1KVTA

Udp-galactose 4-epimerase complexed with udp-phenol
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSVATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Molecular structures of the S124A, S124T, and S124V site-directed mutants of UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 129
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kvtA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kvtA01
3KBOA 4W9NC 2UUPA 1IULA 5A1TA 5AQ1A 4ND1A 5DCUA 4IQ8A 4B4UA 4PIVA 1DRVA 3L77A 5L7WA 3HDYA 3JQ8A 3WR5A 5TC4A 1ONOA 5JS6A 1VE9A 1BDBA 2FR8A 3K6JA 4FOSA 3K9QO 3Q9UA 3M6IA 4ZD6A 1BSVA 3H5RA 3PI7A 5EN4A 4J2HA 2AQKA 4XJTA 4BQPA 1CQIA 1H93A 1HTBA 2DVMA 3IC5A 4PRLA 1O8CA 3VZPA 1CQJA 1PJLA 4IS2A 1DO8A 1MX3A 1F8FA 3GVIA 1R0SA 3DO5A 2FP4A 4NR0A 4PVCA 1NPDA 2EKPA 1PU2A 2BFOA 2C07A 2R2GA 3R3SA 4GX1A 3UUWA 1EFLA 1XELA 1QSGA 2BF7A 3QVSA 1T25A 1UAGA 1KY4A 2BFMA 1E7WA 3H8VA 4TRJA 2NU7A 3UAGA 1PJSA 1YRLA 4A27A 4NH4A 3MJEA 2JJYA 5F5NA 3G0OA 8LDHA 4YAJA 4ALMA 1Q0HA 4XQCA 1H2HA 4UULA 2EGHA 4WCFA 3DBHB 3D3WB 4ZQBA 3O4RA 2GZ3A 3H2ZA 2CF5A 1TLTA 4IS3A 3RIHA 3CINA 3H2SA 3E5MA 3GNQA 3I3OA 3DZIA 2JL1A 3ASUA 1EDOA 4XRGA 4ILKA 1FJHA 4C7JA 2IEDA 1ULSA 1I24A 2ZQYA 4IIVA 3S8MA 5JY6A 1NQOA 1C1XA 5FEUA 1Z7BA 3CXRA 4JP3A 3VPXA 3T4XA 4PVDA 2YDXA 3ADOA 1U3WA 3V2HA 5JC8A 1UAYA 5A9SB 2PGLA 1X1TA 4NMHA 1E92A 3AU9A 1Z82A 1XYGA 3NDIA 2Y66A 3A9WA 3CSDA 1ZUD1 3P19A 5EQFA 4DBZA 2IEBA 1I01A 1DIBA 4XIYA 4DC0A 3DZKA 1WNTA 3B70A 1NVTA 3RC1A 3JD1A 5JNLA 1SZJG 3O8QB 1PR9A 3OMLA 3TOXA 5IG2A 5MGBA 1R4NA 4I8XA 1H9AA 5FI5A 3E5RA 5AXDA 3MOIA 4HADA 4CQLB 3KV3O 1TEHA 2BFAA 3QWFA 5B4TA 3NX4A 4IY1A 2FR0A 1O0SA 4MP6A 4MVJH 1ZMOA 3TZQA 4BO2A 4CMIB 4CMCA 1A72A 4URFA 2Y05A 3E1KA 4CM8A 3X2EA 1NWCA 1YKFA 2PWZA 1WWKA 1D1SA 1FDWA 3BHJA 5JY1A 5L95A 3S1LA 2D4AA 4L0QA 4YAEA 1F0YA 1DB3A 1A5ZA 4AG3A 2WYVA 2WJPA 5G0UA 2YHIB 1WZEA 1WDKA 3WNQA 2AQIA 3UH1A 3VDQA 2FPPA 3JQ9A 1Q2XA 3LK7A 4LCJA 2D8AA 4ZQHA 2DQ4A 4G81A 2GASA 4OQZA 5CPBA 1JWAB 3RBXA 3PWKA 4BMVA 2OHXA 1ISJA 1I2BA 2YQ4A 3WGIA 1PQWA 1X7GA 3WYBA 1G6KA 4XB2A 1R16A 1E1MA 3IQDB 3GLQA 2VUSA 2RBEA 2GN8A 2VOEA 2GZ2A 5EMHA 2I6TA 1PWZA 1X7HA 2OFPA 3U4IA 5JXWA 4CM1A 4QSMA 3GQVA 2J3IA 4ALLA 3DAGA 1U9JA 3DMYA 4FSHA 1LQUA 5DCYA 1HSOA 4B3IA 4JK3A 1EBUA 4DMLA 3WMWA 2DBZA 4MP3A 2ZIZA 5AVOA 5IN5A 1D4FA 3SBOA 4E2XA 2WE7A 2WD7B 3CPSA 1Y8QB 1UH5A 3HFSA 1NQAO 1R6DA 1BWSA 2EP5A 3JD0A 5DCWA 1U1IA 4N5NA 5H81A 3LC1O 2C7GA 4X54A 5ENVA 4NU6A 1E5QA 4PLHA 4OOFA 4JJGA 4YT5A 4BGEA 1UXIA 4CR7A 3K30A 2EJVA 4EUHA 4DGSA 3EK2A 4HNHA 2X9GA 2X9NA 3QY9A 2J6IA 3HFGA 4K1LA 3JYPA 1UDCA 3PYLA 1EUZA 3ZHZA 4IIUA 3SXPA 3G79A 2G76A 2UDPA 4WASA 5G0SA 1SAYA 1KVRA 2XPCA 2I5PO 1I3MA 1PJTA 1U8FO 4FFLA 2FPGA 5KVQA 3JQCA 1T4DA 1K5HA 4BB6A 4CMGA 2XF8A 3BXXA 1DAPA 3DFUA 3TOZA 5BNTA 4ZRNA 3ZWOA 2GLXA 5CEFA 1YB5A 3PTZA 3TL2A 3GOHA 3MWEB 3HWRA 1E6WA 1BTOA 4L75A 1R4MA 1ZJYA 2GERA 1HYGA 3V1UA 3HE3A 3ZV4A 5IXYA 4YJHA 2AEMA 2VYVD 3LYLA 5T8KA 4FIZA 5COQA 4G2NA 3CUKA 1HF3A 4UUOA 1TT5A 4PLCA 1QYDA 2HK9A 3D0OA 4GQAA 4RVGA 1DLIA 4XR4A 4LRSB 3WYEA 4NPCA 3BMOB 4LSMA 2NNLD 2WSBA 1CYDA 3RWBA 1HE3A 1XA0A 2O3SA 1PJBA 1N92A 3HB4X 4P8RA 4XDYA 3IMFA 2AE1A 1UXJA 1ID1A 1Z6ZA 1O89A 2JAHA 3QQPA 4C7KA 1JDJA 2Y1GA 2CFCA 3ZHBA 3WQQA 3K73O 3P2OA 4G5HA 4XGNA 1RYDA 1ZKMA 2IRWA 3FD8A 4QO7A 4CLEA 1A4UA 2YV1A 4DPLA 1VJ0A 4CLRA 1YDEA 2NTVA 1K89A 4PFJA 5AXAA 3WS7A 1L7DA 4YQZA 2RH8A 3LQFA 4D45A 1T2FA 4GPD1 3K2BA 4R54A 4EGFA 1GAEO 2I3AA 2VHWA 4BNNA 1YS4A 4ZQEA 2Q50A 3EVNA 4P38A 4CUZA 1Y6JA 2VT2A 5A03A 1N8KA 3MJSA 3FBTA 1Q0QA 1Z73A 2BRUA 3ZNPA 2O3JA 2Y67A 5DNAA 4BNKA 1DIHA 2GYYA 1SNYA 1YJ8A 2CY0A 3JCZA 3PYMA 2Y1EA 4RVFA 1CEQA 2YDYA 1E3EA 4YVFA 1OC4A 3OH8A 3RC9A 3UF0A 3W8DA 3JQ8B 4E31A 3BMQA 4BNXA 3OF2A 2HAEA 3F4LA 3GRPA 1MV8A 3LSYA 1XQ1A 1ZK1A 3DTYA 3IAHA 1U3TA 1M66A 3U3XA 2E48A 4Z0TA 3WJ7A 1WAMA 5DBGA 1RJWA 3GFGA 4FN4A 4QO8A 1CIVA 5JBIA 3PDUA 3F5SA 3ROPA 2UVDA 3WLFA 4CM4A 1SO8A 3QVOA 3GNSA 1UZLA 4CQMD 5HS4A 1HEUA 1F17A 3I9OA 3ULKA 1E1NA 3PPIA 4A73A 2B5VA 3GFBA 4L4SA 4RJTA 2QIOA 3GEGA 3ON5A 2CF6A 1JN0A 2NLOA 4I5GA 5GZ1A 3ABIA 1EK6A 5JMPA 4CMJA 2AEJA 4R3WA 3UCEA 1PQPA 4WCFB 4D3FA 4Z6KA 1HT0A 1V8BA 2P2SA 1F06A 2PR2A 3C7CB 1KEWA 1DHRA 3MTGA 2HMVA 4GH5A 1HE4A 4BKRA 2D5AA 1DRUA 4MO2A 4R5HA 4EJ0A 3C1AA 3MTJA 5HBRA 4MIOA 4NK4A 2BFPA 2D3TA 3BTVA 2ZQZA 4DWVA 1DDOA 2AW5A 1UDAA 4RLHA 2BI7A 1C1XB 1UP4A 4QFCA 5HRUA 2PA3A 1E7RA 1CERA 2HMWA 3IOYA 4EUEA 1SOWA 1XIVA 3DZGA 4XQEA 4CL8A 5A4DA 3QW2A 3SJUA 4E21A 1AHHA 2GSDA 5JDCA 1QYVA 5DDIP 4I9NA 2C0CA 3PIIA 3I4CA 1GU7A 1QRRA 3GVCA 4OSOA 3V8BA 1N9GA 3LZ6A 4IDEA 1Y81A 5EPOA 1KVSA 1S7CA 4D7AA 3AWDA 3NTOA 3OQ6A 5I8WA 4ZU3A 1GL3A 1KERA 3DZHA 2GD1O 1ZXLA 1EBFA 4YBZA 5I9NA 4PRKA 1YH3A 3KOUA 4RGBA 4I5EA 1R4NB 3RQSA 4D0RA 4AJLA 2EEZA 5IFLA 3KHUA 3PYXA 1IPFA 5A05A 3AM5A 4B4VA 4NJOA 3FI9A 1HDXA 5C7LO 3ICPA 3KB6A 4RPHA 2RCYA 3CH6A 4PLYA 2X5OA 4AJEA 5A5EA 1P9LA 1H6BA 3UFXA 2XXBA 5A9SA 2WDZA 4CM8B 1E5LA 3FWZA 4GL4A 3QWHA 1NPYA 5COBA 1I3LA 5FI3A 1HRDA 4ZN6A 1N5DA 1TXGA 5KJEA 2FWMX 2IYOA 3LVFO 