2UZ1B

1.65 angstrom structure of benzaldehyde lyase complexed with 2-methyl- 2,4-pentanediol
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
555
structure length
555
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGAHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Thdp-Dependent Enzyme Benzaldehyde Lyase Refined to 1.65 A Resolution.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords BENZALDEHYDE LYASE
total genus 190
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
B PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
B PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1B03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1B01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2uz1B02
1V11B 4K9MA 2R8OA 1T9BA 2BEWA 2HJHA 2J9FA 4FVTA 4GM4A 1OLXB 1X7ZB 5EJMA 4JUDX 1W88A 4FZ3A 1OLSB 5MF6A 1OZHA 4X3PA 5D7NA 2JI7A 2O1XA 2Q5QA 2BP7B 4KXQA 1L8AA 4JU9A 4BVBA 4G1CA 4RMIA 2VBFA 4GM1A 3AHJA 2FRDC 2X7JA 2R8PA 4V1CA 1UMDA 3PDHA 2BFFB 5I5GA 4IF6A 2Q29A 1YI0A 1M2JA 2AG1A 2JGDB 2JGDA 1Q14A 2PGOA 4UTNA 2EZUA 4ZP1A 3EXIA 1NGSA 2OZLB 1POWA 1J8FA 1V11A 4K9NA 3HWWA 2C3MA 2H4FA 4GPEA 4JUBA 2NXWA 1V5EA 2WVGA 3AHHA 4IAOA 1DJLA 2Q5JA 1Q17A 3E9YA 2FSVC 3EXG2 2OZLA 1OZFA 3CLUD 4L2IA 1W88B 4C78A 3RIGA 2EZ9A 1PNQA 2PDAA 3AHFA 4GP9A 3UPTA 1TKBA 3D4BA 5MGNA 1UMBA 2JLAA 1M2HA 5MFZA 3AHEA 2BEWB 3GLUA 5C4IA 1TKCA 5IMSA 1V5GA 5K2OA 2VK8A 3RIYA 1T9CA 1YD7A 2IHTA 1Q6ZA 1TRKA 1T9AA 2FN3A 1X7WA 2OO5C 3DV0A 3OOYA 4MPPA 3AI7A 3D7KA 1X7XA 5EJ6A 3EYAA 2J9FB 1PI3A 2BFEA 2C3PA 2XTAA 2QQGA 2JIBA 4JUFA 2OORC 1U5BB 1IK6A 1M2GA 4TWIA 3M34A 1V1MA 1YNOA 2H2HA 1WCIB 1PNOA 5EJ5A 3KOMA 5HHTA 2H2GA 1QS0B 1OLUA 1Y9DA 2PANA 5ESDA 2DJIA 3EXHA 1PTJC 2OD9A 1UMCB 4MPJA 3ZHSA 4FEEA 4KXYA 5K6TA 2H2DA 3EXIB 5DEIA 2Q5OA 3L84A 1PYDA 4RJJA 5AHKA 2YICA 4RJIA 3M49A 4UU7A 4JSRA 3UK1A 2IHVA 2BRUC 1V5FA 2BEUB 3EXEA 3FZNA 4V1CB 4BV3A 4J16C 3M7IA 3DVAA 3OE1A 4QELA 1M2KA 1YHYA 1SZDA 4C7XA 3JR3A 3EXFA 3PKIA 2BFDA 2YIDA 2IEAA 2Y0PA 2V3WA 4UU8A 1X7ZA 2QTAA 1SZCA 2UZ1A 2Q28A 4JU8A 1O96B 2OD7A 1UM9B 4UUAA 3CLTD 2R5NA 2A1TR 1ICIA 4JT8A 4FEGA 3AHCA 1OLUB 4UTRA 5EJ4A 4KPUA 3U3DA 1PT9A 4COKA 3ZG6A 2WVHA 1X80A 5EJ7A 1YTLA 1POXA 4F4UA 2W93A 3IAEA 5BWLA 4Q9DA 3LQ2A 3F6EX 2EZ4A 3FLMA 2VK4A 4K9OA 3GLSA 5K3SA 1UM9A 2BFFA 1M2NA 3DUFA 3DV0B 3LPLA 1OVMA 4BVGA 3ZGVA 3GLRA 3EXFB 4ZZIA 2IHUA 1EFVA 3ZHTA 1NI4B 3EA4A 2H4JA 2VK1A 5I4IA 4WBXC 1OLSA 2BEVA 2BEUA 3EXEB 1AY0A 2BFBB 5K6RA 1QPBA 3K35A 1EFPA 2G28A 1XLTC 4JT9A 3ZHQA 4K9LA 2FWNA 1UPAA 5DGTA 4RMHA 1MA3A 3FSJX 1UPBA 5EJ9A 5ERYA 3ZHRA 4MPRA 1UMCA 3EXHB 2C3UA 1UPCA 3ZGOA 4JD5A 1YC2A 1PVDA 3AHIA 4O8ZA 1D4OA 1DTWA 1YBHA 1QGDA 5ERXA 1WCIA 1N0HA 3F6BX 4TWJA 4UTXA 4BV2A 3CLSD 2H59A 1W85B 3MOSA 1TKAA 2PGNA 5DGDA 3ZHUA 2Q27A 1KEKA 1JSCA 2BFBA 4I5IA 4KXXA 2BEVB 1DTWB 3RIMA 5FYQA 4C7BA 2A1UA 2JI8A 2BFCB 1U2DC 3IAFA 3M6LA 4RJKA 1ITZA 3DUFB 4KXUA 2XT9A 1R9JA 4UTZA 2O1SA 1UMBB 4Y6OA 3LQ4A 1OLXA 3D81A 4GG1A 4XEUA 4BN5A 2E6KA 3GLTA 1BFDA 2UZAA 4KGDA 1NI4A 4BN4A 3JWPA 2JI9A 4KXWA 1PO7A 1V16A 4MQ5A 2QTCA 2VBGA 2VJYA 3HYLA 5HJEA 1V1RB 2JLCA 4X3OA 1RP7A 5I5EA 5EXEA 2VBIA 4JUAA 1W85A 4D5EA 1S5PA 2BFEB 4HD8A 1Q1AA 1U28C 2B4YA 1X80B 3EY9A 4KXVA 4HDAA 2G67A 4K9KA 1GPUA 1T9DA 2BFDB 2WVAA 2C3OA 2QQFA 4UTVA 4V1CI 2JI6A 1NM5C 3DVAB 1U2GC 2H4HA 4Y6QA 1V1MB 4L3OA 1ZPDA 2BP7A 4Y6LA 3U31A 1S7GA 1U5BA 4BUZA 2XT6A 5HYVA 1U31A 1Z8NA 4D5GA 3AHGA 1O97D 1X7XB 2UZ1B 2AG0A 2C42A 4BVHA 4MZXA 5HGXA 4RMJA 3AHDA 1YHZA 2H2IA 3HWX1 3EXHC 2G25A 2BFCA 4GM0A 3PKJA 1X7YB 4C7VA 1QS0A 1YI1A 2EZTA 3EXG1 4QPZA 2NYRA 5BWNA 2OD2A 3CF4G 2Q5LA 4J1TC 4IG9A 3ZHVA 1HZZC 1OZGA 4QQ8A 5I51A 4K9QA 3CLRD 1B0PA 5MFPA 4BVEA 1E3TA 5EJAA 2C3YA 4BVFA 5EXDA 2C31A 1MCZA 4RMGA 1UMDB 4JUCA 4UUBA 2FR8C 1V1RA 1X7WB 4R8MA 1YC5A 5EJ8A 1V16B 4K9PA 5FEMA 3LQ1A 5BWOA 4F56A 1X7YA 2EZ8A 2H2FA
chains in the Genus database with same CATH superfamily
1YBFA 2A33A 1GRQA 4O0MA 1V11B 1SOAA 1NJ5A 2Y2UA 4K3VA 5IDVA 5LQMA 1NNEA 4JSTA 1QWOA 4GBMA 1Y6QA 2IWHA 3KQVA 2XNCA 2AIRA 4L3VA 1N1MA 3VR3A 3T1HB 4AWAA 4F72A 4FIDA 1N6OA 4JCCA 4KE6A 3NOVA 4RLQA 4UMEA 4UFPA 3DO8A 1ZUIA 4URFA 4BLQA 1X1TA 3LNTA 4EABA 3JAMA 2MSDB 5IT4A 4G0PA 1SHUX 3OQPA 5E9AA 3I6MA 2X8JA 1JSLA 4KE7A 4XVHA 4GRAA 1G7RA 1NIJA 4X3PA 4F3YA 4NNOA 1FUUA 1BH2A 4HQNA 5K0JA 4DV7B 2EG5A 3F9CA 4NJMB 2HRZA 2GZRA 2QLMA 1U2GA 3FKSD 2R60A 2QAGC 2X0FA 4I55A 5AFSA 1C30A 1HT2E 2V8OA 3N2GA 4XGKA 4GBED 1P7PA 3MT9A 4PNZA 4D4HA 1XCGB 2YDXA 3MAAC 4RMIA 2FMUA 2VBFA 1HQYE 2QUKA 1O77A 3AETA 2VNSA 4G5HA 2X7JA 4OAOA 5NLLA 4D9KA 1VLMA 2R8PA 3H11A 3QVOA 4HN9A 4NR0A 5CCBA 1FFEA 4N9QA 4NHOA 2BFFB 3PUKA 1B16A 1UBFA 2XCLA 4A6EA 4YJKA 5IWCA 4IS3A 4YLEA 4X1YA 5CTJA 4OO3A 1Z6GA 3D8BA 3RVMA 5JZ9A 2ZJFA 3PR3A 4LTNA 1DG3A 1N2SA 3LHFA 3B9PA 4L57A 3BB3A 2FX3A 3EHEA 1G5FA 2B61A 2GYVA 1IZ7A 2R8EA 3B8HA 3JZMA 1TECE 2ZWVA 5B7PA 3ZD9A 1V11A 4YRRA 2YBEA 3RBVA 3NHZA 1D0SA 2F90A 3GAMA 2LUOA 3ZWBA 2PUDA 3CF2A 4FUTA 1S2NA 1ZX1A 1P2VA 2H4FA 2XUAA 3DGFC 4EGJA 5HK8A 1L4FA 5KYKA 4H2DA 3STXA 4PPGA 2NXWA 4XCXA 3ETEA 3FPGA 1K0UA 2JLQA 4ZCTA 