1OQAA

Solution structure of the brct-c domain from human brca1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
110
structure length
110
Chain Sequence
GSQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Breast cancer type 1 susceptibility protein
publication title Solution structure, backbone dynamics, and association behavior of the C-terminal BRCT domain from the breast cancer-associated protein BRCA1.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 110
sequence length 110
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1oqaA00
3UENA 2L42A 2EBUA 1L0BA 3K0HA 4OFBA 3L41A 3JVEA 4XPZA 1L7BA 3PXEA 3SHVA 2E2WA 1CDZA 3PA6A 3PD7A 4BU1A 4N40A 3PXDA 2K6GA 2WT8A 3EF1A 5ECGC 2EBWA 3PC8A 4U4AA 1N5OX 2ETXA 2M2IA 3T7IA 3COJA 2ADOA 3PXCX 2R1ZA 3UEOA 1OQAA 3OLCX 2LE0A 4BU0A 3PXBA 4Y2GA 4JLUA 4IGKA 3QVGA 2JW5A 3SQDA 1Z56C 3PXAA 3L40A 3EF0A 3K16A 2EP8A 1JNXX 3FA2A 3I0NA 1WF6A 2XNKA 3T1NA 1T2VA 3U3ZA 4IFIA 2COKA 3KTFA 3QVGB 4BMCA 2VXCA 3AL2A 2HTFA 2DUNA 3HUEA 1T15A 3K15A 3L46A 1IN1A 3HUFA 4ID3A 3PC6A 4BMDA 3PC7A 4XQ0A 3SHTA 2NTEA 3SZMA 2K7FA 2AZMA 3AL3A 1IMOA 2D8MA 1KZYC 3K0KA 3II6X 3I0MA 1Y98A 3K05A 3T7KA 1T29A 2INGX 3PC8C 1T2UA 2VXBA 2COEA 2COUA 2XNHA 1GZHB 3T7JA 4Y18A
chains in the Genus database with same CATH superfamily
4MQ4A 2QR2A 3O8LA 1WM1A 5IKMA 1YBFA 4GOND 2NM0A 2V4ZA 3S0JA 1VI2A 3HB1A 1F8FA 3QNUA 1PRYA 4B47A 4F4JA 2R66A 3DKKA 5H0IA 1I1NA 1DE0A 2AIRA 1QGZA 1SU6A 2XJ9A 3QBJA 4NFYA 3SHVA 3TOXA 1YB4A 4J3JA 3SOZA 4UBOA 1KDPA 3FTCA 1GXSB 4Y1FA 3KU4A 2JGDA 5EG5A 4Y6PA 4F6RB 1YK0A 1WY5A 3FR7A 3RFVA 2FEWB 3NONA 4NU8X 1V5IA 3WBFA 2ZRLA 5IAAA 3RHSA 5A6VA 1T26A 2KHZA 1Y3IA 3WYDA 4WZAA 1M2KA 1Z35A 2B2XA 4HBZA 3VQTA 1W8IA 2GVDC 3QITA 3P27A 2X6QA 3H2HA 4GC9A 2PA3A 2BKEA 1P4AA 2GD6A 3GJ6A 3H5TA 1DEKA 1RQ7A 3K1ZA 1BROA 3ESQA 1PLKA 3LXUX 1U1GA 1WSAA 2VAVA 5J4YA 2R0QC 2VN8A 2MYNA 4F5ZA 2Q7XA 2B69A 3GH3A 1ZH6A 4MAAA 4GMKA 5AM3A 3DKVA 3ORQA 4F4CA 3VVCA 3HDQA 1DKOA 2DJIA 3FYSA 5I7AA 1XQ6A 2GLTA 3U44A 1GLNA 1XZJA 1UIMA 4KSBA 5CLQA 5DHUA 1PNVA 3QQ5A 3BREA 3SE7A 2OYCA 1YS6A 3CRW1 3HJUA 1IHYA 3QVVA 1HKUA 4KIUA 2GAOA 2Q07A 3SM9A 2VO1A 3FA2A 4OO3A 5A5FA 5CFOA 5FTLA 4F2HA 1XPUA 1V71A 4MR9B 1OX4A 4C7VA 4YV7A 4BGDA 2IBMA 4GICA 1EHCA 1JFFA 4GMDA 3AJDA 2VQ6A 1I4LD 1V8ZA 1P7PA 1YFZA 3FPAA 1P72A 5BXQC 3SICE 4LOAA 3IUNA 3RS8A 5BR7A 5BY2A 4F84A 2Q6TA 4FE7A 3LGXA 4IRXA 1W1WA 1C8KA 4OQMA 5K0SA 4MIEA 1XWWA 2DULA 1G6HA 4XLLA 5DHQA 2YNMD 2J48A 3K7EA 4POOA 1C8LA 3AVYA 2HV9A 3AINA 2AJDA 1EJ2A 1RCUA 1QVAA 2ERXA 3BIWA 1YBHA 3TLCA 3N7UA 3D0QA 1QF9A 4JQZA 3OCCA 4DXDA 3C3PA 4PNZA 3RS0A 2ZJ6A 1RYZA 1PJ2A 2GTPA 4EFKA 4AUEA 3GFQA 3LPDA 2DWOA 4MCIA 5TGZA 3PC7A 1E7SA 4JR2A 3U9LA 2V7PA 1ZPDA 3VKFA 1W7AA 4F12A 2V65A 3GYGA 4ZP1A 3PRJA 4AJHA 4D0GA 4GMHA 2WAOA 4EAQA 1IK4A 4JD5A 1M2OA 3VTFA 3TW4A 2O2XA 2M6SA 1CVIA 3FGNA 3L7OA 4PR3A 3K72B 5C1OA 5JEDA 1E3DA 4L22A 2HMUA 3DAGA 1H5UA 4L4ZA 1N0IA 1Z17A 4PAWA 4Y2QA 5HK9A 3J7TA 3GGPA 4XLTA 1KO1A 2F7SA 1NI4A 5KNBH 5KQPA 4GOMD 3PVSA 3RUEA 3SCZA 3TJMA 3UFBA 3V7FA 1IAQA 4S1NA 4Z4IA 3LBHA 5JC1A 3QEMA 4WX2B 2QP3A 3VR4H 1ZESA 3OEWA 3HUDA 2XGGA 3HP7A 1GZSA 1RKBA 4YMUA 4GGOA 3JVDA 2ZXUA 3DMTA 3W2HA 3PKJA 3UK0A 1BDJA 2DX7A 3VAYA 2C2YA 2FOLA 4AJLA 2EKPA 1GPYA 3DXZA 1MD9A 4QQNA 2F8MA 3RS4A 3HO8A 3D59A 3W90A 4JXKA 5ALFA 2NT4A 2Q3BA 3HCBA 4GEGA 3RT9A 1K86A 3C5WP 5FAXA 3PS9A 2P3SA 1WLYA 2Y1WA 3IV6A 3EEIA 1QS0B 3DDHA 3AU8A 3FNIA 4R8VA 4DV6B 1ZZGA 2IYNA 3B1YA 2GA8A 1XEXB 2VDQB 3L8HA 1J9ZA 4D45A 3MCTA 3K96A 2P1RA 4L6CA 4EHFA 3MBKA 2YWHA 4IGAA 3IOCA 2C9OA 4PC3A 1EE9A 4GI1A 2BMAA 3TL6A 5ENDA 2JJYA 1R6UA 2IF0A 1CNFA 1XTZA 3UHAA 5J4LA 2QWXA 2XDQA 3DOUA 4PX5A 5TJHA 5H8WA 1WZ2A 1BJKA 2ZRHA 2LVBA 2Z30A 3LM8A 3AF5A 4X1KB 2ZSKA 4XRGA 4TTQA 4KR2A 5IZCC 1E3IA 1MX9A 2IDJA 3K0AB 4OQNA 3WTBA 3NBKA 4C0HA 1QK3A 2LRHA 3Q1LA 3IX7A 2MMCA 3ROFA 3VM6A 4NBKA 1EPUA 1N3LA 3ACCA 3R4CA 3E9CA 4ZMRA 1U9JA 1YDGA 2J33A 1TIKA 2EWWA 2CVPA 3OCVA 1D1TA 1C50A 4PHCA 4ZVMA 4C30A 3EUFA 4I1OA 2Z3ZA 1PJZA 1GQQA 2C4HA 3JR7A 4KO3S 4AI6A 3P20A 2VPXA 1SIUA 3MM4A 3RTCA 5LU8A 1TYEB 1I1QB 1WXIA 4XX0B 1GUYA 5L6MB 3CLSD 4Q7QA 1LZKA 3ZBUA 3GVXA 2UUBB 3CIOA 3QH4A 4RJ2A 1L7OA 3EQ6A 3S55A 1P4GA 2V9CA 1VIYA 2AN5A 2W6JD 3IIEA 4MR7A 3IAS1 4NLLA 4KREA 3GV0A 3F8WA 3IUQA 3Q0EA 5FHQA 4F1WA 4WJZA 1AQJA 3IR6A 3T3OA 1C3XA 2KS6A 2OECA 1FMTA 3FPCA 2VRWA 2W00A 2OPHA 3B6IA 4LF6B 3WLFA 2CUKA 5CH5A 4O1IA 2WJ4A 3CR3C 4PCAA 4AJNA 3CN7A 4RIIA 3DG9A 1NMZA 4A23A 3TLBA 4CKWB 4EFMA 4IHKA 3W2GA 4B6FA 4DR2B 1OILA 2PO7A 4FINA 1KIFA 4C7KA 1XRRA 1SCNE 1XXHB 4LK3A 4BWGA 2H1CA 3A70A 4EATA 3VYSB 3AIKA 2P79A 2GXSA 1SOUA 1H05A 4KMRA 3O4RA 2XEXA 1Y1KE 3LC2O 4G5YA 3TZHA 2YYSA 2DQKA 5IZ4A 3MLAA 1OXBB 2CSUA 3ABZA 2L19A 2Z9BA 5CVEA 2O5CA 3A1CA 2G4VA 4AO8A 1ZWKA 3ZCSA 1YJ8A 2PN1A 2YJ3A 2ZRPA 3LWNA 4OBBA 4PYMA 3NP7A 4UDOA 3F3SA 4I1UA 2FA9A 2ZE7A 2BISA 3CLRD 1NF2A 2VWPA 4HUQB 4EFNA 3M9LA 2PPLA 2R85A 5CX1A 4PAOA 1Z6XA 2X0IA 5B55A 1I4WA 2VF5X 4BV2A 3GPDG 4HNAA 5BV7A 3KWJA 2C5FA 4BVFA 3LX5A 2C00A 5AI4A 5IULC 5JCZA 1XNRB 1YZHA 2TMGA 1L7VC 1PWHA 