1KVTA

Udp-galactose 4-epimerase complexed with udp-phenol
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSVATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structures of the S124A, S124T, and S124V site-directed mutants of UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
molecule keywords UDP-GALACTOSE 4-EPIMERASE
source organism Escherichia coli
molecule tags Isomerase
total genus 129
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kvtA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kvtA01
4FFPA 3ZV5A 4CL8A 3WR5A 3PGJA 3PHJA 4AJHA 2CDAA 1LSUA 1SC6A 3ADPA 1H2HA 3U3XA 3NUGA 4PG4A 2AA3A 1EUCA 2Y05A 3HG7A 3WYBA 3H9GA 3BMQB 4IMRA 3B70A 3FNGA 1NR1A 4KOAA 4B79A 1O6ZA 3LC1O 3ZWWA 4E6PA 1N92A 1PJ4A 3ZV3A 4FN4A 1P45A 2IEBA 3VTFA 4GGPA 1NPDA 1CETA 1LNQA 4F3YA 3TFOA 5JNLA 3FPCA 3SC6A 4B8ZA 2E49A 3ZWNA 4EJ6A 5B12A 1ZXLA 2X58A 2DAPA 4D46A 4YJHA 4AVYA 1MV8A 4AJ4A 3ENNA 2BF7A 5T6BA 5TLSA 4LCJA 5EL0A 3I9NA 4GSLA 3TN7A 4BNTA 1X14A 2PFGA 5L95A 1R16A 4OXKA 2VWGA 3UCEA 1YL6A 4WLOA 1KY5A 2D0IA 3MOIA 2P9EA 4I9UA 2D5CA 4G65A 2NSDA 3JQ7B 1X7DA 3WIDA 5AYVA 1HDZA 1I01A 3D3EA 4RPGA 4WCFB 3EVNA 3PYLA 4UVGA 3RC9A 5KJCA 1DDOA 5CP8A 2OP1A 4CUJA 4YWJA 1PWZA 5IZ4A 4OHUA 1F12A 2O3JA 3D3WB 1IZ9A 1E3IA 1HSZA 3GZNB 1DJNA 4XQCA 3WGIA 4CQMD 3PJEA 4ND3A 1G1AA 1HEUA 1NYTA 3I6QA 2QRJA 3DBLA 4MKZA 4MVJG 3CPSA 9LDBA 3DXFA 4CMGA 4NDNE 1EK5A 1X13A 4I5GA 3RI3A 3GF4A 5B4UA 2F1KA 4GAEA 3E6AA 2CD9A 3KTDA 1U1IA 4P8RA 1ZK1A 3KSDO 4TSKA 4UEOA 4DXHA 3K73O 3QIVA 3SLGA 4B7UA 1TXGA 2C20A 2HJRA 4BNKA 3NGLA 4D0RA 2GPTA 2ZTMA 4A7PA 1ISFA 4PLCA 1RM5A 5TX7A 1Y5RA 2B37A 3NTOA 5IG2A 3CZRA 2O4CA 3OM9A 2O48X 3ASVA 3RJ5A 3BTSA 2GRAA 3INGA 5THQA 4BGIA 5ICMA 4CM8A 3DZGA 2HK7A 3I23A 3KYCA 2GZ2A 1IY8A 3RJ9A 3G79A 1GQQA 3GNQA 3B6ZA 3PHLA 4Q9NA 2J6IA 2PTGA 5G0TA 4YVFA 3LLSA 3RIHA 5DOZA 4FD3A 6LDHA 1DIBA 2JHFA 4R3NA 1NAIA 1DEHA 2NQTA 5T57A 4CMKA 4ITUA 3TNLA 1MLDA 4M87A 3PZRA 1GL3A 4NK5A 4WOJA 2O23A 5HS4A 4FS3A 4FC7A 5JFOA 5BT9A 1EUZA 3F47A 5COQA 1HDGO 3E18A 3ZWOA 4I9HA 2Q2VA 3PHHA 3AUTA 3KYBA 1OC2A 1RKXA 1KVQA 3SBOA 1BXZA 2ZJ1A 3TDKA 3LT4A 4S3MA 1F14A 5BNTA 1U9JA 4FW8A 1DRUA 2E37A 4GLOA 4IGFA 2DTXA 3PZBA 1IULA 1ZJYA 3KYDB 4D7AA 4ZU3A 3FTNA 5IJZA 1ISJA 5J23A 1N2SA 2B83A 3R1IA 3WGTA 4H15A 2VNAA 5TJ9A 3N58A 2YHIB 3DBVO 2XOXA 5JCXA 4MVJF 5ITVA 3WDSA 4W99A 4J90A 3SJ7A 4EJ0A 2GZ3A 1DAPA 4MVJA 1BG6A 4RZIA 2I3GA 5DBGA 1QYVA 2OORA 4YRAA 4YQYA 1RM3A 3AY3A 2RCYA 4R1TA 2CVQA 2NQ8A 3DZIA 3H2ZA 4L0QA 4TRRA 4DLAA 4G2NA 3VPSA 3RFXA 4PGFA 1JU9A 1PGOA 4INAA 1CQJA 1AXEA 1W0CA 4JCOA 5L53A 3C1OA 3OMLA 4IINA 1J6UA 5A9TA 2GYYA 3TZHA 1HYGA 3JD3A 3Q3CA 1XGKA 3WBBA 1T2FA 3KO8A 5H81A 4J9VA 2YV1A 3RBZA 2OP0A 2AQ8A 1PGQA 4RPKA 1FDWA 1MX3A 3PDUA 4GX1A 4DQUA 4XZ3A 1ISGA 2ILTA 2O2YA 2POQX 4ALNA 3GC6A 4AG3A 2HMWA 1EMDA 3AU8A 4OKIA 3JQCA 1LRKA 1SO8A 4BNLA 1V35A 3S2GA 2E6UX 3JQAD 3IUSA 3I9KA 1PQWA 1BXGA 3BMCB 3GUCA 1X15A 2JD1A 4HFNA 2FZEA 2A94A 1QV7A 3L6OO 1JWBB 2FZWA 3P7MA 5JDCA 3BTVA 1TVEA 4KWIA 3RBXA 3W8DA 3WGOA 3H9JA 4FOOA 3MWDB 1XLTA 4JIGA 4NR0A 2EV9A 5KVCA 1I30A 4CV2A 3OP4A 3S2EA 3HDYA 1VKOA 3DC2A 3AFNA 4RL6A 1YL7A 1C0IA 2WD7B 3L4BA 3WFIA 5TRTA 1U2GA 3O9ZA 4O6VA 3UKOA 3E5MA 2BFOA 3PJFA 3C3XA 3INRA 4XYLA 5KTKA 1JTVA 3F5QA 3D64A 2Z5LA 1NXQA 3KEOA 3BMNA 2YDYA 2DFVA 3VPGA 4R69A 4ZN6A 1DXYA 1E6EA 4NQZA 4ILKA 4RF2A 4DL9A 1E3LA 1CDOA 1IPEA 1B0AA 2B5WA 1NHGA 5JC8A 2D8AA 2VHXA 5ILOA 1BTOA 4DBVO 5FEUA 1H6AA 2WTBA 1X7HA 1SOVA 1GUYA 3X2FA 2O50A 5C7IO 2I3AA 1T4DA 4NJMA 3KHUA 4M54A 3GDFA 4XIYA 1C0LA 1PR9A 2PZJA 5K9ZA 2YFQA 4OOFA 4E5KA 3Q11A 4NBTA 1LQUA 1ZMOA 3WNVA 1D4FA 4YAEA 1N8KA 1V3VA 1QORA 5TT1A 3PQFA 4WCDA 1I0ZA 2VYND 4CM9D 1LDNA 4DIOA 3C85A 3LT2A 2HMUA 1I2CA 2FRDA 3LK7A 3OQ1A 3ZH2A 1MGOA 4DLLA 4CQMB 1IYZA 2X9VA 4RF3A 4YB8A 3RKUA 3LT1A 2Q4BA 2UUOA 1TLTA 1O95A 2RBEA 2X5OA 3BMOB 2WYWA 1R37A 1UZMA 5L9AA 5BSHA 1NM5A 3H5RA 1XELA 3JYNA 4C7KA 3GN2A 5EJ2A 1P1KA 2Q1TA 4AJIA 1HF3A 2Q4EA 4FSHA 3QW2A 1JVSA 5FI3A 5BSEA 4RF4A 1LEHA 1ENZA 2FY8A 3KUXA 1H93A 6ADHA 3ZWAA 2HK8A 4CMJA 2CMDA 1RM4A 5HA5A 1E1MA 3C7DB 3KOUA 2JFFA 2ZJ0A 1XU7A 3AOGA 5JDIA 2BELA 4J1NA 2HKIA 1ZSVA 4EBFA 1AUPA 5CG2A 4ZQFA 1NVMB 3P2OA 2W90A 3OECA 3ONEA 2CVZA 4ZGWA 4FJ1A 3D4PA 3WIEA 3JV7A 1U3UA 5JE8A 3U4CA 4IMPA 1C3VA 4IBOA 1H6BA 1HWYA 1JQBA 5COBA 4KWHA 3WWZA 3VDRA 1QKIA 3ST7A 1DC4A 4MO2A 1DO8A 3HNPA 3F3SA 3KLPX 4E30A 3WGYA 2VYVD 1UZLA 1EDOA 1PS0A 4U0JA 4AJPA 3NDJA 5AQ1A 1WNTA 3AI3A 3ZU2A 3FHLA 4OQYA 5CG1A 5H82A 2JL1A 4RDHA 1MG5A 3R3SA 5EESA 4YJFB 3QVTA 3RUCA 4CR7A 5ICSA 1ULUA 4BO6A 3NX4A 4L73A 2NM0A 2V65A 3D4OA 3H3JA 4J1QA 3RU9A 3UHAA 4GWGA 1LSJA 4A03A 4C7JA 1DOHA 1YJ8A 2B5VA 5IXYA 1JLLA 3QWHA 4TWRA 5L40A 3EW7A 5CFZA 4E33A 3AOEA 1E5LA 1I24A 3FD8A 3TF5A 2NWQA 1NPTO 1M67A 4MDHA 4PG5A 4IGEA 2W4QA 1YJQA 1I10A 3BTOA 4Z9XA 3ZW9A 4JP2A 5TNXA 2Y66A 3B1JA 3L77A 1UDBA 3GHHA 4LRSB 3DFUA 1GTMA 1LDEA 1VE9A 3E48A 4DIBA 1ZCJA 4XYEA 1JDJA 3BTUA 1YDEA 5CDUA 3VPXA 1ENYA 3P5SA 4GI2A 1ZW1A 4O1MA 4PCVA 5G2OA 3OIGA 4A2CA 4GL4A 5A9SA 3RUFA 5HM8A 3M2TA 5A1TA 1D8AA 1LLDA 1K3TA 