2PKQO 3KYDB 3OBBA 1N2SA 1GEEA 4LISA 4DREA 1Y5MA 1UXKA 1B26A 4CM5A 1DC3A 1M2WA 4XDZA 2RH4A 4YXFA 3UKOA 4PN3A 5IDXA 4FFPA 6LDHA 4HBGA 4ZA2A 3GRKA 3RBZA 4EYEA 4XZ3A 2BMAA 3FR8A 3F4BA 4HKTA 1N7GA 3C1TA 4W7HA 3EYWA 3WFJA 3QA9A 2VHVA 2IODA 1X0XA 4N5MA 3PZBA 1H6DA 5TRTA 3EZLA 1JAXA 3GVHA 2VWPA 2W4QA 3AOEA 4I1IA 4YAIA 2JD1A 3OJLA 1DSSG 3HG7A 3GAFA 5ICMA 4PLVA 4RO0A 3OIDA 3FN4A 2VRBA 3HN7A 5G4LA 3B6ZA 4IUYA 3T4EA 3JD4A 4JCOA 1DFIA 4JROA 1WVGA 3MJ4A 3RD5A 3ZV5A 3WGHA 5G4KA 1I2ZA 3ZU5A 4MIYA 3C24A 3PLRA 4NBWA 1AHIA 3WX0A 2GN4A 4XD2A 1LQTA 3D4PA 4HNGA 4OXKA 3MCVA 4M49A 2NM0A 3FF4A 2OO5A 1H5QA 3GH3A 4I5DA 4Y6SA 4FB5A 4UVDA 4E5PA 2E6UX 4KTTE 4DQXA 4E2ZA 1EDZA 1R37A 5I8ZA 1KC3A 5F1PA 2AG5A 1M6WA 1IUKA 1ZK0A 3KO8A 2ZJ1A 3ZV6A 3GGGA 3ETEA 4N7RA 4E2WA 3TWOA 1YGYA 4HFRA 1DXYA 1VM6A 3PGJA 4E33A 1FMCA 2V6MA 4B7UA 1G0NA 1ZO8A 3A06A 4W6ZA 4E13A 3RU9A 3WDSA 3IP3A 3ZI0A 1LDYA 3JQ6A 4XR9A 2HCTA 3DZBA 4ZRMA 2BGMA 3GDOA 2O4CA 3STHA 3HNPA 4DIBA 1NFQA 4ZICA 4NG5A 3E48A 1LTHR 5G0WA 5GY7A 1NHWA 2QRKA 1GPDG 1GCUA 3BMCA 2VOJA 2QQ5A 5BSEA 3QWBA 4Q3AA 2VYNA 4IJKA 3VDRA 3OJ0A 2YHUA 1ZEJA 4C4OA 3ENNA 3WSVA 2VWQA 4J9VA 4EUFA 1MG5A 1Y9AA 1PQUA 3RBVA 1R4MB 2YZ7A 3L4SO 5BNIA 1KC1A 2VTDA 6ADHA 4YJHB 3VAZA 2O23A 2NVUA 2QYTA 4E32A 4PG4A 5AOVA 3RUEA 3FBGA 1NVGA 4DIFA 1EFKA 2F00A 1YOVA 2OORA 2Z95A 3E18A 2Q2VA 4BO0A 3PDJA 1DC6A 1B8PA 1LC3A 1TT5B 4Y8VA 3RUDA 4BNVA 4OL9A 1TI7A 1ZXBA 3TJRA 1C0LA 3ASVA 2ZB4A 2DKNA 3Q0EA 2E82A 4K28A 4R3NA 3GHHA 1OMOA 3V1YA 2Z5LA 1T24A 3AFNA 1NFRA 1U7HA 3OQBA 2NVBA 5TJHA 4EITA 2E4AA 1X14A 4ND4A 4Z9FA 3ICCA 1OZAA 4R16A 1VLLA 4EI2A 1MB4A 4GKVA 2ET6A 2H1SA 2EERA 1HSZA 2H5LA 2D5CA 4MINA 3ZWXA 4CLRB 1JQBA 4ZQGA 1W0CA 4YRAA 1ZVMA 3IJRA 3JQ7A 1PJ2A 3F1KA 3VH1A 1LSSA 3MJVA 3L07A 1SCUA 4FC7A 4G65A 3LC7O 4RF2A 3IKTA 4YA6A 1I33A 3ZCXA 4KWIA 1JW9B 1F14A 2EW8A 2QHXA 3K92A 3ZV3A 1E0DA 3BMNA 3QP9A 4F46A 4YAKA 3VVBA 2B36A 4R1TA 3U49A 5JO0A 2CVZA 2GF2A 4MJLA 4WJZA 2ZK7A 3WYCA 4H7PA 3RFXA 1LXCA 4A26A 3TFOA 3RU7A 4WGGA 3V5NA 1J0XO 4MVJP 3BMQB 4AJ4A 1HLDA 1FDSA 3FTNA 3DR3A 5CHEA 1DLJA 3U0BA 4J1TA 3R3JA 1HLPA 4JBHA 5LDHA 1B3RA 5L9AA 3P2YA 4PG5A 1HL3A 1UJMA 2EW2A 1QG6A 1LLUA 1ZSYA 2W2LD 1NR1A 4PLGA 5JCXA 1LDNA 1FK8A 4BNTA 3P5SA 4CM4B 4GMFA 2JFFA 1E6EA 5GMOA 4CMAA 2X0NA 1XSEA 4CUKA 1TVEA 1W4ZA 4IXTA 4R1NA 5FWNA 3B1KA 3UOGA 3ORFA 4HP8A 1GV0A 3RUCA 3QLJA 1BXKA 3F3SA 1LLQA 5DBFA 1NP3A 4E6PA 3OICA 4XGKA 1LRJA 4FCCA 4J0EA 1R15A 2JCXA 1U2DA 1X15A 5KJFA 1HDCA 4R41A 4WLUA 2VYVA 5DP2A 1Y9EA 4CV1A 4J49A 1EVIA 3U4HA 4LCEA 2NQTA 4R68A 3NJ4A 4IDDA 3TSCA 3IS3A 5B1YA 1ENOA 3ZWWA 4E5KA 3TL3A 2QX7A 2Z1NA 3UGKA 3ZW8A 2VHZA 4EEXA 1X1EA 1I2CA 3K5PA 5AXBA 2PTGA 1DBVO 4RF3A 4TVOA 3OJFA 3DMTC 3DHYA 2X5KO 4RPJA 1HDYA 3TZHA 3ZNNA 4CM7A 4OIMA 3EUWA 2QYSA 3GUYA 3SX2A 5L4LA 4H3VA 2A9FA 3G1UA 1CWUA 3OHSX 3O03A 2D2IA 1KETA 1XHLA 4YAGA 4QQRA 1E3IA 3W4IA 5KVVA 4D46A 2PZKA 4JIGA 4ITUA 3PHJA 2HDHA 1T1SA 4GGOA 4XYEA 1ZJZA 2IXBA 1XCBA 1N9GB 4FD3A 4BO5A 1WMAA 3AUUA 5EJ2A 5BNFA 4ESOA 3TF5A 3VZQA 1T2EA 2CMDA 2B5WA 5B12A 1P1RA 4IDCA 4K6FA 4BL5A 4CMEC 4BNYA 1EQ2A 1SPXA 1WW8A 1E1KA 3DZFA 4KUHA 3BTUA 2O48X 4UVHA 1KYQA 1E7YA 2WYWA 3VTZA 1MXHA 4PZDA 1NPTO 4J16A 1ARZA 3BZUA 4RDIA 2VQ3A 1VI2A 3PLNA 3VTFA 5BQFA 2Q45A 1OC2A 1A7KA 4LMPA 4NU5A 2A4KA 3K31A 4R4JA 1PIWA 3INGA 3PEFA 5JDIC 1T2AA 1ZK2A 3QRWA 4CR6A 1PZFA 3ST7A 4TKMA 2DFDA 3E9MA 1H6AA 3I83A 4J91A 4RPGA 4O1MA 4YEDA 4CQMA 5JYDA 2PD6A 3C7AA 1OFGA 2CDCA 4ROSA 2B35A 3L4BC 1LSUA 5ADHA 1WMBA 4W4TA 4DA9A 1QMGA 3IUSA 4ALJA 1GV1A 2RHRA 5K6AC 4FFRA 3GZ4A 4FJ0A 4E2YA 3X2FA 1NX6A 3QVTA 1U7TA 5JSFA 1I30A 2GR9A 1QYCA 2X5JO 4EEZA 3DFZA 2Q1UA 1I10A 3P7MA 2GRAA 2HK8A 2HO5A 1YONA 4I9UA 4A0SA 4BO8A 2VYND 3BTSA 2EKQA 4TWRA 2AXQA 2O2YA 1ENPA 3JQFA 4S3MA 4UREA 3KYDA 4DUPA 1YWGO 1EE9A 4P4GA 1JU9A 1B15A 2OL4A 5F5LA 3DZJA 1Q7GA 5G4KB 3ZWMA 2ZB8A 4IINA 4MOWA 3RVDA 1HKUA 1PL6A 1PR3A 2DFVA 3HSKA 2C5EA 4LGVA 4YRBA 3WOHA 2YUTA 2FN7A 1KVQA 3G3EA 2P4HX 4MKRA 4MVJI 5T67A 3QV1A 1EUDA 4BNGA 4FGSA 1K2WA 2GGSA 3SLKA 4F6CA 5ILOA 1Y1PA 1HXHA 2B4RO 2ZTMA 3LC2O 4DIOA 4HUJA 2FY8A 1EK5A 3H3JA 3JV7A 5L53A 2A35A 2PKRA 3FR7A 1GZ3A 3E9NA 3DC2A 4BO4A 2C54A 1PX0A 3TZCA 1GUFA 1U3UA 4DXHA 3GHYA 4M87A 4OO3A 4YJFA 3S2GA 4KQWA 1GDHA 1U2GA 2NU6A 4AJJA 3O38A 1P1JA 2R6JA 1DC5A 5BR7A 4WUVA 1YL7A 3LLSA 2HMSA 3E8XA 1O94A 4ZVVA 4D42A 4KDFA 5EL0A 2J3JA 1MLDA 3KM0A 2C7VA 4AJKA 4U7WA 4O5OA 5A04A 1YDWA 2O3RA 2VHYA 5IXSA 2O7QA 3BMCB 4D79A 4BO7A 2CVQA 4ZHSA 4CM9D 4PZCA 1XWFA 4QTZA 1LDEA 4DYVA 1AXGA 4XCVA 3UXYA 2EGGA 4BNWA 3ZWAA 3OFSA 1PGOA 1UUFA 5IZCA 1GQ2A 2NVUB 3NRCA 4PZEA 1A71A 2X58A 4A2CA 2ZYGA 4ZQFA 4B8WA 3WWZA 1PTJA 1YOVB 1DJNA 3PGXA 3FRJA 3OA0A 1O5IA 5L4NA 2DPHA 1X0VA 3N74A 1K3TA 3JQAA 2BELA 3RC7A 4DQUA 1Z75A 2HK7A 1OI7A 5G2OA 1JKJA 1FXSA 3HDJA 3PRJA 4BNLA 4M86A 5ICSA 1TA4A 4CL3A 5C7OO 3KLPX 3QWIA 4CLXA 3Q2IA 3NAQA 4MVJF 3VH3A 4D0SA 3UHAA 1PGNA 4J90A 4RZIA 2VCYA 3PFWO 2FSSA 5THKA 2OUIA 3H65A 4W99A 3ZHXA 1LDGA 1ENYA 1LSJA 3DOOA 3VOSA 3ZNOA 3CZRA 3AFMA 1B3BA 3DDNA 1K0UA 3VZSA 2BD0A 3JQ7B 5DBIA 3EVTA 3L9XA 