3AJAA 4P82A 4UASA 2O1WA 3FYHA 2QN7A 4HQFA 4AZSA 5BURA 3PEEA 2EBUA 3GC6A 2F8LA 3BMXA 3EPHA 2BGRA 3EHEA 3WLOA 3HCPA 3SHFA 3QFFA 2HO5A 1ORWA 4LDPA 1G5QA 2VHEA 4P54A 2Z2XA 3HBFA 4FFLA 1PVOA 2B4RO 1C81A 1W87A 2Y1DA 1LFDB 2O2SA 4FUQA 5FI0B 4S04A 3PQ5A 4QTZA 3RSLA 4OXQA 4R2HA 5ECGC 1PE0A 2J9ZB 1IYZA 2OVBA 4RHEA 2YWDA 1RJDA 1YB1A 1U0RA 2H00A 2CVFA 1ZM4A 1O96B 2JAXA 2JHFA 3AHHA 3MCAA 4QUJA 5EC8A 2GCOA 3JWHA 3U16A 1GEGA 4PBSA 3UOWA 4BQFA 1Z38A 3Q5GA 3R6GA 2UYCA 3A3OA 5B37A 5GWXA 3ECSA 4AICA 1AMUA 3L05A 3F6YA 1YA6A 3K3PA 2GZAA 3W2FA 2B2CA 1UKAA 4XJSA 1PJTA 4L76A 2C8VA 2G3YA 3A9UA 4Y2RA 3RAFC 3O8OA 4OFZA 1JMVA 3F7TA 1QFSA 4Y9RA 1U2GC 4NBLA 4PYQA 4OHMA 3SF8A 3AILA 3T95A 3VNAA 2PE5A 2XUGA 2CDNA 4LPSA 3VO2A 2BCEA 3DJFA 4ZQCB 3UQZA 3DC2A 3DEHA 1CY0A 3RRYA 2BFCA 2WF9A 3FG9A 4ZT6A 5B64A 3U26A 3O91A 1PGJA 4ZI7B 4GR5A 4LVUA 4ND7A 2PHZA 1V5WA 5F73A 4V1CB 3DZHA 3W9SA 2QUAA 1E62A 4HYQA 3ZHYA 4DTIA 3B82A 5EVJA 4DJDC 2YOHA 3BUSA 3TL3A 4AFNA 4Z4GA 1OTYA 1TT5A 4W9NC 2WR8A 3IDOA 1G41A 2ZROA 4PYKA 1TF7A 3NQ41 1QTIA 1SY7A 2O48X 1GSHA 2WU0A 1BN7A 4GZLA 4PLGA 3HB7A 1P1IA 4ZHQF 4KFUA 3R76A 1L7QA 1O0SA 4IIJF 5IM4A 2WA1A 2D5LA 4M55A 3D8UA 4CCAA 2C3MA 1SVUA 1A5BB 2C7RA 3UH0A 4PRLA 3BE5A 4DAOA 1BFDA 2P2DA 2R84A 5GIPE 3PNQA 1AIPA 1YO6A 3RSGA 3DOHA 1RHRA 2Z0MA 3SNKA 3PC3A 3CRMA 4QOJA 4X7RA 4BUJA 1E3EA 2VZ0A 3G0IA 3H2YA 3HADA 3PUVA 3REGA 3RVDA 5IN4A 3OJCA 3O4IA 5FUQA 4DJAA 4C05A 2PH3A 4RXMA 1N6IA 3DLHA 4S1TA 4JYBA 3H9UA 2IUUA 2JJ2A 1FZQA 2BTQA 3G2HA 5TF0A 3GCXA 4MLCA 1QZTA 4REQB 5ESWA 1IK6A 2ZIZA 3I12A 4JC0A 4X8MA 4ZXPA 1K6MA 4QUAA 4EF5A 5SZKB 2XWBF 4X3PA 2O8FB 1XDUA 3TUIC 3USCS 4FQ5A 2GM5A 1SIOA 2IF2A 4C89A 3EJ6A 4LI0A 2AYXA 2EGGA 2MCFA 5IJ0B 2C7OA 4L6AA 3TOSA 3E35A 3PGLA 4ITVA 4R83A 4GPEA 1KI4A 1RAFA 4LXHA 2CYCA 2LIVA 2I7VA 4DV5B 3BXOA 1PJ4A 2HM7A 4MKZA 3O1JC 4FQ8A 3TAHA 6LDHA 6Q21A 2JDIA 3FVWA 4XWKA 4C6TA 4KTVE 1LF5A 4O2AF 5UKDA 1QH0A 2NSJA 2XUAA 2VZ8A 1AC5A 1ZK2A 3EWIA 4HGPA 4JSTA 5AXBA 4Z2YA 3GT4A 3VUFA 1KVSA 4XCVA 4W5OA 5AOBA 3NIBA 3T7DA 1NAHA 4F5EA 1I3NA 1M6YA 2ES4A 2VYND 2ZYDA 3DULA 5BUSA 5C1IA 1PFYA 3VVLA 4Y2YA 1W25A 4TS9A 3FFAA 4AO6A 4UCFA 1X8XA 1U9IA 1D1PA 1P0FA 5EJFA 1BCRA 2PUHA 3CUTA 1Q0PA 4FYPA 1IY1A 3W77A 1FSZA 1QTRA 1IBLB 1YD7A 3FZGA 2UVPA 3V97A 4CF5A 1UT6A 4GPAA 4JGIA 3QOYA 2D4AA 2JD0A 2PAAA 3PGMA 1DBIA 3JCZA 2FGKA 4I19A 4JYZA 3AUFA 1X1DA 4KAJA 5F7ZA 1F9EA 1E5QA 1XVAA 2JARA 1ABBA 1ICIA 1CF2O 1Z18A 2I76A 2N75A 3GGDA 2X5OA 3W3AA 4DV1B 1P9NA 1E9RA 3QGMA 4BPRA 4D8WA 1GTRA 5JS8A 1LJ8A 2PGIA 1NXWA 1T8PA 3GUZA 5IARA 1XTIA 1D2CA 2V7EA 3GRRA 2HRZA 4G89A 2RJOA 5IK2A 5LQDA 3JQAA 3GLGA 1C4OA 2ZWOA 2O59A 4GO1A 3ZVNA 2DB3A 1VHLA 1ORIA 1VKZA 1WF6A 1JYSA 2H54A 2ZVQX 4RIGA 4G0ZA 3S1AB 2HSJA 4G8JA 2E6UX 2BZSA 5JJIA 1N2IA 3GWGA 2OFXA 4DPMA 1DINA 3ZWDA 1MJGM 1I1HA 1CUEA 1O5OA 2JVIA 1M54A 4LZNA 1ZMRA 1OBOA 2OXFA 4M3NA 1JJ7A 4AZ3B 1KP2A 1TJYA 4B6OA 3ZZTA 2YRXA 3CA8A 5FBQB 2E7ZA 1I4DD 4OKIA 2BGNA 3FDIA 1L1RA 3CE9A 1UBSB 3OJEA 4KAXA 1X6VA 2CCKA 3KOZA 5HQ3A 1IBKB 3M6XA 1ZUIA 1UJBA 3I01A 2AMJA 1UJ6A 2PRSA 4LC9A 3AQIA 3RWOA 5CLFA 2QXYA 5KOYA 3C3JA 4WA8A 3OAAD 4IBOA 1XEWX 1G1MA 3TTYA 4HDOB 4RZ3A 3LQ1A 3PD1A 2PUAA 5CUQA 3KJNA 1LB1B 2FZCA 1XF9A 2DSNA 3CVJA 4PAQA 2AE2A 2I87A 4O2LA 2TYSB 2HQ1A 4BDTA 1U5AA 4Y2JA 3IEKA 3U4MA 2TMDA 3I32A 2CDBA 2QD3A 1KZYC 4C43A 1V3TA 3E5MA 3LO5A 3I9LA 4DW8A 4E15A 2GLUA 1JAIA 4KGDA 3HVIA 3C70A 4MVJF 3C7TA 3RKRA 1YOVA 2OCPA 1R66A 2QAGA 4YUVA 4Q6BA 1SEVA 3WLLA 3OF5A 2ZQZA 1OLXB 2XWPA 3NS7A 4MPPA 3IVRA 4G5RA 1I24A 3ESXA 3MUFA 5DW3A 3U7EB 5BPFA 1W2WB 621PA 5JZBA 4CTOA 4LDAA 2G63A 4GWLA 3THWB 1PUJA 4DR6B 1B2RA 1QIFA 2D7JA 2C4MA 3DVAA 2XRYA 4GC5A 2JLWA 2CLKB 3OEYA 2VF8A 4ZZ1A 3KQWA 1Q20A 3N59A 4XUDA 3ZHZA 1HQYE 3IERA 4D8UA 4ESEA 2PX0A 3CBQA 5K0LA 5JQGA 1Y6FA 4R1QA 3KBBA 4DR3B 4YBRA 5AW4A 2BLLA 4QYIA 4LXIA 5MFZA 2QY9A 3T61A 3DE3X 5LP6B 2KBFA 2QMEA 4HPWA 3HJTA 4O08A 5J5AA 1SUPA 4GI2A 1O3YA 1X42A 4OH7A 4RETA 4GBGA 3KEMA 4QXOA 3JQ7A 3VSAA 1C30A 5BW5A 5ILGA 1N92A 3WNVA 5KVVA 3I62A 4IVPA 3IPLA 4PVCA 1WDKA 1XTJA 5CDHA 3FE2A 2CXRA 3GPBA 2GJ4A 5I5EA 3D6TB 1HC7A 1B1AA 3EBLA 2WTNA 4C4YA 4G67A 1E2LA 1SBHA 4HV4A 3GARA 3NORA 3NAMA 5CM9C 4N01A 4LXYA 4NS1A 4X6YA 2HA7A 4HDNA 5FL3A 4QSHA 2OBNA 1SQ0A 2H1LA 3G2MA 4Y6LA 2YJ4A 4IKPA 5FUWA 5J9FA 5C9ZA 1K7CA 1AUOA 4JP3A 3EA5A 3LY8A 2WNIA 2C59A 3GW8A 3MINA 4P92A 1MZVA 3VDRA 1ZN9A 2Z2IA 1P77A 1ULZA 1QO0A 4MB6A 2QLJA 1WCYA 2V59A 4H17A 3IA7A 2RBEA 2WQ7A 4ESHA 3MB5A 4XYLA 1QQBA 4UXHA 3H16A 3DP9A 3L9WA 3RRBA 1V95A 1ZI6A 2BCGY 2H2WA 1WZEA 1KHTA 4WFIA 3H1FA 1HH4A 4YCDA 1SXJE 3QW4B 3SR3A 1M33A 2FFRA 3IPXA 2FFAA 2FETA 3HKCA 3QUTA 3M6UA 4BAUA 2L2QA 3HCDA 3HB0A 3EVBA 3P2OA 5LZ4A 3OTHA 4MYTA 3W5UA 5PNTA 1A2BA 2ICAA 2FTKE 2PMCA 3OZIA 4H16A 3T5BA 4RF4A 4C7OA 3AKEA 2IV2X 4B32A 4I0WB 2IU0A 5BQFA 2WYUA 3WVNA 1GFSA 3NETA 4EUNA 4HRVA 1XRQA 2VH2A 2OZVA 2I03A 1U2DA 2VT7A 1KY3A 5DE3A 3W1VA 2P8JA 1RI4A 5FR2A 4U7GA 1T91A 4R54A 5AKLA 4U2CA 5JZ9A 1UM8A 6REQA 1L4LA 3NU1A 3OKCA 3O95A 3PZRA 2F9FA 1X8KA 4LX8A 1D1QA 1H1LA 3JQCA 2VK4A 3LLUA 2ZT6A 2MJLA 4LSGA 1NW8A 3U3MA 