2UZ1B

1.65 angstrom structure of benzaldehyde lyase complexed with 2-methyl- 2,4-pentanediol
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
555
structure length
555
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGAHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BENZALDEHYDE LYASE
publication title Structure of the Thdp-Dependent Enzyme Benzaldehyde Lyase Refined to 1.65 A Resolution.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 190
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
B PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
B PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1B03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1B01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2uz1B02
4WBXC 1WCIB 2Q5QA 4BUZA 5EXDA 5EJ5A 3EXHA 1OLSA 4UTVA 5BWOA 2C31A 4GM4A 4IG9A 1OLXA 2WVGA 2BFBB 1DTWB 4BN4A 1Y9DA 2PGOA 4JU9A 4GM1A 3GLTA 2EZUA 3AHEA 3EY9A 4QPZA 3M6LA 1BFDA 2BEVA 5K3SA 3EYAA 2G28A 1YC2A 1U5BA 1V5EA 5MF6A 1T9BA 4J1TC 2JI9A 1V1MB 5EJ9A 1U2DC 1V11A 3HYLA 4K9PA 4GPEA 4MPJA 2Q29A 4GM0A 3ZHTA 1UMDB 2OD7A 2H2DA 4K9QA 5I4IA 2BEUA 5EJ8A 2VK4A 1UMBA 1V16B 2JI6A 3MOSA 3M7IA 2NXWA 4JU8A 2C3MA 1J8FA 3U31A 2O1SA 3AHGA 1Z8NA 3DVAA 3GLSA 5I5GA 4K9KA 1ZPDA 3EXEB 1W85A 4FEEA 1UM9B 3JWPA 1TRKA 1OZFA 1Q17A 2IHTA 4RJKA 4X3OA 3EXFA 1W88B 1X7WA 5K6TA 4RMGA 1O96B 5BWNA 4UUBA 4UTZA 1X7YA 5HHTA 4F56A 4UTRA 2BFDA 2BEWA 4BVBA 1YC5A 4HDAA 4Q9DA 1PYDA 4JD5A 4Y6QA 2IEAA 1UPCA 4UU8A 5D7NA 4MPPA 1JSCA 4TWJA 2E6KA 2Q28A 3FLMA 1S7GA 2OZLB 3AHJA 2PDAA 2AG1A 1OLUB 1T9CA 4RMJA 2BFCB 3OE1A 3HWX1 1N0HA 3FSJX 1PTJC 4JUBA 3GLRA 3EXIA 4V1CI 3D4BA 1QS0B 4RMIA 3FZNA 3CLTD 4MQ5A 3HWWA 4JT8A 4KPUA 4QELA 4V1CB 1WCIA 1S5PA 1O97D 5DEIA 5ESDA 2VBFA 5DGTA 1TKBA 3RIYA 3JR3A 2BFBA 5FEMA 4Y6OA 1DTWA 2H2HA 2J9FB 4D5EA 1PO7A 1OVMA 1U2GC 2H59A 1OLXB 1IK6A 2OD2A 4UTXA 3EXG1 3CLUD 2PANA 1D4OA 4TWIA 5MGNA 2JI7A 1POXA 4KXWA 1EFPA 2VK1A 2OD9A 4RJJA 4ZZIA 3ZHUA 3ZHQA 1U5BB 1UMDA 4JUFA 1X80B 1X7XA 2FRDC 1YHYA 1V16A 3LPLA 2YICA 3EXHC 4HD8A 4Y6LA 1YBHA 4K9MA 1V5FA 4K9LA 3DV0B 2QTAA 2BP7B 2A1UA 2BEUB 2JLAA 2EZ9A 1SZCA 2JGDB 3EA4A 2B4YA 4FVTA 1NGSA 1M2GA 4MPRA 4BN5A 3GLUA 3EXEA 1V1RB 1DJLA 3F6EX 1UM9A 5HGXA 4ZP1A 4C7XA 4O8ZA 1PI3A 2Q5LA 2VK8A 2NYRA 4RMHA 4JUDX 1X7ZB 1OZGA 1T9AA 1Q6ZA 2G67A 1W88A 1NI4B 2BFFB 1R9JA 2DJIA 2O1XA 5HJEA 3F6BX 2EZ8A 4R8MA 4C7VA 4UU7A 5I5EA 2QQFA 2JIBA 2W93A 3IAFA 2XT6A 3AHHA 3PKJA 2UZ1B 1XLTC 4IAOA 3RIMA 2H4HA 1X7YB 4I5IA 4KXYA 1Q14A 2JLCA 4BVHA 2FN3A 3ZGVA 4GP9A 2BEWB 2V3WA 3PDHA 2QTCA 4G1CA 3DUFB 3LQ1A 4KGDA 2H4FA 2OZLA 2BFEB 1UMCB 3AI7A 3AHIA 2BFCA 2YIDA 1TKAA 4FZ3A 1QS0A 4JT9A 5DGDA 3L84A 1T9DA 1Q1AA 1L8AA 4V1CA 4JUAA 1QGDA 3CLSD 3IAEA 3EXHB 5EJ7A 1OLSB 1YI1A 2PGNA 5ERYA 1MCZA 3ZHRA 5K6RA 2J9FA 1UPAA 3M49A 3RIGA 3CF4G 1YI0A 2IHVA 2R8PA 1NM5C 1U31A 4BVGA 5EJAA 1V1MA 4COKA 1MA3A 3LQ4A 4L2IA 1AY0A 2BEVB 3KOMA 1OZHA 2R5NA 4KXUA 4RJIA 1YTLA 1ITZA 4MZXA 2R8OA 2BRUC 4JUCA 4C78A 1V11B 2OO5C 5C4IA 1B0PA 2C3UA 2IHUA 1X80A 3ZG6A 1YD7A 5BWLA 4FEGA 2OORC 3ZHSA 2H2FA 2A1TR 1M2HA 4KXXA 1POWA 4K9NA 4K9OA 3DV0A 4BVEA 2BP7A 5AHKA 1UMBB 2H2IA 5EJMA 2C3PA 5MFPA 1X7XB 2XT9A 2JGDA 2G25A 2VBGA 3U3DA 1E3TA 5FYQA 2UZAA 3D81A 1V1RA 3DVAB 1V5GA 2H2GA 4J16C 4L3OA 4XEUA 2HJHA 3AHDA 1W85B 4C7BA 3ZGOA 3D7KA 4F4UA 1X7ZA 4UUAA 1QPBA 1M2KA 2Q5OA 2VBIA 2Q5JA 3AHFA 4JSRA 1NI4A 1PNOA 2BFFA 5ERXA 1YNOA 4KXVA 3K35A 1KEKA 3M34A 3UPTA 3EXFB 1HZZC 5EXEA 1X7WB 1GPUA 1PVDA 4IF6A 2VJYA 2UZ1A 5MFZA 1YHZA 2BFDB 4X3PA 2WVHA 1PNQA 3CLRD 4QQ8A 2H4JA 4BV2A 3E9YA 5K2OA 1U28C 2Q27A 1M2NA 1SZDA 3AHCA 5EJ6A 2EZ4A 2QQGA 3DUFA 2C3OA 1EFVA 5I51A 1ICIA 5EJ4A 1OLUA 2BFEA 1UMCA 2WVAA 1RP7A 2C3YA 2Y0PA 1UPBA 3UK1A 4D5GA 5IMSA 2X7JA 2FSVC 2AG0A 2FWNA 3EXG2 2FR8C 4KXQA 5HYVA 2C42A 4BV3A 3EXIB 1TKCA 4BVFA 3LQ2A 2EZTA 1PT9A 4GG1A 1M2JA 2JI8A 3OOYA 3ZHVA 3PKIA 2XTAA 4UTNA
chains in the Genus database with same CATH superfamily
2W2LD 3D8NA 3K2QA 4W1PA 3SQXA 2QN1A 2VT6A 3DB1A 2EP7A 1TZCA 3GPLA 2GPTA 2HIAA 2VXOA 4BNTA 1U3VA 3CUEF 1EJ2A 5DYIA 3ZQ4A 1XO1A 1WY7A 2OXEA 1G20A 3IMEA 2Q1XA 1XEXA 3BFJA 3II6X 3W5UA 5FV7A 1ISPA 3CB2A 1FDWA 1XE3A 1DTWB 1KO1A 1W19A 4DCCA 5LQRA 1M1NB 5DIFA 1GQQA 1GCAA 3N8NA 1JZTA 1RQGA 3NT2A 3IELA 1IG3A 1IMJA 4ZMRA 3U49A 3ONWA 3KUUA 3DYVA 4OATA 5JIBA 4EY4A 4B7XA 3OKCA 5JO9A 4M6WA 5K3SA 3KR9A 2IF0A 2PKWA 3CT6A 1GFWA 3FDXA 3KU4A 4MKHA 4TRMA 5JTTA 2XXAB 3VFDA 1AKWA 1TT7A 2JARA 5CMLA 1GLNA 4NDNE 1SBNE 3W6OA 1WB9A 1A8HA 5E1BA 1JEDA 3T7EA 1U2SA 4IIJA 5LLDA 1KYVA 1U2DC 3RWBA 4HSEA 1E1KA 4ILKA 1F60A 4V3BA 3FWZA 3BREA 4X1OA 4A0QA 4DT1B 2FPSA 1TQ2A 2YYYA 1LBHA 2OR3A 1QYWA 2TECE 4Q4JB 2OCLA 1RM5A 2Y76A 3HGTA 3ZE8A 4BFSA 5IAAA 2B4KA 2VO1A 4DLUA 1E1YA 1R15A 3NLLA 4RVDA 4HDQB 5ER6A 1RPNA 2L82A 1Z4MA 2R66A 3TZHA 4XUEA 4ZV9A 4ZHQF 2FZWA 2JJ2A 3JD4A 1QCZA 3EIHA 4TV8B 2F48A 4OQDA 2WJVA 1EFRA 4KJXA 4WJKB 3KL2A 3TLKA 4Y2TA 1VB3A 3NVAA 4M46A 4RQUA 5FOWA 2OV8A 4KR9A 1UL1X 3OZTA 2FMHA 3B8HA 4G5QA 4QWWA 2NU6B 3FOEC 2NQ8A 3NALA 1FTWA 4G36A 4IV8A 1MIOB 3EULA 5JAPA 2Y67A 3GAAA 3IVCA 1OXVA 3FNIA 1Y6RA 4YMSA 