4OA5A

X-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah solved by iodide sad phasing
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
SKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase family protein
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
source organism Anaplasma phagocytophilum
molecule tags Transferase
total genus 76
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.-:
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4oa5A00
2OB2A 3UWPA 2AOVA 3C6KA 3GRZA 2PWPA 2CMGA 2IBSA 4F84A 4FR0A 1HMYA 2AOTA 4QDKA 1RI1A 5DSTA 5DM0A 4CTJA 4HGZA 4GOLD 2JHAA 4DMGA 5LR6A 1P1CA 1WS6A 2GB4A 4UOEA 1OR8A 2FRXA 5DXAA 1R6AA 1VBFA 4PYOA 1L1EA 3SSMA 3OZRA 3HP7A 2AN4A 4R8SA 3NJRA 4C06A 3CJQA 4E2XA 1JG3A 2AVDA 3LX6A 4CXMA 4E70A 3THSA 4PWYA 3PX3A 4IV0A 4R8RA 5EMLA 1X1AA 4YMHA 3FUXA 3MTEA 2QY6A 4X63A 5E1DA 3SGLA 3FUUA 2P35A 2PLWA 5GM1A 1QAMA 3CVOA 5BP7A 4PYIA 2FHPA 3A7DA 3HVJA 3LBYA 1X1DA 1JQEA 2BR5A 2OB1A 1YB2A 2E5WA 3UFBA 1KR5A 2JHPA 3DLCA 3OU7A 3FUVA 3OU2A 4HH4A 4PYNA 5K01A 2GH1A 3HCAA 3DLIA 5F2NA 4POOA 4PYKA 4GF5A 3OFKA 3HCEA 4CTKA 3Q7EA 1YF3A 3EGIA 1N7IA 1O9GA 4V0RA 1R8XA 5DTMA 3EVZA 1YZHA 3DUWA 3FZGA 3MAGA 4HGYA 1G55A 2DPMA 2NXJA 2AN3A 3GCZA 4QPPA 5EMMA 5CVJA 5FCDA 3TRKA 3TLJA 2BM8A 3A7EA 5GOZA 2ZZNA 1NE2A 1ZHFA 3P9KA 4FSXA 3T0IA 5CVEA 1VQ1A 3P2EA 2PKWA 3M6WA 4XCXA 3CBGA 2PBFA 4LG1A 4PIPA 1M0EA 3I64A 2OKCA 1FBNA 3GIWA 1RJFA 3SSNA 4PYLA 2EG5A 3LCUA 4YUZA 1DL5A 2ZULA 3M4XA 4FSDA 4RVHA 3C0KA 3C3YA 3UJCA 5K0FA 5HOQA 2ZZKA 2NP7A 2C7OA 3FUTA 5LQRA 4QPNA 3JWJA 4PGGA 3KPJA 5KQSA 4RTNA 3KPYA 1VP3A 4CKCA 1M6YA 5F2KA 3UJBA 2O05A 1Q0TA 1EG2A 2ZWVA 5DRTA 3KR2A 2AN5A 3LPMA 1O9HA 1JG1A 1UIRA 3G5LA 8MHTA 2PT6A 4OBWA 3K6RA 4ER7A 1JG2A 3R6TA 2WK1A 4KIFA 3UJ7A 4CWAA 5ICEA 3IHTA 1WXXA 2YR0A 2NYUA 2FK7A 5IH3A 5DSXA 3UZUA 4LWOA 4QTTB 2GAFA 4XUDA 1XCLA 3HA5A 4KVZA 2IH2A 3FTFA 3NVKI 2V74B 3ELYA 3KKZA 3HEMA 5JUWA 1SQGA 1JQ3A 3EMDA 2YXDA 2P3LA 3R24A 2ZZMA 4R05A 5K09A 1XDSA 1MJFA 1SG9A 2OBFA 2O06A 3M6XA 2VS1A 3UBTA 3KPUA 3PX2A 5ICGA 3PTAA 3RODA 4E30A 4DKJA 1IXKA 1P91A 2BR3A 3FPHA 2B3TA 4EMSA 2AOUA 3I5UA 3REOA 3CJTA 4ER3A 1G38A 3SXJA 1QAOA 4IKPA 3A4TA 1R8YA 1F3LA 1F38A 1ZGAA 2PGXA 1QYRA 2YX1A 3X0DA 5EZSA 3G89A 5LQKA 2P40A 4NECA 2IH5A 5T6BA 3G2MA 1EJ6A 3B3FA 5C1IA 5FWDA 4YUWA 4RTMA 5EVJA 2G71A 3CGGA 2ORED 3E05A 4X60A 1UWVA 1QZZA 4YV0A 5KS2A 2ONZA 4C03A 4RTKA 5EEGA 1RJEA 1WZNA 4QVKA 4JXJA 4X61A 2YUIA 5EMKA 4AUKA 5E9WA 2YTZA 4F85A 3SM3A 4RTRA 4QDJA 3FYCA 3OE4A 5EZQA 1VPTA 5BW5A 3BKWA 1WXWA 3FYDA 1KP9A 3UJDA 1KIAA 1XDZA 2YXLA 4LWPA 5E1BA 2GLUA 2I7CA 5E1MA 4DCGA 1AV6A 9MHTA 4BLVA 5E8JA 5CCBA 2UYCA 3CKKA 3I53A 3KR1A 4B17A 5LQUA 4RTJA 2IIPA 3CC8A 4HTFB 2OZVA 2PSSA 4MQ4A 3UA4A 1SVUA 1V39A 3KQTA 1RI3A 1L3BA 2FK8A 3G8BA 4RVDA 3GRVA 2VDWA 4RTLA 5K03A 2PVCA 3AXTA 2VZ9A 1XDUA 1NW6A 3E8SA 3HCBA 3THRA 1MHTA 1UFKA 3PFHA 4C05A 1JTEA 3VYWA 3IV6A 4KDCA 3LSTA 1KPHA 5HILA 4AZVA 4CKBA 3EEOA 3DTNA 3FRIA 5ICFA 4ER6A 2YXEA 4M36A 4YUXA 5DM4A 2ZCJA 1KYWA 1XXLA 4QQNA 4OQDA 2ZTHA 1P39A 3P2KA 2HNKA 3GRYA 2R3SA 4FGZA 4RX1A 1ZGJA 3GRRA 1H1DA 1SUIA 3P9CA 3PT9A 2ZBRA 5CVDA 5EKXA 1KPGA 4CKEA 5IKMA 4GC5A 2JH9A 1VE3A 1KPIA 4A6DA 4AZWA 2C7PA 5EHGA 3RW9A 5FULA 4Y2HA 2I6GA 3EVAA 5EG5A 1FP2A 1L9KA 3NVMB 3ELDA 3AY0A 2PXCA 2UYQA 3BWBA 3GU3A 3HCCA 3OPNA 3K0BA 2XYVA 3WSTA 3M6VA 2P41A 5T67A 1ORHA 3ANXA 3PS9A 5EC8A 4GBED 4EKIA 1D2CA 5K0EA 2Y1WA 2C7RA 3TM4A 5DPMA 5FADA 1RI2A 2GA9A 2FYTA 1M6EX 4DQ0A 4EK9A 2CKDA 4AX8A 3G2QA 4FT2A 5DX0A 1G6Q1 3EEYA 1R74A 2HTEA 3B7PA 4PYMA 4V0QA 4F86A 4Y30A 1SKMA 2NP6A 3G5TA 5FWAA 5EIFA 1BKYA 3LKDA 2R6ZA 3GWZA 2XBMA 4PYJA 4MIKA 1QANA 3M6UA 3S68A 2HR1A 5DTQA 5DWQA 1FPQA 1X1CA 2B2CA 3NWEA 3ELUA 4Z2YA 5LQNA 2O07A 3HVIA 4E2ZA 1NW7A 3MCZA 2P7HA 2XYRA 2UYHA 1NT2A 5M5BA 3O31A 4GOMD 3IEIA 5E9JA 4E32A 3UJ8A 1RJGA 3I58A 2CMHA 3EGEA 1RI4A 2KW5A 5LQAA 3LGAA 2EJTA 1BHJA 4HC4A 4QQKA 5EGSA 3UA3A 2NNWB 2JH8A 7MHTA 4GOND 5C9ZA 5HIKA 3BZBA 4DA4A 4H0NA 3GNLA 3NTVA 2WA2A 1JSZA 4RTOA 2QRVA 3SSOA 3H2BA 3EVFA 3G7UA 4O29A 3KQQA 4U7TB 5GM2A 1L3IA 5K0JA 2VDUE 3FRHA 2H1RA 3DXXA 3I9FA 4KWCA 3LECA 5U4XA 2Z6UA 3F4KA 3ERCA 3QOXA 4EKGA 2XVMA 4RSRA 3OCJA 1XJ5A 2O0LA 3MERA 1PRYA 5EOVA 4E33A 3KQYA 1AQJA 3A25A 4P7KA 2PXAA 1WY7A 3PFGA 3FTCA 3NW9A 3NWBA 4OQEA 5ICCA 1XVAA 3BKXA 4KIGA 4C04A 1X19A 5FUBA 5ERGB 3UJ6A 5MHTA 3P9IA 3B5IA 2YQZA 5CUQA 3HA3A 5HIIA 3HVKA 1KYZA 1X1BA 3P8ZA 2UZ4A 5BXYA 3G2OA 5FQNA 3BUSA 2AR0A 2BR4A 3HCFA 4RV9A 5CM2Z 3L8DA 5C0OE 2PXXA 3OZSA 4FT4A 5H02A 1YFJA 1G8AA 4M38A 5FHQA 5F2OA 2I9KA 4G56A 5HIMA 1SQFA 1G8SA 4RYLA 4HRAA 1RJDA 2PX4A 3FTDA 2JHCA 3EVGA 1HNNA 4GC9A 4K6MA 3MB5A 3E7PA 1NW8A 5EKUA 3TKAA 2FCAA 2P3QA 3EMBA 3JWHA 2NXEA 5DRYA 1DUSA 3GJYA 1ZQ9A 3R3HA 4L7VA 2P3OA 3OU6A 4IV8A 5T64A 4C07A 4OX9Y 5HFJA 3KQVA 2CL5A 2AZTA 2NXNA 5P8WA 4IWNA 1N2XA 3TKYA 2G72A 1BOOA 5FQOA 2ADMA 2XYQA 1JQDA 3G2PA 3GGDA 1RI5A 3P2IA 4PINA 2DULA 3EPPA 2BM9A 1AQIA 2AS0A 2WA1A 4OA8A 4X41A 1QAQA 3LKZA 4LECA 3UJ9A 3ID6C 2H11A 2VP3A 3LDGA 4GEKA 5FTWA 2VDVE 3UJAA 5FA5A 1PJZA 4HSGA 3HM2A 