1L8XA 3HYLA 4N5LA 1RACA 2NZ2A 3AUJB 2W8BA 4P2BA 5L3ZA 2C42A 2OB1A 1Q7GA 4QATA 1F12A 4WNYA 1UK9A 2AJCA 2YASA 5FWYB 2Z9CA 4GX2A 2IP1A 5K3AA 4DNXA 3BRWA 2BP7A 4G2NA 3ZJ5A 2IHNA 3DKIA 3JQFA 2LCIA 3T12A 1VCMA 1T35A 2C3OA 2WHEA 3ER6A 3BH0A 1NXOA 2FFHA 3INNA 3IEUA 3LCMA 4C4TA 3MMNA 1H4TA 2A1IA 1KP9A 3OZVA 3JALB 5FORA 1NVMB 2VDWB 3EGVA 5ENVA 5G0WA 4LC0A 4B45A 1MRZA 5EUBA 5JD6A 1G8GA 3OT1B 3DE1X 3MILA 3O4JA 3NHJA 2OLEA 1GJRA 2IP4A 1LTQA 1WUIS 4OLHA 4BMPB 4ZDJA 1A77A 2XUZA 2AV6A 3MMZA 5EKDA 1BMQA 4PO3X 1H85A 3SKVA 1X7WA 3FUCA 4DFDA 2PUDA 1T8YA 3WA7A 3JPWA 2CYBA 2Z1DA 2PQ6A 2WKQA 2AJBA 3DFKA 2XGOA 4M0MA 4TYWA 1FDOA 2H9IA 2PBZA 1LW6E 3G8AA 4OXIA 3LECA 4PLWA 4Y7CA 1EGVB 1Y81A 2QTFA 1BQ4A 3ZWBA 1TQ4A 2DT5A 5A4JA 2YZKA 3QKIA 1DNPA 3UMBA 3KHUA 1JI0A 3LQKA 5JS6A 2J3EA 3CKLA 2I55A 1XJCA 2D0DA 3IODA 3QLTA 4HXFB 5G0UA 3RVQA 1XZFA 1E3WA 5G41A 3TQTA 5IF9A 5TLSA 1O8BA 3H5WA 1RLJA 1UBRS 2R25B 2F2TA 3KYDB 1GEEA 7GPBA 2J0UA 1QVRA 5DBEX 3UWKA 3E3MA 3QYFA 4MKIA 4KLRA 3E23A 1RWBA 2O3SA 2WABA 3D3NA 4LRYA 4RVSA 4FMDF 1DC5A 2C0CA 4P0PB 3CZCA 1GL9B 4DHWA 4EG0A 4BVJA 1HDCA 1GNTA 1WV1A 2IRWA 2H0QA 3MMSA 2G8LA 2Z95A 3CLVA 1M74A 1L5HA 3TM5A 1NBOA 1C1XB 1JHOA 3E1SA 1E3TA 1BDHA 1M2GA 2XNKA 1IWBB 4DCCA 1GPH1 5HIJA 3PGKA 1E2EA 2GJ8A 2DBYA 2VBFA 1G6KA 1YI0A 3V4VB 1JXQA 1U2GA 5ILQA 2C20A 1YQQA 2VP0A 3W79A 1NF8A 1PGPA 3D2CA 4KDFA 1OC2A 3ELWA 2DPGA 1SR8A 1UAYA 4YQYA 1YDEA 4HT3B 4Z2AA 1MAAA 1SK9A 1T15A 1XVLA 1ZCBA 4UTOA 4HTFA 1ZGAA 1LVHA 3A28A 3RV3A 1KSFX 1CUSA 3I2IA 4PHHA 3VH3A 5A4AA 3KUXA 5AIBA 2CW5A 4QX6A 1D8TA 3PNSA 1SBYA 4ARUA 3HB4X 3KOXA 4V0NA 3V1LA 2HA0A 1IBCA 1KY5A 1UQRA 1YBAA 3DAOA 3LPAA 1E2PA 1UWCA 1SQ6A 4KXXA 5D8DA 3T8YA 5E9JA 4BEJA 4OU4A 4BMOB 4QTUB 1EWRA 2QR3A 3CZ5A 3I9OA 2B7CA 1RPTA 1AGYA 1EP1B 3A3NA 3G8YA 4ZK6A 4B3SB 1R7RA 1C7IA 2GJKA 1AHIA 5LIRA 1BE8A 4EJ0A 2A5GA 3U4GA 1J0CA 2OCLA 1CE8A 3A1NA 4U2KA 5BUCA 2WUEA 4DKJA 4O4HF 3DMFA 4MRRA 3MPUA 4A2QA 4B6SA 2C3UA 2HF9A 4LS3A 5LZ9A 3EXAA 3P19A 3QKRA 4N3CA 5GVSA 1FDTA 4DQLA 3HWSA 4KUHA 4H35A 1JQ3A 3BE8A 3B7PA 1FDVA 4HLUC 1QAMA 2BEUB 3DB2A 3ZKWB 1A4RA 4B3HA 1ZUD1 3CNNA 4HFMA 5GVRA 1ZD3A 5GZ1A 3DWGA 2H7YA 1WDWB 1WPXA 3O3CA 1XZPA 4OBWA 2FEKA 2Z4TA 5EPOA 4JI2B 3NT2A 4QXMA 1F4LA 3W1WA 1R10A 1N1EA 5EXSA 5ICSA 2KM1A 4RV4A 4RMIA 3PFFA 4XGIA 5E7QA 5TPWA 1XL1A 3FNGA 3LVBA 4Z4CA 5BPHA 5L51A 1TAQA 3Q9SA 4JBNA 5IVPA 1KMNA 5FDFA 4YP7A 3HLKA 3W8NA 2Q8PA 3AESA 3PWKA 2OQVA 5IJWA 3HGTA 1RM3A 3PL5A 3D3EA 4R6WA 4UHCA 3SQWA 3D7MA 3AEQB 3DBLA 1DP4A 4AP6A 3N8KA 3GFGA 4LQDA 1NI5A 1G8KA 1DWOA 2HREA 2LR0A 3DTYA 3WIBA 4XUCA 3ADKA 4WKCA 3U81A 1W1IA 1HE2A 3T5CA 1YJQA 2I1VB 3AETA 2P2NA 1IN4A 4KXMA 4R8KA 3S29A 5IT9A 2D5CA 3B1JA 5CT6A 3THSA 5CDTA 4Q9JA 1JIQA 1EVIA 2MSDB 3KZOA 2YMPA 4BHTA 1HURA 4PANA 4EHKA 3E9QA 3H11B 4QNRA 5JD3A 4GX1A 2IWRA 1V96A 1V6SA 3OU2A 1TX4B 4ZVUA 1QNLA 4UBJA 5COBA 2O06A 5JJLA 2CVZA 1FFCA 3QEOA 2VYCA 2JFVA 3DMYA 2O1SA 1UZMA 5B4UA 4QE3A 3CUUA 1IUOA 3CXUA 3BRSA 2H4YA 2QPAA 4HAYA 3V6LA 9MHTA 3G79A 3U3OA 5TS2A 4ALLA 4CG1A 3GLKA 4PZ9A 2RGGA 4MHOA 4YP5A 2FEMA 2O7VA 1O4VA 1NWHA 1DC8A 1CQIA 2Q4OA 2X1MA 4E33A 1B76A 4FHDA 1I30A 4GNKA 3LBIA 1RYDA 3MQFA 4L1KA 4NVRA 4H3HB 3VVBA 5JHHB 1S2NA 1WMBA 3JAKA 1RBMA 1A4XA 4C5BA 3KZMA 3ZWQA 2QM7A 3QVMA 1M72A 1C3JA 3SSOA 4WE3A 1NW6A 2AG1A 2HNBA 4UATA 3NO4A 4AYXA 1OH7A 1YBMA 1T5DX 4R7ZA 4WKNA 4WSOA 5EFZA 5FR1A 4AWBA 5TVKA 2BFPA 2HU2A 2B0JA 5KQRA 1MDBA 4RY2A 3DZBA 1UL1X 3UWPA 4YJHB 2FDXA 3I0ZA 2PUVA 3HWX1 4HWSA 4MKGA 2N46A 3DDOA 4JBGA 4A6DA 2H31A 2KMLA 4YT4A 3VKGA 1LFAA 3QMWA 4HNHA 5F21A 1AXGA 4CTMA 1JHAA 5ICCA 4F9EA 4PHTA 5FJJA 3OJLA 5GY7A 2NO5A 3L77A 4WK0B 1QYDA 3WKAA 4RHTA 5JCPA 5SYAA 2B98A 2BZGA 3OZXA 2PMEA 4CLRA 3PGJA 2YDXA 1HLFA 3EMBA 2P6RA 2H0RA 3H75A 4PINA 1RQXA 3AEUA 2FZKA 2HQOA 3TWOA 1HZZC 1D03A 2D2XA 2H4XA 2FW7A 3JYHA 5LJIA 4QXPA 4QNNA 1XMJA 4RH1A 2V7TA 1DPGA 4BQQA 1WCV1 4D0RA 3FNHA 1ZGBA 1YVRA 2II6A 5JCJA 4B3DA 4MR8A 4ZHSA 4UNPA 3DQPA 4HFRA 1CZOA 1NZDA 2WFMA 4RPLA 3OOJA 5C2JB 2X86A 4GP7A 4FMBB 2JZCA 3K53A 1R0BA 2FI1A 2FSUA 3H13A 4MKRA 5JSUA 1QPBA 2X41A 1KZ4A 1Y8RB 3GVIA 1U0NA 1FK8A 3R20A 4PO1A 1P0IA 4K26A 1L7DA 4M0DA 4IMJB 1T4MA 2QRMA 3R23A 3P2YA 5AKXA 5JATA 1CVLA 4M36A 3PR1A 3ZHBA 1TZ2A 2IYQA 3TGWA 5E3JA 4P7GA 2IA5A 1YRHA 1L5RA 2FFJA 2WJYA 3GA5A 3QU5A 4E2YA 1GUBA 3VR1A 3O4HA 4MI6A 4AZTA 3REQB 2GH1A 5HFNA 4A82A 2BI4A 2NMVA 5F9MA 4XIGS 1WW8A 1SVIA 3O8QB 1HYEA 4Q4LA 2HIAA 2E85A 4WESB 5CDUA 5EMJA 4Z0TA 2EX1A 2GFIA 3NPAA 2FWBA 3NNNA 5DH9A 2Y1EA 3R3ZA 4AQDA 3ZE0B 5KOIA 2Q41A 3AEKB 4M7RA 5JS2A 5M29A 4I46A 1XNHA 3WNDA 2XGMA 4C4PA 1QV6A 1Y7TA 3KKNA 1URPA 1ZCFA 2XI4A 5PGMA 3INGA 1YHYA 3HNRA 1O57A 1M5RA 2IQIA 2JD1A 4RLSA 1QYXA 2AKEA 3ET5A 4H1UA 3Q10A 1G8AA 2AZDA 2CL5A 2VPPA 3ROXA 3W34A 1YIDA 1O77A 2EW2A 4LBVA 4LJYA 4BVLA 4C3ZA 2FHSA 1M9NA 3IVXA 4IJQA 2J5XA 3D7NA 3DV2A 3GJ7A 4QBTA 4TQUS 1BEUB 1GGKA 1V1RA 5D3QA 3KQUA 2NSLA 4CKBB 2QM0A 2LZ0A 4CKCA 1WMSA 2GERA 3SIXA 2DWPA 3LOQA 4KQGA 4K9OA 3ETJA 2XECA 3DAHA 1NJFA 3ED5A 3GPCA 2OV8A 4RHXA 3VDQA 4AZWA 2XAUA 4H15A 1X74A 5EAIA 3CZPA 4F2WA 3PG5A 4ILEA 4HWGA 