3ANNA 3I9LA 4NK5A 5KKCA 1JVBA 3ITDA 3QE3A 4B3HA 4DPMA 4OM8A 2HU2A 2IXAA 4F3YA 3AUTA 1RM3A 1BXGA 1UP7A 2HUNA 2WTBA 2IDZA 5DT9A 3T7EA 4U0JA 2CUKA 4UUNA 2VRCD 3BMNB 1AXEA 1XG5A 2F1KA 4GKBA 4Z9XA 3EZYA 2DTXA 3EHEA 3JYQA 4XJSA 2OXIA 2X6TA 1RM5A 5KJ6A 2CVOA 5U1PA 4KP7A 1WLYA 5ER6A 3CE6A 1CJCA 2DAPA 1BRMA 4F6LA 1VC2A 1D7OA 4NJMA 1FDUA 4JNKA 3PQDA 5K0ZA 2YYYA 3LF2A 4CJXA 4AJIA 5CEEA 4K9DA 1GZ4A 4K6CA 3D5TA 3AY3A 1B8VA 1DIAA 4XYMA 4EW6A 2GCGA 1J6UA 2E37A 3G17A 1ZSVA 2G1UA 3ROMA 4YRDA 4GMGA 7MDHA 2WMDA 1XDWA 3OJEA 2P68A 4QXMA 5CEJA 1YB1A 3BTOA 3HN2A 3KSUA 3LLVA 4AICA 3ZW9A 5DN9A 3TN7A 1QV7A 2H63A 2X9VA 3H9UA 4J9UE 4DVJA 4E3ZA 1I3NA 4E30A 1YQXA 3WB9A 3ANLA 3V2GA 2PFGA 1NQTA 3O9ZA 2HMTA 4RDHA 3ITKA 2DT5A 4L8VA 1LA2A 4Q3CA 4J7UA 1ISIA 1GQQA 1CF2O 5B4UA 5A06A 3JQ9C 1SOVA 2JCVA 4WLNA 2DBRA 3A4VA 2P91A 4NFSA 3D5QA 4MPDA 4NHEA 2QZ9A 3JQDA 2TMGA 2X1HA 3PHLA 2WEKA 4CLOA 4AJ2A 3AI2A 1ONNA 1PJ4A 1HDZA 4AJ1A 2DUUA 2DBVO 2X0RA 1DOHA 3PQFA 5BT9A 3WGOA 2DM6A 3JQBC 1DIRA 2VHXA 4IZHA 3BA1A 3ENKA 3I5MA 3DHNA 2C2XA 1HYEA 4BNIA 1A27A 1JKFA 4OXNA 5B37A 2ZB7A 3ROQA 2UYYA 3WGYA 1X13A 4XA8A 2Y1DA 3V2UA 4YTEA 5TT0A 5HA5A 1DJQA 4H15A 2JAPA 4TMFA 5THQA 4GLLA 4AJOA 2P9GA 5TT1A 1LLDA 1PZEA 2PZMA 3I1JA 4TRNA 2HQ1A 4TKLA 4FPXA 4XIJA 3EDMA 3RAJA 2OP0A 3D4NA 1UP6A 5I7VA 3FNEA 1ZMTA 5GZ3A 2AQHA 5F1KA 1XEAA 1ISHA 1KOLA 3NDJA 4WLEA 1HYHA 5EQDA 3WSWA 1MGOA 2JD0A 1Y5RA 2NADA 4OGWA 1IPEA 4E12A 5KOIA 1H9BA 3SC6A 4R1UA 5JAZA 1J5PA 1MFPA 2NV6A 3C3XA 1KBZA 2FR1A 3WG9A 4BMSA 2W2LA 4GSLA 2YW9A 1O95A 3K2EA 1B2LA 4ZJUA 2J8ZA 1NR7A 3H9JA 4NBRA 4WCDA 4XYLA 4J2OA 3WMXA 3ETGA 3PQEA 2VTEA 4CMHA 4CQMB 4CV0A 1K6IA 3GF4A 2BI8A 4MIEA 4IGEA 1H0KA 4E5YA 4IDFA 2EWMA 1WP4A 3SLGA 4B4OA 1BGVA 1UR5A 2I67A 3ANMA 2C59A 3H9QA 3PHGA 2SCUA 3Q2KA 3WBFA 3VKVA 4BO6A 1UXGA 1LDMA 3AI1A 3H5AA 4CV3A 3GGPA 4DMMA 2RIRA 3OIFA 1PJQA 2PH3A 2VNSA 1C14A 1CRWG 3GZNA 4AJPA 1PGJA 3TQHA 2ZB3A 3ROKA 1VL0A 4D3DA 4MDHA 1N1GA 5LDGA 3M1LA 4BNJA 1KEVA 2Y68A 1NWHA 2DU8A 5T8KC 1QLHA 1EEHA 1GR0A 1L1FA 1NNUA 4GWGA 1I0ZA 1P44A 1LLCA 1X7DA 2A92A 1QYWA 3AY7A 2EIHA 1ZW1A 4WKGA 2ZKLA 4XYBA 5I7EA 5JC1A 5F21A 3INRA 4EBFA 3I9NA 3OM9A 2CSUA 3VC7A 2XOXA 3MJCA 2D1YA 4S1VA 3BHMA 2FRDA 3RUFA 3SJ7A 5IDYA 3JQAD 2Y99A 5TLSA 3FPCA 1JKIA 3I52A 4W82A 4TZKA 1GQYA 4PLPA 2Q1TA 1KVTA 3HDQA 3QVWA 3RUHA 4UVGA 4BNZA 4R9RA 4TSKA 3EW7A 3H9GA 3INTA 5TIIA 3W4KA 1B16A 4YJFB 3ADPA 4DRYA 7ADHA 4BKOA 3U9LA 1AN9A 1H6CA 1Q1NA 2B4QA 1JA9A 4HX5A 3OEWA 4RV9A 1EVZA 2X7HA 1HETA 4BGVA 1GY8A 3O26A 5A9TA 1G1AA 1K6XA 3RASA 3S2IA 4KDEA 4YPOA 3F47A 3CEAA 3MOGA 3R1IA 4RCVA 4FQ8A 1WDLA 4DL9A 1EVYA 4M89A 4M8SA 1P1FA 3ZDFA 2PD4A 4W9NA 2DLDA 4MVJM 3TNLA 4XKJA 4YJDA 3CMMA 2PY6A 1K6JA 4RF4A 4BHTA 4YT8A 5TSDA 2B69A 2WE8A 4CV2A 4ZGWA 2WWRA 4IDBA 2IZ1A 1IHXA 1T26A 1HDRA 1N1EA 2AHRA 2JD2A 4GWKA 4TZTA 4UUPA 1P74A 2Q99A 3KETA 1UZMA 3B20A 3Q6IA 3JQGA 4WLFA 1L7EA 1PWXA 3DMTA 4IPTA 5CAEA 3NTQA 3JQAB 4GVLA 4NBTA 1P1HA 3FHLA 5FF9A 2LDBA 1FF9A 1S6YA 1M6HA 1P1KA 4ID9A 3WTCA 3HADA 3JD3A 3WLEA 2J3HA 5A5FA 5ER9A 5DZSA 4ALIA 1LI4A 1NASA 4RPKA 1Q0LA 2V7PA 1DAOA 5EESA 4U6SA 2H9IA 3PFFA 3C7DB 4BKUA 4XRRA 1UZNA 4JXKA 1D8AA 3GDFA 2VZ0A 1C0KA 1VSVA 2C5AA 1KS9A 3IKVA 4XYGA 3VH2A 3RI3A 2NUAA 1LRLA 1QV6A 3OJOA 4R01A 4Y6PA 2C20A 2GO1A 2P5YA 4BKQA 2QRJA 1U3VA 4CMEA 3KTDA 3D64A 2HSDA 5HWSA 3LU1A 5ITWA 1OAAA 4NBUA 1BXGB 3GUCA 5T5QA 1EUCA 3HJAA 4IJWA 3EMKA 1IZ0A 3TZKA 4BNMA 1LX6A 3H9EO 3PIDA 4WOKA 1SBYA 1YJQA 3ZNQA 3OQ1A 4U0KA 4IJUA 3E03A 1ZFNA 4GX2A 5KNLA 2Y0DA 3ONFA 5TGDA 4HFJA 1B0AA 1B8UA 3AU8A 4IGFA 3DXFA 1M67A 2YJZA 5JDIA 3OA2A 3PWZA 3VPFA 5KCZA 4O59O 4RQTA 2IE0A 4NJMB 3BIOA 1ZSNA 3SEFA 4RQUA 2NU8A 5L40A 5MDHA 4KQXA 1MUUA 2Q2QA 3KYCA 5KJ1A 3RC2A 2ZTVA 1HWYA 3A1NA 3GY0A 2G0TA 3WBBA 5K6AA 1IB6A 1PS0A 4CM9A 2YQ5A 3I9JA 4UVIA 2Y0CA 4HV4A 1PGQA 3DTTA 1TT7A 4LVUA 1ISMA 3ZWYA 4B4WA 5LC1A 4Q39A 5JMWA 1ISGA 4TVBA 3KXDA 1YL6A 3R0IA 2PD3A 4WOJA 3CZMA 4Q3EA 4II3A 3PP8A 5C7IO 3QSGA 1R12A 3AOGA 4U8GA 2VZ9A 5IZ4A 4R5MA 2C29D 1V0JA 4D41A 3TPCA 2YV2A 4Z0PA 2DPGA 4OKIA 4CLOB 3ZWVA 1P77A 1JTVA 1UXHA 1E7QA 3KLMX 4JLWA 4BMNA 4YYZA 1U4SA 4E4YA 4IZIA 4OXYA 4WK6A 4B79A 4FFMA 2W2KA 4UVEA 4PCVA 4CMBA 1N7HA 4LMRA 2Q3EA 5T64A 4WPGA 4LW8A 3SC4A 2Q46A 4MVJE 2TMDA 1EMDA 4XQGA 1V3VA 4I5FA 4II2A 5CP8A 4BNHA 4RL6A 3RROA 5KVSA 1QYXA 4FS3A 1YQDA 2EP7A 4UEOA 3ZZNA 2NTJA 2JKVA 4Q3NA 2X0IA 5TX7A 1E1LA 4R9SA 4FOOA 2ZATA 3ZU3A 3ONEA 2NU9A 4Q3DA 5C37A 1ADFA 3JQEA 3H4VA 2H6EA 3F6YA 2VRCA 3RUIA 4CLDA 3PWSA 4Q3BA 2QG4A 3FNHA 3FPLA 3GN1A 2IZZA 5EIOA 3W8EA 4WNIA 3FTPA 1VJ1A 2P9CA 4ALKA 1VRWA 1NAIA 4WECA 5F3RA 3W4JA 2W98A 2W90A 2ZTLA 4P4LA 4R1SA 2FPIA 1MA0A 2POQX 4XGIA 4DYDA 5JFOA 4E5NA 1NHGA 4IMRA 1RPNA 3LT4A 4QEDA 2G5CA 2Y1FA 5DF1A 1HZJA 2C82A 1BVRA 1Q7CA 1HE2A 4CM3A 4DTIA 3QIVA 1U8XX 5U4QA 3WIEA 5FYDA 3U4CA 1AGNA 1GYQA 2JFHA 1MG0A 5AXCA 2OBYA 1Q7BA 3F46A 2I65A 3JD2A 4J1QA 4EZBA 4BQRA 4GI2A 4BOYA 2Q2WA 1PZGA 1F12A 1BDMA 2PH5A 3VZRA 5KTKA 4IBOA 1UDBA 5JE8A 2AMFA 5GZ6A 3U5TA 1SMKA 1M76A 4OYRA 1E7MA 2R00C 2FZEA 4O63O 4Z3DA 1DRWA 2IYPA 