2QM3A 5DTRA 1Q0SA 3BWYA 3BXOA 3LL7A 1U2ZA 3O4FA 4YUVA 4RVFA 4KW7A 2PT9A 1L3CA 4GUAA 2BZGA 2OPBA 3KQWA 5FA8A 4E31A 3HCDA 4HTFA 2IDKA 3SVZA 2PX5A 5HEKA 4A6EA 4BP3A 5K8VA 3EVCA 1P1BA 1D2GA 2EJUA 5G02A 4RVGA 4YV1A 10MHA 4ER5A 1VLMA 1NW5A 3FPEA 3BWCA 2H00A 3NDJA 1INLA 1TW3A 3ORHA 4FP9A 2ERCA 2Z6AA 2IFTA 5GIPE 3PLAE 5E2BA 1EQAA 5BW4A 2AOTB 4FZVA 3NMUF 4AZTA 3B3GA 4DF3A 3BGVA 3T7RA 3PB3A 2XVAA 5CVVA 5DXJA 2FPOA 5K05A 2IH4A 3GDHA 4FS8A 3ER9A 4BY9E 3AXSA 3KPWA 1R18A 1D2HA 4R6XA 3MHTA 3KQSA 2ZSUA 3EVEA 3FPGA 5HZMA 4DM3A 1VL5A 3LBFA 2G70A 3OE5A 5GINE 4OA5A 3PVCA 2ONYA 4U7PB 3HNRA 4P7FA 2HWKA 3BGDA 2C7QA 3KU1A 2IBTA 3MCTA 5CVUA 2ZIFA 2O57A 1YFLA 1NBIA 5DX8A 4RTSA 5K0LA 4PGHA 2OO3A 3MTIA 3SR4A 1I9GA 3SMQA 3P71T 1XTPA 1EIZA 3T7SA 3V97A 4AZSA 3FUWA 2P1DA 4E2YA 3ELWA 4MTLA 5CIYA 2PY6A 4RWZA 4BLWA 2QE6A 1JG4A 1Z3CA 1YUBA 1FJXA 3SX0A 4C08A 5K0GA 1TW2A 1SUSA 2GS9A 3OZTA 4EVIA 2V7EA 4C4AA 3G88A 2OYRA 3DULA 5DM1A 1Y8CA 3CJRA 3TQSA 4PONA 1VP9A 3O7WA 3AWIA 3RIEA 2EX4A 5HIJA 4KRGA 2QYOA 4BLUA 2F8LA 4YUYA 1TPYA 1I1NA 3TFWA 5EMJA 4QVGA 3KPVA 3LCCA 3DMGA 2G1PA 5JR3A 2ZW9A 3DH0A 2BH2A 1YZ3A 2ZIEA 4R6WA 3KR0A 3CCFA 2AVNA 2B25A 3NDIA 4KDRA 4GOOD 5E8RA 3P9NA 5GWXA 3TPZA 5LQJA 5LQCA 5K0NA 3QV2A 2PV0A 3BT7A 5EIWA 3KQMA 5DT2A 1JSXA 3V8VA 2ZIGA 4E2WA 3MGGA 2P7IA 4XUEA 4P58A 4WVLA 2QRVB 3C6MA 1WG8A 1ZKDA 1IY9A 1ZG3A 2OY0A 1AF7A 5EEHA 5DM2A 5KYGA 2PX2A 4EQZA 1NV9A 2K4MA 4M7RA 2HV9A 1XCJA 3M33A 2ZBPA 3EGVA 5B1SA 2PWYA 3DXZA 3E23A 5CCXA 2ZBQA 2IDJA 3FPFA 4M37A 4ER0A 1VIDA 2OXTA 2IP2A 3KHKA 3LDFA 3HTXA 3VSEA 3EVBA 3T7TA 1KHHA 3ME5A 4PNEA 3FPJA 3G8AA 2ZFUA 3OFJA 3AJDA 2Z6QA 5E9QA 3TM5A 3A27A 4RTQA 4GQBA 5EQJB 2CWWA 5KQRA 2Y1XA 4DCMA 2ESRA 3KQPA 2N47A 4XUCA 4PIMA 1O54A 3KR9A 3GRUA 1ORIA 2AOUB 1BC5A 1T43A 3DOUA 3KQOA 4ISCA 4ATNA 2ZVJA 3GO4A 4YMGA 1DCTA 3DXYA 3BGIA 1IM8A 3TMAA 2B78A 5GIOE 3U81A 3M70A 2UYOA 3EVDA 3GXOA 5K0BA 5KVAA 3LDUA 2PJDA 2AOXA 5E1OA 3R9XB 3DMHA 5EHIA 4PCAA 5LSAA 2JJQA 4RTPA 2NXCA 1G60A 3FTEA 1I4WA 1JTFA 2EFJA 2GPYA 3Q87B 2AOWA 3JWIA 3A26A 1NKVA 1EJ0A 2HMYB 3HA7A 3DMFA 4MHTA 2I62A 4OBXA 2P8JA 3B89A 1EAMA 3R0QA 2ZLBA 3DR5A 3LCVB 5K0CA 4YV2A 2Q41A 3IYLW 1N7JA 5E2AA 5D1NA 5EPEA 4DZRA 3D2LA 1KXZA 4HG2A 5D1HA 4P7GA 4QTUB 2ZWAA 2PX8A 2IGTA 3LHDA 3VC2A 5CD1A 2LD4A 2YVLA 1B42A 1NBHA 4MWZA 1JR4A 5FHRA 5GP1A 3QOWA 4P7JA 4ZTBA 1NV8A 2IPXA 4WXHA 3TR6A 2JG3A 3JWGA 4X1OA 2B9EA 3BWMA 4PYQA 3VC1A 3C3PA 2A14A 3TOSA 2G8NA 3ER8A 3P97A 5DLYA 3B3JA 3HVHA 4BP1A 1NW3A 3MQ2A 1FP1D 4PCLA 5DX1A 3DP7A 1R00A
chains in the Genus database with same CATH superfamily
1FFXA 1U6IA 3EUWA 1M7BA 3C6KA 3EF0A 3ZWOA 4Q3LA 1U3CA 2B1IA 3B1XA 3S4YA 4GOLD 8OHMA 2CFCA 4H7DA 1GPBA 1OR8A 2EKQA 5I4KA 3LQKA 3PC6A 3A32A 3LXXA 1I2ZA 1XZEA 3PQ6A 1RLMA 5HK8A 1E8NA 1FU4A 3I2GA 2C61A 5JYCA 3D7MA 3L49A 3S7TA 1XCPA 2C8KA 1QHXA 3MTEA 1FQOA 2QY6A 3DM9B 4LS3A 4UM5A 3ZY5A 1FK8A 4D9CA 3DLTA 2HT6A 3JALA 1FEZA 1HGXA 2PHZA 4CQLB 4DUZB 4HQOA 3FOCA 1EG7A 1T8WA 2GN8A 1P61B 1KEKA 4F4HA 3DLCA 3W06A 4M98A 5CGQB 1OLSB 1EFVA 4LYJA 4MCIA 1SUPA 1O57A 4QL3A 2ZEJA 3K6SB 4RJLA 1ZLYA 4ZALA 3EVZA 4JUAA 4OQXA 1TC1A 3M4YA 5FXMA 3OCCA 4HXEB 4ACBA 1CUCA 1WULS 3MWDA 2BKUA 1LDMA 1C7EA 2WJWA 1OH7A 2QL7A 4D9HA 3WDSA 4NEGA 4O1IA 3B52X 2F8SA 1IIRA 1RXSA 1HK7A 1MNQA 2Z5VA 4QLOA 4INZA 2BGRA 2RDMA 1V7QA 1M0EA 1JR3E 3ZDFA 1E5DA 1SJ9A 3LUKA 1AU9A 4KQKA 3SSNA 3TJMA 4DMHA 1NWHA 1YA6A 1A04A 3LX4A 3IAM6 3OLWA 4Q66C 4G8DA 4M87A 5E0OA 3II6X 1YIAA 1CEEA 4D97A 2NTVA 4L85A 4ZC1A 3K0FB 1Q1ZA 2A0FA 3CSUA 4NZYA 3HWRA 1QP7A 1XRSB 2PUDA 3JRWA 2XKBA 3CR8A 4EJSB 4C1BA 1QK3A 1C7RA 2DKOA 1UMDB 3D5TA 1W47A 2QV0A 4OBWA 1IUPA 3N9IA 4WESB 1NXSA 1KSHA 4F1JA 1VMIA 2ZIZA 3TQHA 4G1VA 3TOXA 1IEWA 4I4NA 4ZOLA 3IHTA 1H8EA 4IDGA 4WOPA 4B7UA 5EMNA 3B78A 1JHOA 4QHTA 1TVKA 1R0CA 2CNNA 1XVLA 1E1CB 4NU6A 3WLAA 2PBRA 4H4EA 4ETMA 3B85A 3BD6A 3QX8A 1UDRA 2AUNA 4R3WA 2P3LA 3R24A 5IZCC 5JNLA 4UOQA 1FTYA 2GX6A 5JEDA 2FN4A 3GPBA 4BNUA 1V1MA 2Y27A 1GAEO 4OXYA 1VLQA 1W9MA 2FSVC 2H65A 5EWLA 2GTIA 1IHYA 1QB7A 4GMDA 2Z2YA 3TAHA 3VTKA 1VJRA 1W4ZA 4CG1A 1BXKA 3I5UA 1P4HA 1SCAA 1JQKA 5CLQA 2CNKA 3CPJB 3G9ZA 3GUHA 2YS7A 4HAOA 4J0CA 4RK1A 3E8XA 3ELBA 5KX5A 2O2GA 1Z0JA 1OFUX 2OG2A 4CCSA 3VOSA 4LOLA 4GI7A 1V8OA 2GJKA 3D43A 3ZLBA 2YY7A 3WL8A 4OSEA 1EJ6A 2VTVA 2XW6A 3AY7A 3UAGA 3FCUB 5I9SA 2H5JA 3LQYA 1UWVA 1QZZA 1RQ2A 1Z0SA 1JILA 2W0MA 1XU7A 4H17A 1NMEA 1T0PA 4RAOA 5KS2A 1GV0A 4GKJB 3VVLA 5BUSA 3DR3A 2W2TA 3KCNA 1XAGA 5EMKA 4NBWA 1YNOA 2RGNC 4IDPA 1W34A 5ITVA 5LYJF 4ZDJA 1ZSNA 3PGXA 4RFSA 5DHUA 4EATA 1M2OB 3BKWA 3KZVA 2OXEA 3PRJA 2YJNA 3H4VA 1RLOA 3UJDA 1KIAA 5CEJA 2GZ3A 4QNRA 3DOIA 2IITA 2XOEA 1TJYA 4G2NA 2GBLC 2WF5A 2PZLA 1CR6A 3SM9A 2I2FA 4CU5A 1A9OA 3I53A 3R3JA 1ADCA 4Z4HA 2Q2OA 1KMCA 4TL7A 5A9TA 1LQUA 1Q0LA 3HK2A 1MW8X 4B0OA 1I80A 2W7TA 1JWAB 3KEOA 1XNQB 3GYGA 4DGQA 1DC3A 3ADPA 5C46F 3I4LA 821PA 2L0XA 3Q8XB 4OJTA 3M1AA 1HDIA 2FK8A 4M6WA 2ZB8A 1E9DA 3EH1A 2WUEA 4E08A 4IZIA 2G28A 1TQ4A 4GI3A 2RHRA 1PWYE 2KHZA 1K6IA 5FX2A 5JU6A 1RM0A 2A78A 1TJPB 4EA8A 4FWBA 4UM9B 1MH9A 1J90A 4HNUA 4NC9A 