3U3DA 1EK2A 1NRIA 1S2IA 2QGZA 3G8CA 4MRAA 4RY2A 2CUKA 4FE7A 5HQ3B 1LF5A 4LS3A 3K9FC 2PX2A 3CJTA 3DEKA 2VDPB 3ZHQA 1JU4A 2DQKA 5KSYA 2FMTA 1LWOA 3LLCA 4L57A 1N4DA 2JCVA 1N2SA 3AERA 3C3XA 5JJLA 2FQQA 2O7SA 3AK4A 3C6QA 2O2JA 1M2KA 1WUHS 1OWPA 1W5SA 5LYJB 2VUSA 3GF4A 3F0TA 1EK6A 1TF5A 1A4IA 2PRIA 4KN8A 3RYTC 3ZV5A 3OPXA 5CNKA 1CUEA 3GLHB 4I9UA 4ZVVA 2W6ID 1VYTA 5D1NA 5EZ6B 2OXTA 1EXWA 2BT4A 3S28A 1GWNA 4B46A 4Q4CA 3CNBA 2NXJA 4HAWA 3TTUA 3IQFA 4LV5B 1AURA 5JIBA 2AF4C 3M5PA 4KRYA 4Z4GA 2ZATA 5GZ1A 4ZV9A 2VIIA 4KN6A 3DZDA 2G8LA 3F4BA 2FN8A 2KS6A 3T34A 4F38A 3A1TA 1GIAA 2IYVA 4GNKA 4OAOA 1RI1A 3H84A 4C7VA 5C8YF 3PEWA 2C4MA 3IT3A 4FQ7A 3N6XA 5DYWA 5H0IA 4DYVA 4RA6B 2PSHA 5IXSA 1KYVA 2XY4A 4D8XA 3KDAA 3CX3A 3PFKA 5A1TA 5JVDA 1ZD3A 1G8GA 1ZBQA 4M1QA 5A02A 2DOKA 2XNDA 3NKFA 2D8MA 1TA9A 1QFYA 4L4SA 1DZ3A 3M4YA 2PLNA 4GMKA 1YSCA 1IUKA 4LF6B 1CNFA 1GA4A 4QO8A 4ZI7A 1LK7A 2AIRA 2ONJA 1QIEA 1U0SY 2Q1XA 4L8FA 3WGOA 4Z4EA 2PS9A 3I9MA 1P0FA 4J91A 5D3QA 3DT8A 1VLLA 2IV3A 3GJ4A 1D7AA 2QTGA 1SVOA 1FL9A 4YP1A 5H7XA 5HM8A 5HR5A 2GAOA 4WOKA 3OMXA 4TWAA 4DQLA 1L4KA 3ZN2A 3ZQJA 5FWYB 4YJGB 1JSCA 3DOFA 1KJQA 2WAMA 4M8IA 1KU0A 1RZRA 2AG1A 3GY0A 4LZLA 3H9EO 1F0KA 4MW0A 2VLIA 3CKLA 4GKAA 4RK7A 5JWHA 3RGWS 1B14A 1EM8A 4JLSA 3W6PA 3ZLUA 3ZY3A 4BEJA 4R1QA 3F2IA 2Q41A 1JP7A 4YASA 1Q83A 2CL6X 4DY6A 4PRLA 4QLAA 1A9RA 1JR3D 1ZICA 1ONNA 2GM3A 3G1UA 4Q3LA 4CCSA 1MEEA 4TN5A 1AUXA 3ECSA 1CQXA 4X8LA 3U56A 2R6AA 2AFVA 3MELA 1DCTA 4QBFA 2DETA 2ZRNA 3PHIA 3PJDA 3ZDQA 4PR0A 2Q9BA 3JQ9C 3DAOA 1NMEA 5CA1B 3A14A 3UHJA 2OORA 1GNVA 2PG3A 1NU8A 1W581 1ADYA 3COWA 5C1BA 2TMYA 4Y9DA 2DBQA 1MVLA 5FJJA 2RFLA 4F6LA 3EIHA 4WGFA 3GRAA 5EY5B 1V1RA 4MRPA 3CVVA 4YMGA 3JD2A 2AN4A 2QX8A 2UZ1B 3M1AA 3O92A 5M29A 1GGJA 5AK6A 4EVQA 1GTMA 4LVUA 1DKMA 1U2EA 4CTMA 3JQ6A 3TCKA 1LJUA 2QJTA 3G49A 3WKCA 3E9CA 4FFDA 2Q2VA 3RAFC 3HXPA 3RHFA 3OPQA 2O1WA 1L9XA 5AK3A 4OEHA 3NG1A 3J81A 4JODA 3KXLA 5JO0A 1CZNA 2SKCA 4C07A 2B82A 2C5LA 3C43A 4NJMB 4C3OB 3GBSA 5AUPB 1SOVA 4PHFA 2GVNA 4YAEA 1H6CA 4N65A 3PPXA 4RX1A 3BZUA 1XK6A 3FTNA 4Q1FA 3DE3X 3I2IA 4BN0A 2OPBA 3L6OO 1E2GA 2HO5A 2C8VA 1YNSA 1UKYA 1B2LA 1TX4B 4FR5A 4KAFA 2PGXA 4AF6A 5CD1A 1KYIA 4GPBA 1J9EA 3BK7A 4AG5A 4RPCA 2NX2A 3GZNB 1M8FA 1I8TA 5JRJA 3D6NB 4Y2TA 1O0CA 3KKPA 1JPJA 3F7OA 3RU3A 4NG4A 4R01A 4YPOA 4L8GA 2CXSA 5KNCH 4EATA 4Q9JA 2H5EA 3RANA 3RS3A 2IS1A 2QPLA 1NZDA 1CRQA 2XQGA 2FP4A 3DM5A 2B7CA 1TXGA 3OA0A 3ZWMA 3HV0A 2MINA 3P0HA 1O97D 4XVHA 2FOXA 3H5LA 1GCUA 2X0NA 3JD3A 5K8VA 4HWKA 4N54A 3SIWA 2PHZA 4LYYA 4DSAA 4ARZA 1H8HA 4CGYA 1E0DA 1SHKA 2HV8A 3G2NA 1E4EA 1WA5A 1B8OA 3I76A 1EUDA 3NFRA 3OT1A 4RK1A 3FAZA 4KH1A 2IYPA 3HLYA 2QXYA 4O0LA 1I4DD 3PI6A 2XZDA 3K0SA 1OXVA 2WDPA 3P4YA 2B8EA 4QM6A 