4OA5A

X-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah solved by iodide sad phasing
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
b'SKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase family protein
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
source organism Anaplasma phagocytophilum
molecule tags Transferase
total genus 76
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.-:
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4oa5A00
1P39A 2EFJA 2AOVA 3KU1A 4C04A 3FTEA 5JUWA 5CM2Z 5HIMA 3NJRA 1NV9A 4M37A 4R6XA 1U2ZA 1R18A 5EEHA 2OO3A 4G56A 3SSMA 1VP3A 3G5LA 1HNNA 4QTUB 4HH4A 1ZHFA 3B3GA 3HVHA 3IEIA 1N7IA 3DMFA 3KR9A 3OFJA 5DM4A 2UYCA 5FWAA 3TR6A 1G6Q1 4HRAA 1R8YA 1V39A 3TPZA 3G8BA 2AVDA 2VDWA 2FHPA 5E9QA 3TMAA 4RYLA 2OY0A 4M38A 3HEMA 2NXCA 2YXEA 3DOUA 5DX1A 2ONYA 2PXAA 4QPPA 3CVOA 5CCBA 4BLUA 2G1PA 2GPYA 4MHTA 3FYCA 4RVDA 3P97A 1D2GA 5GWXA 2Z6QA 3M6WA 3EVAA 3OZRA 3P9IA 3RIEA 5CCXA 5EGSA 2ZFUA 3LX6A 2PX2A 1BKYA 4PGHA 1JG3A 2QYOA 2K4MA 2FPOA 1X1DA 2YXDA 4E2ZA 4PNEA 4GOLD 2OYRA 1AQIA 1R00A 4QDJA 2Z6AA 3MHTA 1G8AA 4AZSA 1G60A 4AZTA 3GO4A 1WZNA 1P1BA 4CTKA 1VBFA 4KVZA 3NTVA 5FHQA 4BLVA 1H1DA 3DMGA 3HCFA 2C7QA 4OA8A 5DTRA 1QYRA 5FQNA 3HCBA 3MTIA 2IH4A 1XJ5A 1KYWA 3FUVA 2R6ZA 3T7TA 5CD1A 3NVMB 3A7DA 1ZGAA 3UZUA 3UJ8A 1VQ1A 3Q87B 5LR6A 1YF3A 3QOXA 3M6XA 4HTFB 5G02A 3C6MA 2QRVB 3LCCA 5HEKA 3EMDA 3GCZA 2JHPA 1M6EX 3OE5A 2ZWAA 5ERGB 1KR5A 1M0EA 2PLWA 4DA4A 1F38A 5DWQA 5GOZA 2FK7A 3TOSA 4E32A 1NT2A 1HMYA 3PLAE 2ZZNA 3CKKA 4POOA 2YXLA 4QDKA 2P7HA 5DXAA 3DH0A 2GLUA 2BH2A 4F85A 2ADMA 1DL5A 1XXLA 3B3JA 4C4AA 2ERCA 3HVJA 4RTOA 1M6YA 4LWPA 4YUZA 3LKZA 4PYQA 3FPJA 5EHGA 1NW3A 5EKXA 5HFJA 2B3TA 2WK1A 4FT4A 3DULA 3TQSA 2G71A 2DULA 5EIWA 3FYDA 1NW8A 3O31A 3QOWA 3NW9A 5DSTA 3SX0A 3C6KA 3I5UA 3FUUA 3OCJA 4QVGA 5F2OA 3SXJA 4BLWA 4U7TB 4NECA 3KQVA 4HGYA 3ER9A 1SG9A 2OPBA 3AXSA 4Y30A 2B78A 3P9CA 5K0FA 3NDIA 2IBTA 2IP2A 3AWIA 1IXKA 1QZZA 3KR2A 4P58A 5FA8A 2ZW9A 2AOUB 1XCJA 4CWAA 4PYKA 3KQSA 5DLYA 5IH3A 5LQAA 4E2YA 5GIOE 3CGGA 4FP9A 4YUVA 1JTEA 3KQYA 5HIKA 4RTMA 1JG1A 5U4XA 2JHAA 4DCMA 5BW4A 5DM2A 1RI4A 4V0RA 1YFJA 4LG1A 1T43A 2I6GA 3BKWA 4R05A 4DCGA 5K09A 5K8VA 2ONZA 3GXOA 5D1HA 2A14A 3OPNA 2VZ9A 4YV1A 4RVFA 1TW2A 3BXOA 2ZIEA 5EQJB 4PWYA 2PX8A 3GRRA 3T7RA 3JWGA 3IYLW 1XDZA 4C07A 1FJXA 5LSAA 3CCFA 3P2IA 5FCDA 1P1CA 4U7PB 4OBWA 5HOQA 4LECA 1X1CA 4P7JA 4RV9A 4RTNA 5MHTA 3GU3A 1I1NA 1UFKA 3LPMA 4M36A 1SKMA 2NP7A 3HNRA 1KPIA 3LSTA 3R24A 5E8RA 5FHRA 3S68A 1KIAA 3H2BA 4PYJA 3R9XB 2DPMA 5LQRA 4P7KA 3HP7A 2O05A 2ESRA 3LBFA 3O7WA 3KPYA 3R0QA 4K6MA 3DXXA 2AN5A 4R8RA 1YFLA 3PB3A 5DTMA 2NNWB 2CKDA 2P8JA 5DRYA 4L7VA 3VSEA 2BR4A 3FPGA 4BY9E 2AOWA 5EHIA 5E1BA 4YMHA 5E1DA 5CVUA 1WG8A 1Y8CA 4ER6A 5BXYA 4RTRA 2V7EA 5KQSA 5EKUA 4YMGA 2UYHA 5CIYA 2Z6UA 3OZSA 2IFTA 3UFBA 4GOND 1KXZA 1VIDA 2O06A 3FRHA 3ID6C 4IWNA 3BWMA 3EGVA 2ZIFA 2HWKA 3DLCA 4YUYA 4FSXA 2QM3A 3MAGA 2H1RA 3IHTA 1JSZA 3LDGA 3PVCA 3TKAA 2AN3A 3L8DA 4RTLA 3TRKA 4CKEA 3B89A 3QV2A 3MB5A 1BC5A 2KW5A 4KIFA 3PX3A 1IM8A 2AOTA 2N47A 5EMKA 1XVAA 2HV9A 3GRVA 2OBFA 1EAMA 3TM4A 5HIJA 3NVKI 1O54A 2P1DA 4KDRA 2E5WA 3EVEA 4RVGA 1I9GA 2AS0A 3FUWA 3P2EA 4ZTBA 4C06A 1NW7A 3R6TA 5T6BA 4WXHA 3PFHA 3DLIA 3HCDA 3LDFA 1ZKDA 2AVNA 3FZGA 3GDHA 4H0NA 2JH9A 2XYQA 1SQGA 4GQBA 5LQNA 3A25A 2I7CA 2Y1XA 4E31A 5EZSA 3ORHA 2CMHA 1YZHA 1UIRA 3KQOA 3BT7A 2FK8A 3TM5A 4QQNA 2PWYA 3G2MA 4DKJA 2GS9A 2ZZKA 4EMSA 3UA3A 5KYGA 2IIPA 3M70A 3PT9A 3FPHA 3FTCA 2FYTA 3VC2A 2HNKA 4FT2A 4FS8A 2PV0A 5EPEA 3ANXA 5GINE 3BKXA 5E9WA 4ATNA 1NKVA 3PS9A 4PYOA 5EG5A 1RI1A 3T7SA 3B3FA 3GIWA 2BR3A 3C3YA 3UJ6A 3DR5A 4PYNA 4OQDA 5K0EA 9MHTA 4MWZA 1YZ3A 3DXYA 1JSXA 1R6AA 4FGZA 4F84A 1ORIA 1WS6A 2YUIA 2QY6A 3CJQA 3C3PA 4GBED 3DMHA 4KDCA 5CVVA 4XUCA 3OU7A 4PCAA 4CKCA 5DSXA 3ERCA 3HA3A 5HZMA 3TKYA 2P7IA 5T67A 2P3LA 2I62A 4O29A 1QAMA 5FWDA 3UJ9A 4CXMA 3PFGA 2UZ4A 4IV0A 3V97A 3GRZA 4RTKA 2Q41A 4HTFA 3ELYA 2QRVA 1VL5A 3A7EA 1Z3CA 3GRYA 3HCAA 4ER7A 1RI5A 3DP7A 5C9ZA 5E1OA 5FQOA 2XVMA 2OZVA 4LWOA 4DZRA 5FADA 3HA7A 2ZWVA 3GNLA 1RI3A 3E05A 4M7RA 3KQMA 1ZQ9A 2ZBPA 4XUEA 3REOA 4DQ0A 5GIPE 3UJ7A 2BM8A 5DM1A 3ELWA 4MQ4A 1TW3A 2PT9A 4QQKA 4DF3A 1EG2A 7MHTA 1JR4A 5GM2A 4RTQA 4MTLA 4ER0A 4YUWA 3EVGA 3BUSA 5FTWA 1KYZA 2ZTHA 1PJZA 3I9FA 3G89A 1ORHA 2G72A 3M4XA 4EKIA 2H00A 2G8NA 3HM2A 2VS1A 2XYRA 3Q7EA 4R6WA 1XDUA 3LDUA 3ELUA 1RJEA 2PVCA 3SGLA 5E9JA 4C05A 1SUIA 1XDSA 10MHA 4PYMA 3KPUA 3SMQA 1L3IA 3FPFA 3OE4A 1FP1D 2WA2A 3BGDA 3HA5A 3FUXA 2UYQA 2IH2A 2IDKA 4FZVA 1TPYA 5E8JA 4CTJA 3C0KA 3GJYA 5CVDA 4BP1A 3EEYA 3G7UA 3A27A 2ZZMA 3OFKA 2YVLA 1KPHA 3D2LA 4XCXA 3HCEA 5KVAA 2ZULA 1VE3A 3NDJA 3RODA 4RWZA 5K01A 1L1EA 1WY7A 3SSNA 3TLJA 2P3QA 2P35A 2NXNA 3UJBA 2O0LA 3VC1A 1QAQA 1DCTA 1P91A 5DX0A 2BM9A 3X0DA 4YV2A 3O4FA 3FPEA 1G55A 4MIKA 4PCLA 4QTTB 2CMGA 4FSDA 2PX4A 3G88A 3OU2A 5E2BA 5EC8A 4AZWA 3K6RA 5LQJA 2PGXA 4E33A 5K03A 1FBNA 1L3BA 1QAOA 3KQQA 4OBXA 3ME5A 2BR5A 3TFWA 5K05A 4IV8A 4WVLA 2BZGA 2JG3A 4OQEA 1R74A 3LBYA 5EMMA 2PXCA 2R3SA 2IBSA 4E70A 3KR0A 4KRGA 