1G5RA 2XCOA 4MKGA 1FDOA 4HAUA 3TIIA 4A0RA 4BNZA 4UKDA 4ZARA 5ICFA 2PNJA 1MO4A 1W0KD 3UEOA 4XYLA 2GYUA 2H4YA 1Q83A 5ADHA 1XXLA 2ZTHA 1NVKA 1C1HA 1HZZC 2B5WA 5GZ1A 2Y2VA 4Z8YA 4FGZA 3KJFA 3GRAA 1A77A 2IEZA 3LPNA 3HL4A 3CXRA 4YAFA 2JD0A 5HMLA 4EBFA 3DZBA 4DA7A 2G04A 5CLFA 1GGFA 5DO9A 3RW9A 1ORRA 1Z9BA 2AA3A 1H8HA 1P0IA 3MRTA 4H7IA 4QBGB 3WGKA 1ZAYA 1BVYF 4FNAA 1IN1A 2IXTA 1WQ1R 1WOYA 3OZ7A 2OCDA 3MQ4A 4OSOA 4RELA 2IYUA 5EC8A 3U7RA 3NOXA 3PFWO 4JJIA 4AZ0A 2DPYA 4QYWA 1ONBA 4P4TA 5LD2C 2YKGA 2DECA 1GUBA 2CKDA 4MKIA 1IQ0A 4NYIQ 3E58A 4YJ3B 4CTNA 3ABRB 1G6Q1 1UP4A 4GVLA 5CH8A 2XHEA 5KHAA 1U0SY 4M76B 4D82A 1QANA 1QTNA 1ZNWA 2MMCA 4PPGA 5AM0A 4ZJPA 1FP4A 3LQ4A 4IXWA 2ZS7A 1ICEA 4GDMA 4X5OA 1VRWA 2VJLA 1WHSB 4D4LA 1HE8B 1UDXA 2XF8A 4IHJB 4QGHA 3UG7A 1OWOA 1T8UA 4GP9A 3PC4A 1DC5A 1ULUA 5IKOA 5M5BA 5H3CA 3EOAI 2V3VA 3M3PA 4E21A 1S1CA 3T3DA 2FWRA 4DCTA 4XX1A 4IKEA 5LQAA 4YJGA 5G0UA 2BUAA 5EGSA 5TPWB 2HPAA 5BN1A 5AKYA 4N1AA 3CM0A 4ZHQB 1ULTA 3IHLA 5KVCA 2B99A 4O1HA 3S81A 3AR7A 2B2NA 1UMCB 2I8AA 1JG7A 2LUOA 1HYEA 2OLEA 3H2BA 1BKSB 4ZD6A 5IAEA 2Y05A 3T3MB 1FJHA 4DCVA 3MINB 5BSVA 4PLGA 4UUQA 5CB6A 1VGQA 1ZBDA 4IH9A 4B76A 1OI4A 2B8EA 1NQUA 3K8QA 4BUJA 4OB7A 4XPIA 1GU0A 2OAEA 4UAVA 3WKDA 5ARDA 5JYEA 5JJIA 1S2GA 3GLHB 1A71A 1KU0A 3F5FA 3H2ZA 3B48A 3N7TA 1CEQA 4CMIB 4UU7A 3HKBB 3NHPA 4A0QA 4OGLA 3TW6A 2ID8A 4UFPA 1XL0A 5HUJA 5JJ5A 3CUUA 1A5TA 5ECYA 3A2KA 2FSIA 2PMDA 1ONOA 3C3MA 4PRLA 3EZLA 2LW7A 3V4FA 1UJ2A 2CLOB 2QVZX 3L4KA 3WJ2A 4HDQB 1REQB 1ZFNA 2C2XA 2WHRA 1T4MA 2VUIB 4PSAA 3RVDA 4ZDWA 1Q84A 4KK3A 1TU4A 1TCBA 3TFOA 2P1RA 2W00A 3KXIA 1X7ZB 4GM1A 1HT2E 2C1XA 2WHYA 2JHCA 2GN4A 2Q07A 3AESB 3AFHA 1FQKA 3EHDA 3MB5A 2J30A 1YL6A 3UWOA 1BD3A 1A9XA 5KWVA 2FCAA 3EMBA 1RYDA 3RVLA 4UM9D 3WBFA 1ENPA 1E2NA 1EHYA 1K9SA 1MQ8B 2QM0A 3BYZA 3CPSA 3GJ5A 4HRVA 2D1FA 2VCHA 5M34A 2QVCA 4H0CA 4PO3X 3BZWA 4UBLA 4G5YA 2WE8A 3F5SA 4UNPA 4UAJA 4NBUA 1YL7A 4LOKA 3SC2B 4FDLA 3CZAA 2X22A 4WZBE 1P9NA 3U9TA 1UAAA 1JQDA 2BJWA 5JG7A 5KJFA 3FFBA 4R81A 1IG3A 2AS0A 1UZNA 1ZWKA 3IBSA 1ORDA 3F8WA 3B3AA 3KJZA 3D3JA 5KTOA 4EG7A 4IMRA 4PTYA 1WCIA 4ZOEA 3UTDA 5LQSA 2HPHA 4IDCA 4U8HA 3IVAA 4E5YA 3A9TA 4KR7A 2HGZA 5HQTA 1JXQA 3FDFA 1NRJB 5FA8A 3KQWA 3E9NA 1UWKA 4AQDA 1E1RD 3EUEA 2HUPA 3OZEA 3PWZA 1JYEA 4V24A 1ZVVA 2P9BA 4PRYA 2VBFA 4M83A 1YOVA 1HEYA 2WAOA 5EAIA 5FBLB 4ZYLA 4QAQA 5J5AA 1Z07A 2HWUA 2R6AA 4F3CA 4MPJA 1DO8A 4Q9JA 1CY1A 3GGJA 5DLDA 4PC1A 1M5UA 4J6EA 2HTFA 3NO4A 5E2BA 4BCDA 4ZZ0A 2BGIA 2YFYA 1WUHS 1KIMA 2PL5A 4PSCA 1QR2A 4ON9A 3AVXA 4WXEA 2A0YA 1NMYA 3BGVA 5AUOB 2BDEA 3ZZMA 1KO8A 3LDAA 4HDOB 4TWBA 2H1IA 2I0FA 2SCUB 3M49A 1JAHA 3NP7A 1ZK2A 4DM3A 3F73A 3FCCA 2VP5A 3LBFA 4MVJG 1B6RA 5A9RA 1AXEA 2CNBA 3N86A 5A1TA 4XZ3A 1KO4A 3KU1A 2BFCB 3A0UA 3AR2A 3GJXC 5CVUA 4BO6A 3EZ2A 5H4GA 3KQNA 2DERA 5FIUA 3SZGA 4KV7A 3BMQA 4YCAA 1NNI1 1T1GA 2F3RA 5ERXA 4OLHA 3V7YA 1KFJB 4MJ3A 3UY4A 3F78A 4J90A 4OM8A 2B5OA 2HSZA 3LHSA 2ZR7A 3MCWA 3QXGA 4QUJA 4J1SA 3OFNA 3QF4A 4DG8A 3UKOA 4I1IA 1NJ5A 1P73A 1TU3A 5LDGA 3VR5H 4C3VA 4DAOA 4EW3A 4ECAA 2KM1A 5C37A 1JHQA 2H5IA 2IRWA 5BSKA 2EC5A 3HB9A 4B5LA 4RO0A 4B80A 4Q3CA 1PYDA 2OYRA 5KYKA 2YQ4A 3DFKA 1Y5NA 2WJVA 1FVHA 5AW1A 1M67A 3AOGA 3WDMA 2X6TA 1WUKS 1ZOLA 2GYWA 3K9GA 4KPUA 2DLCX 5TPZA 1YO6A 2JGMA 5A05A 4PLVA 3FVWA 3H2KA 4CIAA 3DH0A 5I7OA 1EXNA 2H85A 1U8CB 3O0TA 1JEYA 1LTQA 3ZUGA 1DUVG 1N0HA 4F6RB 2JJYA 4KDRA 5D7BA 3ZHOA 1O7JA 2O5EA 2CCKA 3CEJA 2PXHA 4YAIA 1W8DA 1F9EA 4CETA 3UV6A 3K70D 1U0HC 4G25A 1W4LA 4IIFA 4UHJA 1PT9A 1I2BA 5L51A 5IHPA 2YHSA 3EQ2A 1E79A 5AT1A 2HZ7A 1AS2A 2C31A 2HU7A 1IY9A 4OL9A 1RIFA 4F3YA 1GZ5A 1SIWA 2J7PD 4BVJA 4ZDKA 2EQ5A 3MMXA 3SZOA 2I4TA 3M33A 3IAM1 2YN4A 2ZBPA 3NGMA 1PLJA 3O2NA 2CCJA 3E23A 1J0CA 3GOHA 3MJHA 3Q12A 4MI6A 2HNBA 2J6CA 4F4IA 1JPUA 2EBUA 4S12A 4E3WA 1ABBA 3HCPA 2IP2A 3ZK9A 1ZIOA 4Y6OA 1KQOA 2DKFA 1KHHA 4CNBA 4KG7A 3SLKA 4YRCA 1YI0A 2QQ5A 1U1GA 2NU9A 2Q4EA 3HO6A 3H1BA 1KJIA 3I32A 3EARA 3M6FA 3TM5A 1ZZGA 3QU7A 3RYFA 4EJFA 1QG4A 4BQSA 3ISVA 3O6VA 4Y2TA 4H31A 2ESRA 4MMXB 1I3OA 1TQHA 1XNHA 4PIMA 3KR9A 3I73A 3F47A 1ZJJA 1AKTA 1IOVA 5KTKA 2HF9A 3RS2A 4V0MA 1NMXA 2J3EA 2JJ1D 4WXRA 3WWYA 4AO6A 5HXAA 1WBBA 1GQSA 1CJSA 1U7ZA 5B2EA 3RAJA 3C3XA 3E7XA 3UYKA 1MMFB 4FYKA 1W52X 4EAAA 1RHQA 4HB2A 2VHYA 3S2GA 1T8PA 5EWJA 4TN1A 4MUKA 1II0A 1MOPA 1XK6A 3CUWA 5CHEA 2CNOA 1YRBA 3E9RA 4DIBA 2F1OA 3UG6A 4OBXA 4ALLA 1C30B 1KEUA 5DW3A 5ECGC 1S1MA 4BVAA 1M8PA 4DYHA 2PZGA 2NV0A 1GRQA 2CEAA 2D5BA 3KYIB 4J7XA 5E2AA 4B3BA 2G67A 2YIJA 3AO0B 4L6IA 5AFSA 4NBSA 4OP2A 4DC9A 4BMOB 4LXXA 1L5YA 1AXGA 1U0TA 2C8VA 3GQBA 1YONA 4IXDA 4UMEA 5IDYA 4B6FA 4F8EA 5KINB 4JC0A 3JATB 3IP7A 4H7JA 4NPAA 2ZOSA 4ZTBA 4F3TA 2C7VA 3B9RA 1NJ8A 3CRZA 1WZ2A 2FWBA 2D3TA 3N75A 4G36A 1R88A 3TOSA 4BE7B 5ITZB 3SHTA 1NY5A 1XYVA 3GC6A 2EXXA 2IYSA 2WYWA 3KZMA 1J9ZA 1XRMA 1N7HA 1TKBA 3ONDA 4IAOA 4RD2A 5EE1A 2ODEA 2HSGA 5BO5A 2K7FA 2JGDA 2PWPA 1CRLA 2CMGA 2DCMA 4U63A 4XJXA 1XE3A 2XGJA 2TMKA 3ONFA 4EF4A 5FBVB 3PC8C 2PR7A 4DWOA 3ESAA 3W7AA 4WY8A 5DXAA 2IOQA 3LXUX 2ADFA 4YMVA 4M55A 4YAEA 