3X1KA

Crystal structure of phosphoapantetheine adenylyltransferase ppat/coad with amp-pnp from pseudomonas aerugonosa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
157
structure length
157
Chain Sequence
NRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
total genus 55
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1kA00
4DNXA 1U7DA 3AL0C 1O94D 2QTMA 2O5RA 2PZBA 2I1LA 5DK4A 2V0CA 3AIIA 1KH2A 1N2BA 1OWNA 3OTWA 3CVWA 2E0IA 1KAQA 1YULA 2ZP1A 3NBKA 4MW9A 1M83A 4MAFA 1I6LA 1MB2A 4EG4A 3AKZA 1O96A 1N2OA 1O94C 1NUSA 4ZCTA 3Q10A 1J1ZA 4KR6A 3INNA 1QRUA 2BYTA 5JBNA 2A86A 5FNZA 1Q77A 1WJGA 3PNBA 1T9GS 3UY4A 2DERA 1F4LA 2CFOA 4G5YA 4MQ6A 2DUMA 2QJOA 1R6TA 4MUJA 4MWBA 1IVSA 5K0TA 4QBTA 1JECA 5HG0A 1YUNA 4I6GA 1JILA 4ZT4A 1KH1A 1GZUA 2CYBA 3K32A 1U0BB 4RUKA 4EG7A 3BL5A 1R6UA 1QJCA 4MW7A 2H2AA 1N2GA 4ZT7A 2IELA 3N8HA 4ZT2A 4DDHA 2C5SA 4PY2A 2IP1A 3SYTA 2HGZA 1V47A 2QJTA 1J20A 3SP1A 1NP7A 3ZIUA 3FG9A 3X1MA 1U7XA 2G36A 4DLPA 1LI5A 1G59A 3MMXA 2Z09A 3IOCA 1O0CA 1PFUA 1GN8A 1N75A 2XRYA 1G8HA 2PIDA 3FDXA 1KAMA 3DO8A 1NUTA 2A1UB 4MUIA 4CT0A 2WQ7A 4Q93A 2J5BA 1OWMA 1EFPA 4YP6A 5HUHA 1H3NA 2JANA 1X8XA 1N2JA 3H05A 4CDMA 2VXOA 4TS1A 3QTTA 3TS1A 1I6KA 2CYCA 3UOWA 2QJFA 1JIJA 3RK1A 4MULA 3IVCA 1NURA 1PG0A 1T9GR 1O6BA 1WXHA 1NUUA 1M8PA 3HGMA 4NDAA 1KORA 1O95C 4PBTA 1LW7A 5TEWA 3KFLA 4MW1A 4JXZA 4G5FA 2H29A 3ELBA 4I6EA 3CVUA 3I05A 4MW4A 2PZ8A 3RK0A 3CVYA 1NZJA 4K03A 5BNZA 1TYBE 2YWBA 1J70A 3IUEA 1YIAA 3HMQA 3FOCA 4YP7A 1KR2A 3P52A 4GU5A 1GAXA 3D6UA 3PNYA 3DV2A 1VBNA 4MW0A 5H16A 1IQRA 4AQ7A 3VRHA 4EG1A 3H9CA 4MVWA 5F23A 3MLBA 2NSYA 1TQ8A 1QQTA 2PG3A 3UK2A 4F4HA 1T6XA 1CT9A 3SEQA 1EXDA 1K4MA 1EFVA 2Z08A 3COVA 4JYZA 3MUEA 4QREA 4MWCA 2D13A 4HJXA 4XSVA 5EKDA 3IVXA 5KCMA 1EE1A 1VBKA 1D2RA 4JXXA 2X1LA 4KR9A 1O0BA 3QTBA 4ND7A 2O8VA 1Y42X 1N77A 3E27A 4UZFA 1FFYA 3AG6A 4ZCPA 2TS1A 1KQNA 2QTRA 1QRTA 5AHWA 4ZCQA 4HK4A 2A88A 4A91A 4PBSA 1WKBA 4MWDA 4NATA 2XRZA 1K92A 3KT6A 3G5AA 2E18A 1M8GA 1QU2A 2WQ6A 1JMVA 2EJCA 3ZGZA 5FO0A 2JA2A 2VTBB 2WSIA 3LCJA 3PNVA 4XFJA 4MUKA 1IQUA 1QU3A 3GUZA 1TFUA 3SZGA 3ILVA 1K4KA 1MC1A 4NX2A 4EG3A 4P2BA 1IQ0A 1O96B 3UC5A 4OJMX 4R2LA 3UMVA 3ZJVA 1QRSA 2ZUFA 2R5WA 1ZJWA 4ZCRA 1OBHA 3IODA 3IMGA 4MW2A 4MUNA 1MRZA 4DDKA 5LFAA 1NUPA 1BS2A 2ZUEA 2GKSA 1FYDA 2J08A 3P0IA 1U3DA 3MLAA 3RBAA 2A1UA 1M8KA 3VGJA 3CA8A 1G8FA 2DPLA 4MVYA 2YWCA 2QUHA 1N2IA 1WXEA 4H3SA 3KT0A 1WOYA 5DEOA 3A04A 3VU8A 2J09A 3H9BA 4MLPA 2RD2A 1MBZA 4MWEA 3K9WA 5DASA 4YMIA 1F9AA 4MUEA 4NAUA 1Q11A 3CVVA 1Q15A 1F7VA 1M1ZA 2CYAA 3TZEA 2QUKA 1VBMA 1JZSA 4WSOA 1H1TA 3CLUD 1XNHA 3RHSA 5J5AA 3FWKA 3SDBA 4ZT3A 1KQOA 5J59A 1U3CA 3TQIA 1A8HA 1NI5A 3CLSD 1PFVA 1XJQA 4EG5A 3IMCA 3DPIA 1MAUA 2J07A 1YUMA 1JGTA 1I2DA 1KP3A 1OWPA 3A4IA 4ZT5A 4R0NA 2X0KA 2GM3A 4BWVA 4E1AA 3CLSC 5HUJA 1JZQA 3FH0A 1J21A 4MUHA 5IJXA 3CLTD 2IJGX 4RPIA 1O97D 3NV7A 1NUQA 1Q19A 4QRDA 1G8GA 5DB4A 3FY4A 1OBCA 2A84A 2BTEA 4KKVA 3FNRA 3ZUGA 3AFHA 3HZRA 1N3LA 3CLTC 4EG6A 2RE8A 4U7JA 2AG6A 3TQOA 3NBAA 1O97C 2Z3VA 1TEZA 1F7UA 1T6ZA 1WZ2A 5LM3A 3IMEA 4CQNA 2D54A 4MVXA 1M8FA 4K0RA 3AG5A 3CVXA 1J09A 1N2EA 2A4MA 4OUDB 1GPMA 3IH5A 2CSXA 4DDMA 3ZXIA 1H3FA 3FIUA 5IHXA 3DLAA 2OQ2A 2DEUA 4HPWA 1IH8A 1NSYA 3MXTA 3KT3A 1XNJA 2GOYA 1V8FA 4EGAA 3G59A 3GMIA 1N78A 3N9IA 3C8ZA 4AS1A 1EUQA 3PRHA 3SZ3A 1WXGA 1GTRA 1VL2A 1O5TA 2V0GA 2YY5A 1WXFA 4L2IB 1T6YA 1HYBA 1GLNA 1B6TA 3RFFA 1PFYA 4J76A 4EG8A 3M5WA 2CV1A 1K97A 3COZA 1OD6A 3COYA 4X0EA 1DNPA 2VTBA 5H7XA 5KWVA 2CUZA 3JXEA 4S1OA 4I6JA 4EF6A 1IFXA 5J58A 1KQPA 1OWLA 3QE4A 4KPUB 1QNFA 3HV0A 1COZA 1EFVB 1WY5A 5FO1A 2DETA 1XNGA 2DLCX 3X1KA 1M8JA 3LE8A 4YP5A 3A2KA 4HJRA 1IHOA 4MUFA 1P7PA 4MVCA 3ISJA 1YIDA 1KP2A 3HL4A 3L92A 3IOEA 3P0JA 2CV0A 3IUBA 1MOPA 3H99A 3ZJUA 2J4DA 3IDFA 4U63A 1GTSA 3S3TA 2QTNA 4FZJA 3H97A 4YBRA 3COWA 3LOQA 4WNYA 4U8HA 5TS2A 1PG2A 3KT8A 3Q4GA 1JIKA 1S4MA 1KKUA 3N2YA 3F3MA 2QUIA 4EFKA 3L93A 4ND6A 2E21A 2DR2A 4DJAA 1TYCA 3Q12A 4NAHA 3OP1A 2D5BA 3ZXSA 1J1UA 1SURA 3G6KA 4J75A 1ZH0A 1N2HA 1WXIA 4GRIA 1R6XA 3X1JA 2A1TS 3FETA 1OWOA 2AZXA 3SEZA 4NZPA 3GLVA 1JIIA 3D6VA 5K0SA 4ZCSA 5TEVA 4MW5A 2X1MA 2QUJA 4R2MA 1YI8A 2HMAA 3HFJA 3ND7A 1QTQA 4ZT6A 5KHAA 3TNJA 2OV4A 3CLUC 3TZLA 3ND5A 1O95D 3RJZA 3IVGA 1WQ4A 2PFSA 2AKEA 1VLHA 1H3EA 5TGTA 5LLTA 2A7XA 1ILEA 2PXHA 1EFPB 1ULHA 1NYLA 1JEEA 1EJ2A 3U1VA 4ARCA 1KH3A 1LI7A 4MW6A 4XFDA 1N1DA 1JEDA 3CR8A 4CDNA 1TYDE 2DXIA 4JZYA 2EL7A 1X6VA 3A05A 1RQGA 4OUDA 3CLRD 2CV2A 3N05A 1MJHA 1JHDA 1PFWA 1WQ3A 1MB9A 4JFAA 1TYAE 3P0HA 2YXNA 1ZH6A 2PZAA 4F3RA 2WB2A 3ZJTA 4MUGA 1EUYA 3CLRC 3ND6A 4PBRA 4L2IA 4DE5A 2CT8A 2E89A 2X3FA 3FI0A 3PXUA 2JAXA 4ARIA 2B7LA 4Q16A 1I6MA 2A1TR 1MAWA 3IOBA 3FHJA 2NZ2A 1UFVA 2HZ7A 4KR7A 1ZUNA 4UZEA 4G6ZA 4KPUA 1IRXA
chains in the Genus database with same CATH superfamily
