2UZ1B

1.65 angstrom structure of benzaldehyde lyase complexed with 2-methyl- 2,4-pentanediol
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
555
structure length
555
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGAHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords BENZALDEHYDE LYASE
publication title Structure of the Thdp-Dependent Enzyme Benzaldehyde Lyase Refined to 1.65 A Resolution.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 190
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
B PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
B PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1B03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1B01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2uz1B02
2BFDB 3OOYA 3OE1A 2E6KA 3MOSA 4K9OA 2H4JA 4V1CB 1EFVA 2JGDB 3LQ4A 2PDAA 5DGDA 3ZHUA 5MFPA 3PKIA 2C3OA 1OVMA 2PGOA 2BFCB 3DUFA 3EXEA 1UMBB 4QQ8A 2UZ1A 3DVAB 2XTAA 1Q14A 4KXVA 5EJ9A 4L2IA 3AHJA 3L84A 2FSVC 1X7ZA 4KPUA 4Y6OA 1UMDB 1SZDA 4JUDX 2OZLB 5I5EA 2C3PA 4JT9A 5AHKA 2JIBA 1U28C 4BVGA 3HWWA 2H2DA 1T9BA 1X7YA 5MFZA 3AI7A 1XLTC 2YICA 1NI4B 4UTNA 3D4BA 3D81A 3FSJX 1MCZA 4RJKA 3EYAA 1YBHA 3EXHA 3RIGA 1UPAA 1X80B 2Y0PA 1V16A 1OZHA 2R5NA 1U5BA 3ZHVA 1T9CA 2VBFA 1UM9B 1B0PA 1W85A 3EXEB 4F56A 3DUFB 1POWA 5ESDA 1PTJC 3EY9A 2UZ1B 3LQ2A 1Z8NA 5EJ7A 2WVGA 1U2DC 5DGTA 1YC5A 2OORC 4L3OA 4J16C 3GLRA 1RP7A 2JLAA 3CLSD 1OZFA 2FN3A 5HGXA 1M2GA 5EJ4A 1EFPA 3F6BX 5EXEA 4JUAA 5D7NA 2H4FA 2H2IA 3M7IA 1X7YB 4FEGA 4MPPA 1AY0A 1PNOA 4BVEA 1V1RA 1OZGA 2Q27A 2BFEA 4K9KA 2C31A 2EZ8A 2W93A 5C4IA 3EXHB 1U31A 2BP7A 1HZZC 1O97D 4BUZA 2OD7A 2FR8C 4KXQA 1ICIA 1V16B 4BN5A 1U5BB 5EJMA 1O96B 2G28A 3CLTD 4UTXA 2IEAA 3EXFA 2BEVA 2QTCA 2C3MA 2JI8A 3F6EX 1WCIA 1W85B 1R9JA 4BN4A 2H4HA 4Q9DA 4MPRA 3ZHRA 2JI9A 1T9DA 4KGDA 4K9NA 1ZPDA 5MGNA 5ERXA 2OD2A 3U31A 3PKJA 1M2HA 4GM1A 4GG1A 2OD9A 1QPBA 1YC2A 4FZ3A 1V5FA 2JI6A 2Q5OA 1OLSA 4RJIA 1V1RB 2BFEB 4QPZA 2QQFA 3LQ1A 3ZGOA 2AG1A 5FYQA 2BP7B 2AG0A 4D5EA 2BEWB 2Q5QA 4GM4A 4K9MA 3ZG6A 2Q29A 3HWX1 1T9AA 1W88A 1UPBA 4GM0A 5EJ8A 5K3SA 4HDAA 2BEVB 2PGNA 5IMSA 4COKA 4C78A 3DV0A 4MZXA 1WCIB 4QELA 2QQGA 4RMJA 4TWJA 4RJJA 2JLCA 4R8MA 2BEUA 1PI3A 2YIDA 4I5IA 1TKBA 3CLRD 4JUCA 1L8AA 1BFDA 4JSRA 2C42A 4Y6LA 3EXG2 3FLMA 2A1TR 5I5GA 2A1UA 5ERYA 3AHDA 4J1TC 4UUAA 1YNOA 4K9QA 2O1SA 1OLSB 4KXYA 2DJIA 1OLUA 2G25A 1PT9A 3CF4G 1U2GC 4C7VA 2BFFA 3GLTA 3E9YA 3JWPA 1QGDA 1X7ZB 1X7WA 2J9FA 4JUFA 3ZHQA 2H59A 1DJLA 4ZZIA 3HYLA 5BWOA 2EZ9A 2R8OA 1W88B 3AHEA 3FZNA 1KEKA 3ZHSA 1GPUA 3DV0B 2NYRA 4JU8A 1TKAA 5MF6A 2V3WA 3EXIA 3M6LA 2XT6A 3ZGVA 1YD7A 2VK8A 2VBIA 4JU9A 4RMHA 4UTZA 5K6RA 4BV2A 4MPJA 2R8PA 3UPTA 5BWLA 4UUBA 1PNQA 1UMBA 3ZHTA 3PDHA 2IHVA 3EXHC 4GP9A 1JSCA 4XEUA 5EJ5A 1S7GA 2EZ4A 2BRUC 2VBGA 1YI1A 5EJAA 1YI0A 4BVBA 4UTRA 4BVHA 4JD5A 4O8ZA 2HJHA 3UK1A 1OLUB 4IF6A 4FEEA 1J8FA 3M49A 2BFFB 1PO7A 1V1MA 1M2NA 4RMGA 1X7WB 2J9FB 3U3DA 3AHFA 4G1CA 3GLSA 3M34A 2JI7A 5HYVA 4X3OA 1TKCA 1NI4A 3CLUD 4IG9A 1X7XA 4C7BA 2UZAA 5FEMA 1NGSA 4HD8A 4WBXC 4JT8A 2FRDC 4IAOA 1Q6ZA 5HJEA 5I51A 3EXIB 2B4YA 3IAFA 2VK1A 1SZCA 1UMCA 4GPEA 2NXWA 3EXG1 1UM9A 2IHTA 4BVFA 4KXXA 1ITZA 4UU7A 1YHYA 3GLUA 3EXFB 2Q5LA 5BWNA 3JR3A 4UTVA 1Q1AA 2X7JA 4K9LA 4K9PA 1IK6A 4FVTA 3K35A 1D4OA 1Q17A 1OLXA 1V1MB 2FWNA 4ZP1A 3RIYA 2BFBA 1S5PA 5EJ6A 4RMIA 2VK4A 2Q28A 4C7XA 3AHGA 1X7XB 3D7KA 2C3UA 1PVDA 2H2FA 1V11A 1DTWA 2WVAA 3AHHA 3IAEA 3LPLA 2OO5C 1UMCB 4KXWA 3RIMA 3AHIA 2O1XA 2QTAA 4F4UA 5EXDA 5K2OA 1QS0A 4X3PA 4JUBA 2BFDA 2H2GA 5I4IA 1PYDA 2BEUB 4UU8A 4TWIA 4V1CA 1OLXB 1YHZA 2JGDA 4BV3A 2BFBB 1V5GA 2WVHA 2BFCA 2XT9A 2IHUA 3DVAA 5HHTA 1N0HA 1Y9DA 1M2KA 1UPCA 1NM5C 2EZTA 1UMDA 1V11B 1DTWB 2OZLA 2H2HA 2G67A 2BEWA 4KXUA 3EA4A 1YTLA 2PANA 4V1CI 1TRKA 5K6TA 3KOMA 4D5GA 1M2JA 2C3YA 1MA3A 4MQ5A 3AHCA 1V5EA 2EZUA 4Y6QA 1POXA 1QS0B 1E3TA 2VJYA 5DEIA 1X80A 2Q5JA
chains in the Genus database with same CATH superfamily
4BQRA 3NCHA 3W4KA 2Q3CA 3D3EA 1VG1A 1KERA 4MVJA 2ZDGA 1DBIA 2HFJA 2W6PA 2X8AA 2FZ4A 1D09A 2G06A 2XB8A 2VAPA 2I4NA 3DVRX 4N0MA 3STTA 5EGSA 5KS2A 1OFVA 3T35A 4GR5A 3PKIA 3UEOA 4FGWA 2PGOA 1S2GA 3EXEA 4RWZA 5DM2A 1Z7GA 1Z5VA 2GNAA 1MX9A 1ECBA 3BFVA 3F6PA 3QV2A 4GR9A 3EARA 4BNUA 3KIPA 5CCDA 1B8NA 2HT6A 2R60A 4WGGA 1VGQA 4WKCA 3GRCA 4B3XA 4KXVA 4RWEA 1L8QA 4I5DA 1SCAA 1RBQA 4A9AA 1THGA 1ZWLA 1AQJA 4A8JC 4CF5A 3GFBA 3R8CA 1QK3A 3M5PA 2WYIA 5BV0A 4HXYA 2GM3A 1H6BA 1ZGCA 3NZEA 4UM5A 5DHRA 3PXDA 2XWJI 3BKXA 3KBBA 3PGKA 2VI5A 4MPDA 3KLPX 3NR2A 5AVQA 2F6RA 1XKTA 1AQLA 1WUHS 5DK6A 3I23A 4JT9A 4R0VA 4UHFA 1R4NA 1P4GA 1ZJ4A 1MG0A 3DZGA 3H1EA 3L7LA 3LNTA 1DINA 5EZSA 1Q7RA 4G4SO 3AUJB 4ZQGA 3EWSA 5LZ9A 2IVFA 1RIIA 2PEYA 2VSOA 3FVWA 1O95D 3AYXB 1D0SA 1OCEA 3CKMA 3L92A 1M6EX 4FE4A 2P69A 4CI9A 5JS1A 2UVQA 2LV8A 5LA6F 1PT7A 5KC8A 1GUDA 1SU7A 3UKDA 5AI0A 4B84A 5ADWA 5ALRA 4ON9A 3EGIA 3TAHA 1J2EA 4BNZA 3LQRA 5IVPA 1PVOA 3TI9A 1YZTA 1EWTA 1TFUA 4QOIA 1BCSB 1X8LA 3DZJA 5ADHA 1QWSA 2R5NA 4PX5A 1PSZA 4JV5B 2HJWA 3E8SA 3WJ1A 4E2ZA 4CUJA 4H9GA 3AIMA 2H1VA 1N5LA 2VTKA 3M6IA 3CPJB 1Z0ZA 3JV7A 2XHEA 