3DBRB 3IIKA 5ER9A 2UXCB 1A8SA 1WG8A 3OT5A 5LOVB 4FNOA 3ZK8A 2ZRNA 4G8BA 4X6UA 2Y4OA 1K8XB 3SS7X 5E6SB 3TZ6A 1MVOA 2AMFA 2QK4A 3QXXA 4L0DA 4OB7A 4ZIRA 3KT0A 4ICIA 1S4QA 4JODA 3M33A 2OMKA 2QTRA 1N2SA 2XE8A 2WD8A 1USKA 2V3WA 1CHDA 4M76B 4F3NA 2O2ZA 2P9EA 4MQUA 1UK7A 1IU9A 1V5FA 5CB0A 5KNDH 4JUFA 1VLVA 3ZK9A 1VMAA 2QP4A 4AKEA 1D1SA 3RANA 3CLUD 4JIMA 1ORDA 3C5HA 4K6OA 2JJ2D 3TH5A 1I3MA 2HA5A 1DKLA 3SJAA 1HXHA 3DDNA 4X44A 5L9AA 1PP4A 1NR5A 4WY5A 4RADA 5KMGA 1QUEA 1Z5WA 1XJ0A 4RQUA 2Q99A 3B1KA 1B6RA 4IEIA 1TTTA 4KHPB 3WK4A 5BSWA 3DAPA 3ZJVA 2W2TA 4GM4A 3AL3A 3AM3A 2ZBUA 1DBPA 5KNCA 4DCSA 3I8OA 2RARA 1SEPA 4KPUB 4WADA 3C1OA 4YBZA 3AGPA 4N5MA 1PR1A 2OV3A 2QMZA 2Y9PB 4CR6A 1DAIA 2H1RA 2EP7A 5AUOB 3TNFA 3ZHOA 5IC4A 4OQLA 3RYTC 4C4ZA 1G59A 2H07A 4ACBA 1QZXA 1FJXA 1JIXA 4GW3A 3V32A 3CRNA 3EN0A 5BRAA 5FEUA 3LQYA 2O50A 4EF6A 3GEGA 4XWAA 4O5OA 1GXSA 1OF1A 3VZRA 1CV2A 4EJFA 5BYKA 4F6RA 1ODSA 1E1CA 3TQHA 4KNWA 3ELYA 1DAMA 2RJ3A 3WQRA 4KAFA 3TRKA 5HRCA 1QHHA 3WL6A 2YXBA 1S2IA 3DZJA 4HZIA 1IRXA 5ICFA 3C3AA 2PUFA 1R18A 1QIJA 1H2RS 3I1IA 1RADA 4DPKA 1DC7A 3OO1A 4RHUA 2W0MA 1GTG1 1R0LA 1W9HA 1VB5A 2IYRA 3AP3A 3N8HA 3SYTA 1MHPA 1DJMA 3TLGB 5DHSA 4ERNA 4BVBA 1WVIA 2G07A 4LF9B 1VYVA 5IWCA 2RDMA 2YWFA 1W34A 2AEMA 2BMWA 3W3AD 3ZK7A 3B13B 1VC2A 4ZREA 4DBLC 4F7DA 4IGFA 4O29A 2AC7A 2PM8A 2VZLA 3RIHA 5IK2D 3WAJA 4P08A 1BZYA 3KPUA 3JQAD 4EMSA 2GBGA 1G21E 2QTCA 3R7SA 3EW7A 4RENA 2G9UA 3O90A 4J43A 1AZTA 2YL2A 1V1JA 1TM4E 3UAVA 4DSOA 2J45A 4BO7A 4WMLA 2HPAA 1COZA 1FYVA 4FHGA 4UUQA 4L9AA 1KJ9A 2G17A 2X5JO 4DE5A 5F9HA 4FDLA 3FMGA 1GAJA 3RYFB 1JAYA 3CLKA 5A2QA 3DCYA 3HFRA 1QCYA 2F1JA 4CG0A 4MIYA 4L0QA 1T6BY 1ZJ6A 4FJ2A 2DC1A 1AS2A 2D74A 1UQUA 2A5DA 4IWYA 1E5VA 4DARA 1A8IA 2ZULA 1QGUA 2OO7A 3F8TA 3GLUA 3JZAA 5FKJA 3WWPA 5G1OA 3ROGA 4KQHA 3RVPA 3GVHA 2ISQA 2F1HA 2J3LA 3GJ8A 3FCUB 5HGJA 3WK6A 4EJ6A 3CSSA 3IHKA 5KSOA 3SPXA 3C48A 2CE2X 2QN9A 3VPHA 1JEAA 5COQA 3ADOA 3EGCA 3WSWA 3U39A 1A7JA 1ZU4A 1ZKDA 3BSYA 3D54D 3K6JA 3LJKA 1V7ZA 3ZBQA 4BVGA 2QI9F 4LCJA 4QO7A 4E22A 2C9DA 5K45A 2OUKA 2DR2A 1AKQA 1BFUA 3K9QO 1QWOA 1RHKA 2C9BA 3THRA 5EPEA 1CQPA 2HTFA 3L5KA 3EXG1 3OJXA 5FTKA 1DADA 2GPTA 3H9BA 3TO5A 3TX2A 1HSZA 4PLPA 4ER7A 5F2EA 3ZCTA 4D81A 1WA5A 1L5VA 2R8BA 3W5JA 1S2MA 2O0LA 2XBLA 1UBFA 1DEOA 4MJLA 3LA6A 3EHDA 4BP3A 2OM6A 3RVOA 1LD3A 4ZYUA 4M8KA 3H2ZA 1NVVR 4NQRA 3S2ZA 4XFJA 4IDDA 1TO6A 3D0OA 4BEWA 3IXLA 4CMGA 2EF1A 2QZZA 3O5AA 4B76A 1MO4A 1DV2A 1PHRA 1J0AA 4FLMA 3GUYA 2HHCA 3RRJA 5B6PA 2X7HA 1MFPA 1J8DA 3W2IA 5HMMA 3O3MB 1P1KA 3T06B 3U7QB 4NBSA 3IT2A 1ZN7A 4PQEA 6GPBA 1IXSB 4O2BF 3WHKA 1FUEA 2ID8A 3C7CB 5C8DA 4H7DA 2HQBA 4DA9A 3E7DA 3MS7A 4GVPA 1KYVA 1EMDA 1QS0A 1P1HA 3AUYA 4HTAA 5MFPA 3BA1A 2C9ZA 2GCGA 5KNLA 2Q6IA 3NVMB 2ONZA 1PTJA 2DFPA 1OREA 1W4CA 4KL8S 5JBNA 3UMJA 1W73A 3KE8A 3UAZA 3KQOA 4JUAA 3SXUA 4M54A 4W5HA 3IP5A 3ROMA 1Z2PX 4S35A 2OR3A 1DZIA 1EINA 2A9RA 3A6GA 3CF6R 4N3AA 5EE9A 3WMEA 4D9EA 4EUHA 4JI0B 5DNEA 3R3UA 2CB9A 3O2NA 4LJKA 4OXKA 4YRFA 5AHKA 2HWWA 1P7YA 1FP2A 1GPNA 3LVQE 3KFVA 1VSTA 4WAUA 1BFKA 1FTSA 1X1SA 4ACAA 3R0ZA 3CURA 1JH9A 1XU7A 3CRQA 5ECDA 2K6GA 1C1YA 4E1BA 4UU0A 2D7DA 2FMHA 1TXGA 1ZUWA 2FUKA 4KN6A 3AR9A 1Y8CA 2IZOA 4D8XA 1V2GA 1O97D 1BN6A 1IWPB 3LBFA 2GEBA 2O2JA 3N1UA 1G6Q1 2N47A 3KQKA 3OQHA 5EJAA 4D41A 1QO0D 2FSGA 2PR2A 3A4TA 4IXWA 4KBFA 1E1QA 3DKRA 3G2QA 3PHBE 5FV7A 2NUAA 1C0EA 4EKYA 4K6GA 5L3SA 1A0OA 2AOUA 1JQKA 4LRSB 2RGNC 3D1JA 4IFEA 2O19A 5A71A 3TLXA 4QFBA 1CEXA 2BWJA 1A8PA 2UYQA 4IQ4A 3FHCB 2PSDA 4G63A 4O4LB 3LZ6A 2QRUA 2VP3A 4F21A 4DCNA 4D9FA 4E14A 3GDFA 1RRFA 2EYUA 3FFXA 3URMA 2JLXA 2UYGA 3LKVA 3STWA 5ED4A 4W1QA 5JD4A 2KLHA 1KVRA 1XXHA 2OP1A 4JVLA 3JYOA 1IDOA 4F92B 5EJEA 4FYIA 3IEXA 3OWHA 4NZNA 1Z29A 3F49S 3SJ7A 1NC1A 1XDGA 5EMMA 4KPEC 1M0EA 3KQTA 3TKYA 4R2KA 4D57A 3I83A 4GMGA 1PDVA 3ILYA 3AEZA 3DMRA 1Q0SA 2R8ZA 3AL2A 4PX2A 1HT2E 1OU0A 3M1IA 4HWRA 4KQFA 4AWAA 2BHSA 2I2WA 2UZ1A 4G2TA 4LNUB 1K2WA 2J4CA 5JAOA 2YKGA 5KBYA 4ZTUB 2UZAA 1K2VN 4XZ3A 4ZQFA 1L8LA 5FBRB 4BMSA 2YWEA 5BQ5A 1U5BB 4XJXA 4V02A 5E4JA 3S2GA 2JZNA 4HUQA 4NDNE 5D5QA 1FX0B 1PLJA 1DHTA 1SU7A 1BIFA 3BRWD 3ICOA 1XK7A 1ZCZA 2BF7A 3FKJA 3DDSA 3LX4A 4HAOA 1IZ0A 4JXXA 2JA2A 1H6CA 3TAUA 2PFGA 2H65A 1JKJB 4NARA 2O5RA 4CLEA 5CAEB 3OFNA 3ONWA 1XCGB 1XT6A 4JQYA 5AVOA 1Q0HA 1QO7A 1XQWA 1NYRA 3IP6A 5E4YA 4B2IA 2HCFA 2YICA 4M9RA 2WVGA 1SKMA 4OL0A 3ESCA 2MYTA 5I47A 3WYNA 1QOPB 1W0CA 1IVYA 2I6FA 3G5AA 2FEXA 3K1AA 5IBQA 1N4DA 2W4QA 2C2WA 5A62A 1EFTA 3GELA 5KQLA 4M0UA 2RB5A 4Z7NB 1OAAA 4WBNA 4CV3A 3KRTA 2PZ8A 3OQ1A 1KVUA 3CRVA 2AN4A 4J7XA 1FOEB 4Q12A 4QELA 3ZCVA 1TGVA 2QRNA 3QEBZ 4I2VA 5L45A 4MGYR 1MW8X 1T9GR 4BMXA 4LSWA 1ULAA 2GN6A 2UZIR 4OQXA 3C5EA 2BHNA 1VYTA 1Z39A 2GEDA 4F97A 2Y9MB 2C2ZA 4QTTB 1ETHA 1F8UA 1PEKE 2H57A 4JJFA 5BV8A 2ECKA 1NUPA 1RWWA 3JVEA 4QPZA 5C5CA 3IL2A 4O8CA 1Q14A 3GNLA 4KR7A 1ADFA 1M1ZA 2C1XA 3L0ZA 3W78A 4D3ZA 2JLBA 3ETLA 4HWTA 4RTSA 2YN4A 2OOSA 1IATA 5B7NA 5FV4A 5DT2A 2IDMA 4GZ3A 3QI7A 3GRFA 4DEVA 1KFCB 2IPLA 2QRQA 3HU5A 4PPGA 5C4MA 2W71A 1UPUA 1NATA 4EGQA 4RH3A 3GZ4A 3QU9A 