1OQAA

Solution structure of the brct-c domain from human brca1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
110
structure length
110
Chain Sequence
b'GSQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Breast cancer type 1 susceptibility protein
publication title Solution structure, backbone dynamics, and association behavior of the C-terminal BRCT domain from the breast cancer-associated protein BRCA1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 16
structure length 110
sequence length 110
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1oqaA00
2EBWA 2VXBA 3I0MA 4JLUA 1WF6A 2DUNA 3SQDA 2COUA 3PXAA 1L7BA 4U4AA 3PXCX 1T2UA 3K15A 1KZYC 2NTEA 2E2WA 4IFIA 3PA6A 3EF0A 3U3ZA 3K16A 4BU0A 3QVGA 3T1NA 2WT8A 3PC7A 4Y2GA 4BU1A 1T15A 3AL3A 2COEA 4OFBA 4N40A 3II6X 2ETXA 2VXCA 4IGKA 2XNKA 1L0BA 1CDZA 1IN1A 3AL2A 3L46A 3QVGB 2ADOA 3KTFA 1T29A 2D8MA 4Y18A 3PC8A 2LE0A 2AZMA 2EBUA 3HUFA 1GZHB 1T2VA 3FA2A 3T7JA 1N5OX 3PC6A 2JW5A 3PXDA 3JVEA 4BMCA 2R1ZA 3L41A 2INGX 4ID3A 1Y98A 3T7IA 3K0KA 1OQAA 3UENA 3L40A 2XNHA 2M2IA 3PC8C 4XQ0A 3SZMA 5ECGC 3K0HA 2K7FA 2L42A 3OLCX 3EF1A 1JNXX 1IMOA 1Z56C 3HUEA 3PXEA 2HTFA 3K05A 4XPZA 4BMDA 3COJA 2K6GA 3SHTA 3PXBA 2COKA 3SHVA 3I0NA 3UEOA 3PD7A 2EP8A 3T7KA
chains in the Genus database with same CATH superfamily
2QTFA 1F4VA 4AN1A 4UM5A 3M6MD 4K05A 2Y0BA 3VO1A 3NUZA 1AH2A 3JAKB 1ZGGA 1LSJA 3PWKA 5EJ6A 3QPUA 2OC4A 2XWQA 2BDTA 1ABEA 1Z5OA 4N8EA 5SZJA 3VKUA 4KNYA 1SB9A 5TARA 3WLRA 3EG9A 3ON5A 5C8XA 2EQAA 2Q1SA 3ADOA 4WI1A 3ROMA 4FMDF 1U9YA 5DV9A 5AOAA 3L5OA 5SY9A 4CTOA 5B6JA 1KDZA 2X8AA 5KUTA 5DWVA 1OLUA 2Z8ZA 3UB3A 2GNOA 3B51X 4KDRA 1U28C 4FFRA 1A95A 1MQ8B 1GPUA 2HXGA 4J0KA 2Q99A 4YQEA 3FB4A 3QE0A 3T15A 5D01A 4ZZ3A 5BR8B 3COWA 4QOSA 2XI4A 3ZDAA 2HDHA 3QTBA 4R9VA 5FNZA 1KSHA 2NXJA 4KL8S 2XAAA 4RLQA 2F1KA 2GTHA 3AG5A 3IV9A 4GLFA 2CJWA 1ADGA 5INTA 4OI0A 1C0EA 4BAGA 2C1XA 4RC9A 4UCXA 3FCEA 2WT9A 5C1IA 4CQMA 1BE8A 3RUCA 3UFXA 4EDFA 2QRZA 3BMQB 3F71A 4NHEA 3N39C 4ZZ1A 1KJ8A 3QOFA 4GLOA 5CVCA 1DAHA 4U5XA 4QXPA 1JLHA 4I36A 1W85A 4PG4A 4TYNA 4DQLA 3B1VA 3R7FA 2H5JA 3ZWAA 1M67A 2IXDA 4O3MA 1FP4B 5BWOA 3NUQA 3JYNA 3T34A 1UQUA 1LB1B 2A6PA 2OL4A 4P7BA 4UXIA 4ALMA 4C0SA 5HVNA 1HNWB 2R4QA 4X7BA 2ABWA 1D5WA 2IY8A 4FDVA 4EUFA 4LNUA 3G23A 2IE8A 5A4FS 1RWPA 1R1DA 2XODA 3LQQA 3G3EA 1SCBA 1DS6A 2D5BA 2RBGA 4F2WA 1QYWA 1JW9B 2DFLA 1MJHA 3QMVA 4DV3B 3MWYW 3OIYA 2MJLA 4HY3A 3G85A 4OI4A 4R3WA 4GUAA 3ZK9A 2C92A 1Z8NA 2YV3A 3TKLA 1V71A 1MD9A 3ETCA 4FLMA 5FOSA 2PU7A 4X93A 1QIHA 2HU5A 5AVQA 5KOJB 3E9NA 5FI5A 5IBQA 2JLBA 2WWXA 3SM3A 4PSUA 2XE4A 4HEJA 3A70A 4E5KA 2QF7A 2P4UA 1RRFA 2R8OA 3KOWA 1KJIA 1J33A 4WFKA 1QYXA 2NN3C 1O1YA 2W48A 5K0SA 3C14C 1UMCA 2ZBQA 5GZ3A 3K0HA 1SXQA 4U00A 2GWHA 5CD9A 4OHOA 1FDUA 1UKBA 2L42A 3MTGA 5CA1B 3KALA 2GMWA 3JQGB 4F3NA 4HF7A 3B60A 5F33A 2ECFA 3ZU4A 9LDTA 1Z4NA 2VBIA 2GZSA 4YMVA 4Q7MB 2BMJA 2EJCA 4H1HA 4JL5A 2Z9CA 5EYPB 1L1FA 4ENPA 2OD2A 4U63A 1EXDA 1A8PA 2HXYA 3I5MA 5ALTA 2FUNB 4OI1A 5KI6A 2CLCX 3MRTA 3RU9A 1RWKA 3AILA 3S2EA 2AN3A 3KR0A 5FIUA 4M9XA 3REQA 3BJZA 4WUTA 1CB7A 5A4JA 4ETNA 2VK2A 1X92A 2QVCA 2D8AA 2ZBVA 3FFAA 3OP1A 3FNHA 3S5JA 4ETIA 4C88A 5KNCD 4DV1B 2VNIA 2LR0A 3E5MA 1L8OA 1GZUA 3FTEA 2JASA 3TIIA 3D3WA 3DULA 1DSSG 3O4RA 4R7TA 4YJ3F 4OGGA 3O90A 4DMFA 1ZD4A 1TQDA 5JDIA 2Q0QA 4UVIA 3RSOA 4IJMA 4ZYXA 3B8EA 4WXPA 2FU5C 3CX3A 3GCWA 4HRVA 4JLKA 5EJ7A 5HR5A 4BNGA 4MUGA 3QX9A 4S1TA 1OXSC 1T9HA 5E6UA 8GPBA 2R8XA 2CXQA 1KVUA 2O3UA 3IGFA 5AJVB 3WIEA 2OCPA 2QN6A 1NC3A 2AG1A 5D6NA 1PR0A 1IL0A 1MX3A 3BBLA 1GUAA 2IXTA 2WA2A 5A3SA 2GM4A 2AEEA 2FKNA 2H11A 1W0JA 2AMJA 3U09A 3INTA 1N1DA 1Z6AA 4MVJI 1GOTA 2M6RA 1CFJA 4F06A 1KYXA 2CV1A 1PG0A 3KOMA 2F8SA 4DNPA 1XHEA 4AUKA 3SXPA 4IDAA 3E9ZA 4PE5B 5ALNA 3ZI7A 1Z29A 4O63O 4RHFA 4ZCLA 4HFRA 4Z9XA 3QGMA 1XFAA 4CKCA 1CRPA 1RAEA 4UCQA 3QE2A 3QE3A 2ONYA 1T8WA 4BWYA 4CV1A 2HQRA 3EDMA 3NJRA 1DI0A 1NKVA 2TYSB 1IATA 4HDNB 1EUYA 2A9KA 2GVDC 2MSDB 5GGYA 3EDYA 4MP8A 4ESHA 1C50A 1ZC3A 3CUSA 1YMVA 3JRNA 5FTKA 3WKEA 3WRXA 3BGVA 3AFHA 1Y8AA 2JC3A 2HJGA 3AVQA 4BQQA 5KVSA 2B1IA 2W6ID 1GEEA 1N1EA 3MTDA 3QX7A 4DTCA 4DR4B 1PQWA 3F1KA 2JG3A 5CVEA 1V3UA 1PUIA 5KOHA 4CEJA 3M0EA 1ESMA 2X5XA 4IOMA 3IP3A 3LVRE 4DNQA 4G4JA 2FPIA 1NHGA 5D2CA 2V5UA 2ZUDA 1P0CA 5F1OA 1DAEA 5A0TA 5CX1A 4FJ1A 4E13A 3LHIA 2IOFA 1JFLA 1S2OA 3ZS8A 5ICEA 4ZQFA 1WBDA 1J1ZA 4IHQA 3PNPA 4E33A 4DQVA 4D6XA 4DMHA 2X14A 1SUIA 3ZNPA 4YRJA 1GKKA 5HEKA 2X2PA 3G2IA 1AZTA 3GJ6A 5CJJA 3SY8A 2YIDA 4GI5A 4DRXB 2JRCA 3NHSA 4J3FA 5K0LA 3VO8A 1IEQA 2XUPA 5K3AA 3THSA 4R54A 2JHFA 4WADA 3HKEB 4WASA 4FWTA 4REQA 3EF1A 4O4JA 2FH5B 3GVXA 3GXBA 1XD2B 4X8HA 2IDZA 1NM5C 3JZFA 1PLLA 2FLKA 5EE9A 1IOZA 1X8JA 3RJ5A 3UYKA 3T4UA 3HRIA 4C29A 5FEMA 4OPMA 3S4YA 4AZVA 3DHEA 5BOSB 3ULKA 4C3VA 3K05A 4QRHA 3Q7SA 3WIOA 4L2IB 1VLJA 5CNJA 3C4VA 3DEHA 3PR1A 4BE4A 5ABPA 1OBOA 1HT2E 1QH8B 3BEDA 3FF1A 4PAGA 4RKYA 3TSOA 1OH8A 4RVFA 1KGSA 2GD1O 2OM2A 3QKRA 2PX0A 2W2NA 1MMFB 3IVRA 4MVJA 1DXYA 2TMDA 1XRSB 3MAGA 4ER5A 3ZJTA 4XM0A 2OAQ1 5HOQA 2OHIA 2VA8A 4QG7A 1IBSA 