3THSA

Crystal structure of rat native liver glycine n-methyltransferase complexed with 5-methyltetrahydrofolate pentaglutamate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
283
Chain Sequence
VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glycine N-methyltransferase
publication title Differences in folate-protein interactions result in differing inhibition of native rat liver and recombinant glycine N-methyltransferase by 5-methyltetrahydrofolate.
pubmed doi rcsb
total genus 90
structure length 283
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 3thsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3thsA02
3I64A 4GEKA 4F85A 3UJBA 1I9GA 3KPYA 5FUBA 5F2NA 5EMKA 1AQJA 2UZ4A 5FA8A 1VE3A 2JHPA 2IBSA 3ER9A 2G71A 1G60A 1OR8A 2BM9A 5ERGB 1KYZA 3TMAA 3EVZA 1YZHA 2PT9A 1SQGA 1P91A 1EJ0A 2PSSA 3B3FA 3ELDA 4PCAA 5K03A 2XYVA 3QOWA 2A14A 3DXYA 1NT2A 5D1NA 3BT7A 3HVKA 3C6MA 5EZSA 4ER3A 4RVDA 5CVEA 3G2OA 5EVJA 1JQEA 1Z3CA 2GPYA 3TKAA 3EVEA 1WY7A 3DTNA 3CJQA 4L7VA 4LWOA 4RTSA 1FPQA 2P3QA 1FP1D 3AY0A 3HCDA 4Y2HA 5FHRA 2OZVA 1XJ5A 5C0OE 3BXOA 3GCZA 3IEIA 2C7OA 1EQAA 3P2EA 2YXEA 3ELYA 5BP7A 4CTJA 3B5IA 3DMGA 2DPMA 3G5LA 3BGVA 2P1DA 3LCUA 3R0QA 1RI3A 3DLIA 2ZZNA 5K0GA 5EEGA 2QRVA 4M38A 3THSA 3FZGA 3HVHA 3LDFA 4QPPA 5HIMA 3M6VA 4B17A 5K8VA 5HOQA 2I62A 2CMGA 5EQJB 4GC9A 4R8SA 2OYRA 4HTFA 4GOOD 4AZVA 3R3HA 3P8ZA 1QYRA 3TR6A 1RJEA 4Z2YA 2OKCA 1VLMA 2YR0A 4GC5A 3DOUA 2OY0A 3E7PA 4KIGA 1VIDA 3GIWA 5DTQA 1ZHFA 3BWMA 3OZSA 2EX4A 4PGGA 4E31A 1KPGA 4RX1A 3HCBA 2YXLA 2EFJA 5EZQA 4HGZA 2ORED 4P7KA 5EC8A 5E9JA 1KPHA 4GQBA 1R8XA 2ZWVA 1R00A 3D2LA 4HC4A 1Q0SA 3TLJA 3UJ9A 1JSXA 3HTXA 1VPTA 3HP7A 1ZGJA 1L3BA 4AUKA 1MJFA 2AOUA 3G2MA 3EVCA 3DLCA 3EPPA 3H2BA 