1AKMA 4GOMD 3GGDA 2JJ1D 1TM7E 3EHDA 2GX6A 1GLGA 3DZJA 2HK6A 1VE3A 3P27A 5E7MA 1DNPA 4JP5A 2CVOA 3HLTA 2POQX 4NPHA 3V4OA 5HHTA 1DC5A 1OT3A 2KLHA 2FUEA 3CUKA 4R2HA 2WWVD 3R9IA 3GI1A 5LXTA 2PTHA 3D8BA 4HXGA 3NIWA 4QTXA 4DARA 4FIZA 5TT0A 1CIJA 1N3IA 5FV7A 1U0LA 2F00A 3M2TA 4ZZ0A 1JEDA 3K6SA 4NOMA 4UVEA 5BUQA 3UMMA 3HCCA 3D31A 3ZWYA 4CETA 1FK8A 1KY3A 2G9RA 4QG7A 5MN5A 3A3NA 4G2TA 3VZRA 4YRAA 4KODA 1OZGA 5CYOA 3KTAA 1JIIA 4XYBA 2IKSA 2Q8NA 4HFRA 1SQ0A 3ONVA 3P2YA 2GK3A 4BQEA 1OASA 3GJ7A 3LDHA 4OH1A 1LS1A 2ZRMA 4G1FA 4HPWA 4RKWA 1EBFA 1NMYA 2A5GA 2V7XA 3V34A 5B58T 4P7GA 3GPBA 1C14A 1QTRA 2QHXA 1CQJA 3K9CA 1DXHA 3LQRA 4EHAA 4JMLA 4X85A 3AG5A 1QRUA 4ZQHA 4MTCA 1D6SA 1XC7A 1TZBA 3KEOA 3PUVA 5KX5A 2PPLA 3AL2A 2HJSA 3N8GA 2GF0A 1OZHA 3MWGA 4L1KA 4PW0A 1YZGA 5FL3A 2V7QD 1IN5A 1CRZA 1NJ5A 1PT6A 1O4VA 2EQAA 2GM5A 3GW8A 5F52A 4BTEA 3JQGA 2QW1A 2W8ZA 4H6WA 1EYZA 4AKEA 5KNBA 2ZBQA 5COQA 2XVXA 1W19A 2AEFA 5A62A 2VF4X 1SQGA 2QT0A 5FO1A 3AVVA 2QXUA 2RAFA 2YZKA 3ZLJA 1MX1A 2VTEA 3B9QA 3MM4A 3O8NA 4UARA 4G5RA 1GN8A 2WFAA 5B2ZA 2QYOA 4LG1A 4WTOA 2GKSA 3DDSA 4G97A 4PLFA 3IQWA 1E3IA 2WBLC 3S2UA 5LB4A 1GARA 4CQMD 1G8YA 3V9AA 3TF5A 4F0JA 4X8OA 4V3BA 1Z35A 3AFHA 3VDRA 1A7UA 4AO6A 4KITB 2EBHX 4JY7A 3N87A 3VOAA 1K8QA 3DDZX 4BWGA 1N2EA 1SY7A 2RGNC 3N5CA 1E4VA 1F2UA 1ZLYA 3QPBA 4M21A 4KIUA 4F60A 4A6EA 3QWHA 1JEYB 4E94A 2ZI5A 4R7ZA 1EFPA 3FUCA 4B73A 1K8RA 3B1XA 1CB7A 1SR8A 1L5GB 1KF0A 1P2SA 2H59A 4G1EB 3VVCA 5E38A 1IY8A 5H3CA 4BAUA 4BNLA 2IYOA 4WXMA 4K87A 1KMHA 4HUJA 2WLSA 4NU0A 2RGUA 2C2BA 1XLTA 3LHSA 2QTBA 4W8GA 3HY4A 1BNCA 3QG1A 2R00A 2JHCA 4PLYA 5CXSA 5I9BA 4F6CA 4MQBA 1U6IA 2RAPA 3ZIUA 1TJNA 4WFIA 3OIDA 4UREA 2BI4A 4ODIA 4EW6A 2QYTA 1OJ7A 3ESQA 5DGTA 4YRPA 3TZHA 4N41A 1TYBE 2C5SA 1MW8X 4RZXA 3OSZA 3DR3A 1UDAA 2WNIA 2QK4A 1CVLA 1YD7A 3GFVA 4LJKA 2HREA 4R8VA 1PG2A 1N5LA 2J9GA 2X76A 4IH9A 5BYKA 1DQZA 3V2UA 4EKGA 1L5NA 2DPYA 4UVGA 1AKEA 1CHDA 3M0EA 3KXIA 1FFYA 1I6KA 2XE7A 4OTZA 1MB0A 1E8NA 2WAXA 1LS6A 3G89A 3PG5A 4J0FA 4DCCA 2C9YA 1OA0A 4C4PA 3LUGA 5DGDA 4DMKA 5TMPA 3CSDA 3SZLA 4TKUB 4LRSB 4HGZA 3BZWA 2ZR0A 2ZTLA 3O4VA 1VJ0A 2Z6AA 3UMBA 2RGYA 2YUIA 3H5TA 3PXBA 3SBXA 2G07A 5A9TA 4P4TA 4WDRA 3K71B 5IMSA 2JVKA 1JLKA 3E9YA 5FWXA 3LH5A 3WMEA 3BAZA 1XBTA 1N2XA 1JJVA 2CNWD 1EZZA 3EDMA 1WUIS 5BR1A 1M1XB 4AF7A 3QKSB 2IUSA 1EVJA 2H2DA 2W2XA 5EGNA 4CM6A 1PFWA 1EHIA 1TTHA 2W48A 3ITNA 5BYAA 5AJZA 3RFTA 1RLUA 1J9ZA 3KZNA 1AKRA 4Y2HA 4AJIA 3DZFA 1JIVA 1RW4A 5AUOB 3VR2A 3Q3VA 4J0HA 1WVGA 4Q4HB 1BKSB 4KBFA 4RJKA 2W43A 1EBBA 1Y7IA 4UUMA 3VDQA 4M89A 4LMBA 4LBZA 2I33A 4OPMA 3STTA 3ZU2A 4YWJA 5CB0A 3F3MA 3SQWA 4ILKA 3PL5A 2B21A 3RKSA 5JG7A 2H0AA 3L7YA 2F9LA 3CNLA 5IVIA 2V6JA 2XX3A 1ZVKA 4WE3A 1BAPA 3G7SA 3MCTA 