5B1EA 3L7NA 3IVXA 5BNFA 4G24A 3SQWA 4QDKA 2RI6A 4EFMA 4B47A 1QNFA 1GKLA 1KWGA 4X85A 5C4GB 3QW4B 3MRTA 3PB3A 4MP3A 4P3XA 3I1IA 3U17A 1SM4A 2K7FA 3BAFA 4C78A 3QFCA 5A02A 2AW3A 2DFPA 3RS4A 4E3ZA 4AY6A 1RI2A 3PTAA 2OC4A 4ZYUA 3BGIA 4OQYA 5EIEA 3FWYA 4M76B 4UNSA 1W581 2NADA 1K98A 1UC8A 2D3WA 2I22A 3D3WB 3NM6B 1RZRD 2BGGA 5AVTA 1QBKC 2LR0A 2Z0MA 3NCHA 4BJ3A 1UP6A 3CV3A 2ID4A 3PJRA 4A03A 2JIOA 2W6OA 4HDSB 3OEEA 2XPCA 2VAVA 2R8BA 2BE7A 5K2OA 3NWBA 4QJ3A 2IBMA 4PYIA 5K0ZA 3UGKA 1B6RA 1DUIA 4HQLA 1EKXA 5G0WA 3U48A 5JYCA 1V5WA 1QRUA 1CUGA 1WZ2A 4PR3A 3AW9A 4B48A 3OQJA 2VUIB 4CMIA 1L3IA 3OIWA 2OVBA 4MQFB 4XQ9A 4CF5A 2XDYA 2IFTA 3E1GA 2HLNA 3VH3A 1IPHA 5JO9A 3I83A 3WKBA 5CFRA 5CDGA 1PI3A 3I8OA 3DLPX 3B52X 5BOSB 5IYZB 3QFTA 3UAYA 5CEFA 3EDCA 3VU8A 2J6IA 4YROA 1UXIA 2R6GA 3R3YA 3HP4A 1U5BB 4R8SA 1IK6A 3C98A 4HFRA 4UNIA 5DI9A 4AY3A 4GC9A 2LTAA 3OM9A 3T41A 4WBNF 5IF3A 1FTNA 3O03A 4J0EA 2BGNA 4RJ2A 5HMLA 4BZQA 3DCIA 5I7OA 3RYCA 1SHJA 4ACBA 1C8VB 2GPTA 4BATA 5EHXA 1I7QB 4S0ZA 1ENOA 5M34A 4OK3A 5DHUA 1K7FB 5ALMA 3RUAA 4ARSA 4C76A 1N1GA 3FOFC 4LEIA 1JR6A 3IV7A 1FNBA 1NA5A 1P8JA 4FD3A 3C87A 4MYCA 2WRZA 4TTTS 4A2PA 3GGPA 4C3ZA 2H2WA 1JYSA 2IYAA 3VDRA 3ANNA 3EF1A 4FLEA 1OWPA 1MHPA 2J4DA 1NN3A 2YOFA 3BWVA 1L2TA 1PEDA 2PO7A 3FB1A 3Q7EA 4OUKX 2C0CA 3HYRA 2PXXA 4A0HA 3K71B 3AG6A 1W59A 4GMGA 4GMXA 3DV9A 1JLRA 1VKRA 1WNTA 1BDMA 2DBZA 5T6MA 5JO0A 1ZOSA 1WX1A 1YTUA 2XTMA 1EH5A 3RFFA 1UEXC 4KK3A 5AHKA 1NW7A 2QRKA 2WWXA 4RJIA 2VYFA 5E6RA 3W06A 1E61A 3KLPX 4UU7A 2JDID 2X0NA 3ABQB 3O2JA 3R5FA 4QGFA 1GAEO 5MGBA 2NP6A 1FSSA 4QXMA 3QKUA 3SQLA 2WUVA 4GYWA 1XRNA 2NXCA 4NG4A 3TEJA 4G84A 1KI7A 1UWKA 1ZM7A 1XP5A 4YQEA 3ZW9A 4DREA 4EW3A 4LXGA 2C4VA 3LK7A 1ZRMA 4YFVA 4LWQA 4ACAA 5HOQA 4N39A 1WDKA 1Z5OA 5AKHA 1KYIA 3P9ZA 2C2OA 4MJ7A 2C9ZA 5JFOA 1TYAE 2X3FA 5FH9A 2QQ0A 5F7XA 4V24A 3ROKA 4HXFB 5DTMA 1FDTA 3OT1A 1YAHA 1CJTC 1R4MB 3H75A 1CQWA 1U2QA 1ZMRA 4MGIR 2CLSA 1YK1A 1XHFA 2Z08A 5EWLA 1JRLA 1SZCA 3KQQA 4R0MA 2RE8A 1U1EA 2AXEA 4RC9A 4YDSA 2O57A 1ECCA 2NUAA 4JKIA 4Y67A 4NDAA 3LV8A 1M73E 1OU0A 1ZGJA 3ETGA 2AOXA 4JXJA 5JTTA 1ZK0A 2GFQA 2O6LA 2XT0A 2O3RA 3SHWA 2CLLB 2GN9A 2R1ZA 3MRXA 4LWOA 4N7JA 3ROMA 4CFSA 1R6AA 2IP4A 4IHKA 4QKQA 1X7HA 1VSTA 3UXEA 2FR1A 2QHXA 1WHSA 4L02A 1GTMA 3GEPA 4HFNA 1G0NA 4ZCQA 3F8TA 5EPOA 3C4QA 1MC8A 3P26A 3QMWA 4UTRA 2ZUSA 5EP1A 3FCAA 2AUNA 4B7CA 3HR4A 5A9SA 3RWMB 1Y4ZA 3S5UA 2D13A 3CFYA 2SBTA 3U39A 2OM6A 1JFSA 1O5OA 4DXAA 2WNHA 4IKOA 3RC3A 2QZPA 1M8PA 1RC0A 2OOKA 1IN6A 5EIFA 3GLSA 1D2RA 2R1UA 3DW1X 2V1XA 4LHSA 4Q39A 5G41A 3RUEA 2XLBA 3EZLA 4RZIA 3UUEA 1ACJA 1Z4LA 1XZKA 4GKBA 1HE8B 4HDQB 4OA8A 1HQCA 5HBGA 4LQCA 4HLQB 3FLBA 3S27A 4RETA 4TRJA 1O87A 4YRLA 4KQWA 1XD2A 3GFGA 5JTUA 2WIBA 3ZH9B 4GEGA 4U8HA 4CFYA 3HHPA 4PSAA 3OZEA 5L9AA 2PLFA 5JS6A 1EFHA 4XI9A 3PKZA 2MSEB 4F3TA 3K8OE 2GK3A 5EUBA 1E59A 4PCLA 4KQGA 1FNNA 5BYKA 3A9CA 5CIYA 1KO5A 4Z4GA 1XMIA 4NARA 3UT0A 2C88A 3WLOA 4UAUA 2CHVA 1FW8A 1P39A 2PSHA 4L1KA 3KK0A 5EQDA 3GRVA 3OU6A 5DLDA 3AGPA 3BHMA 3GYBA 4AVYA 3K35A 4LI3X 3QU7A 3LCCA 2O07A 4JT9A 1YOBA 1Z26A 4MKGA 1U8CB 3WRYA 3JVVA 4MYHA 4X20B 4B4UA 4CLRB 5C4MA 2C2BA 4QNRA 3A0RB 2NO4A 5FHRA 2O1EA 3HBLA 3MAJA 4OP1A 4Q21A 5EIAA 2JLUA 4DV2B 1EUCA 4DA8A 3OLWA 5J4VA 1TVMA 1SQFA 4OPMA 3FYCA 4RMHA 4K81B 4A2QA 1JXAA 4C7JA 2HEIA 2PZLA 5IPFA 3CSDA 4V2UA 1RKBA 1KP3A 2I3GA 4H4CA 4JYAB 4ALMA 4F3KA 3UA3A 4IHJB 3O26A 2C3UA 4PFSA 1UBRS 1PNVA 1XALA 5T6BA 4TLDA 4FQ7A 4Y30A 1YFKA 1RWNA 1FMTA 2J3QA 2Q99A 4NENA 5I8ZA 3UW1A 5JSYA 4B0OA 1D4OA 4MA4A 1G6Q1 3IAHA 3ASYA 2IOFK 3F6BX 1BOFA 1NI3A 4HLNA 2BPOA 4PHCA 3OX3A 1AS2A 1EBBA 1I4WA 1UK7A 2VJLA 3KZXA 1KEWA 1AB5A 4RHTA 4JS0A 1KORA 5JG7A 4IKPA 1Z39A 1JJ7A 4KW7A 1FUIA 2R8RA 4G0MA 3RK1A 2PGNA 5BT8A 5DGDA 4D9JA 5LWHA 5TS2A 5E4JA 2B21A 3MCUA 2GRUA 4RVHA 4UAVA 5BSWA 3MCAA 4LJYA 3MS4A 5ADWA 4WT7A 4HDNA 4G5SA 4UM9D 1XBTA 3GA5A 1G8JA 1YO6A 3GB9A 3QG1A 4DA9A 3K4QA 1QZTA 2H6EA 2OPBA 2HK6A 2VRNA 2G9NA 1XV5A 2D1RA 4DFDA 1H2HA 1UKEA 1YOVB 2FPPB 5AYVA 5A2QA 1U65A 1XMSA 2QYTA 1XMQB 4NYJQ 4DQDA 4GXQA 1R4NA 4RJKA 1YZ3A 4XDGA 3VR5H 1R1DA 4DSOA 1ITZA 3ND9A 1CTQA 1WW3A 3MGBA 3NEAA 3NWPA 2DWOA 4MUXA 3MRVA 2E4YA 1BW9A 3V97A 1J06A 2XE7A 3KL2A 5JWRA 3WIOA 4R7TA 5ELMA 2XXAB 5JJLA 2HSEA 1VE3A 2R87A 4R1MA 2IY9A 4YJ3B 3O9ZA 1E20A 1JVBA 3QGMA 3VYVA 5JZVA 3K70B 3IULA 2QMZA 4L5CA 2IUUA 3Q11A 1BD4A 1T4BA 4P7JA 1T1RA 2E6KA 3H5VA 5BSVA 1YE5A 2VF2A 1QG2A 3VH2A 5IXJA 3DZGA 5FUBA 1ZNQO 3I6BA 1XSEA 2LIVA 4F96A 3IBGA 2VCHA 1FDVA 1CF2O 1U99A 3AXSA 1I5EA 3OAAA 3I9FA 3I42A 4V0SA 3FI9A 2VBGA 4Q7LA 1OROA 2PUBA 3A14A 1JQDA 4RWZA 3KYDA 1H6AA 2WSYB 4FFRA 2WC1A 2GTHA 5L7WA 1MAAA 2DQKA 5E1DA 4C22A 4MV3A 3NIFB 5L3ZA 1J2TA 1MP0A 2R7NA 3VU1A 1GD1O 1SXJD 1DBIA 3Q7SA 1I0LA 1TX4B 2B2CA 5KSYA 3I8XA 1WP9A 2BTEA 4NCJA 2BMFA 4IX9A 5ENVA 3EGWA 3EIOA 4ZT2A 2YV5A 1OPXA 3FYUC 3F47A 4X1YB 3VU3A 1CB7A 1CX9B 1Q12A 1U28C 3HCEA 3HM9A 5KSWB 1IQRA 2A4MA 1YQWA 3KTFA 3WSVA 4PGMA 1ZINA 2RGXA 2VPYA 1ISGA 1HMPA 2RHBA 2HMAA 4TT3A 2HUPA 3SG0A 2H54A 3BREA 4YT8A 5AK4A 3ZCXA 2EBHX 3WLSA 2JATA 5H7XA 4REMA 2O8EB 1Y89A 2YCLA 4RXTA 2CXUA 