4NCAA 3VJKA 2LIPA 3IBTA 2V4ZA 1XCGB 4XH9B 2NSLA 2ZSJA 3DDUA 1ODIA 3Q7SA 4DSAA 3X1KA 1O94A 1T1JA 1U2PA 5DPMA 1L5VA 1E3MA 2H5JA 3N7UA 1DMSA 3QWFA 4P0TA 4TTRA 4Y2QA 1D6MA 3IT1A 3V1TC 1HX7A 3AGQA 1XXLA 1VHWA 2J7KA 3DQZA 2FMTA 4IJ6A 3ZCTA 1E18A 4ZJYA 4OI0A 3B6IA 1PZMA 4NENB 4MUFA 4UREA 2VJAA 1N2BA 4BO2A 2FFBA 3VJMA 3N2GB 3MGBA 2PSSA 1C7RA 1X7WA 3QLVA 1JRLA 2VNHA 4MW4A 4RMGA 4J2OA 1QB8A 1KJWA 3TTYA 1XRNA 4KWTA 2PSHA 4BYMA 4NFYA 4US2R 3M1IA 1NNSA 2XUJA 4CVNA 2G9NA 4DKXA 3U4MA 4WZAB 2RCYA 5KNBH 4RK4A 1F4VA 1Y3FE 5D3MA 1I3CA 2ORVA 2OY0A 2VRNA 4G63A 4X1IB 5FBLB 3W8DA 2AIRA 2TMKA 3WFJA 4F56A 2XPCA 1U0JA 3D8SA 1T4BA 4D1YA 3WSVA 2VAWA 3B6ZA 1UKCA 4E13A 1SIWA 4LI3X 5AM5A 4F5EA 1Z15A 2MSCB 1H94A 2I7TA 2MINB 3FHOA 2OQRA 4GEKA 2WTUA 3DVQX 3PFFA 2IDKA 2I1QA 3GCDA 3AEZA 5CDFE 1JEYB 2F4VB 3WLTA 4XFDA 2G80A 4CR7A 1Z34A 2OWEA 4FKMA 4K6KA 1UXJA 4L9RA 2EKBA 1XNGA 1OW3B 1VSQA 2OHOA 3CBGA 3KYDA 4NX2A 3OEWA 2Q28A 4PX3A 1LNZA 2GGSA 3CZMA 3DP9A 1PZNA 1RI1A 2VNSA 4G9GA 2B35A 4MAFA 1U6IA 1Z88A 1EXMA 2WNIA 2OMKA 4B71A 4L5AA 1JDZA 1NUQA 3KKOA 3V8PA 3LZDA 1V96A 2II6A 1QMPA 3N07A 3UFXB 3EA5A 2EBWA 3RT7A 1X1DA 4C7JA 5SYMA 3ORFA 4B3SB 3D8TA 5JFTA 2I2FA 3LKVA 1W93A 4HX2A 4V3CA 2W22A 3OFKA 5CLQA 3UTDA 3W5DA 3IJ5A 4OX9Y 2IX9A 2IZZA 1BAPA 3T5BA 3IMFA 3QPVA 1AA9A 3HL4A 5KYUA 3VO2A 4R1UA 4KIWA 1T4MA 1Z26A 3DEKA 4BLTA 4EHBA 4B81A 3KQMA 2WIGA 5J5CA 2ZR0A 2OORA 5CX4A 3OE7D 4KPUA 1CZHA 5F2KA 5G0TA 1CZKA 4PC7A 1G21B 3LP6A 5CA1B 3QHQA 2QTHA 5DEIA 2C9DA 2EWMA 2ZYVX 3NDRA 4KLCA 4FN5A 5DTEA 4BTLA 1YU9A 3B20A 2G8LA 3E7FA 4IP0A 3INRA 1N3BA 4FWTA 3ETNA 2TYSB 2WTAA 2ZJ0A 1C4XA 1KGDA 4OXYA 4LYHA 5F73A 5HE9A 5LBIA 3UJDA 5JXIA 4N39A 2GBLC 4UD6A 4OO3A 4YV0A 1ECLA 2XE4A 4L7VA 2H17A 3SM3A 1UKZA 3IQEA 3NUQA 1JNYA 2WV9A 3HKCA 3M1YA 4D5EA 4F45A 2CNLA 5I7FA 2RGWA 1IDOA 3IVGA 2JGJA 3MTBA 3Q98A 4RQTA 5DRTA 3EGIA 1PQUA 3A9WA 3H9BA 1WUKS 3SZMA 3L4KA 1J42A 3AOEC 4J16A 1QO7A 1ZWKA 3FVTA 1BO6A 2HWWA 3WRWA 4AURA 4UTXA 1KMNA 4BO4A 2IPAB 5JPIA 5M34A 2IEDA 2GM5A 4TVBA 3KQLA 3T5DA 2YL2A 3GNQA 3F9RA 5MGNA 1FJHA 1WCWA 3DMYA 4RSMA 2O3RA 4XFKA 3ZUPA 4K7JA 4DTCA 2NTNA 4KK4A 4KHZA 1MPTA 3KFVA 3MUNA 3V7FA 4BU1A 3WB1A 4YAGA 1EU1A 5BXYA 2ZKIA 2QX7A 3WK4A 2FUCA 5AW4A 1DQZA 3LH5A 2AN4A 4AYXA 1MX1A 1JDJA 4HDMA 3ZHUA 1JHXA 2HYIC 1I1NA 1RJEA 2NNLD 1HZZA 4NH4A 1YFZA 5FUMA 4FGJA 3EBOA 4N6OA 3AKYA 5HCUA 5KAMA 5DWVA 4HMQA 4MOWA 3SS8A 3F5DA 5T3UA 1AQJA 1GR0A 3LPLA 3R6LA 3OTWA 5FD8A 1Y6QA 2CLIB 1RJWA 3P4UA 4Y6LA 2Y2VA 1NVBA 1CHNA 3UUGA 4LBWA 4OXQA 5ARBA 2W2PA 3AEKA 4YACA 5EL0A 3FFXA 1W8IA 2RAFA 3BE6A 2C2WA 3A32A 2FE1A 4GR5A 4R40A 4YMWA 1SZCA 4YRAA 4CQJA 1EB8A 3IQHX 1HT0A 2B4YA 2BZ0A 3HXQA 6YASA 1LKZA 2UUOA 4ALKA 3Q3CA 3QOFA 4L6IA 4P5DA 4EW2A 4QVKA 1THZA 4RA9A 4C0LA 4JL6A 4ZK6A 3CONA 3KXDA 3RAEC 5K51A 4KI7A 3PXEA 2AS0A 3GLHA 4ZAWA 3VKFA 1R64A 3GDWA 4NEGA 1OKKD 1PI3A 2VK8A 4IH9A 3LYLA 1RW4A 4DR6B 3VKGA 5BW8A 3FTQA 2B6HA 4N01A 5L7YA 3SBDA 3HABA 4DJJA 1W5EA 4MKZA 1SUAA 2VJQA 2ZVQX 1KZ9A 4DREA 5AVYA 3C3CA 1W9HA 1YONA 1YB5A 2KSQA 3S6JA 4YCLA 3ZDAA 2GTPA 1DRJA 4WGFA 3DC7A 3HEMA 2G04A 4IHAA 4D3SA 1XUOA 3DQPA 3TW0A 1V4NA 5A9SA 3NBYC 4N5NA 5BUQA 2UAGA 4OKIA 1T8UA 4QYMA 4CBVA 4DLBA 3PF8A 4DR7B 1W5TA 2XITA 3RF7A 1O5TA 1YVUA 3IHTA 4RLSA 2VQFB 1HQDA 2FW8A 3LD9A 4GD3Q 3AEQB 4Y6RA 2WF6A 4EBBA 1KKUA 2J6IA 2M6RA 3T0GA 2MIIA 1ELOA 3A1SA 2DH6A 3T34A 1CVIA 2OBXA 3X0DA 4HNTA 2O8EB 1TJ3A 2GVDC 2MSKA 1YDFA 3GRUA 1U02A 3JR7A 3RSCA 4D02A 1UQRA 3W77A 1CUBA 1SCAA 3DWEX 1JG7A 1H2YA 3MAGA 3MRTA 4FMDF 4ALIA 2B25A 2BSXA 4EG5A 2C8VA 2EF0A 4YAUA 3GJXC 1WSBA 1TKRA 3PZRA 5F33A 2FSFA 1CZUA 1XQYA 1ZIYA 3PDHA 4TPKA 1Z2EA 3AKDA 3GXBA 4ZC1A 5CW1A 3GP8A 1HNWB 5CB8A 1SPXA 4D0SA 1KQGA 2V5VA 3ZD8A 2Z6UA 3ZNQA 5JNLA 5CVCA 3DE6X 1RXSA 4KV9A 4EAQA 4M0MA 4G97A 3W3AH 1RZUA 3WLIA 3JYQA 4FGWA 1JR4A 2DY1A 1ZK3A 3CX7A 4G2NA 2J9YB 2B2XA 1EFHA 1N6LA 4RIHA 3TLYA 5CAEA 3ITNA 2Q3EA 3P19A 4V0OA 5DW0A 1MAAA 3K6RA 1ECPA 3AUUA 3EYWA 4MRPA 2HMTA 1R0LA 2UYQA 3A3PA 4FI3F 1M5RA 1HYBA 1XMIA 3F1KA 3LUGA 4IG4A 5EIBD 3PK0A 5B55A 2ZBDA 2EERA 4AWXA 1A5BB 4QOJA 3QVLA 2BGUA 1N6KA 1YJBA 5MN4A 4WADA 3SFZA 2ET6A 3GRAA 1MR3F 3FTDA 1T0BA 1B42A 2JGAA 2R3SA 4O8CA 5JMPA 2W6JD 4LRXA 3A31A 4E5VA 3SXPA 4XRGA 4AYWA 4JYZA 3HVKA 2I91A 1H0KA 4F6CA 4HADA 4ABYA 2VK2A 3KVOA 1WVMA 4TWBA 5J2UA 4QLOA 4MTLA 1HLFA 2CNDA 4JEUA 4FYKA 2VBCA 5JSZB 4MEBA 2QK4A 1CETA 1OHHD 2VN8A 3DD1A 4JENA 2WSYB 3EJWA 4EVSA 4FUTA 2GF2A 2HMAA 3HP1A 2CUKA 2RI1A 4WD3A 5FPTA 3CUSA 4W5WA 1RWKA 1Y9JA 4J29A 1GVNB 4S3MA 4ETWA 4U7DA 3AQIA 5JZSA 2H29A 3Q5GA 2LNDA 1SHUX 4IJUA 5GZ6A 3X1YA 1VIMA 3LIIA 3U7FB 5EJAA 3RS4A 1AKTA 4BNJA 4KQHA 4D42A 5AVXA 1R27A 1AURA 5C7YA 4XW2A 1OZHA 2BKEA 2V3CC 1T0JB 2GJKA 3W7AA 4LF9B 2XGSA 1ZSVA 2PXHA 4CLOA 2AB0A 3UM9A 3EVAA 2COEA 5AM0A 5FR2A 5IT0A 1QYIA 3L1UA 4E33A 1BYIA 1GG2A 1FP2A 3ICWA 4HJRA 4N3BA 3BHJA 1RRGA 1FQJA 3SQMA 3TSZA 1HLGA 1GJRA 2O8DB 2CVQA 4S1VA 3E9NA 3HV0A 2W2VA 4YRGA 3HA3A 3E05A 3PQEA 2WDZA 2C97A 2HK6A 2OHHA 5JZOA 4BKQA 4DZTA 1M2FA 3CRMA 3TX6A 2X86A 4P0PB 3ESDA 5FLXA 4LDRA 1E2BA 5KOJB 2W90A 5HKOA 2I66A 3FUXA 4ARBA 2XOKD 4Q0MA 3ED5A 