3X1KA

Crystal structure of phosphoapantetheine adenylyltransferase ppat/coad with amp-pnp from pseudomonas aerugonosa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
157
structure length
157
Chain Sequence
NRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 55
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1kA00
2JA2A 1H3FA 1N2HA 3MXTA 4Q93A 3D6UA 3ELBA 2GM3A 1O94C 4MUIA 1GZUA 4MUGA 5TS2A 2HZ7A 4YP5A 2WSIA 2YWBA 1N2OA 2G36A 3QTTA 2X1MA 4QBTA 5K0TA 4EF6A 4ND6A 1GPMA 1K4KA 1NZJA 1OBCA 1YUMA 2J09A 2QJFA 3CLUD 4UZFA 1JEEA 3FY4A 1VBKA 2A86A 4HK4A 4RPIA 5TEVA 1T6YA 3FETA 2J07A 1WOYA 1DNPA 1YULA 1VBNA 4I6EA 4S1OA 1BS2A 3X1MA 3ZJTA 4YBRA 3N05A 4MW6A 1EFVA 4MUNA 1VBMA 4GU5A 5DEOA 3AFHA 3COYA 2I1LA 4EGAA 4J76A 3UC5A 1O95C 4MUEA 4YP6A 2J5BA 4MUHA 3P52A 2IJGX 5J59A 3A2KA 2QJTA 4KR7A 4XSVA 2DXIA 4JYZA 1Q77A 2WQ6A 1H3NA 3CLSC 3RK0A 1EE1A 1B6TA 1Q11A 1PFYA 2VTBA 3SZGA 4JXXA 2A1UB 3IODA 3PNBA 3NV7A 1NYLA 4MW9A 1WXHA 5KCMA 2A1TR 1XNHA 2DR2A 3SEZA 4NZPA 4ND7A 4Q16A 3IOBA 1WQ4A 4JZYA 1COZA 3IOCA 4L2IB 2WB2A 4CT0A 4AS1A 4R0NA 3MMXA 2QUKA 4RUKA 1M1ZA 4ZCTA 1NUUA 1XNGA 1U3DA 1NUPA 1WJGA 3NBKA 3KFLA 4CQNA 3FG9A 4ZT4A 1WXFA 4PY2A 1X8XA 1T9GS 2QJOA 2NSYA 3CVVA 2X1LA 3GUZA 2CV0A 1TYBE 3ZGZA 1KP3A 1IVSA 3OTWA 5DK4A 1JHDA 1M83A 2HGZA 1F4LA 1KQOA 2YY5A 1MB9A 3UOWA 1RQGA 2QTRA 1JIKA 3K32A 3LE8A 2D54A 4ARCA 1O96B 2DLCX 1JEDA 1IFXA 4XFDA 4X0EA 4MAFA 3IMGA 1OWPA 3UMVA 3DLAA 4CDNA 1TQ8A 2QUHA 1CT9A 1O95D 2YXNA 3X1JA 3ZIUA 5F23A 3HGMA 4R2MA 1F7UA 4F3RA 2R5WA 2PG3A 4EG8A 4OUDA 3AL0C 1IQ0A 3N9IA 2ZUFA 3D6VA 1EJ2A 1U7XA 2C5SA 1MRZA 3ILVA 3N2YA 3P0HA 1MC1A 3M5WA 3IVCA 4DDKA 3SYTA 1GN8A 3TS1A 2VTBB 1KR2A 1ILEA 2CT8A 1OD6A 3BL5A 1J1ZA 1WXIA 1UFVA 3FHJA 4GRIA 2EL7A 4EG7A 2A1UA 2H29A 3G5AA 1Y42X 1VLHA 2D13A 2CSXA 1O97D 3RJZA 2CUZA 3LOQA 4OJMX 1YIDA 3HZRA 2A4MA 2WQ7A 2BYTA 5IHXA 2E89A 3IMCA 1O96A 3RFFA 4CDMA 5LLTA 3IUEA 3VGJA 1ZJWA 1H3EA 2X3FA 3VRHA 1MAWA 2V0CA 5AHWA 1G8FA 4ZT3A 2QTNA 3QTBA 4NDAA 1U3CA 4I6JA 3SP1A 5TEWA 1F7VA 3F3MA 4I6GA 4G5FA 4DNXA 2YWCA 1WXEA 5HUHA 1D2RA 4JFAA 4EG6A 2AZXA 2ZP1A 3AG6A 3FDXA 3CLRC 1M8GA 3SDBA 1QU3A 4OUDB 2PZAA 1I6KA 1NI5A 3KT6A 4KPUA 1ZH0A 1I6LA 4FZJA 4DLPA 1JGTA 3P0JA 1VL2A 4KR6A 1PFUA 2GOYA 2Z08A 2J08A 1EUYA 3SZ3A 4R2LA 1O0CA 3INNA 4ZT2A 3UY4A 3Q10A 1TYDE 1J09A 2Z09A 3CVUA 4KPUB 3I05A 3AKZA 3Q4GA 4MVYA 2A88A 3FOCA 1N3LA 1O5TA 1K97A 3FIUA 1NUTA 3H9CA 4MVCA 3A04A 3VU8A 4AQ7A 1R6TA 1WQ3A 4E1AA 4MWEA 3PXUA 4WSOA 4YMIA 1G59A 4F4HA 2OV4A 1I2DA 2EJCA 5HUJA 3IH5A 1LI5A 5TGTA 1EFPA 2ZUEA 1J70A 1TYCA 4PBSA 2JAXA 4MWCA 4MW2A 1EFPB 1M8FA 1NSYA 3KT0A 3IDFA 3CVYA 3AG5A 4U7JA 1QJCA 1V8FA 1KH3A 1M8KA 5LFAA 3IVXA 1SURA 4EFKA 1GTSA 3ZXIA 3FWKA 2PIDA 4NATA 1M8JA 2CYCA 1MB2A 1YUNA 1KORA 1T6XA 4HJXA 3ZJVA 1MAUA 5HG0A 2QTMA 3ZUGA 1G8GA 1K92A 2E21A 4MW4A 3SEQA 2O5RA 1JILA 3TZEA 4EG1A 2CYAA 1A8HA 3H05A 4MWBA 3PNVA 1PG0A 3UK2A 4H3SA 5FO1A 1YI8A 1F9AA 1KP2A 5K0SA 1TFUA 1N2IA 2QUJA 1JIJA 2J4DA 2AKEA 5KHAA 3ZXSA 2E0IA 1JMVA 5FNZA 3LCJA 3ND6A 4DDMA 1X6VA 1O0BA 1J1UA 1WY5A 4MUJA 3IVGA 3OP1A 1HYBA 5LM3A 1T9GR 3CLSD 1QQTA 4ZT6A 4DJAA 1KAMA 5DB4A 2CV1A 3DPIA 1N2BA 3N8HA 1XJQA 2TS1A 2O8VA 1JZSA 1KQNA 3PRHA 4MULA 1KH2A 1QRUA 2RD2A 3HFJA 1WKBA 4EG5A 1O6BA 3A4IA 2H2AA 1R6UA 4QRDA 2PXHA 4G5YA 2XRZA 4K0RA 2DERA 1U0BB 3AIIA 2BTEA 2DEUA 1GLNA 3CLTC 1OBHA 1PFWA 2E18A 3IUBA 4MVXA 5IJXA 3DV2A 4EG3A 1MBZA 2NZ2A 4ARIA 1N1DA 4KR9A 3CR8A 1EFVB 4U8HA 4L2IA 1FYDA 4YP7A 2A7XA 1QNFA 2V0GA 4ZT7A 1XNJA 5JBNA 4K03A 1O97C 1YIAA 2OQ2A 2PZ8A 3RBAA 2HMAA 4DDHA 3RK1A 3FH0A 1WZ2A 1S4MA 1K4MA 3COZA 3GMIA 4NX2A 3G59A 1N78A 2XRYA 4P2BA 2JANA 4A91A 1JZQA 4MVWA 4PBTA 2DUMA 1NUQA 1ULHA 1J20A 2CYBA 4BWVA 1GAXA 3ISJA 4TS1A 4MLPA 1J21A 1ZUNA 5J58A 1FFYA 3COVA 4QREA 4EG4A 1QTQA 2IP1A 1NUSA 3NBAA 1NURA 1KKUA 1KH1A 1LI7A 3TZLA 1Q19A 4MQ6A 1N77A 2QUIA 3ZJUA 4MUFA 2Z3VA 3G6KA 1JIIA 1ZH6A 4ZT5A 3KT3A 3H9BA 3TQOA 4NAHA 3RHSA 3U1VA 3KT8A 1OWMA 1U7DA 3L93A 2A1TS 3FNRA 1EUQA 1N75A 5DASA 3ND7A 1PFVA 3CVXA 1OWLA 4WNYA 3CLUC 2A84A 5BNZA 1QU2A 1EXDA 3E27A 1MOPA 2X0KA 1OWOA 1OWNA 2PZBA 4MUKA 3H99A 1PG2A 1JECA 1I6MA 3H97A 4JXZA 4DE5A 3JXEA 3PNYA 2B7LA 3FI0A 3HL4A 1TYAE 5H16A 3MLAA 5H7XA 3CVWA 1IHOA 1O94D 3MUEA 1NP7A 2AG6A 1QRSA 2VXOA 3K9WA 3TQIA 3IMEA 3X1KA 5FO0A 3CLTD 3A05A 3HV0A 1GTRA 4MWDA 1P7PA 2D5BA 1T6ZA 5KWVA 1IRXA 2DETA 4HPWA 4ZCPA 4MW1A 4MW7A 4UZEA 1M8PA 1N2EA 1QRTA 3MLBA 4U63A 4ZCQA 1G8HA 3S3TA 3GLVA 1N2JA 3DO8A 1R6XA 3ND5A 4J75A 4ZCRA 1H1TA 4G6ZA 3TNJA 2DPLA 5J5AA 2GKSA 3HMQA 1KAQA 5EKDA 1IH8A 1LW7A 4MW0A 4ZCSA 3COWA 1TEZA 2IELA 1V47A 1N2GA 1Q15A 3CA8A 3IOEA 4MW5A 1KQPA 2CFOA 3CLRD 1WXGA 3P0IA 3C8ZA 3L92A 2RE8A 4HJRA 4NAUA 2PFSA 1MJHA 4KKVA 1IQUA 2CV2A 3QE4A 4XFJA 4PBRA 3Q12A 1IQRA
chains in the Genus database with same CATH superfamily
