2UZ1B

1.65 angstrom structure of benzaldehyde lyase complexed with 2-methyl- 2,4-pentanediol
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
555
structure length
555
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGAHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Thdp-Dependent Enzyme Benzaldehyde Lyase Refined to 1.65 A Resolution.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords BENZALDEHYDE LYASE
total genus 190
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
B PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
B PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1B03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1B01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2uz1B02
4UTRA 4MPJA 2H4FA 5BWOA 3IAEA 1X7YA 2V3WA 1UMBA 2BEWA 4KXXA 2AG1A 3LQ2A 2OD7A 3EXEB 1PNQA 1UMDA 2EZ4A 2BFEA 4BUZA 1Q1AA 4KXVA 4UTNA 1W85A 4KGDA 2OZLB 1Q14A 1N0HA 2PGNA 2A1TR 3DV0A 1TKBA 3FZNA 2EZUA 3M7IA 5EJAA 1J8FA 4RMHA 2FR8C 2H2GA 5ERYA 1V1RA 3DUFA 4KXWA 4K9NA 1YC2A 1YI1A 4K9LA 3PKJA 1PO7A 1W88B 4D5EA 4GP9A 2H4JA 1NI4B 1OLUA 2YIDA 5DGTA 2H59A 2NYRA 4I5IA 4O8ZA 1V16B 1JSCA 4HDAA 2C3YA 3PKIA 3F6BX 3FSJX 4Y6QA 5EJ4A 2IEAA 5K6TA 3DVAB 4RJIA 1U5BB 4UUBA 4G1CA 2BRUC 2H2FA 2BP7A 1POWA 3FLMA 1YNOA 3ZHUA 1UMCA 5K3SA 4QELA 4Y6LA 2Q27A 2WVGA 3AI7A 3EXHA 4D5GA 2JLCA 2X7JA 3AHCA 1QGDA 1PI3A 5D7NA 2BFDA 2XT9A 2FSVC 1O97D 1YHZA 4JUAA 2JI6A 1B0PA 1M2NA 3LPLA 5BWLA 1Q6ZA 1UMBB 2BEWB 2BFFA 3LQ4A 3EXEA 2AG0A 5EJ7A 2QTCA 2C31A 3EY9A 4QQ8A 2E6KA 4RJJA 5DGDA 1V5FA 1ZPDA 4F56A 4GPEA 1X7ZB 4C7VA 2HJHA 4JD5A 4XEUA 4FVTA 1R9JA 5HYVA 3OE1A 4WBXC 3DV0B 1V1MA 1L8AA 2W93A 3MOSA 1PVDA 3DUFB 4JUCA 2IHUA 4F4UA 1W88A 3ZGOA 1BFDA 2FN3A 3EYAA 1YBHA 2BFBB 1V16A 3ZG6A 1ICIA 1T9DA 3E9YA 1HZZC 1UPBA 4GM0A 1ITZA 5BWNA 3CLUD 3DVAA 2OD9A 5MF6A 3U31A 3GLRA 3M49A 4V1CA 2BP7B 2PDAA 1PYDA 4JUBA 1RP7A 4JUDX 3HWWA 1D4OA 2A1UA 3GLSA 3ZHRA 4X3PA 3AHDA 3AHJA 1YI0A 1M2GA 2QTAA 2XTAA 1PTJC 1MCZA 1NGSA 2UZAA 5EXEA 4Y6OA 1S7GA 2BFDB 2J9FB 3CF4G 1PT9A 4UTZA 2DJIA 3HWX1 4GM4A 4KXUA 1YC5A 2OO5C 3IAFA 2FWNA 4MPPA 2BFFB 3GLUA 1MA3A 1E3TA 4JT8A 2Y0PA 2G25A 1GPUA 5K6RA 4GG1A 4BV2A 3UPTA 1OLXA 1V11A 1X7ZA 1KEKA 3HYLA 5AHKA 3AHHA 2R5NA 1U28C 2Q5JA 1V1MB 4GM1A 4K9OA 1WCIB 1Q17A 2XT6A 4TWJA 3PDHA 1SZDA 3K35A 1IK6A 4JU8A 2H2DA 2H2IA 5HGXA 2BFBA 1XLTC 4BV3A 4JT9A 2Q5QA 1UPAA 5ESDA 3D81A 2R8PA 1X80A 1T9BA 1OLSA 2UZ1B 1AY0A 2O1SA 5FEMA 4J1TC 5K2OA 4IG9A 5FYQA 4JU9A 4V1CB 3OOYA 3GLTA 2BFCA 2JI7A 4MQ5A 3KOMA 5HJEA 2PGOA 1T9AA 3ZGVA 2J9FA 4K9KA 4MPRA 1QS0A 4C78A 1X7XB 1EFVA 4X3OA 3CLTD 2C3MA 3L84A 4V1CI 3EXHC 2JLAA 3JWPA 1DTWA 4Q9DA 1DJLA 1YTLA 5I5GA 4C7XA 5EJMA 2BEUB 2WVHA 4JUFA 5EJ5A 4BN5A 4BVBA 1M2KA 3UK1A 4IF6A 4RMIA 3AHFA 4R8MA 5EJ6A 3ZHSA 2C3PA 1OLXB 1QPBA 1V11B 3ZHVA 3D4BA 1YD7A 4ZZIA 2B4YA 3F6EX 1S5PA 2Q29A 1POXA 3ZHTA 4BVGA 1WCIA 1V5EA 4K9QA 1Y9DA 1UPCA 4RMJA 2O1XA 4FZ3A 2QQFA 4UU8A 5EXDA 1UM9B 2JGDB 3M6LA 4FEEA 4MZXA 2JI9A 3JR3A 1OZGA 5I4IA 4BN4A 1U2GC 5ERXA 2VBIA 1X80B 1OLSB 2UZ1A 4HD8A 2FRDC 2NXWA 1TKAA 3EXG1 2Q5LA 4RMGA 5EJ9A 2QQGA 4UTVA 5DEIA 2VK1A 4J16C 2BFCB 3EXFA 5MGNA 1M2JA 5MFPA 2EZTA 5C4IA 3M34A 3AHEA 1X7WB 3ZHQA 4BVHA 3EXIB 2OORC 3RIMA 4UUAA 1QS0B 2R8OA 1X7XA 2Q28A 4IAOA 4C7BA 5HHTA 2BEVB 2C3UA 5I5EA 4QPZA 1U2DC 4FEGA 1DTWB 3AHGA 4L2IA 2BEUA 1X7YB 1NM5C 5I51A 4COKA 5IMSA 2IHVA 2H2HA 1UMDB 1M2HA 4K9MA 4L3OA 2BFEB 2VBGA 4TWIA 2VK8A 4KXQA 1U31A 3RIYA 1O96B 1YHYA 1W85B 2JIBA 2OZLA 1TRKA 2C3OA 2VJYA 1V5GA 4K9PA 1PNOA 1UM9A 2JGDA 1SZCA 2JI8A 2OD2A 2YICA 1T9CA 3AHIA 4JSRA 1EFPA 1V1RB 2Q5OA 3RIGA 5MFZA 4UTXA 1NI4A 4UU7A 1OLUB 2VBFA 2G28A 3EXG2 3EA4A 4RJKA 2C42A 3D7KA 1U5BA 3EXFB 3CLRD 1OZFA 4KPUA 1TKCA 4KXYA 1X7WA 1Z8NA 2WVAA 4BVFA 2EZ9A 4BVEA 2H4HA 2IHTA 3LQ1A 3EXIA 2EZ8A 1OVMA 1UMCB 3CLSD 5EJ8A 3EXHB 2BEVA 2G67A 4ZP1A 2VK4A 3U3DA 1OZHA 2PANA
chains in the Genus database with same CATH superfamily
5M7EA 4CE6A 5TNXA 2H4FA 5AKGA 6NULA 4BIMA 3SIXA 1E6WA 1JMVA 3G9ZA 3NNDA 1AQYA 2H06A 2C9MA 4DNQA 4KXXA 4MO9A 2H1HA 3KZMA 5AKKA 4ZIRA 3PRKE 2GTPA 2WMNB 3WXBA 2LTAA 3PX2A 2DLDA 4LNUA 2EFDB 4IDGA 4UATA 4CKEA 4MITA 2BGTA 4Y2QA 4D9MA 4MQUA 5HJ5A 1BDIA 5AIAA 1VSVA 1Z8FA 4KBGA 5B1DA 1KPHA 3WLIA 1MDBA 1I1NA 1Q1AA 4IIYA 3FRIA 3PUYA 1VMAA 2Z3VA 2AC2A 4N0DA 4C76A 1LS1A 1WCXA 2C0CA 3QXJA 1TU4A 1Z37A 3EWIA 3G2IA 1YZVA 1JA0A 2I8LA 2IZ5A 4JCCA 3TJRA 3DM9B 3K5PA 4KYVA 1A2KC 4ZI7B 4UPDA 4F6RA 1SOMA 4MA0A 2AE2A 3C1TA 3RTBA 2JFUA 4MROA 1WXQA 4NK4A 1E8MA 4CV0A 4IKPA 2W8BA 1Z0UA 3ROGA 3WNQA 2QUJA 2YV5A 1WAMA 1P1KA 2ZE7A 3TWOA 3UHPA 4DC1A 4E4YA 3R9WA 4Y3UA 4LZJA 1XZHA 5L8VA 3CINA 4ZANA 4K9LA 3Q0IA 1Z6GA 5I9BA 1GCGA 2CMKA 1P0PA 5AUNB 3BGWA 5ITVA 1A7JA 1NSFA 1DIGA 3EODA 5KJEA 3WBBA 5EIBD 4FPXA 2IGTA 3B8EA 3TXXA 1V16B 2HA5A 1OW3B 2BBTA 2WM9B 1XRPA 4RSHA 4G0MA 2AN1A 5FRDA 4I4TB 2Q3FA 3PKIA 3TQSA 2BY4A 4DQUA 1XGKA 2Q45A 2XGSA 1ZR4A 4NHEA 1GUDA 2GQ0A 4KXLA 2UZIR 3B1JA 3HI6A 2WSSA 1MQ8B 1W96A 2YJ3A 2REXB 1U63A 5DCLA 4U2GA 3Q1KA 4LXTA 3DGFC 3L4SO 4K28A 3KWJA 5CLQA 2PJZA 5D7BA 1P1FA 1TK2A 5EG5A 3UGTA 4QUAA 1GM5A 1QR2A 2J3LA 