1N25A 2GAJA 4DNFA 4DWVA 1W94A 2PH7A 2UV8A 5EZYA 3BIWA 4WK4B 3HGMA 3FWKA 3S8MA 2FMHA 1Y8QB 4KJXA 4RQBA 3CWQA 1NN1A 1WVMA 1WZNA 1LLQA 2W6IA 3HDQA 4FQ8A 1Q2UA 2C5EA 1OUMA 1M1ZA 1Q11A 1THMA 3H5IA 4MCAA 4O2BF 4CIAA 4XB2A 3ZY5A 4D26A 1A98A 4C0QC 1VHTA 1F2UB 4NBWA 1J39A 1Z39A 2EL7A 1Z37A 4Y1RA 3VA7A 2B20A 1N5JA 3L05A 3KUCA 3TZCA 4KVGA 4BYGA 2QW1A 1QQ7A 3G85A 3UXMA 3WB1A 1CS0A 1LBTA 3BXOA 1J23A 3ETJA 2XKAA 2TRSB 3EULA 4B6PA 5JCZA 5BOSB 1N77A 4D99A 2O54A 1YK0A 4JFRA 2W22A 2J9RA 3VMFA 3FOBA 5EY5B 2CXOA 1VI6A 1ZNXA 4EW2A 4DCVA 3U44B 4YJ2A 1WABA 4PIPA 5JS7A 2ZATA 3QF4B 3WHIA 2OV6A 1FUEA 1X7YB 1II8A 1SUCA 4H7PA 3SBDA 4BNNA 1ZU4A 2XWQA 4Y7DA 2I29A 3S5UA 3T9FA 2JFWA 4MLPA 3WK9A 3DT6A 1TF7A 1LLFA 1G9SA 2HSGA 5ALWA 4Q12A 2Y8EA 1K75A 3DDSA 1HZZC 4QU5A 5HRUA 2ZYTX 3ENNA 2CLLB 2WWFA 3BL8A 3L1JA 4PVDA 4LC9A 4BUZA 1GGKA 3H97A 2PUGA 5KCZA 3R3ZA 4EJ2A 3D7NA 1J7JA 1ISRA 1NDUA 2YWBA 2LDXA 2KQUA 2Q3DA 3AEZA 4J03A 4REQA 2YJ6A 4AJIA 2WHPB 1YFLA 1OHHA 4LSMA 2PS1A 1C8VB 1VDZA 1FMCA 2NO0A 2P4UA 2P79A 3A32A 3GIDA 2AI2A 2YXEA 4I36A 4HGNA 4JJIA 1PG2A 5JCOC 3LGAA 3DHNA 5J4VA 4DR6B 2FAXA 1C7IA 1L4LA 4BN4A 1RR6A 4DMUB 4TLEA 1IQPA 1GTG1 4I2NA 1P5HA 4QUGA 1OZAA 4PG5A 3NEYA 4KLAA 3R74A 4AF7A 4E03A 1S02A 2ERXA 1ADJA 4R5HA 1OFUA 4MUAA 4LYJA 4MV3A 10MHA 2RKOA 4LRXA 2XJ9A 3FN4A 4RH3A 4UDNA 3UHOA 4Q4HB 4D82A 2NQTA 1PR1A 2G4LA 3WRYA 1M2HA 2C7PA 5AKXA 1KPGA 2LNDA 4R8VA 4Q9JA 4FFRA 4R9NA 1DSSG 3JVVA 1I4OA 4AYWA 1OX6A 2W4MA 5LUAA 1ZYUA 1NF3A 2A94A 3EUWA 3N0WA 4LE0A 1ZN9A 3DYVA 2B1GA 4W6ZA 1SA0A 1V48A 1ZD8A 1H2HA 5DISB 1E1QD 4KLCA 1G66A 1U7TA 4UZSA 2FI1A 1NW9B 2DSTA 2P0YA 4HEJA 4KV9A 4UNPA 2C4HA 3GOHA 2DF8A 1U1FA 2FX5A 3ORFA 4KE7A 3PR3A 2OG2A 3PNQA 4TKUA 5E6RB 1J2TA 2PVPA 1V26A 4GI5A 2FNAA 4GM4A 3HR4A 4RKQA 4S1PA 2F7SA 1A4XA 2FZCA 2IRWA 4JELA 4CZ2A 1KDRA 3N8NA 1QE0A 2YCLA 4UTOA 1KQFA 1U8EA 2GPWA 2MYUA 3QV1A 1R0XA 4N0QA 1ORDA 1A9TA 3RTAA 3F7NA 2Q50A 3I2FA 1ODCA 5FL3A 5IMSA 4BAUA 1JSRA 1L5FA 4MGEA 1J07A 4PHHA 1W36D 2QK4A 3Q0TA 5ITZB 4I66A 1IEQA 2XVMA 4JLKA 2FUG6 4PN7A 3TLCA 4W7IA 2VCHA 2F3QA 5FWXA 1GXSB 1OFHA 1XZPA 2JFGA 3NAGA 1VA4A 4D9EA 1ZRNA 2C98A 1TO1E 3LECA 5FWYB 4ZZ3A 2CSXA 2AB0A 2NTYC 3TZ6A 4LF4B 1P7WA 1U4SA 2PS3A 2WTBA 3FPBA 3LWNA 3OF2A 5LQJA 1FUKA 4P1ZA 1OY1A 3EG9A 2W4IA 3MCZA 3ESCA 3LIPA 1PEYA 5TQ2A 2PQ6A 5I5GA 4N1AA 5B6JA 4FYWA 4EJMA 1T15A 3J81A 2AUTA 5K05A 5J63A 3UHJA 4WKNA 1FFDA 2OLKA 5LJIA 4CEHB 1U3WA 5JI3E 2XKBA 4ZVVA 1ULBA 4FR0A 2YZ2A 5ELXA 2LE0A 3H2YA 4OFWA 3C3JA 2Q3HA 4TTQA 4CEJA 3IKLA 2VWGA 3AWDA 4FN4A 4HWKA 2GCNA 4TZ6A 2O6LA 1GARA 5KOHA 2PX3A 1YBAA 3T3PB 4HQLA 4JBGA 1L8LA 1EI9A 4DDWA 1XMQB 1EGVB 5AR1A 5L4NA 3DEFA 2O5VA 4PWZA 3HACA 1KRXA 3CEPB 3R3JA 3WDKA 1TM7E 2XNSA 5CDYA 1U3FA 2W43A 4JJ4A 4UNQA 1TVKB 1A1VA 4GD3Q 5AI9A 3V2IA 4N5LA 1DJLA 2PYDA 3BCRA 2F8LA 5EZ6B 4EHFA 3H9UA 5KPJA 3OTGA 2JJ8A 2QAGB 3HU3A 4M1YA 3W3AD 3JR7A 3EUEA 4C0LA 1ZWKA 4J7UA 4KQWA 5HVNA 3TNFA 4MEJA 5DEOA 4QYIB 2LZ0A 4LF7B 1UJ4A 4TMVA 1D8AA 3MWYW 1E3QA 5HCNA 1T8RA 4CMGA 4PHGA 5IYZB 4QDOA 4RH1A 3WX0A 3VO9A 2P75A 3WMFA 2PPVA 3L1UA 4H4CA 3DTVD 4IGFA 1G5RA 3EPKA 4N6GA 1XIVA 2ESRA 3K5PA 1MPTA 3ZTTA 2D5AA 3ML1A 1TJ5A 4FDLA 3ZGVA 3OX3A 3PUWA 5KMGA 1AUPA 3PFCA 3SCZA 3MINA 1PNTA 4GVPA 5D8DA 3RJZA 2OZVA 4B43A 4Y2XA 3K6KA 2EFHB 4QIHA 1O0BA 2BPOA 4GLLA 4L07A 4E12A 1KDOA 3E5NA 5I9MA 4DQXA 4EO4A 5B1SA 2WAAA 3R44A 2RC5A 2O19A 1M66A 3Q9UA 3RRYA 2XT9A 5ALIA 4LY3A 1MRZA 4NATA 4ENPA 4CMBA 3QBTA 1I3OA 1E2IA 3GPIA 1CF9A 1T91A 4EVSA 1KOJA 1FLDA 2OQIA 4IIVA 5I9IA 2GESA 4E88A 4WJLA 1GNLA 5AVTA 4TL9A 1YFKA 3PEEA 3GP5A 1QG0A 3H18A 5JYEA 1QGYA 5EIFA 1AB5A 2B2XA 3PWSA 2ZB4A 1KP3A 2ZS7A 3AJEA 3MMSA 5FNVB 4CJXA 3V4PB 1J5EB 4URFA 2P1ZA 2NVOA 3CPHA 5I9SA 3IO3A 1W29A 1JVBA 3GLIA 4JGIA 3WIBA 1BS9A 4ZQCB 1JFSA 4A8TA 1DBPA 3GFFA 4HTFA 3SZUA 2VSFA 1Y3CE 1NNUA 5LLTA 4LMBA 3B52X 4QICA 4M8LA 4JEHA 4LVNA 1BXGB 4FJ1A 5AK6A 1VFNA 3OQJA 1OXKB 2HMUA 3BGSA 1M2OB 1USWA 3ASYA 5JO9A 3TE7A 3W8DA 5C32A 1P5JA 2B2NA 3C2QA 4JT8A 1E6CA 3TNJA 4KR0A 1ZJWA 2ZQZA 5CVDA 1EFAA 4EGJA 3KAKA 3M8KA 5B36A 1R6VA 4JXKA 4WA8A 1QTRA 3AFOA 4GEGA 1NXPA 5BPFA 1PS8A 5G1OA 3MAAC 3BK2A 1QE5A 1AGRA 1WUKS 2J0UB 1SXJB 1UQTA 1WMSA 1Y3HA 1Y8QA 3HKCB 4PC1A 1K88A 1UBFA 3L40A 1Q91A 3HVIA 4MV1A 3RU2A 1D0IA 4PAGA 3OTOB 4IGKA 2V3VA 1ETHA 4YJ3B 1ZMOA 5DTJA 1L5HA 1PNRA 3AUAA 4NEHB 3GJ0A 2P5SA 1Q74A 2OYSA 4EEXA 1ZSNA 1K7EB 2ZR8A 3PZRA 1JHDA 1F6WA 5CT6A 4Y2UA 4K9PA 5AXDA 4J07A 1DKUA 4RKWA 4EPRA 4WERA 1OXXK 2B30A 2R3SA 2FFBA 1BJKA 1LI5A 1Q17A 4F5ZA 3A2MA 3NAZA 2HB6A 3LXXA 4ANFA 3B82A 4AXBA 2OCIA 5C8YF 4ZP1A 2ZXFA 2F3SA 3QEAZ 3KQOA 2BMEA 2BFBA 5DH9A 2DPXA 4I1VA 4YS6A 1YONA 4RMIA 3JALB 1KI2A 1P9RA 1RWVA 2R65A 3IDAA 3X1KA 4PN3A 2IS4A 4Y2HA 1AXRA 4OMFG 5U4QA 3S2ZA 4AKTA 2BIFA 4A6EA 4BZXA 1CUAA 4RHCA 2Y05A 4J7CA 3DE7X 3G9ZA 1X8XA 3M5CA 3NV9A 4LV6A 2LUOA 5F52A 2O8CB 3TR0A 2HQRA 5CLLA 3AF4A 1P4AA 4UVHA 1SY7A 4N01A 1WUIS 3L7OA 3GZJA 4P32A 2MOKA 5BURA 4J43A 4YEDA 3GRPA 1G21B 1MVOA 2F00A 2PQMA 2YMMA 2YYSA 3DDOA 3FUWA 3G5MA 2QTLA 1C2TA 3QUQA 1B3BA 4K9SA 3GEPA 4NFYA 5ALQA 1RPAA 3PFKA 4WKBA 3USES 2LDBA 2WHPA 1TGYA 1Z8FA 1DLIA 