4UHKA 3WIDA 1A71A 1NA5A 3GH3A 3L9WA 2EBWA 3AY0A 3NTQA 3MW8A 4HG2A 4J7XA 4JVOA 4JEHA 4M37A 4NOLA 1L8LA 2PZBA 1P0MA 5A5VA 2F9FA 4R1UA 1WDLA 1WDTA 1A7KA 2BRUC 4V0NA 4RKEA 5JAQA 1M54A 1OKKD 4TT3A 3CVWA 4FCCA 3OF2A 3K3PA 3ZV7A 2VJAA 4QYMA 4D98A 4PZEA 2JH3A 1B6RA 3BK1A 4REMA 4ADSG 1BWPA 3BJRA 2BFDB 3UUFA 4MEBA 3DF9A 3DE0X 4ZCTA 3R0JA 4C6TA 1QJ4A 5JXGA 5AXDA 3H83A 4C0JA 2IYEA 4F3YA 2ZR7A 1XROA 2V6BA 3OHMA 4LRSB 1XTZA 4WECA 1B93A 3PQ4A 1M7GA 1YB7A 1XKTA 2NZXA 1Z39A 4ZVRA 5IDVA 1BTOA 2HJRA 3UOGA 4D3DA 1ZD9A 2QRKA 1ZK3A 2OK7A 3CRMA 4UXHA 4RZ3A 4W5OA 2IZ1A 4J0GA 2WSMA 3IUYA 1YASA 1MAAA 4YFYA 5LP1A 3CRZA 1ZISA 4F91B 1VFPA 1NF2A 2Y2UA 1HDGO 2AD1A 1JLKA 3GIDA 3HKDA 4MCHA 3RSFA 1PZGA 2NXNA 3F96A 5JPDA 5DK6A 4B9EA 5B3AA 1OI3A 2JFOA 1TTHA 3ANLA 1N5LA 1P1HA 4JVNA 3TD2A 2G9UA 1RRKA 1QH9A 2BCEA 1W2GA 4K9KA 3DTNA 3D1JA 1CULC 1PK8A 3ZD6A 2Q4TA 3G0GA 4O4IA 4GX2A 4RJ2A 2PZJA 1ZICA 2GBLA 4PY2A 5HX7A 2WUGA 1LWNA 3MSCA 3B7GA 4F7WA 1LLUA 4EGCB 2AZ4A 4P34A 4NY1A 3OM1A 4TMFA 2FSVA 2QL9A 4BFTA 1C2TA 2J5RA 2WT8A 3QXCA 3A6DA 2FJPA 4CMBA 5CCXA 4IEFB 4YALA 4AJNA 3CNHA 4X84A 4D9FA 4NXMB 2FRVA 3RWOA 3OT4A 4YHHB 1EM8B 1OYWA 1QWSA 2ZSJA 1SOAA 4NR0A 1PDWA 3VSAA 2ZQ5A 4AQDA 3RS8A 2UAGA 1AUOA 3HV2A 3DDSA 1GCIA 3L7KA 1V1JA 2FPUA 4QUBA 2Q1WA 2H8GA 4GECA 4R6WA 3FDXA 2WU3A 4XQ0A 2WOJA 4W82A 4B80A 5D01A 3K9CA 3U5TA 2DFKB 3Q8MA 4KUGA 4LTDA 3A4NA 2AFVA 5LOVA 2D2IA 2N75A 3JAKB 3MFQA 1DCFA 1ML4A 3RAPR 2P0AA 3GB9A 4HT3B 2RGBA 5D3QA 2RGGA 3C0KA 1Y8QB 3AGQA 4OUKX 2CGEA 3AWDA 5DI3A 4B6QA 4YREA 3PC4A 3BTSA 4MULA 5FNVA 3LFTA 3LRXA 4NV1A 1KDYA 4YMLA 5JY6A 1C1YA 3ZCSA 2D5AA 2HUNA 4N3CA 3EPLA 2YN2A 3MINB 2C9YA 2Z8ZA 4QVGA 4I5GA 4PZYA 3HJGA 1NYTA 2R79A 4PYOA 4X20A 2O8BB 1M6YA 4AZ3A 4E33A 3ZI0A 1M7BA 5TQ0B 2JAPA 2PRKA 3I05A 5UKDA 2CVQA 4A82A 5DM1A 1KZ6A 4PC1A 4KSCA 1FJ2A 1CZUA 4NHEA 4RDHA 3BSSA 2OUKA 1LU9A 2PHZA 4LOAA 2W0SA 1VSTA 2C7QA 2HA3A 4TTJA 4XR9A 2EU8A 4CR8A 2JJYA 2AD5A 4NPHA 3OY2A 4Y2JA 1C3LA 4YP7A 5JAIA 2J3KA 3W9BA 1G0OA 3E58A 2NU9A 4O29A 3VI4B 2A58A 1E3TA 2XVAA 1X1AA 1GPLA 4FYXA 5C8YB 3O73A 3VTAA 4BVBA 2HU8A 1P19A 4JUAA 5KQPA 3B52X 3UG7A 4FHZA 5LMUB 4EY6A 3JATA 1AZTA 4EA6A 3ECAA 2ZIZA 2AZMA 5JLJA 3KCNA 1PQYA 3W2HA 3J81k 3MMZA 4YXFA 4U8GA 3QKRB 5HJEA 4XSVA 4X24A 3OWXA 2JHCA 1JR2A 2FY8A 2XOXA 3EGIA 1Y82A 3IT1A 4D0NA 5F3WB 4JQYA 1XHEA 2BFDA 1D2RA 1RKQA 4M1EA 4BVKA 2QV0A 5DSTA 4MGIR 1TM4E 4GXNA 1QF6A 3IHKA 3QYFA 2ZR9A 1MA3A 1YR8A 3OLYA 4G5SA 2BUCA 2QMQA 3INTA 4QNNA 3WNBA 4HNVA 1QLJA 1S01A 2FQWA 3ZI7A 5AD1A 3FPEA 3H1EA 3EA5A 1DKRA 2DSTA 1EWRA 4NJEB 5D85A 2PT7A 2GCEA 4FNOA 1XR3A 5IT9A 1J49A 5C3UA 1PUXA 2INGX 1Z0SA 1P73A 1XN4A 2UUAB 3FW1A 1ULSA 4HFJA 4LSWA 1QRTA 2DERA 5ARBA 4LYAA 1FUYB 3KB8A 5FPPA 3PT9A 1PEAA 1Y1RA 4OVKA 2Q1SA 2ZCJA 5KJ1A 2TYSB 1DKUA 3LCUA 4FT4A 4OBXA 5LYYA 2JIBA 1QIDA 4YJDA 1RHUA 4JC5A 3FMFA 1Z4MA 2EEZA 4FU0A 3T7JA 4YT8A 1OT5A 5F4BA 3ROEA 3C3PA 3MBKA 4W8GA 4MOWA 3WLAA 1XI2A 3A6EA 1M67A 2F2TA 1V3VA 3WHIA 4FFBB 1LVHA 3GEHA 4IR7A 4KAJA 1AD2A 5BT9A 3BDAA 4BIIA 3SFTA 2JJ8A 1ZOOA 3LUPA 4PLYA 1E2PA 1LBTA 2XGJA 1NI3A 1J0XO 2I3DA 4EG3A 5IT4A 1CNFA 1QHFA 4CN9A 3JVIA 3VNAA 1CEQA 3NOVA 4JMPA 4MUYA 4N6OA 4DMCA 4E5NA 4JJKA 4RELA 3G0DA 1B74A 2J3QA 2NXJA 2P6OA 1SK8A 2E87A 3LIPA 4FLEA 1FW6A 3UJ6A 1EM8A 3G2IA 3RFVA 2D1SA 3P9YA 4EW1A 2Q1YA 3NUQA 4X6YA 4ACBA 4G9GA 4UCQA 4ARBA 1P0QA 1RQNA 3EE6A 4MINA 1YONA 5TB5A 4JLBA 4QOEA 4CMJA 1RCUA 3VKHA 3A0UA 4I3HA 1JS1X 3DHWC 1R9GA 3N87A 1U1FA 1NNUA 1GFZA 1JT9A 4DCSA 1GZDA 2O05A 3D7NA 1SBZA 3JAKA 3T5GA 3L43A 4D02A 4D56A 1TZBA 2RCNA 2PX2A 4MDFA 3T38A 1TA4A 4FQ5A 1Y8QA 4Y2GA 1FFEA 1I0IA 2WRZA 3MJRA 4C01A 1G38A 1WMEA 3PHHA 4RSRA 1ZNQO 2IDKA 3T35A 5L4SA 3SJCA 3IQGX 2QSUA 1NXOA 3LW7A 2PUAA 5DYTA 1E6EA 2QAGB 3QENA 3H16A 5JYDA 3K0SA 2GRJA 1N9ZA 4GLBA 4CKWB 4OA8A 2A78A 4KO4S 1M1ZA 3WRYC 3GJXC 2G0NA 3STXA 2GASA 3QI2A 2UVPB 5ALOA 4C0QC 3CLVA 5AM0A 1IEXA 2IXBA 4QELA 3WYGA 1GQOA 4NDZA 3F7NA 5DO9A 1ZJZA 1DXOA 2XUFA 3F4LA 4XQCA 2IHJA 1H2XA 5CH8A 3VZPA 1DFHA 2MYNA 2BR5A 3KU1A 2F4NA 3W0LB 3G89A 1XLWA 3ZVNA 2CLEB 2Q0QA 3D9QX 2VAMA 3KLOA 4R0NA 2X0KA 1XALA 1KYZA 4E1AA 1FE8A 2C5AA 3AFOA 3DH0A 3CUTA 1E6MA 1YRLA 2OD2A 4ZO7A 1K75A 1DQNA 1JMYA 5C8YA 4EG0A 5LB4A 4DG9A 2DWCA 1L5WA 1P8AA 3RV4A 4JLSA 1RS0A 1DFIA 2QVGA 2QVYX 3NV7A 2VHVA 1UBRS 3DP7A 1R4NB 3IVRA 4OH7A 3CF4G 1N34B 3M5DA 1A27A 1UXJA 5GONF 1V7CA 4ZV9A 3NCHA 5DB4A 4Q1VA 1N8NA 1LW6E 5F5NA 4HBZA 3GT3A 1FFAA 4RA9B 5JVDB 1VPWA 3TLMA 2Q0HA 3GFGA 4L7QA 5AM4A 4BO4A 3PEFA 3PCRB 4X6LA 2FAXA 4JEIA 3UV6A 2WAOA 3K0CC 1H0RA 1UOPA 5LM3A 3I5UA 2JGDA 3GAAA 1M8FA 4BY9E 1XEWX 1VPVA 2P91A 3VDXA 4MRAA 8ATCA 1MTZA 2R8BA 3BZWA 1E9FA 3VU0A 4Z54A 4RY0A 3GLHA 1JBQA 4JQSA 5B2ZA 4B2IA 1EG2A 4WPGA 5ALTA 3TKLA 3CGGA 2CSXA 3FVRA 3FPJA 3LUFA 1RMYA 1X2BA 4JBYA 1QLHA 1DJQA 1X8KA 4KXVA 1EPUA 4NJEA 4Q7LA 1EG7A 3R7NA 4RHTA 2IHYA 2B5VA 2LIPA 3OZTA 5KNBA 4EVSA 4IGAA 4N3NA 3RRJA 5KC8A 5CB6A 4G23A 4AS1A 4JYAB 2G40A 5D5HA 1YZUA 3GJQA 3KKQA 4FGZA 1GSAA 2QDKA 2XADA 3K4QA 3OPMA 3K1AB 1ADFA 2Q3JA 2VTEA 2Y9MB 3EAQA 5G0VA 3SHWA 3LXMA 5B30A 1L4UA 4LOHA 4GKJB 1ONBA 3DZGA 1R6BX 3DMTA 4FUTA 1OZHA 4HAUA 1UT8A 3RFFA 3EUAA 3ZXUB 5KNDA 3ERCA 2H1WA 3FLAA 1ZU4A 4BZWA 3COZA 1RXWA 5GV8A 1TCBA 3L1JA 3I9V1 1DP4A 1JDVA 1V6SA 1WCXA 1Z4PX 2CLOB 2CUZA 2NZJA 2YJGA 3BMNB 