2C7RA 2B25A 3EVBA 2PSSA 1EJ6A 3JWJA 3KQPA 3B7PA 3E7PA 1I4WA 3OZTA 3EEOA 1G38A 3LECA 3MCTA 3CC8A 2EJTA 4Z2YA 1X1AA 2HR1A 4FR0A 1BOOA 5DT2A 3BZBA 3HCCA 3WSTA 4C08A 1L3CA 1Q0SA 4PONA 4KWCA 3M6UA 1X1BA 3EVCA 1Q0TA 4QPNA 2NYUA 3PX2A 5C1IA 3MQ2A 3SVZA 1VLMA 2GH1A 4RTJA 2F8LA 1XTPA 1JG2A 1JQ3A 2EJUA 2H11A 4X63A 5ICFA 3THSA 5K0CA 2P3OA 2EX4A 2HTEA 3P9NA 3FTFA 2ZLBA 2IPXA 1OR8A 1NBHA 5LQKA 3ELDA 3LCVB 5LQCA 1KP9A 5EMJA 2HMYB 4DM3A 3CJTA 3VYWA 1QANA 2FRXA 2PXXA 4YUXA 1N2XA 3OU6A 4EKGA 2QE6A 3ER8A 3HTXA 3I64A 5LQUA 1X19A 4PIMA 1AV6A 5GP1A 4X41A 2OB2A 1N7JA 2IDJA 1G8SA 3EMBA 3V8VA 1SQFA 4A6DA 1NV8A 1VP9A 4OA5A 3MCZA 3EVFA 3FUTA 1YUBA 4JXJA 1PRYA 1FPQA 3NWBA 2PX5A 5ICCA 2AN4A 3KPWA 2ZCJA 2OXTA 5K0GA 3LCUA 4PGGA 2C7PA 3LHDA 4X60A 5BP7A 1RJDA 1D2CA 3EVZA 1NW5A 4F86A 3LGAA 5HILA 1AQJA 3UJDA 3PTAA 1RI2A 5CVJA 2WA1A 4RTSA 5GM1A 5FULA 1EJ0A 3R3HA 1MHTA 5T64A 5ICGA 3BGVA 4RVHA 2CWWA 4V0QA 2FCAA 1KHHA 2PT6A 4ISCA 3E8SA 3KQTA 5DRTA 5EEGA 3U81A 3HVKA 3MERA 1EQAA 3SSOA 3UBTA 1RJFA 2YX1A 1R8XA 2EG5A 5F2KA 3FRIA 4P7FA 3MGGA 5DPMA 4EQZA 2VDUE 2P40A 1DUSA 1INLA 2VP3A 3BGIA 1JQEA 1JG4A 1D2HA 5F2NA 1SUSA 4GC9A 3DXZA 5B1SA 2G70A 4AUKA 1WXWA 1SVUA 2YR0A 4UOEA 1VPTA 2YQZA 1NE2A 2PY6A 5DM0A 5P8WA 3P8ZA 4HGZA 4QVKA 5DXJA 3KPVA 2GAFA 3MTEA 4RX1A 1WXXA 3BWBA 2AOXA 5EOVA 2PJDA 4CKBA 2JHCA 5EMLA 5KQRA 3EGIA 2OB1A 2B9EA 3KPJA 1ZG3A 5HIIA 4A6EA 2P41A 4AZVA 3G2PA 4BP3A 2XYVA 5ICEA 2NP6A 4EK9A 5D1NA 2YTZA 3UWPA 2C7OA 1KPGA 2ZVJA 3EGEA 3EPPA 3UA4A 4AX8A 2ZIGA 5JR3A 4KW7A 4RTPA 3CBGA 3G2OA 3P2KA 2OKCA 3P9KA 4GUAA 5H02A 4RSRA 1XCLA 1AF7A 2AOUA 1EIZA 1O9GA 3JWHA 3CJRA 4GC5A 4PYIA 4PINA 4XUDA 3A26A 3NMUF 1NBIA 2V74B 2UYOA 3AY0A 3KQWA 4HG2A 4ER3A 5M5BA 2GB4A 2LD4A 2ZSUA 3GGDA 3BWCA 3KR1A 3LL7A 4EVIA 3G5TA 2Y1WA 3UJAA 1RJGA 3FTDA 3F4KA 1YB2A 3HVIA 5E1MA 5E2AA 2AR0A 3SM3A 2IH5A 4GOOD 5K0BA 3JWIA 2PKWA 4KIGA 1B42A 2ZBQA 4HSGA 3AJDA 3G8AA 4HC4A 2O57A 4B17A 3DTNA 2XVAA 5CUQA 1NW6A 5C0OE 5BW5A 1MJFA 3P71T 4Y2HA 5IKMA 2XBMA 1IY9A 2VDVE 3B5IA 5K0LA 3SR4A 4C03A 5CVEA 3I53A 1O9HA 3AXTA 4ER5A 2JH8A 3IV6A 4GF5A 3G2QA 5K0JA 2NXJA 4X61A 1JTFA 2PBFA 3M6VA 4IKPA 2IGTA 2I9KA 4DMGA 2CL5A 5DX8A 2ORED 2PWPA 5FA5A 3KHKA 4E30A 5EVJA 3BWYA 1JQDA 4GEKA 5KS2A 1L9KA 2NXEA 4R8SA 2ZBRA 3THRA 5FUBA 5DTQA 5K0NA 4E2XA 3T0IA 3KKZA 3K0BA 3A4TA 1BHJA 2GA9A 1FP2A 3E23A 4P7GA 3NWEA 3M33A 4PIPA 3DUWA 4E2WA 5EIFA 3GRUA 5EZQA 8MHTA 3I58A 4GOMD 1F3LA 1ZGJA 3UJCA 3GWZA 4OX9Y 2O07A 3LKDA 4YV0A 2JJQA 4PYLA 3EVDA 2AOTB 2AZTA 2B2CA 1UWVA 3RW9A 4X1OA
chains in the Genus database with same CATH superfamily
1CLEA 5AI9A 1P39A 4MR7B 2ES4A 3MOSA 2K7ZA 1TO6A 2NUBA 1AMNA 4M1WA 3FMPB 3W5JA 1KQGA 1EUDB 4MLZA 4QWWA 2J0QA 2C2YA 3PCTA 1YRAA 3P0FA 1NG9A 3LFUA 2GM5A 1MTZA 2BF7A 4XB6B 1T25A 1A69A 3IUPA 3CVXA 1SR8A 4B31A 4QXAA 4M6WA 4UJ5A 4MDEA 4MO2A 4TSFD 3VKUA 5GZ1A 2EKZA 1PJQA 1G9TA 3RVLA 4ALLA 1LPMA 2DPXA 1TRHA 3OF2A 4JNCA 5KAMA 1Z2NX 2B8EA 4GI7A 5CAEB 5KCZA 1MABB 1E1RA 3MRTA 3HEMA 5F76A 2DEUA 3WL6A 3PK0A 1X80B 2AKYA 3SX4A 4GZ5A 4A0GA 4B73A 4ETNA 4P0TA 2P4SA 1B6SA 1CV2A 1P4AA 1H6AA 2J6HA 3R8XA 5B3LA 1LJLA 2A92A 2ZIUB 3OWOA 4KO8A 5ALWA 2WHQA 4NXMB 1S9DA 4MW4A 1LKZA 5FBRB 1N0HA 4MRAA 3DZGA 3ZIAA 1O03A 4FNOA 4IYJA 1WKBA 5CHYA 1P1BA 1RQPA 1X8XA 3GT3A 4JH0A 2VQ6A 4RLHA 1YU9A 2EKQA 2F8TA 1H1DA 3P5SA 2BKVA 2WFLB 3B6ZA 3F1KA 1HG0A 2Q2QA 1C9NA 2IH4A 1ZOLA 3D64A 2H85A 4I1RA 3NHAA 1KKUA 5LN1A 2W4IA 3ASZA 2JC3A 3WTCA 2O2JA 3TL3A 2O8EA 1GGHA 3T99A 1WUHS 5SZIA 2ZYDA 3LCCA 3SDBA 3CUUA 2F8MA 3AEQB 3U3OA 1L7OA 1M6EX 1B76A 2W2KB 4MYDA 4KV7A 4MWDA 1C41A 1LPPA 2A4MA 3F4LA 3IBYA 4P4UA 3D4LA 4UEWA 1E59A 5C7YA 2E55A 1U7UA 2DPYA 2Z98A 4P3YA 4BAGA 1CZNA 1DRWA 3CKKA 2WNHA 4QDKA 1GOTA 5AJTA 4JI7B 1DBVO 2GBPA 2VN8A 4Q48A 2OWEA 1EQ2A 4RHYA 2A4KA 5HFJA 1NW3A 2QQFA 1FTQA 4FT4A 3GDWA 5HS6A 4J7UA 3H5NA 1ONPA 4Q47A 3TOZA 4JQZA 3EXHC 3O31A 2IT1A 3X1ZA 2J07A 4TYNA 5T57A 2RB4A 4UFNA 2GJAA 3VZSA 4NXNB 1AJEA 3SXPA 4M9SA 5K0FA 2O8DA 3TPFA 1QGDA 2IP2A 4IDHA 4OY3A 3LV8A 2OFXA 4DCVA 5JFTA 3EXG2 2MOKA 4UUBA 1Y6ZA 3DBIA 1X8JA 4F8YA 4UZSA 3KQSA 5LA6F 1DAMA 1VTKA 3N5KA 5IWAB 2BMAA 1C14A 2JH3A 4TV8A 2ZQZA 1NQOA 2VNHA 1ULUA 3ZLJA 4CMBA 1KI8A 2X7JA 1Q6YA 3K1AB 3U4MA 1YT5A 2G77B 4RZXA 5B6IA 4TSKA 1L5HA 4KFRA 1OREA 2ZB4A 1UBGA 1VSUA 3MTGA 1EXNA 1PJ2A 3RRBA 2ZIWB 1YKFA 4RVFA 3FZYA 4L75A 3B8EA 5EQJB 4YYZA 3T7AA 3JWGA 2J46A 3IYLW 4X9XA 4F97A 1OLUB 3GFPA 3WTBA 1Z07A 4WK0B 4B3GA 3RRFA 4BAZA 3A1CA 3CZ4A 3EHEA 3FVWA 1I32A 1UKEA 4IW3B 5E8RA 4AYXA 1I0LA 3GLGA 2C2HA 3EF1A 3OMWA 4G84A 1JTVA 3VZQA 3S70A 1COWA 2K87A 2P2YA 4LEIA 4ZDKA 3GCXA 1UFOA 3Q6NA 4L02A 4PG6A 4ZVKA 1CUWA 1X94A 3AUUA 3RVBA 4D8TA 5L51A 3AVUA 1SPXA 2Y1KA 3HP7A 2IPNA 3LBFA 4ABTA 4V1CB 2FG7C 2JBAB 2JRLA 1WLSA 2Q8PA 1QORA 2NV2B 4DR2B 3I6ZA 1EFKA 2XMZA 3FIUA 3PHIA 3UPDA 3PWTA 2WPDA 4Y8VA 1YACA 2A86A 2EFGA 2QN2A 4UU1A 3LD9A 1F2TB 1QLWA 1LX6A 3UPUA 3KLOA 1GG2A 5AW7A 2CNNA 3AIOA 3LO5A 3NAGA 2AF4C 2JGJA 4M76B 4X8HA 3FF4A 2IFTA 2JIDA 3FRHA 2ZRGA 2HIMA 3RUFA 3ET4A 3OJWA 4KAAA 3GNTA 2LKDA 3MAGA 4CEHB 1ZCFA 2O3QA 3GAMA 4EFLA 1H9BA 