3AY6A 1I3LA 3TQHA 3OQ6A 2YZ7A 1PS8A 4H16A 4JXKA 4PN3A 3QE3A 4ONEA 2B36A 2X8LA 2C7VA 2BH9A 4I08A 4L75A 3H9EO 2Y0EA 4XB1A 1E77A 3GQVA 1ADFA 3K96A 5EPOA 1X7GA 1YVEI 4YT4A 2D4AA 2ZB4A 2IRWA 3DMTA 4IQ8A 3HWRA 3RC2A 5L7WA 3IKTA 4RLSA 4P4GA 2PD3A 5CDSA 1NTOA 2Y1GA 1DFIA 2RH8A 4IXTA 4BB6A 4FQ8A 2O3TA 3DR3A 5BQFA 1Z45A 4XWYA 2Y0CA 4FGWA 3JQAB 4UEKA 3A4VA 2P5YA 5TSDA 4GX2A 3QWFA 2O4UX 3GVXA 1ADCA 3NTQA 3EMKA 5JPIA 1LSOA 4J91A 3V1YA 3BAZA 4RQTA 4PRLA 1KERA 4AJOA 4N5LA 5DN9A 4IDFA 4CMIA 1YL5A 4XX0A 4CLDA 4CMAA 1SAYA 4KTVE 1BW9A 4XQEA 5DBFA 2HCTA 4UVHA 1JKJA 2ZTLA 3HJAA 3CEAA 4YJGB 4F6LA 1NHWA 1KC1A 1P1HA 3KSUA 2HMTA 3TPCA 1IPFA 1GD1O 1VL6A 4RJTA 3V2UA 5A03A 2AG5A 4XCVA 4RO0A 4D45A 5IXSA 1U3TA 1GU7A 1XR3A 2YHUA 4A26A 4MVJM 1HDCA 5IAAA 3D0OA 3O8QA 4R5MA 1VM6A 3C1TA 4IDDA 1UH5A 4CLRB 1JKIA 1PL8A 1QXSA 3HDHA 3PQEA 1YB4A 3ROMA 4WK6A 2DBVO 1MUUA 4F6CA 3ZWXA 3LVFO 4Z0TA 1EFKA 3ANLA 4OOEA 4QECA 1H2BA 1SCUA 1K89A 4GQAA 4J0FA 5IDYA 1AXGA 4FIZA 4BIIA 5CDTA 1EEHA 5KVVA 1KY4A 4MIOA 1U4SA 4J4BA 3WJ7A 3WQSB 3Q9NA 1NQAO 1LC3A 4TKMA 7MDHA 5IF3A 4BGEA 2EP7A 4BS9A 3G3EA 5A02A 3IJRA 1ADBA 4ZICA 2HRZA 2PZMA 2YY7A 4XEHA 2UVDA 4CMBA 2PA3A 4MKRA 2DUUA 2IDZA 1PWXA 5CPBA 3VTZA 3CH6A 4A27A 4JLWA 4EUHA 2AG8A 3W6UA 4RPLA 5BNIA 1ISIA 5C3MA 4K1LA 1EVYA 4HY3A 4A5OA 4J6FA 1DIGA 3WTBA 5DT9A 1DPGA 3O26A 4XDYA 4J4HA 4B7CA 2EKLA 3RSHA 4OYRA 5JCJA 5GY7A 5JDCC 3RUDA 3STHA 4RVSA 3RU7A 4LW8A 1UUFA 3LYLA 1NX6A 1SZJG 2EP5A 3I5MA 4E5MA 2CVOA 3VC7A 3FTPA 5JLAA 5DP1A 3UOGA 2J5RA 5AVOA 1A9YA 3C7AA 3PK0A 4PFJA 4PLGA 4WE3A 2OUIA 1LUAA 3VKVA 1JAYA 5AXDA 3GNSA 1U3WA 3BHMA 5AXCA 5U9CA 2DFDA 4XJTA 4RQUA 4WLVA 4YAJA 2Q1SA 3PWSA 5B4VA 2Y99A 4PLPA 2I6TA 3RQSA 2GN6A 2VCYA 3IOYA 1R4NB 3PYXA 1EK6A 4GH5A 4QFCA 1DJQA 1Z7BA 4G5HA 1Y8RB 5ER6A 4CR8A 4J1TA 1BGVA 1KVSA 4XYBA 3UF0A 4CV0A 4AL4A 1Q7BA 4NBUA 1P0FA 3F4LA 3LQFA 2ZB8A 4J1SA 1HDOA 4TRMA 2PLAA 3L6DA 4GBJA 3P19A 3EZYA 4WLFA 4N18A 3WG9A 1M76A 2DPHA 3G0OA 4E5YA 4G81A 2ZCUA 2UV8A 1YBMA 5EIOA 3GG9A 3IL2A 3O03A 4NBRA 3KSZO 5JY1A 3LT0A 1D3AA 4Z0PA 1G6KA 2PY6A 1NR7A 2QRLA 2RHCA 4UUNA 1PGNA 1AE1A 3T7EA 1V0JA 1DHTA 3JQ8B 5IFLA 3ZHYA 3CXRA 3JSAA 3JD1A 3KEQA 4I1IA 3MWEB 4P22A 3ZNOA 2VN8A 4AJNA 2VZ8A 4RLHA 4OGWA 4B4UA 2Q99A 2FPPA 3SX2A 3WWYA 1HSOA 3V2GA 2EKPA 2X22A 3H3FA 4U0KA 4XA8A 3UVEA 2GN8A 4EZBA 2BFPA 1FXSA 3NV9A 2Y1DA 3I9MA 3OIDA 3ZU3A 4PIVA 1LBEA 1UXHA 1LTHR 1L1FA 5JO0A 1V8BA 2DUWA 2AHRA 5JXWA 2UDPA 4M86A 1P31A 3WTCA 2VQ3A 4BKPA 3M1LA 1EDZA 4E2WA 5IDWA 3H9UA 4TVOA 4BKUA 5JO9A 1E7YA 1E7QA 5A5FA 5JDIC 3GOHA 1XQ1A 2FMUA 4PRKA 5L4SA 3K31A 2HMSA 2BFMA 2BMAA 2OOSA 4I5EA 2JCVA 1Y81A 2EHDA 1C1DA 1QLHA 3DBHB 4IM7A 1I3KA 3MEQA 3UN1A 1U4OA 4KUHA 1VLLA 2JAPA 3NT2A 3ZWPA 4NH4A 4DUPA 2GDZA 4PVDA 3JQGB 4AJ2A 3EK2A 2DBZA 5DULA 2C7GA 3MJ4A 3F9IA 4ALJA 1YOVA 2IXAA 2ZCVA 4D3DA 3PHGA 3ZU4A 1Y6JA 1LJ8A 4Z9FA 5ER9A 4D43A 1GYQA 1R4MB 4OH1A 4LK3A 4FOSA 3LF1A 3OFSA 4ZHSA 3JD2A 4OL9A 3DL2A 2H6EA 5TC4A 3AOEC 2X9NA 1OMOA 1BVRA 1PQPA 1XWFA 3W8EA 2QRKA 1GPJA 5EMHA 1T2DA 3ETGA 3F4BA 4PLZA 3TZ6A 1NQTA 1FDTA 3B1FA 1XA0A 4JROA 2PV7A 2OBNA 4JJGA 4ZQEA 2NVWA 1PTJA 2FSSA 3ANNA 1H6DA 1QP8A 5IZCA 4CL3A 3IC5A 5DOVA 4R9RA 5BR7A 2NU6A 1U7HA 2V7PA 1QSGA 2F00A 2VWPA 4QTZA 4NU6A 4CQLB 5A5EA 4CMHA 1NFFA 3PDJA 1QYWA 1SBYA 1MXHA 3CE6A 3CZMA 3W4IA 4CJXA 3DMTC 1NNUA 1PJTA 3DONA 4IS2A 5T64A 4DC0A 3W6ZA 4J2HA 1CRWG 4BB5A 4ALKA 3PRJA 1HTBA 5G0VA 2VRCA 5HRUA 4I9NA 5TGDA 4PLFA 4Y6PA 5I9MA 4YPOA 4IDEA 3JQ7A 5KWEA 3GEDA 1ZNQO 1DLJA 4UUOA 4WCFA 2D3TA 3ZW8A 1E7WA 4NI5A 1ZUD1 3E82A 1P9LA 3I3OA 3K5PA 1K6IA 2B0JA 4ZQGA 3RUHA 3GRKA 4ND1A 3D3WA 5ES3A 3GZNA 4OM8A 4BNVA 4MINA 4XDZA 3FR8A 4B4OA 1XEAA 4BO4A 4UREA 1UZNA 2QQ5A 3C7CB 1WDKA 3AK4A 1K5HA 4JP3A 5A9RA 1B14A 4R16A 1SEPA 4ZJUA 2VNSA 1RWBA 4H7PA 2GN4A 1DLIA 3I4FA 3ZN2A 2C5AA 1R6DA 3KV3O 1H9BA 4JGBA 7ADHA 4QFDA 1GZ6A 4DRYA 3UCFA 1E6UA 2LDBA 4PLYA 3WFJA 3V1UA 1H94A 3TOZA 2DU8A 4CM3A 2VT2A 3JD0A 3OQBA 2C5EA 2XXJA 3IIEA 4AJ1A 5GZ1A 1KEVA 2AXQA 3JCZA 3Q9UA 4E5NA 4JX8A 2HMVA 1UDCA 1FDSA 1P1FA 3PFFA 1W4ZA 3GY0A 3ZHXA 5KJFA 4BGUA 1C14A 4BNFA 4J4TA 4KZPA 4LMRA 3TZKA 3HDJA 3NTRA 2WYVA 1GZ3A 4XYMA 5TF4A 4UVEA 1PJSA 2O7QA 3OEWA 1T1SA 1UJMA 2DTEA 2PH3A 3LU1A 3D1LA 3KBOA 3A9WA 1GYPA 1I2ZA 2A35A 3QQPA 5CAEA 3HQ4O 1P74A 3HN7A 1N1EA 4E21A 2VTDA 1VPDA 3DTTA 4PVCA 2EJWA 5DBIA 1F0YA 1FK8A 5I7SA 4QO7A 3E03A 1DAOA 1ISHA 1TT5B 4MJLA 3KYDA 4CM7A 4NJOA 4PZEA 1PS9A 2PGDA 3VH1A 3CINA 2VTEA 4BNGA 9LDTA 3NYWA 2QZ9A 2OL4A 3Q1LA 4LCEA 1YB5A 2YHIA 1VC2A 3GEMA 4BO2A 5F1KA 3HZZA 3H6KA 2CY0A 1PQUA 5JMPA 3BXXA 4HKTA 5CHEA 5G0WA 2PZKA 1R12A 5AXAA 3K2BA 1Z7EA 1ZO8A 4NHEA 5C37A 3ON5A 1VJTA 2O3RA 5I8ZA 1JW9B 1HL3A 1KVTA 3GR6A 2NVUB 2HO5A 5IDQA 3OJLA 5JY6A 5JYEA 3D5QA 3FWZA 3P2YA 4EGFA 5KVSA 3A14A 1DC5A 5ADHA 1V9LA 2C2YA 1PGJA 1Y5MA 1FDUA 1EVJA 3I83A 4O0LA 1VI2A 3OHSX 1UAGA 2GGSA 3AJRA 4AJJA 1J0XO 3AW9A 3OBBA 1Q7CA 1HXHA 5JMWA 1GYRA 4E12A 2NNLD 4X54A 2G82A 2IZZA 3IUPA 4A0SA 3GK3A 3WGQA 3SJUA 2QZZA 2R6JA 4JQCA 4NIMA 2ZYGA 1T26A 2D5AA 1DIAA 2GSDA 1CERA 2GUGA 4RVGA 4U7WA 3WSWA 4HFJA 2X0IA 3VKUA 3RUAA 