3X1KA

Crystal structure of phosphoapantetheine adenylyltransferase ppat/coad with amp-pnp from pseudomonas aerugonosa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
157
structure length
157
Chain Sequence
b'NRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
molecule tags Transferase
total genus 55
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1kA00
1DNPA 3FNRA 5DASA 4NX2A 2WB2A 3IOBA 2WQ6A 3HFJA 2QJFA 1GTRA 1N75A 1OBHA 2A86A 5IJXA 2O8VA 1G8FA 1V47A 3P0JA 4ZT3A 3FETA 2HMAA 1D2RA 3IOEA 5H7XA 4R2LA 4DLPA 2ZUFA 1EXDA 1U0BB 2CSXA 1WQ3A 4MLPA 2NSYA 5KWVA 3Q4GA 1BS2A 1KKUA 1N2BA 2YY5A 3RBAA 2E21A 3VRHA 4MW2A 1J20A 5TGTA 1TYAE 3CVWA 1WQ4A 1MB9A 3QTTA 3UMVA 3Q10A 4FZJA 1IFXA 2PXHA 4G5YA 4MUEA 3H9BA 1O0BA 2YXNA 3FOCA 1KH2A 1NP7A 5HUJA 3AKZA 3RK1A 3NBKA 1N2HA 1RQGA 4MW6A 1VBKA 3ND6A 4RPIA 5TEWA 1X8XA 4E1AA 1U3CA 3IVGA 3FI0A 3G59A 1R6TA 2DERA 2CYBA 3KT3A 3NV7A 4EGAA 1KQPA 5EKDA 1U7DA 3AFHA 4JFAA 3ZGZA 3ND7A 3DPIA 1H1TA 2AKEA 1GLNA 4ARIA 3H05A 3CLTC 3HL4A 3LCJA 4HPWA 5AHWA 4U7JA 3COVA 5DB4A 1WXIA 4L2IB 1N1DA 2D5BA 4EG1A 4MW9A 3AIIA 2X3FA 3INNA 5BNZA 2GOYA 1QTQA 4P2BA 3P52A 3SEZA 1EJ2A 1ILEA 1YUMA 4RUKA 3CLUC 1O97D 1YULA 2RE8A 1MAWA 1J1UA 4MUFA 2HGZA 2E18A 2J09A 1VLHA 3E27A 1M1ZA 1WXEA 4QRDA 1MBZA 4YP6A 4ARCA 1IQ0A 1TEZA 4I6EA 2VXOA 2YWCA 3I05A 4NAHA 3MUEA 3CVYA 2DETA 3IMGA 2X1LA 3G5AA 3IDFA 1NUQA 1IQUA 1M8GA 4MULA 2E0IA 3X1JA 4L2IA 3ZXIA 4ZCTA 2A84A 4PBSA 2Z3VA 2J5BA 4KR7A 2A1UA 3CLSD 3P0HA 5FO0A 3CVXA 5LM3A 3PNYA 4MUNA 4XFJA 2CV2A 1T6YA 1KH1A 2I1LA 4TS1A 1NUSA 2OQ2A 1R6UA 1IVSA 2DLCX 3SDBA 2QTNA 1GTSA 3IOCA 3FDXA 1K4KA 3UY4A 1MRZA 2ZUEA 3SEQA 4BWVA 1GAXA 1OD6A 3A4IA 1JECA 1NI5A 1NSYA 1LI5A 1ZJWA 1LI7A 4MW4A 4EG4A 3UC5A 1FYDA 4G6ZA 4JYZA 1LW7A 2XRYA 3PRHA 4CT0A 3CVVA 2YWBA 3D6UA 1PFVA 3HMQA 4EF6A 3KT6A 4JZYA 1EUQA 3N2YA 4ZCRA 3COZA 1JMVA 4YP7A 1NUPA 1WOYA 1F4LA 4MWBA 1ZH6A 1SURA 3PNBA 4JXXA 3N8HA 1Q15A 4Q16A 2DUMA 3CA8A 3CLRD 4U63A 1QRUA 1YIAA 2BTEA 1O94D 3A2KA 1I6LA 3N05A 3A05A 2IP1A 3D6VA 4F3RA 1Q77A 1OWMA 5J58A 3ISJA 2DPLA 3U1VA 1HYBA 2VTBB 2CV0A 4GRIA 1N3LA 4A91A 3VGJA 3P0IA 4MW1A 1J70A 1IH8A 3S3TA 1EE1A 2CYCA 1S4MA 4XSVA 3GUZA 2PZ8A 1WXHA 2A1TR 3ZJTA 1GN8A 2WQ7A 1WZ2A 1TFUA 2PIDA 4NATA 4OJMX 3LE8A 4EG5A 1O95C 3AG6A 1MOPA 3KT8A 1N2EA 1YI8A 4I6JA 2V0CA 4MWCA 1F7VA 4ZT2A 2OV4A 4YMIA 1QRSA 3L93A 3CR8A 3TQIA 1R6XA 4H3SA 4DDMA 1V8FA 2AG6A 4ZCSA 1VL2A 5LFAA 1T9GS 1O96B 2VTBA 2EJCA 4CQNA 1KH3A 2H29A 4EG7A 1FFYA 3ILVA 3AG5A 4MW7A 1PG2A 1EFPB 1ZH0A 4JXZA 4X0EA 1QJCA 4PBTA 1IQRA 4MUJA 2DEUA 1I6KA 2J4DA 1KQOA 5DEOA 5JBNA 3BL5A 4DDHA 3H97A 1EFVB 3COWA 5H16A 4MVXA 4MUKA 1M8PA 1OBCA 2J07A 1MB2A 3PNVA 3RJZA 4DE5A 4S1OA 3FH0A 3A04A 1O96A 1KP2A 4KPUB 1G59A 4AS1A 2QJOA 3RHSA 1VBNA 1JZQA 3OTWA 1PFUA 3JXEA 3MXTA 4I6GA 1JIJA 4ND7A 3IUBA 2QUHA 3FG9A 2CFOA 2A4MA 3PXUA 3UOWA 4MQ6A 2CYAA 1UFVA 1VBMA 1JEDA 1PG0A 1KAMA 3MLBA 4KKVA 1COZA 3TNJA 1IRXA 3VU8A 2DXIA 1EFVA 2A1TS 1KAQA 4DJAA 4MVYA 3ZJUA 4HJXA 3SP1A 4ZCQA 2XRZA 3K32A 3RK0A 1KR2A 2PG3A 3RFFA 1K92A 2QTMA 4J76A 1QU3A 2D13A 2CT8A 1G8HA 1JZSA 2AZXA 3MLAA 1X6VA 1NUTA 1WKBA 1J21A 2JANA 4AQ7A 2O5RA 3IMEA 1IHOA 4CDMA 2QUIA 2WSIA 3GMIA 2GM3A 1GZUA 2X0KA 3C8ZA 5FNZA 3G6KA 3GLVA 4OUDB 3CLSC 4MWDA 2V0GA 3NBAA 4KR6A 2BYTA 1U3DA 3CVUA 1G8GA 1ZUNA 4ZT5A 3FWKA 1JILA 2A88A 3QTBA 3N9IA 2PZBA 1NUUA 4CDNA 4XFDA 3CLTD 3KT0A 1MC1A 4YBRA 4HJRA 1CT9A 3ZIUA 1XNHA 3DLAA 1QNFA 3DO8A 2G36A 3IVCA 3MMXA 5IHXA 4GU5A 3TZLA 3ND5A 4MW5A 3H9CA 3TS1A 3FHJA 3K9WA 5HUHA 4U8HA 4MUGA 2Z08A 5F23A 3CLUD 5LLTA 4YP5A 1JGTA 2JA2A 5J59A 1O6BA 1T6XA 1K4MA 1YUNA 3SZGA 3ZUGA 1N2GA 1NYLA 4OUDA 2RD2A 1B6TA 1OWNA 1XNGA 3IODA 4QREA 1I2DA 1WXGA 1WXFA 1H3EA 1ULHA 5FO1A 4EG3A 1N2IA 3F3MA 4EG6A 1P7PA 1A8HA 1TYBE 2X1MA 4WSOA 1QQTA 1OWOA 3DV2A 5KHAA 3M5WA 4K0RA 4HK4A 1WY5A 3CLRC 1O94C 4MUHA 5HG0A 1Q11A 3HZRA 4Q93A 2Z09A 1JEEA 3KFLA 1N2JA 5DK4A 4PBRA 1TYCA 4DNXA 3IVXA 3X1MA 1O0CA 2PFSA 1QU2A 3FY4A 3H99A 1OWLA 3HV0A 2PZAA 1M8KA 2TS1A 5K0TA 1EUYA 4MUIA 2A1UB 2H2AA 1NURA 1H3NA 3L92A 2QJTA 1I6MA 1M83A 4NZPA 2ZP1A 1XJQA 4ZCPA 1Y42X 2DR2A 2QUJA 1OWPA 4J75A 4EG8A 1JIKA 2IJGX 3QE4A 3LOQA 2C5SA 2R5WA 4MW0A 3X1KA 3OP1A 4F4HA 1F7UA 5TEVA 2E89A 1EFPA 1NZJA 4R2MA 4EFKA 1TQ8A 4DDKA 2GKSA 1TYDE 1J09A 2CUZA 4R0NA 1KP3A 4ZT4A 1N77A 3TZEA 1T6ZA 1XNJA 2JAXA 1WJGA 4MWEA 3COYA 3IUEA 1J1ZA 1KORA 2HZ7A 3IH5A 3SYTA 4ND6A 3ZXSA 4WNYA 1PFYA 1O97C 3ELBA 4NAUA 2A7XA 4UZEA 4PY2A 2CV1A 3IMCA 4ZT7A 3TQOA 5K0SA 3UK2A 1PFWA 1YIDA 5TS2A 4MVWA 4QBTA 1MAUA 4KPUA 4G5FA 1JHDA 1GPMA 1H3FA 2IELA 2QUKA 4MAFA 1JIIA 4ZT6A 1KQNA 1O5TA 4KR9A 1QRTA 3SZ3A 2J08A 1T9GR 2NZ2A 1N78A 1M8FA 3AL0C 1K97A 5KCMA 4MVCA 5J5AA 3Q12A 1F9AA 2QTRA 4K03A 4NDAA 1MJHA 4UZFA 2B7LA 2D54A 1M8JA 3FIUA 2EL7A 1N2OA 1Q19A 3HGMA 3ZJVA 1U7XA 1O95D
chains in the Genus database with same CATH superfamily
