1KVTA

Udp-galactose 4-epimerase complexed with udp-phenol
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSVATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structures of the S124A, S124T, and S124V site-directed mutants of UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords UDP-GALACTOSE 4-EPIMERASE
total genus 129
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kvtA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kvtA01
5IZCA 3JYOA 1DHRA 1YB5A 4FD3A 3H3FA 4NBWA 3JQBA 4KDEA 2WSBA 4YQYA 4HADA 4WK6A 1R15A 1XHLA 4NJOA 3DONA 2E6UX 4CQLB 1NP3A 4J4BA 3WGTA 1YBVA 3BMCA 3NT4A 3O03A 4TZTA 5CPBA 4BNWA 1B7GO 3KM0A 4EI2A 2PH3A 1NWHA 1NHWA 3RBVA 4IQ0A 4B3IA 4L9RA 3H9GA 3RJ9A 4PG8A 4FJ0A 3PJEA 1J49A 1P9LA 3K92A 2HK8A 4XYEA 4NNJA 4IMRA 1MP0A 3PWZA 3ZWWA 2V6MA 2VRCD 1E7QA 4URFA 2NADA 3TZCA 1Z75A 2D5CA 3FPLA 5ES3A 3RJ5A 1ZJZA 1V8BA 3OA0A 4NG5A 4OJNA 2PK3A 4D44A 1AE1A 2D59A 3EZYA 3PGJA 4GLOA 1N9GA 2JCYA 4QTZA 4DREA 1YWGO 2OORA 3JQ9A 2F00A 4BKPA 4XYGA 2X5OA 1H2BA 9LDBA 5JCJD 3UF0A 1GZ6A 2Z95A 2PZMA 4O0LA 1M6HA 4XWYA 4RORA 4XGKA 3ZNOA 1PSDA 3O38A 3AY3A 1QV6A 1D8AA 4XJSA 4Z0TA 3FRJA 1BSVA 3C1TA 2YHIA 3HB4X 1P1IA 3O9ZA 1HT0A 2QRJA 5HM8A 3EHEA 3IP3A 4CUKA 4MVJA 3C7CB 3H5AA 2X0RA 1GYRA 3OHSX 5T6BA 2NQ8A 3ENNA 3WXBA 3PJFA 4PGFA 5ER6A 3QWIA 2X1HA 2XXJA 2X4GA 4OSPA 3X2EA 2IRWA 4EZBA 1SB9A 1PX0A 3WQQA 2QIOA 1DC5A 1QP8A 5JMWA 3GZNA 4JN6B 4B4UA 1BW9B 4BO8A 4EUEA 3UUWA 1ULSA 1RM5A 1LUAA 2NTVA 3FF4A 4IDDA 5TT0A 3ETEA 2DFVA 3RUDA 4FS3A 1XG5A 2GCGA 4FFRA 1P45A 2CVOA 3C1OA 4GQAA 4LSMA 4GX5A 4LW8A 1EBUA 4RCVA 3L0DA 5L7YA 1NFFA 3QIVA 1E7SA 2RH4A 1LTHR 2VYVD 4N7RA 5H83A 3O26A 4HBGA 4J3FA 4B3JA 1H9AA 4MIYA 4CLDA 4EUHA 3LC2O 8LDHA 4DLAA 3EK2A 4GMFA 5JYDA 1Y1PA 2PR2A 5I7EA 3EUWA 2NU8A 2Q2QA 3FSRA 3N58A 4HNHA 4BO2A 1VI2A 1C0LA 2WM3A 1RYDA 3Q9NA 3JQ7A 3COSA 1GL3A 4L4RA 2X8LA 4BNNA 4D46A 3DBRA 2A9FA 1M76A 3PHIA 5DCWA 3VPHA 4GX2A 1Y8RA 4OQZA 2VHVA 1ISGA 3IDSA 3L4BA 4YJHA 1E1MA 4BNMA 1I5RA 3WYBA 1GD1O 3BHJA 3MWEB 2FR8A 3BA1A 5TGDA 4YJFA 3WYCA 4UEOA 4FFOA 4DIBA 4AJNA 1PJCA 4UVIA 1C0IA 4B4OA 4JJGA 2OGUA 3U3XA 4IJWA 2I67A 4DWVA 3GA0A 4CM8A 3WJAA 3JYLA 3NYWA 2AG5A 3OICA 4RPGA 2GERA 2VUTA 2WTBA 3HN7A 1WZEA 2OBNA 3JQ7B 1QKIA 4NR0A 4XRRA 3KO8A 3PPIA 4ITUA 1JKFA 2G17A 3DMTC 3RVDA 1IUKA 4K1LA 4BGVA 1A4IA 1F12A 3ETDA 4IDCA 4OIMA 1UZNA 5FYDA 3F5SA 4F6CA 2HDHA 2J5QA 5ENDA 3TFQA 5K9ZA 2JAPA 3HFGA 1IHXA 1MLDA 2O3TA 3BMQB 2O23A 3W6UA 3ULKA 2YDYA 4BNHA 1Z7BA 3RUIA 1J6UA 3INGA 3OM9A 4I08A 3VPSA 5DCUA 3S2IA 5IZ4A 4IS2A 1CQJA 1UDAA 3I9JA 4DLLA 3P2YA 1KERA 2HRBA 4CM8B 2HMWA 2WE7A 2DTEA 4MVJD 3KZVA 1XU9A 1MXFA 3HSKA 6ADHA 1OC4A 5A06A 2CF5A 3TZ6A 2P5YA 3L9XA 4M8SA 4AJKA 1C1DA 1ONOA 5TLSA 2ZTUA 4R69A 4LMPA 4LN1A 1H6DA 3INTA 4XB2A 5TS3A 4XR9A 4I5FA 1FK8A 3SXPA 3FHLA 4D0SA 3VKVA 3IIEA 2B4TO 2GZ2A 1LXCA 2Y93A 3GDOA 1NVTA 2WD7A 4BOYA 5EERA 4YVFA 4AJHA 1EEHA 2ZTVA 3QA9A 4CM6A 1Z6ZA 4BMVA 4DVJA 5I9LA 4R1SA 3W4IA 4TVBA 2G5CA 3A14A 1A9ZA 3WLEA 3VZPA 3PLNA 3STHA 1K89A 1HDRA 4CM5A 2CFCA 4IDFA 1IZ9A 2Y1OA 4LRSB 4AJLA 5KVSA 1PQWA 3ZWXA 1A72A 3BTUA 1ZZEA 4QX6A 3DZKA 4FFPA 3WG9A 5CEFA 4FFLA 4CQMB 5IAAA 4R5MA 5JAQA 1Q0QA 1RPNA 4DRYA 4GSKA 4PLGA 3K6JA 4ZRNA 4FB5A 1SMKA 4MOWA 5DOVA 2Y1CA 1EVZA 1LDBA 2I76A 3DZIA 4J1TA 4XD2A 1VL8A 1UDBA 3PHGA 2NU9A 1BDBA 1L7EA 5GZ6A 4OQYA 2EP5A 2GUGA 6LDHA 1T4DA 2PA3A 4UEKA 4Y6RA 2OMEA 1HDOA 2C2YA 4FC6A 1GUFA 3SLKA 4YAKA 1ULUA 1O9BA 1FF9A 2PNFA 3E48A 4XB1A 3VH1A 1EUDA 5L4NA 5DBFA 2OOSA 1CETA 4PG4A 4RPKA 1E5LA 1NVMB 3GEGA 4E21A 5JY1A 1JDJA 3VOSA 4IIVA 4PRKA 5L7WA 3PZRA 1H93A 3G3EA 5G0SA 1HXHA 5HWSA 1ZJYA 3RFTA 2OHXA 3KVOA 1QYXA 4EEXA 3DAGA 2VWPA 1U4SA 2J3JA 3T7CA 4Z0PA 3QWAA 3GVHA 2AQHA 2EF1A 4TKLA 3MZ0A 4YYZA 2YHUA 3QWFA 1U7HA 5DN9A 4J0EA 4JBIA 1BW9A 1E1NA 1CEQA 3DBLB 4FOOA 2X0NA 2NU7A 3DOJA 5JYEA 1F8FA 2GN9A 3O8QA 1EQUA 3ZDFA 1HSOA 5ER9A 1Q2XA 3WIDA 4M54A 4JROA 4BUCA 3BMNB 4AG3A 1WNTA 4XDZA 1R66A 2B5WA 1WMAA 3NDIA 2YUTA 2PD4A 5HA5A 3MEQA 2VZ9A 4XGNA 4ROSA 1BXGB 4IM7A 4RL6A 4RO0A 2AQKA 1DB3A 4WKGA 4BGEA 1DFGA 3KYCB 3W6ZA 2Q4EA 3AM3A 1YOVA 5L40A 3F4BA 2FY8A 4TVOA 2I65A 3BYZA 1Y8QA 3ADOA 2P2SA 3DBRB 4WJZA 4QQRA 4UULA 2OXIA 1PL6A 1BVRA 1T2AA 3F1KA 3L6EA 3AU8A 2HLPA 1NFRA 2E82A 2FZEA 4YJHB 5L53A 2PZLA 3MJ4A 4IUYA 2B69A 4YQZA 4ILKA 1TB4A 2R00C 3NTRA 4IBOA 4ZQHA 3DMTA 3FWNA 4FCCA 3E8XA 1SEPA 2X9VA 5IZCC 4D7AA 1B8VA 3UICA 4NMHA 5A4DA 5JBIA 1N7GA 2AEMA 4HUJA 2QHXA 3TRIA 4FBGA 1MFZA 4BQPA 1CF2O 2ZB7A 4D45A 1DIAA 4WCFA 5K0ZA 1JQBA 4G81A 4FQ8A 4CR7A 4DC0A 4CLOB 3FR8A 1MC4A 5G0UA 4R5HA 2EKPA 2WD8A 1BTOA 3PIDA 1HDXA 4E5MA 1X1TA 4R3NA 1R0LA 5L95A 1HKUA 2O4UX 3KSUA 5FI5A 5JO9A 3DHNA 2DTDA 1T2FA 1K2WA 1A7KA 3PYXA 1Y8RB 2NWQA 1GQ2A 2XPCA 3ZV6A 4U6SA 5T64A 4FIZA 3ZI0A 3PQEA 3ETGA 4OMUA 3ROKA 5L45A 5U9CA 3FWZA 4PZCA 5ENVA 1VPDA 3WB9A 2JL1A 1I36A 1WW8A 4WCFB 1GAEO 3ZZNA 5JAZA 5F1PA 5JXWA 4CMBA 2JD2A 5JMPA 3V5NA 4CLHA 1I01A 1CIVA 5BR7A 3NTQA 4FGSA 3ZW8A 3KXDA 9LDTA 3MJEA 2ILTA 1EE9A 3HQ4O 4OXYA 1R0KA 1UAGA 1WMBA 1KC1A 1U3TA 4UVEA 1YL5A 4KZPA 1M67A 2DLDA 1YB1A 