1BXRB 4L02A 2FGKA 4FFBA 3MCWA 3SZMA 3T1VA 2BMEA 2ZT6A 5HKBA 1UP4A 2IYLD 2VAWA 5FO1A 5H4HA 1LGYA 3FGPA 3KCQA 4MVJA 1MT3A 2XDYA 3AWIA 5LQAA 1IB0A 4OYLA 1CUIA 1JVBA 3VNSA 4D5GA 3OQVA 3EDQA 1NFRA 4WX2B 2V1XA 3BEDA 3OG9A 2ZWMA 1NXSA 3DF7A 3HWX1 2FMFA 4YP5A 4C0HA 2OG2A 2J0UA 1KO4A 3ENKA 3AY6A 2A9PA 4LJYA 1B0UA 3CKKA 1WVMA 4R54A 3V46A 2W6JD 3UAZA 3NHJA 2BM8A 4CIDA 4CMEC 4JLPA 4K5QA 3ZU3A 3M83A 1GA1A 3LWZA 1F8XA 1XF1A 4UU0A 1GFWA 4MP8A 3PTAA 4RE6A 1BA3A 1P4SA 2X5XA 4RO0A 1Y5NA 1P2BA 5CNMA 5D51S 3U0BA 4CR7A 3NVMB 2E4WA 2BZGA 1OF1A 2QSJA 2W6IA 2G8LA 1N7IA 2QXYA 3ZTYA 5A3RA 4PM4A 3EH2A 4UDOA 3S5UA 5BY2A 2ZJ0A 2YMPA 2XYPA 1S4MA 4CKWA 4LDQA 4RVUA 3ZHZA 2DH5A 1AHPA 4P08A 2DZDA 4KGVA 2REQB 3PPWA 4OMDA 4YRBA 4W5WA 1PJAA 2QG4A 2PX0A 2LCQA 2UVPA 3HFRA 4A6XA 3GG2A 4F9FA 4OX9B 3D59A 1Z47A 2FN8A 2J6IA 1W0JD 3TEMA 3FSGA 3IQWA 1K6MA 1HPLA 1XZLA 1AKQA 2NQ2C 3U7EB 2RGYA 3OUZA 2PSFA 1GTG1 3RROA 4FXOA 1VIMA 3C3KA 4A36A 2EKZA 3K2BA 3DQZA 5EHZA 2JH8A 1FUEA 3NFRA 4OPMA 3O91A 2B99A 2DT8A 3FWYA 4LSZA 3RG2A 4AZWA 5JQGB 5EERA 2HMAA 3TIIA 1T4BA 3F0TA 4WLEA 3OF5A 4A23A 4GR4A 2HWXA 1P4AA 2DTDA 1GL9B 3ND5A 3D6TB 2OBYA 4BDSA 4YNBA 5HFAA 2RBGA 4OTZA 1HEUA 2NZYA 4RAQA 3EVTA 2E9SA 2D4HA 3OTIA 1YNSA 4FSXA 4MPPA 3R9KA 4RNCA 4M8SA 3RWMB 4BASA 1PJBA 1N5IA 2HU5A 1OB5A 4RA9A 5JVDA 5KU1A 2GEFA 2Q0XA 4J3JA 3DEAA 4P3XA 4PICA 4FB4A 3T9EA 4ZCMA 4XR4A 2VF4X 1UC4B 1XJWA 4QDXA 4ALKA 4IDEA 4WHMA 4Y1GA 4HAZA 1WNFA 2VK2A 3AHCA 1RQ2A 2IQIA 3CR8A 2DQ4A 3VZRA 3K71B 3G7NA 1U31A 1J99A 3D54D 3AHGA 4LRUA 4OJYA 4IF6A 2FTKE 1KOGA 5AICA 3RRMA 2BD0A 2IU3A 1ZMBA 1OBVA 2WPDD 4XVQA 4M1MA 5CR9A 5JANA 3O93A 1QIMA 1WQ3A 3INYA 1UXGA 3SVTA 3SIWA 2AYXA 5F9HA 1NVWQ 2WE7A 1SIUA 4I55F 4JFAA 2ZETA 1VSVA 4EA9A 1PS9A 4QOGA 2VDWB 1F60A 1E3QA 2X9NA 1FUIA 3LBYA 5FJIA 4BNJA 5DYYA 1HKHA 3K1AA 2OBLA 1VIAA 3DL7A 4ASUD 3KQKA 2E89A 1K3UB 3IA7A 4WA8A 4P4UA 2VNAA 2WLTA 3HSYA 2C2XA 5BWNA 1Z6ZA 4KOEC 3U3XA 3ZD9A 1WETA 2P62A 4WJKB 3G2KA 1PGQA 1EWTA 2H1VA 1NSFA 5AVTA 4W9NA 2YMLA 1OYYA 3AR3A 3BMNA 3CUEF 4J2TA 4YUAA 2F1HA 1JAZA 1BXRA 5TMBA 4EQZA 1O89A 1T5IA 5HQJA 1T8UA 5AUPB 2IUFA 3OCZA 1GUZA 2NO9A 2MJLA 3GGSA 3BPSA 4JXJA 2ZS9A 1LZLA 2GBFA 2V0CA 2XOKA 3EVEA 3R0VA 1WABA 5ICCA 2ERXA 2W6NA 1SKYE 2HRDA 2QL7A 1Z12A 3M2PA 1JLHA 1QCDA 2C99A 3AC0A 2ETVA 4F2HA 4AI6A 4B8YA 4OLBA 4XRGA 2JGIA 3UPDA 1MB0A 4EG4A 1G5TA 1UK9A 3IOMA 3TFOA 3O95A 1YZYA 4YR9A 3FDFA 2CHQA 3OEEA 2FLVA 4RK4A 4NYMR 1ZCJA 3VUFA 4CUZA 3B85A 4G36A 2IGTA 4HGOA 4PHTA 5GZ3A 5ALZA 3L41A 3A9TA 3O1LA 4QDKA 2D62A 1JHRA 3T7AA 1WPRA 4EJSA 1GCUA 3UY4A 4L75A 1X1EA 2QNRA 2C82A 1YMUA 2A3RA 4GPBA 3S0JA 3WWZA 1B2LA 5JG7A 1KI6B 2ZT8A 3KPUA 4MQ6A 1S3SA 3NHRA 1AGRA 2NSHA 2QJOA 4YONB 3FE2A 2D1YA 4G1VA 3WQBA 3E9NA 1T2VA 3H1AA 1F2DA 3STHA 4BFZA 4DDVA 5A06A 1P31A 2ZRNA 3Q41A 3I52A 3ETLA 2ACKA 2JCXA 2GRUA 4AXXA 3D5QA 3QXSA 4B47A 2P8SA 2REQA 1QZUA 2NW6A 1QAOA 1WUHS 4G5HA 1JHVA 4FN5A 5ILQA 1QHSA 2CK3A 3UGKA 4YP1A 3KJIA 2EZ9A 4DQLA 3RYFA 2EBUA 1D0SA 1L5HB 2ZJZA 2FUKA 4BUJA 3AF1A 2C0PA 2IELA 2P3LA 4GBED 1GOTA 4OXIA 5EY5B 2QUZA 3QXXA 1CK4A 3S2GA 1A95A 1T4CA 1UANA 1YR2A 2GO7A 4Y6PA 1SHLA 3HBLA 4L8YA 2ZB7A 4B34A 5JSUA 4XXHA 5JMPA 5IVKA 4ZXPA 1EYZA 3D6AA 4P2GA 4OHVA 1NNLA 2J9ZB 1RE0A 5HZGA 1IXZA 2GLTA 5FWXB 5TVKA 2ZSDA 1M72A 1QVVA 5JI2E 3SDSA 1X1DA 2YC2C 3H9UA 1BX3A 3AUKA 2C5HA 4FWIB 4YJHB 1R7RA 2YWXA 3OY7A 3ZHTA 1GSHA 3IRVA 4D4LA 2ZAIA 1A2KC 1K3TA 1QSGA 1R0KA 2WFLA 3OIVA 4BQFA 1K9VF 2X8LA 2VHXA 5DLDA 1OGJA 2CVHA 2NZWA 2W2NA 3GWZA 3KJZA 1NQOA 1H2EA 3E23A 4I9FA 4JSTA 2ONYA 3M6MD 3EEIA 1P17A 1X7DA 5EWLB 2UXDB 2Q2WA 2QVBA 3H1FA 4LXXA 4NMMA 1KI9A 3EAGA 3VTKA 3TJMA 1RJ9A 4CEJB 1OWMA 1GPBA 3H9EO 4G8CA 4TZ0A 1OXKB 2A67A 5HXAA 3A9CA 3D43A 1GZHB 4M83A 3AETB 3HJFA 5EG5A 4S1TA 1BMFA 2QOEA 2VSXA 4CL0A 3QEMB 1JPNA 4HCJA 2FRXA 2P9ZA 1WF3A 1YZFA 1KGSA 1MFZA 3BBLA 3HG7A 4LNAA 4KHPB 1J2RA 1JQ3A 1WIWA 1FX1A 1T0UA 1C8VB 1AOXA 3CZRA 3E5RA 3F6BX 3GF4A 3H4TA 3KAQA 3IE1A 3UV7A 2W6OA 3ZGLA 3E9MA 2QE7D 3A10A 3IDSA 3S1SA 4J0CA 3CY6A 4NBWA 2Y66A 1E3DA 4DY4A 2Q3CA 2Z5VA 4Y9DA 2W00A 1RNLA 1CY4A 3OZGA 3ELUA 4KQGA 2VDWA 2VRWA 1GV0A 3OKFA 3QWFA 4ZEXA 3FZNA 4WESB 3PR2B 1SK9A 1SH7A 1SVKA 5I7EA 3WAJA 4YAUA 4N01A 2XWJI 3TQHA 1L7RA 4AKEA 5CG2A 2I1QA 4H18A 5J63A 4RTLA 2B1IA 3MQFA 1I2MA 4Z4IA 5KOYA 2VJNA 2J3DA 3AH8A 1FDSA 2IHUA 4BU1A 4EAAA 4CVNA 2PWZA 1ZHOA 3V6MA 5CDUA 1E60A 5HA5A 5A0VA 4KOAA 3WNZA 3R9XB 3Q3JB 4KAFA 4UTPA 4GKVA 4BKOA 1E9SA 1QQTA 1U5CA 3FMGA 4F4HA 5A9RA 1YCFA 2V7TA 4Y2SA 1Q83A 2E6KA 2FZ5A 2RHCA 3Q1KA 4EUKA 2QRMA 5MFPA 1R0LA 5B4VA 2NZVG 3EH1A 2I4OA 1XMJA 1CJVC 3FBGA 4X97A 3W5IA 5C5EA 3V80A 1R5NA 2QIPA 3B12A 2RH9B 3QKWA 2W4IA 3EFOB 2OG1A 2D1RA 2R48A 1VHJA 3STTA 1FOEB 4XRRA 1V9SA 5I6DA 3M6AA 2GM5A 3KOOA 3B1JA 1QFYA 2FEKA 3QTLA 2BFFA 5FHRA 2X0IA 3OU7A 1AO3A 1GTL1 3SYRA 3JD0A 2IHNA 2O59A 4CR6A 4ZU1X 2YBDA 4MPJA 4AKIA 3AG6A 4I50B 2NV6A 4XWYA 1U63A 3GVIA 2XCIA 1HH4A 3W4JA 3BIFA 5H5JA 4HX9A 1W0CA 3A9UA 1L5QA 2KX7A 2G7MC 2QTRA 5KB3A 1VMDA 2VWQA 2IOFA 1TJYA 2YJ5A 1H9CA 5K8IA 3FHTA 4IS2A 2QK4A 1LJ8A 3WQRA 3S44A 