1T6NA 3DFUA 5GV8A 3TRDA 3WGJA 3ZXIA 3TZ6A 1U2GC 4LVOA 2QAGA 1QH0A 4M9UA 2JJMA 1CJBA 1ZK1A 1Z4IA 2I2DA 4ISBA 2G9VA 4TSKA 4FS8A 2RBKA 4Z5XA 3NGMA 1O89A 3FCYA 2VQ3A 4X97A 2GCEA 4RVOA 4EY8A 1XEWY 1Z8NA 4C1NA 4ZCPA 5KS2A 5CVCA 2B78A 1P7ZA 1HFKA 2V59A 1M1YA 4Q05A 1O9HA 2GNAA 4K2AA 5F1PA 5UKDA 4RZQA 4R0VA 4MW9A 2C42A 1TM2A 3LXRA 3N5KA 4OKIA 4B79A 2FSPA 5DHRA 5HGXA 5DBOA 1SH7A 5DNWA 4CDRA 4QYMA 1I4DD 2GETA 2V9CA 3GROA 1DBVO 4NYJR 3N2KB 5CU7A 4HUTA 1Z74A 1JNYA 1OX4A 2IS6A 4K9SA 2B1IA 1A82A 1MU0A 1QFYA 5EC8A 8ADHA 3FTQA 1Z5WA 5F2EA 2QMQA 1YI1A 4XFJA 3M6FA 4WXRA 1AJEA 1FPMA 3V34A 1JLSA 3FNQA 4I8XA 1N2XA 3W8FA 4DJ5X 4DSNA 3D31A 2ECPA 4HZUA 4PZDA 1SXIA 1MX5A 2G9QA 1DRKA 2XWPA 2CVZA 4KR3A 2RAUA 3WMEA 4JMLA 2OCBA 2X9NA 4CL3A 1BH6A 4CKZA 2BJHA 2JVIA 3WYAA 1PBNA 3NBXX 3NHFA 1H22A 1UT6A 1I2MA 1OTXA 2AEFA 5EYPB 4F8EA 3SN6A 4ODIA 4K9QA 2IIPA 3EISA 3RSZA 4BQRA 1KPIA 3B1FA 2ZRDA 1HKHA 1D7OA 1IB6A 1FRNA 1SD5A 1JLKA 1UJNA 2DUUA 4O5OA 5AM0A 4PRYA 2C20A 5C37A 2B5WA 3QVUA 4P2GA 1IG0A 5DTQA 4FOOA 1SXPA 4YP9A 2HDHA 4M9CA 3K8ZA 2WT4A 3KLNA 3WBFA 4J0FA 4BVAA 1JG4A 5CDTA 4IY1A 1FTGA 1JDTA 2ZXEA 3VHXA 3OBIA 1Z2OX 1GGHA 1T2FA 2AXQA 4OY3A 1RWBA 1DB3A 3W8RA 4KAJA 3K6JA 2X0RA 1N6RA 4PLVA 2EZ8A 5I9MA 1MX3A 4BVGA 4YAOA 3UT6A 2E21A 3ZNQA 1G3IA 5JZSA 2E82A 3DH0A 5A3VA 3RF7A 1NJ6A 1E6MA 5E4TA 4L5AA 3CG0A 1FTQA 3LS2A 4R2XA 4NESA 1C1DA 2REXB 3B9QA 1QRSA 4U7TB 3U7QA 1G291 2QPTA 1AZWA 2AL7A 3GDOA 2V4MA 3JZAA 3BORA 3QPVA 2AN1A 4MI3A 3F78A 3BGOS 4DEXA 4OHCA 4ZI3A 1ZI9A 1UBHS 4OH1A 2C96A 1E5QA 3KZ1E 4NBWA 4UPEA 2ZXFA 2IYPA 5LP6B 3CJQA 4I6JA 5AOAA 4NPAA 4FMDB 2CKDA 2ECOA 5KNDH 2YHIB 4MYDA 2PMFA 3I2IA 4WZZA 5JY1A 4DM3A 4ZZIA 4JOQA 2BP7B 2JIRA 5H3LA 2ZUUA 4RNDB 1U3TA 2PRYA 3DF7A 2OR3A 4XOUA 5B3JA 1E5DA 3UXYA 1KL7A 4INZA 3HJFA 1K92A 3D3EA 1G8MA 1NXOA 3F3KA 2WAMA 3MZ0A 1WXXA 4E03A 2IS1A 3B1KA 4OSEA 1VPVA 2AZDA 2VYND 2VZEA 1KDZA 4YJHA 3K32A 1NHWA 4L5IA 4B84A 4RKFA 4YJ2A 4YDRA 3QPWA 2J1LA 1KU0A 2NX2A 4R3NA 3LWZA 5IULC 5LOVF 2F7SA 2RDMA 3DEFA 3M9LA 4GZ6A 1AIPA 4B71A 4HOYA 4LK3A 1E0AA 1KFJB 2Z2ZA 3SVTA 1Y6ZA 1C7FA 4NV1A 4PYMA 4II7A 2QTZA 4C07A 4TTRA 1GT91 4RHUA 1KH3A 5FTLA 2WF5A 2JGDA 2I7TA 2WIJA 3MERA 1L4UA 2C9OA 1A1SA 1E89A 2ZYRA 3MXOA 4OQXA 4RSHA 3S55A 3PDIB 3H2BA 2HJRA 5JPDA 3HUFA 4D9FA 3E3AA 1RPNA 2ZATA 3AUFA 5JS1A 4ND4A 4GX0A 1Z0FA 4Q4JB 4MTLA 3UT5B 1UDBA 2PWBA 3KTAA 4A36A 3FY4A 3UC5A 5C53B 4RV5A 1KTVA 4FHCA 1KH2A 1CVRA 4DCPA 2PZJA 5JNUA 4FE3A 3OG9A 4U2DA 3SF8A 1E3SA 3EQ7A 1IY9A 1HLGA 3SBOA 1KAMA 2OQIA 4QD3A 1RI1A 2Q2OA 3HA5A 4QDZA 4BKRA 4EG4A 1QQ7A 2YCBA 2EF0A 1QONA 2ZJ0A 3L01A 3HYCA 2XCRB 2VSOA 3EXG2 3PLNA 5IDYA 1EE9A 4Z54A 1H6CA 1D2AA 2NU6B 1P6QA 3CW2A 2QROA 3NEYA 4LTMA 3BGVA 4BUJA 2CVPA 3H1FA 3L02A 1L4EA 2REQA 1WMSA 3SIRA 4GP9A 5JD4A 4N0EA 4WEOA 1K9VF 3KU1A 3UPTA 4ALNA 2FY8A 4H6WA 1PLJA 2PSFA 5JAUA 5HK9A 1PW7A 3VU0A 2ZYTX 1PWEA 2PY6A 1JG6A 2EHJA 3AR9A 1LPPA 1KHTA 2QU8A 2XMRA 4I66A 4O0LA 4B2PA 1RIIA 2DHRA 3HCPA 4B81A 4D82A 3HJUA 1RXCA 2EWWA 3RIYA 2BMWA 2NQ2C 4RF4A 5KKCA 1VHJA 3NHSA 2GHTA 2BMJA 2EFCB 1PGQA 5G0UA 2FDRA 4W4TA 2W7TA 4PZAA 4WESA 1PVOA 3B70A 1VPLA 3LF2A 1IVNA 2JL1A 1TZJA 3BBPA 4WVFA 3VPDA 2IEBA 3GEBA 3E9NA 4X8LA 4I5EA 4MPPA 3FNEA 3PC2A 1FF9A 4IFEA 4QAQA 4XLZA 4PBRA 3VR4D 4Q01A 5JBIA 4N40A 3CEPB 2G1KA 5ESRA 5LDGA 4J90A 2EC5A 3PUHA 3A11A 4BKPA 3GOHA 1I3MA 1PGPA 4ZOLB 4UQPA 4ND8A 4OBXA 4YK7A 5FOTA 1WPXA 2IWRA 3QJYA 2XZTA 2PRIA 3BMOB 3FWPA 3FNBA 3E2PA 1FSPA 3OJFA 4TN5A 2PH7A 4BMVA 1J07A 2R11A 3C15C 3COZA 3M0EA 4KBYA 1W9MA 3HCRA 3SF8B 3DE3X 1DJQA 1VHWA 1RWOA 4AMBA 5C9ZA 3E9RA 3R0IA 5IVPA 3ELUA 3FWZA 3AR8A 3IEKA 3OPQA 2FEPA 1VHLA 5AICA 2VPXA 3ZWDA 3C39A 3PR2B 4J0QA 1C50A 4UOQA 4B3IA 1BDJA 1NOJA 5AI8A 1IWOA 1I32A 4O4JA 2HA5A 1E2GA 1OJLA 1NVXQ 4RQTA 1XVLA 4P84A 1M5UA 1RRFA 1ZFNA 4LF6B 1L4MA 3GLIB 2GXSA 3KPUA 2ZRFA 2I2CA 3HH8A 1XA3A 4ZAGA 5A7GA 4EZBA 2DLCX 5DNUA 3ZH2A 3W9YA 5FPPA 4EAAA 2MYPA 2WJYA 2YICA 4HG2A 4KOEC 2M2IA 2GKOA 1T8PA 3DT9A 1XDBA 3V80A 4KVZA 5B36A 2I6XA 2HF2A 3F8WA 2ZBQA 3GBVA 2BEUB 3FZNA 4YALA 3USES 1U2SA 2JIPA 2BHNA 1WVMA 4LHXA 4DUYB 1JEJA 2OMEA 3MUNA 1C8KA 4JFAA 2KSQA 4PC7A 4NOMA 3WRYC 4AJ9A 4BLPA 4BNTA 4CGZA 3LCUA 1K89A 2IX3A 1J09A 1JA0A 1OLOA 1VRCA 3KR2A 3OE1A 5E9QA 3UK2A 3ZXXA 3IO3A 1BCSA 4OLFA 3UWKA 1U8FO 3ZTTA 5A3JA 3B1XA 4FOTA 3S2IA 2NOAA 3HPQA 1YOVA 3HADA 3CWCA 1QB8A 5H3HA 1N78A 3EXFA 1XZFA 1PDWA 3I2KA 2Z3VA 2V3WA 1ZGBA 5L3RA 3K3PA 1K08A 5JZBA 1ZXLA 3EZGA 5EZYF 2ZIZA 5HKLA 4EMBA 2RHHA 2H9YA 2J09A 2CW5A 3UAGA 2EU8A 1ILWA 1O96B 1KEEA 4IWNA 1I7DA 3IP3A 3KYIB 3AIOA 4KRFA 4D8YA 2FUNB 3F4LA 1HSZA 4EGAA 1TVEA 1H8HD 2P6PA 3A1FA 4BFCA 2FJPA 5SZJA 2RG1A 2PVSA 3IPAA 3K1AB 3C8DA 3D2LA 1G64A 1RPAA 3R3VA 1XJCA 1XN1A 2OAQ1 3JQDA 4LYAA 2RGBA 2ZJAA 3BXOA 2ZYHA 2PLNA 4NSNA 2CB0A 2G5PA 3TLGB 4Q7QA 4QZVA 4BNZA 3OKPA 2A5LA 3GRPA 1H65A 4QBKA 4R01A 4DNOA 3JTEA 4AURA 1AQJA 1JHQA 3AHCA 3H9JA 4M9QA 2WAXA 3CLHA 3PXCX 4RX1A 2NU7B 4MUFA 4BNJA 4QNMA 1OASA 4NQRA 3BRCA 2NT4A 3UJ7A 1RHMA 2QN8A 2BZGA 4N12A 4L3WA 4WA7A 3GG9A 1CB0A 1QYWA 3TIFA 1E1CA 3ZU5A 1P2GA 1BE8A 3MWDA 2C5AA 1SGWA 1GTSA 5EJ7A 2ZUEA 