4OA5A

X-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah solved by iodide sad phasing
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
b'SKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase family protein
molecule tags Transferase
source organism Anaplasma phagocytophilum
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
total genus 76
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.-:
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4oa5A00
3MTEA 2FCAA 3GRZA 4CKCA 1JG2A 2E5WA 3LGAA 4IKPA 3P97A 1KPHA 2O57A 3EGIA 4AZTA 3CGGA 3IEIA 4LECA 1YUBA 4EKGA 5KS2A 2EG5A 2Y1WA 3FUVA 1WG8A 3EGEA 3GRUA 1AV6A 4RX1A 4OA8A 3ER9A 5BXYA 2FPOA 3P9KA 4PYJA 2DULA 1X1AA 3DR5A 3TLJA 2YR0A 3OZSA 3PLAE 1YB2A 4XCXA 2XVAA 3V97A 1RJEA 5DWQA 2PJDA 2O07A 3MAGA 2G72A 3RODA 3SVZA 3WSTA 2IH2A 2NP6A 2CMGA 4DM3A 5ICEA 4ER5A 4AUKA 4CKBA 1I1NA 1KIAA 2BZGA 2PSSA 5M5BA 4XUDA 3PFGA 5T6BA 3R9XB 1IXKA 3E7PA 4X60A 2EJTA 1EJ0A 5CUQA 3HM2A 3UJDA 3NW9A 5EVJA 2XYQA 2EFJA 3HCFA 5EZSA 1UIRA 5IKMA 3EVGA 2ZIFA 1G55A 1WXXA 2OB1A 2VZ9A 4KVZA 4M7RA 2F8LA 4QVKA 3OU6A 5LQCA 5CIYA 2JH8A 4PNEA 5ICFA 4RTKA 3HEMA 3KR0A 3LHDA 4KRGA 3CVOA 2A14A 4GUAA 2P35A 5DXAA 1SQFA 3G8BA 4GOLD 3SR4A 3E8SA 4M38A 4EK9A 1RI2A 3LDGA 1NBIA 4Z2YA 3PFHA 5FCDA 1VIDA 5DM4A 5LR6A 3A4TA 4AZWA 3LBYA 5DXJA 5LQNA 2AOTB 4RVGA 1SUIA 1DL5A 1WY7A 3EVEA 2K4MA 3JWIA 4R8SA 1G8SA 3HVJA 3KR2A 4OBXA 4V0RA 1RJDA 3BT7A 1SUSA 2P3LA 3FRHA 3I5UA 5HILA 4L7VA 4DMGA 1NT2A 1EG2A 1G60A 4YV1A 1RI5A 3C0KA 1HMYA 4MQ4A 5HIJA 3VC1A 4BP3A 4YMGA 3SSNA 3EVDA 1YF3A 8MHTA 1EAMA 4XUEA 5D1NA 5K0GA 2ZIGA 5CVJA 4M37A 3UBTA 2C7RA 3SXJA 5K0EA 4ER6A 1RJFA 2OZVA 1ZQ9A 4YUZA 2I7CA 2BR5A 1BHJA 1NW7A 1N7JA 4YUYA 4HSGA 1JSXA 1YFLA 3OCJA 2UYHA 1VP3A 3DXZA 1WZNA 2CWWA 1YZHA 3MERA 2OPBA 4E32A 1XDUA 4RTQA 5CM2Z 4NECA 3OFKA 2VP3A 3EEYA 3B3JA 2VDWA 5CVDA 2JG3A 4WVLA 5CVUA 3T7TA 2AOVA 3KQYA 2PLWA 1N7IA 2I9KA 3P8ZA 3M6VA 2IH4A 4YMHA 2O0LA 5DRTA 5EKXA 3UJ9A 2ZLBA 2OYRA 2VS1A 3CKKA 1L3CA 3EVAA 2OY0A 3KQWA 4C4AA 2HR1A 4FS8A 4R05A 1AQJA 7MHTA 2HNKA 2EJUA 3O7WA 1R8YA 4GC9A 3CJRA 4CTKA 3GRRA 5DX0A 5EKUA 5EQJB 3G5LA 4QDKA 2I62A 3HCEA 2NXEA 5CVVA 3U81A 4ER0A 2PWYA 5EGSA 4C06A 3KQVA 3FTEA 2Q41A 1VLMA 5GINE 4E31A 5GIPE 1BKYA 4E70A 5DX1A 3CJQA 2ZWAA 3KPJA 4V0QA 4BLWA 1D2GA 5GIOE 2Z6UA 1QYRA 4RV9A 2ZBQA 1MJFA 5E9QA 3FTDA 5ERGB 3ELYA 2PY6A 4EMSA 3FPGA 3PTAA 1MHTA 2JHAA 2ZVJA 2ZBRA 3AY0A 1WXWA 2JHPA 4KW7A 4M36A 2O05A 3UFBA 3AXTA 1JG4A 2AR0A 3SM3A 2O06A 3A7EA 2XYRA 4FSDA 3VYWA 3KR1A 5DSTA 4C07A 3R24A 2UZ4A 5HOQA 3BUSA 4GOMD 5EG5A 4YV2A 2P41A 2IH5A 5B1SA 2OKCA 3DOUA 1RI3A 3LBFA 1X1DA 3IV6A 1P1CA 1UFKA 2ZTHA 2QRVA 4FT4A 2PWPA 3K6RA 3BKXA 3C6KA 1VPTA 3HCDA 2B9EA 3P71T 4FSXA 3UJCA 5LQKA 5E9JA 3FRIA 2Z6AA 2AVNA 2ZZMA 2Y1XA 1B42A 2ZSUA 3LKDA 4KIFA 5EPEA 2B25A 4GEKA 5DM0A 4E33A 5K03A 5F2KA 3M6WA 3BWYA 3G5TA 1SG9A 4LG1A 5FTWA 3VSEA 1P91A 4DA4A 3B89A 4FT2A 3FTFA 1R6AA 3BZBA 5KYGA 3JWGA 3UJ8A 5LQRA 2XBMA 2H1RA 1QAMA 3BWMA 2PX5A 3CCFA 3LX6A 1JG3A 1RI4A 3DXXA 3ELUA 4QQKA 5DPMA 4RWZA 4RTJA 3CJTA 5CVEA 3GRVA 1NKVA 3LCVB 2GA9A 5T64A 1M6EX 3EGVA 4GBED 4QTUB 1XCJA 5C1IA 3H2BA 4BP1A 2IBTA 5GM2A 2NXNA 2AS0A 3GNLA 4CWAA 1EQAA 3KU1A 5E1MA 2H00A 4POOA 1O9HA 3FUXA 5FQOA 4RVHA 3LCCA 3MGGA 3G2QA 4PYQA 3BWCA 2QE6A 3B3GA 3HVHA 4PYNA 1ZGAA 2GPYA 1ORHA 3DH0A 5FA5A 1VBFA 3HVIA 1IM8A 2HWKA 1N2XA 2YTZA 2ZULA 3KQTA 5EZQA 2C7PA 5K09A 2AVDA 2JJQA 4GOOD 3FPEA 3OPNA 1X1BA 3UZUA 1G38A 4MIKA 3GDHA 3EVFA 3LDFA 3THSA 3NDJA 1XJ5A 1INLA 3G89A 3X0DA 1R74A 2PT9A 1L3BA 3BXOA 3KHKA 3C3YA 3MB5A 5LSAA 3UJ6A 1I4WA 4HGYA 4R6XA 4HTFA 5E9WA 4DCMA 2IPXA 3KQSA 2UYCA 3AXSA 1XXLA 3MQ2A 4PGHA 3DUWA 5ICCA 2G71A 2AOUB 3UA3A 9MHTA 4E2YA 3A25A 3PVCA 1TPYA 2GAFA 3KKZA 3KQPA 4HG2A 3PB3A 3M70A 3GGDA 3MTIA 2ONYA 3M6XA 3HCBA 2WA1A 2AZTA 2IGTA 2BR3A 2FYTA 1KYZA 2G8NA 4PINA 4RTRA 2JHCA 1VQ1A 3CC8A 2HTEA 2HV9A 4PIMA 1QANA 4YUWA 5DSXA 2NXJA 1YZ3A 3NMUF 3G2PA 1DUSA 4X41A 2ERCA 2PV0A 3S68A 2NYUA 1NW5A 3RIEA 4RVDA 3MCZA 1VL5A 3GWZA 1O9GA 3FYCA 1L9KA 3NVMB 2JH9A 4HC4A 3KPUA 3I53A 4E2ZA 3KPWA 5KQSA 1KYWA 2C7OA 4U7PB 1OR8A 5E1DA 10MHA 2PKWA 3NDIA 3LL7A 1D2CA 5E2BA 4DF3A 3GCZA 5E8JA 1IY9A 1JQEA 2YQZA 3EVCA 2B2CA 3L8DA 2DPMA 4F84A 2FRXA 2PGXA 3O4FA 5K0LA 3AWIA 4MHTA 2IP2A 3ANXA 3D2LA 3FPJA 1ZHFA 3FUTA 4U7TB 5EMMA 1Q0TA 3ERCA 1KP9A 3G2OA 5DX8A 5FA8A 3LECA 2YXLA 3K0BA 1VP9A 5U4XA 1F38A 4PYKA 4HRAA 1XDSA 4A6EA 4DKJA 1SQGA 3G88A 3FZGA 3V8VA 4LWOA 3UWPA 1M0EA 1ZG3A 5LQUA 5HFJA 3FUWA 4RTLA 4OQEA 1JSZA 2PX4A 1KXZA 1BC5A 3HVKA 4A6DA 2P8JA 5EMLA 4F85A 3I9FA 5FULA 4JXJA 5HEKA 3FUUA 3EPPA 4C04A 3HP7A 3AJDA 3BKWA 5FQNA 2AOUA 3DMHA 3UA4A 4C03A 2ZCJA 4B17A 1RI1A 3A27A 3OFJA 5EOVA 1HNNA 1U2ZA 4X61A 3TM4A 2YVLA 1BOOA 1R00A 3TRKA 4YV0A 4OBWA 1EIZA 4RTOA 5HIMA 2IBSA 4LWPA 3EVBA 4EVIA 2BM8A 3NWEA 3KR9A 2KW5A 4MWZA 4E30A 2Z6QA 2HMYB 4P7FA 5EMJA 4PYMA 3LSTA 3MHTA 2PXXA 3HA5A 4C08A 3TR6A 4KWCA 1XCLA 4O29A 3P2EA 2ONZA 5EIFA 4AZSA 3A7DA 4Y30A 4R6WA 2B78A 4E2WA 4OX9Y 1FP2A 1ORIA 2PT6A 3E23A 4GC5A 5DTRA 5KQRA 2GS9A 5IH3A 1AF7A 4WXHA 4QVGA 2V7EA 