1KVTA

Udp-galactose 4-epimerase complexed with udp-phenol
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSVATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Molecular structures of the S124A, S124T, and S124V site-directed mutants of UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 129
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kvtA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kvtA01
1IULA 2ZYGA 1X1EA 2JL1A 3OICA 4B8ZA 1F8FA 3PWZA 4YBZA 3ZH2A 2CF5A 1DRVA 2QG4A 1WDMA 2HJRA 3GG2A 3JYQA 1YQXA 2WD8A 2BRUA 1ZKMA 4J9UE 4ALKA 4PLFA 4XGNA 4CPDA 3UCXA 4TRRA 1ZK0A 1P45A 2HCTA 4IDFA 3WLEA 1B2LA 3RUHA 3WQSB 4D43A 3VPFA 4MVJE 4OKNA 3SJ7A 4JJFA 1DFGA 3OM9A 3EUWA 2QHXA 4OL9A 3I6IA 4TWRA 3FNFA 1GYPA 4J4BA 4R5MA 4KP7A 4EJ0A 1I2BA 1I32A 2AQKA 4IQGA 3VZPA 4IS2A 4BNYA 1TEHA 4LN1A 2TMGA 1PQWA 4D44A 1OC2A 2WEKA 2E4AA 1H2HA 5IXYA 1LC3A 3DTYA 2W2KB 2R00C 3DBLB 3NJ8A 3Q9NA 1P74A 1HRDA 3H3JA 1K3TA 4GKBA 4TVBA 5ENDA 3GFGA 2VYVA 2C0CA 3BAZA 3UHAA 3DC2A 4OIMA 4EGFA 1XU7A 3WWZA 1MGOA 4NU6A 3D4NA 3WTCA 1R4MA 4PG6A 3D3WB 4YT8A 2ZTVA 3RJ9A 4OMUA 1WLYA 2ZK7A 4XYMA 1FDUA 4XQEA 1JKIA 2OL4A 4L4SA 3H9EO 4CLRB 3OIGA 3BTVA 1MLDA 4W7IA 4HP8A 4JXKA 5AXAA 4KDFA 5A9TA 5BSHA 3VC7A 3DONA 3WG9A 2WE8A 2WWRA 1UP4A 3I5MA 3MOIA 3CZRA 1ENOA 3AUSA 4NJMB 4OJNA 5GMOA 5ICMA 4BVAA 4ND2A 4PZCA 1X13A 2CUKA 3UCFA 2XXBA 2CZCA 4TZTA 1WP4A 1I3NA 1ZXLA 1PR9A 3ST7A 4IUYA 2XPCA 1T2CA 2RAFA 4NK4A 1UUFA 1IY8A 4NBWA 5U9CA 2IRWA 4D46A 3H65A 3DBRA 3AY7A 4F6CA 4BKRA 1OFGA 4IJVA 5EESA 5A5EA 1DLIA 3OSUA 1DXYA 3KRTA 1W8DA 2Y1FA 1MV8A 1C1XA 2WYWA 4J7CA 2UUPA 2Y1EA 1CIVA 2AMFA 1M67A 3A06A 5DZSA 3JD1A 2CVZA 2R6JA 1EMDA 3KYCB 4OKIA 2O2SA 3E5MA 5CEEA 4J1TA 1GQ2A 2D0IA 2YHIA 1Y9AA 1KY4A 4YJFA 4LVCA 4OOFA 1RYEA 1HDOA 3ETDA 4BO7A 5DCWA 1DB3A 1CRWG 2UUOA 1U8XX 3GZ4A 3W4JA 1E7MA 5CFZA 3RVDA 1W73A 3Q9UA 1KVRA 3RI3A 2IYOA 4D0RA 4Z3DA 2VRBA 3H5NA 2POQX 1U4SA 4BL5A 2AEFA 3ZN2A 5HS4A 1A27A 5DNAA 3WFIA 1I3LA 3E48A 1V3VA 4XR4A 3Q3CA 4BO0A 4D3SA 1O0SA 1U3VA 2X9GA 1N9GB 3WGGA 2ZTUA 4FCCA 3ZU2A 2P5UA 1WPQA 3DHEA 3R1IA 4MVJM 3WYCA 3IP3A 3F4LA 1YRLA 1TB4A 5KVQA 4RV9A 2I67A 3R0IA 1H94A 1PJ3A 2FPGA 4CM4B 1ZMTA 4PG5A 4YJGA 4B7CA 5HRUA 1LSUA 1R6DA 4EITA 2GSDA 1UXHA 5JY1A 3IP1A 4W9NA 3NT4A 2PD3A 3KSZO 5FI3A 4J1NA 2V7PA 1AUPA 4E2YA 3F1KA 4CMIA 3JQFC 3GEDA 3EK2A 3ONFA 1NBOA 3ZHYA 4CQLA 3PWSA 1TT5B 3C1AA 3LU1A 3GVIA 4AJPA 1D7OA 2Q4EA 4U7WA 1XHLA 2B0JA 2XAAA 3GN1A 2X5KO 2DBQA 4CM7A 3Q0EA 1J49A 1D4FA 4LGVA 5A9SB 1SEPA 1WMAA 1LSJA 2UAGA 1SNYA 4GSKA 2Z1MA 3GC6A 3LT2A 3OMLA 1HLDA 5IF3A 1GD1O 4Y6PA 4YJDA 4WCFC 4Y6RA 5L7TA 2GN6A 3T4EA 4DPLA 4MP6A 2G1UA 4BMVA 2OP1A 5DOZA 3D5QA 3VTZA 1JN0A 1PIWA 4BKOA 1O94A 1U9JA 5JPIA 5JC1A 4R16A 4J6FA 2OO5A 2DBZA 2VQ3A 5JDIC 2IYPA 1ZNQO 1E3LA 2VUUA 3PHLA 4B4VA 5THQA 2WJPA 2I9PA 3OJOA 1PGPA 2RIRA 1UDCA 1YB4A 1HDGO 1X0VA 4AG3A 1KC1A 1MG5A 4B4UA 1V35A 4CUJA 5KJCA 1E1NA 3QP9A 4FIZA 1NR7A 1D8AA 4R5HA 3HE3A 2AEJA 2PZLA 3ONDA 3ZV5A 2JD0A 3CMCO 3LLSA 4Q3CA 4IDCA 5JMPA 1R4MB 1EBFA 1LJ8A 3PYMA 1MC5A 3PQDA 5A5FA 1SZJG 2B69A 1G0NA 4K1LA 3EYWA 3TNLA 4RF3A 3STHA 3EHEA 2C82A 3QWIA 5EN4A 1IB6A 4YJHB 1B0AA 1MXFA 3DHYA 4UEOA 5EQFA 4JX8A 4JNKA 2V6FA 4UVGA 1ULSA 2BGMA 3EZLA 2HMTA 1Z74A 2W2LA 4GBJA 2A35A 4NNJA 1P1RA 4WOJA 1E7SA 1VPDA 3GPDG 1U5AA 1DC4A 2ZIZA 2EP7A 3BTUA 3CPSA 5EIOA 2WMDA 1VSUA 1EE9A 5TJHA 4E33A 2R2GA 1GPJA 2B83A 4NU5A 1F0YA 1YE3A 3K31A 3PGXA 4FFMA 3V2UA 3WGQA 1SB9A 2IE0A 5JO9A 4LMRA 1VSVA 3I6QA 4ZQHA 4IXWA 4E5PA 4E2ZA 1NHWA 1ZVMA 2EJVA 4GWGA 4ZGWA 4QX6A 5L4LA 2DPGA 4FFLA 4UVEA 1LQUA 1A9ZA 3O03A 4XQ9A 3LLVA 1DSSG 4AJ4A 5L53A 3H2SA 2Q1UA 4O63O 4R1SA 1UH5A 3PYLA 1E3IA 2PD6A 1CDOA 2OFPA 4DPKA 1VRWA 2PZJA 5B1YA 5I7SA 3KBOA 5JBIA 3ENNA 1NQOA 3MJ4A 4L76A 3RC7A 1Z45A 4EJMA 5EQDA 4I9NA 3ITKA 4CM8B 4YRAA 1C1XB 2VHXA 1X7HA 3F9IA 1I30A 4WNIA 4CQMD 4E5MA 1ZSVA 4W7HA 3BA1A 2FOIA 4Z9YA 3FRJA 3V2HA 2W98A 4YJFB 3GAFA 1DOHA 5DBFA 3TWOA 2NADA 4CL8A 4DYDA 4KUEA 4Q3AA 4TQGA 3JD3A 4RPKA 4B3IA 1BGVA 1YONA 3RUFA 2PWZA 2BI7A 1KVQA 3H9GA 2Q49A 3VDRA 5CEJA 3LZ6A 4CLOB 3K6JA 4NDNE 1HYHA 2C5EA 4FSHA 3JQ9A 4HNHA 2DBRA 3NDIA 1HL3A 1WW8A 3RKRA 1YS4A 3I4CA 3U3XA 4BKUA 1ORRA 1GV1A 2VHYA 2VHWA 3B1FA 1FXSA 4CUKA 1CETA 4I1IA 1ZMOA 2X0RA 3JYOA 2CMDA 4URFA 1E3WA 2GASA 1LX6A 3ZV3A 4EW6A 2RBEA 4DMMA 3KTDA 2ZB8A 2YFQA 4YJGB 3C7AA 3E8XA 2Q2WA 3CH6A 3MTJA 4CR6A 3P2YA 1UAYA 5HTOA 4GLLA 5A9RA 3ENKA 5G0SA 1NNUA 2QZZA 2X58A 3E03A 2YJZA 1PL7A 2YDYA 1QXSA 3ROKA 4CMIB 2CY0A 4LSMA 2YV1A 3HB5X 5C7IO 3U4CA 1T2EA 3JQEA 4BNJA 5COQA 5U1PA 2NACA 3IJRA 5TT1A 4I5FA 4EYEA 2V6MA 4FJ1A 4R9SA 1LDNA 4XYBA 1C1DA 2OUIA 4IM7A 3I9OA 4TVOA 3PHHA 5DBGA 3CKYA 3DBHB 3ZWBA 2AG5A 2G17A 3JQAB 3NEPX 1QYVA 3FWNA 3DR3A 3KSUA 3LT4A 1NPYA 2DPHA 3WOHA 4WLNA 1I33A 3ZDFA 4FOSA 1VLLA 3GN2A 5L4SA 3ZWYA 1YH3A 4XRGA 2BGLA 1HETA 1C0LA 4E6PA 3QY9A 4YB8A 4BNIA 1JTVA 4H7PA 2GN9A 5G0TA 4QEDA 3PJFA 1CYDA 1YBVA 1KYQA 3DZKA 3WJ7A 4R1TA 1PJTA 1DFHA 2J3JA 2AG8A 1KVTA 3I9NA 4CMKA 1XYGA 1PS8A 3OEYA 5FYDA 5THKA 5EPOA 2VHZA 4D41A 4YPOA 3IIEA 4Y67A 1R4NA 2FR1A 