5SV2A 1DNPA 1E0DA 2IZ5A 1QH1A 4PG5A 5DTIA 2G9NA 4RZSA 1IPEA 3ROTA 1RJWA 1X38A 1KL7A 1JSLA 3HCRA 4RGYA 3ZU3A 1QF9A 1UMCA 3GH3A 4YDHB 5F3WB 4KVZA 2PL5A 1AKTA 4NBSA 5KMGB 2FK7A 2OCPA 3EGEA 3JQFC 4S1PA 1UJ6A 5DM4A 1QFMA 4KI0A 1UKEA 4UHCA 4HQKA 5JSFA 1BH6A 4P32A 4Z54A 4OLHA 4UBKA 1V6CA 2X19A 1YB2A 5M7EA 2Q5FA 3V8RA 4DLBA 3J80A 1HQDA 2EHDA 1VCIA 1NU8A 1NAIA 2ZCVA 3QNUA 5DWVA 4YVFA 2XE7A 4PTYA 1Y6QA 3LPNA 1GG5A 3WC4A 3SVZA 3V3TA 4B2IA 1BS2A 2XZTA 3BTSA 1CS0A 4IHQA 4AZ0A 3Q8XB 3AEKB 4UPEA 4OATA 5LMUB 3SY8A 2BKXA 3OPYI 3QTTA 1H2HA 1U9JA 3D6NB 4CR7A 2YN0A 4G89A 1G5RA 4TLEA 1U0SY 3KSRA 4HWRA 3SIWA 4EYEA 1NP7A 4L5IA 4PZLA 2C4HA 3GWGA 3QU9A 4UREA 4FMDB 4F2PA 4LMAA 1P9WA 2FFAA 1NIPA 3RC3A 3ZWQA 4QZVA 4OL9A 3UT0A 5DF1A 2OHXA 4MDHA 4M37A 4JL5A 3GY0A 3NU1A 1CUSA 4GR5A 4Y7DA 3AMVA 4H31A 3JU3A 1I1HA 2FEMA 2GMWA 1FYEA 2V7BA 4HQNA 2FZCA 1FJGB 2NO5A 2OM6A 1V5EA 1ZGJA 5KQLA 2NSHA 1Y0BA 4PZPA 5IXSA 5CBKA 3BAFA 1O3YA 4H6PA 1R2QA 1VOTA 1NLYA 4PPNA 5EN4A 5HF5A 4ZEXA 3T5DA 1U1CA 3B1KA 3TOVA 2IDZA 3HL4A 4HPWA 4GI3A 2DLNA 4MQUA 1AQ6A 2CNWD 1NE2A 4Q37A 1F60A 2QDXA 1EX1A 4UEWA 6Q21A 3WHIA 1AKEA 3LCMA 1NRWA 2GOYA 2W00A 5CM2Z 5HGXA 4I5DA 2BBWA 2H1IA 3SQOA 2FG6C 2ES4A 3DVLA 3C8DA 4DJEC 3C14C 3PC6A 1KVRA 1EA5A 5LZ7A 1H6DA 1WUJS 4UEJA 3ZH2A 3WGZA 1O97D 3CO0S 1QO9A 2J45A 2PA0A 2IU6A 1SGWA 4Q4HB 1XT6A 1J1UA 1B74A 1JZTA 4J3JA 4MVJM 1KVQA 3TZHA 3DR5A 1ZL0A 4FMCF 2W2LA 5DN9A 1OZ0A 1NVMB 2BTEA 1II8A 2FPPA 3HU1A 3W06A 5IM4A 3NR2A 2HV9A 4S12A 3QKSB 2W37A 4UCXA 4B40A 3EVBA 1P5HA 4H0CA 3PNOA 9ABPA 2JK1A 1D03A 2WF8A 4G81A 2DE0X 3ZQ4A 1VI5A 2OZEA 5D6OA 3VAAA 3O92A 5LXTF 2QXTA 5C1DA 5ES4B 2CXTA 1ZESA 2P78A 5F2OA 3R9XB 4ZI5A 3U7RA 1BO6A 4GLLA 2QN8A 3V55A 1CZNA 4N39A 3U5TA 2PR2A 4HAIA 2H5IA 1W19A 4YPVA 1E4YA 1D0SA 1NQVA 4ENPA 4BNNA 1MJGM 2J5BA 5JG7A 3ZZUA 3S8EA 3P0HA 3MSXA 2GQ0A 1M2VA 3QFRA 3V8QA 2EARA 3OTIA 3UK0A 4DIBA 1E3TA 5K3EA 1NBIA 3RS8A 1U5AA 1KF0A 2H2IA 3BSYA 2DECA 3LLMA 4QVGA 4RQBA 5G4LA 4JHXA 5JSZB 4KWCA 5IC4A 1WM1A 2I1VB 1HMYA 1QR6A 1RRCA 3T9FA 2DLCX 2OE2A 3BXXA 3OC0A 3HDJA 3SOZA 3D6FA 3B1JA 1F1JA 3JAWA 4KWEA 4ZRMA 1MVLA 5EQJB 4FM9A 3RFVA 1JP7A 3MK31 2XV1A 4KO8A 3GN2A 4N9WA 5ITVA 1SBCA 2O8CA 3A6DA 2JHAA 1P39A 2C9CA 4JDUA 3VZSA 1Z82A 1AG9A 1I13A 1FPQA 4Y9UA 5AI4A 3WL3A 4W1RA 4DV7B 1IZ7A 3JWJA 1M2GA 4RZ2A 4CNQA 4PHTA 1CUAA 4ZTBA 4DLWA 5EJ9A 1RAHA 3I4FA 4HTAA 2WOJA 2O1SA 3BRSA 4R3UC 2R44A 4IOJA 3ICQB 3P20A 2AQHA 5KTKA 1S5PA 4PS1A 5I9IA 1I3LA 4AKSA 3C45A 1FDTA 4BOYA 3W5VA 4LXYA 4RZUA 4YRBA 4L5YA 1NBHA 3KTAA 4Q3CA 4A6XA 1C8VB 3KALA 1QOQB 3D6JA 4C2UA 1IVYA 1SU8A 2V97A 3FFTA 1F4LA 2R6JA 2PT6A 1H1LB 2XYVA 1MFPA 3R6TA 4G56A 4NE2A 4QGHA 3PXAA 4ZDJA 4KH0A 2CF5A 1CERA 3HYRA 3WIOA 5ICEA 3S2ZA 3BHIA 4DNQA 3ELUA 2XXJA 4UATA 4Q4JB 3UGJA 1TVCA 3ILYA 1PDVA 1Z6AA 3SHOA 4AUKA 1XLVA 4QGFA 1FNDA 2Z2ZA 1VMIA 4C9BA 1A2QA 4PYJA 5ADVA 1P9OA 2OC4A 1VE7A 2ON6A 4OK3A 5EE9A 2VHTA 1K66A 3DB2A 1CIJA 3FPLA 3N59A 5AYVA 1Q77A 3TI7A 3TRJA 3IHKA 3TLAA 1NMQA 2PH7A 2HLDA 2WTXA 3IV9A 2W5UA 3URKA 2FMTA 2GF9A 2ZSJA 3HFGA 4LWPA 4PZCA 3U1VA 1I7QB 4FHDA 1N7JA 4GOXA 5CNKA 3EFHA 2ZZNA 2Y71A 2OXTA 4I19A 1JVNA 3QNWA 2VJBA 2C4VA 3NYWA 1SOVA 3FDFA 4Y1RA 2YRWA 1ZD2P 2OHGA 1P31A 2WWXA 4RVSA 3RRJA 2YBEA 3S3TA 3V8PA 2QN2A 4M87A 2C78A 1L5HA 4MRMB 5BN3A 5ERXA 3CGWA 3P9XA 3WNZA 2FE1A 2AZMA 3DV9A 5DO9A 4E5UA 4WZAE 4LTNA 4QNNA 2HXGA 1E5QA 2I55A 3C16C 4FFOA 3L8DA 4H77A 4CTJA 1COWA 2W2TA 3ROGA 3W2EA 4NATA 4P4TA 3RLIA 1AQLA 1G6KA 1DTWA 3PX3A 4I50B 2X40A 3KT8A 2BEKA 4UCFA 4GGOA 2WVAA 5IJAA 3VYTB 1KI8A 5CIWA 3B6MA 1I5RA 2HMVA 2N0SA 4WY2A 1DKRA 2X6TA 2YCLA 4Q02A 4E3WA 4UUBA 3EF0A 2HK9A 4OI2A 5EJ8A 3KTFA 1YUBA 3TG2A 2AL7A 5JBIA 2O8EB 3PZRA 5EUQB 5ARBA 4KE8A 4ZYLA 2A0YA 4OHOA 3ZU5A 4G1VA 3A1NA 3OM0A 1CUBA 2ZAGA 1E3SA 3ZNQA 2O52A 4JL8A 2IH2A 5EXEA 5IYZF 5A2GA 1PAUA 2Z6AA 3O74A 1UPCA 3CONA 1Y4ZA 2W70A 2JB9A 3T38A 4TTVA 1YHYA 1MO5A 3A9TA 3MGKA 3O4RA 4U2BA 1SA0B 5H59A 4CUZA 1AXEA 3LTNC 5DT2A 1CRQA 1KQOA 3WLJA 2O05A 1ZI9A 1R0ZA 4HD8A 5DEOA 1K5HA 4KQGA 2PSJA 2UYYA 1G55A 4QYXA 5H16A 1L9KA 1W85B 4DTCA 5ABPA 2UYHA 2FKNA 4BFTA 3HNPA 3PNVA 1IG3A 2HSGA 2P4EA 2F90A 5CXUA 2RI0A 1YBAA 1Z2CA 1Q0ZA 4JT9A 4HN9A 4L5CA 3F6RA 2WM3A 1FUYB 3SDSA 2FX5A 5LA6F 4LWOA 3STUA 3E2IA 3CCBA 1VJ1A 3HCPA 2ILVA 1SKMA 4F1JA 4GVPA 4M4SA 4KDEA 3MXTA 1YA8A 5LLSA 2JI8A 1NBOA 1Z83A 1QZUA 2ETXA 2YN4A 2ZATA 2QB5A 3R7DA 3VBEA 3QUQA 4EHLA 2NUPB 4X66B 3OU6A 3Q7EA 3TL2A 5JNRA 4URFA 2B4YA 4PU0A 5A5EA 2WU3A 2AMFA 2ZGVA 4I9GA 2C7PA 3KYDA 1JEDA 3KQUA 4JR0A 1KIMA 3VR5D 5IDWA 3UN1A 2RJOA 2I99A 4BMXA 1IRXA 1UBLS 3G02A 4YB8A 4GKVA 5I4BA 1DKNA 2QM3A 2IITA 1Y3FE 2O1EA 5FQOA 2ALJA 3QEJA 2SCUA 4PHGA 5LMZA 2OORC 3T1NA 1Z37A 4J0HA 1S3SA 3K32A 3RK0A 1VLZA 1VM6A 1IBKB 4FC7A 4MEJA 3ZUPA 2QTMA 5JNLA 3W5CA 1GNPA 1LA2A 3UKOA 3OIDA 1VBFA 1MX5A 1WCV1 2VT2A 4EKDA 1NUTA 4NPAA 2JANA 4IVQA 3IMEA 1BDJA 2ZWIA 5AK3A 4LDNA 3OTGA 4ZJYA 3EZYA 1Y5LA 4X24A 5BV7A 1JFVA 1LFAA 2R4TA 2X0RA 4IH1A 4HAZA 2JGFA 4MP6A 3CLKA 3CLSC 1LK7A 1OV4A 1X8JA 5D2CA 2FWIA 4KFTA 3NBAA 5KKCA 4IXTA 2BF4A 3HM9A 4KR6A 1TL7C 4C5CA 3AHHA 4BLWA 2DFLA 2IPOA 3LKVA 2WZBA 5AESA 4M1OA 2ZJ5A 1U2SA 2B94A 2G9RA 4KO2S 3VKVA 2UUBB 1S7GA 1JEJA 1Z29A 4C4XA 4ARZA 3ESQA 3RYFA 2R68A 4UHFA 1JEAA 4HJRA 4BQIA 3RF7A 1BMTA 2XW6A 1XNHA 