2JGKA 3QEAZ 4IAOA 2PFKA 5J2TB 4LFBB 5JYBA 5G1PA 3SEFA 4ZT5A 5B30A 1LC0A 4IRUB 4JX8A 3CSDA 3O9VA 1GTL1 3MNFA 4N4AA 4HRXA 4EHIA 3N8HA 2H65A 3CVXA 2EQ5A 4J07A 2Z8YA 4CKEA 1IN7A 1BDBA 1R7RA 3HY3A 1WQ3A 1OIVA 2FQWA 3BFJA 4JC5A 4PFSA 4QSHA 3U17A 4BMOB 3TGWA 1L5SA 2GNPA 3OIDA 2XCRB 2FWBA 1N7HA 4TXHA 1MJFA 4TYMA 1KEZA 2EP5A 1T9DA 4F93B 4X6YA 4LQ4A 1O9BA 3PGKA 2FGKA 5B58T 1KE2A 3RYFA 5DGCA 1NXQA 2QMOA 3HCDA 3KNZA 3OZWA 1C2TA 5FPPA 1M2JA 4J7XA 3PVZA 5THQA 1EP1B 1YD7A 1NMZA 1H05A 3DOJA 4MR8A 3CPHA 1R50A 4OKSA 4QKQA 4ND5A 4LMRA 3ZVKA 1T35A 5LOVA 1ND5A 4TTAA 3ZXYA 3IULA 5REQA 4OL9A 3EY4A 3TDMA 4DJDC 1JLSA 5BV8A 1IEVA 4TVKA 2GEDA 3ZCQA 4YFVA 2QLFA 3X1DA 2X8WA 5FPQA 1QYRA 3VHXB 1V9LA 4TS1A 1H6CA 1WY5A 1K92A 3DW3X 3MFYA 3CPSA 1AKUA 5DSZA 5A6SB 2JLSA 4QYWA 1Z22A 5C51B 2ZJ8A 4MVCA 4DQKA 2IHNA 3EWIA 3SE0A 4A6PA 4P0QB 4UM8B 1U6KA 1N6LA 5DT2A 1U6JA 2VJPA 3MB8A 2AFIA 5BYKA 3A2NA 1JB9A 5C8DA 1VJTA 1JVBA 3T5DA 4E5PA 1KS9A 1LV7A 3GZNB 1P18A 3AWDA 3IRVA 3ONFA 2MCFA 2FZCA 1ZL0A 3NVDA 4UZFA 3ETEA 3PXDA 3M33A 3VU9B 4JI4B 2EWMA 2Y6UA 1DTSA 4JK3A 4K9MA 1DEKA 4NFYA 4WGGA 2P3OA 4C7KA 4MJ7A 3R9XB 3WWZA 4GL4A 2WJ4A 1Y42X 2JFHA 2H31A 5LC1A 2IF0A 2VCYA 3GRKA 3KXPA 1YT5A 2IY7A 1V8DA 1G8FA 1II8B 1ADJA 1JFFB 1UDAA 2I5PO 2WMNB 3JZMA 2P27A 4R1LA 3ETLA 1A98A 5FHRA 3H1PA 3UCEA 4BVLA 4A0FA 4NBLA 3PXXA 3VO2A 4R69A 3JYHA 2AMVA 2PLNA 4RZIA 3L6EA 2JLAA 1QCCA 4CHTA 1NF8A 1F0KA 4O1HA 4QD3A 3B6IA 4QDJA 4YROA 3RYTC 3A4MA 3DTTA 3RRBA 2FUG6 2XEXA 3WMFA 1RAHA 1VSUA 2W7TA 1SEVA 1JHDA 5DTEA 5K8IA 5T3UA 2R7AA 4NS1A 1YFLA 1IG3A 4DTIA 5F3WB 2VYQA 4Z9AA 4ITUA 2CLOB 3HWSA 4R7GA 4GPIB 2ZS9A 1KZ7B 1FNMA 3WLMA 1U3VA 1KORA 2GYYA 3EIOA 1KQFA 3ZDRA 2ZTVA 3I0MA 3TJZA 1Z38A 4ZCTA 4JI7B 1I4EB 2AEMA 1JHXA 2YICA 4ZEWA 4MUAA 4S24A 4B9EA 4JVLA 4EG4A 5BWCA 2FSVA 4RFSB 3BMXA 2CZGA 4UCWA 4MQBA 4H6WA 1T1RA 3STWA 4V3BA 3ABIA 4YBZA 1FDRA 1XEXA 3CH7A 1HT0A 3HU2A 1SUFA 4Y9UA 5EUQB 2OUIA 3L6BA 3N5CA 5SZIA 1JG4A 2POCA 2W9XA 2R86A 1SUSA 2REOA 2WMOB 3IEUA 1XA0A 3WLHA 4E08A 1N8SA 3C1AA 4AG3A 4RSRA 4AT1A 3CRMA 2ADMA 4E3ZA 5BT9A 2REBA 2C5LA 1LBTA 2B3DA 1KPHA 3KWFA 3MTIA 1K63A 1N3YA 2OORA 1HT3A 1EWYA 3NM6B 2PBZA 2VP9A 4MV5A 5DNVA 4IXDA 1SZDA 1CR0A 1WUJS 4LBYA 2Q3EA 4G36A 3BFPA 4QWMA 2ZRFA 2XZTA 1PFVA 1T1GA 2IOYA 2P90A 2XE8A 3BE8A 4HDSB 4N8DA 3T8YA 2VQEB 2XD4A 4I66A 1LQ2A 4YDQA 2ST1A 3ABRB 1Z25A 3DFMA 3JATA 3T54A 5IKEA 1NY6A 1QYVA 1DAMA 3AR2A 2K2WA 1CUHA 2QN1A 4OXIA 4ZOAA 5AW5A 1ZGHA 2OEPA 3FKSD 5IT5A 1WOMA 3WICA 1P6XA 3B38A 3LQ4A 3CNOA 2JIOA 5I9IA 3IMEA 1YE5A 1XPOA 4O4LB 4BVEA 1GQOA 2DZDA 5ECYA 4C6TA 4DBLE 1U2ZA 4I1RA 5CXQA 3NFYA 4AJHA 4C22A 4F92B 2OZVA 2VNJA 3SJ7A 3OI7A 4CQNA 1GAXA 2NZ2A 1N0VC 2REQA 3FF4A 3TG8A 3Q7RA 2CF5A 3QU5A 5BSKA 1FLAA 1U9JA 2VP2A 3Q12A 4Y98A 1V1MB 5CVDA 3VC1A 1MO2A 3BF8A 3TOZA 2Q5FA 3MSXA 4GWGA 2QRQA 4MAFA 1IZYA 4D9KA 3EUEA 3GN2A 3PE6A 4GM1A 5KWJA 1M2OB 5IWAB 3HR8A 3QVLA 4MKHA 4G23A 4TSKA 4UATA 1DTEA 1KBOA 1CLEA 2ZP1A 1IN8A 1JPNA 1E3SA 3R7DA 4DAOA 2R6FA 5JNSA 5K05A 1DMRA 2QUAA 3HPRA 3W8FA 5JH7B 2FY8A 3PXUA 4DIOA 2W43A 3T6KA 5IXSA 1NUSA 1B1CA 2ARKA 4I9HA 3WGOA 4PPYA 4QGSA 4XWKA 4OGWA 5JATA 3S70A 4QLOA 1NLZA 2WF5A 2H6EA 4Z7JA 1T36B 5ITVA 4PFKA 2HEGA 4KE8A 1WV1A 1QIMA 2IHJA 5KC8A 1PK9A 2HWXA 1X1BA 1C0PA 3V8QA 1IXYA 4L27A 3RSZA 3CX4A 1E32A 1OI3A 2Q0SA 5DHUA 5DXJA 3BXHA 5FLXA 1TVEA 4LEIA 1Y80A 3GBSA 1H2RS 2XQGA 1DKQA 2YOGA 3FTCA 4UHBA 4K9RA 3ZHVA 3ZXSA 1GTJ1 1NI3A 1UEIA 5J2TF 3JQAA 2PMKA 5LFAA 2IV2X 1QGED 2ETVA 3KLMX 4HZUB 2CVQA 4KDEA 3QBTA 4KGVA 3G2QA 4PNPA 2PZEA 1V3TA 4KKXB 4HATA 2HCFA 1KZ6A 1QHHB 3UH1A 4EJSC 5IXJA 2PUAA 1VA5A 3PD7A 4DDMA 4BP1A 1AA9A 2PSHA 5IANA 1KMCA 2HWKA 2KYRA 2GKSA 2J07A 5EP3A 3K70D 1ID8A 4A2WA 2PX2A 3FHCB 5THKA 5EQJB 5IUKC 3ZJUA 3L1KA 5HK8A 4O29A 3QWIA 3DHWC 1J0XO 4JP8A 4EG6A 1J2EA 5AHWA 4U3JB 1NOKA 2ID8A 4MQ4A 2GK4A 4KRFA 2QTVA 4B4DA 4X44A 1E2LA 3H97A 3MJRA 1Y7TA 1C7JA 4CT0A 1CRWG 2IKQA 1RYNA 4FFOA 1K88A 2JPDA 2WSYB 5AVOA 2E55A 2QNRA 1N36B 1S5PA 2CHUA 3L92A 3NP9A 3OC6A 3IHTA 2IX9A 3W5IA 3Q3VA 3GJXC 3HXOA 4LOLA 5CLQA 4RCVA 1UKVY 3ZD8A 4AMGA 5C5IA 1IAVA 2C2WA 2J3QA 2DVMA 2W2QA 1DKNA 1JECA 1WCYA 1EX6A 2MTBA 4HX2A 5TB5A 3UWSA 2PRZA 1JQ5A 2PL5A 4G4SO 3NKFA 4CRWB 1GRCA 3UOGA 1RQXA 2OO5C 1T6XA 2PUJA 3RK1A 3B7PA 5BW6B 1EB9A 4WA8A 2DBZA 1M8KA 1ODTC 1LW6E 5BN3B 3FPCA 3IDZA 2R2GA 2RKWA 1BHO1 4EY3A 1PSZA 5EHGA 3UJ9A 1N2CA 3AVPA 4TMFA 1N9KA 1TTQB 4YEDA 8OHMA 4PZ0A 1ZNQO 2QWXA 1H85A 4BNJA 4HGRA 3HB4X 1MPXA 2AZMA 2FMXA 2WU0A 3OF5A 2VK8A 3ICOA 6NULA 2WF9A 3NS7A 4M87A 1ELOA 1V3QE 2YC4C 4LCJA 3EQ8A 1PS0A 2GCOB 3T99A 1Z8DA 2NV0A 4LNAA 3D2BA 1FU7A 2GF9A 1WEHA 1AQ6A 1GTG1 3DNPA 3F1LA 1BS2A 1J2JA 3WK8A 4ARSA 1VRVA 4WOPA 2QVYX 3CTPA 1MUUA 1ORTA 3UH0A 1GZ5A 2FG6C 2AR0A 3BXFA 4WBXC 2QY6A 1L5GB 4FR2A 4YRFA 4BMCA 4MHSA 5KTOA 4NCHA 1C3VA 2GS9A 3AXSA 1JLLB 3OQ6A 2VNAA 3AINA 3E9EA 1G8YA 1Z6GA 3SSNA 4IUCS 1DEXA 2QMHA 1AU9A 2HNBA 2DQSA 1FVXA 1FFCA 2EJVA 3R3HA 4MRMA 2CFOA 4O25A 2O2JA 2Z09A 4L6CA 3QUSA 3QYJA 1S89A 4DQXA 1U0GA 1VIAA 3PGA1 5FOXA 3U4GA 4MW1A 1GGMA 2VRWA 4XI9A 4DXDA 5LLDA 4RHTA 3PF9A 5IHPA 4BPRA 4EFLA 