3UT5A 1ZR2A 3SHFA 3RS5A 4L5IA 1E3DA 2HI0A 3GGGA 4R8VA 5LQSA 3HCBA 3ONFA 5JBIA 3SMVA 2XT9A 4B6FA 2AOUA 4OGLA 2RKOA 3N8DA 4IMIB 3GCXA 4QOHA 2CJWB 4BZXA 4QJIA 2IV2X 1B41A 1J23A 1DIRA 5JMTA 2WAXA 2R47A 2VUHB 4IDFA 1NVTA 2JAOA 2OC4A 3D1JA 1S2OA 3HU2A 4B0OA 2WFMA 1TO2E 2PBZA 1YH3A 4K6CA 2C9CA 4C7BA 2GZMA 5FNVB 2C7QA 4F4UA 1X7ZA 3DBHA 3ND8A 3DV9A 2P77A 4U2KA 3G0IA 4JBGA 4C43A 4F9EA 2ERCA 1Y1QA 3GLHB 1OR8A 2ODNA 3NT4A 1ZI8A 2EGGA 1PLLA 1BC5A 1NHWA 1YACA 4B7UA 2Q7XA 1CK4A 2PJUA 3EXFB 2YWDA 5BN5A 4NNPA 2ODEA 1G5RA 4S2UA 4PNPA 1M2OA 1KMIY 1DO8A 1I2BA 1E32A 1KSHA 2WF5A 5CHYA 4C22A 3P4YA 5TF0A 3WP1B 1NMYA 1L5HB 3QFFA 3B7PA 4N6NA 4JNKA 4D81A 1PJRA 4N3GA 3SDZA 1GR1A 1F8XA 4RPHA 4FBGA 1FRZA 1YBMA 3HKEA 1TVEA 2ADOA 4HNUA 3AVWA 3AL3A 1U8CB 4Q3KA 3SG0A 4EMBA 3HXPA 4IV0A 1E2IA 5ALIA 1V9CA 3PIRA 4WA8A 4C3ZA 1U28C 2C61A 2EQBA 2Q27A 5IVDA 4BWVA 5EIEA 2FSGA 3AY3A 3FPJA 3PUVA 4I5GA 4IQGA 3H04A 1RQPA 3AHCA 4G8CA 8ADHA 1N2GA 2OKGA 1BCRB 4JOCA 2QQGA 5LU9A 5KPDA 4BLVA 1JKMA 2ABWA 3M6AA 3VPBA 1DFIA 1YBFA 5JPDA 1WQ1R 4KO8A 5I7VA 1JDBB 4IRMA 2WMOB 4J7CA 3RARA 1Q11A 4A6XA 3KLPX 5JC8A 1F17A 1H1LB 4QUEA 5IBCA 5ALEA 5HFJA 3E8MA 2X2EA 5BRNA 3WAJA 2QUZA 3NC4A 2FPPA 1R5NA 4Q4HA 2TRSB 5JNRA 3NKLA 1OLOA 2Z8ZA 2X7JA 4L73A 4C2UA 4YRKA 4RFLA 3KYCB 3ZLUA 3U44B 3FMGA 4H7HA 4UFOA 2OGZA 1GO2A 4CTNA 1ESZA 3CM0A 4JP8A 3EXG2 1LXCA 1DRUA 2GZ2A 4KXQA 4WXYB 3SZUA 4CMIB 2QPAA 1R0CA 3USCS 4JQZA 2B20A 3V4PB 2SKDA 4K03A 4JI3B 1X87A 4MYHA 3MJFA 1DPGA 2M32A 2Z4RA 3A9SA 3QH4A 3LCCA 4O0MA 4HYQA 3U3RA 3RYIA 4C4XA 3U3XA 2Q8NA 3LWDA 4OHVA 3ZS8A 5BUSA 3EWIA 2I4MA 3PFKA 3EQZA 3DFKA 4ETMA 1IN5A 4Q05A 3WNCA 1OLSA 3T7KA 2B7CA 3CVOA 5E9WA 2XUKA 4ERXA 2ARKA 3PJGA 2WM9B 1BTOA 1EQUA 1Q7TA 3T7AA 3MF4A 1B14A 3C39A 4C03A 4IMRA 4P32A 5DK6A 3KDSE 1FCJA 3O38A 4GI1A 4DEYA 4E1AA 3DO6A 3E2MA 4AF7A 4NE9A 2WU4A 3BG5A 1H4SA 1V25A 1X7HA 4ZU1X 4HB2A 4CKXA 1KOFA 3DT9A 3HR4A 4WCDA 3NORA 3ZI4A 5B1EA 5KNBA 4GBMA 3TR6A 5B7GA 2I54A 4OIFA 1FQKA 4KQ2A 2Q2VA 1CQJB 5FI3A 4ANFA 1T4DA 2QTZA 4DYDA 4M9SA 2VPTA 4JYMA 4OHWA 1VKZA 5IAOA 3P45A 4EJSA 4LV5B 3O47A 4M36A 2GDJA 2HF8A 3CR3C 1ARZA 5IN4A 3DA8A 3EDMA 3Q40A 4OHCA 5GOZA 1FPQA 1UKEA 4HZUB 4A4DA 1QP4A 3A2MA 4MMXB 1SAYA 2FXIA 2ZVPX 4NJMA 3VYTB 4DUZB 4F5ZA 1R12A 3NIBA 2ZUWA 4IO1A 5ALLA 6GPBA 3OEHA 3ME5A 2AXNA 2YYZA 3ZWAA 1ZH6A 3J81A 4X8MA 2R2AA 3N8IA 3TNYA 4BMXA 4DCMA 4QYIA 1L7OA 2OZPA 5C8DA 5E9QA 4FWBA 1LDEA 5M5BA 2G88A 1VLJA 3Q72A 4UDOA 2HWYA 4FLEA 5T6BA 1ZAYA 4IICA 5A4DA 4HH3C 2JI6A 1GNTA 4HKTA 1P29A 1JXMA 3IQZA 1FSZA 4K2HA 2PL9A 4TLLB 2HTEA 1TJPB 4A91A 3UMGA 1EHYA 4RPIA 4ETNA 4F9TA 2PYIA 5KJ6A 2QORA 5KQLA 1OH7A 3BF7A 3ITDA 3BK2A 3I01M 3SKXA 3GRFA 1DC3A 1AXEA 1SOWA 2X58A 2GPWA 3FHCB 5B1IA 3ZY5A 3KQPA 2HMVA 5KB3A 4ARZB 2Y1WA 5DM0A 1E5TA 4U7GA 3VPHA 5TT1A 4KDFA 4LMAA 1W85A 5H4HA 2AOUB 3DKIA 4MJXA 1YE8A 3UPUA 1HWYA 2GJ9A 3ROTA 3M4XA 3VV3A 2WIDA 2D5LA 2ZB2A 3BOSA 4HGYA 2J5QA 2QT1A 3ADOA 3VR3A 2I7XA 3GY0A 1R50A 2WD8A 5ISMA 1W7AA 4V0LA 3Q0TA 1KJ9A 3V48A 4BLPA 2GCPA 4Q1AA 3B38A 4ZO9A 1C50A 4OMFG 5BSVA 4BNNA 3SC3A 2SBTA 4WE3A 1C2YA 3EOAI 4XSGA 3DZIA 3H4IA 4M21A 2QP9X 3F67A 4X3CA 4W4TA 2OHGA 5INTA 3DBHB 4TV9F 2JH3A 1IZ8A 4LDPA 5I7UA 4MCHA 4N03A 3WWYA 4BO9A 4G9BA 5THXA 1XZKA 1VBFA 1G7CA 1WS6A 1JB9A 2OO7A 1HI9A 2N3ZA 1JZSA 1RWQA 1VECA 2VUIB 4AC9A 8AT1A 2QUKA 1ABBA 3QEJA 4W5HA 3JASA 4YT4A 2ZR8A 2PKXA 1YZQA 1NY6A 5LNK1 3C3WA 1E1QA 3FGPA 5EAIA 4R5HA 4F3RA 3KSBC 2J46A 2XCSB 4OQMA 2R4TA 5JY1A 1UT5A 4QUJA 9ABPA 4IIBA 3HCDA 2ZWIA 1PJAA 3IJRA 4YRQA 3WYBA 4RHTA 5KMGB 1KJ8A 2PS3A 4ONEA 1AO3A 3IPLA 1KKMA 4X84A 4D9JA 1XJWA 2OOSA 1DUVG 2ZRBA 3AL0C 2FZKA 4MWZA 2R87A 4QBIA 5L3QB 1U0GA 3QSGA 3TSYA 3WRYA 3ORSA 3HKEB 3PNOA 4Y6QA 5SZIA 2IYVA 2IEAA 3LL7A 3PUKA 3ND6A 3OP1A 5JAUA 2WD9A 3ZCPA 4G5OA 1L1FA 3L7KA 1FYDA 4IOJA 4MPPA 2AXPA 3SXUB 3EE6A 3NM5A 2XTMA 4UMFA 2HJVA 4EVIA 1G38A 5TPZD 3MJHA 1A5ZA 3JVUA 4B83A 2WUEA 3CURA 1NQ5A 2WJ6A 3L7BA 3H5NA 4RMJA 3N7TA 5IMBA 1QPZA 1G5FA 1L5SA 2QZZA 1UKAA 3UH1A 4IIGA 3K15A 3RG2A 2OHIA 1E3LA 4XM1A 3EXIA 3NEAA 1Z7BA 5MGBA 3ER9A 1THGA 5TB5A 3R5FA 4LRYA 4DIDA 1E99A 1C3XA 2IUEA 1YK0A 4MQ5A 3ZDDA 3TNJA 2GASA 4N7BA 1EJ0A 2QUJA 1USWA 2OV2A 3DBLA 4QDKA 4J7XA 4I5FA 1EVLA 2ZWVA 4KLZA 4TYNA 4XTRA 3WB9A 3NT5A 3C5EA 3WQSB 1UZLA 1F1BA 5HKBA 2GQ0A 2VPWA 5TC4A 4G26A 1S2DA 3JQFA 5EUCA 5CIQA 1UBSB 3SIXA 4DYVA 3VYUB 5CVUA 4QECA 4E1BA 5IABA 3ZVNA 1YWGO 4MW0A 1XCJA 4ETIA 3JAWA 4GHWA 1MRNA 2P9QA 2O7VA 4Z4CA 2VCHA 1IULA 4JJEA 4MUNA 3EQ9A 1JHZA 4RQAA 1HT2E 1JHVA 2HLDD 2F1HA 2ZVJA 1FX0A 1MDFA 1X0XA 2YNMD 4O25A 2VXCA 4DIOA 4DANA 3O4FA 1OPXA 1UOQA 4H4CA 4QRIA 4CQMD 2V6BA 1EIWA 2X1HA 1EFDN 2D0OB 4JKYA 4GI7A 3QKTA 2LV8A 1Y3DE 4I9NA 2NSYA 1TYDE 2NO9A 2X2PA 2ZULA 4TWIA 4YS6A 2ZIVB 2IEBA 4CNQA 2Z4TA 3KYBA 4DW8A 1I6LA 2C5AA 2VK1A 1MQAA 3UICA 2GA9A 2ZRFA 4M0LA 4C1NA 4YCMA 5EEHA 4KXMA 3RTEA 3AUYA 2VF4X 2AFIE 4MB2A 4B87A 2B8NA 4D0RA 4DRYA 1QFZA 3R0QA 4NFSA 4R2HA 2CXHA 5DHPA 4KWHA 2YV4A 1OXXK 1UODA 1VLLA 1ECBA 2OV3A 1I1HA 1QP7A 1BCSA 2R68A 4NXMB 1BOOA 4RBNA 1WSDA 4XYEA 4E2XA 4N47A 1NDUA 1VGRA 4MW5A 3W3AA 2JPDA 3HUEA 2R6DA 4Q1CA 4AF6A 