1Y63A 4DQVA 5LP6A 2OE2A 1A8HA 3AEYA 3LY7A 3DV0A 3QU2A 3MWDA 4Q4AA 3STUA 3ZIAA 1V3TA 4AUKA 4JUCA 1KA9H 2VQ6A 3LLUA 4R0NA 1QYVA 4U63A 1SQSA 3GN2A 3HCNA 4MPJA 1VCOA 2E7ZA 1DX4A 3OU7A 3GRUA 2JA2A 2Q3EA 5BO5A 1CD5A 4U0KA 4OL0A 1ZRSA 3MMNA 1YU6A 4Q4LA 4RABA 2OCDA 1QCZA 5BURA 4QC2A 1P39A 2JK0A 2YHIA 5F4BA 4E2WA 4OQNA 3IT1A 5KJFA 1N36B 1YR6A 3WIEA 1QYXA 1OX4A 4JROA 3TBFA 4OGLA 2BGGA 1B73A 3O91A 1LWNA 4IG9A 1P0PA 4MPTA 1OA1A 2XNHA 2Z1MA 3D8SA 3KWLA 4WT7A 4YJDA 4F71A 5CIWA 1FIUA 1ESDA 3GAZA 4NYMQ 3OPMA 3T5DA 2GHQA 2Q3FA 3FNQA 4G5GA 4QPCA 1AQIA 4DJDC 4E5DA 5KYWA 1IZ7A 1XNJA 1Y6ZA 1LPOA 3Q7TA 3PC7A 4QOEA 2G72A 4M1WA 3WFZA 4F06A 3TKYA 1FNNA 1P33A 4H7JA 1KFCB 2CDRA 4JYMA 3ZW8A 4URWR 4EPRA 5HIJA 2XLCA 3JPWA 2OQIA 4K6KA 3FI9A 5DK4A 3FFXA 4BLQA 4MWGA 4YRCA 3GA7A 1TJYA 1GT91 4W8OA 3ZWCA 2GN4A 2YW2A 3HL4A 1N6NA 1EP3B 3DFZA 4UTXA 3FYTA 4Q9KA 5IK2A 4Z2YA 3IIKA 4DVGA 1CY4A 2IOFK 3P4XA 3RWBA 5FWNA 2YASA 3E9RA 3LCCA 3EFOB 5IN5A 4DLAA 2FDXA 3H2SA 3PNSA 2CVFA 2QTZA 2RH9B 1J2EA 3LQFA 3P20A 3PUIA 3O8LA 2PCJA 3PVZA 2ZVJA 5EIFA 2UZ0A 2GD0A 4ZT3A 2EW8A 1DHRA 3NVKI 2VYQA 5EJ9A 2O2ZA 1GNPA 3DD5A 4P7FA 3G59A 2NUPB 1P7YA 4CODB 4GU5A 1BJTA 3DAFA 5AFSA 1USIA 5DGCA 2HF8A 3TMKA 1Y7TA 1II9A 3R77A 2Q2WA 3NHPA 2VUUA 3REQB 1Q50A 4OSOA 1OH5A 2DF8A 1JFFA 1P31A 3SI7A 2QTVB 1GV0A 2Q28A 1DRJA 1WW2A 1MORA 4WZZA 3ICCA 1YB1A 2FPMA 2GJ4A 2FN4A 3WK8A 4AYWA 4IEIA 1G17A 5EINA 4P35A 3B48A 3PPIA 1O08A 1Q1QA 1G16A 1N2BA 2D1QA 4BGEA 3D3KA 4Y6SA 1UFOA 5HZMA 5K20A 4C6TB 3N39C 2ZUFA 5IAEA 1D0VA 2NQ8A 2PY6A 3D5QA 1MABA 3NHUA 4Q3DA 4YS6A 4RVCA 2ZJ5A 4HZUA 5TMDA 1YA6A 1CTQA 5JU6A 3T3HA 4IVQA 1BVRA 1IJBA 1ZZGA 3FMOB 2XMSA 4U2CA 3TZLA 1J8QA 1ENPA 2UVQA 3HJHA 4YUXA 3EF1A 4PRKA 3SR0A 2H9IA 4E14A 4HVLA 1IUOA 5KPDA 2A78A 4NJEA 1NPTO 4R54A 1SXJC 2BEUA 1EFUA 4XWOA 3JVEA 4N4AA 1YZTA 4BMOB 2JASA 2WLTA 3OFJA 2DBVO 4H08A 4HI0E 2JHAA 4IF4A 4NBTA 4TKMA 1GTRA 3M4XA 4JEMA 1EXMA 3BKWA 2RH4A 1I3NA 1MTOA 2EARA 2PZLA 4MAFA 5HJEA 1ODJA 4L0CA 2J0VA 1WXGA 3H18A 1FMJA 1E3QA 4IHJA 1T2DA 5EWMA 4GO1A 2LCQA 2CBXA 4ACAA 4RHYA 3TUJC 2FW9A 1E6EA 5AVQA 5KS2A 2FGKA 4D9GA 4U7WA 1K6IA 3T94A 5CCEA 5MGBA 2VATA 3JYPA 5FXMA 3DB2A 3FM9A 3KZXA 3GLTA 3G82C 3L7OA 2G1JA 3K1AA 3O4IA 3WOHA 3C85A 1SH7A 1FUUA 2P5TB 1SKYE 1NUPA 3L3BA 4FGJA 4K03A 4XIFA 2VRCD 1E3SA 4DG9A 3ET5A 4F2WA 3BN3A 5HKKA 4MAAA 4DQ0A 1DGQA 1NF8A 2A86A 3GLFE 2BEWB 1KBZA 2RHDA 1NN5A 1V2HE 3QEJA 4Z4CA 5FUMA 4Z1MA 2JBAA 3N9IA 2XWPA 4GPTA 2QRGA 1JG7A 4AURA 3I72A 5IP5A 5K51A 4X65B 1ZESA 4W5OA 4Y30A 3VQTA 3O4HA 3A3PA 1JPVA 4M9CA 2DFKB 3KDSE 3VH3A 2DCMA 4JR2A 1GU1A 1PJTA 1U6KA 4JXKA 4UDNA 3SICE 4CRWB 4HDSA 1MC1A 3ELYA 4RSMA 4C9BA 3PFWO 3ZLVA 1TKAA 4PG8A 3AZOA 5LMUB 1QHYA 5CIYA 1IYZA 5CG2A 4XM2A 4A36A 5LA6A 1E1YA 