5ILOA 4K5QA 4AJLA 5IVHA 5NULA 3DEAA 1VMKA 4W5JA 3TQFA 1YU6A 3K2IA 1NLYA 3QPCA 2PSSA 4KXMA 3F7MA 3I6QA 1I6LA 2LCFA 2APJA 3BC1A 3PE4A 1XZQA 5KVQA 1KYQA 1Z2NX 3KJGA 4MGEA 1RMTA 2AYZA 1UJMA 4L0DA 3M1IA 3HP7A 2F1RA 4OSEA 5A9TA 3H5OA 1Z6YA 4FFLA 3O6VA 3OSZA 1OHHA 1IHDA 1KAOA 3K0EA 5DYNA 2W98A 4M7WA 1Z2DA 1YR2A 2PZMA 1NAHA 2QTLA 3C5WP 4J1TC 4L5JA 4YJDA 3J81k 3ZHUA 2DCUA 1CHDA 4B3HA 3F8TA 4K9DA 4LJSA 3USZA 1O95D 1T3TA 2ZRIA 3E2MA 5T6BA 1SUDA 1C29B 2VF8A 1GRNA 1GPYA 2GK7A 3E8MA 1L5KA 1XZMA 4A5SA 3DCJA 2Y1XA 4PXAA 2FK7A 3C3AA 3ZQUA 4JSYA 4P4TA 1SXJD 1ESNA 1OKKD 4LX0A 4CIBA 2BKLA 5KPJA 1WULS 5DLDA 4I5EA 2FW0A 4UHHA 5JG7A 2ZBFA 1J5PA 3EZGA 4G1CA 2BEKA 5EJFA 5J5AA 1GPDG 3K35A 1CR6A 1CUUA 1KYVA 2BMEA 3BWDD 1JVSA 1JHYA 2PBRA 4HMOA 5HF5A 3QLUC 3SZOA 2VSOA 1ETUA 5ALVA 4JQCA 1EQ2A 1JEQB 1NP3A 2J8ZA 3EGEA 4UOZA 1FUYB 1NXXA 1FYFA 3RVJA 1MORA 4CLHA 1NWCA 3MVEA 2WP8J 1F2VA 1D0SA 1L7AA 1D1QA 2O4CA 4IG4A 3WGJA 2CK3D 4Y3UA 4CKYA 1NJ2A 2ZQ5A 1FU4A 4AULA 2XNKA 4OK6A 4B4KA 4F60A 5CDGA 4NZMA 3PFBA 3JZAA 3NB0A 4XVQA 1NHWA 5KX5A 1BRMA 1IHYA 3R7BA 3O73A 1BNCA 4KAAA 4WGFA 4AKTA 4U7PB 5A3QA 4R1SA 1T5DX 5HMLA 5JSFA 4I46A 3NHUA 5DK6A 2BFCB 2R6JA 2ZRNA 1FXUA 3CNHA 3GLQA 1P0PA 2YJZA 5BMOA 1QFJA 3QVWA 1FX1A 1DC4A 2ENUA 1L1EA 2QXYA 1NUAA 3HCCA 1N5LA 2HJRA 2HO4A 3IP8A 4EMTA 4OHFA 1UQRA 1A2QA 2WM8A 3EVGA 2XVMA 3OLQA 4X62B 4MSUA 3PRJA 2PQ0A 3F49S 3IQZA 1DG9A 1OY1A 2AQ8A 3EJWA 3VNQA 4UM9D 4R81A 3ENNA 1I9GA 1F6WA 3G8AA 3I1FA 4RGVA 5AKKA 1HM5A 3ZG6A 1DARA 3NBFA 2Q5LA 2NUTA 3R41A 3HLKA 5DGIA 3R6GA 3E9YA 1FDOA 1E98A 5C1OA 5J4LA 3M5DA 3KM0A 2XMQA 2GHRA 5D6OA 1BXGA 5E9JA 4NOKA 3CKMA 4CR7A 3EDQA 4DCUA 2R6AA 2X7JA 4GI3A 3SBDA 1E5DA 1XWFA 2OCYC 3C0KA 5ALPA 4EHFA 1J97A 4LOKA 3E81A 4UUAA 4NBWA 5C1BA 3O75A 1KJQA 2BFEB 3INYA 3IOMA 1NW5A 4K6HA 4NONA 4P33A 3N3BC 5E2IA 5JVDB 2GETA 3IILA 3IP7A 4CU5A 1Z74A 5HUHA 4E1BA 4P7GA 3RBXA 3FSEA 4OHPA 2BGKA 1HO3A 2D7JA 2Q3BA 1W93A 2VPPA 2UZ1B 3EXHA 1TEVA 2BGRA 1BWPA 3OZBA 4HDRB 3WFIA 1KOGA 1YQEA 2IYEA 3IOYA 4MS3B 5HHTA 4OKIA 4EUHA 3N05A 2RHHA 3LYAA 3PJDA 5AJHA 3D0OA 4A8JA 3BXZA 4RLHA 3QXJA 1XVAA 1Z2PX 4QA9A 1XCPA 3HYNA 3JY6A 5CVTA 2OFOA 3FIUA 1SXJE 3K31A 4Y9SA 1P2FA 4DPKA 4EZIA 2IJGX 4QEZA 5EIFA 3UNXA 5KQPA 3U16A 5E38A 1KMNA 4D9JA 3TXXA 1YDWA 5SICE 3RTGA 2VRCD 2FN8A 4HAOA 1VP3A 4CDGA 3LVBA 1GR1A 4HNVA 1SCKA 5ALYA 3BGSA 4YP5A 5LP1A 2C42A 4YCBA 2AOVA 3SX0A 3LO8A 3PF8A 2UYOA 2P8JA 3AXTA 4FP9A 5LU8A 1CR1A 1XVVA 3RODA 2PU5A 1G3IA 4IDBA 1LWOA 3WFZA 2VQ6A 2B35A 3EAGA 2HF7A 4TMWA 3PDCA 3D6JA 5ALJA 1QGZA 4QEDA 1UODA 1FXSA 3BRSA 1OAOA 3IPLA 4E30A 3MYRA 1ODJA 1C7FA 3G7NA 1FP2A 1ZN8A 2JAUA 4DLLA 1TJ4A 4KQJA 5JCOC 3KOXA 3L7NA 1YAHA 4C4PA 1M6VB 2H17A 3G1UA 4YMUA 5K4HA 5C52B 1S1CA 1THTA 4UUBA 3FSRA 1A5BB 1N0WA 1EVEA 1ZIYA 3ED5A 4JD5A 5EFOA 2BISA 3GLUA 1DADA 4FFBB 1LRKA 1U81A 2BT4A 3MIZA 5BSTA 3RO7A 1B6TA 4BLWA 2BEJA 5AM3A 3DDSA 2FSPA 2F59A 3V46A 2QSUA 4O4JF 4RPJA 1FMCA 3D0RA 4YRRA 1NW4A 3GY0A 1YTUA 5B6PA 1LLDA 1OW3B 3KUXA 2PWBA 5AW7A 1THGA 2LTAA 1QIEA 1MH1A 1TJ5A 3N2LA 1DG3A 4LZZA 3U62A 4EY5A 2V1XA 5CP8A 3OJEA 4BVJA 1JL3A 1GNTA 5IYZF 3F5QA 3LQRA 1C8BA 3OEYA 1EEHA 4GDFA 1SKBA 1YBAA 3RIMA 1SO8A 1T6YA 3UAYA 721PA 1ZSYA 3HUTA 2RGAA 1BE0A 1JYSA 3AZQA 4QUGA 2FP4B 4NJMA 3VR6A 3QEKA 2KBFA 5CGZA 1VYHA 2OVBA 3QJYA 5LD2C 1O97D 3EZLA 1XD8A 1DUIA 1X87A 4J0CA 4ZVSA 4LDPA 4HXYA 3PEWA 5AMXA 1TYBE 3I9NA 4MYHA 1NP7A 2VDPB 3CJQA 3KAPA 1FNBA 4IQFA 3MGGA 3MJ4A 4JVSB 4IL5A 3CN9A 2P6RA 4C4AA 3L7BA 2M2IA 3T9CA 3T5PA 1DIHA 4JLDA 3GJ7A 4X8MA 5DH9A 3K9FC 5FPTA 2R3SA 3AFMA 2O19A 1Z18A 5IJ9A 2LCIA 2NP6A 1E9VA 4WT7A 3Q3CA 4XWYA 4NQZA 3ZWXA 1A2OA 2AX4A 2C0PA 5FX2A 3KQVA 2J4FA 3IVAA 5KSPA 5CFPA 3RG2A 4FNMA 3G9UA 1W5AA 3HUEA 1RS0A 2LIPA 3MPUA 3G8CA 5EL0A 1CWUA 3EGDA 3LECA 3Q41A 4XPZA 1CQIB 1M83A 1VA4A 2YFKA 3KXKA 4M0FA 2RGUA 2R6CA 1XDDA 3R5TA 1XKTA 3WDLA 1M7HA 2YWBA 4ENWA 2JLYA 3ZDZB 2VP6A 4RHUA 4Y9TA 3A31A 1ULBA 1RMQA 1R6XA 1U8XX 2H4HA 3L8HA 2FEXA 1VGVA 5A1JA 4A91A 1MAAA 1COWA 1CUJA 4B34A 1XI2A 1DJMA 3RUFA 1GKLA 2FOLA 3C7CB 2CCKA 4MQEB 4EEXA 1SZJG 2PUTA 4XFKA 1YE3A 1Y6GA 1UKZA 2R6GA 4AX4A 5JFTA 3H0EA 3GNTA 1XXHB 3H19A 4QO7A 3FYSA 2NTEA 2Q3JA 4C3ZA 4JSRA 1TZCA 3H11B 5ITZB 5MN5A 1VJRA 4DCCA 1WXDA 3LHDA 3QWHA 5H3LA 4JBXA 1WB6A 3EXG1 4MW7A 5H81A 1H4SA 5GJBA 2H92A 1ZAYA 3FFXA 3ND8A 3WK9A 3VSAA 2PTGA 3AHFA 3GUYA 2QA5A 3H17A 4TVSA 5EPUA 3T5TA 1UXIA 2QRHA 4YMLA 1J4AA 4JGIA 1MVNA 2FI1A 5BP7A 3K8OE 3LLCA 4IJ5A 3ZE6A 5C8VA 5LQCA 3WB2A 1PUXA 2GBPA 3RROA 3UJ3X 4D9CA 1NNSA 1EFAA 1ZU5A 4BFLA 5BNIA 2A67A 1Y37A 2CW5A 4QVKA 3WL4A 3WGZA 3A6EA 1OFTA 5JSHA 4G84A 3VKWA 3PEFA 2X8JB 1UFQA 5I9BA 2FR1A 1I2BA 2XADA 1WPRA 2ZYIA 3K1JA 2AKYA 4EEZA 2IYPA 1K4MA 1CSEE 4V0RA 2N3ZA 5D85A 3IQWA 5ALIA 2YWEA 2P6NA 3LPMA 4Y0AA 4FPXA 3VMMA 1JKXA 1K8QA 4ZCSA 1KR5A 2A3RA 2P4HX 1BMDA 1T5BA 2B4TO 3L6DA 3OMWA 4NC9A 4HWOA 3K94A 3QKSA 4NZ9A 5HKKD 1ZRNA 2JI8A 1AUOA 5A9SB 5B7GA 3KYCA 4ASUA 4ZO6A 4PQYA 4BQIA 4F8YA 3AKYA 2I99A 4JZYA 3GFRA 4WZAA 2P75A 5BQFA 4RULA 4IIYA 2IQ5A 1CK4A 1Y81A 2GZ1A 2C9CA 1B15A 1WMBA 2DBQA 2LZ0A 2ZXFA 3GCDA 3LK6A 2GN8A 1OFGA 