5B3AA 1F8YA 1QO0A 4EB8A 4MW6A 2X58A 4AZWA 4I2NA 3ICVA 1JVNA 3RSFA 4RTKA 2AMFA 4G65A 3JQEA 4EX7A 1RW4A 2PGAA 3CPSA 4FX5A 1ECFA 1XNHA 1C1XB 3G02A 4Z9XA 1ND6A 3FH0A 2XQIA 3V6LA 1WPRA 3EEBA 5DYGA 4JOSA 2UZIR 1F2TA 3LC1O 3NCTA 2FB9A 3M6VA 2GD2A 4QYXA 1WOYA 4XB6B 1YRHA 2P3LA 5DM0A 1KZYC 1YK0A 2WWHA 3R0ZA 4RCZA 1U11A 3UJNA 3ESDA 3RHZA 2G7ZA 5AVWA 1W48A 2B4RO 5K09A 3NBZC 1YCDA 1D8TA 2FZKA 3KEGA 3PA8A 4K9RA 2ID8A 2QB5A 4JLDA 3W5BA 3VSCA 4BFSA 5DT9A 2AGVA 2EDCA 2P5UA 4Z1OA 3HJRA 1SFRA 2GAOA 3GEGA 3P9CA 4HLUC 3GD7A 1RCTE 4RA9A 2WU0A 3M5WA 2MCFA 2HWWA 1SNYA 3NH6A 3FDXA 4EB6B 1V8BA 3OFNA 1EFPA 5C8XA 2QX6A 1ZGHA 5EJGA 2BFNA 1J0CA 3R5HA 3ND5A 1GKUB 3NATA 4ZI2A 4OGFA 4C3VA 2CL6X 1EHCA 1DIRA 1TVKA 1W1UA 4TRNA 2D2VA 5C80A 2NSHA 5DGTA 2QR5A 3DZFA 1MQ8B 3VNAA 1Z0DA 1VXRA 4EKDA 2G36A 2YVKA 1OXTA 1VL5A 1ORHA 2CXRA 3EAGA 4F9EA 1U28A 3T0GA 5CDFA 3EVEA 3ICWA 3EXHB 4IIBA 5KSPA 1T3ZA 4S24A 1QP7A 1BFKA 4JD5A 4D99A 1USWA 3QPUA 4YMWA 1O94A 1PZFA 1JBKA 1Y63A 2HSDA 2O0KA 4YECA 3EFOB 5EKXA 1PR3A 1JU3A 3N5CA 4HLDA 4M8SA 5IRCD 1HDXA 3E4CA 3RHSA 4NABA 3R23A 3K8YA 1EJ0A 3EAQA 1C3VA 5CH8A 3B1YA 2Y6VA 3VZRA 2DPMA 4ML3A 4XA8A 1IHDA 4S0XA 5K99A 3D0OA 1K2VN 2ZJ2A 1IM8A 1NN5A 4AUEA 1D6MA 3BJEA 2JZOA 5JISA 4RYDA 3TVYA 2NO7A 4K0RA 1HZJA 5K1ZA 4CM6A 4DRYA 2P62A 2H3HA 1F4VA 3LA8A 3JCZA 4KXXA 4M60A 4UHDA 1Y1TA 5LA6F 3TSOA 3HXLA 3BIOA 4D8UA 1DZIA 5HIAA 4DPLA 1K3TA 4Y2SA 3HB1A 4P4GA 3NWOA 5ESWA 3L1JA 1QCZA 2IE8A 4B2LA 5CBKA 1QQTA 4JENA 4P5PA 4MB6A 4UUNA 4D43A 1NN1A 1UMKA 3UFXB 2VDLB 3FTDA 1CE8B 2L17A 4GPZA 4IH9A 1JJBA 2ZIEA 2JH3A 3T5BA 3O31A 3GWGA 1X6VA 4HNUA 1W4BA 2ERXA 4ZU3A 4LJAA 2BI7A 1I3OA 4J7UA 3IEUA 4OHWA 2O2DA 1JDZA 1HYEA 2VSYA 3GIDA 1UMBB 4Y6OA 1U9JA 2QVCA 3CF0A 4HTFA 3O91A 1OLXA 2CDBA 2P6UA 4U2FA 4DYDA 2RCYA 3D6JA 1MHTA 3VHQA 3V3TA 2FPGA 4OBEA 3GAAA 4RHYA 3AUKA 5KB3A 3K0BA 3SLGA 5IT0A 2ZJ8A 4RDCA 4LYGA 3UIEA 4E2FA 1XZPA 2MWMA 1MXFA 1NATA 1OQAA 2J67A 4O2BA 1KVSA 1M34B 4NV3A 5JYDA 4LYDA 2CUNA 3EVGA 3FF1A 4ZOBA 2JF0A 3WI7A 4CPDA 1TAHA 2IODA 3R5SA 3TLEA 3HSKA 1MVNA 3FCOA 1KEUA 4NULA 1QAMA 1WW2A 4TYMA 3UANA 2HZBA 4RK4A 4C7MA 1CRPA 1SVWA 4EBBA 2OY0A 2QRQA 1UBOS 2AHRA 4JGIA 4EFKA 4ZT4A 3JYOA 1TJ5A 1KMCA 4JCOA 4NYIR 3QUAA 4CGYA 4DMMA 1XVVA 3E70C 3LBIA 4DARA 5KJCA 1CJMA 2DSNA 5IHXA 3EMDA 1CR6A 3IPCA 4PFKA 4XPZA 2BCJQ 3SU8A 5BR7A 5HUHA 2CLOB 5EXTA 3SCZA 2V6BA 2UVDA 3NYWA 1XPJA 2C83A 2SKEA 5AK0A 3SDSA 3RC2A 2V6MA 3V42A 4JDUA 1ZU5A 3NRCA 5AM4A 5HM8A 4F5YA 3RCBA 2ZJ4A 1F5SA 3NC4A 1RU3A 3ANTA 4WNAA 3TXAA 5JBNA 3I8SA 1EXNA 3M4NA 2FPKA 4I9FA 4M98A 3VM6A 1DWPA 4AN0A 1CY0A 2HDWA 2GBIA 3KE8A 1FFAA 4MVXA 2DLDA 2EP8A 1SUCA 2QUIA 3PFHA 3P9QA 3SLRA 4CMKA 2QT0A 3NV7A 3QBVA 3WO0A 4DCJA 3THOA 3QVSA 2GZDA 1KK3A 4D74A 5BUZA 5IS2A 1T3HA 3IE2A 4HDOB 1OFHA 1CRQA 2PO5A 4CM4B 1HYGA 1I6LA 2NTNA 1NM5C 2X19A 3N0TA 4QDTA 4A8JA 2H4HA 2WT9A 1R18A 3ZW8A 4B8WA 1C80A 4HGQA 3Q0IA 2AQ8A 1XDUA 3GLGE 1UZMA 2IXFA 1IMOA 4QL3A 5AI4A 4CLRA 2WUDA 5FA8A 2XT6A 4FGLA 5HYVA 3FVWA 3PDCA 3KVVA 1U80A 3PNLA 4YCCA 3L8EA 2WHPB 3FDZB 2WF6A 2ZLBA 1IRXA 3FZGA 4HCJA 4HTFB 5EE5B 3V4PB 1O97D 1QYVA 3I32A 2WA1A 4EUHA 5CA1F 5CUQA 4BQPA 1XNQB 1FU8A 3EQ2A 1WO8A 3TAUA 2KLBA 1P4SA 3A8TA 5C7LO 1P19A 4LKOA 1PWZA 1P3Y1 2EW2A 3SMVA 2QJRA 4JBWA 2X8AA 2PUTA 3SQOA 3WMFA 2I9KA 4ZVUA 3ND6A 5E6UB 4WN3A 2I1LA 3EIXA 3GGJA 1VE1A 2Y1DA 4KUGA 5LNK6 1X7YB 3T4XA 3A2MA 4C7VA 3RRMA 3OF3A 3MHTA 3WGGA 3K0KA 2H17A 3C3BA 1V6SA 1VBMA 2Q8QA 3FMFA 3CX4A 3OHPA 4FNMA 5K0LA 3TG2A 4KREA 3GT3A 4JBGA 4AYWA 3UATA 2JAXA 1P72A 2Z4SA 2VPTA 2NSDA 1Z63A 2NXNA 3TRJA 2JFOA 1JFFB 1M6WA 4OB6A 3UCEA 4S05A 4FWBA 2EJVA 2J08A 4ROSA 1HORA 5LQCA 3VGPA 2N47A 2QL5A 3AVVA 1C4KA 2ZSFA 2O3SA 1EGQA 4HK4A 4L2IB 1UJCA 4WXHA 4YC7A 3VO9A 4AUKA 4MRVA 2AFRA 4CTMA 3H2HA 3VXKA 4TV8A 3TOZA 1DJMA 1HDGO 1DVRA 4JJ8A 2C31A 4TVBA 3DXZA 4O4HA 5KQGA 3O90A 1RXSA 5EUCA 1TYCA 3TQTA 2FR8C 1P5FA 3BSSA 3GPBA 1Z4NA 4KWEA 4OHYA 1FFCA 3A1UA 2H4XA 3B7PA 2QTRA 3DZBA 2Q6OA 2ZBDA 5ALIA 2HT1A 1PD1A 4S1OA 7REQA 2WKRA 1T1EA 2OSBA 5B3LA 3LDAA 3ESBA 1T9BA 3C85A 3P27A 3H5NA 3P9SA 3ZE8A 3P9RA 1G66A 1G98A 4AROA 2IUTA 3RFVA 1S0UA 5C3MA 4D41A 721PA 2NO9A 4H18A 3P0RA 3UMMA 2QOEA 3BDAA 3CX3A 3LDUA 4DIBA 5IC5A 2QYOA 2OCPA 1EWTA 1ZBQA 3OEWA 5DDIP 5FI3A 5A5VA 4FT4A 2B4AA 4HZIA 4JUDX 4M9SA 4JOBA 4OLHA 5JY6A 4AQ7A 1OXMA 3Q2OA 1SQ0A 4IIXA 5KDOA 1OZHA 4ZIRA 2C2MA 3D1JA 3I5MA 3H8WA 4Q9AA 3V32A 4MYUA 1G5QA 4UJ5A 1T0UA 3SJZA 4A73A 5BSGA 1GNSA 5HQTA 4GDMA 2O2YA 1P73A 4LDJA 3SFZA 2ZBUA 4FYXA 2HY7A 2OXFA 1Y9JA 3VX4A 5AW7A 1SC6A 2QAJA 3QF4B 2J7PA 4LNUB 4MS1B 3DKKA 1W96A 1UDAA 3HZZA 4HWGA 4CEJB 4ER7A 3GVPA 3FOCA 4NZPA 1J9ZA 1P9NA 3E1SA 4QXRA 4UOZA 4TM7A 1LBSA 4N0QA 4C0JA 4CLDA 4EB0A 4DR4B 3VR0A 3A2KA 2I6UA 2F48A 4TXJA 1JHDA 1G19A 4RF2A 1QMGA 2JHAA 3SE7A 3TCKA 5MN5A 4HV4A 3L46A 3DL4A 4M22A 1XTVA 3HDYA 4B73A 2AG1A 2OFOA 4BP9A 3Q8WA 1E1NA 2JHFA 4DMLA 2JGDB 2IYTA 3K7EA 4HT3B 3BT7A 4BE9A 2FPXA 1JG1A 5TDHA 1JEQA 4L8GA 1H05A 1AZTA 5HQ3B 2F43B 3BMNA 1QMPA 2FLVA 3LOQA 3ZHZA 3FA2A 4RGVA 4XDYA 1QH8B 4JR1A 1W2WB 1ML3A 2L18A 3W5HA 1A3CA 4P38A 5C31A 2C4NA 3RU9A 5CB6A 3H1PA 5A6VA 1W0JA 