4F56A 1A2QA 2NMVA 3FBGA 1Z16A 1HTBA 4L9WA 3K8YA 3HUEA 3THOA 1A97A 4IV0A 5JJCA 1GKUB 3DKPA 4L3VA 2C5EA 3V8RA 2Q1TA 2R85A 4QUDA 2MT9A 1Z37A 4I55F 2G5GX 4QDXA 4IIGA 1XX6A 4GH5A 3X44A 2XDQA 3N87A 1VSQA 5EIAA 1CQIA 3QHPA 1QAMA 4N82A 4OD0A 5EIEA 1VCMA 4B6GA 5JAHA 1BRMA 1G8PA 4BFCA 3UMMA 1E2HA 3E2MA 1IHXA 3A37A 4CU2A 4PYKA 2HF2A 1PP4A 1O95D 4YONB 1VHQA 2HB6A 2N3ZA 3EXHA 1K06A 3DAYA 4MEJA 1G5QA 5DTMA 3VR0A 3ZE7A 2QGFA 4ZQBA 1Q15A 4OHRA 2JLVA 1CY2A 1W87A 3LY9A 3PQEA 2BHSA 4RF2A 3VGJA 2Q6OA 3E18A 1WMBA 3ANLA 2R44A 3I1JA 2CBXA 3TLJA 4L02A 3TRKA 2WT4A 2X9NA 1JKJB 1TK9A 4LNUB 3ZZUA 2HCFA 3BTSA 3QWFA 3OQIA 4ZEOA 3TZEA 1NE2A 5PGMA 1H69A 1GUAA 1U2PA 2J6BA 3RYCA 3TVDA 1V9SA 2FWMX 4DJDC 1EHCA 3E7FA 4OXIA 2M1ZA 3CF0A 5KNLA 4MUIA 3VKHA 2TYSB 1DCKA 2XNSA 2A3RA 3UJCA 1XQVA 3X1MA 1AKYA 1IPFA 1UPXA 3FUTA 1VMKA 1TZKA 3UGQA 3HYCA 1HG0A 4JFRA 5E4YA 2YCLA 2CLSA 2XRYA 3QSYA 3GT7A 1AMUA 3GHYA 1R0XA 3UK1A 1BA3A 4YECA 2R8EA 5KNBH 1EG2A 3FKSA 2ZWVA 4E7OA 4G84A 2VRWA 4NBNA 1T5HX 4TSKA 3K6RA 2FJUA 2OC4A 2PMBA 3T1YB 2FI1A 2XCSB 3MFQA 1FZTA 3D2AA 3ZDQA 2NZ8A 2UXCB 1O9BA 1BXGB 2P2GA 3NUZA 2X5KO 4F60A 1ZOIA 1JT2A 4JP1A 4F6LA 3ASUA 2FR8A 5B3KA 1H22A 3GT3A 3HYTA 3CV3A 1KVQA 3IT1A 4Q03A 5BYBA 5DOZA 3VVBA 3ZKAA 2BBWA 1L4KA 2JFOA 2ZG6A 3H8SA 1A9SA 1THTA 2NU8B 1EMDA 2VSYA 5TV2A 4XVCA 9ATCA 5DZSA 3TTTA 1P77A 3CRVA 3VUEA 4Y2VA 3T9CA 1U63A 2FP4A 3ZCVA 1SOMA 4DZZA 5JH7B 3WL4A 2MINA 1XTKA 2XMQA 3M5WA 3O4RA 3RSHA 4JLKA 2FQWA 4LZAA 3PNSA 3SXJA 5CB4A 1XO1A 4PO8A 1FS6A 4YXWA 4YMLA 4I5FA 1FDUA 1FXWF 2QN9A 1JWBB 1XG5A 5AJTA 2X0EA 3NCTA 1VJTA 4UBMA 1UXJA 3ZWAA 2I4LA 1MVOA 2GVZC 2GAOA 4BQPA 2CXTA 2QN6A 3EFBA 3KNZA 3H5IA 4O6VA 3CW9A 1H4QA 4GZMA 1ZJZA 1KEEA 1UMBA 4QVKA 5IXYA 1KMHA 4D8YA 1WXDA 2BWJA 3REFA 1RRGA 1W59A 2GFHA 3GK3A 3I2KA 4O2RA 4B2LA 4PGFA 3AIIA 5TX7A 1OLOA 4E3ZA 1MAAA 2V7VA 2GN9A 2MJLA 3S2UA 2JDID 1WXWA 1SHZA 3ODPA 1MJNA 3OZGA 1T0JB 1XDZA 2EFCB 4BO1A 1AS3A 1M34E 2QMOA 4CGZA 3L8FA 3OD1A 5E8JA 5GPBA 1IZ8A 1SWVA 1AK9A 2HPZA 4U7HA 1YI1A 2RGUA 4BB0A 1UKCA 5EJ4A 4B17A 3S55A 2QUKA 2QAGA 3CLRD 1ZMTA 1L5SA 4RTJA 4BGEA 4JT9A 1N2SA 4KNWA 4OXNA 4ETIA 3COVA 3JZAA 1A7KA 2FW9A 5B6PA 3I6MA 2X7XA 1R0SA 1XN4A 1E0KA 3M81A 1A8UA 2B61A 3PXCX 5I9IA 1EFKA 1RKBA 5JDIA 4MVJE 2QQ0A 3ER6A 3K16A 3VKWA 2FN3A 4WUVA 5KWJA 3PFHA 3N8HA 2X5XA 5TS3A 3EEOA 3CNEA 5K3FB 4FJ2A 3W6UA 2E55A 2ZB4A 5THKA 1UK9A 1P4JA 2G40A 3GAZA 3L0IB 2YW2A 4TKZA 1IONA 3IA2A 3L93A 4P2BA 4COOA 3N2ZB 1TT7A 1PK7A 1X7YB 2RI6A 4JYBA 2NUAB 1UBMS 4NYIR 2PZBA 2XYHA 3E4DA 1P39A 3RS4A 3SNKA 1IBKB 2B9VA 1Z68A 3DWFA 1E7RA 2R3SA 2QJWA 1PGPA 3SQMA 4AMGA 3RHSA 4IM7A 3CPHA 1LDYA 3LO8A 1R1DA 3DTTA 3QKSA 1SCIA 2QLLA 1LPPA 3I2HA 4WXYB 1TVCA 1E9CA 2PJRA 1AE1A 1BWQA 1L9KA 4FEGA 4KMSA 4RGBA 2GEBA 2Q5HA 2XYVA 3ESDA 1BKDR 4GPD1 3I61A 2P41A 4EY4A 4BXOB 3NKLA 2KI5A 3UV7A 1Y98A 3LFUA 2GHQA 4FYXA 1RYYA 4Q3AA 1VG9B 2VWPA 3GIDA 3G5UA 4O4JA 4XSVA 2GA9A 1T9ZA 4XVRA 1NVMB 1EVKA 3RRZA 5MDHA 1H8ED 2EBFX 1IBSA 3IPRA 3KYBA 1U65A 1LNZA 5C18A 4IV5A 1UJ5A 4PHFA 3HWX1 3PR3A 4MROA 4Y30A 5EJ5A 5L3QA 3C3CA 2HJHA 2PGNA 2RFLA 1SVIA 1Z74A 4QBKA 1ZN8A 1CZNA 3RFVA 4EB3A 3LIIA 1CB0A 1AF4A 3KFVA 4P5EA 3GUCA 2YXPX 2AFIA 4QRIA 1XU4A 5B4TA 1EU1A 4IXTA 4F5YA 3I5XA 5TXGA 2Z3VA 4RORA 3P4XA 1LXCA 1U1DA 3ZQUA 2QX6A 2YMPA 3KJHA 5LB4A 5BWLA 3SIRA 3RC8A 3GVXA 1UKAA 3W4JA 4XLZA 3L8CA 1PKXA 1YNSA 4LQCA 4NJEB 2W22A 2EWVA 4HMQA 3CEPB 3PXBA 2IZOA 4OREX 4IUCS 1U7DA 1GAWA 1E2GA 2DGDA 2IYFA 1A96A 1HETA 3MD0A 4LJ4A 3REGA 1UKEA 3VA7A 2EX1A 4BHTA 3O83A 3GNTA 4J91A 3ML1A 3P2OA 3KQQA 2X8LA 2LDBA 2D2IA 3CT4A 3FHOA 1T9GR 1I51A 3UWMA 1QC5A 3FRHA 3CCBA 4P32A 3A4NA 4IS2A 1JQJC 3KYCB 5U4XA 1ZNXA 5CFZA 2A5JA 1YA4A 1DP4A 2R6CA 3IE2A 4I9FA 2VPPA 2QRZA 3GI1A 2R0QC 3O4GA 2XUZA 3VJRA 4LHZA 1T13A 3DAHA 1M2VB 1RJWA 2X42A 1GO2A 4P7KA 3OT1B 2HDOA 3NHZA 3BCRA 3D8RA 4KIGA 3AF3A 4ZCPA 1PT7A 4MB2A 1S8NA 3MS4A 1KEVA 2OCXA 3KALA 4M9SA 1KYZA 5FAXA 5LBTA 3LTNC 4W1RA 1TUIA 4DLTA 3HY4A 1Q2UA 4KIJA 2I1QA 2DRIA 4Z9AA 5G4KB 5IC5A 4TV9A 1FTSA 4C7VA 3NHMA 4TKUA 1OWNA 4XR9A 1PNTA 4RZSA 4GZ5A 5IT0A 1KBQA 1QCZA 4WNIA 2HA2A 1ZRHA 3CG4A 4YRFA 5IABA 5C52B 2IT1A 2JIOA 5B1YA 3PHBE 4MQFB 1MR3F 3WJ7A 4C2BA 1YR3A 4Z54A 4K6MA 2ZPTX 2O2EA 1SHTX 2IU4A 1P9RA 1ZH8A 3OIFA 4M9CA 3W3ZB 5JQGF 3GJ7A 3EXEA 4FI3C 2R5WA 5DYYA 3EPHA 4V0OA 5D51S 3OZIA 4TMWA 5LUAA 1A2OA 1E9VA 1SXJB 1W1WA 5K3DA 2O7QA 2HM7A 3TI7A 3OSZA 4ARZB 1PCXA 3FYUB 4KPFC 1AKWA 1H23A 4J29A 1PBTA 4A36A 3I04M 1N2XA 5DNAA 1H8HD 2YWRA 4BGVA 5IM4A 1BOOA 3PGA1 3OG9A 2ADMA 4DIUA 1I4EB 2DULA 2YC4C 2OV3A 1P19A 3VZDA 2Q3CA 4AP5A 1UFOA 3NALA 3ESQA 1YBMA 3GZNB 1BRTA 1FU7A 2Z04A 5CXQA 3BWYA 1VCOA 4JBLA 2BRUC 3G8CA 4B4VA 1Z5UA 1WQ4A 1AY0A 3M34A 4D0SA 4LUCA 2Y0BA 4HTFA 1SD2A 3CLUD 3WIDA 1D2GA 2OHGA 2CLIB 5JS2A 5FL7A 4UTVA 3INRA 1ADGA 1OV4A 4R1MA 5A3JA 3KKEA 4ENUA 2A9VA 5IJ9A 1TTTA 3DMTA 1SN7A 1ZM2A 3JX9A 2Z6AA 1X6VA 4WKOA 3ROZA 3QOYA 4GUDA 4NU5A 2HIHA 3H5RA 2DBVO 3R3SA 2QW8A 2EKDA 3C6ZA 1ISMA 4MQEA 4P33A 3RU7A 2MTBA 4ES6A 2CMFA 1U28C 1L8LA 1K4KA 1Y0BA 3IKTA 1XQ1A 1C3EA 2XWQA 4PSVA 3OCZA 4HDRA 4RW0A 4AK9A 