1W88B 2P2LA 4A92A 2J3KA 5L45A 5A06A 3P9QA 3Q0TA 3T3NA 3Q15C 1BH2A 2YS7A 1JKJB 3THYB 5AXAA 5DTJA 1QBGA 1RJFA 1WE2A 5K20A 2NMVA 2Z95A 3WLTA 4C05A 3KQMA 4JOCA 5B1SA 3OZTA 1KAQA 1TT7A 2DUWA 3RVPA 3LQYA 4P38A 2D3TA 1XQWA 1H2BA 1YR7A 2YJ3A 1LA2A 3AVOA 3IIKA 2E6UX 3L04A 3L4BA 4YRZA 4AY2A 2HBRA 3GCZA 3QFCA 4XIYA 3X43A 3HGMA 2OP0A 5C80A 5DI9A 4UVGA 4PY2A 5JZMA 4IDDA 2PMDA 1A4XA 2OLJA 3RSLA 1GNPA 1Q22A 1KI6A 5K8CA 3URMA 2DKOA 5AJWA 3HYLA 1W9MA 2EP7A 5FLEX 4ERNA 2YY6A 5TF4A 3SOPA 4IIJA 4RTJA 1QJCA 3QUBA 3DCIA 3ZX5A 3A1DA 1QP4A 1G3MA 2Y0DA 3QUQA 4PAOA 3RRMA 2X0IA 4F6CA 4UPEA 1U7HA 3EMBA 4MWOA 1A9ZA 4GXRA 2AKEA 3DPSA 3IUNA 1Q50A 1JSLA 1E2BA 4G5FA 5TMDA 4L7QA 4ZFNA 1NIPA 4B3DA 3BVPA 1D6JA 4LQDA 4RJ2A 2P5SA 3HVUA 3DC7A 4XH9B 4IDPA 1NQWA 4WFJA 2VNHA 5FNVB 4ES6A 4XDYA 1PJRA 1XZJA 2GXUA 3E35A 3FZEA 4FEGA 2DHDA 4GNKA 1YCFA 2ASVA 2NZXA 4ZJPA 1I7PA 4EYGA 3CF4G 5BQXA 3Q1LA 5C35A 3ZZMA 3TEMA 4BN4A 1COZA 4KTVE 4AJNA 1A9XA 1DCFA 2HGSA 1NJFA 3PDUA 1A8SA 1MFZA 3AI2A 4J4TA 4PQFA 3E2IA 3B5IA 3X1MA 4BVHA 4F6LA 3RYCA 1Y1RA 4ZAXA 2GCPA 5BRAA 4JYZA 4S3MA 1GDDA 5A5GA 1L6IA 2IEAA 2O2IA 3DBRB 4YRGA 4BMVA 2A9PA 3H05A 1EUZA 2PKQO 4TMTA 1XROA 4JMPA 2RGDA 1PW7A 2O52A 4R7ZA 3D6UA 3V7WA 3SR0A 5BNFA 4EVQA 1R3DA 1VG9B 3U3RA 4PZAA 4X20B 2IF2A 4QOHA 4XPIB 1LLFA 3LAWA 1XTTA 4AG5A 3E3OA 3K4PA 1Q20A 5JAPA 1RQRA 5F51A 2BFBB 2NOAA 3I1YA 5HKAA 4Y2SA 1L7EA 2I7VA 3VTZA 2R1TA 1H1LB 1WZNA 2NW6A 1YFKA 1FRZA 1NE7A 2HA2A 2PMCA 3OECA 2Q4RA 3AIKA 1HI9A 1QORA 3KKZA 5HIKA 3EYAA 1YB1A 1TJPB 1I3KA 2RGBA 3NASA 4D4MA 2NU6B 3RC2A 4JY7A 4URYR 1LY1A 1P17A 4KIGA 3AO0B 4WKNA 4Q4HA 1OC4A 1QIDA 1XAJA 1ZM9A 3QELA 4QHTA 4Y6OA 3STVA 3W77A 5CFRA 3V7NA 1JQ3A 1BFKA 4ZDWA 4URFA 3T7RA 1YVPA 2ISQA 2YWDA 3ISJA 4XXHA 4GFDA 1YVUA 3GIWA 2G9RA 2NUPB 1NX9A 5ADUS 1R12A 1EE1A 1LTKA 4Y67A 4EOGA 1V11A 1TC1A 2XIJA 2ZPAA 2GA8A 4OP3A 2I4LA 1MOZA 1VCIA 2C77A 2YZGA 2FPMA 4EPYA 6ADHA 1H0KA 4BKQA 3G0CA 3GP8A 2NWQA 2Q7DA 3RVLA 3GMDA 4Q9DA 3MQFA 3RE1A 1W5FA 3P9IA 4Q93A 2Q6KA 1ZSNA 2GRJA 2J9ZB 5DBIA 1VL6A 3DFFA 1CUBA 3AI3A 4OATA 4P5EA 2BGLA 2YZNA 4YRPA 1O96A 2FDXA 2D5LA 4F38A 3DZBA 3UAGA 2HLPA 3E6AA 4FEYA 1LDYA 2XTNA 3LKBA 3NHMA 1IPEA 2RGWA 3EUWA 3L0YA 5AVWA 4AY4A 1DEOA 3RC9A 2UZ0A 3ROPA 3F67A 4AP5A 3OCYA 1HLPA 4PPFA 3PJGA 3AJRA 3L9WA 5SZHB 3KJIA 4LY0A 5U4XA 3ZQJA 4BN0A 2F6RA 4IFTA 2P41A 1E3DA 4WCDA 5D87A 4L75A 1I13A 1PP4A 1UK9A 1XCLA 2H59A 3IELA 3TLMA 5CFLA 3A0RB 5I48A 5ADWA 4C2TA 4XFDA 5K3FB 5IKOA 2AZTA 4N65A 1GPBA 2JCXA 1M6YA 2O1SA 3H65A 2AK2A 2D0OB 4XWAA 4L9RA 5E2AA 5HFJA 3WWPA 1X1DA 1FFSA 3GV0A 1YBMA 4HDAA 4KIUA 1IVSA 2ZJYA 4ILKA 4M1MA 2NU8B 1L4YA 3A1TA 1RXCA 3KE8A 4UTZA 5P8WA 4CMBA 1AKMA 1SKAA 1TF7A 2O06A 3OZIA 5GMOA 1ZEMA 5C32A 3U3XA 1I6WA 3ZDYB 4JLUA 2GCGA 5KNDD 2ZW9A 2VHWA 2AL7A 5AFSA 4LYDA 3PQEA 4LYGA 3AOEC 3MHTA 1NT4A 2BKVA 5B64A 1T6NA 4NL4H 2X40A 3ND5A 1RSZA 1TU0A 3IBTA 3AVTA 2AJCA 2PZ8A 4GBED 5GJVC 1WMEA 3V2GA 1DLJA 4NK5A 1WLSA 1MC1A 3O8LA 4N5LA 4ITVA 3CCCA 3H2JA 4B87A 3LWBA 1ZGAA 2VTVA 3P26A 3PGVA 1B3BA 1B74A 1KI3A 2HPHA 2RC6A 4IMIB 4L1KA 1RXWA 2NYUA 5DASA 1E6CA 3LV8A 2J3HA 2P78A 4FIZA 5K8LA 2WQ6A 1ZQ1A 1CEXA 4E11A 2GLUA 4RPLA 3RC8A 3EGOA 1H4QA 3ETGA 3X0DA 4AQ7A 2EL9A 4PIVA 1NBMA 4N03A 3B1JA 3TJMA 1VJDA 3EZFA 3PUKA 5EKDA 4MARA 1USKA 1M2VA 4G0MA 1U8YA 3FOWA 4GX2A 3WGMA 4P6VF 3ZI4A 1VOTA 5DO9A 2YYZA 3WRWA 4FE7A 1G5HA 3NX4A 4P1ZA 2VUTA 3UMGA 4Q7LA 4EUSA 3AL2A 1H5QA 1K68A 2FR8A 4HGNA 3L46A 1QUEA 5JOQA 3NFRA 3MK31 2JJYA 4EW3A 4W1QA 1INLA 1N9GB 3ESCA 5TLSA 4X91A 3MPOA 3FDFA 3RV4A 1M2EA 3UYLA 2JD0A 2W8BB 1TAQA 4D0RA 5KKCA 3L1JA 1UOQA 5IPFA 2CXTA 3H0CA 5KYXA 5ALRA 2P9QA 3OMLA 4OM8A 3A1FA 3L3BA 5A7FA 2P2NA 4UCFA 4E31A 2B7CA 4DG8A 3V6LA 2HW8A 1PL0A 4RWZA 1GDTA 1P5FA 4R8SA 2FRXA 5AH0A 2IS1A 2OGWA 4DLKA 4R71A 2J5KA 3I9JA 4PZZA 1L4NA 4NYIQ 1Z7YA 4V0ME 2DHEA 1W36D 2PKXA 3HV0A 2GF2A 4MWZA 4NY1A 1EYZA 3IP9A 1BVHA 1UBNA 5H82A 1KI2A 5F9FA 1XTSA 3HJHA 4NF2A 3B53X 2PKRA 1ORDA 1C1XB 1VG1A 1I5RA 4FI3C 4ZT4A 1D0VA 1QOPB 4J2TA 1T4BA 5TGZA 1VZ3A 4OLHA 1W4AA 2Q8QA 2EG9A 3IAAA 2NP7A 3OZUA 3JQBA 3KIPA 2V55B 5K8JB 2BFDA 1IIBA 4YIKA 1FSZA 2W5UA 3BA6A 5H7XA 2IC5A 4MGKR 3SSOA 1D1PA 3FCOA 4KE9A 1E1MA 1VJ0A 3ENVA 6CHYA 1XP8A 4K9SA 4KQCA 5FNVF 3W2IA 3JD3A 1IRIA 1CYDA 2JGDB 2Q2OA 3AG6A 2OR3A 2QYSA 1NR1A 2H3EA 3PL1A 4F0JA 4D8YA 1GTVA 1TKBA 1AK2A 1XRNA 3JQRA 2XB2A 1EFLA 3RR2A 1P4HA 1JILA 4YJGB 2DM6A 2IYUA 3Q6MA 1ZNWA 3NBMA 5CVVA 3RPEA 3OM1A 3ZE7A 1WIWA 4CMHA 3OKAA 4BQRA 2WQ7A 2VPIA 4LUCA 3RSCA 1B0PA 1ARZA 3GLHA 5KX5F 2QRJA 4B2IA 1JXMA 3OZRA 3ANYB 1XWWA 1L4UA 1IB0A 2KMLA 1XZLA 1U63A 4JIGA 3FMVA 3EC7A 1FBNA 3OTQA 2IPOA 1C4OA 1G7TA 4TROA 4GM4A 4BKRA 3FZQA 2AFHB 4G5RA 4ZHQA 3ZCVA 2BAGA 1PFUA 3L0IB 2FJ0A 4LV8B 3M5WA 1K75A 1G20A 3Q8WA 5LB2A 4GKKB 1V39A 1Y3CE 2G6TA 1I9CA 4N54A 3HCWA 2PXHA 4M8LA 4BO7A 3GG2A 3LX6A 4MA5A 3Q1KA 4O3FA 2VYCA 1CS0A 5FR1A 4E09A 2BONA 3JQAD 3NZEA 3ODPA 4FIDA 1RT9A 1CJCA 4ZI2A 3CVJA 2A9JA 4I8DA 3IEMA 2R85A 1CV2A 3W5SA 4MXDA 3U5TA 4OJTA 2X58A 3O8CA 3OX1A 1NRXA 1J2UA 1NYQA 1P1RA 3C24A 1JTEA 4XWGA 5FRDA 1V0JA 2DFKB 1JXQA 1P1IA 1W87A 2QT0A 2V7EA 