2VRNA 4Y6OA 1T4GA 4PPGA 1OVGA 1PJ2A 4GI3A 1G6OA 4JL8A 3AZQA 5GM1A 3BJIC 3CH6A 1K6MA 3SJUA 4ZOLB 3FIJA 1MOQA 3N05A 1Y5LA 1DEKA 3B3JA 4U8GA 3WYAA 3AHIA 3EGXB 3E2IA 2ZUTA 2AJDA 3TX6A 4TYNA 4CLRB 3N2GB 4FFOA 3FTFA 2P62A 3IP9A 4J9UE 4KP7A 4V0OA 2VUHB 1I32A 2D74A 2B83A 2NZ8A 2XHZA 3EPKA 3QVOA 3EDOA 4ID9A 1SZJG 2HPHA 2H8KA 4DLTA 3K70D 3Q9NA 4QVKA 1V16B 5THQA 1RPAA 4LBYA 3PJFA 3K09C 4ZEOA 4RETA 2NO1A 1QLJA 4ABYA 4EI9A 2RHCA 2ZWVA 5ITSA 4MHOA 2DKNA 1EQUA 3T1QA 5BSRA 2IHVA 3I2KA 1J1ZA 5AJTA 5J59A 2XWSA 1RAFA 4P3PA 2GN9A 2R7LA 2ZWMA 2IY8A 3VDMA 4D4IA 3I05A 3K2EA 4LY3A 3UA3A 3BL6A 4BWYA 1SBIA 1U2GC 5BW4A 2R8ZA 1Y9EA 3O2JA 1RKBA 3LYAA 4JOQA 3KZCA 1F9AA 2R1VA 3HYSA 3N2KA 1Q57A 1J0XO 1PT5A 4PC3A 4ETWA 2H1FA 3QQPA 5KKCA 3FR8A 2BL4A 1ZEJA 2DHRA 4LVCA 5F21A 2Q5QA 2ZQZA 4WVFA 1AU9A 2HRBA 4GZLA 4HS4A 1CKEA 4YUAA 1UPXA 3L1IA 2FX3A 4IIXA 5DI3B 4E0BA 2DRIA 1Q3HA 1HYEA 5AW3A 2EJUA 1SHLA 1CDEA 3D7MA 2W2VA 3EXIB 3UY4A 4MZDA 2WYUA 4U2KA 4UUPA 1DKLA 4OM7A 5D6NA 1T36A 3HI6A 3L7CA 4KI0A 5FWDA 1ZUWA 4IWXA 1WXEA 2FEOA 5C8DA 4YRLA 1ZN2A 1K1EA 4MKGA 4WINA 4CV1A 4AZSA 5ALRA 4TL8A 2HCBA 4E09A 2CC2A 3UHPA 3A58B 2UXBB 2G83A 1B0PA 1B6RA 1VGQA 4CHTA 4CIWA 1KK2A 1QGDA 1FS4A 2XXJA 5LQRA 1UBJS 5M3BA 2MU1A 3M1YA 1T9ZA 2DHCA 1GKKA 5B3JA 3PQ7A 4KLRA 4ZMRA 2PRJA 3BGIA 3UUWA 1CUWA 3E05A 3GARA 1UKEA 4CYMA 3C3JA 4XDYA 5DZSA 2VBIA 3L41A 3QEAZ 2CVZA 4CQNA 2DQZA 3DVAB 4J1TC 5CVJA 3S1AB 3ER9A 2FZ5A 3WE7A 1SCUA 2XUGA 4RKEA 4EHKA 2ZEJA 2Q3LA 4K5QA 4OJQA 2Z8YA 3A9TA 3RRJA 4MW4A 3ZHVA 4NCKA 5LYYA 3S2EA 3Q40A 2PMDA 2VNAA 1Z6XA 2BMWA 2ILTA 2ZITA 2QD1A 1TUGA 1HFWA 3UJCA 1J22A 2EZTA 2RARA 1Z56C 3BXOA 2PX0A 3JWGA 1CJBA 4JI8B 5AXDA 3UYKA 1BX3A 3CUTA 3MOSA 3O94A 1HBJA 3C8UA 1LX6A 4NLLA 1UJCA 4A8TA 4F1JA 2EZUA 1GZVA 2XDQB 3HCRA 5CYFA 1SUSA 1GTZA 1FY2A 5FUWA 2BFBA 3UJ6A 4BGUA 4ZRDA 2CW5A 4RE5A 1M7GA 4EUHA 5I3CA 4YRBA 1OH6A 4ZU1X 3R0XA 2QV7A 5CB4F 4IWYA 5D5HA 1EE9A 4NU5A 2H07A 4PN7A 3WBBA 1EVKA 4E31A 2FZKA 1TAHA 4DRXB 4E11A 4RTMA 1KZGB 5HKLA 1U2DC 2AJCA 3O1HB 4Y0AA 4FMCF 3RO7A 1JNYA 2Z08A 3LO8A 4GC5A 4ND6A 2R25B 3B36A 3GJ8A 1GNQA 1OCEA 1SKAA 3P26A 1DMRA 3PFFA 2G36A 1WHSA 3A11A 3KC2A 3TRHA 3EXG1 1DX6A 5EP3A 1CZOA 5CFOA 2AOTB 4IZOA 5ITWA 3ROFA 2JLQA 4O4LA 2NV0A 2Y0BA 4L4UA 2RCYA 3AZPA 3TRKA 4LRQA 3I4FA 4MW7A 3FUVA 2Y4OA 3C5WP 4OOFA 2LUOA 2NGRA 3IVGA 4K28A 4N18A 3EEOA 2WPDA 4NTZA 3FLAA 5JAZA 4KWHA 4IRUB 2JFYA 4DCOA 2ASEA 1I3MA 2HU5A 2WHPB 5IXYA 1IJEA 1FNMA 5H5JA 1T3TA 3TNFA 2DWOA 2M98A 4QTTB 2VQEB 4RGYA 2BTQA 1JB9A 5HK9A 4IQGA 1Y6GA 2HPZA 4YDHB 1Y3HA 5FAKA 3MAGA 1D2GA 4AROA 3GLKA 3F7MA 4RQBA 4RPKA 1KQ3A 4O5AA 1JLSA 4RFSA 5DE3A 4ZQIA 1JYSA 3ISJA 1DWUA 1P1RA 1DTWB 2WJYA 1E9EA 1I24A 4AJ1A 4D4KA 3A3KA 3FHJA 4JQCA 2UUPA 3KJQA 5JJKA 