4PCLA 1RI5A 2O06A 5CM2Z 3V8VA 2ZVJA 4CKBA 3B3GA 4XUDA 2YXDA 4RVFA 3G89A 5LR6A 3OZRA 2AOWA 2O0LA 5GINE 5E1BA 4RTQA 5M5BA 4M37A 2PX2A 1L1EA 2GS9A 4PGHA 5DM0A 4FT4A 5GM2A 3HCEA 1VP3A 1XDZA 5FHQA 2YUIA 3I5UA 3SX0A 2G8NA 1ZGAA 1QAMA 1ZKDA 3BUSA 3PFGA 3G2QA 4V0RA 2PKWA 3TOSA 1RI2A 2ONYA 1HNNA 2XYRA 3EVDA 3MCZA 2BZGA 1BKYA 2HTEA 4HGYA 3K6RA 2BR3A 4QVGA 4E70A 5LSAA 3LPMA 2VZ9A 1R8YA 3FUUA 2H11A 1N2XA 3A26A 3GWZA 2VDWA 4RTNA 3UBTA 5LQKA 4DCGA 2HV9A 3DR5A 2IIPA 3KQMA 1F38A 3ID6C 5ICCA 5CIYA 1BC5A 1HMYA 2ADMA 3B3JA 3FPEA 2AVDA 5GOZA 4PNEA 4OX9Y 2HWKA 3TRKA 3MB5A 2ZBQA 3G2PA 2FHPA 2ZLBA 2ZW9A 3UJ8A 3KU1A 1JTEA 5CVDA 4PYKA 4RTOA 4RWZA 4XUEA 1M6YA 4YUVA 1VQ1A 2ERCA 2IDJA 4QTUB 2FK8A 2P41A 4P7JA 1X1BA 3A4TA 2PX8A 3NVKI 4R05A 5BW5A 3CC8A 3HVIA 3NTVA 5FULA 2PGXA 2P3OA 2BM8A 4E33A 3S68A 2ZWAA 2NXNA 1X19A 1TW2A 4Y30A 1QZZA 5DM2A 3TQSA 3HCFA 3AJDA 3FUWA 4YUWA 5FWDA 1G6Q1 3X0DA 4PYIA 4GOMD 3G88A 1JG2A 1P39A 2P40A 3KKZA 3ORHA 1U2ZA 5DX1A 4QVKA 2GAFA 4IV8A 3CJRA 3UA3A 5BXYA 4KDRA 4XUCA 3SVZA 3A27A 2JJQA 4C03A 5ICFA 1YZ3A 4ER6A 1NBIA 4ZTBA 2IH5A 3MERA 3FUXA 2Z6QA 1DUSA 3AXTA 3O7WA 1SVUA 4PYLA 4LECA 4X60A 5HIJA 2AOXA 3PT9A 3TM5A 3E23A 4QDJA 2B78A 1JQ3A 3R6TA 5GWXA 1P1BA 3VYWA 1WZNA 2BR5A 3SSOA 1QAQA 3FUVA 4F84A 3PTAA 5F2KA 3HM2A 1SKMA 2B3TA 5CCXA 5DTMA 3CCFA 5KVAA 4HTFB 4QQNA 3SXJA 1N7IA 5CD1A 2OXTA 2P7IA 2Z6UA 2ZBRA 3IYLW 4ER7A 4EKIA 1L9KA 1X1CA 3CGGA 3P71T 5KS2A 3PX3A 3PX2A 3UFBA 2EG5A 5DXAA 4BP1A 2AR0A 3G7UA 1JG3A 1PRYA 3KQQA 5DLYA 5C1IA 5K0NA 4C4AA 3AWIA 4GUAA 5LQJA 2FK7A 5E9WA 2KW5A 3GXOA 3DMHA 3KPVA 3A7EA 4YV2A 4X1OA 1JR4A 4XCXA 3UA4A 3DUWA 1B42A 3GRUA 3HNRA 4CWAA 5JR3A 3UJAA 3JWJA 3GU3A 4EKGA 5P8WA 1D2CA 4PINA 5FTWA 3PB3A 10MHA 5EKUA 2GA9A 2P8JA 2AOUB 1I4WA 2UYCA 