3ZQKA 5IKOA 2QA5A 4GPAA 5ENZA 1G5HA 1Y4SA 1QGED 4TS9A 1UFVA 2VP0A 1NFRA 1V2GA 3P9YA 4L5YA 4XYGA 5LMUB 1G6HA 1SH7A 1KK3A 2I6QA 2X9LA 1AGPA 3H75A 1CERA 2WU8A 1SQ5A 2JF0A 1AD2A 4M37A 4JJGA 4WX2B 2CLLB 4LW8A 1NNLA 4OUDA 3U09A 1J33A 1JDVA 2OCAA 1QK3A 5DBEX 3TLEA 3ZD9A 2HRQA 1CRLA 4KR3A 4GFDA 1N2JA 2WT8A 4CMEC 5L3SA 2F2TA 3PHLA 4ED9A 2OFXA 5DBIA 4C6TB 2C7PA 2NYRA 5DNDA 2RGCA 4NDAA 4JUDX 3F8WA 4D8UA 1GZHB 3WFZA 2A58A 1OZGA 1WZ2A 5GJWC 2GETA 2FSVA 2Z9CA 4NE2A 3COVA 4I3HA 3RPEA 3A6PC 1JXQA 1J00A 2R1VB 5CM8B 4MB0A 1ACLA 3ILHA 5A5DA 2AF4C 1R8JA 3NDBB 4IIJF 1C9KA 1PCXA 3MIIA 5E7QA 3ZWNA 2PUGA 1E9CA 4HLUC 4OX9B 3IE2A 3RS2A 1KVSA 1T1RA 3B9BA 1GQOA 1GYQA 4D9KA 3QYAA 5AI5A 2CCGA 1R1DA 1E98A 4NAUA 1JLRA 3IOMA 4TMKA 2W71A 4HG2A 4EY5A 2P6RA 5DYWA 4V2UA 2JI4A 1D6JA 2IHBA 2VCYA 3H18A 4RPKA 2VTDA 3L0CA 3KKZA 4N5MA 2JK1A 4DV3B 2GESA 1QZXA 4ZEMA 3NJRA 4E5YA 2WAYA 3OEYA 2JLCA 3KJZA 4GRDA 1QMGA 5LZ2A 2IEYA 1U80A 2QKYA 2OL4A 3FR7A 4UJ5A 1IIBA 5DOZA 3WNZA 1H3NA 2VAXA 4YDSA 2PYDA 1P1FA 3R9WA 4V0RA 3S81A 2IXFA 4E32A 5LNK6 3LFHA 4KXLA 4FYJA 3ANYB 1EVKA 5AKEA 4KRXA 2HA6A 1HNXB 2EFCB 1B15A 3MWYW 2A78A 1X2BA 4ZVPA 4DIMA 1PW5A 2HX1A 3J7AC 3U7RA 3GDHA 1KEZA 4BCDA 1OMOA 4NOMA 4QG7A 3UJAA 1DNPA 3C6XA 3PPYA 3GP5A 2ZE7A 4M86A 1TKAA 4CI0B 5J23A 1AGNA 1CB0A 1K4YA 3HKBB 1QS0A 1U2DA 4RGVA 3VU3A 4X66B 3V34A 3A1FA 4OHBA 1QLJA 1G8MA 4MYCA 4LJYA 5AI8A 1WHSB 5IFLA 1F4PA 3K9BA 3GHYA 2CLDX 3D7SA 1HDIA 6Q21A 4YUZA 2HF7A 3KKQA 4WN3A 1BU8A 2K2WA 2YVUA 3ENQA 4FONA 3RKUA 4EOGA 1JR6A 1PVVA 5CVJA 5GGXA 3V2UA 1E79A 4I4NA 1GCUA 1QHSA 2GZAA 4MQFA 1QDLB 2AG8A 2FSPA 3TX2A 2IH5A 1RQRA 2XYQA 3OJFA 4AYTA 3WA6A 1QSGA 2ZRAA 1WKVA 4PG6A 5ALVA 3W2HA 3IUYA 4FYPA 1AA6A 5CNKA 2DR2A 5K6RA 1CY6A 2B92A 4F12A 1XCLA 3FPKA 4CKBB 3AP3A 4L0DA 2O2CA 3VYVA 1MHTA 1H2FA 3O6VA 4BX3A 2GD0A 3PL5A 1LDBA 3GH3A 4L76A 2R8PA 4KG7A 5A5GA 4FT2A 1JEYA 2OG1A 2YWCA 2IELA 1SCIA 3OLVA 4QFBA 1IG0A 3R3HA 2I62A 3CSUA 1GFZA 3EFOB 1XQ6A 3JAWB 4LBZA 2RAVA 3FHJA 2BGJA 3BFPA 1GTJ1 4FTWA 4O2BA 1L4LA 1YTLA 2C04A 5FWXB 2L69A 5JMOA 3U40A 1DKQA 1ITZA 2NU9B 1CQPA 1ZOIA 2ONCA 2Q7DA 3D6FA 1TJ5A 1RFGE 1XROA 4EY8A 1UPTA 5CK4A 1ISHA 3PG5A 2O2YA 2NACA 2ZT8A 3LLCA 3ICEA 3CTMA 4PNHA 2RHMA 5FNZA 2YS7A 1LA2A 1X80A 5H7XA 3V46A 4GZ6A 4JR0A 2EAUA 4YXWD 3KD3A 5FADA 4RESA 3G3EA 3SSAA 4O2LA 1P60A 1JMKC 2BMDA 2FQXA 3OURA 5CXSA 3UENA 1P5ZB 3LP5A 1T9HA 3DZ8A 3QOWA 5KKAA 4PO1A 2VNAA 1UBHS 5A6VA 3WIDA 5B64A 1WXWA 5CGZA 4ZEXA 3K6SA 5GJBA 2QV0A 3C1OA 4ZRMA 1GAEO 1ZI6A 5DX1A 3VPDA 1K9VF 3K6KA 4NPAA 1H6AA 1R4AA 4BGVA 2NT3A 1JLLB 5JD5A 5LJIA 2BDTA 3K70B 3BWBA 2JFGA 3C0KA 3L7NA 3QQPA 4A8HA 3A4TA 5DU2A 3R8FA 2CEKA 4U8HA 3NWPA 1Q7BA 4OQYA 5M3BA 3BIJA 3A3NA 4MGEA 3R4VA 3RG8A 2D13A 4L85A 1Z29A 3VYRB 4BP3A 1CLUA 5J47A 4QDTA 2VA9A 2WSMA 2PH5A 1E9SA 3BERA 3S29A 4CDGA 2GLXA 4M98A 3FZQA 3HKDB 2Q9AA 2ZYGA 3ASZA 3BXGA 3FYCA 4TL6A 1I7LA 2VTVA 2V54A 3T3NA 1N7HA 1QGUB 1TECE 4AKSA 1PQYA 1XBTA 4U5QA 1V95A 1M1YE 5LIRA 2C5BA 2ZDGA 1WUYA 2BI4A 3E58A 4HXYA 1L4GA 1M8GA 1Q5PA 4JQOA 4M4SA 4RNDB 4TM8A 2YV3A 2QZPA 4M0PA 1NF2A 2HBQA 3B3AA 3AB8A 4EY3A 5JCOC 3WK5A 4P83A 2BLNA 1L5ZA 3I0MA 1FU8A 3JZMA 5DM1A 2IUUA 3IE0A 3B1JA 1ZNXA 1RVDA 2VYQA 1Z5GA 2J5BA 1JLSA 2H3HA 4LV6A 2GPYA 2BFDB 3G2OA 4A9AA 4QGBA 1PNQA 4FJ1A 5A7FA 3C4VA 4J7UA 4BFWA 1YZFA 2YXBA 2ZZKA 2WJJA 1DC4A 2VYVD 3RIEA 3TOZA 4BMYA 1EWYA 2RMKA 5JH7B 4G0QA 2GBLA 4PRZA 4IIUA 4F3NA 5EJ6A 1RYMA 1GPYA 1K4MA 1PR6A 1QLWA 2J1LA 1EXWA 3EY4A 4IL5A 1K8QA 4EIWA 4BZZA 3N8HA 2MCFA 3MOGA 5KTYA 4JLPA 5HF6A 3HJFA 1GFIA 1XD2A 2R6ZA 1FYVA 2RHHA 3G13A 1XZLA 3AOEA 1TE2A 1RCTE 3AJ8A 4P4LA 2H8GA 3O8LA 3PYLA 3R3WA 3Q12A 2VATA 1ZD9A 5CVVA 4JB8A 5JSQA 1RYFA 3D02A 3SSOA 1MJGA 3WLJA 2IYTA 3NXSA 3KXPA 3ZDEA 4AZTA 3TOXA 2QN8A 3HMQA 3KP1A 5TMEA 3HPRA 1TYBE 2FKAA 2YWHA 4GSYA 4PC2A 4EW6A 4KQ1A 3Q0EA 2DY0A 3IT2A 5G02A 4BV3A 1N9KA 1QOQB 1MLDA 2BZGA 3FDIA 4JP5A 2VKTA 5I9IA 3DLHA 2NMVA 2PH3A 1H05A 4UBOA 5K0NA 3RK1A 2YMQA 4P5EA 5DCYA 3ML1A 2NVWA 2RARA 1ZR4A 1M34E 4GOMD 3WJ2A 5ECDA 2GERA 2ZJ2A 4FFBB 4B47A 2RHTA 4NOLA 3WZMA 3NVDA 2Q3HA 4MTCA 4ZIRA 2ZJOA 3ND9A 4Z0PA 3O83A 4YRPA 2W6PA 4DKJA 2UVDA 1GGFA 4MQFB 4DCUA 4AO6A 4MGKR 3K0BA 2YJNA 4K9DA 4DA8A 2CLKB 3KELA 3HN7A 1HL7A 3FDZA 1PZXA 2PRSA 3KSUA 1NJFA 3QVTA 1X94A 3HA5A 3E9EA 2ZCUA 3VAYA 1OT5A 5A0TA 4MQ6A 1ZVMA 2BMWA 3AP2A 5HM6A 1K8RA 1V3QE 3ZK7A 5AK6A 4G67A 2QTNA 1J99A 4LDJA 2JATA 2QYHA 2F00A 4JYCA 2V9PA 3IPRA 4HRYA 3Q88A 3L01A 3CRVA 1Z2PX 2QMEA 2E4YA 2WR8A 3TE7A 3IDZA 1KTVA 1MG0A 4MW7A 3GNLA 4CN8A 1AV6A 4H7DA 2HMSA 2VRWA 4TN5A 2CUZA 2QENA 4PQGA 3F90A 2QGNA 3ZZ1A 4B4DA 2Z1MA 3TMYA 2R7NA 3DS8A 1H2XA 1MZPA 3NWJA 3ZWWA 4C0AC 3THWB 1R6TA 4GM0A 4ZA2A 5JI3E 5FJJA 1ZHOA 4NCXA 4JP1A 4IVRA 3AR8A 2XOEA 4JXZA 1E61A 1ONSA 3QX8A 1F1JA 1R6AA 3N2YA 3IP8A 3R5XA 3S5UA 1EFTA 3ABOB 4E70A 3N0TA 4LNUA 1BE0A 2VDWB 3ZU6A 3F5MA 3IR7A 4K6MA 4NCKA 1I1OA 4R2JA 4XWAA 3RTDA 2IYFA 3OPQA 2EWVA 2XRMA 2ZJ7A 2BFMA 4G9EA 4QTYA 4U4AA 4U7FA 4XLZA 5CJJA 2HSDA 3OOWA 4B76A 3H6KA 1E7RA 3E18A 1WP9A 3VZQA 3WGYA 1U0LA 1FXWA 3NPAA 2TSYB 3G0BA 2INGX 1NVVR 4LFCB 5HUQA 4JCCA 1IQPA 4NCJA 3CR8A 1HMYA 