2B1IA 1G291 4CKXA 2RI1A 2F4NA 3MTJA 3NEAA 1NVEA 4RH0A 3QUAA 5CM8B 1PNOA 4YO7A 5HM6A 1N5KA 3FOEC 3LQQA 5EZ5A 1YSCA 1EUCB 3KSUA 2I8CA 4GXQA 5DIZA 1ZAKA 3L7AA 4TV8B 2JKVA 3JRNA 3NCHA 4O5AA 1BWRA 1XXHE 1XZPA 5J59A 4KO4S 1JG7A 2GD6A 1JKMA 3F1LA 3ZQJA 4LMPA 4HQRA 1V16A 4FI3C 4I4IA 5BUCA 3ZC3A 5F7OA 5JAOA 2NO4A 4R1TA 1CJTC 3WMGA 3K0AB 2Q6KA 4BZXA 3E5HA 3H5VA 3KZ1E 1WVIA 1T24A 3H9GA 1KEWA 3P2IA 2ZJ0A 4MJXA 2YVKA 4RLQA 4AT1A 4HUJA 2QSJA 2VTDA 2YJGA 4QJBA 3S8YA 2UVQA 4C04A 2GVNA 3M5WA 3UG7A 3IIMA 2ZXEA 3N5CA 2DYKA 3O9VA 1MMFB 1VB3A 1JB9A 4L8VA 4YNBA 2YN2A 3FDZB 3EW9A 1XQXA 1XZ8A 2X4GA 3KZOA 3GX1A 3MT9A 3PC8C 4FFSA 4KVFA 1YZUA 1QYIA 4PGAA 3RSSA 3UMSA 3FZYA 3ROQA 5BNWA 2OYSA 3RU7A 3SLRA 1ZI8A 3QXGA 1AKQA 4LW8A 2NYUA 3X1MA 5ESRA 1XMVA 4ZDIA 5E2IA 2XZOA 1GPLA 2CJXA 4MWZA 2JCGA 3GU3A 2D2XA 3DBVO 4YJ3A 2DY1A 2RH4A 1L4YA 3WYEA 1M8KA 3VNVA 1NXOA 4GLBA 5FBQB 4NI5A 1AV7A 1HTTA 3RFTA 1OFTA 3CB4A 3DS8A 1GCOA 1N5DA 3IDQA 4G8DA 4E94A 1YQ9A 1HE3A 1M83A 1IUOA 4NEHB 4NZPA 1ZA2A 1E92A 2RJ3A 5C80A 2VS1A 5I9MA 2N1MA 3OQIA 2NV0A 3H18A 3P9CA 1X9IA 4BQQA 1PQPA 1OWPA 3KQMA 3OOSA 1QVWA 1VLMA 2LCIA 3EPPA 3D02A 3EZFA 3K4HA 4OA8A 1N6HA 4BGUA 2FW8A 3RGWS 1F14A 4I4TF 4R83A 3TBFA 3UJ6A 3RM3A 4MCJA 1CD5A 1DTEA 1NMXA 1TM5E 4ESEA 2VK4A 3R7AA 5GTDA 1IHPA 3BFXA 4Z0HO 4M38A 1A82A 1A9XB 1FSGA 3K9CA 1A7AA 4M0FA 1PT9A 4YDRA 5B12A 2QIOA 3QFTA 2PX8A 4OHCA 7REQB 1LV7A 1TYDE 2FDCA 3ZHYA 1XKLA 3UUEA 3GD5A 1WCWA 2PL9A 3DZJA 1G1MA 3E5NA 3H1GA 3FPSA 1KPGA 2IUFA 5SZKB 4DQKA 1G21B 2EEZA 4RHFA 5DYGA 3DPSA 3FHLA 3WMXA 4A1OA 1HKUA 1RWWA 3F6CA 2ODPA 3U4HA 3X43A 1J1ZA 1KORA 1K9VF 1CK4A 3DBRA 3ORQA 3R44A 3DP7A 3V4ZA 4CQLB 3RHTA 2V7WA 3SYNA 2JLQA 2K87A 3N6VA 2C83A 3IMCA 4BE9A 4TXMA 3AVWA 5B2EA 5D5PA 2OZPA 1NDHA 3C41J 4OGFA 5TS2A 5E1MA 5EIEA 4OXIA 3T7TA 1C7FA 2IRWA 2WR8A 4N47A 3ZXUB 2JAOA 2B99A 2HQBA 2ST1A 2WUGA 4FHZA 2Z5VA 2OP0A 2ZBQA 1O5TA 3PHBE 1YKSA 3NOVA 4MCHA 4PICA 4UHEA 4BNWA 5F35A 4EJ0A 1TVKA 4XQCA 1GQSA 3HUFA 1GFZA 2FZ4A 5GV7A 4ALJA 3OOJA 1E8DA 4EVIA 2QP3A 4C1NA 1M6VB 4FB5A 3LZDA 5KAMA 2D54A 3ER9A 1SUDA 1BKDR 2CLIB 2WNSA 2I4OA 2XNDD 5TF0A 3TM5A 5K0NA 2P91A 5KYVA 5E6UA 1KS2A 4PCLA 3W4JA 3ZJVA 1RXVA 2NNLD 3KUKA 3LOUA 1L7DA 1P3JA 4IDNA 1SZDA 3VSEA 2PU7A 5T4EA 3DZFA 3G2KA 2YWGA 1UDXA 4C3UA 1XX6A 1Z4LA 5BR4A 2JNWA 3MQFA 2NPOA 4TVKA 2HCRA 2AD5A 3GCWA 5H70A 5L3QB 2W83A 1DARA 2HWYA 2PBLA 4JOBA 4YMVA 1T0BA 1Z38A 1ND5A 4ZDKA 4RD0A 4FKZA 4W7IA 4UFNA 1WA5A 4ZARA 2HTEA 3S2EA 1IAVA 1DIHA 3RHFA 2YQZA 3GEMA 4NPHA 3PB3A 4QXOA 5JAQA 5AJZA 5EHNA 4X45A 4AU1A 4BO6A 3R0ZA 1DZ3A 4K9OA 3DE1X 1D0IA 2NP7A 3EJWA 1J2TA 1JHXA 4UTVA 9LDBA 2VL7A 4D99A 1RWMA 1BD4A 1VKRA 2NSYA 8ABPA 5CIYA 4R1MA 2X1HA 4ZI7B 2ZBUA 1EEXB 1SCNE 4Q4DA 2ZTVA 1FP4B 4IX9A 3L6EA 2DSTA 4K6CA 1CJKC 2H57A 1ZEMA 2VTEA 1P33A 3MTDA 4OLJA 3EPLA 1B23P 2QP4A 5JFGA 4R5MA 1HFKA 1CBUA 1E94E 4AMVA 4Y1EA 4EHBA 4K81B 3WIVA 2V6JA 4GOKA 4C88A 1XRQA 2NV2B 3NBKA 1KOGA 2FF7A 1RQXA 2OHVA 1STOA 2NIPA 1IONA 2QM8A 5LC1A 1BE0A 1CR1A 1B6GA 1SCAA 2QLMA 2R96A 3IVGA 1LRLA 3G59A 2HCFA 3OT5A 4OJTA 1Z4OA 1H2XA 2X15A 3K31A 3P94A 4W5WA 5D85A 1VMAA 3BXOA 3EFOA 1DZIA 4NMHA 4KJZA 2E1RA 1W1UA 4JFAA 4LMRA 2QGFA 4P8RA 2E5LB 3V34A 1GGNA 2QY6A 3CO5A 1TAUA 1ZCZA 2E55A 3Q7IA 3ZQUA 4D6XA 2SNIE 5AW0A 2ABWA 2ATCA 2YC4C 1FP2A 4YROA 2F55A 1ZA1A 2WLSA 4JJ6A 2H7YA 1YVDA 4RKWA 5KNBD 3COVA 4ATNA 3NQ41 4JLKA 4N3CA 2NU6B 1FU4A 1N1DA 4MW9A 3RVQA 3AIIA 4HSGA 2ZQZA 2RG7A 1ZN2A 2C42A 3ROEA 1PEKE 4KX5A 1XPJA 3HCOA 3SS9X 4CFYA 3U44A 3C24A 4X8HA 4N41A 2PQ0A 2I2BA 1A1VA 2H1RA 1GPDG 4NRDA 1EJ2A 1Y7HA 2GLUA 2Q27A 4IUDS 4R84A 4TKMA 1WF3A 4Y2TA 3AGQA 5BN5B 4RTPA 2VWGA 3SDZA 2GXAA 3H84A 5E9JA 2IUTA 3QE0A 4O5OA 3SZOA 4B45A 3E27A 2JGLA 5KPDA 5DHAA 4LN1A 3FFAA 2P3LA 4MWOA 4ZAWA 4Q6BA 4ZU3A 3HR7A 3TLJA 2FP4B 1NRIA 3O84A 4J0GA 4KYUA 4OHUA 3WRYA 3MTBA 3E0QA 7MDHA 3FOAA 5A3JA 4E5NA 1RJEA 2AG8A 5BSMA 3TIXB 4AP5A 4ND2A 4C7VA 4Y2GA 5K03A 4M99A 4QA9A 2L18A 4YCJA 2D0OB 1TD1A 2Y6VA 4LXUA 5EQTA 1F8UA 2QSZA 1MENA 2HU8A 3A1TA 4CTKA 2P6NA 5CYGA 4IV0A 4LDZA 2Z58A 4OXXA 4RYDA 5ALWA 2G8NA 3K1AA 1KXJA 1ZZGA 3OE4A 3TTYA 1QKJA 1U0LA 3FNEA 4MUNA 3F74A 3PX7A 1PLLA 1KH1A 2DH6A 3CUVA 3O03A 4G09A 4PZAA 2X0DA 4AIRA 2FSUA 2V6MA 3PR1A 4NG4A 3TTVA 1QMPA 1ZW1A 2FWMX 1TQDA 3QU4A 2P79A 1O8CA 2LE0A 4W5HA 3VR2A 1ZIPA 2VCYA 1M75A 3AFNA 3QKUA 2HF9A 3FFXA 5AVJA 2CXUA 3I32A 1DAFA 1GZ6A 1JQJC 3PGA1 3RKSA 4B44A 2DLDA 3EEQA 3HSYA 3LF1A 2C00A 4KW7A 4L3OA 5IHPA 2ZSUA 3IBSA 4EITA 5JS2A 2GBGA 1YZNA 1ZCBA 2GN4A 3NTVA 3O9MA 1ECJA 4CMIB 2ZYSA 4POAA 2C5BA 1HDEA 1LS6A 2PKXA 3SLGA 4JLPA 4XTRA 1A9ZA 1R3UA 3DCYA 4IILA 5D3ZA 3O8NA 3T1VA 1ZW6A 1S89A 2DH5A 3FN4A 5DEIA 4I99A 3VPXA 4QKQA 4WJLA 5J2UA 3FPEA 4HR7A 4G07A 4P4NA 4GVLA 5JZSA 1AQYA 3CT6A 1XMSA 4G0WA 1VSVA 1R5JA 1LBEA 3WLNA 1EIZA 3ESBA 3FKJA 1YQDA 2CK3D 1A98A 3UGQA 5AOVA 1ZD5A 4AG6A 4ZOLF 1WPQA 3A6FA 3VHXB 4AM8A 1IJKA 5HF9A 4DRXB 3VR0A 3CN9A 1JMVA 3KOXA 4I0WB 4R1LA 2ZIUB 3U7JA 5IP5A 5JI2E 3FUCA 1RP7A 2D0IA 4ZVLA 1XAJA 2P0AA 5FFFA 4OJNA 2TECE 3NBQA 4RESA 4KBGA 3NASA 4BEVA 5B7NA 1NM5A 1OZAA 