3AHEA 3HEMA 4NICA 4UW9A 3RT7A 4KRYA 3VTAA 2HZ7A 2PL3A 1MAHA 4MS1B 1Y6JA 3H84A 4DM3A 4I99A 3BF7A 3TW4A 5DZSA 2QGZA 5F2OA 2G5PA 4UHEA 3CT6A 3TN7A 4BKUA 2YVLA 3MGBA 2I6UA 5EMLA 2A0UA 1R5BA 2PZBA 3NYRA 4QUKA 1LKZA 1IBCA 1E4YA 3M6FA 4KIJA 4D4LA 2C03A 2FPUA 4FD2A 1RI5A 3OSUA 1JA1A 4ZEOA 1J0EA 2VSNA 3ACBA 1PWHA 4NYJQ 2Z5LA 5JXGA 1M33A 1M2HA 4YB8A 4EAAA 2EFHB 4KR3A 1P75A 1Q3TA 1Z6XA 2VT2A 1XOIA 4Y9DA 3PC8A 1FTSA 1ZD2P 2HK7A 3LDAA 4M1YA 4EYEA 1YOVA 1UC9A 2BFOA 2HSWA 2H2FA 3WK4A 1E1KA 3ZWKA 3A4TA 1EUCA 3PYMA 3MWFA 5BQ3A 2TMYA 5U1PA 5BSEA 1W0KD 1JHRA 2QR5A 5FPYA 4AY5A 2AXQA 1BCRA 3MCAA 2ZIGA 1KYYA 2WIFA 5D3MB 2NXCA 1B6GA 1SBNE 5C8YA 3FYDA 4G26A 1C30A 2D2XA 2XBMA 1RRGA 5DMHA 2R8EA 4HDMA 1V6AA 5IUJC 1JWBB 1CUFA 4BEBA 3GLVA 3K09A 3AETA 3HHEA 5DOVA 3EG5A 5JNRA 3RNOA 3EPLA 3UTDA 3FW1A 4G9GA 5AVYA 2CDBA 1JIUA 4Q24A 1E0SA 4BTEA 4URHA 2WA1A 4BNVA 5IBPA 1OQAA 3KB2A 5AKJA 1TCAA 1GU1A 2WOJA 3LQ1A 2VTBA 2PA3A 4INOA 4RJIA 2WPDD 2ZJFA 2GBLC 3LC2O 1QO7A 4XW2A 4GM0A 5IK2A 1O89A 4RPGA 4ZK2A 2QD5A 2C9YA 2PH3A 3OEEA 3NPAA 4XIIA 2AR9A 5AHRA 3THRA 5IN4A 2WNHA 3TTTA 1VHLA 4M46A 1KHHA 1T91A 2PPLA 3G8YA 1C8KA 1RRVA 3TYXA 5HP4A 1ATIA 2GJ9A 4B6OA 1AV6A 1BXZA 1TDJA 3LC1O 2W6PA 1YIDA 1FB5A 4IF4A 2YOFA 1E1NA 4ONEA 4TRJA 3JWEA 2XV1A 5M04A 5FI1B 4JJ6A 2ZUCA 2XXAA 4H1TA 5ARCA 4GYYA 3NWBA 7GPBA 5CM9C 2QVBA 3GGOA 1I4LD 2L17A 2GN2A 4HN2A 2G77B 4LXHA 2JVIA 1YIAA 2IZ7A 1DDGA 3TQSA 3E7XA 1EGAA 4MMYB 1D2CA 1PYOA 1C9KA 5DW0A 3TPCA 4DR3B 1OR8A 3LXMA 1A69A 4EJMA 1REQB 1WW8A 2CDAA 4HKTA 1NFQA 3LDHA 5BN4A 3GLGB 1KY5A 1T9GR 1WUKS 5DYIA 1UBHS 1TW3A 2HR1A 1T3GA 3UMFA 1QGOA 2J3EA 4K40A 3RKUA 1BDMA 1RXUA 4QNNA 3WBKA 4I2NA 1YR9A 3MWDB 4PICA 1T4CA 3TB6A 2IE0A 3QWAA 4V02A 1P60A 5F64A 3QY9A 4F5ZA 5F7XA 2C0CA 1TA9A 1EUQA 2Q50A 1F8YA 1JIJA 4DLSA 2G1PA 4C07A 1VHWA 1KDYA 1LVGA 3ZY6A 1SRQA 1Y7LA 5GJCA 1OMOA 4M1TA 2ZJBA 5BWMA 5CDSA 1Z2AA 1PZXA 3FUVA 1ML3A 1U2GA 2ZREA 3PNVA 2WK1A 2HBYA 1X1AA 2XZDA 1KJYA 5IARA 3WGGA 3BFVA 2LNDA 5AM4A 3FOFC 2BLLA 4BLOA 4JI8B 2OV3A 2VJDA 4B6PA 1Y9EA 2VG8A 2WZBA 3LX8A 2QI9C 4K9OA 4CCSA 4QTYA 5L40A 3GBPA 4GI2A 4YECA 4K9NA 2W2KB 1MRNA 4HMPA 3SQMA 1I2DA 1U8TA 1TEZA 4LRYA 1C9NA 1MEJA 4Z4IA 1F1BA 2C3UA 1OHHD 1UIRA 4FYWA 5EXDA 5C7IO 3IKVA 5F4BA 3RG8A 2Y4NA 2H2IA 3I32A 2QROA 2ATEA 2HB6A 3T9AA 1XDSA 3U3KA 2QZJA 3HLTA 3CEPB 2ZUEA 4I08A 2C00A 3MB5A 4IRMA 4C3UA 1L5HB 4GF5A 4B3BA 5F78A 3A1SA 3EOBI 2XTMA 4L5AA 4KTTE 3TR6A 4DB2A 3VDMA 2H1CA 4WFQA 1IJBA 1XXHE 3NOVA 4FGWA 3E8XA 3OICA 4DL9A 1ZVJA 3ZWQA 4JIMA 2YWCA 1KU0A 2A1UB 1MQ9A 4MW2A 1R0LA 4P92A 1OWLA 5AHKA 1VL2A 1M6WA 3TRIA 3RAEC 2Q62A 3WLOA 4U6NA 3WX0A 1L5LA 4E5DA 5AD1A 1XZDA 3FROA 3OHMA 3OFNA 4R0VA 3VOSA 3ZHQA 4CMJA 4IS3A 2HBQA 3EPJA 1YDHA 1CJTC 5FBVB 2GB4A 5FF9A 2CV2A 3EYWA 5I7WA 5KTRA 5CD1A 3HWRA 1L5QA 4WW0A 4BECA 1HUQA 1YKFA 1TQ8A 2INGX 3KP1A 1JB1A 1J0CA 2I2CA 2IODA 4QUEA 5LXTB 2P3SA 2VBCA 2N0SA 4FINA 2Z4SA 1RZUA 3T5MA 2NZVG 1U8UA 4PM4A 4QAQA 4HQOA 5AK3A 3B85A 3EIHA 4WTOA 3H2YA 1X74A 5C7YA 3NHJA 4EJ2A 1O0SA 1ZK0A 3B1ZA 3O3NB 3PQCA 4TQAA 1Q5PA 3PTZA 5LVAA 1KXZA 3E3MA 1HX7A 3D6TB 2O2XA 2FJUA 2YJ5A 5EJGA 4FCWA 3DP9A 2YL2A 5KTPA 1F17A 4KUEA 3T3GA 2QD1A 4BO0A 5IAOA 3F8WA 4PQGA 3ROXA 3FGNA 5C3MA 2PIDA 4M1QA 1Z5VA 1SOVA 2HXSA 3ISVA 2CB9A 5FUVA 4NBUA 5EAIA 3M4YA 4B9AA 3TSCA 4OQMA 5KCMA 4I5GA 4HLUC 1N3BA 3SHWA 5E7MA 3TS1A 4QT4A 1TM3E 4Z9BA 3DR5A 1NRJB 4DYDA 1MB2A 2JLUA 1A77A 1BD4A 1DJLA 5EJEA 5IDQA 4DIFA 1N5RA 2XUIA 1LLCA 2GTIA 1SULA 4LF9B 4FNOA 3TTSA 3WLPA 4YPFA 1WF6A 1I4TD 2QL6A 3PX3A 3CURA 2ZAGA 3DO8A 2OAEA 3KQUA 4PXYA 3EXIA 4NDZA 5AJZA 4YAUA 3KUDA 1B8OA 5M5BA 1JJAA 2PJUA 2JARA 2PRSA 3ABOB 3CB4A 1ZINA 5FI0B 4A2PA 3A9WA 5G41A 1UJ4A 1FNDA 3UT5A 1G21A 4OHMA 4Q01A 1VSBA 4H6PA 4MB0A 5HMMA 3ENKA 4CYMA 3AIOA 4N76A 5FI3A 2O6HA 4B75A 3MM4A 3D5QA 1T5IA 3HRKA 1VPTA 3ROGA 4PLTA 1PEYA 3PV0A 4M0CA 2AMLA 3DYBA 4IH4A 4RMHA 4WBNA 1TGYA 4MWSA 4RJJA 4MQMA 1M7BA 2NU9A 1C3LA 1SUAA 1CY4A 1PEKE 2XF8A 4AZ3B 4DILA 1WB5A 4PZCA 1KPIA 4QNMA 1EDBA 1DBVO 2ET6A 5CIQA 3KTAA 3CUKA 4WZ6A 5ESDA 3VYUB 4CE6A 1P0QA 1X7XB 1UBTS 3MCTA 2WLSA 1T13A 5ESWA 5FL3A 1TU4A 2WG1A 4CKZA 1XJQA 1H8EA 1F8GA 2QE6A 4ENVA 3BZWA 3QVSA 2B98A 4U2KA 1GAJA 4ZVPA 3UW3A 4ND7A 2Q7OE 3T9DA 4DM4A 4D4GA 1ZMBA 3KJQA 5IT0A 1Y9DA 3N2GB 4GU5A 4ZI7A 1SD1A 5CLLA 5KOYA 1D0IA 2IU3A 4J16A 4PHHA 3ITEA 4C4RA 1BXRB 1IPFA 1Q17A 3UJNA 2HLDD 1IXRC 1Q2XA 3QF4B 3FNFA 1GKYA 2FV8A 2ZR0A 3H6KA 3O0DA 3FGOA 5EMNA 4F2HA 1XF1A 1BRTA 3RVSA 1O5OA 2WABA 3AC0A 4HAVA 2J48A 2ZBRA 3D3QA 2WVJA 1RYEA 3R8XA 1SOUA 1NU8A 1GNLA 1PS8A 1RHMA 3N75A 3PLAE 4MI9A 4QYSA 5FOTA 1Q1AA 1ZESA 1HBJA 1Z62A 2SKEA 4Q39A 1RFLA 4I50B 2AJLI 4RF2A 2C5EA 4B45A 4GGMX 2GUGA 3HDTA 5HWSA 4DDVA 5BSFA 4W5WA 2H4YA 1Y1KE 4ID3A 5EIWA 1B6RA 4H3VA 4UUNA 2V5AA 4I9FA 4CMEA 5LSAA 1JFRA 1OIWA 4Q9HA 3B6KA 4I1PA 4MVJP 4D8VA 3VPSA 3RS9A 2DSNA 3DAOA 2JL1A 3OM8A 1QC5B 1E1LA 2ZIVB 3LM8A 3BRQA 1I1OA 2G4CA 4AYTA 1XRLA 1ULUA 4Q3OA 1SVOA 4KX5A 2HFKA 1C7EA 5C4MA 5IAJA 1EMDA 1XCGB 1YZKA 4U6SA 3SX2A 5ETJA 3JYLA 1E1CA 2G06A 2P62A 1TMGE 1Y3HA 1IMJA 3CWQA 1MC4A 3ZDCA 1HYGA 1APBA 2GFQA 