1TA4A 2G4LA 1YCDA 1E9VA 2X8BA 3F4LA 4K9KA 1E64A 1TNDA 2D2XA 2HCBA 5EJGA 3VAZA 3G88A 2LRHA 4MYDA 4M99A 1WD7A 4NYMQ 3UNXA 1UM9B 4XVHA 1UDWA 1MFPA 1HDZA 2N0SA 4KWEA 5FB3A 2IXAA 2YBEA 3EOBI 4DM3A 1W5AA 1DFHA 3CX4A 5ILOA 3M6XA 3NJ4A 3K2BA 3R0VA 3ZV5A 1PKXA 4YJDA 1Q19A 2TMGA 4LPSA 3KWJA 4L5JA 1EUCA 1FSSA 4MDFA 1G3IA 5DWDA 1WDKA 2PLNA 1NNUA 5K3FA 3DMRA 2NU8B 2R25B 3ZV6A 4KTTE 3ZJTA 1JUDA 4TXNA 1T2DA 1ZOPA 1MUUA 3OCZA 3K8YA 4RYLA 2HN9A 3GPBA 5CLJA 1NVXQ 2D5IA 4JJZA 2CL7X 2QTTA 3WL7A 2XVYA 1DAKA 3MUEA 1KO5A 3JQAB 4JC0A 4L50A 1KOGA 3AIOA 3KDAA 4DQXA 1GEGA 1HKUA 1RWPA 4LYGA 2BEWA 3L7AA 4TLEA 1MC8A 2C7OA 3VC1A 1SXJD 2XMRA 3LRPA 4S1TA 4B4KA 3G2KA 1P17A 3W5VA 1RLTA 2BI7A 3KWLA 1N9GB 2G9UA 1JEOA 3IUBA 2R96A 1PYDA 2XRYA 4KBYA 1NQVA 3ITKA 2I1LA 4MVJF 1DQPA 4OF4A 5EMHA 2IRWA 1GZ7A 1P33A 2BFNA 3RRBA 1R7RA 2JFHA 2Z2IA 5D7NA 4PGHA 3L4EA 1MABB 1XZJA 2PYZA 2PUJA 1HEUA 1M34A 1MD9A 3MCAA 2FSIA 4FFLA 4Y0NA 3V6MA 3VR2D 3ZDZB 3QEMA 3NBQA 4X1KA 1JEQA 2DZDA 1L7AA 1OC2A 3FNFA 5E3HA 1TD9A 5CW2A 3ZHOA 4PRKA 1EINA 5TR9A 4F85A 2VDOB 1MP0A 2RGYA 4YRLA 2BFCB 2QU8A 2V7GA 5G40A 1B73A 3OECA 1X1BA 2F9FA 2ZEJA 3GK3A 4NV0A 3T5TA 5E2IA 3IVMA 3FSJX 1RIIA 2WWYA 2FWRA 2R2GA 3WJAA 4HAVA 3NYRA 4TN1A 4I9GA 4ZMBA 4O4LA 1VG0B 1ISJA 2FMUA 2AN1A 4AS2A 1X1CA 1U3GA 1JJVA 3KJQA 4JAVC 4W82A 4UUNA 4JT8A 4MAAA 1C1DB 3HJBA 4TL7A 1DG3A 1XZ8A 4QRHA 5JV5A 1S5PA 2DLNA 1R0RE 2EL9A 4GDFA 2RK3A 3ZYZA 1MT3A 2GCOB 1PWEA 3H5AA 1YR2A 3PDCA 2UYYA 2GK4A 5C8YA 3VYSB 3WLAA 1II9A 5JUWA 1I0IA 1PK9A 2X41A 3KQHA 2CYBA 3SHVA 1HDCA 1YZGA 2PU7A 4IUYA 1QFXA 4RFSB 4BBZA 4CG0A 4JC8A 1KDRA 1HE8B 4CMBA 2X42A 1M6NA 1NI3A 1FY2A 3HE3A 4LZAA 3NHUA 3VR6D 2ISCA 4P54A 1FLAA 5K0CA 1GU1A 1U2GC 1O9BA 5TIIA 1ZK2A 2HIHA 3GVXA 1P62B 2C20A 1O3YA 1TD1A 2NUTB 4KFRA 1SHKA 1HRKA 1IK6A 4HFRA 1E2MA 3H8VA 3OQVA 4NESA 2YOHA 1SQ6A 4HB0A 4EB0A 3PR1A 2CJXA 4L5CA 3O8OA 4KXWA 3RROA 1FVOA 4HNAB 4I3FA 4FX2A 1J56A 1RDFA 1WXHA 3B7WA 4AJ4A 5A2QA 5I8WA 2QBYA 1ISGA 5BSWA 2GF0A 4IFEA 1EDEA 1LWNA 2C4WA 4EMUA 2V8OA 3D3JA 1V71A 1XWFA 1L5WA 2FLVA 3CPHA 1W36B 1DZIA 3SXJA 2PRJA 3IDQA 4GPIB 4WKOA 3QVJA 2HO5A 3VH1A 3P52A 3BJMA 2FPIB 1JL3A 1Z6YA 4JI6B 2DUUA 2GZHA 3TQCA 3U7QB 3W3ZB 4XVRA 3NH9A 3IIKA 3KR0A 1BXRA 2XWBF 5FOVA 1U0SY 5IPFA 3PGVA 4HDRB 4N1AA 2CD9A 1K8XB 1WR8A 3DV0B 3QPBA 4JWKA 3K9QO 5CHEA 3TQRA 1RPAA 2WG2A 2IA5A 2V4UA 5CPFA 1B6GA 3IYLW 2BGRA 1U28A 3CIOA 4BEVA 1JWBB 1QX4A 1IUKA 2O7RA 1OBCA 1OF1A 3OCUA 2R79A 4M8IA 4ITVA 4XPZA 4XUGB 4CCYA 4FE7A 1FE8A 2M98A 3KLBA 3OTIA 4HI0E 1E94E 2JFFA 1ZDMA 4MV8A 2GM4A 1OX4A 4WZBB 4HQ0A 4ER5A 3BMOA 3CLTC 1RLUA 3C5VA 3DR3A 1USKA 2ICAA 3LLVA 3PICA 4KQCA 4QATA 4GH5A 2L17A 3RCBA 3T1QA 3RBAA 5F2NA 3RVRA 1I2MA 3THSA 1YOVA 3RFVA 1Y8CA 3JS5A 2GFIA 3NZEA 3EWSA 4UBMA 3SEZA 2B37A 4J4TA 1O89A 2VSXA 1X2EA 4XUCA 3HWSA 4OL0A 2ID8A 3OO0A 3UW1A 1Q6ZA 1TGVA 2OYRA 3RV3A 4EGJA 1W88A 3OD1A 1W2GA 3PVSA 5KVSA 1JH9A 2BFFB 3BMNA 1O96A 1O57A 3WAGA 2IXBA 4RFVA 5FPQA 3MBIA 5KHOC 5KSWB 1EUCB 1T6NA 2WMDA 3WLLA 3HY6A 5FL3A 3BGDA 5LKRA 4FLMA 3AHHA 5DTRA 4BQFA 4DAEA 2HNKA 3JAKA 3RWOA 4RHFA 3IIMA 4DBZA 1OQAA 2YW9A 2PA3A 4UEOA 4M0DA 4QM6A 3M5WA 1KK0A 1QNFA 5IX8A 1D5WA 3THYA 3K9WA 4WZ6A 4MK4A 5D84A 3QPDA 2NTEA 2PX5A 3VQTA 3MCWA 1SB9A 1EJBA 1QVRA 3P2MA 2BEWB 2P3SA 4FHCA 3EPKA 2PV7A 3E9QA 1T5IA 4G1CA 2PE5A 3LTNC 3SQOA 4E5PA 1N2SA 5JZ9A 1IEQA 2Z83A 2H07A 2HV9A 3L9XA 5DKFA 1WBDA 1SHLA 4JI5B 2BFEB 3LPMA 1KP3A 4INJA 1QIHA 1AGXA 3BXXA 3GG2A 2J87A 4RACA 2D1RA 2RGNC 4MKRA 4Y2JA 3WB0A 4WY2A 3ZXXA 3BWYA 4JC4A 4KRYA 3KOYA 4G25A 3TUJC 9ATCA 5AM3A 3KSZO 2PWPA 3KYJB 4KQMA 4G1BA 2Z2ZA 1JEQB 2H51A 4MJ7A 2ZPAA 5AI6A 1Q21A 2G4CA 1HUQA 1RHJA 3COYA 3NP7A 3V2IA 3EPPA 1JI3A 4KAJA 4JB2A 1F8YA 2WUGA 1JIUA 2KS6A 2YN4A 5K6AC 2PZBA 3ET5A 3SYTA 1ZHFA 3N5CA 4ZALA 4PFSA 2YXPX 4R8SA 5TEWA 3P0RA 2B99A 2GPSA 4A23A 1U6JA 1AHNA 3LWZA 4Q39A 3OKPA 5CEJA 3EQ6A 2F6RA 2DCMA 3ZW9A 1QG6A 4C2AA 2HV8A 3MTIA 3EZLA 2P9HA 2FMFA 1GPKA 2YV1A 4CIBA 4EI9A 3OTGA 2CV2A 2J5XA 5A0VA 2BMAA 4IUDS 2EEZA 3PJDA 5AW5A 2VF5X 4BKOA 3P9XA 1L1QA 1Q95A 4HNHA 5CITA 1VE1A 1XOIA 2I2AA 3ACBA 4B79A 1NVAA 4DA0A 1UJ2A 3W8FA 3ZN2A 4URVR 2ENUA 1W0JA 3I9KA 3P2OA 2PT6A 1PVOA 2EHJA 4FR5A 2BEVB 1L4EA 3Q10A 2YXNA 3ZCUA 4MB6A 3VSCA 4RM3A 1NI5A 1QHHB 5CVTA 1H8HD 1UT8A 2ZXEA 1FTYA 5EI5A 2UYHA 2FJPA 2DPLA 3KWMA 2XAAA 3QKUA 4H0NA 4JUCA 4LPKA 1U9YA 4ENRA 4JV5B 4WRRA 1REQA 3IIJA 4HPXB 4ND7A 3U39A 4MVJD 2B3TA 4DNQA 3DHWC 1NP7A 3JATB 1GKKA 4WH0A 5HIJA 1SUDA 1F2TB 2NSHA 5BWLA 4FEGA 4URZR 2ZREA 3BQMB 3AUSA 5C1IA 5JE8A 4N7JA 1DU4A 2WK1A 3A4VA 4XARA 1I14A 4EUSA 1GNRA 4JDUA 4DMLA 4TVSA 4REQB 5FP0A 2P9FA 1XVAA 2QW8A 2Y93A 1UEJA 3NGMA 1QO9A 4P6VF 2ZIWB 1XEAA 1Z0FA 3L49A 1NXOA 4EJ0A 2ATVA 4ABTA 3N76A 1SO8A 2PZJA 4F8YA 4QUHA 3GJ3A 4CIWA 1G4UR 3K9LA 5JDCC 3A06A 3JPYA 5CFNA 3K96A 1PL8A 4D3YA 4UZFA 2QX9A 4G37A 5AO9A 1CYDA 1U5CA 2C4UA 2DVMA 1M5TA 2GJ4A 2WKRA 3EDCA 4X7BA 2WIFA 1TIBA 2XNDA 3URKA 4QYXA 1TAHA 3DVLA 3NBAA 13PKA 2FP4B 2TMDA 3PFGA 2FN9A 4A8TA 4P4SB 4CCYB 2XVXA 3CE6A 2QJOA 2C29D 2D8AA 2V97A 2W6QA 4U7HA 4A15A 2BL4A 1T5SA 2AHOA 3NUZA 5HTOA 3ICOA 3V2HA 5I7EA 1DIGA 5BXQC 1MOPA 