1ZBQA 3KYBA 1MG0A 2AE1A 3B1JA 3BMNA 2UV8A 3VVCA 4P4LA 1XQ1A 1LNQA 4M89A 2HU2A 3NV9A 3PHIA 4IDBA 1A71A 3R6DA 4BNFA 2PKRA 2VZ0A 2R00A 2VYNA 1DFIA 3ASUA 4DWVA 1SOVA 1XQ6A 3AI1A 3I9MA 4TKLA 4DVJA 4OAQA 3U49A 4ZN6A 4QO7A 5CDYA 1KVSA 4XEHA 4RPGA 1GQYA 3F47A 4E30A 2IZZA 2GUGA 2CVOA 1ZH8A 1XKQA 3TL2A 1E6WA 2VCYA 1J5PA 3C7DB 3H9JA 2E49A 4BUCA 4MIYA 2X0JA 1E3JA 3WMXA 1ZJZA 1EQUA 2GR9A 2EERA 5LDHA 4IDDA 1LLCA 5GY7A 4A7PA 4BGVA 5T8KC 3A14A 4FQ8A 2J3KA 4MDHA 3JD4A 3Q11A 4FPXA 4MP8A 3ULKA 3GGPA 1N8KA 4BHTA 4UUOA 5HA5A 1WZIA 4ZA2A 2NTNA 2J3HA 5HWSA 4NJOA 3FNGA 3DMYA 1FDSA 1H6BA 4K26A 1KEVA 3OETA 5DOVA 4NH4A 4QT0A 2W4QA 1IHXA 3RC2A 4WPGA 4R3NA 3L07A 2ZYDA 3LC7O 2BH9A 4J3FA 2PTGA 1NFFA 1NQAO 5JS6A 3WDSA 1IPEA 1W6UA 4H3VA 3M6IA 2JCVA 3ON5A 4IY1A 1GTMA 3JYPA 3LYLA 4HFMA 2X1HA 3JSAA 5G0WA 3WIEA 3D7LA 4EI2A 4J2OA 5BNTA 4HFJA 1UP7A 2GLXA 4DBVO 1ZCJA 2AA3A 1LDYA 4MINA 4YAKA 3RUIA 2BMAA 3PZRA 4INAA 3KXDA 1X14A 5CG2A 2OZPA 4JN6B 5ITWA 4L4RA 4IQ8A 3ZW9A 2D5CA 2RCYA 2GRAA 3AI2A 4S3MA 1U8FO 5JY6A 2PY6A 8ADHA 2NQTA 1Q7BA 2NLOA 1DRWA 1WXDA 4PLWA 1XU9A 5DCYA 3GR6A 1UAGA 5JCJA 4A27A 2VNAA 5KOIA 2ZATA 3NRCA 1NAIA 4JGBA 2PA3A 4D79A 5F5NA 1ADGA 2OBNA 3GDOA 3VZQA 4XIYA 1E3WB 4CMEC 4E32A 3VH3A 2AHRA 3K2BA 3F6YA 5G0VA 1HDXA 3KEOA 3RFTA 1BW9A 4P38A 3FN4A 3NTRA 4Q39A 4NBTA 1IUKA 4F46A 3MJVA 2CVQA 1YL5A 2O4UX 2RH4A 5ILOA 4JBGA 3RWBA 5JCJD 2Y93A 3DWFA 3O8QB 3LT1A 4PZEA 5FF9A 4IMRA 4BO2A 2O4CA 2NV6A 5BNFA 2VNSA 4GAEA 3D1LA 1DBVO 5IN5A 1YJQA 3ITDA 3GDGA 4UVIA 3EGOA 4RPJA 1MC4A 2JAHA 3DO5A 1HSZA 5DP2A 1Y1PA 2ET6A 1F17A 2C20A 3DDNA 2VZ9A 3N7UA 4J43A 4DC0A 1C1DB 3TL3A 1NX6A 2HK9A 3PGJA 4BNXA 3B1KA 1E92A 3JQFA 2WTBA 3GFBA 3H6KA 4AJ2A 3JQ6A 4LSWA 4GGPA 5L9AA 3WICA 1LLQA 5KKCA 3PTZA 5COAA 1KBZA 5JMWA 2VWHA 3IUPA 3RFVA 3E1KA 3OH8A 2ZCUA 4B4OA 4AVYA 1DC6A 3GRPA 2AQ8A 5JAMA 1UZNA 3QVTA 1Q0HA 1WDKA 4KMSA 3P7MA 9LDBA 4NZ9A 3KO8A 2OOSA 4WCFA 4BNUA 1PJCA 3JQ7A 4J0FA 4K28A 3L6DA 3GEGA 4XZ3A 4ZQBA 4E5KA 2FZWA 1PL8A 3SJUA 4CUZA 1XWFA 1N92A 2OHXA 1V0JA 1R4NB 5L45A 1E1KA 3U62A 3BMNB 4BNLA 2DUUA 3WNQA 4CJXA 5JDIA 3KB6A 1YOVB 3MEQA 1TA4A 4LCJA 2QRLA 4BNWA 1DLJA 3H3FA 4PVCA 1P0CA 3TOXA 2EW8A 3QA9A 2C5AA 3QW2A 1LLDA 1I24A 3TQHA 4G2NA 2QZ9A 2PGJA 4U6QA 2YY7A 4XDYA 3EVTA 3G3EA 4PGFA 3CINA 5L3ZA 1I36A 1NHGA 3HHPA 3KYDA 2HMVA 3D5TA 1BXGA 2Y0EA 1H5QA 3PLRA 1WDLA 5EERA 4BQRA 4TMFA 1LRKA 3EDMA 3PZBA 4BGEA 1GAEO 1RM3A 1QLHA 4NBUA 3IAHA 1GADO 2NU8A 1A5ZA 2Z95A 1ENYA 4FFOA 4JK3A 3T4XA 1FF9A 3WNVA 3W8EA 4NBVA 1GEEA 3GGOA 4R01A 4YWJA 3P5SA 3QVSA 3VZRA 2F00A 4CMAA 3VDQA 4YT4A 3I3OA 3O9ZA 1HLPA 1F8GA 3TJRA 3AJRA 1HEUA 5AXBA 5A03A 3D64A 4DIBA 5MDHA 2FWMX 1OOEA 2QRJA 4XR9A 3C7CB 2DVMA 5JXWA 3IL2A 4EJ6A 4PRLA 1Q1NA 2AEMA 1GQQA 1GY8A 1P9LA 3WLFA 3ANNA 3V1TC 4XJTA 4PVDA 5GZ6A 4WLFA 4JP2A 1V9LA 1R0LA 2G5CA 2HO5A 1T2FA 4ZQFA 5JFOA 3VKVA 3RSHA 1H2BA 3HADA 1P1IA 2HMSA 4R1NA 3H9UA 1HYEA 1ZO8A 3DTTA 5B4TA 4FS3A 4KUGA 3UGKA 3VPSA 1PGNA 5JC8A 4J90A 2HJSA 1YJ8A 2YFHA 3PXXA 4N5LA 3FHLA 4C4OA 3PK0A 3ZWPA 3X2FA 1T26A 1UZLA 4A73A 1B8UA 3KSDO 1PS9A 1H9BA 4FD3A 3JQGA 2BKAA 2NTVA 4BNNA 4W4TA 2G76A 4PLTA 4ZJUA 3IKTA 3GUYA 2ZB4A 5TF4A 3DL2A 1N5DA 1VI2A 4MIEA 2GPTA 4CM9D 1G0OA 4UVDA 2Q99A 5K6AC 5KTKA 3DZIA 5HM8A 5IZ4A 3ETGA 5LCXA 3S2IA 1P1KA 4KDEA 4EDFA 2FPIA 1O8CA 1ISJA 3QIVA 1IOLA 4RO0A 4YTEA 3GK3A 2NQ8A 1BW9B 3SLKA 1U1IA 4ZQEA 1GCUA 4AL4A 3WFJA 2EV9A 4BB6A 4R3WA 1VJTA 3W8DA 3C85A 1HE2A 2WSBA 2JKVA 3ROMA 2X0IA 3UXYA 1RKXA 1YBAA 3AFMA 3C1OA 1ISFA 4XCVA 4D0SA 4YDRA 5KVSA 4RF5A 2TMDA 3DB2A 2FP4A 3N58A 5L95A 2BD0A 1QYDA 1NPTO 1DC3A 3S1LA 2YYYA 1QKIA 2PFGA 3PQEA 2CFCA 5CPFA 4AFNA 3PJGA 2P9CA 1NVTA 2J3IA 3TF5A 1PGOA 3DZJA 3V2GA 4RLHA 2V6GA 3GLQA 4ND3A 2E48A 1MP0A 4ZICA 3QE3A 4MKRA 1HYGA 2EGGA 2C7GA 3DQPA 4WK6A 4BS9A 1R15A 3KLMX 4DQVA 3OJLA 4GL4A 3WTBA 3QWFA 1O9BA 1Y8RA 4JIGA 1FK8A 1T25A 5IJZA 1LSSA 3H9QA 1EZ4A 4BOYA 1PGQA 2X0NA 2WYUA 5CG1A 5K9ZA 1Y8QB 3BYZA 3JV7A 4OXNA 4R1UA 5TQVA 1IZ0A 4G5HA 1NAHA 4OXKA 1N7GA 2HKIA 1O95A 4M87A 4GMGA 4MP3A 3AU9A 1HDRA 2P4HX 4NFYA 5J23A 1HT0A 2B37A 4RQUA 1AHHA 3RAJA 3JQ7B 2PNFA 1EFLA 5TT0A 3E9MA 5JE8A 1M6WA 4UUPA 1DIBA 1VL6A 3I23A 4NI5A 3HN7A 4CV3A 1KVUA 2Y05A 3HG7A 5JLAA 2DUWA 4ALLA 3E5RA 4E5NA 3IJPA 1QRRA 1NVGA 5CAEA 1Q2XA 2PZKA 5IG2A 2VHVA 1YGYA 5JYDA 1LC0A 3D4PA 1F14A 1JQBA 3QVOA 5EINA 5C3MA 2GCGA 3GG9A 4TRJA 4EZBA 2DAPA 1ULUA 1P3DA 1EVIA 3NUGA 1S7CA 1DJQA 3KZVA 3VPGA 2D1YA 3EC7A 2V65A 4M55A 4PIVA 5I9MA 1N7HA 2EKQA 1B8PA 1RM4A 2CDAA 1ISMA 1PJBA 1PZHA 1ZW1A 3KM0A 1PU2A 3MJTA 2FSVA 2IXBA 3L6EA 4PG4A 1BXGB 4RCVA 1QMGA 3A9WA 3W6ZA 3MOGA 4BO8A 2EJWA 3KHUA 2NVBA 3ZHXA 4FGWA 2QW8A 1JDJA 4P22A 1KS9A 3L4BC 1GV0A 1J0XO 3JQBC 3PEFA 1XA0A 3SEFA 4XRRA 3H2ZA 2P5YA 4W99A 2C29D 4FGSA 4N5MA 1C0PA 5T8KA 5FEUA 4ITUA 1B7GO 1K89A 2HK7A 2Z5LA 5H82A 3GNTA 4N7RA 3ZWNA 2HRBA 2Q1SA 4E13A 3WYEA 5COBA 2IZ1A 1NQ5A 3UKOA 1GZ3A 2JD1A 2WE7A 4DMLA 1BRMA 1PS0A 4H15A 1NM5A 1XELA 1D3AA 4QECA 5A02A 5TIIA 1DAOA 3GVCA 3MTGA 4Y9DA 3LK7A 3CSDA 4NR0A 3M1AA 2PD4A 4NBRA 3V5NA 4U0JA 3HN2A 4BO3A 2CDBA 3F4BA 4IXTA 3RKUA 3INGA 