3LPDA 5C7YA 4V0OA 2CLOB 4D96A 2HA7A 4E33A 3LGXA 4YFVA 2VHQA 1E20A 2GVNA 1EM8B 4BZQA 3DMHA 5LJLA 2AFVA 1E7QA 2QN7A 2FPMA 2VBCA 3MELA 3C3XA 5IZ4A 3VA7A 1CHDA 3JZDA 3QKSA 1Q92A 4RHYA 4D44A 2DQYA 3DKRA 4FFOA 2GBCA 1RWXA 1IJFA 1EDOA 1N1MA 1OBCA 3VYTB 3UAWA 2FSVC 4NCNA 1B7GO 3P7MA 4LZPA 4PLVA 5ARBA 9LDTA 2CVHA 2BMVA 1IAVA 2Z5LA 3P2MA 3S1AA 4YUXA 2IV2X 1FUIA 3EGXA 4OBXA 5BV8A 1GUZA 3U4QB 5CLLA 1RAEA 2IS2A 2LDBA 3NNNA 4QLAA 1X2BA 2GTIA 2YWHA 3EVTA 3SEAA 4TMYA 1SUPA 4U2KA 3ETLA 4K1XA 1EBBA 2ORYA 3ELWA 1YB7A 3KJFA 3AY7A 3WV5A 3MCTA 5AESA 3GB9A 4A27A 4CLDA 2EFJA 4D8TA 1JQBA 2QHXA 3CRW1 4P8RA 4URZR 4AO6A 1E4EB 3GJXC 4JB2A 3KJEA 1GFWA 4EYEA 3IXQA 1NP6A 2F48A 3VSBA 3H2SA 1O5TA 2RGBA 3I1YA 4ZQIA 4CMKA 3EMBA 1WPQA 2WKPA 3N75A 1FFDA 3EGWA 1OWOA 5JWRA 4MUIA 3HNOA 4FVTA 4JD5A 5IYZB 1J2TA 1RHUA 2QU7A 3CUYA 2CJYA 4TRMA 4YYEA 5JPIA 4MGEA 2ODTX 4YRJA 1HE5A 2IUTA 1ZGJA 2EL7A 1VECA 2JRCA 1A72A 2BAGA 2H16A 4FBMA 4H59A 2J6HA 1OAOC 2GNAA 3B38A 3KZOA 5DHTA 4O2AA 5ENDA 3T38A 1EDZA 2XUGA 1SQ6A 1VPWA 3K15A 1UJ4A 2IHUA 2Q46A 1W88A 4OI2A 2WTAA 1XZGA 5TX7A 5C9ZA 5EMMA 2AHOA 4DCSA 2JLZA 3GAMA 5JZ9A 3ANMA 1ESNA 4IGKA 4DV4B 1RWNA 1ULHA 3EQ8A 1XTUA 1J8YF 1N2GA 5F1KA 3Q3IA 1UPBA 2GEBA 2VSOA 3BYZA 3IFSA 3LPNA 4XE5A 5FADA 2VI5A 1SBHA 3K9QO 3SQDA 3GWGA 4MJ3A 2J3IA 4D9IA 2NZVG 5UKDA 3T7SA 4GMDA 4QXPA 1DUIA 1RPTA 2I7CA 3HACA 1USIA 2IOQA 3BC1A 5AI6A 3V4FA 2OA0A 2XOKA 3SKXA 2GXUA 5HCUA 3L6BA 5EJFA 5CJJA 4GD3Q 2H7VA 2KBEA 3FZQA 3TZLA 3LYUA 3L7BA 1Z12A 4XH9B 2X4DA 3LY5A 3DEHA 2WHPB 1O58A 5IAJA 4ALLA 1M83A 2UZAA 2AUTA 3S5JA 4JOCA 2FV8A 2JD1A 5T5QA 4US1R 4Z4HA 4UTNA 2MINA 3MLBA 1ODLA 2Y1GA 3COZA 2EX4A 5A9SA 5L40A 3IEVA 5HUQA 3BHIA 3TDMA 2AZTA 2FHSA 1Q1BA 1RRKA 3RS7A 3NJ4A 3M3PA 4YJ3F 4FDLA 1OASA 4TVOA 3IX7A 1E4VA 4CLHA 2FZLA 3WGZA 1QQ5A 2JFOA 3TAHA 3KLBA 4FNMA 4FYHA 1XDWA 1L4HA 3FTDA 4XWTA 4CV3A 4J4TA 4UTOA 4E70A 5JD5A 4OJQA 3DAYA 3OC0A 1B8UA 4B6RA 7MDHA 5JXJA 1DGQA 2RGWA 5BQ5A 5C34B 5LUAA 3R8CA 3AEUB 1CQJB 1HQDA 2HA2A 4QSMA 5CURA 1I14A 2PZBA 4P5PA 4Y2PA 3UEOA 2CEKA 2IH5A 4I8XA 4MS4A 3ZNPA 2DFLA 4CCWA 4LHEA 2JAOA 1BO6A 1XQVA 3W8RA 1RXIA 4FQ8A 1NVTA 2B5WA 2BHLA 2G25A 3MJCA 3P5SA 1SEPA 4P5EA 1GG8A 1UXIA 1O0BA 3B7PA 1TJ3A 2ZUSA 3VR1A 4PHCA 3TLEA 1N1EA 4B43A 3E1GA 3VYUB 2ZAMA 2HK9A 2Y92A 1G8PA 2AB0A 1NE2A 4L4ZA 4RZ3A 5AJYA 3UFXB 1IBRA 1OE0A 4FOPA 4P4GA 4ER0A 2XE7A 3SEFA 2ZPTX 1D7AA 4IFTA 4XVCA 2Z4TA 3QEJA 3RC8A 3EDRA 2PWYA 1PQWA 2WG0A 4JX9A 1KKLA 3G2KA 4UNNA 4BNUA 4CTKA 5BVGB 3THWA 1S2MA 2O23A 1KI3A 1XLTC 1L5KA 4DV0B 2H29A 3E82A 4AS2A 4B4DA 5IX8A 3OU6A 3WAJA 3CLHA 2HA6A 3LKVA 4POOA 3TZ6A 2HBYA 2ODBA 2V7WA 4OSPA 3JSXA 1XRJA 5TPWB 1UADA 3S3TA 1BOFA 3H99A 4KSBA 5FEMA 3GN1A 4YJ2F 2WWFA 4IG9A 4M4SA 4OGKA 4S3MA 2FTKE 2CK3D 3T7JA 2FWIA 1AN9A 4DIDA 1UIRA 5FI3A 5L3VA 1AZSC 2IY9A 3E9NA 3DF7A 3G68A 4HLUA 5H82A 3BOSA 3IJPA 3SLGA 3QUCA 1ZD8A 3ST7A 1XP8A 2WUWE 1C0IA 4UD2A 2OYSA 1L7BA 1U0GA 1QVZA 4R01A 3C3CA 3S29A 1VCHA 1XVTA 2GYYA 3ADOA 3E7FA 4GOOD 1SUSA 3ROKA 1UWLA 4DYHA 5ADVA 5F2NA 1P4GA 1V45E 3U4AA 4OUKX 4L5JA 4JL6A 1N8NA 3S6JA 4KVAA 4PZAA 3COJA 3GGJA 1YAJA 1DU4A 3TZQA 3RBZA 1J5XA 1DSSG 3BAZA 4MPRA 4Q4DA 4UUNA 3OA2A 2EKQA 2J4DA 1EHCA 4P22A 1O2DA 4X71A 3DEAA 1I33A 5HE8A 2NUPB 4QBTA 1RPNA 2FJPA 3E9EA 3N8GA 4M0DA 4OBBA 3SJZA 2ZLBA 3RFFA 1ZNXA 4KMSA 3HJFA 4DBVO 5K3FA 1SIBE 4G89A 1LTQA 1HE3A 1KSFX 1YTLA 3PV0A 3EGCA 4JX8A 4YEDA 2ZSJA 1NRJB 2DH6A 4RXUA 3Q98A 2OFPA 4FMCF 3WJAA 1IVSA 1LSJA 3SKVA 3KCQA 4GIBA 2C58A 2V6MA 1CUSA 1LTHR 3CPJB 4HNSA 1FLAA 4IS3A 4R8MA 4RMIA 5LVAA 1BGXT 4C3ZA 3RYCA 4DWOA 5LD2B 3F97A 1EDDA 1V11B 4AYXA 1T2AA 1SCQA 4IO0A 5D5QA 2LVBA 3COVA 1E8DA 4ZZIA 4YWHA 3UIEA 3EDCA 3AB7A 1W4CA 4INZA 3NM4A 1BX1A 1X9GA 2G77B 3ZQKA 2D5BA 1ZHOA 2L0XA 3ERCA 4ZYTA 1C7ZA 5AW1A 3FYCA 1AQIA 3UAXA 4E1AA 1XPRA 1ZIPA 3AY3A 1KVRA 4CLEA 3I12A 4OK5A 2O1XA 2WJYA 3DYBA 2FZGA 1RNLA 2GXQA 4U02A 5DTJA 3D64A 1I3MA 1CV2A 1GZDA 1MB9A 4HQKA 3VPCA 4BXOB 1IPHA 3IH5A 3BICA 3HVHA 2GEVA 1OKKA 2IDZA 3H9JA 5C8YF 4RKQA 3E5HA 3QU9A 4MJ7A 5FI5A 3FFAA 4PIPA 5EZ6B 3V8PA 3NU1A 4D0SA 1BOOA 3ZLVA 3IA7A 4BBJA 1D8AA 1WU7A 1FFYA 2GN4A 1YIAA 4LBWA 4D8UA 2R6HA 5EIEA 2X5JO 3DR3A 4AMBA 2CVZA 5CA0F 2OE2A 1JSLA 2WIFA 3LV8A 4DMRA 3DOFA 1BXGA 3NETA 4K8RB 1JKFA 4GW3A 4C2AA 1PX2A 2B21A 3IKJA 2PS1A 4MRNA 1PT5A 1P9OA 1WTCA 4TOIA 3UJCA 5FYDA 4D4JA 2JC3A 4YRAA 1MAHA 1VZ2A 2OO3A 4Q3OA 4PX5A 5E8RA 1QK5A 2DYKA 2PUEA 1E2BA 4J7CA 3I04A 1VIAA 1HYGA 3CCFA 1E2GA 3M82A 1YQ9A 5AKZA 3ILYA 4KQ6A 3ZWPA 3H05A 2O0MA 3EFOB 4TMWA 3L4BA 1JIKA 1SXJB 3CUUA 1C5KA 1TL7C 1W8DA 3A1UA 2ONCA 3U3KA 3UUEA 2OORC 3OM8A 2OOKA 4LBZA 3X1DA 5K0EA 5LDHA 1DKMA 1WB5A 3VPDA 4DCPA 1X7XA 4LDPA 1EFVB 2R6CA 2RHWA 4HTFA 4RFSA 4EG4A 5BMVF 3A9TA 1TCAA 4EGQA 1Z2CA 1XCGB 4FCTA 2VC2B 5CP8A 3TQRA 3VYVA 2FEMA 1RQ7A 2I3ZA 1RAFA 1G20E 3PTLA 1FQJA 5IRCD 3W1WA 4CEIA 4GI1A 4DIUA 4YH1A 1IXZA 4F3KA 1JH8A 5G3YA 3AZPA 3P9YA 4W6ZA 4WN9A 3W2GA 1LGYA 4GZ5A 2G5PA 3IOBA 3O26A 3ELBA 1NXQA 1A88A 1RFLA 1NF9A 2Y3IA 3C3BA 3D4LA 3K8OE 2QV7A 3H3FA 5EKDA 3SGLA 4ERNA 1KDOA 3BSFA 5JRZA 3EPKA 4O6VA 3CH4B 4Y2HA 3INNA 4KITB 5EHNA 1NASA 3OU2A 2P5TB 