4UBLA 5HHTA 1TT5B 1Q7EA 4RTLA 1RR6A 1C30A 1SXJC 2VRCD 2GRJA 3O47A 4QOIA 2H1LA 4D8XA 5AD1A 4DMKA 2QQEA 1NVDA 3OJEA 3Q6IA 4HDKB 5H59A 3TH5A 2H5EA 2QK4A 3IHWA 4D92A 1FNSA 3PHHA 1J5PA 3LOUA 4XOIA 3DNMA 3EVEA 3G8DA 1RT9A 4DDTA 2RHWA 2ZYRA 3A4LA 3F74A 1EA7A 3HGTA 1SOVA 3PFHA 4F5ZA 4BNTA 3LDFA 4NDNE 4UCQA 1WV0A 2OFOA 1Z2DA 4GSKA 1VFNA 4RV4A 4OTZA 4CF6A 1CUVA 2CMHA 3K1YA 1KK2A 3UMVA 4DRYA 1U63A 3MGCA 4WEOA 4QQNA 3L7DA 3WHIA 2WU0A 3D6JA 4Y2TA 2YMLA 3THWA 3JAKA 3GA0A 1GFZA 1AX9A 1GSAA 1VRWA 3PT9A 3UW1A 4MVJE 3WWCA 2WWYA 1ACMA 3NKVA 4O63O 2KS6A 1ESZA 2ECQA 4D4MA 3JQ8A 2ZJ4A 2QRNA 3PNKA 5H5JA 2IWHA 4D5GA 1JRLA 1YZQA 3QX3A 4CF3A 4ND6A 2IHZA 1SZCA 3RFFA 2X1LA 4Q24A 4KIUA 1X3SA 4Q82A 5BOSA 1BCSA 4QM7A 4JDPA 5I7WA 2QMHA 4MQ6A 1LF0A 2HU5A 5BV0A 1L5LA 1WTCA 1V25A 5CVVA 1BQ3A 3DOEA 2P9HA 3PA6A 4RJJA 4BN0A 1BNCA 3FCEA 3ZY4A 1PFUA 1NMQA 4HAUA 2NNLD 2HKIA 2UZ4A 1UJ4A 3BPSA 3ORRA 3KZ1E 1CC1S 1NVTA 1Y1RA 4BIMA 1IVYA 2Q41A 4QD3A 1XHEA 4LJSA 1NBAA 2WZCA 3IPLA 4CDMA 4D79A 2G63A 4R2HA 3DP7A 1S2MA 2V8OA 3OY2A 2XVMA 2R65A 4RHXA 4IWYA 2D7JA 5T41A 1UAGA 4BKQA 5AK4A 4HDRA 3GNLA 4L9RA 2HWUA 1F48A 3GLFB 2JK0A 5ALEA 4CI9A 3EPLA 4L27A 2HUNA 3UJ7A 1IY1A 5DM1A 2R47A 5IUJC 2XMRA 4EG6A 1A9XA 1LS1A 3H9QA 3V34A 4TGLA 2OQVA 4YUWA 1XRMA 2A1TS 1GNTA 3KCQA 1DKOA 1TKBA 4UUQA 4WLEA 4V0SA 1L5MA 4DA8A 1VLLA 4HEQA 3L1KA 4C0XA 2FP4A 4RCYA 1KQFA 1CDZA 1TDJA 1GZ6A 2BMDA 1RJEA 2PVCA 3SGLA 1S1MA 5CG1A 1HNXB 2VJDA 3DV0A 2P9JA 4JI5B 2QLTA 1T6NA 3KPUA 4B4OA 1EFPB 3DOCA 4I36A 4IY1A 5C8ZA 5MN4A 4HFNA 3DR3A 1AQ6A 4GFDA 5BT9A 1FB5A 1QG4A 3DZHA 2VRWA 4F9TA 1EWVA 4N8EA 2Z8ZA 2X2FA 2XWBF 3WJAA 1U80A 3CRZA 4GUDA 2WVGA 3STXA 4NZPA 2IU6A 4LI3X 2V7QD 3CRVA 3QBVA 3WB9A 4EY5A 5B1YA 2BYTA 4RD0A 4LF9B 1W52X 1FSFA 1ICIA 1QE3A 1OQAA 3LX4A 3LUGA 5DMXA 4M83A 2P6RA 1PGPA 1PAUA 4HHEA 4M0FA 2BM0A 2NU6A 5AKZA 1WPGA 3RE1A 2JVJA 1XCOA 2I6SA 2P0YA 3BCRA 3T1VA 2C3YA 1JB9A 2GCPA 1NVXQ 1GA1A 4P35A 2HK8A 4MGKR 1KEEA 1ECGA 4TM7A 3E9ZA 5JAPA 1J0XO 2X1VA 1P9WA 5E2IA 3PRYA 3TFWA 7MDHA 3IAM6 3GFFA 3MMZA 1AXEA 2CJYA 2OZKA 4E5VA 5JAUA 3EB9A 5I4IA 4UHKA 1RQRA 3I2FA 3O6VA 2P6UA 3IOBA 3MUNA 5KCMA 2WWWA 2C7RA 3J7TA 3OZTA 1E3JA 3TNFA 3RANA 1O95D 2J31A 2C5GA 1KVUA 3L8HA 2MWMA 1V47A 4OI4A 4EKNB 4ES6A 2ZVQX 4Y0VA 4L72A 4BC1A 1NI3A 1YD7A 2CL6X 3H2IA 1DKNA 1D2NA 2J5BA 4LZPA 5AKYA 4KE7A 2HHCA 3PDUA 4YJGA 1L6IA 3BILA 3WDMA 2XQVA 4QPNA 1ZD4A 2YV1A 4OJQA 1BTOA 2QR5A 1J06A 3VNRA 5E95A 1LPNA 2H6EA 4R7ZA 2UV8A 4ZMBA 2O2DA 5A71A 3Q12A 1I4TD 2P3OA 2BC9A 3C41J 5J23A 1UPBA 3EXFB 3OEED 5AHKA 1ENZA 1SCUA 1I3NA 4NNOA 5KWVA 1XU4A 3W34A 2ZJYA 5LQCA 1II8A 5EMJA 3U3DA 4FFMA 1JDUA 5M29A 1XYYA 5AK0A 3T35A 2EF1A 1AKQA 5IP5A 1EJBA 1QANA 4ALIA 1YBAA 4U39A 2W93A 3MB8A 1C4WA 4QL3A 4ZQEA 4XE5A 4IUBS 3LQ2A 1OXUA 1SMKA 2ATIA 2IDJA 4AJKA 2OOKA 3B1KA 4ZCPA 5C1BA 1H69A 1P80A 1RYDA 4KX3A 3STVA 2OC4A 5KNBA 3L4KA 5BWNA 5IJ9A 1L4HA 3DMPA 2BPOA 1N2GA 2GAIA 2RAVA 3N8IA 4Q3CA 1H2AS 1Q6ZA 5ILQA 5JSQA 1DEXA 3LUAA 1R7RA 1A96A 3WYBA 5F23A 1O8BA 1I7QB 4XZ3A 4RC9A 3HN7A 1GYRA 3NTLA 2CDCA 4WLUA 3I01M 2CZCA 3FDZB 4C2UA 5FI5A 1NBME 2DC1A 5HILA 1QKJA 2Q7OE 3GLFE 3JALB 1HYQA 4OU5A 3U7FB 2OGWA 4WY2A 1SQ5A 1EFVA 2HDOA 3C3WA 2R84A 1ZLXA 4BMZA 3ITNA 3NO4A 1QVWA 2WM9B 1IXSB 2QW8A 4WNCA 4BFLA 3FCYA 3HVKA 2BISA 2FB9A 1HH4A 1E96A 4JLAA 5EXEA 3QKRA 2CXNA 4LN1A 4F3KA 3AVWA 3P4XA 4QYXA 3JCZA 1INLA 4IKEA 1UZLA 4NCJA 3LY8A 4R1PA 1M2VA 2CXHA 3QPVA 2B0JA 4ZCTA 5B1SA 3ZTWA 2NQ2C 1VL1A 4WZBB 3WA6A 3AVVA 1UQTA 2O0MA 1U65A 4DYDA 1N3BA 3GJTA 4BMDA 1NJSA 1VIMA 3OOEA 2R5WA 3ANLA 3IV7A 2MSWA 4HEA1 3N7AA 4MRSA 1J23A 3HB7A 3MTEA 1DJNA 4Q5IA 2J67A 4WOJA 5EOVA 1REQB 3V7FA 3WICA 1EZZA 4ZC1A 5HIIA 2JCBA 4DLNA 3OEYA 4MYUA 1JVNA 5JPCA 4RF2A 3FMIA 4NJEB 5IEBA 3NATA 3HJAA 3MYYA 1BWQA 2M6RA 1U2SA 1XDWA 2PGNA 1QU3A 4RM3A 3HQ4O 1CNMA 1NWCA 2UVQA 1H5UA 2OM6A 2VP9A 2X3FA 2YUTA 3LNCA 4KW7A 4RTPA 1CVRA 1YC2A 1OV4A 1NT4A 3RHSA 2XGSA 3BQ9A 4ZIRB 5L6MB 1QRRA 3ZWKA 4BFZA 1CR1A 3QW4B 4M9XA 4PINA 1PL8A 1V4BA 2GBLA 4PYIA 3WLIA 4YCMA 1MPTA 2HI0A 1IATA 4JL5A 4DA0A 4JJAA 1SELA 3H05A 5EKTA 4RZSA 4U0JA 5G0VA 2HT6A 3U44B 2Z2JA 4WKBA 3TCXB 2AG6A 4KIWA 1AUVA 2F1IA 1QOQB 5FPHA 1OA1A 1TCVA 4FYYA 3AF3A 5EESA 3TNLA 4G1BA 4CKXA 3I9LA 1OWNA 4PV7A 1IBLB 1WD7A 2XTNA 3R9KA 2ZIZA 1ORWA 3UV3A 5FTNA 5TPZA 5A0TA 4YLYA 1MJFA 3MCAA 3ZGZA 2I78A 4MI3A 1UBNA 4PSVA 4OGKA 3I53A 2DBRA 4HOYA 4LF4B 2DUUA 1RRMA 1EVYA 1RCFA 2JKYA 1ZKMA 4RY9A 5FBKA 3EJWA 2CJWA 1R88A 3RUPA 3VKWA 3BAFA 5C8VA 1ZJWA 5KBYA 1QHHA 2CE7A 3AUTA 2ZB3A 1D07A 2CL5A 5TPWB 3QE9Y 3QXJA 4JR1A 4JJZA 3M3PA 2XNDD 1T15A 4GR4A 4MRNA 2V4UA 2WSSD 4JOQA 4OL9A 1CQIB 4JJ7A 2IRWA 3RSGA 3P0RA 1ZJJA 3T0IA 1FYFA 1LC0A 2WWIA 1DQPA 1DPFA 1FP2A 1GPLA 2JFNA 3E23A 1JLSA 4PFSA 6REQB 4C7OB 2FN7A 3KVOA 4GOMD 4MO9A 1F3LA 3IP8A 4EGJA 4YAIA 3LKDA 1NPDA 3SZMA 5IM4F 2B2CA 3KV1A 2OQRA 4EEKA 4QG7A 1JGTA 3ZNNA 3A8TA 1WKCA 1ZM9A 4BRWA 4D45A 4JFRA 1J0DA 2FWMX 3CW8X 5CM2Z 1QG6A 4XCVA 2HF7A 1L1RA 1P1IA 4NENA 3PLRA 2MMCA 4I9GA 1CY8A 4LXGA 3W6NA 4KMOA 4X1YB 3I1JA 4QTUB 5F5XA 5KYNA 3HCRA 1KZ6A 2HADA 5C7LO 2QYSA 2Y9PB 