2YXDA 4IGEA 4L07A 1BEEA 4U63A 4ZPJA 4L85A 4F4FA 1RWQA 3AXTA 2WVGA 2CUKA 2A9VA 2ZPAA 4ITVA 1CJVC 5KQLA 3KSRA 3GNQA 2I55A 2WU3A 3C4VA 1T8YA 3L7LA 1OZFA 3AY3A 3SS7X 5KNBA 5AVQA 4EA8A 4L5BA 4MKXA 2DHCA 3SD7A 1W88B 2W8BA 3ES9A 3LPCA 1RYMA 4X8HA 4FK8A 4ZALA 3WGLA 4C1BA 5BV8A 3OM1A 1KZHA 2PDAA 1XVTA 4ZXPA 3D6FA 3MS2A 3EIQA 2B94A 5DXFA 2H1WA 1BJRE 2AE1A 3RYTC 5BW4A 1M2HA 4CKWB 3VO1A 1PF7E 3GLUA 2BTQA 5CVEA 1AM4D 4BXOB 4G2NA 3K73O 1ADBA 1G8KA 2C00A 1PT7A 5F51A 3ZI0A 4YGXB 2R1VA 3WJ2A 1FRZA 1N5DA 4YV7A 2W5UA 3A6LA 1B8UA 4YRFA 1D2HA 5I01A 3H9EO 1LVUA 1ZUWA 3F2VA 3LPMA 1BSVA 2VAMA 2KLHA 4QDXA 4TROA 1Z68A 4ZV9A 4MUJA 3W9SA 1Z7BA 1IU9A 3L1VA 1WG8A 3LUAA 1JG3A 4RZXA 5WRFA 2XMZA 4EYGA 5HW0A 1QH9A 3MWJA 3OU7A 5IBQA 3U9TA 1E2BA 1PR1A 3TEFA 4DMGA 1TM5E 3HN6A 1VE9A 4BAUA 4KCGA 3SZOA 3HB7A 2XB4A 2XRMA 4J3NA 4ARIA 2BFEA 4D0SA 1T9HA 9LDBA 3TGWA 3K0CC 4RANA 3ZYCA 3LLUA 5JWOA 1FP4A 3CLRC 4H0CA 1LVHA 2A0YA 3IDSA 1U3FA 4URYR 2HHJA 3QBDA 3QKIA 3G5MA 4W9RA 5DBHX 1FNSA 2Y68A 4O4JB 3RRJA 1QF9A 1Z82A 2P8JA 3UVEA 3IAM6 1H9AA 3VNBA 3IDQA 3NP7A 3SC4A 1SKUA 2GX6A 3N86A 1VM6A 1VCHA 2DTXA 4WFQA 2ZRKA 3ZIDA 4YX9A 3IB3A 1V7ZA 3FJOA 4GVXA 5CT8A 3GDHA 4OXIA 3WHKA 5ADUS 1IHUA 4M99A 2PANA 3IBCA 4MCIA 1OT3A 1E7MA 5GZ6A 3BD8A 3MTGA 4B4KA 2JFFA 3R9XB 1UEJA 1KIAA 1YUNA 2OAP1 1DU4A 1EDOA 1DBWA 1DMSA 2BCGY 2YIVX 2YTZA 3L18A 2HREA 3P4UA 3RTDA 2NUTB 1E0SA 1Z07A 3B5JA 4ARZB 4XPIB 1ORVA 3MSXA 4B6PA 2I6GA 2BR3A 4YUAA 1IHYA 1WV1A 4UNNA 3UB2A 4AQDA 4REQA 2AOUA 3WLRA 3QLEA 4P80A 1X1RA 4AS1A 4RPKA 4R5MA 4NYMQ 3I37X 3P9PA 2VEOA 4O4IA 4PIMA 1XU4A 2QGNA 1MC4A 2ZJ7A 4HY3A 4LAFA 4RMNA 1GKKA 4YYZA 3RTEA 3GHYA 1ECJA 1C3OA 1Z4PX 1U0GA 4PC3A 5HUJA 3UOWA 2XNKA 1Z0SA 1A9SA 3GJZA 3C3EA 1V5FA 3CGGA 3QV2A 1VCNA 2G8NA 4Z9YA 4RKYA 1CZKA 2NUPA 3C3DA 5COAA 3CVXA 1NR7A 4FFBB 3OE7A 3WGUA 3JQAB 3OPXA 2LZ0A 4QULA 5LYJB 1F4LA 4BLTA 4G81A 2KI5A 4FBMA 3RAEC 4RFVA 3JQ6A 4TOIA 5P8WA 4C0HA 3AYZB 1HT3A 3EG5A 2QRJA 5IFKA 2IEAA 4KQCA 5HR5A 1L7AA 1QWSA 3ZK7A 4C20A 1MC5A 1CIJA 3C7TA 2IDMA 2R85A 1T0IA 1M1XB 4DBLE 3GN2A 1U8XX 2WVJA 1O94C 4AB1A 1FYEA 1T9GS 3Q7PA 4ZHQF 3M9WA 2OD7A 1WZIA 3MTDA 4MRMA 5BRJA 3NVMB 1UM9B 4ZGBA 5D1HA 3G0CA 2OKCA 3HBNA 5BY2A 1U3CA 4QAJA 2O9JA 2CFIA 5JPIA 4Q1BA 2NU6A 3TTUA 3WJAA 3FYSA 1AUVA 5K4HA 2WQ6A 2ZM6B 4LBVA 1JIJA 3LP6A 3GOQA 4GFDA 1CT9A 3RLIA 2P1DA 5KAPA 3Q7RA 1NLZA 4W5OA 3QEMA 1YSCA 5L3SB 4M9XA 5B4TA 2VLBA 2ZETA 4IP0A 4DE5A 3S1SA 4JT8A 2HSZA 1OWMA 3IURA 4LS3A 1M0TA 4EB3A 2CVQA 3T99A 3ECCA 3P2OA 1KEPA 1Z08A 4L8WB 4DRZA 3WKAA 2CJWB 3QXHA 3JQRA 4C05A 4WNIA 1QX4A 4DANA 2J5KA 1NBEA 2J45A 5HCUA 4FC6A 5KNCD 4PC6A 3VPCA 4MVYA 4INOA 1IN8A 4JDPA 4QWWA 2OL4A 2IQ5A 2RHWA 1X8XA 3OF2A 2VK4A 2ZTHA 4YCDA 2EAUA 3OWOA 3WV5A 3LRPA 3Q8LA 4Q4AB 5HWSA 1YJQA 3R3ZA 2HK7A 1Z5GA 2W70A 3K5IA 4DAEA 3V4ZA 4Y2VA 5JD3A 3DV0B 3EZXA 3N7UA 4PPQA 1VMAA 8ATCA 1XCOA 4JQOA 3QKRA 2RKWA 3HXQA 3K2BA 3UKJA 5BV2P 3CW8X 3KXKA 3GLGA 2V98A 3BGSA 3GH1A 3PGMA 2IP2A 3RVOA 1O03A 3UB3A 3UHAA 4AJPA 4BCBA 2GYYA 2XCUA 3O94A 4TKLA 5KQRA 4WACA 2B4TO 1FQOA 3U4AA 5FX2A 2VUUA 1QGUA 3MOGA 3BXEA 5E7MA 7YASA 2NAPA 1VSUA 4FSXA 3BD6A 3BJMA 4OMFG 4PC1A 3CVJA 2AT1A 2B98A 3LIIA 4YV2A 4MVJA 3DOHA 2IIVA 4X1KB 5PGMA 3NDRA 1YMQA 2X7HA 2EJUA 2P2SA 3RAJA 3TW4A 1VP9A 2FWNA 1MO5A 4Q16A 1VFNA 3UAVA 1Y3BE 4FSHA 1UPAA 4XIIA 4MQUA 1U6JA 1NWCA 2FR0A 2ZPUA 1XEWX 1VGVA 3GGCA 1FFXA 3KJGA 4MB2A 3ZZ0A 3R8XA 2UV8A 2QBYB 2Y71A 3QWBA 3COVA 4ABTA 1X14A 2I9PA 3G2IA 5LZ5A 1XWWA 5BVHA 1DG9A 1L5FA 1BYUA 5CVUA 5IAOA 1TPYA 1F51E 2P5YA 2XAAA 2ZSBA 2AZTA 3SOZA 1PVDA 1OFGA 3QUCA 2XF2A 4HGRA 4QUJA 1G41A 3UFBA 1F8UA 2GPWA 2RGUA 1TQHA 2VJQA 3FMGA 1T1SA 2X86A 3JVDA 1HA3A 3OQ1A 3T34A 1DRJA 2C03A 1XG5A 3FDFA 4PLWA 4O29A 3JZFA 4UE3S 4BGUA 2ZT6A 3GCGA 4EJ6A 5U4XA 3JVUA 1ACLA 3U7FB 1UC5B 2PLRA 3I0MA 4C7OB 1Z0KA 4CM7A 2Q27A 3T3DA 2X41A 1LDBA 1KY4A 4XARA 3CKMA 5G4KB 4H17A 1N9ZA 3ABOB 4EO9A 2P9BA 3IQDB 5C7YA 4UU0A 4HWKA 2JIZD 1H93A 1UXHA 2MSCB 4K1LA 3QSYA 2IV3A 1PHPA 1K88A 2Q6LA 2QX7A 2HSWA 1WXDA 1FDIA 1N8SA 2Z30A 2OC9A 1U2DC 2NV2B 5C52B 4KQHA 1NR1A 3NOQA 3P0EA 1HNZB 2JJ1A 1UZLA 4NBLA 2CMDA 2O5CA 1D9ZA 1FJ2A 1GY8A 1DAFA 3HABA 2ZI7A 2EJTA 4M1ZA 2J0UA 2IZ6A 5CNMA 1M5RA 2GPAA 4BWVA 3DE1X 4YPFA 1XD2B 3KB6A 2K5UA 1VBNA 2SKCA 4CI0B 1U9CA 1T5TA 2JHGA 3SBEA 5HP4A 3UPDA 1Z2NX 1V5IA 3ILXA 2CD7A 2P79A 1CFZA 2GLXA 1SCNE 5KOJA 1E79A 1UJMA 4BZZA 1QO7A 2OQ2A 2X4GA 2QSJA 1DFHA 3B2NA 6REQA 3GHHA 3OP1A 4Y2GA 3WO1A 1QANA 4FCCA 5CB4F 3RBAA 4PV7A 4RFSB 1WA5A 4C4XA 1SKQA 4IEIA 1YXMA 2H48A 1B14A 1W5FA 3GFOA 4WL0A 5L95A 4GL2A 3LT4A 4QDUA 4EW2A 1NYLA 3C1UA 1XPOA 3DMFA 1JDNA 3RSHA 4KGDA 4U2BA 1NI4A 2GF9A 4J3FA 3O75A 4JLKA 5AW0A 1QIFA 3ETCA 1LFAA 3B6MA 3JARA 2AR7A 4FFVA 4MUAA 4AU1A 2JLCA 2O2SA 2OO3A 5JYBA 1BQ4A 3WL5A 1GARA 1LVGA 4MI9A 5K8UA 3OZTA 1LNZA 1CY6A 1O9BA 2QR2A 4P1ZA 1HL3A 1TD1A 2MR5A 3GGOA 4HQOA 2DQSA 3PE4A 1C0PA 4MZDA 3C74A 1MOPA 1CUXA 2AYXA 5IK2D 4I4TB 1NUAA 5DM2A 1JH9A 1VG0B 4E2YA 5LQAA 3KYDB 4KXVA 3L0BA 2B8WA 3BWEA 3QY0A 2ACKA 5GONF 4BFTA 4I8DA 3FTEA 2WVAA 5JXIA 1VRVA 3ZE0B 2GK4A 1ZA1A 4NS4A 3DVRX 3MJ4A 2H5IA 5DHPA 4MAFA 4G4SO 2I3ZA 