1LDYA 2WUWE 1QQ6A 1YWGO 1GGJA 2RBGA 4B3CA 5JSKA 3Q7SA 2N1BA 4XX1A 3MWFA 2VOEA 3KZNA 3U6KA 1OH7A 3AI7A 3CZAA 4D4HA 3EYAA 3N2ZB 4BLOA 3DKPA 1KY4A 1CP2A 2IHTA 3PSAA 3IQDB 4ZI5A 3JWJA 3FOZA 2COEA 4WEOA 2VP3A 4HVAA 5JZVA 3FTCA 4UHFA 3BWVA 4FYIA 1NYQA 2FUEA 1DC3A 2W6PA 1T5SA 4OJTA 4FWIB 3WA6A 2VF5X 2IEIA 2HEGA 4K9DA 4I1SA 5BSKA 3T7JA 4RPLA 3IP3A 5DULA 2WHYA 2WHRA 3AETA 2J07A 4TKVB 3UUEA 2CK3A 4C2AA 1DG3A 4CM4B 3H2KA 2FP4B 4HLUC 3DAFA 4A0RA 2PV0A 1KMMA 2ZIAA 2DWQA 5BQ3A 3ORFA 4NBNA 3FMOB 2VUTA 3EY4A 2YXLA 1RRCA 3ZJTA 3JQEA 1UMDA 3L7JA 2FH5B 5HVNA 1MH9A 2H52A 5AVSA 3KSBC 5EE1A 1CY8A 4NHEA 5C5IA 1VBMA 2VYVA 1Z7GA 1E5XA 1D3AA 2PD4A 2OHOA 2I1LA 2N3ZA 3HY4A 4KAJA 5T57A 5CFNA 3Q8LA 4GT1A 4XUGB 2XWQA 4ZVKA 4W99A 1TVMA 4B3TB 3MAAC 5ADVA 4QDJA 4HDAA 4B09A 2ZLBA 2ZKLA 4QHYA 1SUCA 4E0BA 5JHGB 1ESZA 1D0IA 2VHCA 2JARA 3NORA 4CLXA 1J0XO 1SB8A 1QFZA 4BMNA 1CEXA 1H3NA 3DNFA 1DELA 1UZNA 3C98A 2O3TA 2WJIA 4H59A 4PO3X 3O2QB 2V9ZA 2P8JA 4L50A 5DTQA 3SLKA 2CDCA 5DBHX 3SSNA 2A1UB 4JSTA 2KBEA 1YH3A 4XIYA 1PBTA 1LBQA 1MV8A 2UVPA 4G1FA 2C7RA 5FPTA 1KMHA 3EYWA 3DKVA 4OJQA 5L3ZA 1AIPA 3N7UA 3SEZA 1Z6TA 2XUHA 4JJ8A 4EA8A 3IOBA 1HQCA 1SCQA 4FKBA 4M1YA 3JQQA 5JS8A 1OILA 3PUJA 4XLTA 2QMHA 1E1RD 1XJWA 2IIVA 5DNDA 1L6RA 4YECA 2Z83A 3U26A 2AG8A 9ABPA 3A1CA 2Q3LA 3UH0A 1I4TD 3MMNA 4ARSA 4D9NA 2XYVA 1H0RA 2V7XA 3L0ZA 4OJKA 4QOEA 3RKSA 3ZGYA 2QBYB 4G8JA 2WWRA 4GMFA 3FSJX 5D5HA 3U4MA 3NBMA 4QUGA 4XDHA 4HXFB 4MJ7A 4XYGA 3QKWA 3TJZA 4BQRA 4M9CA 2H2WA 2P7IA 4DV2B 1WBBA 3LPAA 3OOSA 3ILXA 3Q6NA 1I1OA 4TWIA 4UVDA 1ULUA 5C8VA 2X1HA 1WJGA 4FFOA 3IBGA 5FBRB 3HCEA 1JA1A 3LU1A 3ODPA 3DFMA 1H4QA 1VIMA 4CM8B 4WZAE 4QJ3A 5GZ3A 4PC2A 4TYPA 2I2FA 3SXUB 3D3EA 4NDNE 4HN4B 3AEQB 3OLQA 2NTVA 4FPXA 4MVJA 4LGCA 4JVNA 4ED9A 2HGZA 4RXUA 2Q4OA 3INRA 4ZMRA 2OGSA 3WGQA 2WFLB 2ETVA 4MROA 5DNYB 1NXPA 1ZH4A 5C1OA 3E82A 1M7BA 4P8RA 1BWRA 2ZYVX 4D6XA 1FNBA 3NHJA 5LXTF 4M1TA 4M8KA 1R0LA 1RDFA 3CXRA 4ARCA 3BWMA 2JDIA 3EDCA 3FLBA 4RAQA 3OQ1A 1RAFA 1N2SA 2ZYDA 3SGLA 1CX9B 1HI9A 2AOUB 4FE7A 3UMFA 2PE5A 4MQEA 5JI3E 2GCEA 1SXGA 1KNQA 1DBWA 2FZCA 3MM4A 2NUAB 1A50B 5I47A 2P9YA 5CNMA 2XDWA 2CWDA 2V8BA 4OK5A 4OP3A 4ZTUB 2D1QA 1Q22A 3PA6A 2Z2YA 4AS2A 4OUDA 1JKJB 1OFIA 5CLHA 3ZZTA 2DFKB 2ZJ7A 3TR0A 1JVSA 1DAGA 1TDJA 4K88A 4QJ4A 1KI8A 2QR2A 4DV4B 3EVGA 4BP8A 2OAP1 1E98A 2B4TO 4XYMA 1JDNA 4RNCA 3PC7A 2OLJA 4UNQA 1SGWA 3G02A 3EIUA 3C6XA 3C3MA 1QPGA 4OJNA 4P35A 3TS1A 3KC2A 2VTBB 3FDZB 3LF1A 3LHDA 3PUXA 2DB3A 4ROTA 3ZS8A 1ZOOA 3FHJA 2B94A 3U81A 1I3CA 4ZAZA 4BNXA 2GS9A 3HLTA 4JJGA 3N0WA 1E3SA 1JDUA 3HV2A 3SJCA 3ISVA 3LXRA 4PIPA 5PNTA 3A9VA 2K87A 3GHYA 4LRYA 3LCUA 5HKLA 1SZPA 3CW8X 3S2EA 2JIZD 1CIVA 3UAYA 4BXOB 3DEZA 1G2QA 4R1NA 1P7WA 3QGMA 3EWAA 1LJUA 1O8BA 2GYYA 2XTZA 2QW1A 3DA8A 3LPMA 2V6MA 4EMBA 1ILWA 3BK1A 2EGHA 1SD5A 1NUAA 3CGWA 2V0CA 4NE2A 2Q99A 5THQA 3ZOZA 2VYNA 3SBOA 3VYWA 1AUOA 1QORA 4LDJA 2N42A 4GIBA 3MTQA 4IH9A 3RQIA 1FZTA 1T5LA 1I1QB 2W58A 4YDRA 1KF0A 4Z49A 2FMUA 3ZW8A 2O5EA 4BTLA 1BKSB 3IVRA 4ZTZB 2NN3C 1LBIA 3AM4A 3CX7A 1FX0A 4EG6A 1VRCA 2QROA 1MB0A 1X8JA 3CLRC 2RHCA 3AEYA 3IAUA 3KS9A 3VZPA 3WK7A 1ODFA 3ROTA 3LWNA 3KWMA 2FN4A 1X8LA 1T9HA 3AHCA 3HKEB 4E5MA 3LT0A 3MTEA 4NMMA 4OQNA 1UKZA 5EVJA 4F3TA 3VC7A 5IW8A 1AD2A 1BNCA 4LDRA 5JAQA 2C7PA 2RHGB 4FLEA 1KZHA 2ZCJA 4C5BA 1PJQA 5KKAA 1EUYA 5F1YA 3AJDA 4EI2A 3DTVA 1Q1AA 3AJ8A 2BFCA 4N48A 1C1XA 2ZTLA 1WL8A 4MOWA 2DJIA 3CVUA 1QHYA 3R7FA 1HA3A 4OCZA 4E11A 5B1EA 4F9GA 1CUFA 4V0MA 2DTEA 3PFCA 3JPYA 5BMVB 1R6TA 1WQ3A 3OQPA 1O03A 2FWNA 4WFJA 1VJTA 4E09A 3EGXB 1I3NA 4HWKA 3UG7A 4AZ3A 4CN9A 2VHJA 3DKIA 4X95A 3BXOA 5AI6A 5CLFA 4LYHA 3VR3A 1S8NA 1UJNA 4JY7A 3ODGA 4EUEA 4RHCA 3PXBA 1W5FA 1WQ1R 1Z4PX 3AKYA 3GPIA 3JYOA 4YUXA 1EFPA 4M9SA 3BH0A 1A2KC 1QKIA 1C9NA 2B4YA 3W79A 3NTQA 3B3JA 1Y63A 4FNGA 4U9UA 4FNAA 1A77A 2X7XA 3TW6A 1E64A 1VIAA 2QAIA 3PVCA 3HVRA 1FFDA 4REQA 4LZZA 4IINA 3SQNA 5JALA 1PV2A 1EWTA 1NQWA 5LA6F 1KDVA 3NM4A 5DLDA 1G6Q1 1SVUA 1QS0A 1KTVA 3I9OA 5SYNA 1RHQA 3PUVA 4E6PA 1GITA 2Q5JA 4A23A 4C2BA 1P45A 4R6XA 2PIDA 5IP5A 1GTVA 3O0TA 3WNDA 3OEED 1SC9A 5CGQB 1TMOA 2PFGA 1CUIA 2SKDA 1S2MA 5IVIA 5CX4A 2HU8A 3G49A 4OQYA 4DRZA 1T3GA 1ZEMA 1PTJA 2IVZA 2HRBA 1HYQA 1N6KA 2PNJA 4ZEMA 3LCMA 4HP8A 3QPVA 4FB5A 5LKRA 3H3JA 2IZ5A 2BGKA 4M9QA 2QZZA 2O8EB 3PPXA 3UF0A 2V3VA 2W6JA 4GGMX 2X22A 2BPOA 3W5VA 4DRXB 1GCOA 3DDUA 3QJYA 5JVDB 4PYNA 3M34A 3H75A 1E1DA 1SHLA 3QXCA 5JLAA 3ANMA 1ADYA 3BTVA 3EAQA 4K1LA 5JTTA 3I76A 3EXFA 2QUJA 4E32A 1Z62A 1JLSA 1HDGO 3H8WA 2BEKA 4JS0A 2Z04A 2REBA 2WU1A 4WACA 5JG7A 1P75A 5KHAA 4JP8A 2I8LA 1QF6A 4X71A 1N2ZA 4RTOA 3WGOA 2DPHA 3ZNOA 3BTUA 1NNUA 2BE7A 1YL6A 5ALMA 2HLDA 2UZ1A 4IDEA 1X6VA 2XF8A 2C4VA 1E7SA 1P1FA 1LWOA 1TTTA 2OWEA 2VA8A 3UJBA 1NF2A 4KXWA 3ZLTA 5LQDA 2SBTA 1K75A 5T7BA 4EL0A 1KAMA 2P5YA 1XU7A 3GRUA 4G0YA 4KQJA 4ZYYA 4WBNB 2V1UA 4R1LA 3IB3A 3G9QA 4W6ZA 1TD1A 1ISMA 1JXQA 1SC4A 1G4HA 3OM8A 5T3UA 5BQFA 5KTOA 1SOAA 2I1QA 3DL7A 2A30A 3TTUA 3K96A 5DM60 4V1CI 5HRUA 4X91A 2YASA 3GLIB 3THYB 4H17A 4KSCA 4IJMA 4QGSA 3KJXA 5JYDA 5JJIA 4BKMA 1DFHA 1KJ8A 1T1GA 1MVLA 4JJ4A 5B12A 5CA1B 5JANA 2B4AA 3RYFB 1FBTA 5E7IA 2X8LA 2VJBA 3UQZA 3KEQA 1X14A 2ZROA 5EPUA 3RIGA 3ZTWA 5D5PA 2EERA 5KJCA 5FL7A 5FTJA 3BN3A 3LZDA 4ZOEA 4II2A 4IXNA 3VHXA 2H1OA 1E0JA 2AHOA 4JVOA 4B3BA 