1KO7A 3KPWA 2GK7A 3IUSA 3Q1KA 4AJJA 3G8YA 4JLWA 2FU5C 5GINE 3JAWA 4BNVA 5B6JA 4TX1A 3M9LA 4BO5A 3TW8B 1BNCA 1YSCA 2HWKA 4ZYUA 5BOSA 5C51B 3T9EA 4D9GA 2OM2A 1T5DX 2JPDA 4X1IA 5BUCA 1JJBA 1SEVA 4HPXB 2W6MA 3AEQB 3WYDA 1WM1A 1T3ZA 1VE9A 3C3JA 3V00A 4XGRA 2D5CA 2OHVA 3CE9A 5DSZA 2PMEA 3TJRA 3R9WA 2HO5A 2OXCA 3N5CA 3V97A 1CBUA 2Z9BA 3FX2A 2X4LA 5CIYA 1UPUA 4F2HA 2DEUA 1JG4A 1A4IA 3WOHA 4E1BA 1PTJC 4WGGA 3HHPA 3ZXIA 5DNVA 3VI3B 4UUNA 4Z9BA 2DCUA 3FIJA 4UXIA 1FNMA 2PQ6A 4Q21A 5ALJA 2XA2A 2VQDA 5ERYA 3V8EA 5CDSA 1SUBA 2ZRKA 3PUXA 4L08A 4QM6A 3AP3A 1TEHA 1P4AA 2BTQA 1S0UA 2E1RA 5I8ZA 5B3JA 1U0BB 1WU7A 1NVBA 2CBZA 2GT1A 1X39A 2IU6A 2ORIA 2ZU6A 3PHHA 5CTJA 5F33A 2IP1A 4WV3A 3PWKA 5EMJA 3PNPA 5CDFE 5THQA 3HDVA 2PKQO 3T3PB 4KO4S 5M7EA 4EOGA 4FZRA 4M1YA 4UPVA 4DXDA 1C8VB 1WXFA 2AZMA 1J21A 2Y68A 1UOQA 1EEXB 4EJSA 3P9NA 2B4RO 3IQIX 4ZQEA 3QV2A 1P17A 1SO8A 2GRUA 1Y3DE 4U5QA 4IQ4A 1P1KA 1M1YA 3JD4A 5BN5B 1N9GA 1V6CA 3KQMA 4JT4A 4NYMQ 1G6KA 1PJ8A 1Q57A 2DFVA 3KL2A 1U3GA 4I1OA 1OH8A 2P7IA 4UHFA 3ZD6A 2EYUA 1SXJD 4LJSA 4MWTA 1UQUA 2OQVA 4LF8B 1T4DA 1ZKDA 4JY7A 4R8MA 2WWYA 2OY0A 4PPQA 3O8BA 3UXHA 3DJFA 5DCYA 2NU7B 2ZT6A 4O4IA 3U44A 3AG6A 5JNSA 1B26A 4Q93A 4P2GA 1AKRA 2BGTA 4QXAA 4EKYA 4DR1B 1IZYA 3WYCA 2GPJA 4FC6A 2IDJA 1ZVQA 1HZJA 1OWLA 4FX2A 2OVBA 5AI0A 3PWSA 2C4TA 2WUWE 4AICA 4TL9A 4IVNA 4XWAA 3R0VA 1E3WA 3TLGA 3L8GA 1Z5ZA 3GGOA 3WKCA 4MHOA 1L5ZA 5JADA 1WSAA 3ST7A 4L9SA 9LDTA 4GIBA 5KJCA 3GOQA 1T8YA 1EGQA 1HFWA 1LH0A 2FZKA 2GEKA 2GYVA 5ALNA 1J8FA 3TOZA 1BCSB 2H7CA 3L0OA 1O54A 1V11B 3AL2A 4IIJB 4WEQA 4F1KA 4YRPA 4O4HA 4EFDA 1WW8A 3GELA 1XXHE 4L4SA 1IEVA 1N25A 4FFWA 3L79A 4BBZA 2JFNA 2P9HA 2PAFA 5TEWA 3SKXA 3B3QA 4N39A 3U81A 3BDVA 2X9GA 5K0BA 2J9RA 1CUGA 1PWHA 2QR3A 2V45A 3MAAC 4CDRA 4PO9A 5JAMA 1JTVA 2H0RA 3R9XB 2C2OA 4QNNA 2GZMA 1CUUA 2PMCA 4KMMA 3EQ6A 5ADWA 3NBUA 2YIMA 4W1SA 3V8PA 1EBBA 2Z5GA 3WMWA 3AUJB 4OYYA 4WFIA 1THMA 3PPVA 1NMZA 4JLBA 2FA9A 3JPWA 4IIEA 4L16A 1P2UA 2Q45A 5IULC 1ZUD1 5K3AA 4JSRA 421PA 5B2ZA 2VBIA 1K1EA 3T4PA 4M1WA 1Z0UA 1UPFA 3TZLA 3ZE1B 4BVHA 3AERB 5AVXA 2CVFA 3ANNA 4LV6A 3NIDB 3AL0C 2HJRA 1KK2A 2FWAA 3OFND 4DLKA 4D43A 2OBXA 2C82A 3MWLA 4REMA 1ZUNA 3SX2A 1S89A 4HWTA 2WHPB 4BNDA 2FX5A 3D4IA 3LUCA 4DWJA 1Z5OA 3NNDA 3UGTA 2CV1A 4BL5A 1Y81A 1X2BA 2R11A 1R00A 3RBZA 3VZRA 1WCWA 4DCPA 3GCDA 3LLSA 5IW8A 3TRJA 3WV4A 1WB9A 221PA 3SQDA 5FUXA 4EYEA 1GGVA 4PLHA 1CP3A 3CTMA 4HB0A 3Q8WA 3UAXA 5FPTA 2QJOA 1Y7TA 3M6IA 3WO0A 5KNDH 5AVJA 3DB2A 3DDCA 1HXHA 5I7EA 5CCEA 5IBCA 3E22A 4MA4A 5KUTA 2H1CA 3GDOA 4B32A 3IKVA 2WSLA 2ATCA 2QXTA 3RB8A 2BFOA 4KHZA 1A7UA 1VPDA 2H29A 3IX7A 1CV2A 3DVAA 4NS4A 5MN5A 3W5SA 3OTQA 2GZDA 3GBSA 4CXMA 1Z62A 4JKOA 1Q92A 3EXFA 3U7EB 5FT9A 3OURA 5IMBA 3VTZA 1AK1A 4QT0A 3FTNA 5E1DA 5F77A 1TUBB 3OCWA 3WWPA 2PLWA 4W7SA 1RCFA 2ZSIA 3ROTA 1PLLA 2BISA 2FPPB 3IQFA 3ILSA 1NDHA 3UHAA 2FMXA 1NF3A 4MLZA 5F2NA 1W94A 1O89A 2A4KA 2BFMA 4B3CA 1YF3A 3E9DA 1C4KA 5B36A 1WHSA 3LP8A 1EK6A 4LVOA 4NJMB 3KUDA 3JARB 5E6RA 3AONB 1ISJA 3W9SA 3HB1A 2GO1A 4R5MA 2XECA 3IVRA 2JAXA 2BM8A 5EQTA 2GD2A 3N2GB 3R7AA 3ZQ4A 5L7WA 1YJXA 3FXAA 5JCJA 1N2EA 4L5JA 5H59A 1PQUA 3A06A 3FHLA 2TMYA 1TCAA 3N3BC 1DEOA 4NICA 4XCXA 5FBKA 2PBFA 1Q3TA 1YCDA 3I64A 2GKGA 5L6MB 4P22A 1XTZA 1SPXA 2GCEA 5KDOA 2EG5A 4RJTA 5AJVB 4RPHA 1UBHS 3NNNA 4RMHA 4WK2B 1QFXA 1PJTA 1ZJ4A 4X7PA 3VI4B 3IDSA 5I7WA 5JI2E 2HYIC 521PA 7AT1A 1J8DA 4M0CA 4XM2A 2N75A 2VYVA 3CUEF 3FB4A 4AY2A 1M6YA 3FETA 5FPHA 4TPKA 2VDKB 3W5JA 5JMWA 3V34A 4NNPA 1V16B 1QV6A 4KR0A 4G01B 1U99A 3VZCA 1U0GA 4HDKB 4PCVA 4Z7QB 2PT6A 2QGNA 2OHXA 1Y5MA 3HUDA 1ID1A 4JI1B 1E0JA 3ENNA 1LLQA 3JWEA 5K4AA 2EHDA 4Q47A 3EEQA 3QTLA 4AMBA 4PFKA 1NLFA 1RSZA 4QTTB 3F46A 2I1LA 1J1UA 2IBMA 2V74B 1KYQA 2I34A 1REQA 1Q2XA 3DPUA 2C7GA 2XOKD 3LPDA 1L4UA 2XWPA 2XYGA 5FBHA 3D8HA 4ZVPA 3KDSE 5AW6A 5F5NA 2ZJYA 4HLUC 1X13A 5L9AA 1NLMA 3I92A 5FUVA 4A8JB 1NXWA 2AC2A 2DUJA 3JWPA 2XYPA 2BEVB 5HX7A 4RNCA 1EUDB 4R16A 4RY2A 2YZGA 4FMBB 2Z8ZA 2PZ8A 4K9OA 1KYVA 2V7TA 4LWQA 3W8RA 4YACA 1SG6A 2I55A 2ZIVB 3HKCA 3ICEA 5LYJA 1L7BA 1UANA 5BSWA 2WWVD 3WMEA 2IZ1A 3O73A 4EMBA 1IFXA 4HGRA 4PM4A 3H17A 1O96A 4PYRA 1P4RA 2HMWA 4BBPA 2P4SA 2JBHA 1NI4A 1DTWB 4CV2A 1F5SA 4RWEA 4DV5B 3EISA 4F3NA 2B35A 5DI9A 1ZD3A 3F67A 1PT8A 1RJEA 5DISB 2I33A 4EJ0A 2YNMA 4AUKA 4IHAA 4CRWB 2FSUA 4LF5B 1I2AA 2PLRA 2YTZA 1SU8A 2JFUA 3GRFA 3K1AA 1BXZA 4WTOA 3ZV7A 5J2UF 3M6MD 5AWFC 2RHOA 3KKKA 2JB9A 3PSAA 2BFAA 5CMLA 1ZNZA 5E1BA 2I7CA 1C1XA 2NAPA 3VJLA 3AH8A 4RJJA 3WNCA 3H2YA 4FGJA 1G8MA 2GK3A 1G7SA 2O20A 1GZ3A 3WHIA 5LQUA 1RWMA 1GCAA 2P9ZA 2ZR9A 4JJ4A 5DASA 4W1PA 4CLOA 4N8SA 3M6LA 4NH0A 2ERXA 1T10A 3I0NA 4P3XA 5JXJA 3IO5A 1PI3A 4B0PA 1CT9A 1F2DA 1BTOA 3VPFA 2X6QA 4JUFA 1IM5A 4M8SA 2VN8A 3RS0A 3KZCA 3T1NA 1F06A 2DQKA 2AF3C 2E49A 2F59A 4EEXA 3WMRA 1DCMA 2MSWA 4HJRA 1C7QA 1MENA 1QO0A 3P1JA 3TOVA 1LQTA 2CMDA 4OQ4A 3K0HA 2WUGA 3RR2A 3IQDB 3U4MA 1I24A 1KYWA 3SYKA 1N3LA 4IKOA 4M0FA 1U3WA 4FXOA 4J2HA 2G09A 3K30A 1RE0A 3VYRB 4UTPA 4D99A 4ZU6X 1VE3A 3WYFA 1VRCA 4NV0A 1NQAO 3LX8A 2ZUTA 4AS2A 1NLYA 