4OA5A

X-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah solved by iodide sad phasing
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
SKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O-methyltransferase family protein
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
source organism Anaplasma phagocytophilum
total genus 76
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.-:
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4oa5A00
3V97A 4PCLA 2ZW9A 2QE6A 3NTVA 3EMDA 2C7RA 1TW2A 4L7VA 3E8SA 1NV8A 1L1EA 4LG1A 3LKZA 3P2IA 1AQIA 4AZWA 5DTRA 3LECA 5FUBA 1JG1A 5HEKA 2IH5A 2GA9A 3M33A 1JQEA 3KQSA 3R9XB 5FA5A 1I1NA 3KPWA 3HCCA 1VPTA 3CKKA 3UA3A 1YFLA 1L9KA 3M6WA 5DRYA 5KS2A 3ELUA 4XCXA 2B25A 4XUCA 2IP2A 3HA7A 4E2YA 3BWCA 3HVJA 2O07A 3AXTA 5IH3A 3HEMA 3TLJA 4FS8A 5DM1A 2DPMA 2PLWA 2BR5A 4FZVA 1NW8A 2EFJA 4GOLD 4MIKA 4HGZA 4U7TB 2YXEA 3GRVA 1VBFA 3QV2A 3UZUA 2P40A 2XVAA 3MTIA 1O9GA 2VDUE 1RI1A 5DRTA 2V74B 3K6RA 3PS9A 4PYQA 5EMMA 3B3FA 4KRGA 1NW7A 2ZZKA 4OBWA 3D2LA 1X1BA 2ZVJA 3AXSA 5GM2A 3TKYA 2YTZA 2P7IA 1SG9A 5K0NA 3TOSA 4EMSA 1JR4A 4QDJA 3HVIA 3UFBA 3G5TA 1R8XA 3R24A 4R8RA 2CKDA 4BP1A 4C03A 5BW5A 3OZSA 2IFTA 2LD4A 3EVBA 2B2CA 3EVEA 5E1BA 1YZ3A 2AOVA 1XJ5A 1X1AA 1WG8A 2G71A 1G8SA 2P1DA 2ZTHA 3FPJA 4U7PB 4E2XA 3MHTA 5EMLA 4QPPA 2ORED 5EOVA 4E2ZA 3EGVA 5GWXA 1R00A 1KPHA 4PGHA 3OPNA 4JXJA 2ZFUA 3ELYA 3OZRA 5K09A 3TM5A 1WY7A 2IGTA 5EHGA 4BLWA 1JTEA 3FTCA 5K0GA 1I9GA 4YV2A 2JH8A 2OPBA 5DM0A 5K8VA 3IYLW 3E7PA 2PKWA 1M0EA 2UYHA 3PFGA 3IV6A 3PTAA 2HNKA 5HILA 4BLUA 5EVJA 1ORIA 2I7CA 3BKWA 4O29A 5D1NA 5EC8A 3G7UA 2P41A 4P7JA 2GS9A 3TRKA 4C4AA 2V7EA 3NDIA 2UYCA 1QAOA 1JSZA 2PT6A 3P9KA 5LQJA 3BKXA 1KR5A 3G89A 5CVJA 2O0LA 4X60A 5E1DA 1VIDA 4C04A 3KR0A 4EK9A 4PIMA 4IV8A 3NJRA 3MCTA 4YV1A 4RTKA 4DF3A 4EKGA 1EJ6A 3VSEA 3C3YA 5K0FA 2OO3A 3HVHA 5E9JA 3K0BA 4FSXA 3P71T 3KHKA 1NW5A 4RWZA 5DX0A 5E2AA 2BM9A 1G38A 1RI2A 2Z6UA 3EEYA 3P8ZA 4GC5A 5DWQA 1RI4A 3KQTA 4MTLA 3UA4A 1KHHA 3BUSA 1VP3A 2YR0A 4HTFA 2R3SA 1ZQ9A 3FUWA 3M6UA 1AF7A 3HTXA 5LR6A 3HCAA 3G2QA 2GH1A 2GPYA 4PYMA 3CGGA 2YX1A 4F85A 3FZGA 3EVZA 3NW9A 1N7IA 2ONYA 5CUQA 1MJFA 1IM8A 3PX3A 2G72A 3MTEA 4LWOA 5EGSA 5ICFA 3AWIA 5T67A 4A6EA 3OU2A 5DLYA 3UJBA 1NV9A 1QAQA 2I6GA 2EX4A 4PONA 4RYLA 3P97A 1FJXA 1SUIA 3KR9A 10MHA 4YUWA 2P35A 1KYZA 3JWHA 1YF3A 2ZWAA 3G2PA 4GOOD 4GEKA 1P39A 2A14A 4YUVA 3AJDA 4X61A 3TR6A 5C9ZA 4XUDA 2C7OA 4PCAA 4E33A 3HP7A 5DM4A 8MHTA 5C1IA 4UOEA 4YMGA 3G8BA 5K0EA 1XCLA 4GQBA 2CWWA 1IY9A 5FQNA 5G02A 2XVMA 3B5IA 4OX9Y 3GIWA 3I53A 5EQJB 1SUSA 3ME5A 4QTTB 5E8JA 3PX2A 4PYKA 5KQRA 3OE4A 2C7QA 3OCJA 1YZHA 2NNWB 2EJUA 2FYTA 3BGDA 2ZBQA 3HVKA 5T6BA 3RIEA 4DCMA 3SM3A 3BGVA 5KQSA 2AOUA 1XDSA 2PT9A 1R8YA 3P2EA 5GP1A 4PINA 5EEGA 2ZBRA 3UJ8A 1R74A 3KKZA 1Z3CA 3SSMA 5CD1A 1MHTA 2OBFA 2P7HA 1TW3A 4NECA 1EG2A 1M6YA 1EJ0A 4ER0A 4HGYA 4Z2YA 2HTEA 1H1DA 3WSTA 3M6VA 1VP9A 2G8NA 3FPGA 3G2MA 5MHTA 4E70A 1I4WA 1XTPA 2ESRA 4PYIA 3GO4A 4QTUB 5CVVA 5FA8A 4C07A 2Y1XA 4AZSA 2PY6A 1VLMA 3A7EA 4HH4A 4WVLA 5LQUA 1G55A 5HIMA 1NW3A 2ZULA 3DUWA 5GIOE 4M36A 3OE5A 1SKMA 3GXOA 3G2OA 4C06A 3B3JA 2WA1A 3BGIA 4V0RA 1NT2A 2B3TA 5E1OA 4RTJA 4RVGA 3QOXA 1L3BA 2XYQA 1KYWA 3DMGA 4KWCA 4P7KA 1HNNA 5BXYA 2IBSA 3ID6C 4E32A 3LBYA 5B1SA 4R05A 5LQNA 5M5BA 1XDZA 3EPPA 3SR4A 1JQDA 2AS0A 4OQDA 3A7DA 5DPMA 2PX5A 4X41A 3UJDA 1KPGA 2QRVA 3NWEA 1U2ZA 1EAMA 3IEIA 4FT4A 4CTKA 3NVKI 3KU1A 4GC9A 3LGAA 5D1HA 3VYWA 5ICCA 1BC5A 4BLVA 1NE2A 5E8RA 3FYDA 5LQCA 2Q41A 3I5UA 3ORHA 2PGXA 2B78A 2QM3A 3GGDA 4PYLA 5HFJA 2OZVA 2WK1A 1XCJA 3LCCA 1XDUA 4YUZA 3LDFA 2FK7A 2PJDA 3EMBA 4QPNA 5CVDA 1KXZA 4XUEA 5KYGA 4MHTA 5GM1A 3FUUA 5F2OA 1O9HA 2OKCA 3HCFA 3G5LA 4RSRA 2F8LA 1BKYA 3E05A 3SSNA 3DR5A 3U81A 3UWPA 4ER6A 5EIWA 1SQFA 3CJTA 2CMGA 2CMHA 4LWPA 2OXTA 3UJCA 3VC1A 2Y1WA 3EGIA 3LDGA 4OA5A 5HIJA 5F2NA 1DCTA 3PLAE 3MB5A 3MERA 2PWPA 3ANXA 2AOWA 4V0QA 1JG2A 3CC8A 3DP7A 3CBGA 3FPEA 3MCZA 3P9NA 3FPFA 3O31A 4P7GA 5DX8A 1RJGA 3DMHA 5E1MA 2O05A 5F2KA 5FWAA 5K0JA 5GIPE 5HIIA 3GCZA 5ICGA 3KPJA 2DULA 3HA5A 4DA4A 2P3QA 4CKBA 5HZMA 2R6ZA 1DUSA 4HTFB 2GLUA 3Q87B 3BWYA 2VDWA 4RVDA 3O7WA 3TMAA 3B89A 4C08A 4X63A 1NBIA 4CWAA 3SX0A 1L3IA 1FPQA 4QQKA 2WA2A 3KQPA 1QZZA 3ELWA 3M4XA 2I62A 5JR3A 5FTWA 4YV0A 1XXLA 3THRA 3FUTA 2PX8A 4OQEA 3T0IA 3KQWA 3DMFA 2AVDA 3C0KA 5EKXA 2ZLBA 1L3CA 2NXCA 2UYOA 2P8JA 2VZ9A 3DOUA 4ATNA 2ZZNA 2VP3A 4OA8A 2QY6A 4PYOA 1VQ1A 1NW6A 3FYCA 3RODA 3FPHA 5EEHA 5EZQA 3SGLA 3TQSA 4E30A 2C7PA 3C6KA 4BY9E 2OY0A 5EG5A 1PJZA 2ZIFA 1X1CA 3Q7EA 1FP2A 5C0OE 1FBNA 4MWZA 1BHJA 3KQMA 5T64A 4ER7A 4F86A 4RTNA 4DCGA 2Z6AA 3FTEA 4DKJA 5E9WA 3DTNA 1V39A 4A6DA 2YVLA 2Z6QA 2NP6A 3TPZA 3R0QA 4EKIA 2ZIEA 4KIGA 2VS1A 2ZSUA 3GRUA 2AZTA 4GUAA 4RTLA 3NVMB 4E31A 5CCBA 2PSSA 2AOUB 3T7RA 2IDKA 3SVZA 3S68A 4R8SA 4EVIA 3KR1A 1F3LA 3BT7A 4DZRA 1AV6A 3F4KA 1G6Q1 2JJQA 3M6XA 5P8WA 2ADMA 4HSGA 3P9CA 5BW4A 5DX1A 3HCEA 4KDRA 3GRRA 3A25A 2IDJA 5LQKA 4E2WA 3ER9A 1X1DA 3QOWA 5FWDA 3UJ7A 3OFKA 3DXXA 3C6MA 2BM8A 3OU6A 4KVZA 3BXOA 3T7TA 4KDCA 1QYRA 2NXNA 2AN4A 