2HHJA 2HQBA 3FBGA 3NTRA 4BO9A 5GVSA 5L53A 2D6FA 2QT1A 1OYWA 2F4VB 2SKCA 1KARA 2QD1A 1P1FA 2I33A 5JISA 3E3AA 2GHIA 2PUWA 4NOKA 4QJ3A 1RZVA 1A4UA 1EGHA 4DLWA 2JEZA 2WTNA 1UH5A 3RWMB 3ZV7A 3CF4A 3PQFA 1ZVKA 2G8NA 1DAGA 3VO1A 3KDPA 6LDHA 1D0VA 4QYMA 5G2OA 3WLRA 5JSFA 2XB2A 3IEKA 3TX6A 5AUNB 1W9MA 2BFDA 4B46A 2A3RA 4Q4HA 4ZOLF 3WK8A 5K5EA 1RLOA 3H8VA 4KACA 4EDHA 4BNDA 1X7HA 3CUUA 1LCIA 4XD7A 4C3UA 1V6CA 3C7DB 1Q95A 2PFSA 1F4LA 3CT6A 2N1MA 3CRRA 3HNRA 3TLMA 1NKSA 4FD2A 5ANRB 4IFEA 1PK8A 5HHTA 1DLJA 4DLLA 3JCZA 3U4QB 3PF9A 1Y9DA 1YS6A 4P22A 1CZHA 5CIYA 2B8EA 4AJOA 2IUSA 2JS7A 1BXZA 1E63A 2N75A 3TCXB 3TSAA 1KEEB 4EBBA 3ODGA 2Q9UA 4R3WA 2IHYA 1M1UA 1Q44A 2A5FA 3ABQB 4J3FA 3WBKA 3RYFB 3SM3A 4YVFA 3SGLA 2MYTA 4FOLA 4NG5A 1FLVA 1RBZA 3AQ4A 3DBHA 3KYBA 1C9KA 1NMZA 4KIFA 4KXUA 3I45A 5AHRA 1E62A 4IIUA 4ENRA 2XECA 3WNCA 4JB8A 3RUAA 2F48A 2B8JA 1NONA 3KXKA 2OBLA 4U1RA 5A4MS 1SKBA 1UF9A 4IHAA 4BKQA 4D0GA 3Q8XB 3PQ5A 2AF4C 1MA3A 4RD0A 1GA1A 2TMYA 2V74B 1RC8A 3GFSA 3ZK7A 2PN1A 1YA4A 3PD7A 2B34A 2ZWOA 3ORSA 4ZI5A 5LQSA 4DTIA 2VT6A 4F9FA 3JQBA 3RVDA 2H1HA 5GMOA 2CE7A 4Q3EA 2VCEA 2EBUA 2XNDA 3KQTA 4Z9XA 3ROXA 1P2FA 3PCXA 1QHFA 1X80A 2R66A 1MPXA 3TINA 4LF5B 1ZUIA 4EI2A 1JZQA 3R6LA 4YMUA 1EK2A 3DO5A 3EGOA 2ZIEA 3IUBA 3OOYA 1XQ9A 4CM8A 1XRLA 2E6KA 2TS1A 1PG0A 1Z6PA 4KU4A 4Q16A 3SHVA 2Q5IA 1U2GA 1YVRA 5DGDA 1I0LA 3PGMA 4NPCA 1W6RA 2GPJA 1NJ2A 1UMBB 4OLHA 3C5HA 4HEHA 2XGJA 5I7OA 2CHQA 2IBTA 1ADYA 3L6UA 1A71A 3DOEA 4KRXA 1F0NA 2BOVA 1TXGA 2C2OA 2EERA 2OECA 2VP6A 3OP4A 4G1MB 4L5IA 4UW9A 5CNKA 1JKFA 3TFOA 1F7UA 1QC5A 1RFGE 1UM8A 5BN3A 1O97C 4O1IA 1TVKA 5ENDA 3CRMA 4TKLA 2DX7A 4YYZA 1UMKA 4KQXA 3JVUA 5GZ3A 1YV9A 4KQ1A 5HMMA 1WXDA 1N2SA 1RXUA 3O94A 2JD2A 1FSZA 2DE0X 2NW6A 3G0DA 3R0XA 5TY0A 3H5AA 4E21A 2PUAA 2XRMA 5CB0A 3GRKA 1JR3A 4QYIA 1AKNA 2QG4A 4ODIA 4EO7A 3HXKA 3OPQA 2CT8A 1E7SA 1TO6A 1DB3A 5HGJA 5T3YA 4QNNA 2VHTA 4P4NA 3R6TA 1ZLXA 4MMXB 4QTTB 5KYTA 3O93A 2CLCX 2AXPA 1FQJA 3IQWA 4UTNA 4L7VA 4TQ9A 4JXXA 1U6JA 2ACWA 4LNUB 4B87A 3Q8LA 2P3LA 2YNMD 2HL6A 2D4AA 5HIMA 1MIOA 2BGTA 3OOHA 3P97A 4IWXA 2FWJA 3PYLA 1X1QA 1UZUA 4IUYA 4KQFA 5ER6A 5F77A 3UT5B 2AH5A 4LZOA 3CCBA 3H1PA 1IHYA 1ZNZA 3R76A 3TD2A 1EWYA 2HA3A 2QAIA 1EMDA 3X44A 2O48X 3STWA 3DTNA 5FFFA 2G82A 3JZMA 1Q0UA 1RWPA 3A1CA 3O3OB 4PU0A 3ZQJA 5DNUA 3AEYA 4MB0A 1SXJE 3REQA 2V0GA 1JEOA 1Q92A 3OOWA 3FBTA 4AUMA 1W5FA 3EBLA 3GAFA 3K09C 1SKUA 1B00A 3A8TA 3EZLA 3LP8A 5A4AA 3W9BA 2IPMA 2WVJA 3D3WB 4CV3A 1JVSA 4TLMB 4LZWA 1DDIA 1YC5A 1YDWA 3L7KA 4P54A 1QZZA 4XJTA 5ETJA 4BFVA 4M38A 1TZCA 1W8IA 4H0CA 2OZKA 1ZK0A 2HK9A 3PHIA 3WNZA 4JQCA 2C4NA 2NNLD 3IYLW 2FN3A 3CO5A 3D59A 3LY5A 5B4VA 3FCCA 3C7AA 2LRHA 1AMOA 3MCWA 4YJFB 4KKXB 2JJ2A 5FTKA 3HJFA 2YJGA 1IATA 1W6UA 1W0JA 2I6QA 2Q2WA 1KR2A 3DV2A 3LDAA 4R7GA 5EMJA 4B6JA 3ZNPA 3IESA 4L74A 2GI4A 1J0CA 1BXGA 1UBLS 4B80A 2R8XA 2XUZA 3MUNA 1QIEA 3P7MA 4JEUA 3RVKA 2KE5A 2V6IA 3MTJA 1N36B 5EJEA 2QDXA 3EQ6A 4X6XA 2OFFA 1UDXA 5TPWA 2FLWA 3DWGA 1LSUA 4F45A 2WICA 4BAZA 4NABA 1N6RA 1UJ6A 1W4BA 2Q4OA 2I6SA 1II9A 5HQ3A 5TC4A 2AEEA 3UPUA 1KMQA 1Q7GA 1V9LA 2G6TA 5K3AA 1L7AA 4KQKA 5DWDA 1TD1A 1MB3A 1YI8A 3GX1A 4AMUA 5IX8A 2OM6A 2HHHB 1G21E 2CNWD 2X4GA 3B89A 4URVR 3L6BA 4RLSA 4ZHSA 5I7RA 3FTEA 4LXTA 3TW6A 4DZTA 1AT1A 1ECLA 1UFRA 1XJWA 2YWDA 3HFSA 4OI4A 1H8HA 2IPOA 3D7SA 4D4MA 2OT3B 4MWSA 1VBNA 4KO2S 5FTMA 1Z0JA 1V0JA 1ZDMA 2GBLA 1EP1B 1PK7A 4QFMA 1N6NA 2O4CA 2XMGA 4MYUA 1M75A 1CQJA 3QMVA 2YWJA 4A03A 1NVBA 3ZDCA 1VPVA 5AVKA 2DUUA 1TJPB 4PAMA 1AQUA 2O06A 4KB5A 4D0NA 4IIFA 3MCTA 2OGTA 3P0FA 4PSKA 1ZCFA 2OD2A 2R62A 3PHBE 4MJ7A 4C03A 2AJCA 3AU8A 3PYXA 4TTAA 5D51S 4E5PA 2CL0X 1S8FA 2OK8A 2YZMA 3C45A 3U7QA 4RY9A 3W9UA 5KJFA 3A04A 4IFBA 2G4CA 3U7HB 2FZKA 1CB7A 3THRA 2HJRA 1NOJA 2VZLA 1ECPA 4JSTA 2WFMA 2ZE7A 3HDYA 4FOOA 4CTKA 4K1XA 4GZ6A 5AM1A 5LCXA 2ZTHA 1NVUQ 3WFIA 3M6UA 4U3JA 2O8CA 3R1IA 4DV0B 2ETXA 1E8DA 1OLSA 3V7WA 2J45A 1EFTA 3Q87B 4RJIA 5AJWA 4KMSA 2PJZA 2HEGA 1TYZA 2W2MA 1CY2A 4DYDA 3CVUA 4R41A 2FN8A 3VX4A 2V98A 3A7DA 2QQFA 3SYMA 3AFMA 4GYYA 4QECA 1I3NA 5T41A 3SY8A 4FQ5A 4GS5A 5E8RA 5CA1F 1XRQA 1G2IA 2PT5A 4OXQA 1X86B 2XDWA 1XZJA 3GD5A 1ZH8A 1R0KA 2YC4C 3NYRA 2Q29A 5BNFA 3I62A 1FYEA 4W5JA 3S2GA 1IM2A 3M9XA 3IA7A 4BJHB 1UPBA 3NXSA 2WINI 3MWDB 5DNAA 2EV9A 3WMGA 4PBRA 2JIRA 1QTIA 4C4PA 4ZZ0A 5DVZA 5C8ZA 5KUTA 2ZPTX 1DKOA 3SC6A 3W2IA 1WETA 1AUOA 5TLSA 3FETA 4PNZA 5CCEA 2NXJA 4JP3A 2GD1O 5IFLA 1NG1A 3ES9A 4PIMA 5C46F 5IJZA 3HSKA 3O95A 4FYPA 2YFYA 4JOQA 3UWSA 2PX8A 3GVCA 3ZE1B 4ARSA 3QKWA 1Z9BA 3GCZA 3DL7A 2FDCA 2OC9A 1ISPA 3ZDZB 2YIDA 1RHUA 4XOIA 4Z4QA 4QGGA 3TNLA 1UOEA 3O91A 2OAGA 4JUCA 2WKQA 5KYNA 2DPHA 5LC1A 4KAFA 4DV2B 3NVAA 1K4YA 2XBMA 1V4VA 1NVWQ 2FXIA 3AFNA 3L7AA 1GAWA 3J81k 3RC2A 1KJNA 2ZU0C 3VR5D 4A0QA 1E9CA 1PWHA 3HYTA 1NXSA 2E2WA 3GMIA 4UUAA 4V24A 3ZHOA 4CHTA 4ESHA 3W8RA 4EHBA 1Q1BA 1VPTA 3LK7A 2QUIA 1SN7A 3JWEA 5F4BA 3T3HA 1ZIYA 3O75A 2APJA 4IDGA 1N2JA 3PPYA 4LV8B 2HIHA 3IPAA 1I7PA 2Q1SA 3CMCO 3HFJA 2P2YA 5D87A 5DYYA 2NVWA 2X58A 2JC3A 5LJLA 3ZVNA 1VKZA 1EPUA 3KOYA 2O8FB 4KN6A 3SZOA 1LZKA 2FW9A 3G59A 1JVNA 1NVKA 