1SCBA 3K9NA 2AJLI 2QNIA 2JJQA 2I3BA 5KJCA 2I7VA 4RH0A 4HX9A 2Q7DA 3PWSA 1N34B 4BO4A 3D02A 1MVOA 1G3RA 3LDFA 4MA0A 1GGNA 2SCUA 3AKYA 3HJNA 3PC8A 5EUMA 4UM9D 4X5OA 3AL0C 1U9IC 1Z75A 3PB3A 4UHBA 1XKXA 3VH1A 1FP4A 2ZSHA 1ODFA 1QHIA 1HT0A 3DWEX 3VNUA 3JQ8B 5JD6A 1SA0B 4QDTA 3M4NA 2X9LA 4R51A 2JFXA 2NZYA 1OB2A 3D7LA 3P9CA 1UKVY 4ZAYA 3W2HA 4U7PB 1MMFB 3UK2A 1EGHA 2X5KO 1G38A 3GNLA 4C4ZA 1Y8QB 1FNBA 4KQIA 3KKKA 4NZNA 3G9QA 4PHHA 4PR3A 2O3RA 4X6XA 5JS8A 1G9XA 3L43A 1AGYA 4MDYA 5DXFA 1JAIA 3TTVA 5F73A 1BEZA 2EKLA 3PICA 1C7QA 1I9CA 4X64B 1QE5A 3BD9A 1NP6A 2PFKA 2XCOA 4PY2A 5K7SA 4DMMA 1G5HA 3EMVA 1CU1A 1AH2A 1TECE 2IYSA 2ZYGA 3FETA 1LVHA 3LQQA 4DLUA 4RVFA 4WNIA 1GG2A 1FPQA 3QVWA 1P8JA 4OHWA 4ZCLA 3Q7EA 4QPJC 4F6RA 2XZTA 2WJGA 4UTRA 4UVHA 3ROEA 4AKSA 4JKOA 3OZRA 4WFQA 2QTCA 3H17A 4TRJA 1TOAA 1UMDA 2AG6A 3OLXA 4NOJA 2A9RA 4WN9A 4JBXA 2VPYA 2ZZMA 3AEUB 1MRZA 1QHGA 1DC4A 5AI8A 4UBIA 1I2ZA 1ZMTA 4ZOEA 2EKPA 4C4OA 2R84A 4FLFA 4PYIA 1BOOA 3UO8B 4BMPB 1ZCFA 2Q62A 1CY6A 1LKZA 2NTJA 4M9SA 3O93A 3RIYA 1ND5A 1Z15A 2AVNA 2GZ1A 1F8UA 4MUFA 1QG6A 1FSPA 3E5NA 3UJAA 2IL1A 3ZZNA 3FYDA 3B1WA 3QXXA 1G5RA 2VOEA 5M04A 4HF7A 4IUBS 4M9UA 4NPCA 1HWYA 3BWMA 5ES4B 2ODPA 2OHFA 2ZIZA 3OHSX 2GCPA 4PYJA 3ANSA 3GFFA 4O2AA 4RGQA 1W5AA 4DNFA 2GFHA 2VK2A 2F3TA 3ZW9A 5G1OA 4OP1A 2YIVX 3RM3A 1G19A 4EG7A 4CKWB 3MVEA 3EPJA 2B6NA 3ZWDA 1M74A 3WLPA 1L7BA 4ZYXA 1IZZA 1W4RA 4K1XA 3I09A 4TROA 4BX8A 5KVQA 1VRWA 3PNVA 4JCCA 2V7TA 4ERXA 5TARA 1YTUA 1K06A 4XSHA 4HRAA 1NP7A 4R81A 1KHHA 1X7DA 3U7QA 1JHPA 1RQPA 4UJ3A 4D3FA 5AVUA 1ULTA 3I6MA 3WSWA 1GUDA 3SE0A 1W36B 3GBVA 2WYVA 4B17A 5ALIA 1XZIA 4FMBB 1XZGA 3B1ZA 3TLEA 1V3UA 1YZYA 5BT9A 13PKA 2P2NA 2XRZA 1GDHA 1UPUA 4CJXA 1XTPA 4NVRA 1XWFA 4DT1A 1V4BA 3BCSA 3GJ0A 2UZIR 2Y2VA 3DNFA 2XE4A 1TW3A 1AUVA 7GPBA 4CGZA 4OK3A 1K66A 1HO3A 2Z2IA 3SSMA 3VU0A 4AX8A 5AXBA 4JP2A 1C0PA 1MV8A 2VTBA 4ME6A 5C4GB 2WUDA 4JD5A 4PO3X 5TJ9A 4N7JA 3G9TA 3A6DA 4B7XA 1KOGA 1SOWA 2C82A 3RTAA 4MQFB 2B0CA 5MGNA 4AMGA 3ANNA 3LKVA 3A4NA 3I32A 3UV6A 4RVGA 1HKUA 4OLBA 4Q3AA 2J9YB 2AE2A 4QJ5A 4AJHA 5REQA 1VSUA 3G2KA 5CXXA 1E79A 2A7XA 1A50B 1GCGA 3G0BA 1DX9A 4UHDA 5AXAA 3ANTA 5CDHA 5AO9A 1DFIA 3UGJA 3COVA 1TEXA 3AVPA 3ACDA 3IV6A 4AF8A 3UQZA 4X1YA 5FBWB 1WHTA 3OZIA 3ZXYA 1YKGA 5BSMA 4ZJYA 4AECA 1YR7A 2H1VA 1L5SA 2RBEA 3PXAA 1NWHA 3ZWAA 4I6GA 1B8VA 2OKGA 2X9VA 4N7BA 3B85A 4UASA 3R7DA 1BRMA 3HUUA 3LHDA 3AP2A 5IDXA 4HL6A 2ETXA 1P61B 3WAKA 1F51E 1G5PA 1XWWA 2EFCB 4Q00A 1U0TA 4WY8A 2J7PD 2Q3CA 3EC7A 4YP6A 2ZU6A 2X5NA 4PM4A 5E4TA 1TZKA 4AX4A 3A31A 3IP6A 1PTJC 5CA0F 3HU2A 1HNZB 2CHEA 1GCAA 3GFOA 4ZKEA 5J2TB 2BBWA 3K1ZA 3WK4A 4KYTA 5FT9A 1LUAA 5LQDA 1E18A 1T0BA 2JNWA 3BK1A 2ZUVA 3C6ZA 3DWGA 4PGAA 4RTJA 2B7LA 4KSCA 4KU4A 