3EVGA 1ZGJA 4AUKA 3AY0A 4FSDA 3HCDA 4P7FA 3HA3A 2PXCA 3EVFA 2JH9A 5BP7A 3HM2A 1D2GA 2IPXA 3THSA 3FUVA 4YUXA 4CTJA 5DM2A 3LBFA 4RTQA 5DTQA 5ERGB 3GDHA 2CL5A 2G70A 1RJDA 2B9EA 4FR0A 5K01A 3LCVB 5K0BA 7MHTA 3A27A 3DXZA 2PXAA 3LSTA 4RTSA 5E9QA 2ONZA 5EMKA 3I58A 2OB2A 2HMYB 2BR4A 4CKEA 3E23A 4P58A 1ZHFA 5HOQA 9MHTA 4H0NA 2YQZA 1YUBA 1G8AA 3ER8A 3GNLA 1N7JA 3UJAA 4RTOA 2AOTA 1KIAA 2PWYA 5FQOA 2XBMA 5LQAA 4DQ0A 1XVAA 3JWGA 3KPVA 4IKPA 5IKMA 4F84A 3FRHA 2KW5A 3JWIA 3A26A 1UFKA 1P1BA 3CVOA 3NWBA 4FGZA 3PFHA 2JG3A 1KP9A 4RVFA 2AOXA 4X1OA 1RI5A 3NMUF 3KQYA 3LPMA 5DSTA 1NBHA 2HV9A 3I64A 3JWJA 3KQOA 5EMJA 2AR0A 4QVKA 5DT2A 2JHCA 2ZCJA 2FPOA 1FP1D 4RTRA 2EG5A 5K03A 1VE3A 4GOMD 4M7RA 5CVEA 1BOOA 1DL5A 3OZTA 2VDVE 4GF5A 4IV0A 4R6WA 3TFWA 1P1CA 3EGEA 3KPYA 1PRYA 3BWBA 4AZVA 3B7PA 4B17A 3CCFA 1JTFA 3EVAA 3GJYA 2HR1A 3L8DA 5EKUA 2UZ4A 4RTPA 1WXWA 4PYJA 1HMYA 3KQQA 3MGGA 2IIPA 1R6AA 3CJQA 2OYRA 1F38A 3FTDA 3SMQA 3X0DA 1Q0TA 5CCXA 2N47A 3DULA 4QQNA 5FCDA 2BR3A 3M70A 2K4MA 2FK8A 3TM4A 2PX4A 2NYUA 3O4FA 1VL5A 1IXKA 1JSXA 1QANA 1RJEA 3PVCA 5LQRA 4M38A 2IH2A 2ZBPA 4OBXA 1YB2A 2NP7A 4MQ4A 3RW9A 2BH2A 1OR8A 4QVGA 4KW7A 4HG2A 2PV0A 2I9KA 1RI3A 2NXEA 1T43A 3C3PA 2BZGA 2NXJA 3G8AA 3DXYA 3LKDA 4RVHA 3PT9A 2P3LA 2PXXA 3A4TA 1EIZA 2PVCA 3SSOA 3NDJA 2AN3A 3GRZA 3V8VA 2XYVA 1SVUA 3TKAA 2UYQA 3HCBA 2JHPA 5K0LA 3EVDA 2GB4A 2ZIGA 3OFJA 1WZNA 2HWKA 3LHDA 3UJ9A 2QYOA 3BZBA 3REOA 4FP9A 1B42A 4HC4A 2XYRA 5GOZA 3KPUA 2ZZMA 1D2HA 5DTMA 4POOA 1UWVA 3DLCA 3EVCA 1RJFA 3IHTA 4Y30A 5EIFA 1UIRA 4C05A 1SQGA 2EJTA 4ER5A 4PNEA 2IBTA 1O54A 3P2KA 4M37A 4RX1A 2IH4A 3SXJA 3GWZA 2ZWVA 1D2CA 2PX2A 2E5WA 5HIKA 1N2XA 1P91A 4Y2HA 5EPEA 3UJ6A 1M6EX 4GBED 3VC2A 1WS6A 4EQZA 3HNRA 1NKVA 1X19A 3GU3A 4ZTBA 1JG4A 4DM3A 4YUYA 5ICEA 3CJRA 2O06A 3R6TA 4ER3A 3FUXA 1JQ3A 1ZKDA 5FHQA 5EZSA 3P9IA 3I9FA 1JG3A 1WXXA 1Y8CA 4PGGA 4WXHA 2G1PA 2PBFA 4QDKA 5FADA 1EQAA 2H00A 4PYNA 3G88A 4YMHA 5DXJA 1QAMA 3T7SA 2ERCA 2YUIA 1INLA 3OU7A 5EHIA 4LECA 3ELDA 5CM2Z 5FHRA 2FHPA 1G60A 2AN5A 2GAFA 5E2BA 5CVUA 4IWNA 5CIYA 2O57A 4DMGA 4KIFA 3LX6A 4PIPA 3DLIA 3EEOA 2AVNA 2H1RA 4RV9A 4CKCA 4CXMA 1ZG3A 4PWYA 5U4XA 3KQVA 5H02A 2OB1A 3R3HA 4ISCA 3BWMA 4K6MA 3GRYA 4AX8A 1R18A 1ZGAA 5K05A 4RTMA 2H11A 4FT2A 1TPYA 5K0CA 5KVAA 2P3OA 1ORHA 2FRXA 4R6XA 2AOTB 1Q0SA 3LL7A 5JUWA 2JHAA 5DSXA 1KPIA 3DH0A 3MAGA 3MQ2A 2YXDA 3LCUA 3LDUA 4BP3A 1AQJA 3KR2A 5GINE 3UBTA 1YFJA 3ERCA 5DXAA 4AZTA 3PB3A 2QRVB 2FCAA 3H2BA 3FTFA 4HRAA 4G56A 5FULA 4GOND 3FRIA 5LSAA 3B3GA 2YXLA
chains in the Genus database with same CATH superfamily
3MELA 1U5BA 1G5TA 2K6GA 1SKAA 1Z6YA 3PNLA 4XW2A 4C0JA 3GPLA 2ZS8A 1H69A 1S3SA 4JCOA 1J49A 1TW2A 4L7VA 4CEIB 3A2KA 3NIBA 3SZGA 5JXHA 3ER6A 3IAS6 3KKMA 1SCIA 1AGYA 5IF9A 2ZJ8A 2OTCA 4LF4B 1A4XA 1DTWA 1GTZA 1SU6A 2DFTA 3QU5A 4ZDWA 3O4RA 3KAPA 3D8UA 3Q12A 5JPCA 2J0SA 5CHYA 4D1YA 3DCIA 4LJ6A 5KDOA 1YFLA 1I6LA 2EWVA 4IXNA 3WSWA 4I9NA 1CVIA 2I7XA 5DHTA 3IHWA 3HJCA 1PKEA 4R2HA 1K5GA 4Z49A 1K6EA 1Y63A 3AXTA 3ETEA 5DE3A 6Q21A 4X00A 1S89A 1S3GA 4MYSA 1G8JA 2JEOA 3DZJA 3GQBA 3IAM6 4B4VA 4MIKA 4Q3KA 4QXAA 3CA8A 5LZ8A 2PKRA 4LY6A 4ERXA 1V8ZA 4OYYA 3IOEA 3EISA 5EXPA 3ZX5A 3E9ZA 1KNXA 5F78A 3UGQA 2WU4A 1RWOA 4FKMA 1MT0A 2FW0A 2BSAA 1LF0A 1HYHA 4KQIA 5EPOA 1YL5A 1Y6FA 1TIPA 1UBRS 2R6HA 2MSLA 1U4NA 3D2LA 3K9GA 3OLZA 4NC9A 4ARBA 5A6VA 5KKNB 4GL2A 2BBSA 2PUEA 2ADFA 1LU9A 4Z8XA 3NR2A 4WKNA 1R8XA 2C20A 3AUKA 2V7QA 1FSZA 2VJQA 4KJZA 4Q18A 4BQQA 1F1JA 4KMOA 1XJ5A 5EP4A 1VGQA 5MN4A 1XAHA 3NIGB 4N0PA 4EX7A 5EOVA 1EH5A 2ORED 1OPXA 1ST2A 3AYZB 3VPFA 5H3CA 4OHYA 4EABA 3NPAA 1E5XA 3ELYA 3OWOA 4EY5A 5TS2A 1PSZA 1Y1RA 2HXYA 5B1IA 3W7AA 4DXAA 4S35A 2DWUA 4ZICA 1KJZA 2VJLA 3L77A 1FU7A 4DSUA 2FGJA 2OLKA 1MEOA 4MUIA 5EAIA 3F5SA 4HGNA 4YDRA 5A3QA 5HQ3B 5CP8A 3UMVA 3CVUA 3SZMA 2JGEA 3H9QA 2TS1A 5D1NA 4CCWA 1TA4A 4JVOA 3RVPA 4YV7A 4K9LA 1Z8FA 2V7EA 5SYAA 2RHOA 2VG8A 4LC1A 3ABRB 2CLCX 1N0UA 3SQDA 3V6LA 3BKXA 5CVJA 4HUTA 3ZZ1A 2GKGA 4GXRA 2NU6B 3KSUA 4RK4A 4G0YA 1TUGA 3NJRA 4OXQA 1II8B 1MD9A 1RHJA 3VR1A 4CKCB 3M3DA 3K96A 1IZ8A 3VSEA 3AJAA 1L5QA 2CXQA 1DJMA 1OIXA 2OO3A 5LD2C 1ONNA 1C3OB 1FOEB 3U3MA 5IN4A 2FEKA 3FM9A 4U8GA 3K9HA 5IM4A 1FNBA 4ARIA 3EEYA 3DF7A 4GAEA 4G9GA 3VX3A 2ZRBA 4UFPA 3IDSA 1QKIA 3WLFA 1LJLA 1QS0A 1JHYA 1P18A 5HS6A 1EA7A 1Z0FA 3C3DA 3DBOB 5ERYA 5HF6A 1L4EA 1RWMA 4CV2A 1DV2A 1NIPA 3WA7A 2PJRA 3T6KA 1MN6A 1O89A 1ZSYA 4CE6A 3AEKA 3GCGA 3K0KA 4IVQA 4LKOA 5EN4A 3A1DA 4X71A 5G3ZA 1EX6A 2XA2A 3EXG2 4GL4A 5FXMA 2RKOA 3TXYA 3WK4A 3AWIA 1YXMA 1H3EA 3AIKA 4BP8A 2O8EA 2X1LA 2FPGA 4RYLA 4CF3A 3JD1A 1JZTA 5ALYA 4MR9A 2QN7A 1SGWA 5CEEA 1CHNA 1R6XA 3LV8A 4XSVA 4L74A 4ZAZA 3VV2A 1B6TA 3INYA 5BWOA 4YCSA 3PITA 1P39A 1T5BA 4JA0A 4NE2A 4UUPA 1DSSG 3HUDA 2WMOB 3CZCA 4RD3A 4EX6A 3PRHA 4HUJA 3TL3A 3E15A 4BMZA 2QQEA 2C0CA 4I4TA 3SEFA 4DCVA 1GPBA 2FSSA 2J9FB 4KQFA 4NNJA 4BLPA 2AKYA 3C1AA 1DAKA 3EK2A 1BWRA 2AG5A 1ZD2P 4YMUA 1YK0A 1QXSA 5H4HA 4KQHA 3RAFC 2DZDA 2LIVA 3H87A 5EJ9A 1CTQA 5KQSA 2PT9A 2O5EA 4ARAA 4OI4A 4N0EA 1TB4A 2YYZA 2ZBRA 3IELA 4B0OA 1GRRA 3K20A 3ENZA 