3H8VA 1FYDA 3WOVA 4ZALA 1JQDA 2P7HA 2WHXA 3AYXB 5EP3A 3VNUA 5DEIA 3AHFA 4ILKA 5JFGA 1HE5A 2IVFA 1R00A 1RYDA 1EEXB 1DE0A 2Q46A 4H3VA 4TQAA 2OQ2A 5FBHA 1V37A 4YLYA 2HRDA 4ER3A 3HYRA 1Y9AA 3C5VA 1CKEA 1Y9ZA 4GEGA 2XGJA 2OAGA 2QYSA 3MTIA 3CLKA 1XELA 3GMIA 3L5OA 1Z5PA 3OIDA 5BVGB 4CQMB 4FMDF 5E7JA 3TTVA 4ZK6A 1JAZA 2DUMA 5IXSA 4E88A 1FK8A 3LP6A 4O2AA 4BWVA 3PG5A 1YF3A 2WV9A 4OAOA 4Q1EA 1QZ3A 3I5XA 1RHJA 4CMKA 3UW3A 4TS1A 5G2OA 2AR0A 4Y2UA 1E1QA 2WNIA 3RT7A 1FFYA 5E6RA 1Y82A 2ESRA 2OE2A 3KAKA 3MPOA 1WUJS 4JC5A 4V3CA 2EV9A 2PRYA 2ZVPX 2GHQA 3EY9A 4FMBB 4N5IX 4PIMA 3EX7C 4PM4A 3A1SA 4Z4IA 3K1ZA 3R20A 4ZC8A 1QH1A 4MUXA 4AKEA 3A4TA 2C1EA 3OT1A 4R31A 2AX4A 4U1RA 4CG2A 5IN4A 2Z3VA 2BD0A 2VPIA 4OHWA 3AX6A 4PGFA 4IKEA 1ZSVA 4RVHA 5GOTA 5EJAA 5EINA 2BT4A 2RJNA 1TGVA 3L93A 4DJDC 5BSHA 2DULA 2OO5C 2R4UA 1W9MA 4MS3B 4PR0A 2FJ0A 5ELLA 1NQTA 4B45A 4EY3A 2BH9A 1J2TA 4O4IB 2COUA 4GPIB 4DLAA 4UBMA 3W6NA 1KQFA 2JJ2A 4WESB 3U16A 4YFYA 1A82A 1INLA 1USUA 2HSJA 2H7YA 1JFVA 4HDMB 4ND2A 2JZOA 1WMEA 3F7NA 3GB9A 1SAYA 4D0SA 2QVZX 4ZGWA 4QDZA 4YT4A 4GLJA 2Q8PA 2ZREA 2DJ5A 3DZIA 3EGIA 4N3GA 1X74A 2E5FA 1YDMA 1IHOA 1O94D 3R7WB 2XQKA 4ETWA 4A26A 5JEDA 4Y2VA 1SU6A 4WERA 2ICAA 1KOLA 2HQOA 2WSMA 4MV1A 1I5RA 3W9YA 4CPDA 1PKXA 4DRXA 1P5RA 1DQSA 1EK0A 4R9RA 5E4YA 1ORIA 3PWSA 3V1NA 4F11A 1F1BA 3TLGB 3ZD6A 2D5BA 3PDHA 1DX4A 3DDNA 4TMZA 2R1TB 2PTHA 3O2NA 3R9IA 3FFBA 5LB4A 2XMGA 3IMKA 1KPHA 1OASA 3RFUA 3GUYA 2DECA 4S1NA 2P6NA 4QTZA 5B7PA 4Z0HO 2ZEJA 3A9SA 4OLFA 2WFZA 1ADBA 1AVTA 1E2IA 2ZATA 2MINA 3G23A 3H5VA 4XUCA 2EQ5A 5EE9A 1RLJA 1PLLA 3TVDA 2V98A 5HF6A 1HFJA 1E6LA 2HDWA 3GJ0A 1DJLA 1A76A 2F4VB 1WXDA 3K2EA 3RS7A 4TYMA 4G5QA 3LFTA 1J0CA 3IIMA 4YXWA 3SQMA 3S70A 2FPXA 4F5WA 4R71A 2I54A 1OX4A 2HREA 1FMCA 1YMVA 4R9SA 3ZY4A 3UGKA 1W44A 3L4EA 4N7BA 4E2FA 1FDIA 3NASA 2O54A 3KV1A 4L6IA 5LD2B 1R3DA 3GNTA 1TJYA 4S1PA 5CFMA 1H5QA 1T4DA 1HTWA 4EW6A 4R0MA 1BO6A 2E37A 3GEMA 3GVIA 1KYTA 4RDHA 2J6IA 5CK4A 2N46A 4MW5A 3HB5X 4IQGA 2O7QA 1IAVA 3CLRD 1TADA 1L7VC 1NVTA 5TVKA 2WYHA 5LQAA 1DJQA 1SXIA 4RCZA 2XNCA 3UJ7A 2VDNB 2H9AA 4ILEA 1OXXK 1P29A 2XD4A 1YK1A 2CD7A 3R3HA 4ZQGA 4OXKA 2IU0A 3ZHZA 1JJVA 2W22A 3NVMB 3C3PA 2HA7A 3K73O 4LZLA 3TLZA 2O8BB 4LQDA 5A05A 4G09A 1EFAA 1QQ5A 1XLWA 4NV1A 4POAA 1C4KA 4RMJA 2ZRJA 1DTWA 5LZ4A 1K89A 2BCEA 4MJXA 2IPMA 1ZLYA 4RESA 2C5FA 3EDQA 9LDBA 1F48A 1UEJA 2JLWA 1JU3A 4HQ0A 4J0QA 3BKWA 3K92A 4MB6A 3ZWNA 4XGNA 2UYOA 5FTNA 4WVLA 1E3MA 4K9PA 1RXUA 1X1TA 2FHPA 4Q82A 3GCZA 2AKYA 3MT7A 3ZDDA 3C3DA 4JQCA 2X1MA 1UDCA 3OFKA 2AFHA 2I6QA 5K0TA 5DK6A 4RY2A 1XVAA 5BVGA 4BLQA 1GPMA 2QJFA 4QXAA 4C29A 4XQ9A 1RLOA 1VBKA 4Z9YA 2A86A 2PS0A 2FZWA 1M10A 3ZV4A 3EGXA 4B3RB 4HXYA 1G2OA 4YH1A 5GV8A 3W3AA 4OHYA 3U3JA 5K05A 3V4ZA 3JAMA 4BNIA 3F9CA 3DXFA 1JSXA 1OKKD 2DHCA 3GK3A 4AO7A 2PZLA 3H9EO 4KZPA 4D79A 3GGGA 4GVPA 1SXJA 5EXPA 4C0BA 2ZI5A 3H6HA 4P4SB 2ZB7A 3OBBA 4U7WA 2R00C 4Y1RB 1XA0A 5LC1A 3AUSA 3DWEX 1STOA 5DYNA 1GQ2A 3I4CA 4MKIA 4NG5A 1I9GA 2XCRB 5JQGF 4ESOA 1YOVA 2OUKA 1AX9A 1FUEA 1XRPA 3ZCRA 4MRMA 1DGQA 2Z1MA 3O8OA 1T0JB 3CLSC 2JD1A 2O0HA 4JU9A 5LKAA 5CT6A 3K9HA 4HN2A 4FBMA 4ZHQA 3HXQA 5FUMA 2JAUA 1J24A 1KVRA 4QU5A 1LRLA 4RETA 2XQVA 2LW7A 2IKQA 2RHHA 3RGWS 4CODB 3K7EA 4YONB 1WV0A 3FGZA 5D7NA 2XVYA 1LUAA 2ZETA 4RH3A 1SQFA 3HA2A 4ER0A 3ONDA 4DV7B 2GN9A 4KYUA 3GIDA 1WB6A 4KFRA 4NYJQ 4Z9AA 5C8YB 3VX3A 4FNOA 5CD1A 4EUFA 4R1UA 4DLYA 5C4IA 3FCYA 1JDBB 4TMWA 2DPGA 2B99A 2KLBA 3GLGB 1MG0A 1OVMA 5FV7A 1E3EA 1JR4A 5A0VA 1N0IA 1S3GA 2VSYA 2WOJA 4K6CA 1XQ6A 5D84A 3U3RA 1ZOIA 4ZCTA 2WAYA 5EI5A 2OV1A 3E1SA 2GZDA 1MQ9A 1NUPA 3KR9A 4AP9A 2Q0SA 3BJMA 9LDTA 2FXIA 3GNQA 1TM5E 2WWHA 1MEJA 2JGNA 2PH1A 2AI1A 3R77A 3DQQA 4XOIA 3C43A 3TECE 2IEAA 4O25A 3DEAA 3ZHUA 1H2ZA 4O1HA 4S2UA 1GAJA 4TZ6A 3UAWA 1K2WA 1VRVA 1F2UA 2WUVA 3T7RA 4ZANA 1M2VB 4F8JA 1SXJC 3VNVA 1I0ZA 3QXHA 3KALA 1KNXA 3EVCA 5JAIA 1XTPA 1PHPA 4Q12A 1QYRA 3DO5A 4DQUA 4Y0AA 3PCRB 2AUMA 2GN2A 4XWTA 4CT4B 1UJ2A 1Z82A 3CB2A 4JP1A 4K28A 4UAJA 3HK2A 4J91A 3AKDA 3G0OA 3CW2A 5FR2A 1T13A 4PPFA 1PL7A 3GAMA 1T10A 5SY9A 3S5UA 3EPPA 3IR6A 3JASA 3WL3A 4BMSA 2B1RA 3IMGA 4MQEB 2IU4A 3AINA 2N9UA 4LECA 1W5EA 5JMOA 3HM9A 3GRAA 1HDEA 3AF1A 3UUWA 1KAOA 2PSDA 1FLAA 2PLAA 3OP4A 4B5KA 2QM8A 1IM5A 3T7EA 3B1YA 1HV8A 2QMEA 2F43A 3VKFA 4ZPJA 3WDLA 1S2IA 2R5FA 2X13A 5LA6B 7GPBA 5HJEA 5LYJF 2IX3A 1U0LA 2NXCA 2NSHA 2RGAA 3I39X 3PQ2A 1O87A 2FWRA 3FHCB 4I5IA 4LWQA 1EJ2A 3WKDA 4EF4A 5HKOA 1UXOA 3GP8A 2RKOA 1TEHA 3L0DA 2ONJA 3D9QX 1VMIA 1XRJA 5IMBA 2CVQA 1BHO1 4EKDA 2F62A 2E87A 1BHJA 2VTEA 3DEHA 3EIHA 4XI9A 1M1XB 4S1TA 1I32A 3DUFB 3QHPA 3SYTA 2C3YA 5ABPA 1ILEA 2QTVA 3Q3EA 4EJSB 3U09A 2DWOA 5JDCC 1BFUA 4UCFA 1QANA 5AIAA 2RI0A 2HBYA 1WPGA 3UJAA 1U8UA 4HGOA 1G3UA 1Q0LA 3CBGA 1KSGA 3KZMA 5LP6C 1J2YA 1WCV1 2BZ1A 3AB7A 4Y6LA 1WHSB 3BQMB 4OJMX 1PQUA 5I3ZA 4EHKA 2GVDC 4WGFA 1MORA 1FVHA 3HZRA 2O3SA 1L5NA 4RADA 4YV1A 3K1AA 1JB1A 4JUDX 4S1VA 2BFDB 5EG5A 4M0KA 3JV7A 4BMXA 2BLLA 2VC2B 2V6GA 4TTJA 3RFFA 3TUZC 1W8DA 1D1QA 2DC1A 1DG9A 4RKEA 3NHZA 1BJKA 1PAUA 3ICQB 