3LCVB 1RI1A 5IH3A 3ERCA 2ZCJA 1UFKA 1JG4A 5K09A 3HVJA 2AN5A 5F2OA 2PWPA 5U4XA 5CUQA 3T7TA 5E8RA 3JWHA 2UYQA 3LECA 3SSNA 1INLA 4HH4A 1NW7A 2I7CA 1XVAA 1L3CA 2YQZA 2IDKA 1KHHA 4FS8A 2H1RA 4AZTA 3HA5A 5EMLA 3RODA 3KR9A 5MHTA 3NW9A 3IHTA 4RTLA 1FBNA 2HNKA 5EMMA 1KPIA 4E2WA 2G70A 3KPWA 3B89A 3OCJA 2JHAA 4FGZA 4E30A 1VBFA 4P7FA 3A25A 1EIZA 2I6GA 4EK9A 2ZBPA 4P7GA 4EMSA 4ER0A 4RTRA 2IH2A 1O9HA 4PIMA 3FRIA 1X1DA 1UWVA 4DQ0A 4GF5A 3UZUA 3FUTA 4KVZA 3GRVA 5EKXA 2ZULA 1DCTA 1D2HA 4GOLD 5DSXA 4RTKA 5DM4A 4KDCA 4PYJA 5CVVA 1YUBA 3LBYA 5E1MA 1EAMA 2G72A 3HCCA 3OU7A 4X61A 3VC2A 4R8RA 2FPOA 5DSTA 3TM4A 2AOVA 4FZVA 4RV9A 1KXZA 1R74A 5FWAA 1RJDA 2AZTA 3M6WA 4FSDA 3REOA 2AN4A 2PT6A 3O31A 3EGVA 4C07A 1Y8CA 5DX8A 4BLUA 2VP3A 4X41A 2PWYA 4PWYA 3CKKA 4OBWA 5HEKA 2IH4A 3GRYA 2DULA 3EEYA 4DF3A 4QQKA 1V39A 3G8AA 4E2XA 1D2GA 5JUWA 3LSTA 4YV0A 3M6UA 5LQNA 3FPHA 2N47A 2LD4A 3R9XB 4P58A 5DPMA 1DL5A 3HEMA 2AOTB 3VC1A 4DZRA 3KQYA 2ZIFA 5EIFA 2PLWA 2ZFUA 3HCAA 3UJ6A 2CKDA 1Q0TA 2FYTA 4E2ZA 4HRAA 1QANA 4OA5A 3F4KA 3BWYA 3E05A 4KRGA 3FTFA 3SMQA 1NW8A 3KQPA 3T7RA 3NWEA 3C3YA 3ELUA 3P9IA 4MTLA 1G8SA 3NVMB 3LX6A 2CWWA 1AQIA 3TKYA 3EGIA 2R3SA 2O05A 3UJCA 1JTFA 4EQZA 4PYOA 3KR0A 3LHDA 3NDIA 5D1HA 5EOVA 2Z6AA 1G38A 4WVLA 4R6XA 3GDHA 2EJUA 3U81A 1IM8A 5CCBA 5T64A 2JHCA 2PXAA 1AV6A 4KW7A 2P3LA 3MTIA 5HZMA 3GGDA 3PVCA 5CVJA 5K0BA 3LL7A 3K0BA 5E9QA 1TW3A 4BY9E 4G56A 5EG5A 3BWBA 5EPEA 3Q7EA 1TPYA 2O57A 3P9KA 1QAOA 3ME5A 5FA5A 4A6DA 3P2IA 1P1CA 2YVLA 4V0QA 4RTPA 1KIAA 1KP9A 3T0IA 4MQ4A 4RVGA 4QDKA 3OE4A 4OQDA 2OPBA 2EJTA 2PBFA 2K4MA 2C7RA 1FJXA 2IP2A 1G55A 2ZSUA 2PJDA 3DULA 5C9ZA 4RVHA 2VDUE 3B7PA 5DX0A 3EEOA 2XVMA 3OU6A 5EIWA 2ZTHA 5E2AA 2QRVB 2F8LA 5LQAA 4K6MA 1AF7A 1XCJA 2AS0A 3G5TA 