4LJAA 4J03A 5TF0A 2AK2A 1RP1A 2W90A 1VXOA 3C3PA 4IQ8A 4EB3A 3PVCA 2CV2A 1Z2PX 5IXSA 3OTHA 2VBGA 3HJBA 3K0AB 3CLRC 4R2KA 4ZHQB 4OJTA 1BVRA 3HN6A 1LEHA 3JS5A 4PWYA 1ADBA 4MHOA 3PPYA 1MA0A 2DPMA 1JU3A 3D4OA 4FKMA 4OL0A 4MDHA 5D6NA 4KTVE 2NV2B 3NHBA 4UREA 4EUFA 5GGXA 3ND5A 4ZAYA 5C7OO 5B4TA 4EBFA 2JGRA 1XEWY 3WFIA 3QLJA 3KR2A 1F6DA 2EX0A 2VHYA 5L7YA 1UJ2A 2CHFA 2D2FA 3CBQA 2JKVA 2RHBA 3EFEA 3V1LA 3C7TA 1YE8A 1XA4A 2QPAA 4ALJA 2FMUA 3DEZA 4OHVA 3BWBA 1W25A 5ESWA 5KTSA 4ZI3A 2RHHA 2Q5OA 3BXGA 3ZX4A 1VG0B 2E0IA 4PZUA 4EGAA 1P3DA 1L8LA 4ZJZA 4UOQA 3SVLA 2UV8A 3SM9A 4CQLA 2J5QA 1Z82A 1U3VA 3O2QB 4H4CA 2X2EA 1NQVA 1C3JA 1LPSA 2VEDA 2ZJ3A 4MP3A 1JAYA 1KQNA 2Q9BA 1EG7A 1KTVA 1CF4A 1TAQA 4KAAA 3ABQB 2DU8A 2H54A 2R86A 5GOZA 3NHMA 3WLTA 3DM5A 2PBZA 1E2FA 1CLEA 5F9MA 3P52A 2PYDA 1LCIA 1BVUA 1OZFA 2XKKA 3NMUF 1GAQA 1KYWA 1S4MA 4UBMA 5EJGA 2YDXA 1T35A 5BWCA 1BDJA 1PR0A 4W1RA 2UVQA 4G0QA 2O1WA 4M1SA 2AJCA 4CG0A 2EP7A 5K8VA 4IJQA 3K30A 5GZ3A 3GJ7A 3JSAA 3LDFA 1FMLA 3EXIA 3RTAA 2XLBA 4EFDA 3VU8A 3TIVA 3IJEB 3FCAA 3OCXA 5AVVA 3EZ2A 2BEVA 2WTXA 2GJAA 5HOEA 1TQ4A 2BTQB 3AK4A 2IUUA 2VK4A 1CZKA 1R66A 5CVDA 5KWSA 4K2HA 3U3DA 4LX0A 2OMKA 4TRJA 3VQTA 3CLTC 2O5VA 3DDWA 1Q7GA 4K6OA 1RHRA 1FXUA 2K6GA 4AAYA 4C6TA 2Y9MB 3BH7A 1K63A 1OX4B 2DWUA 3JY6A 3CRNA 4LN1A 3RSHA 1H6AA 4NS4A 4I1SA 4FOOA 3OF3A 1R6AA 4MQ4A 4C4OA 1M73E 4ZYUA 4N5DA 2PEZA 4NARA 4QWMA 1ZESA 2ASEA 3ZU6A 4KX3A 4G5XA 4BNNA 2K7FA 2PXXA 4QASA 3HV0A 4DJDC 3O38A 3I9OA 2B6HA 1AV7A 4PZEA 5TLSA 1PT6A 2M6RA 1D0IA 2J9XB 5FBHA 4MLCA 1JDTA 2ZJ2A 3SIWA 4F1WA 1TEHA 1APBA 1PJCA 2O20A 4V0MA 1CQXA 2BKAA 2OK8A 4FS8A 1OGJA 4GP7A 3RYIB 3SR0A 2QENA 3AC0A 3EIQA 4RENA 4EQZA 5C2JB 5KNCD 3IUEA 1MTOA 3QEMB 1EWVA 3EZXA 3KSDO 4NFHA 4IXNA 1NG9A 5CU7A 3ZHYA 1TUIA 1UBEA 1DAFA 2RARA 3MLEA 3M70A 1XJQA 5AKYA 4CMGA 1J8FA 2E82A 4N5NA 1Z2EA 5E6SB 1R6VA 1RYFA 4RXMA 1U9JA 2PMEA 5C80A 4EHJA 1AF4A 2G70A 4LNHA 2I4RA 3V80A 1X87A 1MFZA 2ATCA 1B6TA 2JGJA 2GZ3A 2WC1A 4MYHA 2XE8A 5L3QB 1BWPA 1R4ZA 3DHVA 1A2BA 2A35A 3FYUA 3TW8B 4GPBA 4WLEA 4CEHB 1H3FA 4MR8A 4ENRA 4N8DA 2B83A 3A6PC 4AJJA 2C3YA 3DULA 4JLNA 4P7BA 4R68A 3AF4A 4O4IB 5EHQA 1JJFA 3JR7A 2V7XA 4EA6A 5FAXA 1UQTA 4FOLA 3W5IA 1P80A 2P0YA 4MWBA 1PV2A 1IN8A 4I5EA 3ZXSA 1MH9A 1YBVA 4XA8A 4YV1A 4RK6A 1MENA 4MGHA 4F11A 3L05A 4BFLA 3B9RA 5JVDF 3B3GA 4JENA 2Q0QA 4EG6A 2YC4C 2V98A 2PKRA 3M9XA 3MTJA 1RRGA 4M21A 5I9IA 4YACA 2A1UB 4O25A 4PQGA 2FKAA 3HCEA 4HN9A 4DARA 4CDNA 1A4UA 4DJTA 3I9NA 5CCXA 1DTSA 4ITUA 1VKZA 1OOEA 3U4GA 2HJGA 3ZS9A 4DIFA 5B58C 3LVRE 1V3UA 4CHTA 3ZV5A 3AEKB 1FP4A 3IQEA 3QF7A 4IRXA 3TQTA 1YF3A 1MIHA 4N7RA 5DHFA 2GX6A 2BR4A 2GCEA 2O54A 2C61A 4KN6A 4GP6A 4GLJA 4OBEA 2W6CX 1DOAA 1FB5A 5DPMA 2D7CA 4U2FA 4EB6B 4Z7OB 4OJYA 4AJ2A 2CUZA 4G1EB 4Q9JA 4D97A 3BTUA 4RVSA 2OFOA 4YCDA 4KAJA 4DCUA 1V6SA 5DBOA 2OO5A 1MB2A 4OHFA 3VR5H 3KXPA 4RTQA 1AE1A 4G4JA 2NO7A 3IMFA 4LGVA 4MJXA 2YVQA 1SXJC 3D1VA 3VOBA 1E1RD 5KNCA 4LQ4A 3DZKA 1ZCAA 3T0FA 3C6KA 1SHJA 4I1RA 1Z18A 4X45A 5CGQB 4CM6A 4PO8A 1COWD 1C8KA 1I9GA 3CONA 3B5IA 5U1PA 6AT1A 4XCVA 3E5NA 3VVBA 2ZYHA 3AP3A 3LQRA 4KAFA 2XMBA 4UASA 3E1KA 2PMCA 4M53A 4CFYA 4CPDA 4B9AA 1E9BA 3U62A 1FDRA 3SXUA 4F56A 1ZGBA 3UPDA 1UC4B 5CA1B 3EIXA 4AX8A 1UOEA 5FF9A 1KXZA 2BELA 3Q4GA 4N01A 5ALHA 3QWAA 2AWOA 3OQMA 1OI2A 1IUPA 4NZ9A 2W8BB 1JQEA 5B1IA 4JN6B 2JAWA 5GV8A 4XIJA 3UWDA 2CLIB 1EP3B 1O0CA 1IAQA 1Z6PA 1SZPA 3TLAA 3UWMA 2H5EA 4PYJA 1VCOA 2D1YA 1UFOA 4AN4A 5E0OA 2FX5A 3TXAA 4E21A 2VNAA 2AC7A 3RODA 2BFBB 2J09A 1V16A 3IVXA 3VX3A 1MO2A 3UJAA 2JIQA 1A4RA 1PJZA 1R6XA 1ZL0A 1DKOA 1RHKA 2MJLA 3DMTC 2NZYA 4G63A 4ZD6A 2W2QA 4TKVB 1CP3A 3SSOA 4EG7A 2CJFA 3IXLA 4PG7A 5DM60 3EIFA 5YASA 3I6YA 2C1EA 4DYDA 5HOQA 5LP6F 3OFKA 6YASA 2PFSA 4EARA 4Q7QA 4QYTA 2XUQA 1ESDA 4YXWA 3VC2A 2GDJA 2KHZA 4ZVNA 4YCNA 3KXDA 2R5FA 3EIWA 3ZIAD 2CZQA 2HWUA 3D5TA 3HJCA 2FETA 4ZMSA 2CKDA 2FCRA 4DFDA 1QP0A 3NVDA 1WDTA 4FI3C 1GYRA 4NH0A 2GJ8A 2VP9A 3JQBA 4X3PA 4G9BA 4HLNA 1N3YA 1UP7A 4I4LA 4RV5A 5FI1B 2QTAA 5LB4A 5HZKA 1AHPA 3D6FA 4MXDA 1Y1LA 1U02A 1A2OA 1K9VF 4UUQA 2DHEA 4IQ4A 2I8CA 1U81A 2IGBA 4ZOLA 3GRUA 5EP1A 3H5NA 1ZFNA 4YV2A 1E3DA 2J9FB 2Y77A 1EZ4A 3FZEA 4LRTB 3BE8A 3F96A 4D8WA 2NSYA 1JHOA 2I4IA 1KS9A 1ZSYA 2JBAB 2NTYC 1K6MA 3B1YA 3HLKA 4HVAA 4UUOA 3SXPA 1JQ5A 3U40A 3UHAA 3V4ZA 5KTYA 5J1SB 3B7WA 3A1CA 4FDTA 5FFNA 7YASA 1B3RA 3K1JA 2PGIA 3DL4A 5IDWA 4MI3A 1A9OA 2WM8A 4O4HF 3QJ5A 2N1BA 3IDQA 1AM4D 4UBLA 4ZEVA 5F9HA 3BULA 4M0MA 4F12A 3KOOA 1Q0QA 1GPJA 2ZBFA 3W5CA 1CUZA 5F52A 5IP5A 3CJRA 3PX7A 1OZ0A 2OGTA 1Q57A 1PNRA 1E4EA 2V55B 3LOUA 5BNIA 4AX4A 3OEEA 1DNPA 4M3NA 4NPAA 4DDHA 4EI9A 1J2JA 5LA6B 1THGA 1YJQA 1FTNA 4EHAA 1KOGA 1GPUA 2D5CA 2ERYA 1T3SA 3ZDCA 2YQ5A 3CVOA 3D5QA 5E8JA 3O3NB 2C0QA 3VU9A 5IJXA 5J2UA 3L0DA 4YRCA 2OOSA 3RVNA 4MIOA 4HH0A 4F5EA 3ORQA 3NBZC 5FUQA 4NYJR 1RYEA 1KEZA 2OCKA 1RYMA 4Q00A 4D42A 3EZFA 2XTMA 3FCUB 3TEFA 4W99A 1LBTA 3ISVA 5TARA 4YRGA 4UHJA 1GSOA 2ZUFA 4AZ0A 1RLIA 1T0PA 3N8DA 4IIFA 2AG6A 2HI0A 5EINA 1CJKC 4NOJA 1NUQA 4TWJA 2YCBA 1AHNA 2Q3CA 1EK6A 4KO4S 3EVCA 2P30A 3G13A 3OT1B 4YO8A 3E3OA 4J91A 4ODIA 