3FPFA 2BMFA 4PO8A 3V4FA 2YRXA 4DIKA 1L3BA 1IEQA 1ZVJA 4IQ4A 3RSQA 1T3LA 2WTAA 2P2DA 4Q47A 1X13A 3PDIA 3PA8A 2I1WA 4DARA 1DAKA 3KOWA 4TUYA 4QKQA 2ECKA 5AM2A 4CV0A 1D2RA 3R76A 5HUHA 1GP2A 1LNSA 1VKNA 5LYYA 4YMUA 4W1SA 2PAAA 2NZVG 3EXFB 4FXOA 3WL4A 4LFCB 4OGFA 5KNDA 1LC3A 3HCAA 4M1MA 2FWIA 1I14A 2GERA 1TMYA 3N53A 2VDOB 4I50B 3OZBA 3ROEA 4A0HA 3PF8A 4FJ2A 5H4HA 3NNSA 1JHQA 2OZLB 3L7LA 1XCBA 2M32A 3FYUA 2OYSA 5TQ0A 1KO1A 2VCHA 4NZNA 1D8AA 4W1QA 1YHZA 2YBDA 2EKLA 3RVQA 2P77A 5ALUA 5FI0B 1N4DA 4PTYA 4POOA 4B8ZA 3KJHA 1JEQB 1P0FA 2IUTA 1Z4QA 3Q4GA 3T7IA 2DHDA 1N3LA 3MSXA 4L8VA 1E9CA 1JHXA 4REMA 2ZUUA 3M6AA 4JROA 1GGVA 3G9TA 4MRNA 2R68A 3LL4A 4YJ3B 3RLFA 4AQ7A 2IQIA 1OA0A 3SN6A 1GSAA 3EDYA 3ZQKA 5B7GA 1T24A 1Y5LA 4WSOA 2PKXA 1FNCA 4GF5A 1ZG3A 1AGRA 3JWPA 1GPBA 2PBFA 1MAAA 2BMWA 2NUTA 1ZWLA 3W77A 1W0JD 4AAYA 2QTFA 4MITA 1JHMA 2GR9A 1S5PA 4MS1A 3IE2A 1DXOA 4NPHA 2H4WA 1YR3A 3GJZA 4GZ5A 2XR1A 4KXUA 3ZDEA 3CUVA 1N8SA 4C06A 1N2CB 1IN5A 5EJ8A 4DDVA 2I71A 2LPMA 2PHZA 2V6IA 3QEJA 3HJNA 2CXXA 2OM6A 3NOOA 4ASUD 1QJCA 1V8FA 3OEWA 4TV9F 3TUIC 3O9MA 1BWQA 3G2LA 3L49A 2O2EA 2FWPA 2VDRB 4Q3NA 2EFHB 3HPRA 4XLLA 1YKSA 4OQXA 3N0VA 1QVRA 1R27A 3S2UA 3V6LA 3P4XA 9GPBA 1E3QA 5EIXA 4Y9DA 2A0YA 2HI0A 4DUPA 2F1JA 4CMGA 3OU2A 1Y7LA 5HEKA 4BFUA 2BE9A 1ND5A 2JRLA 3RB8A 3KJEA 3CNLA 5DYYA 2IH2A 1GRRA 1Q12A 3PC8C 3QKSA 1ZW1A 4MGIR 3SR0A 3IHKA 1VECA 3DLTA 3HHEA 4CM9D 2FWMX 3Q3VA 2MINB 4WL0A 5LWHA 1FFCA 2M6LA 3B82A 1X38A 1Z6QA 4CIXA 2VBGA 1NQOA 1A1VA 5GIPE 3NRBA 3HEAA 3L1KA 3U4IA 3TNLA 5BWMA 1AK2A 3L1HA 3GUVA 2ZJ1A 1W93A 1ZONA 1ST3A 1EUCA 2RB5A 2W2TA 4H3SA 5IC6A 1T2VA 2DPYA 2Y1FA 2ZVJA 3DT9A 3HKCB 4JR2A 3BM5A 2DPMA 3IAS1 1RYMA 1TFUA 2O3RA 1E63A 4WZBE 3CNNA 2PX2A 2UZIR 4PGMA 1X77A 4YJHA 2AKEA 4GPEA 3AUJB 2PN1A 1C2TA 3EH1A 2XKJE 1GEEA 4LCBA 2E0IA 4GD3Q 2RHLA 2WJ6A 3BSWA 4JSRA 4L0CA 3ND6A 4RD0A 3R8XA 1J5EB 4RJLA 2B82A 4ZAYA 4Z4CA 1AKYA 3FVWA 2H4ZA 4CF5A 3PQ4A 1WY5A 4GI1A 5GQSA 5T8KC 1G4UR 1Z4LA 2CDAA 3IRVA 3M82A 3PRKE 2GFHA 3W78A 5KNCH 2UZ4A 3NU1A 2VDWA 3A6JA 1UADA 4EI8A 5K8IA 1BMFD 2Y6VA 1P6XA 1WD7A 1YTLA 2YUTA 3IEIA 4N18A 4WV3A 4ADSG 2HF8A 3RVMA 3MS7A 4C20A 4HTFA 2OFXA 2W70A 5JIBA 5ICCA 1KQNA 2V58A 3N3BC 4DLWA 3ZXUB 1VKHA 1M5UA 3I6BA 4B7ZA 1N0VC 4EKYA 1KH2A 2P78A 4QYWA 4UMDA 4PRYA 3JYNA 3IXLA 3MEQA 3NHKA 4DM3A 4EPYA 5IYZF 4YAKA 2I80A 3LBYA 3M0EA 4KRXA 1YC2A 1XTRA 3SFVA 5LL6P 5ES4B 2ECOA 3I6ZA 4UHEA 3EOBI 3TRFA 2BTEA 2NACA 3OOHA 1SCBA 5EJ7A 2G1KA 4H6PA 4F97A 2HNBA 3TD6A 3AQ4A 3LQRA 3S55A 2WSBA 5EUCA 3OQBA 3ZCTA 4DQ0A 3O1LA 2ZJ2A 4KR9A 1JH9A 2R4TA 4LUCA 3EQ2A 4YJGA 4A03A 1YZUA 3RHFA 2VAPA 4MWTA 5B2EA 2VLIA 2JEOA 5JRJA 1NHWA 3SOZA 2VNAA 5KVCA 2V3CC 1NT2A 1PZNA 4P3PA 1R2QA 4ZCMA 2QXTA 3WS7A 5L53A 4NMLA 4DILA 2WC1A 2Z8ZA 3AEUA 3VZQA 4BO2A 5IMSA 1AO3A 3TMYA 2XRYA 3I9MA 4XYEA 2QV7A 2JATA 5IDYA 2F55A 3EGDB 1BTOA 2C5AA 1Y5NA 5F77A 5TRTA 3BHMA 3PFWO 4PF1A 4QSMA 1FS4A 3P71T 1ZD1A 4BL5A 2ZXEA 1EFRD 5CX1B 3M6VA 2FG7C 4DQXA 1MX9A 2IYZA 3WSWA 3MBKA 6CHYA 4JOBA 1AXEA 1P2DA 3COVA 1IMJA 2A5YB 4WDRA 3K0KA 4Q1VA 4Y98A 5ERYA 5BR4A 1F12A 3EJWA 4J1QA 1CUZA 3D4NA 3B8EA 1UXJA 1L4FA 3JQCA 3D1LA 1U0TA 4C4ZA 4EO7A 4Z4GA 1BS9A 1I5OA 2RG1A 2QNBA 4YRQA 3Q7RA 4KMRA 4ZT5A 3RROA 2KX7A 3EA4A 3CZ5A 2GCOB 2GHRA 3EUAA 3NIBA 2H5IA 3HDJA 1RYYA 2HW8A 3FZYA 4EDHA 1ZA2A 4CUZA 2B92A 5MGBA 4JYMA 1ECFA 1K86A 1RI2A 1W52X 4BV8A 5D6NA 4JI6B 2H4HA 5HZMA 4PC6A 3SWWA 2W6JD 3HUFA 3ESDA 2QVXX 4R1PA 5EPOA 1DVRA 3LIPA 1A8QA 3M9WA 5L3VA 1T4MA 1U2GC 1YJXA 2PPVA 3H99A 3P1JA 4OB7A 2Y2VA 3DMTC 3FHLA 3IQWA 2WJ3A 1Z4NA 4BFCA 3TNFA 3BIFA 4C7VA 8GPBA 1C3XA 3HU1A 3IDQA 1HO3A 3MJTA 3QOWA 5C37A 1JEJA 1OX4B 2H00A 1KS2A 3C1TA 2VQFB 1C8LA 1P1CA 4FD3A 3LSTA 1ZDMA 1P7ZA 2HLDD 5TS3A 3TQIA 1WO8A 4WEQA 1XPUA 3TRIA 2B78A 3MWDB 5FO0A 3ZI7A 3DP7A 4HOYA 4JMPA 4EHIA 1GTRA 1MZPA 2P0YA 3IR7A 2FN7A 1MMFB 5DBOA 4TN5A 1OROA 4LJSA 1KY2A 1RHUA 2X9VA 2DFDA 3OIWA 4UULA 1MIHA 1C7RA 2EATA 3IV6A 1Q1ZA 3OICA 2R48A 1YBVA 3NHRA 3R3SA 2CNLA 4TYYA 5EQTA 3MB8A 1Z0SA 2QVGA 3WX0A 5JWRA 2FKNA 3SAJA 1RIFA 5SY4A 3PCXA 4DA0A 4RSHA 3KKQA 4BNUA 2VTVA 4C7MA 4Z9BA 3B2QA 1B0ZA 3L06A 3PYLA 5AJUA 4LGYA 1MDBA 4WECA 1S9HA 1U8ZA 2CDRA 2RI6A 4DY6A 3OCYA 4RFVA 5J5AA 3GFOA 3TFWA 1KAQA 4K0KB 3QU5A 1AUPA 2YX1A 4OSPA 3H2YA 4YJ3F 1S9DA 3G0GA 3L6DA 4F5DA 3HYTA 2WG2A 1YS2X 4LNAA 1Q17A 3B5JA 4V03A 5ALSA 5EGSA 1S2LA 2QG6A 4FSDA 4DBZA 1I4DD 4REQB 3AF6A 4IUYA 5CCDA 4E94A 1R9GA 2DFTA 1T25A 1W1IA 1I5EA 4MVJD 2JGAA 4RJTA 4MUMA 4OGKA 4ZZ0A 2H08A 1HRDA 1BE0A 1R0SA 3FCOA 1NR7A 1ZH2A 4K6FA 5I9SA 2AN5A 1MA3A 1Y1SA 2AQ8A 4NC9A 4LC9A 4X24A 5BP7A 1N2HA 1G18A 3GP3A 3Q3CA 3SX0A 5B7NA 3GLFB 3VPCA 5LZ5A 1QOQB 3LZCA 4YUWA 1QC5A 1NNSA 1O94C 2BGRA 4MQ4A 4DWJA 5JXGA 4Q3DA 4XX0A 1ZJ5A 2FZEA 1W5TA 2A9RA 2AG1A 3ZR4B 2FFJA 2V7UA 4ARZA 4LXTA 4B84A 3W8DA 2GUGA 4AB1A 4CG1A 3WMXA 1YZGA 2P11A 4WNIA 4AQDA 1Z6GA 1TU4A 2ZZKA 4HDOB 4R40A 1GA1A 3VU9B 2ZR7A 1FXWF 3V7NA 5C1PA 2GRUA 2O0MA 3KEOA 3GAFA 3PV0A 2C3MA 3EGDA 3BHIA 1HOTA 3IDZA 4XLZA 5HW0A 1K8YB 4BZPA 3VH1A 8LDHA 3BZBA 5AI9A 1RTKA 1X19A 3TOCA 2OLEA 