5MHTA 4ISCA 3UJBA 3QOWA 4PYLA 4PGGA 5E1BA 1XTPA 1NW3A 2ZBPA 4QPPA 3TOSA 1QAOA 5D1HA 4RTNA 1T43A 3SGLA 3C6MA 3VC2A 1JQ3A 4ATNA 1H1DA 3LKZA 3M4XA 4GF5A 3A26A 5DM1A 1G6Q1 5DT2A 2AN5A 2ZWVA 1KPGA 3FPFA 3SMQA 3GXOA 5EMKA 4E2XA 2ORED 1JG1A 5H02A 3OU7A 1NV9A 3SSOA 3B7PA 4GOND 5BP7A 3FTCA 1NW8A 3QOXA 5DRYA 2YXEA 3BGIA 3OZTA 4RTPA 2QRVB 3JWJA 2FK8A 4P7JA 1NW6A 1UWVA 2WK1A 5E2AA 2GB4A 1FP1D 3Q7EA 4FGZA 4C05A 5EHIA 3DXYA 4PONA 2FK7A 3KPYA 2G70A 5T67A 2WA2A 1X19A 4DZRA 3NTVA 4RSRA 1P1BA 3DLCA 3ORHA 3DMGA 4Y2HA 5K0BA 5DTMA 5LQJA 4CXMA 4IWNA 1ZGJA 1EJ6A 2ESRA 1VE3A 1P39A 2R6ZA 1SKMA 2NNWB 3GO4A 4EQZA 5KVAA 4FR0A 3BWBA 1NBHA 4IV0A 3REOA 3SSMA 5DLYA 4OQDA 4RTSA 2ZIEA 3HCCA 1PJZA 1Q0SA 2IIPA 4BLUA 2CL5A 4QTTB 2NXCA 5K0FA 4PIPA 2P40A 5EHGA 3BGVA 3P9NA 3PX3A 1QAQA 4QDJA 4X63A 4HH4A 5DTQA 3CBGA 2AOTA 2VDVE 2IDKA 3PS9A 2QY6A 5E1OA 3T7RA 4EKIA 3R3HA 1NE2A 1O54A 1V39A 3KQMA 4P7GA 2LD4A 3SX0A 5EEHA 3THRA 2B3TA 3BGDA 5FADA 2P3QA 4DQ0A 4PYOA 4FP9A 4XUCA 4ZTBA 4BY9E 2AN4A 4P58A 3ME5A 3P2IA 5E8RA 1JR4A 5HIIA 2IFTA 3PX2A 4R8RA 1M6YA 1TW2A 5G02A 3TFWA 3KQQA 3LDUA 3P9CA 1TW3A 1WS6A 2BM9A 1JTFA 3HA7A 3FYDA 5EEGA 2CMHA 5CCBA 4PWYA 2PXCA 3C3PA 3E05A 1I9GA 1R8XA 3P9IA 5K0JA 1R18A 3F4KA 3OE5A 4RTMA 4HTFB 2C7QA 2ADMA 2P7HA 3G8AA 3GIWA 5DM2A 2UYOA 5EC8A 4AX8A 3DTNA 5C0OE 3EVZA 3EMBA 3KPVA 5K0CA 5F2NA 1X1CA 2UYQA 3P2KA 5F2OA 3TKAA 4ER3A 3GJYA 2CKDA 4F86A 2PX8A 5JR3A 2P3OA 4CKEA 1FJXA 2ZZNA 3GRYA 5JUWA 2G1PA 3G2MA 4IV8A 5GP1A 5K8VA 2ZW9A 2EX4A 2IDJA 5K05A 2V74B 2FHPA 2OB2A 2PX2A 5EIWA 1XDZA 2BH2A 3GU3A 2QM3A 1XVAA 1RJGA 3NVKI 3OE4A 4OA5A 3T0IA 2PVCA 1L3IA 3M33A 3QV2A 4BLVA 4RVFA 3TMAA 4X1OA 5FWAA 5GOZA 3JWHA 4GQBA 5K01A 5BW4A 5GM1A 3UJ7A 3ELWA 4K6MA 4KDCA 5CCXA 1Z3CA 4PCLA 4PCAA 3TPZA 3DP7A 3DULA 3R0QA 3NWBA 3O31A 1JTEA 3G7UA 3HNRA 3M6UA 5HZMA 3OZRA 1QZZA 2YXDA 3HTXA 2NP7A 3DMFA 4QPNA 3EEOA 4UOEA 3UJAA 3ER8A 4G56A 3I64A 2OO3A 1NV8A 2OXTA 4RYLA 1FBNA 4AZVA 2GH1A 1ZKDA 4YUXA 3R6TA 2AOXA 2P7IA 4PYIA 3NJRA 3TM5A 3IYLW 4HGZA 2VDUE 1L1EA 2R3SA 2ZFUA 3MCTA 5FWDA 3KQOA 2XYVA 4QQNA 4CTJA 3HCAA 4KIGA 5K0NA 1DCTA 2ZZKA 1Y8CA 3ELDA 5ICGA 1G8AA 3T7SA 1F3LA 3Q87B 3DLIA 3FPHA 5FUBA 3TQSA 3RW9A 2QYOA 3LCUA 5GWXA 3LPMA 2H11A 4DCGA 2PBFA 1YFJA 2PXAA 3EMDA 4H0NA 3PT9A 4MTLA 2YX1A 4FZVA 1KR5A 3I58A 2I6GA 2P1DA 2OBFA 4ER7A 4YUVA 2GLUA 5CD1A 1KHHA 4KDRA 5FHQA 5BW5A 1D2HA 1FPQA 5C9ZA 5LQAA 1PRYA 2YUIA 1KPIA 2N47A 3B5IA 2XVMA 3B3FA 3OU2A 3HA3A 3TKYA 5HIKA 2BR4A 2AOWA 4P7KA 5FHRA 1AQIA 1JQDA 1SVUA 2AN3A 5P8WA 3ID6C 3IHTA
chains in the Genus database with same CATH superfamily
4FSHA 4NHEA 2O54A 1A8HA 4EI2A 5ITWA 2FPSA 2ECFA 2G4LA 3JYPA 2C2OA 3MWKA 1PFUA 5KOJB 1Q1GA 3HHPA 2PJRA 3TK1A 3PI7A 3GLSA 1I13A 2PD3A 4P2GA 3JQPA 4NMHA 4D1YA 1FYWA 4PAOA 3EIEA 1MFPA 1UJ2A 2ZSAA 5IUNC 4HYEA 4IXTA 1WE2A 1YB2A 2W83A 5EJGA 3RTEA 4KQ2A 3N0XA 16PKA 4P6VF 1N5IA 1W9MA 3K15A 2OBLA 2VK4A 3QP9A 3B85A 3RSFA 1YOBA 2AJCA 2OHIA 1N2GA 1X0VA 2HDHA 1P0QA 1F51E 2FB9A 2VG8A 4PZZA 5CCDA 4W1SA 1MHPA 4MEBA 5REQA 3RUDA 2NO7A 5KSPA 5U9CA 4BDSA 4RWEA 2ACKA 1GO2A 2AE2A 2QZ9A 4MAAA 3UV6A 1SUBA 5K6AC 3I45A 1T8SA 3HM2A 3OZDA 5AI9A 5L3QA 1PQUA 2SBTA 4FFSA 4IHJA 5C32A 3HCFA 2J3IA 2FXIA 3QVVA 3VVBA 4BIMA 3ENZA 1K5HA 4GU5A 3VV3A 3GLGE 1DU4A 2AL7A 1GKIA 3H8WA 2XCTB 1OZFA 3I9KA 5TQ0A 4EB8A 1X13A 1XU9A 1Z13A 2EZ8A 4KRGA 4OB6A 3GFSA 3GZNB 1FSFA 2I03A 2AC7A 4FDMA 5DNWA 3T15A 2ZRBA 1AXEA 5HA5A 2ZIWB 4J76A 2UVPB 2BDEA 3E8SA 4Y7DA 3ZGYA 3WR5A 1DIOB 1HDXA 4QOGA 3UT5B 2CJPA 4CETA 1IN5A 3WLSA 3OA2A 1SBIA 1NJSA 5FCDA 4NRDA 3RS5A 5CFNA 4CF3A 1XWWA 4RVGA 1QKKA 1PQ4A 1W94A 1TU3A 3EG9A 4OFWA 4HLUA 5JAUA 3U62A 3T9CA 1JJIA 2DTDA 2I4IA 2WQZA 4L95C 2G5TA 1C0IA 4U0KA 1UPXA 2E4XA 3WGIA 4MCIA 1U9IC 1HMYA 5HIJA 3DMNA 4W63A 3SSNA 2L17A 2VRNA 2NU7A 4Q3AA 1FQOA 1X42A 3COYA 2B0CA 3IHLA 4FC7A 4K40A 4CV1A 1A0OA 3LTNC 4PHCA 4M8LA 1Q2XA 3QJ5A 5B3JC 4TXHA 3KETA 1QP8A 1NOKA 2FVXA 5DHUA 5F7JA 3KV1A 4YRJA 2IXFA 1KC1A 3S1AB 4LI0A 3THYA 2VTVA 2DUWA 4FHFA 1N8NA 1G7RA 1LRJA 5AOVA 1WXIA 1YZHA 3O4VA 4HH1A 1Z0JA 1SU7A 1L8OA 5EYPA 2GF0A 3AI7A 3OHPA 2AV6A 2Y0EA 4OI2A 4QAJA 3RF7A 3SC4A 2A3NA 1SR8A 3WLPA 1N7IA 3H2HA 1OX4A 4MVJM 5K4AA 4L7QA 4BAUA 1T4CA 2GCNA 3LPCA 1XNQB 5KHAA 3K1AA 1V95A 4TWIA 1C7FA 3S29A 4CEIA 1OAAA 2CC2A 4R05A 5AO9A 5TGDA 3VVCA 1G2IA 2IXTA 4WCFC 1IBKB 2EJUA 5KNDD 3C70A 2R85A 3GGOA 2ZJFA 3R9IA 4CQMD 4I9NA 2GN0A 1HYHA 3FKSA 4DXAA 1WKBA 2BEWA 2PWYA 4HAOA 4QDZA 3E03A 4OQPA 4YRFA 4BB5A 4BMNA 1MC1A 5JCXA 1U9YA 3WIEA 3TH5A 2UZ1A 3W5JA 4DV7B 2W58A 5GINE 4OJMX 3QUSA 3FLAA 3DAHA 1SBHA 3GVXA 5GIOE 4ABTA 4BLWA 1EP3B 1CRLA 3HR7A 1HE1C 2XUPA 2Z6UA 5BYJA 5FOVA 1TTHA 2ZBQA 4ZJPA 5E9QA 3RUAA 1QPGA 2C00A 1WVGA 3PU6A 3WLEA 4BE7B 3PTAA 4ZQCB 2GEBA 4RFLA 4DCOA 2JIPA 4QZVA 1JKIA 4IH9A 1R0KA 3I9V6 3JYHA 4R84A 1MB4A 1JPUA 2JKZA 3DBRB 1Q1AA 2NO9A 2O4UX 4MAFA 3V8EA 3TQCA 2HBYA 1QHIA 3NGLA 4W7IA 3FKQA 2BHTA 5DBHX 3P2OA 2W00A 1QK3A 2GPAA 3DOUA 5FRDA 1QPZA 13PKA 3WAJA 5ERXA 3G82C 1SHUX 3HJAA 3N3AC 4Z7JA 4WOKA 3GJ4A 3KT0A 2B9EA 4TXNA 1H6CA 4JX8A 4OKSA 2A8YA 4XE5A 5DLEA 3ZWCA 2FZ4A 1QZXA 