2NYAA 1TCAA 3OFJA 4C87A 1PFWA 4HRAA 2AD5A 1WMSA 3KKEA 2D2FA 2OG2A 3DDZX 4U2KA 4FE7A 1VFPA 1NOKA 2I7XA 1M2JA 2REXB 4TYYA 3COPA 3RTGA 2OY0A 5MF6A 1ESEA 2VNKA 2VPYA 3I8OA 3ZWWA 3H2YA 4QOSA 4BLUA 3DTTA 5KVCA 1CUJA 1HQDA 5CK5A 1X38A 3GK3A 4TKVB 4U00A 1NFQA 4ZYYA 1WXDA 4LF7B 2WJ3A 2ZI7A 2ZFUA 2ZAMA 3FFXA 3MGAA 4R2KA 4X7RA 3T95A 5K8LA 5MFZA 3Q2IA 2HW8A 2K4MA 1XF9A 5DM70 2IPOA 4AMGA 2OYRA 1QC5A 3L0BA 1Y3DE 1WB6A 1G60A 2ATVA 4INOA 4INPA 1BHO1 4OKIA 5EP2A 4EG3A 2UUAB 4WBXC 2CE2X 2IZ7A 3A3OA 3DHVA 3KWMA 3NTVA 2LP4Y 3HWX1 3PL1A 2I2AA 1SUBA 4Q93A 4WZBE 4EEXA 5B7NA 1HK7A 2VYVA 3LP6A 1J2TA 2BJHA 2QLNA 3LWZA 5LZ7A 4AUNA 1KYWA 2Y2UA 3BRQA 2BGNA 3C6XA 5D8DA 4D9JA 4RD6A 7ADHA 4EPYA 4V0LA 4UVEA 1L1FA 1UM9A 1OXBB 2Q7XA 2B8WA 2Y4NA 3C6MA 3UMSA 2XMGA 1IRIA 1ZH8A 5ERGB 4NLLA 2ZJ8A 3RVDA 3JD0A 1AUXA 1L7RA 1R5NA 5CLIA 4YPFA 3WLAA 3U4QB 1E3LA 1W581 3V8RA 2VHXA 3KTAA 5AI0A 4F3TA 3NNDA 3HWSA 5FEMA 2ZXFA 3M2TA 1G3QA 1GGMA 3H0CA 1OUMA 2GLUA 2ADMA 1JUDA 4J2TA 1A8IA 1M6YA 4YUZA 2GKOA 4KYVA 3QWAA 4O3FA 2NMVA 1KFEB 4ZU1X 1Z8HA 2Q3FA 3MLAA 4QAQA 4XFKA 4PFKA 3LQRA 5JOQA 5ECWA 3ZE1B 1VL6A 3IXMA 4CM5A 1U3UA 2IYZA 3D4PA 1B14A 1L5KA 1O57A 1NJ5A 3N70A 3ZWDA 2ZDQA 3H5TA 4N47A 2Q1SA 1N8TA 2X4IA 4D0LB 5KMGA 1T34A 1CTQA 2G17A 2W48A 1X7GA 4Y6RA 4BE4A 1IG0A 4DAEA 2R25B 1QP8A 1EHCA 1E1CA 4WECA 4BO2A 5KTYA 1ZK0A 3EIHA 3HZZA 4RL6A 2D0PB 3I30X 4N5LA 1LSOA 1FW8A 1N0IA 1VXRA 4PAGA 4QUJA 4YUVA 1RPJA 3HP1A 5EE0A 5CYGA 2J33A 2ZE6A 2WABA 4V0RA 2G5TA 3D54D 3L0DA 3BKWA 1QTRA 5ALUA 4XGNA 1MT3A 3KT6A 4QDUA 2WOJA 3EIQA 4R51A 1ILEA 3ZKAA 5E6SB 2J7PD 3BBPA 4YV1A 5JBQA 2ACVA 4KSBA 1E2KA 2RGUA 4KC0A 2VAWA 1TQ6A 2B82A 2SKEA 4GRAA 1P6XA 4S3MA 4WDRA 3WBJA 3Q9SA 3K2EA 3QSYA 3DFIA 5LSAA 1DRVA 4PLFA 4ARIA 3OPVA 1O94A 2CXSA 3L1IA 4FR2A 2IZ0A 4H7HA 4P92A 5GZ6A 5A6SA 5ADVA 3ICEA 3WXMA 3GU3A 2CLLB 2KI5A 3H9EO 4K88A 5IC5A 3D5TA 5JNLA 3LSTA 4LRUA 1F3OA 1JEAA 4DR7B 2Y6VA 3GB9A 3IALA 1M2FA 1QMPA 4EA7A 5LQRA 3C3EA 3MJFA 4FOLA 2OZEA 4RFVA 4Y9RA 3CB2A 3I8XA 3A4YA 4CN9A 3TDKA 3Q0EA 3A6PC 5BURA 4W7SA 4QYWA 4UBIA 1YFLA 1BXRA 2R6FA 3P5BA 2YJ5A 4MPJA 3ETDA 4B81A 4MDFA 4FJ2A 4GP6A 5DI3B 4B6OA 1X3LA 4BFXA 3G2KA 1H1LB 2G1JA 5CVUA 3M4NA 3PHJA 5SY9A 1QR6A 3F49S 1YZYA 5HJ7A 1QYIA 3HCPA 2PD3A 4J03A 4EOGA 3O4IA 4HCJA 2QS9A 4KTVE 3SZUA 3W9YA 1JDNA 1A2KC 4L73A 2MJLA 2OXFA 4RHCA 4X97A 3WXBA 3M0EA 1EXWA 2IYOA 4N9WA 4BX9A 3R09A 3GFBA 1XNJA 4DOMA 1JEYB 4C78A 4D0RA 2DFTA 3HUEA 3C4QA 3CCBA 1TLFA 5EGNA 4PCVA 1M6VA 2H4HA 3BN3A 5DT9A 4XPIB 4BOYA 2Z5LA 5KAPA 3EARA 3JQAD 4DWJA 4KREA 2R85A 3AM4A 4AKTA 1F20A 1U5CA 3DT9A 1O94C 4MW7A 3IKVA 3TM4A 3D7MA 2HQSA 3HL4A 3KLMX 1US8B 4NL4H 1O54A 2B21A 3DV2A 4ERNA 5A4DA 1PYGA 4UDNA 2GN1A 4RVGA 1I9GA 5SY4A 5LMNB 4C06A 5JCPA 1UR5A 3RROA 4CLXA 2W6PA 2QYTA 4OBEA 4BPBA 1UJNA 1ZM3A 1XSEA 1KDPA 2X40A 4H0NA 2EQAA 2O2IA 1KDZA 4KQMA 5ENVA 3I2JA 4DNPA 2G1UA 1XT6A 4LVCA 2V3CC 3MWFA 2I2CA 1HURA 4MKHA 4D4KA 5FB3A 1PJBA 1XAGA 2XIJA 1YZTA 4B4UA 3UK6A 3SJBA 3SC2B 2GS9A 5L9AA 4ZWNA 3MQ4A 1JU4A 4FEYA 2N1BA 1IK6A 3HGMA 4E07A 1KI3A 1MEOA 1NU6A 2HNKA 2YN4A 3AUKA 3BH0A 3MEQA 5F21A 1ONBA 3QA3E 3HXOA 3Q9LA 4RJLA 2WVHA 1YIOA 2GGSA 1XHLA 1FMJA 1W5BA 2AUTA 2NTJA 1C0KA 4E1VA 1CU1A 1KERA 3DZFA 4ZPJA 4KBGA 3PWZA 3RM3A 3DR5A 4N5MA 3RHTA 4GXTA 1R0WA 5AKGA 3EZXA 9MHTA 3EQZA 3QYAA 5SICE 1EUCA 4F84A 5JZMA 2W2LD 3OJLA 1XD2A 2OL4A 4KDCA 1DDIA 1A9ZA 1JVSA 1W48A 2BKUA 1MVLA 2DHCA 1H2WA 2PD4A 2QDKA 2QW1A 3FCCA 4YA6A 3WFIA 5K3DA 4CLHA 2P7IA 2WMYA 4Q4CA 4LSMA 2AI1A 1UJ6A 2FI1A 3SN6A 5GGXA 4IGEA 1IBSA 1NRXA 2ZRJA 4TL6A 4F4HA 4DJEC 5IYZB 3SS8A 3NCTA 2Y1FA 1FDUA 3QX8A 5C31A 1Z62A 1S7CA 2DP4E 1LA2A 3JWEA 4FNMA 3STTA 1S3IA 1ACLA 1VL5A 3TQRA 4DA7A 2VCHA 3HCAA 3QEOA 3OUUA 2F3RA 4TQAA 1FDOA 2KWIA 3CWCA 3I2YX 4HBZA 4IIXA 2KBFA 2CDBA 5DWDA 1PQWA 2GARA 4DV3B 3WGLA 3K9FC 1GV1A 1Q83A 1ZINA 4LJYA 2W6QA 2ZUEA 1P7CA 3UKJA 3ZJUA 1R6VA 4HT3B 4G9EA 4HS4A 1U3CA 3L0SA 1BXGA 3HKCB 1H3EA 4KAXA 4LJKA 2G1KA 2R1UA 4DR5B 1DAKA 3BHNA 3BWDD 3K70D 2IS2A 4OYHA 4OQQA 2BV3A 4KGDA 3HO8A 3N0VA 2IXEA 3HU5A 3PITA 4TXHA 1O97C 2CNLA 1B74A 1AF4A 1ORHA 3MTBA 4E7OA 2FSVA 4MWTA 3PP8A 2DQSA 2I4MA 3ZS9A 3FE2A 1VJ1A 4PAQA 2EQ5A 2FWNA 2P77A 1BAPA 2VT3A 1UZUA 4M0PA 4QJ4A 1VI2A 3REQB 5BNTA 4ZO4A 1P3Y1 1TEVA 5CX1B 3WL8A 2WVAA 4MV4A 1H0RA 3KXKA 3EFOB 3UENA 2IDKA 2X8BA 4Y2YA 5E8JA 3T7IA 2CHUA 4AURA 1LUAA 1M6HA 4KO3S 2B6HA 2DECA 4CMCA 2C0QA 4E5SA 3WOVA 5TGTA 4JUBA 5CNJA 2BRUA 2B4TO 4D46A 5DNYB 1QIKA 1A50B 2IYQA 3OKPA 5GGYA 1L1EA 4C7XA 2M98A 5FTKA 1IEVA 1II9A 5BMVF 5C4MA 4NJMB 3KBOA 2F1HA 1Z8FA 1M2OB 1CQXA 2P62A 1IJBA 5H82A 1QRAA 1SKAA 2OCBA 3ZVLA 4YV2A 5IFLA 3IT2A 3U7GA 2FPKA 4FSDA 1DWOA 2GRUA 5BPHA 3F8TA 3DNPA 3F8WA 3GDGA 3T12A 4B85A 3FETA 5ITZA 2GAJA 3NOVA 4UMFA 3HI6A 3MSCA 2I7VA 5JSUA 3TEMA 3ISTA 1RAAA 2GJKA 2ZJZA 3HSYA 1LBSA 3D4BA 4DFDA 4CKZA 1MFZA 1EUYA 4EFNA 2AN1A 1GTRA 4KI7A 3BJIC 4L8FA 3UCFA 1KJQA 2BDUA 4K8OA 2RGNA 3EE6A 3U1BA 1SJ9A 2FSVC 5SZHB 2ODEA 3ZQJA 1Z74A 4QFBA 1UBJS 4PQYA 1MDBA 2OLKA 3LECA 2XNKA 4LE0A 1N1GA 4EPWA 5KOYA 5AKHA 4B7CA 2J0VA 2NACA 2V9ZA 3CF4A 4FR0A 3IAUA 