1NN1A 2WMYA 4MWDA 5D8DA 4M89A 5C1IA 3DAYA 5FTWA 3WRXC 2UVQA 4FNMA 3PB3A 2PKQP 3ZGZA 1LVGA 4WXRA 2YIMA 2DCUA 4MKRA 1L5HA 1QZ3A 1ZGBA 1O6GA 3OZSA 4G07A 4Q4LA 5EXPA 3WK5A 3QKIA 3M9WA 3GZNA 1SHZA 1CLUA 3LXXA 2YVUA 3GJZA 4C5CA 2JA1A 4EYQA 3KHSA 2PZKA 3V1YA 1SNYA 4WZBB 3WOVA 2G4LA 1YNOA 1A8PA 3ODPA 4M9RA 4U6NA 1ZA2A 4MMYB 5DWDA 2E5WA 1C14A 1LLQA 2HRZA 1BDJA 1MPTA 1TUBA 4LY9A 3G5TA 4UAUA 1OH8A 3VKWA 5E7JA 3RWBA 4KZKA 3OUUA 1SFRA 4YJHA 3DO6A 1N7HA 4X1KB 4C4YA 1PLLA 3ND8A 1PJ4A 2QRJA 1NW8A 3UXHA 3M4NA 5KYWA 3EDOA 2PA0A 4DMFA 2VYVD 1EA7A 3KYIB 4XYMA 1K66A 2W6QA 2A9VA 2Y2VA 5LL6P 2PFKA 2QPLA 3K0AA 4PQFA 4KQHA 2YY7A 3OZWA 4TTIA 3A1FA 4BBPA 4DQKA 4CEJA 5EUQB 2PAAA 4G3XA 1LSSA 3O83A 4B44A 3AETA 3NYIA 1UWVA 1EEXB 1WOYA 3E81A 1I3MA 2SBTA 4C05A 1R64A 4HNRA 2J09A 5ICMA 3TCKA 4KXQA 1QP4A 1N1GA 4AULA 2JDID 1U90A 3L77A 4Y98A 3HRKA 4QECA 3C6YA 2B6HA 3DZCA 3HEBA 4RM2A 4F12A 4DSAA 5ICEA 5JRZA 3DHVA 3C8UA 4TMWA 4F71A 2PH3A 1F14A 4CV0A 5M04A 2JI8A 1CYEA 1LS1A 4YUVA 4B6PA 4BMXA 4ZMRA 1NUAA 3FNIA 3DYBA 1NBHA 3DPUA 4UPDA 4RIFA 3MCZA 1TD1A 3TD9A 1BMDA 3FN4A 3WB0A 3GMTA 1KQOA 2IT1A 2XTAA 4LS3A 3FR8A 4YASA 1KOFA 3GYGA 3RTBA 2DUWA 4EG5A 2RGUA 1ODJA 4WESA 5K09A 1W4LA 5IDWA 1R9MA 3P0FA 3R1IA 4GR9A 3TVDA 2C58A 5ALQA 2XCOA 4BNDB 4NBTA 4CMCA 1JJ7A 1R0RE 5K8UA 1GGVA 1NVVQ 3VNBA 1MH1A 3HUEA 2ZM6B 5AH0A 4NNJA 4BVJA 3CLSC 3JQ6A 3AVVA 3B5IA 3FH0A 1TJNA 3R3WA 5AVKA 1XMOB 4GX0A 5IJXA 4EIWA 4OKSA 1Q7RA 1T1JA 1O94A 4O2BB 4XDYA 4GKKB 3G85A 3D1VA 1RPAA 1PR0A 1Q19A 1TCVA 2GUGA 2BMAA 4RNDB 4HUTA 4E2YA 4TV8F 1JG6A 4RYLA 3OFSA 2X77A 1VMIA 2HPAA 1EVJA 1U1CA 3N74A 5EQFA 4MR9B 5JISA 3E6AA 3LPAA 3AILA 3PGXA 1VB3A 3HYRA 3NH6A 2Z3VA 4LOIA 4JD5A 4DG8A 4P5DA 3FPBA 1BC5A 3U19A 2AXNA 3RADC 1PYGA 4NBLA 2FPWA 3T0GA 3TPFA 4EBBA 3AUSA 3CVXA 2CB9A 4K9MA 4RANA 4AMYA 1HC7A 5IM5A 2VPTA 4WDQA 1ABFA 5IBPA 3ECCA 4NS4A 1TKAA 1Z2NX 2HIAA 4KUEA 3TH5A 3WOHA 3CZ5A 4URFA 5LDHA 3QEBZ 1HFWA 3PPIA 4AS3A 3HBFA 4O1IA 3ELDA 1CPYA 3RI3A 4KXFB 3LNCA 2VQEB 3L8YA 3OOHA 3HA3A 1RWMA 1SWWA 4LHYA 3NQ41 2GA8A 2R751 3WBBA 4QYWA 5DNUA 4XQGA 3K6RA 1PFYA 3VVCA 5J4KA 4BJ3A 5EJ7A 1WD5A 4X91A 5IJZA 1N8SA 1SBHA 5IDYA 2EJVA 3ROQA 1FTWA 3E7XA 2NX2A 4HGYA 2W0MA 1FJGB 5H7XA 1K7CA 1ZOIA 3KZOA 3BL8A 1FFSA 3V3TA 4MRNA 3QFRA 4EF6A 3NHZA 4QC2A 3KSDO 3VMMA 4PX2A 5CMLA 4BMZA 4PNPA 3HE3A 2XE8A 4Z9YA 5BYKA 3GUVA 4W1SA 721PA 1CD5A 4PONA 2DX7A 1UBEA 2IY7A 3PIRA 4OKNA 4WZBA 3VR4D 2H5JA 1NM5A 3QWAA 3RBZA 3AQ4A 5EIEA 4RV5A 5EMKA 2Q3LA 2JFGA 1QHXA 1T36B 3IHTA 2EZUA 2JEOA 3L1IA 3LFHA 1W73A 2C9OA 4I55A 5GVSA 1JYFA 1DBQA 1N1MA 2YHBA 3TZKA 3A1UA 3M3PA 4W5NA 2Y1DA 3L8CA 5F52A 1HT0A 2BGTA 1TM3E 4X1KA 3LVQE 4QAQA 1HDZA 3OPXA 3P0JA 3UB4A 2G4VA 3NT2A 3OCYA 2G0AA 3GRCA 3PDHA 1LVUA 4V3BA 1E94E 2PVSA 3WFZA 1T15A 2QTVB 1UKVY 1R8XA 2PVPA 3G13A 4ZO9A 2JGMA 1T5OA 1M2KA 4K9LA 3SBEA 5CP8A 5DVZA 5KTYA 1M9NA 3FCXA 3GEPA 3OU6A 4F60A 1OI7A 2CMHA 2QTNA 5G4LA 4QBFA 1KDTA 1U8AA 3A6HA 1PIWA 3E03A 1YC5A 3KKMA 4PR3A 4KK4A 2M6KA 4KQCA 4IV8A 1CUGA 5C8DA 3ENNA 2FUG6 4QG3A 1A88A 1CDOA 4NBKA 3L6UA 4V38A 5LWQA 5EHIA 4B46A 3V33A 2ORED 1QRDA 1KIAA 2W6ZA 2XVZA 1NDUA 3CWCA 3PFIA 1GUDA 4QLOA 3EB9A 3L07A 2ODEA 4WJLA 4U02A 1J8VA 3LYLA 3U3DA 2R6ZA 4LHWA 3ZXYA 3MHPA 4TLCA 2PBRA 2VRNA 4GZ6A 2WDZA 4CLEA 1SXJC 1ZONA 4DJAA 3LVFO 4ZV7A 3UJ7A 5KJCA 4FKZA 1BS1A 3QFSA 3OI7A 3RT7A 1QVZA 3KR9A 1IM8A 2BDTA 1TJ4A 3SQNA 4XWKA 3I2HA 3JSXA 3OC0A 5HZHA 1W5TA 4DDWA 2ZRPA 4MCJA 5JJLA 5FI0B 2I91A 4M4SA 4NNOA 3PCTA 1H4QA 4XB2A 2XYVA 4BNDA 4W5HA 2GZRA 1PDVA 4J3NA 5BN3B 4DV6B 1HK7A 5C46F 4GLJA 3L7LA 4O8CA 4UNNA 3H2BA 5E6RA 1UPTA 3G1WA 3MD0A 1M5UA 5KSZA 1QR6A 3GFRA 3IBSA 2GN2A 2NUAB 2FWJA 3UFBA 1BZYA 4MPRA 1XZDA 3G2OA 2OV4A 2X0NA 1EFDN 2P35A 1O95D 4GOND 4O2BA 1SU4A 3EZ6A 2XMCA 2ZRAA 2CNLA 4Q4AA 4S0XA 4HH4A 1Q7BA 2ZUWA 3RRYA 5DLEA 1MOSA 4JP1A 1Y7LA 4U0KA 1ZN8A 2OQRA 4KKXB 3NUZA 1NPYA 2NQ8A 4YUZA 5BMOA 5EJ6A 2AXQA 4H60A 2VOJA 4Z3DA 4MR9A 3D7MA 2ZBQA 1U2RA 2A4KA 3DMPA 1OPXA 1WV1A 4BJ5A 1SVIA 5G1OA 1BROA 1XHLA 2JLRA 3GJ0A 3PJEA 1YCDA 5CGZA 3SHFA 3PQ2A 4OSPA 5AHXA 4CM9D 1N1DA 2WJYA 3N0XA 3PICA 3DL2A 2Z43A 3IMKA 4JWKA 4X63A 5DMHA 3ZGNA 5JAHA 4QRHA 4NE7A 4YLGA 4A2QA 2IK8A 2FVYA 4HXFB 3AO0B 3I8SA 4HO1X 4XSGA 4M6WB 3CQ9A 2W4MA 4R9VA 1CZKA 3KKEA 2M9MA 1MB9A 621PA 3HP7A 2VDRB 3MTGA 3RGWS 2Z3ZA 4ZFNA 3QU2A 3C74A 1C9EA 1X77A 3B2EA 5AJYA 3VHXB 4K3UA 2PBZA 2YTZA 4LBZA 3ABRB 1KK1A 1U8YA 2P4UA 2R8YA 1PZHA 3A1TA 3NEPX 4YROA 3WX0A 4OXKA 5I4IA 5DOVA 1LX7A 2YJ3A 3JQBC 3TM5A 4HBGA 2O19A 2RGXA 5JT1A 2PN1A 2OZEA 1VCHA 2B8EA 4U7DA 1E5XA 1P3JA 2J45A 5TV2A 3D8NA 2FX3A 1MG0A 1QR2A 3MJFA 4E0BA 1L5OA 1A9RA 1H0KA 1CP3A 1R6AA 3ZWOA 2HRCA 4NCXA 4V0LA 1FBTA 2EF0A 2QTLA 1MD9A 2C5BA 1EX7A 4LDPA 4LMPA 2XZLA 3OLVA 3IB6A 4H2DA 4XOIA 4GKAA 4ONEA 5JWOA 5CURA 5MFZA 2QX4A 2VHTA 1YCGA 2HIGA 1U7DA 4WASA 1Y9JA 1BEEA 2HTEA 3VVBA 2PX5A 2W93A 6LDHA 2I4NA 1MMFB 5IJ9B 1DKPA 1SVOA 2A9RA 1OWNA 2P1ZA 3EXFA 4IYJA 4QGFA 2ZVDA 1GPAA 3RC3A 2R6DA 1MKYA 3QX3A 5AVZA 2WTEA 5EA2A 4MAFA 1I6LA 2Q2NA 3KOZA 1S8FA 1DPGA 2WIDA 1N4DA 4R5MA 1JSRA 3L8DA 