4RLSA 2H63A 2BGLA 3WQRA 2OP1A 4J91A 3U5TA 5TSDA 5AXDA 1QYCA 2Y1FA 4P4GA 4NU5A 4YAEA 4NHEA 2GR9A 4B7UA 1QYWA 2D0IA 4PN3A 1ENZA 1ID1A 1N5DA 2Y67A 1E0DA 4J9VA 4L4SA 3ZU2A 1ZK3A 3FTNA 3U4IA 4QXMA 3UFXA 4E5KA 5MDHA 1SBYA 3VDRA 3DEYX 1HYHA 4II2A 1MG0A 1NBOA 1BHSA 1IE3A 1ONPA 2R00A 3PJGA 4IXWA 1ENPA 3V1YA 1XQ1A 4Y98A 4RQTA 3W8EA 3D7LA 5A5EA 1Q0HA 5DOZA 4CMIA 4CL8A 2XXBA 3OIGA 2HMSA 3KYDB 4XRGA 5IJZA 2GF2A 3LT4A 2FOIA 4D3DA 2IDZA 3U62A 4Q3BA 1CJCA 4H16A 3C3XA 3D3WA 3JQEA 3X2FA 4FSHA 3OBBA 4LCEA 4UVGA 5JSFA 4CLRB 1GEEA 3DHEA 3UCFA 1J4AA 1GZ4A 1YS4A 1DC3A 2AQIA 3DBHB 3F3SA 1IPFA 5KVCA 1B3RA 4EJ6A 3GVPA 4CMEA 5EJ2A 5JC1A 3DO5A 4Z9FA 1N92A 4GLLA 4KUEA 4L4XA 3QWBA 4R1TA 1UXKA 4BO9A 1E1LA 1HYEA 1V3UA 4DMLA 5L9AA 1E7YA 2IZ0A 1K0UA 3TOZA 2Y1DA 1I30A 5CPFA 2HK9A 2QYSA 3QWHA 4RVDA 1ISMA 3LT2A 3TFOA 2JCVA 2EW2A 4BKQA 2EGGA 1PWXA 2YV2A 1VJ1A 1H9BA 1PQUA 4E5YA 2BMAA 5DNAA 4ZQFA 3H9UA 2HMUA 4IGFA 1X7GA 2C29D 1U1IA 3AW9A 2GGSA 2IYPA 5ILGA 3RROA 5JW6A 3NDJA 4CV2A 3AWDA 1E5QA 4XCVA 4YAJA 1SB8A 1KEWA 4OL9A 4J7UA 4JJIA 5EQFA 5DP1A 4N5NA 1PTJA 1GADO 4MVJF 5CP8A 3U49A 3LDHA 4RF2A 4RDIA 1JAYA 1ZK0A 3OA2A 1LC3A 3PI7A 3BIOA 4OSOA 3LYLA 1YDWA 3GN2A 4KDFA 3CEAA 4Z3DA 1DLIA 3OETA 4YT2A 3ONDA 3WGZA 3JQCA 5KOIA 3ZWCA 3DDNA 3AFMA 5ICMA 1HE5A 1UXHA 2Y99A 1PR9A 1PQPA 1HSZA 1ZSNA 2EERA 3ASVA 1BGVA 4YEDA 4CQMD 4UAGA 3OJOA 2WE8A 3RCBA 5JNLA 2DPHA 4EW6A 4DA9A 3BZUA 1ADGA 1LEHA 1R16A 3A9WA 2X23A 4YRDA 3AUTA 5JE8A 1PEDA 4XYBA 4RF5A 3SJ7A 2ZYDA 3R3JA 1CDOA 3EAGA 3HDHA 4YBZA 1AN9A 4MVJP 5H81A 5T5QA 5F5NA 3VC7A 1B26A 4PLZA 1ISJA 3JQAB 5T8KC 4HXYA 3VH4A 3GGGA 3OQ1A 4E32A 1OMOA 3E9QA 3W8DA 4TKMA 1GCOA 4BO6A 4RDHA 4BKUA 3SX2A 3Q2KA 4EJMA 2DTXA 1GYPA 3LLSA 5CG2A 1LJ8A 3GG2A 3MJCA 4IMPA 4W4TA 1U3VA 5IFLA 1N2SA 3KOUA 5C7LO 1OFGA 2PGJA 1HL3A 1SEVA 1SOVA 1PR3A 1PGOA 1DIBA 1XSEA 1MV8A 3PIIA 4YPOA 2ZJ1A 1J0XO 2NNLD 4OOFA 2XF8A 1GUZA 4TROA 3G17A 3I83A 3FR7A 1MB4A 4KUGA 1AHIA 4J4HA 3B1JA 3AOEA 2IEDA 1ZH8A 4NI5A 3I9NA 1PU2A 4OKIA 1QSGA 2Q50A 4MJLA 3DAPA 3H3JA 4AL4A 4K9DA 3QE3A 3RQSA 4R9RA 1G0NA 5JO0A 2JKVA 1R4MB 5K6AA 4IIUA 2DPGA 2VCYA 1EFKA 4BGIA 2Y05A 3D5TA 2VWHA 4QT0A 2Y0EA 2Q2VA 2GDZA 3JQBC 3WR5A 3M1LA 3F9IA 3K5PA 2Z1MA 3HNPA 5C37A 3WGQA 1XU7A 1IPEA 2CY0A 1TEHA 1E3IA 3H6KA 2EGHA 2C59A 1CWUA 1F14A 3ZNQA 1HZZA 3D0OA 4DIFA 3O4RA 4WASA 2OUIA 1FDWA 4AJIA 3H9JA 3NAQA 4NZ9A 1I2CA 1TA4A 3I9OA 4DYDA 5A9RA 1LSOA 2OL4A 5ADHA 4AJ2A 3TF5A 4OAQA 2ZTLA 2NU6A 5CFZA 1WZIA 3RUFA 2O3QA 4C4OA 1YXMA 2Y0DA 3LVFO 2C54A 5JC8A 5JAIA 3F5QA 1L1FA 3EVTA 4L74A 1ZSVA 1YO6A 1AXGA 5JCJA 3H5NA 1I24A 1NQAO 4PLWA 1Z82A 2WYUA 5U1PA 4B79A 3CZRA 1ZW1A 3HWRA 4YTEA 4EBFA 4L75A 1LLQA 1VSVA 3L9WA 3O8QB 3GHHA 2BD0A 5CDTA 3N7UA 3S2EA 1QR6A 1A27A 4L0QA 2CF6A 3UAGA 1BMDA 1X13A 1DRVA 2PKQO 2X86A 5CEEA 1SZJG 3GMDA 1I0ZA 2QW8A 3K2BA 4I5DA 1H2HA 4YJFB 3RUEA 5LDHA 1Q7BA 5KJ1A 2DM6A 4UUPA 1KEPA 4MKRA 3TQHA 1B0AA 5LC1A 4OKNA 4WEOA 1DAOA 2O4CA 5AXAA 5COQA 1F17A 4IPTA 4DIOA 3RAJA 1MUUA 5I9MA 1XQ6A 2R2GA 1NXQA 1WLYA 3VVCA 2JJYA 3JQDA 3ROMA 1O94A 5A9SA 1YOVB 2UVDA 1W73A 5GZ3A 1RM3A 5TX7A 4W7IA 3D4OA 2AEJA 4NH4A 2V65A 5BQFA 4HV4A 2FR1A 2NUAA 3RUCA 3CSDA 3GFGA 2E37A 3RASA 1T24A 3NX4A 3WIEA 1I10A 1S6YA 4ZJUA 5FF9A 3WSVA 5EMHA 1EFLA 3IUSA 1EBFA 3PGXA 2W98A 3B1FA 1Z74A 3OSUA 5DULA 4B4WA 3WBFA 1HE3A 4JJFA 2NM0A 1LRLA 2UDPA 1SO8A 1SCUA 2Q1UA 3TWOA 4XKJA 4OH1A 5B4TA 4G5HA 3WX0A 5IDQA 1YJQA 1NHGA 1I8TA 3CMCO 5F5LA 3ZWAA 1XEAA 2X5KO 3ZWPA 4WNIA 2UUPA 3VPFA 2FWMX 4JQCA 2DVMA 3D3WB 2IYOA 5JDIC 2JHGA 4XYLA 5JS6A 1NNUA 4H3VA 3L4SO 3LT0A 1P1JA 2VNSA 2GN6A 1KY5A 2YV3A 2VTEA 4RPLA 2HK7A 1DDOA 2ET6A 4ZRMA 1X7HA 4WGGA 3BMNA 5DT9A 4CMKA 2DKNA 3T4XA 2X9GA 3JSAA 2DBVO 3VAZA 1NASA 3U0BA 4FR5A 1PZFA 2FSVA 3ZV4A 3QV1A 2GSDA 3Q0EA 1R37A 4WLVA 2CDAA 3BAZA 1KY4A 2WEKA 1R0SA 4OHUA 4N5MA 5EN4A 3KETA 2H6EA 4BL5A 1C1XB 1NTOA 1AUPA 4U0JA 4BO7A 3VZRA 5GZ1A 2Y1GA 1LDNA 2AQ8A 4W6ZA 4UUNA 3K8ZA 4E13A 1NM5A 1DIHA 5JAMA 1T1RA 4Y9DA 4ND4A 2XAAA 1Y5MA 3UVEA 4PG5A 5KJ6A 1KBZA 2EWMA 1VKOA 1B8UA 3OFSA 4R3WA 1B14A 4Q3NA 3JQFC 3WMXA 4DQXA 2LDBA 1GYQA 4E31A 2W2LA 2B35A 1IZ0A 4XQGA 4E3ZA 5CEJA 1R6DA 4R68A 1FMCA 1EK6A 4U8GA 3PFFA 4W99A 1MXHA 4JIGA 2P91A 4J4TA 4MINA 2QZ9A 4B4VA 3QSGA 1EZ4A 2CDCA 3ZGYA 4KQWA 1GDHA 4TRRA 1Z7EA 3I4FA 4IJUA 4XJTA 5IDWA 3H8VA 2GPTA 4YCAA 4R41A 4E5NA 4BO1A 4WLFA 4O63O 1FJHA 3RIHA 3WYEA 5B1YA 4U6QA 2VUUA 4BMNA 4LMRA 3VTFA 4IDAA 3T4EA 4K6CA 3LT1A 2AW5A 3PHHA 4ALKA 3C8MA 1GTMA 3JD4A 4I9UA 4K6FA 3I9KA 1DPGA 3KB6A 3AFNA 3BTOA 2EHDA 4NQZA 3ENKA 2QG4A 3ZWVA 1FDUA 3QY9A 2E4AA 4E12A 5A1TA 2P68A 3H2SA 3NEPX 5KVQA 1PZGA 3OEYA 3QVOA 4Z9YA 4J16A 2B0JA 5EQDA 3I5MA 2W4QA 1HWYA 5J23A 4DBVO 1Y9EA 3TOXA 2X22A 2W2LD 3RKRA 4KMSA 5DDIP 2AMFA 2HQ1A 4Y8VA 1YB4A 3GVXA 1HDYA 3DBHA 1MGOA 4MKZA 2P4HX 3IS3A 1X7DA 1XELA 3VHRA 2X5JO 3TZHA 5BSHA 3QVTA 1N1GA 3PQFA 2V6BA 3QJ5A 3GDFA 2YV1A 4ZICA 1UP4A 1BXGA 1SAYA 2WWRA 4MP8A 4NBUA 3KEQA 3K31A 3AOGA 3MTGA 1QORA 1UDCA 5KKAA 4A27A 3TL2A 3PDJA 5F1OA 5IDYA 5AYVA 1HRDA 4OM8A 4JK3A 3G1UA 4IZIA 3H9EO 4E33A 4DC1A 3I23A 3G0OA 4BVAA 4WOJA 1ARZA 