3BZBA 3FKSA 3N3AC 4CF5A 2QV0A 4EHBA 5JNSA 2IYWA 2YV4A 3PTLA 4JT2A 1QH9A 2YWHA 1Q0TA 4KJZA 3VI4B 3IP6A 3MQ2A 3ODGA 1RBQA 4LJLA 2N3ZA 2GH1A 4UTPA 4E94A 1Q12A 2BRUC 4TQ9A 2IHBA 1QH8B 2IYVA 2LRHA 3BE4A 3DFMA 4L6IA 5IM4A 2QPOA 2AKEA 4PSCA 2XCUA 2PIDA 3ACBA 4F4JA 5JD6A 5FKJA 2HCJB 3WYGA 5D5QA 1KP9A 1T0PA 2R5NA 3H6KA 4LHSA 4Y6GB 4UEOA 4JLVA 4JLWA 3UGTA 1B7GO 2P4QA 1KBQA 1UPCA 1N2XA 1U3VA 2XR1A 3EZLA 4OUDA 4WKPA 1XQ1A 1NVBA 2WG0A 1DMRA 1W73A 1E60A 5DHRA 1E2NA 4BNIA 4BB0A 2O2YA 1YSCA 1G8HA 2HA0A 1Z9BA 1KRHA 3DW3X 4UDOA 3PNBA 3E3NA 2J3MA 5AQEA 1PTKA 3L1HA 4IDAA 3SZLA 5HE8A 3RVSA 3HCOA 1CFZA 1PR1A 4WUVA 4JAVC 2UZ1A 2Y1GA 2RGNC 1OJLA 1Q3TA 3EF0A 3OFND 4C0JA 4ZYZA 5J4YA 3WA7A 3HHPA 2AEMA 1E3QA 1KAQA 2RGGA 1U0HC 4QDTA 4CHGA 3HKEA 4YXFA 3DE2X 4DG9A 4R9VA 1R6BX 2ZWMA 4IVQA 4I4NA 2C2XA 2Z83A 2A7XA 3R3HA 1PR4A 4V0QA 1KHHA 1R0XA 4DILA 5C3UA 4CDGA 4RJTA 2JLXA 4A1FA 1QZUA 1VECA 3A6HA 3S1AA 5JHHB 4BKRA 1Z0KA 3UBTA 3PE3A 1NP6A 5IAKA 4BJ1A 4D99A 1P72A 5HBRA 1IY8A 3BGIA 4HWRA 5LFAA 2V0GA 2WWVD 3VU9A 3U39A 3ESZA 2ZI6A 3L84A 4F21A 3SNHA 4K86A 1I1HA 3LIPA 3LLUA 4J0CA 4BX0A 4KP7A 3MAJA 3A14A 4WPGA 1FVFA 1VPVA 1YHYA 4H3KB 4B6GA 5AXBA 3P8ZA 2OLJA 2IELA 1C3OA 4I46A 5HDBB 5DYTA 4RX1A 1WXXA 1BS1A 3SZGA 3EXG1 3KHTA 5DNCA 2OB1A 2QXTA 2VQDA 4IS2A 4P38A 5CX4A 2W43A 4AZVA 5H4HA 3GT7A 5CYOA 1UXGA 5HGXA 3LY5A 3DNFA 2E9SA 4P4TA 3FMVA 3R9WA 4HSEA 3GP8A 1AGRA 2I2FA 4ZYXA 5HM8A 4DR3B 3FJYA 4PLWA 1FUYB 3B60A 4WADA 1I2CA 1WKVA 1HNWB 2BTQB 2EGUA 3DXFA 5B37A 3W8RA 3HYLA 2VJBA 1L4KA 4HTAA 5E4JA 4GC5A 5KYUB 3LAWA 5AW5A 4FCWA 4LJRA 2DPGA 3S2YA 1UBOS 1RAHA 4OLFA 4MS3B 2IA5A 4Z5XA 1LS6A 3CIFA 5ELMA 1P4RA 6NULA 4QBTA 1XQWA 3F4KA 3LVQE 4OQYA 1LLFA 2AR0A 4EX6A 4AXXA 1U0TA 2OAGA 2PZMA 4DCCA 1WCWA 5K0BA 4C20A 4PR3A 2O8BA 2ZBQA 4YRSA 5CVTA 5C4IA 1SXGA 3I52A 3MMXA 1T9DA 4O4HB 4Q3LA 3WJ1A 4ZN6A 3PUJA 1U94A 3PPWA 3FIJA 2O3TA 3Q15C 3VX3A 4IEEA 4C03A 4OFZA 4EHLA 1WBDA 3R9IA 1VPWA 2R6R1 4M53A 1EFUA 4ER5A 4Y2SA 4JA0A 4HGOA 4W6QA 1PCXA 2TECE 3MN1A 3GI1A 5ESRA 3M6VA 4QXOA 1TLLA 2IGTA 3U9TA 1FNCA 4JVOA 1DI0A 4ZV7A 5IBRA 1N33B 4KL8S 4ZJZA 1WW2A 1RKQA 1X1EA 2PS1A 3ZJ5A 1VBKA 2A67A 1DXYA 3BSWA 1W29A 4O08A 1TTTA 4N48A 4PSAA 1E7WA 3ILXA 3PC8C 4R8SA 5FYDA 1R3UA 3BVPA 3GPCA 1N3LA 4D0SA 1OZFA 2GA9A 4P81A 2ZYWX 3KUUA 1EINA 1CIVA 3KTFA 3VHRA 2X5JO 3F1LA 4UATA 2DQZA 2PE5A 3VH4A 5CB0A 1LCIA 4TM8A 4YJDA 3ET5A 4DV7B 5ARDA 2O7VA 3L77A 5B57C 5AM0A 4WCFB 1L8OA 1V8ZA 3D9QX 1W34A 4B46A 1BCRA 4L4XA 2CV1A 1RVV1 4URZR 4B6RA 1XZQA 1HY3A 4OP3A 1DAOA 1JKMA 4TUYF 1YJBA 1U3TA 3OHSX 4RFSB 1BE6A 3TRDA 4IX9A 2CMFA 4ARUA 4HH4A 2O48X 3HJUA 1MV5A 3DYVA 1C9EA 2LCQA 3ZZNA 5K45A 4BVHA 3N2ZB 4TKUA 2IUTA 2WIKA 4KB5A 4BN4A 1A9QA 2NPFA 2FHPA 3JD3A 1WW8A 2Z8YA 4WA7A 2DWPA 2J0EA 2H52A 2HF9A 4BV9A 3T5AA 2GPYA 4LYJA 5CDTA 3II6X 4EARA 3KYDA 3NT2A 2H07A 2YRWA 1JHMA 3FR7A 3HDGA 4J8PA 3RIEA 3UT5B 4I99A 1BD4A 3G49A 4WL0A 3R1IA 2NAPA 4DCJA 1RQ2A 1V5WA 1LEHA 1X1DA 3VDXA 3MXTA 4NNPA 1Z37A 4YWHA 1L4MA 4N7JA 2V7XA 2AWOA 3EISA 1IPFA 2VA8A 4GMGA 2NU9B 4A2CA 4B8WA 5AUPB 2RAFA 2JZCA 3KFLA 5EINA 2XE7A 4YASA 4AQDA 3GNSA 1ODCA 3E22B 4K05A 5I51A 1SUAA 5KOJA 1NAHA 1ZMOA 3O74A 2C29D 1T2CA 2HMWA 4RHFA 2BGKA 2W5UA 3TLYA 2DR2A 3DP9A 5D3QA 3QOFA 1MA0A 4UUPA 1ZNYA 3KDPA 3UMRA 4E4TA 3DBHB 3ICOA 3V7NA 2PH5A 1GN9A 4S2UA 2FEKA 2IY9A 1N8SA 3M1AA 3OTIA 5JPIA 4BRZA 3VNSA 1GGVA 1SCKA 4K9PA 4MUJA 4TKMA 1KR5A 2OM2A 4N6OA 1GZSA 3JRNA 3BE8A 5G41A 1EZ4A 4DMCA 3L01A 4IQ8A 3AL0C 3E2MA 1TQDA 2JGAA 4YMWA 3FUCA 1F5SA 4POOA 3S7ZA 4UD6A 3DVSX 4Q3BA 2C5LA 2YHSA 3DH0A 1GUAA 5DXAA 3ZI4A 5CK4A 2H63A 2AT1A 3HVJA 1NN1A 3HBMA 5H83A 3GLHB 5A4FS 2NOAA 3DULA 1OV6A 2O7RA 4GPTA 2ZE7A 5LXTB 2MMGA 4CFYA 1U7TA 3MLEA 2W0SA 3N86A 2XLCA 3MS4A 3CZ5A 3PG5A 1TEXA 5ALLA 1VRCA 2M6SA 1CEQA 1GZ3A 1P9NA 2GTIA 3IQWA 1PFQA 5CEJA 2IBTA 2JVIA 4JI0B 1KDOA 1IWBB 1U8AA 3EASA 5EKDA 2QUZA 1SXQA 2AOUB 1ZAYA 3NHSA 4F4IA 4I8XA 3R3XA 4XJTA 4YPOA 5LNK1 5CDFA 2VAVA 2H59A 2B6NA 3CRMA 3DQPA 3RK0A 2GQ0A 3S28A 7YASA 3BRSA 4A5SA 1XDDA 3H5AA 1CR4A 1JHAA 1T6ZA 3T9EA 4G0ZA 4NBKA 1A8PA 3AJRA 1JV2B 1KEUA 2BWJA 2EU8A 2NSYA 3B9QA 3DWIA 5C8DA 3OAAA 4CIBA 1SOWA 4Q1VA 1DC6A 1Q0HA 2I8AA 2CJXA 2QYHA 2R8XA 4PWYA 2VP4A 2I76A 2P5UA 3EVNA 3OZDA 1S96A 2X8JA 1IQUA 4L3WA 1P1CA 2CLIB 4WRRA 3WI7A 4PSKA 5DBOA 5JFGA 4XGKA 1P0CA 1D6NA 2JIZD 3GFRA 4L4SA 4NESA 5WRFA 3OSZA 3DVLA 1KOLA 2V98A 5CXXA 3HNRA 2HCFA 4DUYB 1WDMA 1PX2A 4G1VA 1T9KA 1QWSA 2QAIA 1DAIA 3NZEA 4NFYA 1N1MA 3KQHA 4GKKB 2FNAA 2Y1LA 4DC1A 4DDHA 1QS0A 5ELXA 3ZK7A 1KJZA 1E61A 1PLJA 4QU8A 3RI3A 2GPSA 4RJ2A 3TRJA 4OB7A 1M0SA 3OCCA 4BRSA 4DR1B 4NMXB 3T3NA 1W4AA 3NRBA 4J0KA 3LJKA 2FLKA 3H8SA 4ILEA 3BMNB 4LCEA 2VYFA 3X2SA 4EUNA 3ABIA 2PJRA 5BMVA 2JFZA 2R1ZA 1AGNA 5I5GA 1TEHA 2XX3A 3KNZA 3OJOA 2QE7D 2XA1A 5E1BA 5CCDA 5I7UA 1Y8CA 3PEFA 3PHGA 1UDBA 5AHXA 3TWOA 3VSCA 3LDHA 4XCQA 1L7BA 1KXZA 1PVVA 1M74A 1YV9A 1DG9A 4GI1A 1XEWY 2V59A 3N3BC 4LVOA 3ZLUA 4UHFA 3SQWA 3H11A 4ZU6X 3QUBA 5NULA 5TC4A 3BL8A 4YT2A 3FYHA 5JYDA 1ABEA 3JAMA 1SA0B 1YKGA 3K16A 2QJWA 3OIVA 2O2GA 3CA8A 4WXEA 1CE8B 1ZUWA 1YBVA 2HSDA 