2XVYA 3FDFA 2XGGA 5CA0F 3WRYC 2O2IA 1YCGA 4HLQB 1S8AA 2FEKA 3M6WA 3VSEA 3OKAA 2PGNA 1DAFA 5FTWA 1QRSA 3DDZX 4Z86A 2EIHA 4RZSA 4LSGA 3H9BA 2QENA 3ABOB 3WDLA 4HF7A 5ESXA 2EKPA 2I0FA 1MAHA 3ZVRA 2RI0A 2H2DA 2Q50A 2WLTA 3MTAA 2XOKA 2B61A 2L42A 4FXPA 3D81A 4BEWA 1B8NA 1SWWA 3OFSA 2RHCA 1TT5B 2B1JA 1DDGA 1T0PA 2PEYA 2VJCA 4P3NA 2W42A 1MPTA 2HRZA 3UW3A 4KHPB 1NQXA 4MYRA 2QM8A 2V59A 4FYWA 3ZPXA 5KYUA 1W19A 2NTJA 3CH5A 2AHRA 3D6MA 4HWOA 1JW9B 1V11A 3IKLA 3IULA 2XITA 3QTTA 5CH3A 3ZHBA 5CYGA 2YWGA 3U44A 2UXCB 1PK9A 4JOSA 3C7KA 3NIGB 3ZQ6A 4JIMA 5ER9A 2YTZA 4O2RA 2QUAA 3R0IA 4N5HX 3WADA 1BVRA 2AVDA 3OPNA 4DZZA 4TS4A 4CQMB 5HFAA 4TUYB 5D6OA 2PGOA 3TAHA 2QB5A 1WUKS 2J3MA 5JNWA 3HXPA 3PSAA 1TVKA 2CUKA 3K96A 3EXHA 1UKCA 3D6JA 3HCOA 4DCMA 1U9JA 4N0PA 3V48A 1K66A 1JAXA 5IARA 5IT5A 3L04A 4B6OA 4EIWA 3KFLA 4ZEMA 9MHTA 4PLYA 2P27A 1SUCA 3I30X 3O5AA 3O83A 1GPNA 3GZTB 4XB6B 1KJJA 4RZXA 3W2GA 2ZYTX 1Q19A 3V2GA 2BTEA 2H08A 2O0JA 5KYXA 1ZOSA 2JGDB 3T0FA 2QYHA 4BFYA 2BFFA 5FLYA 6NULA 2QMYA 1NUQA 4MQEB 3UMFA 1KNXA 3IEVA 1J6UA 4PINA 2JHCA 4X6LA 4Y1FA 2QAGC 3EFOB 5B1HA 1T6YA 4BAZA 2FEXA 3PR1A 4YLEA 3UPDA 3HRHA 4M76B 4A15A 3NMUF 2DPGA 2WSMA 4X41A 2PZAA 3DCJA 3ESYA 4IZIA 4LE0A 3PUHA 1QE0A 3ZHUA 4J3JA 1DMRA 3D4OA 3DS8A 1ZAYA 3ANYB 1LBTA 5CU7A 3BA6A 1FYEA 3CIOA 4R9SA 4DLNA 4OAPA 3E35A 3F8SA 1KMHA 3G2LA 1VMKA 1TQ6A 4GQIA 4XEHA 3HACA 2P9CA 1RWQA 4BNKA 1ZRMA 1U3UA 3KJHA 4ZZ0A 3BIFA 3VPDA 1HNWB 2GERA 4Z0TA 2GDJA 2OXRA 2PBRA 2DHEA 3ANXA 1MQSA 5EWJB 3EIQA 1CEXA 2ZE5A 1CG6A 1P74A 3SX4A 3UN1A 4J1SA 4QUEA 3QXSA 5I7RA 3U7HB 4CW7A 4LF8B 3TDMA 1F38A 2XZTA 3B1WA 1NW9B 5K3DA 3G88A 1UMDA 2HZBA 1QFYA 3A6EA 3ZU4A 1B6SA 3OAAD 5LP6F 5J2TF 4RORA 1B6RA 3P1JA 1U9ZA 2DFTA 1PQWA 2FPUA 1V26A 5IAKA 4TTSA 1E6WA 4JEMA 3RVOA 1MX1A 3HFRA 4JLBA 1RIFA 3VDNB 1L8QA 1M33A 4LA4A 1JXOA 1P4HA 4R3NA 5FV4A 1NRWA 3RYCB 1BRTA 1H9AA 1M9NA 1Q7TA 3I2KA 4B17A 1EFVA 1GQRA 5AW6A 3EUFA 5LD2B 3PYMA 4TYNA 1R00A 1BD4A 4X3CA 4YC7A 3SY8A 1IHYA 1V7CA 2BDUA 3L8ZA 3R6WA 2IW1A 2ZJBA 4M1SA 4MUFA 3RC2A 3USES 1J33A 1EIZA 3PKZA 2BMEA 2IXBA 2P77A 4CR6A 2F4NA 3VOSA 4Z1OA 2D0DA 1W73A 3ABQB 1USWA 1PZXA 1AHIA 4I1VA 3D1VA 4AZSA 2VJDA 1DVRA 1FP2A 1TCAA 3CW2A 3EOAI 1DT5A 3RHTA 1QNLA 2OENG 3VSDA 4PO8A 5EE0A 5DNUA 4Y2SA 5CA1A 4XCVA 1GQQA 1WZUA 4OREX 4RTNA 1DO0A 3ZDYB 3HEAA 4RIGA 4RW0A 3EXEA 3JATA 1L0BA 2NSYA 1YMQA 2HMWA 1CR4A 4I1UA 1B2RA 1QH1B 5TPZA 2FSIA 1XP8A 4FQ5A 5AHKA 3T34A 3HSYA 2GJ9A 4CLRA 1ZINA 1CUSA 1WSBA 3RS9A 4AP6A 4B46A 4PNPA 3WRVA 2W2VA 1DKMA 3CX6A 3WK4A 2ZB4A 4BJHB 1N3LA 4ALLA 5IXSA 5BP7A 4FE3A 2DQKA 4G9GA 4D0LB 2GEUA 1M6WA 1SH7A 3BE4A 3TO5A 2W2LA 2HA7A 4A1FA 1LDGA 1VL8A 1RPNA 2GB4A 4I81A 4IOLA 5CNJA 4H3SA 1JE1A 3DXYA 3HSSA 1LVHA 1NP6A 5KU1A 5LFAA 1USIA 5JANA 5B2EA 1JZSA 3NTVA 4TOIA 2A7QA 5HS4A 1CY4A 2HN9A 1DBIA 2AFVA 1E2QA 1E4VA 2PYZA 2QNBA 2QTAA 3FNGA 3G9XA 3JALA 4P31A 4QQFA 1T9AA 5J5AA 1FRQA 3ZZ1A 3DAFA 3OJ0A 1IMOA 2D7CA 4QEKA 1R9JA 3HKBB 5AKZA 3SSMA 2UZ0A 4F6RB 1E3QA 1H2AS 2NTYC 3ZHSA 1EVEA 3EA5A 2H54A 2DM6A 1BS1A 3DVQX 3UAWA 3V4RA 5JS8A 2BHRA 3FZEA 3DBOB 5LOVB 3SBEA 4YH1A 1KOFA 3NYRA 3STWA 4FW8A 3R3VA 4RAQA 3T7RA 2YNMD 4DUPA 5J1TB 3JZFA 1X7DA 1IOLA 3TLKA 4QVIA 4NP6A 2AJ8A 5EEHA 1OYWA 4EB6B 3UF0A 1MDBA 3VSCA 1JTVA 1YZKA 2XUKA 2RHBA 3INTA 3LF2A 3ME5A 2VZLA 4DY6A 4HWSA 3G13A 4HDSA 3N5KA 1BS2A 3GT3A 4AUEA 4DWWA 4HLDA 5EJ9A 2RHWA 4CG2A 1TF2A 4W7HA 4MGEA 1VKJA 4OMUA 5I4KA 2VSOA 4UUNA 1QO9A 3VUFA 4DT1B 2XTNA 3DHEA 4EYOA 2COUA 4RK4A 3K6SA 4ZU6X 1AKUA 2Y93A 1HRKA 1DO8A 3Q15C 3G8AA 4MKZA 4BFUA 2OL4A 3TNFA 1E77A 2Q1SA 3TBFA 4TL7A 4X65B 4BMCA 1FB5A 1LXCA 3EMBA 4G9EA 3TKLA 2VHVA 4REQB 5I8PA 1GXSB 1PCXA 4BBPA 1D6MA 2JFOA 2R1UA 5JR3A 5FBQB 4JC8A 2XGJA 1KSHA 2DPYA 2OHFA 3VKFA 1RR6A 4L0CA 2V45A 4MA5A 4MWSA 2XKAA 5GP1A 4F5EA 3BE8A 3GEHA 3JQQA 2VP9A 5I3CA 2EX4A 1R6XA 4JI5B 5L51A 1VL0A 3X1KA 2WIAA 4X95A 3AI1A 3I12A 1KDTA 3A3PA 4GPZA 4PZ0A 3V4OA 1Z0IA 4ARCA 2GGSA 1NXQA 4YJKA 2QW0X 3HNPA 3SICE 4TTVA 3ETCA 4J2OA 1FFXB 3IDOA 2BN4A 3EDYA 1CFZA 4YFYA 5GOZA 5L40A 3ET4A 4NZYA 4QUAA 4TRMA 2EJVA 3AVTA 4YNBA 4JB8A 4GKBA 4OHYA 2ZVPX 3EW9A 4FUTA 1BNCA 4G81A 3E7WA 4LVNA 1YR3A 4FXOA 1EB9A 2ZIZA 4LY6A 4ZOEA 3GB9A 3LG2A 1L2TA 4K86A 2AYXA 5B3JA 2R7MA 1XXHA 1JLLA 1OOEA 3MF4A 2NAPA 3R5FA 5D00A 3SJBA 3W05A 5GV7A 1W5TA 3OC6A 4BEVA 3HCNA 3PD0A 2D54A 2J5KA 5JZVA 1GSAA 3FZQA 4R9RA 1K4MA 3JQ8A 1HH4A 3O73A 1Z5VA 3OP1A 3IE1A 4GRIA 3IYLW 1EXNA 2CZQA 4IAOA 1LLUA 3C4JA 4EMTA 1GRQA 1F4PA 3ZJ5A 5D51S 4S24A 1D2EA 1QIJA 4HLUC 3KHSA 1VJGA 1ISGA 3NBYC 2QXTA 1LS1A 1F4VA 1ZHHA 4GL4A 3N2GA 1XEWY 4QARA 5FPYA 1I5EA 1KI1A 3UG6A 2YVAA 1L5QA 4PWZA 2W98A 4YI5A 4NS1A 4B7UA 3QIAA 3HXMA 1DXQA 3I0MA 2QEQA 4K6GA 1W1IA 2BKAA 1G1AA 3PQCA 2H11A 4M6WA 2ATCA 2JRCA 5FUVA 3TCKA 3V1KA 4FC6A 3PT9A 2Y1GA 4NG5A 3PC7A 1ZBQA 4A3SA 2C61A 3NHWA 4ZVOA 3FCUB 2HHAA 2PR7A 3AQ4A 4J0DA 5KMGB 4R4JA 4O2AA 1QWSA 3EGCA 4F56A 5LQAA 4CKEB 2PZBA 3I4LA 3VR1A 3TTXA 2FTKE 4AM8A 1GSOA 2C2KA 2RB4A 5JY1A 4QBFA 2RHTA 4AK9A 1OGJA 4J1QA 1D8AA 4D0GA 1LX7A 3NYWA 2ANBA 2AJBA 3AYXB 4WBSA 5H83A 2AE1A 1ZVVA 3IHTA 