3M5PA 1JSLA 4MVCA 3SJZA 3C5CA 1E1YA 1R5NA 1OI4A 3A4NA 1Y3AA 3INYA 1K6EA 4H7IA 5ALOA 5AFSA 2BM8A 2FN4A 4I7EA 4V1CA 1EX6A 4A0SA 4LFCB 1RWPA 3IBSA 1N75A 5KOHA 2C78A 4Y6GB 2I0FA 3MOGA 1ZG3A 4ZYVA 4KXUA 1H0SA 3JW8A 2BZ0A 1ODIA 1GNQA 5LA6A 3ZWNA 2OLKA 3UUGA 1WOYA 1QHNA 4GIBA 3BMQB 2ZI6A 1E2UA 3M8KA 4XQ9A 3JQRA 2IHJA 3Q3GE 2HJRA 1AZSC 1B93A 1FVHA 5C3UA 3E1KA 3LBYA 3ZW7A 4PG8A 1H9CA 4IAOA 1EGQA 3VH4A 5DCLA 5ALIA 3HZRA 3ZIDA 4GL2A 1BU8A 2ATIA 3QE2A 2OILA 3QLUC 1O6GA 3CZQA 3AH8A 3MFYA 1FRFS 1BA2A 3EIQA 4DLXA 4DBZA 3CB4A 3EQZA 1NIJA 2GBPA 3G13A 2QLTA 3K4HA 2JD2A 3UVEA 3AFOA 1L8AA 4PC2A 2DKFA 3ZVKA 2QTNA 2ZBDA 4G5SA 4RD6A 2HBRA 1Z0IA 3FCXA 1R9MA 3OWOA 1EE1A 3LY7A 3R0IA 3MTGA 4J0JA 4AZ0B 4QUEA 4DA0A 1CY6A 4P5DA 1RW4A 4REQA 3U7JA 4CDGA 5HF8A 2GK4A 1RYFA 3EH2A 1OA1A 1M6VB 4KKXB 4RFVA 3N3BC 3QKSA 2PLFA 5CK4A 3KKOA 4UCWA 2ZU6A 3VOTA 3WKDA 3KYIB 2I3DA 2GVNA 4Q4AB 1AQYA 2ZTLA 3H6GA 4RX1A 2HDOA 4FB5A 3WQHA 5CBKA 1D6MA 2W6PA 2ZPTX 4GPTA 4N4AA 5IJ0A 2BEJA 1KMHA 3NIGB 4I9GA 4Z3OA 4L7VA 3I73A 1G5RA 3E18A 5DK6A 1QLJA 1EFKA 5GJBA 5CYFA 3TCKA 3V2IA 4N8EA 3ITKA 1CC1S 5ESDA 2R60A 4Z4HA 2BGIA 5AVTA 3ER9A 2OHIA 4QA9A 1SELA 3Q9LA 4ZHQB 2J67A 3TD9A 1VE9A 3WQQA 4YWHA 1AK9A 1RXIA 3EAGA 3P7MA 3P4UA 4HH4A 1P80A 4IIJB 2NVUA 4FQ7A 3R7WA 1T9BA 4WXPA 1NF9A 4YRKA 4P53A 1SAYA 2CDCA 3N07A 2NIPA 3T6KA 4J0DA 5JRJA 2FSVA 2GF2A 2V6IA 1AKRA 2OP0A 1M2JA 1HSOA 3ILHA 4I1RA 4M6WB 4MWEA 4YMLA 4JBYA 4CBVA 1SD5A 5EIWA 1QU3A 4EUSA 2OZPA 1KDTA 1X15A 4AMYA 3W2EA 3CE6A 3OTQA 5M5BA 4LWOA 4HQOA 3OJFA 4CMEC 4LDJA 2P9GA 5T8KC 3DEJA 2JGKA 1JN0A 2IC5A 4FNMA 1ECBA 2WSIA 1PFKA 3KAPA 3QPBA 4CJXA 1YQUA 4RGYA 3LUGA 4N40A 4PLZA 3TXAA 4XWWA 2B1RA 5DX1A 2A0KA 4CM4B 1NJ5A 2FZ5A 3GJ5A 3V46A 3E7WA 3WB9A 2XCRB 4A3SA 1LLQA 2X5XA 4D99A 3E22B 2DYKA 2QMOA 2KPOA 1TD9A 4XEHA 3PTLA 8AT1A 1LXCA 5FD8A 2G67A 3S1AA 1C9NA 4CLOA 2NYVA 1EVYA 5KO2A 1EIWA 4MW5A 2POCA 1NRXA 1UT5A 1CUFA 2KX7A 3WR5A 2C4VA 3L79A 4LAFA 3BMOB 1MMFB 5SY6A 4E1AA 4YXWA 2VLBA 3HBAA 1E1KA 2WJZB 2JKYA 1UXGA 4GZMA 4BKQA 1TCVA 1UAGA 4HWOA 4U7PB 5CIQA 4L27A 3G5LA 5EFOA 3OM9A 3ZLUA 5KTNA 1EFCA 1I5RA 3LK6A 2ODPA 1VSBA 3BWMA 3NBYC 5L3QA 4TYNA 4IIHA 4TKUA 3PF8A 4J0EA 4D9KA 4TUYF 5DM2A 5GTDA 5JMOA 1V8FA 3QVXA 4RAQA 1Y7HA 2DWUA 3L7LA 4FFVA 1NLFA 1ZVVA 2ORIA 4HATA 1LPOA 2CLSA 4YP1A 3ZOZA 4B3XA 1EVLA 4LHWA 1G19A 5L3RA 1O03A 1FFHA 3UWOA 3NHYA 3AZOA 3D1VA 5CFLA 2NU8A 3T3PB 1ENPA 5THQA 2QJTA 2W2MA 4B4KA 5JCJD 3UAOA 2FY8A 1II8A 4BC1A 3OE4A 2HDNB 3FBWA 3I23A 1PQPA 3ZNNA 3EGDA 2DUNA 1RWVA 1X1RA 5LMNB 1WBDA 4QGBA 1WQ3A 1XMQB 4PYOA 4TZTA 1C8VB 5HZKA 2P9HA 3K70B 4C3OB 1UBGA 4RMJA 3M3PA 3G2JA 1OLXA 4LOLA 1QKKA 4MV6A 3SYRA 1Z6PA 4PGGA 3CWCA 3WWYA 1M34B 4RNCA 1VPTA 1PF7E 3OZEA 5AOAA 4EHDA 1XZKA 4X8OA 5FCDA 5JNSA 1NTRA 2FPMA 2X7JA 1GCIA 2PJUA 5TY0A 1Z74A 2AB0A 3W5VA 1XQ1A 1BDIA 3MQ2A 3HBNA 1FJ2A 4PNPA 1RAIA 1PSZA 4BZPA 1GO2A 1X7XB 5HUJA 4LSMA 2F4VB 5KX5B 1U5CA 2A33A 1XZEA 2NUPA 5FLKA 5EKSA 4ALJA 2BI7A 1Q12A 3AWIA 4BKUA 2ZYHA 1I6MA 1QIDA 1SUAA 5I8PA 1SB8A 3DWFA 2QRGA 5EZQA 2NVBA 3C4JA 4AS3A 2J0EA 3UBTA 3FTPA 2YR0A 4W7IA 1QLHA 3A6FA 3L6OO 4HRAA 1JDUA 1EFVB 5JUWA 3EZGA 1ZN8A 1GARA 2FSSA 3V33A 2G7MC 5A9RA 5LP6A 4DV0B 3VTAA 5JARA 4NBTA 1KNXA 5C1DA 2X2EA 2G0TA 4PRKA 4C06A 1SVMA 4G4GA 3ZJYA 3PX2A 4Y18A 2WJHA 1ISMA 1KAMA 4MB2A 5EIOA 1ZLYA 2ZYVX 3EG5A 3KS9A 4RIEA 4CMHA 3BXXA 3BT7A 1EB8A 3VNUA 3TZLA 5KYKA 1TLFA 1KJJA 1CRWG 2ZQYA 1XCJA 4IKEA 1I2AA 3FYUB 1M1YA 1CG6A 1EGAA 1MX1A 4ES6A 2IZ1A 2C97A 3C1UA 3B52X 3ZWWA 3UJBA 2HSGA 3MJEA 3ME5A 5BWMA 2PDAA 3NHSA 1U6KA 1VLZA 3L2OB 3HUUA 4KO8A 1CYEA 1SCJA 4YLEA 4D8YA 4IJMA 1NR1A 2OGZA 1YQWA 1K3FA 2Q49A 3ICWA 1RNLA 1CLUA 2XQGA 2QX4A 4ZYTA 5CJPA 5HKBA 3KZKA 2BDUA 1VLQA 2J9GA 4GPZA 3M2PA 5EZYA 4UMVA 1RDFA 3E5HA 3ROQA 4XB2A 2P0YA 4IY1A 4JYAB 1BMDA 2NGRA 4G9GA 4YCCA 1EUYA 4Z3DA 1JDBB 3PVZA 3KVYA 2MT9A 4K40A 2O2YA 2GO7A 3M83A 4MV5A 4RD4A 1M2HA 2OG1A 5ITZB 1NLZA 4DA4A 2XA9A 5CNKA 1IOLA 3HABA 2YYYA 1O6FA 2XTAA 4HCJA 4QYMA 3CUWA 2YV5A 1J07A 2QRKA 1DQPA 1Y1TA 4E4YA 1B26A 4GKKB 4Q3AA 5EJMA 1GT91 3HFJA 3K5WA 4OF4A 1X14A 1XDSA 3K9CA 4FB4A 3LL4A 5DM0A 1I2CA 3ICQB 2BFBB 2QN1A 1NP6A 3I42A 4ZVLA 3FOWA 1VJTA 3NP9A 3D5EA 4LKOA 3BBLA 2DGDA 2E9SA 2GHIA 2D8AA 3IAXA 1Z63A 4AS2A 3VRHA 2IYFA 2RGNA 1G5IA 4HDCA 3CEAA 4WXHA 3WGQA 5LUBA 3BWYA 2R4QA 3BFJA 3JQ9C 3RWMB 3I6QA 2QLNA 3UATA 1OIWA 4MWOA 3TW0A 4MV4A 5KNCD 1HNZB 1CQWA 1NBHA 5IMBA 3UGQA 2UYHA 1XQYA 1VBMA 3E1GA 1M75A 2AKYA 3AY7A 3SBOA 2G8NA 2RGEA 3LDFA 4KYUA 3RS3A 4KFTA 1Y5NA 2PUTA 4TYPA 1ZN2A 4I08A 4ZAFA 5LDDC 5LQNA 2DPXA 1XNJA 3BKWA 5HUQA 2YVKA 1RZUA 4UPVA 2X8AA 16PKA 2BEKA 2OE2A 3ZV4A 4BL5A 4TWBA 4DZTA 1HG1A 4LMRA 4YRGA 3GLFA 5KJCA 4OKNA 4KWHA 1Y6GA 1T5LA 2QTZA 3KE9A 2WKWA 3AVOA 5K0TA 4XAQA 5ALEA 1BOOA 2FVXA 1KEKA 3ZHUA 5LIPA 2Z09A 5DN6A 1L2TA 1O8CA 2Z9DA 2A3NA 3JALA 3KPJA 3TB6A 4ZV4A 3HN7A 4OHUA 3MUEA 5JZVA 3EZLA 4XCQA 4G86A 2QZJA 3KR9A 2D8MA 3OECA 4M0PA 4RD1A 3TYXA 1M2NA 3FF4A 3P0JA 1G9XA 2K2WA 3EGIA 3L7NA 1HK7A 4DMUB 2PJRA 5F2KA 1K68A 3ZDEA 3LPCA 3MJDA 2G76A 1LK0A 3AKCA 3IIMA 2H8KA 4XYEA 3SSMA 3TNYA 3IQDB 4ZWNA 1KVQA 