2R7LA 4KYUA 4O2LA 3CMMA 5A5DA 2PL9A 4X90A 4OHVA 4QOSA 5AJUA 1BFDA 3ORQA 3KJGA 3PVSA 3FPGA 1FB5A 3AKEA 3R0ZA 5GZ6A 2ZUEA 3LGXA 4FNMA 1HEYA 3NS7A 4GLJA 1L0BA 1Q0ZA 2PAAA 4JBWA 4PQFA 4AZSA 2NSYA 1NJ5A 1E92A 2G76A 3NRJA 1EJBA 4UTPA 3NTRA 1I4LD 3AVQA 4LZWA 3V2GA 1L7AA 2R4QA 3NJ4A 5I45A 5KYUB 4K6OA 5AICA 4FUQA 5B4UA 4CMJA 3B3JA 5EPUA 3SS9X 2HSDA 2JFPA 1RCFA 4ZO4A 1TTPB 1Q2UA 2H31A 2V7WA 1NXVA 1Q0HA 3PUZA 3QVTA 4PXSA 5DCWA 4EUEA 4CUKA 2FRVA 2NTYC 2ODEA 4AMUA 3U6KA 3EF0A 2WLTA 1CNEA 4YJ2B 2GJ4A 3LA8A 1BNCA 3TW8B 3AY7A 3VKWA 5BXYA 2XGJA 1XZMA 1J8VA 1E6CA 1UDRA 4PWZA 4TSFD 2G9NA 5DPMA 5JYDA 3PXUA 1EGHA 2EFCB 2OZKA 3WBBA 5FL7A 1EXDA 3EPHA 1PR1A 2H3EA 4WK2B 5CRIA 4ZRDA 1BC5A 1UKBA 2BKUA 4U9UA 4JB2A 3T4PA 3WLSA 3CCBA 1KC3A 3IALA 4OQ4A 4E6EA 1YA6A 1KEVA 1W19A 3FMVA 2VZ0A 4WSOA 4ITRC 2EQ5A 3IAEA 4OH7A 3RUIA 1LLDA 3QUQA 4HWTA 1XDUA 2C9ZA 2JEZA 3SEQA 1S8FA 3M6LA 1KXZA 2XUPA 4XUEA 1CR1A 2DETA 4OFZA 1SC9A 3IOMA 2E4VA 1TM3E 5COAA 3LWZA 2Q5LA 2WFLA 4TSRA 1PUIA 3RVMA 4O25A 4HGQA 4DJJA 4DIKA 1PD1A 4LWPA 4O33A 1VI5A 1H8HD 4K6HA 3GI1A 1EK5A 4L4RA 5IK2D 2LKCA 3GWGA 4Q9DA 4QUHA 3S7ZA 3ROFA 4CCYA 2JLVA 1E98A 1W1UA 2EIXA 3K5IA 3W4KA 1OB2A 3DMHA 4DA6A 2WDPA 2FKAA 2HHHB 2H1CA 3PC3A 5HIIA 1TA9A 3ZHTA 5AIBA 2ZYTX 1ZW1A 3AR9A 3NALA 3HY3A 1CS0B 3OTHA 5JY1A 4D9CA 1SCKA 2GEJA 4L1KA 5ALXA 4DC0A 1RADA 1UJ5A 2IOQA 1OZAA 3KUCA 5LYJF 5KAMA 4B8YA 2BJVA 1UZUA 1J4AA 2CNWA 1KOJA 2OZEA 4PC3A 1IFXA 3UGJA 2EZTA 2HD4A 1R66A 3IIMA 3PHLA 5EIOA 2W2KA 4OP3A 3T0IA 4BS9A 4CMBA 5IUNC 4AYXA 5AVXA 2NXCA 4BV3A 4S1OA 1DBRA 4FFBA 1SHLA 3UK7A 1R0BA 1VQ1A 3THXB 5JNWA 1R16A 1N0WA 1IG0A 2YCLA 3DFMA 4G97A 4JITA 2C7PA 1PJ3A 1A2KC 3EA0A 4MV3A 1JR2A 3ZHXA 1JEOA 3AR4A 2CZGA 2QQ0A 2TMDA 1AUOA 4UBLA 4A2QA 3DBHA 3LFHA 1STOA 1MGOA 5CDFA 4B2PA 2FMIA 1JLKA 3MJSA 3R7FA 3S1AA 4CN8A 5BNWA 2WWXA 3R0QA 4J9VA 1VMAA 4MH0R 4IVPA 1RC0A 5JXGA 3AJRA 4IZ6A 1TZJA 2AZTA 2BFCA 2ZTSA 4XIFA 1LZKA 4DIBA 2DUMA 4QG3A 3HQ4O 4O8CA 3ESQA 2V6GA 3O03A 3AVVA 2WYVA 3OFND 3PGA1 1N3LA 3AFGA 2JJQA 3DUFA 2IZOA 4LF9B 3O3NB 3ISVA 2W7TA 3TTVA 1KVUA 5BT9A 2QNRA 1JG6A 3VH3A 2IHJA 2OXRA 1P0QA 4ZT3A 3A25A 2CMDA 5TXGA 2O4CA 4FM9A 4RGYA 3DDWA 3LRTA 3AKDA 2EBHX 2IBMA 3K0AA 5HCIA 3DXXA 4EW3A 1H9CA 3T7TA 1FYVA 4WXYB 2YWHA 5BV7A 1Y1QA 2IHKA 2J3KA 3D8HA 3E1GA 4P0QB 2DPXA 4Q4AA 1A5SB 2REQB 4GRAA 1W4AA 3HA3A 1E9VA 1KZ4A 2JH9A 5DBIA 3HM2A 3VHLB 5FX2A 5HW0A 5B55A 2GF0A 2RK3A 4IP0A 5ALRA 2X7JA 2CHUA 4AN0A 2IS4A 4QEDA 4CM9D 5AK6A 3ZNOA 1XTSA 3LBFA 5AP9A 1G2QA 2VK8A 4PQEA 1V3TA 1UP4A 3KC2A 3RTAA 2XMSA 4INPA 4E5NA 4DQVA 5HVNA 1IEVA 4MLZA 5FBLB 3RKUA 2QY9A 3OCZA 1U3GA 1GGKA 2GNPA 3TCXB 4E5PA 5IASA 1GAJA 3UJNA 1TLTA 3FWKA 1MJHA 3E53A 4JKOA 2BR4A 4CKEA 5EKSA 2F64A 4EVRA 1CP3A 2COKA 3DGEC 4BZPA 2JZOA 4BWVA 4X8MA 1G7CA 1GGMA 2X41A 3A6GA 3P52A 4HGPA 3W5CA 3RTCA 5B7PA 4BJ1A 4PGAA 1ZOLA 4JLVA 3RTDA 4AY6A 2JGAA 4OB8A 1DE0A 3QKTA 1QUEA 2C3OA 1L7DA 2YJNA 4WMLA 2VXBA 2XBMA 4JXZA 5ICSA 1JIKA 3PGJA 1E5DA 3KZOA 4AKGA 2R6JA 2A9QA 3A26A 5ULLA 1VSBA 9GPBA 1MPTA 2R1ZA 3WRXC 2A1UA 2Z1MA 1KP9A 4Z1MD 4UE2A 1E8DA 1NYQA 3GCWA 2OM6A 4JEUA 3CUEF 4M1MA 4EUHA 4OPMA 8ATCA 1IZ9A 2VF5X 5A3VA 4EBBA 3RKSA 3THWB 3NX4A 1M2FA 4QVKA 3H5LA 1SMKA 1YRBA 2GFHA 2VCHA 3OX2A 1T1EA 5IJAA 4P2BA 2VTKA 3Q9UA 4Z8YA 3F0TA 5AJHA 4A8TA 4CF5A 2QSJA 4K9PA 1DOAA 2QG6A 5ILOA 1YMVA 1YUNA 1XIVA 3HCWA 1KFJB 3WP0A 2UUCB 3ACBA 3I2YX 4ZJZA 4QM6A 4P53A 1E2JA 1EG7A 2NUTB 1UR5A 4JP5A 2HJRA 2XAUA 4RTPA 1X8XA 1T15A 2P4UA 4I1YA 4PG4A 5FUWA 3JQAA 3DE4X 3SC2B 4K6CA 4PR3A 5K8IA 1OAKA 2BTQA 5C3UA 1NIJA 2B1IA 2DERA 4RA9A 3J81A 3EJWA 2XB2A 1T6NA 3NAQA 3QHAA 1ZJZA 1FDVA 1B0AA 1KSGA 3ZVKA 1YSCA 3OJLA 1US8A 1V3QE 1OR8A 2GN1A 4YRIA 5CR9A 3QUBA 1JHVA 1COWD 5IC4A 3LWDA 1N92A 1JFFB 1C3EA 4AZ0B 4EGJA 3PUJA 4UDNA 3OE7D 2VJMB 4C29A 1OFUA 4PFJA 3KYIB 5FWXB 1TZ2A 4ARZA 1JWLA 3H11A 3ZY5A 1F0NA 2PSJA 4XQ0A 1CUIA 1GYQA 4AKEA 4DTCA 4IUDS 1W73A 2E2WA 1T4BA 1Q1QA 1U4OA 4R41A 3SEAA 3V1TC 2FEPA 1XNQB 1T5OA 3BZBA 5LQSA 4BPBA 1MTOA 1L4NA 2YXNA 2V6FA 4G01B 1XCPA 3RRNA 2FNAA 1WP9A 1SIWA 1Z08A 2JIQA 3OMWA 2R44A 2IP1A 4DIEA 2OWEA 2DWCA 3MCUA 1SULA 1MEEA 2C4WA 2BM1A 5AI6A 2FQWA 3N76A 2E21A 4P4LA 3P2KA 1N9GA 3B20A 4W4TA 4XJTA 1WLSA 3S8MA 2Q6OA 4HNRA 1NBAA 2PKCA 4DLWA 2UXCB 1FUUA 3X3HA 3P9PA 4MUMA 3WDSA 1K27A 1GPLA 1ZXBA 3FNRA 4J0HA 4BMNA 3LZDA 5LLTA 4DBZA 1T1GA 2VHJA 4L5CA 5KU1A 4MW5A 4RS3A 1AQYA 2Z43A 3OEEA 1GPDG 2O2EA 2O8FA 5TQVA 2HA2A 4M89A 3BIFA 3GF4A 4RD4A 5HJ2A 4IHKA 3SC6A 3CWCA 4J07A 1EHIA 4LZPA 4X6XA 3U9LA 4WLFA 5DGDA 1ITZA 2VDJA 2MOKA 1E2GA 1LTQA 2O3RA 1YS2X 1IVSA 4F6RB 1ZCAA 2WINI 3OT1B 3CYFA 3OEYA 3PDCA 1L5OA 1T9HA 1Z7WA 2QPLA 3GFTA 4BV8A 2GBLC 4DLVA 1JA0A 5L7TA 3GRYA 1DRUA 2ACVA 2NUBA 3I2FA 4RZUA 2HK6A 3JPYA 5TY0A 1T2AA 2H11A 4ZGGA 1H5QA 2FPUA 2V58A 3U7HB 1CB7A 1HETA 3OO0A 5CITA 1AN9A 1W48A 3ZQUA 4C4SA 3ENKA 2CLFB 1PR4A 2VNIA 2FX2A 4AX4A 2HW8A 1NUQA 2GBGA 3RI3A 2D7DA 1KQFA 1EE9A 1AGNA 3PDWA 3VH2A 3WBFA 1C81A 3KR2A 3LT0A 2IPLA 3TCNA 1ZEJA 4AIIA 4YMVA 3OPXA 4EI2A 3KHSA 3FRIA 4IAOA 1F0KA 1WHSB 4PC2A 2RJ3A 2ZXEA 4AG6A 2CDBA 3SP1A 5KOHA 