1E7SA 2OGUA 1KVUA 1P33A 2GD1O 1DC6A 2AQHA 3DTYA 5L45A 3DEYX 4YXFA 4ALMA 3TWOA 1Q7GA 3T4XA 2WD7A 2AMFA 4XJSA 3DOCA 4CR6A 4QO8A 2VWHA 4DYDA 3H5AA 5L7TA 3PLNA 2J3IA 3CSDA 2VT3A 4C4OA 3ICPA 4NMHA 2OO5A 4R1UA 5KJEA 4ZVVA 1A5ZA 3QVXA 1UXKA 2NUAA 2C54A 1EQUA 3QY9A 4R9SA 1ZBQA 2WE7A 3WNQA 1OAAA 3NJ4A 2RH4A 1E1KA 3RC1A 2OHXA 4BKQA 1P44A 3RWBA 3HUDA 2CF6A 4YA6A 4FJ2A 4WEOA 1A4UA 1J4AA 4YT2A 2GZ1A 1ULSA 1LDGA 2LDXA 1U5AA 2Z1NA 3GLQA 1AHHA 3GH3A 3OJFA 5FYDA 3ROQA 1CYDA 5FI5A 4XRRA 1Z73A 3GVHA 4AICA 2FPGA 4GX0A 5BSGA 3ZWVA 1VL0A 2AEJA 2VUTA 3JYLA 1T2CA 3GPDG 3PQDA 1IHXA 1C0PA 1DIHA 4D3SA 1M75A 3ITDA 3UGKA 1A72A 5A3VA 1QG6A 3ROPA 1PL6A 1U5CA 4UAGA 2DM6A 1YBAA 2SCUA 4NBVA 5DF1A 4YDRA 5G0SA 4BO5A 1Q2XA 3KM0A 1I32A 4IDCA 3V2HA 3GT0A 5JSFA 5ILGA 3I6IA 1R66A 4OXNA 1XSEA 4ZRMA 4CQMA 1LDBA 4GMFA 1LQTA 4CPDA 2PNFA 3D4NA 1P1JA 4IZIA 3TZQA 1BSVA 1NVGA 3PYMA 3BMOA 5F1PA 1Q1NA 1ZZEA 5BSFA 2P2SA 4NK4A 4DBZA 1T2AA 1ZIDA 5CEEA 2XPCA 3A06A 4QQRA 1F17A 1UXIA 4FFRA 1NP3A 1LLQA 2H1SA 4CM1A 5IDXA 1BDMA 1FF9A 3IDSA 4W9NA 5I9NA 4JBHA 1CF2O 3KZVA 4R3WA 3LC7O 3OEYA 1DIRA 4XGNA 2B4TO 3W4JA 4BO7A 3ICCA 1KEWA 3DQPA 4FFMA 1B8PA 3NKLA 1B7GO 4IDGA 4FB5A 5JAZA 3BHIA 3U5TA 2EW8A 1W6UA 3GGPA 2X7HA 4BUCA 1CWUA 2RAFA 2GLXA 4PLHA 4Y6SA 5LC1A 2RIRA 2Z95A 4MOWA 1OOEA 2XXBA 2I5PO 4RPHA 5IZCC 2FP4A 3CKYA 1WAMA 2BGKA 4GVLA 4R5HA 4IQ0A 1OC4A 3I9JA 3B1KA 3PJGA 1N7HA 4NFSA 4FDAA 3B20A 3WYEA 2TMGA 1LDMA 1PSDA 1R0KA 4RVHA 1KYQA 1Y8QB 4B3HA 3K6JA 4DMMA 4P38A 4BNZA 2H63A 2X0JA 4N7RA 1GZ4A 3EUWA 4RV9A 1QMGA 2JAHA 3VVBA 4XGIA 3TSCA 4YJFA 5JW6A 3QA9A 1DRWA 4GGOA 2X4GA 3TJRA 2VWQA 4WCFC 1ONNA 1GR0A 2O2SA 3FNEA 3WOHA 1MC4A 3L9WA 3GN1A 3C24A 4ZA2A 3DAGA 4OMUA 4N5NA 3IP3A 2CUKA 2YW9A 5JAQA 4HV4A 2ZB3A 4YAIA 3VAZA 1IHYA 1SEVA 2NU8A 5EQDA 4EEZA 1I5RA 5CDYA 2Q49A 3GVIA 1YXMA 4FGSA 5G4LA 4W82A 4CLOB 1E3JA 1OBFO 3H5NA 3E5RA 4M89A 2C29D 4MVJP 5THKA 2PH5A 4ALLA 1KC3A 4FFNA 4DIFA 2ZTVA 4R4JA 3WQQA 4DGSA 2H9IA 1PJ2A 2P5UA 3BIOA 2FN7A 4D3FA 2C0CA 3CMMA 4N54A 2ZIZA 4R68A 2D1YA 5DCYA 1U28A 3MJVA 3MCVA 4UUMA 4CM4B 3UICA 1GPDG 1QV6A 4Q3AA 4FFOA 1EE9A 1P1RA 1DHRA 4BMVA 3GGOA 3E1KA 2EF1A 3FI9A 1XDWA 3ITKA 4XQGA 2NVBA 4ESOA 1DC3A 3WICA 4RORA 3GRPA 4BNJA 1W73A 4ZD6A 1YH3A 1TB4A 2WYUA 4JN6B 1ML3A 3PFWO 4QSMA 3FWNA 1VL8A 3DBRB 3BA1A 4KUEA 2Y1OA 3U4IA 4BNHA 2FWMX 3JQAA 4R1NA 3H2SA 3PEFA 4XD2A 3RC7A 4DLBA 2Y1EA 2W98A 4PLWA 3TRIA 3OSUA 3TZCA 1MFZA 1E6WA 2R2GA 3ROKA 2AE2A 3T7CA 1OFGA 4IIUA 5FFFA 4IJUA 2JCYA 2B69A 4XRGA 1ISMA 1UP6A 3R0IA 3GAZA 3PHIA 3GA0A 4Q3CA 5T67A 3ZGYA 3PLRA 4QUKA 3CTMA 1S6YA 1F8FA 4Y67A 1TT7A 1C1XB 1E3SA 4WEQA 2RHRA 3G1TA 4BNIA 4Q3NA 3QWIA 3UAGA 2BRUA 5DNAA 1QR6A 3JQ6A 1EBFA 3COSA 1FJHA 1LI4A 4XQ9A 4U6SA 2A9FA 4E3ZA 1ZK0A 5U1PA 2ZATA 3ABIA 2BFAA 1GDHA 3UXYA 1YQGA 5LDGA 4OSOA 3O38A 2PD4A 1YBVA 4BQRA 3TFQA 4MVJH 4WPGA 1I3NA 2BD0A 1T1RA 2GN9A 1LU9A 5F3RA 1DSSG 3ETEA 3L4SO 3N74A 4TQGA 2AEFA 1CIVA 3CMCO 4MP6A 1MG0A 3MZ0A 2YDXA 4NBWA 5L4LA 2HSDA 1D1SA 1PEDA 2ET6A 3ZNNA 2DBRA 4IJWA 4E0BA 2WEKA 5HBRA 2I76A 3SXPA 4DPMA 2VYNA 4CM9A 4O63O 1E7RA 2VHVA 4QT0A 5TQVA 2ZK7A 1I33A 2CSUA 1KS9A 1ZEJA 1PJBA 4PZCA 4AJLA 1PJ3A 4BNUA 2O3UA 3CIFA 1F8GA 4R41A 3GHYA 4U8GA 5U4QA 3ADOA 3S2IA 3ZDFA 3DZBA 1EFLA 4DTIA 2FOIA 1E3WB 2DT5A 4LISA 3MJTA 2HRBA 1ORRA 2VOEA 4U5QA 1WLYA 4BNNA 1PJQA 4DWVA 4FBGA 4MKXA 4YT5A 3F1KA 4B7XA 4E2ZA 4DPLA 4UULA 1MFPA 1KETA 3GG2A 1E1NA 1ZSNA 3C1AA 2BKAA 4KDFA 3IP1A 2I65A 3PWKA 2FHSA 1PL7A 3EVTA 3AU9A 4II3A 2H5LA 3LC2O 2AW5A 4W6ZA 1M6HA 1IL0A 3V8BA 3ZWMA 4LSMA 2DC1A 4LGVA 1M66A 1R4NA 5LCXA 2VOJA 1SPXA 5L51A 3KLMX 4HFRA 3S8MA 1FDVA 1UXGA 5L7YA 4E2YA 3GFGA 2PGJA 1Y8RA 5T5QA 5B1YA 5TS3A 1YQXA 2PKQO 5DCWA 3WJAA 1ZVMA 5G4KB 5JC1A 2NTJA 3HFSA 3IMFA 4DC1A 1E92A 2VYVA 1QLJA 2G5CA 4WLUA 3GVCA 4IQGA 4MVJD 2CDCA 1U8XX 1NFQA 2Q2WA 1X0XA 1TI7A 3E9MA 3EY4A 3S55A 3VH4A 3WGZA 4CUKA 1N1GA 1Y9AA 2D2IA 4Y98A 1XYGA 2PZLA 2QHXA 3WXBA 2UAGA 1JWAB 2X1HA 3OETA 5LDHA 4JJIA 1KOLA 3HDQA 4RVDA 3QSGA 1E1LA 1MC5A 3JTMA 2DVMA 1EVIA 2ZKLA 1L7EA 4IZHA 4BNYA 1BVUA 1U3VA 4RDIA 1UR5A 2ZTUA 3JQ8A 1O94A 4J7UA 3TL3A 3ANMA 4P4LA 4L76A 1H6CA 2QYTA 1JKFA 3WX0A 2WJPA 3ZNQA 1N9GB 4HX5A 2ZYAA 3K92A 5F5LA 1UAYA 8ADHA 3R6DA 3WLEA 1X1EA 1XQ6A 2VHZA 4ND5A 4PG7A 4XIJA 2C07A 1A7KA 3DMYA 2W2KB 4W9NC 2VUSA 4O59O 1OZAA 1YQDA 1BWSA 1GADO 2OMEA 3QJ5A 4UVDA 4E2XA 4LN1A 1YO6A 5KVQA 2WSBA 4L8VA 3H9QA 1Z6ZA 3DHNA 3F5SA 2VZ9A 1GV0A 4EITA 1IUKA 4R01A 4XYGA 3U09A 5I9LA 1MA0A 4WUVA 3EAGA 1SB8A 1YOVB 4DREA 5HS6A 4D42A 1CJCA 2EXXA 3DZJA 1GCUA 1HLPA 1ZSYA 1W8DA 4F46A 5JS6A 3MTJA 2YFHA 4BKOA 2A4KA 3AUAA 3F6YA 3GNTA 4J16A 1ZKMA 3BZUA 3DBHA 1LXCA 4CV3A 1ZK4A 3LF2A 3RAJA 5I7VA 3RROA 1WW8A 3VPHA 4A10A 5EINA 3JQGA 4EW6A 1ONPA 1VJ1A 2JFHA 4RZHA 1EBUA 2HLPA 4I5DA 2FR8A 3E9QA 2BI8A 3HFGA 2WWRA 3RVDA 4YJHB 3W4KA 1Q0HA 3KVOA 5EQFA 1B15A 1V6AA 3MJCA 4Z0HO 3BMQA 3FN4A 1SB9A 3C8MA 1R4MA 4RCVA 1WPQA 3FRJA 3HE3A 2YQ4A 3RKRA 4GWKA 1C0KA 1VRWA 1YKFA 2EW2A 3WBFA 3WGHA 2P9GA 2DQ4A 3RD5A 3HN2A 3ONDA 1WP4A 5TJHA 1UP4A 1Y9EA 3GVPA 3GEGA 3IS3A 2E82A 4FR5A 4UEJA 1I3MA 4JBIA 4DA9A 4K9DA 