1XU9A 3GPIA 4QECA 2VNAA 3CTMA 2GNAA 3GZNB 3E9QA 3PVZA 4QUKA 3WTBA 1ZBQA 3NJ8A 5COAA 1GYRA 4E0BA 4TRRA 2DTEA 4Z9YA 4CLHA 3RUAA 4GAEA 1QXSA 2FMUA 2X8LA 3KRTA 4BV9A 1GADO 1P0CA 4MVJD 1IOLA 2PV7A 4J1SA 4MVJG 5H83A 2I3GA 4DPKA 4L76A 4N5LA 3ZWBA 1GPJA 4QT0A 1A9ZA 3LT1A 3IP1A 4J4TA 3EY4A 4PLZA 1ZK4A 5DOVA 3PJGA 4NFYA 1G0OA 2XAAA 2Q1WA 1KIFA 5CDSA 3MEQA 2EKLA 1LEHA 5ILGA 2NSDA 2O4UX 2PGDA 3DBLA 3NDRA 4J7CA 3D7LA 2X4GA 3QVXA 3E82A 3KYBA 4NI5A 4WLVA 3U62A 4UEKA 2W8ZA 3VKUA 1RWBA 1T4BA 1DPGA 1NVMB 2A94A 3D1LA 3FCOA 2HRZA 2Z1MA 3HDHA 3FSRA 5JCJA 4KMSA 3WWYA 2PNFA 2FZWA 2J5KA 2V65A 1C0PA 4CMKA 1BXZA 5T57A 1MP0A 1LUAA 3WNVA 1Y8RA 2PK3A 4H16A 2CZCA 3TFQA 2LDXA 1OBFO 3AK4A 1YBVA 3JTMA 1ISFA 5CDGA 3DONA 4DLBA 4AVYA 3COSA 4OJNA 3DBRA 4XX0A 4YDRA 2P4QA 2Y1CA 5CDUA 3ZWCA 4FDAA 1BW9A 1Z45A 1HZZA 3M2PA 3U09A 1PJCA 1Y7TA 1HDGO 2D0IA 4FR5A 3K96A 1PZHA 5I7FA 1FDVA 1SB9A 1AUPA 2OGUA 3JQGB 4WNCA 1SEVA 4UAGA 9LDTA 5F1OA 4DBVO 5T6BA 3PXXA 3KUXA 4NBVA 1D1TA 3RFVA 3AY6A 3IUPA 4AJNA 5DULA 4GVXA 1Z7EA 1T1RA 4JP2A 4DQVA 4J4BA 3JQBA 3RKRA 4B7CA 2G82A 4J4HA 4Y67A 1WXDA 4I9HA 1PS9A 3V1TC 4EJ6A 4AL4A 4OHUA 2CDAA 3VPGA 2GUGA 4CM6A 3A14A 3GNTA 3GR6A 3JYOA 5TS3A 5C5IA 1EQUA 2OOSA 4IM7A 1PJ3A 5JAMA 2O2SA 4GBJA 3S2EA 5A9RA 3CKYA 3ETDA 3PZRA 1YBAA 3OP4A 4PG6A 4NQZA 3WXBA 3IL2A 4BV8A 1NYTA 1OOEA 1F8GA 3CIFA 3AJRA 4YB8A 1ADCA 3M1AA 1A7AA 1YE3A 4Y98A 2HJSA 4F45A 5TJ9A 2VWHA 3D3EA 1V3UA 3EGOA 1GD1O 1C0IA 3PJDA 4ONEA 1LNQA 2QRLA 2EF1A 4RF5A 3UVEA 4B8ZA 4BIIA 4DC1A 3GMSA 1I8TA 1W6UA 4Z3KA 2UV8A 4WCFC 1VPDA 4LRTB 5L45A 5U9CA 3NT2A 4BS9A 2O3TA 4AJHA 4CR8A 1AE1A 2JFGA 2PZJA 3L6EA 3OSUA 4PLTA 4RLSA 3RFTA 1E3JA 1P1IA 3KYCB 4A03A 3PHHA 4MKZA 5DP1A 3VPSA 4GSKA 4KUEA 3AI3A 1XU7A 1JWBB 5JLAA 1V9LA 4O6VA 1EVJA 2AEFA 4EJMA 3DAFA 2OP1A 2VZ8A 4J0FA 3UCFA 3DQPA 4RVUA 3F1LA 4JQCA 5ENDA 2DBQA 3Q11A 3UICA 1A4IA 1ZH8A 2NQ8A 3ONDA 5KWEA 1D3AA 2J5QA 3I9KA 2PZLA 1I5RA 3BYZA 4JBGA 3KSZO 4L74A 1VKOA 4JX8A 3BHIA 2BHLA 3KSDO 2GN9A 4YT4A 2O3UA 3DEYX 4FJ1A 4J6FA 3Q1LA 2IZ0A 4INAA 4NFHA 1E3WA 1QR6A 2PKQP 3EC7A 2V6GA 3AW9A 4DLAA 1U4OA 4JJFA 3HUDA 4YJGA 9LDBA 1C3VA 1KVUA 4XEHA 4RVDA 4K26A 2I76A 5A3JA 1ADGA 3ZU2A 1ULUA 3LDHA 3RJ9A 3GC6A 4ALNA 2ZCUA 2CDBA 3KEQA 2WM3A 2YFQA 1DIGA 1ZCJA 3ZWNA 3N7UA 2W2KB 3W6UA 1E77A 4B3JA 5CFZA 4FW8A 5A02A 1DEHA 3LT2A 4KTVE 3PJEA 4MP8A 3C85A 2B0JA 2X0JA 3N58A 1LRKA 4M55A 4PGFA 2HLPA 3NEPX 4LSWA 2OBNA 3JQFC 4WE3A 5C3MA 1U5CA 4KZPA 4ND5A 2I66A 5JO9A 2VUTA 3TDKA 4J3FA 2WD8A 1IYZA 1YL5A 3DOCA 2BLLA 1R0LA 1BG6A 1C1DA 1QLJA 4P4NA 4MKXA 1KEPA 1LC0A 3MWDB 2UUOA 3BAZA 2YV3A 3WGQA 2QW8A 3IDSA 3DB2A 2EV9A 1R0KA 1J49A 3A28A 1O6ZA 4JBIA 4GX0A 1PS8A 3GK3A 1DFHA 1U28A 5TF4A 1JVSA 1DHTA 1JLLA 4R69A 2CNBA 4CUJA 1PEDA 4KUGA 5LCXA 1P33A 3GN2A 3JYLA 1SC6A 1SB8A 4OMUA 4YQYA 4BB5A 2VT3A 3AUAA 1NAHA 4TQGA 5IDWA 3WGGA 1IE3A 2RHCA 4DLLA 2GZ1A 2ZYAA 5KKAA 5L51A 2GPTA 4IXWA 3WFIA 3OETA 3AM3A 1GUYA 3JSAA 1M75A 1YQGA 1V3TA 5CDYA 3AUSA 2DC1A 1JAYA 2C2YA 3VVCA 2ZYDA 1CETA 3IJPA 4KWHA 2P9EA 2AE2A 2J3KA 4BNUA 2ILTA 5JCJD 1ZK3A 3GA0A 3I4FA 4RVHA 1J4AA 4RORA 3H7AA 1KEUA 5BSFA 5HM8A 2NVWA 1DC4A 5BSGA 3HZZA 1V35A 1ENZA 5L4SA 4LVCA 1GCOA 4GX5A 5IZCC 1O9BA 4NZ9A 2Y0EA 4I08A 1MFZA 5K9ZA 1MC4A 2BGLA 1YBMA 1FDTA 5IAAA 1XGKA 3CMCO 4L9RA 4CODB 4RZHA 4LN1A 3ZH2A 5H82A 3GVXA 3L6OO 3WIDA 1RM4A 5IJZA 3EAGA 4N18A 4BO1A 5JAIA 2OZPA 1E3LA 1RM0A 2HJRA 4PLFA 4FFOA 5I7SA 4B7XA 5IF3A 3AM4A 4FFNA 2I9PA 1E7SA 3QJ5A 4IQGA 5TQVA 1I3KA 1ML3A 3GDGA 3PHIA 4HFNA 3KZVA 8ADHA 4IQ0A 4A7PA 3DBLB 4N54A 3DBHA 3D3WA 4NNJA 2G17A 4D43A 3WGZA 4FC6A 2HKIA 5A3VA 4U6QA 5IDQA 4OKNA 1GUZA 3VPHA 5HS6A 3PK0A 4IDGA 1DFGA 2O7SA 2GN6A 3W1VA 1BMDA 1WDMA 4YCAA 1E6UA 1H2BA 1VL6A 1WZIA 3U4DA 3KVOA 1WPQA 3RKUA 3VH4A 3GMDA 1P3DA 2FOIA 3D4OA 1Y8RB 4BO9A 1BVUA 4BO3A 2ZJ0A 4JJIA 5EINA 1GZ6A 2I99A 3VHRA 1LBEA 1TB4A 1SEPA 1GEGA 4J7XA 2B37A 1A9YA 1W73A 1XR3A 3DBRB 5HTOA 4NDNE 4UUMA 4L73A 5CG2A 1BW9B 4Z0HO 3B1JA 2OMEA 2V6BA 1XLTA 1GYPA 2E49A 4JGBA 1IHYA 2YY7A 1QORA 3O8QA 3HHPA 4KOAA 1QKIA 1QP8A 1KY5A 3DBVO 2NWQA 4YACA 1ORRA 2VN8A 4JN6B 3RCBA 3LT0A 1LSOA 3GG2A 3OECA 4CQLA 4R51A 1LJ8A 2VWGA 2WYUA 4GGPA 3I23A 5CG1A 3NTRA 4CMIA 3UCXA 2P5UA 4YT2A 5AYVA 2JHGA 1PGPA 3Q9NA 2Q49A 1YXMA 3L6DA 1W8DA 3WICA 4FJ2A 4YR9A 3H6KA 3JYNA 3GVPA 3F9IA 5EERA 1ONPA 4HFMA 3NGXA 3WQSB 4WEOA 4MVJA 3ZN2A 1PSDA 1B7GO 2B4TO 2X86A 4IJVA 2YHIA 3UW3A 1H94A 4BGIA 4NIMA 4HY3A 4O0LA 2BGKA 5CDTA 3C8MA 4LK3A 2EXXA 4P22A 2AQ8A 1LU9A 4J43A 4BUCA 5L7TA 3DL2A 4BKPA 1XQ6A 3GAZA 3FWNA 1IZ9A 2NACA 2EG9A 2Q4BA 3NV9A 1YO6A 1V6AA 2UAGA 4BNFA 3Q3CA 3W8FA 2RAFA 2DUWA 4IMPA 5KVCA 2FSVA 1R66A 1YB4A 3H5NA 1VL8A 3NT4A 4YWJA 3S55A 5JPIA 4HWKA 2AG8A 2CD9A 1NBOA 4OSPA 5KIAA 3GEMA 1ZZEA 1HE5A 4M1QA 3GT0A 4J1NA 2ZTUA 4W7IA 5JW6A 3IIEA 1PL7A 1I32A 1RKXA 1NM5A 2D59A 4OOEA 1NFFA 2O3QA 3FNFA 5JAQA 3ZHYA 3I6QA 2JHFA 2WD7A 3R6DA 1Y8QA 3H3FA 4U5QA 3KEOA 1EE2A 4FGWA 4D3SA 2R00A 3HQ4O 2BKAA 3T7CA 2HRBA 3NGLA 3MJTA 3G1TA 3WQRA 5JDCC 2X23A 3G49A 1P0FA 5KJCA 1RYEA 4IDAA 3NKLA 4OQYA 4Y6RA 3OEYA 1NTOA 3W6ZA 3DOJA 1ZNQO 2PGJA 