4NENB 1V6CA 3JQRA 3ANSA 1YI1A 1NE7A 1IE3A 4L02A 1R0SA 2RGCA 1NMEA 2PIAA 2BM0A 1EFCA 4AF8A 4AZWA 5JCJD 5AJTA 9LDTA 2GARA 3OHMA 4J4TA 1XXHE 4M46A 1UC4B 5HF9A 4B6OA 3HR4A 3ZK7A 3WL4A 4M8NE 1PQPA 2PR7A 5AT1A 4HX2A 1E79D 3ZTYA 4UOQA 4DQLA 2C9CA 3RBAA 3PEWA 4YP1A 1SPXA 2Q4BA 2YXBA 1EQUA 5B30A 3L7CA 2OQ2A 4V2IA 2ZYIA 2IP4A 4QGHA 2R11A 2A1IA 4RJJA 2PFKA 4NBLA 1EE2A 4JXKA 1PSWA 4Q0MA 8ABPA 5UKDA 1XELA 4TQUS 3FSEA 3HJAA 4B2LA 3GDWA 4CKWB 3PICA 3K2IA 3GVXA 4L16A 3UKOA 3GLIB 1NMYA 1LFAA 1O9GA 4OJMX 5AOBA 5AJWA 3JD2A 4RMIA 1H2HA 2NADA 2PUWA 3PS9A 1SNYA 4PYQA 4ARSA 4F4IA 4HV4A 1G7TA 3U48A 2C4KA 1KIMA 2YTZA 4HNHA 5T4EA 3WB0A 1XTIA 5TIIA 5BO5A 3RHZA 1A3CA 3SIPA 3HVIA 3IAS1 2NPFA 1N25A 4C03A 3AUSA 4LYFA 3MBOA 4TSKA 2AG8A 4ABTA 3JYHA 1RBMA 2D54A 5IAOA 5DP2A 4XJXA 4UNNA 3T1VA 3U39A 4LK2A 1QRUA 4KACA 2ZIAA 4WX2B 4ND2A 4I66A 1DUIA 1ESMA 1KAOA 1XKQA 1CUGA 3Q3CA 4MWBA 4ZOBA 1TUIA 4W6QA 3D2AA 2IV3A 3K9CA 3IR6A 4LDAA 4P4UA 2B7BA 5FAKA 3IAM1 1ONPA 4DSZA 1WY5A 1JFSA 2O8CB 4XASA 1AMUA 1VPDA 2OLEA 2O2HA 2WWFA 3DZDA 3FCEA 2H16A 3LNCA 3QE0A 5CHEA 3VZDA 4KV7A 2BDTA 2BY4A 3DPUA 2YNMC 3COZA 4TTAA 4UD6A 3RR2A 5JD6A 2GZDA 2AFHB 3FIUA 4DLYA 2OGTA 5AW8A 1N5MA 1W8IA 1DKUA 3G7UA 3TTXA 1SK8A 3WICA 1T0IA 2QT9A 4CLOB 2Y71A 1E3JA 4NG5A 4V1CB 5LCXA 5FLXA 1NXXA 1P2FA 1SXJB 5ENZA 1VIDA 1W5SA 3WGZA 1NN3A 5BSFA 1U9JA 2NZUG 1HE1C 2J0QA 4DF3A 3W8DA 4I4LA 1L8XA 3O38A 2B92A 3CB2A 4KGZA 5E7QA 1FDWA 1Y4AE 3D4IA 4JC0A 5JIBA 1RHQA 1XSEA 3ZY2A 2O48X 5E9JA 1MB3A 1KS9A 3I8SA 2ZUTA 2QGFA 4E07A 2J4DA 3JYOA 1KYTA 1Z3IX 4OFXA 4A73A 3AFMA 1KP2A 2ORIA 3HKCB 3LXRA 3OQ1A 4F4DA 1QX3A 2A84A 4LDQA 2QX9A 4ZI7B 1F5NA 3P8ZA 3RIYA 1XAJA 4F3CA 5DNAA 4LMBA 3NEPX 1OXUA 5FOVA 5CFOA 1Y7IA 2WZBA 2ID9A 4F0JA 2V98A 3D0KA 2JBAB 2B1RA 3E9NA 4QULA 4DY6A 1TMOA 2ICAA 4KVGA 3AVYA 4HFRA 2QK4A 4K8OA 4KVFA 3BHNA 1CXZA 1E2KA 1PGOA 1L5RA 1SBCA 2Q8PA 3CPHA 3G9UA 3FZGA 3AF0A 3RT9A 3OJWA 1POXA 2EZ4A 2HPZA 4TKLA 3AINA 1T4CB 3N7TA 2DBRA 4NAUA 3VTAA 4PNZA 5CXQA 2R1TA 4F1KA 3TNDA 2OQRA 1RC1A 3OA2A 5JS2A 1OREA 3EEFA 1PX2A 4C7OB 3MIZA 5IT0A 5G0SA 3HXQA 3PEVA 3BK1A 1FSSA 3TPFA 1K5HA 2OV8A 1XTUA 2PGAA 1RU3A 3CKMA 3F46A 3GVPA 1ZM2A 3HJHA 1U2QA 2NWQA 5JAZA 1SC1A 5BT8A 4X7PA 5G02A 1QYIA 4EI8A 5B7QA 5AM5A 1ODLA 1DC7A 2R00C 2ZREA 3F4LA 4ICIA 4NMXB 1EGQA 2WJPA 4LOAA 1T9CA 4PYRA 3SZLA 4B09A 1N7HA 4YXWD 1LPOA 1EUYA 4HMPA 1ZZEA 1VLJA 3OAAD 2Q45A 4ZIRA 1KP3A 1SCNE 4LXGA 5C4IA 5DB4A 3BQMB 4J1SA 3QXSA 4CFSA 5IVPA 1NRIA 2WY2D 3MWDB 1YQWA 4PS1A 1SQ5A 3VNRA 3VGPA 1L5ZA 3JWPA 1TW3A 4LTNA 4PSDA 5A06A 3EEQA 2H2WA 3L8GA 4GMGA 2RD2A 2BBWA 1JIJA 4E5MA 5KTNA 4FE4A 4JX9A 5AHOA 4BVHA 3JS5A 4GH5A 4Y1EA 2OUIA 3PTLA 2O2XA 4RMJA 3E0QA 3H7AA 1GY8A 4L50A 4Q3OA 2ZRNA 4AMVA 3V4LA 2RONA 2V7TA 5DI9A 1XDWA 4II2A 5AHWA 2RAPA 4RE5A 4G5RA 5F7OA 1QQAA 2ATVA 5TQ0A 5C5DA 1YE8A 4R9UC 5KYXB 2WYUA 4OOFA 3MMNA 3AESA 5CH8A 4QJBA 4PZDA 4X7RA 3O90A 2EW8A 1QV9A 2Z9DA 1E1RA 1EFTA 3O0TA 5E0KB 4GMDA 3SI7A 5HPYB 2ZRPA 3VQTA 3FKSA 2XBLA 3NHSA 2YMLA 3QLUA 3TCKA 3VISA 2HJVA 3MAAC 4D8UA 2RGYA 2QM7A 3QENA 4WZ6A 3WKCA 1DOHA 2QG4A 1C30A 1A5ZA 1MAWA 3Q7SA 2AS0A 1EWTA 1XD2A 2WF8A 3LQYA 1CRPA 1KPGA 2DHCA 1P1FA 4PCVA 1P2TA 4Y1GA 2XIJA 1WB9A 1GFIA 2ORVA 4PE5B 3ZHBA 4CL0A 5HUHA 3MWLA 2Q41A 4LMAA 2VSXA 1JNXX 4RGQA 2OCDA 4MWGA 2HUNA 3REFA 4XB2A 1ZK4A 2X9GA 4KE8A 4QPNA 1H4VB 1CUDA 5SZJA 4JD5A 2QAGB 4IOMA 4URFA 5IDXA 5JJLA 4HAXA 3IP3A 4JUBA 3JQ7A 1XGKA 1HE4A 1URPA 1Q3KA 1Q50A 4NABA 5IJXA 2OXTA 4CV1A 3EGIA 3LDGA 4OA5A 2H18A 2OC9A 1SBYA 2FPIB 3GGGA 2ZAOA 1IM2A 1SVIA 3ICOA 1E2PA 2Y99A 4HB3A 3CC8A 5E7JA 4EAAA 1FW6A 2MHCA 3CNNA 1A95A 3EXHB 3KOOA 3O31A 4HDCA 4YJKA 2OV6A 4GVXA 4MW0A 1YTLA 3QVKA 1J21A 2OD9A 4CG2A 3ICPA 3QBVA 3TX6A 4PSKA 2AUMA 3MRSA 3SHQA 4HTFB 4KYVA 1ORRA 3DONA 2BMJA 4JP8A 2P2DA 3W4JA 3EYAA 1NLUA 3FDFA 3HBJA 1KI6A 3I72A 2WD8A 3OOJA 4HH3C 3R5KA 3KQPA 1Q5PA 3FDZA 4MRMA 4QXMA 5CB0A 2HJGA 4PLWA 2AHOA 3A3OA 1KOLA 2E87A 5FTWA 1S3FA 3I92A 3PNPA 5HJ5A 2GT1A 4MRSA 1O57A 4MJ7A 3T3PB 3UH1A 3E22A 2A5JA 2X2OA 1KZYC 4I55F 3DOUA 3OKCA 5J5VA 1RSZA 2VHWA 1FFYA 3H9BA 2IEDA 4K87A 4RHEA 5DK4A 3UVEA 4EW1A 4U6QA 4F8YA 2O8DA 1O08A 2QYSA 5EZQA 5DT9A 1CVRA 1HK7A 5J58A 5EG5A 4FHCA 2CCGA 4JBLA 1RAGA 1SBTA 2FWJA 3L40A 3QVGA 1QDEA 1P9OA 4IZOA 1V48A 3FLBA 1ZUD1 4DNOA 4OF4A 3VPCA 1IHXA 4BCCA 2V9PA 4MYDA 1Z82A 2CT8A 4A6DA 4YXFA 1SA0B 1ND6A 2IIVA 5H0IA 2NPOA 2QIOA 4GPEA 5KDLA 2AXPA 3WB1A 3KQUA 2DVMA 3ODPA 4FGKA 4N5IX 5AI0A 4YI3A 5ALTA 3TH5A 2VS1A 4AYTA 2Q21A 1TX4B 3PGVA 2I3BA 3GG9A 1NR1A 4MWEA 2P0EA 4N9QA 2PBZA 3V2HA 1YB7A 1KDZA 2HIHA 2QTVA 1A97A 1AHHA 4ILEA 5D6NA 1G98A 1ZVMA 1IN8A 3COVA 3TW4A 3DC2A 2UYYA 3PGMA 1T8SA 1ESNA 3LQ2A 4JJ7A 1OT5A 3ILHA 4Q4HA 3ZV3A 4CDMA 5CLJA 5D85A 2VPIA 1S5PA 4TMVA 3RFTA 2FPRA 2ZG6A 2K87A 1JHDA 1Y82A 1OIWA 1U6KA 4JJIA 3WR5A 2I1QA 1YAHA 1QYRA 3NM4A 3DCYA 2I6UA 5A4DA 2XCSB 4TV9F 4MUJA 1BE6A 4BVGA 3CTPA 3UMGA 3W1EA 3QSGA 4TQGA 1W88B 4QWWA 1TYZA 2DE0X 1XPJA 2JNWA 3E27A 5HNKA 6CHYA 1BD4A 2G1AA 4JYPA 1ZI6A 2K2QB 2NSJA 1RXYA 3CUTA 2VDLB 4WZBA 3Q6IA 5CT5A 3MC1A 1YH3A 4V39A 3KQNA 4NOJA 5AVKA 