1M2WA 1RKXA 2ZB4A 1DIGA 3ON5A 4JP3A 3RFVA 3ORFA 4YAGA 1YONA 2Y0CA 4AJ4A 5KIAA 2VHZA 2B4RO 4A26A 3DWFA 3K2EA 2ZB8A 4PVDA 1HF3A 4P38A 4P4NA 2P9GA 5HRUA 1J5PA 2FPGA 2HKIA 2IE0A 2Q2WA 1U3UA 2NV6A 1P3DA 2UYYA 3ZW9A 1ZK2A 4N5LA 2W2KA 4BGUA 1P1FA 2Q1WA 1NPTO 2PFGA 3AJRA 3OEWA 1D1TA 3GEMA 3EY4A 2EV9A 1LDEA 2EP7A 5BT9A 1B2LA 3PYLA 4XX0A 3F47A 2GN4A 3NT2A 3WFJA 4CL3A 3GF4A 5A03A 2GO1A 3RU7A 2C20A 4I8XA 3ZU3A 1RJWA 2AE1A 5DBIA 2YW9A 1BDMA 4EUFA 3E18A 1NR1A 4I5GA 3GZNB 5G2OA 2G1UA 2I99A 3B70A 1JLLA 3GAFA 4CMGA 2NSDA 2VHWA 4ND2A 3OIDA 4GSLA 3SJUA 3AUAA 3ZV3A 4CUJA 4CR8A 1I3MA 4BNXA 5CG1A 3HE3A 2X58A 3UKOA 5I7FA 3VKUA 2IZZA 2HSDA 3KRTA 1PJBA 1ZVMA 3WTCA 4PG7A 1YVEI 3ICPA 3OJLA 3RC9A 5CAEA 3I9MA 3WLFA 1GEGA 4BNZA 1HE2A 4HNGA 2JFGA 3GRKA 1RM0A 4IS3A 4J7XA 1V0JA 3ICCA 2QX7A 1HDZA 4HP8A 4JBHA 5TJHA 3HJAA 2FR0A 3FNHA 4CMEC 1O0SA 3NJ8A 3DQPA 3GQVA 1E7RA 4WPGA 1ZKMA 1U28A 4WLUA 4DUPA 5L4LA 3RBXA 2D2IA 4TMFA 5H82A 1NR7A 3G1TA 3PHLA 1G1AA 2GRAA 3DZGA 3ZWNA 5G4LA 5TJ9A 4AICA 3DXFA 1P0FA 4MP3A 4ALJA 4CJXA 2ZQYA 3HDQA 1E3EA 1JWAB 1DO8A 4UREA 5ICSA 1ZBQA 2RHRA 1VJTA 3C7AA 1UR5A 3E9MA 2NVBA 2JFFA 3WICA 1XKQA 2BRUA 3CTMA 2I5PO 4H7PA 3DZBA 3I4CA 4PLVA 1T2DA 4JXKA 1PGQA 1C1XA 4AJOA 3U9LA 3C7DB 2I3AA 2E48A 1K6XA 2QRLA 4P8RA 4YJGB 3GNTA 4Y6SA 2VHYA 1Y6JA 1QG6A 4R01A 2A4KA 1O8CA 1I2ZA 4PZEA 2FP4A 2YJZA 2C7VA 5AOVA 4ID9A 1BRMA 4D79A 1RM4A 2J8ZA 3JCZA 1B15A 4YWJA 4IQGA 4CUZA 3JD1A 3ROQA 3BTSA 4OOEA 2FN7A 5EESA 2W90A 3MTJA 2VZ8A 4E2WA 5I7SA 3RC7A 1UAYA 2PZKA 5B4UA 1O5IA 2RCYA 3E9NA 4D3SA 4BO3A 5IF3A 1ZSYA 4W82A 3MJTA 3JQFA 3K9QO 1LA2A 4NBRA 3SC6A 3PK0A 4CM7A 3V2UA 4J0FA 3ITDA 1KVTA 3CUKA 4CQLA 5IN4A 1NQOA 5HS6A 4E2ZA 1U2DA 2ZB3A 2QQ5A 1D7OA 3GY0A 4UVDA 3IMFA 4O1MA 1XWFA 3DZHA 1ADBA 1DOHA 3DB2A 4YB8A 1X1EA 3GH3A 4R4JA 3DOOA 3DMYA 4A03A 1T25A 2Z5LA 3FN4A 1G6KA 3S2FA 3NT5A 4XQCA 1EK5A 1UUFA 3AUUA 2WYWA 1CYDA 4JLWA 4XQEA 1BWSA 1EE2A 2HUNA 1A4UA 1XGKA 2JD0A 2VRBA 4WECA 5G4KA 4JP2A 2Q1SA 3BHMA 2OZPA 1LLUA 3LLVA 3VDQA 4RF4A 3ZU5A 1E6UA 1XR3A 4MVJM 4JNKA 3Q9UA 3H65A 3RSHA 3KEOA 4GMGA 1X14A 4HFRA 4DQUA 3V8BA 4NFHA 4CMCA 1A5ZA 1TI7A 3GVCA 4QSMA 2VZ0A 2YFHA 2YFQA 4M49A 1AGNA 1PJSA 4YRAA 3Q11A 1WWKA 1ZXLA 1TT7A 1YL6A 4BO5A 1KYQA 3GPDG 4N18A 1KVSA 4ZQEA 5KNLA 1SNYA 1ZMTA 4CQMA 1PS8A 2PKRA 1E3WA 2BI7A 4R1UA 4GVXA 1DAPA 2YQ4A 4RVSA 3ST7A 3QHAA 4B7XA 1PGNA 8ADHA 1DHTA 1ENYA 1KC3A 4CM9D 4NIMA 2DBZA 2NVUA 3PEFA 3GZ4A 2PH5A 4GBJA 2E49A 1YBMA 4XR4A 4F45A 4KWIA 2HU2A 2IEBA 3DHYA 1QMGA 3ZHXA 3WGHA 5KWEA 1KEVA 3P2OA 3VZQA 2YHIB 3R3SA 4AVYA 4IDGA 1DLJA 4Q3DA 4BNIA 2AG8A 2OP0A 2DT5A 3TNLA 3OP4A 5B37A 1E7MA 2JHFA 3OJ0A 2QRKA 3PP8A 4YA6A 3GOHA 4AJEA 1OI7A 4IZHA 4OXNA 5A3JA 4B7CA 3AI2A 1ZIDA 4Q3EA 3U4HA 4BMSA 4FW8A 5A9SB 4BNVA 4I9HA 3ZWOA 2XOXA 4TRJA 4RV9A 5JDIA 3PDUA 2BFMA 1PZEA 3S1LA 1TT5B 3AUSA 5BSEA 2HMVA 4LCJA 4DGSA 2BGMA 4YDRA 1GV1A 2BI8A 5ITVA 1NPDA 3P7MA 4W9NC 2YQ5A 3JQ8A 3GFBA 2Y66A 3S2GA 1HLDA 1B16A 5FEUA 1YGYA 2J3IA 4J49A 1V3TA 1U8XX 4B8WA 1KVRA 3PLRA 4FFMA 3PZBA 2BKAA 4NK4A 3GT0A 3L6DA 1Z45A 2VYNA 3BHIA 2HJSA 3W1VA 2Q99A 1G0OA 4J1NA 5JY6A 3I1JA 1KOLA 3DFZA 1VLLA 2HJRA 4JCOA 3KYCA 4BB6A 1QYDA 3F4LA 3E5RA 1D3AA 1D1SA 1LDYA 1GQQA 1VL6A 3KUXA 1XA0A 1RYEA 3CKYA 3DZFA 3R6DA 3WJ7A 4CLXA 1DSSG 2BHLA 4FPXA 5L7TA 3FNFA 1T2CA 1IB6A 3FPCA 2RAFA 4GI2A 2NTNA 3AI1A 2YYYA 2Q4BA 3ITKA 1LRJA 4CV1A 5B4VA 1JKJA 4IQ8A 4L73A 4YT5A 1YQXA 1P1KA 3HDJA 5KTKA 3IJPA 5I7VA 3S55A 3RC2A 4CM1A 1ZO8A 1I32A 2EIHA 3B20A 3KYBA 4WLEA 4FJ2A 1Q7GA 2HAEA 4MIEA 4D0RA 2JCXA 5AXCA 2Q1TA 1RWBA 1MX3A 2GZ1A 2J5RA 3E82A 3MJVA 4IY1A 4PLCA 1X0XA 4Z6KA 5BNIA 1KETA 1O95A 3UHAA 4YJGA 4ONEA 1BG6A 5THQA 2D4AA 1LC0A 2YY7A 3LF2A 4E0BA 3ZHYA 2P5UA 2P9CA 1WXDA 1Y8QB 4YT4A 2VYND 2I66A 3GRPA 3LC7O 2I9PA 1Q7CA 3OMLA 1EDOA 1EVJA 4HFMA 1GY8A 5L3ZA 4RPHA 4MVJI 3WDSA 2P4QA 2A35A 5JFOA 4CM9A 4J1SA 3F46A 2O3UA 4U7WA 3KSDO 4EITA 2EW8A 1QLHA 1E1KA 3GHYA 3CIFA 4IJVA 4XA8A 2RHCA 4NBTA 2GZ3A 2C5EA 4RZHA 4MPDA 3SLGA 1XLTA 1PS9A 3CH6A 5T8KA 2WD7B 4XIJA 1LLCA 1SPXA 2VTDA 1YKFA 4LK3A 4E4YA 5A5FA 3HG7A 5K6AC 3MOIA 4GVLA 4TZKA 4O5OA 3G49A 3GMSA 5TNXA 3WGOA 5JDCA 5CDUA 3QLJA 1GUYA 1YQDA 1QV7A 2ZATA 1C1DB 1A9YA 2GNAA 1T4BA 1P1HA 1LX6A 1YE3A 3B6ZA 3C85A 3NTOA 4W9NA 1UP6A 1H5QA 4GX1A 2AEFA 4AJ1A 2LDXA 2W8ZA 1U5AA 1ZNQO 2Q3EA 3Q3CA 4ESOA 2X7HA 5BNFA 5BSGA 1LNQA 1VE9A 3GUCA 3WTBA 1IYZA 1NAIA 1M66A 4BNUA 3EC7A 3PWSA 4DYVA 2UUOA 3GNSA 4IDEA 3I6QA 2PKQP 1PWZA 2TMDA 4YR9A 1PL7A 2B5VA 1WVGA 4FC7A 3KBOA 4BNLA 5BSFA 1ZK1A 1GZ3A 1H6AA 4EJ0A 5DZSA 1UZMA 1P44A 1FDVA 1WAMA 4QO8A 1AXEA 1T26A 3MOGA 5ILOA 2HO5A 2G0TA 2VHXA 2UV8A 3LZ6A 4UUMA 3ZWBA 4Q39A 1W8DA 1U4OA 4I9NA 1VL0A 1NX6A 3AM5A 4XEHA 2ZYGA 2QYTA 1NQTA 5AQ1A 4A5OA 2DBRA 4PLPA 2RIRA 4MDHA 3NUGA 4HKTA 4ND3A 4XIYA 4MP6A 3M2TA 3KTDA 3KYDA 1XDWA 4HFNA 1LDMA 4RZIA 1NPYA 1DFIA 4NK5A 2ZIZA 3GVIA 4ALMA 3TPCA 1K3TA 1H94A 1PJ3A 4J6FA 2NVUB 3CMMA 3AI3A 1C14A 2DBQA 3DL2A 3OQBA 4KUHA 5JLAA 5G0VA 4CM4B 4O59O 1N1EA 3TDKA 2VNAA 7ADHA 2J5KA 5DBGA 5L51A 2A94A 3H5RA 4E5PA 1LBEA 3D4PA 4NFSA 1LRKA 2P9EA 3DTTA 3JQGB 3ZH2A 3ZHZA 