3NAQA 3HB5X 4IUYA 5A3JA 4BHTA 3G49A 2OZPA 3NEPX 1ONOA 1EVZA 1N5DA 1HKUA 3DBLB 1HE3A 4HP8A 2Y93A 4HNGA 1NPYA 1WMBA 4GPD1 2GNAA 1I36A 2R00A 4Y8VA 2HDHA 2IZ0A 1NVTA 1I2BA 1RYDA 2C59A 4IDBA 4YRDA 4CQLA 2XF8A 3A28A 4WNIA 4UUPA 1B3BA 2EEZA 4EDFA 1ZK3A 1I8TA 1IOLA 2PKRA 4RGBA 2AQKA 3LSYA 4ZRNA 4E4YA 3H8VA 4NU5A 3D5TA 3PJDA 3NRCA 3PIDA 3ZWBA 2CF5A 4LRTB 3ASUA 1MP0A 4CM8B 3KYCB 1LRJA 3DZKA 4PLVA 3QVSA 2EWMA 2DLDA 4JBGA 2ZYDA 3QVOA 4WGGA 1PGPA 4URFA 2O3SA 3PXXA 3Q6IA 4OIMA 3IQDB 3PIIA 4O5OA 4AJEA 1NBOA 2EERA 4M1QA 3ZWCA 4BO0A 1E5QA 1U7TA 2DPGA 1TEHA 1HZZA 2IXBA 4TZTA 1PU2A 1WZIA 3AWDA 4ALIA 3EYWA 3JQFA 5F1OA 3DAFA 4YRBA 5EN4A 1PJLA 4BV9A 4CLXA 4CLEA 2PWZA 3A1NA 1NQOA 4CMEA 1EZ4A 1EUDA 2CDBA 2W8ZA 3UCXA 2AE1A 2W2LA 4MP8A 4EI2A 3VOSA 4BL5A 1HDRA 4YR9A 5KJ6A 1K6XA 3CUKA 3IAHA 1KEUA 3JYQA 1KIFA 4ROSA 3RBVA 4DMLA 2J3JA 2X6TA 3AUUA 4I8XA 4NZ9A 2DKNA 3UFXA 1P77A 2EIHA 3EGOA 1VJ0A 4GMGA 3L0DA 4CMCA 1ZJZA 4L74A 2G76A 4J2OA 4OQZA 3UW3A 4DQVA 4OO3A 3SVTA 4LMPA 3AFMA 3Q0EA 5A06A 3JQBA 4IJKA 1HLDA 4BNXA 1HZJA 3K8ZA 3ZWYA 2X23A 2ZB7A 4BO3A 3MJEA 5IN4A 2JHGA 4LVUA 5IN5A 4NNJA 4BMSA 4IXWA 3JQ9A 1ID1A 1PZEA 3ZCXA 1Z74A 2OBYA 3ZV6A 4IJVA 2UUPA 1T2EA 2BGLA 2QYSA 3JQEA 3F1LA 3RFVA 3WSVA 1ZEMA 3ENKA 4MP3A 2Q1UA 5KJ1A 4OSPA 3ZHZA 3JD4A 3NT5A 5AOVA 1A9ZA 1Z75A 3VVCA 3LZ6A 1TT5A 4HXYA 5L4NA 3AUSA 3DZFA 1R15A 2AEMA 3R3JA 4D41A 4Z3KA 1BXGB 3FBGA 4EYEA 1GFSA 3ETDA 5KKAA 3HHPA 1U8FO 2HJSA 1B8VA 3S2FA 1PZFA 2JCXA 4CM5A 1L7DA 3LLVA 2HAEA 3FR7A 1O5IA 4YTEA 5T8KC 1KEPA 1PR3A 3HSKA 1DBVO 1MB4A 1DFGA 2EGGA 2NLOA 2Z1MA 3EDMA 3INTA 1XG5A 3VZSA 2J3HA 2JJYA 1KBZA 2HQ1A 3OJ0A 4CODB 2NVUA 2QW8A 1J49A 2D59A 2PR2A 3BMCA 3F46A 1SNYA 4JK3A 1LLCA 4R51A 4GX5A 4LSWA 2TMDA 4JJFA 1PIWA 2BGMA 2I99A 1QRRA 2UYYA 3BMNB 1R0LA 3KXDA 3GPIA 1G0NA 1K0UA 1B2LA 4MVJE 3IJPA 3NGXA 2EKQA 1BXKA 4K6CA 4BQPA 3EZLA 2GO1A 4HADA 2YV2A 4MIEA 4CLHA 5TT0A 1T4BA 2P91A 4YQZA 1H9AA 1CQIA 3W1VA 1NQ5A 4ZQHA 5FF9A 3ORFA 3ZV4A 1LC0A 1D7OA 4IIVA 1Y1PA 2HU2A 3SEFA 3GMSA 4KTTE 3OICA 2X0RA 4NJMB 5COAA 4OAQA 5JAMA 5CDGA 1XKQA 3DOOA 3OA2A 4MPDA 4JNKA 1ARZA 1SMKA 3EHEA 2I67A 3DHYA 3U0BA 4AFNA 4XKJA 1YONA 2X5JO 4XR4A 5DCUA 4W7HA 1F06A 1K6JA 3QWBA 1WDMA 4J0EA 4KQXA 2B35A 3BYZA 1GEEA 4D79A 1GQYA 1HYHA 2NV6A 1WMAA 2QIOA 5K6AA 1ZK2A 5DDIP 2V6MA 5JBIA 2P4HX 1YRLA 4E32A 3H7AA 1V3UA 2CFCA 4L4XA 3VDQA 3WB9A 4E31A 4KQWA 5CPFA 4IY1A 3DO5A 2V6FA 4Z9YA 2EG9A 4GVXA 3H65A 1JAXA 4ND2A 3L6EA 1BDBA 3GDOA 4I5FA 2PGLA 5JCJD 2PKQP 1Q0LA 3L9XA 4J7XA 3AM5A 5GMOA 1HRDA 3OA0A 4CV1A 4BNWA 3VZPA 4HNHA 4EUFA 2YV3A 4Q39A 2X0NA 3GGGA 4BNMA 4BGVA 4XB2A 2YQ5A 5MGBA 1LX6A 3MOGA 3RUIA 1UXJA 2VZ0A 1RJWA 1MXFA 3QHAA 5CEFA 4WLNA 4KMSA 2QG4A 1FMCA 4NG5A 4RF5A 2G1UA 2WD8A 4J3FA 1YGYA 3JYPA 3U4HA 4PG8A 1QYCA 4R54A 2Y67A 2JD0A 2OFPA 1WZEA 1RM0A 4NFYA 3ZNPA 1E0DA 1LA2A 4K28A 2IEDA 2CNBA 4Y6RA 1D1TA 1A7AA 4B3JA 3G17A 3U49A 1GUZA 4F45A 1UP7A 1IB6A 3I1JA 2B4RO 4B8WA 4B4VA 2EGHA 2IZ1A 2JFGA 1Y7TA 4WKGA 1M2WA 3PGXA 3VZRA 4LVCA 1DB3A 3NT4A 1NAHA 3RCBA 3UH1A 4OKNA 5B4TA 2J5KA 1WXDA 2O3QA 3FSRA 3ZHBA 3H4VA 4K6FA 5K0ZA 1A4IA 3S1LA 4BOYA 4YYZA 2Q3EA 1YB1A 2V6GA 3SC4A 1HE4A 5JYDA 3E8XA 2BLLA 1IE3A 2Y1CA 1QYDA 4YT8A 3M1AA 1X0VA 3FBTA 2NU7A 8LDHA 3KB6A 2YUTA 2GCGA 3OH8A 1GV1A 3I9LA 3JQDA 4E13A 4FC6A 1HYEA 4M8SA 3OJEA 2B4QA 2HK9A 1LRLA 2R00C 4NPCA 1LLUA 1XIVA 1WWKA 3U4DA 1PJCA 4TKLA 4YCAA 1ZXBA 4HBGA 3DDNA 5KKCA 1NASA 5A9SB 2J5QA 3V5NA 1A71A 1Y8QA 2IODA 4L4SA 5F5NA 3FNFA 1NWHA 2G0TA 2HUNA 4J7CA 1HDXA 3U62A 1U2DA 1VSVA 3GDGA 2WMDA 3W8FA 4ZQBA 3DFZA 2J8ZA 2P68A 3TOXA 4CM6A 4OXYA 4GKBA 4GLLA 4K26A 4MVJI 1YDWA 3VPFA 4DVJA 1ENOA 2A92A 3K9QO 1VSUA 4FFLA 3FNHA 1ZFNA 4TROA 2G17A 2QX7A 4W4TA 3VH2A 2EJVA 1TA4A 3M2PA 3AY7A 2Y1FA 4E5PA 4HWKA 2JKVA 3Q2IA 3ULKA 5DP2A 4BKRA 3SLKA 5KNLA 4TRNA 4S1VA 1ADGA 3GMDA 3FF4A 2OXIA 1PZHA 2Q50A 3KRTA 1E3EA 2X5KO 1BHSA 4CLOA 4KP7A 3L07A 3JQFC 2PK3A 3MJSA 4XGKA 3RFTA 4YACA 4CMIB 2X9GA 3GZ4A 4CMEC 4TZKA 4Z6KA 2NTNA 3QRWA 5CEJA 1BW9B 4YEDA 1NWCA 3AM4A 4YAGA 4L4RA 3ONFA 2Q45A 4HUJA 4TRJA 3FCOA 1P3DA 2Y0DA 2C82A 4ID9A 5GZ6A 4BVAA 4DPKA 4CM4A 4TVBA 2WDZA 3PPIA 1EE2A 4DYVA 4PZDA 3WMXA 5BNFA 3O8QB 4UVIA 1PZGA 3V1TC 1G0OA 4Q3BA 3AM3A 4U6QA 3JQBC 3DWFA 2FR0A 1J5PA 2P9CA 3OIFA 2E4AA 1UDAA 3DAPA 3VZQA 1WDLA 2GF2A 1O0SA 4Q3EA 4PG6A 3DBRA 4RVFA 3T4EA 4YJGA 4WJZA 2YJZA 3QLJA 1B8UA 2JD2A 4YBZA 1QYXA 3WMWA 3JQ9C 1B26A 3G1UA 3WGGA 1EQ2A 2V6BA 5ENDA 1YS4A 2DBQA 3DZHA 3GAFA 4CUZA 1RPNA 4BO8A 1Q0QA 3RASA 4CLRA 2VHYA 4B4WA 4WECA 1CEQA 1YE3A 2E48A 1C1XA 1HE2A 1PX0A 1XU9A 2GASA 3NDIA 3X2EA 3JYOA 2WE8A 4ND4A 4BMNA 1IZ0A 2VRCD 1JVBA 3E9NA 1T24A 5I7FA 5MDHA 2J3KA 4B3IA 4BV8A 1S7CA 3QWAA 1O89A 4TMFA 4II2A 5A4DA 4Z3DA 1HETA 4W7IA 5ENVA 5A04A 1AGNA 1DFHA 1H0KA 5F21A 2PD6A 4D0SA 1O8CA 5HTOA 5AXBA 4A73A 5TIIA 2Q46A 2NACA 4Y9DA 4EUEA 1XCBA 5KCZA 2X86A 1WVGA 1LDYA 5L3ZA 1V3TA 2NU9A 3DOJA 4M55A 2BI7A 3QV1A 1H5QA 3PVZA 4HFMA 2C2XA 2YYYA 3MTGA 4GSKA 1GAEO 3LDHA 1N7GA 1ZH8A 3NJ8A 3ZU5A 3TL2A 1YWGO 1JA9A 4P4NA 2I66A 1B3RA 3L4BC 2Q1WA 1A27A 3WS7A 4PLTA 4OJNA 3KETA 5KOIA 4H3VA 2GERA 4RVUA 