1J99A 3W2IA 2GBPA 4LOJA 1NZDA 2CGEA 1LX6A 3Q72A 1Q0PA 4JI3B 2VH2A 3BRSA 3MS4A 2QMHA 3TR6A 3AW9A 1XNJA 1CR1A 1OWMA 2D59A 5HBRA 4QOFA 1URPA 5J2TF 5FEUA 2QPOA 4BJ6A 4DMGA 2X8WA 3VSCA 1OLSA 1XR3A 4Z1MD 3A9VA 3EC7A 5ER6A 2X6TA 4EY3A 1E9FA 5GGYA 3V8QA 2BZ1A 1QBGA 1OYVA 1GU0A 1V3QE 1V3TA 1CZHA 3TTTA 1VKJA 3BWEA 1PGQA 4ENWA 5FA5A 5LR6A 5I7AA 1L4BA 2Z4SA 4U2BA 3G2MA 4PTYA 3KPWA 4LE2A 5DXAA 3VJKA 3LPAA 3H1BA 3PGVA 1LBSA 1XTRA 1NSYA 3OOYA 2H1WA 3TRKA 4I81A 3RLIA 1LSSA 3OEWA 5FV7A 3MQFA 2GPSA 4M9UA 4DDWA 3AF0A 2XCRB 3FWNA 4C88A 2WHPA 3VPBA 1EGHA 2ZXFA 4HG2A 3VNVA 3GLGA 1L4KA 3G0IA 1N6RA 3D3NA 3EPPA 1GWNA 2TMGA 2X9NA 2MINB 4UTPA 1K7SN 2D3WA 4K9KA 2WMOB 2ZI7A 4Y67A 3R74A 3HBMA 3GG9A 3RS9A 3WK7A 1QCZA 2C3MA 3LA6A 3KQHA 1AD2A 4R31A 1NXTA 1TZJA 1YZ3A 1W36C 2C8VA 4JHLA 3TMYA 2CLSA 1P7YA 1QF9A 4TSKA 1P2SA 4RTNA 4U7WA 1RACA 1EX6A 1QUEA 2VDPB 4PONA 1LI4A 3DUWA 4D0NA 1RT9A 4CRWB 1DJLA 2H9AA 1C4OA 2GA9A 3K92A 2IHBA 1NN3A 3U7HB 1LFDB 4D26A 3N7UA 2Q6TA 4MYDA 2B2CA 2BF7A 3TINA 3ZGNA 4G25A 1EM6A 1DT5A 3Q7EA 1Q0LA 4E5UA 3CEHA 4JLDA 2DBZA 4KN5A 3HXKA 1LS6A 3VBEA 3ZEIA 2OAP1 5H9WA 1OFHA 2A59A 4PR3A 4DJAA 2OB1A 3DE6X 1M5TA 4QWWA 5B7GA 2AXNA 2WG2A 2AOVA 4G97A 2YINC 1WSDA 2Y8EA 1WKVA 1YD7A 3OH8A 4A1FA 3SR4A 3O47A 5COAA 2DF8A 4B2YA 3MS2A 4E3ZA 4UNPA 3TGLA 4G0WA 4ND6A 5AK5A 3EW9A 5BQ3A 3TKYA 4BL5A 5IVKA 1XVUA 3LWZA 2YWJA 3WP0A 3TD2A 2CJXA 4XKJA 5ALIA 1N2ZA 3T54A 1KWGA 1I4TD 3M6LA 4ZAGA 4UKDA 1Z0FA 5CB4F 3K6SA 5FTLA 5CDYA 3JR3A 1GFSA 4QQNA 4HUTA 1YRQA 5TS3A 2CUKA 1L7DA 4MV4A 4BO1A 3D6MA 4DRXB 5EMNA 4YAUA 3MF4A 2L82A 5TPWA 5DEOA 3BHJA 2OTCA 4X1OA 1XQ1A 1ZBQA 1DX6A 4BX2A 4DXDA 1MXFA 3HBJA 4B80A 1IOWA 3M8KA 1G8FA 4KP7A 5A4FS 2QIPA 4QRDA 4J0QA 4UTVA 4HF7A 3TFOA 3WDKA 4LFBB 3D3JA 4J16C 3G5AA 1ACMA 3TVDA 1YU6A 2XRMA 521PA 1Y1PA 2P4QA 3LC2O 3IUYA 4Y2XA 2RHDA 4OMDA 4JNKA 1DPGA 3ER9A 4CKZA 4HJXA 1FYXA 4WE3A 4EQ6B 2PGJA 1YRLA 4K40A 2QE7A 4Q47A 2IV3A 1J1IA 1Q3HA 2J3HA 1QTNA 4PC1A 2PS3A 2MR6A 2HQBA 4IDFA 3RROA 2GS9A 4QOIA 4AS3A 3UY4A 1XPUA 1ATZA 3N2GB 4EYKA 1AQJA 1GZ7A 4L4SA 1EX9A 3FVVA 1PHPA 2DWOA 2IXFA 5IK2D 1JKMA 3BXXA 4IF4A 1PZFA 3RJ5A 2CDAA 4O2AF 4UOZA 3H2ZA 2NU9A 4I55F 2BSAA 4JC5A 4CKCB 4OHBA 2NZ2A 4PAQA 2FOIA 3GJYA 2G0TA 2JBHA 3EK2A 3GOQA 3ANTA 1DEAA 3S2EA 5A3VA 4I1IA 3EAGA 3GHHA 1IZ0A 3TRIA 4JB8A 1GZ6A 1QHIA 2W22A 3EF3A 1DFGA 3KQWA 3L1IA 4NNPA 1KJJA 4NNJA 4GL2A 5I8ZA 1NBMD 1NM5C 2FRDA 4NS1A 1WQ4A 4BVKA 1J5PA 2GN8A 2XHZA 1RTKA 3FWZA 3Q0TA 3QH4A 4UU1A 2WA2A 1FVHA 1HURA 3ZYZA 1M2HA 5BOVA 3ZQ6A 1XF1A 4HRYA 2FNAA 1DOHA 1FOEB 2PG3A 3HB1A 4K9MA 2Z09A 2FWJA 3TMAA 3G5UA 4XDYA 3F98A 3RVDA 4C4PA 1VLZA 1QO9A 3M3DA 4NU6A 2PO7A 4AMVA 4B09A 3GJRA 3TTUA 1U3FA 3LQFA 1VJDA 2B0CA 4GSKA 1Z5ZA 1MD9A 4QPJC 5BR7A 3PCRB 4K6CA 3NAMA 2PE5A 2PUCA 1HT0A 1MC5A 4YMGA 4ZI7A 3FKQA 2QZ9A 4GC5A 4H4DA 5K0NA 4I5GA 2IE8A 1UR5A 3LMKA 2YR0A 1Z2OX 1H6BA 4WLFA 5E1MA 4UAUA 1G17A 5I3CA 1GNVA 3SF0A 2OUKA 1QIGA 3LWDA 4LX8A 3HJHA 1T9CA 1XI2A 2QZPA 4TMXA 1OYYA 2HT6A 1RQRA 3S2SA 3CG4A 3S7TA 3U4DA 4HSEA 2LD4A 3TQCA 1EZ1A 2VP5A 5TXGA 2Q99A 1S2DA 4Q7LA 5EQTA 3ULKA 4LE1A 5CDHA 4EI7A 4F72A 5JSQA 5F64A 4BLUA 4MTLA 1UXJA 5AMXA 2HDNB 3SHTA 3LP5A 4KCGA 3I01A 5EWLA 1ISGA 3GT0A 3ORYA 2IYTA 3OBIA 4GEGA 2WHQA 5CCEA 5IXJA 1BWRA 3OIUA 2JFHA 1KEWA 4KXYA 4AJNA 4DTIA 3GF4A 4URWR 3T9CA 5A4IS 2AJTA 1LVGA 3FPGA 1V1JA 3Q9NA 3TX6A 2PXAA 3BKWA 1GT91 3HB9A 1SXJA 5C37A 1P44A 1L6IA 1RWQA 2CNWA 2ACVA 4TXMA 3RUFA 3A1EA 3VPSA 1KY4A 1W2WB 2PRZA 2XXAA 4F85A 5IF9A 1GL7A 1VHLA 5ITWA 4BRZA 4WWHA 2WMYA 4UHCA 2R44A 1KVTA 4V2UA 4DUPA 3E0XA 4OGGA 3TSAA 3OJXA 5EE5B 1L6RA 3RNLA 4DN6A 2H1RA 3M6WA 4YRTA 1FXSA 2BFNA 5KHAA 5KX5B 3ZY2A 4CEIB 1G2IA 3NRBA 3LO5A 3H8SA 4MYCA 2LCQA 2VJQA 3OMLA 4WBNB 2YJZA 1U7HA 3L49A 1CJBA 2PANA 3A6KA 1OU4A 1Z75A 1O57A 2ORIA 2YJTD 3BTOA 5AK3A 4ZU1X 1B93A 4AMGA 1HYQA 3HLYA 4R40A 2Y0EA 1SHTX 2JAUA 3N6XA 1LB1B 1NJFA 2LPMA 2QVXX 4H6XA 4PVDA 4PZCA 4ZGGA 4A6DA 3PI6A 2P9CA 1HSOA 2VDNB 3UGQA 3SBOA 2NADA 4TVKA 1B76A 2QUZA 2NU7B 1EUCB 4FFSA 4G24A 1BVYF 2DSTA 3WGKA 2A9OA 2W2TA 1U04A 1R16A 1NXVA 5HBGA 3SC2B 4X54A 4C5CA 4ZO9A 2B8NA 3LLUA 3AETA 1SUFA 4UZEA 4EJSA 3HCFA 4DCMA 1HZZA 2POQX 1DLJA 4HP8A 3WWZA 5CFZA 3KLOA 4L50A 4JOSA 1J97A 1RMQA 3U37A 1NJ8A 5F5XA 3C3WA 3U19A 3PZRA 3C5EA 4HS9A 1D2HA 2A9FA 4JLKA 4UVDA 2JDID 3RJ9A 1JHZA 1OUMA 1NLUA 4HDCA 1T1IA 4K3VA 2WQ7A 1ONNA 4S1WA 3WK5A 1GO2A 1GSAA 2BC9A 4UNIA 3P4YA 3L6CA 1YQTA 2PT7A 4UVEA 1LNZA 4LWQA 2KBFA 4O2AB 2EBFX 1YFZA 3G89A 4XSGA 1J1ZA 2V7GA 3KZNA 2INGX 3U31A 4B40A 5L7WA 4GP9A 3ZDBA 1ZGHA 4KE7A 1FDUA 5KOHA 4I1PA 1U2EA 1Z6YA 2QD5A 3FVWA 1KI9A 4LDZA 2ATXA 4PTZA 4WKGA 1DUVG 1G4HA 4XLZA 1WOYA 4XSHA 4CETA 4PCAA 3QVJA 4R9RA 3QKRA 2VZ9A 1V4BA 4QUKA 3PIDA 3HR8A 1J06A 3QOFA 1JKJB 3SQNA 1U3TA 2R96A 3TCNA 4DIMA 5K8UA 5K6TA 2VTBA 3BE4A 1U5BB 2VVTA 4J0FA 4KR7A 3BMOB 1Y7IA 2GM9A 3HBNA 4FJ0A 4Q1CA 3MWGA 3NH9A 3TR0A 5BSFA 1JR6A 1EH5A 4LZZA 1BQ4A 1YNOA 3OTWA 4ZK6A 2R6GA 4Q4CA 1GZ5A 2XD9A 1N34B 2QL6A 2X5KO 1HDOA 3RRFA 2FSHA 3AJEA 2WE8A 3KVOA 2CC2A 4KIFA 4NDNE 2G09A 2ZRCA 2C4TA 4PS0A 3UTDA 4EJMA 1AKMA 3ZUPA 4M0EA 4WOBA 5DTEA 1CTQA 4F1JA 