2BP7B 2J4CA 1JDNA 2Q5IA 3A3NA 2CUNA 3F0TA 3SHQA 3SG0A 4BB0A 1R0XA 5CYOA 5I7SA 2VWHA 4R0VA 5KS2A 5DNYB 1I5EA 2PZJA 1I6LA 2RK6A 3RC1A 4DBLE 1RYYA 4JOSA 4KQ6A 5D8DA 2C8KA 3GLFA 2B8EA 2JRCA 3PNLA 1Q1ZA 1CQXA 4IQGA 4D56A 4IP0A 2E4VA 2G70A 4QBGB 4GYKA 1YQUA 3UAXA 1GLGA 2G63A 4FINA 2BEWB 1P2BA 1WSDA 3CMCO 3IRUA 1U0GA 2B21A 4QUGA 4BQSA 4YBZA 1N3LA 4MI6A 3GBSA 4QOIA 4MW1A 1GPAA 2BAGA 2Y66A 4R2JA 3CEPB 3O93A 4EGCB 2GN0A 3B9BA 2PZ8A 5GPBA 2Y1LA 3VPFA 5JZVA 4DGSA 4NNOA 1DC4A 4G2TA 4HNSA 3E61A 4X1OA 2I8AA 2VPIA 3KV3O 2CVQA 5EXSA 1JSZA 2X41A 3RFCA 4C0JA 2WWFA 1RM4A 1MP0A 1TLLA 2VAVA 3O8OA 1H2YA 2WJ3A 2XAUA 1WW3A 4OJMX 5CVDA 4KV9A 2HPAA 1XKQA 3DDWA 2V7QA 2JGRA 3ZKWB 2W48A 1CUXA 1XEXA 2CNNA 1OIWA 3D54D 3EGWA 3FXAA 4MLDA 5DHUA 3ZS8A 4FQ7A 2Z6VA 2XAAA 3L93A 3N2IA 3UT5A 3Q3CA 3JYLA 4WESA 3TUIC 2I4TA 4G01B 1RYMA 4HAOA 5JCOA 1Z13A 3M9XA 2VYNA 1M2OB 4ZO8A 2B92A 3SR4A 4BGVA 2JG3A 2WEKA 4WJZA 3NX4A 5DW3A 5EERA 2VTBA 2IKSA 2P6MA 4PPYA 3U4MA 1NQAO 3SS7X 1ECLA 5T64A 3IDZA 1K3UB 2YS7A 2ZG6A 4UE3S 5AW4A 5IMSA 2VEOA 3EIHA 1VTKA 4E88A 5LKRA 4X62B 5FR1A 4QXAA 3USES 4K9LA 3BRCA 4RYLA 2AYYA 4B43A 4B7ZA 4QULA 3DNPA 1Q7EA 1R0CA 1T8SA 2C04A 3FVWA 5JMOA 4PG6A 4GKJB 3EVAA 1DC7A 3N86A 2PCLA 4IDAA 4ERXA 4NXMB 3CLHA 2FNAA 4J9VA 3W05A 2FR0A 2FFBA 4UU0A 1JH9A 4YMGA 1ZK2A 2ZYUX 3TW8B 1XEWY 1EK5A 1HG1A 1Q1QA 1PT8A 2IKQA 3AKYA 3H9JA 4K05A 2ZAYA 4DJ5X 5CDGA 1USWA 2ZSBA 2VRWA 1VKNA 3FGNA 1OXVA 4WKPA 4EEXA 1MEEA 1FNSA 3DBHA 5CPFA 4DEXA 4LQCA 1RMYA 2EWWA 1NW5A 2IIPA 1N36B 1GTZA 2IYVA 1UM9A 4L9SA 2FRXA 3ILXA 2SKEA 1N7GA 1Z33A 3CPHA 3AUAA 4PWYA 3PCTA 3FNIA 3SGLA 4Q0MA 5CGQB 5TV2A 2Y9PB 3RRMA 5LU9A 2QQGA 5K9ZA 4FCTA 3H86A 4PPFA 2RGCA 1N5JA 1N9GB 3UJHA 3F47A 3K09A 4BQFA 2DQKA 3O5AA 5DP2A 2O2SA 5T8KA 4CKBB 5HYVA 4Y67A 4NOLA 4JQZA 4TMWA 4YDSA 4Z53A 2WTUA 3RBVA 4EF4A 1MQ8B 1U9ZA 1OXXK 1ZUNB 3A27A 2CJWB 4N5NA 3VU8A 2DXIA 3LBNA 1Q0QA 2B9EA 3DYBA 2H08A 8LDHA 4CTMA 5I8PA 3SKXA 1BFKA 1U0OC 2DOKA 3USZA 1JEYB 4OSOA 5JXIA 2XVYA 4B17A 4AURA 2EW1A 3D43A 4RDHA 1KQFA 3FMOB 1GJRA 3IBTA 3PK0A 4GQIA 4M9CA 4EB3A 1QGUA 2ZRLA 1MB4A 3R6WA 1A2OA 4B6QA 2C0PA 4GBED 1QF7A 4BVKA 3A6GA 1W36D 1HQKA 3WWZA 3Q8KA 2X8LA 4Y2SA 4C2BA 1Q0TA 5AXBA 4FJ2A 4N8DA 3EQ2A 5TB5A 4Q1AA 1V8DA 3R3JA 5EJ4A 2XYHA 4AS3A 2WWIA 3DSRA 2W2LD 3MINA 3C6YA 4BPBA 2WSIA 4FZ5A 4BRSA 3IPCA 5FD8A 2JL1A 2B5WA 5H68A 3ZY4A 3OESA 3U4IA 2A0KA 3PXGA 3RD5A 2I2XB 2AJLI 3CZPA 3CC8A 2I8LA 1BQEA 1D2CA 2A33A 2RGNC 4FFBB 2QZ9A 2QD5A 5D1NA 4IZHA 3D6TB 2V1UA 3FWKA 1BG6A 1KYTA 4FFVA 4QAJA 3U19A 1ENZA 1D07A 4A2CA 2VHCA 3WWEA 2CL6X 3KV1A 3HJUA 3QEMA 1KGDA 5IJ9A 4CDNA 1IY1A 3WZLA 4B8YA 1Q50A 3S2GA 1ZGZA 3D3WB 2PUFA 1QPZA 2NUAA 4QU9A 1KIAA 3PDCA 4PFSA 2OBFA 3IVCA 4QPCA 4M6WA 3MMXA 4Q24A 5GOTA 4EMSA 2K6GA 4WNAB 1BFDA 1PS9A 2I6TA 3JZAA 3MRSA 4WXYB 4FWBA 3WGYA 2DB3A 1X1BA 3UF0A 5H02A 4RTMA 4X7PA 4TTTS 3UXMA 4MUGA 5F2NA 2H31A 1RAFA 2GILA 3NAGA 3S28A 5CRIA 5EOVA 3EOAI 3Q9UA 1H5QA 4Z9BA 4LA4A 2D7DA 2E4UA 4HS4A 4M89A 1VGQA 2IV2X 3G2QA 4J0QA 3U1BA 1YE3A 1SM4A 3I0MA 4A92A 5HTKA 3E81A 3UGKA 1FS5A 2GO7A 1JSRA 3LM8A 4CM4A 2FOIA 3G68A 3P32A 4DR7B 3RVDA 5HA5A 1SUEA 5I7UA 1A69A 1V3UA 1TVEA 3MWGA 4WSOA 3FYUA 5SYNA 1L5QA 1L5RA 2QL6A 3HKBB 2GBLC 1XD8A 2B7CA 3CW2A 4NBVA 4EYQA 2FUEA 1E2LA 3E0XA 1RWQA 1GU0A 1L7AA 5ALNA 3LLSA 1X7ZB 4U3JA 3CLRC 3T9DA 1Y8CA 2AK3A 2P5UA 3C7KA 1Q11A 1VLLA 1Y8QA 4E4RA 2OKCA 4XD7A 5KX5B 2QVCA 3T41A 4OX9Y 3L6CA 3VZCA 2P2YA 3X2EA 1ZDMA 2OGUA 3HEBA 3BXPA 1NW9B 1FF9A 5CPBA 1QC5B 1K27A 1ZSVA 1XF1A 3I9OA 3IEMA 1YL7A 5A0VA 1VFNA 3ZHVA 3MJCA 3P96A 3R0VA 5AICA 4EHHA 3ZGXA 3WKEA 3GLKA 4HPXB 3GYBA 3A3YA 2IHNA 1DKPA 4KNYA 3L92A 2X9QA 4YJFA 4CIXA 4K0KB 5K7SA 1HX7A 4E5MA 4OYHA 4DLAA 2HLDD 3ONDA 4LF7B 2ZBDA 4A10A 4Q15A 1B41A 1P81A 3K0EA 4QC2A 2CCJA 3OC6A 3NKVA 4MUBA 1NVAA 1CEQA 3QOWA 3TKLA 3EHEA 3G88A 3KJZA 3P2KA 2KWIA 4Z4HA 3LOQA 2WB4A 2QVXX 4LHVA 4BB9A 3FPJA 3OP1A 2OXRA 2QYTA 2QW0X 3PI7A 2QTZA 3O21A 1RDFA 2X5JO 4YAWA 2NQTA 2QTTA 4QBHA 4JD5A 2AUMA 1JHYA 5MN6A 2GEBA 2W8BB 5KQRA 1CYDA 2IXDA 3GEGA 2VUIB 1X7YB 4PWZA 1COWD 2OSVA 1QCZA 5C7IO 1EHYA 1SQ5A 2HRQA 2LIVA 3N07A 4DM4A 4FSHA 3VVMA 1M1YA 2VNHA 2YQ4A 3HDVA 3VYWA 5ITZA 2PX6A 1KZ9A 4PG7A 3TZEA 5LUAA 1G8KA 2FPMA 3KUDA 4L4RA 2I7XA 1HDRA 3WGKA 5CA0B 2QR5A 4R41A 3R6DA 1LJUA 3OY2A 3KL2A 1MOSA 4YHBA 3PVCA 1E1CA 4YJ2B 3IUYA 4TKUB 3WDLA 4KVGA 2M6RA 1L1QA 3SF8A 2MMGA 1ZK4A 3EMDA 5CLIA 2YOGA 2J5RA 2E49A 1ZWKA 3JQ8B 4EI9A 3K9FC 1G41A 4MV9A 1NUHA 2OA0A 3RAJA 3PPWA 1U9IA 1RHRA 1Y63A 4DMMA 2QL9A 4NCAA 5GM1A 1VLQA 4UUQA 1E1NA 1JQBA 2PMFA 3C3KA 4P5DA 1H0SA 1W47A 1WMSA 1N6LA 5FUYA 2JS7A 5KCMA 3FTEA 4I1PA 4NDAA 3ZK7A 4DOMA 2VTBB 4EB6B 2GESA 1JMKC 1TQ4A 2JVIA 3IT3A 1FMCA 4X8MA 4RMNA 4CLXA 2HQSA 3UMGA 1MU0A 1PJ3A 1RAGA 4AY3A 3LMKA 3UA4A 1IUNA 2SKCA 3HLKA 2CZCA 2FAXA 1Y33E 2OOSA 2Z2JA 4L02A 5CDYA 1FW6A 2C2WA 1ZXBA 1N32B 4RVOA 3OPYA 1FRNA 1AGYA 5BRNA 2P2ZA 3WBBA 1G16A 4GBJA 1ECGA 1EXMA 3BTVA 5AVZA 1NNSA 5DM60 4G0NA 1PJ2A 3ICOA 2XKKA 4JK3A 3FOWA 1P8AA 2E4WA 5EZ6B 1P45A 2HI0A 2JIPA 3WBFA 4EO7A 3DCNA 4WXMA 1JYSA 5C8VA 4BFVA 