4MVWA 4LE2A 3VTFA 2VPIA 2O8BA 1F0YA 2LZ0A 4HQLA 2Y0EA 3LQFA 3OHMA 1HRDA 2ZSEA 4KYUA 5GVSA 1VJDA 4HCJA 1LBEA 3NPMA 4WAUA 1IDN1 2XWSA 4G5HA 1GPUA 4WXRA 4YJ2B 1PR3A 2P0EA 4UTOA 4ZT7A 2G36A 1C3OB 4BFUA 3KE8A 1QYXA 1I2AA 2BDEA 4JLVA 2O0MA 3G7NA 4O2AB 3QYJA 3NHBA 4BNIA 1R0XA 2OV6A 2GCEA 3QFHA 3R7SA 4PV7A 2YMPA 1E3JA 3SVZA 1A5SB 1KPGA 5FPSA 2OHJA 3OQHA 3JXEA 5DSXA 3WWZA 3HDTA 3OMXA 1KJNA 2PMWB 3BGWA 1H23A 3TAUA 4WVFA 5JJCA 1M9NA 3JQEA 4EYEA 1KARA 2O52A 3ROKA 1VP3A 2HBZA 1AGRA 1OH6A 4KIJA 3B1VA 1KKLA 5I9TA 3PLAE 2IE0A 2PR7A 5EXXA 2C2KA 4C0SA 1GZ6A 2JGRA 3DM5A 1BMDA 2DPHA 3RSSA 3PEYA 4F7WA 4GKAA 1G1MA 4L3WA 4Z0TA 4P2GA 2HJSA 3L93A 3LUAA 3JQ7A 2EFGA 3NYQA 4HNRA 1SVWA 3WIOA 3CF2A 2D62A 2RHCA 4UD2A 4B4UA 3L41A 1G8GA 4R7ZA 3TLZA 1VIVA 1IBMB 1HE2A 2DFNA 4DTIA 1SD1A 2AQ8A 2MYTA 2P5SA 2X0NA 3W5IA 4F6LA 1IUOA 4BLQA 3QTLA 2JJYA 4G0ZA 3TH5A 3PC8A 3JQBC 3VZRA 3HYCA 4DLZA 4DDVA 2FPGB 2OGWA 4KO1S 3JYOA 2BCGY 1C8BA 2IXEA 2V7VA 1ZUHA 3P97A 2HADA 2NZUG 2QTWB 4EX7A 2FK8A 3AZOA 3WGQA 2AW5A 4BUZA 3B2QA 1DT3A 3TZEA 4IRUB 5M04A 1KBQA 4AB1A 1HY3A 1U2EA 4L78A 1TMOA 3W6UA 4BNXA 5A4KA 3C7TA 5T4FA 1KPIA 4NCHA 3IEXA 1SIBE 4RSHA 2B7LA 4UUOA 3J81k 4O02B 3SHWA 1DC6A 1SA0A 1NMSA 2W2XA 4EYKA 1GILA 4IJWA 4E7PA 1VMAA 3G0OA 3VZBA 1CS4C 1X3LA 3A3OA 3SD7A 3AVQA 3CHYA 3Q6IA 4XFJA 4CZ2A 4XM0A 5DHQA 4A1OA 3W1EA 5FI5A 4P08A 4AMZA 4CMEA 1YA4A 1UIRA 1LWOA 2JFOA 3EQ8A 5FV4A 3EIFA 1H22A 2YX1A 1KAGA 3G8CA 1ODTC 4F71A 3CNBA 4DLPA 3E7DA 3LX5A 2ZBRA 2ZCVA 4R71A 4HHEA 4HMOA 1MGOA 3BIOA 3B48A 4P5PA 4YP6A 4EO7A 2F3SA 3OSZA 4KWCA 3PGA1 4R3UC 3R7DA 3GEDA 4YAOA 3V80A 3RB8A 1K2WA 2DYKA 3CLRC 5ED4A 3Q7TA 3MD9A 2IXTA 5KYWB 2X8WA 1WU7A 4K9PA 2AZXA 1JE0A 1CEEA 3ASYA 1JN0A 1DARA 1DRVA 4WOCA 1T4CA 1Y7PA 3EXAA 4C14A 3W79A 4FM9A 4HLUA 4NIMA 1UMDB 2ZE6A 5DTJA 1QANA 4F2PA 1N5IA 2JBWA 1U9IC 4K9QA 1IY2A 2ZCJA 1A9QA 3I30X 4FZJA 4CFYA 2I6XA 1MNQA 3A6ZA 4BS9A 4YBZA 3UAOA 1O03A 2PZKA 1RHMA 1UMBA 3OJCA 3TSAA 3OT5A 3ZLJA 1V35A 4ZCMA 3HLYA 4ZYLA 2IP4A 3DLPX 3HJUA 2NYAA 4CG3A 4QQRA 5IWAB 1ORVA 3MBKA 4IYRA 1CPYA 4M54A 4DR3B 1LQUA 4J0QA 3NANA 5KTSA 3IJPA 2BN4A 5F52A 3RKSA 5JYDA 3I5UA 1RCUA 1UMKA 3DGEC 4LEIA 2WFLA 5BUZA 3BCSA 3CW2A 4OI2A 4CXMA 4OXIA 4ROSA 3EXEB 3RQSA 1EBUA 1ZSNA 1AF4A 1KVQA 3T95A 4FNMA 2V65A 1LFAA 4OJYA 1YR8A 4C5CA 1PUJA 3Q1LA 2IHKA 5B1DA 3ZQUA 5DEOA 4F46A 4RTQA 3H7AA 3LL4A 5HF5A 4JT4A 4D6YA 1U2QA 2ZYUX 4J0GA 3IE1A 3H9EO 4RJKA 1UAYA 2NP7A 1KHHA 1V6AA 1RAEA 2GKOA 3P1JA 3LE8A 4LBVA 4P3XA 4DWJA 8OHMA 5K6TA 4IMPA 4PLYA 2WLTA 2WSSA 1W1UA 3DLIA 4N0DA 3ND5A 1DIHA 1TQ6A 1DXHA 2WKSA 1QYCA 2DE0X 2PUWA 3BMQA 4I6EA 4II2A 4NMXB 3RK4A 3MYRA 4LVUA 2VDRB 3D2CA 4R5MA 3T7DA 4CHGA 2O8CA 4TKUB 4X7MA 4QGSA 3G79A 3CW8X 5IK2A 2JAXA 5IDWA 1J49A 1XV5A 2UUCB 2W2OA 4IHJB 4YJGB 4C4PA 2OE2A 2AUTA 3WGJA 2I29A 1W6RA 3OQBA 4I50A 2QAJA 4WKPA 4EZEA 2YHUA 1NWHA 2HIMA 4KNVA 4CIVA 3HJRA 4JD5A 1P0MA 2V74B 4GP6A 1NC3A 5FTWA 3LKDA 3WGHA 2QTGA 3ZH9B 1KZ1A 2XUZA 2XBLA 4IH1A 4MS4B 3K5PA 5TV2A 5H3CA 1GFSA 1KMHA 1YB6A 1JSCA 1WCXA 3PX3A 3IT0A 1USUA 1Z22A 4RDHA 1SOMA 2MSDB 4YFVA 1FOEB 5J59A 1S7GA 4DDMA 2H7CA 2VYNA 1AQUA 1RADA 3ZWOA 1I6KA 3FWNA 3AHJA 5F64A 1AN9A 5F4ZA 4BRWA 4CM4A 4CIXA 2BKAA 3AB3A 3LFTA 3WS7A 1TQHA 1UK7A 1ZMXA 3OLXA 4YECA 4BLWA 1KP2A 3Q7QA 1JR3A 4TT3A 5KYTA 1JYSA 5BV7A 3K2IA 3UWMA 2BF4A 5BO5A 2RI0A 3JQDA 3JQ7B 1V8OA 4LOJA 5EWMA 5AXBA 1XLWA 2VHJA 2XRFA 3W4KA 6REQA 2X4GA 3G0HA 2CXTA 1R6VA 2G5CA 2VSYA 1EI9A 5ENVA 1DTSA 5EP3A 1Y1RA 3DDZX 2P4EA 3DTYA 4AZ0A 3ENWA 1B26A 4QELA 4RD0A 1Z7WA 5E6UB 1P74A 3G2QA 1A1VA 3FCYA 4DIKA 1VL0A 4LX8A 1VBNA 4LDZA 5ESDA 2VBFA 2NGRA 5HKLA 2ZI7A 1YDHA 3RAGA 5D5PA 2QY6A 4KREA 1FB5A 4IIDA 3AVPA 4LVCA 5B12A 1CXZA 2HK8A 3H2BA 4F4HA 5KOYA 4ER3A 1DEAA 3AERB 5EGSA 3GA7A 3L6EA 4BNMA 2XGJA 1NWCA 4P4TA 5DXAA 2PL5A 4CQLB 2I9KA 4Z4QA 4EJ6A 3SJ7A 1E1CB 1ZD8A 3EGDB 4JLMA 3V1KA 4Z51A 4JI7B 1PV2A 1PO7A 4K6FA 2PH1A 4JKOA 4DG9A 4EQ6B 2I5PO 7ADHA 3H0CA 1GPWB 4P80A 2G7ZA 2A0UA 2LUOA 2B5WA 3STYA 3CINA 4S24A 1M1UA 3IQXA 3QBJA 2R0QC 1II8B 2JFWA 5JWHA 5GPBA 3W7BA 1KRXA 3MMSA 4L0MA 3WLSA 1R3DA 4BWYA 1MORA 3SEAA 2FEWB 5K4GA 1Z8FA 4QDJA 5B4VA 1YGPA 3PRKE 1XZAA 3K70D 2PZMA 2QTLA 5EKXA 1V0JA 1K7XB 3DL4A 3LXUX 1ETHA 3QXHA 5AVJA 1WP4A 2V96A 4OAPA 3W04A 3STWA 3PNVA 4X9XA 5L8VA 3G68A 1BROA 1RPTA 1XTPA 2RDMA 3ANMA 1YQGA 3QUCA 3ZHQA 2PX2A 1CR1A 3QLEA 2QRVB 4NATA 4OI1A 3R3ZA 1DGQA 1ENPA 5JCOA 3W1WA 2K4MA 2BGWA 1CEQA 3LW8A 4AICA 5HZGA 4QU5A 1JG1A 1V16A 5CP8A 1NJ6A 3BXZA 3EXHC 3ET4A 4UPEA 3ETDA 2HJGA 1YL7A 5ADWA 4UW9A 3F7TA 1AZLA 4Y1EA 5CB6A 4LF6B 2QTAA 1ZEMA 1NN5A 2YHBA 2BP7B 2B8TA 3FDJA 1JQAA 2JLAA 2QD5A 3CKLA 1S89A 4BNZA 5AVUA 1XAJA 2J9GA 4C0HA 4CLHA 2Q9UA 1O1YA 4LI0A 1KP9A 2HJ9A 4XXHA 3COSA 4OFXA 1K4KA 1Y1LA 3Q7EA 5KYXA 1DJLA 4X6XA 1FZTA 1QNLA 4KB5A 2G63A 5HGXA 4EO4A 1AGYA 4CKYA 4B2IA 5C81A 5JCPA 1JDSA 4B6QA 4KVFA 3L0BA 1E0KA 2OSBA 1TU4A 1U1IA 1V8BA 3V4SA 3G5UA 2WOOA 2UUAB 1I2ZA 5BY2A 3TIIA 4X64B 3QFTA 3R3VA 2X8AA 2ZYSA 4EZIA 4CL2A 3IIIA 3JD3A 4CDRA 1NI4B 2YZMA 4R01A 3L7DA 3B7GA 3A4IA 1N75A 2DJIA 3PUYA 1G7RA 3F6BX 2AOTB 2EV9A 4NJOA 4A5OA 4DMKA 5C3MA 3PNMA 1CUDA 