4GX1A 1HE5A 1ZFNA 3WSVA 4CM3A 3QVWA 5KKAA 3EMKA 3WX0A 5IN4A 4IINA 1LI4A 4IZHA 3NGLA 4BV9A 1SC6A 4XQGA 3S2GA 4XYGA 1ISIA 3QSGA 1J4AA 5ES3A 2Y1DA 3WBBA 1DAPA 2DLDA 3JQGB 1VKNA 4Q3EA 4I5GA 1SAYA 4PRKA 5U4QA 3ZWAA 1P1FA 3NDRA 4RDHA 4AJEA 2VT2A 3OECA 1K5HA 2B4TO 5BSEA 4RJTA 3Q1LA 1NVMB 4WECA 2O2YA 4J0EA 4CQMA 4GVXA 4CV2A 2X23A 3IQDB 4LRTB 3VH1A 2YHUA 3PDUA 3NX4A 2JJYA 3U0BA 1ZK1A 3GQVA 4WEOA 3HJAA 2B5VA 4FFRA 4P4GA 1R0KA 4XGIA 2JFHA 4JQCA 3DBRB 3RUEA 2AQHA 2EKLA 3TZQA 5A06A 3ZNQA 4E0BA 4CM1A 1A4UA 4CMEA 4GSLA 5TX7A 3S55A 4QFDA 3VHRA 5JO0A 3L4SO 2BGKA 1XCBA 1EK5A 1E77A 2JD2A 4O6VA 2YHIB 4J2HA 1Y9EA 5F1KA 3NT2A 2DFVA 2ZJ1A 5L7WA 4WOKA 2J5KA 2X9VA 3GA0A 3JD2A 1U3UA 4IIUA 4LCEA 1Y7TA 1ISGA 1U7HA 3INTA 4K6CA 4BNZA 3F46A 1YDWA 1Y8RB 2UVDA 4YRBA 4RZHA 1B8VA 4M49A 1I3KA 1GZ4A 5AXCA 5ER9A 2HSDA 5BNIA 1NFQA 2G0TA 1UDBA 3PYXA 3ZNNA 4PZDA 4XKJA 1A7KA 2X22A 4OXYA 1GL3A 5F1PA 2X8LA 5I7FA 4WGGA 1Y5RA 5L7YA 5TGDA 3E9QA 1ARZA 4RVUA 1XSEA 3OA2A 4AJNA 3WGTA 4E3ZA 2Y0CA 4FOOA 1GUYA 2C59A 4GI2A 1ZK4A 4CV0A 2IEBA 4OM8A 3IOYA 4EUEA 1EEHA 3UN1A 3DOCA 4WKGA 3AI3A 4MVJP 4XB1A 2C54A 4DLAA 1XR3A 2YV3A 2PLAA 1B14A 4WASA 3NYWA 4HFNA 2W8ZA 3WJAA 1QR6A 2O3TA 2BHLA 4IGEA 5B37A 2B35A 4DQUA 2OMEA 3FF4A 1VM6A 4J49A 1MFZA 4CQLB 1CERA 1U4OA 2HDHA 2XOXA 3EW7A 3FD8A 5A05A 4I08A 4IBOA 3GNSA 1WAMA 2JHGA 4R41A 1NTOA 3DMTA 3OJEA 4XYEA 5G0UA 3W1VA 4WNCA 2YQ4A 1BSVA 3K92A 4A03A 1EUCA 2RHRA 1VE9A 3I9LA 2I99A 1NP3A 1YKFA 5JW6A 1TLTA 3RBVA 5LDGA 1AXGA 3OHSX 4YT5A 2NU7A 1FMCA 1UXJA 9LDTA 3RBZA 3UICA 3G1TA 3OQ6A 3ZU3A 4CMJA 3WSWA 1VJ1A 4FJ2A 1IPFA 2QX7A 4MVJG 2DM6A 4PLCA 2Q1WA 2Q2VA 3H5AA 4YQZA 1B3BA 2O3UA 2YZ7A 1ML3A 3NT5A 4CMCA 1U3WA 3JTMA 1BDBA 1H6DA 2VRCD 4JROA 3VVBA 1JVBA 4DPMA 1LBEA 5KWEA 4R68A 3GDFA 1DJNA 1BG6A 4BNKA 1KY5A 1H0KA 3GVPA 3OJ0A 4FJ0A 5EJ2A 2JCYA 3KLPX 4KWHA 4II2A 3DAGA 5IZCC 1RYDA 1SOWA 3B70A 3PP8A 3SXPA 1V3TA 5I7VA 2VUTA 1P1HA 3AK4A 3KV3O 1PEDA 2PZMA 1JU9A 2FR0A 3RCBA 1YBMA 4YAJA 4XDZA 4BMSA 3KETA 4IS3A 2CDCA 2D3TA 3U09A 2J6IA 3LF2A 1EK6A 4NIMA 5DULA 3VOSA 2ZQZA 4OHUA 4DREA 1UXIA 5C7LO 5L51A 3AUTA 2EW2A 5KNLA 1D1SA 1KETA 3TOZA 1B15A 4MIOA 4MOWA 3GMSA 2I3GA 4OSPA 3BMCA 2I76A 3UH1A 5DCUA 3BHMA 4Z0TA 1F12A 3PIIA 3RUDA 4YACA 4NPCA 1BVUA 3ADOA 3WB9A 3MJEA 1O5IA 1ZK3A 3LC2O 3ZWOA 2GD1O 3Q2IA 4L9RA 1LA2A 2XXJA 3GGGA 4XGKA 4R4JA 5AYVA 4CQMB 1NWHA 1J6UA 3IUSA 4R54A 4IJUA 3LT0A 1H6AA 2GDZA 4ZRNA 1G6KA 4LW8A 4A26A 1I3MA 1C0IA 1E6EA 3R3SA 3PVZA 4E5YA 1KERA 4PLPA 5T5QA 4ND1A 4AICA 5K6AA 1E3EA 3H8VA 1YB5A 5IAAA 4AJOA 3FR8A 1C3VA 4CR7A 4J7XA 2X5JO 3T7EA 4N54A 1GR0A 8LDHA 1GEGA 3WWYA 1JVSA 1ENPA 5DBIA 4M54A 3C3XA 4BO5A 1QG6A 3DBLA 4HBGA 2DU8A 1I2ZA 2W90A 3FTNA 1S6YA 4FFNA 4YVFA 1T2DA 5T6BA 1BWSA 3ASVA 3PI7A 1T1SA 3PRJA 3CTMA 1ZJYA 3RC1A 4HFRA 2P9EA 2IXAA 3IS3A 4EUHA 1AHIA 1XIVA 2NU9A 5DF1A 3EVNA 2GN4A 4QFCA 2Y68A 4DQXA 3HWRA 3BMOA 3HDJA 4KWIA 3GY0A 1E0DA 1DIRA 1K0UA 5CP8A 4RL6A 1B16A 2PR2A 4GX0A 1Y5MA 1ONOA 1ENZA 1F06A 1GUZA 3KEQA 3OFSA 1PR3A 3NTOA 1GDHA 4L0QA 4CV1A 4OQYA 4I9HA 3RU9A 1M2WA 4RVSA 5A3JA 2PKQP 3M1LA 1EDOA 3G17A 4PFJA 5BT9A 2Y0DA 2O3SA 1O6ZA 3FI9A 3JQDA 4GX5A 2HRZA 3BZUA 3TZKA 3MCVA 4GX2A 1M76A 1E7YA 4NJMA 2O23A 1EVYA 1E1MA 4IDAA 3TSCA 7MDHA 5DN9A 1LU9A 4F45A 3DFUA 3W8FA 3ICCA 4OQZA 2I65A 3UAGA 3UCEA 4MJLA 4AJKA 5DT9A 4B3HA 3NDJA 2FRDA 2GYYA 2UDPA 4GKVA 2GN8A 1DIGA 3LF1A 4KQXA 1QP8A 1U28A 3DHNA 3GVHA 4FR5A 4TSKA 3G79A 5IDWA 3BMQA 5DP1A 2G82A 5AQ1A 1A72A 1L7EA 1ONNA 1U7TA 4Q3DA 3ZI0A 1LQTA 1P33A 1MUUA 2H9IA 2ZYAA 2ZKLA 1UR5A 3QHAA 3RBXA 4CMHA 1L1FA 3KYCA 1OI7A 3PIDA 1E6UA 2D4AA 4BNHA 3HDYA 4U6SA 1UXGA 4H16A 4WE3A 4XWYA 5IXSA 3GF4A 4Z0PA 3DZBA 4XB2A 1R66A 5TLSA 3T7CA 1NWCA 1CQJA 4Z9XA 1RPNA 2YV2A 4E2WA 4RF2A 4Z6KA 4A0SA 4J16A 1DRUA 4IDEA 1M66A 1TT7A 1AXEA 3RIHA 2YUTA 3L4BA 5MGBA 1YB1A 3JQBA 4P4NA 1QYWA 3OF2A 4BO1A 1A4IA 1H9AA 4FW8A 2NVUA 3H7AA 5F1OA 3ZV4A 1SMKA 1PQPA 2QQ5A 3DMTC 4TZKA 3I52A 4Z0HO 3HFGA 3WMWA 3H5RA 1HF3A 4QUKA 2FR8A 4LK3A 3ABIA 5H81A 3AOEA 4CODB 4RVHA 3HSKA 1R0SA 4MKXA 2AW5A 4Z9FA 2PV7A 5HBRA 5ADHA 4Y98A 1NQTA 3U4DA 4K6FA 3MWEB 4DRYA 1GFSA 4BIIA 2J5RA 4D7AA 3GNQA 3RUCA 4D3DA 5GZ3A 5G4KA 4ZVVA 1T1RA 3AY3A 2JFFA 5T57A 3COSA 1O89A 2HLPA 4TKMA 1TT5A 3BMCB 2WD7A 4N18A 1SO8A 1R16A 1X0XA 3ICPA 1PGJA 1PX0A 3ZNOA 2B36A 4IJWA 5ILGA 3OA0A 2EHDA 2Y1OA 4UEKA 5A9SA 1E7WA 2QRKA 3K9QO 2D5AA 1JW9B 2ZTLA 4ALMA 1T4BA 1I10A 1RM0A 4FN4A 4PG7A 4DGSA 1HWYA 2X86A 3GHHA 3GEMA 2QYTA 3K5PA 2P91A 1FDVA 2Q46A 5CDTA 1K2WA 4MVJA 5FI5A 2NNLD 3ZWCA 4EBFA 2P2SA 5ITVA 2BELA 3A1NA 1AGNA 2PH5A 3AM5A 2NUAA 1YVEI 1VKOA 1PL6A 3BXXA 2GZ1A 1CF2O 3K2EA 4CMBA 1X7GA 2FPPA 5C37A 4JCOA 3FBGA 2NVWA 1XG5A 3P19A 2FMUA 5A1TA 1HDCA 4AJLA 1JAYA 2J5QA 2DQ4A 4CM9A 1HE4A 3TZ6A 1CEQA 2ZCVA 3ZGYA 2X7HA 3AW9A 1BHSA 4MVJD 5BSGA 1HZZA 3FPCA 1D1TA 4RF4A 5JAIA 3ETEA 3CEAA 4X54A 4Q3BA 1GU7A 2ZB7A 1TI7A 3R3JA 1E7RA 3MJCA 3NAQA 3BTSA 1ZZEA 2X5OA 4JP3A 2BFPA 5TRTA 5KVCA 3A28A 1DHRA 3BMOB 1P31A 3UW3A 3RROA 2PH3A 1I2CA 2B4QA 5AXDA 1VJ0A 4YJHA 3G1UA 3OEWA 4GWKA 5H83A 3SBOA 4FC6A 5T64A 1PJ4A 1MA0A 