4Y9DA 5G0VA 2O50A 4WEQA 1NXQA 4D44A 1XKQA 4L4XA 1Z74A 3HB5X 1E3WB 4XWYA 1U5AA 2V6FA 3PJFA 1MXFA 3GGOA 4PLWA 3DAPA 4YJGB 1CDOA 3ZU4A 3L4BA 1GFSA 1P45A 1T2DA 2EJWA 2Y1OA 2YFHA 3I6IA 5ES3A 2VUUA 2XXJA 3QWAA 4AFNA 1T2CA 5BSHA 4M54A 2X22A 3I9MA 2Y93A 5G0TA 2Q4EA 1ZEMA 1ADBA 3RSHA 4EDFA 1PL8A 5TNXA 2ZCVA 4A10A 5I9LA 5IN4A 3L0DA 2EHDA 3FNGA 4TRMA 3GPDG 1IL0A 3NYWA 1YVEI 2QZZA 3RJ5A 3NUGA 3SVTA 2PLAA 3TZ6A 3B1FA 2B83A 3MZ0A 4ND3A 1GTMA 5I9MA 3ZWPA 5J23A 3NT5A 4OAQA 5ITVA 1VSUA 5L7YA 1IY8A 3DHEA 3BMOA 4TROA 1C1DB 4PG8A 3F5QA 3QHAA 3UN1A 3L9WA 3C1OA 3DWFA 4OH1A 2DTDA 2J5RA 2JCYA 1EZ4A 3GG9A 3K8ZA 4HXYA 4XQ9A 1VJTA 2BH9A 1LDBA 1ZIDA 4A5OA 1NQ5A 4ND2A 5L3ZA 3LF1A 4QFDA 5B4VA 4QX6A 1MC5A 3GEDA 2FHSA 4L4RA 5JYEA 2HMUA 3TRIA 3AOEC 5FFFA 4CPDA 5CPFA 4GLOA 2Q1SA 1B14A 4BGUA 4Q9NA 1HDOA 1I36A 1BHSA 3M2TA 3OIGA 4WLOA 5DOZA 2GDZA 1VKNA 4UEJA 3E6AA 2AA3A 1E3SA 3S2FA 3ZGYA 4PG7A 3WGTA 1P31A 4E5MA 3WJAA 4BVAA 4RPLA 2NTNA 4XB1A 4RVSA 4FBGA
chains in the Genus database with same CATH superfamily
2OAEA 3KBOA 4W9NC 2JFWA 1CG6A 1KE2A 5A1TA 3I04M 1SR8A 4IQ8A 1ZGGA 5DCUA 4B4UA 2Y1XA 5E4JA 1DRVA 2HSZA 1L5LA 2P6RA 1NBHA 1INLA 1X86B 5CM9C 3K6JA 5KINB 1V6CA 4ZD6A 5B2EA 4IR7A 4J2HA 1EXWA 2WB2A 1DNPA 2VHQA 3A3PA 4BUJA 5GJCA 4KBGA 1HTBA 4UNIA 4PRLA 3AW8A 3H0KA 4GU5A 4JUBA 5H02A 1E3MA 2ZRKA 5ALEA 1Z0DA 4Z0NA 2ZBVA 4G0OA 2IFTA 1UC5B 2FJUA 4Q9JA 2FP4A 1OE0A 1XP8A 3V00A 1D6JA 3RODA 4P4TA 3A0RB 1JQKA 3SJAA 4US1R 1FFAA 2CVFA 3R3SA 2FF7A 4KXUA 1EFLA 1N6PA 1JZTA 3VU9A 5LFAA 1E7WA 4XPIA 1HMYA 2NU7A 1SWVA 1FRNA 4JBWA 3UAVA 4MQ4A 1PJSA 2AJLI 3OWXA 5JYCA 5FQOA 5CA0A 3VPAA 1TCAA 1T3SA 3IT2A 5FXMA 2QTMA 2QUBA 3GPCA 2JJYA 3F98A 1NXXA 1RXIA 8LDHA 2YMMA 4B87A 2PZGA 1Q0HA 5KQPA 2EGHA 3B5EA 4N12A 4WCFA 3CUEF 5JFGA 3GPBA 3G8YA 3NEYA 4QICA 3DKPA 2JFOA 1RHQA 3VNAA 4DLVA 3RC8A 2TMYA 4JC0A 5FBLB 3IBSA 5FR1A 3KKZA 2E2WA 3P1JA 3DZIA 4JOSA 1Y33E 2Q29A 2DOKA 1MEJA 2HPAA 5HM6A 3C3AA 3OKFA 5KNCA 4C7JA 2WHQA 2QSZA 2YWHA 2IXTA 3ZCPA 5BSVA 3MQ4A 3K9GA 3W7AA 2BFEA 5GJBA 1PWEA 3ADOA 4CI0B 4ZO4A 5CD1A 1ZM7A 1GG8A 1D4OA 5JC8A 2AN9A 4S04A 2G1PA 4RTNA 1V47A 1QE5A 1ZH2A 2REBA 3FPJA 3KEFA 4RCZA 1UM8A 1JYEA 2ZVDA 3IMEA 1NVKA 1XYGA 1Z82A 2I62A 1L4GA 1I80A 4MVYA 1JUDA 2OEPA 1VBKA 4V0KA 4A2WA 4EQ6B 3P19A 4DBZA 3B60A 4F2DA 3C6QA 3H1BA 1DIBA 3Q8MA 1Y48E 1U0NA 4OHXA 5H5JA 1XBTA 1IN5A 1N6RA 6AT1A 3B70A 2J30A 1A1SA 2PKCA 3CUWA 1NVTA 2CK3D 2ZI3A 2X19A 1ICEA 4M6WA 5JNLA 4IHQA 4MAMA 5SZJA 1JIVA 1NW8A 3OMLA 5MHTA 1G16A 1O2DA 3C15C 1OA0A 1J07A 4OAOA 3AVWA 3WLPA 4I8XA 3RAPR 5BMOA 3PUJA 5K20A 1H9AA 2ZT7A 4LE2A 5B7QA 2UKDA 2M32A 4LWOA 1I4DD 4Q1FA 1YCDA 3FYDA 3MOIA 1U8UA 2QGFA 3LQYA 3KV3O 3V33A 1UEXC 3CNBA 4YQEA 4MKIA 4DRXA 2IP4A 5B4TA 2ZJ4A 1MTOA 4MP6A 2RGXA 2VAWA 4JVSB 4CMCA 4BO2A 3U48A 4CMIB 2RK3A 1CS0B 2WSIA 3EXHC 1EWKA 3JRNA 2GEUA 4QRHA 1QTIA 3E1KA 1OGJA 5E4YA 3RIYA 3TRKA 4WXHA 1C7RA 3WLIA 3X2EA 2W6MA 3HBMA 5FH9A 2R84A 1C0EA 2O0MA 1FDWA 4KBFA 4WXPA 4H17A 4D3XA 4U9HS 1UWCA 2D4AA 4YAEA 1F0YA 2DFKB 2VP2A 1A5ZA 2O2GA 4LGYA 2GPBA 3EGXA 1OH6A 3K0AA 1RIIA 3WNQA 1SURA 5DSTA 1DKRA 1NXSA 3JQ9A 3GLIA 3HO1A 1O1YA 4KWCA 1OPRA 2Z57A 4MGIR 3TLKA 3ZEIA 6GPBA 1DKPA 3PTLA 4KJZA 2JI9A 3REQB 3RBXA 1ZMXA 3PWKA 4BMVA 1ORIA 1I2BA 2R1VA 2YQ4A 4YS6A 3WGIA 1FTSA 1U9CA 1G6KA 3OT1B 2WKQA 1R16A 3EWAA 3ZZ0A 3IQDB 4U7HA 3U31A 3GLQA 2QTRA 2AKAB 2OKGA 2VOEA 5DHTA 4Z7NB 1ZD3A 1VSQA 5ADUS 1NI3A 4HWPA 1UF9A 4MUKA 1ND5A 1O3YA 2OFPA 4RXMA 4AWAA 2ZAOA 1G5FA 3NHYA 1Q22A 4I50A 3SQLA 2V9PA 4DCMA 3GQVA 4KLAA 1P2SA 3AHFA 4KYIB 1U8CB 5A6SB 3DMYA 3HP7A 1KNQA 2D8MA 3TEMA 1XEFA 4HLCA 2RKOA 4GC9A 3HCCA 1N1MA 3ED5A 4MUAA 4P36A 4M1EA 4UBIA 3GLGE 4P86A 1V1MA 4JK3A 4D96A 3HDTA 1J06A 2YWJA 1EBUA 4CGZA 2DR2A 1WX1A 1P2TA 1TPZA 2PKXA 4PSKA 1QFZA 1T10A 2ZIZA 2OBMA 3EA0A 5IN5A 5U4XA 1M72A 1RC1A 2FRXA 4OQNA 2GWHA 3OU2A 3D59A 5ILQA 4HNSA 1UH5A 3TAUA 1BD4A 1HA3A 2HNKA 3JD0A 3KZXA 4HDNB 1ESNA 4N5NA 5AKJA 1SRRA 2ZWPA 1VL2A 2C7GA 2QMQA 3KQVA 4X54A 1P6UA 3RS8A 3LT5A 4NU6A 4AKEA 2A5DA 2GQ0A 3KU4A 2AOUA 1U99A 2IXFA 5D5PA 2V4MA 2YZKA 5NULA 2VLBA 3GU3A 5L3VA 2F4VB 1MX9A 2VZLA 4FDUA 2C5GA 3T1YB 4DGSA 3EK2A 1YI8A 5HMLA 1J8FA 4K1LA 4N01A 2XGOA 2K7FA 3ZR4B 2IYAA 4M38A 5DTEA 1Z4KA 3O47A 4IJQA 1J5EB 4HDMA 3SPXA 1VE6A 3EVCA 1AZLA 2GN0A 1XEXA 4G8CA 3CKMA 4Q7JB 1GQSA 2I5PO 1CB7A 3AC0A 3VUEA 2WTUA 2ZE7A 1I3MA 3DE6X 3NEAA 5EP3A 3PQ3A 5A71A 1NF9A 3K53A 2WIBA 3EBLA 3GFRA 1T4DA 1UMDA 3E5HA 3LKBA 2EFGA 2RGDA 1UKAA 3KXIA 5JNUA 1V45E 4JR2A 4CF3A 4HWSA 3TL2A 3LAWA 1W93A 1OFVA 3EA4A 1E6WA 3EQZA 1BTOA 3DF7A 4Q4HA 4L75A 1PFQA 4PFKA 3V1UA 1Y5LA 3HE3A 5FLXA 4AY6A 2AEMA 1H4SA 2GTHA 4UU8A 4D4JA 4Z4EA 2B7LA 2WSMA 3BJZA 3W7VA 4AO7A 4GF5A 2XMCA 4NNPA 5T8KA 3Q7IA 2UZ1A 3OZIA 4FIZA 3FKSA 3IKJA 4KLRA 4G2NA 1HF3A 2IDJA 4UUOA 4CIDA 1TT5A 4FX2A 4DMGA 1FE8A 1GCIA 4ZYYA 4BCBA 4XR4A 3IXMA 2F55A 3OFJA 1NTRA 1II8A 3DL4A 3ELWA 3WYDA 3BMOB 1E79D 2ZIEA 4NXMB 1Z0JA 2WSBA 5DTQA 2NP6A 2J48A 5JD3A 2ID7A 3PRKE 2JI4A 2P2LA 1PJBA 3QLVA 3R40A 4ZAGA 2QVCA 3TBKA 3ZHSA 5NLLA 4EYOA 2XRYA 1UXJA 3ONNA 5EIBD 1JHAA 2V1XA 4ZDWA 