3FWHA 1YVUA 4ZCMA 1J07A 4J7AA 1QGDA 2GLXA 4LCEA 3CQ9A 5TF4A 2MSCB 3N8NA 4BTEA 1HYBA 1WL8A 2B1IA 3EVEA 2BCJQ 1DIBA 2X7HA 2XCIA 3BWYA 4FX5A 1USWA 3ZLBA 1SG9A 3QE3A 4GX5A 3DHEA 4OP2A 4ICIA 4XR9A 5JMPA 3IV6A 5CD9A 2QTRA 1T5LA 5L4NA 2GETA 2XUIA 1OC2A 2YW9A 3GOHA 4REQB 2JD2A 2BHSA 5LLSA 1H4TA 1XTIA 5A5FA 4IDDA 3RYFA 3ZV7A 1INLA 1DHTA 2GPAA 3B6EA 1JR3D 3A9CA 4FFLA 1M34E 2BGKA 5TPZD 3STWA 3VI4B 1LLDA 3W79A 4IHJF 4XQ0A 3KPVA 2C31A 2G9VA 3ESYA 1FNNA 4D3XA 4YCJA 4XTRA 4DLKA 2DWQA 1H0RA 3LUKA 3WL3A 5C5EA 5ILGA 3U0BA 4Q3LA 1NPDA 3FHOA 3MWLA 3GGSA 1G8SA 2P7IA 1JT9A 4C7VA 2E6UX 5ES4B 5CAEA 4IIJF 2VJAA 1WDKA 4GPTA 2O8BB 4IO1A 2OFWA 4BJ1A 5CDUA 2ZCUA 3K09C 4M1YA 3RAPR 2OZPA 5KYNA 1HBJA 1NT2A 3NHAA 3ZVMA 3L0IB 1CZLA 4UULA 3QYFA 2P41A 3T4PA 3MWDB 5DM0A 1X7HA 4EOGA 4JUCA 2VUSA 4DA7A 3TIFA 5IBPA 3GK3A 3UMCA 5BVGA 1YR7A 3EYAA 4RWZA 4X6YA 2BE9A 1XBTA 4DLUA 5LSAA 3GDFA 4CEHA 2JIRA 4UEKA 4IWNA 1HT1E 2YZ7A 1M34B 3OFNA 3WB0A 3ILXA 4YI3A 4OO3A 4L0QA 4PM4A 5C4GB 4D81A 1VL0A 4NYIQ 1SUCA 3EA5A 1E3IA 1W93A 4HYYA 4H6VA 4MULA 4A26A 2FMKA 4QYXA 3T5DA 3CUKA 4BMNA 2LUOA 4MUAA 2DQSA 1II8B 1GFZA 1K98A 3HEBA 3JQCA 3GPDG 1W5AA 1FJXA 1YT5A 2IPMA 3IAXA 4ZRMA 1XQ6A 3MWJA 4J0CA 1U7WA 1KC3A 1UDCA 2IFTA 2WU3A 5IZCA 1X1RA 1YOBA 3VO8A 3I52A 2AXEA 1VPEA 3P9NA 2PM8A 3COSA 4GSLA 4ANFA 3WKAA 3OOWA 1NPTO 3AV0B 1ZCJA 2B4KA 3W8FA 5G0TA 3PXUA 4AJEA 5JS6A 3U1BA 1PEAA 3QITA 4XWYA 3CRZA 2RI6A 4MA4A 1GGMA 4AY4A 3L46A 4FC7A 5SY6A 1B0AA 1ISHA 3WSVA 4DGSA 5F76A 2VDMB 2YVLA 2EX1A 3AILA 1P2UA 3BIJA 4LVUA 3TNJA 5I4KA 1DXOA 5BSRA 2GFIA 2PFGA 3OX3A 1FP6A 4Z9XA 2CZGA 4B17A 1B23P 4KH1A 3P0FA 1QGAA 3U80A 1VLMA 5A62A 4RK5A 4EO7A 4RELA 1KQFA 2XMRA 5AK4A 2G4CA 4GX2A 4M1KA 1N9ZA 5AVYA 1SVOA 2CY0A 2QN2A 3KEQA 4YECA 4AJHA 5CVTA 5EXSA 1HOTA 1ZA2A 3PXGA 4KRXA 1MIOA 1YNSA 1OFGA 1Q1ZA 2GCOA 2ZGVA 4IIJA 3L04A 2GD6A 2YV4A 1J90A 3OEYA 4MPPA 5FQNA 1NJ6A 2HAEA 2ON6A 3A27A 3HUFA 5K3FB 4ZCIA 1E2LA 1T8TA 2D1SA 3K8YA 3P5BA 4AG3A 4Z7QB 1W1UA 2GYVA 3ZLUA 2DLNA 2ZIVB 3Q8KA 5K09A 3NP7A 4ATNA 2FGKA 1C30B 5IU6A 4OXIA 3GEBA 4EG3A 5KQSA 4D7AA 3ONDA 1PK7A 4U5QA 3OQ1A 1V11A 4RC9A 4KMRA 4II2A 4IFIA 4DAOA 1P0FA 4WERA 4BB5A 2JLUA 1RVV1 3PE3A 2A3NA 2O8NA 2R5NA 3A1FA 1T1EA 3A58B 3H5RA 1R3DA 5AXCA 1V1MB 5DSZA 1QLHA 2O2IA 3OC6A 1JB9A 1O5IA 4F4CA 3KOUA 5NULA 1BCRA 2AE1A 4NXMB 1V4VA 1HRDA 4BMCA 1I1HA 2WEKA 2YQ4A 1PQUA 3NV9A 1W49A 3T34A 2FFRA 4O0MA 3IIEA 5JXIA 4GXTA 5D84A 3WRYA 4MV1A 2E1RA 2P9EA 2OBLA 2YWBA 3EQ2A 5BV2P 2E37A 1WTAA 2BFBA 4HMPA 2GZMA 2IYNA 2UXDB 5FOQA 4F5ZA 2EP8A 4M54A 4TKMA 1EUDA 3GFVA 3PFWO 3CZQA 2VYNA 3SX0A 1ZMRA 1WUJS 3FMOB 3I2HA 4IIUA 2GH1A 1J9EA 1N7IA 1QZUA 3UHFA 1GDDA 2I9PA 5BVHB 2NUTB 1Z0SA 2F6RA 1IY8A 2DBYA 4ITRC 4C7JA 4D9CA 1BRTA 3CWCA 4H1HA 4L16A 5AJWA 1QOQB 2EVWX 3A70A 3KU4A 1SXJD 4UBKA 4ZVSA 5IM5A 3FLEA 3NDPA 4ZXFA 2P2YA 2PGXA 3LHIA 3OQBA 2DHRA 4E30A 3OQ6A 5IH7A 3GJZA 5TV2A 1KY2A 2C82A 2GI4A 2SBTA 3H0KA 3KL2A 3OPMA 2Z8ZA 2VJOA 4DSUA 4GEKA 1SJ9A 2D1RA 3WGUA 3V48A 4BMOB 1BJTA 4H31A 4ZOLB 1XROA 2LBPA 2R25B 3MHTA 1CJVC 1Z0DA 1GVHA 4EO9A 1H5UA 1JZTA 2AL7A 4HKTA 2DZDA 1N9KA 3NOQA 4OBWA 1PG5A 1DBRA 1X7XB 3FB4A 3CLTD 1IQPA 5AVOA 3B1WA 5HKBA 2OBNA 2VHWA 3F0TA 3TR5A 1UK6A 2VP0A 4NMXB 5A9TA 3VZDA 4A6XA 3OE7D 3H4IA 5KVQA 2GYUA 3U1VA 4PFQA 5IWAB 2BKUA 2EC5A 2DFNA 4X84A 1QFZA 4D74A 3CMCO 3JQ7A 4L8WB 3RYHA 5KDOA 3CW9A 3DDUA 3DBLA 4Y7CA 5HFJA 1P7PA 3ILVA 4FDMA 1KSJA 1U8CB 4WK6A 3W3AH 2XQKA 1H1TA 3AUAA 4EMSA 2HY7A 4IGAA 4JUFA 3NTRA 1US8A 3HI4A 4PCVA 4N8EA 4PRZA 3QEAZ 4AXBA 5LA6A 3Q9SA 4MVJE 5LIRA 1K7FB 3T9FA 1HG1A 3LX4A 1DEKA 3GARA 3UAOA 3VU9B 1QPBA 3DVQX 1U3GA 4RANA 5JJKA 3MMNA 5ECDA 3ENWA 5C1PA 3D4BA 4W8GA 3OPYA 4ZHQA 5KJFA 1B2RA 1E5XA 3OJFA 3SCZA 4Q1BA 2RGCA 4R8VA 1KMHA 3PQFA 2ZSFA 4XR4A 4QSHA 5EESA 4FLEA 5EIOA 2Y6UA 3TLKA 4BVGA 1SU7A 4RMJA 2Y71A 1XIVA 4L8GA 4HGRA 5KMGB 1TGVA 1FY2A 2OM6A 1USUA 2X9GA 3Q8XB 4A0HA 1BHQ1 1TYEB 1ZCFA 2HPHA 4TLLB 4W7HA 4AJIA 3OZUA 1SPBS 4C7OB 3PC7A 4DDVA 4DNOA 3C0KA 2HIMA 5I4IA 3MWYW 4WZAE 1P3Y1 2V9PA 4UVHA 1S0UA 4YJHA 3H8WA 5C8YA 1E2DA 1OLSB 4HD8A 1F8GA 4GAEA 1TQHA 2D62A 4NAVA 3VNRA 3ADBA 4HDMB 2HJ9A 3KLNA 3E15A 1ACJA 1KO1A 2F3SA 5ERGB 1QC5B 4C04A 2NLOA 4M36A 2DGDA 1MVNA 3I23A 3U3MA 2ZDGA 4RETA 5EJ9A 3GZ4A 4O08A 2JH9A 3L8FA 4HUQA 3HP1A 4MRMB 3TZHA 2X8JB 2XGMA 3HGTA 4LDRA 4AIIA 4B73A 3BCSA 3BCHA 1ZWLA 3CW8X 1Z2NX 4GPD1 2PD4A 4E5NA 2LR0A 3GEIA 2B8WA 3QVSA 4II3A 4PQRA 2I62A 1C7FA 2HMUA 1STOA 1YV9A 1SHUX 2HRRA 5B1YA 3BT7A 2C2BA 3O0TA 3NUZA 1X7WB 3QWBA 3VZBA 4QPNA 2I6TA 4R9UC 1T3TA 3U7GA 1CT9A 4FGWA 5P8WA 4KACA 2C4VA 1G5TA 1VMEA 1XKTA 2YVKA 4QJIA 2FEAA 5IBQA 4OM8A 3HMQA 3TZCA 4JI0B 1ZEJA 2UXBB 4C7BA 4RIIA 3LZ6A 1MC1A 3SZOA 1E32A 2PEYA 3HCCA 4HH4A 3PK0A 1EP9A 1RM4A 3GO4A 2H51A 4IEFB 4JJFA 3BB4A 3ODPA 3ELDA 3KXLA 4ASUA 1LK0A 3PGXA 5FUBA 1WF3A 3A6DA 1KBZA 5A71A 3KZXA 3BTVA 1W75A 1HK7A 1MAUA 1PUIA 4AJ9A 5KTRA 4BNJA 3ZDAA 1W8IA 2C2XA 4I9UA 4O4JB 4XPIA 4YXWD 2PZGA 3KVVA 4C6TB 3AHGA 4FYJA 4ZZ0A 4DB2A 4ITVA 3LVBA 4L2IA 1LJLA 1U2GA 2I99A 3TJMA 2OECA 3EVGA 1M7GA 4KFRA 3WGYA 1BIFA 3KOYA 2QJOA 1Y3HA 1T3LA 4L1KA 3IR7A 4FR0A 3BD9A 1CULC 