3HYNA 5BYJA 1BMFA 2OK7A 1DO8A 4XIGS 4D3XA 3D2CA 3FYHA 3KB8A 5IM4F 1DO0A 3UCFA 4IFEA 1JSZA 5HFNA 4PX5A 4TMKA 1ZSVA 5DTIA 3L0YA 1T6XA 2NADA 2Z5VA 3BFXA 3PPVA 4BRSA 1EXNA 2NTYC 4DTCA 4BE4A 1AXRA 1MV5A 3FDZA 2A58A 4YP0A 1OFUX 2WYHA 4IBOA 3C3YA 1T0PA 2Z3VA 3IUQA 1SBZA 3KVYA 3LX4A 2FR8A 3GVIA 4KK3A 3W5CA 5CYPA 3Q8KA 1SC6A 3CRRA 2QRKA 4U39A 2QPTA 2WKRA 3BFJA 4UAJA 2E9SA 4ZALA 4HYTA 3KBBA 3NYQA 3CH7A 1A71A 3NHJA 2KW5A 4CI9A 1O94D 2BDTA 5I8ZA 1JJAA 2O7VA 2J1LA 2VPXA 3BYZA 2BPOA 3CEPB 2WKQA 5AJVB 2FEMA 4P7KA 3SXJA 2QZ4A 2QRMA 2BMEA 1LFAA 1WMAA 1JWLA 4KKXB 1CJTC 4HLCA 4HUQB 2P6MA 2W6OA 3PU6A 4CLXA 1ZD9A 3W1VA 1H0RA 1Z2AA 4G41A 1YA4A 3IAXA 3ZZ1A 7MDHA 4CNQA 3PEEA 1JQJC 2BHSA 4UCWA 5HFJA 5TV2A 4I5IA 5JCPA 2P6UA 3NUQA 2AMFA 5KPJA 3T7RA 3NT2A 3T1VA 4CF7A 4L50A 1J42A 5I5EA 4H16A 4JQYA 2A5DA 3EH2A 4W4TA 1NASA 3ONWA 1UUFA 1P4SA 1G3MA 5CXUA 2IXDA 1YDFA 4GUDA 1EFDN 1U5AA 4F04A 1QC5B 3PNMA 4ZICA 1WSBA 1Q0PA 3QY0A 4H4EA 3T9FA 3QSYA 3KPYA 3OTIA 3O8CA 3T7KA 4M0EA 4UEWA 5GTDA 4GE0A 3HM9A 1R27A 1WF3A 4O5OA 3C3CA 3S2YA 1V4VA 1QK5A 4W5TA 5A6SA 4PC2A 2WZCA 4BASA 1XMQB 5C8YA 1PJQA 3KD3A 3OE4A 2XZOA 3IP7A 4LHYA 4B9AA 5H16A 2UXDB 2ZREA 5K0LA 1RWKA 3G2HA 5DOVA 5TRTA 4GMXA 1NBME 5FDFA 1N2GA 3DEYX 3O3MB 1E2EA 3BHIA 3EGWA 4DN6A 2BV3A 2DM6A 1LEHA 1BYUA 1H66A 2PD4A 3WK9A 3B2QA 4MVJE 4AZ3A 5IVPA 3H6KA 5IPFA 3RQSA 2ZM5A 1E63A 2A9VA 4HH0A 5J2UA 3TQIA 1HZJA 4EAAA 5GZ6A 4IV5A 1A8IA 1H23A 2AXNA 2ZBRA 1NZFA 4NYIR 4Z8XA 3ORSA 5ALLA 4P7JA 3CA8A 2WWHA 4XD2A 1GL9B 1HSOA 3M7IA 2XTZA 1K5DA 2Q21A 5EN4A 4A8JC 4BWVA 1ZK0A 1CE8A 2KSQA 2WIDA 3FRHA 1OLSB 4PFSA 5AOBA 5HTOA 5AVTA 4MUAA 5HSGA 1Z2OX 3H05A 5JAUA 1H2EA 5ALSA 3UKOA 3CYFA 2ERXA 4J7AA 3SS8A 2CFCA 2L0XA 4D4GA 4EW3A 1MW9X 4M9QA 3O8BA 2JLRA 1ZM4A 3TYXA 1I0IA 4BQQA 1KR5A 2P3QA 3I6QA 4IWNA 3C7DB 2Q7XA 3EYAA 2CFIA 1TJ3A 5G0UA 4X84A 2IH4A 4OX9Y 2NLOA 1CUDA 3DFKA 3LAWA 4AQDA 4AT1A 3U3MA 2YC2C 1WMDA 1G55A 4UD2A 1HF3A 3ZVKA 4CHGA 3DP7A 3R8XA 1R0ZA 2ATIA 1R8JA 3DOHA 5A0VA 3THWB 1E62A 4UTVA 5E9WA 3OPYB 3L6UA 4XIJA 1U98A 2QG6A 4MKXA 2KLBA 1ZKDA 2JC3A 1X7WA 4PTYA 1XE3A 1WCWA 4DDMA 5IFKA 1H9CA 2R2GA 1AIPA 4C0SA 3UAVA 1RACA 1Q0RA 3ZUPA 1ORIA 3U4QA 2VHTA 1KRWA 4BATA 2GDZA 5DM0A 1DDGA 4DV3B 5AW8A 1AZWA 3OMWA 4XEUA 3ZCRA 3AUAA 2B1RA 1OLUB 2I80A 3CQ9A 1RJWA 3NH9A 3NS7A 3OA2A 4JT8A 4KUGA 4OQMA 4OP3A 4XQ9A 4UVDA 4E4TA 4O2BA 4V1CI 1YFJA 1B8NA 2CEKA 3THYB 3H5OA 5DOZA 3UGKA 1O0SA 5HQJA 5CCXA 3KO8A 3ZCQA 2NSDA 4OO3A 3HFSA 1G8JA 1SKYB 1Z4JA 1ZMOA 3KKMA 2ZJ8A 3N1UA 1Y8RA 3SZUA 2MSWA 3K53A 2BN4A 2JJ8A 4FNMA 3GLFB 1Y9DA 2AMYA 2QN8A 2B5WA 1ZNWA 3BRWA 2NSJA 1RBZA 1U3VA 4LGMA 4REQB 5DX0A 2FPKA 1N6RA 1ZDMA 3B51X 1K97A 1L5FA 2XT6A 1NLMA 2PWAA 3I28A 2Q6TA 3A9CA 2E82A 5JJIA 1VSQA 2HXSA 3W3AA 4UTOA 