1JDJA 1QQ6A 2PQ6A 2Y1GA 3ZHBA 1NXVA 4HAIA 4F5YA 3A6KA 2MINA 2XUAA 1THMA 4MS3B 1RRVA 1XJCA 1ZKMA 1P4JA 4I1UA 3TE7A 1E1RA 4WBNA 2ZYUX 3G2MA 1XTTA 4PZAA 4RTJA 1OX6A 1VJ0A 3QLTA 4OATA 3AG6A 3LKZA 1M83A 3J81A 3VX3A 1IEWA 2I8LA 2NTVA 5AXAA 2FCAA 4PFJA 1Z28A 3TUIC 3ANXA 2RH8A 3LQFA 3WS7A 1ZWKA 4H60A 3TLMA 1GAEO 1TFRA 2CFRA 1TUBA 2I3AA 4GLJA 4RH0A 1R8SA 5J58A 4KR6A 2WHEA 3L4KA 2WNSA 4KE6A 1N8KA 5ECWA 3MJSA 1YIAA 3E5NA 1Q0QA 5K8LA 2P4EA 5E6RA 5JADA 2Y67A 4FEYA 3GFSA 1IZ7A 4I4LA 1DIHA 3GJXC 3JCZA 4QDKA 4PZZA 2I2DA 3PYMA 2XNKA 3JZAA 1LJLA 3ZIUA 4G5SA 4CKBA 2YDYA 4HDSA 2V0NA 1E1QD 3MVEA 2VFAA 3NCHA 2HSEA 4C03A 4PW0A 1EFDN 4IKPA 3K1TA 3UF0A 3W8DA 2E5LB 3JQ8B 1G21A 1PW7A 3ABSB 4E31A 2B9EA 4BNXA 3OF2A 4M21A 2VPTA 4J0QA 5C8DA 5HK9A 2JRCA 5DNDA 2WIGA 4OPMA 3ETLA 1JZSA 1W1WA 1E4EA 1SY7A 4GWLA 5AR1A 1ZK1A 5EHXA 3LQRA 3DTYA 1H0HA 1GQOA 1M73E 3IAHA 4REQB 3T34A 3U3XA 2N46A 2ZXFA 4NPAA 3H99A 2PT5A 3CCFA 4Z0TA 2O8BA 1WAMA 1IRIA 2PG3A 2NUPB 4FN4A 3SNHA 1Z29A 5JBIA 1U2GC 3PDUA 1YZFA 4KCGA 3CU5A 1RBQA 5AKYA 3RFCA 4PHTA 3PDIB 1T34A 4ZVRA 1O94C 3NHZA 2F43B 2RAUA 3DPSA 3ULKA 2JKYA 2BTQA 1Y3IA 1XVVA 1UWLA 3GFBA 3EH2A 3OIVA 3OPVA 4RJTA 3I01A 3VSEA 3ON5A 3S1AA 2CF6A 1L2TA 3Q5EA 4GBGA 3IMCA 2QUAA 3C5HA 4DQLA 2H4HA 1YDFA 1ZD4A 2ZEJA 3TZBA 2OO3A 4P7GA 1EK6A 4AWBA 3OWHA 1JYSA 5JMPA 4BDSA 3CRRA 5KNCH 4D3FA 4C7MA 2HNAA 1VBNA 3FFXA 4WL0A 2A7QA 1V5GA 1IH8A 1RKBA 3DZCA 3ONVA 1DHRA 3R5HA 1LX7A 3TD2A 3PSHA 4WZBB 3OFVA 4BKRA 4MO2A 5F9FA 2WP0A 2GXAA 4EJ0A 2AMYA 4MIOA 4GHWA 4HLNA 1WB5A 1ODIA 4A82A 1HI9A 1OHHA 1ELOA 1NUTA 2ZQZA 1YI1A 4BQOA 4CI9A 4ZYTA 2PUAA 1OA1A 2DY0A 3UAOA 1CY8A 2AW5A 1ATIA 3LCUA 2WILA 4EA6A 2BI7A 1UP4A 1GGFA 2J4CA 1VL5A 1ZN9A 2J0UA 2HMWA 1CERA 1GUDA 3IOYA 2EW1A 4ZT4A 4XQEA 4DCSA 2WPDA 3ILHA 2JAWA 3VU3A 3C3CA 4IFTA 2R8XA 3KQLA 3ORHA 3RLIA 1DEOA 3L4EA 2C0CA 1E1YA 4HH4A 4I9NA 3LLCA 3N8KA 13PKA 4EECA 4O4HF 5BV2P 2VSYA 1A2KC 1TADA 5FHQA 1Y81A 2Z43A 2YVUA 4GOJA 1KVSA 4K05A 4UBMA 4D7AA 5LMZA 3KWLA 3AR5A 4ZU3A 4S0ZA 2INGX 4W9RA 1KHHA 3TB6A 1Z33A 1ZXLA 1EBFA 3BN3A 5DSXA 1WDWB 2J4FA 5ALWA 5J5VA 3RYCA 1YH3A 2J9GA 2BGWA 2X7JA 3G5LA 4XLZA 1LVGA 3RQSA 1IOWA 5FR2A 4D0RA 3IBCA 4JBLA 2QXTA 3QEKA 5AJVB 5IFLA 3UH0A 3K1ZA 1IPFA 3QUSA 1QGZA 4MCAA 3FVVA 4NJOA 3L5KA 3U6KA 1HDXA 4BLRA 3ICPA 2GAOA 2YHBA 1X7XA 1L8LA 4EMTA 3CH6A 3V4FA 4AJEA 2J32A 4KDRA 5E7QA 5A5EA 3TLXA 5A9SA 4MWOA 1KXJA 4IWYA 1NPYA 5DM1A 1RMTA 5FI3A 4AN4A 4QFMA 5EE0A 1UQRA 2FKAA 1V16B 4ZYZA 4NATA 1TXGA 5KJEA 2V7GA 2MSWA 2J46A 3KYDB 4WN3A 4Q00A 4EHIA 3O92A 3DOFA 4ZTZB 2XJ9A 3KR2A 1G4HA 4CM5A 4GFDA 4O1IA 3N8DA 4FKMA 5AI6A 2J31A 2Q5IA 2ZS9A 2I2CA 3EVFA 3JASA 1VMKA 4XDZA 3ZY4A 5KYYA 1E1CB 1KK1A 1NW6A 1QP7A 2OC9A 3HI4A 1IEQA 4FSXA 4MCHA 3WL4A 2P67A 4TT3A 6LDHA 1E32A 2HGSA 3DV0B 2ZP1A 4JLOA 1ZICA 4K5QA 3RBZA 3IB3A 4HKTA 4QULA 5E6SB 3RVBA 4W7HA 1K8RA 2GARA 3EYWA 3HJTA 4J75A 3WFJA 2VHVA 3N2KA 1WM1A 2AS0A 4KG7A 4ROTA 5LSAA 1NP7A 4FYXA 5B7NA 1G21E 5TRTA 1BX1A 3BE6A 3K6RA 4MR9A 3EZ6A 4B6EA 3X1ZA 5DHFA 3R75A 2VWPA 2W4QA 3EULA 2EX4A 1E64A 3W9BA 3DDOA 5ALKA 3PFGA 3PE3A 4Z7QB 2E7ZA 5ICMA 5ARDA 4BVJA 2VRBA 5G4LA 1WA5A 3VC1A 1DFIA 1ECJA 1B76A 1FFCA 3MJ4A 4JROA 4NYMR 2ZRBA 1I2ZA 3PLRA 3H2YA 3H97A 3WX0A 2GN4A 1JG2A 4JC8A 3VISA 3D4PA 1B93A 2PQ0A 4HNGA 5J1TB 3MCVA 5CDHA 2OO5A 3G6KA 4FB5A 1L5WA 1Q19A 4H1TA 3OQNA 2OWEA 4QYWA 4XQ0A 1HURA 1KC3A 2VDRB 2AG5A 1U0RA 1X42A 1M6WA 3AEQB 3FF1A 5H16A 2ZJ1A 3AFOA 1IM8A 3ILSA 3PC7A 4X65B 1JQ5A 4AXXA 3ETEA 5CB6A 1L4YA 1PX2A 3TWOA 2PKYX 1XNGA 4HFRA 2K6GA 2CUTA 1PG2A 2PWBA 1TQHA 4PX2A 5F9MA 3RS9A 4F04A 2P4SA 4WV3A 1FMCA 2JAXA 4QBFA 4HGPA 4JB3A 5DLEA 2VNIA 5EZYF 4B3FX 3A06A 4E13A 4GSYA 4RETA 1SD5A 1PKXA 1R6AA 3JQ6A 4ZK6A 4ZRMA 1JECA 1DXOA 4P0PB 1SVWA 3DWIA 3LG2A 3HU1A 4MZDA 4NG5A 5G0WA 4B46A 3VPCA 3I73A 4QC2A 1GPDG 4WACA 4AWXA 3NHJA 4MRPA 4C01A 2XKAA 2B3TA 4GZMA 1JVNA 3Q4GA 2MYNA 3K71B 2X8AA 1BHQ1 2A0UA 4Q3AA 1VTKA 1VLJA 3AGQA 4ZOBA 3VDRA 1PJZA 3N75A 3T7IA 5F23A 2PAAA 3IRVA 4J9VA 3K4PA 3NBFA 1B2RA 5KQRA 3RKSA 3N6VA 1R4MB 3WKCA 2FK7A 4QJ5A 5HQJA 2V97A 2F64A 3ESCA 4LYHA 1M2EA 3VAZA 2IH5A 4BPBA 1U0BB 3DAOA 2HR1A 1ULZA 2ONJA 3GBSA 3WP0A 3SJBA 3R7SA 1YOVA 1XTJA 1BHJA 2Q2VA 1HOTA 3PDJA 3VNUA 3JS5A 4Y8VA 3RUDA 4RACA 4AD8A 1R74A 5K8JB 2C5BA 1XCOA 2RDMA 5GONB 4K9QA 2E82A 3DL0A 1AGYA 3AMVA 2R1TA 3ZGOA 2J59A 2NSHA 4BLVA 1L5OA 1L7XA 3AIMA 4EB0A 1VZ2A 5FYQA 3E15A 3V1YA 1T24A 4HYQA 3L40A 4RNDB 1D6SA 4QQNA 4UD2A 5B36A 5KX5A 2FMKA 1H23A 1U7HA 5TJHA 4MLDA 4EITA 2PLNA 4DA4A 1WCYA 1X14A 4ND4A 1SK8A 2H1HA 1JFLA 1OZAA 2LIVA 3MERA 4U8HA 5GPBA 4EI2A 5K05A 1YK1A 4NYMQ 5H3CA 5BVGB 3O2QB 3QYAA 4OBEA 4UNQA 3JZDA 3U5TA 3U4GA 1QZUA 4F84A 2P9QA 3C98A 3OOYA 5HKAA 3F9RA 1M1XB 1JQBA 3K2QA 4JQYA 5IM4A 4IHJA 4JELA 4NU8X 4F4JA 3BXGA 4PS1A 3VH1A 2C7PA 3K1JA 2C1XA 3CG4A 5B3JA 4U5XA 3A1DA 2OO7A 4X1YA 5ALMA 4QUEA 2BEWB 3AILA 3ZDQA 5I7WA 5LQKA 2RFLA 3FMIA 2BEUB 4IH4A 4CDGA 4YA6A 2Q9BA 4RM2A 2CMFA 1UFRA 2MU1A 1W2GA 3RVJA 3EPJA 5I51A 3BF7A 4FMDB 4JL5A 1DBIA 5K09A 2B78A 2L17A 3I39X 5ALXA 4A16A 3ZDYB 3E9EA 3U49A 421PA 2XT0A 2CVZA 