5BQOA 4UUOA 1H8HA 2C9ZA 5DM0A 4IIGA 2BGKA 2EQBA 3JTEA 1DG3A 1CUYA 3WDKA 3FYCA 5C4MA 2A5JA 1RPAA 5K3FA 4CM7A 4H7KA 4QJ3A 1BXGB 2XZDA 4LF4B 1VHDA 4MW2A 1ZNYA 4RIEA 4YCBA 3ME5A 3T95A 1V8BA 1H5UA 2G4LA 1KMHA 2IF2A 2R84A 1XMPA 2WIJA 5JSUA 1VCHA 2YRXA 3CKYA 3GVCA 5C1IA 3UJDA 1SB9A 2COUA 4JZKA 1EFCA 2D0PB 2GETA 2ZAIA 3NETA 1O1YA 4GPTA 3TPCA 2ZRJA 3D6MA 2IW1A 4Z3KA 3MYYA 2GRJA 1PQUA 4LG1A 4DW8A 4HFRA 1QHXA 1N2HA 1RQGA 1VMDA 2OZVA 2G88A 2Q49A 3AB8A 3EGIA 3L8CA 4DLUA 4PO8A 4G36A 5D3MB 5F7JA 1DI0A 1EVQA 1SIBE 3EEBA 4P3NA 4BNDA 2Z8ZA 3WWPA 1A7JA 3DJYA 1CR6A 1NSTA 4Q3LA 2IS1A 1CQJA 2P7HA 3IKMB 4C21A 2YFYA 3GARA 3IP8A 5FLEX 2MOKA 2O3SA 1D9XA 3JQFA 3ZZTA 1JIQA 3ETCA 4ON9A 1XPOA 4FNAA 2Y1EA 2XQKA 4YCCA 1Y7LA 2HJVA 2CDAA 2H4XA 3C3XA 3F49S 1V2GA 1Z0DA 4H4DA 4KFRA 1GTL1 2H4HA 1BU5A 2WMNB 3HYNA 3JWHA 5AHWA 2P6RA 4LYFA 5AKYA 3G17A 1GUZA 3QX7A 1HRKA 1LLUA 1VIAA 3QPDA 4FZRA 2B2NA 1YL6A 3INNA 4KXVA 5M04A 4P0TA 5L95A 5BYBA 4J0IA 4KE6A 2FZVA 2Z8YM 3LYUA 3DAPA 5EXDA 1QS0A 2ZEJA 5C7OO 2Q4TA 3Q7QA 4XDHA 3WKDA 5TQVA 3JATB 4MP8A 1K06A 3HXQA 5AQ1A 3MUOA 2PU5A 5CT5A 2HIHA 1NNUA 3FB1A 3FZGA 3PLRA 4NP6A 1L7BA 4AFNA 3HJFA 3SOPA 1V26A 4BNJA 4UTPA 4G0YA 1R4MB 1SK8A 2IPXA 1KO1A 3ORRA 1A88A 4FEYA 3VJMA 1CV2A 3QU2A 3JR7A 3FLBA 4K28A 3M3DA 3AF2A 5E1OA 1K6EA 3EOBI 3N0XA 3TGLA 3D8NA 1MO4A 1O08A 1SZCA 3Q8LA 3PQDA 2WMDA 3AXSA 2GEKA 1HO3A 3UAWA 1MG0A 1RXYA 3H04A 4RF2A 5LM3A 1KHHA 2HO4A 1AS2A 3OX1A 1CP2A 4G1CA 1CE8A 1K3FA 4J0EA 4MRAA 5GM2A 3WISA 1C7ZA 1OFHA 2CV2A 3OEHA 1JWLA 4FONA 4EP1A 1FUUA 1MDFA 2GHRA 2LD4A 3NRJA 2HCTA 4O3FA 3E03A 3LFTA 4U2DA 3U49A 3DAYA 4ER3A 3NXKA 1WSBA 3BB4A 1MIOB 1XU9A 3IA2A 4HTFA 3WGHA 3A6PC 3E48A 3L0OA 3T1HB 2QTNA 1GAWA 1FXWA 2E4YA 2OENG 1D6MA 1C5KA 2EF0A 3OEED 5I9SA 5EFZA 3R9IA 4Z7QB 5FP0A 4ZVKA 5LJIA 2COEA 2IDMA 3RS3A 4LDRA 1P6UA 5J2TB 5TT1A 3BE8A 2IU0A 4NJEA 4JVOA 2B2CA 2IX9A 1FFSA 1TK2A 2HLNA 4AL4A 3KEFA 3MWEB 4D82A 5DOZA 3GGPA 4IXMA 4EG4A 1O77A 1WHTA 2FSVC 3UH0A 4C7OA 3FPKA 2X6QA 3N2LA 3PD7A 3J81A 3UJ8A 5CT9A 3GFVA 4ZO9A 4ND8B 3DE2X 2CHUA 3JASB 4PRKA 4QQFA 4EA9A 1Y8ZA 1F2DA 3R3ZA 1AGXA 2PXXA 2WJGA 3H5OA 4RXTA 1IY9A 1Z28A 2XA1A 4ESVA 2ORVA 2NM0A 5BUQA 5H1YA 3COZA 6ADHA 2BFCB 4MVJP 3TZKA 4OU4A 3FFWA 2MSWA 3ZTWA 5AW1A 1LVHA 2NW6A 4B76A 1PVDA 3HVKA 1Z62A 3G3EA 1ZM2A 8AT1A 5LYJA 4IRXA 3STTA 3CA8A 5JV5A 3H3FA 4V0MA 1FDUA 1GLVA 1N9ZA 2F8LA 4NS1A 2R6ZA 1MB0A 3COSA 4LZLA 4DUGA 1E3EA 2GUWA 4I5FA 2FOLA 3BDVA 1D6SA 2RK3A 4WW0A 5FPQA 2ZREA 4OQXA 2G1JA 4R68A 3HYCA 3K0FA 1ZPDA 2IQ5A 1JIXA 2ZVQX 2R8RA 4IIJB 4WN9B 4FW8A 2G4CA 1UMDA 1I2CA 2VJQA 3IRVA 6LDHA 2BH2A 3MYRA 1E7MA 4A1FA 3UGTA 3AVQA 3ED5A 4YMTA 3JS5A 1V7CA 5TT0A 1GG9A 2Z5LA 3F3YA 3HXLA 5BP7A 1RYFA 1GZDA 2NYVA 3JQGB 3GPLA 1NI4B 1EE1A 1LNZA 1OI2A 4W5NA 1KJ9A 3MN1A 1OILA 3SC4A 2H5LA 3VDMA 5JNSA 4JKYA 4WLVA 5BVGB 1AKRA 2WJHA 2YWDA 3IUNA 5CG1A 4O4JA 1NQ5A 3G49A 4PV7A 1S3GA 2I62A 3GFQA 4GOOD 1EWKA 4OQEA 1SVIA 3DEAA 2HLPA 3K0CC 2QLJA 1RWNA 4NV1A 4MGIR 1TZCA 3LECA 3DCIA 1O95C 3EXFA 3SX4A 2MIIA 3V1KA 5HF8A 1ZC3A 3LWBA 3AP2A 3WJAA 2ZYAA 5FF9A 4COOA 4AJ9A 2PRKA 4JMPA 1Y3BE 4UXJA 4ZIRA 3O3NB 1VSQA 4RW0A 3PEVA 1RABA 3E9EA 1LRJA 4F8EA 1BGWA 3GJSA 2D1RA 3WAJA 3RRXA 2NU9B 2HXSA 3A9UA 4CI9A 2IT1A 3P9SA 2IGBA 1JT2A 1KEVA 5CEJA 2ZE5A 3ESXA 2XWQA 3CBGA 3P0FA 2XMZA 5I7RA 3ZLBA 2WKSA 3TH5A 5BPFA 3PIRA 4MKZA 4LQDA 3QEBZ 4BEWA 4N5DA 5JAZA 4XVRA 2INGX 5HCIA 5KZMB 4OAQA 4YMLA 4HS9A 3ODPA 2Q0HA 2JIMA 2GBPA 1NLFA 4JENA 5EC8A 2BONA 3KXIA 5AW5A 1QIMA 1URPA 5FV7A 3KFVA 4MUJA 3STVA 2AC7A 3C2QA 2F3TA 4EG0A 3EG5A 5IK2A 4IO1A 2J0QA 5JEDA 1DL5A 1Y3HA 1A71A 1REQA 5IEBA 4IOLA 2Q62A 4EJ6A 1DT5A 1N5LA 1U3WA 2H6EA 2DUJA 2ZIXA 5HKLA 2ZCJA 1WEHA 2OBLA 3N7AA 3PHIA 2M1XA 3TNFA 5CAEA 1RP1A 2AEEA 1B15A 2JF0A 1MB2A 3C3WA 3LUFA 4CM3A 3DDOA 1TEHA 3VC3A 2XKJE 2HX1A 2PGXA 3KUUA 1E2MA 4NSNA 3LT5A 1YJ5A 4IIYA 2C9OA 4AS1A 1USGA 1TXGA 1S8NA 4QASA 4PSVA 3U4QA 4X1KB 3WIUA 3B13B 4MUYA 4I6GA 4R9RA 5IM4F 2G6BA 5JMPA 5JZOA 4DCUA 3O95A 1V0JA 1QF6A 1H9BA 5DNCA 1PV1A 1JVBA 1FRVA 1DQPA 1OC2A 2BKEA 2DKOA 3OQ1A 3ORSA 5LQNA 1QH8B 5JW6A 4JJZA 2QRVA 2BV3A 1CJSA 2QN6A 6YASA 4M83A 4E03A 4TM8A 4EM6A 2N1BA 2HRZA 4X6UA 4JXKA 1B3RA 3GXBA 3FUWA 3WMEA 3L6DA 3A1DA 4INOA 1BXZA 2NTYC 2A30A 2VWPA 3BUSA 5TS3A 1U2DC 4D9IA 4IHJA 1V1MB 4GF5A 1S9HA 3B6JA 4C0HA 3PWSA 2OLJA 5KTSA 2H06A 4M1YA 2NZJA 3BWEA 4OQ4A 4H1TA 1TW2A 1UBCA 2JHFA 4WL0A 4E5SA 5ALLA 3QX8A 4F6RA 3AUJB 4R9UC 4XLLA 3EZ7A 3AFIA 3TE7A 3GJXC 3T3DA 4Q3EA 3KK0A 4OB8A 1KE2A 4EEKA 5JAHA 5B1HA 1KOFA 5BORA 3NWOA 1UZMA 5FJJA 1TMOA 3VR3A 4XVUA 3AR9A 5DGDA 3G6KA 4RFSB 4F45A 2E2WA 3GRYA 3VQTA 3KQQA 3WLPA 3FNHA 6REQB 1AUXA 1JEQA 1GTVA 5ALSA 4F56A 4MH0R 4JLAA 3BMCB 3U16A 3ZH9B 1KO5A 4P4UA 4KBFA 4JN6B 1PL6A 1E8NA 5TMBA 1UF9A 1Z7GA 1Q0UA 3ZWYA 2YWFA 3K94A 3B82A 1TQ6A 3MBOA 3FLAA 4HGOA 5E1BA 1UK6A 1K6JA 2OORA 3L0DA 1F6DA 1OKKA 1Y9ZA 4EIWA 1AU9A 1SIOA 3FA2A 3VR2D 4BNIA 2J46A 5AKXA 3IUPA 1M6WA 4QATA 4MIEA 4KXMA 3DXYA 1ONNA 2AW5A 3RIMA 4CLOB 4FOLA 3TLXA 5HFJA 1GAQA 1YZKA 1T9BA 3MT7A 3HTXA 1NOKA 1DCTA 4O0MA 4Y1RB 4EMBA 3QUSA 