2VRNA 3ZGOA 1D1TA 1E2EA 1WA5A 2BH2A 4B4OA 1POWA 1V8DA 2FN3A 4LI0A 1IWBB 2C77A 2PMWB 3LX4A 3PICA 5TLSA 4RWEA 2GFQA 1THGA 3OQHA 4LGVA 3W5BA 4KK4A 4MUNA 2O1EA 2Y1GA 3PDIB 1T91A 3DEIA 5L4LA 4OHMA 3DTVB 4EI7A 4HWRA 4M99A 1Y9JA 2O6LA 2WINI 4ND1A 4GOND 1U94A 3D02A 4J76A 4R0VA 2JF0A 3V8RA 3WBJA 4ANFA 4B3SB 2F17A 2GEFA 3TLXA 2AVDA 1R5OA 4PFSA 4UHKA 4URFA 3IBYA 3U7HB 4XSVA 2VP0A 4M1QA 4Q18A 1QIGA 1QGUB 1VL1A 2IQ5A 2J48A 1DXHA 1K1EA 2BL4A 3PWTA 5J2UB 5KMGA 5LQRA 2XDYA 1G20B 2WEKA 1XMOB 4FQ7A 4AIIA 5IT9A 1U8AA 2XKAA 3PFBA 3THYA 1WMDA 1PO7A 3W0LB 2HF7A 3GHHA 3P9NA 4O0LA 2BHRA 3V2UA 1N32B 5JC8A 1EBBA 3OF2A 4QPJC 1GPAA 2W2VA 1JT9A 4LX0A 2R1VB 4HLCA 5K1ZA 4XVHA 3V7YA 3VHXB 2YJ4A 1SIWA 4IICA 1YAHA 3WWEA 4CI0B 3SQLA 2UYGA 2VDQB 5C8YA 3TQCA 1NJ1A 5MGNA 2JASA 5KWJA 1RAGA 2HC9A 4QRIA 5FPHA 3UBMA 4CCAA 4C7OA 2V55B 4QU0A 2ISCA 1DOAA 2O7NA 2IUEA 4YJGB 2GETA 2IY9A 2V7VA 2A2ZA 4G86A 4C3ZA 1TF5A 5K20A 4R0NA 2CZGA 2YV5A 2OGUA 1X3LA 2P3OA 4P7GA 4UDNA 4F1JA 1UWKA 2FQXA 3I12A 4HGRA 3VR5D 5EKXA 4HT3B 4L4UA 2QTCA 1N2CA 4JQOA 2SKEA 4G63A 1H8HA 1YZLA 1CS4C 4YAUA 3JR7A 2CXQA 2Q6KA 3L1IA 2I03A 3V9PA 1ZS9A 4NBUA 1VRWA 2X4LA 1GWNA 4L8WB 5AJYA 3WMFA 2L0XA 3BK2A 1E1CA 4WXMA 3QYPA 4ZREA 1X8XA 5FXMA 3X3HA 1XZMA 2I9KA 1OMOA 2QS9A 1P4JA 5T64A 2X1VA 2XHEA 2CV0A 3U61B 1KP3A 4LSGA 1ABEA 1KI6B 4TL9A 5DK4A 3L43A 4TM7A 4B6SA 2ONCA 5JU6A 5E9QA 2XWBF 1C2YA 3ILYA 3PXDA 4YT8A 2GTIA 4H2DA 2A67A 1C3OB 1YK0A 2R751 2VTKA 4QDKA 1RNLA 1M2JA 5THKA 3Q41A 1LPMA 1PHRA 3O38A 4P22A 5FIUA 3O03A 4MI3A 1MZVA 3KXKA 5EQFA 1JEDA 1Q20A 1FUKA 1Z0AA 2XUAA 1JHYA 1YDGA 3GFFA 4AG5A 3ZGVA 3K9FC 2FEWB 1YJQA 2Q3MA 4PYMA 3L1UA 4Z99A 1XCLA 4IQ8A 3BMNA 3FOWA 1VMDA 1ZZGA 2W11A 5F23A 2FZKA 3HGMA 4Y7CA 3DHVA 4IDNA 2CMKA 1PJ2A 2HV9A 3E2IA 2R6DA 4IV0A 5AXDA 1ACJA 3I09A 4G85A 4BEJA 4KXLA 4EPTA 2BFPA 1UF9A 5IVKA 2YV4A 3B6KA 1DAHA 1REQA 3I58A 1I2MA 3KR0A 3N9IA 4H3KB 2GLTA 5E4FA 3FKJA 3GA5A 1U7XA 2QE7D 4LDAA 1XLTC 1X87A 2NXEA 3B5EA 1DTSA 5ECGC 3W3AD 4IHQA 2PKEA 4WXRA 3LCCA 4GQAA 3M4JA 1XYVA 2XNKA 2SECE 1OKKA 2ZB8A 1KZ9A 1ATZA 4GYWA 1FFGA 4Q6BA 1WXIA 3D59A 4FT4A 1XALA 1ISIA 5CA1A 4P86A 1DIGA 2H29A 1ZUHA 1VLHA 1AE1A 2A5LA 4D9CA 3DOOA 5JJ5A 1XA3A 3TQFA 5I7AA 1LDNA 1YJAA 1AY0A 2IHVA 2XYGA 3DHNA 2FCRA 2VJLA 1WCIB 1IDN1 2JA1A 2QZJA 4N3CA 5IPFA 3HN6A 2VT7A 3ICWA 1VXRA 2B61A 3OCUA 4CDMA 3UV3A 4Z3DA 2ZIFA 2FOIA 2X3FA 5HSGA 1Z83A 4DJTA 5JAHA 4EJSC 1SKAA 5KOJB 1EAYA 2PXXA 2JLXA 5B5SA 1UBHS 2AYZA 4B3MB 1WNFA 1DMRA 2J7KA 2FMKA 4YRIA 1SA0A 5CDYA 4DNXA 2XLBA 2IXEA 4NRDA 5LQCA 4LVNA 1GM5A 1LTQA 1VJDA 1L1EA 3IE0A 2VAXA 3Q3GE 1IK4A 2WF6A 3HFSA 3CF6R 4RK4A 2BAGA 1LF5A 2WTBA 3PDUA 1N33B 2BDTA 1EJ0A 2G76A 3QU4A 4PGGA 5H80A 1QTRA 4XUEA 2O05A 1QH0A 1J8FA 3B12A 4FOSA 1QDEA 4YRPA 1YE3A 5KYGA 4KR6A 3WBFA 2W4MA 4NI5A 3UMSA 5FA8A 2E48A 5JMTA 2XB2A 4IHJA 2J08A 3SOPA 3TEFA 4FBGA 5JLJA 1PQWA 3EGEA 1RWXA 1LSSA 1ZP6A 2VXBA 3ICVA 3RNOA 4BVBA 3A8TA 3D5EA 2FWAA 5DYIA 2O8DB 3RRZA 2BW0A 1R6BX 5IFKA 3QVKA 3VOSA 3FOCA 2ZSBA 4G37A 4LHEA 3USZA 5BPFA 1NJ8A 3A04A 2YWRA 1BW9B 4UOZA 2V9PA 4OHPA 2P3QA 4BNYA 2CDBA 3K5PA 4W5WA 4CJXA 4NOJA 3E7DA 4HDMA 4DPKA 2X8AA 3VNSA 4B7UA 5CVEA 5CM2Z 5CYPA 1IJBA 1TFRA 3D1JA 3IH5A 4FFDA 8ABPA 4K1XA 5ULLA 1LQUA 1IZ8A 4IV5A 3RFTA 3RRYA 4WPGA 2AJ8A 3RK4A 5A06A 4UXJA 2IXFA 4FIZA 4L5JA 1XGKA 2AFHB 3C48A 4MAMA 3X0DA 4J9UE 5IEJA 3CSSA 4TKUA 3PFNA 2AX3A 1WSWA 1XEFA 3Q5DA 2IBMA 5ERGB 4ZVTA 3U60B 5DKFA 1VCMA 2ODAA 1JG6A 4FZVA 4XB1A 1OXUA 2X5NA 3E58A 1WP4A 1KC3A 4FI3C 5EMKA 5H81A 4G26A 3RJ9A 5K99A 2IYEA 4IDCA 3Q72A 4JLSA 4IY1A 7AT1A 4BFVA 1CJUC 2WTUA 2CYCA 4F2WA 4G07A 4PZZA 3TDKA 3U3ZA 3FPHA 3RSZA 2P2ZA 4EVSA 3OWXA 4WWHA 3OC6A 1FFSA 4DWOA 3BRWD 1MTOA 1PDOA 3WKEA 3WL8A 1XC7A 3IPXA 1H6DA 4RPHA 5AVUA 4CNQA 1H93A 3RC1A 1QE0A 1VE5A 2DGDA 2FTKE 2FPMA 5FQNA 4X8OA 2I9PA 3M6FA 3M6LA 1OU4A 3LQQA 4GW3A 3T3DA 1A0OA 2QENA 2C2ZA 2O2HA 4E4TA 4EG1A 1GUZA 3KB8A 5ICGA 13PKA 1ODLA 4Y9UA 4HDKA 1LB1B 2G82A 1GDDA 1YOVB 2XCLA 4UAVA 4NYMQ 4W63A 2VP6A 5JE8A 4AJ9A 3TG2A 2QN1A 1P2VA 1T15A 2G63A 2FA9A 4ARZB 1Z56C 4MLCA 1LLFA 3HJCA 3D7SA 4NONA 2NZJA 3ETNA 4DLNA 3VFDA 3AVQA 4AZWA 3B3AA 3T9AA 4LBZA 1S7CA 5EJGA 4PN7A 1ZVKA 2BKXA 1HL3A 1Z16A 4HQFA 3V8MA 3WC4A 3RRFA 3ZCSA 4DDMA 3OWOA 2BN4A 4EO9A 1JKFA 4YCSA 3S2IA 4Z4QA 4DS3A 3TMAA 3CZMA 1NI4A 3VOBA 1MJ5A 1SXQA 2GK4A 1FF9A 3MTGA 4NH4A 4WA7A 5TF4A 5KYWA 4O4HB 1Q16A 4JK3A 4JL8A 5E4TA 1IN1A 1ZM3A 2TS1A 3QMWA 4IO1A 5G53C 5EWJA 5E3HA 1U1EA 2BFAA 2CN1A 4ZQHA 4CVNA 3IPAA 2FUG6 1RD4A 1RJDA 2VF2A 2XTMA 1PVOA 4URUR 3DDSA 4PGAA 4EG5A 2PMCA 4RIIA 4YAIA 3T3PB 2XRZA 2GDJA 1GQYA 3MPUA 1G9XA 1NG9A 4FFNA 4BFWA 2BMJA 3L0PA 3L7NA 1SCKA 5FBVB 4CEHB 2IW3A 4OY3A 5ALIA 1LDMA 4IZ6A 2K7FA 1RRFA 4GUDA 2YR0A 2HKIA 3O9ZA 4N6OA 3HDHA 3KHKA 3N8IA 1GU1A 4NCAA 1M73E 1GAEO 1DFGA 5KTNA 3DAOA 3UYLA 4NCHA 3RO7A 2QD1A 1RBMA 2JHFA 1XZLA 2GEJA 1C9DB 2YCBA 4N01A 3OH8A 4YP7A 4E70A 3BJRA 3D8HA 1UPAA 4MPJA 3BGVA 3PHHA 2XT6A 3ZTTA 3ZU5A 4CKBB 4EFLA 4ZVMA 4V0RA 2V0GA 1PEAA 5BNIA 3FMGA 4J0HA 5AK3A 2UYCA 3THXA 2X8WA 1GRVA 1ZGJA 4RSMA 2VNHA 2J7PD 