3CH5A 5AESA 1DU4A 2WFMA 5DYIA 3OUZA 3KKLA 4H6XA 4OQNA 4MPPA 1WWKA 4LE2A 2EP5A 2ZE8A 3UMBA 3QYFA 4WKCA 1HKUA 4YJHB 3ANXA 3QPUA 4LDAA 5LC1A 4EKIA 1ZO8A 1V26A 3BJMA 1EVEA 3OC6A 5A4DA 1GNPA 5HQ3A 3D6UA 4DQ0A 2VKTA 1ZM7A 4AXXA 2OMKA 1KBOA 4FQ8A 1URPA 1P7WA 1PE0A 1KZ9A 1R74A 3MMZA 3R2JA 1XYYA 1MU0A 1NBME 4FHGA 3ZWCA 5KYWA 4GMHA 4XVHA 3G5MA 2PUWA 2V1XA 1KDYA 3B1YA 3EGWA 4MIKA 4CMJA 1H5QA 1JU9A 5BSGA 1EESA 1RHRA 3O2QB 2VHQA 2ZXUA 3M7IA 4PX9A 4TWZA 5C80A 4FEEA 3PNBA 1QVWA 1E1QA 2XVXA 1K6JA 2ISSD 4IG9A 4YP5A 1C81A 1UK6A 3U4HA 1JXAA 1PJSA 3GF4A 1D5CA 2D4AA 1NW7A 2Q1WA 1LPNA 3B13B 3GAMA 2XYRA 1QOPB 1VSBA 4GBGA 5DULA 4Q3KA 4LJ7A 1BW9A 1UPTA 3LG2A 3EVTA 2OBMA 1QH1B 2AZ4A 2EJTA 5CU7A 5ALGA 1OGJA 4YXWD 3PEEA 4LMBA 5IVDA 4J1TA 2JH8A 4QUGA 2H2DA 2O4UX 3GNLA 4OQMA 2F6RA 3AHIA 1GN9A 3U7HB 3EVFA 4AWBA 1TLLA 5CA1B 1FFWA 1AGYA 1WY5A 4DJAA 1L3IA 3WLHA 4Z51A 3PNYA 2GSWA 3IBGA 3DF7A 3R7NA 3C7TA 5D8DA 1XPJA 3A6PC 3I9FA 4JU9A 2YWEA 1IY1A 4KITB 2Z6UA 1L5KA 1M33A 2DHDA 2NUTB 1Z6QA 2YRFA 3DT8A 4A03A 1XJ5A 4EY3A 2UYYA 3HO8A 3PU6A 4LYHA 4W9MC 1KNXA 4JU8A 3WHPA 2RHHA 1DJQA 3C8ZA 2I2CA 2Z58A 1FTQA 2WD7A 2CGEA 2PH5A 3S2FA 3A9UA 4M1EA 1PS8A 1NUUA 5LJIA 4MVJI 1CIVA 2F4VB 2Q1XA 2WWIA 4IILA 3WNBA 1GTJ1 1FDRA 3VMFA 3FPCA 1L7AA 3L84A 3UPUA 5DCUA 2AR0A 2W6ZA 1EBFA 1Q77A 3WA7A 2PT5A 3WNQA 1L6RA 5BORA 4M38A 1I0IA 1HEIA 4WD3A 5FHQA 3T15A 3PE4A 3WQRA 3GUZA 3KM0A 4OLBA 3QE3A 2Q4DA 3H1AA 2PX4A 3HCRA 4GX5A 4HRAA 3FVRA 3AFOA 1PFVA 3ZY3A 1NR5A 1W4AA 3ZDBA 4HX2A 1L5NA 5HUHA 4QU0A 4Q16A 3E7PA 1YZNA 2ZUWA 5G40A 1MN6A 4LYYA 4WBNB 4MI9A 4ZT7A 1CF9A 1EE1A 1OXUA 4JR2A 4RF4A 2CHEA 5HW0A 4EI2A 3RVBA 1QX4A 1ISSA 1UUFA 1FSFA 4U7WA 1SKQA 4KQ2A 3WLFA 4RK7A 3GLIA 3KKNA 1LBQA 3PHJA 4OX9Y 5JWOA 4ARCA 3EDCA 2Z2XA 1HLDA 4TQ9A 1EFAA 1G7TA 4U3JB 1E3EA 1ECFA 2QK4A 3HHEA 1HLGA 3SQXA 3P2IA 3G2PA 4QPJC 1G21B 4YX9A 3VR4H 4NS1A 4OA8A 2GSDA 3EDRA 3NHJA 3D31A 1QQBA 1JWLA 3UJ9A 1R4ZA 3A3OA 1EJ2A 3VGPA 5IVPA 4U7DA 4YLYA 4C2UA 4HSGA 1VHJA 4M86A 2ZWPA 3HM2A 2YYAA 4QARA 5CYOA 3ZHUA 3VHXA 1BDHA 1EXDA 4FDMA 4YMUA 3RFXA 3ADKA 1E58A 4QLAA 4WQMA 3F2VA 4TLAA 4X3CA 3OEHD 4RF3A 4RXTA 3MRSA 4IF4A 4EQ6A 1VJGA 4QSHA 4DXHA 1Z12A 4TZKA 4D4JA 5TE9A 5IS2A 4CTOA 1QH8B 1W5TA 3SHFA 3V4SA 3VTAA 4CM8B 3G2KA 4JOQA 4WLNA 2ANBA 4H7PA 1F2UB 4FP9A 5EE5B 4G0MA 3U1TA 1C9EA 2I8CA 4FYWA 1NQVA 2GGSA 4G0ZA 3AKCA 4IJUA 2BFDA 2GQ0A 3RYCB 3SXPA 4DC0A 3U7GA 1USVA 1U9JA 4II3A 5BN3B 4CZ2A 1Z7EA 3KAJA 1B23P 3RK1A 1FFDA 2Y8EA 3V2GA 4RIFA 2XGGA 1VYHA 3HLTA 5F4ZA 4L27A 4M88A 1AS0A 1DO0A 1X3SA 3UM9A 3KQSA 1SBHA 4RKRA 3FPGA 4BPRA 4LDPA 1GNLA 4HGNA 4DIEA 3PVCA 2P6PA 3MWYW 2WPDD 1I4DD 3GGGA 1YE3A 4R1LA 1G7RA 4TV8B 1W0JA 2C4KA 5DX8A 2V7PA 2G0AA 2Q3LA 1DHTA 3NHAA 4LXQA 4MWCA 4WK0B 4QU5A 5F9FA 2R7MA 2N1MA 1ODIA 1P0CA 3E1KA 3N8DA 1RHMA 3SJ7A 1XTPA 1LI4A 4D6PA 3AIKA 3C70A 1IWOA 1VYVA 1SUCA 2O1EA 1ADBA 4R9RA 1GL6A 2R60A 2CZGA 5LJLA 4R3NA 1KVTA 4LNUA 3VPBA 2JFQA 3UHOA 4C08A 2QV7A 3EDMA 4OHFA 3ZHCA 1MBZA 2C5SA 2JARA 1XEWX 2LPMA 2P9FA 2VJQA 2X4DA 2CN1A 2WP8J 3DDZX 3DFIA 3WR5A 5CFQA 1XVTA 4R2WA 1HA3A 3CJRA 2HJWA 1B0UA 1IH8A 3G02A 1AN9A 1G5PA 4WERA 4KXXA 4JA2A 4OQPA 4RZQA 4ZVNA 1TPYA 1Y37A 4X85A 3HLKA 2AWOA 1NUHA 3MOIA 4GECA 4KH0A 4EW2A 5TGDA 2WLSA 1C9DB 3MJ4A 4AJIA 4K9RA 4U2GA 3WL3A 3KU4A 4B79A 2I76A 5JBIA 3MB8A 1RAIA 2EWMA 3KYDA 4ILEA 1Z6ZA 4E88A 2FFRA 4G5FA 4JJ6A 3JYLA 5FBRB 3RRYA 1ZXLA 4CKCB 2HV8A 4IXNA 3ZWKA 1Y3BE 3PQ7A 4RPGA 5DT2A 4US2R 1APBA 5JYDA 1J2RA 4BKMA 4OUDB 1C1DB 1UEJA 5AK4A 1STOA 2X0RA 5CLHA 4KXMA 4RL4A 3GCWA 4YP0A 3IOYA 1XKXA 1PS0A 4BTEA 1NOKA 2JJ8A 4M7RA 4MYHA 4RZIA 5KAMA 4HV4A 1M8JA 1GOTA 1PNQA 2O5VA 2MHCA 4I5DA 2IP4A 5I7RA 1GTVA 1MO6A 5IT5A 1KK3A 4Q7LA 3U3RA 1EWVA 2VTEA 1DT3A 1XEFA 1U8UA 4HCJA 4FE7A 3OE1A 1KWGA 3LKBA 3TUZC 1F9AA 4GR9A 1SXQA 2WAYA 3ZXXA 3IIEA 2IL1A 4GVXA 3QVLA 1CQJA 4KGDA 1WEKA 3TDNA 4DLVA 5F98A 3Q5EA 4NOLA 4GQBA 1DFIA 3CLTC 3T3OA 3FOWA 5FL7D 5SV2A 1UOPA 2H18A 2IIQA 3DHVA 4KGVA 2FNAA 4N8EA 4QOFA 3MQFA 4RJKA 4WECA 2AJLI 4ASUA 1WVIA 1E69A 3UB4A 2I7VA 1YZFA 3GN1A 4OATA 4YB8A 2EYQA 1DFGA 2B21A 3FTQA 3GXOA 1VB3A 2WIBA 3HWSA 3FZNA 3ETHA 4QWWA 3M9XA 2PJDA 4F9GA 4WNCA 2AFRA 5EHIA 1TLTA 1TFRA 4PX3A 3LVBA 4LDRA 3DFUA 2PUFA 4KQ6A 5HRCA 2NUPA 3H2JA 1ZP6A 4KQJA 4I99A 4FW8A 3TAXA 4IWXA 5FI3A 3SF8B 1R8JA 4OTZA 3HBLA 4M1QA 5ENZA 1YUMA 1K6XA 3OECA 4JBGA 2W8BB 4K81B 2GXUA 3D54D 3MBOA 5FPPA 3L05A 4RU1A 3PGJA 4X91A 3MRVA 1YDFA 3D2LA 2QTAA 4GMFA 5DBOA 1DJLA 3NP9A 3ZCRA 2QMHA 3CIFA 1DPFA 2ZIAA 3IVMA 2ZREA 3SHVA 3L6OO 1RCUA 1WMSA 1BVHA 2Q7XA 2H52A 4HLCA 3AUXA 4Q01A 2G25A 1YK1A 3ZV5A 5BQOA 5K3FA 3F6CA 3GFBA 4HH1A 1YKGA 3HVHA 1CVLA 4TXJA 4DM4A 5K01A 1Z7WA 3LBHA 3BERA 1HLFA 3OLXA 5FPQA 4B31A 2ZB3A 1CXZA 1WPQA 3NHBA 1EI9A 4L15A 4CMKA 5DM60 3QVMA 3C7DB 1SOUA 1WDMA 1BE0A 2E82A 3I3SR 4I55A 3L3BA 2AC7A 1V2GA 2RHDA 3ILVA 4KMOA 2VKQA 4P7BA 3PX7A 1JDBC 2SHKA 2PMFA 1T2CA 5LUBA 2YL2A 3ENWA 2PYIA 1Z83A 4TTRA 3A58B 1Y1SA 1ZIPA 2P4HX 1ZOSA 4AZ3A 1NJ6A 1R6AA 3EHEA 3SSMA 3OZRA 5HFNA 1OX4B 1ZI8A 3LK7A 3VPGA 4D0NA 3H0KA 4D9BA 4CL3A 4BFVA 4R8RA 1J24A 1N1DA 3NNSA 1L7OA 