2AFIE 2Y4OA 2YVAA 3DTTA 4MICA 5JXGA 3BMXA 5G02A 2GUWA 3GLQA 4B3TB 1UXOA 2ZIAA 3OM9A 1U4OA 4RZUA 4KXQA 1QV6A 3S81A 1Y3DE 1E2IA 3MB5A 3PYLA 5H4HA 4FXPA 4UM8B 2R1ZA 3HDTA 3WKDA 3WHPA 4BLSA 4CUJA 2LKDA 4K1LA 5HK9A 1RLMA 3D6HA 1Y1QA 4MCJA 1NXSA 5TPZA 5A4AA 2HIHA 3DC2A 4I55A 1K8YB 2JGDA 1UC9A 2IDKA 1A50B 4WPGA 4DA0A 4F6RB 1CYDA 1JDBC 2OQ2A 2Q1YA 3AFGA 2ZIEA 1FFHA 3FROA 3MOIA 4CMHA 2I2CA 1THZA 4XLLA 5CEEA 2PUBA 3LYLA 4AKTA 2QRJA 1K88A 5A1TA 4BGUA 1LF0A 1XAJA 2IQ5A 2QTBA 2BN4A 4LQCA 3MQ2A 4N7MA 4UDYX 4XLTA 1JEEA 3RIGA 3VTAA 4ALKA 5L3QA 2Z6UA 3HDGA 5JYCA 1OLUB 4Z4IA 5CDFE 4GOJA 4UAVA 2AMVA 4Q1FA 2VF4X 1XX6A 2G1UA 4L72A 3RKRA 1EGVB 1BEEA 5EHZA 2FK7A 1AH2A 3RS2A 1CDEA 2J30A 3VAZA 4BGDA 3ENVA 4WY5A 3P0IA 2GF9A 3JWIA 1Q2XA 5JO0A 1WZ2A 1GFIA 3RAEC 3ESZA 2QMUA 3WYBA 4LCJA 5E1DA 1T9GR 4P3YA 3C5CA 1FXWA 4BVFA 1KO8A 1RXSA 2EZ9A 2N1MA 3G1WA 2ZPAA 3OE4A 1ND5A 3P0HA 4HWSA 1RM0A 1SY7A 4MMXB 1E66A 1RRPA 4MV3A 1UZNA 5HZMA 3TIGA 3BKXA 4MVJA 3B3JA 1KO5A 4TVSA 5GVSA 3NI2A 1P9RA 4RVGA 4NEHB 1JL3A 4X92A 4PEVA 4BQRA 1KKMA 1RQPA 2HNAA 4OYHA 3RC2A 2G67A 5L3SA 5JPCA 3Q5EA 1J20A 2WAOA 2HT1A 5CXUA 2JJ2D 1Q1GA 4F0JA 1Z4QA 1QAQA 4R8SA 4ES6A 3SZLA 4YONB 1H3EA 2B98A 1NVXQ 1TMYA 3H3XA 3STYA 1EP1B 1N32B 5DSTA 3OQOA 1P31A 4R3NA 4XGIA 3QBEA 1HH4A 4GPAA 2GASA 3ZW7A 1CNFA 1AKUA 3WL5A 3AP2A 4CJXA 5ICGA 3L4EA 4G36A 4DIBA 5THKA 1EX1A 2BEWA 1WSAA 3N7AA 3H11B 2W6JA 2FKNA 3L40A 1YL5A 3KHKA 4YNBA 2MYNA 3LUHA 4OOEA 1Z4JA 2ZKIA 4IV5A 1ODIA 1ORRA 3KYCB 1HQCA 2D00A 2OVBA 3I64A 1Z3IX 1JA9A 1ZQ1A 2RONA 3DEJA 3TXYA 3RM3A 1MB0A 2XZDA 3RS8A 5CLJA 2PRIA 4XAQA 3SEZA 3U61B 1ZQ9A 2JCVA 2VJLA 3HMKA 4XTCS 2V7UA 5J3JA 3WRXC 3B9BA 4MVJP 3ZBUA 5CA1A 1P2GA 5AFSA 1NVAA 1CP2A 4K81B 1FP7A 1VSBA 1N7HA 4I8IA 2EJWA 2FSVA 1XZLA 4A0FA 1TKBA 4PIVA 2FWBA 3JWGA 4J0DA 4DJFC 2ZZKA 5LOVA 5EPUA 3ZCTA 1HY3A 2EZUA 1JTEA 3EHDA 3MMSA 4D45A 3F67A 2PL1A 2R4TA 1H22A 1W88B 2XVAA 4WECA 3VR4A 1HFWA 3DBHA 3FA2A 1VJ0A 4FCVA 3OLXA 1RRCA 2PNFA 1PTJA 2WTBA 4IMJB 3SX4A 1Y9ZA 3FCOA 4D6XA 3ZLJA 3DR5A 4AN0A 2ZWOA 2ZI6A 2H8GA 3E84A 3LL7A 1E7RA 4X8LA 3TAXA 3DONA 4NBKA 5G1PA 1NR7A 2H1CA 5I6DA 2QGNA 3H9EO 3ZWOA 3ETHA 2PJUA 3L77A 1FTGA 1RWOA 1ZD9A 2YXEA 5LMCA 5ALOA 3TQOA 2XAAA 2FZKA 4HY3A 2D1FA 2D2IA 2G76A 3DAFA 3F2VA 4KI7A 3NIGB 4W6QA 2XNDD 3OIDA 2EJUA 2WT4A 3B70A 3CXUA 2AFHA 4MS3B 4N9QA 4J3JA 4A0QA 3O7WA 1U7ZA 2MTBA 3BPSA 4XGKA 3CEAA 5CH8A 2E89A 2VHVA 3B36A 4D5GA 1NW9B 1WD5A 4K05A 5B30A 3F3SA 5DDIP 1Y4AE 2V5UA 3BG5A 1DKQA 1C7IA 3MJDA 5KX5A 3R0ZA 2AKEA 4XWOA 5K01A 2Y2UA 3TTVA 1TTTA 1ZMOA 1YHZA 4TWBA 4A92A 1UF9A 3QFHA 4CF4A 2IYYA 4OI0A 4L5IA 4YHHB 3IQDB 5BNWA 5JC1A 1DCTA 2Y2VA 1UBFA 4JIGA 4M8LA 5JAOA 4H60A 3PHLA 2O4UX 1UMBB 2OV4A 5GJWC 1IVYA 3CZPA 3WZLA 2FR0A 4K87A 2DKFA 4C4TA 1ORIA 1R37A 1X86B 1EUCA 2NU7A 3KSUA 3O74A 3IE0A 1WBDA 3DMDA 1E0AA 3GW8A 3JZAA 5T7BA 2ZJ0A 5ALEA 5DWDA 2J0UA 4KBYA 1NWHA 3O8LA 4M9RA 4MS4B 1QRDA 5CM8B 2C1ZA 3TOZA 4AUKA 4E31A 3ZDEA 2FW9A 3CVVA 2XYRA 1CJUC 4UAJA 1QB8A 3A06A 4GPIB 1U2ZA 1ZW1A 2P9FA 5CDFA 4PYRA 3STVA 3SHFA 2V6IA 1WB4A 5JO9A 1DDOA 4IHJB 2PWZA 3HXOA 3B82A 1QXSA 1D1SA 3F46A 4HVLA 3V4SA 2XQGA 4NENB 1X1DA 3FBGA 1HT2E 2WQ6A 4UBJA 4LCBA 1JDUA 3DHWC 3TNFA 1L5WA 1YDMA 1T5DX 4DNXA 3KKQA 5L6MB 3B2EA 1WMFA 3MOSA 2V0CA 1GZVA 5AM4A 1PVDA 4OX9Y 4P93A 2H4YA 2WSSD 3LTEA 2P0EA 4A0RA 1KETA 4D1YA 2H0RA 3VU0A 1MW8X 4ISCA 1XZMA 4ZOLF 4ILEA 2GN1A 4R8RA 4EEXA 3AVXA 4XFJA 2NU8A 4NF2A 2XGOA 1TI7A 1BVHA 4GOXA 3E9YA 4A82A 1VL2A 3FOBA 1IY9A 4MR7B 3MGBA 3CLUD 2X4LA 1SBZA 4C3UA 1ILEA 4R98A 2WZCA 4FJ1A 5FWAA 5C5CA 2VFAA 3TGPA 5LQAA 1DAHA 3BMOA 3S2GA 4MKXA 1QHNA 1M74A 3IBFA 2F9FA 3PHBE 5EA2A 2OHGA 3M49A 2PMKA 2LV8A 2Y76A 4S04A 2Y9PB 2A9RA 3OICA 3QPWA 2Z9CA 5HDBB 1BYUA 1Y3BE 4OHYA 3LC1O 2FW0A 3DWGA 3TE7A 2CXPA 2FOLA 2MIIA 1U11A 3RUCA 1I5RA 1IHUA 3GJ4A 1XZFA 3ED1A 4WK2B 3ZHRA 4TTAA 5LXTA 2X3UA 2W70A 3H8VA 3B51X 4B4WA 4NCBA 2FCAA 3NOOA 1F2DA 3CV3A 1H2RS 3SSMA 1CS0A 3DEKA 2H57A 4G86A 2V0GA 1QE0A 3C1UA 1I4OA 1XWWA 2OCDA 1KR5A 3IT0A 4M8SA 4M9XA 1OY1A 3DG9A 2C04A 3JD2A 2FLKA 1KYYA 4LBYA 1XUOA 4FFMA 4QDOA 1YK0A 1MT3A 2V6BA 1B0ZA 1CU1A 2DJIA 1IK4A 2H2WA 2NOAA 3E1SA 3ETJA 3FWKA 3OIVA 4N9WA 4DMMA 4GR4A 4GM4A 5BR8B 3AVVA 3DAGA 2PVPA 4KQJA 1ZVVA 2NUPA 4REQA 4X94A 1KR2A 1RM3A 1V41E 2WYWA 3C16C 3MEQA 1QVAA 1YFKA 5BP7A 3RYFB 3M1AA 4C2TA 1WZEA 3EULA 2FMIA 2OGZA 3FDXA 1B14A 4QXMA 4LJ9A 2G63A 4B32A 4MX8A 4RTOA 2QRLA 1V37A 5HMLA 2ZEJA 3W2EA 4CKBB 5CT4A 5JD6A 3QVMA 2MSKA 3DFMA 4MUBA 5ELLA 3ZV4A 5FP0A 1DUSA 1U8FO 1C1XB 5FD8A 5I45A 4ZVLA 4LMRA 3RFTA 2QN1A 3I0ZA 5DSXA 1K6JA 1MU0A 4ZCLA 1AC5A 4J3FA 5L9AA 1U1GA 4G5SA 1UWCA 2RK4A 3BIOA 4ZYWA 5I7VA 3FTEA 2BISA 2HF9A 4YMVA 1YJ8A 2QLMA 2VOEA 2W2OA 2XUPA 1NYLA 2BGLA 1IYZA 2C03A 4A23A 3P27A 3PSAA 2GOYA 2PLFA 4GM1A 6LDHA 3C5VA 4CLOB 2ZJ7A 3D54D 1HF3A 2DKNA 5JSKA 5JD4A 3ABRB 4NJEA 2ZI9A 1PQ4A 1MEEA 1HR0B 3TLGB 5DXFA 1XFDA 4LISA 1UPXA 4YRKA 2EIXA 1RI2A 2FSFA 4PBSA 1VYVA 4KE9A 2WIDA 1O89A 2NGRA 4NMLA 4GI2A 3STHA 4M76B 1F1JA 3SPXA 1I0LA 1YULA 3IOCA 5BNZA 1MHTA 3ZJUA 1ABFA 1XZEA 4MLDA 3VJRA 4ER6A 5KAMA 3EEIA 5FTMA 1LZKA 1TMOA 1L9KA 3ND9A 