5KVVA 2Q49A 2WYVA 3C24A 3QP9A 4CMJA 1OOEA 1R4NA 3GDGA 4NFYA 1YDEA 2W2KB 3EGOA 1K6IA 3UGKA 1GR0A 4ND5A 4CMIB 3GUYA 4TQGA 4ZGWA 4IINA 2VT2A 4Z3KA 2OFPA 1LDGA 3GN1A 4MVJE 3HB5X 3JV7A 3WOHA 2CNBA 1M75A 2JD1A 3H2ZA 4TRNA 2AXQA 1ORRA 2BH9A 1B8PA 3AU9A 3GEDA 4S3MA 1I3NA 1W6UA 1SC6A 3D1LA 3HHPA 3IP1A 5HTOA 4R54A 3T7EA 4LISA 2ZCVA 4BNTA 4CPDA 3L07A 2GYYA 4D41A 3SVTA 5A05A 2BFPA 4MKXA 1VKNA 3ZV5A 4R1NA 1ISFA 4DPKA 3IJRA 2FSSA 2C82A 2NTJA 4WOKA 1O89A 2BFOA 4WE3A 4PLHA 3CINA 3JTMA 1U7TA 2O2YA 3QVWA 3ZCXA 1CERA 4CLOA 2D1YA 3GGPA 4O6VA 4CM3A 4D42A 4DPMA 4BV9A 1UXJA 1VRWA 1DJNA 5IN5A 1JWBB 2IXBA 1OZAA 1H0KA 3DZJA 5G0WA 3AM4A 3GAZA 1C0PA 2PV7A 3RD5A 4YJDA 3I9LA 4B8ZA 5IXYA 5EL0A 4YRBA 2G76A 4F3YA 1IOLA 1DBVO 2O3RA 1TT5A 4I5EA 3JD2A 4E30A 4M55A 3RU9A 1JVSA 2PD6A 3JQ9C 2JFHA 3ZU4A 4F6LA 3ANNA 1L7DA 1UXIA 4K26A 4RVGA 4BKOA 3INRA 3IC5A 2BF7A 2V6GA 3OF2A 4DXHA 4HY3A 3BMOB 3WSWA 3ABIA 2PD3A 3WWYA 1UH5A 3RKUA 4PIVA 3R0IA 3LU1A 4CMAA 2J3HA 1W4ZA 5EINA 3ROPA 4II3A 4YXFA 1HLPA 2Q45A 1O6ZA 4GPD1 2PZJA 3ZHBA 3P5SA 3V1UA 1HZJA 1JW9B 4OO3A 4BNKA 4GWKA 3VVBA 3VPXA 3VZSA 1UJMA 3P19A 1KIFA 3AY6A 3E5MA 3FNGA 3GK3A 1EVYA 1X0VA 3H7AA 2FMUA 3SEFA 3TN7A 4LSWA 2EEZA 5JDCC 4FGWA 1IL0A 4WUVA 1M6WA 3UOGA 1E7WA 4GWGA 2B4QA 3AY7A 4NDNE 3SBOA 3PVZA 1PZHA 2H5LA 3HN2A 4GH5A 2B37A 5DP2A 3H4VA 2ZJ0A 3ONFA 3U4CA 3W8FA 2ZYAA 2GASA 4PCVA 4MO2A 4U0KA 3FTPA 1PGJA 3D3EA 4RF3A 2V6FA 1DIRA 1R4MA 2EJVA 1LU9A 3A28A 4XDYA 4C7JA 1QRRA 2QZZA 1DEHA 1PIWA 1H6BA 2ZTMA 4A10A 4ZVVA 3RUAA 1HEUA 4RPJA 1E3JA 3ADPA 1JA9A 1EUZA 3EMKA 4MVJH 3EDMA 1U9JA 4CR6A 3PYMA 2R6JA 3AK4A 5C7OO 4PRLA 3IUPA 5IG2A 4HWKA 5TF4A 5MGBA 5C3MA 2PY6A 2HMTA 5F1KA 2VYVA 5I9NA 1SOWA 3VH2A 5G4KB 2CD9A 4RLHA 2OO5A 3OECA 1U8FO 3CPSA 3SC4A 3ANMA 1BVUA 2GLXA 4XYMA 4BIIA 1ZXBA 2B36A 1HYGA 3L6OO 4DLBA 5ITWA 2PGLA 1NAHA 3JQAD 3HDYA 1P33A 4DL9A 3QRWA 5GMOA 1U2GA 2ZQZA 3PXXA 4EYEA 3NKLA 4QFCA 2J6IA 1W0CA 2NACA 1VC2A 1KVQA 4PZDA 4YAIA 1LQTA 3QQPA 1I33A 4F46A 4ZU3A 3HFSA 3IKVA 5TQVA 1TVEA 4XGIA 4NBVA 4P4LA 1E3WB 1NFQA 3A4VA 4Y6PA 2O7SA 4KOAA 4ALNA 4KQXA 5BNTA 3CE6A 3PFWO 3Q6IA 1ISIA 2D8AA 4MIOA 1LSUA 4QO7A 3E6AA 1ZK4A 1MA0A 2UAGA 1E92A 3BMCB 5A9TA 4WCDA 3KLMX 4U5QA 3LQFA 1MG5A 3W4JA 1DRWA 3JQGA 1P1RA 2PWZA 1Q1NA 1N7HA 4PG6A 2FPPA 4EGFA 4PFJA 3UN1A 1YL7A 4A2CA 1E3SA 4BO4A 3TJRA 1PGPA 1HE4A 1GV0A 1DJQA 1JAXA 1R12A 4GAEA 1IULA 1F0YA 3MJSA 1EMDA 1MFPA 3V1TC 4A73A 2CVQA 5JPIA 1YBAA 4H15A 4JX8A 4XZ3A 3FD8A 1A7AA 4MVJG 4A7PA 3RFXA 2DC1A 2Q46A 1N9GB 1P74A 4NJMB 1FXSA 2ZCUA 5THKA 3TZQA 4BKRA 5I8WA 3D64A 1ADFA 3I3OA 4L8VA 2C7GA 2C0CA 2DUWA 3DFUA 3EZLA 1P0CA 1ZMOA 4ZA2A 1CRWG 2EJWA 7MDHA 4B3HA 4GKBA 3WBBA 2Z1NA 3LSYA 4CLEA 4WLOA 4M86A 4CM4A 4YACA 3JQ8B 3MWDB 3HADA 4R9SA 5FI3A 4J1QA 4LVUA 3ONEA 1C3VA 3OQ6A 1N8KA 4UUOA 3KSZO 2BFAA 1K6JA 3GC6A 3QW2A 2DFDA 2BLLA 3F6YA 3EW7A 1E6WA 3LF1A 4L76A 5EPOA 4AJJA 4KP7A 2H9IA 5AXBA 5JCXA 3H9QA 1FDTA 2WJPA 1C0KA 4UVHA 2O48X 4S1VA 2VWQA 1GFSA 4ZHSA 3Q2IA 1ISHA 2FRDA 4CV3A 4ALIA 4INAA 3E1KA 4ND1A 1PJ4A 3LC1O 4Z0HO 1Y5RA 4PVCA 3E03A 4AJPA 3DTYA 1LSJA 4GGPA 3U09A 3UW3A 4QUKA 2PGDA 2IZ1A 5KKCA 3DAFA 3IKTA 2EKQA 4KTTE 4D43A 3OJFA 1U3WA 5L4SA 3BMOA 2DU8A 1U5CA 3MCVA 2V7PA 3JQAA 5U4QA 1HETA 1EDZA 2WMDA 3M6IA 3W4KA 3WNQA 2F1KA 2I3GA 2EG9A 2J3KA 4FFNA 3ZNNA 3JD0A 5DCYA 4IJKA 3IQDB 4TWRA 2VN8A 2Y1EA 5KJEA 4PLFA 4WNCA 2WDZA 3TZKA 4E6PA 2VOEA 3RI3A 1NQ5A 3Q1LA 4HX5A 1DXYA 4QFDA 5KCZA 3I6IA 1DFHA 1S7CA 3I52A 4CODB 3DBLA 1CQIA 2C5AA 2IODA 1QXSA 3B1KA 3RBZA 3UCXA 1LQUA 2TMGA 3A1NA 2NQTA 2Y68A 3F1LA 4IXTA 4QEDA 4DMMA 2C2XA 5T57A 1GCUA 4FJ1A 5TT1A 1WPQA 3RUHA 1YRLA 4JGBA 3GGOA 1YQGA 1MC5A 1VM6A 2X9NA 5A3VA 4Y67A 5G0TA 1UZLA 5GY7A 3JD3A 4BHTA 3FCOA 3ASUA 4BQRA 3V2GA 4LVCA 1EUCA 4GL4A 2JAHA 1GPDG 1AHHA 4R51A 4DQVA 3PRJA 2VT3A 4PLYA 3OJEA 5TC4A 3GNQA 5KJCA 3WWZA 1GPJA 4W7HA 2FZWA 5A04A 3GG9A 3K73O 3EVNA 1DRUA 1Z73A 2GD1O 2SCUA 4CV0A 4KTVE 2CMDA 1EVIA 4G65A 4BNJA 4AFNA 2FHSA 3WGGA 4FOSA 3FNEA 3VTZA 5IDXA 1YH3A 1T1SA 3NJ4A 3NGLA 1T2EA 3HUDA 3M2PA 1GQYA 1P31A 2I6TA 2ZKLA 3FBTA 3JYPA 4BO0A 2IXAA 3R1IA 1R4NB 1ADCA 2DQ4A 3BMQA 5FWNA 1TLTA 1OAAA 3ZWYA 4E2XA 2CUKA 3HZZA 1ZEJA 4RVUA 5HS4A 4QECA 3VH3A 1E3LA 2NLOA 4D3FA 5FFFA 5CHEA 4ZQBA 1WP4A 3IL2A 4OXKA 1PJTA 3ZWMA 4LGVA 3D5QA 1NYTA 4J2HA 3ZN2A 4OYRA 3IAHA 1B3BA 1ZCJA 3JYQA 3UXYA 5TRTA 3TSCA 3KV3O 1ML3A 1E6EA 2VQ3A 1PJQA 3G79A 1F06A 3V2HA 1NWCA 2CSUA 2YDXA 3GLQA 1JVBA 2X0IA 2ZK7A 4ZQGA 4XQ9A 2H1SA 5COAA 2NVWA 4C7KA 5CDGA 3KLPX 4PLTA 4M89A 3QVXA 3NV9A 3WGYA 1IY8A 1HTBA 1ZUD1 3M1AA 3WFIA 5CDSA 4UEJA 3CXRA 2B83A 2BELA 1KS9A 5AVOA 1DC6A 4ALLA 3K96A 1WDKA 1KVUA 4RVHA 1OC2A 1PJ2A 2HCTA 1D4FA 3S8MA 5LCXA 3QVSA 3CZMA 3L77A 4NPCA 3KHUA 5COBA 1Y81A 4JBGA 4WLNA 2AHRA 1UXGA 4DBZA 4K28A 4FN4A 1E77A 4X54A 2O7QA 1V3VA 3PTZA 4J2OA 4DPLA 2BGKA 1LSSA 1NVGA 3DR3A 1JTVA 1DC4A 2D5AA 3ANLA 1LI4A 4E2YA 3D4NA 3WGIA 1LLDA 1I3KA 4RGBA 4BNYA 1FDSA 1BXKA 2GN8A 1OBFO 4RQUA 1PJLA 2G82A 4NJMA 3VPGA 5C5IA 2YZ7A 1UP7A 4YT8A 1JKIA 4TSKA 2CZCA 3WNVA 4ZN6A 4GX0A 1Q0LA 4G2NA 1QYVA 2PLAA 3PQDA 4DTIA 1VJ0A 4BS9A 