2Z5GA 3TF5A 4OXIA 2ZR8A 1SVOA 1EX1A 3RYIB 2IZ7A 3P97A 2WRZA 5IDYA 4AZTA 2DH5A 1YUBA 5MF6A 3LU1A 4OSPA 2ZG6A 3CUEF 1DWQA 1QLWA 1J7KA 3C3EA 4U2BA 5G1OA 1AV6A 3K0FA 3PUVA 4P08A 1BO6A 1OV6A 3G2IA 2F1KA 3U7RA 2NTNA 3HDHA 4HNUA 1SZJG 3AC0A 4HUJA 3H5AA 4L6IA 2MDTA 4MRPA 4RK0A 4RH1A 1Y4ZA 4TSKA 2OD7A 1F4LA 3EGWA 3D7SA 2H63A 2SNIE 3LQFA 1ZD1A 4GE0A 5JRDS 4WESA 3PXAA 5P21A 3RO7A 4JY7A 4KK4A 3T7EA 1K3FA 1C2YA 4QOSA 5IKOA 3ESBA 4LBZA 2V1UA 3H6HA 4GMHA 1OE0A 1OFGA 1U9CA 2W37A 2W6PA 3H0EA 3EC1A 1B8UA 3TZHA 3UHAA 1OVMA 5CK4A 4JBIA 3BJRA 2PS9A 2O5CA 4DQVA 2DG2A 2R66A 1Q57A 3RQIA 2C5BA 1GD1O 2KPOA 4H17A 2BFNA 3AVQA 3EVGA 1YFKA 2IE8A 3GFPA 3LL4A 2ZIXA 3NGXA 1F2TB 4NS4A 5FF9A 2YV1A 4BQPA 3DUFB 1YH3A 1RZVA 3A9CA 2JH8A 3BD7A 2X0DA 3KZCA 4A8HA 1IM2A 1K88A 1JEOA 4XZ3A 4XVCA 4HRVA 2HJ9A 4RVCA 5ECDA 4BC1A 4EYQA 5FT9A 2YQ4A 1OI3A 1J2JA 2L19A 4P54A 1TM4E 4G37A 4C20A 1AZSC 2HCTA 3GZJA 1QBKC 1KOJA 3Q8XB 2GDZA 3R6LA 2EHDA 3W6ZA 2VJKA 4P4NA 4O8CA 3M49A 1U8EA 2WF8A 5FEUA 4X64B 2X41A 5HDBB 2RONA 3GJXC 2EEZA 3DC7A 4MZDA 5FNVA 4J16C 4RFSA 3ZI4A 5IM5A 1QRDA 4JA0A 2NV0A 1XMJA 2VSYA 1YQGA 4WOPA 3S2IA 5HR5A 4BPBA 3QGMA 2E4UA 4YCLA 4Y1RB 2L82A 1M1ZA 3T9EA 4MQFA 5C1BA 1YFZA 1EEXB 1IHOA 1UBMS 4RD6A 2Y2VA 5LLTA 4FMCB 1EGMB 4RPGA 5K0EA 2ZXFA 2XZDA 3L0DA 1LX6A 4E5MA 3KSRA 3I04A 4TMZA 1BE1A 5BY2A 4EJ2A 2JGJA 1G21B 1EQ2A 1T29A 3OPYB 5FV7A 2MSEB 4BKMA 4IFEA 1FJ2A 3IHWA 2H1IA 1ES9A 2OPBA 4KXFB 4Y2XA 1FFAA 3UY4A 1N8KA 2BM1A 3LK7A 5CM2Z 5L4NA 1H4VB 3MB8A 1GUZA 3ZQ4A 2H1CA 1QTIA 4LK2A 3HCRA 7MDHA 1RMTA 3L7BA 3JRNA 3WO1A 1HWYA 2GZDA 3LUDA 1G63A 4O4LF 4BJ6A 2OYRA 4IH4A 4NIMA 3JWPA 4C6HA 4HFJA 1LBEA 1OZ0A 2PSDA 3D2BA 1K7SN 2ZR9A 3BE6A 3IIKA 4LSMA 1E5DA 1TA0A 7MHTA 1IN4A 4ARVA 1T36A 1XZLA 3QNWA 3PNSA 5A4AA 4Z9FA 2YL2A 1L8LA 2CJWB 3L6DA 4XWKA 1JSCA 3D59A 5EE5B 5DX0A 5K6RA 4RPIA 1WF3A 4X62B 1QGAA 2Q1WA 1JDJA 2PLRA 2PWBA 2VDNB 5CVVA 4AG6A 2I2CA 4YRKA 1I6MA 2R96A 1C9NA 1XXHE 5AVWA 2E0IA 5JAMA 1FXUA 2FW1A 2QLBA 2XHZA 4RKQA 2HCFA 2WYWA 4HNTA 2O8DA 4JC0A 1BKYA 2UUOA 2R6CA 1P4AA 3BH0A 4LDPA 3N2NA 2XYGA 5H82A 2I3GA 1ZXLA 2F3PA 1KGDA 2HJVA 2HT6A 3RFCA 1XZGA 4LTMA 1HETA 1IM5A 3U09A 1GZ5A 3KHTA 1H5UA 1LU9A 2GBPA 1IDOA 1W88A 5JFOA 4I4NA 2GK6A 3HMKA 4Q9HA 4OHOA 3K32A 1ZMOA 2XF2A 3TLYA 4KPYA 1ARZA 3VJMA 4CEHA 3SK0A 3N87A 5JS2A 1XZIA 1FE8A 3SQXA 4G0ZA 2E5LB 4QEZA 1DAMA 1OH5A 3JRWA 1LQTA 1SHLA 2HJWA 3IV6A 4C7OB 1GJRA 1BFKA 3K6RA 3KJIA 3A4YA 4V1CI 3FVRA 4Q4JB 4C7JA 2HF2A 1GSHA 3PVSA 2R1VA 4H3KB 4HQLA 3SNHA 4AB1A 3PIDA 1FMFA 2I76A 3N05A 4OYYA 4KQJA 4D4IA 3EIFA 1II0A 3N9IA 1VG1A 1R10A 1KNQA 3LLUA 3P9PA 1WZEA 3T94A 2P3SA 2O9JA 4GR4A 1RQLA 1YS1X 1YJXA 2GN8A 3ELUA 1TAHA 5CLHA 2JLCA 1XTVA 3HDJA 1S2IA 3GRVA 4H4DA 1XRSB 4RY0A 2WJGA 3CTMA 2OV8A 2RGNA 2ZT7A 2NXNA 2VHEA 1NQVA 2FWBA 4L0QA 4LVOA 1G2PA 4K0RA 4QFMA 2YZGA 5E1MA 3TLEA 3H2IA 3QVLA 4RGYA 1GU0A 4WNAA 1OSNA 3IS3A 4AMUA 4ZZIA 3AB8A 3HC7A 1NJ5A 3H99A 3LUHA 1LLFA 4BRWA 3G2QA 4RPKA 4DMRA 4XWGA 2BYTA 2VPZA 5ALNA 4BFCA 1LVUA 1BXGA 2HTFA 4HP8A 5EZQA 1AQYA 4GWKA 1KDVA 1IG3A 3Q11A 3PLNA 2LNDA 3ONEA 5BMVB 2HRDA 1E5QA 4F96A 3GEDA 1YAHA 4MIKA 2FLVA 3GYBA 4Q1FA 1BHSA 4JS0A 1C7JA 4P84A 1NHWA 5K3OA 3MB5A 3PHLA 1JWAB 3W4JA 1AT1A 1BH6A 1T1EA 3TVYA 3V4FA 1ZN9A 1WZ2A 3N6XA 3P9QA 1R8QA 1QM5A 2AFIA 1CUUA 2PS3A 2ZAMA 4KMSA 2BFBA 4E2YA 1WM1A 5ADWA 4FMBB 3HXQA 2CW5A 3GLIB 1QCYA 3E5MA 4IGAA 1AS3A 1HX7A 4KYUA 4DRYA 2R7LA 1C14A 2A0XA 2C2ZA 5LIRA 4S2EA 2HK6A 1OY1A 4PSAA 3NRJA 5EUBA 4IWXA 1E3MA 1DTSA 1COWD 1NC3A 3LUKA 4KXLA 1KBZA 2BR3A 2ZTSA 1W96A 3GH3A 1LBHA 4GX5A 1L7AA 2VP2A 3G2PA 2XKJE 5EIEA 2OUKA 4Q3NA 1DT3A 3LYAA 3ENQA 3IERA 4R68A 1EUDB 1W5AA 2ZKIA 4FOPA 1XTQA 4MV3A 3B51X 3OM0A 1E94E 1M2OA 1NSYA 3B2EA 3I3SR 4L51A 4KOAA 3UJ3X 4CL8A 4F8JA 5KQSA 3SIXA 1H8HD 1PJSA 3STVA 4OLAA 4DGSA 2PO7A 1W4CA 2C7BA 1G5HA 2VTBA 4RXTA 4DBLE 4DV0B 1SXIA 3S2YA 1E7WA 1RAIA 2VQDA 2BZ1A 1GUFA 1WWKA 2DPMA 3D4NA 3I83A 5JD3A 4CM9D 5CW1A 1KQFA 3D2LA 2HIGA 2ZRJA 4O1MA 2FPGA 4BDTA 1FS5A 4C4YA 3IR5A 1L1RA 2NYAA 1ZCFA 5MN4A 1NWCA 2QN7A 4HRAA 2HIHA 1R5JA 3HYRA 4LF5B 3OT5A 5HK9A 1E6CA 1KDRA 5JNLA 2BGKA 2P5UA 3ON5A 4WEOA 2AJTA 1IY1A 5HIAA 1KBOA 1O5OA 1HDYA 4HUQB 5BSRA 1FMTA 2F2TA 2PQ2A 2XUIA 2ZDHA 1SXPA 4B3RB 2QA5A 3E2PA 4YGXB 721PA 3FUUA 2HBZA 1J09A 2Y92A 2Q8PA 4XD2A 2AOUA 5THQA 4C03A 2NZJA 2W6MA 3D6NB 1L7RA 3QLVA 4R2JA 5F1PA 3PTZA 5DULA 5FPQA 1PS0A 1Z5NA 3IKVA 1OWLA 4OJQA 3UK7A 3PJEA 5CB0A 3LE8A 4A0FA 4C22A 1OKKD 3EC7A 4N7BA 1LDBA 5HIMA 2V6MA 1COZA 2IBSA 1ISSA 3NHUA 3FM9A 3Q12A 1ISPA 2HXGA 2WWGA 3DKIA 3UT6A 1J2EA 3WLIA 1ZJJA 5KINB 2HO4A 2NZ8A 2CE7A 1NVBA 4GI7A 4BWFB 1PS9A 2A5LA 3KJQA 1JU9A 4YECA 2PT6A 3LFUA 1X2EA 5TGTA 1OXKB 2OP1A 2ZJ4A 3IH5A 1L4MA 1SCDA 2DPXA 3NHFA 2H2FA 3T7KA 3CB2A 1BHQ1 2ZBGA 2VP4A 1ZI9A 4PFJA 2P0EA 1MGPA 4RIIA 5T8KC 4NEGA 4QXRA 1M2HA 3SZ3A 2Q5QA 2IU3A 5F4BA 5CT8A 1FVXA 1HEYA 2H65A 2ZS7A 1CJSA 4QGHA 2JBAB 4ID9A 4C3OB 4X44A 3AUFA 1NJFA 4MUAA 3SHTA 3GXOA 3Q4GA 2VYND 2VPYA 1JG1A 2H1FA 2V65A 3V8PA 5GJWC 3GDOA 3W2EA 1DCMA 3DV0A 3ET5A 3LDHA 4US2R 4FOOA 2CVPA 4XOIA 1C9DB 1Z15A 5EIAA 4MPRA 