2FPPA 2Z0MA 4U2EA 2PXXA 4RH3A 1ANKA 1HG0A 1N6PA 5EE1A 2G28A 5LMNB 1DCFA 2JGFA 2Y66A 4NZOA 1D3AA 2GLUA 4MIEA 1JDPA 1ZJ5A 4R9VA 3ROMA 3JALB 4B44A 4EFDA 1CEXA 3C3PA 5K05A 2Y99A 4XWWA 4BP9A 3AVXA 5JAQA 1UP6A 2FSGA 5JXWA 1HX7A 2YVAA 2A8YA 3A1UA 2DUWA 1EB9A 5JFOA 3QEBZ 3USES 5AHXA 1IEWA 2XSZD 2YQZA 1E2QA 1K4MA 5ESXA 1H6BA 2XDAA 2YN4A 3E22B 4MV1A 4RU1A 1XXHE 1UKZA 2R87A 3BX1A 3OHPA 3QVJA 4RACA 4B3IA 2X58A 3KL2A 2XQJA 3A6JA 1PZGA 5AJYA 3KBOA 2CB9A 1RZUA 1USKA 2QW8A 1GLVA 1R0LA 2PBLA 1M6EX 2X1VA 4PC1A 4R84A 3R7LA 1IXKA 3D81A 3DXXA 3H1AA 4KQCA 2I87A 1PFUA 3LP6A 5F3DA 3BMNB 2JBWA 3JASB 4PXYA 3SC4A 1P4GA 3A1EA 4URXR 4TKZA 2GNPA 3NDJA 3D0RA 3UW1A 4MI9A 2BHRA 2ZCJA 1KEEB 1NA5A 3ABQB 2AYZA 4OL9A 1N1DA 4X6UA 1E1CB 4Z9XA 1P2GA 4DCSA 4E2YA 1Y1QA 4PWZA 3WHIA 1ZL0A 2IZZA 3I9OA 2NNWB 4OATA 4MI3A 2F55A 4JBGA 3N2IA 1KDPA 4XQ0A 5TMBA 2Z04A 1JA0A 4HVCA 9LDTA 4HNSA 1E61A 621PA 1WV0A 5B4TA 2C5BA 2VNHA 1BS9A 4D3SA 1EFRD 3V2HA 4WLOA 2HSGA 4BNDB 3BPSA 3T0IA 2QAJA 1YZUA 2ORED 4W9RA 5BSTA 1S8FA 3T4XA 5SY9A 4PIPA 4UMFA 5LMZA 2IH2A 4PG7A 3RDPA 4DW8A 5TS2A 2B8WA 1LI4A 1E32A 3UH0A 3H16A 1GRNA 3I52A 3H2BA 1U0FA 3ERCA 4QUKA 3HUDA 1OHHA 1RVDA 2IYQA 3L5KA 4BP3A 2ECKA 4LY6A 4IMPA 5JPIA 4CF6A 2P79A 3P9YA 2EF0A 3PKZA 1UOPA 1VHTA 2PS0A 3CINA 4HEQA 2XCUA 4BZPA 4BRZA 1CUXA 2WU0A 4JZYA 4WA8A 1ZUNB 2B98A 4DA8A 2NSHA 1AQUA 3ZWOA 1Q1AA 3KQOA 1UMCA 4HWPA 3FCYA 2AZ4A 4R8LA 5EFOA 1CRPA 2PWYA 3WWDA 4IDEA 4MK4A 4RVNA 1NQVA 4Y1EA 1AKUA 3QNUA 4IFTA 3VKVA 1D09A 1OI4A 1ZI9A 3M6VA 3UJ3X 1I13A 4BGIA 5C1DA 4CMIB 1BROA 2BGTA 2NO4A 2W2KA 3NT4A 4B7ZA 2OENG 1AO3A 1W75A 2XIJA 3WHPA 4JI5B 1QGZA 2HR1A 2PZGA 3GRVA 3RFUA 3IB6A 4M0FA 4AMYA 2FMUA 4EBFA 1C9YA 1ZYUA 4RL4A 1B8PA 4RENA 3D2LA 4R05A 4EIWA 1MEOA 5SY6A 3KOYA 2GHIA 4EG8A 3EPRA 4YCLA 1NX6A 1TDJA 1YI0A 1X77A 4HGQA 4Q1BA 2ZFUA 5D5PA 1EJ0A 5JASA 2X0RA 4FDAA 4MVJM 2J5RA 4KOEC 3TD9A 3C6BA 3FWZA 1G0NA 3FFWA 4S3MA 1FX0A 3WAGA 3D6TB 3OZUA 2QVZX 1JJBA 5DMHA 5FFMA 2E6UX 3S8YA 4GLJA 1JIJA 1SN7A 1RWWA 4AN0A 4KQJA 4L9AA 4FBMA 4HEA6 1FXSA 2QN2A 4CTNA 2FYTA 4ER6A 3PRYA 1AGPA 1P3Y1 5FTMA 3O5AA 1ST2A 2ZWPA 1XQXA 2QLBA 5JDCA 2IDMA 3Q5DA 1TQ8A 3EXFB 1BD4A 4L7QA 1O5IA 1U3GA 2MOKA 2XLBA 5EMHA 2UZ4A 4IHQA 4A0GA 1E2PA 4ZOCA 4LJ9A 5EI5A 1YZHA 3ND7A 1RI4A 1VMKA 1I2DA 2I66A 2JAWA 4LRYA 2XDYA 3N28A 4UXJA 2LDBA 1FTYA 5GJBA 4YP7A 1YI1A 2OCIA 3X1YA 4HJRA 2JIPA 5AQEA 4EA8A 1W2WB 4BVJA 2GO7A 2HU8A 3RFFA 4INOA 1P9OA 2JEZA 4LGCA 4PSAA 5CX1A 3DH0A 3WP1B 2ZJBA 2ZIAA 3NGXA 4DSNA 3GEBA 3SZRA 4X90A 3MOIA 1IRIA 4O1HA 1KDZA 3LHIA 3ABRB 3LECA 3K35A 3LBFA 4M1SA 4LJAA 5I4BA 5JHHB 2R4TA 1J4AA 5AVZA 1F0NA 4Q16A 3UNXA 1TQ2A 1O87A 1A5AB 1R15A 2ZI7A 2YHSA 1M2EA 3LFUA 2I3AA 2W83A 5FHQA 1U81A 3ZVLA 1SBQA 1LBQA 4UDYX 4QG3A 