1P1BA 3R8XA 4MP6A 4LCBA 5G40A 4QYSA 1HT3A 2ETVA 1JEJA 3FCSB 3PUVA 5IKPA 4ETMA 3HZRA 3VR0A 1PK9A 2GNPA 4DXDA 3UWDA 1B76A 4C7KA 1QMPA 2A6PA 3MT8A 3FDZB 4KX5A 2YY7A 4CCYA 4ZYUA 3Q8WA 4FCVA 4ZN6A 2CVHA 1T5IA 5AVUA 5A0VA 4PG8A 2O7RA 1R6XA 3QVKA 4BUJA 3MF4A 3QW4B 2WJYA 4BPBA 3EGXB 3LY7A 4ERXA 2XAUA 2QSYA 3NC1C 2Q6TA 4UHHA 5AK5A 2VK8A 1CY0A 1AA6A 2VBIA 1G7SA 2GHRA 2DFPA 3IPRA 2I4IA 2QV7A 3A3YA 4BU1A 1GZ7A 1SK9A 1MNQA 1KZ4A 2JGAA 2JD0A 5CB6A 5TS3A 3E7WA 4Q82A 1C9JA 4RUKA 3VU3A 2XRFA 4B74A 4O4JF 3L82B 2VHJA 1UMBA 1QORA 3MT9A 3VTAA 1N7IA 5EWLA 4CLRA 2GSWA 4DHWA 3ZIDA 3OM8A 4FSXA 5EJ5A 2GBCA 2I1VB 2F1JA 2IYWA 2DHCA 4MX8A 3MJFA 1KH1A 3U7GA 3UK6A 5AW2A 1O6BA 1NV9A 1UWCA 2J0VA 3B48A 3DFUA 5FWDA 3W8EA 3WGHA 1SBQA 3A3PA 3KYJB 3TAUA 1RHRA 3G88A 3KEQA 3VH3A 3C5CA 5CDFE 1GKIA 1PW7A 2ATIA 4WKOA 2V58A 1PO7A 1ZCAA 4WV3A 1KNXA 3OTWA 3UMGA 4NHEA 2Z8YA 4LJ4A 4P38A 1R15A 3SE0A 4R71A 4XDGA 1T1IA 3KSMA 1CJTC 2GXUA 3HR7A 2QRKA 3WWPA 1LVUA 1EFPB 1ORWA 3LWDA 4J8PA 1YJXA 3LM8A 4B79A 4IQ0A 2WTAA 4JR0A 4HRAA 4AP6A 1QRDA 2IPXA 1M33A 3VZBA 3W06A 4YP0A 4OP2A 1SCUB 3BIJA 3PEVA 4QYWA 5FUMA 2OXIA 2CFTA 1LXCA 2QTRA 1TUEA 1EUCA 2R1TA 3E05A 4HD8A 3GLFA 2NWQA 1PJAA 1RQNA 2W6MA 2WU1A 4HZUA 3RS8A 5HR5A 4I1SA 4KRFA 4CM5A 4L16A 1EG2A 2QLJA 4WBNA 4ZEVA 1T4CA 4JBHA 2B83A 2XGSA 3JTMA 2Q2NA 1R4ZA 3LL4A 1JIKA 1WQ1R 4XQEA 5EFZA 3O4RA 1YZQA 1ZINA 3E03A 3AMVA 2RHDA 2Z58A 1P9OA 4FBGA 2D59A 5E6UB 4KO4S 1XBTA 1KI6B 1IN8A 1VTKA 4S1VA 1GV1A 4IJUA 2IWHA 3SYRA 2VQEB 3PWZA 1V2GA 2RHHA 3B5IA 2K6GA 4EB6A 1PJ2A 5FIUA 3ZHZA 3KRTA 4AX8A 4Q7MB 3EXFB 1KZ6A 3M3HA 5G02A 2DHEA 1M83A 1X70A 2AJBA 3TW8B 1BSVA 3TZHA 4IF4A 4QRIA 3G8DA 5CURA 1HG0A 2VLBA 5K0ZA 2N42A 2ZANA 1NUQA 3QUTA 5EKUA 2YHUA 4CT5A 4DLVA 4UEKA 3QBJA 4AIRA 4B33A 1TU4A 4R2WA 1LPNA 2C59A 4GNRA 5E4YA 4PYRA 5TMBA 4BP3A 4DC1A 4DG8A 5JBNA 4PC3A 5KSWB 1JS1X 2B35A 5HCIA 4P5PA 2PAAA 3WLKX 5AXAA 4HGZA 4CTMA 5LZ2A 4CW7A 3DVLA 1XQ6A 5LOVA 3AUFA 4UNIA 1DQSA 3G8YA 3OJCA 3P0HA 1JBKA 4I5EA 4MV9A 1T5SA 1Q83A 3BQ9A 3JSXA 4P4UA 1LBIA 2Z0MA 3VYTB 3BILA 4OXNA 5JD6A 2Q4EA 2AJTA 3I32A 1IYZA 5JZMA 3USZA 4EY5A 5CCBA 1WW2A 4R68A 3JQ7A 5EE9A 1BJRE 2Q0XA 3IVMA 2PLWA 3PF8A 3ZJUA 2DERA 1MQAA 3CEMA 1HEYA 5EEGA 1FP4B 1UDCA 2IE8A 3CSDA 2QTWB 5JPCA 2NPIA 3SYKA 3FNGA 3FPEA 3LT0A 1XKLA 1N8KA 1WCV1 5BSGA 4OU4A 2OZPA 3K0BA 1CY8A 1J97A 2D1FA 3C16C 2ZYVX 4IIXA 1VLQA 4CM7A 4ZCMA 1S3FA 1Y3BE 2BVNA 3E48A 2HNAA 1RI4A 1TCVA 4M9CA 3SJUA 3NTUA 4Q1EA 1DNPA 1TEXA 3M4ZA 1QB7A 4B4VA 4IGEA 2GPSA 1K6MA 3G7UA 4IR7A 4UXIA 4U6SA 3DEAA 4KIWA 4YUZA 2JHPA 4IRUB 1MH9A 2F3PA 4IVPA 3G3EA 2ZVDA 3ZNOA 4WOBA 3RVMA 2R1ZA 4MYRA 4OGLA 3ILXA 3EWAA 4OL0A 1ZEMA 1NMQA 3G1UA 4NIMA 5IFKA 1WUYA 2C7GA 1D8TA 5FI5A 1X0XA 3RBZA 4QLOA 4DCCA 4YDSA 2WTUA 2NACA 1EX9A 2QAGC 1K8XB 3CEJA 3GAAA 2P0EA 3VPSA 1DEXA 2OV1A 5FBVB 2Y1FA 4ZYLA 2GKGA 1ZI6A 3WADA 4EFKA 3V8BA 3VNVA 6AT1A 1FTQA 1E2LA 2EW1A 4UU8A 1G7RA 1AKMA 5K3EA 2P2LA 3QHAA 4MPTA 2WKSA 4D3FA 1E9FA 3KTAA 4LRSB 4PGHA 3WSWA 2NM0A 1E7WA 3TUZC 2YMQA 1TA9A 4K05A 1J20A 1SD5A 1G19A 1OGJA 4YY3B 1YF3A 2IHUA 2I76A 2XZDA 3DVAA 4FOTA 1YZLA 3JQ9C 3TJRA 4YRZA 3MYRA 3K4QA 4I4TA 4G1BA 4K46A 3SS7X 5HIKA 3SC4A 1VKRA 1AB6A 3WL8A 3R3WA 3ESRA 4G2TA 3IE1A 3DBIA 1C3OA 4ZEWA 2FMTA 2CEKA 3WTBA 2ORIA 5ILOA 1Z88A 2BD0A 2Q3FA 3A36A 3D64A 4A2PA 1UUFA 1GNRA 2PR7A 4JKOA 2VDKB 4X85A 3WGTA 1L0BA 1FIUA 1EFUA 2ZWVA 2ST1A 1G3MA 4BTVA 2D5LA 5J59A 3SS9X 4DMHA 4TLDA 5KDDA 3TGPA 3P9IA 2WW8A 3DGFC 3IPYA 1DC7A 3OZTA 4JQYA 3EZYA 4LDZA 3MTQA 1RC0A 4MLCA 4BWVA 3L18A 3JD2A 4ZALA 3B8EA 3DB2A 2FX3A 4U2CA 3OKFA 4OSOA 3KJGA 3K5WA 4GI3A 3GGJA 3V55A 2EP8A 1I13A 3GBVA 4HK4A 2IODA 4TRMA 2O0LA 5FH9A 1QUFA 2O20A 4MS3B 3DOUA 2F1OA 4PVCA 1Q1NA 3GUYA 2A78A 2G70A 4AIIA 8ABPA 1BROA 1NASA 1W2GA 1KY4A 4RE5A 3U60B 3ZJVA 1R6DA 2R6GA 2DTXA 3K0AB 4L3WA 1QS0B 2P4SA 2RAVA 3OVMA 4A0HA 2BUBA 3LV8A 3P4UA 3A1NA 3TOCA 3GRUA 1IBKB 2JIZD 5IKMA 4C4OA 5KWIA 2RGRA 2PJDA 4J1TA 3E22A 1UKCA 4IY1A 1KK2A 3FHOA 5BQOA 2I0FA 2XQJA 4EKNB 1LDNA 3T3NA 1R37A 2BE7A 2BR3A 3KKQA 4MARA 5DBGA 3TG2A 2AS0A 1KAHA 2WHXA 3GJQA 3PIRA 4HQFA 4HLUA 1BXRB 2FMKA 2PCJA 1XHFA 3BL5A 3IDZA 3MOSA 3AVTA 3CNHA 3I6IA 5TPZD 4DJTA 4RJTA 4B3HA 3JZFA 4M9SA 2OCAA 2BKAA 4XSHA 1EGMB 2VPXA 1KMIY 4NXNB 5EIOA 4OQXA 5AESA 2ZSKA 1X92A 4HWSA 4BFYA 1BVRA 3L0CA 4Q3BA 3PFWO 4L4XA 1RPNA 3GJXC 1DG3A 2ZSEA 3ZOKA 3SBOA 3LO5A 1V95A 1GCGA 1HLFA 2Q1YA 5CLFA 2VCYA 1SXJC 1E1CA 2N1BA 3L84A 1MNAA 2BJHA 1ZD3A 3T3IA 2XE6A 1VI2A 5CITA 2F43B 1KSJA 2TSYB 5EIHA 4IEFB 1ELOA 5B57C 1F0YA 1SHLA 2AD1A 3FD8A 3QVUA 5ALDA 4U2KA 2C3PA 1R8YA 1RACA 2J0QA 3LLUA 4O4IA 4EL0A 3AH8A 2IU4A 5BUQA 4AF6A 1YRBA 3LD9A 5AI6A 1U04A 3RBVA 2AA3A 2ONCA 4K6MA 1JU3A 2NO4A 4TXLA 1G6OA 1HZZA 3O9ZA 4ZAWA 2PNJA 1AK9A 3QQ5A 5AKZA 1NJ6A 2NXEA 3PIIA 2E5LB 3I73A 2BFAA 1VLVA 4GMKA 3GZ4A 2IXBA 2D3WA 1GR0A 1X19A 4R83A 2V7GA 1EIWA 3ULKA 1N2XA 1L7MA 2VSYA 2ZR7A 3ZJTA 1L5RA 1IM8A 1OAOC 4JQSA 4HNAA 2LIVA 4OKIA 2VNJA 1M6YA 1NQTA 4G8DA 4DEVA 5CXUA 4DQ0A 1SKMA 3AY6A 3SQMA 4WXPA 5F1KA 4NC9A 1DQZA 4LC0A 5C7YA 3LYLA 3SIWA 3JQFA 2C07A 4Y1EA 2G9NA 4F5WA 2F3UA 4ARAA 4B7UA 1GDTA 3UVEA 4JS0A 