3V8RA 2G17A 4Q5IA 4K81B 4YTEA 1X9GA 1AHHA 2QTVA 2Y27A 1R0BA 4C21A 2PT6A 2ZSFA 3O4GA 1KKLA 4LSMA 5AXAA 2IYZA 3TTUA 2JLVA 4A5SA 1C8BA 1I7DA 4NBVA 3H5VA 4H7EA 5EIFA 1PVDA 3ZVMA 3RU2A 1S9DA 2J7KA 3V00A 2GZMA 4OJNA 1PFGA 4MV5A 3U26A 4JQOA 1DTSA 5A2GA 2ISCA 4FYMA 1R9JA 5HG0A 3ONDA 3AM3A 1SUWA 1CE8B 3NZEA 4IFEA 3F6CA 3ZWMA 4HN2A 4L4RA 1JN0A 1GGNA 4Q1EA 1KJIA 5DN6A 2HMSA 2BKLA 4EI9A 3KNZA 2H5EA 1D2EA 3K32A 3PI7A 5AQEA 3NHSA 1TC1A 3EQZA 1TLFA 4QU5A 7ABPA 1JU4A 2ZKIA 5DDIP 1NQXA 2NO1A 3K1JA 4U7PB 4I8XA 2XUPA 1JTVA 2P69A 4TT3D 4X95A 4RQBA 4GW3A 4YIKA 2WINI 5ALDA 3CV3A 2X2FA 5K0BA 5KO2A 1B23P 4EH1A 5HQ3B 4BLOA 2VYCA 2AWOA 1Y1SA 2FUEA 4BNZA 3RREA 2QZ9A 3U39A 5AJTA 5BN3A 1R0ZA 1QIFA 1BFDA 1Z0IA 1WKCA 5B6PA 5JDIC 3FFAA 4OMCA 5I7FA 1E5QA 1IC6A 1N6OA 2IDJA 2NUAA 1PYOA 3S2SA 2PT9A 3V9AA 3OO1A 3WNVA 5A9SB 1O0CA 2COUA 2V4ZA 3LT5A 3VO8A 1HSOA 3O4HA 4CJXA 2RH8A 2V65A 2B5WA 2WF8A 2YNMC 3GFOA 4XDGA 1YVPA 6YASA 4OQQA 4QYTA 2YV3A 3O2JA 3BIWA 4FD3A 4OQLA 4CT0A 1B8PA 2WQ7A 3S99A 4B8WA 3A4TA 3RO7A 3O8LA 1KJWA 2IPOA 3P9ZA 5TF0A 2NZ8A 5A5EA 3AQIA 2ORYA 2Z1NA 4CDMA 5B4UA 2PGOA 2ZIEA 3NJ8A 2JI7A 3WHLA 3V2UA 1F2TB 4ZOCA 4U00A 4I8DA 4PWYA 1HFJA 2D06A 4IVRA 4YJ2F 3WMWA 3MAAC 3B6KA 1EE2A 2YRFA 5BSKA 1NQ5A 3KSMA 1FXUA 5TEWA 4A0QA 4M6WA 3OVMA 3UKOA 3PD1A 3STUA 4PC2A 3W4IA 3LX8A 2R6CA 5E8RA 3U40A 3V1UA 1CUWA 2K6GA 1K2WA 5KHLB 1WTAA 4G2TA 3IP9A 1FLVA 2WFZA 3CZQA 5DBHX 2DT5A 1J70A 3GDFA 1NTRA 3FVQA 3O4FA 1KY2A 5TE9A 1JDTA 3HMQA 1XLTC 4ZODA 4OB7A 2OFOA 3C6ZA 3QUCA 4PNZA 5KTSA 2F1KA 4EVRA 4B3RB 1XVAA 4GU5A 1JHUA 1Q3KA 4TUYF 5AKIA 4CMIA 4HLCA 1G2OA 1AV7A 4KIGA 3OICA 4AUMA 3WGHA 1X15A 3I30X 3I45A 1UP6A 5H70A 1UWLA 2QSZA 2ZXFA 4EMSA 1S5PA 5CFPA 1IOWA 3LSTA 1E66A 2X4DA 2XUAA 3CU5A 4XLTA 2CVFA 1EUCB 1I2CA 4BMDA 4C0WA 1ZUHA 1JQKA 3WS7A 2NSYA 2I4LA 1JSCA 3NHMA 4S2UA 2G1PA 4IILA 4TRMA 4Y0AA 4ZAYA 1LD3A 3MCAA 4NCHA 3CNLA 1EFVA 3KQYA 3ZE9A 3ZGXA 4JYZA 2HJWA 1WXDA 3PSAA 4IFBA 5ERXA 2JCBA 3R3VA 4ZK6A 3IVXA 4Y2PA 1V8PA 2VBGA 3ZD7A 1JDBB 4WXHA 1J9EA 1RLTA 2ZTSA 5U4QA 1B0PA 4BEJA 3GL9A 4M53A 5CM9C 4AJ9A 4DLBA 1X9IA 1ZM9A 1YZHA 3QLTA 5ETJA 4IGKA 3U3RA 2B4RO 2IDZA 4C3VA 3QTBA 3JQGA 3QUAA 4IGIA 1Z9BA 3RIMA 3UMRA 3ESCA 1V35A 1N77A 5JYEA 2VWHA 2BV3A 1BMQA 4KYIB 1BCRB 3C7DB 1IE3A 3VFDA 1MFPA 4XTCS 4CGYA 2JGFA 3BK7A 3A14A 2QD5A 4F5WA 4EF4A 1DCKA 1HDOA 1CE8A 2WZQA 3QPWA 4H15A 2CLIB 2UYYA 3GROA 2PNFA 3VSEA 3MMPA 4BRSA 4EHFA 1LH0A 3ILYA 4GP6A 1K92A 6Q21A 4U9UA 3WK7A 3T7TA 3SCZA 1OA1A 1WUJS 2PE5A 2VVTA 2ZJAA 1JAIA 1ZS9A 3AHEA 1FSFA 2A5GA 4IQ8A 2JA2A 1L7NA 5DBIA 4FCTA 1SUPA 1G20E 1KHHA 2MIIA 4YRSA 2GEVA 4WY5A 1JWAB 3VYWA 1XDGA 2IEIA 3UWOA 1GT6A 2YCLA 3DCIA 2HF8A 2H2GA 1ONSA 2HJ9A 5H82A 5HQ3A 1QU3A 2WZBA 1ZG3A 5TMEA 2ZAYA 3KEFA 1HWYA 3CNEA 4MWSA 4W9RA 5EMHA 4BE9A 1RAEA 1GV1A 1J0AA 1XZPA 3AIOA 4QQ8A 1GPNA 2Z0MA 3ASUA 2JIRA 2N1MA 3BWDD 1T0JB 4UC0A 3TB6A 3HDYA 4Z0NA 5I7RA 1DIRA 3HWWA 2WIKA 3QFCA 1WZEA 4KBYA 4KO1S 2L19A 5DHUA 3WL5A 4ESVA 3DDHA 3ZWNA 5FX2A 2GKSA 1E0SA 4OA5A 2QMZA 3SHTA 4EHDA 4YN3A 5HW0A 3VNVA 3MCVA 3NKLA 1QV9A 2ETXA 2IYQA 2XQKA 3MJCA 1MAHA 3ML1A 1JJVA 4UTZA 5DNEA 5DW0A 5JDCC 3UCFA 3ZU5A 4HADA 4S04A 4OX9Y 1N6NA 1K1EA 1KMCA 1GL3A 3CZCA 1H4TA 1H5NA 3D4IA 2GAAA 1UXKA 3DWFA 3L4BA 4FHEA 4HDNA 4QUEA 2BSQA 3H8WA 2QVLA 3L7IA 3LXRA 1YQGA 1YQXA 5LU9A 5L3SB 3KT0A 3EGCA 2ZU6A 2BM0A 3A04A 4RFLA 3LLMA 2J0VA 2RG7A 4MDEA 3FSEA 1BOOA 4YMIA 4C4PA 5BSHA 5I7HA 1Q11A 4EARA 4S05A 4NH0A 5DH9A 3FCOA 3OH8A 5KQRA 1JSXA 1UBSB 3W8NA 2HBZA 5JTUA 3IPLA 4F6LA 1SELA 3F71A 2ZJYA 1TVKB 1ZZGA 2LIVA 5E95A 1BA2A 3G2JA 2CBGA 4R1NA 3COPA 2DPMA 2IHKA 1NF8A 2YV5A 1R0YA 5KNCA 3ILHA 1VXRA 3TUZC 2Q5LA 5EJAA 1E4VA 1RAHA 3LOUA 3VR2A 1S1MA 2AOUB 2O6HA 3LIIA 1FY2A 1MEEA 3BICA 1XJQA 1VG0B 3CH6A 4J0EA 3LZ6A 4PU0A 1JGTA 2BKVA 1OXXK 1BX1A 3DAOA 3I1YA 3H9JA 1IWBB 3NHAA 3O2NA 2EZTA 3ICWA 2F64A 1JTEA 3AUFA 2VWPA 4IDBA 4UJ3A 1QP7A 4PVDA 3VHQA 3FXAA 4GM1A 3IAAA 4PNEA 4PHCA 3Q7RA 1Z88A 1W47A 5A5FA 1F8UA 4GPIB 1U0EA 1TTPB 1W2HA 4E3ZA 2Q3MA 4XJXA 3BRCA 5FBLB 1K6JA 3HCPA 2I7VA 2R44A 3P2YA 1VHWA 5GINE 2VTVA 3CPHA 1TTQB 4DJDC 4RZIA 1UDWA 1KDRA 4FS3A 3ZY6A 5HIJA 1P2FA 3ITKA 3ZLJA 2SHKA 4C0BA 1N3LA 1P4HA 2DKOA 1CNEA 1GGEA 3NBAA 3IB3A 4UHHA 3TQOA 3W5HA 1Y6FA 4PHGA 2XYRA 3E5HA 5AW7A 5JFGA 4JVSB 1WZ2A 1U4SA 2GH1A 1A2OA 1OC2A 1IY1A 5AJXA 1T4GA 4M1WA 2Q07A 3EC1A 3G2QA 1XZ8A 4JU9A 4RZQA 3RVOA 3M6UA 4BJHB 2GN0A 1SOVA 2EKBA 4ZVKA 3FCYA 1MF7A 1F3LA 4R16A 1N2CE 4ENVA 3U1BA 1THGA 2LE0A 1JB1A 1T1EA 4HQLA 4UQPA 2ZYIA 5B57C 5ALSA 3DFKA 3UNXA 1BCRA 1UAYA 3ZOKA 1TF7A 1N78A 3QOYA 3MTQA 2DG2A 1ODSA 3MSXA 4ZPJA 1BO6A 3C8ZA 4FMDF 1QHHA 2GERA 4UEWA 5A0TA 2N47A 2O7SA 2P9QA 3F5SA 3OF3A 3P2MA 3SX2A 3IRUA 1XD8A 3P4UA 2PMDA 1XDUA 1K3FA 2I9KA 1VKNA 3OQOA 1T2UA 4TLEA 3NIGB 3MTIA 1JPVA 4J76A 3W3AD 3VJMA 1IN1A 4TQUS 4YRFA 4RCVA 4UDNA 1OE0A 1OD6A 1VPDA 2YXPX 2JFFA 2ET6A 1KEEA 1WE2A 3V7UA 4LXQA 4IJ6A 4QA9A 1DMSA 5EE5B 5J58A 4DV2B 1IOZA 2OOSA 3AUXA 5DTJA 3EGWA 1G21E 2Z4SA 2OCGA 1UJ6A 3KRTA 4DIDA 2Y3IA 2JFVA 4UNPA 5EZYB 4P6VF 1KEUA 3W7BA 3LDUA 4GFDA 1O9BA 2C7GA 