3PUZA 3HUFA 1H8ED 1M0TA 1DOHA 2IOFA 1F9EA 1DAPA 1KRHA 1O8BA 3F5DA 3TTYA 3IUPA 3GYGA 2I7DA 1XO1A 1WOYA 3ECSA 4DIDA 3WL6A 4C87A 3SFZA 2Q0HA 1BEEA 1JRLA 1UPFA 1R0LA 3B6MA 4J49A 3RFTA 4F9TA 5EJ7A 5JVDF 4MRVA 3IO3A 5EHQA 1MW9X 1UIMA 2VHXA 2G67A 4WDRA 4DOMA 3DAPA 3SU8A 2WPDA 1E96A 1XMQB 1BE0A 1SK8A 2OGSA 3DZIA 4UM5A 2ZIEA 5D3ZA 5K3FA 4B4VA 2EGHA 2EJCA 1A5AB 2WJYA 4RD0A 4UXJA 3CU5A 1OWMA 3PFBA 1CJKC 4I1IA 1LC0A 3R0XA 2V0GA 3W78A 3PFWO 1ML4A 3MHPA 4V24A 3GR6A 3BTUA 3Q1KA 3FKSD 1CQJA 3ZBPA 5TX7A 3S5JA 2GJSA 2C2YA 3O0TA 4OSEA 3ZGZA 3K9LA 2H18A 3IJPA 1NFQA 4OF4A 3T35A 2V54A 4JQSA 4EJSB 2Q7DA 1VB3A 1Y82A 4QJIA 4N82A 2YHUA 5E8RA 3VGJA 4EHLA 5AKYA 2Q1TA 5BMVF 3T9AA 2H1SA 3JQGB 4X3PA 1JLHA 4MQ6A 5J3JA 4MP8A 1DQYA 4PC7A 3RRFA 1WULS 4O2AF 3OPVA 1YDFA 2YBEA 4P32A 4Q19A 1HTWA 2VAVA 3QPAA 3O8CA 1Z2AA 4HFMA 5DM70 2EF1A 1LF0A 2OVBA 3OZ7A 3CLTD 4F1KA 4L5JA 1QGDA 3EISA 5HXAA 4X5OA 2FN8A 2FUG6 1V9SA 2DHRA 3DTNA 1SCAA 4EL5A 5K7SA 2OKGA 2F1IA 3QFRA 2CEAA 2I29A 2XCQA 5F2OA 2WAAA 5F73A 2REBA 2XQFA 3R7LA 1MB3A 3CWQA 5ECYA 3ZIUA 1Y98A 1C3OB 3FROA 4Q4DA 2JLAA 3BTVA 2ZW9A 3DG9A 4Q0MA 3OM9A 1Y3AA 2JFWA 4IQ4A 4LGYA 5H3LA 2V74B 4Q15A 4TKMA 2R8XA 4LZOA 3BJEA 4GVPA 4I1OA 3T5GA 1TM3E 1XTZA 2GRJA 2OO5A 1BGWA 1K9VF 2WUEA 3UUGA 3WZLA 1YU9A 3V4PB 5CFQA 3VPCA 4DB2A 3MJFA 5GZ1A 2ZBVA 3GUUA 1W87A 1DTEA 2QDKA 4QT0A 4ZT7A 3GLGB 1LLQA 1KORA 1X9GA 2DP4E 2GM9A 5ICSA 5B3AA 4BYGA 4BEBA 3IKMB 5DNCA 1KKLA 4M1KA 1GZUA 1Z3CA 1YDHA 3K72B 3KLMX 4JLAA 4YP6A 1I4TD 1QTQA 3NWBA 4J94A 1SBYA 2HMUA 2J31A 2BEUA 1JTEA 3GEMA 3OIYA 2A94A 4RV5A 4DDMA 1YCHA 2DUJA 4YJDA 3KT6A 2UVQA 1NDHA 1YT5A 2YXDA 5DDIP 1M2GA 2BI7A 2I6TA 2JJ2D 3COSA 5YASA 3C98A 4MUBA 2QG9A 2PRZA 4EOGA 5HSGA 3KAKA 1MENA 2QSZA 3QUCA 4OXNA 1A9XA 1L4EA 1OXBB 2FFRA 3K70D 1SELA 1L5RA 2VL7A 3GPIA 3NJRA 4O2BB 3UK0A 1F5SA 4HGZA 1X7YB 4OXXA 1HFWA 2F1HA 4Q1BA 3FWHA 1L1EA 4WZBA 3W2HA 4KO4S 2EKZA 3O94A 1P17A 3ISTA 1L4HA 4N0DA 1O97C 3C5HA 3HS3A 2DTEA 1PGNA 2YHSA 3A6GA 3D02A 2F59A 2FWRA 2Q2WA 5ALUA 4O6VA 2ZKLA 1XKLA 1M7HA 4IEEA 3Q9SA 5E0KB 1FDTA 1GGHA 1T2NA 1Z68A 2BGLA 2Y76A 4OIMA 4HY3A 1PNVA 3BK1A 3I01A 3PFFA 4IIHA 4XRGA 5C8YB 5IVPA 1QO7A 4BL5A 2H8GA 2ZQYA 4LV5B 4AQ7A 2P1DA 3WLTA 4AF7A 5JBQA 1WRBA 1XMVA 3A9RA 3GGPA 4ETWA 1VZ2A 1R6TA 1H2RS 4UATA 1D4OA 1JIJA 5TQVA 5HKKA 2VAPA 2AG8A 2PYDA 4QGGA 5D85A 4AY4A 3V7UA 2I4LA 3T38A 3TW8B 5FUMA 3JQAB 1G8FA 2BGUA 3B60A 5C4GB 3BDVA 3LPAA 3QX7A 1Z0FA 5ALWA 4EY5A 1LZKA 3DOFA 3LNCA 3NBQA 2AX4A 2ZQ5A 4TWZA 4LYHA 2GWRA 1JEYA 1KSGA 4PZAA 3LYHA 3OD1A 4BX2A 1LSSA 3WL4A 1MC8A 5H9WA 4JLPA 3GRZA 1M74A 1K5DA 1I4EB 2G9VA 3GFRA 1XUOA 5ULLA 4O63O 3GGCA 3AOEC 2IQIA 2AK2A 3EF1A 3FTQA 1CP3A 3VNQA 5DYWA 4EKGA 5KS2A 4E07A 1KO8A 3DTVA 3OE1A 5BSFA 5LOVF 5H16A 2W6ID 2ZTMA 3L7MA 5T41A 4D4JA 5BNTA 1P1HA 3WKEA 4LJ9A 2FUKA 2IP4A 2IYAA 2YY7A 4MLDA 1WVIA 4MROA 1TUBA 3B8HA 4FI3F 4DR4B 1B0AA 2REOA 3U9LA 4B7ZA 5A3SA 2O59A 2AT1A 1EU1A 1I6WA 1NN5A 5AW7A 1KMCA 2V7WA 3O8BA 4DSOA 5KWEA 4MP6A 2O7NA 4I4CA 5JNUA 3PE4A 1UZNA 4DJDC 4MUYA 4OCZA 4EFNA 5EUMA 3TZLA 2BLNA 2FEMA 3FSJX 3GEPA 1M8FA 3PCRB 2NTVA 1P29A 3TW4A 1MKYA 1KAQA 2HWYA 4RV4A 3SHFA 5CMLA 4WUVA 2OFXA 4Q1VA 4V0LA 2RHHA 5AW9A 5JD6A 3PC6A 4C4OA 2GCIA 4J4HA 1XTKA 2KI5A 1ZM2A 3FOCA 4R1QA 1SZCA 4DXDA 3OLVA 2FR8A 2W2QA 4KVZA 4DQUA 3CSSA 3VR5H 5DT9A 3ZVMA 1YZLA 3CZAA 2CMKA 2EW2A 1PTJA 3OQIB 3PZRA 3QF4A 2QTFA 2R79A 1XJQA 2H9AA 3C7CB 4GUAA 4KUEA 2P35A 4TS1A 4WCVA 5DXAA 2DHDA 5HVNA 3SR4A 4BNYA 1QFXA 1CLUA 3GFGA 1U99A 4OUDB 2YXPX 2QSYA 4LCJA 5E3HA 4A23A 4AZWA 2VLBA 2G4CA 3F49S 4Z9YA 1NG1A 2R6FA 2FSHA 3U40A 4AMGA 1IK4A 4WNCA 5IBQA 5IJ0A 2IDMA 3NKLA 1OF1A 1W0KA 3MT7A 4R1PA 3PD1A 1A88A 3F90A 3L7OA 4ARZA 2N1BA 4D9KA 4D96A 1HYGA 2GCEA 2WTEA 3ABIA 4D45A 1C9MA 3OCZA 2ZIGA 4JODA 5EI5A 5TEVA 3KT8A 5L7TA 3CH7A 1UH5A 2C7RA 5FP0A 3VKGA 2GXSA 2XIQA 3GCXA 1BCSA 4ER6A 5B1YA 1MRSA 2CDRA 4BFXA 2I7CA 1PSWA 2PG3A 5DI3B 3RTDA 4D8TA 1YFLA 5BV2P 1L4UA 1XTUA 3U31A 1Z6QA 4M7OA 4RTQA 4OK5A 4KPGA 1K6JA 3RNLA 4ZO8A 2NZVG 2OCAA 2J1LA 2V7GA 3T4PA 4I19A 1ZESA 4L5BA 3ACBA 1Y9EA 2OP0A 2ATIA 4YRQA 2I9KA 1RWXA 1JKJB 2W43A 3OIVA 4KQKA 2O0LA 1JF8A 3ROEA 3ZX5A 4BNWA 4KODA 3ZU5A 2J59A 3O47A 2AC2A 3NP7A 5BUQA 1QDEA 5JCJD 1YC2A 4DJEC 1KH1A 2XMPA 3NYQA 1M2WA 4RE5A 3OCYA 4JL8A 2YOHA 3EMVA 1EUCA 4I55F 2ZPTX 2ZU0C 4TVOA 3O4RA 4ZVTA 4B4OA 3NFYA 1VE5A 1UUFA 1U0TA 4EG6A 2ZK7A 2PL1A 4HN4B 1N6PA 1FC0A 1E7SA 4W5WA 3IURA 1EGVB 2O3UA 2ZE8A 1Q74A 4X9XA 4ZCLA 2BFMA 2DQSA 2OWEA 1Q1ZA 4JJAA 3UCEA 3RT9A 2E9SA 3GRPA 4ZN6A 5A9SB 3FB4A 2QD1A 4JB0A 4RMJA 5ERGB 1NF3A 1XRNA 3SJCA 2F00A 1XD9A 4KW7A 4O4HF 2NT4A 3UFBA 1E0KA 1WW2A 3O4JA 3PITA 3R75A 3A7EA 4MV7A 3TPFA 2HX1A 3VYWA 1T5BA 5IZ4A 2Q5FA 1AO3A 3ECAA 2UZ4A 4UUPA 1Z26A 2WABA 2G5CA 1VGQA 4KBFA 5AUPB 2DRIA 3CS3A 3ACCA 3PFCA 3ZIDA 1VHWA 2JLQA 1D1TA 4XM2A 3F6SA 4Z0PA 4DCJA 1EK2A 3FRIA 3LC1O 4JR1A 1PG5A 4MJLA 4P22A 4UD2A 3QBDA 5GVRA 5IJAA 3PXXA 4PRZA 3SE0A 1BEUB 3VHLB 1ZEJA 4ND6A 2GK7A 1L6IA 3U3JA 3DHYA 4EB3A 4LG1A 2C98A 3G5TA 4I5FA 4WN3A 3VR3D 3AUUA 3HZOA 5C5DA 3B89A 2BE7A 4FT2A 3UUWA 3KNZA 4AIRA 4GEGA 5KYGA 