1N2GA 1OFVA 1TIBA 2VJYA 5K8TA 4TL6A 4KDCA 4DUYB 4LC0A 4PLFA 1B8UA 1OI4A 3M9WA 3R0IA 1UPTA 2A7QA 3U60B 3P45A 4FZVA 4GL2A 4EG3A 2RB4A 3R76A 5BRJA 3CVOA 4QWMA 4HH4A 3DL7A 4Z0NA 2PS9A 4ZYUA 1THMA 4CCYB 4FS8A 2AD1A 1YNSA 2CHQA 3ZWNA 1U2RA 2HOQA 2J5QA 3GQBA 3OPXA 3Q6MA 4URYR 3FBWA 1YS6A 2FVYA 2OHFA 4BL5A 1WY5A 4LF6B 4D81A 4L8LA 2ZTHA 2GCEA 5LN1A 2A1IA 3PDUA 4MJLA 2Z09A 5IUKC 3KFLA 4GWKA 1MABB 2OTCA 2QTAA 4XFKA 4JFRA 1JQ3A 5EE1A 2PRIA 2KYRA 4PN3A 5KNCH 2J4FA 3VBCA 3AF0A 3H13A 2IEAA 3P9YA 4HBZA 4BX8A 1CQIB 4UQLA 1IB0A 4QNRA 1M2WA 5E8JA 1GDHA 2JD2A 4TMTA 4R1UA 4DEYA 5KHOC 4PCAA 5FI1B 1LXCA 4EZIA 1FQWA 5K0LA 1EB9A 4HDOB 3L0YA 4BO8A 1ZMBA 4EI2A 1WXXA 3HE3A 3SXPA 4DANA 4HV4A 3BJIC 3S27A 5JRZA 1GGVA 1C30B 2DR2A 1G3QA 3CTPA 3DVSX 1FS4A 3GUYA 4H1WA 1JIKA 4H17A 4INJA 6ABPA 4PINA 3SS8A 5AW2A 3T52A 4P4SA 3DTVB 1QYDA 4J7UA 1X1TA 5AM5A 1HV8A 3W2HA 2R00A 1JPUA 3HA7A 4KN6A 5L3SB 1K68A 1YVPA 3O3MB 3BZUA 2VHVA 1RADA 4RV9A 1A4RA 1KWGA 2TMYA 2HA2A 3HN6A 2NXNA 2V8OA 3GFRA 4OGWA 4EGFA 5ENDA 2ECPA 4L95C 2V7QD 4QBKA 3M7IA 4H60A 2C5AA 3JYOA 1Q7TA 3BRQA 2EWVA 4BX9A 2Q5LA 2WIDA 2EQ5A 2FPIA 4PF1A 4U7WA 5B2ZA 4ZKEA 4R2KA 5HKAA 2ZR0A 4AP9A 4DIEA 2ZRKA 4DT1A 5J23A 3HXOA 4WNYA 4HFNA 1AC5A 2AQIA 2DTXA 2VYND 3PTAA 4EHFA 3HKDB 4P92A 3FRHA 3TQOA 2J33A 3V4LA 2ID7A 2PV0A 4BQPA 3MWJA 1H0KA 2DP4E 2AX4A 3NGXA 2C0CA 1P7WA 1Y3AA 1TUEA 2MDTA 3DWFA 4QGAA 2PAAA 3WQRA 4D74A 2A9PA 1YK1A 2QUKA 1MJFA 4F5EA 3ANNA 4X1YB 4O4IA 3UUFA 1MB3A 3DW3X 5KJEA 2BUAA 3QBJA 3FX2A 3QU5A 5DXAA 1Z26A 3ZV6A 3OA0A 4L73A 1H9CA 4HVAA 4AUMA 3FLMA 2QTRA 2ZUUA 1Q95A 1EGMB 1ND6A 4KOAA 2IYQA 5E6SB 3L7DA 3EDCA 4GGMX 3IJEB 4H7EA 2QTBA 2NPFA 2J87A 4CJXA 4ZGGA 3H5WA 3N2GB 4IH4A 5DSTA 5JFOA 3GFSA 4MKRA 4MR8B 1XRRA 3CKKA 3TN7A 3VR4H 1RBMA 4B1FA 3D8UA 3PBKA 1K7EB 4OV6B 1ZISA 2RGUA 1C7RA 1GRNA 4OU5A 2EEPA 3AERA 4FGKA 2ERYA 2J0UA 1YB6A 2W90A 3WLOA 1CIPA 1MA0A 3NEYA 3CH7A 3AZPA 3KVYA 2PSSA 4BN0A 2J3IA 2ZIAA 3K6SA 1NDQA 2V03A 3PEEA 2OBNA 1YE5A 4JOCA 4DVJA 4L3VA 3H4VA 3LX8A 1PX0A 1JDPA 2QZPA 3LBAA 3OCWA 3DH0A 2HBYA 1BX0A 1XHFA 1D4AA 3DC2A 2VF2A 1TEXA 4R2LA 3TW4A 3VXKA 1FK8A 3FKQA 3D8BA 3JQPA 4JI3B 4K88A 1X42A 1Z8HA 4MQ5A 3SQDA 3ZGYA 1XDWA 3TCXB 1HEYA 1JAHA 3MG9A 4XGIA 4B31A 3KJHA 3A6JA 4EBFA 4F5WA 3QENA 4ZMSA 4BXOA 3JWEA 1MQ9A 3PL1A 4EAQA 2NTNA 1DAMA 3ANMA 1DWOA 4LSZA 1YDGA 2IK8A 1NWCA 1NXWA 2JLBA 3GMSA 3PKZA 3UMJA 1ZMRA 3AVTA 1RC8A 3FOCA 3H8VA 3H83A 1W581 5EQFA 4IS2A 2ECQA 5TGDA 2M32A 3TZCA 1NLZA 4LKOA 1EH5A 1FRFS 5C5CA 4MW6A 1CB0A 2JW5A 4WRRA 5LMNB 16PKA 2VH2A 1OV6A 5ALZA 2Z83A 3T3MB 1R8SA 1ESZA 2QG9A 4UU7A 5K6RA 2EJUA 3HSKA 1R1DA 3RT1A 2O5CA 5BV8A 4AECA 3VTZA 3IALA 1GNRA 1XPUA 4A23A 1W7AA 1AK1A 1NMSA 2G9ZA 1HYHA 4IINA 4WNCA 3WYCA 1HDZA 5L4NA 2W6MA 1UK9A 5EWJA 1B3BA 4QAQA 4QBIA 5EY5B 3UH1A 4GR9A 5JEEA 1QHHB 1BX1A 2RGGA 1S9DA 3KX2A 5F78A 4DHWA 1W1IA 4M8IA 5J3JA 3PEFA 3TSAA 4XH9B 1YJBA 4UNRA 2WWYA 4A15A 3LCJA 5K8IA 4Q1FA 3TTWA 2BGUA 4DR2B 5LQMA 2AIRA 1UBEA 4WDRA 2A9VA 3BREA 9MHTA 2AFHB 4BFZA 4IDCA 5D3QA 4YUVA 1GZVA 3B3FA 2GAJA 3Q9LA 5IDYA 1LPOA 2POCA 3SEZA 1ILEA 4TUYA 4CKEA 3IP7A 2IOQA 4ENQA 4RBNA 3HYTA 3GFOA 3H5LA 3HABA 4N54A 3O1LA 4WTOA 3RUCA 4CHTA 1GTG1 2R6DA 4JVMA 1NW3A 2XEDA 2B3TA 3GCZA 2PDAA 4NOKA 4R40A 1WOMA 1KJYA 4ZU1X 4LOHA 3ZV5A 3GZNB 3AY0A 1K7FB 2FB9A 4YJ3F 1HQCA 4M1WA 1JI3A 2AJTA 3CUEF 3I05A 1PCXA 2HA0A 2PJZA 4EB0A 5FWAA 1LDBA 3D5TA 4L51A 5AM4A 4LY9A 4EYKA 4FKMA 1IQUA 4LJ5A 4OXQA 2O2HA 4KDFA 1PR4A 4NNJA 1KYWA 3RUHA 4ZI2A 1M0EA 2WU1A 1WCIA 3G82C 3QVXA 5EHQA 1MZVA 2FMKA 5EMNA 1PUXA 2Y1OA 3UAVA 1MF7A 3VTKA 5FR2A 3Q87B 4IQ4A 4RLSA 3BULA 3A37A 4FK8A 4PHCA 2YZGA 2WU0A 2ZUVA 1HORA 3L7KA 3OCYA 1QORA 1ULAA 3R5FA 5AKZA 4BMNA 4KXXA 4JODA 1IQPA 5LOVA 1CPYA 1ZOPA 4S2UA 2A58A 2X9GA 4DMUB 1YT5A 3IHTA 4CMEA 3W5HA 2ZYVX 3FDXA 4XD7D 4ITUA 3QPCA 3S40A 5AM1A 4NCKA 1J39A 1Z88A 2GF0A 5G3YA 3EVFA 3A4IA 4E14A 1GZ7A 1NI5A 3NYRA 2BGLA 3TBHA 1LI5A 1XVVA 3LKBA 1P5RA 1DINA 3MBIA 4LXGA 1YBMA 4DWJA 5ICMA 3PF8A 2I9PA 2RB5A 1DADA 4WXHA 2XGSA 1P4RA 221PA 3SFZA 1N4DA 2GTPA 2ONJA 4R3WA 1RXEA 2GFIA 3EXG1 5I9BA 3WK6A 4F2HA 4PZ9A 4S1VA 2WVGA 2NTJA 2R5FA 1EJ6A 3MXOA 3QLTA 3DAFA 1OA0A 4DLRA 1BYIA 4WCFB 3PR3A 3HRIA 2QNBA 3T4UA 1XEAA 3PQ7A 2ZZMA 3QGMA 3U9SA 1J8MF 1OIVA 3LRPA 4G4SO 1I0LA 2GYVA 4HYQA 1XXLA 3AEQB 4ZQIA 4C3VA 1K6XA 2P9ZA 4W1SA 3VR6H 2J7KA 3MNFA 2VKQA 1I4EB 2C94A 1CULC 5DCWA 5KNDA 4MV3A 4AY4A 1E3WB 4P33A 4D0RA 3GT4A 1J0CA 3S1AA 4CQJA 2Q3DA 3FPBA 4K9RA 4BVHA 2RBEA 1S0UA 1YTUA 1OC4A 2ZPAA 3MAAC 2CXQA 1T2VA 2P1DA 4OIMA 3OCZA 4QOEA 3PWTA 3TD2A 3ZW8A 1JLRA 4RK6A 4Y2QA 1Y9AA 4HEA6 4JEUA 1JXQA 2HB6A 2VJKA 3EGDB 4JKIA 4ZMRA 3WHPA 2R87A 4IDHA 4L57A 4CPDA 5H4HA 3NHRA 1KBOA 3ISJA 3A9WA 2EW2A 3NHUA 2I3GA 2Q7OE 5KOYA 1MW8X 4KEAA 1J8FA 2AJCA 5AVOA 1F5SA 4YRTA 4BP9A 3AINA 1CR4A 4TZ0A 2G17A 2RBKA 5E9AA 3GP5A 3DAHA 2V9ZA 4DMKA 1KA9H 1RWBA 4DXHA 4MQFB 3UTCA 5AM2A 3CB2A 3LC7O 1A5SB 3WJ2A 1RJ9B 3ANXA 4WD3A 4LE2A 1UZNA 1RI3A 1T36A 3L02A 4Q7KA 3RUEA 5LYYA 2YXDA 5DTEA 2ZDHA 3B53X 4HNHA 4Q66C 5E95A 4EBBA 4GG1A 4X7MA 1TJ5A 5F51A 3RTCA 4AG5A 