1JN0A 3PP8A 5T8KA 2ZQZA 2P4QA 3PTZA 1LSSA 4FCCA 1E3WA 3GUYA 2VHWA 4QEDA 1GUFA 4N5MA 4BO1A 2W2LD 4R1SA 5EERA 4RPJA 4BO9A 1OI7A 3HADA 5B37A 1Z82A 3WQRA 5C7OO 5HWSA 5ITWA 1SOWA 3O4RA 5K6AC 3QVWA 3I52A 2IE0A 4D44A 1DRVA 3NDRA 1NFRA 3I4CA 4WASA 3EC7A 3QP9A 3OF2A 4WOKA 4EEXA 5H83A 4IS3A 5FWNA 2GR9A 3AI1A 1GQ2A 2I9PA 3VH3A 5KIAA 3BHJA 3Q2KA 4IPTA 2Q2QA 4XR9A 1GEGA 4J43A 4GKVA 3N7UA 2DTDA 1XHLA 1O9BA 1AHIA 3PWZA 1BMDA 4NFHA 1RYEA 5DZSA 3AI2A 3OJOA 3FPLA 5G4KA 2WM3A 4KUGA 2AQIA 4L9RA 1E7MA 4QXMA 4EJMA 2O7SA 5C5IA 5I7EA 5I8WA 1VKNA 1HT0A 2Y68A 3M6IA 5JAIA 4DQXA 4J9UE 5G0UA 2VRBA 1B16A 2IYOA 2FPIA 2ZQYA 4FPXA 3U9LA 2IYPA 5A05A 3K30A 3UUWA 1AN9A 2NTVA 4AJKA 4IDAA 1C1DB 1KVRA 2BHLA 3IKVA 4WNCA 3D7LA 2XAAA 4MIYA 1HDYA 4Q3DA 4KDEA 5GZ3A 1P0CA 1X1TA 3HB4X 4QX6A 3DHEA 1M6WA 1N9GA 3I9OA 3DB2A 3WYCA 2FSVA 2CZCA 3GFBA 2VUUA 4FJ0A 3WLFA 1ENPA 4M49A 5C7LO 1ZMTA 1HE5A 2FR1A 3K2EA 1GCOA 1T25A 4YJDA 3ZI0A 1P1IA 2NADA 1GY8A 2W2KA 4WLEA 4YAKA 1BRMA 3RUEA 1K2WA 3ZZNA 1R0SA 4J49A 3VHRA 3PI7A
chains in the Genus database with same CATH superfamily
2XMZA 2ZIAA 3D3KA 4BQSA 3E22B 2OZEA 3Q3JB 4ZVUA 2CJYA 3G9ZA 3B1YA 1T8WA 1YI0A 2X9QA 3WR5A 5KQLA 4TSFA 2IV2X 2EBFX 2E2WA 3TX6A 3M6MD 4K9NA 3FG9A 5AVSA 4A5SA 3CX4A 3ADPA 4A92A 1Z13A 2A57A 1CNFA 3NUGA 1ZNYA 4PG4A 4NKRA 3BMQB 5BVHA 1RE0A 2FX5A 1NR1A 2IPAB 3FDJA 3R0QA 4GYYA 4KOAA 3FROA 4C0LA 4H0FA 1JQDA 1X7ZA 3PCTA 4KVFA 1O08A 1O6ZA 4L1KA 1FLNA 2B61A 5LA6B 4RELA 4B79A 3U3DA 3K0HA 4DSOA 1N92A 4E6PA 4URVR 4MJ7A 5LOVA 3LW8A 1NPDA 4B9AA 4O25A 3TFOA 2QRMA 3AHEA 5DMHA 2FFBA 4AKGA 1XNGA 3FPCA 4EJ6A 4B8ZA 1TYDE 3JU3A 4PYKA 5BT8A 1C8VB 2C7BA 5B12A 2X58A 1S2DA 3P26A 5DKFA 4YJHA 4AVYA 1XB2A 1PNTA 2EQBA 2WIKA 4HVTA 2PRYA 2ZUCA 2PJDA 5T6BA 5AVKA 4B3GA 2BM9A 5F2NA 1FRQA 3K7EA 2QE6A 2CLMB 2V6IA 4J0JA 1X14A 4H3KB 1J2TA 4G5OA 5IYZF 3IMKA 1ELOA 1QHEA 3CGWA 1UMBB 4A0QA 3OZEA 3AVXA 1YL6A 5IYZA 4WLOA 4P4SB 2NUTB 5DW0A 2XKJE 4EL5A 4G86A 3RANA 5B57C 2WWFA 3AKDA 3K15A 2MSCB 1C2YA 1H69A 1Z4IA 2GA9A 3I42A 3D3EA 3PFNA 4R8RA 3PYLA 3GLFE 3ETCA 1A8QA 1W4BA 4X65B 4HWGA 5CP8A 1T15A 2YWFA 4DV1B 2OP1A 1N77A 1NMQA 1BU5A 1THZA 3AJ9A 3FZYA 3FHOA 4OHUA 3D3WB 4HD8A 2GJ8A 1E3IA 3ANTA 2AT1A 1SBNE 5JSZA 3L18A 1G1AA 1JQJC 1NYTA 1DBIA 2H3EA 3DBLA 3I6QA 4JA0A 4MVJG 3CPSA 2ZRGA 1YB7A 4RWZA 1EK5A 4S1TA 1X13A 4XSHA 2YS7A 4D9CA 2BEUB 3ASZA 1JMYA 2WKPA 4E7OA 1U0FA 5B4UA 1NN1A 2OXFA 1BMQA 2RJOA 3PC4A 4GAEA 3KTDA 1G9SA 4YAFA 1X38A 3JWJA 2FUG1 3T5GA 4TN5A 2LKDA 1K5PA 4HPWA 3LLMA 1RYZA 2GTPA 4FYHA 3CF6R 3OHPA 4UEOA 4DXHA 1LPMA 3K73O 1Z0UA 4YONB 1CUEA 3I0MA 5DVZA 3PD0A 5AW3A 4P0PB 1P1BA 4EB6A 3PXBA 4PGHA 1ISFA 5IH7A 4TMKA 4Q4CA 1PR4A 1WP9A 4AG6A 4C0KA 5JATA 3UJ3X 4H7EA 4W5QA 3ZIAA 2H54A 1DX6A 3INGA 1QNLA 2VXCA 4LBVA 3I23A 1B93A 1U0OC 2A0KA 3RJ9A 1GQQA 3WGLA 3VR6H 3MTIA 1QJ4A 1JXOA 3B6ZA 1CRZA 3LLSA 4L02A 5JXIA 3CA8A 5KTNA 4L9SA 5T57A 3K3PA 2JRLA 1DEHA 4AROA 1D8TA 1KYXA 5JAPA 3N2NA 3L8ZA 4LV6A 3NWJA 4M87A 3PZRA 2OM6A 1GL3A 2JGDB 2ZAYA 5CHYA 5M7EA 1PYOA 3IERA 4WOJA 4R84A 3PUIA 4FC7A 1DKQA 1FXUA 3F8WA 1JLSA 2PSFA 5E3JA 4Z2YA 4DDTA 5BN3A 4D6XA 1UKAA 3ZWOA 2QUKA 4I9HA 1GXSA 3JALA 4BCCA 3PHHA 1M6YA 1FVXA 4QBGB 3C6BA 5AFSA 3UENA 2P65A 1RXIA 1BXZA 4MRMB 2JFYA 1UJ6A 3LT4A 4IHKA 3SOPA 3NV7A 1ZJ5A 3GOQA 3QKIA 4LDAA 1ZX1A 2WFLA 1T2VA 1Y7HA 1ZL2A 4BMPB 3T9BA 3KYDB 4C76A 4LRYA 2JARA 1HGXA 2B83A 1WS6A 3CUYA 3WGTA 3A6EA 5ENZA 1DBRA 1NW4A 2AR9A 4HF7A 5KNBH 4B3TB 5TMPA 5B7GA 3KP1A 1QIGA 4M4SA 2ONJA 4URHA 5HRAA 2XOXA 4MVJF 4K9RA 4KR9A 2J48A 3FIUA 3Q5DA 3TRFA 3U7RA 3WDSA 1XU4A 4ZYWA 4W99A 4J90A 2EFDB 2XQGA 4KC0A 2GZ3A 1DAPA 2V7VA 4MVJA 5AI6A 1BG6A 4N9QA 4RZIA 2ZSUA 1EFVB 2QAGB 1E4OA 3LPMA 3PFHA 4EARA 2VK2A 3H87A 2PUWA 1P4RA 1EJ0A 3AY3A 3H1PA 1NP6A 2FEPA 4O2AA 1CF9A 5ALNA 3DZIA 4L0QA 5ADVA 4DLAA 3NASA 1DAMA 1ZITA 4RXMA 5K0FA 3FLEA 4PGFA 4YNBA 1RRVA 3PNBA 1Z17A 1U0EA 1FA9A 3W5BA 2YZ2A 4NWIA 4WESB 1E1CA 2QTVB 1J6UA 2QMOA 1E1DA 2GYYA 3WXMA 2ODQA 2CWWA 4AN0A 4E2FA 4LZPA 2EC5A 2WYOA 3R3XA 5JZ9A 5IS2A 1XGKA 3TPFA 2XGMA 1KP3A 3C3AA 5H9WA 1YMVA 1PGQA 1RHQA 3A31A 4GX1A 1P18A 1RLJA 1E0SA 1XXHA 2ILTA 5BN1A 3V1KA 3KKLA 1PNQA 2DFNA 5EMMA 1ZN8A 3VYUB 2CBXA 1EMDA 5CGQB 4CDMA 3NATA 4L2IA 1LPPA 3ESDA 2VDRB 4X90A 4JI1B 2ZETA 1SO8A 1XWWA 3GFPA 3VR6D 1BOFA 3W6OA 4IIDA 3JQAD 4POAA 5BY2A 2ZBRA 5REQA 2V8BA 2XJ4A 3DEJA 4AZ3B 2KBFA 3D3QA 4JC5A 5HBGA 2A94A 1QV7A 3P7MA 2DPXA 5FBWB 2QAIA 3AV0B 4KWIA 1TVEA 4LJLA 5JJLA 3RBXA 3W8DA 5FLKA 4BE9A 5IT5A 1UMCB 2VAXA 2WT8A 4YROA 4BMOB 3ZX5A 5CGZA 1CD5A 1M3SA 1GKIA 1N2CE 2ZYUX 1BMFA 4WXHA 3CJTA 4CV2A 5BWCA 1CQWA 1VIVA 1VKOA 4MO9A 3PB3A 4G63A 1YL7A 1Z62A 3UKOA 3OP1A 4JEHA 3QENA 3RS4A 3MTAA 4Y2RA 4QDZA 4TL8A 4AJ9A 3GRVA 1R50A 1Y3IA 1JIVA 4XYLA 4XVQA 1DMSA 3OMWA 2Z5LA 1NXQA 3QMMA 1D07A 1NDHA 3BMNA 1XZHA 2JLZA 3VPGA 4ENRA 1QDLB 4DHEA 4O1IA 5I45A 1XXHE 2ZWPA 5KNBD 1W7AA 1QC5B 2YJ4A 3ELUA 5F77A 5JC8A 1NHGA 2H5IA 4I6JA 4YRTA 4G8JA 5E2AA 1BQ3A 2DQZA 2YY6A 4L27A 5JG7A 1QRTA 1UFOA 4F21A 3NORA 1KF0A 5FOQA 2XCTB 2WTBA 1SOVA 4Q9HA 5ICGA 3PDIA 2CDNA 3CU5A 4WXEA 4G5XA 3V9PA 2FWAA 3CW9A 3VVMA 