3L77A 3WQRA 3NTQA 4GLOA 1OAAA 1YL6A 2VYVD 4BKQA 1YWGO 3A4VA 4WCDA 3PLNA 1LLUA 2GZ3A 2LDXA 3M2PA 4C7KA 1U5CA 1W0CA 2H6EA 3I83A 4FBGA 1GCOA 4O1MA 1QV7A 3S2FA 4HKTA 4WLVA 4CLEA 2IDZA 3FSRA 3WR5A 1PWZA 4OO3A 5T67A 4AJIA 5F5LA 4BQPA 3L0DA 4J9VA 2Q50A 1XGKA 1CQIA 1WNTA 3QWBA 2UYYA 1P77A 5KJEA 1V8BA 3QWHA 2J8ZA 4CR8A 4D45A 3ZV6A 1DPGA 3G49A 4YRDA 3VH2A 1U2DA 3ZWWA 1SB8A 2P9GA 4RLSA 5JDCC 2X4GA 1VC2A 1ZEMA 2Z1NA 2OP0A 3BMQB 3PPIA 1Z73A 4ALNA 4KTVE 2PK3A 1DIHA 2JCXA 3RC9A 2EIHA 2BLLA 4I5DA 2NWQA 6ADHA 1JWBB 3U5TA 4DYVA 4NQZA 4CM8A 2D8AA 3U4HA 4BKPA 1N1GA 3D3EA 3WGYA 5I9NA 1A7AA 2EP5A 4J91A 4XX0A 4K9DA 2EXXA 4II3A 1Q0LA 3L9XA 2VOEA 1ADCA 3K73O 3PFWO 4MVJF 3WS7A 3CE6A 2OBYA 2IEDA 1QORA 2VOJA 4ROSA 3U4IA 1EUDA 4ALIA 3ANLA 4ZD6A 4WCFB 3EY4A 4RDIA 1AN9A 3ZWMA 3GRKA 2EWMA 4XJSA 3S2EA 5A04A 4CLOA 1IL0A 4CL3A 3ZZNA 5ICSA 4ALJA 2WYVA 4P8RA 4HNGA 3RUAA 4GPD1 4G81A 3JQCA 5FWNA 4UEJA 2GO1A 4R51A 2ZJ0A 2NVUB 3SVTA 4RGBA 4DBZA 3WYBA 1ISHA 2GNAA 2XF8A 3ZWXA 3QLJA 2AXQA 3WGHA 4ZQGA 1X15A 2HMWA 2VT3A 5FFFA 3TRIA 2ZQYA 2FN7A 1KEPA 1NXQA 1E5QA 2C07A 5A3VA 4YAIA 2BFAA 5TJ9A 4ZHSA 1BMDA 2X6TA 1YXMA 1N2SA 4XIJA 1C14A 3QJ5A 2Q2QA 3AU8A 3IC5A 1EDZA 4FDAA 5IZCA 4IQ0A 4M8SA 3AM4A 1BVRA 5G4KB 5ENVA 3KYDB 4OH1A 1OZAA 5CPBA 2Q45A 3C8MA 3E9NA 4XD2A 1E1LA 2WD7B 2HQ1A 4YCAA 4A10A 1P44A 2PGDA 2JAPA 4LRSB 4RORA 4YAGA 1MXHA 3O38A 4L4XA 4L74A 3U9LA 3MJSA 1ZXBA 1PZFA 3DBHA 4IMPA 3I1JA 4J4HA 1ONPA 4WJZA 5JNLA 3JQAA 4PLVA 1QYXA 1Y6JA 1ZK2A 4Q3NA 1XDWA 3O26A 1LDGA 4TRMA 3ROPA 3G0OA 1HKUA 5KCZA 1T2AA 1YDEA 2C2XA 2SCUA 3F1LA 1HDYA 3NKLA 1Z7BA 2H5LA 5BQFA 3AOEC 3VH4A 4MPDA 4B3JA 3I4FA 1FDTA 3FWZA 4AJJA 3ONEA 1I5RA 2A94A 4BO9A 4FC7A 2FZEA 1ID1A 4OOEA 2E82A 4NFHA 3K30A 4RVFA 4KUHA 3E18A 1Q0QA 3P2OA 5EMHA 1JAXA 2BFOA 3ZCXA 4KZPA 5BR7A 2ILTA 1YL7A 3JQAD 1LDBA 1ZUD1 3DAPA 4J7UA 5A4DA 1Z6ZA 3FNHA 5IDXA 2O3QA 2AE2A 4WUVA 4YR9A 4PLHA 1MFPA 3OQ1A 1BTOA 3LDHA 2DC1A 2PGLA 1H6CA 3VZSA 2Y67A 3DEYX 3K96A 4JLWA 2AQIA 2YQ5A 4YQYA 5B12A 5CDUA 4C7JA 1GZ6A 5KVVA 2GF2A 3AUUA 4LISA 1NR1A 1VL0A 1UZMA 4QO8A 4NFSA 3PFFA 3IMFA 1UP6A 4UUNA 3I9KA 3OBBA 4BNTA 2HUNA 5JSFA 4GQAA 4LVUA 3ZWVA 3AFNA 1RWBA 3QV1A 4F3YA 4E2XA 2Q1TA 1HZJA 3TZHA 4RPLA 2LDBA 5JAZA 1JLLA 3DZFA 1U2GA 3F3SA 4G65A 4CLXA 4I9UA 1SPXA 3W6UA 4M86A 4L73A 4OGWA 3HQ4O 1I01A 4BV8A 1GUFA 3VPXA 1NPDA 4ID9A 1KC3A 3GZNA 4UREA 3PDJA 1DHTA 1A9YA 2EG9A 4QSMA 3GHYA 3OQBA 3TPCA 4E4YA 1QYCA 1I8TA 4S1VA 1YO6A 3IDSA 2DTEA 1N1EA 1T24A 3B6ZA 2QYSA 2O3RA 3MWDB 3V8BA 5G4LA 2O50A 4BGUA 5I7EA 5AVOA 4IIVA 3JCZA 4ZRMA 5F3RA 1WWKA 1SEVA 1PQUA 3INRA 1JKFA 4ND5A 1OBFO 3CIFA 5JAQA 1LDMA 5CEFA 5EL0A 2W2LD 3KUXA 1ZSYA 4OSOA 1NASA 4R9RA 3TZCA 1G1AA 4M1QA 5ER6A 4O5OA 5CHEA 2H63A 1MB4A 3DFZA 5JCXA 2IODA 4BGIA 4CLHA 1LDEA 3N74A 1QLJA 4QQRA 1HTBA 3FR7A 3HUDA 3ZHZA 1JWAB 1JKJA 3LSYA 4WLEA 5F21A 5KJ6A 1QSGA 1M6HA 1LXCA 3PHJA 1LUAA 4GMFA 5C5IA 3ZHBA 1XEAA 2ZTMA 2IZ0A 1YQDA 2A4KA 4B7XA 5IFLA 4JJIA 3WBFA 3X2EA 2VWQA 3JQ8A 3QWAA 2GZ2A 1IYZA 2O7QA 3K8ZA 2BI8A 1WZEA 1Q7GA 4HXYA 4DTIA 3KOUA 2A9FA 4U5QA 3V1UA 1PZGA 3PJDA 3VKUA 1CJCA 2QIOA 3GMDA 1KEUA 3QVXA 2VWGA 2X9NA 5BSFA 2RH8A 3CXRA 1KEWA 1PJSA 3PWKA 3SLGA 1AE1A 4ONEA 1DIAA 1MX3A 2DKNA 3PHGA 2EF1A 3GPIA 3SC4A 4YAEA 1L7DA 3IKVA 3RJ5A 5L4NA 4ND4A 3WQQA 1LSOA 3HB4X 5TSDA 3WGZA 4A5OA 1LRJA 1RJWA 2NSDA 5GZ1A 1ADBA 1UDAA 2E37A 4KOAA 3O8QA 4EEZA 2VRCA 3V1YA 1V3UA 3Q6IA 2FY8A 1SBYA 5C7OO 3RFXA 1B26A 3WGIA 1SCUA 4IZIA 4L75A 5TS3A 2YW9A 3OIDA 3FTPA 7ADHA 4RZIA 1P1JA 3UVEA 4EEXA 3GVXA 1WMBA 2B4RO 4BNGA 3JYLA 5TC4A 1I0ZA 1NFRA 1UJMA 1PJQA 3AUAA 1ADFA 5IDQA 4HX5A 4NMHA 5I9LA 2BFMA 5HS6A 3W4IA 5K0ZA 3PQFA 3UFXA 3OP4A 1ZEJA 1RM5A 2JFGA 3AOGA 4PLZA 3DXFA 3DZGA 2WM3A 3F5QA 3CZMA 3BHIA 4QXMA 5I8WA 1CWUA 3FPLA 3SC6A 3ZU4A 4XQCA 4DC1A 5KJ1A 1GYQA 4W9NC 4FFPA 4EUFA 3VPHA 2OORA 4TRNA 2V6BA 4DIFA 5CDSA 3LQFA 3M2TA 2BF7A 4B79A 4MVJH 4CM5A 4XA8A 4F6LA 1FDWA 4IDGA 4I5EA 2P4QA 1DC5A 2D59A 4W82A 3HDQA 1KOLA 1ZSNA 1DDOA 2ZB3A 5LC1A 4I8XA 4LMPA 3EAGA 1YOVA 3CUKA 4HUJA 1PWXA 2C2YA 3QQPA 3C1TA 3B20A 3C24A 2DBVO 2GGSA 3AY6A 1YQGA 4D3FA 4JBIA 4DL9A 3RASA 3LVFO 4GVLA 4YYZA 2DT5A 3AM3A 3DOOA 3GT0A 3TDKA 1VL8A 3DZHA 4BB5A 4IGFA 2I6TA 3FCOA 1B3RA 3Q2KA 4UVHA 1LEHA 4DIOA 1NYTA 3GOHA 1Z7EA 4HY3A 4RVDA 4AJ1A 4MVJI 1GYRA 3RQSA 1DEHA 2DFDA 4YT2A 1P0FA 3MZ0A 4MKZA 2NU6A 3ROQA 6LDHA 2PKQO 4A2CA 2B5WA 4NG5A 1PTJA 2VYND 3D4OA 3GZNB 1W4ZA 2JHFA 2VTEA 1LRLA 4HADA 4DLLA 1FJHA 2NM0A 5B4VA 1HDZA 5KIAA 2I66A 2OXIA 4WEQA 3HNPA 1ZIDA 4KQWA 4D42A 1PSDA 2W2KA 1GPDG 4HV4A 2RHCA 1PJ2A 2VWPA 2WDZA 3JYNA 4Y8VA 2A92A 4ESOA 2Y1CA 4ZU3A 3S8MA 3NGXA 4DXHA 4Z3KA 4QTZA 1EE2A 3ADPA 2EEZA 5JYEA 1Z82A 1EQ2A 3ZW8A 4JBHA 3GAZA 3D3WA 3SX2A 4CMGA 1EBUA 4DLBA 1QV6A 2FHSA 4U0KA 4O0LA 3ORFA 1EVJA 3FBTA 2HMUA 2H1SA 3KVOA 1C0KA 2YDXA 3I9JA 1JA9A 4RPHA 5JDCA 5G2OA 4CLRA 5KJFA 4KTTE 3WIDA 2NTJA 2F1KA 1KIFA 1BDMA 3BIOA 5TNXA 3EZYA 1K6XA 4TROA 4CM6A 4J4TA 1R37A 3WXBA 4B7UA 4B8WA 4HWKA 4AJHA 2GERA 1U3TA 4B4WA 4Q9NA 4J1SA 2VZ8A 3RD5A 3FNEA 1WVGA 3JQ8B 4N5NA 2DTDA 3UF0A 4PLYA 1OC4A 3DBVO 3PJEA 3UUWA 