2VZEA 1RC1A 2RGNC 1DELA 3QFHA 1Q2XA 1YQWA 2WD9A 3CPJB 4K6KA 1X87A 2XYQA 4I8IA 1QGDA 3GUCA 4NPAA 4TVBA 5LQNA 2CJXA 2XQFA 3FNEA 1KO8A 3SIPA 4BRWA 3FKQA 3V7YA 4G4SP 2HMYB 4FMCF 4GMDA 2ZBDA 3CN7A 1Q2UA 2O2GA 3IEXA 4FVTA 4MKZA 3IOYA 3JQPA 4CLHA 2XCRB 5JD3A 3KV3O 5JSZB 1MVOA 1XD9A 1YIOA 2EFCB 2Q9AA 5JMTA 2BL4A 3IDFA 5AESA 4LVOA 2PGXA 3TM4A 1GTSA 2FUNB 5JSYA 4W5TA 1GDDA 2FPXA 3NRCA 3RTGA 1GR0A 1ISFA 3QMVA 1T5TA 3JARB 3KZCA 1FTQA 4EYKA 3AFNA 4TYMA 1WQ1R 5TS2A 1KMNA 3AF6A 4ARIA 4NENB 3RSLA 2QYTA 3PZRA 2FPPB 4US0R 1MXFA 4ZO6A 1EP2B 2FZGA 5JADA 3JU3A 3EW7A 1WCIB 4ZEMA 1EQ2A 3JPWA 1U2ZA 1OYVA 1LLDA 1PJTA 1SVNA 1Z7EA 2BFNA 2CXSA 1TVKA 1RAAA 1I10A 2GF9A 3C6KA 3MYRA 1NP3A 4H08A 1CZRA 4FZ5A 2H8KA 5AFSA 2DR2A 1KYQA 3CJTA 3KP1A 5DF1A 2PQ0A 2WT9A 1JLMA 3BJZA 1SG6A 1A5SB 3KVNA 3G88A 1LPNA 4MVJD 2Q1XA 4RL6A 4HFNA 4JQZA 3SS7X 2AOUA 5HIAA 3FLEA 3IKMB 2Q5OA 3MWJA 4TLDA 1RWWA 5EE0A 3WGOA 3SD7A 2DCMA 1E7MA 5GADl 2AZXA 4V0RA 1ESDA 2O8EB 1U28A 1MAVA 4TROA 2GXAA 1N9KA 3CM0A 4NV3A 5I8ZA 4PQEA 3I01M 3EG5A 1U7OA 2NVUB 3IPYA 1P5ZB 5FKJA 4B79A 5BR1A 4AKGA 4HWKA 4R2MA 1EDZA 1PL8A 2ZJ2A 4PGAA 1I0ZA 3H5NA 5BUSA 1G9XA 4U4AA 2P2CA 4CM7A 5BSWA 2VYQA 3IUNA 1MPXA 2ES4A 1OZGA 2DH6A 3IVGA 4H4EA 4PXSA 5F12A 1GGHA 3HBNA 5AYVA 2X13A 2FW1A 3B51X 1CIVA 5CTJA 4N48A 2FSPA 5TX7A 1ZLYA 3ZWVA 3KK0A 1PT6A 1W4CA 2C20A 2CXRA 2UZ1B 2Y93A 3UW1A 4S0ZA 5EIAA 1I94B 4H0FA 1YDFA 1L7MA 4R9UC 1VGRA 4FSDA 2WVAA 3K6KA 3ST7A 3VAYA 2WYIA 2C4KA 2QR3A 1Y0BA 2WJVA 4CUKA 5COBA 3P2OA 4MW6A 3RRBA 4JJ6A 2ATCA 5LQKA 4MYTA 1NLMA 3ZY4A 4GZMA 3GZ4A 4E08A 4XGKA 1PJQA 1ULAA 3C1UA 3QKSB 2PVCA 4NESA 1PE0A 1YGYA 4BQOA 3W5CA 2ZB4A 2A9JA 2F17A 4MPTA 3KXKA 3O3MB 4MIEA 3QY0A 3VR5D 3MHTA 4NYMQ 4HVLA 2BFEB 4Q0MA 1X3LA 1VJ0A 2I3ZA 1DAMA 3AJAA 2XY4A 3NJ4A 5THXA 4D96A 1T29A 4HAIA 5TGZA 3RRZA 4QDUA 3SMVA 2FN9A 2XMBA 3NM5A 4FYJA 1ONOA 4XIGS 4BCCA 1UM9A 3TLCA 2B35A 4MVJG 10MHA 3ZR4B 3ND6A 3IS3A 2YX1A 3L0YA 4MMXB 1W96A 4X64B 3RNLA 3GG9A 3A6KA 3SX0A 4C22A 1I4TD 2VNJA 1ESNA 1TAGA 4MA5A 1QK3A 1W4ZA 3V5NA 4ANFA 1KQFA 2HZ7A 1TVCA 1C50A 1JA9A 5AKZA 1TW2A 3UM9A 4IKEA 2R7KA 3CW8X 2CJWA 3E15A 3V4LA 3WDLA 4UZEA 1JR3A 3ZYCA 4P7BA 2B8WA 2XTJA 4QFCA 3W2IA 3DCNA 3DHYA 3Q88A 4FR5A 4EY3A 1QIIA 3UAOA 1CJUC 1J1IA 2J5XA 3AL0C 3F4KA 3ACBA 3BA1A 221PA 2V7UA 3NBZC 3UAVA 1HI9A 3AFIA 3N2ZB 1YS4A 4G8JA 1ADGA 3EEFA 3RLIA 3DKPA 1P4JA 3NRBA 3TZQA 1B2RA 5TC4A 4B45A 4MQ4A 4WLUA 3EGEA 1PNVA 2P5UA 4E3WA 3JZIA 4OHWA 3QLUA 3FIJA 4Q3DA 2CLFB 3ZVLA 1JQ5A 4RTPA 3C3YA 5K8VA 1MB2A 3RIHA 3ZIAA 1UK6A 2WZDA 1O96A 4CT4B 4CU5A 3FWZA 3GD5A 3R5JA 4OHXA 1V2GA 5IAJA 3ZDBA 4CFSA 4R71A 2EJTA 4FE7A 5JSZA 4INAA 4BZXA 2YWRA 4Q01A 4MJXA 1T2AA 1I3NA 1Z5WA 1MO5A 2RCYA 4V3CA 1JB9A 5CLIA 4CG0A 4KITB 5I9TA 2F1RA 3WVNA 1RKUA 2PKCA 3O38A 2R6HA 2DJIA 3AKEA 4K6FA 1RI4A 1II9A 3JARA 5AHRA 1EK0A 3I6BA 3CEPB 2CC2A 1YOVB 2OOKA 1JECA 1ZUIA 1KP9A 4FX2A 5AVRA 2FPPA 1R8YA 2DVMA 2GZ2A 2O1SA 3EVGA 2XQVA 4J94A 1RFGE 5C1PA 1NBOA 1NVBA 1DJPA 4MIYA 1SUCA 5K99A 1QG4A 3F8SA 2YJNA 2VQ3A 5FA8A 3B1FA 3MWYW 3VH2A 2ID8A 4HWRA 4C76A 1QYDA 3L7OA 4DJ5X 2A30A 3AJRA 2R87A 2DHRA 1SCJA 4X92A 2FETA 4CLDA 1TUEA 2ZBRA 1NY5A 2DPXA 3B2QA 3U44B 2XOKD 2Q3HA 3E7WA 1U3UA 4KEAA 4KWHA 3V2HA 1PT9A 2O8EA 2JFHA 3RSGA 1G1AA 4AW9A 4TSKA 1MLDA 1U6IA 2PH1A 3VYTB 5JUWA 1SIWA 1P6QA 4N3BA 4Z86A 4PSUA 4UEKA 3TL3A 3K9BA 3W7VA 1YJAA 4IMIB 3ZY5A 3MMXA 3P27A 4X3CA 4Z2AA 3E3MA 4FFOA 1BIFA 2FSFA 3B2NA 1FRNA 1H2BA 1XMPA 3JAWB 3JPYA 1V3TA 2J3HA 3MA0A 2GAOA 2IPXA 4JHLA 1IB6A 5E6SB 2A7QA 4GM0A 2WG2A 3QI7A 4D25A 1CS4C 1PHPA 1RVDA 4ME6A 3GNTA 1G3RA 3HJAA 2H4ZA 1VMKA 3F3SA 4GOJA 5EMJA 5KUTA 1OTYA 4DUYB 3TKAA 5GJCA 2KLBA 4HX2A 4UFNA 4OQXA 3VUEA 1H3NA 2J0SA 3GGGA 1F2VA 4IOMA 5KSPA 2W2LA 1E1NA 5CXSA 3RSHA 4TS1A 1W7AA 4P8RA 3NTUA 4UTRA 1O6FA 5B6JA 1R8QA 1N6HA 3L8ZA 1O6BA 3EULA 4G1UC 1NIPA 1M8PA 4X7MA 3PGKA 2CK3D 3QKSA 2SICE 3GAZA 4OG2A 1JEOA 2Q2VA 3JALB 4C29A 4EYSA 3FNBA 3VJKA 5BSGA 2A5YB 3D6HA 4BRUA 4NG5A 1HQCA 2BFEA 3VYVA 1LDYA 2GF2A 3EXHB 3ZHVA 4Y6GB 1I3KA 3QU5A 4R05A 1FBNA 1XTIA 2FVXA 3IDOA 3QLVC 2WMNB 3DQPA 5CDYA 4RTRA 4D6YA 2C7VA 4OB6A 2VK8A 4DARA 1N2SA 3RK0A 5T57A 4JVLA 2ZYWX 3PC8A 2C1EA 4FBMA 1QRRA 4IHJB 4EO4A 2GEKA 2O9JA 3FRIA 4UMDA 1GKKA 4F5DA 1CUZA 1NXTA 4IJMA 2QTZA 1AT1A 4L6CA 3TLKA 1UJMA 1QF9A 3UEOA 5CVVA 3WL8A 1DJOA 3IA2A 5K7SA 3U37A 5KWJA 1FTSA 3CEHA 2Y0CA 3ZD8A 4M21A 2W98A 2P6RA 3FOCA 1KZGB 3IP1A 4K46A 3O74A 3BE8A 4RXUA 2CKMA 3HB9A 2PPVA 3PFNA 5ALEA 3G3EA 1ZHFA 4MDHA 3D6MA 3JRNA 3D6UA 1DMRA 3LQFA 3WSVA 1T8WA 4EZIA 5LLDA 1DC3A 4WY2A 1VBNA 3D4NA 1JQDA 1U81A 5ELMA 1DZ3A 3T4XA 3SC6A 4BLSA 2HB6A 1XRRA 2V0NA 3ONVA 2C8VA 3AZQA 3ZDEA 3EIWA 5K2MA 2PXXA 5I47A 5MF6A 3IPRA 2H59A 3L7MA 5CCDA 3KL2A 1EXDA 2FR0A 1U2EA 3BL6A 3MUEA 3KZMA 3TD6A 3F5FA 4RHCA 3W6ZA 3OX2A 4E6PA 4ZGGA 2HGSA 5IKPA 2N3ZA 4YRCA 1LKZA 4KN6A 2RARA 3RTAA 1XGKA 5EUBA 3RBVA 3SOZA 4LOLA 2XNHA 2B1GA 3JTEA 4PCAA 2H4YA 2PXCA 1E1CA 2UYGA 4DG5A 4OFXA 4RZSA 5IVDA 2VZ0A 2ZIXB 3EIXA 4BNWA 4EJMA 3JQQA 1NMSA 1IXYA 2V8BA 5AI4A 3N3AC 2C04A 2X2PA 4KIFA 2ZVJA 5CVJA 1EJBA 