1AKWA 1WCV1 4A15A 4XIYA 2GS9A 2IYSA 2YFQA 2ZRFA 4FDVA 3B3AA 2ZXUA 4E5KA 1HT3A 3KQYA 3Q11A 2ZZNA 1LQUA 3OKCA 1AIPA 1A8HA 2JGKA 3PBKA 1D4FA 3WNVA 2CJWA 2VKTA 1IN7A 1N8KA 1V3VA 2WILA 3OO0A 2DHDA 4R8SA 4ENTA 1NQWA 2Q8QA 3NW9A 1GA6A 5FPHA 5J1SB 3QPBA 4CM9D 3C85A 3LT2A 1NLUA 3JZDA 4DCCA 2HMUA 5KSYA 1I2CA 1XD2B 3ODGA 2RGRA 2GETA 2Z04A 1RTTA 3ZH2A 5EIXA 4DCJA 1ADYA 1KJIA 2D1RA 4FKBA 3VHXA 1K0FA 4G0PA 4MRPA 3KLBA 3OX4A 4YB8A 3C3WA 3F97A 1DBWA 2Q4BA 2UUOA 1TLTA 4GE3A 2X5OA 2A0YA 3L8CA 1R37A 2GBFA 2JGLA 2M6SA 2AOUB 3C2QA 3CRRA 1JQEA 3GT7A 3EJWA 3G5LA 4B3CA 3JYNA 2XE4A 4P80A 1OKKA 4W9RA 5EJ2A 2W2XA 1P1KA 1E18A 3OPYB 1SXJA 2Q4EA 4FSHA 4HCJA 2HBRA 5LP6C 4DNOA 2YWXA 3WADA 3V3TA 1KZ6A 5FI3A 3NTVA 3AR7A 4HDMA 5KPDA 1UKEA 2H31A 1ENZA 1HKHA 5E1MA 4DV5B 2YQZA 4HB3A 5IHXA 4QUEA 3KS9A 3DE2X 4I55F 2DQSA 2Q5CA 1UEJA 4I55A 1P6XA 5IC6A 4YK7A 4N12A 3EXIB 4QZVA 1IVSA 2HKIA 3OKFA 1PVDA 2QRPA 1JECA 2EBUA 2VK4A 3B3JA 4JWKA 4EBFA 5LWHA 3GEBA 3DDUA 2W90A 3FKSD 4O2BB 4QWMA 4BMDA 3QYFA 1GIAA 4FJ1A 5DNDA 2DFTA 2FFJA 5ILQA 9MHTA 3U4CA 1U4NA 4IMPA 3VPAA 4IBOA 3DKVA 1H6BA 1HWYA 1DZIA 2PRSA 4X95A 4X60A 5COBA 5FHRA 4A8JB 4F9TA 2G83A 2CHVA 2YCBA 3WWZA 4KQ6A 3VDRA 1QKIA 1FNMA 3KT0A 5KNDA 2VZLA 3MHPA 1NZJA 3MNFA 4LHWA 4W1SA 4E30A 4HQOA 4IMJB 1RPAA 3TTWA 4ZZ3A 1EDOA 9GPBA 4CKCB 2RGNC 5AQ1A 4RK6A 2NNWB 2QSJA 2W6ID 3ZU2A 1ZNXA 1WMSA 2ZS8A 2Q6IA 3R3SA 3RUCA 2RHMA 3QVTA 1E2HA 1S3FA 4CR7A 5H4GA 5ICSA 5KMGB 4QREA 3CUUA 3NX4A 1L4KA 4U9UA 2JG3A 1DTSA 1SXJE 2NM0A 3H3JA 3S70A 4ZI2A 4AYXA 3AGQA 1IHUA 5D7BA 1N0HA 4MTCA 4A03A 5HPYB 1DOHA 1Y1TA 1NRXA 2GBLA 4MYDA 3MMSA 4TUYB 5JBQA 1E32A 1MB0A 2B5VA 4MWSA 3WWCA 4ARUA 3VJKA 4HAOA 4B85A 1E5LA 4MROA 3TF5A 1OYVA 2MDTA 2GM3A 2A1UB 4FEEA 3UNXA 4Z9XA 4DSTA 1UBRS 1I10A 2ZSJA 3BTOA 4I8IA 5TNXA 2JI9A 4PR0A 1RI4A 3FMGA 2AXPA 3LIIA 4D9MA 4DZZA 1YRQA 4LDRA 4LYFA 1VE9A 4UTNA 4DIBA 4WXPA 3TSAA 1JDJA 4DS3A 3WV5A 5CB4A 3BVPA 1IN4A 3IOCA 4HLDA 5ALKA 4AW9A 3DDWA 4LQDA 1D4ZA 3UK0A 1WMDA 2HHCA 4QRHA 3BXZA 3M2TA 2GRUA 5HGXA 1D8AA 1LLDA 3MWYW 5CCXA 5J2TB 2GT1A 3OQ6A 2XRFA 3GLGB 2CVPA 1YACA 4PN3A 2B36A 1NMZA 2X8LA 2ON6A 3GU3A 3EIFA 1QB8A 5CRIA 1ADFA 3WHIA 4IDPA 2JDID 1II8B 3QU5A 1SUIA 3WYFA 4YT4A 3IKTA 2ZB4A 4B81A 3DMTA 3RU3A 3M8KA 2C4VA 2PD3A 5CDSA 2Y1GA 2ZSFA 3BJRA 4IXTA 3D6TB 4M0CA 2JBAB 3QNWA 1GPMA 5BR4A 1A2OA 4ZXFA 4EQ6B 1AVTA 2B20A 2CLCX 2XOKD 3JQAB 1CY1A 4P35A 3LL7A 4Q6WA 4O8ZA 3QWFA 2CK3A 2F59A 2O4UX 1LPBB 5SY9A 3ZQ4A 3JZAA 4OQQA 1NJ6A 2FFHA 2DHEA 1GKYA 3EMKA 3MD9A 5JPIA 3ZDRA 4J91A 4YP0A 1Y1LA 3BAZA 5CLJA 4PGMA 4AJOA 1J9ZA 3QH4A 3GROA 5DN9A 4IDFA 4G4JA 2REQB 5M5BA 3ET4A 2EWWA 3EGEA 3HN6A 3RVQA 1SQ6A 4FCVA 1SAYA 4EB0A 1T3TA 2AI1A 1BW9A 2JVJA 3BD7A 3IAM1 3KD3A 1HE1C 1HLGA 1TYBE 3N0RA 4FXPA 3P2MA 4P7KA 3EDCA 1GNRA 1VBNA 2ZTLA 3RYTC 2YV5A 3CEAA 1E9AA 1Q0ZA 3F73A 3MA0A 1FQJA 2CNDA 1S2GA 3OFJA 2HMTA 1K8YB 1TEZA 2F8SA 2KHZA 1IPFA 3ZDBA 1R6XA 4W5NA 2AG5A 3CKMA 2V97A 4RO0A 4KX5A 4QPNA 4I50A 3WLTA 2IW3A 3HCEA 4JNCA 4MVJM 3FMOB 5IAAA 1F9EA 4OA5A 2HN9A 4QJBA 2G9ZA 3C1TA 4O3MA 4HK4A 4CLRB 5CXXA 1PL8A 1QXSA 3HDHA 1A5SB 1QCZA 2DBVO 1MX1A 4HH3C 2RGWA 2ZR0A 3EA0A 3LVFO 5FUYA 4Z0TA 5CIYA 3G2OA 4LRXA 2IOFA 4N5IX 4RFLA 3L92A 3LT5A 2W6NA 2WF5A 4YMGA 1ESEA 2J32A 3MBKA 5DU2A 1SCNE 4P2GA 1S3GA 4QFBA 3E4CA 5CB6A 1KSGA 5ESDA 4G07A 3Q9NA 3VV2A 1NYRA 1LC3A 3ILVA 7MDHA 5IF3A 4MZXA 2WT9A 5LJIA 2FLKA 4BGEA 4BS9A 1II0A 1KK0A 3G3EA 2ODAA 4M3NA 3UJBA 1EFRA 2D0DA 2YMQA 3LQ2A 3OC0A 4XEHA 5FL7D 4CMBA 1AMOA 8OHMA 5JSKA 3TLXA 4AO6A 1K6MA 2XCQA 4NHOA 4EKDA 4C43A 5KYTA 2AN9A 4JJ7A 5KQMA 4LFCB 3IPLA 1ONSA 1SHTX 2YOGA 4BE4A 1PV1A 1ZNWA 4KVZA 4RPLA 3S4YA 1FTNA 1K3FA 1QG2A 4HY3A 4A5OA 4J6FA 4MUXA 1X9IA 1EZZA 3WTBA 1TQ2A 2P2YA 4FE7A 3FTDA 5ALZA 4FU0A 4L3WA 1I2MA 4M1TA 2B2XA 1E63A 4J29A 2FLWA 4OYRA 3RSHA 4DV7B 5JDCC 1CUHA 1T36B 3FSEA 1XQVA 2FW6A 2HIGA 3CEMA 4NF2A 4RVSA 3RU7A 5K51A 1B6GA 1NTRA 2VBFA 3LYLA 1NX6A 1Y9ZA 3BDVA 4KW7A 3CUWA 3FTPA 1RAIA 5JLAA 1D0IA 5BW6B 5HFJA 3IMGA 1TLFA 3C7AA 1TU0A 4M1ZA 3IDFA 4G4SP 1K75A 4WE3A 2JIBA 3VKVA 3EJ6A 1U65A 5AXDA 2QGFA 4FT2A 2YTZA 5AM0A 1MEOA 3F6EX 2YRWA 3P0FA 4MCIA 4RA6A 2P9BA 2Q1SA 3M34A 1GAQA 2XUFA 4AXBA 3RU2A 5B4VA 2Y99A 4PLPA 3GJ4A 4WK2B 2VCYA 3IOYA 2PXXA 2Q0SA 2IS6A 3KEMA 3L0OA 1H2FA 5BV8A 5K8UA 5BYJA 4F71A 1WEKA 4MR8A 1DJQA 2NSYA 1Z7BA 1HT2E 2A14A 5AVJA 2D8MA 4NU8X 3GZTB 1M73E 4ER6A 2W4IA 1DWUA 4CV0A 3NMUF 3WRYA 1ZM3A 1BJTA 3UH0A 4TM7A 3BQMB 1PG5A 4J1SA 1NQVA 5ECDA 1HDOA 1V7QA 4Q1AA 2PLAA 1ACJA 3PUXA 4GBJA 3P19A 3SQNA 3EQ7A 3OO1A 1NF8A 1O7JA 2WVHA 3VYSB 3WRXA 4HWTA 1UBLS 1COWA 2ZOSA 4MWZA 4Q9IA 3E9RA 1ICIA 4G81A 1H9CA 3MK31 3UMSA 3KSAC 2QN8A 5EIOA 1YBMA 2QKYA 4X6UA 1MPTA 4NBRA 1OFUA 3LT0A 3KQLA 5EIBC 2FRVA 2QTAA 1QIDA 4D2IA 1PHPA 3KWFA 3A6JA 3PXAA 2LWIA 2FRDC 3CB4A 4IIHA 4L6IA 4NH0A 1AE1A 3KQHA 4B3XA 1BVHA 1DHTA 1DPFA 4U7JA 5IFLA 1FZQA 1VE6A 3M3HA 3OTOB 3CXRA 5C53B 3HJGA 2PYDA 4J0GA 2PWPA 5F9MA 4RNCA 6ADHA 1O95C 2FPPA 1SBTA 2Q99A 3OIWA 2X22A 4DVGA 4EZBA 3IO5A 3D6AA 5IAEA 4DSUA 2GYVA 2PLNA 1FXSA 4M38A 2Y1DA 3OIDA 4JOBA 4L08A 5CK4A 1HY3A 2ZPAA 3L2OB 