4RQTA 4O59O 3DOJA 1XLTA 3RU7A 3ZU5A 1R12A 2O3JA 4IJKA 3L9WA 1IZ9A 3UOGA 3BTOA 3E82A 4UAGA 4IPTA 2VUSA 5DDIP 4L8VA 2C7VA 4RVGA 4UULA 3HZZA 3BHJA 4CLDA 2VN8A 1Q7CA 4E12A 4BO6A 5L40A 2I3AA 1PJLA 1IHYA 3DAFA 3L6OO 2VTDA 3H4VA 3JD0A 1IE3A 4GGOA 5IDYA 1X1TA 2Y99A 2D2IA 1HXHA 4BNMA 4GH5A 4WLUA 4J1QA 5AOVA 2CD9A 1BXKA 3VAZA 1LTHR 3QRWA 3TFQA 2CSUA 1EUZA 1EVZA 4YEDA 4BMNA 3TN7A 4ILKA 5B4UA 3CMMA 2CF6A 2Y1GA 3OIFA 4MO2A 2FSSA 2Q4BA 1V6AA 2Y66A 3GUCA 4NK5A 3OJFA 4PN3A 2E6UX 1K6IA 3JQ9C 1E7QA 2DTXA 1EFKA 4U8GA 1HSOA 1DO8A 4NHEA 4OYRA 5I8ZA 1E3SA 2O48X 4DUPA 4JJGA 4UUMA 4FB5A 2HAEA 4PLGA 5CDGA 1Z75A 3O4RA 1N9GA 4Y6SA 3WGOA 1M75A 1Y8QA 4XYLA 1T4DA 1H93A 3ZNPA 4BO4A 4DA9A 3D0OA 2HK8A 1BXZA 1HE3A 3VTFA 4E31A 3W4KA 2O7SA 4E21A 2CNBA 4PCVA 4W6ZA 1OMOA 2Q3EA 4CM4A 3ANMA 2EGHA 3E6AA 4BNVA 4WLOA 1X7DA 1Y81A 3HFSA 3HDHA 1E5LA 4PG8A 1UXKA 3F5SA 3GH3A 1TVEA 1TXGA 1K6JA 2EKPA 4YXFA 3AWDA 3LC1O 4YA6A 3TFOA 2P68A 3NJ4A 4R69A 1PZEA 2I5PO 2OGUA
chains in the Genus database with same CATH superfamily
4S04A 1IULA 4ZC1A 4EB8A 4EG6A 1YZVA 3QM1A 4A4DA 2XF2A 2I0FA 2AV6A 1UMCB 2Z9BA 1F8FA 3S68A 1ECJA 1UOQA 2H18A 4FSDA 1LX7A 3GUUA 5F4BA 3EE6A 2HO4A 2QG4A 1L8LA 3EA5A 3GG2A 1CUSA 3JYQA 1E8DA 1YQXA 3IIIA 1LPPA 2WD8A 5B1SA 4R8MA 1ZKMA 1OSNA 4J9UE 2B2XA 3HU5A 3VU9B 4H08A 3AEQA 1TUBA 1PUIA 2PIAA 4XGNA 4MULA 3MILA 3N7TA 3NASA 4Q03A 1ZK0A 1M7BA 1P45A 2HCTA 1ZVKA 4D43A 5JJLA 2V1UA 3VPFA 4MVJE 2ERCA 3EULA 4MPRA 4A1OA 3PDWA 4CN9A 3HWX1 3I09A 1TQ8A 2NU6B 4JJFA 4FLMA 3T5BA 3WL3A 5C32A 2GUWA 4I3FA 5I5GA 4G0NA 4OL9A 3I6IA 4JJ8A 4JDUA 5LKRA 1I2BA 5EE9A 2XADA 2OKGA 3PUVA 4EY3A 4EM6A 2YVAA 1MABB 2YX1A 1WF3A 4Q9JA 5HFNA 3ZY4A 3WFZA 4NYIR 5GM1A 3JPYA 1H2HA 2BJHA 1JDTA 1NQVA 1TZCA 4HPWA 1PZMA 1FL9A 4LVNA 3P9YA 1ESNA 1IIRA 2WTUA 1XMSA 2G28A 2JKYA 3Q9NA 1J0CA 1P74A 2W2QA 3BGIA 3H6GA 1GNQA 2X8WA 5J2UA 1G64A 4MRSA 2E6KA 3E81A 4BJ6A 2F3SA 3G82C 1E79D 5KTRA 4E4TA 2I7XA 1LW7A 1RHKA 3DC2A 1XU7A 3I05A 1FY2A 1M1NB 2IXGA 2P9YA 4NU6A 2P3OA 3TRHA 2ENUA 4BJ3A 3E70C 4MVCA 4MROA 3R5JA 2MYPA 4X3OA 4YT8A 1Z8DA 4XYMA 2OL4A 3T1OA 3H9EO 2H4XA 3OEHA 1NDQA 1YE8A 4W6QA 4Q6WA 4CLRB 2PUAA 2VIIA 3REFA 2ZXUA 3V8MA 3ROTA 4ZV4A 2F48A 1YCHA 3P71T 4N3CA 3SDBA 3UB2A 1QG4A 3DVAA 3IPXA 5A9TA 2AR9A 2IPOA 3H13A 2BGJA 5KNBH 3G9UA 1ZI9A 2GVDC 2X19A 3DONA 2Z09A 2Y2VA 3X1JA 5KYWB 4W5HA 1KAHA 3QBDA 1H4SA 2VXYA 2WWRA 4DMRA 4J2TA 3RSQA 4P34A 3LLMA 4D25A 4Z5XA 2OV1A 2AMVA 3CZRA 3KOWA 3FZYA 4JX9A 4G0MA 3JATA 4NJMB 4D26A 4I99A 1Z47A 5CIQA 1S8OA 3G88A 3QLVA 4PZCA 2YXBA 1G3RA 4XOIA 2ZBVA 3AZQA 3D9QX 2CZCA 4HXEB 3S81A 1WP4A 5DHTA 5EIEA 5GTDA 1RAAA 3C97A 5KX5B 1A9XA 5CT4A 1PR9A 1WBJB 3D31A 1SCBA 2CXOA 4DXAA 1IY8A 4IG9A 4Y7CA 4AKIA 2WF5A 2AFIE 3CX8A 3IXQA 4X1KB 1KKLA 3LY5A 3AY7A 1K4MA 3T9CA 4F6CA 4EPXA 2IY9A 1P62B 1TYCA 4LY9A 4UAJA 3SGLA 1KL7A 5DNWA 1QK4A 5A5EA 2XVYA 5HF9A 1DLIA 4GP7A 4M4SA 2O0HA 4ZVUA 2QVYX 4NH0A 4PEVA 4BQIA 4FFDA 4Q4JB 1JLKA 3I6BA 3KJQA 1DT5A 2WYHA 4B73A 5FUYA 2GD6A 3MCTA 3V6LA 1C1XA 5KSOA 1GL6A 3EA4A 2Y92A 1BA3A 2Y1EA 1TKAA 1BX0A 1PEAA 2W2XA 3A06A 4W1RA 5DZSA 3PCRB 4M2LA 2R6JA 3MPOA 1EMDA 1Q20A 4QOSA 1FVOA 5K3CA 3WLQA 4CIAA 5AVRA 5K4GA 1GWNA 4IIHA 1R6UA 1G8SA 1XLUA 3FSEA 2JFPA 1GPAA 4ZKEA 4QBKA 5IF9A 1NVAA 2ABWA 1SHJA 3DZDA 4DNFA 3VYTB 4BN0A 4W5QA 1EUQA 3EXHB 3W4JA 2G83A 1CR4A 2CLEB 3F90A 2C88A 3BL6A 3H75A 4J07A 1XTUA 4BB0A 4HGNA 1HKHA 3JWEA 4KVGA 1N6HA 1KS2A 2KI5A 2VRBA 2POQX 5K1ZA 1U4SA 5AHWA 2AKEA 1K7EB 1IN8A 4JBWA 4OHPA 1E6KA 2QTZA 4FLEA 3WFIA 4ARSA 2QI9F 5JEDA 3N2GB 2J46A 1YT5A 3EMVA 3IE0A 2QJFA 1U3VA 4Q1BA 1N9GB 3L6CA 2OXFA 4FCCA 4MW1A 3EH1A 2YS7A 1U8YA 4V0ME 1GZUA 1ULHA 5AM1A 4MDEA 5JVDF 1SWVA 3NM6B 4FKZA 4OQNA 4RV9A 1Y3AA 3GDHA 4D0LB 2DKOA 1H94A 3GEEA 1E2HA 2ZM6B 1ZMTA 4PG5A 4WXMA 4B7CA 4IDQA 1LSUA 1XXHA 1FJ2A 4KSBA 4EITA 2PX3A 1KEEA 3N6XA 2GSDA 1VRVA 5BYJA 3RU3A 3COJA 4KXNA 1JDBC 1UXHA 1YZUA 5AH0A 4DSTA 3DYVA 3GDWA 1BFUA 1Q0RA 4HB4A 1QYRA 2JHPA 5GP1A 4WADA 4OQXA 1E5VA 3UIEA 4DV7B 1Q74A 1E96A 3CPHA 5J2TB 3FNQA 3VAYA 4Z4EA 2BMEA 1Q0ZA 4IGIA 3WMGA 1COWA 3KZOA 4CMIA 4G85A 4LF8B 3K70C 3GEDA 3KV1A 1RJ9B 4C4ZA 1DG9A 1WCIA 4F8YA 2H00A 4CQLA 4AJPA 1TT5B 1KPHA 2TRSB 5IZCC 1BE6A 2C84A 2EBWA 1KJIA 2Q4EA 3IKMB 5ELLA 3GN1A 5ARBA 2X5KO 4PYKA 4R2IA 4CM7A 4YMIA 3R7LA 2FLKA 3NWEA 1D4FA 4LGVA 1A88A 3HCDA 2UAGA 5FOWA 1VFPA 3IDQA 4OP1A 3I4LA 3KTOA 2GAIA 3N75A 4OK3A 4EG0A 3GC6A 5DU2A 2LD4A 5TPWB 3RODA 2FSGA 3U6KA 3D3QA 4AO7A 1XKTA 4FGKA 1Q19A 1OFVA 1HLDA 2X3YA 1J2TA 4IDNA 4YJDA 5C5CA 5EIWA 2ZS9A 5KNCA 4YWHA 3T4EA 1WNFA 3FJ1A 3L4JA 2XHEA 1CUVA 2G1UA 4BMVA 1I2AA 2GM4A 3MJFA 3D5QA 2DG2A 1OGYA 1W29A 5KAMA 5LBIA 3VTZA 5BN1A 1NNEA 3OPMA 3N8KA 4M22A 1MAUA 3K8QA 1Y63A 3GX1A 3UK1A 1JWLA 1RJDA 2W2TA 4AJ9A 3AETB 4YUXA 4MKIA 1ZNQO 4GF5A 1T3SA 1D6NA 1LFAA 2IYFA 3O8OA 4K0KB 5IVDA 1E9DA 1VA4A 3WDKA 2X0KA 4QFBA 4CEIB 1EI9A 3ZI7A 4IO1A 2HV9A 2GETA 4XFDA 3BE8A 1YB4A 3C6MA 5JANA 1G9SA 1GXSA 1HDGO 2AZ4A 2A0KA 4FYYA 5JS1A 3E05A 3EBLA 4B4UA 1BFKA 4F96A 4Z2AA 3T5TA 2H52A 3IO3A 2FYTA 2B5OA 3LVRE 2JGLA 3NPMA 3RHFA 4BFTA 5K3FA 4WOPA 2AEJA 