3LT2A 4B3CA 3EVBA 5EN4A 4DA7A 3GLHB 3N7TA 3RYTC 3FTQA 2IDZA 4PQGA 4QG3A 3SEFA 4UOZA 3T5GA 4DKJA 2RGNC 3NJ4A 4B44A 3LSTA 2B61A 1QZXA 4HDOB 2PV0A 3E2PA 2WKRA 4DNPA 4HDRA 1DV1A 1GPWB 1A1SA 4DSTA 1T6XA 2JBHA 1D9XA 3H9CA 1DKPA 3HWSA 3KL2A 5FUBA 3UAZA 4G2NA 1U2DC 5DGTA 5IVKA 1H2WA 4CL8A 1KIAA 3H0KA 5EAIA 4W8OA 3TGWA 4G07A 2IS2A 1V8ZA 1G0OA 3FOCA 3L93A 3KTDA 4KPUB 4EB3A 1KDPA 5CB8A 3S7ZA 2CLIB 4WIAA 5BW6B 4G3XA 4PZPA 3G5UA 1IWBB 2WYOA 3HWRA 4XM2A 3ZH9B 3IP6A 4P31A 1EFPA 1DKQA 1VSVA 1Z47A 2V9CA 2SKEA 1ID1A 4A0GA 5LU8A 2WD7A 1NXQA 3FNBA 1JU4A 1NULA 4F91B 3J80A 1LLUA 3KYCB 4O29A 5DKFA 2CLEB 3WAGA 4EHIA 2ZRHA 3BRWD 4R2KA 2XXAB 5E9WA 3AVVA 1SVKA 4MLZA 5CH8A 4BQNA 2GN1A 3KOOA 3QWHA 5AKGA 1PR3A 3KCNA 5AKLA 4DNOA 1WRBA 2YV3A 1GGHA 3WKEA 3ZWPA 1F8YA 5BWMA 3NANA 4TRNA 2BFEA 3UA4A 2JHFA 3M70A 1KFEB 2XNHA 2VHCA 4U5XA 3H13A 4DABA 5C4IA 2ZE5A 3PDUA 5CXSA 4DA8A 5E6UA 2OLEA 1EQUA 4RK4A 1P81A 3ZIUA 5BVHA 1V16B 3REFA 2YH2A 1NBMA 3ZV5A 5FULA 4F2WA 5CAEB 1DRKA 1QOQB 5CB4F 2V6FA 2UUOA 3VU1A 1XVUA 2WA1A 3IBTA 5CR9A 3EXFA 2B4TO 4B7ZA 4CU2A 4IICA 3OT1B 5KKCA 5KO2A 4O1MA 4RIGA 3F6EX 4IKEA 5CLGA 1NWHA 3GCXA 5DBIA 4F9EA 4L51A 1PU2A 5FOXA 3D4IA 3QU7A 1DPGA 1ABEA 1KIFA 1X77A 2WMYA 3A26A 4PYOA 3O8OB 2F55A 1HEIA 4R01A 3IIJA 4UJ5A 5DW3A 1U2TA 4RESA 1EVLA 2RGCA 3ENKA 5F9MA 3ZHRA 1T9DA 2EDAA 4OAPA 1XDUA 4BNJA 5MGNA 1IOVA 4XVQA 4YAWA 2HRQA 3ADCA 4GOKA 5JXHA 3HDJA 3G1TA 4JYMA 3OECA 5CPFA 1ISGA 4YRAA 1FFSA 4BZQA 3TVYA 3SMQA 3TKLA 2ZT6A 3KJIA 3NUGA 1ZI9A 4CLHA 1K3FA 2CB0A 1T36B 2CLSA 2J32A 3B1VA 4YRDA 4BVAA 1VIYA 2VDWB 3UHAA 3L7DA 2GR9A 4V2UA 1N2CB 1COWA 4PRYA 4A0SA 5JS8A 2XRYA 3I5XA 2VF2A 3AOEC 2GZDA 3TKYA 3VJMA 4UAUA 4EUFA 2NZJA 3PXEA 4PLWA 1FQKA 1I3MA 1VSUA 1H1LA 1V1RB 2X0NA 2DJ5A 5ED0A 4EY7A 3LAWA 2HSJA 3NHSA 3ND5A 2Z9BA 5FPPA 2WUWE 3IERA 1ZX1A 2HNBA 3HA5A 3U4CA 1LVHA 1XZEA 2R6FA 2VAMA 4TV8B 1WQ3A 4AJPA 1KYTA 4C29A 4R2IA 4WNAA 2XT0A 1P2VA 3DDZX 2QMUA 4M8KA 4RY8A 2BGWA 1H4SA 1JYEA 3KXLA 5CU7A 1N9KA 5KOIA 4QGBA 4MAMA 3LYUA 5E6SA 1A4IA 2HCTA 1KTVA 4P3KA 1E98A 2ILTA 4KQHA 1CF2O 1EFKA 4EJ6A 5EWJB 1CCWA 3DC7A 3M5DA 2G7ZA 2G1UA 5EPOA 1CIJA 2H11A 4E31A 1ZVQA 2QNIA 2O8EB 5HF5A 3O31A 2F9FA 2QVXX 3NBUA 4S2UA 4P08A 5A4FS 5IJ0B 4FMDB 4RPLA 3U49A 1IFXA 4ZKEA 4E1BA 4FLEA 1L6IA 2ZYHA 3NETA 2P2GA 1J70A 1M7HA 1SJ9A 2PBLA 2WD9A 3DE1X 1WOYA 3VGPA 1GZSA 4IHJF 3SLGA 1IPHA 2XOKA 3LZ6A 1AN9A 3UCEA 1SO8A 5FUXA 2Q2QA 3Q8MA 1MOQA 5TRTA 3C39A 4DNQA 2R5FA 3G2OA 2QYSA 3SXJA 1VRCA 4V38A 5A5GA 2PFKA 1TMGE 3E3OA 2GK4A 3A58B 2EWVA 1IUPA 1VYVA 3T5CA 3V00A 1RYEA 2CBGA 2O1SA 1R5NA 3IEXA 4XPZA 3T95A 5KSOA 1E6WA 4DUZB 1P0CA 3MGAA 1T8WA 4AO8A 4NJMA 1OLUA 1KVRA 2Q1XA 2BGMA 4QFBA 3EJ6A 1ODLA 5K0NA 5D84A 4J2HA 3WK5A 1XTKA 5CFQA 1K6XA 1YZGA 3H17A 5CIWA 5DIZA 4M0KA 1RI2A 3I2KA 2E3JA 1HMYA 1XRJA 2OHIA 3IDSA 5CW2A 3NH9A 3NM4A 4EHLA 2VSQA 4RLHA 4C1BA 7REQA 4ZYWA 3QPVA 1SB9A 1E1LA 1D2EA 3CN9A 4WQMA 1XNQB 2W6JA 5KTOA 3AR7A 3VPCA 6GPBA 4G0VA 2FEKA 1KEKA 1FC0A 4YRGA 1RCFA 2JFOA 3C7TA 3TNYA 1L3IA 4UUPA 1TKAA 4EA7A 5MF6A 1CD5A 4IH9A 2E4ZA 4ZGGA 1AO0A 4C2BA 3LI2A 3M2TA 1VIAA 4MYSA 2IPLA 5E3HA 3ICVA 5J5CA 3DBLB 1WW8A 2AOTA 4IIJB 4QJ5A 2J59A 5EMKA 5T4FA 1XZNA 1BXRA 4G0NA 4B45A 3SS8A 1YOBA 4XGQA 3WA7A 3DOCA 1WHTB 2BTQB 3WYCA 2TMGA 4Q7JB 3SD7A 3L7MA 3WOVA 1M8JA 3IXMA 4DLSA 4UU0A 1H5UA 3HC7A 3SZMA 2ZUUA 3GLHE 1H05A 1Z0AA 1PQPA 3HVKA 1JJIA 4V0LA 4AYXA 3AEKA 5A3VA 5IKXA 1T2EA 3VI3B 4N48A 1GAEO 2W2PA 5A5EA 1FA9A 3H3XA 1C3XA 1KJ9A 3KK0A 4KMOA 1R66A 2XTJA 3ISJA 5A5FA 2F43A 1V96A 3FPAA 1J1UA 1Y5IA 2ZJ0A 1AKTA 4P3YA 4Q34A 3SZGA 5IC6A 2FETA 1EFLA 2J3JA 2I5PO 5BYKA 3U3DA 4II2A 1EXVA 3QOXA 3H2ZA 4K87A 2C4VA 4LY0A 4RFSA 5F2KA 1YQ9A 3VDNB 3HY4A 5JASA 2YHSA 3WIUA 1D6SA 3UJ3X 1PNVA 2JGMA 2OCDA 3SJBA 1KETA 3QHPA 1HKUA 3N74A 2YCBA 4ZD6A 1DCKA 2WM3A 2XH8A 4OQPA 4TT3D 4LF8B 1KC1A 2QEQA 3W2HA 3NBFA 2A2ZA 1Z7BA 2OBXA 3GLGB 1ISSA 3LCMA 5GV7A 1PV2A 2M1XA 1KRHA 2FRDC 3CKKA 3Q1LA 1JEAA 3SHFA 2OFPA 3AUKA 1V1JA 1CUUA 3R3HA 4E15A 3UMVA 1ABFA 1CDEA 1EDDA 4JLUA 4GPEA 3HYRA 4ZC8A 4BX9A 1SUIA 2FMUA 4RTJA 3A1DA 3AFIA 3BBPA 1LF5A 1HI9A 3ISTA 4I5FA 3ED1A 4W63A 4MKZA 2CCKA 3LS2A 4PY2A 1VE3A 2GARA 1KYYA 2PWZA 3U5ZB 2CKDA 2Y0EA 2JFZA 1EBUA 3WRXC 1OYVA 3PQ8A 3GLUA 3UMCA 1SXPA 4OXKA 1RU3A 1WSWA 3ONFA 1C8KA 3G8AA 2E37A 1QK5A 4YREA 1H4TA 1EGAA 2PRZA 1J1IA 2DCUA 3N8IA 4O4LB 5DT9A 5EQJB 3QBDA 5REQA 3M3DA 3C1OA 2F9MA 3COPA 1L7RA 2BGNA 2C1EA 2C5HA 5B64A 4NZNA 2R79A 2WTEA 5K4GA 4KZKA 4QDXA 2P6OA 4M9XA 2LWIA 3B1FA 1OXSC 4GPZA 1M34B 2GILA 5HDBB 4F3CA 2YY5A 4IMIB 1Z26A 3C74A 4M9ZA 5IKEA 3EOAI 4XB1A 1W0KA 3MB5A 1KXZA 1SXIA 2WU4A 3PDCA 4ID3A 1DDOA 4BNTA 2GTIA 1BVUA 3OQNA 2A59A 3PUYA 1R8SA 1CUDA 4JLMA 2FG7C 4RF4A 1FLAA 4INAA 1U0LA 3PHLA 1WDKA 5EOVA 1N2CE 1LW7A 4E1VA 1K5HA 4YGXB 2ZJBA 3H86A 1Z45A 4EY4A 2F8SA 1UPXA 3NDBB 4F4HA 3CZPA 2VIIA 4I55A 4ZQEA 3AHHA 2IQIA 3B3QA 3BJMA 3OIUA 4YCBA 3WGMA 1Y6FA 4UKDA 1NR1A 5F64A 1FMTA 2DTDA 5K1ZA 2PRIA 2GZ2A 4POOA 3FRHA 3IOYA 5G0SA 4RPCA 1P74A 3K2IA 1UMCB 3BFJA 3N75A 3NGXA 4RD1A 3SVTA 2JLWA 2DR3A 1LPAB 4KXWA 3PIDA 3HUEA 1H2RS 1WD5A 5CW1A 5A03A 1LPMA 4ASUD 4EATA 3ZKWB 