4GWKA 1NJGA 1XA4A 3OURA 3NVAA 3HI6A 3ZR4B 1FNCA 1WBDA 2PX6A 4PQGA 4IDBA 3BCUA 1NONA 4MWGA 1TT7A 5KCMA 1DPGA 3TQSA 1FDUA 2CFRA 3EWIA 3UJCA 5L45A 1N36B 1IN1A 1RFLA 1QHHA 2GJSA 4AP6A 5BSUA 3FE2A 4LGMA 2IHNA 3MUEA 2IHYA 2Y2VA 4R9UC 1SD1A 2DF8A 3A1WA 2XF8A 4HPXB 5E9JA 1KOFA 3RJ5A 2JGIA 2VP0A 3OPMA 4MROA 2BLNA 1RRCA 3FKQA 2QX8A 3OLQA 3DP9A 2PT6A 3G8YA 1GM5A 1LZLA 5ENZA 2WM3A 3RVDA 2QGZA 1R4NB 1RAAA 2H2IA 4KH0A 1O3YA 4FW9A 3H13A 2G25A 1AUOA 4CIVA 1HEIA 2I2FA 3RUFA 1UEIA 3BWDD 1NOIA 4LY6A 2JFGA 5IC4A 1MO6A 1E4EB 3DMTC 4HYQA 3ZV3A 4MJLA 3C8MA 2P9EA 1FIUA 2WIFA 4FCWA 2YC2C 1OX5A 3HNOA 4MGZR 3NANA 1JWBB 4BO7A 5BW6B 5LC1A 5LUAA 5LXTA 1DJPA 2Q6TA 3CMCO 3DWEX 3M3PA 3K30A 3OQHA 3G9UA 4QPNA 4F2DA 1R27A 3DOIA 2DEUA 3LE8A 2HSJA 2ZB3A 4ZI7A 2FFAA 2NMVA 1S3IA 1U5CA 5KHAA 5CB0A 1FDWA 4QUIA 4KVFA 2VJOA 3ORRA 4YWHA 3WWPA 2X23A 1UBKS 1UK6A 3C6BA 5JAHA 3KRTA 5JRDS 1KFKB 2G1AA 1Q7EA 1XLUA 2CXHA 3AG5A 2LRHA 3C3YA 1GKIA 3D2CA 3DZJA 4BVEA 1S89A 2FG5A 4YRSA 2FX2A 1E62A 5KYUB 1XLTA 3F97A 3H87A 3NXSA 5CYPA 3DW3X 3RARA 3TDNA 4DCMA 5LQUA 2PZMA 1LS1A 4H6PA 4P08A 3OFVA 1T2VA 1SB8A 1PR5A 3WSTA 3FBTA 4IJUA 4EVRA 1NUQA 3UUWA 3JQGB 4ZYVA 4OM8A 5TX7A 1LDGA 1F20A 2QK4A 3A9TA 3NBUA 1ZCZA 2JFBA 1ARZA 2ZYVX 2V55B 1X7YA 1C41A 4X44A 2I0FA 3D6TB 1F0KA 4AJ2A 4F12A 2VH2A 4MS3B 1E6KA 2QZSA 1I13A 3ONDA 4QNNA 3C6QA 1YR3A 4I7EA 5HEKA 2BEWA 3RT1A 5BQFA 3C7KA 2P68A 4MHOA 4P3YA 3HFGA 1JPNA 2WWYA 3TLZA 2GNPA 3OIYA 3H2JA 1Z34A 1A9QA 1J23A 1HMYA 1TLLA 3FDZA 4NCIA 2DR3A 2QYSA 4Z49A 2C2XA 3GUVA 4E4RA 1KP9A 1DKLA 2FVXA 4MVJE 4TRMA 5AVYA 2LVBA 3K0CA 4I6EA 4EH1A 4BRSA 5ELXA 1IWBB 4CLOB 3S2EA 2O1XA 4IIVA 4L8YA 1PR9A 3TM4A 4FSDA 1E3MA 4PNHA 1V71A 2Y27A 3DBHA 4FMDF 2X76A 3KSUA 1X2EA 4X93A 3HXTA 1IPEA 2QORA 2FWJA 4HEHA 4WECA 5KNDD 4YUYA 3WA7A 1O6ZA 2GN1A 4ESHA 3AGQA 3RFCA 4CMAA 4S2UA 1RYZA 1G1MA 1C4OA 1M75A 3FNGA 3NMUF 1U9ZA 2FZWA 4C2BA 1MVOA 2EP7A 2FN8A 3AF5A 4I0WB 3GDGA 2R6CA 3T3IA 1ZH6A 2X14A 1Z0AA 5AXBA 3RSQA 2BYTA 1EX7A 1AS0A 4QDJA 2WF7A 1GU0A 1Q14A 3PSHA 3ZU6A 3H04A 3NNSA 3BG5A 4DLVA 3NHJA 4QJ4A 2HBQA 1LDYA 3C6ZA 5LQRA 4N49A 4LJKA 1CY8A 3KELA 1CLUA 2ZYSA 3O7WA 4DEYA 4NYMR 3ROXA 3QLVC 4DG9A 1YS7A 2NLOA 3H11B 3QE3A 4FHFA 3CSUA 4P34A 2YX1A 2QW8A 4UHFA 3D54D 3LT0A 3STYA 3ZGYA 2RG7A 1G8YA 1PEYA 5JDCA 1VIYA 4HF7A 3AL2A 3AHHA 3R3JA 4TV9A 4M0CA 4PHFA 3N2LA 2EKLA 1N2CB 1XCLA 4Y9RA 2BJVA 4GOMD 5DH9A 5H70A 4EY4A 1GG8A 2YWFA 5IJ9B 1JIIA 4A2CA 3AVTA 4I9HA 4UEJA 3VR5A 5JCZA 1EIZA 1RIFA 1NXWA 2C9DA 3D2BA 2I4IA 3I30X 2W4MA 2JW5A 3TGLA 2VDKB 4YMVA 1U0TA 4Z6KA 4OGLA 2IZ7A 4R81A 1K8RA 1M76A 4L5JA 2IXEA 1GPKA 4NOLA 3T06B 4DMKA 3LRTA 4DL9A 3GVXA 1YFJA 4FNOA 3WTBA 3EDMA 2NUBA 3BFXA 2FQXA 2XUHA 4JL5A 3UJBA 4OCZA 2Q41A 4D0RA 4QHSA 4RV9A 2IHTA 2A5GA 1JA9A 3GZJA 1TRKA 2TS1A 4LQLA 3ZQKA 3ZV7A 2GVNA 4W9NA 1OF1A 1W5TA 4B7AA 1U98A 1VKOA 1UZNA 4CIXA 2QW0X 2ZAMA 3A4NA 3A58B 1B0ZA 1V25A 2GCOA 3BSFA 3VZPA 4QYIB 3EGOA 4OOEA 4QSMA 1T4MA 2ZB8A 1GLNA 1NMQA 2I66A 2JFPA 4G85A 3U4CA 3T7DA 3IELA 5F3WB 4KH1A 2JIBA 4ZQEA 3EEFA 4KE9A 1QKJA 2YY6A 2WM2A 2JKVA 1B3RA 4A0SA 2CN1A 1FE8A 3LTNC 5BUQA 2JEYA 4G0ZA 4GI2A 5DWVA 5AXAA 4FGJA 5JZOA 3I0NA 3OPYI 3N3BC 4GZMA 3T3EA 5DIFA 2BH2A 2OGWA 5HQJA 4ENPA 5INTA 3A05A 3PDUA 3OIDA 2WLSA 4N5DA 4DNQA 2BFWA 4XWGA 1SBIA 2ZQYA 1Q92A 3CISA 3E5NA 1VB5A 5FBZA 2ZJ1A 3EPRA 5DTEA 4CKYA 3GPLA 2W2QA 1EEHA 3VZSA 3O4GA 4QTUB 1H2FA 1QH1B 2XOKA 4FQ5A 1H2ZA 4TMYA 1QVAA 1GUFA 1ZWLA 2C99A 2NTYC 5K6TA 3O8CA 4M3NA 3AB8A 4CTKA 2WTXA 2HN9A 3LAWA 1PFQA 1TVKB 4XEHA 2FV8A 2Y1GA 3A26A 1L7EA 3I34X 1PYDA 4I1YA 5CBPA 4NJEA 4RJJA 2VOEA 1I30A 3IAXA 5B6JA 1C2YA 1G8FA 3WWZA 2J07A 1SCKA 3L4JA 2EWVA 3U44A 1PG0A 1YZHA 3ETJA 1P75A 2FMIA 2R44A 4KZKA 4LBYA 2Y9PB 4UARA 2A1IA 4Z2YA 1CR1A 3RIEA 4A0FA 1A1VA 4JXZA 3HU2A 4IXDA 4QG7A 4TVSA 3NFRA 4MWDA 4Q7MB 4Z9FA 3PL1A 3L8HA 2ZAGA 3ZD8A 3HLYA 5IU6A 1ZD9A 1T3SA 5EIBC 4WAUA 4BQQA 2IY7A 3GG2A 3ML1A 3U3MA 4AO8A 3HVRA 4URWR 3WLHA 1I3CA 5TQ0A 4YR7A 3JR3A 3E2MA 3KVYA 3ZCTA 3V9AA 3ZJ4A 2R0QC 1XIVA 2R25B 2XHZA 1GRRA 1ZY2A 3GL9A 1UBEA 2DSTA 1UIMA 2BUCA 1DX9A 1ZN7A 1DTEA 2VDVE 5D5QA 5DHTA 1ENYA 1G18A 1X7ZA 3S70A 3F7TA 3WB1A 4A6PA 4B3RB 4ZAFA 3K1ZA 5JJ5A 4EKNB 4XIYA 2V6JA 4JJZA 1ODFA 2A6PA 2ST1A 3U5ZB 2JGKA 3WAKA 2BC9A 6ABPA 5D3KA 2G4LA 2YZNA 4FMBB 4G0QA 5E1BA 1JDBB 4B45A 2ZR9A 4C21A 4KXMA 4F91B 1PFYA 1VHDA 2DQZA 3MAGA 2L2QA 1Z6ZA 3T0FA 1XZJA 1QF7A 4S12A 1P1IA 1RWKA 2JASA 2QEQA 3O5AA 1T0HB 1SCJA 4HQ6A 3ADDA 1PL8A 1CUBA 1MNAA 4QFBA 4X92A 4WNCA 7AT1A 1C0KA 1Y34E 3R7LA 3VPFA 1DBSA 4QGHA 3JTMA 4BTEA 4KHPB 2OGUA 4E21A 4L9RA 1Q0TA 4COKA 1M7BA 1W34A 4EF6A 1X80A 2VDOB 3DOCA 4E88A 1FBNA 1KYVA 4OD0A 3TX6A 3U7IA 1EYZA 3B89A 4HI0E 4DQKA 1YQGA 2CLDX 2VDPB 3GRRA 1BCRB 3IAEA 4XUDA 5NULA 3RAGA 3QUSA 4DIEA 1Y8QB 3MTQA 3LQ2A 2C98A 4A6DA 1T8TA 3T9FA 4IH4A 2XVAA 2ZIGA 4DSAA 1Z0JA 4K6OA 1XQ9A 2BFFA 1KEEB 1O96A 2FWRA 1RVDA 5C3UA 5G1PA 3D4LA 5I4KA 5BT9A 4YRZA 4PZEA 4CMIB 1VJDA 3RS0A 2PKCA 3ZZMA 3TMKA 3D64A 4NXMB 4WZAA 3PFNA 3EXFB 3V9PA 2G7MC 1G5PA 3LHIA 5LBUA 1TA0A 4HSEA 3EA4A 2FRXA 2F3RA 2ZITA 1WEKA 2OV3A 3E22A 2RK3A 2VZ8A 3CZMA 3DDNA 1VE7A 1XHEA 