4KE7A 1LBEA 2FKNA 1I13A 4OREX 4PIVA 1Y1QA 5JS7A 4QDXA 5MGNA 3VDXA 3C98A 4GXQA 2FZ4A 3BK7A 1KAQA 2DUWA 3FW1A 3NNNA 4ZJPA 2XNHA 4WV3A 4DV6B 2UXCB 1O8BA 4C1NA 5BVGB 3HA7A 1YMQA 3P20A 3EPJA 5DEOA 4BKPA 3RB8A 1WCWA 4CEHB 4TVOA 4C3ZA 3ZLAA 2ATVA 3U4QB 2QE7D 1A3CA 2WIBA 5JO9A 5CIWA 3PQ2A 2V4UA 3PR1A 1E7QA 5A5FA 1Q91A 3EGDB 5JDIC 2VBCA 1LNZA 1Z6QA 3KJXA 3GOHA 3FYUB 4G1UC 1GAJA 1XQ1A 3ZDQA 1SCIA 4PRKA 5JNUA 1H2EA 1H8EA 1Q74A 3K31A 5E2IA 1N2HA 1SVWA 2O0LA 2BFMA 5K2MA 5AHWA 3HWSA 4DHWA 4MUEA 3EPRA 4QBHA 1QLHA 3DBHB 3SVZA 1V4NA 2WWIA 3W3AA 3TGPA 3DMNA 3UN1A 4AS2A 2ZRMA 1U4OA 4RS3A 2N42A 2FEKA 1NV8A 1NGSA 3NT2A 4ZANA 1NBAA 2X77A 3T7TA 4PVDA 1U0TA 5EPEA 4OG2A 5E38A 4G9GA 3KFXA 4PQYA 1N2GA 5GOTA 2C7GA 3MJ4A 3PUKA 2EQ5A 1YOVA 2IXAA 1G2QA 1LI5A 2F43A 2P8JA 2FPOA 2BHSA 2SICE 2YINC 4HLQB 8ADHA 4NMMA 4U7DA 3IQXA 3BDAA 1QFXA 3OQVA 1KXZA 5DHUA 1D1QA 4RAQA 4DDWA 1THGA 5FI0B 4OH1A 1JQLB 1V5WA 5B7QA 4HTFA 3RHZA 4IOKA 1MQAA 3JD2A 3PTLA 5FOTA 2WW8A 4MDFA 1QH1A 3WL4A 4C0HA 1IZ7A 4EBBA 5LFAA 1PQPA 2IXFA 3N87A 3MMNA 4MNTA 3UBTA 4MRRA 1XQYA 4KIGA 1G63A 3GLHB 3EWSA 1SUFA 4HJXA 5EMHA 3EGIA 2V74B 3ETGA 4JB3A 2QJTA 4MULA 3ZCRA 2YY5A 3QVLA 4QOIA 1XA0A 4NNOA 4JJGA 4TT3A 3N2KB 5DYTA 2FMIA 2VDJA 4CHTA 3KKEA 5A6SA 2EX4A 1T0JB 2YMPA 3UMMA 5EMKA 3T3MB 4BYGA 4CL3A 4V2UA 2V0CA 2NU6A 4DG5A 2R1UA 4KQ1A 1HNZB 2QX6A 4PRYA 3B8HA 3RS3A 3NIGB 3PRHA 1KZGB 4Q93A 1NFFA 3PDJA 4BFVA 5P8WA 4B47A 5GONF 1I94B 3CZMA 3W4IA 4CJXA 1WB9A 3KKKA 3W05A 3DONA 4IS2A 4K3VA 5T64A 3W6ZA 5IAGA 5LR6A 4P3OA 3O83A 4MMZB 1TQHA 3AO0B 3T0GA 1XAJA 3JSXA 2ZJ4A 3I2FA 2VRCA 3IJ5A 2ADMA 2VF4X 2Y6VA 4WY5A 7REQB 4FXOA 1YFLA 1U28C 3I4LA 1C9NA 3HBJA 3JQ7A 3GEDA 3U40A 4PICA 1ZNQO 4UUOA 3TINA 2QM3A 5KWJA 1NVDA 3DM9B 5G1NA 4TYYA 2QDKA 3T7KA 1E2JA 4F6RA 2FK7A 2WF8A 1E4EB 3LPLA 4Q4AB 2R7MA 4ND1A 3FWYA 1N6PA 2GPSA 3ZY4A 4EGSA 3Q0TA 4I19A 2V3WA 4OM8A 4JLBA 2PAAA 3OZVA 5E6RB 2VF5X 4G5FA 5B1IA 1I6WA 3LBAA 2B21A 1BN7A 2C83A 1TZJA 2H65A 1TJ3A 2JLAA 3AIKA 2AG0A 2G72A 3CB2A 3GELA 4MCHA 4OM7A 1UEXC 1EHIA 1EWKA 3BULA 3MINB 2ZR9A 2AXEA 2QQ5A 4UREA 3C7CB 3WKEA 5LQDA 2I2AA 2OXRA 3L0PA 2XNDA 3QTBA 1B14A 4R16A 1KEEB 1SEPA 4NCIA 2UZ4A 3QTLA 1RWBA 3W7BA 2HSJA 2GN4A 4CCAA 3UBMA 5C80A 1DLIA 1UQUA 2QM8A 1DINA 2GFQA 2X1VA 2QXTA 1DXHA 3SEQA 4DCSA 6ABPA 3FTFA 3ILSA 3V3KA 5C4MA 2W9XA 1GZ6A 4II7A 4N6GA 1TQDA 3GT3A 1E6UA 3UCFA 5TVKA 2LDBA 2NO5A 4UC0A 2Q5EA 3I45A 5F23A 1EG2A 5ALDA 4KXXA 3WWPA 1WQ3A 2MINA 1TAGA 1L4NA 1MW9X 3TQOA 3EOBI 1R10A 3M81A 3MFQA 5CVUA 2C9MA 4UTZA 3AEQA 4CFZA 4FIDA 5D01A 1IFXA 3IIEA 4M0PA 2GF9A 4MKGA 3TM5A 2JZOA 3VTKA 3YASA 5GZ1A 3DULA 1E79D 3OE1A 4TS1A 4IIJB 4N7BA 1IH8A 3Q5GA 2HWWA 1ND5A 2V4ZA 3P9CA 4MW1A 1W4ZA 3GY0A 3V55A 3ZHXA 5CDFA 5AW2A 2PQ0A 1VG1A 4D0LB 4BNFA 4A91A 2WD9A 4KZPA 4Q9DA 3M4XA 2FEOA 3B52X 2XCUA 4ZK2A 4ZPXA 4BX2A 1PT9A 2O7QA 5AK3A 3MD0A 4OK6A 4J0IA 5IJ0A 4EOGA 5K3AA 3THXB 1SKMA 1P17A 2JGRA 3K8OE 1IJEA 1U0LA 4YMUA 1MC8A 4XLTA 2XH8A 3V6MA 4YMTA 2VTDA 1UJBA 1VPDA 4PVCA 2NZ2A 3UPUA 2HCFA 4EMTA 1OH5A 2WHQA 5I7SA 5INTA 2V7QD 1K86A 3NXKA 1O97C 4KCGA 4Q82A 2FVYA 4FINA 4CNBA 4MJLA 4PAGA 3EX7C 2PNJA 1JV2B 4EK9A 1NQUA 1W0JD 2P9YA 3IVRA 5JROA 3GYBA 1ODKA 1DCKA 2C03A 3SF0A 9LDTA 1EB8A 2JLBA 3NYWA 3VSAA 2OL4A 1UEIA 4LOHA 4MHOA 5HCUA 4F3KA 2YHIA 1CUCA 2OHVA 5K8IA 1WXFA 5HGJA 4S24A 3GEMA 2Q9BA 2D1FA 4ZOEA 2J4DA 2VNHA 4RK1A 2HEIA 5JCPA 2VQEB 1FFEA 4IJMA 3BXXA 3SPXA 2BFDB 1L4FA 1Z8DA 5CDFE 1KKUA 4N3GA 2C9OA 5AXAA 1YJXA 3K2BA 3R5KA 4UE3S 2OTCA 4WBSA 4M8NE 3KL2A 2D62A 3ON5A 1UC9A 3MCTA 4KQ2A 1BE6A 1S01A 1TECE 1JW9B 1O57A 1KVTA 5CIQA 5F2OA 2HO5A 3B3FA 3VQTA 5IDQA 3OJLA 4IOLA 2XGJA 4XDHA 5JYEA 5AWFC 4I1RA 3W5DA 3P2YA 4J1TC 4DC9A 4EPVA 1PRYA 1DC5A 1WUYA 5ADHA 4RM2A 1V9LA 4QAJA 4O0MA 4DTCA 5EY5B 1EVJA 2X8JB 3I83A 3VAYA 2GFHA 1RWXA 4ZEMA 3UWPA 1TTTA 1G8FA 2D00A 2Q1YA 2GGSA 4OQ4A 2KB0A 2L69A 3SYMA 3AW9A 7YASA 2DBYA 4JVMA 4HT3B 1J2RA 1LK5A 3H2HA 1P2UA 1GGMA 5JMWA 2NNLD 4RS4A 4XGQA 4LNUB 5KTTA 3I6ZA 4WK4B 3WGQA 1QBKC 1QX3A 3ASYA 3IH5A 2EDAA 1JEEA 4FLFA 1QGAA 3RADC 1UQRA 2LCFA 1TIPA 2ZYGA 4JLNA 4ND8A 1RJGA 3T15A 4JJEA 4K6KA 2F3PA 4EHHA 4RVGA 4U7WA 2H8GA 4E4TA 1G5IA 4P7JA 4QGSA 2X0IA 1DAFA 1ULAA 1YR8A 1SHZA 4ZI7F 1T8RA 1QVVA 1SVUA 3ILYA 4DJAA 5LYJA 4ZI7A 1SVSA 2GD1O 2JIOA 3L8HA 4Z1MA 3T1NA 3DTYA 2YZMA 4KPEC 1ILEA 4ALMA 2C1EA 1Q7GA 3U9TA 3KXPA 4JBNA 2AMFA 4POOA 3DOCA 1X1CA 3MBOA 5JAUA 5L7TA 1JFSA 4UNSA 2RI0A 2X6RA 4DIUA 4G23A 1PZMA 2J4FA 4NMHA 4R1UA 3CYFA 1N0WA 1ZXXA 1ECLA 3WK6A 4R05A 4YP6A 1T9CA 1NT2A 2HJ9A 4WD3A 5BSTA 1Y80A 2NP7A 4QULA 1X7XA 4MITA 4JXXA 3QOXA 2WE7A 1UFKA 3HMQA 4RZQA 4UJ3A 2RH4A 1SU4A 4OB8A 3I2GA 1DELA 3RWBA 3D7MA 3K05A 1IHPA 2G06A 3OCXA 2C8KA 1L4YA 2HHLA 3QKRB 4WEOA 4YQEA 1J4AA 2OYCA 2GZ1A 2WJ4A 2P2NA 2Z1NA 3HRHA 3ZTWA 2FPUA 3NGMA 1CJBA 3O21A 3C3MA 3EVAA 4IIEA 4L5BA 5ERXA 2ZANA 3AP1A 4K81B 4LI3X 4YP7A 1CYDA 3TQFA 1L7MA 3C3KA 4XRRA 5K8TA 1Z73A 2GAJA 3RARA 2G09A 2VUTA 1C9MA 3H4TA 4B6PA 4TL9A 4UAJA 1ZCBA 1FRZA 4JYPA 4XM2A 4C0JA 3UGKA 2HHHB 4KAAA 2HA4A 2R1VA 5A3VA 1KS2A 4L7VA 1KMHB 4UAGA 3WVNA 1X1QA 4YDRA 4E11A 1CY4A 