1UCFA 3FPKA 4HYQA 1UQUA 1MEEA 3DL2A 3O9ZA 3TLGB 4A27A 1TT7A 3VHXB 1O7JA 2KQUA 3PLNA 1DDOA 3U4AA 4YI3A 4DUZB 1K4MA 4OPMA 4UEJA 3ZTTA 4YJ3B 4EMTA 3BSSA 4D9BA 1P1KA 2JH9A 3WLQA 2HF2A 1XNRB 2ONKA 2Y1XA 1WEKA 2ZTVA 3H1BA 3IRVA 3QIAA 3PGJA 4G37A 4X8LA 2C3OA 1Q7TA 5BV7A 3EC7A 3K9CA 1Z6QA 4YCSA 1G17A 4Y18A 3LQFA 2J45A 3R7BA 4DR6B 1W85B 2EEZA 3MBOA 1JQJC 4P84A 3F96A 4XQGA 3BKXA 4ARAA 5AUNB 2AW5A 1MX3A 3HKDB 1E8NA 4KN5A 3N8HA 3MTAA 4MWOA 5TVKA 3TJRA 1X92A 1NZJA 3V8QA 3IAXA 4DNXA 1Y8AA 2XCIA 2RC6A 3GLHE 3HGQA 4URUR 5GPBA 4ADSG 4B48A 3UFXA 3GFOA 4RIIA 1X2BA 4MWZA 4UVIA 2RJNA 1A0OA 1U0FA 1E5VA 2VWGA 4JKOA 3RKSA 4ZDJA 1THMA 3CXUA 2F1RA 3HA3A 4GIBA 3NLLA 2Z09A 1BRTA 1CUZA 1ECJA 2HJSA 3ENVA 4MYSA 1YGPA 2OCAA 4HNGA 4W99A 4TLAA 3RSQA 4TRJA 1R66A 3LUBA 3T1NA 1OLSB 4BMXA 1DG1G 2W4MA 3JPYA 3SNKA 2V7WA 4RM2A 1ABBA 2O2EA 4ER7A 5KQLA 4EO9A 2A1UB 2Q2VA 4B9AA 2VO1A 3O8DA 4UNSA 4RHUA 5KOHB 1ZMRA 3ITDA 4BNJA 3UHOA 3EDCA 3HA7A 2AQ8A 2Q4EA 2QTCA 3F3SA 3GEHA 3QX9A 3EZNA 3M3HA 2XNCA 3KQMA 3UYKA 1ZQ9A 4IUCS 5GIPE 4F7WA 2BM8A 3K0AB 1DC5A 3IR5A 4HQFA 5EMNA 5HJ5A 3WRYA 7MHTA 2Z0MA 3W1EA 2XCTB 3T6KA 4IGIA 4E13A 1DBPA 1GCUA 2FOLA 4LQDA 2YWRA 4Q02A 2KSQA 4EELA 1C7JA 4KR6A 3E9NA 5FTWA 3IMKA 3RGWS 4CM8B 4HB3A 1ZUD1 4ZQFA 5ICSA 1FRZA 1UPTA 2CFOA 2FPMA 2FMKA 2AEFA 4GZMA 3W4IA 4FM9A 3Q7EA 3OZAA 4HB4A 2NM0A 2WDPA 5EXSA 4MUYA 1GM5A 1GCIA 2F64A 1IQ0A 1L5WA 10MHA 4R1SA 3UTCA 4KH1A 1T5DX 3C39A 4P5EA 3ZS8A 1LQTA 3FNEA 4N1AA 2FR1A 2Y4OA 4XDZA 3GGOA 4WHMA 2UYGA 4D9IA 1JP7A 1TQ2A 3G7UA 9LDTA 2NXWA 3Q10A 4OHOA 4BNVA 1XRSB 2XCOA 5KVAA 2JB9A 3OEWA 3RODA 5CU7A 4C43A 2ORVA 1WY7A 5LLSA 1A5AB 5IK2D 1FJGB 5JATA 1QE0A 4MGYR 3WGUA 4BWYA 1ML3A 2CVQA 2O0LA 1E2LA 1I0IA 3BMOB 2JGRA 1Z6GA 3OT1A 4G3XA 4M1SA 4QTTB 2MU1A 1V16A 3HI4A 1KORA 2H65A 2Z58A 5JAHA 1ZD5A 3JQAB 2GNPA 3MCUA 5JRZA 3UEOA 3K6RA 1VLJA 3RVPA 2ZI9A 2GD2A 3WRYC 4PZYA 2WJPA 3L5OA 4G26A 4HAXA 4HPXB 4IJUA 1K63A 4B3BA 1ZM7A 5A7GA 4MMYB 1FUEA 1GNVA 3ZGXA 3LRXA 1EBBA 1RABA 3PJRA 5BSMA 3C3CA 4TMKA 4AT1A 5JSZB 1IN5A 2W70A 1W1WA 1F4LA 1FRFS 1KO5A 2B25A 2PSEA 2PSSA 2VNAA 1Z0ZA 1MH1A 1N9GA 3I23A 2G36A 2RB5A 3U7JA 1OFUX 4F11A 1RBMA 2V4MA 3C8ZA 1SH7A 3FI0A 1QZXA 1Z8DA 3BD8A 3NAQA 3FWZA 3HCCA 4FZ3A 3AP3A 2BZSA 2NAFA 1X1BA 1Q0QA 2CDRA 3FMFA 3R7WA 2FW0A 3NM4A 2ZRPA 5LLTA 3DYIA 1BKDR 1UJ5A 1JIXA 4FQ8A 4PZ0A 1DTSA 4QX6A 3D81A 3L7LA 2PZFA 3THSA 4B75A 3NJ4A 3BK2A 4NFSA 1TU0A 3MPOA 2AUNA 2C00A 3OCVA 3NV7A 3MUEA 4HADA 5K2OA 1IN4A 1R8QA 5ERXA 5JSFA 1Y9JA 3LCVB 4DA6A 1GL6A 2FZGA 4WBNB 2X0KA 1C9JA 1W0JA 1ZNQO 1OB5A 1ECLA 2ZDHA 4V39A 3ZWVA 4TUYA 3NHPA 2GPTA 4UM7A 4YUXA 3NXSA 2ZJAA 1RBYA 5LQUA 1I3CA 3KKLA 3EWIA 4FEAA 2IEYA 1KJ8A 1G3MA 1EKXA 3EXIA 1F0YA 4FYJA 4Z4CA 5F5NA 1G2OA 2QRMA 3KJXA 5B53A 1KVTA 5KHAA 3D6MA 4QLBA 5LL6P 4KR2A 3FROA 3N2GB 4NZYA 4KFCA 1PHPA 1H2XA 3DEIA 4M89A 4DDWA 3N7TA 4HVAA 1MH9A 1JJAA 1FFDA 2Q9CA 4RQTA 1E2HA 4CKYA 1U8FO 4DG8A 1NGSA 4ZCMA 2YWGA 4P6VF 3H8WA 3LUFA 4BWVA 4QUKA 2A0FA 4DIEA 1L5ZA 2ZPUA 3ZVKA 3K70B 3EJ6A 5UKDA 3RIXA 1VGVA 1T8WA 1O96A 2PSDA 2RHHA 3KKNA 5I7EA 3EG9A 4J0IA 4EMUA 1VHJA 4N4AA 1BGWA 3BEOA 3GQBB 4L6CA 1CERA 2ZUVA 1ZD8A 3R6LA 2NU8B 3DVAA 2XD4A 1XKTA 4BTLA 1I01A 3PGXA 2VEDA 2GAOA 4F6RB 1I2AA 4FIDA 3BIXA 3K5WA 4UOEA 1XZCA 1E8MA 1XZEA 1BQEA 4OUKX 1XWWA 1V5EA 1V8PA 4PNZA 4RH0A 5F98A 4EW2A 5CIWA 3I61A 4J07A 2VI5A 4MGHA 1SEVA 1UBSB 2A3NA 2I0FA 1C8LA 1E9AA 3PUXA 3SHFA 4C3VA 4BO3A 3KPVA 1ZI8A 3AHJA 3QVKA 2ZB8A 4KUHA 1CR0A 4ZRNA 2XAAA 4XB2A 1HGXA 2AOXA 4AMZA 4FX5A 5D3MA 4CKBA 4ZOLF 3QKSA 3V46A 5JNVA 5AWFC 1I3OA 1CFJA 2B9EA 3K2QA 3MJVA 5D5PA 1KAHA 1WF6A 2XUJA 4Y0NA 4UMEA 4FNGA 3WGZA 5FF9A 1FX0A 4RMGA 4R8MA 3R7FA 1SCJA 2QHXA 3NHBA 3EVTA 5BYAA 2QIPA 1LBQA 4ARBA 4BC0A 2H5JA 2FPSA 3N2KA 4LF6B 5LZ9A 4GUAA 1V6CA 3IQFA 3V1NA 5JTTA 3G1UA 3AINA 1FFXB 4NZZA 1Z6ZA 1ENPA 4DUGD 1M75A 3AP2A 4DTIA 3NBZC 3RJ5A 5JLJA 2JIBA 1E4EA 3H5LA 4YS6A 1UJBA 2UYOA 1E2BA 1I1OA 3OJFA 4BVFA 1XAIA 1KMNA 3N0XA 1J8MF 4HZUB 3B70A 1K75A 4O59O 2QM7A 1RJGA 2X5NA 3V4FA 1YB2A 2VBFA 3VV3A 3I04A 1WEHA 1LQUA 3WGOA 4E51A 4ISBA 5EWLB 2IKQA 3JWIA 4CGYA 2PFKA 5IRCD 1B42A 4HSGA 3OQNA 1A7JA 1RSZA 1ZISA 2JA2A 2I65A 1OZHA 4UXIA 1JHZA 3OT5A 5DBGA 3RRXA 2OBYA 3WGTA 5KC9A 1NW6A 1GPNA 1KQ3A 4J2HA 4ZVUA 1AC5A 1K6EA 2EHDA 3EFBA 3H9CA 1G5IA 1Q44A 3VPCA 3WG9A 5HRCA 2JH8A 3ICCA 1BHSA 3JS5A 1CY4A 1DIAA 1ZOIA 3EXEA 3UANA 5F5LA 2JASA 4QT4A 2YHIB 3ZPXA 3FDIA 2ZANA 4PC6A 4O33A 1XFDA 1GVHA 1N2EA 1YBFA 3LVBA 4U0KA 3BWYA 3T3OA 4GEKA 4JENA 1V7PC 4JJ6A 3THRA 4RNCA 1O95A 2R00A 3BSFA 4ETMA 4R5MA 4DVGA 5IMSA 2C8VA 3VTZA 1UFRA 1AU9A 4MHSA 3QH4A 3WB2A 4DV5B 3BD9A 4N3NA 1UWKA 5KVSA 2C2MA 4ZMRA 1YR3A 1DEHA 2JGDB 3L0PA 5DYNA 1WY5A 1NOIA 3AKDA 3GEDA 4DQVA 1K27A 4BLOA 3BIJA 4YV0A 4EJSC 1XF1A 2JJQA 4A2QA 2WB2A 2QRUA 1M8GA 2NZXA 3RJ9A 3VKHA 1S02A 4EA8A 2AFIA 3LA8A 1D9ZA 4DS3A 1HDOA 3U4HA 4EL5A 3V9AA 2XXAA 3NJRA 5JMWA 2Q1YA 4UHHA 1ZD9A 1LBTA 4FN5A 4BYMA 5HUHA 4U8HA 5E9AA 1VPLA 1PJLA 1X77A 2AZ4A 1DADA 3OIDA 2PLAA 1PZEA 3DMFA 2FQ1A 3JASB 2QNIA 1GNSA 1NXPA 3NEPX 4KPUA 2D1YA 4BFYA 1A72A 4F3YA 1UOPA 1PJ3A 