2NXCA 4GNKA 2D6FA 4F04A 1TECE 1R15A 2GK6A 4O0LA 4E5KA 4Q34A 3ZWKA 1II0A 3RH0A 4YLYA 1YOVA 3L8GA 4P98A 4EVIA 3QJ5A 5CYFA 3IUJA 2PH7A 4ZQBA 1V8DA 2W58A 3E9DA 2H2DA 1PKEA 1Z2DA 1IJFA 2RKBA 1O6CA 2AZTA 1W0KA 1M8GA 3OX4A 1JAXA 5DSZA 2O4UX 1V2HE 5E4TA 3ZW9A 1N3YA 3F46A 2J33A 5EIWA 2EWVA 5I9NA 3I61A 5SY6A 3PEEA 2V7WA 3ZHSA 4D8VA 4TRJA 4TKVB 3MPUA 4B82A 3QPVA 4C4OA 7AT1A 3U44A 4QGAA 3RS2A 3ADBA 3OOYA 2OCLA 1DFGA 2VPYA 3IEKA 3PFKA 3SE0A 4XVUA 1Z16A 4UVEA 2GUWA 2W71A 4RS3A 3ZCXA 4ZEVA 3SQWA 3NR2A 3U4QB 1Z83A 5B1DA 1M2EA 1M5TA 4P3OA 3W2EA 1SQSA 3UMBA 3ZV4A 2EV9A 2YJZA 3QEOA 3MJ4A 3SZOA 2XD9A 3KEQA 1PWYE 3KKLA 3IMGA 4W1RA 4TQAA 3R2JA 3GGOA 2CMGA 5AJWA 4DY6A 1BS2A 5E6SA 1FYDA 1KI8A 3HSSA 4DRYA 2VLIA 3GN2A 2NACA 3B8HA 5A2QA 1GCOA 4FLFA 1MO2A 4DLUA 1LUAA 1MJGM 4URYR 2O7RA 2DPLA 1TIKA 1M33A 3ICOA 1H2AS 3M6WA 4WNCA 4F46A 4FYYA 1V5WA 4HYEA 4LA4A 3MWLA 2XUIA 4IUDS 1UMBA 1USUA 4YRRA 4TL9A 3D1LA 3GRYA 4IDCA 1QRAA 1F9AA 2GEUA 4WZAB 4GI7A 3T5BA 1XPRA 1ZVQA 4LDRA 1JH9A 1CHNA 1H5UA 4QBHA 5DWQA 2SNIE 1JA0A 3AERA 1CRPA 2HPZA 1RQPA 2FN4A 3V4VB 1D5WA 1RJEA 3EXHA 1GZ5A 1X7YB 3FKJA 4QOFA 2F8TA 3C8DA 3EF0A 2O2ZA 5DW3A 4R69A 3CT4A 3WWDA 4IHJA 2JASA 4AYTA 4EW2A 5BWOA 1U5BA 4OHZA 4U6SA 2PM8A 4XYBA 3SM3A 3QM1A 3GVHA 1H4VB 3REQB 3EVCA 1IZYA 1YJXA 5EWMA 3WLPA 3GJRA 5SY4A 2JBAA 4NJOA 4YJFB 4KXMA 4DABA 2ZWAA 2XA9A 1E2JA 2ZJ8A 3GFTA 3L0DA 2FWMX 3G2HA 3O84A 1WAMA 4U5QA 4YECA 5IT0A 2HY7A 2NOAA 1ODFA 5IYZB 3UICA 1WDKA 4DTIA 2IJGX 4HNSA 4F56A 4KRXA 3NTVA 1GGKA 5C81A 4X41A 2C29D 2FWBA 2XWPA 1U9ZA 3M3HA 1GJRA 1XAIA 1XCLA 3IIIA 3WL6A 4HAOA 4BMYA 4QATA 1RHMA 2BTEA 3ZUGA 2JFUA 2ZUBA 4TVKA 4LI3X 1ZN2A 1SCUB 1E3LA 1MGPA 2RE8A 3BCUA 1Z35A 2WSYB 5EINA 1OTXA 1IY8A 2ZPAA 4YXWA 5CIYA 4HEQA 4RS4A 4UM7A 4PG6A 4H6PA 3M89A 3UENA 3U4CA 1ZBQA 3CRW1 1V7PC 1P1IA 2LPMA 3EZ7A 1L5FA 1GZ6A 4K0RA 2RHRA 3ANMA 4MA0A 1HZZC 4JQCA 4RFVA 3RPEA 2H7VA 5JAZA 4IIHA 1GPMA 2ZIXA 2DJ5A 3IKJA 4HB4A 4ZVUA 1ADBA 2QN1A 4L5IA 4PC6A 2FRDC 3BX1A 2BTQB 5IHXA 1MV8A 1N6RA 3F1KA 4ZHQB 2GOYA 1V8FA 2VYNA 4GLOA 4GXTA 2F1IA 3UKJA 3ADKA 5FPKA 5DX8A 3W1WA 1J23A 1Z7YA 5ERYA 2FWIA 4L4UA 1N32B 1WO8A 3PRHA 3TOXA 4WGGA 1VE6A 1WXGA 4ZAGA 3V8PA 3O03A 3PUYA 3NFYA 3OZAA 5JNWA 3LC7O 1GTRA 2V0GA 1B6GA 2IU6A 4IZOA 2EYQA 5EYPB 5BVGB 1E2LA 1K5GA 1AQYA 1G7CA 3ZC3A 2BBTA 5DX1A 1NOKA 3SK0A 3BRWA 3Q40A 1USKA 3QVLA 5F1YA 1EA5A 5MN5A 3E2IA 1ZA1A 2ZANA 4ZVMA 3HCDA 4RWEA 3CYFA 4DM3A 3AP2A 1DC5A 2DPYA 1ZGGA 3OCWA 1YE5A 4TKVA 1NBWB 2Y4OA 1ZUNB 1M0TA 5CUQA 2BONA 2HREA 2GESA 2ZI5A 3VDNB 2WTMA 1COZA 3IXQA 4NCJA 3AUAA 2Q5IA 3KQSA 3QEJA 3ZBPA 2IXDA 1CNMA 1XNGA 3OLWA 4FD2A 3VKFA 3QMPA 3LPDA 1EM6A 1U98A 3U4QA 1FFXB 2Q8PA 2XEXA 5EXEA 1ZD3A 3NHWA 1MW8X 1UKAA 3FYHA 2A9OA 4R3WA 5A3SA 4AMZA 2FHSA 2XJ4A 2CLHB 5F4ZA 3RS3A 1Z5NA 1CUVA 4OP3A 1S8AA 1BMTA 1RLOA 3OLZA 4O1HA 1RW4A 2I33A 3H99A 4KNVA 1NJ8A 2YOGA 3VKUA 3RIGA 5AW4A 3ZJUA 2HAEA 4MRMB 4S1NA 1AF7A 2C2HA 2I67A 3D0RA 4G86A 2PANA 4MR7B 1L5RA 1RT9A 1E9BA 5C8VA 3AB3A 2B3DA 1N2ZA 4PAGA 1ZJ4A 3AM1A 3H4IA 3COWA 1VHTA 1OIVA 1SXJE 4I4NA 5FD8A 1D4AA 2QEQA 4WZAA 2ZE6A 1EGMB 1QHIA 3IHWA 3ZG6A 1I1HA 4XVRA 2G08A 1PR5A 5CDFE 5IJ0B 2FFAA 1ZVKA 3RNOA 3W1EA 2I65A 2ZJBA 3AI7A 5B53A 2IYYA 1QH0A 1OBFO 5A03A 4TYWA 4KQKA 1OGIA 3RVPA 4B74A 4YAKA 1X7YA 3GMSA 5DYGA 3LBFA 2H1RA 4PFJA 3TNFA 5F23A 4P0PB 3NEYA 4YCDA 1J1UA 1BKYA 2HDHA 5M3BA 2JB9A 3K09A 1ZH0A 4Q3CA 3MN1A 4LMBA 2LXNA 1M74A 3M3DA 2YW9A 4YT2A 1YBFA 3F6SA 3KZVA 4N7MA 1E20A 5JCPA 3REQA 1HG0A 1DAIA 1XCOA 4YAFA 5JCOC 2OLEA 1G3IA 4HSEA 2P2GA 3N2GB 4YJFA 4KK3A 1W5SA 1JIIA 4NK4A 4EZEA 1DTWB 3PNLA 3B1KA 1W49A 1OVGA 4RV4A 5TEVA 3RUCA 4AMVA 4BBZA 3L7DA 2RHBA 4JIMA 4HYTA 4B73A 1BXKA 1RP7A 3VM6A 4HNUA 3OEHA 2V4UA 3CNOA 1ZDMA 1YD7A 3OE7A 4P31A 2J3MA 3GJ5A 4PCUA 1L4EA 2FKAA 5B3LA 1T9ZA 1VJDA 3CUWA 4MI1A 1M1YB 4F4DA 2IYVA 1ECBA 4HNAB 4RPGA 1R3UA 1KOJA 1LFAA 3N07A 1DX6A 1SGWA 3HB0A 1RWPA 3VXKA 2QBYB 2DWUA 3KIPA 5EJ4A 2MHCA 3BGSA 1OUMA 1Z0FA 3LF1A 4HNGA 2H92A 1U02A 3DFUA 4XM2A 2IKQA 1Q0ZA 2B36A 3MBIA 1WY7A 2Q45A 4KYUA 2HZBA 3LA8A 1NI4B 4LQLA 5LBUA 3T06B 5BMVF 4CG2A 4AY2A 4D9HA 2CL7X 1JQLB 1QGYA 2EX1A 2FR8A 4J9UE 1QCCA 1GKIA 1UC9A 4Q7JB 2BZSA 2ZROA 4WI1A 3L46A 3YASA 2CY0A 2HCRA 4PG4A 4XPZA 3VR4H 4JZYA 4P38A 1LF5A 1NW3A 1RQGA 2BEUB 3CNNA 1JKMA 4XCQA 5ARCA 2X8WA 3N05A 1AMOA 3EDMA 1T9DA 2BTQA 4FYWA 4BZQA 1NG9A 1K08A 1U4NA 2I2WA 1TZ2A 4K9RA 4ZHQA 5I48A 1K8RA 1ANKA 1BHSA 1E1DA 2ZR8A 2DY0A 1UK8A 4M1QA 1CQIB 1PHRA 4M8KA 4V39A 4Y9SA 3H1GA 2VSNA 4PTYA 2F55A 4NBRA 1RTKA 4MUGA 2CEAA 2Y6UA 4OOEA 1K8ZB 4PBRA 5EYPA 3T8YA 2G25A 4OSOA 5A4FS 5BVGA 1ORVA 1D4ZA 1E0AA 3PFBA 4BNFA 3NC0C 3VAZA 4Q16A 1I6MA 2I3GA 2C95A 3USZA 3KVRA 2VCYA 2ODQA 3QOFA 2HHHB 1TF5A 1QIGA 4ESEA 4I1IA 3LX5A 4NMLA 1HA3A 4LVNA 1HZJA 1Z2AA 4YR7A 1VJ1A 3JYOA 1ZUNA 1SZPA 2RAPA 3SC4A 3SHOA 2BBWA 3ZZNA 4IICA 2LUOA 2H1OA 4BGUA 2QUAA 2P4SA 2I8AA 3QBJA 3I8OA 3TW4A 4RLSA 2XYHA 3HKEB 4C7OB 1C3JA 4M3NA 4GQIA 3VO1A 1YA4A 3WGUA 3ONWA 3TTTA 4DMUB 3DOHA 1P5HA 1EH5A 1FFXA 3OTWA 4CM6A 1IN6A 3BJMA 4I9GA 2VA8A 1XA0A 2LP4Y 3QYAA 2FFQA 