2BT4A 2FRDC 4GP9A 1Q92A 2GF2A 2XYGA 3DZ8A 4NV0A 3VTAA 4WJZA 3FCXA 2ZRDA 2ZK7A 5LNK6 5BW8A 1QIFA 1R6UA 3RFXA 2QN1A 5CITA 2BKXA 3RU7A 4WGGA 4C08A 4MVJP 3BMQB 2FWPA 3VRHA 4RIGA 1QMPA 1ZHFA 3TIVA 1FDSA 3ANYB 3FTNA 3USES 5JHGB 5JANA 2OUKA 4J1TA 1WMEA 4BJ6A 3AF5A 2XIQA 4JBHA 4DZTA 3RQIA 3P2YA 3I1IA 1FL9A 4PG5A 3ZVRA 4YCJA 1HL3A 1UJMA 2EW2A 4XWWA 1G42A 1K4MA 1QB8A 5DW3A 3EFOB 1ZSYA 3FGNA 2W2LD 4MTLA 4V0RA 3CNQS 3OM0A 3IVXA 2QY6A 1FK8A 2HJGA 2DUJA 4ZKDA 2JFFA 1CUIA 1XSEA 2OBBA 1TVEA 1W4ZA 1DKUA 3BIFA 3DMPA 3M6XA 3PNSA 4IXTA 2HA2A 4L1KA 1V1RA 4UQOA 3UOGA 1F2UB 4HP8A 1GV0A 2RGWA 4PC6A 4NMWA 4PBTA 1BU8A 5DBFA 2CMHA 3RRJA 2JJ1D 3U3JA 5K45A 1NP3A 3BFJA 4LTMA 5F2KA 3NHFA 4XGKA 1LRJA 4HMOA 4FCCA 3OTOB 4CT5A 3HYTA 5BMVA 4WLUA 4C1BA 1ULTA 4P3NA 2F8MA 3AP2A 1ZG3A 2NQTA 2QYHA 3NXKA 1QE3A 3H9BA 4IDDA 2BH2A 3IS3A 1PLKA 3TL3A 2QX7A 2P79A 2WMOB 4EEXA 4YMSA 4OB8A 1I2CA 1DTWA 2GFIA 3NQ41 5AXBA 2PTGA 3IIJA 4INPA 3R0VA 3RABA 3BUSA 4HRVA 4J0HA 3UUGA 2JCGA 2V54A 3K6SA 3FDIA 4DZRA 3VO1A 1HDYA 3DV2A 3CLUC 1M0SA 4XWAA 4V1CI 2QNIA 4FHGA 3EUWA 3T5AA 2QYSA 3GUYA 4RSGA 2ZOSA 5TGZA 4OLHA 1SKYB 2IYZA 1YI0A 3OMWA 1V96A 1CR6A 4XD7D 4GZ6A 3NR2A 3D8HA 4D46A 3FLEA 2IPMA 3P71T 3PHJA 3MRTA 3P45A 2WJGA 4F7DA 3HPRA 3MJRA 1ZJZA 1IM5A 1N9GB 4FD3A 4BO5A 3TIGA 2WSSD 4Z99A 2ZROA 4X6UA 1S3FA 4M1YA 2QF7A 2VC2B 4MZXA 5LU9A 4JUIA 1RQXA 1TTHA 3VZQA 3FFBA 3ZLJA 5HFAA 1GPUA 1JGTA 2P3LA 3UJ6A 4TMYA 4HAZA 4IEFB 2DUNA 4K6FA 1G63A 2IEGA 1N6LA 1K08A 3CF2A 5D84A 3ZHCA 4S0XA 3A9SA 3RK4A 3K0KA 5AM2A 5AJUA 1K4KA 1TTQB 3BTUA 1QHYA 1LNSA 4I4TF 3ZHUA 3D3NA 3EXEA 1WTAA 3L0BA 1QRDA 1H2YA 1MXHA 1UPAA 4O2LA 1NPTO 1U11A 2ZITA 4J16A 4ZCSA 3BZUA 2GXQA 4RDIA 1VI2A 3TW4A 3VTFA 1WKVA 5LD2C 1J23A 2ONYA 1OC2A 5DXJA 3WGJA 1CR1A 1Z56C 4ODIA 4AY3A 1UPTA 3UFXB 4PQRA 4AC9A 2ZRQA 1HM5A 5TQ2A 3STWA 2JIDA 1N8SA 1G9SA 3PEFA 1JTFA 3VPBA 1FYVA 4CR6A 4H4EA 4PONA 3ZZUA 2VJMB 1AVTA 2HA5A 2IDMA 3I83A 3PCRB 4DCGA 2AK3A 1S3IA 4O1MA 2PZEA 3LDAA 4ZP1A 1XA3A 3B3JA 1C7IA 1OFGA 1VDMA 1ZN7A 2CDCA 1T13A 2HF8A 1IDN1 2IVFA 2J87A 1T35A 3R6LA 4YYEA 5ADHA 1UBFA 2NO5A 4P3XA 5IXJA 4DR3B 4AN1A 4F9GA 2HXYA 1WCV1 2V03A 5D00A 1MO6A 1LK7A 5K6AC 1MQSA 2J09A 3HACA 2YCBA 3TX2A 2FEMA 4N6NA 1QX3A 2HT1A 5CD9A 2BGJA 1NX6A 1I94B 3D31A 3CSUA 4O4LB 2XBLA 2FE4A 3H6GA 3VR6D 2G3YA 2G7MC 3I2JA 1XTSA 2WM2A 3U3OA 4MXDA 3VHXA 4OFWA 2GR9A 2P3SA 3DFZA 2Q1UA 1I10A 2VKQA 2VPWA 2GRAA 3LFHA 4KMOA 2XRZA 5KYXB 1R6TA 3EZFA 4Y9UA 1RAHA 3UB4A 4JITA 1CZKA 1OLSB 4DUPA 2XQKA 3O6VA 3CWQA 2OL4A 2AN3A 2QY9A 1R9GA 1VGQA 1KU0A 2VQDA 2WZDA 3GJQA 3PEVA 4QOJA 4RZUA 1L5GB 4OXIA 4D9JA 5D86A 4B82A 2AG1A 4HLUA 4IINA 5HMMA 5LNK1 2ATVA 2NT4A 2OHJA 3G5AA 1FS4A 1HK7A 4R7ZA 3WOHA 4YRBA 3G3EA 5FA5A 3WZLA 3L1UA 2P4HX 1P39A 2ZLBA 4P7JA 3QV1A 4BNGA 2PUBA 3QX3A 1RXEA 1U2QA 1ZGBA 2XWJI 3CNEA 4KXLA 1U0EA 4JKOA 3LC2O 1A50B 3A58B 2IPLA 4IKOA 4H18A 2DFTA 4NQRA 5J63A 4NMLA 1U1CA 3H3JA 3RSFA 2O8NA 3VSDA 4CEHA 4LJ9A 5L53A 2Z2JA 4DLZA 4F8YA 1DADA 1GPKA 3DC2A 1KFKB 1PFGA 2ODTX 3IUQA 1NOKA 5EIHA 2NO6A 4ZVSA 5F7OA 1U3UA 3NASA 1TCCA 3IT1A 2D1RA 3GDWA 3EGDB 3S2GA 1TO6A 1VCIA 1GDHA 2R60A 5AKHA 3V48A 3O38A 4ZXPA 3B7GA 3G85A 4JJEA 3ICQB 2PTHA 2IE8A 4GPIB 3RC3A 4WUVA 3LLSA 2HL6A 3OSZA 4XWKA 3E8XA 1YR3A 4KDFA 5EL0A 1N6HA 2BHNA 1MLDA 1SU4A 4M3NA 3PT9A 1ADJA 2P27A 2W6ZA 2MOKA 5J2UA 4Y0NA 3UG6A 3BMCB 3JVDA 4BX8A 4PGGA 1E2JA 2QPAA 1YVDA 3EGIA 3NJRA 4GT1A 4ZHSA 1TAHA 2PT9A 3R8CA 3WRXA 1UODA 5B6IA 4RMGA 1ZH0A 2QMOA 4ZV7A 2O0HA 1LDEA 4E3WA 4O8ZA 4UTPA 1V7QA 3GJYA 1P0PA 1TGYA 5D1HA 4L5BA 2CJWB 5HDQA 4BNWA 1UM9A 2C9DA 3LE8A 5A7FA 1UUFA 1XAHA 1QGDA 2NVUB 5CB4A 1GNQA 3NHSA 3NRCA 1A71A 2VSOA 4PZEA 1YQEA 2QD5A 5HDBB 3AVQA 2YXBA 4DLKA 4ZK2A 1MJ5A 5DM70 1LPNA 1CC1S 2FMIA 4C4XA 1N77A 2Q3FA 3FYUA 1XALA 3WLTA 3D7KA 3KVYA 4HTAA 5L4NA 1WF3A 1X0VA 3AXSA 1YC2A 3N74A 5LZ7A 1JE1A 1ZJWA 3JQAA 3UHJA 3PR3A 2BZ1A 4PU0A 4JI7B 1HFJA 3RC7A 3PKIA 3AR9A 3IGFA 1PE0A 1WXQA 2G7ZA 2JGKA 2W6QA 3A4YA 3OZSA 1FXSA 3TCKA 3WB9A 4A1FA 4B4KA 4BNLA 4M86A 3A6GA 2FKNA 5A6VA 1TA4A 1BEEA 1NOJA 1MO5A 4CLXA 3OCXA 4GKJB 1WPXA 1ZPDA 5CCXA 3UHAA 3HTXA 2NUBA 4ENQA 4XVRA 5HOEA 2O2JA 3R76A 3ZLUA 5I7UA 3ORRA 3O8DA 3SFVA 4FE4A 4R8KA 4BLPA 3G2QA 1RXSA 1FFEA 2YJ4A 1ACLA 2AYYA 2ES4A 1U0FA 3EVGA 2XA1A 4AY5A 2UZAA 4KRXA 2C2BA 2BDEA 2FH5B 2P1ZA 3FMFA 1EK2A 3MLEA 3PQCA 3OPYB 4B3CA 4ENSA 3FYHA 3JQ7B 5DBIA 4JJZA 4X61A 1XCPA 2BDTA 3HY6A 3ITDA 3L02A 2ASVA 4GIBA 3GW8A 4HDQB 4OM8A 4PQFA 3W8RA 3WV4A 1BXGA 1UMBB 3DFMA 1UP7A 2E55A 2PRJA 4KPGA 1Q20A 2HUNA 5CT8A 1HEYA 3IHTA 2QAJA 3OOWA 3KQUA 4EELA 1G3UA 4UUNA 4FINA 2DR0A 1GNVA 1V3QE 1XG5A 2ZIGA 2F1KA 2B6NA 2XNSA 3UZUA 4KGDA 4ALNA 4Q93A 4JT8A 3JYQA 1P3JA 3EHEA 4RV4A 2OXIA 3H2KA 3EA5A 2QTFA 5JAOA 1QPBA 4KP7A 1J33A 1EI9A 2QLMA 3FZNA 4EY8A 3HYNA 1YJCA 1CJCA 3BWDD 2DAPA 5AOAA 2Q3HA 1YKSA 4EW2A 3OURA 4RPCA 4ZCRA 4IV8A 2UVPA 5DNEA 1JHPA 3KKOA 2YYYA 4CJXA 3E4CA 2P0AA 5IEJA 4D4HA 4I8IA 2O9JA 2XD4A 4XUCA 2AFHA 4BEJA 5JSUA 4DR5B 1RXVA 3BCHA 4XYMA 3IO5A 5EJAA 4RFVA 4YXWA 4EW6A 3EPKA 2GCGA 1J6UA 2FEOA 2RH9B 1F2DA 5HZKA 4MGHA 3F7MA 4GMGA 