3SYMA 4BFXA 4DTCA 3G9UA 5IYZB 2DLDA 1Q6ZA 1KSJA 2P11A 4L1KA 5GOTA 1HWYA 4LXHA 3SIPA 3ZXSA 4GDFA 3FUUA 5BNZA 1KY4A 3I1YA 5GM1A 5T57A 1LC3A 3KTAA 4F92B 5L40A 4B46A 1G9SA 1Y3AA 2ZIXB 4KXNA 4U6NA 4DJEC 5A0TA 3HDTA 3SQNA 4R2XA 2GPSA 3L9WA 1PR0A 3L0YA 5CT6A 3KQUA 3MYYA 3OLYA 4WKNA 2HF7A 2Z98A 5ES4B 2EKPA 4J3JA 4MGZR 3NC4A 2WIGA 3WTCA 3ZGVA 2ATVA 4EG6A 5DKFA 2D0PB 2J5RA 1HYBA 2C95A 3KAQA 5CDUA 1QOQB 5K2OA 1TF5A 1G3RA 4MUMA 3K5PA 2QIPA 4KKVA 4M1ZA 5CR9A 3VKFA 3MWFA 3TQRA 4TS4A 3ZHQA 2XUJA 1PGOA 1XV5A 2FR8C 4MVJH 3ZC3A 1WLSA 2YV2A 2GILA 1KI8A 1V9LA 2O8NA 3BCHA 5CK4A 2Q29A 4YJ2F 1C5KA 4JH0A 2G9NA 1NN5A 2RGCA 1JLRA 4YUZA 4KAAA 1OT5A 1J2EA 1IHDA 3RQSA 3ZBPA 2BYTA 4NXNB 4I08A 4F04A 5BSEA 4N76A 3AUKA 1Z2PX 1VRVA 1U8XX 2PSHA 3GA7A 1GT91 1M0WA 4B6EA 1BWPA 1GVHA 2R2GA 4Q7QA 4BGDA 4MUYA 1AN0A 3KYCA 1T9DA 4TTQA 3BB4A 2AMJA 1ATIA 1MO3A 2Y9PB 2AN5A 1WXHA 1JG1A 1ATZA 2WWFA 2PIDA 3HACA 1PV4A 3ZX4A 1J8QA 3VR5A 2XE6A 1A7JA 3EAFA 1W2GA 3BIWA 2J46A 5AICA 3RQIA 2ZK7A 5F7OA 5JRJA 5LWHA 4KPYA 1RFLA 3DCYA 1RRMA 3V8BA 3MK31 2I2AA 1GA1A 4WADA 2LR0A 2F9FA 1CE8A 3WRXA 3W5HA 3K20A 1FXWA 1KQGA 1S2MA 3DVLA 4CMCA 1D4FA 1IUOA 1W581 4PZZA 5JXWA 2QLFA 2JGKA 4A5OA 3QEBZ 2CDRA 4HWSA 1O6GA 5E6SB 3ORSA 1XDSA 4FFBB 4NZ9A 4OB8A 3AF6A 4LE1A 3D6VA 2VYNA 3PX2A 3SQLA 3R8FA 5J5CA 3GUUA 4RCVA 1FVOA 1Z0KA 5AKLA 3BE8A 2PSJA 4Y9RA 1XNRB 4UBIA 2CL6X 3AVVA 4HVCA 1ZWLA 2GCOB 1DRUA 2HLDD 2QAGC 3K9CA 2VQ3A 3CWZA 4EYKA 5KC8A 4R2MA 3KHTA 1R8YA 3IBCA 5KVVA 4EHDA 2YX1A 3IDZA 2GPWA 4QYSA 2GF0A 1KORA 4F5ZA 2NT3A 1DQNA 5T4HA 4YRDA 2HLPA 4DHWA 4RTMA 5JDIC 3LIPA 4AMZA 2ORED 4GI2A 2H92A 3ANSA 4MO2A 4NCKA 1SXHA 2R8XA 1W5AA 5KOIA 2Y77A 1E98A 1UBKS 2F00A 2FZVA 3GRKA 2X14A 1KDTA 3Q88A 4R1NA 3RVSA 4DIFA 4X0EA 3JQQA 1Y9AA 5JVDA 4HAZA 3A4MA 3AUAA 5LLTA 4LF7B 1B3RA 4JHLA 3ROKA 2JF0A 5A9SB 1BE6A 4EFMA 5CB4B 1FFEA 2EJCA 4ZV4A 1HFEL 1XMSA 5KTYA 4KO2S 2VNIA 3KDAA 4JASB 4D26A 1KHTA 3UT6A 1IDN1 2WUDA 4GR5A 3STUA 4D02A 4XSGA 1GARA 2A1UB 4AD8A 2V3WA 2AYYA 5F3WB 1VIMA 3D4PA 5KSPA 4KVGA 4N40A 1R6TA 2WTEA 1H05A 3VYVA 3GPDG 4YT8A 2JIBA 4FMCB 1FSPA 1I2CA 3TZKA 4X7MA 2D7DA 1CR4A 3HCBA 5JCJD 1J09A 3HXQA 1MHTA 2R7AA 2VIIA 5AOAA 1E0SA 1KJYA 4KDCA 4OAQA 5AD1A 2RH4A 3VM6A 4BVKA 3KC2A 1UKBA 4RD3A 5TJHA 4F9FA 1WU8A 4H1WA 1K7XB 1FXSA 1DIAA 3IQGX 3M4JA 3RFFA 4QGSA 5JV5A 4Q05A 3I01M 1O87A 1R9NA 4N6GA 3RK4A 1ZICA 3GRRA 4GHWA 4FFPA 1H42A 1SCDA 3IP5A 1PW7A 1V25A 4QXRA 5F1OA 3RABA 4ZYYA 3AIOA 1PUXA 1YQDA 2VYVD 1P9OA 3V1MA 3AUTA 4NCBA 4D79A 1UZAA 1TKAA 4XJSA 4CM9A 3RFCA 3BWBA 1A50B 3QV1A 4R8VA 1IIBA 3PL1A 4XB2A 4NTZA 4OF4A 3MJFA 1L4EA 5T67A 4DDMA 3LWBA 3VR6H 3RE1A 2FEPA 3PD7A 3PQ3A 3TM4A 1I2DA 4N65A 4EK9A 3GJ8A 3P27A 4KOEC 3G2QA 2WP0A 4DV6B 2F4NA 4X9XA 3AILA 1R6BX 4JLAA 2DR3A 3IP1A 4J0DA 4XDHA 2RH8A 4JEIA 2D13A 4PX5A 4DPLA 5BY2A 4R0NA 1NQOA 3O3OB 3S68A 2QSJA 4YC7A 4WJZA 3MXOA 2HA5A 2PQMA 3B1JA 1J9GA 3F9IA 4HAVA 8ABPA 2C0QA 4F71A 3KKMA 4DMUB 3AP1A 3B1VA 1NQXA 1ZH6A 4XFJA 3O47A 4B87A 3BJEA 4KX3A 2VHZA 3CR7A 1PNVA 2P8SA 1CZUA 2C2GA 4LJRA 2ACKA 3A6ZA 4CMBA 1Y9JA 3BXPA 1Q1EA 1R7RA 3ECSA 3IAUA 2JIQA 2OZKA 1GA6A 2IZ6A 3TZCA 4KO1S 1ZCFA 3PHCA 4AS1A 4F9TA 2JI8A 2BELA 4ML3A 4IZ6A 1HG1A 2PVSA 1PD1A 3AW8A 3CLHA 3P9YA 1T9AA 2ASVA 4N3AA 2CMKA 2J59A 3IMKA 4TZ6A 1JJIA 5ICSA 4GI5A 2I3DA 4URYR 1MTOA 4Y9UA 5DBEX 4NPCA 2PN1A 2BGUA 5SICE 3IQHX 2H1OA 2DB3A 1I4OA 3WRYA 1O5IA 4W8HA 4EKGA 3L6CA 1T6XA 3SP1A 4KE9A 1BU5A 5EOVA 4QUBA 1QR6A 3DVRX 2J7KA 4W9NA 1WJGA 2FEAA 1WY7A 2A59A 3CNNA 2ORYA 4C04A 5C5EA 2Y1GA 1SCUA 2QD4A 5JQGA 2QX8A 5F23A 2QYSA 4CLXA 1GGNA 3GGSA 2JLUA 3R4CA 3QFFA 1YR1A 2GERA 3HBAA 3E3MA 3AV3A 1T9HA 2C00A 4PG7A 4C0BA 5JS6A 2QTCA 2MYPA 2NO6A 3DE7X 3QTBA 1GL7A 1YH3A 4FT4A 1SVLA 4LEIA 4YRNA 2FVYA 3O0DA 2V6FA 4BJ1A 3U16A 3VNVA 3I39X 5HIMA 1TB4A 4QPZA 3REQA 5J58A 3V4ZA 4J94A 1N33B 1JLMA 4B7AA 2QNBA 3BS4A 1ICIA 1QO0D 3KSZO 3B38A 5BR1A 2GMWA 4EA9A 5HZGA 5HBRA 1ZJWA 4WN9B 4LHEA 4I7EA 3LYUA 1JPNA 5EJ7A 2Q5QA 5SYMA 3EW9A 3I2FA 5IVKA 1TKRA 4MVJF 2C4NA 1Z2EA 4FBGA 1RQXA 2IYVA 4IDFA 4C07A 4INPA 1DDOA 3DMTC 1TPZA 3E5NA 1HDGO 5C53B 4ETNA 2FZ5A 2E9SA 2HK6A 2D1RA 2EL7A 1PFUA 4AKIA 3S27A 4OMCA 3GGDA 3AERA 4EKNB 1ZK3A 4TWRA 3TZQA 1BIFA 2WA1A 3QKRB 3OPVA 1AKNA 1NVVR 2P2LA 3LDGA 4BX3A 3NXKA 2QUJA 4O63O 1I36A 2BHRA 3OO1A 3DPIA 4UCQA 3L5OA 2QM3A 5DTRA 3UC5A 3SWWA 3BXOA 4H6VA 4CUKA 2EDCA 4TXHA 4GUAA 3SXUB 2IUTA 3CX6A 1MZPA 2OGSA 1OCEA 1YRHA 4BP3A 1EVLA 2UZIR 1N2OA 3UB3A 3V1UA 1PBNA 2PYDA 5CAEA 2GEVA 1M1XB 3HJGA 4TLLB 1NW5A 2HLNA 1E1QD 3DDSA 3MHPA 4FLFA 2I1VB 1UJBA 4IH4A 4UVHA 3JQPA 4MP8A 2PRSA 2ERCA 5E6UB 1GJRA 3VJMA 4B3MB 2C8JA 3QGMA 1GYQA 2HJVA 4MQMA 3Q8MA 3CNOA 1WSWA 5CT8A 3JVUA 2XQJA 3LGXA 3AUSA 1D1TA 2E48A 1YZGA 3DV0B 4D5EA 3IPCA 1JR6A 1Z18A 3RG2A 3EWSA 3RVOA 1LK5A 4PSDA 4Q6WA 4REQA 3T7AA 4D57A 3ER9A 1WBDA 4LVCA 3W5BA 1D2HA 1S6YA 2ISQA 3NX4A 2BE9A 4PO1A 4H08A 5B3JC 1KI7A 3S8MA 1F5NA 2W2VA 3HUUA 2GJ4A 2IBTA 1FQJA 2ZIFA 2WJIA 2JVJA 3IB3A 2VF2A 2WF7A 5G1NA 5AHRA 1P6QA 2H6EA 4CT4B 2J87A 1F2VA 3HJTA 4G5RA 1VPVA 1D1PA 4GX0A 1UQRA 2NTYC 3FCOA 1EIZA 1MG0A 2R79A 