3KHKA 5T6BA 2GB4A 3SGLA 3WSTA 2C7QA 2ZIGA 3OFJA 1F3LA 1FP2A 2V7EA 4KWCA 5G02A 2QE6A 3GO4A 5KQRA 3SM3A 5GP1A 3VSEA 2IFTA 2ONZA 3FTCA 5K0FA 2QM3A 3I58A 1H1DA 2YTZA 4UOEA 5ICGA 2G1PA 2H00A 3EVBA 4YV1A 3RIEA 8MHTA 3Q87B 5DM1A 4DCMA 3BKXA 3ER8A 4POOA 4DM3A 3BWCA 3V97A 4C06A 3THRA 1YF3A 3LDGA 5CVUA 4YUYA 3KPJA 2I9KA 1WXWA 2B2CA 1O54A 4DA4A 3DP7A 4CKEA 3HA3A 5HIIA 1SG9A 2BH2A 4RTJA 4YMGA 2PX5A 4H0NA 4FP9A 4KIFA 1ORIA 1I1NA 1M0EA 3MQ2A 3CVOA 3QOXA 4PONA 2E5WA 3JWGA 3LDUA 3DH0A 3L8DA 4LWPA 4MIKA 2YX1A 5K0EA 5LQUA 3R24A 5H02A 3UWPA 4R6WA 3LGAA 2HR1A 4OQEA 4JXJA 1XTPA 4DMGA 1YFLA 2XBMA 3NWBA 2BR4A 3P97A 4GBED 3KQOA 5EHGA 4HG2A 4ER5A 4FT2A 3KQTA 2WK1A 5DWQA 2NP6A 2P7HA 5K0CA 3ELWA 5K0LA 3FTDA 2IBTA 5FQOA 3TFWA 2GH1A 1X1AA 1XXLA 1RJFA 2ESRA 2PXCA 4BLWA 5KYGA 5GIPE 1UIRA 3LKZA 3GJYA 3BZBA 3FPGA 4U7PB 3DXXA 5EHIA 3EVGA 4EVIA 4M36A 2VDVE 2ZZKA 5B1SA 3RW9A 4CXMA 1YB2A 4MWZA 2Q41A 3LCCA 4BLVA 4QPNA 1T43A 3P2KA 3P9CA 3UJDA 4YUXA 1YFJA 5EGSA 2CMHA 3A7DA 4PYQA 4CKCA 3KPUA 1JG1A 2Y1WA 3BGIA 1KR5A 2JH9A 4YMHA 4YUZA 5BW4A 2NNWB 3JWIA 5E8JA 2PY6A 4NECA 4PYNA 2AVNA 2OB2A 2QY6A 3C0KA 3SR4A 1KYWA 3KR2A 5K05A 2XYQA 3KQVA 2V74B 3M70A 3I9FA 3BKWA 5T67A 2P35A 5FADA 4M7RA 3SSMA 3ANXA 4RSRA 4O29A 2HMYB 1ZG3A 2B9EA 3C6KA 2UYHA 4IKPA 4RTMA 1O9GA 4C04A 1MHTA 1IXKA 5E2BA 3NDJA 3TPZA 2VS1A 3FYDA 3EMBA 3IV6A 4IV0A 3FYCA 1R18A 2WA2A 1M6EX 3CBGA 2FRXA 3OE5A 3NJRA 4AZSA 7MHTA 4LG1A 3P9NA 2GLUA 3T7SA 4E2YA 3EVAA 5DRTA 5HILA 2IGTA 2OO3A 5E1DA 4CTKA 2CL5A 5ICEA 5K01A 3FPFA 5GM1A 3EVFA 2JG3A 5LQCA 1NE2A 1N7JA 2Y1XA 3FTEA 1VL5A 4WXHA 3C3PA 4RYLA 2PXXA 1XDUA 2IPXA 5IKMA 5DTRA 3M4XA 2QYOA 1BOOA 1PJZA 1EJ6A 3E8SA 4OA8A 1NV9A 3BGDA 2NYUA 2OBFA 2ZZMA 3NMUF 3DMFA 2XVAA 1NW6A 3FRHA 2B25A 3PS9A 2NP7A 