5FLXA 1EDBA 3KEQA 1E2EA 4ZODA 5BQ5A 5JH7A 1XNQB 1DJQA 2VA9A 1EBFA 2F3SA 4K8OA 4EG5A 1D09A 3A1UA 5CX1B 3QWHA 2QG4A 4C0AC 1RI1A 4D57A 2QXUA 1IE3A 4GI2A 3GVPA 4YMIA 3L1VA 5CX4A 2DKNA 2BGWA 1WETA 2G8LA 3VMMA 1XE3A 5CLFA 1QO7A 3EWAA 3NDRA 4XX0B 4UTOA 4XWGA 1QIEA 1S8FA 3FVTA 4L28A 1YS1X 2IYOA 2FZGA 2O2YA 1XO1A 4PFJA 2I3BA 3CZRA 4KAJA 4R8VA 5KIAA 3RWOA 4Z7NB 4QM7A 1CLEA 2ZYTX 1M1NB 1J56A 2JJYA 2F9FA 3LV8A 1YKGA 1ZGCA 4FE3A 4ZO7A 4BV8A 3KJNA 3AUTA 1RW4A 4B2PA 4BNXA 1T10A 3CF0A 2IU3A 2BMEA 2R6FA 5KHLB 2P7IA 1H8HD 4PM4A 5TF4A 3QXSA 4EY8A 1YJCA 1SVLA 1XQ6A 3U3RA 2Z5FA 5C3MA 2Y27A 3E7XA 3TFOA 3MAGA 1JJBA 4O2AB 1NVUQ 1EFVB 3MUFA 3WL8A 3KAKA 1SBQA 2UVPA 3UFXB 3KAJA 1IEVA 5FFNA 3IR5A 2J07A 2KHZA 4Y1GA 4DG5A 1KFCB 3ZVMA 4E2YA 3DFKA 1JMYA 1Y37A 1ECBA 3FH0A 3ELYA 4JELA 2XDAA 1KR5A 4EGQA 2ZQ5A 1O96A 1Z4PX 4MYSA 5HHTA 2NSJA 4O33A 2JIOA 5DCLA 3TEFA 4ZYTA 1PZEA 4M88A 2EGUA 4LF9B 5AKIA 2R65A 2A5DA 3B1FA 1Z4MA 4NCIA 1NG1A 3E9MA 3Q2IA 1PFUA 3K70B 4V0NA 1M5RA 1RWOA 2CUTA 1CDOA 2IOHA 2O07A 2XTMA 3EWNA 3L06A 3IUBA 4R01A 5J4KA 3B12A 4LCJA 3HJRA 3UW3A 2AC4A 2VQFB 3D4LA 5KNCA 2BT4A 4ZVVA 3F4LA 2HUPA 1NKTA 1U3TA 3ILHA 2UZ4A 1ZMOA 4B2LA 1N6OA 4WOBA 3LXRA 4RO0A 1Z9BA 3HCCA 1YRLA 5G0WA 1LF0A 3F97A 3MLBA 3TNJA 5B55A 1COZA 3GA0A 5JASA 2GTIA 3LQ1A 2QAJA 4R2HA 5BUZA 1QAMA 3OQVA 2IDJA 4KYVA 3FMVA 1IZYA 1SOMA 4MVYA 1GYPA 3UHPA 1FXUA 3WYGA 2X42A 5IBPA 4Y6OA 621PA 5FT9A 2XCIA 4G67A 4BN5A 2Z43A 1IEXA 4G5HA 2JDID 4L9RA 1Z5OA 1IOZA 1K6IA 1GT91 5B1SA 2XRZA 2AR9A 2QMQA 2WAAA 2DU8A 1YAHA 4CF5A 1GSOA 2DHRA 5P21A 4B87A 1RM5A 1XJ5A 1T3HA 1TK3A 2V74B 2X9NA 3NHFA 5JSYA 5AK6A 4B4VA 4DQLA 3T9AA 1ABBA 4N48A 4EOGA 2ZT8A 1X6VA 1NONA 5HM8A 3C6BA 4M9RA 4AQ7A 2GR9A 2O5RA 2JLVA 3ESDA 4GWLA 4F1WA 2IYRA 3DMYA 4G4SP 3RBZA 3CUWA 3B6EA 3INYA 3GMDA 4JT8A 3SC2A 3RU9A 3IKLA 5ADHA 2TMDA 1GCGA 3AVUA 2R11A 2RC6A 4Q1EA 2E82A 3LCVB 2XLCA 4BMYA 5J2UF 5TARA 2O59A 3PXCX 4KN8A 2A8YA 4P7JA 1B6RA 1HH4A 5C2JB 1Y5RA 3TB4A 4KACA 1W29A 3Q3GE 1J0BA 4UBOA 3SI7A 3EPKA 4AQYB 1PEAA 4FFMA 1VL8A 5AI5A 4G0ZA 3C87A 1SUAA 3R8CA 3VJRA 1HQYE 1NC1A 2WJPA 4CODB 4QDZA 4U4AA 4PCVA 4CM9A 3DO8A 3OEHD 3KPWA 1P4JA 2CD7A 1JR2A 1U7TA 4A0GA 2B5OA 2WKPA 4IX1A 1IG0A 4B3GA 2OO3A 2C07A 1LPSA 4IQ0A 3EA0A 4RTQA 4FMCB 1TAHA 5BXYA 1ID8A 2WD8A 1Q2UA 2R751 1XTSA 2ZXFA 2R8XA 3N0VA 3H5AA 3P4XA 4TL9A 2PUHA 2D1YA 2GNOA 4B3RB 4Q4JA 5LDGA 3T61A 1K08A 4XARA 3TIIA 5AW7A 5KINB 3FE2A 3WO1A 1BSVA 1Q0PA 5IWAB 4ILKA 5LXTB 3BD9A 3U0VA 4EA8A 1DXHA 3CUUA 4BCCA 5IT5A 5JS7A 4OMFG 4U7PB 3L3BA 3WIEA 3KQKA 3R7WB 3KQTA 2G1UA 4E2ZA 3V6MA 1X7XB 3RUPA 1MT0A 3NPAA 1HK7A 3FTQA 1P7VA 2TSYB 4BFCA 1YR3A 4Y6SA 4DKXA 1V1RB 3UWOA 2QDKA 4DZZA 4TMZA 2PJRA 1IEQA 3GLHA 1V25A 3KSDO 1FVFA 3WGOA 1MNQA 2WJVA 1U8UA 3TR6A 2B6NA 1O89A 4D8XA 3A36A 5H0IA 2J0VA 1YMQA 3DDCA 2ZJAA 1NXXA 4DCJA 1VJTA 4MRMA 3VPHA 4DMLA 4KREA 3T35A 1N0WA 1YS9A 4Z2YA 3HBJA 3ZD8A 4GXTA 4FEAA 2AR0A 3T7DA 4WZBA 3OP4A 4MV5A 1I2ZA 1RQLA 2HEIA 4DUGD 3N2ZB 4ZXPA 3F7MA 3EEYA 3MELA 1N3BA 2IYZA 3BGWA 2FFJA 3F7TA 4I9FA 4LJLA 3LQ4A 4TXNA 4XB1A 3FJ1A 1FVHA 1AV6A 3DQZA 1MXFA 2EP7A 3GK3A 4UXHA 1B76A 2CW5A 4DV2B 4RELA 1T2DA 1MLDA 3NAZA 3KLMX 4GQAA 4JLOA 2AMJA 4MRNA 1UXOA 2C2MA 3IBYA 3OZGA 4ZOEA 3S8MA 4E5YA 1YF3A 1PJCA 4J75A 1NBME 4IG9A 1J00A 2CFSA 1FBNA 2W6IA 4NBKA 2NU8A 1EDDA 1BOOA 1SC1A 3LAWA 4P84A 2GPYA 1GYRA 3NAQA 5FKJA 4B4UA 1GITA 1T2UA 3Q5DA 4C0XA 2DC1A 2F43B 2H11A 1QJ4A 3ETLA 1NA5A 3KOUA 4DQVA 3PLNA 3MTGA 3KE8A 1EFKA 3VM6A 1D4FA 1FTNA 1NW8A 5KYYA 2P27A 3RT9A 2O8BB 4ZT4A 1YRQA 4AK9A 2JAXA 1XP5A 3EC2A 1M1XB 3DT9A 2QKYA 3LNCA 3GUCA 3I04A 3MS2A 3ROPA 5BWLA 1Z5PA 1EWQA 4JBLA 4K87A 1DBWA 5H9VA 1W85A 4KNVA 3ZGNA 3NTQA 3VOTA 1GILA 4UU8A 1RXCA 3BJMA 4PX3A 1EP3B 3IQDB 4UBLA 3GLIB 4I46A 1LSJA 3WK7A 2O8NA 4UOEA 1TMGE 1UKVY 3HDGA 4NU8X 3TQRA 4LECA 2C3PA 4AULA 4NZZA 3W1VA 4B9AA 3O75A 4JITA 1QE3A 3IMKA 5DE3A 3SFTA 2XCRB 4FN4A 1FQOA 2BE9A 2AFIA 1A27A 3FCEA 2JI4A 4H0FA 4I66A 3WXBA 1XZAA 3VOAA 2GK3A 1D5CA 1ZBQA 3GGSA 2NUPA 1EXVA 1FJ2A 3E2MA 4F84A 3D7RA 5KQMA 4FD3A 4RD1A 2Z3WA 3MAJA 1DX9A 2EL7A 4RABA 3W78A 4CUKA 5IK2D 3QXJA 4LZPA 3AFOA 3BL8A 4QDTA 2YHSA 4UHJA 4NABA 1HL7A 3NOQA 2AI2A 4IFBA 3RT7A 3KDAA 4ALNA 3QM1A 1UPFA 4KIFA 1U4NA 4PRLA 3E9YA 3TYXA 2WQ6A 1X74A 1IBSA 4LV8B 4HXGA 4XAQA 1L1EA 2O8VA 1MV5A 2GXSA 4G4GA 2FG7C 2J9FA 3U9TA 4D9BA 2QBYB 4MKGA 1GFSA 2JCYA 2XMRA 4HN2A 3GAMA 2JJ2A 3CM0A 2FPKA 5AXCA 3IOEA 4HKTA 4J1TA 4MXDA 1KNQA 2IXFA 4B0OA 5K0BA 2FMUA 1M66A 3BZBA 3H2SA 4CGYA 5KSOA 4NYMR 3BMQB 3TR0A 1PYGA 2EDAA 2JVJA 4WBNB 5KWVA 1UMBB 4DPKA 3IULA 1EK6A 4PAGA 4MB0A 3EG9A 1R9JA 3OOHA 1JRLA 2ZRQA 3RBAA 4BRUA 3EODA 1WBBA 2W6JA 4MS4A 2GZAA 3CVWA 1PS0A 1GRCA 5K8CA 3NGLA 4N3NA 2X7HA 3VAZA 2IP4A 2YHAA 4KP7A 4ZZ3A 1BMQA 2MMCA 3TF5A 4KLCA 4LZNA 1PRYA 2YXNA 1ZXLA 3GJ4A 3IT2A 4JU8A 3WTBA 4MR9A 5E9WA 3U56A 1KMCA 2OO7A 3UUWA 1XTZA 2HT1A 1G8YA 1RJFA 4IDOA 1Q21A 2AZDA 1ZKDA 3ENZA 3IEIA 1RFGE 4QARA 3UJCA 3ZWVA 3QE9Y 1WPRA 2IYEA 2EGGA 3QSGA 5E7JA 1DFGA 1FSFA 4I55A 3CMMA 3QWIA 3K9GA 4QGBA 2HEGA 2GA8A 3MJDA 4H18A 3AHFA 4YAOA 3COPA 3GNQA 