1L4BA 3L0PA 3P4YA 1Z0IA 4EJSC 3FUWA 5IAAA 3ELWA 4MTLA 3DVSX 4EGFA 2P2SA 5FTJA 5HM8A 4HFJA 1KK0A 3KRTA 2QE6A 4YJFB 5D3KA 2C2MA 1UBUS 1ISGA 2JCGA 1K5PA 1IOZA 2WKWA 3PEFA 2X41A 4P4SB 2LXNA 1QP8A 3AI7A 2X15A 4OJNA 3NONA 3ROPA 1O94A 2W6JA 2I9PA 3QIVA 5AO9A 1BCRB 3LY7A 4X20B 4GLFA 4ALNA 1TADA 4JA0A 3R75A 3ROEA 1M10A 2JIDA 2XQVA 4G97A 3X2SA 2IEBA 4QVGA 4XGNA 5D87A 1U0FA 3T7KA 2H54A 4A8HA 4ALMA 5JR3A 1GPNA 1VA5A 3L7LA 3CWCA 4DREA 4BO9A 4QREA 3UW3A 4X8LA 4EI7A 3W5UA 5HA5A 2H1VA 2CLKB 3NTLA 1MX5A 2BKVA 4G0YA 4JHXA 3H18A 2OMEA 3BL5A 2X8JB 5JHHB 1ZA2A 1FDIA 5AXCA 2O7NA 1U2DA 3PIRA 5AKGA 4BFZA 2J9ZB 2GAAA 1D03A 1D7AA 1XOIA 3COZA 2JLSA 2MYTA 3IPYA 3FM9A 3MWEA 2YHAA 2PQ2A 3IR7A 4JOCA 4NV3A 5CIWA 5TVKA 4BNWA 1MF7A 1D4ZA 3GAAA 4KSBA 4ZEVA 3ZS8A 2DJIA 2QDXA 4L72A 5LN1A 3TD6A 4N7BA 1TCVA 1C0PA 1CLUA 3DEYX 4FCCA 2K4MA 3OOJA 3CX3A 2HV9A 4R1QA 4LXIA 4C4YA 5CCXA 4GPZA 1TM5E 4JOSA 3V8MA 3W78A 4ZAFA 1WMDA 4JGGA 1M34B 4EHBA 1JHZA 4KQ9A 4BJ5A 3UAYA 3KHKA 3TB6A 5AM2A 5KTNA 2OVFA 4O2BB 2AE2A 5AW5A 4YIHA 3R5JA 1GPYA 2BEWA 1QDLB 2EKBA 2QMYA 5D85A 1H6DA 5FI0B 3QG1A 4LJ9A 3UJPA 3ZQJA 1DKUA 4D9FA 2BZSA 5E9QA 1XZNA 3A27A 3SPXA 3ZDRA 5K3CA 2VDRB 3D8SA 3DQZA 5AK6A 3DE4X 4IINA 5JQWA 1A3CA 2OUKA 2Z08A 2Q4TA 5MGNA 1HE1C 1FSZA 3HU5A 4M0DA 5I7FA 2ZYVX 3W8NA 4ISCA 3IXMA 3WGYA 1UBLS 1TO6A 3A4YA 2XUIA 5BQPA 3E35A 2P67A 5CYPA 2AT1A 2M6RA 4UEJA 2A9KA 1OJ7A 1M54A 3PQ5A 5IP5A 4IHKA 4ZI5A 3X1YA 1ULHA 1B1AA 1V5EA 1YCFA 2UYOA 2VCEA 3EVDA 5LA6F 1CY7A 3EX7C 4DARA 2LKDA 5DGCA 5BYJA 3L0SA 2BFBA 4FW9A 1RRPA 2H2FA 3KOOA 4LIPD 2O19A 1F8FA 1HUQA 4K6KA 1HTWA 4O33A 1RS0A 5JDCC 1G60A 2D1TA 1AMOA 2H4FA 5EJMA 2WTUA 1TGVA 3AHFA 4RV5A 2EFJA 2OAQ1 4ND8A 5FV4A 4V02A 3PNLA 3GLFE 2H7XA 5BT8A 2I62A 4DSZA 2WOOA 2ZJAA 4LZZA 1W0JD 5AKHA 3T8YA 3R0QA 3H8VA 2ZCUA 5K8CA 1SKAA 3ILXA 1U9IA 4LRTB 3IYLW 2IF0A 3OZXA 4MKFA 3ZWVA 4EF5A 4P93A 1CJKC 3AF5A 1U9CA 3MC1A 4Z5XA 4G0XA 4K3UA 3VTFA 5AKEA 1VKJA 1QE0A 2O7SA 1OE0A 4YQFA 5I7SA 3CZMA 5EQDA 4CTMA 5FHRA 3JYNA 3EZ6A 4WSOA 1OT3A 5JMPA 3WZ2A 4GE3A 2P6NA 3CVWA 4S0XA 4C89A 3H11A 3KT3A 3Q85A 3VU9A 5LOVF 4PZLA 1Z2AA 2ACWA 1XJWA 1L7EA 3PP8A 4A8TA 1A9ZA 3WNZA 4BGUA 1YAJA 1M9NA 1CHNA 1GTRA 5KCZA 2P68A 1JLKA 3GRZA 3S70A 1MB9A 2JD1A 3W6ZA 2IBSA 1H0SA 4FR0A 2IYYA 1WDLA 4QDKA 4KFSA 1AKVA 4OQYA 1E5VA 4HGZA 2RG7A 1WS6A 2NVWA 5C7YA 2ECFA 4GPAA 5PNTA 2GB4A 1MDBA 3C6BA 2WJHA 3L46A 4OOEA 2NGRA 1JLHA 2YJ3A 4NH4A 5HF8A 3RC9A 4OL0A 3JQEA 1PFYA 3P2YA 4A26A 4ALKA 3AR8A 2VSFA 1Y8QA 4UHHA 5JSYA 2HFJA 1T6ZA 1KKLA 2HYDA 4B5KA 2VJOA 3LX6A 4LFBB 1AA9A 3LUAA 3KOZA 1UFVA 5D01A 3B8EA 1JI3A 4UVGA 4ZO7A 3THXA 4JB2A 3B60A 1Q7EA 4I2VA 4G23A 4NESA 4X63A 4OJMX 1X8KA 2R84A 1OYYA 4MVJP 5CFNA 4E0BA 4PICA 1TM4E 1KA9H 5GZ6A 2AV6A 3PUHA 2OECA 3B5JA 4YR7A 3OU7A 5L3ZA 4PNZA 3R0ZA 1JFSA 2CNLA 1G5TA 1PQ4A 4CTKA 3IUJA 1RRFA 3PGKA 1SK9A 2JJMA 4HWPA 2JLQA 3A11A 2QN7A 4RBNA 5GTDA 5LZ9A 4ZOBA 1QGUB 3W6PA 5KQMA 1OFVA 3IAHA 3ZOZA 5EMMA 1G63A 1LZLA 4GLBA 5FCDA 1GQ2A 3R9KA 4R68A 4DFDA 4YQYA 1NQWA 3QMMA 3IBFA 2SKEA 1DUIA 1L9XA 1PZEA 3K94A 4WXMA 2YV4A 3U37A 1RWQA 5K4GA 1Q22A 2CJWA 3BE6A 2FV8A 2ZTSA 2VUHB 3D64A 3LT5A 3V55A 2XQKA 3OPYI 5JCOC 2B1RA 4OM7A 1YS6A 1XTJA 2QOEA 2YFHA 1EVIA 1H3FA 3OIYA 3CNHA 3TCXB 4MDHA 3LGSA 1VJ5A 3NUQA 4DJ5X 3PTLA 1P62B 2B34A 3SBDA 3IS3A 2IS4A 3Q41A 4IGEA 4RA9A 1VI2A 3PXUA 1E6EA 3AEKB 4AKGA 2IPLA 4Q00A 1OD6A 2YJGA 3VYTB 3W2EA 3OKPA 3KDPA 3WGHA 3WMFA 5FWXB 4BE9A 1R5BA 3EH2A 1N6IA 2NSYA 2O05A 1MNAA 2I2DA 4PR0A 4OP1A 1CZLA 3I9JA 4RHFA 3MJVA 4ZV7A 2NUTA 3WP1B 3ZKWB 5F1YA 4EJMA 4B4DA 2OESA 8MHTA 3GL9A 4R8LA 1G3MA 2OK7A 4M0LA 2G83A 1EVQA 2IW3A 1GDDA 3UIEA 4MP6A 4AUMA 1CDDA 1MIOA 5H70A 3UGJA 4OX9B 3MM4A 4FZ5A 3C3KA 3IJPA 4XUDA 4K6HA 2P69A 1KC1A 1OBFO 3IOBA 3NZEA 3QUTA 4X24A 3I6IA 4R71A 4ZCLA 1VCHA 2YNMC 5AW4A 1Z2OX 3IEUA 1A82A 1QMGA 3IHWA 2JCYA 4INJA 4G1UC 4R1TA 1G19A 1K88A 3G68A 5I5GA 2KS6A 2PMKA 5FOWA 4DIMA 3UHFA 3M4ZA 3O4IA 4G5XA 4FCVA 1HT3A 1T6BY 2E6UX 1BS1A 2V55B 3EEIA 4PXYA 5HF5A 4UHEA 5A04A 4ZK6A 2FRDA 1H2RS 3I8XA 3RUCA 5J2UA 2FWJA 3O5AA 4ZO6A 3RSZA 4BNIA 1DTSA 2XD9A 4IKPA 3CRNA 4MS3B 1RPNA 1W5FA 1D0SA 4DDHA 2VDMB 2Q4OA 4XCQA 2IHVA 1QIKA 4I46A 1EFPB 4UEQA 4WBXC 4AN1A 1SOAA 3Q2OA 4PRKA 1ESZA 3ZU4A 5EVJA 2XB2A 3CGGA 1CWUA 5AHXA 1KFKB 4I4IA 4YRBA 2OEPA 3SR0A 1VIYA 2DQ4A 2ZUVA 4EEZA 1UJMA 1SC3A 1U5BA 2ACEA 2ONZA 2ZJ7A 4IFTA 4WOBA 2ODPA 2Q7OE 3HG7A 1WUIS 1WZNA 3BMNA 2WKRA 4XJTA 3EGDA 5JSKA 2IYOA 5KU1A 2I54A 4JJZA 5KQPA 2FW6A 1N77A 1N9ZA 1GD1O 2WV7A 3EZYA 3MTBA 1HT0A 3KTOA 3VH4A 1I0LA 2VBCA 1PG5A 2WZBA 2PZKA 2Z2JA 3DCNA 2P5UA 3FWZA 4CFYA 1VECA 1WHTB 2GLUA 2GPBA 3H7AA 3NOQA 3KSAC 1U6KA 1VSVA 2VWQA 2ZJ4A 4BV2A 4BMNA 1H2FA 2YWHA 4IVQA 3JQCA 4BAZA 5LMZA 2UZ3A 1LI7A 5BV2P 3B6ZA 5G3ZA 4Y0AA 3KHUA 4EO4A 3D2BA 1WXIA 3ESBA 4U02A 1EZZA 1V39A 2IXFA 4YK7A 1QG6A 1PR2A 5JEEA 1DOZA 1LSUA 1QE3A 4YHBA 2A8YA 2YYSA 5ARBA 1NNUA 5FP0A 3CUVA 3ZCPA 3K4HA 4WA7A 1QGYA 2VK4A 4K28A 1O1YA 3EOBI 4UNSA 4ANFA 3NHKA 5HILA 2POQX 3LMKA 1PX0A 1SD5A 3S5JA 4DXAA 2RONA 3PCXA 3C98A 4DOMA 1JE0A 5JNTA 3RS8A 3ZVLA 1ABFA 2B8JA 3Q7RA </