2PZLA 1FEZA 2YIJA 3LLSA 2A1TS 3I0ZA 2C4UA 4IDCA 5JMPA 3BXZA 4CCYA 1SRQA 2JEZA 4FOTA 2P6OA 4MRAA 3PQDA 3HBLA 1JUDA 1L3BA 3U5ZB 1G0NA 2WHYA 3BXPA 3ESDA 3R7AA 4JHXA 1HPLA 3JWGA 3QWIA 1PO7A 2V7QD 2X2EA 2AKAB 1NBMA 5DW0A 1GPLA 1MXFA 2B99A 1XMOB 5EQFA 3F5FA 4OYYA 3HY4A 1FQWA 3R24A 3KFVA 1QAOA 5E6UB 1VP9A 5FUWA 4BE4A 4E15A 1G42A 4RD6A 4UVGA 2BGMA 2H59A 3STUA 3EZLA 1IMJA 1L7QA 1NMEA 1TKBA 4PWZA 3NTLA 5K3SA 2PFKA 2HMTA 5G3YA 4GP9A 1NVFA 2BKUA 3UMBA 4B8YA 4WOJA 3QHQA 3RLFA 4Q5IA 3GPDG 3SY8A 1U5AA 4JI8B 3L93A 1DC4A 3BTUA 2OA0A 3E2PA 4CCAA 4HC4A 1VSUA 2IV2X 4R2LA 5TJHA 4E33A 1GPJA 1Z6PA 5EJ8A 4FFMA 4ECAA 1TJ4A 3WGQA 2BYTA 5JO9A 4I8IA 1MO4A 3SM9A 1AG9A 1NHWA 3UT5B 4GWGA 3F9RA 4KQCA 1X1RA 3ZXXA 4B44A 4ZI7A 4QDUA 3SFZA 4FZ3A 1F5SA 2BFWA 4JD5A 2Q6LA 1MA3A 2HWUA 2AFHA 2IZ6A 2QXTA 3IRUA 3LIIA 5CA1A 1UBCA 4LQLA 4PFSA 3S2YA 4LF5B 1R6TA 3PYLA 1TZMA 3HU3A 3AV0B 3N05A 2XMSA 5EZ6B 1TO2E 4DPKA 2PZJA 5B1YA 5JBIA 4U5XA 1AS2A 3QMWA 4EABA 3ENNA 3UGTA 1NQOA 4L76A 4OSEA 4QU9A 3RC7A 3LGAA 1YR1A 3UHPA 4Q93A 4S12A 4FZVA 4I55B 4ZKDA 3F9IA 1I30A 1FMTA 2YICA 1XF1A 4R2HA 4KX5A 3ER6A 3LX4A 1M0TA 4PBRA 1ATIA 3B1XA 3FRJA 1BH2A 1WKBA 3AF1A 4YJFB 2PUCA 1DOHA 2IUUA 1BGWA 4OMFG 4AW9A 3TWOA 2NADA 4FP9A 2Y1WA 4DB2A 2YRWA 1ZINA 3COWA 2BCJQ 5IVPA 1K08A 1W2GA 2B25A 4L0MA 4EUNA 4D0GA 2WIBA 2FEWB 3P52A 4L7VA 4YJ2A 3WLMA 2Q41A 3K6JA 5LWQA 4UOZA 1WKCA 2GYVA 3AL3A 2GYWA 5DMHA 4UOEA 3HVKA 2A5JA 4P84A 5K4HA 3RKRA 3KL4A 1JJBA 3EDCA 3IKJA 3I4CA 1XRPA 1P5HA 5DK6A 1DBPA 1EZZA 1GJRA 1SBCA 2HNBA 1GV1A 2B6HA 1CETA 1OIVA 1IH8A 3IT1A 1ZMOA 3JYOA 1OH7A 1MZPA 2Q27A 2GASA 1O6GA 1TQ6A 3KTDA 4L5JA 2YFQA 1Y4UA 4OHKA 5DN6A 3Q98A 4YJ3A 5HKLA 4I4CA 3VR6A 5CBPB 3E8XA 4PHCA 5AKEA 1T36A 3C5HA 4LHEA 3FUTA 2X7XA 1G21B 4DV2B 3HYNA 1WEHA 1G5FA 2Q2WA 3CH6A 3MTJA 1UAYA 2Z2KA 5BRNA 5A9RA 3KXKA 5EMKA 2X4LA 4WJKB 5K01A 2QZZA 3E03A 2X0DA 5K2OA 1PL7A 2XAUA 2YDYA 1DQRA 4MGKR 5KQLA 2NZWA 4BX9A 5FPYA 3ROKA 4LSMA 3O84A 3VDMA 1ZICA 4KNWA 5KYKA 2Z30A 4LRWA 2QXUA 3RTCA 5C9ZA 5LPNA 2CB0A 4IIJB 1IWBB 2RMKA 3SF0A 4FE3A 4FJ1A 1I6LA 3V00A 2ZDHA 4WXEA 5T4BA 3GRZA 2GFIA 4KGXA 1SQ0A 4O4IA 2ZGVA 3IAUA 4IM7A 3MPUA 2GD2A 2OHFA 3PHHA 2WW8A 2JGRA 4PF1A 1HTTA 1Z7GA 4QXAA 3VSEA 4EX7A 5L3QB 1BOFA 2QV7A 3VX4A 3NEPX 3EAQA 4L5AA 2PX6A 3LT4A 1NPYA 3TNJA 4FZRA 1ZKDA 2NW6A 1RLMA 2ATIA 2H29A 1TJ5A 3MIZA 4WD3A 1ZUHA 4YRRA 1J8YF 2PL3A 5CM8B 1VLLA 3ZDFA 3HVRA 1FVFA 5L4SA 2A9PA 4LG1A 2IYVA 3AVOA 4M83A 4MUFA 1EX6A 4HX2A 1CG6A 2WNIA 5IJXA 4QEZA 1J2JA 2NGRA 2WWHA 4H7PA 3PJFA 3O47A 2BHNA 2B8EA 4O29A 3DZKA 2VAVA 1Q7TA 1KVTA 1XYGA 4RHUA 4AF6A 1PS8A 5SICE 5FYDA 3RTBA 3I64A 5CFNA 2VHZA 2QRVB 3ND9A 4JDPA 3S7ZA 2JB9A 1QJ4A 5ALSA 3V33A 4G56A 5K7SA 5IVIA 1JFFB 3N8HA 3BB3A 1ZBQA 1SVIA 2WWVD 1FBNA 1RLOA 3B1JA 3ZIDA 4E13A 3GD5A 3TEMA 4XXHA 4RS3A 3OLWA 1L4KA 1C4OA 1U02A 3NV9A 4ZXPA 3VM6A 4MAAA 4DR1B 2R00A 3ASUA 3LFTA 1VBFA 3OZCA 1XQ6A 3O8DA 1TTHA 1S2OA 3AI1A 4IDHA 4RIIA 4DUGD 1W19A 3ZBTA 2BUCA 4OAQA 1DNPA 4O4LB 4RA6B 3U49A 4HGRA 5J5CA 2YY6A 4RPGA 1K27A 1YJXA 3F98A 1WUHS 4L5IA 5LLSA 2IYRA 4EO4A 1NU6A 2CVOA 1XRNA 4C9BA 1SXPA 1ZH8A 4INJA 5JHHB 1XKQA 3CLHA 4UW9A 3TL2A 3TTUA 3ZLUA 2IBSA 4H7DA 4L2IA 4AD8A 3V4PB 2IP2A 4WWHA 4ZODA 1VHLA 3U7QB 5BP7A 5KJ6A 4F06A 1TMGE 2X0JA 4PSCA 2DZDA 2JCBA 3OC0A 2GR9A 5LDHA 2XEXA 2WAOA 3HYCA 3UAYA 4BGVA 1GFIA 3IQGX 4KE9A 5FL7A 2CHVA 4JVSB 3Q11A 3K3PA 4YCMA 3E53A 4RXUA 3TAUA 4FPXA 1N2HA 1QTRA 1SCNE 1ULZA 1ZN9A 4MP8A 3GGPA 4BHTA 3WL7A 3VC1A 2A9OA 3A7EA 1XTSA 1S96A 2G08A 2G63A 2J3HA 3MJDA 4NJOA 1PCXA 4HMOA 7REQB 3NBXX 3KR1A 1FSSA 3OETA 3PPVA 4RTQA 3HR4A 4O2BF 2QPLA 5JADA 3EOBI 1IHXA 1VE5A 5CFLA 3W77A 3QUSA 4KC0A 1Z3CA 5EZ5A 3P9PA 4RKEA 2RGEA 1T9HA 3GLFA 5HKKD 5KOHB 3AJAA 1BDIA 5FKJA 3VZDA 1FYWA 3ZZUA 5C8YB 4M9UA 1FYEA 3EY9A 1KKUA 3PUXA 5T4FA 1JXMA 2MU1A 4R83A 2REQA 1NQAO 1XVLA 4HDMA 1IPEA 1W6UA 2P8JA 1J25A 1NBIA 4H3VA 2VAMA 3R3ZA 4MQFA 3VX3A 2JCVA 1GTMA 1UMDA 3LYLA 2X1HA 4QJ3A 3WIEA 3ESCA 3HKCB 3TD6A 3RAGA 2ZRPA 4FNOA 4DCNA 4RMIA 3RT9A 3RRJA 4DBVO 4J29A 1MB9A 2H48A 3PITA 4PQGA 1WMFA 2Q5OA 3RUIA 1Z6AA 1M9NA 5ALOA 3TLGA 3OCZA 4KQHA 4ERNA 1AKMA 4INAA 3HKDB 3P5BA 4D6PA 2OZPA 1NW6A 3BWDD 3LKZA 3SQOA 5ITWA 2RCYA 1M0EA 4OXIA 3REQB 1N1DA 1U8FO 1F2VA 2IC5A 4EW3A 1ISSA 4WNAA 5BUQA 1K98A 5JY6A 1JDNA 2VDNB 1KZ9A 3HCCA 4MO9A 4TV9A 3WLAA 1ODSA 4XVCA 2NLOA 2C9DA 3GXOA 5BNTA 3R9XA 4NFLA 1YUBA 4F9EA 3A3PA 3GR6A 2RAVA 1PVDA 4FILA 1OX5A 4KRGA 2VNAA 1N6RA 2I55A 5JCJA 4A27A 4ZJPA 3QF7A 2ZATA 3NRCA 3PWTA 3D8BA 3QMVA 4D79A 2FW8A 1ADGA 3DHVA 4NJEB 1OW3B 3OZEA 4XIYA 3E1GA 4H3KB 3RIXA 4M88A 5DSTA 2VNJA 2G25A 2ZBFA 1FP1D 3U4GA 4C4AA 4QA9A 1NP6A 2H11A 3VH3A 2IX9A 2HSJA 2AHRA 2XA2A 3K2BA 3LDFA 5G0VA 1HDXA 4M9RA 4M1KA 4U9IS 4AYWA 5KMGB 1A8IA 3MGCA 2Y9PB 4DUYB 1BW9A 3MAGA 1ZA1A 4DLTA 2PBRA 3O4JA 1YC2A 1XPJA 3VOAA 5KDOA 4NBTA 1M83A 1LNSA 3IP8A 3MJVA 2G9VA 2EARA 1KI6B 2O4UX 5AVQA 3WWOA 3T5PA 4HDNA 5DNYB 5CCXA 3DVSX 3D1VA 3QJGA 5FF9A 3DDUA 4MAMA 3COVA 4E5DA 1E1CA 5LWHA 2V54A 1UBGA 4ND7A 2CE2X 1JBKA 2OCGA 1D2EA 2EFEB 4P7KA 4EF5A 5LJLA 2O14A 4F4FA 2GEKA 1VBMA 