2OCAA 3ILVA 4JLUA 4X1OA 4AULA 1ZRHA 3AY7A 3E8SA 1UJBA 5D51S 3WWYA 4HXGA 1XPUA 1KOGA 3QVGA 4O4JF 2BEUA 4MIOA 1WUIS 1JHAA 1QR2A 1JIXA 1XWIA 4R2KA 1ZNZA 3VAZA 1V0JA 1SHTX 5JVDF 3C6KA 1KFEB 2WUFA 4BNLA 5B3KA 1VMKA 2JFNA 2W71A 5IFLA 1U1DA 3Q6IA 2D7DA 2QM0A 3C3PA 2FOLA 4NBUA 4B5LA 3H86A 3ANLA 1JEYB 3DKVA 3DL7A 3N2EA 3PTZA 3R1IA 4Y2PA 4ZYLA 1FS6A 1NUSA 1O95C 3ZGOA 1LDNA 2ID9A 4NDNE 1YC2A 4UW9A 1AQIA 5BVGA 2O7RA 1OB2A 2B20A 4QUGA 1Y4AE 3KX2A 5CAEB 2C92A 5T3UA 3CPJB 4W1PA 1JEYA 2QUBA 4M8KA 4MR9B 1PV4A 3GX1A 1X9HA 3BXFA 5ALUA 4G0WA 3IQIX 2NXEA 3C45A 1FDRA 2FMXA 4ND8B 1A9XA 2NTEA 4AZVA 2R48A 3QELB 4YH1A 4DCGA 4FGZA 1ND5A 1RYDA 4OAQA 3SZRA 3B51X 1CLEA 4IDGA 4CL2A 3O1LA 4TLEA 2BFBA 5CH3A 2YVQA 3ZEIA 4I5IA 1E2UA 2EEZA 3HKCB 3JASB 5L3QA 2RJOA 1XMOB 3ZDDA 1RSZA 1JDSA 1C9KA 3V4FA 2BEVB 1XKLA 4EKYA 3TBKA 3WRVA 2A5DA 3CSSA 3HCBA 3ZDXB 5ALEA 1GZ4A 1RQNA 1QK4A 1TAGA 2XECA 5AUOB 5BVGB 4UCFA 1BMTA 4P35A 2VP6A 1PLKA 5KYYB 2YKGA 2AXPA 3MBIA 2ATVA 1G42A 1UCFA 1J2JA 1FUEA 3I9MA 4E1AA 3B3GA 4M1WA 4AJEA 3KQHA 4Z8YA 2NVWA 3R41A 5ALKA 3HXOA 2VQSA 1HQDA 2I62A 3DMTA 4OG2A 2X9VA 3V8RA 1AQNA 3SVZA 3HN7A 8GPBA 3R4VA 3ZLUA 5DLQC 4DV6B 1U8AA 2BVNA 3QEKA 4FZJA 1P4JA 1VI2A 4NBVA 4ZCSA 5JJCA 3DLBA 2E4WA 3I1FA 2DZDA 3UGTA 2PUCA 1U2PA 4RSRA 4UKDA 3PUVA 2BJWA 3W78A 4J3JA 3I72A 1FTSA 3VBCA 4C5AA 4FOPA 1E66A 1GFWA 4JBIA 2MT9A 4QU0A 3HO1A 3H19A 3AVPA 4F2HA 1I7PA 3MW8A 4PZCA 3JX9A 3DKPA 3LHDA 1JXOA 2W90A 3X44A 1N77A 5JSHA 1Q2UA 1J2YA 13PKA 1P4GA 1MA0A 2QAIA 4BN4A 4C2TA 1X87A 3QE4A 5A9RA 5H0IA 4QTYA 5LB2A 2Q5FA 1XYYA 3M2PA 3R77A 2HF8A 3K09A 4QUAA 4WKBA 4KNWA 4QODA 3THWB 3IEVA 3AF2A 5AXCA 2GEBA 5T4BA 4OHOA 2IE0A 3X1DA 3HEAA 4H7EA 3EXAA 5ECDA 4DA4A 3MVEA 4JI8B 1DBQA 5F33A 3B6IA 4YT5A 4LQDA 2VBIA 3ISTA 3DTTA 1E2HA 121PA 3MLEA 2YHUA 4JUAA 3EGIA 1QTNA 3FJ1A 4U7FA 4JYZA 1PFWA 4J29A 1ZD4A 2BFEB 4QHYA 2YDYA 4WDQA 3U7RA 3USZA 1C9NA 2WD7A 3GPDG 4LX8A 4RK6A 5G4LA 1QQ6A 3EUEA 2HF9A 1J1ZA 1UWLA 2BFDB 3QFHA 5CX1B 4DLKA 2QRHA 3A25A 1T2UA 1MT3A 1JKXA 3JU3A 3B48A 3OM8A 3RO7A 2X2EA 5TIIA 2LV8A 4WCVA 1WXQA 2JKZA 5KSOA 2R7KA 3BH0A 5BXQC 3BK7A 1XAJA 3G8BA 2DPXA 3AB7A 1VPTA 5FOWA 1MJ5A 3CZPA 3NTRA 1VZ3A 4BNKA 2PHZA 1E99A 3AUYA 2XSZD 1S7GA 1ESCA 2BTQB 2XGSA 1E2EA 3JALA 4P3KA 5F9MA 4J2HA 5JIBA 2FQWA 2FYTA 3LVBA 1SVLA 3HP7A 5K8LA 4U9HS 4XE5A 1QDLB 4MVJG 5HKKD 1K7CA 4EX6A 1HTBA 1D8AA 2C61A 2NWQA 3T1TA 3NI2A 3S2SA 1RWMA 2QPAA 4D8XA 1X1DA 2UZ1B 3JAKB 5AVRA 4XWWA 4MS4A 3U4DA 4HH4A 2P2NA 4D9MA 1LNSA 4JKOA 4F9FA 1S3SA 4CZ2A 2PD6A 5IBCA 1M2FA 1J25A 3NBYC 4XB2A 4E14A 2GXAA 2W98A 4ZC1A 5LA6A 4K8OA 1ST2A 2WG1A 2QTTA 3OEHA 1GV0A 3G0BA 4UZSA 3WNQA 4ZOEA 3EA5A 2AEEA 3JVIA 3STUA 5J58A 2Y92A 1ULAA 5CJ2A 4AJ1A 1F12A 1YZYA 4WFKA 4BDTA 4B1FA 1C1HA 2I1QA 4JB0A 1PZGA 1RKQA 2WSSA 3PXEA 3C14C 1RXIA 2PD3A 5K8VA 5AK5A 1ZWKA 4Y9DA 4CR8A 5C32A 3K0SA 4I1PA 1NE2A 3D5EA 2WHEA 3HJBA 3EE6A 3W6UA 1TCBA 3OMLA 4OH7A 2YVLA 1K3UB 4YAFA 4NJEB 5EPUA 4RE6A 1OAOA 2YZKA 4YAGA 4OYHA 1ZJ4A 5K4GA 1E9BA 1SJ9A 1O1YA 3K9BA 2RIRA 4QGBA 4Y0NA 3SXUB 1WDTA 5KWIA 5EJAA 1W7AA 4ROTA 4RZUA 3GLFB 2COEA 4ARCA 1GDHA 4M37A 1IVYA 5EXDA 2EL9A 3U3JA 3VR6H 3LBHA 2DXIA 1AGPA 3LUDA 3W2EA 3IA7A 3RQSA 3N0VA 1RJ9B 4GR9A 1ZGAA 2AQKA 5FNVA 4IIUA 4RD6A 2HI0A 3ASUA 2IYRA 4IXNA 4QASA 1NVKA 3CEJA 3MELA 4ZO8A 1DDIA 1P1FA 1A7UA 2OHIA 4J0GA 5HG0A 3UG6A 1U8YA 1MR3F 3E23A 1LV8A 4J6EA 1IY0A 4KQ6A 5C8YB 3V8MA 4RSMA 4KLCA 2AOTA 1NBOA 2VAWA 2WMDA 4QPPA 4ZO7A 4AM8A 3IMFA 3TQFA 1CV2A 1O5IA 1P4AA 3M81A 4B3FX 2E4AA 1SURA 2C1ZA 1Y8CA 4JLNA 2V03A 4LI0A 1UBCA 3IP8A 2UUBB 1VIDA 1UBUS 1P0CA 4I2VA 5HF8A 3TAXA 3TQIA 2CSXA 5JFTA 1GPLA 3X0DA 1H42A 1VG8A 2WIDA 1ONPA 2EBUA 2FSGA 3DHYA 3EIWA 1EGMB 2J9FA 4FIZA 5ITWA 1OD6A 3ELYA 4F5EA 3ET4A 2EX4A 3QUTA 4PO3X 4DDKA 4ZYYA 3C3KA 1NZDA 4OU5A 2H57A 3I76A 2DTDA 2FP3A 2PU7A 1C5KA 1OILA 4OQPA 3P9XA 3B1WA 1WF6A 3WYFA 4J75A 1NMYA 3QENA 3AM4A 5D00A 1IG3A 5H9VA 3F46A 3IOEA 5DPMA 3CIOA 3JRXA 3O4VA 5CFPA 5JEDA 2FCAA 2QIPA 1GTJ1 4NG5A 3OAAD 3MMZA 4OSPA 5L4SA 2QJFA 4AECA 4YP7A 2JBAA 1GTL1 2GH1A 4UVEA 4E3WA 4TZ0A 2ES4A 4BMXA 1RAIA 4BVBA 3ZDQA 3A2NA 1GDDA 3AHJA 3FZYA 1QZZA 1C3JA 1EBFA 1G20A 2BR5A 3FVQA 1NT4A 1UXJA 2FGKA 4FR2A 1N4DA 4HDCA 4JL6A 4KQJA 4JELA 3PNMA 1GGMA 4NFYA 5G3YA 1HKUA 1UJ6A 5P21A 3BK1A 4C06A 3HSYA 2AWNA 4BECA 2ECKA 2VPIA 2BHTA 2Z57A 3F1KA 3AR7A 2HCBA 2VYQA 5KQMA 3KTOA 4NCBA 2C9MA 3F7MA 2PZEA 4Z3DA 5C46F 3FOWA 2I91A 3C8UA 1P4HA 4WKCA 5AHXA 3S0JA 4UTNA 3ZDAA 2O8FB 4GU5A 2OZLB 1CS4C 2JAHA 2FLWA 4L73A 1C0IA 3IEPA 4L5YA 1KR5A 5K6AC 3L4KA 1JUDA 4H6VA 5DNEA 2VP5A 4OK6A 1AXRA 5CFMA 2GZ1A 3Q85A 3X43A 2QS9A 1QO9A 5CT9A 2OB1A 4C2UA 4QFCA 2R5FA 1YDEA 1GR1A 1KC3A 1WUKS 2B34A 3EVZA 5HS6A 5EMNA 4RPIA 3QOFA 4LDPA 3PJDA 3DBHB 4KX3A 4V2IA 3BYZA 1F14A 5AHOA 1Q17A 3H5LA 5EQFA 5ALFA 4U7HA 2PFSA 3FPHA 3I73A 3AF3A 5T5QA 4XXHA 3RJZA 5BYJA 1VOTA 3HYNA 2UUAB 4W7SA 1U0JA 1L3BA 4ZVOA 1K4YA 2Q1WA 1B43A 1S8OA 2PL9A 4NECA 1J22A 1G2OA 3KJHA 4B6JA 3DAGA 2YYSA 3JYPA 2W6CX 3F6YA 2PUGA 3CUEF 2H85A 1XDDA 4RVUA 4LSWA 4DUGD 3DZKA 2MYUA 3JW8A 3WLLA 2FPWA 5AWFC 1DOZA 1RHRA 1EK1A 4U00A 5AUPB 5MFZA 1QIKA 2GILA 2BEWB 