3NLLA 4US0R 5IJWA 4EHFA 3T3OA 2HDHA 1B0UA 1HA3A 3D2AA 2ZWPA 3M5CA 2HB6A 1S9DA 2WU1A 1LK5A 1ULSA 1D2EA 2IYEA 3TJZA 4BB6A 3BDVA 1NI3A 2IT1A 2PT6A 2QN8A 4GNRA 3FBWA 5KYTA 3A2LA 4HWRA 4M1WA 2LDXA 3U81A 5A3JA 3K2BA 1ZM2A 4GBED 1FX0B 1O4WA 2CUNA 2FF7A 2EJBA 2QTGA 3DE0X 4TZKA 4C4RA 2CNWD 1BE6A 5K0FA 3GRKA 4D9GA 1D3AA 2BEKA 2E5LB 2VATA 3CH6A 3W2HA 4LHXA 4XEHA 5B3KA 2PGOA 3JCZA 3SS9X 3QJYA 4RD2A 4CF7A 3C4VA 4C4YA 1PN3A 3SI7A 2HUNA 2JKYA 3Q6MA 4BLWA 2IEZA 2I1QA 3QMVA 5KNBD 3FFBA 3WGHA 3PR3A 2VYFA 2C96A 4Z1MA 2G72A 3IOYA 1KZ1A 1JLRA 2QVCA 2XIJA 1GPAA 3A6ZA 6CHYA 1FSPA 4A36A 1HQKA 4FCWA 4IGFA 3G2NA 4RVDA 3T4XA 3QPUA 1JYFA 2G9ZA 2WKWA 3P9PA 1ADJA 2PZFA 1N4DA 1PJ4A 1YQQA 4D79A 4UEQA 3AP1A 2XUAA 4AC9A 4EW3A 3CKLA 3M4NA 3MJTA 3JTEA 3JVIA 4NABA 1Y6GA 4J2OA 1A9QA 1KC1A 4UDXX 2GJKA 3NRCA 3V8BA 2DBVO 2FUG6 4GOLD 4A0SA 5BV7A 3EIOA 1WJGA 4LHZA 2GT1A 1JJ7A 4JLSA 4U7TB 4YTEA 2AD1A 2J7KA 4KYUA 1YCGA 2O8CB 5DHUA 3REFA 3WL8A 2WWHA 2WJVA 1KE1A 3JD3A 1Y4DE 4AO8A 2H17A 4YUYA 5JC8A 1Z35A 5IAEA 3NKVA 3VR4H 4QGFA 4O4HA 2XA2A 3E3AA 3EVDA 1BCRB 4IKEA 1K2VN 2CDCA 3ESQA 4ZAFA 4J2TA 1YTUA 1YWGO 1XTTA 5EIAA 4NZZA 2MYPA 3LZCA 3PQ8A 2E1PA 1SOWA 5EXDA 1QNLA 3VPFA 1XMQB 1GR1A 2XYPA 1VHDA 1I7QB 1JQKA 2O2JA 4KN9S 3I5XA 2RAFA 2WICA 2WUEA 2JFGA 2QD1A 4LYYA 4H08A 3OKCA 4ZYVA 2XCOA 3G2HA 1Y82A 2ZT8A 3G1UA 4N39A 4WOPA 4XB1A 4RF4A 2HU7A 4GYJA 3R3SA 3VAYA 1YDHA 2AKAB 2IYXA 4BNWA 2RHJA 1PD0A 4ROTA 4NXNB 1DC6A 4WCFA 4CQLB 4Z3KA 3ZWMA 5KYUA 1YRAA 3BMQA 3NQ41 3QA9A 1DWUA 2IQIA 4W5JA 5DEIA 1FS6A 4LJKA 3CVWA 3H9BA 2JHCA 3RF6A 4ADSG 4NJMB 2B4AA 5CNMA 4AP6A 1F0PA 4PC7A 4D4GA 3QLUA 5GONB 3PWTA 1OU0A 3F3MA 1V3VA 5JFTA 1OIVA 1NBOA 5JCOA 4ETMA 1QDLB 3M34A 4J7UA 4JJ8A 2OQVA 3ZU4A 4RMNA 1M1NA 1R18A 2VSYA 3ONEA 3WMGA 3STUA 5TQ0A 4EB0A 1H9CA 3T1QA 2DQ4A 1SB9A 3SXJA 5SY4A 3DBRB 3H2JA 4GRDA 1V71A 2Q2QA 4KRYA 5K8TA 3WKEA 3BJMA 1AU9A 4MWSA 1FRFS 3AF2A 5EUCA 2PU7A 4U6QA 5K3BA 1A9TA 1WXHA 1XHEA 1Y3CE 5JNRA 1PDWA 1TJ4A 4YIHA 4YT5A 4BQIA 3WDMA 1DX9A 1I9CA 1JPNA 4YIKA 3RYHB 3R9IA 1NF3A 1N2JA 3K0KA 3UMFA 2FB9A 3IVMA 1N6OA 5T8KC 1OX4A 1TK3A 1NLMA 3ZHZA 4AULA 3GJ3A 5G53C 2F1OA 4TS4A 1JEYA 5ALFA 5LNK6 4I5DA 2PS9A 1US8B 4F1KA 5GM2A 2W2KA 2NV0A 1K3UB 3C6QA 3NWOA 5AIBA 4COKA 3DW1X 4FWIB 3LRTA 2AG5A 4V24A 5GVRA 2PWPA 2WSBA 2XUHA 4LJYA 2ZDHA 4XJTA 2WF6A 5LP1A 5DOVA 3MQ4A 2JKZA 1BNCA 1O95D 1FX1A 2F17A 1Y81A 3HL4A 4AJ1A 1H1LB 4TWIA 1T91A 3ZE2B 4PPQA 4OXKA 2JFZA 3EGOA 2Q21A 3WLKX 1NW6A 2C9OA 2I2WA 4OQMA 4IJKA 3UV6A 4JASB 4RFVA 4CYMA 1H5QA 5LKRA 4Q1VA 1UKCA 5AVZA 1JFLA 4KKXB 4DQKA 4EPRA 5FLYA 2OGWA 3DKIA 2XCUA 4K9PA 4X3CA 5CH5A 4F84A 3PEVA 2XPCA 5LQRA 2GXSA 3SF8B 3ZU5A 2FQQA 1RKBA 3R23A 5I48A 4UHDA 2ZRMA 5CBPB 3O8BA 4A2QA 3JQ6A 4L8LA 3H6GA 3PXBA 3QMPA 1I80A 4K88A 5TVKA 4AZVA 4LA4A 4GYYA 4U1RA 1XMVA 2BJWA 3FI0A 1NRWA 4WJLA 4Z3OA 1IHPA 3KNZA 1D6NA 3E7DA 3I01M 4EHDA 4ZYLA 4LYAA 3WGJA 1XNRB 2HO5A 4RJKA 4CNBA 4OXQA 4B3FX 4W7SA 2DR3A 2ZE5A 3QKRB 3RSCA 2P9GA 1LH0A 3AKDA 3NBYC 4FINA 2WAMA 4P54A 2C5FA 4RTRA 5A6VA 3ZD9A 5HQ3B 3ICPA 4KSYA 4KWTA 3KM0A 1T5TA 4J6FA 4QQKA 3CUVA 4YRSA 1N6PA 2QSZA 4X44A 2N75A 4QT0A 3E4DA 2NQTA 1ZXLA 3K70B 2ZB4A 4HDSB 1DXYA 5ILQA 3T5BA 3NALA 3PUKA 4QUBA 5DX8A 4BVEA 2YRXA 4A8JC 1WUTA 1NPYA 3LQ1A 3J7TA 4Q1AA 4GWLA 3U7EB 4A4DA 3CLSD 5AKIA 3SHQA 3UVEA 2Z0MA 3BK2A 3G85A 4O5OA 2I4TA 1EB9A 4KUHA 1D07A 3A3PA 4ZAWA 4JI7B 4HAUA 5B1HA 3CWQA 3W34A 2XDQB 1K27A 2A33A 3FH0A 3LFTA 4UPVA 2FFBA 4DQLA 4OH1A 2G04A 2WZQA 3ANNA 2W4IA 2X6RA 1OV6A 3CJTA 4HFMA 4JLVA 5WRFA 2O2YA 3CR3C 1BKDR 3S2YA 2Q3MA 3TH5A 3DHNA 1W94A 3ICWA 2HMVA 2NW6A 3JQ9C 1AURA 1FTWA 1UBOS 3IAEA 3L5KA 3OUUA 4KVZA 5D2CA 3M6UA 5SYNA 2VQFB 4OSEA 3TD6A 4L07A 3RD5A 1M6NA 1N8SA 2ZAYA 4UARA 4YAGA 3T3IA 3VHRA 2XE4A 2ZJZA 2OQRA 3ETDA 3P0EA 4DA9A 4J0JA 3BA6A 3LKDA 1G5FA 4ZREA 3RE1A 3IA2A 2EZ4A 4U39A 4FUQA 4FZ5A 2ZS8A 5T3YA 1VMKA 1LC3A 4OHCA 3WQBA 2JJYA 4AJOA 2LE0A 1U3WA 4I4TF 1Q14A 4QVKA 4YK7A 3CRQA 3ENZA 1U7PA 2Z5GA 4JGGA 2IBMA 1F17A 3X44A 1MP0A 5F2EA 2XV1A 3CVXA 3VKUA 4TLEA 1QRUA 5JAPA 4HXEB 5BW8A 5CW2A 4PAMA 4Y6PA 4Z99A 3WV4A 1JPJA 4OH7A 1IZYA 1SIWA 3TSYA 3QE4A 4PZZA 2FR8C 5ELMA 4RM3A 1G21B 4OGFA 2PQ6A 1S02A 3GP8A 2HN9A 1LUAA 3H97A 3NWBA 4KXWA 4R1TA 3UWOA 4DABA 3S68A 4KUGA 4OA5A 3GA0A 4HEA6 1OLUA 1AUVA 3I3OA 4HGOA 2BOVA 1RKVA 3EFHA 3GRCA 3GLIE 3PQ7A 3W1VA 2ZRFA 4NVRA 2QGZA 1JR3E 1DC8A 5HUJA 3QX3A 4E22A 2PX6A 3INYA 4Q3EA 1TF7A 1NUTA 1Y9AA 4Q9IA 2QW0X 2PZAA 3HA3A 3AI2A 2PL5A 3JQQA 4RTLA 4M7WA 2D13A 3C87A 1II8A 4BP1A 5BN3A 5HPYB 3I9JA 1B6RA 2FGJA 3IHKA 1XYYA 4M88A 2XW6A 3IR6A 4IOMA 3I6QA 4Z8XA 2M9MA 1NDHA 2X0IA 4HH1A 5D01A 4FYKA 3FR7A 3IHWA 4HAVA 4WUTA 5COQA 1L2TA 3G02A 3ZHUA 1PX0A 3SFZA 4BRSA 3KTDA 4Y6LA 2ZUEA 3JARA 2WVGA 4IY1A 2VYND 2YXLA 3QHPA 4B84A 3QUBA 2PSDA 4Z7NB 1E9DA 3HWRA 5KQLA 4U2DA 3DYIA 1PI3A 1E61A 1M54A 1KDRA 2CBZA 3DOIA 3DLTA 3T1OA 3WZ2A 3EDQA 5FOXA 4F86A 3DDNA 3OZVA 2JPDA 4C4AA 3E53A 1N5DA 5CHYA 1O97D 1JHUA 2Q5IA 1LI5A 1IB6A 1LV7A 2JCGA 3CR7A 5AYVA 3V1YA 4BCCA 4MVJM 5K3AA 1XFAA 3KYDA 3CNLA 5CXSA 3ZWXA 4AKSA 2VZLA 4BQEA 2ZXEA 5K45A 1FBTA 2WZDA 4AKIA 4OKNA 1U1FA 3LPLA 3HJAA 