4J3FA 3E53A 2HWXA 2PX5A 2VF8A 3BWMA 1Y7HA 4L4YA 3S7ZA 1IJKA 5KSOA 4P8RA 1OIVA 5FKJA 2HHJA 2R8ZA 2F3SA 3GRAA 1Q7EA 1F5NA 1PJLA 3GP8A 3CKLA 1NBMD 2Q07A 2CXTA 1EP2B 3JD3A 3ETNA 5COBA 1UWLA 1K5GA 1X38A 1M6EX 4E11A 1I14A 3LY7A 5ESWA 4P4LA 1FK8A 2C9ZA 1P0CA 2AS0A 2FE1A 3LV8A 2IZ5A 2OK8A 2QSUA 4GP7A 1JDVA 1GKYA 4J16A 1PJCA 4S3MA 3AF2A 3QVUA 3QXHA 1L4BA 5JVDA 2IPMA 2DOKA 4RVHA 3PWKA 4S1PA 4W5OA 4UEOA 1AXGA 2GXAA 3ETEA 5FA5A 2C2WA 1EZZA 4FX5A 2JIZA 5DCLA 2P69A 4GBMA 1PD1A 4F4FA 1UMDB 2XQIA 1J56A 4JWKA 3AETA 3VNSA 1TZKA 1ZD9A 3MWEA 2ZRPA 1D3AA 4FZRA 4H35A 4L5YA 1XJ5A 1U8YA 4HBGA 4PFSA 1XB2A 5LSAA 2DR2A 2BC9A 2Z4TA 1G8YA 3FG9A 4KXWA 1K6MA 1KVQA 4S0ZA 3HWX1 4HDNA 2FGJA 2Z1DA 2LCFA 4L1KA 4K0KB 1SY7A 3NBZC 1LZLA 3IBGA 5LL6P 3P9ZA 4M60A 4YEDA 2D1YA 2EFYA 4A0GA 3EEBA 1DAOA 3ES9A 3KQPA 4U2DA 3SZGA 3WICA 5HX7A 1KJNA 3QW2A 2C4HA 3ESQA 2A0YA 1S9HA 3F6EX 4Z99A 2A0UA 2ONYA 3B8EA 2DKFA 1EE1A 4LNAA 2IGTA 1E5LA 1DIGA 2QR3A 3ABSB 2D3WA 3OZIA 1V1RA 2AQ8A 3W9YA 1N78A 1A5ZA 3QLUC 4Y2UA 2G9ZA 1C81A 1YZ3A 5KNBD 1KGSA 1OU0A 1WV1A 3OQNA 3HB7A 1TZBA 3KUUA 4MV1A 1E9DA 4L8YA 4DIBA 1MO6A 1QQ7A 4CMIB 1E1QA 2A9QA 3I53A 3KPWA 5AVTA 3FR8A 3NXKA 1ZSNA 1OR8A 2WUVA 4G2TA 1OILA 4I50B 5ENVA 3WP0A 1DKNA 1NLYA 3LM8A 2O7QA 5B7GA 3H97A 1LFAA 1WD5A 3CZ9A 3ZV4A 2CFCA 3QFHA 1DPGA 2CKMA 4INJA 1HG0A 5EHXA 4DR6B 1M6VB 1THTA 3JPWA 4MULA 5HK8A 2XUQA 4N47A 2WWTA 4MVJF 4QOEA 2J3JA 4CI0B 3ZK8A 3EYAA 1J07A 1GPAA 3GCGA 3WFIA 2XJ4A 1VCMA 2X1HA 3JRXA 4FJ2A 4GXNA 1QU3A 4GGOA 8GPBA 5KKCA 2AJDA 1JR2A 3OECA 2J09A 3PPYA 4JMLA 1WB6A 4Z8YA 1DJPA 3T7IA 3GZNA 4RTLA 2IYZA 1QH8A 1E4OA 4ZCSA 2ZJ7A 1T9KA 3TTUA 1CJCA 3ORQA 3T1NA 1TVKB 2AG5A 1HT2E 1LTQA 4OXRA 4NBLA 1E4YA 1NATA 3CUTA 1M8GA 1NVFA 1ZOIA 5B6JA 1DS6A 3T41A 1YRYE 2FR8C 3B3AA 5CJJA 1KJYA 4ZICA 2ZAIA 3DBVO 1NDQA 4GG1A 3FOWA 1I2DA 1Y81A 4H7IA 5A7GA 2ZSIA 3SG0A 5C81A 5KTTA 4OBWA 1RIIA 3A58B 2WTNA 2QG4A 5SYNA 3BSSA 1XQWA 1EQUA 1Q3HA 2JGDA 4V02A 4EVIA 4DDHA 4MWZA 1OJ7A 1O57A 3BJZA 4MA0A 5JAQA 4DB4A 1SC3A 4GYWA 4MQEA 3RWBA 5IU6A 2GVDC 1NPDA 1V5GA 1XCLA 3ABRB 3IR7A 1YRBA 2QVXX 3RTGA 3OTOB 1M67A 4RVNA 2QAJA 2VJYA 1H6BA 3ND5A 3MCWA 4QVGA 2G04A 4I8DA 5JG7A 3QXJA 4Q39A 1V7QA 1VMEA 2F17A 2WWHA 3K35A 3QOWA 4KE6A 2MCFA 3UJBA 5GZ6A 2A7XA 4IG9A 2FU5C 2B6HA 1Q21A 1XTIA 2HD4A 2IDZA 1UT6A 5FPPA 2V7QD 4EUEA 4LFBB 4GNRA 3IQHX 4ZYWA 1TEVA 1ZL2A 4FBMA 4C5CA 4Q9AA 3A26A 4MGKR 1F14A 1MVOA 2FWJA 4FZJA 5DM1A 4FINA 4JSRA 1U31A 3O3CA 2M6LA 4DHWA 1MAAA 2QQFA 2WFMA 2ORED 4URZR 5CGQB 1Y1QA 5BWBA 1FUIA 3GN2A 3HG7A 4Z7NB 1SVSA 2E1RA 2XTMA 3WGTA 2CHFA 2JK0A 2XNKA 3UXEA 2EQAA 3JARB 4H7DA 4PG6A 1HE4A 1L7QA 1J1IA 2CB0A 2ZUBA 5LMNB 1BDHA 4P7JA 4L57A 2PKQP 3Q6IA 1UJMA 1RLUA 1ADBA 3M81A 5HJ2A 5ECWA 3LX5A 4JGBA 1W6RA 2ORIA 2RGCA 1RMQA 2Z6VA 5FBWB 3PI6A 4BGDA 1P2SA 4EHJA 5EVCA 4FW9A 4IDFA 3WMEA 5KNLA 2RGRA 3MD9A 4FWBA 3ETDA 1UC4B 2Q3DA 1U8FO 4K88A 4JYMA 1QC5B 4FR0A 3EWIA 4WA8A 2Z2ZA 2DWPA 4P92A 3AVPA 4MI3A 2GFHA 2FMFA 1A82A 2GETA 1Q6ZA 4NEHB 5BWNA 3GMSA 3ORRA 2JVIA 2RFLA 3DDOA 2QI9F 1JHDA 2FN7A 4G0VA 4QDJA 3F1KA 3RSGA 1T5IA 4FE7A 4FFBA 4RZIA 3VXKA 1UDAA 5FOSA 5DGIA 2FP4B 1V39A 5A5GA 3ZWNA 2I78A 2GK4A 3CEAA 2PRSA 1MC5A 3HO8A 4LJLA 2B3TA 1ZUD1 3IB6A 4ZTBA 1T0BA 1JDBB 2P5YA 2WJ6A 4P58A 3X2SA 2BGGA 1TEZA 2A5JA 1K8XB 2HRQA 3OJXA 1QF7A 1L5OA 2POQX 2H4WA 1L1FA 5BV7A 2EDCA 4UREA 1V71A 3UK6A 5DHRA 3FDIA 5KHOC 4R71A 1MU0A 4QGBA 2IX3A 2IUSA 1QQAA 1ZISA 5LLDA 5M2QA 1KE1A 1DRUA 1R18A 2E1PA 2BGMA 1TECE 3R0VA 3OOSA 4KCGA 4PF1A 5DU2A 1OB5A 4MH0R 2Q6IA 4YR9A 4GECA 4B6FA 5AW8A 3KXDA 4RF5A 5LZ5A 4CLRB 4F9FA 3KPVA 1ZHOA 1X1CA 2N3ZA 2UYQA 2X7HA 5AKJA 4O4IA 3NHJA 1J0XO 1FJXA 2BTQB 3C3CA 2P3OA 1NPYA 3AV3A 3BSYA 3QWFA 3VKVA 1Q1EA 1WHTB 4FNGA 4CLOB 4CL0A 1Z06A 1M6NA 4M9RA 3RIYA 3KUCA 1VA4A 1J1ZA 3RG2A 1OI7A 1E7MA 1DTWB 1HE8B 1W6UA 5KJ1A 1VE1A 4RZ2A 3KKKA 5B58C 4N3CA 3GEIA 1YDMA 1Y9DA 4YQYA 2VQSA 1VCHA 3O8NA 3MTGA 2BJHA 1DKQA 4BZWA 1L3IA 4QYSA 3JZMA 3M9XA 2I54A 2GPBA 3BEOA 3EZFA 4X1OA 5HZHA 3O8DA 2CXOA 3DPSA 4GVLA 2PRKA 2B1QA 4CDMA 3QENA 1E0SA 4PCLA 4Z49A 4CM5A 2HSEA 2QW1A 3BICA 4H6WA 5J40A 3O31A 4I9UA 3GMTA 3M2TA 1A2BA 3M6UA 3QHAA 3I1YA 4U7JA 4J0EA 1QIKA 3D7RA 3DMFA 4XIYA 3Q88A 5HMMA 2WJHA 3SR3A 2A0KA 5I9NA 1WMFA 3DB2A 1I2ZA 2W4IA 4A8PA 4ESHA 3JYQA 4AZVA 3HU5A 4Z4GA 5HZGA 4J9UE 3R6TA 2WM9B 4ZI7A 2D0PB 3C16C 4LISA 1E8DA 4ZCPA 4BNZA 5I51A 3ADPA 1U04A 2HWWA 1K7YA 3HO6A 3ITKA 3VZBA 5SZJA 2NPIA 1NI3A 2JFUA 2FLKA 2IT1A 1PWEA 2FPLA 3TLZA 1E5TA 2B1RA 2EBHX 1UJCA 2XLCA 3A6FA 3KJZA 4X8MA 5B5SA 5ILOA 4LOHA 5FUBA 2IK8A 1OROA 3S2ZA 4XVUA 1CQIA 3IO5A 3BMQB 3KB1A 3LCUA 4NOKA 3LPMA 3TI9A 2PBFA 4I5DA 4L76A 4CMAA 3DDHA 1W29A 1V43A 2AUMA 4FZVA 2G28A 4RA6B 1Y5RA 1KHHA 3RIXA 5FHQA 4YMUA 4RULA 4YJ3A 1SAYA 1HT3A 2PANA 3RS7A 5F21A 1SXJE 2M6RA 2V1XA 2H52A 2PV7A 3FZNA 3T4UA 1GEGA 3TR5A 2FWPA 2Z4SA 1K89A 3B3FA 3P5BA 1SOVA 3P96A 4YPVA 4P7KA 3UCXA 3NWPA 5IWCA 2E4VA 3OPMA 1W4RA 1PZMA 1H3FA 1Y3FE 3LKVA 4OQYA 4RFSB 5BSMA 2XKBA 1FYVA 1JVNA 4OP1A 3RUIA 4Q1DA 3AM5A 4F2PA 1DKOA 3BHJA 5DI9A 2W48A 1GT91 2Q6LA 1G6OA 2QJTA 1JJFA 3TBHA 1AK1A 