3SDBA 5L3VA 1S1CA 5EP1A 2JIMA 3WQSB 2CL5A 1ZHHA 4LDRA 1L7OA 1N57A 1P3DA 3A27A 4HSEA 2NIPA 3LSTA 2NT4A 1PWEA 3O8QB 3B51X 3N59A 4BRUA 5B7NA 4X95A 3QJGA 1TIBA 2C5HA 2HMYB 2YYYA 4PF1A 121PA 2ACEA 4RF2A 2Q49A 3O8OA 2ACKA 3TZHA 1YRHA 1GT91 1NSYA 1YB4A 4F91B 1LSSA 2I1VB 3II6X 3KSZO 3D02A 3DS8A 3E6AA 1Q1AA 2EJWA 3BWDD 4GZ3A 4R1LA 3USCS 3V4VB 3HM9A 1N5DA 4IIJF 1XVAA 4TV8B 1UCFA 3PWSA 3SF0A 4LYAA 2E18A 2R79A 3O3MB 1MLDA 3GEIA 4P0TA 3U4CA 2VTBB 1W49A 1TJ4A 1UC8A 2AZMA 3JQDA 4XUGB 4KNWA 5DFAA 1OLXA 3VU8A 2ZCUA 3OEWA 4DE5A 1G41A 2D62A 2Q1XA 3PQDA 4QO7A 4QWMA 1X7XA 1F2DA 1ES9A 2N3ZA 2WVJA 3E3AA 2TRSB 3IPXA 3P4XA 4NX2A 3U4QB 1FP1D 2QXTA 4UBOA 5H59A 4A5OA 2FP4B 1BOOA 4CKBB 3TNFA 1DOZA 4IUYA 1LLFA 3CXUA 1DDGA 3KPYA 2OC4A 1R64A 2RI0A 4HB4A 3BWBA 4Q4JB 3K1YA 4NH4A 4Q7KA 3SHTA 4DJAA 5FUQA 4FZJA 1V5WA 2HA0A 2GK7A 2OD2A 1SD1A 1Y3DE 1KF0A 4DJDC 1I2CA 2PNFA 4Y7CA 4L5YA 4BMOB 2P5SA 2HRQA 2N47A 2CBZA 3M70A 1TO1E 3L4JA 3HKEA 5EE5B 3L5KA 3JAMA 2NYUA 1OXSC 1RE1A 1B7GO 3GEMA 4RD6A 3MQ4A 4HCJA 1SVSA 3UAGA 1M8GA 1SFRA 3CRRA 3M4YA 4IIHA 4HNAB 2HNAA 2OO5C 3RVRA 3EHDA 3S70A 1YA4A 2GDZA 3D3WB 4NV0A 3G5AA 3H4VA 4IIYA 5HQJA 4EFKA 4RVHA 3G23A 4ZT5A 2V7XA 4B3DA 4BE9A 2P3LA 2PXXA 1GWNA 4NJMB 4WN9A 5IBQA 3VSDA 3C2QA 3QJYA 4HLCA 3NORA 4FNOA 3N8NA 4XIIA 1C8BA 5FT9A 3E9MA 3TKAA 3NWPA 1PT5A 5AUPB 1N32B 1PUJA 3OFJA 1VXRA 2PRJA 2W2QA 1V1JA 2REOA 2CE7A 4Q3BA 2A0FA 1D2HA 4OU4A 2XYPA 1VA4A 3DV0B 3DLCA 3PR1A 3LOUA 1BXGA 2X5NA 4JJZA 3F49S 1N2ZA 2XF8A 3EIUA 1YRLA 2Q4TA 1PQWA 1DIOB 4N47A 5A2QA 3GWZA 2VH1A 1RPNA 4MQ6A 5EIAA 2P9ZA 2C9DA 2PX2A 1N2XA 2D6FA 4NBSA 4HTAA 5B2EA 3NO4A 1KAGA 3GQVA 4XRGA 1TD9A 1EJ2A 1WCYA 4E5YA 1C0IA 1CKEA 2A5DA 4I4IA 1IH8A 1GOTA 4ZWNA 4H59A 5IUKC 3EB9A 5BMVF 4YR7A 3GEGA 5KWVA 1EZ4A 2WU0A 4GNRA 2PQ0A 3C3AA 2PUVA 1EQAA 1WHTB 4G4GA 4BAZA 1VYHA 1OGYA 2ERCA 3C3KA 3BDVA 1AS2A 1YQGA 2XUDA 1HLPA 3QW4B 3FYUA 4YYEA 2HADA 4MRNA 2GAFA 5DF1A 2YBEA 3WK5A 2NZJA 1ZD5A 1Z62A 1QTQA 5LYJA 3BL6A 3OJCA 1PNQA 4M9SA 4JBGA 1VJGA 4PIPA 4UMVA 4NONA 5BNTA 2Y4OA 4RV9A 5E6UA 1C1DA 2PLAA 5DIFA 4PR0A 3KQVA 3AU9A 5KWIA 2XMQA 1OJ7A 1R18A 2Q8NA 1T1RA 5K05A 1DWOA 1RM4A 1A2QA 1TPYA 4TVBA 2F90A 4RIGA 2A88A 1ORHA 1U1IA 2LCFA 2V7QD 3IP1A 4XVRA 1I1OA 3VKUA 4DV7B 2XI4A 1FYFA 1HLFA 1YIAA 2VKTA 3C1OA 4H7KA 4K8RB 5L9AA 4RPGA 3NKLA 2UUOA 4MV5A 4BP3A 1MP0A 3GA5A 4EGQA 5C8VA 5HIAA 1GUFA 3ERCA 1CEEA 1ATIA 1U7WA 1D8AA 1XTQA 2X2PA 3ST7A 4R1QA 3B2EA 4DWJA 4AN4A 4J6EA 2GSWA 3CISA 3DMPA 2RGNA 1OY1A 4ND6A 4OHUA 4NBVA 3O1IC 3IKTA 1F7VA 5KTTA 3ZE8A 3L92A 3LUDA 1EFRA 4QEZA 4NEHB 4ALKA 1GPNA 3EGXB 1NLFA 5C4MA 1F60A 4BEJA 1XX6A 2D00A 1FJHA 3OUZA 4GGOA 1LPSA 821PA 1Y1TA 2QAGC 4OLJA 1GITA 3GJ5A 4H1WA 5CTAA 1V41E 3ACCA 3KQSA 3SYKA 2XZLA 3AHIA 3LCRA 4YRLA 4Q34A 4OATA 4XUCA 5FBKA 1J09A 4MQUA 2JGDA 3EXHC 4KU4A 1O94A 5REQA 2NVOA 3GLFB 3FWHA 3QX9A 2XUFA 1NA5A 2FA9A 1UK9A 3MT7A 4BMVA 2YJ4A 1MENA 2IYSA 1CZNA 1UBKS 2QKYA 1NP7A 1YACA 3KKLA 3HA2A 2WYWA 2G9RA 4RH1A 1JYEA 3A4VA 3AI3A 4URUR 3OX1A 3K4QA 4EJFA 5J4VA 3ZI0A 1CQWA 3DD1A 3G8YA 4KRGA 4GRDA 5IVIA 3ROGA 1S7CA 4TUYB 4R31A 4BE7B 5I51A 5EWLB 4D57A 1G3IA 3UMCA 1Z73A 3UWOA 3NEYA 3IUQA 1S2LA 2OWDA 4F9FA 4AJIA 3S6JA 1SVOA 2MINB 4TOIA 1IC6A 4XQGA 2LD4A 3CNHA 4JI0B 4M7PA 1Z8NA 3N8KA 4RFSA 3QYAA 5LWQA 2FSVA 1J23A 1J6UA 1SIBE 2HF8A 3G2KA 2IHZA 1QTIA 5FLYA 4E2ZA 1P5ZB 1U7ZA 1A2OA 5NULA 3DPIA 2IXAA 3QE4A 4CM5A 1SCQA 1JZSA 4JLNA 2QM8A 1ADJA 1THMA 5F3DA 1T2DA 5B4VA 3IKVA 3OIUA 3O2QB 4TTVA 3ZHCA 2XJ4A 1E9AA 4A0QA 2ORWA 1MIHA 3PWKA 1S4MA 5IUJC 3DVAA 1C7JA 3B53X 3BFKA 2RKBA 5DEIA 2PKWA 5L40A 2R84A 4DM4A 2COUA 3RU2A 1RQ7A 3NBMA 2DUWA 5MFPA 4BLUA 3H84A 4P5DA 1YNOA 1XQ1A 4GOJA 3KE9A 2X8LA 4XI9A 3DKRA 4L57A 2QNIA 4P35A 1XI2A 1YZQA 1DELA 2FUCA 4GLOA 1UDWA 3TOCA 4LTDA 3W90A 3KLOA 3NFYA 1FVOA 1PK7A 5THXA 1GPUA 2NV0A 3WGYA 3KR0A 4MA0A 3ZY6A 5CU7A 4DR3B 1H3FA 3NAGA 2XF2A 1R8QA 3LVBA 1T0UA 4RTKA 3M6AA 4IDNA 2WJJA 2ZE8A 4M1WA 2HSEA 5LP6C 1HZZA 3HABA 3Q3GE 2BF7A 1K6MA 2VPQA 1XQWA 4IX1A 2IEYA 5HM8A 5K3EA 1CR4A 2VJBA 2BTEA 1LNQA 1M72A 3HJNA 1H0SA 4KXYA 3H0EA 5L95A 2O7QA 4IHAA 4RJLA 1U0OC 2BEVA 4YCJA 1J7JA 3OUUA 5FI1B 4XFDA 4B79A 2VBCA 4NJOA 1ZCZA 1Z12A 1AHIA 5JI3E 3OP4A 3G79A 5JY6A 3MCVA 4V0LA 1O4WA 2AYXA 1IK4A 4LTMA 5T8KC 1WKCA 1AF7A 2IUTA 1ZK2A 1G4HA 1R0WA 2F1KA 2ISCA 4ENWA 3DC7A 2JFVA 3G2QA 4TWZA 5K20A 1V16A 1Z6XA 2NUPB 2YX1A 3H4TA 3IE2A 3VYSB 1KO4A 1WWKA 3OPYB 4QKQA 2PMBA 1VE9A 2X6RA 2BFFA 3RYHB 4BRWA 4A6EA 2M32A 3TIIA 2UUAB 1U5BB 5I01A 1J1UA 2I0FA 4DSAA 4BLQA 1SOAA 3E0XA 3G6WA 4F3KA 1QAQA 2HK8A 4INZA 1P61B 1ULBA 4KXQA 5CT4A 5DHUA 3ZU3A 3Q0TA 2J6BA 3DKPA 4JDPA 4DDUA 10MHA 1IZ7A 3C39A 1MO3A 1ZD3A 4FHEA 1N6RA 4MUGA 4B6QA 4FYPA 4ZREA 3T5BA 5BSEA 5B3JA 2X23A 3H6HA 3DBLA 3LPNA 1U8CB 3R2JA 3U7EB 1XFAA 3OX4A 1JMYA 2ENUA 4PCAA 1DTWB 2V55B 2GR9A 1BDIA 1TYBE 4CT5A 4E13A 1HMPA 2JDIA 1ZN7A 1PR6A 2KHZA 1OBCA 3NEAA 1ZGBA 3QOFA 3UHAA 4HT3B 3DV9A 3LY5A 1GILA 1EGVB 3VHXA 1OV4A 1H94A 5EJ2A 1E61A 2RGGA 3B1KA 2C7QA 3IULA 2ONJA 1YZHA 4MYHA 5IC6A 3GQBB 1BN6A 4IINA 4OG2A 2VJDA 2GD1O 2AOUA 2CXPA 1C4WA 3MWEA 5KJEA 