3IOYA 4GGOA 4J9UE 1H6CA 4WCFC 2POQX 2VRCA 5DF1A 4Q9NA 3PHJA 3C1AA 4I1IA 4KWHA 2O3JA 4ZD6A 5B12A 4BB5A 3WQSB 3LK7A 4IDBA 1ZFNA 3OH8A 1HDCA 3TL3A 3DOCA 5A02A 2DAPA 4TRMA 3A06A 2O50A 4GKVA 4P22A 1X15A 5LDGA 5IXSA 4M1QA 4OGWA 5T67A 3AOEC 1EQ2A 5EIOA 1KEUA 3EYWA 4EEZA 5TIIA 3JQ6A 4Z9XA 1IHYA 4NU6A 1V9LA 4N54A 2VUSA 2AA3A 3GR6A 4RVFA 3OIFA 5KJFA 2VWGA 1K5HA 4R16A 1VSUA 2CVZA 2RBEA 4BV8A 4M87A 1F8GA 2FPIA 4IGEA 4J43A 2O2SA 5F3RA 3K30A 3UH1A 1JU9A 3JYNA 3N74A 3BTVA 3RC1A 3PJDA 2PTGA 2EXXA 3ZNPA 4CLRA 2OBYA 3WS7A 1A71A 1PL8A 2C07A 4CMHA 3U4DA 4J7CA 1PS0A 3BXXA 1HDGO 1ZEMA 3DC2A 4A0SA 3FI9A 4RJTA 4LRTB 1QLJA 3WMWA 2VOJA 3DBVO 2CDBA 2X0JA 1YJ8A 1TXGA 1WDLA 3NDRA 5F21A 2DUUA 4Q3CA 2EKLA 3NRCA 4BNGA 3L4BC 1XIVA 1XCBA 2X6TA 4BNFA 1Y7TA 1V35A 4FDAA 2O3SA 2A92A 1XYGA 1JN0A 1GU7A 3RWBA 1I2BA 1I3LA 4EDFA 4J90A 2AE2A 1P77A 1ONNA 3NGXA 3PWKA 4WEQA 1Y9AA 3FBGA 1BXZA 5HBRA 1V6AA 5I8ZA 3UCEA 1ENOA 4HFJA 5C7IO 2D3TA 2RH8A 3GPIA 4Q3AA 1WDMA 2HRZA 5CDYA
chains in the Genus database with same CATH superfamily
1O9HA 5AK4A 5IZCA 4KMMA 1SBCA 4OB7A 2XE4A 4R83A 4PYKA 1L4LA 1I6WA 4ALLA 5AIAA 1KI9A 4B44A 4KDEA 3DMFA 1HR0B 2HR1A 5BWBA 4HADA 3K9BA 1KJQA 1FU8A 2KJQA 2Q0QA 1R15A 1XHLA 3E22A 1L5GB 3DONA 3TX6A 2C9YA 3S1SA 2V0NA 2H54A 4KAFA 3DZCA 4QGHA 4HGPA 1KQGA 3DW1X 4C76A 1B7GO 1RWNA 1WF3A 3AB8A 3I2FA 1NWHA 3KM0A 2XYHA 4UBLA 4YPFA 3RBVA 5J1SB 1TM5E 1YULA 4EFMA 3PJEA 5K3BA 1CUDA 3TTTA 1TNDA 5D7NA 2HK8A 1KARA 4XYEA 2HFKA 4NNJA 3VO9A 4UHDA 3EQZA 5BV2P 2DFKB 3JXEA 4QXAA 1U1DA 5PGMA 4O4HF 1CXZA 4URFA 1NT2A 1NL3A 2NADA 3MB5A 4TWBA 3VVLA 4OI0A 2HZBA 3A9CA 1ZJZA 1A9RA 3HKEB 3LFHA 3OA0A 4QHSA 4ZKDA 5AHWA 3PRYA 1LBHA 5DISB 1RHQA 4BRSA 4BRWA 1VB3A 3GD7A 3RKSA 4V0MA 3A27A 1YWGO 2XDQB 4YI3A 5FTWA 5THXA 3AJ9A 5C5CA 1Z25A 4LF7B 3HYSA 2A9JA 4PSDA 4GL2A 2RGBA 3UA4A 3V6LA 5BVHA 2J48A 4JSYA 4V0ME 2ZIGA 1CUHA 3UF0A 1EAYA 1VGRA 4O0LA 3WGMA 2JJ2D 1PSDA 1W5EA 3DO8A 2Y27A 4TTTS 3TNJA 1FEZA 2OFFA 1AY0A 3AY3A 5KPJA 3EAQA 3QMMA 2NIPA 2UZ3A 4MQEB 4ZAXA 4AMBA 4QBIA 5BR1A 2VJPA 2YHIA 2YIDA 3CG4A 1HT0A 2QRJA 3MAGA 3O9ZA 3O92A 2DY0A 4Y1FA 4A3SA 1Y34E 3A58B 5IABA 1DO0A 2HBRA 4CUKA 1GITA 1D2AA 3VJLA 1L8QA 2Z2YA 1I6KA 1R5JA 5EUCA 1N2XA 3KR1A 3T5BA 1X3LA 3VDXA 4AJ9A 1T4GA 4CT0A 4V1CA 2OCIA 2WZCA 3OHSX 3Q4GA 3TGLA 1PW7A 3CZPA 3GCXA 3U4GA 2PJRA 2FU5C 1KI7A 2R96A 3OQVA 2PRKA 3P97A 4PGFA 5ADUS 4CEJA 3L18A 2XXJA 1YZKA 2IRWA 1ZA2A 4FT4A 5JFTA 4D1YA 4N7BA 3UPUA 3WQQA 1PT7A 2P3QA 1DC5A 3MJDA 2ORED 2YC4C 2C8KA 3GZNA 4B4UA 5JMWA 4RTKA 3OSZA 1NATA 1OGYA 1M74A 2FLWA 4ZARA 3UUWA 2C7BA 5FJIA 5EJ4A 1RM5A 1FY2A 1Z4KA 4IDDA 3T61A 3Q0TA 4G5RA 4XJVA 5TT0A 3LLMA 2R4QA 2XIJA 3A70A 3GLTA 5ALNA 2IYRA 4EMTA 2GCGA 1VG8A 4V39A 3T3GA 4LX0A 4RAQA 4GQAA 1E5XA 5SYAA 1Y48E 1UPXA 3KAJA 3QX7A 4LW8A 1EBUA 3SC3A 2C84A 5D3QA 3GP3A 3IT2A 1ZP6A 2B3TA 3OOHA 4N7RA 5AM1A 1IJFA 3FROA 3KPJA 4G5YA 4HQFA 4NKRA 4EAQA 4QDKA 1B6SA 3ZJ4A 5H0IA 4B3JA 3IAFA 5BWLA 3WV4A 8LDHA 5JYDA 4PO8A 3EK2A 5AKLA 1SVLA 2PR2A 2IA5A 5CNJA 4BN0A 4CIDA 5I7EA 2GJ9A 3OZCA 2Q5EA 3QU5A 2VJQA 3JQ7A 5CK4A 1GL3A 3F6SA 4BNNA 4CW7A 2C95A 3N9IA 4XUEA 4JLOA 3IQXA 3R4VA 3PHIA 2A9FA 1M76A 4QUHA 2PU5A 4KIJA 3RAEC 1KR5A 1LKZA 2GWRA 4L02A 3V8EA 3V8VA 1YMQA 3ILYA 4GX2A 2RHGB 3RTAA 1C30B 4NS1A 3L4JA 1HY3A 4RAOA 4EW2A 4YJHA 3DW3X 1MOPA 3KJEA 1QS0A 4DJTA 2AOVA 4L95C 2EKZA 1JDVA 1SVMA 4JLKA 2XBMA 5F2NA 4G4GA 4B9EA 2V9CA 4X62B 2FR8A 2E5LB 4YRGA 5HRCA 5G41A 4UEOA 3TX2A 3P9KA 1WETA 3T0IA 3AESA 2IHTA 4GOOD 5CBPB 1L7PA 3RVLA 1XEFA 4KXQA 4AKEA 3RV3A 1PJCA 5ELXA 5EJGA 4B4OA 3UJ8A 3BK7A 1ZCBA 3TLYA 4DWVA 4BAZA 4CM8A 1PV4A 2C92A 1I14A 3O1HB 2OPHA 3WJAA 1XZ8A 5H80A 3OICA 5JZMA 2IFTA 2GERA 3QXGA 1Q3KA 2PUEA 1BKDR 3T5GA 4QTTB 2QMQA 4UHBA 3KO8A 1FNNA 1JKFA 3BM5A 5I45A 4J3JA 2BH2A 1A4IA 1ZCZA 1U9ZA 3O8LA 4IDCA 1C4WA 4OIMA 3W3AD 4Q1BA 4NS4A 2RKOA 3EXIA 1QS0B 5FYDA 4OGLA 3ZK8A 4LXXA 4F6CA 5I9TA 3TFQA 1JHDA 1YK1A 1SVIA 1RR6A 2JAPA 3ZHRA 1IHXA 1MLDA 3ZDCA 1BGWA 1OZGA 4ZOEA 1ECJA 1FFDA 2G06A 1KPGA 3LLCA 3ICOA 5T4BA 1IK6A 2GCNA 1DBSA 1OWNA 4MYTA 4OG2A 1T8SA 5IZ4A 1KR2A 4TKZA 3I9JA 1BNCA 1A0OA 4AD8A 2YY6A 4EVIA 5ICCA 3A2KA 5HQ3A 3I58A 2HRBA 4YJ3F 4CM8B 2HMWA 4URYR 3MN1A 2W70A 1XU9A 1J8DA 3Q3IA 2I22A 3KAKA 4RVOA 3FLEA 2QOEA 2YXBA 4UTNA 1XRPA 2PZAA 4HQKA 1RDFA 4QYWA 2GCOB 2HBYA 1DBIA 4N3BA 2P5YA 3L9XA 2WWHA 1JG3A 1SHJA 3MIIA 1B6TA 1UQRA 4QXRA 4WGFA 1OI3A 4OYHA 4BFWA 5BUCA 1C1DA 2VC2B 3BBPA 3Q98A 2ZUTA 3CS3A 1DCKA 1M0TA 1Y6FA 2PGIA 3ZDDA 2QTWB 1QJCA 5AMXA 3INTA 3N6XA 4XB2A 1KOFA 4BBJA 1QG0A 2H08A 3DWEX 3H16A 3WGJA 4YCCA 4Z7JA 4B2PA 1YFLA 4Q3KA 4KVZA 3SXPA 5CXXA 5JTTA 3NWPA 4TLEA 3VKVA 2GZ2A 4N76A 3VVMA 1E2NA 1W29A 1HFKA 2Y93A 3O0TA 4ZCMA 3NZEA 4EKEA 4HDSA 4RK0A 3DMGA 4MV3A 1JYSA 5DTEA 1YVPA 5DGTA 4BOYA 4M4SA 3S5UA 4LE0A 1GKIA 2WTMA 2NV2B 1SCNE 1J5XA 4RHFA 1GZSA 4PTZA 5CNKA 4AJHA 2DR2A 1VJDA 4CM6A 4GLFA 4BMVA 3EPKA 1FMTA 4HNAB 4CDRA 3W4IA 2BSXA 3DEHA 4XDGA 2X0FA 1N7JA 3WLJA 4C5AA 5E6UB 1HDRA 1EG7A 2WHPA 1RWWA 3QYFA 3T06B 1V8DA 1VIMA 2J7PD 4AJLA 5CLFA 4XD7A 4IRXA 1KP9A 4HPJB 4MW1A 2I8CA 1V7PC 2BFFA 3DZKA 