5G0SA 4BO5A 3B53X 3KM0A 5L3VA 1J25A 5H68A 3GT0A 3SK0A 4M1EA 1M6EX 4XSGA 5ILGA 2DX7A 5JSFA 4OXNA 3D6HA 4OK3A 1X3LA 3O7MA 1Y1SA 4MXDA 3NRJA 1EX9A 2CJPA 3KC2A 4GRDA 4CPDA 1P1JA 3I3SR 1R8JA 2BKEA 3MXTA 4NOMA 4ZCPA 3TSYA 3EAFA 1RXSA 1R18A 2I7VA 1NF9A 4TTSA 2V1XA 3HLYA 1CQPA 5F1PA 1Q1NA 3R7FA 4DMFA 5IM4F 3AMVA 4NK4A 1FE8A 1E0AA 2ZT7A 2XPCA 2GO7A 3L7JA 4OYHA 1UXIA 2AS0A 5IM4A 1NP3A 1LLQA 2NQ2C 4GQIA 4RPIA 5IDXA 1FF9A 1A5BB 5I9NA 4JBHA 4M83A 3KZVA 1Z8HA 3LC7O 4V0RA 1DIRA 5D3MA 2DH6A 2PZEA 4KXMA 5EXTA 3CNOA 2QF7A 3EB9A 3DQPA 3S7ZA 1WQ1R 1B8PA 3NKLA 4IDGA 4MS1A 1ZMRA 2B7BA 4CCWA 4RTNA 1WY7A 3FPHA 1T1GA 2Z9CA 4GIBA 1WVMA 4KQKA 2EW8A 1W6UA 5ILOA 4BBPA 3EG5A 1G7TA 1VCHA 4US1R 4X7MA 3LVQE 2K2WA 4V0QA 5TF0A 3H75A 5LC1A 1FNSA 1ZD9A 1PN3A 3G0BA 5FNVF 3IAUA 2FP4A 2FUKA 4B8YA 1AO3A 1OCEA 3CKYA 5FNVA 4ZCQA 1KPGA 1VMAA 1T3LA 2EZTA 4FK8A 4R5HA 4ASUA 1ZUNB 2G5GX 4C6SA 1OC4A 4JL6A 4ARAA 5IWAB 1YZUA 4CNQA 1N7HA 4NFSA 3WYEA 3ER6A 4JGGA 4ZVMA 2TMGA 1PSDA 1U7UA 1FJ2A 4X1YA 1NUAA 4OHVA 3FOCA 1C3OA 1H65A 2F2TA 4DMMA 1DT3A 2IPXA 2H63A 4OYLA 4XM0A 1GZ4A 4H4EA 5LLDA 4QATA 1D5WA 4V0KA 5EYPB 3ZD9A 1QS0B 1TCCA 3EUWA 3BCHA 3L1JA 3R3UA 2JAHA 4QGBA 1DOAA 3VVBA 2KMLA 2RSLA 3TSCA 2GD6A 1RLIA 1Z35A 4MGZR 2AC4A 3FTEA 1G9TA 1KI6A 3E7XA 3PXDA 4MV9A 2A7QA 5E7JA 2OCBA 3IV6A 1AUXA 1NBME 2E21A 3TQTA 1JHVA 2VWQA 1R0CA 3PSHA 2YS6A 3EFHA 4QGAA 3UJ9A 4C6TB 5K03A 4RA9A 2O8DA 2V3VA 2GUWA 4FFDA 4RHYA 3W5SA 1W25A 3QELB 5JRJA 1U63A 3EXAA 2P35A 3OEHD 6PFKA 5JAQA 4YAIA 3AB3A 3F4KA 4GOND 4MS4A 1GRQA 2J9XB 3SBDA 3VAZA 3IQZA 5EQDA 1K08A 1OB2A 4KHZA 4EEZA 3C97A 3GVIA 2G08A 3W2IA 1B41A 1OUMA 3UO8B 2CEAA 4W82A 4M89A 3UJAA 4CLOB 2PH5A 4BQNA 4F96A 3BSWA 4D3ZA 3SSAA 3LKBA 3X1MA 2VEOA 4DIFA 1YGPA 1GQRA 2GAFA 2WLSA 2MT9A 3FTQA 3CRVA 4HN9A 4K9KA 2XWPA 4NJEB 5GWXA 2H9IA 2XQVA 4JZKA 5LUBA 1V3QE 3PWTA 4D3FA 3CMMA 4OGLA 2ZIZA 3WLJA 3DLCA 1KMCA 4HC4A 2EF0A 2I2BA 4YDQA 3RVSA 3R3YA 2IF2A 4I4NA 1T1EA 3AJAA 3NVKI 2MSWA 3H6HA 1MAHA 2FW0A 3I34X 1JT9A 4IEIA 4C2UA 2PO5A 4UE6A 1R0YA 1WKCA 4TSFD 3IVXA 4XQGA 1H2ZA 3HK2A 2NVBA 3BA6A 4H1WA 4HYEA 4ZMBA 1Y6FA 2R47A 1GTRA 4OMFG 4BC1A 5KHLB 2ZBVA 4UXJA 4RORA 3H1TA 3A1FA 3ET5A 1W73A 2WAYA 3BCUA 3EBOA 2WYUA 4YPFA 4KOEC 3OQJA 3F3KA 3PFWO 1OV4A 4IZOA 4B76A 4EEXA 3TEJA 3D9QX 1QFZA 3DBRB 3HR8A 4KUEA 3S27A 3L0SA 1QO7A 3L7CA 1GSOA 3MVEA 4XD2A 2P3SA 1DGQA 1YCDA 4PNEA 4PIPA 1OFHA 3H2YA 1KFBB 2AE2A 1TC2A 4M1MA 1OFGA 3AB7A 4IIUA 4L5YA 3T7CA 4M60A 4D3YA 3IELA 2JCYA 3A2KA 1QUEA 3R0IA 4ZCMA 3GAZA 3GA0A 4Q3CA 3ZGYA 2Q27A 1E2LA 1MOPA 2WSYB 3REFA 1UDWA 4R31A 1MMFB 5B30A 4UTRA 1TT7A 2FZGA 1WLSA 1JE1A 3VJRA 5ES4B 3G1TA 1QVWA 1M1XB 5EOVA 4PW0A 1P7PA 5I6DA 1YASA 5JTUA 1TZMA 3IHLA 1VTKA 1EVKA 1SHJA 2YOHA 4FFSA 3JQ6A 4G0XA 4PYIA 1FUKA 3JPWA 4NDAA 4PAMA 2QG9A 4LX8A 2ZJYA 1HM5A 1FJHA 2GZMA 4GC5A 2Z6UA 3M49A 1M7GA 4XQ9A 4TQAA 5CA1A 1DL5A 2DULA 3DE7X 1ZK0A 1Y7IA 3KWLA 5EKTA 3HM9A 4P2BA 2YN0A 3A7DA 3ABIA 2LD4A 4R81A 5HUHA 3A36A 1SQGA 3DMRA 2QAGC 2XVXA 2C3OA 2FPKA 4Z4EA 4MVJH 1SZCA 1XTQA 2OVBA 1I3NA 1O1YA 1Z36A 2ZRDA 3FFXA 4F8YA 2GN9A 4URUR 2H4XA 3EVZA 4W7SA 5CYPA 2NPFA 2Z98A 1DBSA 1KAHA 3VR2A 3L4SO 2PRKA 4TQGA 4DV3B 2YXDA 2R48A 3VX3A 3FFTA 1DIOB 2GJKA 2HSDA 5JNRA 3M3PA 1PK8A 1RBMA 2NIPA 4KXYA 2PSEA 2ZRJA 2DBRA 1CC1S 3IPXA 2ZVJA 3ND5A 4LZWA 2A4MA 3M0EA 5DFAA 4E0BA 1UKVY 1C7EA 2WEKA 4QUHA 4WINA 4L5IA 2COKA 2I76A 3TOVA 5JARA 3WGVA 4ZCIA 3PA8A 4F2DA 4XUEA 3RDPA 2VJAA 1LJLA 2J33A 1I33A 4L6AA 3OZDA 1DADA 2H2WA 2ANBA 3ZIAD 1M8PA 1G3MA 1S3IA 1U0BB 1PJ3A 3LYHA 5KTMA 4BEWA 4X8HA 1VL1A 1VLQA 4BMCA 3ZDFA 1TM5E 2PYZA 3FLMA 3FMIA 4Y1GA 1EFLA 1RBZA 3CNNA 2FA9A 2G9VA 2RHOA 3FUVA 1QZZA 3NC1C 4OJKA 4CTKA 4E03A 5JUWA 4BY9E 1MBZA 1E2PA 2XNKA 3EG9B 4URZR 1SUDA 1P2FA 6AT1A 4E2ZA 4BCDA 1EHYA 2YWDA 2OV2A 3DBIA 5SZJA 3ROEA 1KETA 3OPYI 3GG2A 4WFKA 4KDFA 3N2GA 1X8XA 4E1BA 2PGAA 2QQGA 1VG0B 2FMHA 1X80B 4ZU1X 5EIWA 2X2FA 2NG1A 3EVTA 4OU5A 4EJSA 3W1EA 1ABFA 2CXUA 3LVBA 5KYXB 3U7HB 3C14C 3LC2O 3LPCA 3NFYA 4W6ZA 5K3SA 5AW5A 5EWLB 2TMKA 1IL0A 2E85A 4RIEA 3G9XA 3ZWMA 5DM70 3LBYA 1SRQA 2DC1A 2DYKA 4A1OA 2OD9A 1R4NA 2OV8A 3LNTA 2VOJA 3VAAA 5L51A 1SXIA 1T4CA 1MA3A 1QE0A 3KB8A 4HFRA 4P7GA 1G8GA 1REQA 2XVAA 2H2DA 3OF5A 1FDVA 1UPFA 2FKAA 3PQ4A 5FUBA 3GFGA 2PGJA 2XVZA 3NIWA 3DP7A 4K1XA 4M1YA 5LXTB 1V45E 4FEGA 2PKQO 2W00A 3OOHA 1YC5A 3PEWA 1YQQA 2NTJA 3DMFA 1P62B 1V7CA 3D2BA 3HFSA 4DC1A 4DR5B 2BGRA 2FW9A 4RD6A 5KC9A 3MT8A 1FNDA 1PF7E 4IQGA 1JE0A 4AYWA 1DUVG 1R2QA 4MVJD 1QFYA 2CDCA 1G8SA 3B13B 2Q2WA 3IPRA 4TPKA 5ED0A 3VH4A 3BEOA 2VTBB 1ILWA 4E1AA 4Y6GB 3Q3HA 3IVAA 1QU3A 2VPQA 4RTRA 2QNRA 3JASB 4WZBA 5BQPA 1ORDA 1XYGA 2OBMA 4OGKA 3A3OA 4QHTA 4EL0A 3N05A 2UAGA 1JWAB 1US8B 2WIDA 3N9IA 3OE5A 1G8JA 5F3WB 2C7PA 4H6VA 1KOLA 4UHJA 3EQZA 3EWAA 4CZ2A 2QJWA 3CX7A 4YAOA 5ALMA 5BPFA 2ZAGA 4RQAA 5BP7A 1EVIA 3AW8A 3BD9A 3AF6A 1L7EA 1R0BA 2QTHA 4TYWA 1IOWA 4F4IA 5L3QA 1E6KA 4CF6A 4RDIA 1IG3A 1WXWA 4MUNA 1VLVA 5HK8A 4BB0A 3ANMA 2XTMA 2BFFB 3URMA 2JLVA 1YDHA 1TMKA 2P6RA 2GPBA 1HK7A 2WJPA 5DE3A 1JIUA 1JEYB 4RCYA 2H11A 3B1WA 4MGYR 2R8RA 3BAFA 4XJXA 5B53A