3PC8C 4BZZA 3HKBA 2G0AA 2VXBA 2X0FA 1OAOA 1G4AE 1W2HA 4Z1MD 1EWVA 1WF3A 3S7ZA 3PWSA 1UT8A 1UBHS 4ZO8A 4QVIA 3W3ZB 1G21B 1YUNA 2FG7C 3MGBA 3HRKA 5TPZA 3ZDDA 3DHYA 3JWPA 4WECA 5CTJA 3RHFA 3A1SA 1QGOA 2JGEA 1L5OA 1ULHA 2Q9UA 3ESRA 4LG1A 5E9AA 1G38A 1KAGA 2PFKA 1XLUA 5HZGA 3WXMA 1X7YB 4I8IA 1HL3A 4IIUA 3WB0A 2XVMA 5F1YA 1USUA 3EDCA 3KYDA 5TX7A 2GBLC 3QVTA 5FBZA 3NANA 2NG1A 4AX8A 2XMQA 4MUHA 2R8XA 3P5SA 4CR8A 3I6BA 1H2EA 5BQ3A 1JGTA 2OHFA 3A0UA 4FUTA 2JCVA 2V9ZA 3BHMA 3H42B 3R5KA 3MNFA 4XDGA 1UC4B 3ND7A 1XL0A 1XTSA 2JI9A 1OASA 3BM5A 4PNHA 5F1KA 3VV2A 1QHXA 1UBJS 1PGOA 3I2HA 4CM9A 4GOXA 5LBTA 3NHWA 1P1JA 4HX5A 3PC4A 4PZ0A 3BILA 5E38A 3SLGA 5K8UA 2VPTA 1VJCA 3BHJA 2DWCA 2ZQ5A 4DY6A 3MA0A 4ZOBA 4BNLA 4RO0A 1MN6A 4YJ3B 4BO6A 2JLSA 3BHIA 1JLRA 1QH8B 2WU3A 2A7XA 4K0RA 4R0VA 4B43A 4AL4A 4C78A 3E9NA 2FKNA 1Q0UA 4G5OA 1N5DA 4JAVC 1K5HA 4KXNA 2ACKA 1AKNA 1WQ4A 3OEED 3L0CA 1JX6A 4R5MA 4RVHA 4TV8A 1GR0A 2HSZA 3B9RA 3TFQA 3MD9A 2MYUA 3CUVA 3AF6A 3WL5A 4QEDA 2FF7A 3SDZA 1QC5B 2ZAIA 2Q0XA 1NVVQ 3CF2A 4AQYB 4LHVA 2ZAGA 3IUMA 3SMQA 4OA5A 3ID6C 2BGJA 3WZLA 1ELOA 1R5JA 3RIEA 1U7UA 1PR2A 3TF5A 3QTLA 2CJPA 2O0MA 2B92A 3AV0B 1QKJA 2FMXA 5IYZA 2JVJA 3N0TA 3GEDA 2PGNA 1X77A 1W49A 1R6DA 1XSEA 3Q7RA 2QTLA 3JD1A 1RM0A 2XITA 3B3GA 3NTVA 2D1FA 5B1EA 4QDKA 3LQRA 4F0JA 3R8XA 1TRHA 1UEXC 5L4NA 4AUNA 3K15A 1KDVA 4YV2A 3HPRA 1NAIA 1XLVA 4BUCA 4BWYA 1U2EA 3CF4A 1MABB 2YIJA 2WWRA 5IU6A 1FP7A 1R15A 1UM9B 3ANMA 5I9LA 5J4VA 2W2KB 4HR7A 2VH5R 3ZDZB 1TF2A 2ZRJA 3NBAA 2NXWA 3S8EA 1B1CA 2ZRFA 1TTPB 1LA2A 4QYXA 5F1OA 3K4QA 4HF7A 4XQ0A 4UPEA 1EK0A 1SIWA 4HNTA 1CJKC 1FIUA 3NTXA 2XVAA 1KY2A 4GP6A 4L28A 3FROA 3VISA 2IHVA 2WG0A 2ZRDA 1PKXA 3Q6MA 4ENQA 4JJGA 4RIHA 4C21A 1EHIA 1I6WA 4CV2A 5JYCA 2PZJA 3HV0A 1FJHA 4FGSA 4MWSA 5CXSA 4K8OA 3RSFA 4AJ4A 4CPDA 4Q1FA 3ZJTA 3FOBA 4MLPA 4DCUA 3K92A 5DYNA 5T3YA 1GGHA 3U3JA 1WMFA 5LD2B 3FOAA 4I8XA 5IJ9B 1SUIA 4Q7KA 2FRDC 2L0XA 3L7AA 2JAUA 4BX9A 1FSFA 1OBVA 1WMDA 4FVTA 4HLDA 1D6JA 2MIIA 3Q7TA 2IXEA 2NO7A 1E1QD 5E1OA 5JWOA 2NZVG 3ZR4B 4Y9SA 4YT2A 3PUXA 5CEEA 1DCFA 4G0MA 4RVCA 2H85A 4NBNA 4WA7A 3BPSA 4HH1A 3WGNA 1P74A 3BXZA 3H11A 1DARA 2P6PA 5EN4A 1NP3A 2GKGA 3SSAA 1JPUA 4TTSA 1IE3A 3KX2A 4MUBA 3WGKA 4ISBA 1XRLA 3SC2A 1KJQA 4BRUA 1W1UA 1Q2XA 2CCGA 4KV7A 4MAMA 4WN9A 3RAPR 3CCCA 4TTRA 5EJ4A 3RROA 1QCCA 2PZMA 1NN3A 4DMKA 4MW2A 2RGYA 3MAGA 2EBHX 3HA3A 1GSIA 4KDRA 3I6MA 4K6FA 4ZAWA 2VZEA 2JFYA 1XPRA 1DFHA 3MD0A 1H3FA 2YQ5A 4K86A 5BN5B 2ECOA 2VKQA 1P2GA 4AT1A 2P77A 2R6CA 2YH2A 1H5QA 1NZFA 1B8NA 2ZPAA 4WZBA 2PLAA 3PIIA 5TARA 4YUYA 5T8KA 3JYLA 1WXWA 1LBQA 1T2DA 1XCPA 2B8TA 1XZHA 3FOCA 4ZTBA 4JLJA 1EWTA 5AUQA 4E12A 4QGSA 2Q1TA 3HE3A 2HPZA 2JH9A 4KG7A 1GPMA 1U4OA 4KE7A 2WKRA 4OA8A 4YJHA 5E6RB 3UK6A 1EFRA 1E9AA 2WLTA 4Y6OA 4G0NA 4LCEA 3WLPA 4WZAE 2Y76A 4CM8A 2OWDA 1KETA 3OPYA 4O4IB 1SM4A 2VP2A 2LKDA 2X8JB 4RACA 1Y9EA 3K0SA 5J2TA 1KEPA 2CHGA 4AVYA 1Z0KA 2A1TS 1ZY2A 3G8BA 4OFWA 1K7EB 2XA2A 1NLYA 3I53A 4EG6A 3O84A 2RH4A 1ZHHA 3T35A 3F1LA 3OFND 4MO2A 3H0KA 3EGXB 3KT8A 4LJ4A 2Z5GA 1WBJB 4XSVA 4GUAA 1WPRA 1QIHA 5A4KA 4CT0A 3L7KA 3NC1C 4EUKA 1LBEA 1P60A 1YMQA 1ZUHA 1Z13A 2NAPA 5C46F 3SX2A 4BC0A 1VKNA 3HJNA 1RMYA 5L7YA 4EOGA 4R2JA 3ZDFA 2ECFA 4NE9A 4TKVB 4OB8A 3TR5A 1R00A 2AD5A 1XMPA 4CL8A 1GZ7A 1W36B 4TL8A 1XTBA 4TS1A 3IE1A 4B6EA 2F67A 4DLZA 2SNIE 2UXDB 4K9KA 4A7PA 3CU5A 3GBPA 3U17A 5EJ8A 1L5QA 1XQ9A 2WYOA 1C3OA 2BLNA 3OSZA 2EKLA 4FIDA 4IZOA 3H9JA 1PT7A 4UPDA 3DV9A 1HOTA 4V0MA 4Z4EA 1AK1A 4COOA 1HKHA 2ZTVA 4JJAA 3TD6A 5AI5A 4X9XA 2CHFA 5CM8B 3REQA 4Q1AA 2VXYA 4N18A 1ZHFA 3I37X 5D51S 2XTMA 2R9VA 5I8ZA 1DAOA 5JSZA 1KZHA 1DUSA 4H7HA 4BCBA 5CA0F 2B83A 1NUHA 3B1WA 3N2KB 1BHO1 2OHJA 4IDCA 5FL7A 2IP2A 2EEPA 1G3UA 2GPWA 5AVWA 2XZDA 1XZBA 1I36A 4HN2A 4EYEA 3LOPA 4QU8A 3AEKA 1IQPA 3OKPA 4EPTA 2O1XA 3TBHA 3AUSA 4K0KB 3VPCA 5CVJA 4U2EA 4AXBA 4W99A 1DQZA 2NUTB 2FUCA 2OZLA 5EIBD 1GVNB 2QZ4A 3FLAA 4Q3LA 3TMKA 3KLBA 3R6DA 2H8GA 2IY9A 5A7FA 4D25A 4HQKA 3Q8LA 4AKIA 1KOGA 4LHEA 2OXEA 2D5AA 3U09A 4YPVA 2NV0A 2IIPA 4YAEA 5HKKA 4AX4A 1FQKA 2CV2A 5J5VA 2Q3LA 3V1MA 3R3JA 1Q1NA 4V0SA 4N76A 1E8DA 4E07A 4RJLA 3MTEA 1Q7RA 4CKBA 1NV9A 1TVMA 1UJMA 1RJGA 3JQQA 3JZDA 3EZ2A 3PHCA 4MWBA 4LJ8A 4HPJB 1O95A 3DL0A 1KEZA 4RYLA 2BSAA 3DZCA 3E9YA 3P0FA 2J4DA 4ZU6X 5J40A 3OQBA 3F2IA 4EB0A 2Q8QA 1DQNA 1OHHA 3LYHA 2H52A 1UDCA 5BV1A 4HSEA 1GG8A 2D3TA 2XMGA 5EQDA 1E9SA 3UCXA 3W5CA 1K97A 4NCHA 4CF4A 2Z8YM 2HWYA 4TRRA 4RGBA 3NYQA 4FILA 5G4KA 1DAGA 1GV0A 5LOVA 4WERA 4OBXA 3CG4A 2PSFA 3OPMA 4LTMA 3Q3JB 2PX5A 3H3XA 2DMRA 5E6UB 4HPXB 2Q3MA 1C9JA 1C14A 2YC4C 5HRUA 1QF6A 1MJFA 1YZ3A 1FU8A 5JG7A 3N7AA 4UEQA 1R8QA 1YZUA 1VSVA 2EP5A 2YWXA 4YRQA 2H5JA 3OX2A 1UOQA 1X80B 5DYYA 4EW3A 1N5JA 3PENA 4WBXC 1HPLA 1V5EA 2P6MA 3IQIX 2XMPA 4E7PA 1NSFA 2JGFA 1C2TA 4LF8B 4A8HA 3AF4A 4CEIB 4CUZA 4JNKA 3PHGA 3AM5A 1U0FA 3VSDA 4GDMA 1PX0A 1WR8A 2REXB 3DLPX 5KYVA 3SY8A 4BTVA 5H80A 2ZBPA 1SQGA 3ANNA 4O5AA 3UWSA 5AUPB 4URHA 4ZOCA 2E37A 5HYVA 3D8SA 2W43A 3CO5A 4H1VA 1L9XA 1P91A 1NYTA 2GN0A 2H29A 2IXTA 3P94A 2X23A 1NVDA 4X65B 4LFBB 2X6RA 3F98A 