1GXSB 1S3GA 1ZM4A 2RCNA 3M6IA 9MHTA 1E60A 3VR6D 1P6QA 2WMYA 4U9HS 3JAMA 3LPDA 2C07A 5H3HA 1QQTA 2RIRA 4LXGA 2ZPUA 4UQLA 3FCUB 5H80A 1I6KA 4EF6A 1SVIA 2YQ5A 4U8GA 5CDFA 3A9VA 3RUEA 2LUOA 3BWVA 1BMFA 3OQHA 1KMHA 1OH5A 4AMVA 4AS1A 4HK4A 4OI2A 1LI4A 4NMXB 3HJBA 2QU7A 3THWA 1T25A 5H16A 4BZXA 1CX9B 2ZZMA 4C7OA 4BUCA 2AOTA 1BX3A 4X8OA 5KJ1A 1X1TA 1VJGA 4BLPA 2HA3A 1MF7A 2ILVA 2YHIA 3GAZA 4QTZA 5E3JA 4YQYA 2OXIA 4ZQHA 4JHXA 3TTUA 2EEPA 4Q3AA 2V7XA 4AJ2A 4AQYB 3HB5X 2QAGB 3LHSA 3U3ZA 3NXSA 1J8QA 1YCHA 1FXWA 2QV7A 3GELA 3NCTA 3NV9A 3OJXA 4M99A 3C48A 3ZHYA 2QK4A 2EJUA 5JY1A 1QJ4A 3CFYA 2H85A 3L8EA 5CM8B 3SLKA 3KSAC 2HEIA 1PQPA 3LXUX 3K1TA 1B0ZA 1Z07A 2IU6A 3QIVA 4UOQA 2CZQA 2AFVA 3SHOA 2F7SA 4ZYTA 1AQLA 3Q4GA 1DE0A 2B1RA 3NBUA 5HILA 2M6KA 4K6KA 1N5JA 5L3VA 3NVKI 4EFKA 2IZZA 1QNLA 2PQ2A 3H16A 2ZZKA 4RDCA 2IS4A 1QDEA 1JDBB 2XOEA 4RD2A 3SJCA 2VJKA 1COWD 1YVDA 4INJA 2RGNC 3NYQA 1T0BA 5HOEA 3OZGA 4M0UA 4RIIA 5K7SA 4RTSA 5E8JA 5J63A 1QRUA 4WNCA 4L8WB 3CG0A 2WUGA 1PTKA 3EQZA 4H7KA 4OCZA 2EF1A 4ECAA 2I2BA 5PNTA 4XKJA 3VR3A 2ZB3A 1MV5A 1PNOA 4RORA 1SXHA 1ORRA 3ZOKA 1GQYA 3WDSA 5B6IA 3KEOA 2YS6A 5CTAA 1GFZA 1QKIA 2G5CA 2SICE 4GQBA 4G24A 1GHTA 3SC2A 4RZ2A 2C94A 2VJCA 2XY4A 5FO1A 3USES 3D2CA 3HGTA 2LE0A 4P83A 4R8VA 3PRHA 4X45A 3TFQA 2CMDA 1DRWA 3DOCA 2HSEA 3I2YX 1L7RA 2C59A 3BGOS 1TLTA 2CJWB 2CHVA 3CZ9A 3JSXA 1U0SY 4X41A 5LXTF 4QUJA 3WK5A 3I1JA 4CQMB 1UBGA 2OD7A 5I5GA 2I91A 1SPBS 3CZRA 4RIEA 2H48A 3D6MA 4XLLA 4YBRA 4Z2YA 1U9IC 3FLAA 1K6JA 1UF9A 4NG5A 4E2WA 2NYAA 3R0ZA 3PE3A 2GK6A 4E5SA 4V1CB 4K6CA 5F2NA 2GXAA 1CEYA 5DNCA 1A72A 3RM3A 5DGXA 3PP8A 1L5ZA 4MEJA 4B46A 4EJ6A 2ENWA 4V0LA 3ZHCA 2AFRA 3COYA 1P1CA 4BNIA 2EX1A 4CMIB 5AVZA 4C2UA 2VDWB 4R68A 3ZQ4A 2JBWA 4A1FA 4QATA 1I1HA 4JJKA 4MUEA 4PZUA 1O8BA 4RY2A 5G4KB 1E7SA 2VOEA 4F11A 4P0PB 2ZB4A 2FX2A 3TAUA 4PN3A 1QGYA 1GL7A 2VT6A 2RGGA 3VX3A 4D8TA 1HNXB 3WVNA 1L5RA 1A7AA 3CH6A 4FMPA 5AR1A 4PN7A 1FFGA 3VUFA 1U0EA 3OLCX 4L74A 5C8ZA 4I1VA 4PSVA 3RQSA 3VU3A 2PO7A 2CUKA 4EPWA 1UZAA 5TRTA 5CFMA 1HXHA 5GY7A 4KLNA 4TT3A 4Q66C 3ZDQA 1K08A 2A86A 4JJ8A 2ID4A 2X4IA 5DTIA 3BE6A 4S35A 1LJ8A 3I39X 4OMCA 5AKXA 1UK7A 4Q82A 3H7AA 3WYBA 4LY6A 3PPWA 3WO1A 1DDIA 3KEFA 2OWDA 1RM4A 4TWJA 3QMMA 5J4HA 4JZKA 3QEMA 3LUDA 1Y6QA 3ADDA 4NOLA 4IDQA 2OD9A 3AFNA 5AK5A 4MW4A 5KREA 2ZYHA 2D59A 4J94A 4KLRA 1J07A 2E21A 4P31A 5HTOA 2KWIA 1I6MA 4DR7B 1ZO8A 1CD5A 5HZGA 1ZGZA 2PJDA 4MPTA 4N48A 4G09A 1TRKA 4TXJA 3SJBA 2CUTA 1EWKA 4W9RA 1CUCA 1QV6A 1TUEA 2OILA 4TPKA 3DEIA 3K5HA 4DCNA 2RCYA 3BZBA 4E4TA 2Z2JA 1RMYA 5AUOB 1RC1A 3LZCA 1JZQA 3MUNA 3A10A 1QHFA 4JI0B 5FDFA 2QAGC 4EGFA 4S2UA 1LDEA 2BJWA 4BNDB 4CG2A 1EVIA 2AJ8A 5HF6A 2BCGY 2CXNA 3L8YA 5DCLA 5FH9A 4M1ZA 1XJ5A 1NRWA 1ZCFA 4HFNA 3GJRA 1U8FO 1UFKA 1J2YA 1XZ8A 3T94A 4Z54A 3AVWA 3KR2A 1LDNA 2F48A 3P0HA 2JCYA 3I72A 5KDLA 5F73A 2JEZA 3QKTA 3KVOA 4U39A 2J9FA 2AI2A 3BK7A 3WYEA 3OCXA 4OFBA 4JLPA 4KREA 3KAQA 821PA 2NUBA 4K8OA 1Z6QA 3WNDA 5J58A 1U99A 4R83A 3OOSA 2WEKA 3KL2A 1C9YA 5ALDA 5ERXA 2ETXA 2GPSA 5LYJB 5E4FA 1E1YA 3ZKAA 3ORHA 2B25A 2X2EA 2V3WA 3IH5A 5ARDA 4CFSA 2VAXA 3H5WA 2WIBA 1E9AA 2ORIA 1NV8A 3HTXA 5E6UB 1UEXC 2E85A 3BB3A 2W4QA 2VZ8A 4HH3C 5KS2A 2J59A 3FYTA 4IJWA 1GA6A 3MJVA 5LBTA 2Q3MA 1ESCA 3L01A 3E1SA 1DAGA 2AFHE 2W2OA 3QFRA 4IH9A 4KMMA 3CLTD 5FBZA 3UJDA 1ZNYA 4GVPA 2HQ1A 1DLIA 4GC5A 3WJ2A 3IT0A 1VB3A 4PLZA 1J8DA 4G5OA 1FSFA 4YV1A 2NU7B 5AI6A 5AW3A 5E6SB 1OU0A 2I6XA 2N46A 3E27A 4EL0A 2WKQA 3FCXA 3K8YA 4TQGA 4TV8A 3I5YA 2R751 5HKOA 2XMRA 3AVXA 1EK6A 2WP0A 2YXLA 3ML1A 4JCCA 4YDSA 1JEJA 1RYDA 3SQNA 4TRNA 4IG9A 1E9CA 3U7FB 2O54A 3U1BA 3A7DA 2EGUA 2ZQZA 3T7CA 3T4XA 4WZAE 5F5NA 1EZZA 3T06B 1AD2A 2IYFA 2JFPA 5FTJA 5KYWB 5LDHA 1JSRA 1T1JA 2CJYA 3CLKA 1KIFA 7YASA 4WZBA 5I7EA 5A9RA 1UM9B 3DXZA 3I2GA 4DAEA 4GP7A 4ZGGA 3C98A 4N6NA 2YY7A 1NWHA 1PR1A 1Z08A 3GOQA 1YZYA 1P2BA 3OJWA 5FL7D 2OQVA 1FNSA 1Y4AE 4I4CA 2PMFA 4ZT3A 1ZVVA 3B7GA 2QYHA 2QU8A 1D09A 3MQ4A 3RSQA 3PQ7A 3BMOA 2UXDB 4UUOA 1TX4B 4HAWA 4N5IX 5CX1B 2NGRA 3COJA 2WWGA 5B2EA 3ZN2A 2Y1EA 1Y4SA 3GH1A 1FLDA 3ZWCA 4Q0MA 3RBVA 4M7PA 2ZRPA 4L9AA 4RV9A 4YCNA 3BICA 1NBIA 3CZQA 4DWJA 4LPSA 1QWOA 1Q57A 3FGPA 4G5YA 4IS2A 4V2IA 5K6AA 1PGQA 2XA1A 2XB8A 3O47A 5E0OA 5BXYA 4NK4A 3I34X 2Y4OA 3PDIA 3RS8A 3V4SA 2PGIA 2X1VA 4AWAA 1Y89A 1H3NA 5K8VA 3EY9A 3AWIA 5T41A 3FVRA 4S04A 2C7RA 5I51A 1UKAA 4HEHA 4PHGA 1DRUA 4YJ2A 2HHHB 1IUOA 2CMFA 3EBLA 1H9CA 1LNQA 3L1UA 1VQ1A 4G5HA 4YRQA 4N5DA 4O2AA 2YUIA 3HNRA 3VZDA 5KINB 3EMDA 4U02A 4FB4A 1Z75A 1IOLA 1EG7A 1AQYA 1RI4A 4DANA 3LGSA 2C83A 1EVQA 3Q3GE 4LISA 3QV2A 2I80A 1GZDA 3UWMA 1KSFX 1TTHA 1W2GA 5AK0A 1XAHA 3F6RA 3FVQA 4QGGA 3DP7A 1LF0A 3HZZA 4J9UE 5DOZA 5U9CA 2IYWA 1AXRA 1RWBA 2Z58A 3D2AA 4TM8A 3QJ5A 2BFWA 4TSFA 5E3IA 4HRAA 1H5NA 4LRTB 5H4HA 3KYDA 2D2VA 2RAFA 2PK3A 3K9NA 2CHFA 1CC1S 2EDCA 3NHWA 1C1DB 3OPMA 4L08A 5H9VA 3BM5A 1ENOA 1N6PA 1P62B 2QUHA 3IE1A 3FMPB 1KQNA 4D79A 4FDUA 1NT2A 4CL2A 2ZTLA 1UPAA 2FRDA 3SDZA 4YXFA 2O8CA 1ULTA 1OBVA 5JDIC 1DFIA 2F9FA 3ONEA 2AX3A 1CDZA 2B78A 3R3XA 1OXUA 4X92A 4A2QA 3S8EA 2ZXUA 4RV5A 3TLXA 4WEOA 