1E77A 1VA5A 1IVNA 5I5EA 1W35A 3WE7A 4YT2A 2ASEA 1KH3A 2AEJA 4RLHA 2DQSA 4DQLA 1XLTC 1TA0A 4M9ZA 4QFCA 5B58C 2RG7A 3QEBZ 1GCIA 3MUFA 1WV1A 4C07A 2CV0A 5IANA 2BGMA 3FJOA 4JI1B 2MYNA 1N3LA 2A59A 4I4CA 4Q7JB 1KQ3A 1IEXA 2FE4A 1ZKDA 4G5YA 1U90A 2GD1O 4RVHA 4C5AA 4F21A 4XD7A 5CXUA 2E5FA 2GPNA 2IGTA 2DPMA 3HCNA 3SFTA 5IZCC 1OPRA 4LA4A 4OVKA 3EBPA 1DAGA 4RABA 1FXWF 1SULA 1OVGA 1Z13A 2QTCA 4OLJA 3T7RA 1TF5A 3TXYA 1A8IA 4DMRA 3J80A 1F5NA 3P7MA 4F1WA 4GGMX 1EK5A 1ODKA 5HZKA 4IS2A 2J6HA 3KAPA 3X2EA 4XWOA 1UMCB 5GV8A 1ZVVA 2A35A 1WXFA 3AF1A 3I6YA 1XTQA 3SX0A 5GOTA 4NARA 3ROXA 4LHSA 2A9JA 1R0KA 4HR7A 3TLBA 1P5RA 3MTAA 3QG5A 4WK4B 3CQ9A 5CU7A 1C3LA 4HC4A 1YRLA 1Q0PA 2XYHA 3S1AA 1AQIA 3K5IA 4ZCSA 4XIJA 2PD3A 1EA5A 2W6CX 4MROA 3TLMA 3X1JA 4WN9B 1H66A 1I2CA 3U4GA 3WLOA 5A03A 1EM8A 1YVDA 4V1CA 2BLLA 3GELA 3LV8A 4DGSA 5C2JB 1Z5OA 5DDIP 1JF8A 1QGDA 2VSFA 6REQB 5AKIA 1FFDA 1IZZA 1XDWA 3DNPA 1A7AA 3DT8A 3IRUA 4WUTA 3U56A 1LTHR 1ZQ1A 4PSAA 2VAVA 3ZHXA 3LI2A 1UKVY 1SQGA 1W44A 2WFZA 3WK6A 2B7BA 1NL3A 1AKNA 2QMZA 2F1JA 5BOSB 2QI9F 1DWOA 3M49A 2ZDQA 1EE2A 4TRNA 5CA0A 4CEJB 2I55A 4IDDA 3DZJA 3FF1A 2IC5A 4DCJA 1H6CA 1XZCA 4OXRA 4AT1A 5HX7A 1E7YA 2KW5A 2O5CA 1S2IA 1OWNA 3NV9A 1W76A 3GGOA 5BW6B 1G59A 2D6FA 1NZJA 4MUHA 3WYGA 1W0KA 5KNDH 4CMAA 2DQ4A 5AR1A 1QRDA 1UDAA 4L02A 1O95D 1LBQA 3KJXA 5IXSA 3ZE9A 1OZAA 4KGXA 4XR9A 1PR9A 3M89A 3O21A 4EKNB 2QM0A 4YMLA 2AFHE 2ZAOA 4I9UA 4RAQA 3IBYA 4TKMA 4G0VA 3I39X 3JWIA 5E6SA 1XD8A 4MYUA 2HA4A 1TPZA 3SJCA 2OWDA 4NHEA 1E2FA 3WWOA 2ODWA 2C3UA 2JH9A 1GYPA 4Q34A 3UANA 3DOIA 2R6GA 2Q50A 3PTLA 4O4LF 3W2EA 2BVNA 4DSUA 2XHZA 1RS0A 3VDNB 1RYZA 4OSEA 2A1TR 4EY7A 3NJ8A 5B2EA 4JR2A 1OFVA 4L1KA 5AHWA 2BSQA 1I4EB 3UV3A 5H4GA 2CB0A 2Z08A 1QB7A 3L8ZA 3R6DA 4JLWA 3UJ3X 4TQGA 4GXNA 5EE3A 4CM5A 2C98A 3MEQA 3I42A 1MC5A 3R7LA 2R1TB 3QOYA 4J1NA 4LZLA 3LX6A 2Y2UA 4CUZA 5C8YF 3EPLA 2ZAIA 3OZGA 3ETHA 3RC7A 4XVQA 3U5TA 4WKCA 3OX4A 3UK0A 1YA8A 3TS1A 3Q3JB 3W2IA 1GU7A 3MSXA 3OJWA 1ZNWA 4JDPA 3ABSB 1FFXB 1D1SA 3BMCA 3JQAD 5DYYA 5EIBC 4Q48A 3G2JA 3KVNA 3AEUA 2O6LA 5CBKA 3KRTA 4I55A 3S2FA 4HFJA 4WBNA 1W47A 2PTGA 2DPGA 4PAQA 4U0KA 4RL6A 3HUFA 1QTRA 2C0PA 3HEAA 1QPBA 5KCMA 4QDOA 1NYRA 1UT6A 2EGHA 3KVRA 4HTFB 4HH1A 4MR8B 1IBCA 4PCUA 1P6UA 5TQ2A 3SOPA 4LF5B 4N54A 1NATA 2YJTD 4YMIA 1GZDA 2CYCA 1ZESA 1XDSA 5JEEA 3OPYA 4Z54A 3T9BA 2A14A 2A86A 2C54A 3G85A 5D3QA 1UDRA 3RYHA 1L4UA 2X9GA 3ZHZA 4L75A 2Q3DA 3L77A 1PL7A 2G0AA 3OOSA 1NE7A 4L27A 4JLDA 4F3CA 1EUDB 2XB9A 2L18A 3OCVA 1QDUA 5F1PA 4K88A 4ENVA 1HDYA 3HR7A 4CM1A 4UJ3A 1CUZA 2EX1A 2VSQA 1VDZA 4B3DA 3PXXA 4X44A 4PZZA 5ITSA 1I3KA 1KPHA 3SLRA 1RZRD 2OM2A 2H4JA 5CT9A 2X0KA 2LDXA 1BW9A 1IM2A 1MG5A 5FBWB 3RFCA 4Q16A 1MJNA 2YWRA 2IU3A 3GEGA 2IEIA 4WLUA 3H2ZA 4M7RA 4GE0A 3SJZA 1QWOA 1ZAKA 3MXTA 1KEVA 4XA8A 3FPAA 1U7TA 1WDWB 1GRRA 4IXDA 2R65A 1PUIA 4L72A 1H8ED 4ZOAA 3R8XA 3RV4A 3GHHA 4MV7A 3TVDA 2PBRA 2C0CA 3SF0A 1FDSA 1U2GA 1C30A 3PHJA 2HWKA 1JAXA 2ZYTX 1DIAA 1PEYA 4YDRA 4FYWA 3V8MA 1YKGA 3IC5A 3ROQA 2G09A 4YEDA 2WU0A 1VI6A 3FYDA 4JIGA 1XEFA 4X8OA 1JLMA 4OHUA 2WMYA 3C15C 3IS3A 4MQUA 3ETEA 3D5EA 3VR4A 3ZHYA 2QZJA 1G7SA 2AG0A 3RUPA 3QKSA 1MW9X 4LGVA 4DCTA 4FGUA 1QHGA 2VJDA 4YJ2F 4A26A 3SF8B 3N5KA 3ESZA 3QVUA 1KJIA 1NC1A 4QL3A 4Z7OB 5A3JA 3V8NA 3DEZA 3E23A 2ZRMA 3OLYA 4O2AF 3AC0A 4J0KA 4HRVA 3T3IA 4Z4FA 1F6BA 3EEQA 3HFSA 5CJPA 3W34A 4EYOA 3E5NA 3GN2A 2SICE 1C7QA 4HDSB 3GEBA 1WCIB 4R1MA 5FI0B 1MB9A 4WNAB 5H59A 4MR7A 2HMYB 1OROA 4JOSA 2C5EA 5EA2A 1NX9A 2JCGA 3ICPA 5LM3A 1RM0A 1EM8B 4CEIA 2ZE8A 3CRW1 2EKZA 3N8KA 4UTVA 4YAWA 5F1KA 5I3ZA 5ALFA 4MUKA 1CRWG 2QYOA 1W36D 4HSGA 2FSSA 1U8FO 2BAGA 3MVEA 1XTTA 2BFBB 3G2NA 5BV0A 5L9AA 2PGOA 4W1SA 1NVMB 2WYWA 2F55A 1HE4A 1O54A 1SKBA 5LXTB 5A2GA 4HY3A 3AHEA 1U0BB 1SK8A 3OI7A 1F20A 1F6DA 2KMLA 4QO8A 3EY9A 3FLBA 2V9ZA 1OWOA 4Y1RA 3TL6A 1QCDA 1XMSA 2WWTA 2Z56A 5KEIA 1WXDA 2AYXA 3D59A 1EXNA 2P0AA 1GCOA 1NBAA 2Y77A 4E5UA 4JHXA 1OFUA 4CCWA 2BV3A 2G28A 5FWNA 4DMMA 4ER0A 1CDOA 1DAPA 2A6PA 1LH0A 1JHYA 4HWPA 3AI3A 4QDXA 2H5IA 5KC8A 2PLWA 3DWFA 4LOIA 4WOPA 1TEZA 1BNCA 1ZKMA 4DF3A 2P69A 4BEWA 2W42A 4LX0A 4XI9A 1ZBDA 3HZOA 1T3ZA 4ZVLA 2FUG1 3GMTA 3OIVA 1G8FA 4EO9A 4LOAA 4DA7A 1GGJA 2MSNA 4MS3B 1BKDR 2I0FA 2FWAA 5AK3A 4O63O 1L3BA 2PSFA 1GNPA 1SXGA 3N7AA 1TO6A 3N6XA 4RJLA 4ESVA 3UVEA 3HO8A 2UUBB 2C59A 1EQ2A 2WRZA 2B2NA 1I01A 1LB1B 2FPKA 4EI2A 1QG4A 2J45A 4MGIR 4RD3A 2O3TA 1SD2A 2C7GA 4WWHA 3AR6A 3TBHA 4F7DA 1PL6A 2Q41A 3M7IA 2WZQA 5T4EA 2I3DA 4LGMA 5EUQB 4GS5A 1VKOA 2CLHB 2XYVA 3LQQA 3PLNA 3GRCA 2MR5A 2JHGA 2OM6A 2ODQA 1JHDA 1DQSA 4P53A 1LCIA 3L0DA 4ZVTA 3VUEA 1NJ8A 1R88A 3KL4A 4CDMA 3DZGA 4CKCA 2G72A 1P1HA 1NBME 1SUEA 1DQRA 3KDPA 1TYEB 4QDUA 2TMYA 3G89A 2RGNA 4FFSA 4ZOLA 3OFJA 1YZTA 1Z33A 1M73E 2ZRCA 1FLDA 3VU8A 1M0EA 3EEYA 1EX7A 5B2ZA 4DY4A 5TS2A 4BBJA 5E0KB 5HXAA 5REQA 4WY8A 3FUTA 1YVRA 2CBGA 4X54A 1ISRA 4UVHA 2O8FA 2G71A 2HU8A 4L3VA 1G8HA 1MVLA 5C0OE 1ODSA 1TTPB 2EHDA 4MIEA 5K6AA 5DNCA 4RAOA 3C41J 3OPYB 3RYHB 1UADA 5F21A 1R0SA 3DBOB 3MMPA 4AG5A 1D6NA 3H9UA 4PQEA 1YUBA 1X9HA 5LQUA 4OA5A 4J49A 2WHRA 1ZONA 3O8NA 4FOTA 3QKRB 