4B71A 3OIVA 4EZEA 4GZ5A 4OHXA 4RPKA 5HJ5A 3AR8A 2B4TO 2AGVA 2EL7A 5JJKA 1GA1A 4KPUA 4CKZA 4OSPA 4R31A 2BYTA 2UU9B 3SN6A 5A0VA 4G07A 3A4VA 3ZDAA 2NSDA 4ZCQA 2YOFA 5FOSA 3Q0TA 4D79A 4LNHA 4TXLA 1ZMTA 4L0CA 4HRXA 5HIKA 1G2IA 2WILA 5BT9A 1VA4A 1S01A 3QELB 1P5FA 1X38A 1XTQA 2BM9A 2R4TA 4TZ0A 3JQ9A 1YDWA 4OXXA 4YRNA 3TKLA 3DZKA 3JD3A 3PTAA 3TUZC 2FEOA 3IKVA 1U7OA 2Y77A 1RC1A 3ZE8A 5ARDA 5FP0A 1UOPA 3R3YA 1QHSA 3VC7A 3AVTA 3RS7A 1P7VA 2BUBA 5DLYA 1Z0UA 3CX6A 4Q4JA 1RKQA 4I50F 4IIDA 3SS9X 4R3WA 3W6NA 2VCEA 3HRHA 4IUDS 4GX5A 3TLGA 2AG0A 4IVRA 3EXIA 3KSMA 4IWXA 1DIOB 3W7VA 4CKEA 3D3WB 2DECA 2D54A 1TQ8A 2PKQO 3WMFA 3QOWA 4CDMA 4D3FA 2IHZA 1TJNA 2WBLC 2IIVA 3GL9A 4KVAA 3TLKA 5CYGA 3I76A 4A0QA 5JO0A 5HOQA 3E2MA 2P5UA 3Q4GA 4KWIA 2QTAA 2ZW9A 3P8ZA 4EQZA 4TRJA 2DZDA 1MV8A 5H70A 1ZL2A 5DTIA 4XARA 3ENZA 1N2ZA 1USVA 2RHCA 4TOIA 2FWIA 1LW7A 3FUVA 2F43B 1A4UA 4JJ4A 4REOA 4G26A 2QG9A 1JEQA 3SZRA 4B0PA 4PC6A 4BLPA 1Z4NA 4YXWD 5JCOC 3MHPA 4MUKA 4PPFA 1ZNZA 3BWVA 4UAUA 2PKRA 5DVZA 5FI3A 3RYFA 2ZJ3A 4QUBA 3GQBB 1F0NA 3PC8A 4WK6A 3SM3A 2Q9CA 3S5UA 3GLIA 1CBUA 1W48A 1AGNA 4TMVA 3KYJB 4OHRA 1ACLA 1CU1A 5I51A 4OGLA 4LBZA 1UDBA 2ZJYA 3AY6A 1KH1A 1N9GB 1WMEA 3OC0A 4LI3X 2WF5A 2EJTA 2OAEA 2XGSA 3A6ZA 4H0FA 2WG1A 1XE3A 4XSHA 1YZNA 4C0JA 3D0RA 1OWNA 2FN9A 2IEDA 4FK8A 3ITEA 5B4VA 4Z9XA 4FEEA 4RPCA 5DNUA 1N5IA 1N6RA 5TE9A 2F90A 4DRYA 5KSYA 2RC5A 2GBLA 3DGEC 3HA7A 3NDPA 2UUCB 3VKVA 4EEXA 2F8SA 4A36A 1FXWF 3C1AA 3FXAA 2NZWA 3FN4A 2AKAB 2VA9A 3FZEA 4IXNA 1L5ZA 4QDOA 4RKYA 1R1DA 1YS1X 1DJOA 1QFJA 3U4DA 2IBSA 2OG2A 1CYDA 4QGFA 2C2OA 5EE5B 1E0AA 1XV5A 1AA6A 1N6LA 3QG5A 3RSCA 2NTNA 1YA4A 4MKHA 1H93A 1M67A 3HBMA 1UPFA 4GBMA 3HVRA 4DAEA 1AGRA 1Q74A 1YMUA 1Z4MA 3ZHTA 1AURA 1T0JB 2EZTA 1G291 1FC0A 4OSOA 2PBRA 4RC9A 4DSTA 2I22A 2J87A 1S2DA 5LB4A 3U3ZA 5DYGA 1Q0ZA 1M7BA 3TS1A 1T36A 3PPYA 4P3OA 4FKZA 3WLKX 3AO0B 5KIAA 3NTUA 3U7QA 2ZJZA 2AW5A 2E89A 3O2SB 1XEWY 1ZO8A 1C1DA 2P2ZA 1S7CA 3FFWA 3L0SA 4Q7LA 1GR1A 2AHOA 3C97A 4LOJA 4RFSB 4ZZ0A 1J90A 2AYYA 3PQ4A 2YVUA 4JROA 4ND4A 4ZU3A 5JC8A 1P7ZA 2RSLA 4MPRA 2FX2A 3L82B 3QUBA 4DUYB 3PGA1 4Y7DA 1P1BA 2AZXA 1T9CA 3E03A 3NC4A 4J3NA 3RUPA 3RVBA 3GJZA 4CF7A 4EB3A 3I6YA 3QFSA 2PLWA 2HU8A 1YNOA 5KI6A 4PZAA 1RXSA 3ESZA 1AKYA 3BTVA 4FR5A 3HG7A 5K3CA 1T1IA 4NE2A 1J4AA 2FFQA 4Y0VA 5BMVB 1XIVA 2I62A 3H8WA 4N0MA 4OQDA 1MJ5A 4CEHA 2QZPA 1XROA 1MTZA 2IFTA 1ZRNA 2AI3A 2RH5A 3BFXA 4A91A 2YJZA 5EWMB 4M0LA 4P9NA 1B7GO 2WTMA 4HXYA 3IFSA 1IXRC 1PDWA 1HOXA 4B9EA 3GFRA 3SHOA 3WFJA 2C7PA 1NP7A 5C5EA 2WT9A 1IZ9A 5JDCC 2DPYA 3QY9A 3GN1A 3HBLA 4G01B 2QRVB 4B34A 1V7CA 2IW1A 1DIBA 2VAMA 4MYRA 4UCXA 4N8DA 4UQLA 2PPVA 3BTSA 1SFRA 2DPLA 3DEAA 3FX2A 4ZRMA 5ECYA 2W0SA 2QUIA 1WNTA 4YHBA 5U4QA 2FWMX 3MGAA 3ZVRA 4D7AA 1IONA 3KV1A 4UVDA 3CC8A 4Q24A 1JSCA 4HYEA 1PFQA 1HDGO 3UKDA 1H0KA 1CS4C 2JATA 2OUIA 2ZIEA 3M6IA 5ALPA 2QXUA 3F71A 4O2BB 4HMQA 2EXXA 2FRDA 3CF4G 2C5HA 2G0NA 4TLCA 5EJIA 4CV1A 3UXHA 5DTRA 1N36B 3VFDA 2QGNA 1JJAA 1VTKA 2BH9A 4C0XA 3GWZA 1ZQ9A 2W93A 5DM70 4NEQA 3PUJA 4JB8A 5TRTA 1CUUA 3KKQA 4ND8A 5TQVA 4D0SA 4CN9A 2XE6A 2C98A 3P9QA 1T3LA 1GDHA 4OH1A 4UD2A 2Q5QA 5FNVF 2DLDA 2XHEA 1M1NB 3K2EA 4QYWA 3FPHA 4RW0A 2CGEA 4M0CA 4CIDA 2VF7A 5IBCA 1Z36A 1KP3A 4GOLD 2YVAA 3BRQA 4DR1B 2O54A 2HJ9A 5LJLA 4NYIQ 4E5MA 1GNPA 3TTXA 1E6UA 1LRLA 4K7JA 4TT3A 2OXIA 3STTA 1NG1A 1T8TA 2DTXA 4L8LA 3JQBA 4J94A 1A8HA 4FYWA 4W5NA 3FI9A 1U5BA 2EIXA 4OHFA 2EFJA 3LTNC 2VT3A 1MLDA 5KTOA 3TCNA 5DI3B 3NAZA 3PNVA 4RVOA 3ZQUA 3ZYCA 4C7BA 1XZ8A 3UMMA 2PLRA 3E5NA 4KBYA 4QEZA 1JHYA 2Y1LA 4JB0A 3TW8B 1JL3A 1WJGA 4CM1A 3R0XA 3WYCA 3QG1A 4D4IA 4QWMA 4NXMB 3WWDA 3R74A 3COWA 4HEA1 4JUBA 3ZGXA 2OBXA 3TZCA 4V03A 5HE9A 1D07A 4E5PA 1P7CA 1NXVA 3GLGE 3WJ2A 2PZKA 2YFQA 3RJZA 3NFYA 4QJ3A 4ETNA 5F5XA 1DXHA 1NW3A 3QUCA 3TVYA 4K6MA 2FK7A 4Q3BA 3KWLA 2X4DA 1GTJ1 3TQQA 1OXKB 2C9YA 4JEHA 3WNBA 1Z6YA 5EYPB 4LYFA 5KDDA 2A9PA 5TPZD 2ATEA 3MZ0A 5HMLA 2N3ZA 4DLKA 4OHKA 2E1RA 3BAZA 5JR3A 1VL1A 4BZXA 1LJUA 2ECQA 2W90A 2C61A 4E6PA 3KSAC 4XFDA 4K9QA 3R9WA 1JW9B 4W9RA 3B60A 1Z8FA 2RE8A 2I4NA 4RDXA 3KB2A 1KQGA 1Z08A 2PZBA 1ZNQO 4FCCA 2JHPA 3SI7A 1TCCA 1Y4DE 4KN9S 2RHHA 4IIFA 4KSYA 4QHYA 5C8ZA 2V6BA 1DU4A 1JG7A 1JQJC 1MUUA 1SC4A 1WHSB 3PB3A 4JLSA 4QOSA 4CTJA 2F48A 3KOYA 2HFJA 4R1NA 2A92A 3P9SA 2O6HA 3EK2A 1Q91A 1DZ3A 3R09A 4XGKA 3WGYA 1CY2A 3WYAA 5BN1A 3OM8A 1NVKA 3AT1A 4LHXA 2IEBA 4QJIA 2VHQA 1XDWA 5F7OA 1LS1A 3PP8A 4CM9D 1G16A 3L4KA 3LX8A 4INAA 4DIFA 4LF7B 3L7DA 4IUCS 4YT5A 4H77A 3EGEA 4ZPXA 4BP8A 4MLZA 4MQFA 3QE4A 4Y9TA 4R1TA 2QDKA 4I5FA 3X1XA 3AIMA 1BEZA 3WWZA 4RTLA 3DGFC 3DHNA 1VFNA 1X7GA 2EKQA 3H99A 4M37A 1KKUA 4AF7A 1JAXA 2VC2B 3D2BA 3A9WA 1PJSA 3EC7A 3K9BA 4HQ0A 2R6R1 3L7BA 4F46A 3K09C 1SCUB 1A71A 1KE2A 3PUHA 2NTJA 5A04A 3QV1A 2Z2ZA 2BFNA 2B7BA 2O2DA 3BMQA 3BXEA 4B3GA 1W0KA 4JOQA 3RIYA 4WY8A 4QULA 2ONJA 1CB7A 1SKAA 4UFOA 2DPMA 1N4AA 3THYB 4WTOA 4YONB 8LDHA 4KFCA 3ADBA 3NNDA 4XVCA 2CNKA 2DY0A 4UTXA 3HFGA 5CRIA 3NM6B 5K6AC 3CEMA 2CKDA 1ZAYA 2ORYA 1JA9A 5FADA 2O3JA 3EAQA 1U1EA 4YYZA 3FCYA 3GCGA 2J7KA 3JARB 3RU3A 2ZDGA 1IPFA 