2ET6A 2C20A 2H4YA 3NZEA 2BUBA 2LNDA 3K71B 3PGJA 2BP7B 1OAKA 4YP0A 1XZFA 1E92A 1Y3HA 1SUAA 4XH9B 2ZRNA 2F4NA 5LQJA 2PPVA 5TQ0A 3JQ6A 3RC8A 2WQ6A 3R7SA 3A6JA 4GGPA 2IUYA 4C76A 3SX0A 4ZEWA 3H1GA 5MFZA 4KYUA 5IMBA 5C1OA 3QU9A 5COAA 1KJWA 3L0ZA 1K3UB 3RFVA 1QRTA 4B4OA 1AO3A 1DC6A 1E62A 3GRPA 1ZGAA 1FZTA 3QOYA 5FLEX 1QHNA 2G1JA 3HYTA 5BURA 1G38A 3FCEA 2WMYA 2ZRKA 4CIWA 1SC9A 5JAMA 3MF4A 1PD1A 1SOUA 3QVTA 3G7UA 4RQAA 9LDBA 1RU3A 2CNNA 1CNEA 2VZLA 3AR7A 2X7JA 4BJ1A 1RQPA 1DX6A 1SU8A 4K28A 4MWCA 4ZQBA 4EJ2A 2OSVA 2O2EA 3KSMA 1C7IA 1PL8A 3SJUA 4LZNA 4YLEA 1N92A 1JV2B 1OZGA 2OHXA 1R4NB 3UPUA 1RXWA 3U62A 2O0MA 3E9DA 2PV0A 1VCNA 2ZBPA 3KB6A 1YOVB 1FBTA 1AZTA 2BVNA 2QRLA 1R6BX 1ESMA 3N53A 4G89A 4K3VA 1DLJA 4PVCA 4W63A 1P0CA 5FOQA 4B74A 3T7JA 2EW8A 3QA9A 4KO2S 1SU7A 1J9EA 1V8FA 4DBLC 4F72A 4BC0A 4DCPA 1MTOA 1LLDA 2XDQA 2YWCA 1JHVA 4V39A 1AZSC 2P40A 2DYKA 4EGSA 1FRVA 4F6RB 1V43A 2QZ9A 1T4MA 5TGZA 2BC9A 4FKBA 4F5WA 1TPYA 3RRXA 3PC3A 1BVHA 4XDYA 2J7PD 4CYMA 3QYJA 4IIYA 1YMQA 3SS8A 2PKCA 4PYQA 3IPCA 2V8OA 1RQLA 3FPHA 3V3TA 1N77A 2XMDA 1TYDE 1NJSA 3D5TA 2HWKA 2PUGA 2MSWA 3H8SA 1A97A 2QU7A 3C48A 4EECA 2CV0A 4Q05A 3OP1A 3WLNA 4BQRA 4TMFA 1OLUA 4TTJA 1K7SN 2H4ZA 5H8WA 1Z6QA 2MDTA 3ENVA 4ARVA 4LDRA 4X7PA 5I9BA 4WFIA 4E70A 1BZYA 4BEBA 4P0QB 1QLHA 4M8KA 2AZMA 2I2XB 5IYZB 4ZTZB 4ZVMA 2FG7C 3OOEA 2M2IA 4PCUA 2KMLA 3DVQX 3VSCA 4AG6A 1K5DA 1NVWQ 1R0WA 2HJWA 3GGOA 4R01A 4POOA 4YMVA 3TGPA 1RWQA 3C7TA 4DDMA 1WDTA 4HRXA 1UPTA 4YT4A 1GR1A 3E35A 3EZNA 1HLPA 3QYPA 1F8GA 3TJRA 5LP6B 4GPZA 2QD4A 2GKSA 2JLSA 3OZBA 2W70A 3K8OE 1NNLA 4TN1A 5LQKA 1HEUA 4ER5A 2Q5IA 3D64A 1ZI8A 2OOKA 1OOEA 1XV5A 3FCYA 3FKJA 3C7CB 1GFZA 2QD1A 4GRAA 4QPNA 4DILA 2WJ4A 1AMNA 1SA0B 3T3HA 5ECGC 1W94A 4U2DA 2CHGA 1Q1NA 1GY8A 1V11A 4N5HX 3V1KA 2B8JA 5F73A 3TMAA 2CYCA 3V1TC 4BZWA 4XJTA 1V45E 2V4UA 3PFBA 2DKFA 3W2TA 3IJ5A 2O54A 3ESYA 3NGMA 1HT1E 4JP2A 2G5CA 1ZN8A 2GBIA 1H2BA 4EMTA 5BR8B 4BLUA 4HNVA 1QCCA 5B4TA 4D92A 3EJWA 3ZHSA 1KSHA 3HPRA 2ISQA 2IBMA 5FBLB 5IJ0B 4DCOA 1BKDR 1L4YA 4H6WA 1NOJA 3VNVA 2YFHA 1YJ8A 1X9GA 3DTVB 4N5LA 4WK4B 2XXAA 3CNOA 2RHHA 3X2FA 1T26A 4RTRA 1RIIA 4Q7JB 2TMKA 1R9NA 1SFRA 3C45A 3K5IA 4P7JA 4AZTA 5AD1A 1GSIA 4P5EA 4Z4HA 5C1PA 2V7VA 4FD3A 1V95A 1RAIA 1N5RA 2QLTA 4O2AF 3ZLBA 2QJOA 2BKAA 2NTVA 3A2NA 3CIOA 3R7WA 2VK2A 3W3AA 3GBSA 1ZM4A 4R31A 4W4TA 2G76A 5CLLA 3FFAA 4ZEOA 3RARA 3X0DA 3IKTA 3KB8A 3MK31 4PBTA 3V1NA 3CNHA 3I2YX 1YCDA 2GPTA 1YS9A 2HQSA 2W22A 1WW2A 1XZBA 3GRRA 4LSGA 1CS0A 1WXWA 3PNBA 1XRSB 2WIGA 5K6AC 2ERXA 3L0BA 1KFEB 2JASA 5IZ4A 3ETGA 4M7PA 3QTTA 1DS6A 5E9QA 4M0EA 4P2GA 2IUFA 4OGGA 3TG8A 2OWDA 1WXQA 1AB5A 2FPIA 2QRQA 3B9QA 3KKKA 3OQVA 4JC0A 3VUFA 4ZFNA 4BPBA 3FSJX 2GF9A 2O8EB 1T1JA 2PVCA 3TVTA 1U8UA 3SIWA 3TR5A 3BGSA 4KN6A 4AL4A 2E55A 3KYJB 4C5AA 2WNHA 4EO9A 4ZHQF 2A78A 3BSYA 2D8MA 4ZAWA 4MJXA 3ROMA 3QVJA 6ABPA 2ZRAA 1EGQA 5FA8A 2FPUA 3EXFA 1B0PA 1C3XA 1G55A 5HSGA 4OG2A 2TMDA 1NUPA 3Q72A 1JQKA 1Z4QA 4M1EA 3S7TA 5IUJC 4PZYA 2Y0PA 3CVOA 2BD0A 3G2KA 3LGXA 4MWSA 5KU7A 3MD9A 2WPDA 2YYYA 4UZSA 1AHNA 4UM7A 5CPFA 4G63A 3JY6A 1MAAA 3GJRA 2P9CA 4ZALA 4NSNA 3TJZA 5EQJB 3DLPX 5FA6A 4R0NA 3TF5A 1PGOA 3DZJA 2J6BA 3GIWA 1IM2A 2OG2A 3WL4A 1MP0A 1DTEA 2NZ2A 4Z1MA 3HY6A 2JDID 2JH9A 3HM2A 3KVRA 4UZFA 4WK6A 3KLMX 3OJLA 4HNAA 1O9BA 4ETIA 5GAJA 5IJZA 1WETA 1VHJA 3H9QA 3TM5A 1ORHA 1EZ4A 1ULTA 1PGQA 3R74A 1Y8QB 3JV7A 3INYA 4UM5A 1E0AA 3JW8A 1XZIA 2PYIA 1KZYC 3CF4A 2I03A 3PC8C 3A9CA 3EZ9A 1FDRA 1F3LA 2G8LA 1XXHE 4MP3A 1HDRA 2P4HX 3KLOA 4NFYA 1IEQA 1FXUA 2JKZA 1AHHA 2FQYA 1GPKA 1EFLA 3K6SA 1RWVA 2EJCA 1SXJA 4KAXA 1ZONA 1HQKA 1VPWA 5J4LA 2KX7A 5C3UA 3BGOS 5FH9A 5C51B 3I23A 1EVKA 1THZA 1U94A 2C8KA 5CT8A 3HN7A 5ALMA 3FOEC 3PUJA 4DLBA 1A96A 4DWOA 1CY2A 2FFAA 3MWFA 3G5UA 3SJZA 1RCUA 3MWJA 4EWLA 4QDZA 3FWPA 4HGPA 4HGOA 3ZE7A 1X92A 3REGA 2XXAB 1B73A 1TQ2A 3W5JA 1NBEA 3CLSD 4IXNA 1A2KC 5HDBB 3A6DA 2HN9A 3FDXA 1K5PA 1YS2X 4REOA 3OU2A 2FW1A 3ZJ4A 1K0FA 4J1JA 1UPCA 3B1VA 3BE6A 3DE6X 5LBUA 2YOFA 5LA6F 3KUDA 1V71A 4MITA 2CZQA 2J07A 1RKQA 2M9MA 4B3RB 3QA3E 2DAPA 1ULUA 1P3DA 4U2CA 4YDHB 1PFWA 2AUMA 2HU7A 2NXNA 4HGZA 4IHJA 5DKFA 3ZS9A 1NF9A 4BMOB 3B12A 3KZVA 3VPGA 3ZYCA 2D1YA 4N4AA 1FNBA 3FYUA 1T8SA 4I4IA 2XX3A 4PIVA 1N7HA 1DARA 4EG7A 5ED4A 5I5EA 4ENQA 5HZMA 4PGAA 2G4LA 3TRJA 5CVVA 1V8OA 1FE8A 3AVYA 1IJKA 1BXGB 3MUOA 3A9WA 3CVVA 4BO8A 3N2ZB 4B81A 5IARA 4F56A 2DWCA 4ZT7A 3VHXA 2NVBA 2DWQA 3MINB 3GA7A 4RIFA 4DCVA 4P22A 4AAYA 4JP1A 3L4BC 1ESZA 2HU5A 4LGMA 1D0VA 2DH5A 2QX8A 4LXUA 1YCGA 1PAUA 3D6TB 2P4SA 3JZFA 3P45A 3LXUX 3PGKA 4MGHA 4DDUA 4G84A 1NN3A 2ZIGA 3QX8A 4XRRA 2GWHA 5FULA 3E84A 2V9PA 2YFYA 4MW5A 5AK5A 1R0BA 3X1DA 2HSEA 4FUQA 4ITUA 4E51A 5H82A 1QGUB 3GNTA 2IHKA 3L01A 4M7WA 1ZVQA 4G0XA 1PV4A 2YNMC 3PR1A 1KDVA 1M3SA 2NAFA 3SQNA 3GLIA 3ZLAA 5LFAA 4BN5A 3PFCA 1UBMS 4FQ7A 1PDWA 1QIFA 2IHBA 3CEMA 5AW3A 2NN3C 2X77A 3VNAA 1XELA 1D3AA 3M7IA 5JAHA 4U7JA 2Q4OA 2X2PA 3GVCA 3L8HA 3RJTA 3RIYA 2X0EA 4B4DA 4YMHA 4FHEA 4BQOA 3M1AA 2PD4A 3L3BA 2ZYUX 2GCOA 4LHSA 3VNBA 2E85A 4Y2HA 3V5NA 2BZGA 4W5JA 2ZWAA 