4JBWA 1FS4A 5THXA 4MH0R 2APJA 2D5CA 2XNJA 5LC1A 2Q21A 1GAQA 2BCGY 4GVLA 5DX1A 2W6IA 1T8PA 3IV9A 3BMQB 3CKMA 4OLAA 4YB8A 4JGIA 4ML3A 3LT5A 3LBIA 2B2NA 3HRHA 3JYHA 4O2AB 4GP7A 4BFUA 3SYRA 3F73A 2PUFA 1M83A 2EEPA 4EZBA 3VR2A 2OHJA 5ICMA 4KEAA 1DB3A 2FFHA 2FPPA 1JFLA 2ID9A 2C7QA 1N2OA 2BOVA 4H6WA 3HFJA 3E0XA 5LZ8A 1NVUQ 4MVWA 4KE8A 1O95C 1V6SA 2R00C 3M6LA 1YJ8A 4DQKA 4AZTA 4JJFA 4Y2PA 5FLKA 3K0FB 2JCSA 2M1XA 4NABA 2DSTA 2JCYA 5I01A 1F0PA 1UP6A 2CCKA 3I9V6 4BLVA 1W25A 1YRYE 1FFGA 5EZ6B 1QQ6A 2Q0SA 3DONA 4OA8A 4HZIA 4QGBA 4U4AA 3UHPA 4CTMA 4XVCA 3RF7A 5AW2A 4RLQA 1T36B 1U9ZA 2J3QA 4C3UA 2BMVA 4U2BA 4E3WA 5ALFA 2QTVA 2UZIR 1ZGAA 2V58A 2E5FA 4NYIQ 521PA 4C7BA 1FP4B 2PZBA 2VDKB 3U7EB 1F0NA 3WR5A 1VL2A 2J9FA 5BWOA 2JW5A 5LWQA 2ODWA 2WD8A 2B30A 1AKUA 3HB1A 4JLBA 4L50A 5IDXA 1U0BB 3IIIA 4HZGA 1DZIA 3R74A 3TDMA 4F93B 2R1VB 3WQQA 1EG7A 1JNXX 3D43A 3IQHX 2YWFA 4F4FA 3ZLTA 1CUCA 4IINA 4S12A 1KP2A 2JFVA 3N59A 3WL7A 3T3GA 3D8HA 4GZ3A 2W6JA 3T9BA 4BVBA 4UVGA 1A8UA 4NCKA 3GZNB 4PHCA 5BN5A 3B6JA 4HQOA 1L4LA 4LI0A 1T2NA 2B3TA 4RAQA 5L3RA 3RUEA 1SHJA 1LK7A 5BY2A 2VK2A 1EEXB 2NQ8A 2X5KO 2G71A 1NVVR 4AJOA 4NULA 5FOUA 5DSTA 2RJ3A 5JNWA 1I5RA 5HR5A 3DAPA 5F1PA 2QDXA 3VO9A 3IEPA 5I7HA 4HR7A 4ESVA 2BSQA 2WD9A 4K26A 3KQVA 3NM5A 3ER9A 1R0ZA 1WBJB 2DF8A 2FPIA 5JCXA 5ADUS 2W6ZA 1M34A 2PGIA 1H6CA 3KR2A 3MINA 4GKAA 4GM4A 4WXRA 2BMEA 4H7EA 2PAAA 3GJ6A 4G8JA 4CWAA 3KJHA 1O2DA 4QA9A 4YFYA 3AF5A 3H5IA 4JNKA 1DSSG 4HDCA 2L42A 1XA4A 5U4XA 4U7GA 4I6GA 1URPA 4LZOA 5DM2A 5K1ZA 2C2ZA 4DCGA 2I6GA 4JYAB 4LK3A 2WG2A 3ETCA 4EFMA 1RWWA 1UMDA 2CFCA 3CVVA 1JDJA 2D5IA 2YMMA 2E85A 2OHOA 1TW2A 4BNMA 3RD5A 2R8ZA 4NOLA 5I7VA 1F17A 3COSA 2IHYA 3NFRA 1G3UA 3T4UA 4ZEMA 1UAAA 1A2BA 3I5AA 4R9UC 3G2HA 5F51A 1XELA 4TV9B 2JEZA 2P27A 3KUXA 4M1ZA 3B48A 4IHJF 3OKCA 1KPIA 3OO1A 4REQA 1EX7A 3IT0A 1EDBA 3EQ8A 4Y1RB 5DLQC 2G0AA 6ADHA 3MLBA 2VJQA 4NI5A 1XMPA 3ZTYA 2H7VA 1YZVA 1GUFA 4X1IA 4A8JA 1TFUA 3GFTA 1GQSA 3QQ5A 4OU4A 3KPYA 1VYVA 1UK8A 1T4BA 3MWEA 2NUAA 2PZAA 4FIZA 1NXWA 4XIIA 4Z1MD 5L3SB 2YBDA 4C5CA 3RT9A 2IHKA 1SU8A 3DAYA 2HWXA 2WZBA 3R7DA 1WZ2A 5KQRA 2QUKA 5EHIA 3S29A 4JR0A 4D9MA 1JAYA 3C6BA 4DV4B 5EZ5A 1GKLA 5AHRA 4LXTA 2KX7A 1S8AA 2C9OA 3KEQA 1DJPA 4KXVA 1AS2A 2XB6A 2WBLC 1VYHA 4ZVSA 1IHYA 4A0FA 2OK7A 3EBLA 5B4VA 4OBBA 3CONA 1M5RA 3GGGA 1MX9A 2YYYA 3IUBA 3NBXX 4GYJA 1ZC4A 3K6JA 5JPDA 3IBCA 1R10A 2QT9A 3L8DA 4I1VA 1CVLA 2VHWA 1LPAB 4G5QA 4QGAA 1N92A 4UXHA 4CKEA 3ZHUA 1GLVA 5G4KB 5KWSA 2OV1A 5KYYA 4LC1A 4MIYA 1SHLA 7REQA 3SEZA 3A0RB 2XKBA 2FVYA 4KSYA 4MUFA 4HFRA 5DLPA 3WRXA 2WHXA 4LDJA 4NTZA 1KY4A 2FPGB 4JI3B 3TCKA 1E9VA 3TTSA 2FG5A 4MR8B 2P11A 3E1GA 1N34B 1MO6A 4JL8A 1R4NA 4PLZA 4R0VA 1JKJB 3RTBA 1DX9A 3WY9A 1J0EA 1P44A 2ZRIA 1NW7A 3CGWA 1DPGA 1XG5A 2WAOA 4GGPA 4D4JA 1TVMA 2RH8A 3VMFA 2AVNA 2AIRA 3E6AA 2Y76A 4NE9A 4L8YA 1NF9A 4ND8A 1X6VA 4LJ9A 4YIHA 5DCWA 3SQOA 1VHDA 3WGIA 2P4HX 2V7VA 3OH8A 3K6KA 3SQLA 2GILA 3NHYA 2GCGA 2E4WA 2YVAA 3M70A 4FCTA 3FPHA 1W35A 1C1DB 2FYTA 5GINE 2D2XA 3IAM1 2QLJA 8ATCA 2EBUA 4X20B 3GWGA 1LPOA 3H4IA 1RI1A 4PANA 3UK1A 2OAEA 1HTWA 1QMGA 4C6TA 3NP9A 4MSUA 3DEYX 5CBPB 3CEJA 1RWVA 1N5KA 4BXOB 3AESA 3I6MA 3ESYA 1OKKA 1WMEA 1C7ZA 3EQ9A 2ZWPA 3QEJA 4URFA 3IAAA 4MYHA 4XJXA 4D43A 1GAXA 1K0FA 2Q28A 2A35A 1L7NA 3CJQA 1OLXB 2QVCA 4K9NA 1TUBB 4PS0A 4GBED 4M22A 5KWEA 4R7GA 3QENA 2AN9A 3HEAA 1AMOA 4CODB 3CLSC 2X0FA 4YMUA 2E7ZA 1ZM2A 1S3GA 1SU7A 1WB4A 4FKZA 4G1FA 4RANA 4C2TA 2O8VA 3AF4A 1I36A 4ETWA 4C7OA 4I1IA 3OBIA 2ZJ5A 4KLCA 3DB2A 4GO1A 2QRVA 2DT5A 3EIFA 3M6AA 5ALMA 3ZBTA 4M99A 1OXVA 3DDSA 4EQ6A 3ZKWB 3S8YA 3JARB 1E3WA 5FQOA 3BREA 4LWOA 3KZCA 5DN6A 2MYNA 5FADA 1GGKA 1RWPA 1TK9A 2WKQA 4JT8A 1T4GA 4IVNA 3EK2A 1UXOA 4LGMA 5A9SB 1J09A 3REOA 2UU9B 4FK8A 4M54A 1OX4B 2Y0DA 3HXMA 1LX7A 4CR7A 1UANA 1T2AA 2Y92A 3C24A 2ZJ3A 1C0EA 4BDSA 1I7LA 2KMLA 1X0XA 2C83A 1SEPA 2ZI4A 5TF0A 2QV7A 5JXGA 4N40A 4IZOA 4M1YA 5BV2P 1EGAA 2D54A 4KYIB 4I7EA 4ZOLA 1OIVA 3TFOA 2AQKA 4II7A 1IG3A 4UEQA 1XDSA 4HWKA 3VM6A 5ALSA 2ZRMA 1P81A 4EJ2A 2O1EA 5CDGA 1UQRA 4NV3A 1IVSA 1E1MA 1W5TA 4AF6A 2XMDA 1K0UA 3HJNA 3PV0A 3R7AA 1PR0A 4LGYA 3A1VA 1U5BA 3KQUA 3X1MA 4RVUA 1L4EA 3H4MA 4GBJA 5GOTA 1QE5A 3SR3A 4B7XA 5CB4B 1L7XA 2QEQA 2YJGA 1HUQA 2H2HA 3K5PA 3R77A 2FX2A 3LBAA 4O4IB 5BR1A 5AW1A 3ZVNA 3FCSB 1PFGA 2YZ7A 2BI4A 1OXXK 2MSNA 4TXJA 5F33A 1U8EA 1N6RA 2NXNA 4JBYA 4B6EA 4RJIA 1G20A 3VC1A 1F7VA 1M73E 5CT6A 3JATB 1ZOSA 2Q7DA 3X0DA 5K3BA 2YQ4A 4PPQA 3EZ7A 1X7XB 3LMKA 4DREA 1Q1ZA 2B7CA 2IHUA 1IWPB 1SCNE 5C8YF 5LQJA 2PGXA 4RPLA 3PCXA 4QTXA 3RC1A 3HB9A 1T5BA 3DKPA 5FTJA 1ISGA 2UZ3A 2WE8A 3C16C 3Q0IA 1LZKA 2XYHA 1ADBA 4YJ2F 5DXFA 2FJUA 1MB2A 2CF6A 2GPNA 1H8ED 4EI2A 3L9WA 2ICAA 4R1NA 1Z12A 2H5LA 2OOSA 3B1ZA 2BFAA 1F12A 3D6HA 4YI5A 4Q3DA 2QBYA 1ADGA 2PQ0A 4BZPA 2PKEA 4ZO8A 2VYQA 4UASA 3WYEA 3CO0S 3CZ9A 1WDLA 1FS6A 4JOSA 4R0MA 2H31A 1SM4A 3O26A 3JAWA 4KQHA 2WLSA 4KWCA 4RLFA 1T4CB 4BN5A 5C1IA 5BNFA 4EYEA 1Y7TA 1ZU5A 1W36D 5JAZA 5EJIA 3D7SA 3I1FA 1EUDA 5HF5A 1IDOA 4F5EA 1AK2A 4H17A 3FPAA 5C1OA 2HDWA 3NTXA 3E0QA 4A8HA 3WNBA 