2MHCA 4G1UC 4MA5A 2HIMA 2Y1OA 5KWEA 1ZITA 1MAVA 2XQIA 1Z9BA 3EZFA 3PJEA 2M6KA 5BSEA 5C7YA 5JZOA 2OFWA 3RYCB 1D6SA 3TMAA 3KKZA 1SKYB 3ZYZA 1N8SA 3D3KA 1ISPA 3PHJA 3GR6A 4YMWA 4CQMB 1U7WA 3NGMA 2HK7A 4AZ0A 1FP6A 1DAKA 3AUXA 4BNYA 4BIMA 2XADA 4H7EA 4RTNA 4I5EA 2RBKA 3PX7A 1L3BA 1XTVA 1PG2A 1GDDA 3C6QA 1K7XB 4MS3A 4BVEA 3DOJA 5JAMA 4OK5A 4PGAA 3M3DA 3JASA 4A10A 3HACA 4JLDA 4EKGA 6CHYA 1GIAA 3VBCA 3AWDA 2VDUE 5T57A 3MJTA 1YE5A 3FWZA 3T1YB 5EY5B 2ZJ8A 4OHZA 2ZRKA 3L8EA 4YDHB 1XCOA 4KHZA 3G49A 3PRHA 4B7ZA 2ATVA 2AWOA 1XN1A 1KNQA 1SOVA 2A94A 2R5FA 2YZ2A 4Q7JB 4RF5A 3TIXB 3VR5A 4ZTZB 2PL9A 4D9JA 1XPJA 3COZA 4PWZA 2PGOA 4C4OA 4ZHQA 2LBPA 3C3BA 2F3QA 2QTVB 4IIJA 1X13A 1JZSA 4Q4CA 1LCIA 2DLNA 2PEZA 3SWWA 1U8AA 2J4FA 5EHIA 1XYVA 2PX8A 5M7EA 3TOCA 1E6MA 3PCTA 3RTDA 5FPTA 5EKUA 4ECAA 4WH0A 3OVMA 1M2VB 2ZIAA 5LXTB 2OC9A 1Z33A 2J1LA 2RGUA 2GB4A 1QTQA 1BS9A 1U63A 1VMEA 2V4UA 3LUFA 3WWCA 4N7JA 4RY9A 3HYNA 4ZJUA 1LWNA 4RHFA 3UKOA 1RXCA 5B3KA 1YJBA 2QJRA 1Y98A 3STXA 5E7IA 4D8VA 4F4HA 5BYBA 4XI9A 5G53C 2HJSA 2B4AA 1A9XA 2PR7A 4J0IA 4CM4A 1NQTA 3D43A 1OXTA 2GA9A 5HK8A 4AROA 3OZRA 1E96A 1Y5RA 3VPBA 3E22A 3ASYA 4X7MA 2F17A 4FPXA 3WS7A 4GHWA 3QHAA 3T1QA 1G2QA 3MUNA 2OORC 3SIWA 1Y7IA 2C1EA 2Z4RA 1C41A 3TRFA 2WWFA 3W8FA 1UMBB 1K0UA 1NE2A 2LP4Y 2NWQA 5C37A 3K8YA 2QQEA 4CIXA 3DMNA 4EX7A 3IO5A 3W5HA 1TA9A 1F2UA 4AMVA 4AY5A 3PDIA 1P8AA 1X1BA 1JLMA 1K4YA 4F6LA 3BMOA 1V16B 3HCAA 4HP8A 3KL4A 4QDZA 3WRYC 5JBIA 3IS3A 5C81A 1I5OA 1P9WA 4C20A 1AHNA 4CQLB 3W3AH 1ML3A 1HDIA 1WEKA 4G0XA 4KNVA 5AI9A 2CJFA 2OLJA 3EZ6A 4WZAB 3PFNA 1BX1A 3SBXA 2CLCX 4O2AA 1E3JA 3KVOA 5CD9A 1HQKA 1MO2A 4NEHB 2GXAA 4EPRA 2ASVA 4K2HA 3UA4A 4YI5A 1GCAA 2WMYA 1UBCA 4YK7A 4DV2B 5DHTA 1FNSA 4URVR 2E4UA 1DKQA 5JS1A 1NBMA 3OZDA 1Q83A 2P4QA 4ME6A 4MQBA 1QPGA 5JCOA 4CZ2A 5EKXA 4D1YA 1G0OA 2F4NA 2VHYA 4OGKA 3T3EA 4OP1A 4D26A 3HCOA 3HMKA 3MTJA 2HT1A 1X7ZB 4M0KA 2NXNA 2CYAA 1HT0A 5THKA 4AJEA 2P75A 1E4EB 1OX4B 1Q50A 2R00A 3CG0A 4RJKA 3PLNA 1JFFB 1H66A 4Q34A 3BZBA 3RNOA 5LZ2A 1Q11A 4E5YA 2K2QB 4UDYX 3BD6A 1M34A 3AYXB 2D3WA 4TMZA 1V1MA 3GFVA 4HUJA 3N75A 3A32A 4RMGA 4V3CA 4PZPA 1BDMA 1J2TA 2DUWA 3AB7A 3F0TA 4QLOA 4RKEA 3D4OA 2LKCA 3PNPA 1AN0A 1WKCA 3AHIA 4NV1A 3NJ8A 2VXCA 2A57A 3IQEA 4JI6B 4BMCA 1R5OA 2HOQA 1X7XA 4K9NA 2AJ8A 4II7A 1T4CB 3SD7A 4P0TA 5FL7D 1EJBA 1NSTA 5DK4A 4PF1A 1YCFA 2OXRA 3VO9A 3GAMA 2J6HA 2PKQP 2QD1A 2ZWMA 4F60A 3VC1A 3BA6A 3GN2A 5CGZA 5JAPA 4BLTA 3OUTA 1EFVA 1L4BA 2WRZA 1IOVA 1HNNA 4HL6A 4ZEXA 1ZEMA 1ZGCA 4HK4A 4TUYB 3FBGA 3S40A 1CIPA 3U7IA 4D6XA 5KC8A 2Y68A 1LUAA 521PA 3L6CA 5HIIA 4ZJYA 1UPXA 4ZDIA 1QHYA 2FP3A 3H65A 1TEVA 2AXEA 4XFKA 4ZA2A 2J30A 3HVKA 4LEIA 3NVAA 1MC4A 3EWAA 3MRSA 4BZWA 5HKKD 1T9ZA 2QJWA 4TM7A 2WWYA 4B3CA 2P8SA 4Z6KA 3FYUA 1JHPA 3QEMB 3YASA 2CD7A 2CJXA 1FXSA 2PZFA 1CSEE 1BNCA 2WW8A 3P96A 4FT2A 4G81A 4RU1A 1O95D 3ZZMA 3DR3A 2PAFA 1H0HA 3UUEA 5AM2A 1A27A 3I30X 2H4WA 4KE6A 1OHHD 4YIHA 1P2TA 4C01A 4FZVA 3O4VA 5HSGA 2QUZA 3QOFA 5KX5A 2H06A 3HY6A 9GPBA 1QBGA 4A92A 2GRUA 2HSDA 4FDMA 3AI7A 1E8NA 3EFBA 2XRZA 2PV7A 4RKRA 1BSVA 2L18A 2ZR0A 2I9PA 1F4VA 1MNAA 4LY3A 3DZFA 4Y67A 2CLIB 4N5IX 4YC7A 3T94A 3UICA 5ITZA 4J0FA 3AFHA 5TSDA 1B8OA 3NHBA 1RBYA 2ST1A 1GPJA 4Q9NA 5IKOA 3TR0A 1H22A 1Z5VA 3IAUA 4F96A 2XB9A 2CZQA 2FH5B 4V0QA 4PM4A 4IDHA 1X94A 1D2AA 3U1BA 2XTNA 5DDIP 1F7VA 5AW7A 4UDNA 5JDCA 5HF6A 1EEXB 1E2QA 2A9JA 2BFBA 2XDQB 3DZ8A 3FCCA 3QF7A 3WJ7A 3UG7A 1KAOA 4MW6A 1QG4A 4XQGA 4XRRA 2Y6UA 2JGMA 4LIPD 4XWGA 2V6FA 3QFCA 2DSTA 4BFTA 2GYUA 2IVFA 2X2PA 4D5EA 4QT4A 1W5SA 3T3IA 3EODA 1JF8A 1U8UA 1VIAA 2LE0A 2ZUFA 4G0WA 4YP6A 1D04A 2ZUBA 5EIHA 4NULA 5EWLA 5TQ0A 2GSDA 5BP7A 3RSZA 5DCWA 3VC3A 3N76A 1QDUA 3LDHA 5EIEA 1Y4UA 2QT9A 1AZLA 1YC5A 3Q7IA 1O9GA 4H0NA 4DDMA 1UR5A 2X3UA 3HN2A 4GXNA 4KO2S 5EE3A 4AKSA 2SHKA 3OY7A 1Z7GA 1ISIA 4MEAA 1XUOA 3VSBA 1YOBA 4FDUA 4G65A 3WJAA 3KUKA 4AK9A 1NNUA 3KXPA 4FCVA 3RFUA 4LQCA 1OI2A 2EDAA 4MR7B 5KPJA 1SU4A 2G28A 4QXAA 1QP8A 2V6GA 4NMWA 3R24A 3THOA 3AXSA 1DMSA 5FBKA 2JLAA 2Y99A 5I7SA 4G8CA 4QUKA 3A1DA 2H2IA 1LPBB 1U8EA 1L7AA 4BLOA 4L8VA 4KR3A 3Q87B 4OAQA 3AOGA 1DXOA 1DWUA 1PZFA 3H83A 4KK3A 4Z9BA 4AJ2A 1KK1A 3IVGA 1OWLA 1TCAA 2BMJA 1M1UA 2GEFA 2OBMA 4MMXB 4RZ2A 5CH3A 5DZSA 3SC3A 1KAEA 3O0DA 3GH1A 4YAOA 3WL3A 2OK8A 5BR1A 3CM0A 2PBLA 4G3XA 3A6LA 1ZINA 3CPJB 3NEJA 3NHZA 4Y1GA 3TSZA 3TG2A 4DHEA 2QROA 2GCEA 3EWNA 3HUFA 4EJSC 3PPIA 2PUEA 2X9VA 2PXXA 1XTUA 2ZYRA 4ZI3A 1KSHA 4QPJC 2PCLA 3P97A 3PFHA 1MQSA 1KHHA 2OOKA 3EXG2 1SC1A 1Q7BA 5E9WA 1VJGA 5H5JA 3I9V1 3BBPA 3BDIA 2ORVA 4PIPA 4PTLA 2I3ZA 1P2BA 2G5PA 4KC0A 4O0MA 1Z45A 2HK8A 2FLWA 1MV5A 3R8CA 4ER0A 1JR2A 1VCHA 1KOFA 3H7AA 3SDSA 4GD3Q 1ZD9A 3AB8A 1I8TA 1NN5A 5J4HA 1A9RA 3BL8A 4QQFA 4KJZA 2XCOA 1LDNA 4X0EA 3RK4A 4L4YA 3RLFA 2IXAA 5DBOA 5DSZA 4QYSA 1A5AB 1VRWA 1CY7A 2C96A 5CX1B 3RD5A 4IDFA 1Z47A 4ZOLF 5KWVA 3N6XA 2HBYA 1JZTA 4H6XA 4HNAB 3CW2A 4N1AA 4X71A 4BNNA 1H6BA 3LC7O 5IT4A 1K89A 5AXCA 3R9IA 2FNAA 2RGCA 1YR7A 3D8TA 4JENA 4ADSG 2PXHA 1ES9A 5JFGA 1YTLA 5JALA 3M4NA 4WNCA 3A7DA 4PONA 5HCIA 4B6QA 2UKDA 1M8PA 1E2NA 2AF4C 3KLNA