3PEWA 2M98A 3OD1A 2P68A 2QE7A 4P4SB 1KO4A 2XOKD 2Z2KA 1YB1A 4NE9A 2JI8A 4W1SA 1H3EA 4F8JA 3I2IA 5ERGB 3PKJA 5DW0A 2VH1A 2PVSA 3JQPA 1K3FA 4WI1A 1I3NA 1NURA 1YQXA 3K0CA 1HUQA 2BFDB 2JHAA 2O1SA 2CNLA 3OHMA 2MR5A 1GG2A 2Z83A 4O8CA 3SSMA 2FQWA 3VZBA 3HH8A 1FRFS 1MJHA 3MT9A 4YHHB 1NQTA 3KAKA 3K5IA 1THTA 1GOTA 1ESMA 2A9KA 3ITKA 1LA2A 2CXTA 1ZCAA 1G98A 1ISIA 1JMVA 2QIPA 2DHDA 5ESWA 5A06A 1EK1A 1VG8A 4AF8A 2ZYWX 1SOVA 2JCVA 2VAVA 4WLNA 1PN3A 2AI3A 2LKDA 1E9DA 3NETA 2DBRA 4PBRA 3A4VA 5DH9A 3NS7A 1JB9A 3D5QA 2ROQA 3FSGA 4NFSA 4RE5A 3TOVA 3CRVA 2FK8A 2QZ9A 5K0LA 4B31A 3V8NA 5CLHA 4JMLA 4QPDA 3OCZA 2WEKA 3GBVA 1RS0A 4MDFA 2B4YA 3EF1A 1IB0A 1LW6E 2EKBA 1OBCA 4GM4A 5K0CA 5BT9A 4QT4A 5JWRA 3W7BA 2UUBB 2VHXA 2ZIWB 3ENKA 2VDMB 3RRYA 1P17A 2OAGA 4MWEA 3DHNA 2CHGA 5D3ZA 4BNIA 4G0YA 1H2EA 1WBJB 4OXNA 5FWXA 5HJ5A 3DD5A 4BV3A 4Z4GA 3OJXA 3M9XA 4XA8A 5KNBD 5FOUA 4NY1A 4YTEA 1N4AA 1EA7A 4MUEA 4PO1A 5HA5A 1UBNA 3T7AA 5FUWA 4P2GA 3IDOA 2LCFA 4ZV9A 4DIKA 5HUQA 3LUJA 3LY9A 4ZVNA 4AJOA 4I1SA 2V45A 1JE0A 3NNSA 3RRMA 5IH3A 5ALTA 3G9XA 4OAPA 2I4TA 1E9RA 5D5HA 3RSSA 4CRWB 2BZGA 4FPXA 3EDMA 2OP0A 1GITA 4IZ6A 4EX7A 1CLUA 1N2HA 3OZXA 1SCIA 5EJ4A 3WNBA 3WWDA 2AQHA 5BOSB 5AW6A 3L8YA 1S1MA 5GJVC 1WMFA 2P1RA 3PC8A 3QVLA 4IGAA 1ISHA 4DKXA 5FWYA 2A9VA 3CNNA 2DF8A 4K9OA 1WSWA 4XDGA 1Y5RA 2ZWVA 1IPEA 4MH0R 4AK9A 1AF4A 2VJDA 1VIDA 3OX2A 5KQGA 3V3TA 2DECA 4MW7A 3I2YX 3TGWA 1TM5E 1LPPA 1UC8A 3O9VA 1EFAA 3LZDA 1THZA 2FR1A 4R40A 1MAHA 2ZI5A 2QN9A 4GSLA 2YW9A 1O95A 3KWMA 4BQFA 4ZJUA 4UHFA 5BN3A 4C0SA 4K81B 1IK6A 3GUUA 3H9JA 5LOVA 2V9ZA 4J2OA 1G3MA 3MAGA 1K6IA 3KUCA 2BI8A 3TECE 4MCJA 1PJAA 1NBIA 3C8DA 4IGEA 5DYYA 3TLCA 1ODFA 4HN2A 3IEIA 4IDFA 3R8XA 1TEZA 1WP4A 2ZPTX 3IPXA 3CQ9A 2I67A 2WC1A 3ZKWB 2H4XA 3WBFA 3TQSA 3Q2KA 1N2CE 2SCUA 3VKVA 1ETUA 1QKKA 2HIGA 1UXGA 2DQYA 3E1SA 4G0PA 4IFBA 1IY2A 1P73A 3E23A 3N9IA 1JXOA 4HTFB 2PH3A 2YVKA 1KWKA 2QRVA 5A4KA 5IBCA 5MFPA 4QPJC 4GO1A 4BMCA 1FTYA 1PGJA 1JU3A 2I55A 2XDYA 3G0CA 3NTXA 1HTTA 3ROKA 4B33A 4MDHA 2FWNA 2Q4TA 4YO7A 2DSNA 5LDGA 5C5DA 4LWQA 4OJKA 3NCTA 4RKYA 2CUNA 1OXVA 4Y7CA 5BV7A 5JUWA 1I0ZA 1JQAA 1YS2X 1XMXA 1CV2A 2O8EA 4BHHB 1LLCA 1PP4A 2A92A 3QA3E 1EM6A 1DZIA 1RZVA 3U61B 5AIAA 5I7OA 4R9NA 5MN5A 2PS0A 1XRMA 1THGA 5F21A 3F6EX 3L1KA 2RGYA 3BHMA 1Z8DA 1Q83A 4NZZA 4C43A 2VAMA 2Y99A 1ES9A 3BSYA 1T9DA 2ECOA 2ZR8A 3FDZA 4BIMA 1EVEA 3NRJA 1JKIA 2PXAA 3EH1A 1V5FA 5AHOA 1V1JA 3ZJYA 1OFHA 1WXEA 2FW1A 4JJAA 5FJJA 1VPVA 1RYNA 3ESQA 3KZNA 2OYRA 5E3JA 3BPSA 2P90A 2QUJA 1Z5NA 2YVAA 3B6JA 4JYPA 1RBYA 3H11A 3HJHA 1JI3A 4BNZA 4C0HA 3H9GA 4UNSA 1KOGA 4OHMA 3FSJX 1VCHA 1QHHA 2NU6B 4DRYA 2WWWA 1Q1NA 1ZUIA 2B4QA 1XTQA 3I8OA 1XMOB 5DLYA 1JA9A 1LF5A 1P61B 2GWRA 3CCCA 5F1YA 3ZIAA 2X7HA 3RS4A 4R2MA 4GXNA 5F3DA 4BQPA 4YPOA 1K6XA 3S2IA 4KDEA 3F47A 2YRXA 1COZA 3CEAA 4NDZA 2ZUDA 3MOGA 1RRMA 1WDLA 3ECSA 3O2NA 1EVYA 3ZG6A 4D4LA 4J0DA 3SICE 2A0FA 5HZHA 1S2MA 4R8RA 3ZDFA 1LY1A 2LRHA 1RHRA 3QNMA 1ABFA 1L4EA 4W9NA 3UO8B 4JFRA 4O4JB 3TNLA 4CVNA 4ESVA 4U63A 4YJDA 4EF6A 1L7QA 3TLZA 1ZVVA 2PJZA 1FU7A 1XB2A 4FQ5A 2D7DA 1TOAA 3DZDA 2YZMA 3TD6A 1D9XA 2E9SA 3Q1KA 1CBUA 4HH3C 5REQB 4FFBA 4PCAA 4JI1B 1UJBA 3QQ5A 1IHXA 2AG0A 1T26A 1HDRA 2YJ5A 2LXNA 2YV4A 3NOQA 3OLCX 1BO6A 4HQKA 3NIBA 4UUPA 1FSZA 4H3SA 3OE5A 5EOVA 3B20A 2PYIA 1MB0A 1P29A 3Q9LA 4R0NA 1J09A 1YA8A 1M1NA 1V41E 3B51X 3JQGA 4MK4A 4RKWA 1FS6A 1X9GA 2C78A 3Q3IA 4IPTA 2NN3C 4LC0A 4TV8F 1Z2OX 2XNDA 4MGEA 1P1HA 1C8BA 2JGNA 4F4HA 1JKJB 4Z3OA 1FF9A 4ID9A 4WZZA 4RGVA 2J7PD 3MWLA 4X60A 1UWVA 3UJNA 4ALIA 3O7WA 1NASA 3RAFC 2O8DA 2IA5A 1P2DA 4Z51A 1QK3A 4JASB 2FN9A 4UZSA 3H1EA 3E27A 3L6CA 5EP2A 2HU5A 4X1IB 2C3UA 4EA8A 1DX6A 3C7DB 1F9AA 1UZNA 4HUQA 5KOJB 3JATB 1GSAA 1UBRS 5FPKA 2R87A 4PAWA 1AH2A 2NUAA 2C4TA 1D2RA 1LRLA 1SVMA 2D6FA 1G18A 2PAFA 2Z4TA 4D56A 3KYJB 4BKQA 1V4BA 1U3VA 4HGZA 4CMEA 1G60A 3IAM6 3ETCA 5LKRA 4DJTA 3LU1A 4TXNA 2JF0A 2CN1A 3CH4B 4LV8B 1FIUA 3H8JA 3FOBA 2P9YA 3ZJUA 4L5YA 4WESB 2R6FA 4LXTA 1PT7A 1B0ZA 4LWZA 3MMXA 3EMKA 1IZ0A 4BNMA 3QF4A 1KU6A 1N1DA 1Z5UA 4WA7A 1C7ZA 1VXOA 1LZKA 3E22A 4G9EA 4URUR 1WBBA 1KKLA 4GKAA 2JCBA 4GX2A 6Q21A 4DJJA 1NUUA 1RXUA 4KAAA 1KIMA 3ONFA 1WBDA 1WQ4A 5TGDA 4IGFA 3R9XA 3CNLA 4BRZA 3UT5B 1S2OA 1M67A 4PICA 1UDWA 5JDIA 4JL8A 3N87A 1JFFB 3LBAA 3N5KA 2B61A 5E1MA 2MJLA 3VV2A 4ZC1A 1JNYA 2R8PA 3OLXA 3RIXA 1KIAA 2QVLA 3W3AD 3D1VA 1Z6PA 2CHEA 1Y1LA 1ECCA 1U1GA 4IIBA 3M70A 2KE5A 3H5OA 2RAVA 2ZTVA 4Z8YA 1WF6A 1OXMA 2CD7A 2EFJA 2FN3A 3A1NA 4OBBA 3KVNA 3PEUA 3NFYA 1TNDA 3IQGX 5FI1B 1NLZA 1PS0A 4CM9A 2PUTA 4RPIA 1UWKA 3EQ7A 1IBCA 2LV8A 3TIIA 5SV2A 5LJIA 2IBTA 3EXHA 5EEHA 2A30A 2QMZA 1FX1A 4HNVA 9MHTA 2XDAA 1JDZA 2WJ3A 4Y2JA 3M5DA 1H4TA 5ED4A 2ZS8A 4Q9AA 2AZXA 2R9VA 1RQLA 1MQ9A 1Z4LA 1KGSA 2QU7A 4UM9D 5IKOA 1KEEB 3TPZA 4BFYA 4G1UC 4F6RA 2XA9A 4TVBA 4UBNA 4YPVA 1IOZA 1RSZA 1XF9A 1OYYA 3AVYA 2PD3A 1QKJA 4TYPA 2JLWA 1I3CA 3A2NA 3PP8A 5C7IO 3HN6A 1ULHA 2XRMA 3QSGA 2P41A 5LQUA 4IG9A 3EZGA 3NHUA 4LHVA 1T1EA 2HLHA 2H0RA 1RPZA 1C8VB 1MIOB 4R5MA 5IZ4A 3TIFA 5EE1A 3TPCA 3DVSX 4Z0PA 1GLGA 3N3AC