1SXHA 1H94A 4AJ2A 5AVOA 3CX3A 4YO7A 3CUTA 1CULC 1QXSA 4C4ZA 4AN0A 3B6EA 1R4AA 1PR3A 4JELA 1ZRNA 4BO7A 2V6JA 4F71A 5CXUA 4ZRMA 1MABA 4NP6A 5BPFA 4Q21A 1PYDA 3C5EA 4X41A 2QMYA 2QAGB 3VHQA 5KWIA 5L6LB 1X80A 2ZJ2A 5EY5B 4IM7A 4NVRA 4KR3A 1U2RA 3L05A 1ID8A 1W5EA 4UHJA 1N0WA 1ZSYA 3DTVB 4CV3A 1RZ3A 5FR1A 4MI1A 4NV1A 2FWIA 5AW8A 4X94A 5FPPA 3O2SB 1UC4B 3RAJA 4DSZA 1UIMA 1OI7A 1A77A 2P69A 1JF8A 2W4QA 3G0GA 1OD6A 4DC9A 1OASA 1U3FA 1ULBA 4KIJA 5EZYB 1V45E 1ONNA 3EIXA 4K2AA 1F4PA 1I30A 4TVBA 4IUYA 1O1YA 4XX0A 2CWWA 1MFPA 3VR3D 1N7HA 2FCAA 2X22A 3ZG6A 4ZFNA 2RJOA 2ZQYA 5EIEA 5JISA 2PN1A 2HK7A 2V1XA 2RONA 4KHZA 1GTSA 5FAKA 3DJFA 2EG5A 3DPSA 2HNBA 2ZAGA 4F2WA 4H6PA 1NJFA 1C7QA 2W2KA 3PD1A 5JVDF 3BH6A 3VPXA 4R2XA 3ULKA 2O59A 2VCEA 9GPBA 5LP6F 3ER6A 3O9VA 5IABA 4HH1A 2IZ6A 2OCYC 3QEMA 4R40A 5I8PA 2AMFA 3O4VA 5SYMA 2CDNA 2EGGA 4CLEA 5DBIA 3WFZA 2O0KA 2COKA 1RHQA 2G1AA 5EJFA 4Q7LA 4BNDA 1BMTA 3VU1A 2PZGA 3PE4A 1U7OA 4RDIA 2WHPA 4YMSA 5KKNB 1PD0A 2FUCA 3GEBA 4ENQA 3L02A 3TINA 1DTWB 2CYAA 3QIVA 1M7BA 1TJ5A 2H4ZA 2ZSFA 1WNTA 4UU7A 1NQWA 1A82A 2R1TB 3FWKA 4P34A 3QKUA 4UQPA 3U26A 3O95A 4MVXA 4ZGBA 1U0JA 5KQMA 1XCLA 1USUA 4J91A 2FFAA 1OFTA 1S8OA 1TO2E 1Y4SA 2UVDA 2VHEA 3CJRA 3IE2A 5FL7D 1D2RA 4M9RA 4MUKA 5U1PA 5JTUA 4IZIA 5AM4A 2PA0A 1LY1A 5D87A 4ER3A 4MQ5A 2ZSUA 5EJ5A 2F2TA 1IQPA 1RTTA 1VPDA 4GBMA 2NLOA 4G8BA 3WYNA 4BNWA 3UJAA 4QEZA 5FBQB 2YWCA 4HNQA 4EKEA 5HQ3A 2AA3A 4HMQA 3QQPA 1J99A 4PGAA 5HE9A 4B34A 4QUIA 5EJGA 5JS6A 4IBOA 1P2VA 3R0VA 4UW9A 3D7NA 3D4OA 1U0RA 5JMOA 1YB4A 2D0OB 2IEZA 3ZJVA 4PX3A 3G2LA 3PQCA 3PWKA 4OQFA 1KFKB 1XAJA 2AEJA 3SR4A 3ZXYA 1O9HA 4G5HA 2QQ0A 5LOVF 1DJOA 1L5NA 1SUCA 2X0NA 3EGOA 1H2HA 2VAMA 4IKOA 1ULTA 3WB0A 1AXRA 1NVKA 5ALOA 3W5SA 5ALXA 1M8KA 1KTVA 3D8NA 1RKUA 2ZRDA 2JJMA 1TCUA 4KWTA 4L4ZA 3K2IA 5J58A 3TRIA 5EVJA 1E99A 4GGMX 1U1CA 2JJ1D 4QPDA 3DO5A 2C31A 2CY0A 3PXAA 5ANRB 3QPBA 4IHJA 5K0NA 2JBAA 3WL4A 1HEYA 3C7AA 3KKZA 3K0BA 2ZJOA 1RJ9B 4QXPA 3FGOA 1RBZA 4RD1A 4PZCA 2X0RA 4GMDA 3F8SA 3LF2A 5BQOA 3HJCA 2GZMA 2OORA 4OX9Y 2FUEA 2XMBA 1E1KA 4C22A 4ZZ3A 3RW9A 1YDFA 3CNQS 3NVMB 4O5AA 4G86A 4Z49A 4RU1A 5GIOE 2FEAA 3BDAA 4NAUA 4IWXA 1VE9A 1ZIDA 2BKXA 4V0KA 2NSHA 3DHEA 4Y6OA 4IMJB 1MUUA 2BDEA 1CT9A 2L19A 2BEWB 5D3KA 5TQVA 1NYRA 2P6PA 2MSLA 3K9BA 1TM1E 1ST3A 2I5PO 1TT5A 1X1SA 4H35A 3HDQA 3ZHTA 1RYYA 2OHVA 2WJGA 4CT5A 2B1GA 2ERYA 3DF9A 4PM4A 1SWVA 1OHHD 3VPDA 4A91A 1XQXA 2B35A 4M9UA 3U2QA 2QL6A 1U3GA 3TPZA 3LQKA 3L7CA 4BRUA 5E9QA 2AEEA 3TMAA 4BLQA 2XKAA 2QRGA 2NXCA 5E0KB 3V7WA 1CVIA 1CHDA 2ANBA 4NCBA 4PBTA 1JT2A 3GLKA 1C0PA 4DADA 2GD6A 3O2JA 2H54A 3KALA 4R2IA 2YYSA 1GGJA 2DUJA 3C15C 4MV5A 3EPKA 3F46A 4I1PA 1ODSA 1V3VA 3QU2A 5I9LA 4HDMA 1TYBE 3J81k 2F43A 5REQB 4ZMSA 3ESQA 1PGOA 4GOLD 4I4LA 3HMKA 1IDN1 1R0YA 4MS4B 4YQZA 1JXQA 2ZQ5A 1B3RA 3BFPA 4CCYB 1NVWQ 1HFJA 1V11A 4YQYA 3GVCA 3I6YA 3QKIA 1MF7A 3O8RA 1H8HD 1RM4A 4UJ3A 3K8ZA 3I9OA 1XJ5A 2VR1A 1V8DA 3BXZA 2HPAA 1E5XA 5A02A 4PN7A 3VQTA 1EK6A 1NI5A 1WHSB 4XDHA 3UYLA 4BFWA 4E1BA 3RJZA 4FYWA 4R8VA 5LR6A 5A62A 3M6XA 1SZDA 3AKYA 1RQXA 2ACWA 5JADA 2WU4A 1AKEA 1RJWA 2VNSA 2WF9A 3EDRA 3JZIA 4G07A 4AYTA 5JC1A 1JX6A 3OJ0A 2DWUA 3A36A 5EE3A 4LSWA 4FCCA 1DFGA 1CCWA 5JFOA 2D1QA 5KPJA 3LP8A 3TOSA 2M32A 2BCEA 4OJKA 1HMYA 3MGBA 5BRNA 5LBTA 1GQYA 3LRPA 3CSUA 3D6FA 3IAHA 1C0LA 2YCLA 3PXUA 2BMJA 4NBVA 4WJKB 4TWJA 3GPDG 3EAQA 3ZXSA 2W0MA 3CVWA 3LS2A 3B9BA 3UK7A 1MAHA 5K4HA 4M9QA 4BX8A 2WUDA 3OFVA 2IUYA 4IIEA 5E6RB 3IUEA 4HS9A 2JEYA 4XWGA 1NN3A 1IY2A 1PQ4A 2FX5A 4JUAA 4OGWA 5I4CA 1W7AA 4IHQA 1NW8A 2BGJA 1EGVB 4V02A 2B1RA 4C30A 4S1NA 3FZEA 3GLFA 2HJHA 4BQFA 4NECA 2FW7A 2HF8A 3ZZ1A 3EEQA 3UOAB 2XV1A 4P58A 4I1OA 3RUHA 1VJ0A 2DQYA 3E9CA 4NAVA 1EAYA 1Z35A 1CEXA 2W6NA 1VCMA 3IT3A 1YRBA 3CGGA 4G8DA 1G4UR 2X0DA 1ZMTA 3UUWA 1H2FA 1UWLA 3KQYA 1W46A 2QPLA 1G8JA 1T3LA 3TI9A 3L0OA 1QIHA 1V95A 1B6TA 3DM5A 3VFDA 2R751 4QYIA 4WOCA 5TGDA 1DV1A 1OF1A 1T24A 4WINA 5LVAA 3SFTA 5BWCA 2ZSDA 3M6FA 1EFPA 5I45A 3GRRA 1KBOA 4FONA 1FJXA 3TZBA 2FUKA 1QQ5A 2QA5A 4FI3C 2ZT6A 3NUZA 4BUJA 4Q6WA 3FYUC 1E2JA 1UXJA 5D00A 1CK4A 2ID7A 2QROA 3B2NA 4P7JA 2CLKB 4LKOA 3RFUA 4G6ZA 2H9IA 2JFGA 3HRKA 1JILA 1FF9A 3C3AA 4IILA 2WIDA 5M3BA 2XUFA 3H2BA 3OIWA 4FGSA 5AVXA 3PR2B 1E4OA 2WAMA 1DQYA 2EP8A 1DO8A 1P29A 3SHTA 4YAGA 1HOXA 5CFRA 4B76A 1JBQA 1Y5LA 2DUNA 3O7WA 3FSJX 3FH0A 3FVVA 4JOCA 4K6MA 2PMDA 4LOIA 1TIKA 2CW5A 4ZEOA 3WYAA 4MB0A 4HLQB 1X14A 4C5BA 5LIRA 1JR2A 5HKKA 4G81A 4S0ZA 4JB2A 1IAVA 1E2FA 4MGIR 4E21A 1NP7A 1EWTA 5AVVA 3BL5A 3VGPA 1E5QA 1YR1A 3GJ0A 1SRQA 5JDIA 1M7GA 3NEYA 3TLBA 1Z08A 3UFBA 5C18A 5EJ2A 1P2TA 3BMCB 4RNDB 1N0UA 3EGVA 5B12A 2YW2A 1YZFA 2VAPA 2ZIFA 5C8YA 4EHHA 1SCBA 1U98A 4NR0A 3LDGA 4GMKA 4QSHA 2PFSA 1AZTA 4A8PA 4GG1A 2PZKA 5I7RA 1P4HA 1EWYA 1GU7A 2INGX 4F1JA 4D7AA 4YJ2A 2YDXA 1DBIA 5GJBA 4H6XA 2Y99A 5IC6A 1DNPA 4NH0A 1KJJA 4LV6A 1IM8A 2YOHA 1WXEA 2QTBA 2FETA 3OQIA 4FWIB 1J2EA 1J5XA 3RYCB 1NRWA 2DKNA 3OMXA 4EG7A 5F1KA 1MRNA 1DIHA 1KSFX 2QIOA 3V7YA 4TLLB 2XOKA 4F6LA 2IIQA 1WXIA 1QNLA 2FEWB 3GYBA 4Y2RA 4BX2A 2IS4A 1G5HA 3PPVA 1AT1A