2XQGA 3EGIA 3BN3A 2YASA 2XNHA 3GA7A 1EDBA 3R44A 4HDOB 4NYMQ 1IHDA 4FD3A 5CFPA 1Z4NA 2C3OA 4OA8A 4KQ9A 5C80A 1QUEA 1SBCA 2OQIA 4LXXA 4Z3KA 5JC8A 1L5VA 5JADA 1VE7A 1X8XA 2D0OB 5H9VA 4YRPA 4QD3A 1UKYA 1QO0A 3ZV6A 3BVPA 3PLAE 4R41A 1RJEA 4DR3B 3C97A 3WYFA 2Q5OA 4P3XA 2BP7B 5L9AA 2QAGA 3C8DA 3LX8A 1EGHA 2OYSA 5ICEA 2MHCA 4M22A 4ABYA 2XXBA 2HQRA 1ABFA 1BSVA 3BWXA 3RYCA 2PKXA 1Z35A 2W11A 5COQA 4IXDA 3EH2A 4QYMA 1DC6A 1SGWA 4F38A 2FZLA 1M1YA 3VPHA 2GEKA 3IR6A 1EJ0A 1IY8A 4G5OA 1EIWA 1J49A 3GOHA 1JN0A 4J0KA 4KQFA 4LYEA 1BZYA 2AQKA 3RVKA 4DLTA 1XZHA 3DEJA 4XQ9A 3VNRA 3TNDA 3L46A 3CINA 3PQEA 4QVKA 5F2EA 5JRJA 4JB2A 2WJAA 2BOVA 1BJRE 1TQ2A 4NYJR 2XMZA 3R20A 3NKFA 4ZT3A 3OCXA 3OZAA 3EPLA 3ANNA 1PIWA 1WB9A 4F8YA 5FORA 2XA2A 1KY5A 2YJ5A 5B7QA 4O2AB 3VZDA 1RI2A 4JBGA 3DE7X 4G4IA 4X1IA 4HV4A 4PGFA 4FX2A 1IONA 4RELA 4H4CA 5K9ZA 3VPGA 2W0SA 5CG1A 4Q37A 5JAOA 3K7EA 1KDPA 2KHZA 1OYOA 2EW1A 2Q4DA 4OBXA 4Y6OA 1RJDA 1QS0A 2VRCA 4EPRA 1ZH0A 2P3LA 2OM6A 3R09A 4YRSA 1Y1LA 3U16A 4EPWA 1GYRA 2AW5A 3B82A 3CUUA 3W4IA 2EZTA 2BHSA 3O3MB 3QKRB 1O5IA 1USKA 2KLBA 3DLAA 4FZ3A 4UCWA 1FLVA 4J7CA 1PKEA 2DWUA 1YIAA 5LA6F 4G67A 3IEUA 4B73A 2QROA 2J45A 4LF9B 2FJUA 5AKGA 1RJFA 3GJSA 5F12A 4N18A 1CB0A 2J30A 1Y6QA 5L4SA 1QV9A 1N7HA 4JJ7A 2WY2D 3DXZA 1XQVA 2AN9A 3F3SA 5AJHA 3IDAA 4JZYA 4DEYA 1ZIYA 1K8RA 3N7TA 1GADO 3MAAC 4CCYB 3X1MA 4DLRA 5EJ5A 1KWKA 3SKYA 5ALOA 1QZUA 2BCEA 3D6HA 1UR5A 4WFIA 4LUCA 1FP4B 2O2EA 3FNFA 3E3OA 2QL5A 4E03A 4HT3B 1MX9A 1H69A 4EG8A 3I2FA 3QI2A 5D6NA 4B3HA 4CLXA 3ZGNA 4FS8A 1GNQA 3AL2A 4LZPA 3WOVA 1SXQA 3D6AA 2HNKA 1MT0A 1FCJA 4UEJA 1PWYE 1T3GA 2BFFB 2LZ0A 2FF7A 2Q4BA 3QVSA 2HEGA 4G0OA 4HNSA 4Z0HO 3WK8A 3ZXIA 1UZMA 3T5DA 1EFAA 3DOIA 4DTIA 1T91A 1Z4OA 3HCEA 1RCTE 1SXHA 1E2EA 4N65A 4KO3S 4LXQA 4PCUA 2XUGA 3QPUA 5AW1A 4PIVA 4W9RA 2X9NA 1BQ4A 2JW5A 4JQCA 4E31A 2ANCA 2IU0A 2PL3A 4KGVA 3PQ8A 4XI9A 1D03A 3I1JA 3KRTA 5ALSA 5BMVA 3H4TA 3HY6A 2FR0A 1G41A 1Z74A 4NZNA 2J9ZB 4TSFD 1PNOA 3FGNA 3D31A 3IUNA 4GH5A 4I6EA 3WE7A 4CV2A 2BSQA 2DY1A 4ZU1X 2H59A 1QR6A 1ZICA 1NF9A 3DCYA 3D1JA 3OLZA 4LOKA 1E1CA 4PG4A 3TE7A 3M3PA 3EGDB 2C97A 3RCBA 1PR2A 2OEPA 4UDYX 3N8IA 3O38A 4NZZA 3OZVA 4INOA 2B2NA 4A92A 3IVAA 2AFIB 1QIDA 4EJMA 2QTHA 3D0QA 5FPHA 4GLFA 2QP9X 1NWHA 1ZNYA 1RI3A 3DFIA 3LBFA 3GAZA 3VC3A 2OZEA 4AO8A 2W71A 5C4MA 1Z36A 1O8CA 2CXNA 3WNQA 1CIVA 5D3MB 2DUUA 5F77A 4GOXA 4KAFA 5BN4B 1TIKA 1B42A 1P7VA 3OZEA 3PDCA 2FZGA 3TOZA 5ITSA 1HFKA 4MO9A 6REQB 2UXDB 2Q46A 4XJTA 4OGFA 3KZ1E 3T7DA 1A27A 5TSDA 3WBFA 4TLLB 3MUEA 4EGCB 5LQRA 3KKOA 3HWWA 4QU8A 4DCVA 2BMJA 1TJYA 3D0KA 4Q7MB 3HA2A 1GCIA 4RTJA 4XASA 5F5XA 1JDPA 2DEUA 3AUTA 1LTKA 4H0CA 4I9HA 3L92A 1MT3A 3WWCA 4R51A 2C92A 2VTKA 1R0ZA 1M8KA 4IS2A 4Q34A 2WYUA 3MJHA 4F9GA 3IP9A 2JLBA 1U0HC 1D5WA 2H07A 3MJEA 4X7BA 3RDPA 5LP6B 4ND5A 4AQDA 1Y63A 1JXMA 2B4QA 4IGEA 4IZOA 3BWCA 1SIBE 5DLPA 1JLMA 4IWYA 3RM3A 3WO0A 4JSYA 2ETVA 3BWEA 5CA1B 4BFVA 4G97A 4CM4A 4TVSA 1YVDA 2BRUC 1GDHA 1SCUB 3A9WA 1H2YA 2J4CA 3T3NA 2X5OA 3MRXA 4TT3A 4EF4A 5K20A 1MR3F 3IQXA 3TSZA 2JBHA 4LHZA 4EI8A 5B64A 1GR1A 3HSKA 2J7KA 3IAAA 2C4TA 3U17A 3ZWXA 3FX2A 3SF8A 4BUCA 4F4DA 2IPXA 4PGHA 1XRJA 3S55A 1WCIB 4KX3A 2AOUB 3P7MA 3F9IA 3SZUA 4ZI2A 1JSLA 3N0RA 4QUKA 5J4HA 4J75A 1S9DA 2GPNA 1N5JA 1XDBA 2FAXA 4P93A 4YAOA 5AW3A 4WN9B 4D80A 2AK3A 5DYTA 3RARA 1EWYA 1IEQA 2BMFA 3CIFA 2JGNA 3GK3A 4FGKA 1PR0A 3V8NA 4CIBA 1T8PA 1A9OA 2CK3A 4M53A 3HCPA 3NHKA 2AXNA 1WR8A 2LDXA 4C0HA 1DKLA 3ZN2A 5IN5A 5D86A 2YHAA 3ESDA 3IAM1 4R3UC 1YZVA 3G85A 4KQCA 3KKEA 4CL2A 1ZR4A 1VL5A 5CDSA 4HGNA 2I5PO 4N5IX 5LNK6 2DF8A 4N0EA 4YJFA 2ACVA 4RF2A 3GT4A 3QPVA 2VQFB 1QX3A 1FUYB 1Z8FA 2QNIA 1P2DA 1U6KA 4CM8B 2EGGA 5J1SB 2MSNA 3QIVA 2OYCA 1VSQA 1HA3A 3HFSA 2G6BA 2BFPA 3EQZA 3M1LA 5E2BA 9ATCA 5KTRA 2QTWB 2YQZA 2LW7A 5E2IA 1W59A 1X0XA 1B8VA 2FRXA 4D26A 1PDWA 2QDXA 1FDUA 3DV0B 3E0XA 4TZTA 4ZT5A 3RU7A 1Q0TA 4NVRA 5DX8A 1PTKA 1OXUA 4QQRA 1ZXBA 4UW9A 4A2QA 2CNWA 3N0TA 5AHXA 3ZHCA 1U2SA 3Q3GE 4ODIA 1P2VA 2HJHA 3GOQA 3WDSA 5FUWA 1SVIA 5L95A 4LX8A 2NUTB 4KAAA 3UWDA 4KAXA 4YAIA 3CNLA 2PA3A 4HYYA 4TYYA 4CV0A 1P2TA 2PX4A 5BWOA 1YR9A 4TTJA 1ZDMA 4EUFA 3UK2A 1JLSA 3TN7A 2XQVA 3V32A 3ZE9A 4OLJA 2BTOA 1HYBA 4TLMB 4WXMA 1XVUA 5CFLA 1SWVA 2C2HA 2WV9A 2NPFA 2PGDA 3NS7A 3DMHA 4IYRA 1E6EA 4WJKB 3HL0A 4EKEA 5CNMA 5JAIA 3HM9A 1MRNA 2C1EA 1K7FB 3VKHA 3KE9A 4IRXA 1SXJA 4JI6B 1SMKA 1EK6A 4QHTA 3SEFA 3ZVKA 3EVBA 2HO5A 4P3PA 2BM8A 3LQKA 2C4KA 3KR9A 3DQPA 2GSDA 3QVGB 3PNVA 4LY3A 5CPBA 5BN4A 4EJSA 2GRAA 2C9DA 3MHTA 4NXMB 1ZONA 4PRKA 3P2EA 3KAQA 4Z54A 4EZIA 3KZMA 3DNMA 1NMYA 1S7GA 3QELA 1UXJA 1W93A 4M0FA 2V5UA 5ENDA 3EZYA 3IKTA 2O8BA 5C31A 3JQGA 4KWEA 5LWQA 1U2QA 5EWLB 4YK7A 3V00A 2GM4A 2C8VA 4ESVA 1NNEA 1IG0A 4BU1A 4L3OA 1KMNA 4PGGA 3BRQA 5DBFA 4NDAA 4D8WA 5SY6A 3ZCSA 1FBTA 2JANA 3K09A 1OX6A 2F1OA 3O1JC 1BDMA 5FOTA 1G4HA 1T4DA 4GZ6A 1IB0A 2B69A 4QYIB 5CXUA 1HG1A 3OTWA 1FLNA 3AHCA 1D9ZA 3AIMA 3O9VA 4Q7LA 5DT2A 4PFQA 1E9EA 3FPFA 3RBZA 2C9YA 3TWOA 2NO4A 3MMNA 1VDZA 2IHJA 3BTSA 4Q4HA 5CAEB 3VR6A 2EZ4A 5I6DA 5I7SA 3KOYA 1QCZA 4IEIA 