3W0LB 2K7FA 3X1ZA 4KR2A 3DWFA 4C4TA 1EPUA 3A05A 2Q6IA 3BOSA 3K30A 1NZDA 5T4FA 1EG2A 1M6YA 3STUA 2Q8QA 2OBMA 4NAVA 2D7CA 1A27A 3GDGA 4P2GA 2FPPA 1S6YA 1I4WA 5EI5A 4PYIA 2L0XA 5EMHA 4B4WA 3KKEA 5FA8A 5EHZA 3HUTA 3L4KA 3IP8A 1KAQA 2P9YA 2CNWD 3Q7IA 1A8HA 1JQLB 3AP2A 4G84A 2ZRFA 1UJBA 3VO8A 4AZ3A 1TK2A 2JJ1A 1ZK3A 1ZC3A 1Z0DA 1UZMA 2QAJA 3HYRA 3OP1A 5AVSA 4RTJA 3CE6A 3DMTA 2CJFA 2VYNA 1E63A 4KSCA 2V5VA 3TR0A 1HNNA 3TLEA 5DGCA 3RU7A 3PNSA 4FW8A 3VSCA 1W5EA 4F96A 2O59A 2W71A 1LLCA 5JS7A 2QUIA 2ZTLA 2BZ0A 4ZI3A 1QLJA 4FWBA 1ZMOA 2X5KO 3V7WA 3NWEA 3HDQA 2GDJA 4G8CA 1VHDA 2RARA 2FDRA 1Y8ZA 1Y5RA 3LQKA 1RHMA 2VPPA 3DE0X 3N75A 1G6HA 1VSQA 4ZQIA 1DXHA 3FYDA 1FRFS 3HB1A 4MP6A 4WKBA 2WMNB 3H05A 1J00A 2QYHA 3GK3A 5E7IA 5AVJA 3GFPA 1Q11A 5GY7A 1Z6QA 1JRLA 4ARCA 4LPKA 4QELA 1LA2A 2VT7A 3LDFA 4RDIA 3S3TA 4BNFA 5ALGA 4RADA 1PBTA 2BCJQ 2FMXA 5BURA 1JBEA 1T2EA 1NW4A 1E2MA 1NQOA 2BN4A 4BU1A 5HQTA 1YBMA 4MCIA 1EFDN 2R8EA 3N28A 3OD5A 1ADYA 1P1JA 1UPFA 2ODNA 2KYRA 3QV1A 4H4CA 4XWOA 4IZIA 4DV6B 1I9CA 3MB5A 3T34A 4IDDA 3DP7A 3VR4H 4CM3A 5KTPA 2D2EA 3G0IA 4NE7A 2XCOA 1VA5A 3QG1A 1IVNA 4UNRA 2P8SA 2HLHA 1T3ZA 1C9KA 1QS0B 1FNSA 4KK4A 4QDUA 2WOJA 1PZFA 4ZT7A 3OIYA 3ND5A 2GPAA 1K8QA 4RZ3A 4CWAA 3B89A 3ZWYA 4HH0A 4MWOA 1GPMA 1X3LA 4LZZA 4CNBA 1ZMBA 3I4CA 5JJ5A 2XGSA 4HWOA 3F9RA 3FKJA 2OCAA 3G13A 2GGSA 3GZNA 5DYTA 5CBPA 2R86A 2JH3A 3BD7A 1KY5A 3RJ9A 3DAHA 2PX8A 2O8EB 5HG0A 2FPGB 2PZBA 1HUQA 3ZX4A 4WZZA 4ZK2A 1FSPA 3PENA 1O4VA 1E2NA 4MR9B 4OV6B 4HPJB 4G1FA 1SCAA 4J4HA 3NATA 4O59O 1Y1SA 4RKFA 3FDXA 3PJFA 4YALA 2VT3A 4YWJA 3ZCSA 5JJCA 4LIPD 4BTEA 1DFIA 1EX7A 4NVRA 5M2QA 1H93A 1LDYA 3R9IA 5ARBA 2B61A 1D6SA 1VYTA 3DPSA 3HNOA 5EXDA 2V5UA 5IARA 4ER7A 1QKKA 2ZI5A 3OM1A 4MVJH 1KI2A 4I4TB 4OEHA 5E9WA 1U8EA 1UL1X 3R5HA 1JP7A 1M1ZA 4N0MA 2XT9A 3IP9A 3CKYA 4F45A 2Z6QA 3GT7A 3KSMA 3RAGA 1MB0A 1BE8A 4G0XA 1L5NA 4Y2PA 4BC1A 4C4XA 1CIVA 2X2EA 3FTNA 3RS0A 2WJVA 3WJ7A 4G4SP 3KZCA 3AEZA 2QAIA 2YN2A 2ZTMA 1GGFA 1R10A 3T06B 1RTTA 1VDZA 3QHPA 3WK6A 1Z15A 3ZWBA 2F55A 5G3YA 5BW4A 1FNNA 2NYRA 3E4DA 3MTJA 4RQBA 2J59A 2G5CA 1VPEA 1QR6A 4Z0HO 1XPOA 1FDRA 1A0OA 3FROA 5D3KA 2LRHA 4CKZA 1RRGA 3C6MA 5GPBA 4OQXA 1M1YE 2QW0X 2X22A 3JQAD 4D92A 1X1SA 1QV6A 2HK7A 3UOGA 5HWSA 4FSDA 1AO0A 2JARA 1IBCA 1WF6A 4MA5A 3UPUA 5KYWA 1Z4NA 2ECKA 3ABQB 3R23A 4FFLA 1BMFA 2NUAA 1LKZA 1D2GA 4FJ2A 1ZAKA 1NF8A 5CFNA 3BGSA 2GZSA 3DNFA 3OZWA 2OGWA 2XLCA 2XWSA 2VC2B 3HB0A 3LXMA 2EIHA 4FPXA 3WGTA 1LI5A 4MICA 4AJLA 2VRCD 2PZMA 1L7MA 2MSCB 2P9HA 2UDPA 3I73A 1A1SA 1JDPA 1K0FA 1YS7A 2P69A 3Q8WA 4KUGA 1FU4A 5EHQA 1EFPA 4ON9A 4QDZA 4UNSA 4LN1A 4RJ2A 1DADA 1YU6A 2I5PO 3AUYA 3JQ8A 2QV0A 3MGKA 3SZRA 3TRDA 1EK0A 4G1VA 3G17A 1CV2A 2DG2A 3V3TA 1NQXA 1PNVA 4PN3A 1X1TA 4NY1A 1ZVJA 3C6BA 3E5RA 1PT9A 2CY0A 4H27A 2FFAA 4ZCMA 5I7HA 3GVIA 4RCVA 1KIAA 4X24A 3U0BA 2PKEA 3TINA 2JI6A 2KS6A 4F84A 4ZANA 4ETNA 1PFVA 1XAGA 3JRWA 3NWBA 3Q11A 3NXSA 2WM3A 3KSDO 4N5LA 5HE8A 1RC8A 2E7ZA 2P9GA 1PNRA 4GX1A 5NLLA 5ELMA 3ZCUA 3KQYA 2JL1A 4PLYA 4CCYB 5IJZA 3S81A 3LW7A 1NQVA 3I64A 5B4TA 2GBIA 1CZRA 4C7MA 3RLFA 4DB2A 3NTXA 1NLZA 4OH1A 1G8GA 2ASEA 4YGXB 9ATCA 4CLRA 2GCPA 4FBMA 1V8BA 1V3VA 2VZ8A 3OZTA 3DVSX 1M2OA 5CNKA 2VDRB 2YWEA 4J0QA 5IKXA 4R2KA 4Y2XA 4AZVA 5EMNA 3W8EA 4DNXA 3TZEA 5K3DA 4LHZA 2UZ4A 4N3CA 2V9ZA 4HPWA 1JAXA 2Z4RA 2JANA 5F12A 2YWCA 1HWYA 2CXRA 1G16A 4JASB 4TLMB 2OVFA 1J0XO 1NF3A 2H17A 3ZD9A 1XZLA 2OHOA 3PXXA 4OB7A 1TEVA 2I29A 2W2KB 5DHSA 4EDHA 1SG6A 2CEAA 2CHFA 2D7JA 4KQXA 4KPFC 1EFAA 3DYVA 4AF6A 2OG1A 2QN1A 3WX0A 2Y1FA 2FFJA 2EGHA 2ZBPA 3NIDB 3UK6A 4KI0A 4ZT6A 5CYPA 4NH0A 4YCAA 4ZAXA 4UBKA 1ZYUA 5FO1A 3MMZA 4B31A 2AKAB 4NCHA 4CM8A 1KEEA 1XL0A 1QH8A 2V6JA 1JPUA 2JIOA 3GLRA 1JHZA 3DBHB 2Y68A 1RVV1 1JLRA 1OFHA 5L51A 3I5YA 2VF2A 2BEWA 2HIGA 4G2TA 5FPYA 2WW8A 2DHRA 3S1AB 1TK9A 2JFNA 2UYQA 1MNAA 2H2IA 3HB4X 3PGKA 4GD3Q 4NV3A 4ANFA 4YMLA 4JNCA 3TX2A 1ABEA 3RNOA 5T6MA 2BFCB 2AMLA 5JAQA 2IPMA 2WSLA 3C8DA 3HJTA 2VOJA 4J0FA 4YDQA 1TJNA 4UW9A 3ND7A 4NF2A 1ISIA 4DMFA 3S44A 3X1YA 4RVCA 1GUBA 5EIFA 3DUFB 4PTZA 1OGJA 1A50B 1R9MA 2AJ8A 2F7SA 3MJ4A 3PK0A 4AG5A 4MUHA 721PA 1U1CA 2A5LA 1QWOA 3DSRA 1D2CA 4L8FA 1VHTA 2E5WA 3PHIA 4EMBA 1LSJA 1GUZA 1Y1PA 1EB8A 1RKVA 1WTAA 4GPD1 5B2FA 5AVTA 3K0AB 4MITA 3NLLA 4N03A 1GKKA 4BCDA 4CUJA 1FRQA 2UAGA 1JMVA 5BWNA 1X70A 3QFFA 3SEZA 1RLOA 4LQLA 2Q3DA 4WXPA 4ALJA 1KI9A 1JG3A 4CM1A 4O3FA 1THTA 1JLLA 3U56A 2YZ2A 3JQQA 1DRWA 3TQOA 4EL0A 2OG2A 3HJRA 3B52X 4LECA 4TPKA 2VNAA 3SC3A 3N8GA 2HYIC 3KT0A 2OV3A 3D6UA 3IDAA 1KYYA 1WNTA 3A0UA 1C9JA 2C5SA 2FLVA 3KOUA 4E4RA 4EFLA 1Q14A 1AGPA 3L6EA 1VL2A 4YMWA 5U9CA 4MYCA 1ZP6A 1BX1A 3DFIA 2OV4A 3R7DA 3AJ9A 3UCEA 1O5IA 3D5EA 1G18A 1WXFA 2A33A 4HDKB 4Q6WA 4CKEB 1XE3A 2Y9MB 4EO4A 1YONA 2QDXA 4F5WA 3OCWA 4I55A 4J3JA 1ZVVA 2XV1A 3JWEA 1A9QA 3FWNA 4IUBS 4QUKA 1Q44A 2LTAA 4US1R 4CV3A 1Q0SA 2VP0A 3KJNA 4B3RB 1SUBA 2I99A 2WM2A 3DO8A 4MWCA 2RHHA 1ZUWA 2X5JO 3OZFA 3OG9A 3USES 2WQ6A 3ZVMA 3RSLA 3LUFA 3EBLA 3COYA 1GCOA 2BKEA 5GINE 1AQJA 1E5QA 2X77A 4HBZA 3UBTA 2A1UB 1DX4A 3IT2A 4LRUA 2PMEA 5EJ5A 3R3JA 