3T41A 1V26A 4LX8A 3WG9A 1GG8A 2ZUEA 3BCSA 5CEFA 2R1VB 4FFLA 3KJXA 3PQ3A 4R5MA 5AW7A 4MA4A 5ERYA 5IAAA 3IAS1 1NVWQ 4ZRNA 3TXYA 2Y1CA 3RG8A 1EVZA 1LDBA 1P8AA 4XD2A 1WDTA 3CCCA 4X7MA 4XGQA 4BMPB 1DPFA 1RYFA 1TX4B 1L7EA 1N2HA 3CLHA 4M9RA 1QONA 2GUGA 2F1HA 3BWEA 5REQB 3ITEA 1T4DA 1H3FA 3NWOA 3OKAA 2PA3A 1UC8A 2YN0A 1XXHB 1HDOA 2ODEA 4URXR 4CTKA 3SLKA 4FCTA 3VH1A 1O9BA 1FF9A 3DBIA 3C1UA 3BL5A 1EUDA 1JILA 2XYVA 1RQNA 4E21A 1NDHA 3GEPA 1CZNA 2REQB 2ZW9A 3N3AC 1PV1A 3R5XA 1NM5C 5L7WA 3FE2A 2VJCA 3N8DA 3PQ2A 5E7QA 4AB1A 1H93A 5G0SA 1JSCA 3QX9A 4EAAA 5ADVA 4GPIB 2XOEA 3QYJA 2AVNA 1JJ7A 2CLHB 3KVOA 5AI4A 5JEEA 2PWPA 1GVNB 1NDQA 2W11A 3ZWDA 1D5CA 2NU6B 2QY9A 5EEGA 1KDOA 2D0OB 5AVXA 4BQSA 3BIJA 1Y7PA 3OE4A 2PRIA 3QWAA 3OO1A 2JK0A 1J39A 2EF1A 4L2IA 4AIRA 4TKLA 3MZ0A 4OEHA 1SCQA 4TT8A 4KXXA 4UMEA 4YYZA 1U7HA 3JR7A 3SU8A 3EEQA 4J0EA 2ZIVB 4YMVA 4LZWA 5ALXA 3E9CA 3W34A 4FMPA 2FYTA 2X0NA 2PGXA 3ZQ6A 1F8FA 1SOMA 2JJ2A 3JWEA 4ENSA 5AM2A 5CFRA 1XEWX 3O8QA 2IDJA 3EOZA 3H86A 3S7ZA 3T6KA 5DXJA 3ZDFA 3BJEA 5IEJA 5HQTA 1TIKA 1EU1A 3C16C 4LKOA 1Q2XA 3FFTA 2FZ4A 4P08A 4JROA 3IHTA 1P5FA 4TX1A 1WNTA 1X8XA 5FR2A 4XFJA 5NLLA 1XMOB 1WMAA 5LZ9A 4I5IA 1YC5A 4NCIA 1JA0A 1NF8A 5HA5A 3EQ6A 2E4WA 5LOVA 2JHAA 1UBCA 3V7FA 3DYIA 2D5BA 2WUFA 2H65A 4RL6A 5JAHA 4RO0A 3K5HA 2HF2A 2CXTA 3JALB 2I55A 1D1QA 1UOEA 3FWKA 2QTZA 3W6ZA 1FQKA 3T1VA 3FWPA 1SUDA 5LMCA 1O0CA 4FYVA 4C1NA 2I2XB 3FLAA 1NQVA 2FY8A 2YFKA 2I65A 1ORDA 3BYZA 1Z38A 1R88A 1TM7E 3WGVA 2ZQ5A 1EFDN 2PEZA 4KE8A 4RMNA 3BE4A 4K86A 2E6KA 1W94A 4WH0A 1T2AA 2VJMB 2B30A 4TV9A 2HLPA 3AU8A 1NFRA 3GH1A 2NZUG 3O8BA 4L5YA 4FGZA 5A4JA 1ZR2A 3N28A 1Q16A 5JSHA 4UZSA 3KUCA 3OZSA 3JPYA 1N2GA 1G59A 3IBFA 3SYLA 4QBKA 4FCCA 4EG5A 1ZRHA 3THXB 4MLPA 4I9FA 1P1BA 2X9VA 5IZCC 1MJGA 1W19A 2LVBA 3W5IA 2QJFA 5JBIA 1N7GA 2XWJI 4MNTA 4NEGA 2X1MA 1YDFA 2G09A 4RLFA 4RENA 5A6VA 2QYOA 5CH3A 3TRIA 1CS0A 4FBGA 4NXMB 4PCLA 2XEXA 2WHRA 4DLRA 2YOHA 4Y1GA 1M2VB 4B6QA 3M49A 4MCHA 2M6RA 3QYAA 4QO8A 4X45A 3C87A 3VR5D 4S1NA 4BZXA 4OAPA 2E4UA 4MV9A 4PSAA 4DC0A 4BJ1A 1WEHA 5MN5A 2PU7A 5G0UA 3OTIA 4EFNA 4JUDX 4KFRA 2WD8A 5CVCA 1BTOA 3HGQA 1GIAA 3PIDA 2VHJA 4UM9D 3R75A 2BM9A 4AY3A 3KQKA 2GXAA 2APJA 4ACBA 3W5CA 5KYTA 1YR1A 5C32A 1HKUA 4UHJA 4TKVA 1JLHA 3R3VA 4XQ0A 1TA9A 3P4UA 3C14C 3EVCA 2PL5A 4MAAA 2H51A 2DTDA 2RAPA 2QN2A 2XCRB 4E15A 4NF2A 3EHDA 4GM4A 1U0BB 1XTSA 3JZIA 3ZV6A 4BBZA 3GX1A 1U31A 4HAIA 5DHFA 3I6MA 1KZ6A 1DMRA 3O2NA 3PD7A 1KZHA 1CNMA 5JCZA 1WMEA 5FUMA 1LNZA 3VR5H 4RJKA 5FPKA 1OYVA 1MVOA 4YMLA 1CV2A 3OLQA 3PQEA 5TMBA 4BVFA 5JVDF 3NXKA 5IF9A 1W4CA 1G2OA 3L6BA 1XN1A 2ZRPA 4IX9A 2AZDA 1GAEO 3DKPA 4FX2A 2J07A 5DTJA 1QTQA 3ZZNA 3C0KA 4H08A 5E1MA 5FWDA 3VNAA 3KKNA 1JEYB 1GPUA 1I01A 3G6WA 4DEYA 1XD8A 5BR7A 3KFXA 1RTKA 4DLUA 3MJEA 2XMGA 3HY4A 5BQXA 2ZJ5A 1GDTA 3WISA 2QMZA 4HGOA 1EE9A 2RH5A 5K2OA 4JHXA 1E6MA 3JARA 5TQ2B 1YS1X 2L82A 4JKYA 3BIWA 2PL9A 1WMBA 4F04A 3NPMA 1U3TA 4UVEA 3U7QB 1E9EA 1QRUA 4NULA 1M67A 1YB1A 3EIQA 4ZT2A 1EJ0A 2OEPA 1A8UA 4WY8A 1VIAA 3WLRA 1B41A 2R5FA 3SQDA 2OP1A 1TTPB 4B45A 1SU4A 3V8QA 2WFLB 1UPTA 4QTYA 1Y1SA 4EGCB 1J2TA 1SJ9A 1VB5A 2GHIA 4FHZA 3HI6A 4IUCS 5EOVA 3ECSA 2Y1FA 2Z1DA 2GAIA 3EXEA 3KVNA 3QBVA 4P4GA 5CHYA 4YREA 2WILA 3RODA 2DJ5A 1CCWA 3T1HB 4YAEA 3K6SB 2CYBA 3NWBA 2ONYA 1FRFS 1K06A 1QYWA 2D0IA 4PHCA 1ENZA 1N5DA 4U2FA 2QG6A 4PN3A 3UENA 4YRIA 4A36A 4TL9A 3TUIC 3SCZA 3T94A 3K8OE 4YMWA 3ZZ1A 1YZLA 4MS4B 3W0LB 4JWKA 5C5DA 3EEOA 1EHCA 1NBOA 5KYGA 2BPOA 1IE3A 2VDKB 4UUAA 1ONPA 1E1QD 1B2RA 4A2WA 3ZJUA 1UPCA 2GESA 1LPMA 2I54A 3BBLA 2ONJA 3UKJA 1R8XA 3ESBA 4IXWA 3U7QA 3WHLA 4ZFNA 5FXMA 3HKCA 2CFOA 3B9BA 3IKMB 3BUSA 5A5EA 4JC0A 2AN5A 2QLTA 1S0UA 4YRJA 1CZUA 1BX0A 1W85A 2R8ZA 4TM7A 1X7WB 2HMSA 1ODCA 2W9XA 3DTVA 1WUKS 2BV3A 1U4NA 2WFLA 3LT4A 2NU9B 4B6SA 1UXOA 4D3DA 3U62A 2HEIA 5JBQA 1CJCA 1ESEA 3IDFA 5EPEA 4D4IA 1T29A 4TL8A 5A4MS 4UEWA 5T7BA 1IATA 1MJGM 4B3BA 4OYLA 4YRMA 1U1EA 1YR6A 4JR2A 3HB9A 4LCEA 3FH0A 5HX7A 3SJBA 2PGAA 1JNYA 7GPBA 2RONA 2C7OA 3W9BA 2JLVA 2H31A 3DHEA 4WNAA 1GZ5A 1YS4A 3F3SA 1DC3A 2AQIA 3NOXA 3NUZA 3GPLA 1B3RA 4OMCA 3T3DA 1RLJA 4C20A 4DJEC 1MPXA 2C5BA 4QVGA 2PLRA 1ZOSA 5JC1A 4EH1A 4Z9FA 4EATA 4IWXA 1JHZA 4KUEA 4KIWA 1AX9A 1CUJA 1HYEA 3ZZTA 1V3UA 2PRZA 4GMDA 2I7VA 2HPHA 4FKZA 4DMGA 4MWCA 2O54A 1ES9A 1T2UA 2V5UA 3GU3A 4JD5A 3QWHA 3DCJA 4RVDA 1ISMA 2A5GA 3LT2A 4I66A 3TFOA 2EW2A 3IDOA 4W1QA 4Y1RA 1JTEA 1R2QA 3N0XA 5ANRB 5FNVF 5ALEA 2PLFA 4G4SO 4KO4S 4DNPA 2HMUA 4IGFA 4P83A 2OQRA 3T38A 3U9TA 3VSEA 2R97A 3WB0A 2C29D 2YL2A 2GGSA 2ZPUA 5CM8B 5JW6A 2QN8A 2O2ZA 4UZFA 3NDJA 2PX6A 3AWDA 1K5PA 2ZBVA 5CVEA 1DXOA 5KNDD 5LQJA 3U16A 1U2SA 2DZDA 3N2GA 1Z6PA 2WBLC 4TLLB 5EWLA 3TRHA 4PN7A 5K6TA 1RVV1 1W0KA 2YZNA 1KS2A 4JJIA 1E9FA 5DP1A 1NXOA 2JFUA 1GADO 2FX5A 3QSYA 1FUYB 3LOUA 1GKYA 3Q7RA 1QK4A 5E4TA 1N5IA 3CLTD 1U0OC 3KQHA 4RF2A 1UJ6A 4JUIA 4U3JB 5GGYA 3VR3A 1JAYA 4BLSA 2ZVQX 5H5JA 1TL7C 3MW8A 1ETHA 3STWA 4BQEA 3U7HB 1P2VA 3MMPA 4IOKA 3W6NA 4KI7A 4K9NA 3LUFA 4YHBA 3WGZA 1L5SA 3UPTA 1M5RA 1RLTA 1YB2A 3DDNA 4L2IB 4F5YA 1C5KA 