4OFXA 2B4KA 1ZX1A 2ORWA 2IE8A 1EUCA 3RADC 1Z0JA 3NONA 4LJ9A 5DYIA 3C7TA 3M6UA 1VJ5A 5KYUB 3QMWA 4RLFA 4P58A 2FLKA 3LBIA 3VR3D 2PUGA 3CZ4A 5JJKA 4G0MA 3R3YA 1JDZA 5FAXA 3RTBA 2WYIA 2L0XA 2AOXA 2WZCA 5CFZA 3T9CA 3LWDA 3PJEA 3EIWA 1AA9A 1ZM7A 3QHAA 1P17A 4O4LB 2PT5A 2YKGA 3ESCA 1R6BX 4WCVA 3SM3A 1GUYA 3FUXA 3GNTA 5JY6A 1V7QA 1C3OB 1OLXB 1N8KA 1UDCA 1C1DB 2DTDA 2OHJA 3P9KA 4II2A 5HW0A 3AHJA 3LTEA 5C4IA 2PH1A 3IAM6 3HXPA 4JQCA 4US1R 3HP1A 4JQYA 4WFIA 1BXKA 1Q1NA 2HGZA 2PN1A 3LBYA 4GLJA 4URXR 2ZM5A 4YO8A 1DRWA 3ITEA 1GADO 1OKKD 3IR7A 3FDZA 1W0KD 4GW3A 1DRVA 1X8KA 1MBZA 2FEXA 3WLLA 3ZGOA 2IZOA 3FCCA 2SBTA 3HCFA 3MFYA 4G5XA 3FCXA 4AWAA 2H7CA 3GDOA 5IH7A 4Z3OA 4WLOA 4Y2HA 4YJGA 1V8ZA 4Y6QA 3GFTA 1U1IA 5ALRA 3SHFA 4RZIA 2OFWA 3OG9A 5EJAA 3OQ6A 5F76A 1LD3A 2DETA 1HURA 3O8QB 2BHTA 3A6KA 2VZ0A 2FQWA 2QD1A 3A11A 4MULA 1L2TA 1O54A 2B8NA 2FW9A 5HWSA 2EBUA 4JYMA 3V7WA 3ML1A 3Q3EA 1QCYA 2P1RA 3PUIA 1WZEA 3PKIA 1LDMA 2Q6OA 3U17A 3CLSD 2O2ZA 3ZDZB 1L7NA 1RTTA 3PNYA 1PZXA 1GNLA 1E5VA 2ISSD 2XR1A 1MA3A 2WV7A 1PW5A 2BFFB 4IFIA 2PGIA 5FUMA 1G6HA 2VUHB 4D3ZA 1FIUA 1EX6A 1WU8A 5JJIA 1NV9A 2CFCA 1KZ4A 3K1ZA 3QE2A 2O2EA 1DKUA 2WJZB 4XUDA 3TDKA 5B5SA 5I5EA 1JLLA 1INLA 1E2JA 1L7XA 2MYUA 3MVEA 4TTAA 2BDTA 4H7HA 2ZTLA 5ETJA 5GMOA 3HWSA 5BR8B 4KIGA 3RH0A 5CBPB 1GXSB 4UM9B 1BTOA 5A7FA 2ZDGA 3DHVA 1POWA 3G9TA 2CNOA 1AB5A 5KOHB 4DR1B 2A0UA 2Q6IA 3H11B 3PDJA 2VRCA 2VOJA 2IBMA 3GCGA 2YVLA 2VHXA 4LTDA 4XM1A 1I51A 1Z75A 2K7FA 1N9KA 2GZ3A 1ADCA 4XWKA 2DWCA 4JT2A 4CCWA 5TPWB 1W2GA 1DBRA 4UEQA 1G21A 1LW7A 2E6KA 2XRYA 4ND4A 4DQUA 4K3VA 1CZRA 4OI0A 3TOSA 3FBTA 1A95A 1VZ3A 4KMMA 2XF2A 3I12A 4CQLA 2ZBEA 3LVRE 3PG5A 2AXQA 2H2HA 3N6RA 2X5XA 4C06A 1BW9A 2YYSA 3OSZA 2Y99A 3WDMA 1WOYA 3KVRA 3ZI0A 3A4TA 1R0KA 3ADKA 3JQAD 4QQKA 2NU7B 4F72A 2GYWA 1SURA 1N92A 2JD0A 1YMVA 3VX4A 3THYB 4XCXA 4WERA 3N8HA 4N03A 5IF3A 1XPRA 1ZU5A 3ENQA 3TSZA 1TE2A 5M5BA 4IGAA 3GMTA 3LYAA 2QRMA 5FDFA 4PQRA 3ADCA 4XD2A 1T5TA 4C78A 1GN9A 3AEZA 3CZ5A 5K3BA 3RCBA 2V9CA 4D9NA 5JYEA 3U6BA 1YFJA 4X6YA 1TCVA 2I80A 3LVBA 2Q28A 2YWRA 3OWOA 3QVMA 5EIBC 3KYBA 3TNYA 4ZN6A 4AUNA 1U81A 4A4DA 1WDTA 3A9CA 4HXFB 1BE1A 4N40A 3F5FA 2Q7XA 1E0KA 3GLHE 3H2BA 1PG5A 3WADA 3PKJA 5DHQA 1YCHA 3B3GA 1QAOA 4LEIA 4KQEA 3TW6A 1NN5A 2ODWA 1SC6A 2JJMA 1SPBS 3FTPA 3R20A 4OF4A 5L3QA 4BFLA 1IJEA 2DBZA 1P74A 2IYXA 4FDVA 1KYYA 4I4TB 4Q1DA 1SUPA 3F46A 4UVDA 3RS2A 3EWIA 5HZMA 2QD4A 4JMLA 5ADUS 1CY4A 5IN4A 3KKNA 1E1KA 4LSMA 1ZMXA 3A3KA 4WZBE 1CY7A 1LBSA 1PGNA 1DG1G 1TIKA 2B1JA 2FUNB 4DG9A 1KGSA 3CSUA 5FBHA 4FGUA 3PNMA 1MOPA 4HVTA 5FWDA 1TF5A 3KJIA 3DUFB 1IBCA 1XFDA 3EVZA 1SXJB 2GN2A 1SU4A 3H3XA 5FPTA 4B7AA 1EK0A 5JVDA 1TUBB 4BO4A 3ER6A 1QYXA 1ZYUA 4FXOA 2ZJ7A 4W9RA 2CWWA 5FWYA 2XT9A 2IYTA 3ZZ1A 4PYMA 3QI2A 1UWLA 3E9NA 3DOUA 4DRZA 2AI3A 4FGWA 2IYYA 1GFIA 2QJWA 3EIXA 4A9AA 3LUHA 4UDNA 2VK8A 2H29A 3UXEA 2ZYIA 3IEKA 1V3VA 5REQB 4W5OA 2ATIA 1U4OA 4Z5XA 1FE8A 2J31A 2BY4A 4B6FA 5TMPA 1V6AA 2C0QA 2JAUA 5LB2A 1TCAA 4GX5A 3U40A 4WFJA 2VPYA 5CB8A 3LSYA 1D8TA 2QTVA 1ICIA 2POQX 3V1LA 5DJ5A 3KOWA 4LJ4A 4EVRA 1I6KA 2EX0A 2P4QA 1QQBA 1M34B 2A9QA 3W8NA 5KYGA 4GMFA 3ZHXA 3K0CA 3BL5A 4AI6A 2AFHE 3PFNA 2HDOA 1LBHA 1G4UR 1RHJA 1O95A 4NENB 4M0UA 2R7MA 1IN1A 3ITNA 1BE6A 5DNAA 1T3TA 4WH0A 3GP8A 1J5EB 3FAKA 1W5BA 2NU6A 2IQIA 3F2IA 2VT7A 5DBGA 3KQWA 4JI5B 4ARBA 2FFHA 1NT4A 2B4AA 2OCBA 3MRTA 1C7QA 1EUDA 3HUUA 4MEAA 1OYOA 4RWZA 2FUCA 3DZDA 3DNMA 3AP1A 4CI0B 4E07A 5BW5A 1JZQA 1DKMA 2ZJ8A 3EXHB 3G0OA 4PZUA 2QPAA 2BFDB 3GCXA 1JIJA 1CF4A 1SRQA 3W7VA 2CFOA 1PR9A 4B3DA 3DGEC 5C7LO 1TZJA 2CYAA 5KCZA 1FDVA 3DE0X 1OLSA 4W5TA 2QROA 3QVKA 2QYSA 3KWMA 3TLCA 4Q9AA 2FP4A 1GPNA 3VZBA 4TZTA 3F4KA 3JW8A 1XAHA 1YVEI 2H1WA 4UEOA 3NWJA 4I1IA 4E7PA 1XTTA 4M21A 1GO2A 1CQZA 3BYZA 5A0FA 2NSLA 4RHEA 3EGXB 3ZV4A 4C87A 1N5MA 3AM1A 4WCFC 4QPPA 1Z08A 1L3IA 1DCMA 1MX1A 2GD0A 3SN6A 1XU7A 1U90A 2QAIA 1CLUA 4XZ3A 5IULC 1JZSA 3E3NA 1UADA 4AQDA 1I3KA 5LLDA 3ETHA 4A82A 1QBGA 1FXWF 9ATCA 1UBOS 4F2DA 2PR7A 3FFBA 2WSMA 1HNXB 4UBIA 2VAMA 4LKRA 1C1XB 4RSHA 1O2DA 2BN4A 4R5HA 4UVIA 1SWWA 4UHHA 3N3AC 1SZPA 2BEVB 2JIRA 3GMIA 3OJOA 4OP2A 4FYHA 1GZUA 4XVHA 4URVR 1UR5A 1WUKS 1Q44A 3I9KA 3PCRB 1SXGA 1JXMA 5AHKA 2HWKA 3L40A 5FTNA 3D7LA 3S2YA 3BIJA 4JLUA 3E53A 3SZUA 3HR4A 4HDMB 3THYA 3H0KA 4K40A 2NNWB 4CMIA 3GNLA 2WIBA 2G5PA 3DULA 2PD4A 2AGVA 4PEVA 4QUEA 1M2NA 3T0FA 1G7TA 3QKRB 3AVOA 1AM4D 4OBBA 1OAAA 1H94A 2BHLA 1KI2A 4R1OA 1EP2B 4TLDA 1SK9A 4WLNA 3RS9A 1UPXA 2H18A 2JZNA 4ZJZA 4W5QA 2VRBA 1UBGA 3VPCA 1XEWX 1XZCA 3I3OA 3OECA 2ZUWA 4PGMA 4JLMA 5I9TA 2GJ4A 1KERA 1KFKB 3HGQA 3ED1A 2GAOA 2P2GA 2WHRA 3RVMA 2ZYRA 3C3CA 4DMGA 4FDMA 1U2DA 1QB7A 1FXSA 1IPFA 3IUJA 3VHXA 5HUHA 4HLCA 4OHRA 4X1IB 4RE6A 1H4SA 3K96A 3OPQA 2PE5A 2VXYA 2GXUA 3KIPA 2BP7A 1SVOA 5FRDA 2P67A 2C2KA 4CLDA 3PHCA 3TLGB 3KQLA 3OIWA 2BJWA 3F6SA 3M1YA 1C0LA 4F4CA 2IXGA 4CWAA 4HDKA 1L8XA 2IOFK 1H3EA 1F2TB 2BMWA 4TYMA 1VG1A 2EJVA 1CJCA 2XUQA 4DSTA 4W63A 1F2VA 3HV2A 5LP6A 1R4ZA 1CETA 1XVIA 2ANBA 5I3CA 3SQLA 1KDTA 4ZVRA 1YB7A 3OOYA 1NOJA 2XIQA 4QYSA