4GFDA 4JLJA 2EWMA 5ALWA 3J81k 3PHHA 1XEAA 1CIVA 2YXEA 3UAWA 5KBYA 2VAVA 3B6MA 5BSUA 1XAGA 5SICE 2ZTSA 1NW6A 2DGDA 3TQTA 3U3KA 4V0LA 2F8MA 1IWPB 2X6RA 2XODA 1NI4B 2RBKA 3D6FA 2UVPB 2V7EA 5HYVA 3WFIA 3KQKA 4E13A 4ZEMA 3NHAA 3QWFA 3W5BA 1PYDA 4RF3A 3V7WA 2NZVG 2W6JD 2D13A 2E4XA 3VR4D 4RULA 3DBVO 1X80B 1J0CA 1LPAB 1POXA 2DC1A 3X3HA 3TDNA 4BZQA 1XA0A 4MDEA 4TMYA 3SF8B 2EKDA 4UTNA 3LQ4A 1ZW6A 4AMVA 3IT2A 1NOKA 1PJ8A 4QRHA 1RXEA 3HY6A 1LV8A 3ADDA 3AERB 3KKLA 3WA7A 2V98A 3C39A 3LPLA 2C2GA 2CN1A 2R79A 2H11A 1L4HA 3RF7A 1BWQA 2WM9B 4C78A 1KZ6A 4Z1OA 3I04A 4FJ1A 4R2LA 5DTMA 3V3TA 4U0JA 5DO9A 1F4LA 4IICA 4HRXA 4PSVA 4QDOA 3RAPR 1YS2X 1H94A 2Y92A 5KYGA 2ZRJA 1QCCA 4LJ7A 3SZMA 5JECA 4FHFA 2Y2UA 3K9LA 4B3HA 5EE9A 3G5LA 1YRAA 4W9MC 1T5TA 2IEBA 1GGKA 2DHEA 4MRNA 1W88B 4WKGA 3GLRA 1COZA 2CVHA 2GQ0A 1F17A 3AWIA 3M6LA 3OQOA 5JY1A 2PJRA 2OCBA 1L6IA 4MR8B 1OWLA 4BNGA 4CI0B 4ZMBA 1A72A 3FF1A 4G86A 5TJHA 1XO1A 2CXXA 2H3EA 3QNMA 4L15A 2QORA 4ZHQF 5EPOA 1O57A 3UJ7A 1DAGA 5JVDB 3W5IA 4YMUA 1DT5A 1ST3A 1ZNZA 4O4IA 1O6FA 1Y3FE 2P90A 3HADA 3I9LA 3PDIA 5LU9A 1NBOA 3R3YA 3AQIA 1L1QA 2VYVD 2IITA 1E4YA 3ZJTA 3P0EA 3G85A 4XYEA 4OQ4A 3TB4A 1WBDA 3HJTA 3GJZA 5JSYA 3TG2A 3DNPA 1U8TA 3BIFA 3K2QA 3HO6A 4YNBA 4HC4A 4EG3A 2RGCA 5IJWA 2ECOA 3DOCA 3I8OA 1LC0A 4WAUA 3BXZA 2GBGA 5KYNA 1PLLA 5IBQA 1Y89A 1PFKA 1Y6JA 1GZ5A 2FUNB 2W2MA 3AB7A 4K3VA 4M0LA 4MH0R 1IPFA 4RD3A 3VR3A 1Y9JA 3ZHTA 5KHOC 3O2SB 4A0RA 4O4JF 1XVVA 1L5MA 1YQGA 3M6UA 4S1OA 1V4NA 1UK8A 2BFDA 2I8CA 3GBPA 3V8RA 2HMWA 3LCJA 3HCPA 3EXHB 4HP8A 4YPVA 2B4KA 3K9BA 4RC9A 1H4QA 4X44A 2PEYA 1O5TA 2F64A 3LA6A 5JBIA 2PRKA 4YAIA 3GUHA 1Y3BE 4KAAA 5I9IA 5JROA 4DMRA 3DP9A 1T8RA 4MS4A 1Z5UA 4NBRA 3U49A 3TMYA 4J1QA 3QP9A 1GA6A 4C0BA 1X70A 3LT5A 4K9DA 4TMTA 3ROPA 3OIWA 4TVOA 1M7BA 3KYDB 4BCCA 2YIDA 3KHTA 5A5GA 1HE4A 5ITZB 5JNUA 2BR4A 3TZ6A 1WG8A 3TSYA 3FIUA 4HTAA 1CJMA 1H8EA 1MT3A 3PKIA 4Y2VA 1V1RB 2C2OA 4KNVA 2VF2A 4B6PA 5BUSA 4EEKA 5TPWB 4I55B 4PXSA 2XOKA 3UCXA 3IEVA 3HBMA 2WOOA 1VXRA 4ZO9A 5F23A 4DJAA 3KJEA 3WC4A 4TLAA 3EG9A 4HGOA 1L3IA 3TD2A 1RC1A 1D5WA 3LC0A 1XEFA 1OVMA 3E61A 4HS9A 5AKZA 3RIGA 5C2JB 1ZFNA 4WJKB 3FDJA 4IFBA 1T4DA 1HE2A 1WP9A 4D0NA 1P2DA 1ZGHA 1EG2A 1MO2A 4QDJA 1RNLA 1E96A 2PRZA 5BW8A 4QFMA 1Z0KA 1TT7A 5EPEA 3TGWA 2AE1A 2QMOA 1M9NA 3DVQX 3U6BA 1Y4SA 4ALJA 2IY7A 1XCJA 1ML4A 2GZMA 4KFTA 1M54A 1U3WA 3QLVC 2B25A 4M9ZA 4PRZA 4LA4A 4TQ9A 4CL3A 2PUBA 4ZODA 2PXHA 2Q3BA 4B3MB 4JJKA 2FZCA 5KSZA 4GOOD 4FYYA 3ACBA 1RXUA 3FNHA 3WHKA 2W2TA 2CF6A 2EBFX 1YC2A 2B30A 4KDEA 4B7CA 2Y1LA 4GPD1 3VOSA 1SQFA 4TQGA 1H2FA 1VZ3A 1XCGB 4JLAA 2QSUA 3A37A 3OJCA 4G0NA 2BP7A 3IFSA 3DEJA 1B6GA 4XASA 4JGGA 5IDVA 2RGNA 3KAPA 3DYBA 5G2OA 4IL5A 4II3A 5KNDA 2FX2A 4CIXA 2QU8A 5DW0A