1IZ7A 1UXHA 1XP8A 2Y99A 2EERA 4MUAA 5BN1A 4YEDA 5BN5A 4W5QA 2JCSA 4AP5A 1XNHA 2FE4A 4DYHA 5JNLA 2HCFA 4EW6A 3L7LA 1ADGA 1W87A 1QZXA 3X2SA 4YRDA 2OXCA 1PEDA 3SP1A 1NY6A 1RKUA 3AEQB 3SDSA 16PKA 1CDOA 2R8OA 2VBIA 1OT5A 4ZVRA 4KV7A 5H81A 2LKCA 4CIXA 5T5QA 2W2XA 2XVXA 2YV4A 4EO9A 4GXNA 2LUOA 5T8KC 1QHHA 3OQ1A 4XJXA 4E32A 4TKMA 1ELOA 1EGQA 1VHJA 3DDHA 4BKUA 4F6RA 3IPLA 4Q0MA 4Q4HB 3LLSA 3E9EA 1LJ8A 4IMPA 3MJCA 3VNSA 1TM3E 3KQPA 3NV7A 1EIWA 4OATA 3KOUA 5C7LO 4U7FA 2ZZKA 2PGJA 3LKBA 1XEXA 2XMCA 1Z29A 2Z3ZA 1PGOA 3IOBA 1GUAA 1ZL0A 1MV8A 2AH5A 3N2LA 3KSMA 3PIIA 5D1NA 1LTQA 4OHMA 2ZJ1A 1Z26A 1J0XO 2NNLD 3SWWA 5K0JA 1A1SA 3DS8A 2WHPB 2X5XA 1GZHB 2FG5A 4YLEA 1O5OA 3G17A 2IHBA 4UARA 1OKKA 1RYNA 1Z13A 1G3RA 3O95A 3MXTA 1EINA 1MJ5A 3O4JA 4LFCB 3OLCX 2BFFB 1AHIA 4FHEA 4J4HA 3B1JA 5F9FA 2ZSAA 4TOIA 1ZH8A 4NI5A 3W6OA 3I9NA 3KAPA 1XD2A 4MJLA 3U61B 3DAPA 4OQMA 4AL4A 1JB9A 5GVSA 1N3LA 1NNI1 4F4JA 2ZE7A 4TXLA 2QI9C 4UAVA 3RQSA 3CSSA 4PO3X 5LYYA 4Z7OB 1OXBB 3EMDA 2JKVA 5K6AA 4IHJB 2AF3C 2VCYA 1J24A 2HQOA 1E8MA 2Y05A 4Y0NA 4ZQCB 4JGIA 3C5CA 4QT0A 5JCOA 2Q2VA 4L8GA 5ETJA 3HK2A 2P3OA 3WR5A 1QHFA 1N6LA 2Z1MA 2OHIA 3RIGA 2IE8A 4KITB 3ZCVA 1WOYA 3TSZA 1Y1LA 2I33A 1EUDB 1XU7A 2Y8EA 2LPMA 2ZRHA 1IPEA 1CULC 4YMTA 3WP0A 3H6KA 1F4LA 5TQ0B 4R2KA 1D7AA 2C59A 3E2PA 4OJQA 1CWUA 1F14A 2PT6A 1C7IA 1E1DA 1P8JA 4DIFA 2E1PA 2ZULA 3FYHA 3TGPA 3O4RA 4WASA 1FDWA 4AJIA 1NGSA 3FYCA 3NAQA 1TA4A 1RQPA 1C1HA 4H77A 4DYDA 2C96A 3TCNA 5A9RA 4W6QA 2H5EA 1K7SN 5CXUA 3ABSB 5SY9A 1SVNA 5ADHA 3RS2A 4OAQA 3TF5A 3AL0C 4RS4A 3LX5A 4RA9A 5F73A 1WZIA 2NU8B 4MVXA 2O3QA 4AMUA 3LHFA 1USKA 3H6GA 3LK6A 2JJ8A 4FDTA 5JAIA 3F5QA 1KJIA 1PNTA 3EVTA 5K0BA 3HU5A 2VKTA 5JCJA 2DMRA 1I24A 3REGA 2I2CA 2XT9A 1Z82A 3T7SA 1MEEA 5KTMA 1WD5A 4PPQA 1B1CA 4WY2A 2BOVA 4L75A 4MI9A 1VSVA 3GHHA 3Q9SA 3KPYA 5ELMA 1QR6A 4L0QA 4UHFA 1BEUB 2UZ1B 1K68A 3C5VA 3NKVA 4KIGA 3MMZA 4I5DA 1YJAA 4YJFB 1SXPA 2AL7A 3R7WB 2YMMA 3DSRA 2DM6A 1KEPA 1JECA 2YHAA 4PICA 2FW1A 3COVA 4DHWA 1K98A 2WNHA 3ZVKA 5LC1A 4OKNA 5AXAA 1LJUA 2X15A 2WTUA 1G60A 2MYUA 2D5LA 1AGYA 1OWPA 4L5IA 1OJLA 2JI9A 4FUTA 1MX9A 2AJ8A 2J6CA 1W52X 2R2GA 3H1AA 2JA2A 5I9MA 4WN9B 3OZBA 3UJAA 4QPDA 4AQDA 5DNCA 5IAOA 2IKQA 3U40A 1E0AA 3FLBA 1C1YA 1O94A 2X3UA 3RFFA 4OHVA 1M9NA 2UVDA 5EFOA 3M0EA 4BP8A 5JECA 4ZHQB 1UT6A 4F1KA 5TX7A 5JASA 1K97A 3D3JA 4PZZA 2RK6A 2JIQA 5FNVB 1UZAA 4NH4A 2B1JA 1YTLA 2A6PA 3LXMA 3MWKA 5BQFA 1X7XA 1Z0FA 4P0TA 1KMNA 5JR3A 2JGLA 2LRHA 4AKSA 1G8PA 4ZJUA 1Q21A 1EFLA 3DE0X 3EIOA 4DJFC 3OY7A 1PZXA 3TM4A 1SCJA 2ZBPA 2L17A 3PGXA 4GI5A 2YW2A 1EGMB 3H0EA 2GJKA 3BIFA 3RE1A 3EEFA 3UWDA 2J0VA 1C9KA 2VK8A 4OH1A 5B4TA 3WL4A 5I9IA 2YJ6A 3CB4A 2AYYA 3BWBA 5E6SB 5SYMA 1I8TA 3CMCO 1OZHA 1T5IA 1WKVA 3AL3A 4IJ5A 3BICA 1YQWA 2A30A 4LOJA 1R50A 3CX6A 4KODA 3ZWPA 4D4LA 2XQKA 2PIAA 1A69A 3VPFA 1T0PA 1WUJS 5AKYA 4ASUA 1XLWA 2AKYA 3MBIA 3MWGA 4LV8B 3MD0A 4EJSA 1C3XA 1DWUA 4RWEA 3L4SO 3LT0A 3G0IA 3T3OA 1P1JA 3HKDA 5JEDA 2YV3A 1G7SA 3OIVA 1PVDA 1OF1A 4B6EA 1DDOA 2EJCA 5J2TA 1Y8CA 3ZDXB 1M2EA 1VLQA 4UATA 4WGGA 5DT9A 1JVNA 1GTSA 2X9GA 1WXWA 1W93A 2CVHA 3ZHUA 2DWPA 2QUAA 3VAZA 1XLTC 1TCCA 3CR8A 1CHDA 5LR6A 3VA7A 2R1TB 3AM1A 1WB5A 2FSVA 5JRDS 1NVVR 4MYSA 1N5JA 1QHIA 1Z9BA 3QV1A 3B1XA 2GSDA 4FINA 2J31A 4OUDB 5DE3A 3Q0EA 4A8JA 5KOJA 3IP8A 3QBJA 2CDAA 1SIOA 3I6YA 2WEKA 3RHZA 5BOSA 1K4YA 5EN4A 1P4GA 2H6EA 1ZYUA 2HDOA 2HBQA 1BE8A 3MSXA 5AD1A 1AKNA 4BUJA 1SOAA 1AUPA 3AG5A 5LQRA 1KY2A 2PANA 9ATCA 2FPIB 2J9GA 4HYQA 3KJNA 1G8YA 1X80B 3SEAA 2IS1A 1EFTA 3K8ZA 1DKQA 3A2MA 1PT5A 4GI7A 5ALFA 4PX5A 2XJ4A 4WKOA 4BP1A 3J80A 3DGFC 3ZQKA 3WWPA 1OE0A 1KORA 1AM4D 2CNWD 4B3GA 1DKLA 4IGAA 4MEBA 4Q3NA 3JQFC 1W581 2VJDA 4NCJA 3G6KA 4JI1B 2B35A 1VG9B 3QEAZ 3IEIA 1G5RA 1JUDA 4W63A 3ZCUA 4R68A 4W99A 3V4SA 4U8GA 4E3ZA 1FP1D 2ODQA 3EA0A 4U2EA 4F6RB 1MXHA 2VQFB 4J4TA 3SNKA 3QSGA 1SQ6A 2KW5A 1ACLA 3LQ4A 1Z4NA 2CV1A 2EBWA 3O73A 5C18A 1SKUA 3G7UA 5GTDA 1QCDA 1MN6A 3QFFA 3IVCA 4IJUA 1BMQA 2WF5A 3DOFA 2WRZA 5EQJB 3BXZA 2GPTA 3QNMA 3RLFA 1KU6A 1IBLB 2JLBA 3KTOA 4LXIA 4F60A 1IIRA 1Z4PX 3S70A 3COWA 4WLFA 5ECDA 5TEWA 1A50B 4GUAA 2QNIA 3RIHA 3ZKAA 4TLAA 3EGXA 1Q0PA 5B3AA 1OXUA 4HEA1 3ZVNA 3CCFA 2CLFB 1O95D 2IOYA 4GOXA 2DHEA 4QODA 2WMOB 3M1IA 4D9GA 1SRRA 1VIYA 5H68A 1SQ0A 1X42A 1GTMA 2LIPA 4I0WB 1UMBB 3BGIA 1CVIA 1FUUA 3BTOA 4KOEC 1P18A 4OV6B 5ECYA 3JY6A 3ZWVA 1UMKA 4W5OA 3CISA 3Q8WA 1O6BA 3EVBA 4PAOA 3WL5A 3FPEA 3V4FA 1MO6A 4MJ3A 1ZGGA 4JKOA 3UT5A 2PXHA 1NY5A 4FOPA 3H2SA 1YJ5A 4ZVNA 2FF7A 3OEYA 4ZGBA 3QVOA 2DOKA 4J16A 1WL8A 3HRHA 1M2HA 4PPGA 4RJIA 4XVHA 1XFAA 1W96A 2EZ8A 2W4QA 3I5MA 4ZPJA 2GMWA 3D0KA 1AUQA 4DDHA 1KYYA 3FPKA 1E5DA 4GO1A 3RKRA 5GWXA 1ONSA 1FC0A 4G8BA 5KSWB 3ZWAA 1QGZA 3CKKA 3HCCA 1MO2A 1YB4A 4ID3A 4B3RB 4L07A 3OCCA 3DBHA 3QH4A 1ZH6A 3T3IA 2VQ6A 3DGEC 4X90A 1X7DA 3AF1A 5IT4A 2XUAA 3QVTA 4GUDA 3Q3EA 1LX7A 2PRSA 3K4HA 4KNWA 3T8YA 4XDHA 1SIBE 3QJ5A 4XTCS 4DQDA 1Y6GA 2WTNA 5AW1A 2VJLA 5I3CA 5IBPA 4YMGA 2WWRA 4LJYA 4NBUA 2KX7A 3I34X 3KUDA 4KAXA 1PL0A 2XZTA 2BDEA 2W2VA 3UG6A 4YV0A 4LSGA 1XNRB 1S9HA 1HRDA 