2R751 5A06A 1AE1A 2RGAA 1BCRA 1JFRA 3N2KB 1G5IA 2YXEA 3L43A 2QRVB 1A8QA 4BKQA 4RKFA 2F3TA 2CBZA 1NUSA 1FP7A 2OG2A 2WK1A 4MMYB 5KOIA 5U4QA 4M9UA 4PPGA 5EJ8A 1P45A 1WUTA 5JXGA 3MTQA 2C82A 4M6WB 1ZCAA 1DJNA 3E9NA 5JDCC 3QVWA 4GXQA 5KC9A 4B31A 1W0JA 1QQ6A 1IZ9A 2G5PA 3BB3A 1RNLA 2HMSA 4NJEA 2NNWB 1PV1A 3C1UA 4UEKA 1NBHA 3LQ1A 4AKGA 1FQWA 5AWFC 1GA6A 3A05A 4HDRA 2RGBA 4AKHA 1US8A 4N7JA 1LV8A 3L0CA 2OCYC 4M8IA 4WGGA 4TN5A 1CZOA 2BD0A 3LGXA 1Q11A 4CU2A 1BXRA 2A78A 2ZT8A 4O2LA 4B4WA 4QXPA 5JH7F 4XLTA 3DZ8A 2QY6A 1CQPA 1ZD8A 4AMBA 3UEOA 3MCUA 1ZIOA 3KL2A 1FEZA 1VLQA 3EXG1 4PU0A 3BGDA 3VR2A 1QFZA 4HUTA 2HDWA 2JGRA 3IVRA 2R5WA 4R01A 3IE0A 4YP7A 1ZM9A 5CA1F 5L6LB 2G1KA 1PNTA 4R2XA 5DBEX 1V7PC 1M6YA 4QBIA 5EWMA 2BGJA 2J3KA 4EZEA 1MRZA 2O3SA 5A3QA 4LTDA 1ULHA 3P9YA 4PYRA 5DGXA 3ZD8A 3BDAA 1SHJA 3ZWDA 5KZMB 1R8XA 4FFNA 5K0JA 1KSFX 1TK3A 1DRWA 3C6BA 2EW8A 4ZV7A 3RAJA 2BFAA 3JYOA 3IBFA 3KT3A 3OLWA 3LXRA 1TZJA 3ILYA 3QSGA 5NULA 4CZ2A 1UOPA 4WESB 1UKEA 3IIJA 3QVKA 5CIWA 1S3IA 2FPXA 4QASA 4ER3A 5C5IA 1BMFA 5AKLA 3WA6A 2JHGA 5KSZA 1E2JA 4AD8A 2BT4A 4X7MA 3T8YA 4JBYA 4EA7A 2IOQA 2D1SA 4BQOA 4Q3EA 1ZCBA 2FHPA 2OB2A 3L7AA 4L4XA 1A9PA 5IK2D 4J1NA 1AN0A 1JEYB 3AI2A 1DELA 4RJKA 4BNNA 1CU1A 3PF9A 3B70A 3FAKA 3QEMA 3ZX4A 4JX9A 3GPLA 1ZI8A 3DHWC 4BMOB 1S8FA 3DL2A 4HSEA 3UWSA 5MN5A 3VH3A 1E2IA 1SG6A 2VWPA 1H85A 3KBOA 5EFOA 1W47A 3DJYA 4KDCA 1JEDA 2L2QA 4C1BA 4MVCA 5DHTA 5A6SB 4BGUA 3RU2A 4K3VA 1UDCA 1U2GC 4TMFA 3OZRA 4FEEA 2QPTA 2EOAA 1K06A 4F3KA 1LWNA 1SUDA 4BJ5A 1PU2A 3H2YA 4ETMA 4E3WA 1RCUA 4K28A 5IC5A 1NV8A 1GG9A 3QE3A 5IDQA 2CXRA 4YUXA 1Z4MA 2P7IA 1U5BA 1A77A 4PYIA 5JTUA 2HSWA 3A31A 4C29A 4OOEA 1MP0A 5KVQA 4XM0A 4FIDA 5CXSA 1D2NA 2NSDA 2XYVA 2NU8B 4P3YA 3LQ4A 4CTJA 2PUAA 2Q3LA 3KYJB 3LT4A 5C8XA 3KLNA 5JYCA 1Z7EA 2RK3A 1Y8CA 2H7CA 3GBVA 4HRYA 3NRCA 3T7SA 5J47A 4EEKA 1IJFA 3C87A 3TXYA 4X20B 1RLJA 1XA4A 3NFRA 4MI9A 1ZUNA 4ROTA 5E7MA 3IPAA 2QYTA 2QTVA 5LPNA 3WGOA 5IWAB 1LDNA 2NLOA 2WWWA 3ORSA 2H1LA 1L5YA 3AUJB 2PKEA 1Y33E 2GHTA 1FUUA 4OBBA 2XADA 2XE6A 1L4FA 1Z16A 3LAWA 4NESA 4PS0A 5I9BA 3BX1A 1PRYA 1IEVA 2V8BA 4ENVA 1U4NA 3O6VA 4PTLA 4XGIA 3RK1A 5JH7B 2F1JA 1BW9A 5KSYA 4YJGB 1KPIA 1YS4A 3B5IA 3GQBB 4TLEA 2GVZC 2XY4A 1DWUA 2R68A 1T2EA 2XUZA 4PTZA 4YDHB 4BO8A 2P2NA 1OXMA 1CNEA 2O48X 3MRSA 3ONNA 3A9UA 3O8OA 3F96A 1XPJA 3CM0A 1J97A 4QM6A 1GQOA 1WXGA 3DOEA 3OQ1A 4LC1A 4XYBA 3IEIA 5TJ9A 4KX5A 2J9RA 4HBZA 3BWDD 2FZCA 2GNOA 3RHFA 4DNXA 3H9JA 1WG8A 3RS3A 3PQFA 3IDZA 4TKLA 1BCSB 1G8PA 2C5HA 1HFEL 1F48A 1NKSA 1Z4LA 2RGDA 3RRXA 3L0OA 5CYPA 4BS9A 1ZN2A 2E21A 2Q45A 4POAA 4A6XA 1WLSA 3B1XA 2PJDA 1CEEA 2HK7A 1GQ2A 3LT2A 3RODA 3TSOA 4MV9A 4DG8A 4R81A 1R8JA 1U7WA 5ER6A 1NFRA 5GTDA 2JIRA 2VUSA 2JARA 5CT9A 4AKSA 4EF5A 3QMMA 4KPEC 4R9UC 1PVOA 3DLTA 2FMIA 4WXRA 4ZQEA 2X0JA 4BAGA 1KZ4A 4I3GA 1E1RD 4ED9A 5A5EA 5B3LA 2ZUEA 4L85A 3BF8A 3W2IA 1BU5A 3WV4A 3TLMA 2QT9A 5C8YA 2HMTA 2J87A 4UVHA 4L15A 4KYVA 1KARA 1ZD4A 2VDRB 3D7NA 5FBHA 1XG5A 4I08A 4IJVA 3ZHXA 3OQPA 3K0KA 3KCNA 3QX3A 3E8MA 1N2EA 1ONSA 3A2LA 1IQUA 3FWZA 2P2GA 2J46A 3KVNA 4O4JA 4WA7A 3I9V1 2I7VA 4Q1EA 3R8CA 4B9EA 3ICPA 4O08A 1JR6A 1HQKA 1NBIA 1WKCA 1QH0A 2OFPA 2ZI7A 3ZGLA 3KLPX 1ZJ6A 3A4TA 3GXBA 2X1MA 4WRRA 2NACA 3FFXA 1TMOA 3RSLA 3U2QA 1YUMA 1Y5IA 3L4KA 3ZLTA 1X3SA 2QN6A 4AKTA 3GLFE 4FOSA 1ACMA 4CLDA 3F98A 2PL5A 3DEHA 1TO2E 1SCBA 1V7ZA 3E9DA 2CHUA 3C6QA 4G1VA 2X9QA 4ZTZB 2MTBA 4I9GA 1JUDA 3R3XA 3TW6A 1DOZA 4DLPA 2ZYSA 3DHNA 3M2PA 3QMPA 5DHPA 4ZPXA 4AXBA 2PSFA 4X1YB 3RJZA 5L3ZA 3B13B 4NPCA 2PS0A 3LLMA 2GBCA 3DDWA 3RJ5A 2P90A 3KALA 4BFTA 4E32A 1WMDA 1WZNA 3CSUA 1BVHA 3IMKA 1P7CA 3U3MA 1JDBC 3ENKA 3M3HA 4G89A 1F06A 1QX4A 4L27A 4LYJA 3G02A 1DIHA 1QXSA 5COAA 3QKSB 3KL4A 5IBCA 4IRUB 4DLSA 1R4NA 1YR7A 4IHQA 5IC6A 2AN1A 2SECE 4QWMA 3WYGA 3L0IB 1T6XA 5KKNB 2ZE6A 1ESEA 3DMPA 4BO1A 4Z4CA 5H4GA 3THWA 3DT9A 3CX7A 2GEDA 2ZDQA 3DMRA 2Q0QA 1AV7A 1EYZA 2HQBA 2IUYA 2ZCUA 4BRUA 1AQJA 1CERA 1TPZA 4MWOA 1PN3A 1PHRA 4B84A 5E4FA 1FU4A 1ND6A 1HZJA 2VF4X 2Y66A 3S40A 1JA1A 1T9DA 5EGSA 4ER0A 4C06A 1HEUA 5AQ1A 4ZCRA 1KJQA 3H4VA 1WXDA 3CGWA 3CYFA 3RC3A 3UXHA 1NR7A 1R0YA 2XMGA 3A6KA 2VT2A 1SNYA 3L02A 2R0QC 2PEZA 3F6YA 4MUNA 2WUGA 1Z2EA 4BCDA 2G36A 3O84A 4CT4B 3R4VA 2V0NA 3TQOA 3MWEB 1QTNA 5FBZA 4NPHA 3U26A 3BCHA 1Y8AA 4UAUA 1E20A 1OTYA 4Y2JA 1RRPA 2VTBB 1EVLA 4BNUA 3IBYA 2EQ5A 1V35A 1RZ3A 1R8SA 3AW8A 3KVYA 1YKGA 3L3BA 2CFIA 1NXPA 4KH0A 1XJ0A 4B71A 1U8AA 2WSBA 4L72A 3ROMA 2XLBA 4KNWA 5DSTA 3ZGVA 3D2CA 1XIVA 3Q72A 3L0PA 3ZH9B 1QOQB 1M8JA 4KK3A 2H4JA 3R23A 2IH5A 1ZGHA 3W5DA 1U2DC 2H2GA 1JBEA 4P0TA 3IC5A 2WJWA 5B6PA 1X1DA 3UV3A 3CNQS 4CXMA 1SIOA 3KVRA 3NNDA 4QG7A 4WZZA 2GF9A 3UW1A 4IOJA 3UGTA 3LDAA 3UJCA 5HJEA 2GJ4A 2AVNA 1BA2A 4NU8X 3P2JA 4LDNA 1C7RA 3O7MA 4KJZA 4GLJA 4RD4A 4HCJA 1Y6JA 5I01A 3BWYA 4DA4A 3V7YA 3RUFA 3C1AA 3RYHA 1JKJA 1NUTA 1N2HA 3PR2B 3QW4B 1Z08A 1JG3A 4RC9A 1M2JA 2HF8A 3FCOA 4Z3OA 4GI1A 1JDZA 3LP8A 4CMIA 5DNDA 1P6QA 1OC4A 3AIOA 3AKDA 1Q0UA 4HNAB 4XB1A 1GZSA 1KK0A 1NKVA 3OLQA 5EZ6B 2HY7A 1JNXX 1H5QA 3STYA 2IBTA 1KFEB 1XCJA 1Q14A 3B9RA