2W11A 4Y67A 2X0EA 1G16A 5K8CA 4JVMA 2AKEA 3ZXYA 4FBMA 5CVTA 1X13A 3KB8A 1S9DA 1T26A 3IOCA 1I5OA 2WNIA 2O59A 3VR4A 3TRIA 2W58A 4X3PA 4DMMA 3BC1A 2BZSA 3GGCA 2G5TA 4PQEA 4X7RA 4B2PA 4F04A 4YLYA 4BMPB 1D7OA 2FUKA 2P4HX 1SUEA 3ET4A 4DPLA 2OCBA 4HQKA 4CEIB 3R7WA 3W7VA 3IJ5A 1CIPA 1GA4A 4OIFA 1G38A 1NBHA 3FPHA 2HDWA 4QOEA 1QHHB 2RIPA 2QP4A 3ZS9A 1A9PA 4C05A 2VDWA 2Q5EA 2HSZA 3MB8A 2FPPB 4FGKA 3ADKA 4OHMA 2R2GA 1XAHA 3E84A 1ECGA 1HY3A 5GONF 1JLSA 1Z2PX 1EUQA 3I4LA 3UUWA 5BWBA 4MQMA 4D8YA 3BWYA 2A9FA 1T35A 1XEXA 3CX8A 3TLGB 1ZQ9A 3QEBZ 2FRVA 5A1TA 4GPAA 2ZJOA 2JGRA 1C0PA 2O23A 1RAHA 2AIRA 3O4FA 3OCUA 1E9SA 2VP4A 2WPDA 3PNVA 4JI5B 4A8PA 1D1PA 3BDIA 1H2YA 4MKGA 4PYLA 5T5QA 3W7AA 1NVEA 3SYTA 1IHPA 1FNNA 3D8SA 4M0FA 3F3KA 1TVCA 4HXGA 3EA4A 4PZEA 4YTEA 2C78A 3R7DA 4TUYB 4GMHA 4DLYA 3OQMA 2O8DB 1QG4A 3RTEA 4QDZA 1FSGA 3JWGA 4YA6A 4U2EA 1BA2A 2B25A 1UIMA 3HYCA 1E2UA 1VE6A 3GFRA 2QPOA 4ZEMA 1JXMA 1SZJG 3ZU6A 1O94A 3OX4A 3WYDA 4LJ6A 5CNIA 3O1LA 1X7DA 2DBZA 3K6SB 4MQ5A 2O8EA 5EZ5A 1QCYA 2WJ3A 1VL0A 2A9OA 3GJ8A 4Y6QA 4TM7A 4RZSA 3AVQA 1VHLA 1XQXA 3H11B 4HO1X 2ZUCA 1J0AA 1JEQB 3KALA 4JVSB 3A9TA 2ZB7A 3FNQA 4PFQA 3SP1A 1USVA 4EVQA 1JILA 3JYLA 3K3PA 2D1QA 3T5MA 3EODA 1CDDA 1RQPA 1GTL1 2VDMB 3ESQA 3JZIA 1DAPA 1SC1A 4XJVA 3WGIA 3RTCA 2WB2A 4PPFA 2F2TA 2UZ3A 3UWKA 1Z22A 1JTVA 2FEOA 1WZIA 4GLJA 2AEMA 2XI4A 4BUCA 5JJ5A 3F73A 2GZHA 4KSCA 3C8HA 2FLKA 3TVDA 3T7CA 2DMRA 2A3NA 2DWPA 5JT1A 4OREX 2GEUA 4PWYA 2VHVA 2VHXA 2CKMA 2XDQB 3D3NA 3H7AA 4YGYA 2GZ1A 2ERYA 3TIGA 3ZX4A 4MW6A 2BMWA 3HDVA 4FHZA 3DE0X 4Q4AA 1A5BB 2JIDA 3UPDA 4ZMBA 1JAZA 5KVAA 1E2PA 2FSVC 4RDXA 2AJDA 2ZBVA 3ZCXA 4QT4A 2Y1WA 1V8FA 1DKNA 3UUGA 1MD9A 4B48A 5FTJA 1JYFA 1YIDA 2ZIXB 3JYPA 3UNXA 2A1IA 1A9RA 4E22A 2HD4A 3NVKI 2QMEA 1GVHA 1XCPA 1MKYA 2AF3C 2QTVB 1H85A 1SGWA 3CA8A 1NBEA 1VJ1A 2PS0A 3GN1A 1OSNA 4G89A 4XVHA 4JI7B 1MP0A 4Y2QA 4URHA 1A8SA 1Q7BA 4ENWA 4DV3B 4K8RB 3WA6A 5A9SA 2JFUA 2WWTA 4RHUA 4DG5A 2IX3A 3SF8A 3UAYA 1YVPA 4BNMA 4C2UA 1RI3A 4FXPA 3RW9A 1NI4B 3LIIA 3LRXA 2E55A 3NDRA 3SZLA 3EEBA 1I4EB 2XX3A 4Q3CA 3VZCA 4A82A 3EYAA 3L5OA 4IXNA 4QHYA 3EXHA 2WNHA 3RIGA 2JIMA 3GLGE 2SHKA 4B6QA 2PKEA 3QBVA 4OHZA 3VBEA 2E4VA 3EZGA 1EFRA 3RROA 4ETIA 4CIBA 3OU2A 1WHTA 4KP7A 1JUDA 4B31A 5FOVA 4JC4A 1MU0A 1N9ZA 2ZRMA 3PE4A 2NUTA 3IILA 4WEQA 1RFLA 2F3RA 2JIQA 3A1SA 1Y82A 3C24A 3K16A 3PUKA 3VR3D 4OA5A 2IP1A 4EQ6B 5BMVF 4TT8A 4MYTA 3MBKA 5CTAA 2Z6VA 3FPFA 4BMNA 3FYHA 5K8JB 1MABB 1E0AA 2ZRGA 1YB6A 4MCJA 1HDIA 3QI2A 3SSAA 4IO0A 1XXLA 4AM8A 2VJAA 5I7VA 1DC5A 2UZ1B 4KXFB 5B55A 4ZT2A 4P7FA 1SBCA 3DE5X 5IDWA 2X4LA 2D54A 3NEJA 1OX5A 3P9ZA 1GNSA 2OORC 1P60A 2FOLA 3K0FB 1NNEA 4A10A 2HA0A 2WF8A 2DAPA 4BWFB 5CIQA 1JAHA 3KOXA 3MG9A 1OVGA 2JAQA 2Z30A 4GPTA 2ALJA 2LGJA 3N5KA 4FCCA 5DTQA 4ZAXA 2JLVA 4L4UA 5A4KA 5HGXA 2E4YA 5DBFA 5E1DA 3LX5A 4RTOA 2X2FA 4FONA 4C9BA 1UK7A 3REOA 2OOSA 1JN0A 3IQXA 1M34E 3FZEA 4JUAA 2OHXA 1R0RE 1DRVA 5J47A 4MK4A 1QGED 3UHFA 2QUZA 4MVJM 1QNLA 3ZQ4A 1E3MA 4DCJA 2FX2A 2IZZA 2RHLA 3E8MA 3O2QB 1RKQA 1RTKA 4YJGB 5G4KB 4CETA 3CVWA 1ISJA 4YCNA 2O2JA 4JJGA 2AW3A 5IJXA 2HKIA 3WGVA 4P36A 1SB8A 3AM1A 1PNOA 1USIA 2A0YA 2OQ2A 3WIEA 4BVEA 4REOA 5E4JA 4C1NA 4ZGWA 2HLPA 2EZ8A 5F5NA 2YOFA 2H48A 3A1EA 3CLRC 3OIFA 1HLPA 1KSHA 3QVTA 4A16A 621PA 1SR8A 4TZ0A 2AOXA 1MB4A 4PCLA 4TYPA 1SOAA 1JFLA 2PO7A 2FR8C 1JJAA 3M4NA 3AUTA 3QKSB 1Z0UA 4BN5A 5KX5F 3AETA 2ZYSA 4TV9A 1KAGA 1U2RA 2OGZA 3K9CA 4ER3A 1BOOA 1WEHA 3PQCA 3ZWQA 5L45A 3KQMA 5CGZA 2BEVA 2QZJA 2XTZA 3R7FA 2HAEA 2QPLA 4BKMA 1UAGA 3LVFO 3VV3A 4L1KA 3VDRA 5DP1A 4W1PA 3RCBA 3FF4A 5C9ZA 1RRCA 2HT1A 1QF6A 1WX1A 1H9AA 3I28A 4NZ9A 4OTZA 4G8CA 4N9QA 1E32A 4S2EA 1G5QA 2YQZA 4WLFA 2SNIE 3DBVO 3EQ7A 3TBHA 3BB3A 4LQLA 3VJKA 3WLIA 4B3JA 4CFYA 3IB6A 4QD3A 1IHUA 3LPNA 1PYGA 4O59O 2BWJA 5LQUA 5A1JA 3EEFA 1DXQA 3ZDFA 2ZKLA 1JG1A 1QDEA 3CKLA 1ACMA 4X1KA 3K9QO 5JCJD 1ZL2A 4N54A 1B6RA 2VZEA 1U4OA 1V5FA 4ALKA 4YIKA 4CKBA 3DE2X 4ZT3A 1L7BA 2XSZA 3KZNA 4MHSA 1NTRA 1UL1X 2GTHA 4WWHA 1NYTA 4JJ7A 1S8NA 3DULA 4MULA 3T4EA 4BFSA 1DI0A 4LSGA 4I6JA 2ZYWX 3W78A 4YUAA 4LK3A 3JU3A 1ESNA 3V4OA 5D1HA 1JRLA 3IEIA 1WUTA 2YYZA 3LCRA 4V39A 2WNSA 3DE6X 1Z3CA 4WDRA 5BVHB 5EIEA 2NUAA 1T9KA 2XCIA 4KCGA 3DXXA 5JW6A 5HTOA 4KO1S 2WDPA 4K9MA 3I6ZA 4N41A 1Q7TA 1UODA 5JVDB 1X3LA 2I6XA 3I8XA 5JAOA 4QBFA 1UJ5A 3ODPA 4QAQA 3UJ6A 3AR8A 5EJ8A 2O8NA 2PKQO 2PUCA 1QZ3A 3NI2A 4YBRA 1JH9A 4OGFA 2HMTA 4ND7A 1WCIB 3CNLA 1QXSA 2WWWA 2P2CA 1YWGO 4JJFA 2QVYX 1KQ3A 1DJPA 5LXTB 1NF2A 4Q47A 2EYUA 4FJ2A 4M9QA 3W3ZB 4D43A 9MHTA 4AO6A 3MMNA 1SKQA 1L8AA 1SNYA 1T2CA 1VXOA 3C3EA 4R1PA 3UWOA 1BFDA 1CP2A 4QQNA 1W7AA 2IXGA 3RAFC 1NM5A 2QLLA 3ERCA 2Y27A 1P17A 2VH2A 2FPPA 1UDRA 3VYSB 4RMNA 3MJCA 4BQFA 5LP6A 2ILVA 1PV4A 3GUZA 2KS6A 1IQRA 3OSUA 1ZC3A 1C4KA 2ZJFA 3T6KA 1LNQA 4AULA 1CJVC 1G2PA 1TUIA 4YP7A 5AVWA 5JJCA 4JZKA 1L9KA 3VR2D 1KFCB 3ZE7A 2BLNA 3TLGA 4B7AA 1YNOA 2P4QA 3PGVA 4K9QA 4KN5A 4P83A 2C7QA 1EXNA 1SHJA 2DZDA 2G9ZA 3S2YA 3VQTA 2WQ6A 3QXCA 5CT9A 1YU6A 2WYHA 2HM7A 2H92A 1NUUA 5KJ6A 2C7BA 1JQJC 1FFAA 2ORED 4KDEA 3S1AA 5NULA 2YQ4A 3AEUA 1MQSA 5F1PA 3OAAD 1R0WA 