3VKUA 5EJIA 3DT6A 1ZM4A 4RKEA 1IXSB 4E30A 5EJEA 1GKUB 1WNFA 1ODJA 1TT5A 3FTNA 3VGPA 5IT4A 5A04A 4TL8A 3WI7A 3ZEIA 3HY4A 1BGXT 2OENG 1SY7A 4R41A 3EAFA 2J67A 1MEOA 3LC0A 4WIAA 3SE0A 3IAAA 3NBKA 4ZGBA 3PD7A 5IS2A 1Z39A 4G4IA 4LFBB 4Z7JA 5FUVA 2OB2A 3VSBA 2P9BA 1N0WA 4FUQA 4REOA 3W78A 1VJ5A 2JGMA 4G0OA 1UEIA 2YJ6A 3HB4X 1GDHA 4H3SA 2YJ3A 4GKBA 1C30B 4NV1A 1XMPA 4Y18A 3HV2A 4YDHB 3HWX1 3G5MA 1Q0ZA 3UB4A 3NASA 2EXXA 3RAPR 4E15A 2C2GA 1QIIA 3A37A 3GEHA 1LK7A 4XCVA 1ZM2A 1SGWA 1QC5B 1PS9A 3QW2A 3HJAA 1R0BA 3FFWA 3AJDA 4FI3C 4F3YA 1D2MA 1WHTB 4I4TB 1AKRA 1VSUA 2RB4A 2H18A 3H2HA 3PI7A 1A7KA 1RPJA 4FNOA 1QHFA 4OQLA 3ONVA 1LY1A 1CF2O 1XEWY 2OXTA 3RTBA 4EB6B 3QX3A 1AKUA 2I6TA 4IHJF 3ZCQA 3LLMA 4MVYA 4JODA 5SICE 4F0JA 4JIMA 1P1KA 1RYEA 3AY7A 1ENZA 1ZZEA 3QQ5A 3QYPA 3M70A 4ACAA 4ICIA 4UAVA 4CG2A 1DAEA 4K0KB 2HCRA 1I3NA 1KEEA 5ALDA 1MB3A 1QH1A 2BE7A 2R97A 1C7FA 2Y68A 4G89A 1AQYA 3G9ZA 4Y6OA 2ZIGA 1T1GA 4MR7B 2RG1A 4R0NA 2J9FB 3W8RA 4JY7A 3PT5A 1UCFA 3QUBA 1KE2A 4GR4A 1S7CA 5FBZA 4HO1X 3WGTA 5JDCA 5KX5A 1SCBA 2A88A 3BZUA 4RGBA 5HPYB 2Z9BA 3LO8A 1TYCA 3AJEA 4X92A 2H59A 1CE8B 1YS7A 3IEUA 3PRJA 4LQDA 2D1FA 4MV0A 3IUPA 2OQVA 1ZNQO 1J9GA 3FCEA 3UXHA 3VU9B 1IB6A 2P2GA 5GQSA 1P6XA 4Q7KA 5GMOA 2HQBA 3EDYA 2ZPTX 3S0JA 2WA2A 1Q7CA 1BS2A 4KI0A 5AUQA 1XMJA 4I14A 1T0IA 4PVCA 3ADKA 4XGKA 3RSHA 5GGYA 1UJCA 4WGGA 4YA6A 4YRCA 3VHRA 4Y1RB 3Q8MA 1KSFX 5TY0A 4JI4B 1OH5A 5TGTA 2ON6A 2XLBA 2H5LA 3K16A 3N2ZB 4KX5A 5ENDA 3M1LA 4QARA 2R5WA 3OEED 4MMYB 2XCOA 2HCTA 2JCXA 4XX1A 4UU0A 4CM3A 2HGSA 1GSIA 1A9SA 4CF4A 1HFKA 4E5DA 4HQ6A 1Q0TA 2XUFA 3AK4A 3OZAA 4UNIA 4JGGA 3Q8WA 4YYZA 1PGQA 3R76A 3AONB 1PJSA 1KYWA 1NBMA 2VHYA 3AOGA 4CR8A 2QPOA 3HB9A 1DG9A 3RIXA 2PL1A 2C5GA 1U3FA 3BL8A 4HFNA 1UJBA 3DDSA 3EW9A 4KQFA 3GRRA 2BZ1A 1BEUB 2BKUA 1S4MA 2J3MA 1XJCA 3KHSA 4IZOA 2OAGA 2FR0A 5ESRA 4N48A 1QFJA 2QUBA 3O4IA 2OT3B 2PUVA 2H1OA 4YV2A 1V9LA 3QFCA 3TTUA 1CWUA 3B9QA 1BXGA 5H9WA 2GBFA 4PY2A 4YMHA 3BGOS 2AV6A 2XCUA 1WQ4A 3S68A 2WBLC 2ES4A 3BICA 3GGPA 5J4KA 1KI1A 5FOUA 1DBSA 1U7PA 5T64A 3ZOKA 4AMYA 3K6JA 4KIFA 4C9BA 4PBRA 2YY5A 2D2VA 3FPSA 4KIUA 5JATA 1YZYA 1HE1C 2Q5LA 4G07A 2O2IA 1QAOA 3AESB 3IVRA 2P3LA 1K68A 1NUTA 3OQIB 5JT1A 3G2IA 4Y8VA 7MHTA 1TTHA 1EK2A 1T9AA 4S1PA 4X41A 1GNSA 3MC1A 1VIDA 3PHGA 4ZVRA 4CKCB 1G2IA 4B4WA 1T13A 1UBTS 5IKPA 1MZVA 4YRSA 2G9VA 3H6HA 1RBMA 1XJ5A 5HOEA 4C0JA 1JPJA 2CK3D 2P2SA 1XZGA 4W63A 1V6CA 2JA1A 3JQBA 2FX2A 2QQFA 3CZPA 1IUPA 1FVXA 3MG9A 4HXFB 2Q3JA 2NZJA 4IQ4A 2YNMC 4I08A 1BH2A 4MMZB 3GU3A 4X6YA 4I19A 1E20A 1B76A 2D7CA 2P90A 3PKJA 4S2EA 1VZ2A 2VQSA 3TRKA 1IOZA 4K5QA 4H3HB 3W06A 3G5TA 1M6VA 1KYTA 3G7UA 2ZJYA 2PKQO 3FTCA 4GWKA 4P36A 2ZXFA 2H4WA 3HYTA 3M2TA 3IKMB 3ZX5A 2HWXA 1JKJB 2AJDA 4JL5A 4MICA 5LA6B 5IC4A 1OI2A 3I4FA 2QVBA 3FJ1A 3QVGA 3JV7A 4Z9AA 5JAHA 3T54A 2RJNA 3DZKA 3ZGZA 5ALOA 1GL9B 1NLFA 5EMJA 2PU5A 2BIFA 3EODA 3DUFB 3GZ4A 5TX7A 3P9PA 5L40A 1PRYA 1KJYA 1M3SA 3HSKA 2GRUA 1KYXA 3GUUA 1J2RA 3R1IA 5LB2A 4D6XA 5AIAA 4B3RB 3QFSA 4JN6B 3T5MA 4HUQA 2OZEA 3OT4A 3ZZNA 4IV5A 4E12A 1CIJA 3QTTA 2KQUA 2OLJA 4LOKA 3IILA 3IVXA 1C1XA 4PHGA 4LXYA 3DLCA 4YO8A 2N1BA 2YY6A 4CLRA 3W6PA 3ZKWA 4KLNA 1TX4B 1MV5A 2DFKB 3ZVMA 3ZQJA 3IR5A 4JT9A 3AT1A 2VT7A 5HNKA 4Q21A 3WHIA 4WACA 2HJRA 1DAHA 1QH9A 1W5FA 4DPMA 1APBA 2OCPA 3I73A 3T7TA 4B7AA 3FE2A 4FFMA 4JUAA 4R9SA 2FW9A 3L6UA 3U4IA 3KT3A 3EX7C 1U9IA 3NOQA 3TRDA 1CUAA 1QF6A 4ZI2A 3RSQA 4PYQA 4XB1A 1VCNA 1YR3A 4M22A 1QP8A 4ND5A 1JHUA 3HGQA 2AFIB 2XNHA 4NOJA 4FT4A 2JGLA 1VB5A 1S01A 2HU7A 1JEJA 3LYHA 4IWXA 4Z1MA 3D5TA 3CWCA 4KUGA 3HLTA 3SC4A 4EA9A 3JWGA 4LE0A 3TN7A 2RHOA 4QUGA 4PZDA 4I50F 2DPXA 3NTVA 4EHDA 2CLCX 1BDBA 2IY7A 3NWEA 3L5KA 5DIZA 1ZD2P 2NQ2C 3V1LA 4B9EA 1HM5A 5EUMA 1ESNA 3VVBA 2XW6A 3IL2A 4HGZA 3V7UA 1U9JA 4BQOA 3O3MB 4CKEA 1B7GO 3ZGXA 1KMCA 1NN0A 1ZJ6A 4MGHA 2Q6IA 2R8XA 4RJIA 4HEHA 1CS0B 1A76A 4B6OA 2W2LA 3LU1A 1D2GA 1PT5A 1GT91 3HYSA 2AGVA 1MTZA 3GJ7A 3NM4A 4U0JA 5I9BA 5J43A 1NRJB 4HVAA 4S04A 1IVSA 2BRUC 4RXUA 1XVLA 5C5CA 3ELBA 4YCDA 5JI2E 1QTIA 4G5XA 4OOFA 2P65A 5IUJC 4NQRA 4BNKA 1YRHA 3GD5A 5FJIA 3CPJB 3U9SA 1Z18A 2GN6A 1NJSA 1WW8A 2WWHA 3BFVA 3IEIA 4MA0A 4P92A 5TJ9A 1J25A 1K5PA 1K6MA 5JYCA 2QR2A 3ZD6A 1XPJA 4O4HA 4IX9A 3V3KA 2I8AA 4NBVA 1L5LA 5LL6P 4DMCA 1XF1A 4R0MA 1WO8A 1SG0A 1OIVA 1V3VA 5EEGA 2BE9A 4RTRA 2Q1UA 1Z47A 4YIHA 2V1UA 3IKJA 1ICEA 4MW6A 2JGDA 2CNBA 1GTMA 2DHDA 3KX2A 4JLOA 3FI0A 1JHRA 1VMEA 3LAWA 3K1JA 2OEPA 3CVJA 3EFBA 3VNQA 1P2VA 1R3UA 2BTQA 2H1VA 2YRWA 3EIQA 4I1SA 1J8DA 5AYVA 3UMMA 1QRTA 4C4OA 4DR5B 1F48A 1V5GA 1LPPA 1CUWA 4RD6A 4XEUA 2YV2A 1Y8RA 4DABA 3ORQA 1JPUA 1Q74A 4JJ4A 1FS4A 2R85A 3TRIA 3FRIA 4D4MA 4RDIA 3MM4A 1IIRA 2HFJA 2I4NA 3LM8A 3O1IC 5U1PA 1X1QA 2C5FA 3C48A 3L1JA 1M2KA 3WGZA 4B43A 5LQKA 1TA9A 1CLEA 4Q9AA 3TEFA 5CK5A 1Z0JA 2GEDA 1IY1A 2GO7A 5AK5A 3DAPA 2CLEB 2EKQA 1Z5ZA 4CR6A 1JJ7A 5FPKA 5ERXA 2D5CA 3UT0A 2HDOA 4IDOA 1D2NA 2BFOA 4I6JA 5BQOA 3F6CA 3B52X 2WIBA 5GONB 5CM2Z 4P81A 5I4KA 1XFAA 4C7MA 1EP3B 4EECA 4IF6A 4D9EA 3E84A 4H1TA 4RZXA 2LCFA 1WTAA 1LPSA 5B3LA 1WAMA 3E15A 3DWGA 4I4LA 8MHTA 2HF2A 3CJRA 4AJJA 4PO8A