1EUDA 3SVZA 2DLDA 5I5EA 2AOUA 2NIPA 3VAAA 3GLGE 3Q3HA 2LD4A 1F2UB 2WB2A 3H4IA 3NYIA 2HA5A 2CNNA 5DN6D 3A9RA 3U4HA 4JOQA 3UUWA 2JAPA 2B21A 2R1VA 521PA 4XJXA 1ZZEA 1KWKA 1F7VA 2D13A 3EUAA 4LZWA 6Q21A 1RAGA 4YJFA 1Q84A 5AW4A 3T4EA 4YCSA 1IULA 3L4KA 5BNWA 1TC2A 5I7UA 3R5SA 4NSNA 2IH2A 1GSIA 1JFSA 2O2ZA 4RVUA 4BQSA 3OCVA 2CLFB 1LX6A 2Q9AA 3R8CA 4LDQA 2HJ9A 1XV5A 4BBAA 5LOVB 2HMUA 1TYAE 3KQKA 1NBMD 1IZ7A 1I3OA 1PGJA 3NTRA 4ZJZA 3ER8A 3T9FA 2GZAA 2XMBA 3MYYA 3ITKA 4LWOA 4WHMA 5CGQB 3L79A 3GUHA 2DH6A 2HWUA 3OFSA 4I4TA 3IQGX 4D3DA 3PPVA 3WLAA 4TTSA 1HEYA 1R9GA 2AYXA 4B4UA 3O2NA 2QQFA 3BRWD 5COQA 3KHKA 4B2PA 5KNDA 2XUOA 3TCXB 1NVMB 1PJQA 4D9HA 2OCLA 3LLUA 3WRXC 4WZZA 2HRCA 3BMNB 4TVOA 3IPRA 1WPQA 2GZRA 5K45A 4BZZA 1DHTA 2JD1A 3ZWOA 4COKA 4D9NA 2QRVA 1KAGA 4DOMA 2UYHA 2FMTA 3TJRA 2ACVA 3HBAA 4MMXB 1SHZA 4KYVA 3CKLA 1IMOA 1AKTA 3WQBA 3W5BA 1QLWA 5EHIA 4LOIA 1EPUA 1IBRA 3QPAA 3FPSA 3KZNA 2PMEA 3PXEA 4IJVA 2ZTSA 3BZUA 4YAJA 4NJOA 2PSFA 3BX1A 1T8TA 3FFWA 4UE6A 5KYKA 1K06A 1MNQA 2P3LA 4QQFA 3VGPA 3Q87B 4YT4A 5JJLA 3BTOA 5CB4B 3E84A 3KO8A 3WQQA 1U2DC 2NSDA 2P9FA 2J3MA 3DOFA 2VHQA 2GJ8A 2QL9A 3T7KA 3DYIA 4YPOA 2OQ2A 4DIMA 3GF4A 3L49A 1NMSA 4KQXA 3T5BA 2JDID 2WTMA 3OLVA 5DPMA 2PBLA 3RVNA 3ST7A 5IXYA 3EWNA 2WD7A 2QRMA 4KQ6A 3HVHA 1H4VB 2MYUA 3H2ZA 3PBKA 4AO7A 1O94A 3FVTA 5SY6A 2YQ4A 1Q1GA 2J85A 2UDPA 2VKTA 3O1HB 1VLVA 1U3UA 4HPWA 4IIFA 3EIFA 3N9IA 1K7SN 3R3WA 3R7WA 3UG6A 3JV7A 3AKCA 3T1VA 3BWYA 4XRRA 1GPJA 2CLSA 8LDHA 3RHZA 1ISSA 1KEPA 4KQFA 4MQLA 2YASA 4QDOA 3JYOA 1VGQA 4A5OA 621PA 3BHMA 5HCIA 5LYJF 1M6EX 1B16A 4BFYA 2ZKIA 3N7TA 3QJGA 4TWAA 2EX0A 4L15A 4U0KA 1AJEA 1ZKDA 2W58A 4DCJA 4ZGBA 3ZH9B 2H1SA 2DECA 2OFXA 2H51A 4L02A 1FEZA 1SUPA 2O0MA 3NKLA 3QOWA 1DWOA 2Y8EA 1HMPA 3GJ3A 3OUTA 4FYJA 1GR0A 2D1TA 2JGMA 3FPFA 1QE0A 4FKMA 4M83A 3AM1A 4DLWA 2CXHA 4W63A 2NYRA 3E9MA 4UZSA 3LC7O 5GZ1A 1NJGA 2XW6A 4OFXA 5DNAA 3AHJA 2P79A 4OQDA 1OVGA 1ZY2A 2O23A 2GJ4A 1N6KA 3LCJA 1FP6A 4RA9A 1ZD1A 1T2CA 2R5NA 2ZSIA 5JDCA 3PIIA 4FZJA 1L7PA 2CJFA 2HPVA 3PZBA 1ONBA 3IUSA 4AY3A 1E2JA 2YX1A 1G8PA 2PGDA 4OAPA 1AUQA 2C9MA 4AU1A 4XB2A 2JJ1A 3DDWA 3NETA 3N1UA 1E0DA 3ZLTA 1OYVA 3IVXA 3S1AA 3NBAA 4CLXA 1DO0A 3E3NA 2GD2A 3DNFA 4J43A 5AM1A 2BVNA 1Z6TA 3EGWA 4C30A 1GZHB 1QRTA 3LMKA 2I8AA 1J5XA 5JNLA 4AP9A 3CF6R 1KP2A 2BHNA 1VXOA 1E9RA 3A06A 4QE3A 5KNBH 1KVSA 4GWKA 3JATB 3QMPA 3KSDO 4QQRA 2O59A 4PTZA 1X77A 1I24A 2VDNB 4EPVA 5ISMA 1TW2A 3Q7EA 2FHPA 5C1DA 1EJ2A 3KEGA 1F5SA 5KQSA 3TIGA 1LEHA 1Y6FA 3VSDA 1DOZA 4C6TB 4CCYA 2L69A 1P3Y1 4CLRA 2JATA 1LZKA 4YVFA 1SC6A 1QHYA 3RTBA 5JISA 4TL6A 4RE5A 2BR5A 4PRZA 3U3MA 4GQAA 4AIIA 5I8WA 2DXIA 2R4UA 1M0TA 1V4VA 4TKMA 4X9XA 4Z51A 4CCAA 2GRAA 2PH5A 2XCSB 2ZR7A 4UAGA 1BKDR 3OH8A 3GLFB 2GBCA 2Y77A 1XQXA 2ICAA 4H7IA 2FQXA 2IKSA 1FLVA 1M1XB 1NULA 1UJNA 2P0EA 3IAUA 2I1WA 3JU3A 1UL1X 4HNTA 3ZE0B 3U4QB 1JAHA 1LV8A 1Z33A 3N2KA 1PWYE 4FYIA 3WYFA 3UW1A 4R2IA 3REGA 5E4TA 4DJAA 3AP1A 1V5FA 3IBSA 2QDXA 2WTBA 4AW9A 1JU9A 2F43A 2J0UB 1X1RA 2ORED 1DJNA 4PHFA 4OHRA 3C7TA 1JWAB 4D9BA 5ARBA 3KOUA 3VU1A 4CT4B 2B9VA 4RZSA 2UUCB 1CR2A 2XLCA 1NFFA 5GONB 3MJTA 2ZYWX 3RHSA 4HWPA 2WKRA 5KJFA 2QRUA 1WDWB 2B30A 3DWFA 2AZ4A 4TYQA 1NI4A 3OD1A 2RGXA 4G0YA 4KN9S 2A0KA 2CFTA 1AQIA 1WXQA 1I4DD 2H8GA 2Z1DA 3U3JA 3GDWA 4YT2A 5IK2D 1PV1A 1YB6A 2XRMA 3KLBA 1G3RA 1SCAA 3K9CA 3OEED 2YMMA 1WDKA 3QKWA 3ED1A 4ESVA 2WLTA 4EDHA 4FR5A 4G86A 4GX5A 4PZLA 1WMSA 1UPBA 4QUAA 3K16A 1U0BB 4MWTA 4L4ZA 2GDZA 3IIIA 3KR9A 2NPIA 2RBKA 4W1RA 1R0WA 1YULA 2IXEA 1OV4A 1OE0A 5AVKA 4B85A 2DFTA 1FL9A 2P5YA 4YFYA 3TH5A 4EKEA 5DYYA 2PUBA 1Q21A 1KJ9A 2OCXA 1UMKA 1G8GA 4GMGA 1W73A 3CO0S 3ZS9A 5K4GA 4JP2A 2V7WA 3QV1A 2ZUFA 3I58A 2JLWA 4ZICA 1NBOA 4BX3A 1RZRD 4X1YA 3CT4A 5DM2A 2JGNA 2FEAA 3SQWA 5IKPA 4G0UA 2VDUE 3W5VA 1AF7A 2ZCJA 1X39A 2ZWVA 3CZ5A 1S3SA 1EK1A 1LPPA 1SBHA 2CL7X 2P40A 4BQNA 4RCYA 3U56A 2JGEA 1D2GA 3G9QA 3TCNA 1XMVA 2JAQA 2QTAA 1ZP6A 2HHAA 2J4DA 4IGKA 4PZYA 1QTIA 3EBOA 2OZKA 4KQGA 4MIOA 2ZSJA 3VOBA 2QT9A 1GYRA 3MIIA 3G6WA 4US2R 4ZAYA 5TT0A 2EZ9A 4KH1A 1CT9A 3CJRA 4QL3A 4RVHA 1E9FA 4WXHA 4YJHA 3RREA 3TQTA 2GEVA 1F7UA 3OWHA 3TAHA 2OORC 3WGQA 3MJCA 4L95C 4QECA 4WMLA 2XCTB 1FFWA 1N5MA 1RABA 3PT9A 3LPLA 3RVMA 3OEHA 4JAVC 2B8JA 5AHXA 3KTDA 2QM3A 1X7YB 3GRVA 3H2SA 4MLZA 1RQPA 2BZ0A 3RB8A 2WZQA 2IPNA 4YCJA 3S68A 4G3XA 4P7KA 2PZAA 3AFGA 3V8RA 4RLFA 1QIKA 2Z1MA 4DRZA 1JEYB 3JWHA 2Q4OA 2DJ5A 2BW0A 2A7XA 3HI4A 2J5XA 2VPYA 5FUXA 3MGCA 4ALLA 5DTMA 4DR5B 4DDWA 1N2CB 2H2WA 3D4OA 5EIBD 4H18A 4WUVA 2HMTA 2C5GA 2YFYA 2GYUA 4N39A 4RBNA 2N47A 2VVTA 3PLNA 3ANMA 2JFQA 1CUVA 4NESA 3NDBB 4I3GA 4QBFA 3VV3A 4KXNA 5CB4F 1R10A 1OZ0A 4OQFA 1KI7A 4MYSA 4OLFA 3D6FA 4LJ8A 3UOWA 4B2YA 4F6RB 3VUEA 4J8PA 1OUMA 3DT9A 1OXTA 1Z4LA 5KHAA 1H23A 1Q11A 5DXAA 4IW3B 1JHVA 2AEFA 4NDAA 3UZUA 3ER6A 4R9UC 2P7HA 2Z83A 3TBKA 3N5KA 5BSGA 4DS3A 2FZ4A 4R1PA 4BZQA 3EBPA 1M6HA 3G5TA 3LL4A 2VWHA 3OFND 3QXGA 4LI3X 3B20A 1M1YB 4LGVA 4ND8A 4IGFA 3Q85A 4P3XA 1YOBA 3PXGA 5JCZA 4Y2HA 1FJXA 4ILEA 3GN1A 4YRCA 5ANRB 2FKAA 1L4LA 3MILA 1KEUA 4H1VA 3T0IA 3UIEA 4ER0A 3STYA 1GQFA 