5I8PA 1WSAA 4BO3A 2JGNA 1H1LA 1POXA 1IDOA 1NZDA 2CDBA 1S89A 4GI1A 1GLVA 1J8FA 1HE5A 2D62A 3A27A 3RKUA 4CM3A 3EMKA 3NAZA 1RLTA 2EAUA 4DLZA 5GOTA 2NSHA 3IIMA 2BTOA 2JAQA 4R3UC 1F2UB 1USIA 1N0IA 4UU8A 2HDOA 3RVNA 3HDVA 3SOPA 5AOCA 4N03A 3WBBA 1V9SA 2DLDA 5IK2A 3KDAA 3JQGB 1XPUA 2BN4A 1LB1B 4FZ5A 4H1TA 3W5CA 4KE8A 3WHIA 1P1FA 3NDRA 1I4WA 3ZWAA 3I01M 4JIMA 1FVHA 2N1MA 2WHEA 1C8BA 2HZ7A 3DKVA 1G16A 3ORYA 3WSTA 4C04A 1N36B 2B4TO 2ZSUA 1P5RA 3ZHTA 4RJTA 3I1YA 4J0EA 3CUUA 4KYTA 4CV2A 1NXOA 2X23A 3MBIA 3A9TA 1PNOA 4U9UA 1H1DA 1XJCA 2WWWA 2AFHE 3SAJA 4DLRA 2K7ZA 5FBQB 1XZMA 1ZNWA 4M37A 3RUPA 3OQOA 4WEOA 2AN4A 1CULC 3DZ8A 4UHJA 1J5EB 3Q7RA 3BSSA 3PNQA 5FL3A 4F84A 1T91A 1A9RA 1UFOA 5CJPA 3RUEA 5KTTA 1CR0A 1SVLA 5CXQA 4HTFB 2DWOA 1BXRA 1JPJA 1YK1A 4HQRA 5JAUA 1UDXA 3GAMA 3DG9A 1NC3A 1QTIA 3OPXA 1ISRA 2FF5A 4CM1A 3PQCA 3RS7A 3PENA 5TX7A 1DKRA 3VHRA 4NCKA 3VR3A 1HZZC 1CHNA 1QB8A 3LUGA 3RK1A 4QD3A 3L4SO 4DIDA 2DSNA 2E3JA 5J58A 1RRCA 4O4JF 1NYQA 2BGKA 4YXWA 3LBAA 5HJ5A 2J7KA 4X6XA 3TQIA 3ZJ5A 4B3TB 2FP4B 3DTNA 5KYXA 4OH7A 2GBCA 3UJCA 2L69A 3AG5A 1JHOA 3NT2A 2CVFA 2W2PA 3HB7A 1QK3A 5GONF 5JH7A 5LKAA 3Q7SA 1BRTA 3B60A 2WU8A 4A6XA 3FH0A 2WYIA 2D74A 4DMFA 2A5LA 3BEOA 4KL8S 3G0IA 2RGCA 4K6CA 4DYHA 4LF9B 3WIBA 4HQFA 3F46A 1Z28A 1YDWA 3K05A 1Y8RB 2UVDA 5AOAA 2M6RA 5FNVA 5TE9A 3CVYA 1X6VA 4EGJA 1E69A 4HVAA 4M49A 2WWTA 2G8NA 4Y18A 1L1EA 3TI9A 3LPAA 2BKXA 2OHIA 2HSDA 3ETNA 2G0TA 2ATEA 5HHTA 1UDBA 2WMNB 3BJIC 1AURA 3PYXA 1PG0A 1TMOA 2PZAA 4IEFB 3L0YA 4OXYA 1LK5A 5F1PA 1L5KA 1MF7A 2A88A 4B3SB 1E2MA 3CH7A 4AJNA 1XSEA 1NV8A 1J9ZA 3E8MA 3P9KA 3PGA1 2EHJA 4KPGA 1OJLA 1LY1A 1NMXA 3KT6A 3CUWA 3L8DA 4ZI5A 3BULA 4CV0A 5LQAA 3U37A 2J41A 3PFGA 1PD0A 4P3NA 3IOYA 1EX9A 1FTSA 1U2DC 2WG1A 2ZIXB 4NRDA 3DOCA 3IOMA 3R0JA 1IQ0A 4XB1A 1JZSA 5AKYA 3A2KA 1NOIA 5SZJA 3RVBA 2C9CA 3T9DA 1MR3F 3TOSA 1XUOA 3PFKA 2FMXA 1V7ZA 2GXAA 3Q10A 4YCCA 5GM2A 4IGEA 3AIKA 3SS7X 4DQUA 1W0KA 2OMEA 1VM6A 5IMSA 4CQLB 1TMYA 3FVVA 1G3MA 3DKRA 3HCNA 1F6WA 3R6WA 2PMWB 4HLUC 5E0OA 4JYPA 3QSYA 4YUYA 1TF2A 4I08A 4IBOA 4IIGA 1NRXA 3DAYA 3FLAA 3QPUA 2LIPA 3FUWA 1NTOA 1JHMA 1NJ5A 2SHKA 2J3MA 2Z8YA 2DFPA 2NPIA 2CLFB 3DMTA 4P4TA 5G0UA 2WVHA 4ENPA 2YQ4A 5HOEA 1NIPA 4KH1A 1FUKA 4KFSA 1EUCA 2RHRA 2VATA 5ALPA 3UOWA 1VE9A 4PSAA 2PUFA 1NP3A 1TNDA 4LRQA 4AN0A 2DP4E 4W8HA 5K6TA 1TLTA 4JWKA 1BYUA 3C3CA 1XROA 1KDZA 1I6MA 2GNOA 2CVHA 2XNJA 3GCZA 3OHSX 1HNZB 1GZVA 2NU7A 4QOHA 4UJ3A 4QAQA 1QE3A 1GSHA 1C3LA 1XTKA 3T41A 3MRTA 2OBFA 2IYAA 2Q0SA 4IUDS 1WULS 4PYLA 3FYCA 3L8MA 4YRZA 1Z26A 3UJAA 4B5KA 2RFLA 1EQAA 2VI5A 1BEUB 3K6RA 2Q5LA 2HCFA 2UZAA 2QX7A 3O8OB 4G0ZA 4OFZA 1QOPB 5SYNA 5F5XA 2DUMA 3RWMB 3NHZA 4Q4LA 2RGRA 2JIMA 5KWSA 1BJKA 4NEQA 3ZX5A 1BDBA 1GXSB 4Y6GB 4MGZR 1QG0A 1O6BA 2XIQA 2ZR8A 4JROA 1UOEA 5C31A 4R68A 4JA0A 3VVBA 1H3EA 1R8JA 2IIQA 2A84A 4LDPA 3SEAA 4ZVRA 3R8CA 2RB4A 3U3RA 1QIHA 1H0KA 1M1XB 3HL4A 4LJ9A 5K3FB 5ESXA 3STXA 5EA2A 1FU8A 2JJMA 1DBWA 3OQMA 3KLPX 3DAGA 3EQ2A 1E98A 1FNMA 3FXAA 1ZLYA 4YP9A 2VUTA 5FPSA 3KOYA 4QXPA 5AW7A 3KV3O 1PEDA 2PZMA 3AVPA 1F7UA 2GBLA 3L6UA 5CD9A 4MLPA 6REQB 1SKMA 1DKNA 3HCEA 4BMSA 4Q34A 4IS3A 3EN0A 2AX3A 3PF8A 2XCRB 4KXVA 4N47A 2DECA 4UHFA 2VYFA 3IVAA 4LCBA 3TQTA 1AGPA 5HPYB 2A58A 2J6IA 2P6NA 1Q12A 3QBJA 3LF2A 4NIMA 1Y6RA 5JD4A 2NXJA 4OHUA 1QH0A 2MWMA 5L51A 1OH5A 3AUTA 5KNLA 2R4UA 1KETA 1XXLA 4C7BA 4N0DA 1VYHA 3VRHA 4XJVA 4DGQA 4RWEA 5D51S 1IMOA 2FFQA 1VBKA 1NNI1 1FU4A 2I76A 5H3LA 3H6HA 1X87A 3BHMA 3HLYA 1F12A 1WQ4A 2H51A 3FWHA 1G291 4LTNA 3RHTA 3V8PA 5LZ5A 4C14A 2QLNA 3WB9A 3MJEA 1P91A 1W5TA 3SR0A 3ZWOA 4L9RA 3CB2A 5FWXA 2GLUA 1L7PA 4DJFC 2HX1A 2CJWA 1XALA 2IPMA 2VTVA 5AYVA 4CQMB 3BQ9A 3GJQA 3IUSA 3KKEA 4DA0A 4TV8F 2IY7A 5JZ9A 2IH4A 2GDZA 4ZRNA 3LUJA 1L6RA 2C8JA 4H59A 3CU5A 4P4SB 3GLFE 1W36C 4ARIA 2BCEA 4KQIA 5EHZA 4BFSA 1CQXA 4PQYA 3OQHA 3OX1A 4B43A 5BOVA 1W5BA 2EOAA 4RJIA 1W9MA 4RV4A 1NYRA 4X24A 5T5QA 1KKMA 1NVBA 1T3GA 1E3EA 3H8VA 3TQSA 2AYXA 2YIVX 5K0NA 3N2KA 3ZQKA 4CR7A 1GUDA 3VR4H 2R1VB 4G4SO 5ITZA 1EFHA 3O90A 4GPBA 2FQ1A 5I7HA 5REQA 4B3CA 2FK8A 3JAWB 1QUFA 1T8TA 1MAWA 1P8JA 3DBLA 4EHNA 2W90A 4EB6A 5DSXA 3TTYA 4ED9A 1S6YA 2PX0A 3KKPA 4MJ3A 1K88A 4YVFA 1D2CA 3AKEA 2HXSA 2C9BA 3IBTA 1ZJYA 6Q21A 4IXDA 2EKBA 4L5CA 3W8RA 4EUHA 1AHIA 1XIVA 2XMQA 3FA2A 4LQDA 3H99A 3EARA 3NIWA 3K9NA 2FW7A 4UHHA 5K3BA 1U2GC 2JCSA 1GAQA 4UTRA 2Y68A 4DSNA 1M2JA 1Z0IA 1KF0A 3HDJA 1TPZA 2JLYA 3DDWA 3ELWA 4PAGA 1ECBA 2PR2A 3NBFA 3UJBA 5B36A 5KSYA 1Y3IA 2VA9A 2PRJA 4H3HB 4EGCB 4R40A 1EYZA 4TXLA 1QDLB 2H85A 1GUZA 3OFSA 4BB9A 4FOPA 4L0QA 2IS2A 3KQPA 3MELA 4TUYB 2CLIB 4WH0A 2VT7A 4OQYA 1UIRA 5E9AA 4AKEA 4IWNA 5JJ5A 3ZGZA 1RRPA 5EWLA 8ABPA 3F8TA 5BMVF 4U1RA 2R4TA 3G17A 2AC4A 4GQIA 1MO3A 5IX8A 4FWIB 2Y0DA 2F1HA 4NCJA 5HQJA 4FNGA 4DZTA 4TL8A 1X3LA 1J24A 3BERA 2HRZA 4B17A 1BHO1 5DGHA 3UC9A 3LY8A 4JNGA 1C80A 2GHQA 1D4ZA 3IMKA 2INGX 4LJ8A 1MEEA 7MDHA 3IMCA 1LU9A 4F2PA 2OBBA 3H2BA 1GM5A 4M1SA 3W8FA 2X1MA 3ICCA 1OYYA 1RMTA 2O6LA 4HAXA 2L82A 2PXXA 1C9EA 2VP5A 2PYDA 2VPIA 1ANKA 1RWPA 3H1AA 5F35A 4DA7A 4RS4A