4JJ4A 5TRTA 4TV9B 4JEUA 4JI6B 2BGRA 2FWPA 3X1YA 1C9MA 1USGA 5AP9A 4V1CI 1NUSA 3OPNA 4DLKA 4LRYA 1G5HA 4KWCA 2OCYC 2JI9A 2X14A 3TF5A 2TRSB 5GJWC 4XIYA 4MRMA 1F8YA 2RIRA 3OFND 4C2UA 4JBWA 3FHCB 1K7XB 1P0FA 1ZGJA 3GBPA 1JR6A 1ZJYA 5GPBA 4MR7A 1A77A 2C2GA 3L8MA 2Z5LA 3QIVA 1G41A 1CUUA 3PITA 3I6ZA 3QVOA 2XMRA 1U0GA 3BFVA 3IBCA 4ZC1A 1UZNA 2Q6LA 4JKIA 5CA0F 1GUFA 3F8TA 3I73A 3RS7A 5JZMA 3IR6A 1T9AA 3A1EA 1XCGB 4Q15A 5IJ0A 5FORA 1G42A 4M1OA 4B0PA 1I4OA 4EY8A 1NLZA 1XAGA 2J41A 3VJLA 1VGVA 5GV7A 4HH1A 1EVIA 1WA5A 2G0TA 2YYAA 3GEIA 2FKNA 4R2XA 2GT1A 4OQPA 1PZFA 3KWMA 4W7SA 2VA9A 1AHIA 1YZKA 3BAFA 3K30A 3LKVA 3TTSA 3UJ9A 1PZNA 1TRKA 1V8ZA 4G1EB 3B13B 3H8SA 5C5CA 4XQEA 2C57A 5EE9A 5AIAA 5ECDA 2BGGA 4ZYWA 1HDEA 4Y2RA 4UOEA 3QG1A 1EVQA 2IZ5A 4KQWA 4C88A 3JZMA 1SBYA 3N2GA 3KG2A 1DTWA 2ZU0C 3ZIUA 1ECGA 1QH8B 1UMDB 1K9SA 4GG1A 2VAVA 4QUDA 1VSBA 4JU8A 4II3A 2JD0A 3VR6A 4NIMA 3VNUA 2XA2A 2GM4A 4ACAA 4HGNA 5KSYA 2P3SA 4M1SA 4GPEA 4QDOA 4EHBA 2JJ2A 2ZCUA 2EGGA 2OM2A 1M1YA 1QLWA 1XFDA 2R00A 3ESDA 4ITRC 4Z4EA 4IOKA 4KX3A 1D9ZA 1E3SA 2GZHA 3M70A 5LNK1 4EW6A 3DO8A 2RDMA 4RVCA 2A1UB 5LQRA 4C4SA 1L8AA 3K70B 4P81A 2E5LB 5IZCC 2IODA 2XLCA 2JCGA 2HA0A 4KTVE 3IGFA 5EJIA 4YJGB 4DXDA 4PZ0A 1NI4A 1ZVJA 3HM2A 4WIAA 4XKJA 2O0LA 3FUTA 4DEVA 5CEEA 4OQZA 3UBTA 2HA2A 4LF8B 4CMAA 5DN6D 1NURA 1T9GR 3C16C 4TLLB 3GX1A 1KJNA 5GOZA 4B3BA 3PRKE 1TADA 5DULA 2OPBA 3QU7A 3HGMA 4PCVA 5FTNA 3WL4A 2EW2A 4UAGA 5GAJA 3LY9A 2QLJA 3JQRA 2MTBA 2CHGA 3WA7A 1WBDA 3G49A 1Y6RA 4C5AA 4R1MA 3Q8WA 4E11A 4FDLA 3C15C 4OCZA 1NFFA 5G02A 2PPLA 4AY5A 4QBGB 2PY6A 4IM7A 5HKOA 3RFTA 1SG9A 3DB1A 1IU9A 3D3NA 3OA0A 1FLDA 1P8JA 1Y4AE 3AR9A 3B9RA 4MW4A 4G67A 1VG1A 3BHIA 2WJPA 1ODTC 2HO4A 4OXXA 3AR5A 4H27A 4OFZA 2G28A 5TARA 2P4QA 1ZOPA 2YWBA 2WJIA 1B0AA 4DRZA 1E18A 1D2CA 3ENZA 4C3UA 5B64A 2L69A 2CJYA 1AU9A 4I0WB 4Z1MA 4I1SA 2E4XA 4R9NA 4YI5A 4GOXA 3HJUA 4P9NA 2DBRA 3QLJA 3R5SA 1EFRA 4GAEA 2VJQA 4RIHA 3FDIA 3ZHUA 3F78A 3IIJA 4URZR 5AO9A 3HU5A 2BKUA 5IHPA 3ZLUA 4RTQA 2FPLA 2RH5A 3E61A 4AU1A 1RBQA 3HKEA 4C7OA 1AK1A 3HPRA 3TRIA 4C7JA 1Y6JA 5LD2C 3GJ7A 4YCBA 4Q7EA 3UZUA 4I14A 3RS5A 4CL2A 2DHDA 2ATIA 4W63A 4FZRA 4U2CA 1DBWA 2PSJA 3EXIA 4TLBA 2OYCA 1SULA 1P18A 1KVRA 3OOEA 4AZVA 3O3OB 4WFKA 5I4CA 3KTAB 3PHJA 1YQUA 1VBKA 3FGOA 5JQWA 5M2QA 3TLGB 2ORWA 4YY3B 3UQZA 1NKTA 1WD7A 2QD1A 4XM1A 4HQFA 1VQ1A 2OFPA 2PWAA 2YVLA 3FMIA 1XTSA 1NN3A 1TFRA 1TL7C 3V42A 4F06A 3OX1A 4ALIA 4EPWA 2ARKA 1WLSA 4XB1A 5FUQA 4PFQA 1ILWA 3EEQA 1EEHA 2RIPA 1LBEA 2M1ZA 2ODPA 5LU8A 2WKRA 3P9KA 3I62A 2BVNA 3FR7A 3TRHA 4EECA 1Z33A 4OQDA 4RD4A 4M2LA 3W4KA 3LGAA 4M49A 3KXDA 3W5JA 3VPFA 4Z4GA 2ZFUA 1T0IA 3OLQA 3T1QA 2A88A 2CLLB 3RVNA 1CRQA 2ALJA 4A91A 5A4IS 5K6AC 4ND5A 2O3QA 2BE7A 3H2IA 4PRYA 3EWNA 5CVCA 3ICVA 3SBDA 4BL5A 4J0KA 2Q4OA 2V6JA 5BRJA 1TE2A 4XJSA 1PR6A 4XX0B 4YMHA 4HY3A 4NYJR 2GKGA 1F4PA 2OZVA 4IW3B 3K0EA 4H59A 3U48A 1SCNE 3ZEIA 1A1VA 4KIUA 3S2IA 2A33A 1E6WA 2AXPA 2VP9A 3A4VA 3UATA 5IH7A 5EL0A 1A98A 4IIJF 4JKOA 1NF9A 3DDWA 2XZPA 4DLRA 1EB8A 1G4HA 2VL7A 1K4KA 3F7MA 4JBHA 5DLPA 4MWZA 2PJZA 4QT0A 1QXSA 1PEKE 4QNMA 4J0QA 2Z6AA 4FX5A 3TCNA 1QH8A 2ZSAA 1UMDA 3LT0A 4R2LA 2NO7A 4IDDA 4FI3C 5C7LO 2X9LA 5MDHA 4IH1A 2AXEA 3P32A 1G2PA 2EQAA 4ABTA 5LWHA 3ANXA 3IQDB 4OYYA 3TRJA 3G23A 3R7DA 4O4LB 4V0ME 2VKQA 2XMGA 4I2NA 3GP8A 1XRPA 2Q5FA 1XTTA 3S27A 2H2FA 4AY6A 3EOZA 5BSUA 4JI7B 2A1UA 1B3RA 4N5DA 2O0HA 4B3GA 1UKCA 4C78A 1OFVA 4NOJA 4B84A 5JXJA 2UZ3A 2BR3A 5LA6B 1MDFA 4J90A 3H1TA 5EAIA 3V1TC 2YWCA 4WCDA 4E2XA 4YRIA 2AMLA 4WL0A 1OMOA 5KYKA 4YJGA 1ZK1A 3C5WP 5DGXA 5LIPA 1VHDA 1ORTA 2WKQA 2Z2YA 2RD2A 2QYOA 4KFUA 1YS2X 5ES3A 4QPPA 4Q1CA 4NFYA 4YDRA 4OFWA 3AL2A 2B0CA 5KVAA 2HPHA 1XRNA 2C97A 2QNBA 4HPJB 1JZSA 4KH0A 2IEYA 2PD4A 5B1YA 2WDPA 3CLUD 5A6VA 3JQFC 3T5DA 1VI2A 4BNVA 3RJ5A 4PN7A 2VDKB 3FWKA 1LI4A 4JMLA 3VU3A 1II8B 3MTAA 3U17A 2PCLA 3TQIA 3GELA 4OYRA 2J6CA 4OBEA 1IZ9A 4X71A 4AF7A 4ZI7B 1GCGA 2QN6A 1XXHB 1YUMA 1I2DA 2XCUA 3DGFC 3HVKA 5LMZA 2XSZD 5FQNA 4OF4A 2R5FA 3VNRA 1NOIA 2A5JA 2D3TA 4KQ9A 5KAPA 1WMSA 1ORRA 4C6HA 1BXGB 5FWDA 1ZN7A 4D3SA 4FP9A 1JZQA 3ILXA 5DHQA 1Y4ZA 2V74B 3HY4A 5ECGC 4JL6A 3HHEA 2V9PA 4YUYA 3RSOA 1ABBA 3TLZA 3CUVA 2CDNA 1JZTA 2Q6TA 1Z4JA 3G8DA 3LYAA 3AVUA 4MI6A 4QU9A 4ZOAA 1MX9A 1C1XB 1G21A 1OKKA 2VRBA 4YACA 1GGFA 5M29A 3TZ6A 2RB5A 1OBCA 2YZ7A 4M22A 4PG7A 3DE1X 1XEWY 3A6JA 7MDHA 3ON5A 3ESYA 2I6QA 1I2AA 1NR1A 1H23A 3BDIA 5EJFA 4FFLA 2JAUA 3I53A 4KGDA 4E94A 1O97C 2PA3A 4KQMA 3HI6A 5E1MA 5F35A 1TEZA 1IRIA 2GBGA 2D2EA 4HVAA 4FGSA 3TLGA 3WGGA 5JRDS 3VVMA 4LXUA 5CLJA 1RD4A 3H6HA 2QLLA 3I92A 5BN4B 1DB3A 2B2NA 2A4MA 3WK6A 5LVAA 1UP7A 3A06A 4OD0A 1HTBA 2NO0A 4MV0A 4A2PA 2QAIA 4R3UC 5BSRA 4PZLA 1VDMA 1RKVA 3KAPA 5F3DA 1H05A 4KXWA 4AX8A 5C5DA 4URVR 1DDOA 4ZTBA 5FPHA 1W9HA 2F3PA 4E4YA 4RM3A 5I3CA 1SHJA 3I9JA 1ULBA 2ZE8A 2BY4A 2YVQA 3EHEA 3G9TA 3JZDA 1CJCA 4S24A 3I76A 3KB6A 3TTYA 3GLQA 1C8KA 4WOJA 1OLUB 2NTYC 1GNSA 2VF8A 4FHGA 1M6VB 1T6YA 1R6DA 2BBSA 2HSZA 4IJUA 1QZTA 4QKQA 2FUG1 4PSCA 1MZVA 5EPEA 4C03A 4JJ8A 4PCLA 5HUQA 5J2UF