1LRKA 4KO1S 4BEWA 2QRVB 4QNMA 4G56A 4BTLA 3U4DA 5SY4A 5HF5A 1DEHA 1ULSA 2E3JA 1I6WA 1XVLA 2ZW9A 3ND8A 3R3YA 4DBLE 2CVHA 3SJAA 3TPCA 4FD3A 2IEAA 1LVUA 5GOTA 4F9TA 2GZAA 5IAAA 3EAFA 3GEPA 3F5DA 3OTWA 4IIGA 4OBEA 1I4TD 3L0SA 3BWXA 4FGJA 4MYTA 4YGYA 5ILGA 3R7NA 3SK0A 2OA0A 2KJQA 1OJLA 1IUOA 2H07A 2ZJZA 3D6JA 3JQAB 4W9MC 4YCCA 3H8WA 4HWPA 4BVFA 2P6UA 3UO8B 2A1TR 1BA2A 2BTQB 4GZ5A 1E1QA 2JLBA 1V5EA 3MRXA 2RGXA 1TO2E 1OFGA 4EJMA 5C8YF 1NQAO 3NBKA 4RA9B 3V4FA 2O2YA 1H0KA 1SVNA 4KHZA 1R4AA 1C1XA 1UPCA 4BDTA 2VRNA 1MFZA 3E3MA 1US8B 2ZJ6A 3LVQE 4IVRA 5HA5A 5HKOA 1NDHA 5BW6B 4IOKA 4TLBA 2X0JA 221PA 2I4MA 3D43A 3PXEA 1FDIA 4AL4A 4K9MA 1L7XA 4L27A 4MWTA 2A7XA 4RA6A 1KJ9A 3IKMB 4ARZB 2IV7A 3H11B 2BFBA 4RF3A 4DNFA 1Q7BA 4KQJA 2AWNA 1SG9A 1W87A 3IKLA 3N2ZB 5WRFA 3WYGA 2RHTA 1B8UA 5CAEA 4HI0E 1NJGA 4GIBA 1D3AA 4V03A 1AXGA 4PEVA 2ZU0C 4UTZA 1QHXA 4OXNA 1BKDR 1X1AA 2CVPA 2VQ6A 2XIQA 3VZPA 2YMMA 2ZI9A 4HYQA 1Z2EA 5J23A 2O5VA 4JLKA 2WUDA 1ZXLA 2BCEA 2HMUA 1S2IA 3LT1A 3QKUA 3K71B 1P44A 2GPJA 3U37A 1N9GB 3OM0A 1AKQA 4IIJA 4RFLA 4NBTA 4YTEA 1JNYA 1HY3A 3F5QA 4CQMA 1JTEA 1QB8A 5K0GA 1J39A 2PZFA 3WYAA 1TECE 4OHOA 2MYPA 3WL7A 4PXAA 4ZZ1A 2IODA 1UAAA 1E32A 1U9ZA 2R7NA 1HDYA 4PC7A 1M0EA 3PFGA 4MEJA 4TVSA 2WC1A 4HX5A 4JODA 4UVGA 4AO8A 2ZITA 4KLZA 2O8FB 1ORIA 3BKWA 3IIIA 1V9LA 1XUOA 2Y1OA 3F7TA 4KIWA 2RHWA 4BECA 2R87A 3NKFA 2QVYX 4A8HA 3D6MA 3OICA 2RGDA 4IPTA 5KDDA 1Q1GA 1KFEB 2AFRA 2PH1A 1KR5A 1BCRA 3C1TA 1HYGA 3T3NA 2W4IA 5AW7A 4R8KA 3WGOA 1GU0A 2G67A 2VJOA 4O4LB 1P3JA 1D09A 2Z5FA 3OUTA 4JL8A 4X84A 5BN4A 4XKJA 4LC9A 1IUPA 1CUYA 2Q3BA 2ZB4A 3KHKA 2C00A 4ERNA 2AKEA 5SY9A 2VTVA 1H5NA 3OZVA 3LOPA 4RVUA 2MTBA 2W6QA 5EUQB 3RUFA 4C3VA 3RU3A 4BBPA 2WHQA 4BQNA 3ONWA 3QKIA 4FYIA 1RI4A 3UA4A 2ANCA 3EWSA 5IJ0A 1CJKC 4HADA 2X9NA 1N5OX 3N05A 3CFYA 3VO2A 5CDSA 2FWBA 5CW1A 1E1RD 1RBZA 5AW9A 5GAJA 2QJRA 1D2EA 3BFVA 4EEZA 2OCLA 2XQIA 1MW8X 2G4LA 4X94A 3FKSD 2WD9A 3W5HA 1CFJA 1IJFA 1DX9A 2IZ5A 4IJKA 1GFZA 3VV3A 1W35A 1OYOA 2GF2A 3B85A 1YCDA 1Z35A 2H29A 2J3JA 5DP1A 2Z2KA 3DGFC 2XUGA 3UJ3X 5KOHB 1GXSB 5BN5A 5CPFA 2B4KA 4B81A 3H4MA 3N2IA 4JYCA 3KR9A 4Q12A 4DC9A 1T9GS 1RLUA 3CGWA 4R0NA 3IP7A 3R3VA 1KEUA 3A6DA 4MTCA 4YUWA 2HU5A 2P2SA 2PR2A 3IJ5A 1XWWA 1SAYA 1K6XA 1NDUA 2D0IA 2ZRCA 4GPBA 4LBWA 4RFVA 3V1UA 4E15A 2VT6A 4NFHA 4RM3A 4YP7A 2G40A 4ZYYA 1C2YA 2B8TA 3BH7A 4PPGA 5P21A 4BLOA 4CZ2A 1IOWA 3D6TB 3HY6A 1D4OA 3P9RA 2HZ7A 4CQLA 4R0MA 1XF1A 4UARA 4UDOA 3OSUA 3B36A 4AUMA 4A92A 1NKTA 1P77A 3ASYA 3FFAA 4FNAA 4WTOA 4BMXA 3A31A 1WSAA 1TYCA 1B3RA 3GEEA 5FBRB 5BMVA 5IMSA 1XEXA 4CIVA 1KH3A 3T0FA 3TR5A 1J97A 2G88A 3KUDA 1KI8A 5I9IA 3MGBA 5GP1A 4D9HA 1M1XB 3VNBA 4AXBA 1R74A 1ZRHA 4Q21A 3OTGA 4Q3AA 4O1HA 3T5CA 1G0OA 1TNDA 3C98A 3VDXA 4MX8A 3MAJA 2CYAA 4FHGA 2DHEA 3L0PA 1OFTA 4RPJA 2HTEA 3WSTA 3JQFA 3EARA 2IXGA 4E70A 2JLYA 2I2BA 3H13A 1X9HA 1P1RA 3R9WA 5EIBD 2CV0A 3IB6A 4WVLA 5EJ6A 4IIXA 3SG0A 4Q1VA 4LE1A 4NQRA 5I7AA 5JH7F 3IAXA 3H9UA 4YT4A 2GWRA 5DWDA 3PNMA 3KZMA 2QM0A 3AQIA 3DL2A 3INTA 4V0RA 3TSYA 1NT2A 1X8LA 1YZLA 4O1IA 3DT6A 2QTCA 3C97A 3B38A 3FVWA 3NIFB 4BFZA 3V4ZA 4EA6A 3GVHA 5FH9A 1X15A 4WOBA 1G20A 4J16A 2PKXA 4Y6GB 2DFKB 3AUXA 3LU1A 1X74A 5TQJA 3BCSA 2Q6VA 5A05A 2QSYA 4WH0A 1AJEA 1NVUQ 4K0RA 5GMOA 3JCZA 1X1RA 5K8LA 4LHXA 4B3MB 1IAVA 5K99A 5AM1A 2P9CA 4L0MA 1BAPA 3N58A 4IRUB 5AXBA 2P5UA 5KOJB 4EJSA 4F7DA 4NZOA 5KJFA 4X97A 1DAHA 1BS2A 1TVMA 4CR6A 4DMCA 1CVLA 4KFUA 5MF6A 3FOEC 4DRZA 1CG6A 1F2TA 1PR5A 3GEDA 2WICA 3RSHA 4U2GA 5BNIA 3P94A 1BEUB 2Z83A 3MXOA 5IAJA 2FK7A 2WKQA 1MAUA 2XMZA 5CVDA 2QLMA 1UKVY 4TLAA 1LRLA 1TYAE 4JK3A 3T1HB 1PDOA 4ZV7A 2P2LA 4BNVA 2F8LA 1Y7HA 1RS0A 2GNOA 3MMPA 2I7VA 3D64A 2X0RA 1SQFA 3R9XA 2UVQA 4RSMA 2W90A 4AWBA 5JJBA 2EU8A 1KRWA 4PSVA 5HIJA 5MDHA 3R8FA 1WUKS 3RRFA 2ZRDA 4CU2A 2UU9B 2N9UA 3SYRA 2C03A 1YQTA 3OHSX 1MNQA 1RJGA 1DINA 1U0JA 2HK9A 2HN9A 2H48A 2XVXA 4LXIA 1S1MA 3NHRA 2HHAA 3TSZA 5CB6A 5IXYA 1ISSA 2AQKA 3AETA 1H23A 4R1SA 4TS1A 2IYWA 4AECA 1NAIA 4B4DA 2GZ1A 4DTIA 2VT2A 1VLQA 3VYVA 5L3RA 2WD7B 1JKXA 3O84A 1M2WA 2ZB3A 4MIEA 4BO5A 4DW8A 2Y0BA 2RHBA 1Z29A 4LVNA 4OYLA 5EXXA 3GMTA 5FUYA 3KBOA 5E6RA 5JR3A 2Q2OA 3JQ9A 3FZQA 1ZN8A 1HFJA 1XXLA 3THRA 2I2WA 3MUFA 4P83A 5ARCA 3KQWA 5JO9A 2RBKA 4B76A 5IHPA 1NN5A 1L3CA 3LWBA 3P9SA 3PI6A 3N2LA 2R1TB 2P3SA 3FSJX 3IEUA 1W5FA 1UPAA 2YJTD 3ZNPA 2XZTA 2DCUA 1B14A 2GWHA 3GPBA 3ZLUA 1OH6A 2BGGA 1DJNA 5CMLA 3C3MA 4JLBA 1VJ1A 2NPIA 3CT6A 2YC2C 4GZMA 2OK7A 3I52A 2RGUA 4YACA 5K5EA 4YRTA 5LLDA 4MKRA 1GQ2A 5JZ9A 5DHPA 5DI3A 3BCHA 2HKIA 2COEA 2IYQA 1Z26A 5B53A 4UCXA 3ZH9B 4DKJA 1V39A 2ZYAA 1ZCBA 3OY2A 4JI5B 1SUCA 4GBGA 1V7PC 4QGSA 2WKWA 4BVAA 1G5QA 4G0QA 4PTLA 2DQKA 2RHLA 3HV0A 2XHEA 4KN5A 1JDVA 2WT9A 3GLQA 5ITSA 2XODA 5KC9A 1PWZA 4ZIRB 2HSZA 2X8WA 4ZC8A 1BXZA 1Z2PX 5EGNA 2IYVA 1JALA 3FVTA 3KR1A 4DZRA 4X1IA 1TM1E 4XVUA 2FSUA 1X13A 1G7RA 2G6TA 1C0LA 3EGWA 4HSGA 2R8PA 1OXKB 2GCOA 3HKDA 2J0VA 3OBBA 2QRQA 3GRRA 3M6IA 3VJMA 1AZSC 3ER9A 2C99A 1JI3A 3QNWA 3L0IB 1PR9A 3COWA 3KKNA 4IYJA 1MJGM 3CF4A 2BSQA 4X6YA 2AWOA 3W9YA 3W77A 3F1LA 