5JS6A 1X7WA 1LA2A 1JKIA 1SBNE 1P73A 1ZH2A 1AD2A 2GN0A 3DHVA 3ZWKA 5JFGA 3PVSA 2YQ5A 1WIWA 2ZT7A 1AZSC 3EA5A 3KKOA 2A7XA 4PEVA 1BE1A 4IJVA 4KOAA 3R7SA 1XI2A 3G2JA 4EL5A 1M1XB 4IDFA 5JCXA 4ZU3A 1UJNA 1SQ5A 1WVIA 3ISVA 1Y1PA 3ADDA 4C7OA 5KYWB 5E4FA 5DDIP 2R8OA 1J33A 1CZLA 1Z2OX 3F5MA 3CG0A 1BCRB 2E4XA 3T06B 3KSAC 2O2GA 1SVWA 2WJGA 3ZHCA 3E5RA 4OJTA 5E1OA 2WJWA 1O6FA 3H2IA 3ZLBA 1A3CA 1D2NA 2KJQA 4BKOA 1ODIA 1G17A 3WAKA 2WEKA 5GIPE 3F8SA 3P5SA 2P65A 4MGIR 3ZKAA 4KOEC 5AD1A 3SXUB 1BDHA 1CQIB 1I3LA 1WCWA 2CL5A 2XCRB 2QBYA 3PC6A 4QPCA 4DMFA 3EN0A 2ZB8A 2QMYA 1VPDA 5ALYA 4FT2A 3X1XA 4AN4A 1QO0A 3UT0A 5L3QA 3WNVA 4UTZA 2X40A 1QYIA 5JECA 1HPLA 1ZUHA 4LRUA 5I3CA 1DE0A 1S2LA 3IUMA 2A33A 1M1YB 4K6FA 3LQFA 3QELB 1XLWA 2MSKA 1RE1A 4RF3A 5JTTA 3KAJA 3THOA 2JDIA 3LKZA 3WXMA 1RQ2A 2XCTB 4YDHB 5E3JA 3I8SA 3NNNA 2AWOA 4AUKA 2PE5A 4EA8A 2BRUC 5FI3A 2NQ8A 1CUEA 4YX9A 5LOVB 4LK2A 4NK4A 5A3QA 4E08A 1O08A 1ZSYA 1XAJA 4TTSA 1YE3A 3PRKE 3GI1A 1J8MF 3DKIA 1R3DA 1UXHA 1MZVA 1X38A 2QSUA 3OZRA 2RK3A 4N8DA 4PZZA 3CWCA 2PX6A 1ORRA 4DREA 4ZQHA 1Q57A 3EWNA 3USCS 4D8UA 1V1MA 3C43A 3OEED 4FKZA 3L6EA 2Z2YA 5K03A 1T0HB 3V8EA 2JHCA 2VKQA 1QG6A 2YFHA 1ZH4A 4JYBA 2AC4A 4ILEA 3GLSA 4ITUA 3D7MA 4BQSA 3JD4A 2LKCA 2OTCA 2Q2VA 3S28A 4L9SA 1MUUA 4K8OA 1NI4A 2V1UA 1X7XA 2V7BA 1IY8A 4AG3A 2NGRA 1Q1EA 4QVIA 1U3UA 1E6EA 1Z12A 2H3EA 2WM9B 4TLAA 5EHQA 2OBMA 2WSSD 2VAVA 1TAGA 3D5EA 3ZGZA 1M8PA 1SBHA 3TLBA 4TXJA 4BO6A 1GZ4A 1JPNA 4NECA 1KYIA 3MELA 2FWRA 5JSZA 2CVQA 5K20A 1TC1A 3PR2B 4PQFA 1WTAA 4DL9A 1IZ8A 5ICEA 1W581 1FOEB 4I0WB 5CA0B 3IIMA 5JEEA 5LMCA 4HADA 4WN9B 3DYIA 4H59A 1BMDA 5ENZA 5FHQA 3P9QA 1XEWY 3VOTA 1JAYA 1WS6A 1XTBA 1F1JA 1MABA 2CXNA 4EW6A 3RLFA 3OHPA 4OYRA 3T1NA 2XYGA 1EVQA 1IONA 2C96A 2E6UX 2JCGA 3IXLA 3BHIA 4A5OA 3DMYA 3M6MD 3R23A 1E1RD 2XITA 1EBFA 1SC9A 2YN4A 2C8VA 3LXRA 1QGAA 3B1XA 4HWGA 1R3UA 3RAJA 2P6UA 4U7TB 1U5CA 3QLVA 5CBPA 2IXEA 5DTEA 5A3SA 2E7ZA 2NUPA 2DBRA 3OPVA 4WNCA 1TMKA 2V03A 3LHFA 4GOOD 3FUXA 5LFAA 1KYQA 1UXOA 2AYXA 2CD9A 1X1EA 4RVOA 2ONJA 3NWOA 2VOEA 1IZ0A 4AWXA 3ACBA 3K4HA 3OMWA 1XQWA 1NXTA 2IHBA 4G5OA 5FQNA 5KI6A 4MI1A 4DR1B 5FHRA 4MGYR 1YJAA 3ELYA 3QWBA 1K08A 4N3GA 3QEJA 5HKAA 1BMQA 2QE6A 4CWAA 2I1LA 1LPBB 1KYZA 1R8JA 3RODA 1UP4A 3WG9A 3MCAA 2YVKA 4ES6A 121PA 1E0KA 1DTWA 2WM8A 2WVAA 1KOFA 1YTUA 3NHJA 4B81A 1Z6TA 3CZ5A 3CO0S 5PNTA 2XE4A 1UEJA 3L79A 1GVNB 1YVUA 2P6PA 5H83A 4F6CA 1FS5A 3K8YA 3LLMA 4B2LA 3INGA 5DNVA 3BB1A 3FMFA 2HA5A 3I0NA 1E20A 3K20A 4F3TA 1Z5OA 1L4HA 2ZUWA 1ARZA 1L5VA 4L8FA 3K9NA 1MO2A 4U63A 1JXAA 1USKA 2MJLA 3FROA 4Q9KA 4B47A 2EW8A 4C0WA 1DUVG 5AM0A 3VKUA 3SLRA 4EZIA 2R4TA 2JFBA 2F64A 4KO8A 1OI3A 2DU8A 4G0UA 3KSBC 4DR5B 3WLFA 2E4UA 1GITA 3PFGA 1LGYA 1T9HA 3PFBA 1NRIA 3K6RA 4J2OA 4KTTE 4GEKA 3SQDA 3GGDA 3P27A 1KI3A 4H7KA 4RPKA 1G8MA 6Q21A 4L95C 3D1JA 2IYLD 4KVAA 5AJYA 3A70A 5JR3A 3VNUA 5ICCA 3N0VA 4LQDA 3HFRA 1XWIA 1E0SA 4OK3A 4YNBA 1YMVA 1R12A 1YHZA 3K0KA 5EIAA 1PR5A 3D6MA 3UV3A 2Z1MA 3VZRA 2EQAA 3TFQA 4AY6A 5EC8A 1FFXB 3TX2A 1FZTA 3DTYA 2QF7A 4MB2A 1COZA 2NZ2A 1ZJZA 3MWGA 4WVFA 4WY2A 3OCJA 1NW8A 1LTKA 1TA4A 1OKKA 2H57A 1A77A 3IIEA 4LRTB 1NMEA 1IY0A 1M2KA 2OBFA 4MQFB 4D9FA 2AC2A 4MWZA 4CN8A 4ZCQA 1TIKA 3IE0A 1ZD5A 2JJMA 3R5FA 1NW5A 3BXEA 2P5UA 4FNGA 4WCFA 3E27A 3AERB 3IOEA 3C3MA 5HKLA 4CN9A 4CT0A 1W25A 1XTIA 2PWPA 5TF0A 5A71A 3C41J 4MVYA 4DYHA 1EEXB 5JI2E 1RAGA 5THXA 4D6YA 4ZCPA 1DOZA 3PNYA 1I94B 4Q9LA 3IDFA 3LFTA 3DF9A 3OTIA 1KBZA 3LUFA 1Z06A 2FW1A 3QEKA 4MA4A 4X63A 4X66B 5J3JA 4RW0A 5D3QA 1JQBA 2FWAA 3DMPA 3BZBA 2GOYA 5ALPA 4E5YA 1Z17A 3B9PA 4HQRA 2A9RA 2GZSA 4NLLA 2EJCA 5ARDA 2OWDA 3GJYA 3EF1A 3IT0A 4EA6A 1VBKA 4LYHA 4RHTA 5F98A 1OAKA 2I67A 1TUBA 4IYRA 5M34A 1J06A 1G63A 1SG6A 4UUMA 1K5DA 3QVWA 2RH4A 2WSYB 1HLGA 1N2HA 3PXUA 1JHQA 1N6LA 1E1DA 2P9CA 2V4ZA 3KCQA 4JHXA 4LQCA 5TT0A 5IAOA 1ZR4A 4HGOA 4CM9D 2WJ6A 1W5SA 3UOAB 1FRZA 1Q1GA 3SEAA 4WZBB 1LBHA 1T1EA 1SVMA 3B9QA 3AVOA 4CE6A 5K0EA 5JQGB 5JS2A 1FDSA 2B9VA 1V7PC 2PKCA 2VP3A 4K9OA 4C4AA 3G5TA 3Q15C 4QULA 3JWIA 1NMYA 3VX3A 3F46A 3MJTA 1TIBA 2O3TA 3KQQA 4L50A 5BR4A 1M1YE 1M1NA 1PFVA 2BFCB 1DV2A 1X1TA 3NPMA 4GGPA 4N6OA 4B32A 3E53A 4ZHQB 1E79A 3ASZA 2O2CA 4JJEA 1MJNA 1RIFA 1SG0A 4LNHA 4RVUA 3L0YA 3E5HA 3DBRB 3K7EA 3JARB 3KHKA 5EJ9A 4AN1A 1QQBA 3CX3A 1BTOA 1W34A 1RYFA 2ZJZA 1KHTA 1D2AA 4RH0A 1F6DA 2PRSA 3JQ8B 3OFND 5BQ3A 1T8PA 3AP3A 3QU5A 2OZLB 2CNNA 2I6GA 2G76A 3IP8A 4J0QA 3MCUA 4BY9E 3OJWA 4XFDA 2AFHB 3ZW9A 1Q7CA 1VL1A 1THTA 2GH1A 3SK0A 1U28C 4YCDA 5TX7A 1OXTA 2Z6QA 4BVGA 1DO2A 1QK4A 3IVXA 4GECA 4HDNA 4E2WA 1BCRA 4NFHA 5IJAA 1XTQA 4BRSA 3I2IA 1J5PA 4IBOA 2HR1A 5IT5A 1YRYE 4Z0PA 1IWPB 3OZFA 3PNLA 1R8QA 2PD3A 1Z4QA 1GLNA 2XF8A 3QKIA 2XV1A 1XLTC 4MQLA 5TMPA 2C8KA 3OWXA 1BS1A 2P1RA 2R6ZA 1CQIA 5LYJB 4HX5A 4P33A 3EJWA 2QL7A 3PXCX 4WK2B 1T3LA 3OZEA 2CK3A 1K1EA 3GMSA 2ACKA 3FTNA 4MQUA 1XMOB 2Q7DA 3TOXA 2ES4A 1AS0A 1OPXA 2CHGA 1P29A 4GSLA 1UK9A 4OQQA 1EP3B 1UC5B 3K96A 1UOQA 1W93A 1OREA 2B5OA 1PGOA 1YKFA 2J07A 4UM8B 4DC0A 1U0BB 2Q4BA 1T6YA 4N5HX 1CVRA 2VBFA 4FM9A 3OCWA 4XTRA 5KWSA 1SUSA 3RKSA 4I6GA 2ORVA 1B0PA 2NU9A 