1V39A 2X9GA 5AJZA 2PUDA 1GR1A 5KYYA 3VKVA 4NX2A 5BSGA 1V4NA 1RMYA 1RR6A 4OIMA 3VKHA 2VUIB 4HY3A 2YMLA 2VJCA 1ZNWA 2Q1UA 3TW0A 4CKEB 1NQ5A 3DONA 1JLLB 1UPFA 2CYBA 4DNPA 5ALEA 3MBOA 3ACCA 4TKMA 2PL3A 4LWZA 4HYQA 4U3JB 3RS4A 7REQA 4ER5A 5KWIA 4MVJF 3K5IA 5DT2A 1CDOA 1DRUA 4B3GA 1NN1A 4JBXA 3T5GA 5DT9A 1UR5A 3D0QA 2FMXA 2IP1A 4L5IA 1MABB 2H85A 3NUGA 4JBWA 3EQ6A 3ANNA 3ORQA 1RI1A 5KVVA 1UC9A 5TJ9A 4LQLA 2GBLC 2WY2D 3UTCA 3HCCA 3ORHA 4B2IA 3AFGA 4FZ3A 3WIEA 3QWIA 1YRQA 4EKGA 2QLTA 4TYQA 1B1CA 4YS6A 1VJRA 2BFFB 3GPCA 3OA0A 5LVAA 4IFTA 4BNFA 2EX0A 3BB3A 1C8KA 2IEYA 1SB9A 1BXGA 3EE6A 3LVBA 2JJ8A 4UBOA 4JI5B 3SZMA 1ZK1A 4N9WA 1MRSA 1JXMA 2W6ID 5BNZA 1CR1A 4C01A 3NHYA 3W34A 1UZAA 1VPTA 2FWJA 4URVR 1S7GA 4BUZA 1QO0A 3OQIA 4Z5XA 4EJ0A 1UFQA 2D5CA 1FTSA 1XQ1A 5AXAA 4WASA 5K4AA 5AKZA 1P0PA 2F8MA 2Q4DA 3MLAA 1UMBA 2B7CA 4E5DA 4UM9D 1LK7A 3VUEA 3T0FA 1U4NA 2ROQA 4KV7A 2MR6A 4HTAA 3L6BA 4JJFA 2YFHA 5ESRA 1IOZA 1HQKA 2RDMA 1T36A 3STVA 3KUUA 2XCQA 4X8MA 2JGRA 4ZVNA 4GKVA 5IVHA 4ZU6X 4BQQA 1KRXA 1KK2A 3I6QA 3IMEA 3CLTD 5BSTA 3QNMA 5HFJA 4B75A 2G0TA 4QPDA 1SCDA 4X1KB 3I6MA 1BOOA 4ND4A 2WKSA 3DE0X 4AWBA 4QYIA 3L8ZA 2RIPA 2DETA 4D9KA 3V4PB 1NU8A 1F8YA 2FU5C 4MA4A 3VR6D 2R96A 1GQFA 2VNJA 4P0QB 2YQ4A 1NJ2A 4FE3A 4GWLA 4DSZA 1IN6A 4HCJA 3EPKA 4PQYA 1VL8A 4PPQA 5KHLB 3TXXA 4R41A 2KB0A 1FUUA 2ID7A 3ONEA 4A5OA 3OMXA 1ENOA 3ZVRA 3H4VA 2XF2A 3BHNA 1QDUA 2XVZA 5I6DA 3C8HA 3CO5A 3EIWA 4C4XA 4JJ6A 3LNCA 3C85A 3MCTA 1KS9A 3UWSA 4UCQA 3QRWA 5J23A 4HDRA 1M66A 1WVIA 2FY8A 2Q5QA 1R0XA 2IELA 3N07A 4I46A 3IPYA 1N2GA 3RAGA 1EWQA 1Q15A 4C0WA 1XP8A 3IOEA 4TMYA 3OZUA 4D4KA 3WB1A 3AI1A 2C03A 1V43A 2Y71A 3R4CA 4AF7A 5DLQC 3LHIA 2PFSA 2JAOA 1ADGA 1TLFA 2KE5A 3CRW1 4NAVA 4J0FA 4BMYA 4QLBA 2EW1A 3GT7A 1LPSA 4O2RA 3V7FA 5KNCD 2P9QA 2JGFA 4GICA 1A72A 1DDOA 1RWKA 2PYIA 1CJMA 2XJ9A 4KOAA 4LYGA 2HAEA 1VYTA 3NATA 1AK9A 1FDWA 2EHDA 3KETA 5AESA 3OD1A 2PCJA 1JQ5A 4Q93A 3JZDA 4FFRA 1P73A 1TL7C 4G1MB 3WLTA 4BLTA 5K8CA 4DV1B 1E0AA 1L7AA 2NV6A 1E6CA 1NLUA 3DF9A 5CBPA 1V7PC 1ZVVA 1FW8A 2I2XB 2E4YA 3A31A 2XADA 3G8BA 1C0IA 3K53A 2O0JA 3O82A 4IM7A 1Q7BA 4BO1A 1A7JA 5D2CA 3NMUF 3RSHA 3P27A 4ATNA 3H0EA 1E2LA 3E8XA 2VK4A 3LUBA 4BGUA 5LN1A 1XDDA 2R00A 4OI1A 5CG1A 1ZMBA 2IRWA 1A9YA 3GOHA 3JY6A 1TRHA 2W8BB 2YYSA 3JSAA 3OJLA 4UZFA 3K9QO 3LKZA 2P9GA 1CUJA 2X4GA 4XSGA 3KLMX 4N3BA 1YIOA 5FWYA 4RVGA 1W85B 4JYAB 1YS7A 2NQTA 1G7SA 3CZCA 5FFMA 3E18A 1KL7A 5DMHA 3FB1A 1VFPA 4I5GA 3CRQA 4RF3A 1EFCA 3VJLA 5KOJA 3USCS 4CUKA 1K3UB 2B8JA 2HMVA 1GAWA 3LY7A 2JHGA 3TSWA 4C0HA 4PLWA 1DT3A 3AY3A 3D64A 3TO5A 4QFDA 4V0ME 3GU3A 3I2YX 4NENB 4LJ7A 4EGAA 4Y2XA 3I52A 5B1SA 3LBIA 4JLDA 2E1PA 4MUEA 2DSNA 4YP6A 4EZIA 3TEMA 4L6CA 3LGAA 4N3AA 3RGGA 3UB2A 4MRMB 5JV5A 1H05A 1FXWA 1VSUA 4J6FA 1DZIA 4RY0A 2CHEA 1RKXA 1S89A 3NVDA 4UPVA 3ZY5A 3WLLA 3WRYC 4I8IA 2WQ6A 1IHUA 1PZGA 4IYRA 4DYVA 2NW6A 1Q11A 1JSLA 2PKYX 4EPVA 2GM4A 5BRAA 2ECFA 1OZHA 3DFFA 5MN5A 1EM8A 2KM1A 4LOKA 2PGXA 3HY3A 1YQDA 1W581 4LJ8A 3KAPA 2I62A 2JH3A 1ESCA 1EGHA 1SOMA 3E8MA 1PX2A 2PR7A 4I1IA 1JPUA 1Z4KA 2C99A 1YCFA 4KWEA 4JXKA 4B32A 5KYVA 3EGWA 5CJJA 4PSAA 4EEKA 1HT0A 2GZRA 2WTEA 5DXFA 3TTWA 1ICIA 4H7FA 4L2IB 1PFQA 2YJ3A 2YQ5A 2ZIUB 3GAAA 4HS9A 4WLUA 3S5JA 4P0PB 3IPLA 4DCTA 2O2DA 2IYQA 3NOXA 1PR4A 4LXUA 3SMQA 5B64A 3SIPA 2ZRKA 2GXUA 1DJNA 2X15A 5FB3A 3HCFA 2JCYA 2VJMA 2WIGA 2R86A 2QRZA 3HH8A 3KBBA 4Y0NA 4HFRA 1BXZA 1FU4A 3FWYA 3M3DA 3X43A 3C70A 3R44A 3LLCA 5J5CA 3ZDRA 3RAEC 1QYVA 1XPRA 3L8CA 4DBVO 5K3FB 2YXBA 1JXOA 3M4ZA 5C4MA 4IMRA 1GPKA 4PY2A 5P8WA 1RWOA 2J9RA 4MQMA 2W00A 1NI4B 4G4JA 4X1YA 1OREA 4QXRA 4I9NA 4DCCA 3EPLA 1SKMA 1B2LA 1P5FA 2GCNA 2V7TA 1KI6A 1VGRA 4KVFA 3RRJA 3MWKA 3UWMA 4O33A 3R7AA 5K7SA 1M83A 4IKOA 4JUCA 4TX1A 3RC3A 3BJEA 2YY5A 3LLUA 2IYVA 5BYAA 1Q0RA 2J9GA 1W0JA 4QQRA 1Z47A 4RL6A 1DC8A 1DIAA 2BKLA 3WV4A 3SSAA 4L0MA 1T6NA 1E92A 4JQZA 2HCRA 4HXGA 3KVOA 4X6XA 5JPIA 3ROKA 1O96B 1ZD9A 4K40A 5CEEA 3C8DA 3LJKA 1Y7IA 1SRQA 3VX4A 4DIMA 1NN5A 3OZVA 3UUFA 3PE4A 1PJLA 2DE0X 4GPAA 3HWSA 4CTNA 2WF8A 2WJGA 1EDBA 2WICA 4RX1A 5JS1A 3R9XA 3OZFA 2MT9A 2W2LD 1EBUA 1KDOA 1DV1A 5DBEX 4D57A 2OXIA 4HDSB 2DHEA 4AO6A 4FB4A 1SXPA 3I5MA 3DMDA 3HZZA 4V0LA 1Z8NA 2QPTA 6LDHA 1JG3A 1M7HA 2YMMA 4XR4A 2G09A 3RBZA 3UMMA 5AW6A 1OV6A 1QHNA 1ND6A 2ZSAA 2J3JA 3ANTA 2ZBVA 4QPZA 3F4KA 3OOJA 1Z6YA 4NQRA 2OGWA 4PRZA 1CV2A 1LRKA 5EJ2A 4Y2PA 4CM9A 4FWTA 2Q5FA 2PGOA 2HJGA 4LY0A 3QVMA 3QOYA 4DDKA 1AV7A 4EJFA 4XWKA 1EVZA 4AY2A 1CQIB 5E0KB 1TPZA 4P32A 4A2PA 2R6FA 4DJ5X 4C14A 4E30A 1E5LA 2I3ZA 3L8DA 3NDRA 4EPWA 3WA7A 1PWHA 1QIHA 4BECA 3G5AA 3ZV7A 1T1JA 1YASA 3FPEA 2HYDA 4HEJA 1W46A 4O08A 1BEEA 3A1TA 2YRFA 1Q7TA 2ZUDA 2CUZA 3LOQA 3PGKA 4B76A 4YIHA 5JJLA 1Z17A 2X3UA 3TSCA 1OYVA 2VHEA 4YQZA 1XRSB 1Z68A 2J5XA 4CIWA 1KEKA 3KK0A 2PUFA 3QA9A 2OHJA 3FE2A 3OPVA 3X2FA 1PS0A 5F64A 4ZA2A 2FPUA 3MLEA 5JISA 4P3OA 3QYAA 4XASA 3Q6IA 3QPUA 2QX8A 1PJCA 3JARB 3NQ41 5F12A 3DJFA 4M86A 4X1OA 5CDSA 1SKYE 2Z5VA 4TUYB 3C16C 4GX5A 2ORVA 2X5KO 2D2EA 4PINA 4QM6A 1MIOB 2AW5A 3AR6A 4OL0A 5LLDA 4ZOQI 