2VAVA 5JASA 2BEWB 5F7JA 1EWKA 4OXXA 2HA4A 4UW9A 2HRQA 3NUQA 1U0OC 3UN1A 3U6BA 1AKYA 5FBVB 1IWOA 5DHAA 3NWJA 3EOAI 4IIEA 4L4UA 4QQ8A 1NW7A 4WCDA 4ZZ3A 1PQYA 2QUKA 4Q4LA 1Y8CA 3JALB 3MGAA 3R3YA 1IHYA 4HWTA 2E21A 4RK7A 1N77A 1F4VA 3Q88A 1UBMS 1ZGGA 3G23A 2Z1MA 4EMTA 1LXCA 2GARA 4HEQA 1RZ3A 2G40A 3KR1A 4M8IA 4EB6A 1E2QA 1KFKB 3RRJA 2ODWA 4D9HA 1DC3A 3OCUA 2EOAA 1WY5A 4HNAB 4NBVA 1TVMA 1XOIA 3DV0B 4TX1A 4AJPA 2IU6A 1RW4A 1V1MA 4EENA 4H7JA 4DLLA 3D8BA 1J8DA 2ZATA 3GZNB 5BQPA 4AZ0B 1YZYA 2VNIA 2M2IA 4X41A 1S8NA 4A15A 2ZPUA 5K4HA 3UMSA 1WM1A 1L9XA 3B52X 1FFWA 1VMDA 2JFPA 1IBSA 3OT1A 2WUVA 4U7HA 2RDMA 3RRXA 4GI3A 4DAEA 3NPMA 4ABTA 3CXRA 1OPXA 3EIHA 5JJLA 1YBHA 1OIWA 1U4NA 1SUAA 2CDNA 2QLNA 5E9JA 3ELUA 3ANLA 1G5IA 3MPUA 3E8XA 4H7EA 4KQ1A 4F93B 1EUDB 2OK7A 2PX8A 3D3EA 4ZODA 1UXKA 4J8PA 1E77A 1PFUA 3E2MA 5SZIA 3U44A 1NRXA 4KXNA 5I7RA 1SQ5A 5JYDA 5LL6P 1NY6A 3ZI4A 4DREA 4DG8A 1FVXA 5ALUA 2DUUA 5BVHA 4EAAA 1TUBA 3QY9A 3SJAA 2ZRHA 1YQWA 3VNSA 5MHTA 1CCWA 2P6MA 2X86A 3T61A 5MN4A 4MQLA 4QUDA 1RP7A 2LGJA 3JU3A 3UMRA 3ECSA 1ZM4A 4M87A 3CY6A 4HYEA 3II6X 3D1LA 1OLOA 3PNOA 2WV7A 4X1YA 2ECQA 3AFOA 1SU8A 5IDXA 4L6IA 2XTAA 3JQAB 5GM1A 4C5BA 1GZ3A 1I3NA 3AUSA 3ZK7A 3HB0A 1VXRA 3LUGA 3NBAA 2X6QA 4C14A 4W7IA 2HWYA 3N59A 1WXGA 4LPSA 3N0WA 2ZRJA 4ACBA 2W6OA 1NVEA 4FMPA 2A9QA 3OKFA 1EA7A 1NHWA 4OHUA 3MWKA 1XCBA 1YC5A 2OO5C 3PL1A 1R8SA 1JKIA 1P81A 2WYIA 3WQHA 4UVIA 2JNWA 1YIDA 3KTAB 4BB0A 3HQ4O 1YB1A 1R6DA 5F7ZA 1QP8A 2OYRA 5JWOA 2H9YA 1YRWA 4P6VF 4MCHA 1Y1KE 4D02A 3DBLB 4GH5A 3DF9A 1Z28A 5E7QA 5BYJA 2HMWA 2ZJFA 4OLHA 5JFGA 3FGOA 4OTZA 4BDSA 5A5GA 1YRBA 1AIPA 2JHAA 1CUCA 1E1NA 2D6FA 1P29A 1NVVQ 2JLSA 3FTCA 3SQWA 1GTL1 1HMYA 1G0OA 3QUAA 4UBNA 2P75A 5DULA 4EY4A 2P6RA 1CRQA 4KRFA 1JIVA 1ZS9A 2ZRQA 3GLGE 1QU3A 2R62A 4TS1A 5JDCA 1GKIA 2H63A 1BSVA 2D0DA 4NENA 2G9QA 3ETEA 4LXHA 4PZ0A 4ZGBA 5M29A 4KNVA 3PPWA 4A10A 1FFCA 2J3EA 4KZKA 4WZBA 2IPLA 2UDPA 3ZDXB 4B6OA 1E2KA 2R65A 1N5JA 3FHTA 4BC0A 2QRGA 2PHZA 4RCYA 3T0GA 4BCBA 2DP4E 2VDRB 5HK8A 1OYOA 3K35A 2JGKA 2QTVA 1D2NA 3F6RA 1SOUA 1Z6TA 2O2SA 2FPWA 3FNFA 2H2IA 1EK1A 5JCOC 2A88A 1L7VC 2CFRA 3KB8A 4TXHA 3HTXA 3OWOA 2AWNA 5EHIA 3CE9A 5KNBH 4GRAA 3H9GA 3T9EA 3DCJA 1A9XA 3K2IA 1PNVA 4J0GA 3HUTA 1L7AA 4MR7A 3W9YA 1ZGAA 4DHWA 821PA 2AYYA 3VH2A 1EVYA 1TVCA 5FLEX 2KB0A 1NBWB 2FPOA 3OOHA 4HDMA 1TMKA 3E3LA 5JNLA 4XGRA 1NBAA 2G5TA 3EUAA 4UQOA 2IJGX 2A3RA 1VRWA 1EE1A 3AFHA 1L3CA 1QMGA 4NSNA 1JB1A 3R6DA 5A4DA 4DM4A 1M1UA 1F6BA 5IT0A 1G59A 1OROA 2Q07A 3UYLA 1M10A 5C46F 4JI8B 1RI4A 4KQ2A 4NKRA 1RR6A 1XTQA 4W5RA 1RRVA 4KFSA 2XXBA 3CYFA 3NYRA 1CUUA 1HI9A 2RBGA 3AR3A 3HO6A 4JCOA 5EWJB 2O5RA 1VJTA 2YUTA 4LTMA 4DEVA 2OCBA 1QVWA 2OV6A 4ZQGA 1NTRA 2XBLA 2FW6A 5JZVA 1PSWA 1CQIB 3C3YA 3OKPA 3KT8A 4JLAA 2LKCA 5K6AA 2FPIA 5K0JA 2ZI3A 1U28A 2FWAA 2AYZA 1KQOA 1ARZA 2QX7A 2QX4A 4PGMA 3CG0A 3UT0A 3IKMB 3KJZA 1OBVA 1WMDA 1AQNA 2DKOA 2P40A 1ZOPA 3E18A 3JASB 1P4SA 1R9GA 1E1CB 2O8FA 2MMGA 1DV2A 2VP3A 1R8JA 4BNZA 4EVSA 1SCDA 1PD1A 5AH0A 4LYFA 4R8LA 3IQGX 4EB8A 4MB2A 4NL4H 5KPJA 3UZUA 5HMMA 3SNKA 1H8HA 2O06A 3K96A 4PW0A 2K4MA 3UJ9A 2FWPA 3WLHA 4PX9A 4CKBA 2CN1A 1E1KA 3NIBA 5B53A 5LQMA 1XPOA 4J16A 4P7JA 4AROA 1YS9A 5AVWA 3KQKA 2JDIA 1C1XA 1DO0A 3PB3A 2HLDA 4GMXA 5EE9A 2OYCA 2H3HA 3UOGA 2BGUA 2F9LA 4TSFD 2Z1DA 3HHPA 6ABPA 2FN9A 3USCS 5EAIA 3IEKA 4XIYA 3JQPA 1PSDA 3MZ0A 2MSNA 2RGNA 1F48A 4D46A 2BJHA 5KEIA 1G4AE 1P1BA 4ARVA 4ZHSA 4F3YA 4V0NA 2P68A 3O9MA 3MM4A 3ZZTA 1PV4A 5D5PA 1WCIA 5CX4A 5I7EA 4JP5A 3KPJA 1GGEA 4YDHB 1T4MA 1H0HA 3OEHA 2HWXA 1JMYA 4FEYA 4A16A 4XIFA 1CY4A 1IN7A 5BRNA 1WIWA 4NBUA 4PFSA 4PGAA 2GCNA 2JA1A 2JGDB 3KZVA 4MUXA 3EPLA 4FEEA 1WX1A 3VRHA 1B1AA 5J9FA 2ZUCA 2YJ6A 5K0GA 1T6YA 2IIVA 3VJLA 5KJ1A 1R50A 2UZ1A 1RC0A 4KDRA 1LRKA 2O3QA 4EY8A 5BMVB 1P77A 4RDIA 5B55A 5HJ2A 2L2QA 3CNBA 3ZGYA 1SC3A 3U60B 2AT1A 5ADHA 2B4RO 2BMWA 2JGEA 3FXAA 3QPCA 3DL7A 2ORVA 3GA5A 3QUQA 4RY8A 4UM9D 1UBJS 3W7AA 3FMIA 3DXXA 1Q21A 1ZD5A 2DH5A 2IOYA 2Q3LA 1T4DA 2GK3A 3LY8A 4NJOA 2B7BA 1SXIA 4J9VA 1K5DA 2UAGA 1PJQA 3AYXB 2QW8A 3HKBB 3O1JC 4WFKA 4BLQA 3FPHA 2BV3A 3OSUA 1BYIA 1EYZA 2XWBF 5F2KA 2C29D 1E5QA 2O7SA 1DRUA 2WPDD 3BHNA 1K6EA 3DZIA 4LY6A 2ZBVA 1EVJA 2HRZA 2JGMA 3DLAA 1TIPA 4FN4A 4PICA 3R7DA 3U17A 2RJOA 1MZVA 1XMIA 4Z2YA 1KS2A 2ZJ1A 4P1ZA 3VR5A 5CA0B 3H0EA 2B34A 2XXAB 1ZNZA 1T2UA 3QBVA 3MGGA 4KQFA 5GQSA 4R71A 4YPOA 4A6EA 1JYSA 4WY8A 2XTNA 5ESXA 2C3UA 2EARA 5L3SB 2FJUA 3EIEA 4M8KA 5LJIA 1UAGA 1E5VA 4CR7A 4XUCA 2UUBB 4TSFA 3ZCPA 3U9SA 4G9GA 4AKEA 5EZYB 5KSOA 5E1OA 4KPEC 1PT8A 3BQ9A 3F7OA 3MT9A 3QKIA 4RS4A 3T9BA 3T94A 3U3RA 3TF5A 3PVSA 1CJCA 4GE3A 1QVVA 3PENA 2OR3A 1Z0KA 3GAAA 4INAA 3CGWA 3GVXA 3D0QA 2AJBA 4I46A 4WADA 3C2QA 3B3FA 3I92A 5LYJB 3ESXA 2WHRA 3V7UA 1D1TA 3I8OA 1B4DA 4M0LA 2QKYA 3QG1A 2W6ZA 2IYRA 3GCZA 1Z88A 4EHNA 3ACBA 4QG3A 2FQ1A 1N2CE 1Z34A 4LY0A 4AMYA 1UMDB 1XKLA 3VMFA 4MWTA 1EHYA 1R7RA 4I2VA 3AETB 1I32A 1ADFA 2J87A 3PF9A 3KUXA 4NICA 1G8JA 1J1UA 5FBZA 4Y6GB 1LPOA 4FYVA 1EXDA 2QRMA 4TS3A 1KVSA 4G8JA 4NOLA 3I2JA 4IUCS 1E4YA 1OB5A 1GJRA 1QCDA 3OTIA 3RVQA 2ZAGA 1RJ9B 2H4WA 1CNEA 3KSRA