4KDCA 4GFDA 4BMSA 3MJCA 2P91A 2QOEA 3LY9A 4P32A 2YWXA 4OHXA 2QL6A 2VPYA 5AKIA 4ZVUA 5TQ0B 3RUCA 3V8MA 2PXCA 3K8ZA 3W3AH 3WHLA 4BO7A 1E6EA 4WW0A 2C88A 3AESB 4COKA 4ZZIA 1TZMA 2O3TA 1TEXA 5B37A 1Y3IA 2XDQA 2CGEA 4NK5A 3CZ5A 1NBOA 3F97A 4F6CA 1ZY2A 1C30B 2EXXA 3KEOA 2JRCA 5J4KA 3OWXA 5F3RA 1I7QB 1XD2B 1YGPA 1N2BA 3R20A 1JA9A 1X8KA 3JXEA 4JYAB 1VECA 3SC4A 1EBBA 1HPLA 5C8ZA 4C4YA 3PHCA 1Y42X 4K40A 4JS0A 2DEUA 3LX4A 2OCXA 3L6RA 3OZDA 4DAOA 4E22A 3ZY4A 4AJ4A 5JSYA 4LOLA 13PKA 1G7SA 1GNTA 1II0A 3BJRA 4DQ0A 5LU9A 3L6UA 3IMCA 3WGKA 1I13A 1TMKA 1C3LA 2H5LA 1UDXA 2B21A 2JIBA 2X58A 3JQ7B 4BNDA 3T7CA 3VSAA 1KYQA 3BL8A 4UATA 5DHAA 2AOXA 4PLVA 3WGHA 4F8JA 2VSYA 1LLUA 3WZ2A 3T1QA 4TLDA 1SR8A 2LVBA 3S1LA 2AR0A 1AK1A 1P2UA 2JHCA 2YINC 2DT8A 5CDHA 4MQ5A 2HO4A 4KJXA 4OSEA 4ROSA 3RYIA 1JFRA 2VDVE 4RH3A 4V1CI 1B23P 4OU5A 2A59A 6AT1A 2C2OA 3HH8A 1R50A 3R0IA 4QX6A 5D3QA 2GK6A 1H5UA 3FMIA 1KI6B 3PZBA 3U9TA 1N8NA 3PRJA 3KVRA 4Y8VA 4AG3A 4WT7A 1GADO 5LU8A 4X65B 1FMLA 3OZIA 4K03A 3FDZB 1XT6A 1YZVA 3Q5EA 4MRMB 3WIUA 3PCRB 5GV8A 5KYNA 4KPYA 2PX3A 4FDLA 1L5SA 4K2AA 4UQLA 1R6BX 4FU0A 1DLJA 2V97A 2BR3A 3G2JA 1E4EA 1HKUA 1JHAA 3TM4A 1OROA 1J07A 3E22B 5JBIA 2VUHB 5D2CA 4UQPA 3S2YA 1MV5A 1HYQA 1IXKA 4PG8A 2IH2A 2ZBGA 4EQ6A 5LQRA 3X43A 2RE8A 4RESA 2O8DB 3ESYA 1ZIYA 4TYMA 5HTKA 4R1OA 2VQFB 2CLLB 4FQ7A 1R0RE 5HDQA 4EKDA 1MEJA 4IJ6A 4DEYA 4JQOA 4IXTA 2WIKA 2Q7OE 1KU0A 5I5GA 4RWZA 2A6PA 3ABSB 3QVGB 2HL6A 3ECSA 4RHTA 2GN6A 4L8WB 4V0ME 4YO7A 5DIZA 3UIEA 4RXTA 3PC6A 2GQ0A 4AQ7A 5DJ5A 4OAOA 4Q1BA 1ILWA 2NZVG 1B0UA 1E9CA 2TSYB 3KP1A 3UJ9A 1NLMA 1O58A 5DDIP 3LW8A 1I5EA 3WK7A 4UM8B 3EIQA 3DDZX 3ICVA 2A67A 1Z4JA 2JI7A 2QTVB 4BB5A 1SC6A 4HGOA 3WDLA 1SU4A 3SY8A 3IHTA 5JMOA 3BDAA 4R2LA 1EFRD 1O54A 3GUYA 4HAWA 3IUPA 4LRXA 2ZAMA 1MO2A 3A3YA 3KD3A 4Q4HB 3O2NA 5K8UA 5JQGA 1NPTO 1TAUA 1A5BB 1MAHA 3H3XA 2Q4RA 2R68A 3L1JA 3TLZA 1SXIA 4MIYA 4KQCA 3KJEA 3SOPA 1RFGE 4EGCB 3I6MA 3QIAA 1NFQA 3C85A 5J9FA 5JATA 3P9IA 2YDXA 3CBQA 2CSUA 2JFGA 1W1WA 3I1FA 2P9TA 1KOFA 1XV5A 5ENDA 3LTEA 5FADA 4PYNA 4JOSA 3NPMA 4YMHA 1P7WA 3GGSA 4ZOLF 5EHIA 1R0YA 3ELDA 1NP6A 1O94D 2I33A 4QIHA 3F78A 5JDIC 1K9SA 2W2NA 3DZKA 1WDWB 4IXWA 4WZBB 2AN5A 4XVHA 3ZDYB 4BNXA 5CYGA 1JG7A 4XWTA 4OMCA 1MJGA 4HAIA 3BMQA 2B2NA 4MV6A 3U7RA 4AJ1A 2BIFA 3TNLA 2C8JA 4CMKA 2WYOA 3OFVA 3AUTA 4B47A 3K2BA 1N9KA 4YT2A 1JXAA 1ZD8A 4H1UA 4AFNA 1N36B 3U3RA 1UBJS 1WDKA 2GEBA 4PZAA 1HSZA 2AN9A 4YCNA 4EUKA 4DLXA 3O8OB 2R5WA 2LP4Y 3EPRA 1DIAA 4KGXA 3FGOA 3RC7A 2XECA 4KQEA 1RWBA 1EM8A 2ZYRA 4X93A 1A9YA 5CM9C 4KQMA 3SBXA 5JUWA 4IRXA 2JHAA 5BQPA 1HC7A 1PDVA 1UK7A 5CDYA 1MIOA 1SUWA 3SICE 5IW8A 2ADOA 3TBKA 4ITUA 1QGDA 3VOSA 3Q40A 2SHKA 5DXAA 1Y98A 2Q1WA 4QHYA 1OLXB 1XTKA 2HSGA 1W4RA 3HGQA 4OHPA 3VR5H 2R66A 2Z2XA 3FPSA 1NPYA 1X7XB 3ENQA 3LMKA 3PLRA 4QLAA 1U80A 3KWFA 1KSJA 1LLQA 4KMMA 2G1JA 2ANBA 3MF4A 2WHXA 1RRKA 4P5EA 4Q7MB 1JF8A 4Q7EA 2Y9PB 3EMDA 5ITVA 2H1LA 1T4MA 4LG1A 3KVYA 3GZ4A 1NVKA 4AS2A 4EGSA 1VXOA 4DDTA 1VZ3A 4L73A 2QRKA 2FW9A 5DTRA 4G0NA 3AHGA 3ZVLA 1OXMA 1VFNA 4KB5A 2EQBA 4WZAE 5FI5A 2YZMA 3T38A 3KYBA 1I1NA 1IPHA 3KPWA 3ITEA 5BN1A 4PHTA 1E2IA 4WOKA 3UA3A 4X7MA 5AKXA 1EKXA 5FOUA 3HKEB 4BNJA 4MA4A 2GYVA 2FZWA 2JFQA 4HQKA 1FJGB 2O07A 1PD0A 4HWGA 3HEMA 3V8BA 4N49A 1QMGA 4UNPA 4A82A 3U7IA 3DBRA 4FZVA 2JLQA 3ZWPA 1A8SA 2N0SA 3ZE7A 1J20A 3GRVA 1YS6A 5BWCA 3DA8A 3QV2A 3QVJA 3UHOA 4M4SA 1XCMA 1DV1A 1OBFO 1T0JB 2Y1DA 3ITNA 3EODA 4S1PA 1RI1A 1TVEA 1CUZA 3DHYA 3X2SA 3P1JA 1EMDA 4TWAA 3B3FA 2Q2QA 2ZYUX 1KRHA 3PC7A 4FXPA 3GLGA 2X6TA 5FNZA 5J1TB 3HDTA 5EIEA 3ET5A 5I7VA 5L4NA 4LGVA 2ZUWA 1V8OA 1ZN2A 4YPVA 1ECPA 1G3MA 5FYDA 2P1DA 2JJ2A 1Y6GA 5D5HA 3EDCA 3F6PA 4GM4A 5AW5A 1TZKA 1BXGB 2PU7A 3OLWA 4OFWA 2VEDA 2E4AA 3EGVA 4LSMA 5ABPA 2VAMA 2XB8A 1PZEA 4OK3A 1JILA 2FMFA 2PH5A 1KMNA 2NXWA 4HHEA 3SM9A 2WWTA 3VI4B 1XLTA 1Y4DE 4GX5A 4BLWA 4DADA 3ETJA 3LWNA 5GJVC 1ECFA 2D0OB 4HNSA 4YV2A 4ZAYA 2GAIA 2M1XA 4JI4B 1Z8HA 5LXTF 4ASUA 2JDID 5D7BA 3RAPR 3TIVA 3W6ZA 2IUSA 5TPZD 2XNDA 3F74A 4Z86A 5EVJA 3S7TA 1J0CA 4NG4A 4R9SA 5T4HA 3WLIA 1FBTA 3SFZA 1ZIDA 2XE4A 4IMJB 5C1OA 1E3DA 1S02A 2FUNB 1OX5A 1GL6A 2MMCA 2P4SA 3FYUB 4WCVA 5JYCA 1P31A 1QPBA 2SECE 2BTOA 1HRDA 4X5OA 4B4UA 4KR7A 2O2CA 4AU1A 2J3IA 4EK9A 2QJWA 4MK4A 5LYJB 2HU7A 2YZGA 3OF2A 4HFMA 3WL6A 4AMZA 5E6UB 2QQGA 1C1DB 2YFQA 4U7JA 3HVUA 1T29A 2A5GA 5LBTA 4MVJF 1T3SA 1X7GA 2DAPA 3HVHA 4QOFA 5J40A 2BFOA 2ILVA 3C43A 4YB8A 3Q8KA 1YR2A 1P3Y1 2R6FA 3N1UA 5E2AA 3D8NA 4MKIA 5A5FA 4CMHA 2I66A 2VWHA 1AMOA 2OFWA 1SD5A 4K2HA 2Z6UA 4HVAA 1T8YA 1CDZA 1I3OA 1S2MA 2XXJA 1V0JA 3AB8A 4YCDA 3BUSA 3TGLA 4LOHA 3JY6A 1E5LA 3RG2A 1ZNWA 3PHBE 1EVZA 4BEBA 2UXDB 1E6WA 1DUVG 2EFEB 3OIDA 1IWOA 3QLUC 2VHZA 4DZTA 4CLHA 2GH1A 3PXBA 2VYND 1JFVA 2EZ9A 3HXTA 1SZCA 1GZ6A 3E84A 4HQ0A 4DCJA 1GGJA 3L49A 4K7JA 2ATIA 3T9AA 2KM1A 1IBKB 3ZU4A 3PX3A 3UT0A 3PCXA 1ZL2A 2G72A 3TR6A 1U7PA 4YRPA 1FEZA 1XCOA 2AF3C 2PZEA 2X2FA 4H7JA 3C7DB 4QRHA 4DR1B 4C30A 1TJ3A 1CUVA 2I6GA 1D6NA 1KI1A 4JUCA 1K63A 1H1LA 5AW2A 1Z5WA 1NNLA 3P0FA 5DNEA 1HOTA 2GZMA 4MB6A 2PKQO 5KSWB