2G07A 4PHFA 5BSVA 3CCFA 1ENZA 2GHIA 4LZAA 3R5SA 3KYBA 2YZMA 1HWYA 1KJIA 3S28A 3GA7A 1E1NA 5DSTA 4JC4A 2C31A 5BUCA 2ERXA 3L0IB 4KACA 2PA3A 4HEQA 3C97A 4HDNA 5HGXA 4RABA 1YBHA 3CPJB 3LTNC 3TSOA 3GJ4A 5E1OA 3HB7A 4BKOA 3TPCA 1C41A 4PSKA 5I9MA 4FHEA 4YRRA 1N6HA 2ZWMA 5IBRA 2VDKB 3F2VA 5BSMA 3ED5A 3BUSA 1HYEA 4D8WA 2B1GA 1ULZA 1A95A 4R2LA 4U5QA 4DVGA 5EZYB 3SKVA 1XMSA 1YR2A 4F91B 1P4AA 3M6IA 1SD2A 2VJPA 2O6HA 4JYBA 3QKRB 1Z36A 1XMJA 2A88A 5BWBA 2YY6A 3L07A 1QWSA 2F9LA 2VDPB 4YCJA 3VU8A 2ZIGA 2GH1A 4BX0A 1R37A 1SVLA 3W7BA 2AMFA 3RS8A 1QPZA 4X41A 2YFYA 4BRWA 5CD9A 1U63A 5CVVA 3CUYA 1A5SB 4XWYA 1LLDA 3MGCA 4PC7A 1SUIA 4H15A 1AUQA 3NTXA 2DBQA 2PKRA 3LFUA 2EFYA 1EP3B 3KEGA 3KZ1E 5B1HA 2OHIA 3A25A 3VU9A 1Z5ZA 1LX6A 4AKIA 1B8VA 1XKTA 8ATCA 2P40A 1ACLA 3P32A 1QRAA 4E3WA 2QL6A 2GA8A 3PWKA 3ETEA 3MGKA 4XD7D 5A0TA 4N5MA 5TE9A 1NLFA 1P60A 1SH7A 1WCWA 4PYQA 2AXPA 5ENZA 1XX6A 4BJ3A 4ZYVA 3H1FA 3QI7A 4LOAA 3GJRA 1AKTA 1GZSA 2CLMB 3TZHA 2P9TA 3TX2A 3GRZA 4A36A 4JB8A 2O2XA 4KQIA 3PTZA 3WL6A 3N39C 2C7QA 2FRXA 5AK6A 3SVLA 1W36D 4TRRA 2FW0A 2JFBA 3OEHD 1BVUA 3BK7A 3I1FA 4P83A 5K3SA 3MN1A 3QKSB 4KFTA 3J81k 1XQVA 1PEYA 4F5EA 1IOWA 1N9GA 2H6EA 4WBSA 3AEZA 3BPSA 2ZJBA 3P20A 4M4SA 4IX9A 4NE9A 3TSAA 5DHPA 5HKKD 1V9SA 3BERA 1LLCA 2YWGA 3BIXA 1GXSB 3UKDA 1RBZA 2KBFA 3NC4A 2F6RA 5TX7A 2CHGA 1R18A 2DQSA 4IH4A 3FUWA 4GRAA 5LDGA 4XVRA 1AURA 2G83A 3L41A 3OZRA 4D81A 6REQB 1FDSA 2P6PA 2GRJA 3OX1A 3B1KA 1K6MA 4IIJF 1SVWA 5B37A 4GFDA 4C78A 1YI8A 7ADHA 3AOEC 5F52A 3B6ZA 2RI1A 1DAFA 1PJZA 1VLVA 1BDBA 3FYTA 3H5WA 4F3CA 1N2IA 2TMYA 4CKCA 3A4MA 3CG4A 2YWDA 4UEOA 1NMQA 1B26A 5IF3A 2YN2A 3INYA 5CTAA 2ZRMA 2GZ3A 5I7EA 5JMWA 2GAAA 1FB5A 4FK8A 1IJEA 1X7XB 4YGYA 5K3AA 4Q9JA 1D2GA 1Z34A 3SBEA 4NXNB 1UOQA 3DXYA 2XGSA 3BZWA 3QENA 4AZVA 3I1YA 4MUJA 3IVGA 2HJRA 4YRAA 1KC1A 4ENUA 4A15A 4YYEA 4PO1A 1EIWA 1THTA 4AM8A 4KIUA 1U9JA 3NGXA 2WSYB 1JR3A 1N5RA 3HUUA 1Z29A 4C4AA 4TSKA 1X1AA 4G0VA 1R9NA 3C2QA 3JVDA 4DSNA 4K86A 1Q21A 3QPDA 2AF3C 3RT9A 1MB4A 2JHAA 4JEHA 4DTCA 2RD2A 2UUBB 1L7DA 4Q7MB 1EE9A 3KJIA 4QRDA 4WK6A 3MD0A 5LU8A 1OI2A 3KQTA 1JR3E 3FGNA 4I55A 3VDQA 2F1HA 3COJA 3NVKI 1PU2A 2A9PA 4NK5A 4F71A 1M1YE 3HWX1 5DIFA 5GONA 3WGKA 3KOXA 1N1DA 3DE2X 1WOMA 3PZBA 4ID3A 4BJ6A 3LLSA 2V4ZA 5K0FA 4BMCA 4FCWA 5IFLA 1Z45A 4BPRA 2N0SA 4YC7A 2ZPUA 1YSCA 3WGJA 3C7CB 2QW0X 4YIKA 2C2OA 1RMQA 3QFCA 2YWHA 1QOZA 2NSDA 2XAUA 4OMDA 4WBNF 2PZ8A 4HKTA 3HFRA 3CISA 2J9FA 4CIAA 2X9QA 4F60A 1HMPA 3MG9A 3FH0A 4E03A 3KQNA 5L3SB 3X1YA 1IBSA 2WW8A 1QFXA 1ODKA 3MCWA 1M9NA 4FSHA 2ZSJA 3UYKA 1T26A 2O2GA 5FWYB 5BOSA 1I24A 3DMHA 2O4UX 3FM9A 1QLHA 3D2LA 4A91A 1NUQA 1UOOA 2A0UA 4WKNA 1V9CA 3WLEA 3QBVA 3MTAA 1WZEA 7MHTA 4NYMR 1FX1A 1X7YA 1NM5C 1MAHA 1N6RA 4OI4A 3ILSA 1EX1A 3SNKA 3W6PA 4H7KA 3BXGA 1TJ3A 4X60A 3RNLA 3IXMA 2AEFA 1A4IA 4XQ0A 2GPNA 1PNRA 1FFEA 3KVRA 4S3MA 1KKUA 2D3TA 2I5PO 2HFKA 5EWLA 3U4DA 4C88A 1HG0A 1E4EB 3UJ8A 3D4OA 1IHPA 3DYVA 3OZCA 4IIDA 2FEAA 1IYZA 3BGWA 4MR9B 3U7EB 3AM3A 4KO1S 4O4IA 5JCJA 3LRTA 4D8YA 5CGZA 2B36A 3NNDA 4Y2RA 2FEPA 3ZNPA 4B85A 3TQOA 2YXPX 3BX1A 1G1AA 4B6GA 3KIPA 1NXQA 1OW3B 1RAIA 4N0DA 4R3WA 4WOKA 3HEBA 1TKCA 2GA9A 2JDID 2V03A 3KT8A 2FEKA 2ZCUA 2VAWA 1RWMA 5EFOA 3H17A 3ADPA 2GWRA 2P67A 1LKZA 1RPAA 4F3NA 3UCFA 1PFVA 2QUAA 5HF5A 3VKWA 1F6BA 1TF2A 4OSOA 4E1VA 4PSUA 3CW9A 3X2SA 1TIKA 3IAM1 3C1UA 1N6IA 3EFHA 2DMRA 5E6SA 4KOEC 1TTPB 1YZQA 2B2NA 5C5DA 1RXEA 3JXEA 4N5NA 3MCVA 3TXAA 1E6UA 5EXDA 3GCGA 2WR8A 3GZTB 1PEKE 4JOSA 4F4IA 1YCGA 3DMTA 4GE0A 2Q6OA 1DINA 5A3JA 4IFEA 1YQGA 5FWDA 4I9FA 2IPAB 1XQXA 5TGDA 3LQ4A 1A4UA 4TLEA 3ROMA 4EGSA 4HSGA 3HM2A 3BICA 1FP4B 4QBIA 5CIQA 5CPBA 4XIGS 3N3AC 2OB1A 4R01A 4EFDA 1YTUA 1CS0A 3QWFA 2WYOA 5M3BA 1XCPA 1ORRA 2F4NA 3MYYA 1QYDA 3C3CA 1GFIA 5ETJA 1RYHA 2FLVA 2J3MA 3ZNQA 5TNXA 4HUQA 4AXBA 3NXSA 4QJ5A 4QNRA 4MW7A 5HRAA 3TB6A 8AT1A 4NBTA 3WGGA 3C7KA 1BVRA 4BLPA 4IFBA 5LB2A 1F0PA 2YOGA 3DLBA 5AVYA 1U11A 3DEKA 1V26A 1QNLA 3JWHA 2VHWA 5EZYF 3VPXA 5F7OA 2O8FA 3A2LA 3WNQA 3HJBA 3IJRA 5KOYA 1H1TA 4PLCA 3L7BA 2OFWA 1LA2A 4NLLA 2ISSD 3VC1A 5FH9A 2VK2A 4JIGA 1K2VN 3L02A 3CN9A 3JRWA 1IH8A 2C5GA 4FYHA 3G0CA 3ND9A 2ACVA 2EF0A 4DCVA 1ZO8A 5A9SA 5CW2A 1VHWA 3LL7A 3GG9A 4ARUA 3F8SA 1SQGA 4UUPA 4WKBA 5KOHB 2H31A 3DBOB 3L6UA 1CRQA 3PT5A 4QOIA 3TKYA 4ETNA 2VJKA 5EJ6A 3NBYC 5E9JA 5ILGA 3ONWA 2QX4A 3ZY3A 4C03A 5G40A 1RZVA 3MOGA 1KBOA 3IVMA 2ZR9A 4GUAA 1K8RA 3KZVA 1QP7A 8OHMA 2QY9A 1OB5A 3GC6A 3KB6A 3ZLUA 1P33A 1HM5A 4FONA 3DV0A 1FZQA 1LPBB 5DF1A 2DBZA 4GPTA 2WMNB 3CPSA 1BVYF 1X9HA 4IUBS 1NBEA 5MDHA 1A7AA 1E0SA 4L28A 4HX5A 4K6GA 3QVOA 5FUYA 3ZQUA 1PYDA 3AJEA 5JNUA 3A3KA 2P2SA 1JG4A 1NVXQ 4FHGA 1M2OB 4CV1A 4DIOA 2CD9A 5IF9A 5FTLA 3KOZA 1GPH1 4XJXA 4KN5A 4UBKA 4XB6B 3QTTA 1L8LA 3HJRA 4GOOD 5U4XA 4FCTA 2WJHA 1Y8RB 3KTDA 3GT0A 3BD6A 1K4KA 2OA0A 5B58C 2XE8A 3VI3B 2Q29A 1BRTA 4G4SO 3VR3D 4DREA 3EXHA 5JS7A 1T2NA 5T4FA 3FFAA 3WVNA 5HJ7A 4MS3A 4HBZA 4HC4A 4Q9DA 5TQVA 2VDUE 1CUDA 1YI0A 2EGUA 1ZXBA 1VBNA 4FTWA 4RVSA 3F6BX 2EBWA 2PL1A 3OCVA 1M1YB 3CUWA 1KAEA 3X1MA 3FCCA 2NM0A 