5AYVA 4DY6A 1KBQA 3L7KA 3P9QA 4CG1A 1MDFA 3AIOA 2IYZA 1FS4A 5HXAA 1HUQA 3AF2A 2OD2A 4NJEB 4BVAA 1ZJ4A 1FZTA 1D04A 1ODJA 1RKXA 2H85A 3P71T 5AOAA 3COJA 2ZB4A 3EIUA 5DSTA 2XKKA 2B8JA 2VQSA 4HB2A 4TZ6A 2WWWA 1SBIA 1TADA 4YX9A 1QH8A 1VYHA 1XMVA 2Y0CA 1IBKB 1ZU4A 3Q7QA 2PQ0A 3TTXA 5DM70 2IYUA 4HDCA 5IKEA 1JEQA 1S1CA 3O7MA 4P38A 4P4NA 2P9GA 1NQUA 4RK4A 2IE0A 1I0IA 1E0JA 2Q2WA 4TVKA 2C2OA 5DBOA 2HTFA 4FP9A 3D8HA 3O83A 4G41A 3SXJA 3OPMA 3H5OA 5E9WA 5BYAA 4EB3A 2RGWA 5J1TB 5EIAA 1WXGA 1XJQA 1S96A 3GCDA 4Y30A 3O8CA 1XX6A 3GEMA 4B0PA 3HFRA 1RYHA 4KHZA 3DJFA 5HGJA 2H2IA 1MHPA 1OYOA 3SC2B 1M6YA 2ZAGA 2ZLBA 3NT2A 4GYWA 3WK7A 4FCWA 1NRIA 3I8SA 4DV4B 4CGYA 2XNHA 3L8HA 1SZPA 2C20A 3BDIA 3HRIA 4CI9A 1XI2A 2A7QA 1NR1A 4I5GA 3MHTA 3FJOA 3BF8A 3KD2A 1UBTS 6REQA 3K0CC 1AD2A 4ND2A 3OIDA 1JJIA 3AUAA 3ZV3A 3AEQA 2W2QA 4D8VA 5FOUA 3VC1A 3WJ1A 4RTLA 3BWXA 3UHFA 2OB2A 2YYSA 2ECQA 3UKOA 4DLSA 3VYVA 3HXOA 1U8AA 1DJOA 2BJVA 5BSUA 3ZC3A 1ND5A 3DL0A 3KZOA 3W7VA 4ZOQI 4FWTA 5DH9A 1SHLA 2XYGA 1YVEI 2VHTA 3ZHSA 4I3HA 2Q6TA 3M70A 4JI3B 1HE2A 1WW2A 1T6ZA 2JFGA 1L3CA 5AJVB 3HDVA 4Z4HA 4R9NA 3ZIAD 2GTPA 2GM5A 1JEYA 1HDZA 5HUHA 4HS4A 2FR0A 4CMEC 1EFRA 3BQNB 1J7KA 4BX8A 4TYNA 1H3NA 2C61A 3P2MA 1E89A 4LNUA 3FZQA 1E7RA 3AFGA 1GAJA 2RHLA 4WPGA 5JNUA 1ZKMA 4DUPA 4G0UA 1SK9A 2JI4A 3RBXA 5CLGA 2AFIE 4NBLA 2HT1A 1IDN1 3PHLA 1G1AA 3K1JA 1Q6YA 3AB3A 1ESMA 4KFSA 2DERA 2I2FA 1JXMA 4ALJA 5JI2E 4LXUA 3QNUA 1EB8A 2D7CA 3PRKE 3G2JA 1WJGA 3GI1A 1W6RA 4I4TB 5ICSA 1VJTA 3OCUA 4YQEA 1FFEA 2GA8A 4Y2GA 5CGZA 2JFFA 3N05A 1XKQA 4ESEA 2VT6A 1UL1X 3UAVA 2H2WA 4ME6A 2HJGA 1T2DA 4BQNA 3DT9A 1C1XA 1MT0A 1ZD8A 3C7DB 3ZD8A 5G3YA 3H84A 4BP9A 2X8WA 4XWAA 2AKEA 2WSSD 1QGUB 2VHYA 1R6AA 1LPBB 1Y6JA 1QG6A 5BN5B 2NZXA 2EJTA 1L4MA 2ZUWA 2P77A 3DVSX 4LNUB 1I2ZA 5GOZA 1W5SA 3S8YA 1Z4OA 3WHPA 4DCOA 5C0OE 4RXTA 4K87A 2PO7A 2YJZA 2ZI9A 1N8SA 5AKHA 3QKSA 5ALPA 5ARBA 2P3SA 1RM4A 2XE8A 3JCZA 1B15A 3SZUA 4IQGA 4D9EA 4HL6A 2JBAB 1L5FA 4HZUB 1DX9A 3BTSA 2P9YA 1XJWA 2XGSA 3UGJA 1J2EA 2XRMA 1CFJA 1QHHB 2JFQA 2PZKA 1EDEA 4RFSA 2OOKA 4RSMA 3NVMB 3S0JA 1T3LA 8ATCA 2VDMB 1Z5WA 3FIJA 5DLQC 2OORC 4NZYA 3QF4B 4BO3A 5IF3A 1RZRA 3KQQA 1ODTC 1LA2A 1N5OX 3PQ7A 4YQFA 1VYVA 1UJCA 2ZRIA 4J0FA 2H7XA 2IP4A 1GG9A 2ZTHA 2PE5A 4E2ZA 4R1LA 3LBFA 3DAYA 4JUCA 4LHWA 4DAOA 3B89A 1VI5A 3OQIA 2D06A 5SY4A 3RSCA 4CDMA 4DIUA 3ICEA 1TMKA 4G6ZA 1QUEA 4CCYB 1TUEA 4Q6BA 2YJ4A 4M3NA 2G77B 1XWFA 2C77A 3DZHA 3GT4A 3B2EA 2QD1A 3ECAA 1A8SA 2YCLA 4JH0A 1Q6ZA 3CFYA 1T25A 3W8RA 2QLNA 5IBRA 2AJCA 4C4ZA 2IXDA 4M9SA 5EUMA 5F1YA 1RRFA 1WP9A 3JVVA 1XMXA 2H1OA 1UUFA 2UVPA 3AVOA 3QA3E 3AUUA 4N8SA 1CYDA 3KT0A 3IERA 1XJ0A 4TLCA 1SA0A 2HUNA 1A4UA 2VRBA 1NIJA 1VMAA 2JD0A 4HEQA 4INPA 4LY0A 5G4KA 3BHMA 3FKQA 3V55A 3NIBA 2QSUA 4C08A 5CT5A 5BRJA 4Q1EA 4FD2A 2A78A 2I8LA 4KQCA 3D7SA 3EFOB 2CGEA 5K3CA 2PZ8A 4FXPA 4JNKA 5DN6A 1Z34A 4RE5A 4QQKA 3MUFA 5HOEA 5FOTA 3AHHA 4Z5XA 1ZM3A 3LUBA 1IQUA 2B4KA 2GEDA 2WIKA 3KDPA 3O6VA 4KR6A 2H9YA 1V1JA 1A5ZA 6AT1A 2AC4A 3K9NA 5KNBH 1TI7A 4V3BA 4QSMA 3ENZA 2JLAA 3W3AA 4LZAA 3GLIB 2VSXA 2YFHA 4M49A 1J0AA 1N2BA 4TXJA 2YV5A 3FW1A 5FNZA 1YL6A 3FGZA 3O4IA 5F64A 2WSSA 3F3KA 2HLDA 3IOEA 5KNLA 5HCIA 1SNYA 3P4YA 5ICFA 1X1QA 2QPAA 3BZBA 4CQMA 1FFXA 1QGYA 3GGDA 2PKRA 1E3WA 5ICEA 2BI7A 1KXZA 1G8GA 1R8SA 2OZKA 2ZPAA 1DAPA 2P3LA 1YD7A 2YQ4A 3EVZA 3NFRA 4R1UA 3AHIA 3KB1A 3G5MA 3QHAA 2QTRA 3TJMA 3N5KA 2IH4A 4OHYA 4IOLA 3WRXC 3OBIA 2EWWA 1DHTA 1SC1A 4D97A 3JS5A 4QOEA 2PDAA 2PT7A 3MS7A 3GZ4A 1Z7GA 1TCBA 1TVMA 1I1HA 2BN4A 3FMGA 3QPBA 2E49A 2IEGA 3ISTA 3VSDA 2Y9MB 2ZVPX 1YUNA 4BWYA 1L7NA 2IEBA 3DHYA 3ZHXA 2Q5QA 3R20A 5CMLA 5CYGA 3FCYA 3R3SA 4AVYA 4RCYA 4IDGA 4PC6A 4DM7A 4Q3DA 1KPHA 2QJOA 3CNNA 4BNIA 3AF0A 4TTQA 2UXBB 2IF0A 2AG8A 2OP0A 4JL6A 4WOCA 5CFMA 1IUPA 2O6HA 1IG3A 2OR3A 2JG3A 2WF7A 3ZKWA 2D2EA 2OVFA 4Z8XA 3PP8A 3VDNB 2QTFA 4WFKA 4FFVA 3HCBA 2OGTA 4QQ8A 3UK0A 3ZQUA 1NRJB 4RW0A 2IK8A 5A3JA 5CFPA 4BMSA 5HQJA 3M5WA 2UYQA 4I9HA 2VDJA 4JLBA 4RV9A 5JDIA 2HCJB 2H7VA 2H17A 2G36A 1GTRA 3M6VA 4YALA 5LZ4A 1SHTX 4C0SA 4FBLA 1LPAB 1X8LA 5CTAA 3QVJA 2ZSHA 1QGAA 2BI8A 1NPDA 3P7MA 4W9NC 5ITVA 2YQ5A 3HBMA 4D6YA 4JUBA 2QN9A 1WOMA 1KYZA 3O4HA 1B16A 1HLDA 2GO7A 5FEUA 1E3MA 4D6XA 1TYEB 3O8NA 3BCRA 4J49A 4UBIA 1U8XX 4JXJA 1WUTA 3TQCA 3L8ZA 1OXKB 4FFMA 3NP9A 4JWTA 5CBPA 3OAAA 4F96A 3IR5A 3GT0A 7YASA 3WFZA 2I1LA 3PGKA 3A04A 5H1YA 3CJRA 4XB6B 4OXIA 3NETA 3MTEA 5GV7A 3ZK9A 3W1VA 4E3WA 3S5JA 2P6PA 2BAGA 1R9GA 1VP3A 2C9MA 1KOLA 3UJ9A 1LCIA 2HJRA 2PV0A 3KYCA 1J20A 2QZPA 2I1VB 3DEIA 2NV0A 3PR2B 2ZSBA 4ZJYA 3KU4A 3KUXA 5KWVA 1ZUHA 4JVMA 2I0FA 4CLXA 4F2DA 2JARA 2BR5A 3WJ7A 3C3EA 4FPXA 1MOZA 2IS4A 2H3EA 1QGOA 2ZGVA 2FEAA 2Z0MA 2CCGA 4O1HA 4WJLA 3W6PA 2Q28A 5B4VA 1LRJA 4D9FA 5K8UA 5U9CA 1JKJA 3QOWA 4ZVOA 2O5EA 3IPRA 1XFDA 3ROGA 3S55A 3ENQA 1GARA 1ZO8A 2BFCA 3KYBA 3BGOS 3R0VA 4AO6A 2FI1A 4LDJA 1CZHA 2P8SA 2AFIA 3E2IA 1J0BA 2VP6A 4OUDA 5TVKA 2HLHA 5AVKA 4MIEA 3RADC 2YWJA 3BB4A 2VJKA 4M7RA 4E51A 5CAEB 2J5RA 1SZDA 2AFHA 5BNIA 1X0XA 2QVGA 5EXXA 1OSNA 1KETA 4XOIA 4X63A 4YJGA 5CLIA 4UMVA<