2XGMA 1Q1QA 4RKRA 4YRFA 2C4KA 1VLJA 3UMSA 1POWA 2ZRPA 1VBMA 3KEMA 1Y9EA 3EY9A 5BSRA 3BWDD 2O50A 1KMNA 1IULA 2H8KA 3KNZA 5HJ2A 2WWVD 3VO8A 3WQBA 4AZ3A 5KQLA 1I7QB 4HH0A 4FYYA 1UADA 3MGKA 3N59A 2NU7A 1LQTA 5LQAA 1ZUNA 2CF5A 4JLPA 1KAMA 2WZBA 1CE8B 2A0FA 3O83A 3UXEA 1L2TA 3IBFA 2HU5A 5FL7D 1M2GA 1WG8A 1DKMA 2O4UX 2XADA 3IUNA 5KSPA 1E1MA 3QA3E 3SE7A 1C30B 1ENOA 1GG9A 4G5RA 3VZPA 3AV3A 4CKCB 2IYXA 1HNZB 1Z5UA 4X84A 1P18A 1YKGA 4W1RA 2GD0A 2D00A 2XTNA 3QW2A 4DSAA 5LMNB 4IJQA 4AMBA 1BG6A 2G88A 4RDHA 3H4IA 5JEDA 4K9KA 5JATA 2WU8A 3WYAA 3MYYA 1KP2A 3OM1A 5IK2A 3CZ9A 1E2JA 1IXRC 2CXPA 2I6TA 1UJ2A 4G0QA 4HNRA 1QV6A 4I3HA 4AJKA 2OO7A 5EVCA 2Q49A 1E8MA 3OLQA 2V3CC 2HPZA 4AY3A 5GVRA 4RSRA 2ZREA 5DNEA 3GMDA 2DUWA 1BWSA 2J3LA 1TEHA 4HBZA 5EJMA 1EX7A 5JH7B 4N47A 3H6HA 4XB6B 3LZDA 1PG5A 1VHJA 2JHGA 4Y0VA 3QYFA 2HV8A 1TEZA 3LCVB 1K2WA 2EDCA 2A7QA 2Z8XA 1KS9A 1XZKA 3CRZA 4XX0A 1TPYA 2ONYA 1I2CA 3OF3A 4KYUA 1YCDA 4DIBA 3TB4A 2P9JA 3FKSA 1WZCA 4D9NA 1REQA 3EIQA 3SPXA 2W2KA 5FBQB 3OE7A 1XQ1A 4TTTS 1W1WA 1V8BA 3JVIA 1ODTC 3I5UA 5FPTA 5L3SA 4GC5A 4YT2A 1X2EA 1OD6A 2P2ZA 4X41A 1P19A 1XPOA 4X95A 1WMDA 1CUZA 2W2TA 3NKVA 3TOZA 4J1NA 3IKJA 2P35A 4KYTA 2ZAGA 3RBXA 3WZMA 5K0TA 2N9UA 2X77A 4DW8A 4JYAB 2BMAA 1V47A 2O3SA 4GM1A 1ZN8A 4ISBA 2ZBFA 4BGIA 4N40A 2Z2KA 4B09A 1HGXA 2FW8A 2LIPA 3UXHA 5IARA 2MSNA 4OJKA 3BAZA 3A0UA 2Q5FA 1C80A 3N2YA 4E3ZA 1Z4LA 2BM9A 2XUGA 4Z4GA 4M8SA 5ECGC 5B7PA 1TQDA 5COQA 4DQUA 3TNDA 5HZKA 2G08A 1IY9A 2PM8A 1L7OA 4WXHA 1AXGA 2YR0A 4XLLA 3HCAA 5EP2A 4F3RA 1NSFA 1SC6A 3FHJA 1CHDA 1D4AA 1SOUA 2FF5A 3GH1A 4AB1A 3RC3A 1UXGA 5SZKB 1NL3A 2WLTA 4EHJA 2R00C 1FFGA 1QVAA 2Q0HA 3FOAA 3L02A 1XZDA 2MSLA 2YHIA 2ID8A 4WTOA 5IT9A 3P2EA 1XNHA 4OBBA 4PYNA 4P4SA 4WASA 4DBVO 3H1FA 5B3JC 1QQAA 2NOAA 2J08A 2WUDA 3R6GA 1PEAA 3QKUA 3A6KA 4J0HA 4PSUA 3V2GA 9LDBA 3DA8A 2JCXA 1VSQA 1WSBA 2MIIA 3OCYA 1TT5B 4V3BA 1GZ5A 3E7XA 2ZZMA 3GFOA 1PQ4A 3W5IA 4MDEA 5F2OA 1E2EA 1M9NA 2FKAA 4XLTA 3THXA 3CX7A 1Z82A 3BMNB 3U3OA 1GPNA 4WX2B 5IN4A 3Q6MA 1IZ9A 2GCOB 3DMFA 4ZKDA 1O95A 1QHYA 2GAIA 2XQIA 1XTVA 4TTRA 3SYLA 3NBKA 5LMZA 1PI3A 4I5IA 2FQ1A 2AI1A 2BEJA 4XOUA 4J0DA 5ESRA 3R7LA 2OPHA 3O8CA 5CG1A 3K8QA 3G0BA 2QRVA 3AUYA 2X8JA 4WZBE 4QXOA 5HNKA 3CXRA 4CQMD 4N76A 2V4UA 4UNRA 1DEAA 4B0PA 3IX7A 5FLXA 1KO4A 3IMKA 2PPLA 1DO0A 3SSOA 1Y42X 4QO8A 4G81A 2SECE 3AZOA 4OQ4A 3NT5A 4D4IA 2QUKA 3AHDA 1HETA 3B78A 2RHCA 2X1LA 5CK5A 2UU9B 2WYUA 2WTMA 1EG7A 4R8LA 1XU9A 1U80A 3AERA 1KI7A 2HLHA 4EB0A 3L7NA 3FMGA 4F84A 2W7TA 1ONNA 1OYOA 2WE8A 5I45A 4H0NA 2JIPA 5SZJA 4LDNA 3HXLA 4WRRA 2OVBA 1K8YB 4AN0A 3ESAA 3CCFA 1P7YA 1SQSA 3Q7EA 3PT9A 4RZUA 1FDIA 3FCXA 1FX0A 5EJGA 3WO0A 4MJXA 4O63O 5FR1A 4KO3S 4JBNA 3EFBA 1PR0A 3BDVA 4FMCB 5HUJA 2OCXA 4DTCA 2OYRA 5BWOA 3OIYA 4UEWA 1TM2A 4RVNA 3AIIA 4KWIA 3RFTA 3PDJA 2ZDHA 4EFMA 4PICA 2GEJA 3PT5A 1PDVA 1XC7A 3HY3A 5IEJA 4PSDA 2JVIA 2PMKA 3T7EA 3ZCUA 4WHMA 3IHKA 3ZDBA 5DBHX 3DV0B 4OP1A 4L5YA 3KX2A 4LCJA 4JU8A 4E51A 3T7JA 2HYIC 1JDZA 1C8LA 3L4JA 1QF7A 2IYFA 5K6AC 4MUXA 4F7WA 3CEAA 3K92A 3CRVA 5CVUA 2FYTA 1I5EA 1KBQA 4BMZA 4BO4A 2DLCX 4RENA 1CUFA 4O2LA 5FUVA 3OLVA 2Y92A 8MHTA 2WWGA 3H87A 4P98A 1OH6A 3LUPA 2YIJA 2HU7A 3UPTA 4RIHA 1N57A 1K9SA 2BDTA 1V43A 5EP1A 2VJQA 2W6ZA 1ZJJA 3UN1A 5AK4A 4PAOA 3RJ9A 3N2NA 1GNTA 4OHCA 3AJDA 5CX1B 2KBFA 5DW0A 2MDTA 3EIEA 4DUYB 2RFLA 1P7VA 5DM1A 5EJAA 2HSEA 2JK0A 3OU7A 4YUVA 1KZHA 3WWCA 4AG5A 1GAJA 2XUJA 4BMXA 4BVHA 1XZ8A 1T3ZA 2QMOA 4JD5A 1UPTA 3OY2A 2BH2A 5H3LA 3BSYA 2W90A 3X2FA 5TEVA 5IYZF 3L0IB 4C30A 1PYOA 2BFFB 4FHDA 2AFHA 2DHRA 4U8GA 4IOMA 5JYCA 4YAUA 3G2QA 3OOJA 1QIMA 2AFRA 4EVRA 2KYRA 1J1ZA 1XA3A 4ZCIA 4C3ZA 2JFQA 5F33A 4BXOB 3VM6A 3FNIA 1EWQA 1G3QA 2ZB3A 4H6WA 4EARA 1Q22A 421PA 3A4YA 1VG9B 3VUEA 1CBUA 4DADA 4LISA 3G2HA 3IH5A 3QP9A 4PO3X 4C7BA 1N32B 4E11A 3O9VA 5JD3A 2KPOA 3EWIA 1JJFA 1YE8A 4LJLA 1IL0A 4KSYA 3RSFA 2DUMA 3UGKA 1B2LA 2Q4DA 3RRMA 4CKEB 3E7FA 3HKEA 3PNKA 4YJHA 4ATNA 3RYCB 3CVVA 1DL5A 5FXMA 1LK7A 2L18A 5SV2A 5A6SA 4OU5A 2OV4A 3QYAA 4O1HA 1FSFA 4AZSA 1UBMS 1E1QA 2ZPUA 2R0QC 2VHYA 2JFNA 5AJHA 4O25A 4DLUA 3NUZA 4LXGA 3NEPX 2WWXA 5CFNA 4GX0A 4BLRA 1E0DA 1OV6A 4KQGA 3BVPA 3FGOA 4L76A 1NJ5A 3N07A 4RK1A 5CX4A 5FNVF 3B13B 4DPKA 1ESCA 2WF7A 2WWHA 3QLTA 4UCFA 4LBWA 1GGVA 1I2MA 3D5QA 4R9RA 3ZXSA 3OLWA 1M0SA 1OTHA 1GU1A 2CYBA 1WXFA 1U6IA 5CTJA 5F2EA 2ZYGA 5TMEA 4YFYA 2IUEA 1XWFA 2YJ3A 3WIDA 2R8ZA 4FFSA 3VHXA 4JEIA 4BBJA 1D7AA 3TQIA 1E7RA 2YDYA 3P9SA 2K87A 4WOJA 3QNUA 1D4OA 4UMDA 4X6YA 3ZTYA 1FS4A 1SIOA 3AVUA 2OXTA 5T7BA 4P3XA 4I9HA 1ODKA 1O5OA 1J0XO 2ZI4A 4I2VA 3QENA 2BUCA 2XCSB 1F5SA 4CKCA 2EX1A 4OJMX 3JASA 1NNLA 3P5BA 3Q9SA 4ZOBA 1X2BA 2IITA 1N2OA 1FSSA 5FT9A 2R87A 1KYVA 5AK3A 3QTLA 2IOHA 1HYQA 3A3KA 4OYLA 2B0JA 2CC2A 2X42A 3FZGA 3C7KA 4OHWA 4BFWA 2UXBB 3PGLA 4PRZA 3NFYA 5LUBA 3H3JA 3PJRA 3EMDA 1N8TA 2J30A 2R7LA 1B4DA 4GMGA 2JVJA 2BJVA 2V8BA 4P84A 4B4UA 3T9DA 1NUAA 3P19A 4JITA 4YJ3F 3VRHA 3A6EA 1APBA 1OF1A 1VJ5A 3SDBA 2IHKA 2IYVA 3HXTA 4LKOA 4PC6A 3ZDYB 1PUJA 2VJNA 3S2IA 2WYVA 3RIMA 4FNMA 1DJQA 3E0QA 2ZI7A 4CEJB 3EHDA 1ADCA 3SC3A 2ZW9A 4BASA 2Q41A 3GARA 4HFR