1FYWA 4HVTA 2AXQA 4HAIA 3QEAZ 1XCMA 3QPCA 2ZDHA 3HKDB 1KFEB 4D5GA 5CFPA 3DHEA 4TT3D 2NO0A 5ALQA 5GV7A 3D0KA 1XZPA 2IPLA 4IHJB 4XDYA 2WJYA 4NBSA 2WZBA 1UXIA 4R83A 2I78A 4DZRA 5IJ0A 3BIWA 1RWNA 4KTTE 3LO5A 1TF7A 2PVPA 1MP0A 3B1ZA 1JI3A 1U2PA 3IQZA 3PNLA 2RJ3A 3OY7A 4FYWA 5FEMA 2ZTMA 1R16A 3K0AB 2ZIEA 2QI9C 1KYYA 3NAZA 3PJDA 1FQJA 4IZHA 5DH9A 1Y5MA 5FI1B 3S1LA 2JL1A 4CCWA 2ATIA 4FHZA 4J0IA 4Q1FA 4EPRA 1NXWA 4E08A 3DM5A 1ZR2A 2PQ6A 1C9YA 3NEAA 1RI3A 4KW7A 3X44A 1R74A 3SZGA 4BO5A 2NSJA 4LHZA 5A3RA 1MKYA 2XZPA 2OESA 4HLUA 4F6RA 4G5HA 2AVNA 1V5GA 4PLTA 1L4BA 1K27A 3LKBA 4B48A 1JIXA 2APJA 2Q9UA 4W5HA 4UPEA 1OZGA 1CY4A 1KSJA 2PS9A 4C7OB 5CB4B 4FMCF 5AO9A 1NW4A 4Q16A 4N39A 1YO6A 3WV5A 1U5CA 2VUUA 3V3TA 2R25B 4QTYA 2D62A 2JI8A 3A1UA 1ODSA 4KXNA 3SYMA 2YJNA 1EEHA 5I4IA 1HT1E 4IFIA 3JYQA 5E2AA 4IF4A 3T54A 2ZSKA 3GLGE 3MWEB 3NIGB 2TECE 2ZRCA 1T2EA 4ZYZA 4RUKA 4AJIA 1W5AA 3EWSA 1NXVA 3QQ5A 4IKPA 4ISBA 1SBHA 4KE6A 2JGJA 1NVKA 3I92A 3V46A 2YVQA 1N36B 1TT5A 4CMIA 3RUEA 3Q5EA 1GZ6A 4YLEA 3MVEA 4MQLA 1JR3D 2CXHA 4DMUB 1TMGE 3KFLA 3UJ6A 1DAIA 3U4GA 2GBPA 1LV8A 2GK7A 4Y2JA 1T0BA 1SZJG 1T9GS 2GZ1A 4YP1A 1ULAA 5H1YA 2ZWAA 2A14A 4O6VA 5DV9A 4IIEA 1TYBE 3CNBA 5HBRA 1NQVA 2DFLA 3GEHA 4MWOA 3AK4A 5CT9A 4LF7B 3UH1A 1LNZA 4F4DA 4P7JA 2GJAA 1N1MA 3CMCO 3UOWA 1NPTO 5JAZA 3JVEA 3ZIDA 4URWR 5LA6A 5F51A 3EXAA 4MCIA 3PFHA 3OMLA 4DDWA 1YR6A 2XI4A 3UTDA 4BOYA 1JDVA 3BS4A 2JGKA 3HA7A 4BX2A 1APBA 3JWEA 1MD9A 3IHTA 3OPXA 2CFIA 2ZI6A 1J9EA 1NTRA 2X77A 3JQBC 3NBQA 3GEIA 1XZEA 1SU7A 3EMDA 1AXGA 4WTOA 3R9XB 3EZGA 3S68A 1NX6A 2AMVA 2W7TA 3I2KA 4UATA 2PMDA 3NAMA 4BGVA 3OKPA 5LDDC 1QGZA 2I55A 3G9UA 1E3DA 1HT2E 4BRSA 4BCDA 9ATCA 3N2GB 4ALMA 2PG3A 2H11A 4GS5A 1BGWA 2YFKA 1GZ5A 3VTAA 3DYBA 3NGMA 1G38A 1FQOA 3CZPA 4P6VF 4P82A 3RF7A 5F73A 2EP7A 4OBEA 1CB0A 3TZCA 1BC5A 3T5CA 4MCAA 3ZU3A 1OFTA 4F38A 3QVVA 1PNOA 3B20A 4PN3A 2BGGA 3FUUA 3IVCA 4ZMSA 1PNQA 2Y6UA 1EVQA 2RC6A 1Q1EA 1UJ6A 1YRLA 1Q44A 2CT8A 3JATB 1W34A 2YWXA 2QLBA 1OD6A 3GGJA 1EQAA 3OPMA 2KWIA 1U9IC 1IPFA 1WW2A 1NVVQ 3BXHA 3HXKA 3SC3A 3SR4A 1XTVA 3U4QA 1WU7A 3B9RA 5F7JA 4DB2A 4RQUA 1TNDA 3QOXA 4HDNB 3CCBA 2X6TA 3IRUA 5KX5F 2D4HA 3M9XA 4KO3S 4ZOAA 4DABA 3VO1A 3CKYA 1U3UA 4DLZA 3W7AA 4EGCB 4OI2A 5DIZA 3BXFA 3QXGA 5BNWA 2AIRA 2B3TA 2E89A 3WGTA 5BN3B 2LXNA 1ODIA 4UHDA 4RTJA 5B4UA 1C7ZA 2BKUA 3I73A 2OG2A 2EXXA 3VH3A 4RTQA 2DY0A 3AZQA 4QBFA 3HBMA 2WYUA 4ZT3A 1ZITA 4OIFA 3VZRA 1MU0A 4QD3A 1B0AA 3WJ1A 2QSYA 5LZ2A 3ME5A 4J4HA 2YWEA 1ETUA 2OBNA 2Q21A 3FBWA 1SHJA 5DLEA 4BNDB 1ZMXA 1O5OA 4P2GA 5DM1A 1M7GA 4WZBA 2PWZA 2GZMA 4JB3A 2NAFA 4OUDB 5DYGA 4RA9A 4KJZA 2E55A 1JDJA 3U3XA 1ZH0A 2V5VA 4GMXA 4JAVC 3WP1B 1Z7WA 1H2BA 1EFTA 4OM8A 1KI2A 4LC1A 4EY8A 2XMCA 3I04A 1NIJA 5IUNC 2V1XA 3EZ9A 2AD5A 3D5TA 5DBFA 3ERCA 1RQNA 4DCJA 4Q4CA 3M4YA 1DP4A 1ZSYA 2FEOA 3INNA 3O3CA 5CR9A 1O0CA 1TYEB 1P5ZB 4UASA 5JWOA 3QNUA 2B9VA 1IG3A 4U9HS 2OBLA 1L5LA 4GPD1 1IE3A 2XX3A 3STUA 1U7PA 4WLOA 1P44A 2BM9A 1R7RA 1Y5IA 1QWOA 3CX3A 4L73A 1DHTA 3DXXA 5CBPB 5HP4A 2G3YA 1E2DA 2C1ZA 4YQEA 3WQBA 3T3IA 3ZEIA 1KIAA 3HCWA 3MCAA 4EDFA 4S04A 4IDOA 3ZDXB 3N2NA 2VH1A 3KOOA 5U4QA 1CRLA 3H3FA 1RLUA 1XE3A 4GP6A 4AJHA 2J45A 4X7PA 4CMHA 2CXPA 4PCAA 1JWAB 2WWWA 4MVJP 2A0WA 5E9WA 2I3DA 2QX7A 2HUNA 4Y2YA 4B46A 2G1AA 1GPLA 3ON5A 2JAXA 3H2JA 4MWCA 4D3YA 3AM5A 4BGIA 1J0AA 1RQ2A 3WTCA 2GN4A 4GNRA 1Y6QA 2ZFUA 1G66A 1AUVA 1ZOSA 4IIBA 1Y4AE 3IVXA 2W2LA 4H35A 3S81A 4MI1A 3G2PA 1UPBA 3O26A 2DUJA 1GFZA 3TM4A 3RAPR 2ZS8A 2CUKA 4RL4A 4KR2A 4X5OA 1J0EA 1NFRA 1VL5A 1CUAA 2GESA 2H07A 2XUOA 1CR4A 1JUDA 1K8ZB 1RXIA 3BXPA 3GFSA 1MAUA 3NETA 3PBKA 2Q5CA 4PQGA 3I0NA 5E4JA 3SEAA 5DRYA 4ACBA 4B47A 1XRQA 3ZYCA 3KD3A 3ND8A 4YMGA 3RBVA 2K2WA 3HXMA 1Q5PA 1U1DA 3PD1A 3UK6A 3HN7A 3ZWBA 4X92A 5KVQA 3DFIA 4PR3A 2UYYA 4XFKA 2E7ZA 2H9YA 3K0AA 4U2BA 3NZEA 4JB2A 3RTBA 4ENPA 4L7VA 2Z2JA 3TW8A 4RYDA 4Q1BA 1F9AA 3QWHA 5F2OA 4D0LB 4KV9A 1FDVA 3LCVB 4HMQA 4WLVA 3THXB 1JMYA 1ZCZA 4B7AA 1BCSB 2PZEA 1VKOA 2ZJFA 2W9XA 5GJBA 4IXWA 3E3MA 1FYFA 3FPGA 4UU7A 3HHPA 1NLMA 3EASA 5EP1A 2EBUA 4CLOA 1XR3A 3P0EA 3LPCA 3MGBA 3QWAA 4GGPA 1NN0A 1OI4A 3P45A 4CM5A 3TDMA 2FPRA 3LQ1A 1P7VA 2PLFA 5E0OA 4IVRA 4LV8B 2UXDB 4X9XA 4MR7B 3V9AA 3KWFA 1XTKA 3EFOA 4M9ZA 4J29A 1GFWA 1QQTA 3DBRA 2YWJA 4MQFB 4G0XA 3GEBA 4DPLA 1EJ6A 3OD5A 2B2CA 2Q41A 4LGMA 1MC5A 5JQGA 4B8WA 3OSZA 2HNAA 2IW1A 5KNDH 2HK9A 5KU1A 3FVVA 4MULA 5HF8A 4QLAA 2UYHA 4Q03A 2NPIA 4ZGGA 2F00A 3AESA 3ETHA 1RFLA 2YS6A 3EOAI 3M6XA 1R6UA 1R5NA 4HTFB 4R2KA 4UVHA 3HUTA 4WCFB 1X1CA 2F90A 2IDKA 3OQVA 1E89A 3S4YA 1L5VA 2IV7A 2DEUA 3A9TA 4H9GA 1PL8A 1HDZA 1R0KA 5IJXA 3WRXA 1YT5A 2NZ2A 2DZDA 3GT3A 3MWJA 1VJ1A 4H6WA 4KL8S 5JSFA 2XE7A 4YY3B 3A3YA 3RCBA 3VA7A 4FZ5A 1CZUA 2OZKA 3MAJA 1EFVB 3ZX4A 1KYIA 2C2HA 1E3JA 3NTLA 4B4WA 2FSVA 3ZDCA 3T15A 2UXCB 1QAOA 3PD0A 4FYYA 5TPWB 2D0IA 3LECA 1XNJA 5ADUS 4RIEA 3KFVA 4G97A 4U3JA 3ZS9A 3E9NA 4DDHA 2GBFA 3DD5A 1F38A 1P6QA 2BEWA 3ULKA 4BE7B 4Q00A 4F4JA 4DIBA 2AN9A 4WZZA 3CZ9A 1H2EA 1NVGA 2Y66A 1MXHA 3IELA 4BDTA 3G59A 3SVZA 3UHOA 1EGMB 1YR9A