3EOZA 2ZYTX 3K2EA 1Z2EA 1TT5A 2C5FA 3F5DA 4LHZA 2WY2D 1DO2A 1D07A 2F3PA 2OOSA 2Q6VA 4MR9A 4JVMA 4RJLA 5FA5A 1F2TB 2OAGA 1AY0A 5EJIA 3ZU3A 1QP8A 1USUA 1XZGA 4QARA 3ZVMA 3DSRA 4RW0A 4M76B 4LFCB 4IHAA 4I3HA 1L4FA 2Y93A 5FWYB 4LWPA 6GPBA 1FK8A 3PC3A 2CWDA 3EGXB 3ZE2B 4M6WA 3HFJA 2XKJE 4DJTA 1YQGA 4F4JA 5H1YA 4EWLA 2QGNA 2AKAB 1IQPA 3IIEA 1H1TA 3A26A 4H59A 1GUBA 1ZGCA 4RD6A 2WILA 2PH1A 2H0AA 4EG3A 1Q0LA 3EEIA 1V1RB 2OCAA 5FB3A 4OB7A 2HIGA 1J9GA 2ZS7A 3IA2A 1YDFA 3KPWA 4GNRA 3E3AA 2XPCA 3U44A 4NWIA 1CUWA 3EVEA 4DEXA 3PNLA 3TEFA 5B53A 4YV2A 2BELA 1AF4A 5FUQA 4OBBA 2PUCA 1AOXA 4EUEA 2CLKB 5JQGA 2O8BB 3PU6A 5FBRB 2G70A 4QFDA 2YN2A 4KPUB 3U6KA 1DJPA 2BL4A 1J7KA 3CZCA 4LMAA 3IFSA 4QJ5A 5ALWA 5E1BA 3BRCA 2BWJA 3VFDA 4YIHA 5JMOA 1KVRA 3QY0A 1ISMA 4NS4A 4IHJB 3FNEA 4JU8A 2AR7A 3BCRA 4AVYA 2UU9B 2RKBA 1XDGA 3P4XA 3ITDA 1ACJA 5DKFA 4G0ZA 5T4HA 1ZC4A 1U02A 4G25A 4CIDA 4MINA 2VWGA 3FIJA 2DPLA 4PGMA 4EIWA 2XCLA 3EDCA 4WAUA 4WXEA 1WHSA 2RAUA 3U7GA 3O74A 4EMUA 2OCBA 3CEMA 4CKWB 1DRVA 4ZI5A 1MB9A 4ZYVA 1SQ0A 1R6UA 1QIJA 2FPOA 4WKPA 1XKXA 2FXIA 3AUFA 5K2MA 2OUKA 3OWOA 4FU0A 3NKVA 1UPFA 4FYKA 3I0ZA 1Q1QA 4JP3A 4NNPA 1H2EA 4OBXA 1N9ZA 1K3FA 3OJCA 5IHXA 1K8ZB 2NZ8A 5CM2Z 4NAVA 1EVKA 1JALA 2I7DA 3ZVNA 1XCOA 2O20A 1H8ED 2ECOA 3MT8A 4RMIA 3WNVA 1SFRA 1VZ2A 1H22A 4NG4A 3IUQA 1EFVB 2ZGVA 5I8ZA 4B35A 2DPXA 2QX9A 1MJ5A 5EOVA 3EVCA 3CVVA 4LJ6A 2QNBA 2Y67A 1P2UA 3UTCA 3A9CA 4HNRA 1UDBA 4ZQGA 3C5EA 3G8BA 3DFUA 2XCOA 2B7LA 1CQJB 1E9EA 3CRVA 2V59A 3IYLW 2IFTA 2J5RA 3BIJA 5GONF 2OXCA 3A6JA 4RADA 3OQMA 1RJWA 4CLOA 2D06A 2E9SA 4PYQA 4BMDA 1U0FA 2RONA 2WM3A 5JAZA 2NUTB 1OLXA 3G68A 3U3OA 5AI0A 1P0FA 4HRYA 5EUMA 2DUJA 4DA4A 1USWA 1G17A 4WEQA 4D82A 2RD2A 4G63A 5LQMA 5FO0A 1PUJA 3HZHA 2KBEA 2TMKA 2ZB8A 2KX7A 2I54A 4J0GA 5SV2A 4JEHA 5J3JA 2ZSDA 3KTOA 1L2TA 3H5LA 3G5LA 1EVYA 4JN6B 1G6HA 5C4GB 2DWUA 4ZO4A 1A9QA 2VHYA 2XGOA 2ZUUA 3K96A 4ZTBA 2JHGA 4IZ6A 5I4IA 2FFAA 3DDCA 1C2YA 4ZA2A 1MB0A 3MCZA 3PD1A 4Z7QB 2FWIA 2Q3LA 3VX4A 5A4KA 1V7ZA 2BKEA 4KZPA 4QUIA 3G79A 1WVMA 3SC4A 4L50A 4UAJA 2XUJA 4NCBA 1XN4A 4ZGWA 1R16A 1VKNA 4XTCS 3AUXA 5CNMA 1EZ1A 1MC5A 1P5JA 1DRJA 4A8JB 3DV0A 5JNTA 3I6BA 3CIOA 3IBYA 2WI8A 3VPAA 4R2KA 1CKEA 1JQBA 1KEWA 4JXZA 1R4MA 2AV6A 1NUHA 4ND6A 5EXTA 3ZCXA 1GO2A 3C43A 3URKA 3M6AA 1D2RA 2ODAA 5GIOE 2HKIA 1RKVA 1BMFD 3OQ1A 4D8WA 1PNQA 1QBKC 2D1SA 2FFJA 2C2GA 2FEPA 3CYFA 4REOA 4B33A 1R6DA 4XB1A 4PO9A 5BSMA 3OY7A 4LPKA 5CLGA 3U7HB 2CNOA 1S2LA 2NAPA 2VPQA 3VXKA 4EB3A 2W42A 5FBLB 3G0OA 3DE0X 3ZUPA 5KTYA 3GQBB 4UAUA 1MLDA 1T4DA 1MT0A 1KQGA 4XZ3A 2YZ7A 2XKKA 1C9JA 4X64B 1ZFNA 1S8OA 3NHYA 1JS1X 4KNVA 4EUKA 1JYFA 2H5IA 2W2XA 3HADA 3LP5A 2FZEA 5IWCA 4MKXA 4RM2A 5EWJA 1EXNA 1H66A 4PGHA 3VH2A 1IC6A 3ZLUA 5YASA 1RAFA 3CLRC 3EOAI 3EQ7A 3S7ZA 3ZWBA 4BFUA 2GEBA 5DLYA 4CM9A 4RE6A 3SP1A 1U3WA 1L1RA 3HVRA 1ZJJA 2IUUA 1UUFA 1PJTA 2PZKA 2GBFA 2QRLA 5A9SA 4NU8X 2HJWA 4YGYA 3H1FA 1QHXA 4YAIA 1M74A 5CH3A 4ROSA 3W9UA 4ZQEA 2QR2A 4BATA 4O2AF 1QYCA 4WKBA 3O91A 3VR3D 3C6YA 2VSQA 1OC2A 3O9ZA 1N8KA 1R4NA 2G72A 1MU0A 1NR7A 1PBTA 2VF5X 4G4SP 3RS7A 5JEDA 5J1SB 3THXA 3RWBA 4MCIA 3KKPA 3QYPA 4PWZA 1A5TA 1TRHA 1Y8QA 1JF8A 1YHZA 2W22A 1ZLYA 4NNOA 4RXMA 3SK0A 3IUEA 4YAFA 3FDZA 1X1CA 5F52A 4EA9A 2BSQA 5EJ8A 1HYBA 3D31A 3JWIA 4NJMB 3FPJA 3AVUA 3FMGA 4X0EA 3KQLA 2FX5A 4B0PA 3BPSA 4U7GA 2I34A 3BUSA 1SWVA 1X6VA 5IW8A 4B32A 2OGUA 3Q40A 3GLRA 1ZN2A 2BJHA 2O4UX 3C39A 1M8GA 1T5SA 5C7OO 3TRFA 2HOQA 3R5KA 2WWTA 3KQPA 4WKOA 1MB3A 2DP4E 2DMRA 1NYLA 3LLSA 2FCAA 3HL4A 4QJ3A 2Y1FA 4ZVUA 1PT8A 3LBFA 4POOA 4OXYA 1ODIA 2O8VA 3C8ZA 3FHTA 5KJEA 1ADYA 3KZOA 1AS2A 2G63A 1GP2A 3SBOA 4MUNA 1NNI1 3ZHTA 5DWQA 1MIOA 2COUA 4WACA 2OXRA 3H1EA 3JALB 1C7IA 4YP0A 4C08A 1QQ5A 2BGUA 1YQ9A 5EINA 3V48A 4KOAA 4CL8A 3I62A 5IVPA 1BS9A 3KVYA 4HB0A 4LSGA 2QX7A 3VYTB 4UVEA 3QMWA 4BLTA 1GFSA 3P8ZA 5L3SA 4Z2AA 5LNK6 3EDOA 2C8KA 3UMMA 2XZLA 1N4DA 2QJOA 2VF2A 3PUVA 3K9WA 2WTUA 4EFMA 1F9EA 1SUCA 4FLFA 4HYYA 1WZEA 1KYTA 4JP5A 4UJ5A 4URWR 4OOEA 2RK3A 3LFUA 3I5UA 4ZV4A 5LKRA 1PHPA 3SBXA 1LD3A 1ULAA 5DNYB 3C7AA 4K6MA 1NVDA 4A8JC 5EJ9A 2EFYA 1GYPA 2X8LA 3MTAA 3V42A 5A02A 1U11A 3GMSA 5CDYA 1G1MA 4WCFB 2A9VA 1DMSA 4JMLA 4QDZA 3BIOA 3A1EA 2PWZA 1Z0AA 4RA6B 1US8A 4KQHA 1C4KA 2J30A 1GUZA 1M2WA 2F8LA 5CH8A 4XSHA 2OXTA 3W4JA 3ABZA 1GVHA 3JCZA 3VNVA 4B3MB 2B5VA 1S7GA 1XYYA 5B1HA 3A6GA 5EGNA 2NUAA 4MGHA 4DSOA 3ENQA 4EO7A 4E7OA 1V2GA 3AHDA 2E4AA 2OMEA 1YS6A 2MHCA 5JWHA 1TQ2A 2A88A 4D8UA 1DPGA 2WWIA 1UJ5A 5EZ6B 3AL0C 2Z4RA 2CJXA 3KT8A 2NPFA 1W8DA 3V8EA 3Q11A 3DXXA 4UMVA 3AERA 3S29A 3PUHA 5L3RA 4JCOA 2FAXA 1OAOC 4MZXA 1K0UA 4QO8A 3R40A 4LBWA 4KMOA 5FBWB 1Y3IA 4V2UA 1ISJA 4YWJA 4CM7A 1OX4A 5IAAA 4LFAB 5LKAA 2IY9A 1JIVA 4KDCA 2BV3A 4Q1DA 4K6FA 3GROA 3OTWA 4LSWA 2C7VA 3IJRA 2PG3A 4DBVO 3IT3A 1MNAA 4LE1A 2GBGA 4JQZA 4Y0NA 3DZDA 1CUYA 2HSDA 3P20A 4RAQA 1D9ZA 1KNXA 4D57A 3BMCB 3CIFA 1CLUA 2B36A 3ZX4A 4IM7A 4RTLA 2IPAB 4CUZA 3OLXA 4P7FA 1BQ3A 4LVNA 1FRVA 2EWVA 4YAWA 3T1HB 2HM7A 1ZD5A 1KMQA 3FLBA 2IHZA 1ZKMA 2IIBA 1VCOA 4BFWA 3AEUA 3KQWA 1X19A 5AICA 1NN5A 3VU0A 3ZLVA 1FJGB 3GC6A