4O6VA 3F2IA 2QUZA 1YRYE 5HMMA 1ZUNB 4AF7A 4BKOA 5JJIA 4WK4B 4KPYA 1X2BA 1JV2B 4MS3A 1YE3A 4BX0A 4H4EA 2AFHA 2DQ4A 2Q6KA 4G09A 2XKBA 3OE4A 1MB0A 2VI5A 3OPYB 4N76A 4E15A 3GJQA 1D2EA 3UHOA 3VJKA 2HRBA 1KQFA 3DBVO 3OICA 1R15A 2YWEA 3W5CA 1ODLA 1O0SA 2PKWA 1RHQA 1S2GA 2F1OA 1E6UA 1YQQA 1EWVA 2OO5C 2Y1KA 3C5CA 3O8NA 4KV9A 5EZQA 4ES6A 4MLCA 2V9ZA 3IAUA 2B35A 4HMOA 2OK8A 1XCPA 3H2ZA 2PX3A 3I45A 3JS5A 4H08A 5KYGA 3JQQA 1ORTA 4HAIA 1N1EA 2Y05A 3WLMA 1ISPA 2BISA 4RIHA 3ZNNA 3DM5A 1KMHB 3R20A 2WJIA 5K3FB 2ZWMA 4JBXA 1E3JA 4JUFA 5DLPA 1C1YA 1JIKA 3Q40A 4K2HA 3B6KA 1R8XA 2C4WA 1D9XA 4C4PA 3M34A 1TI7A 4MJ3A 5FORA 2QXYA 1NBMD 1R3DA 1RE0A 4OHBA 3WLEA 1J2UA 2IU3A 3KJZA 2V0CA 2MMGA 5IYZF 3ADBA 2A9QA 1C9DB 4JP5A 1EZ1A 3OM0A 2X0JA 1N5OX 5TQ2A 4BP3A 4B3SB 4NQZA 3LA6A 4TTPA 1RQPA 1WIWA 2RBEA 1UJ4A 2YYZA 3E2IA 4E5SA 1GUYA 3LPNA 3CS3A 1NX9A 3ONVA 1LX6A 1QFZA 3LYUA 3NYRA 2WHRA 2VDRB 3EC2A 4RZ3A 5GZ3A 3A9VA 3RYHB 4TYNA 1NBME 1Q7RA 4OI1A 2H2DA 1H4SA 1E9RA 4DIDA 1T8SA 1W30A 4ZKEA 4S35A 3D5TA 1S8AA 2YRXA 3T5TA 4XX1A 2Q5OA 5DXAA 5HBRA 1GTZA 5BV7A 1NMXA 1MX1A 1NJ8A 3EWNA 4YN3A 3W9UA 1CRLA 2ZJ5A 3LP5A 1B4DA 3SZUA 3AEUB 1DCFA 4I1RA 3V1TC 3P2YA 2IF0A 3C24A 2I7XA 4YI3A 3PXGA 3X2EA 1GIAA 1JX6A 2WWVD 5BN5A 1NVAA 2JAQA 2NV0A 1TFUA 2LXNA 4FXPA 1K7SN 3UW3A 3I2GA 4X7PA 2X0IA 3ZWPA 3LKZA 1LRJA 2VHQA 1JECA 2VK2A 3MCVA 4RPGA 2H7XA 2GPBA 1UUFA 1T5HX 1IZYA 2OCLA 3AOGA 1N7HA 3BC1A 2MINA 3CCCA 3EGCA 3IB6A 3JYLA 4MGHA 1J8MF 4P32A 1YRBA 3ZC3A 4B6SA 2AMVA 1H2EA 4B6QA 5CJPA 4D3DA 5LOVA 1R66A 4TMFA 3QTBA 1H0RA 3ZTYA 4HYTA 4V03A 3LCJA 3UZUA 1T5SA 3H7IA 3VDQA 3WK4A 5B55A 2JGLA 1EX9A 1ADYA 1ZOLA 3SC3A 3K5PA 4RTQA 5J5AA 4L0DA 1Z45A 1WY7A 1BXRB 2H31A 1R5BA 1J8QA 3PGXA 5CMLA 4BLWA 5GTDA 3AF6A 3T1VA 3RSCA 4ZJZA 2WMOB 1EWRA 1OFIA 1Y0BA 3PEFA 2ASVA 3M89A 5IK2A 5AJUA 5C35A 3TDKA 3D43A 3GCXA 3COJA 2R84A 1JKFA 4XQ0A 5H5JA 5C1PA 3HRKA 2GASA 2XMGA 3MWYW 3DPSA 5EZYB 3CVWA 1YZGA 2R1TA 3KAKA 1F17A 2JK0A 1SKAA 1VGRA 5EP4A 3OQ6A 3IMCA 4IUCS 3T4PA 4CLXA 2FW8A 4HGNA 2AQIA 3HZOA 5HZMA 3W1WA 4DCOA 5JALA 4ERNA 1ICIA 4FEGA 3Q98A 4HYYA 1K7EB 1T8UA 2VJDA 1A9ZA 4KL8S 1KI6A 3M82A 1VPWA 4UCXA 1KRHA 2AVDA 5CYFA 3AFIA 1EQUA 5GIOE 4JHXA 4M87A 3CZCA 3R0JA 4TSRA 4F04A 4EY6A 1RKVA 3SJAA 3KT6A 2DUNA 5FWYB 5G0SA 1KI9A 2XDQB 4I5FA 5KYVA 3F98A 2HR1A 4TYYA 5JHHB 2XRFA 4Q1EA 4D57A 5M04A 1WPGA 2IYWA 1ZM3A 3NTLA 2I3DA 2ZZNA 2FH5B 3V8EA 4L50A 3GGSA 2DWCA 4FKZA 4F6LA 3OE5A 5TMPA 2TYSB 4DXDA 1M2NA 2JCYA 3B7WA 1XEFA 1NL3A 2CCKA 2V96A 3BFVA 4D02A 2GZHA 3L1IA 4B85A 4BJ6A 2HCTA 4KIFA 3UYKA 4B31A 4IINA 4PS0A 4B6FA 1WB5A 3ZHTA 1RYEA 2VQDA 2QLTA 4UZEA 4GBJA 1WQ3A 3RUDA 1KARA 4E09A 4EDFA 4C4TA 4MQMA 4RHFA 2P2GA 4F11A 3WXMA 1K5PA 1SEVA 4F93B 2IHJA 2AG6A 4CCWA 2PV0A 4LRQA 5HJ5A 3H9QA 2YFKA 4H1TA 3NETA 4R3WA 4DKJA 1N8NA 5LMCA 4FM9A 3OJEA 3EXEB 3BMQB 3PVCA 2K2QB 3SYRA 4N6NA 5KOJB 3NBFA 3WQRA 1C1XA 2YYYA 4ICIA 2CNBA 4OJMX 3ZD6A 3LTEA 4EITA 3QM1A 1QP8A 4B9EA 4X3CA 1GG5A 2DH5A 1HFJA 2H4ZA 1S9DA 4XUEA 3CNLA 2ONCA 4EATA 3IEMA 3NYIA 1PR0A 1MA3A 3BFPA 1Z18A 3LUJA 3KPYA 5T8KA 5EJ9A 2I6TA 2OAEA 3P5SA 3B2QA 4YQYA 2O54A 3DR5A 3R7NA 4CT0A 4MUYA 1EDDA 2Z1NA 2J6CA 2BMDA 4ZDWA 1XRQA 2FN4A 3QKSA 1E3WA 3GPCA 4OK5A 5AR1A 1SCQA 3A04A 3ZS8A 1ZM2A 1XNRB 4KAFA 1YZFA 4M6WB 4OHRA 4CCYA 1FYWA 1N0HA 1Z5PA 3PUIA 1IXKA 4KPGA 1YA4A 4WZBE 5K0TA 2DETA 2X4DA 2B25A 3T7IA 2JB9A 1KKUA 3MPOA 5C5DA 5KOIA 2FFHA 2W2LD 3HJGA 4IR7A 1KO4A 4LJ8A 1E9EA 1UBGA 2QP9X 3H2GA 3OZDA 5K5EA 1J49A 1W36B 1IY2A 2W37A 3DWFA 3ENKA 3FYUB 3QEJA 4ND2A 1V3UA 4NC9A 1UH5A 4QICA 2QRVB 3OA2A 3MFYA 1C8BA 4HNQA 2XZDA 5D85A 3WKDA 3PBKA 3TW6A 2R6JA 3L8FA 4DDWA 3VGJA 1U63A 1W46A 3W4JA 5LQSA 2AMLA 3RSSA 1TLTA 4FNGA 4U2CA 1U7XA 2B69A 3BHIA 1KE2A 1SK8A 4OB7A 1KZ1A 1ZQ9A 2BDEA 1PJQA 2E4VA 2ZI5A 3QYFA 3TSYA 3WYEA 5HX7A 3C1OA 1P2UA 3GN1A 3RGGA 2W6MA 2HBRA 1ILEA 4EFNA 4B3DA 1N6HA 3BWCA 1OC4A 4BBZA 4DIMA 3U4IA 4UATA 2QZZA 4DR5B 4X8OA 1INLA 1O6BA 1JLHA 3GQBB 3QE2A 4KJZA 4AKEA 3L6BA 2RAFA 3G89A 3BEOA 5B4UA 1OU4A 1R0LA 2UAGA 3DCJA 5CR9A 4UM9B 2ZSIA 2GLUA 1UXKA 1Y9AA 4NHEA 2XE6A 2H5LA 3DMNA 1KU6A 2PJRA 2CBGA 3FPKA 4BHTA 3FYDA 1CHNA 2O1WA 2NVUA 3OFSA 3U7JA 3E81A 4EPTA 1X8KA 1XZLA 2P6OA 4ETMA 3LY5A 3LX6A 2UZAA 3N87A 4KPUB 2BWJA 3CM0A 3S2YA 1W47A 4O2LA 4EW1A 1ZD1A 4JJGA 4FD2A 1GP2A 1I2CA 1QSGA 1XD9A 3AC0A 3AR5A 1JXMA 1KI4A 5FUMA 3AP1A 3LLMA 5HJEA 3DBLA 4YONB 1J9GA 1E7SA 2BGIA 2QL7A 1WNFA 1PR2A 1WTAA 4PS1A 2R6DA 2FUEA 1Z2CA 5CDHA 1BIFA 2PGXA 4EYSA 3H8JA 1Z2DA 1T2CA 2NZJA 1B73A 4I14A 5BUSA 1OI4A 2O4CA 4B9AA 1LPOA 4GF5A 5LMUB 4DR7B 1DEHA 3KUCA 4DF3A 4PAWA 1K0FA 3GARA 1AB6A 1F1BA 1P74A 3WZ2A 4RO0A 2ZUWA 1VQ1A 2HT6A 3IP5A 1EVJA 4TMTA 2ZDGA 4BFYA 4Q3EA 2P6NA 2B1RA 2AFIB 2O2HA 3HB4X 3PV0A 3EFHA 4O59O 4ZPXA 4RDHA 2C3OA 2PR7A 2YRWA 3DB1A 3I6YA 1WJGA 1R37A 2H5EA 4FYWA 1D3AA 4M1SA 3RODA 3VZDA 4EI8A 1ID8A 2WSIA 3GFQA 1J0AA 2QTLA 5KTPA 3CUYA 4BPRA 5LBTA 1EE1A 3TZEA 5J2TF 1EFCA 3H9BA 1QDEA 2PQMA 4BEBA 3NHMA 4E6PA 2DFDA 4DY4A 2QX4A 3ER9A 1ZPDA 5TJ9A 1ZBDA 2XWBF 1CF9A 2OORA 1GZHB 3IAM1 4KP7A 2P90A 1USVA 3HN2A 2XCQA 3E35A 1LH0A 1YHNA 3GJ5A 4L7QA 3CB2A 1SOWA 3NTOA