1RJGA 3MGGA 4E32A 3OU2A 4AX8A 5GIOE 1WXXA 3KR1A 1XCLA 4HSGA 5KQSA 5HFJA 2PVCA 5E1OA 2NXJA 3MAGA 3MCTA 3GRZA 4FSXA 2C7PA 5HIKA 4FR0A 1JQDA 1ORHA 5EEHA 2AN3A 2JH8A 3I53A 4DKJA 3OFKA 5DT2A 4ATNA 3QV2A 3EMDA 1NBHA 3UJ7A 2OB1A 5EMJA 3LKDA 4X63A 1ZQ9A 1G8AA 1BHJA 4OBXA 4U7TB 4PIPA 4IWNA 2WA1A 3KQSA 4QTTB 4A6EA 3KQWA 3M6XA 2ZIEA 3PFHA 3O4FA 4ISCA 9MHTA 1WG8A 2NXEA 3LBFA 3OPNA 5K0JA 1RI4A 3AXSA 5FCDA 1EG2A 1JSZA 4F86A 4C05A 3MTEA 1R6AA 3MHTA 1XDSA 3HA7A 1NW5A 1IY9A 3GRRA 2R6ZA 2FCAA 3CJTA 3G8BA 4AZWA 2PV0A 3PLAE 5DXJA 3OZTA 5LQRA 4MHTA 2UYOA 3FPJA 1SQFA 2PX4A 2AOTA 3DXZA 3M33A 5FQNA 4C08A 1SUIA 1WS6A 1NV8A 3GNLA 1SUSA 4PYMA 3EGEA 1VP9A 4BP3A 5DRYA 1NW3A 2O07A 1NKVA 2NXCA 1L3IA 4GOND
chains in the Genus database with same CATH superfamily
1EBBA 3BXHA 5FUYA 1N2CE 2P69A 3Q11A 4AYWA 2Q3HA 1DOAA 1YVEI 5DN6D 2HEIA 2C2OA 1Q7TA 3DZIA 4M9RA 5KJEA 3OIDA 1U0SY 1YZHA 3HDVA 3FZYA 4H1VA 3UMBA 3KZNA 5G0WA 4OX9B 2K5UA 1KJNA 2RHDA 4L0DA 3M3HA 4Q1AA 3L07A 3JRNA 3DXYA 2W6NA 3GZNA 3I9JA 3M5DA 4NPHA 4UTNA 4J3JA 4XGKA 3S8YA 2W0MA 5FXMA 4DWVA 1ZJYA 4XRRA 3MQFA 3S40A 2DFKB 5AKYA 3U3OA 4F60A 1D7AA 5B5SA 5GZ3A 2XUZA 1BVUA 1RM4A 1BFUA 3FLBA 4AZ0A 2Q45A 1RFGE 5AVKA 4NJMB 4ZANA 5BP7A 5A71A 1XTZA 3BGVA 4DSOA 2GETA 2GQ0A 1RADA 3VDXA 3LX5A 3ZWQA 2P6NA 1TYDE 3T5TA 1OYOA 4FYIA 4PSUA 9ABPA 1R9NA 1EYZA 3E5NA 4PY2A 3HADA 1WD7A 2GEKA 2W2KB 1T0HB 3R3HA 4EWLA 3TR6A 5TGTA 2C2HA 4JHXA 3UUFA 2R8OA 2EP5A 2Q8PA 3BHNA 1A9SA 4GC5A 2YW2A 4LHSA 3GIWA 3PXDA 2H4YA 2WZBA 3ZTWA 3ETDA 4KAJA 5KOJA 1G8HA 3PPWA 2A1TR 3A32A 4IDHA 1E6EA 2H1SA 1FYXA 3BJMA 5IC4A 3MGBA 2B7CA 3AF0A 1XU7A 5E9JA 1Z6QA 3B12A 2ZWVA 1TCAA 2ZYVX 1JAZA 1ODTC 2O7QA 5C53B 5G1OA 4L8GA 4FKZA 1VPTA 4I3FA 4PSDA 4X9XA 5BSUA 4UDOA 4ZT2A 3F1KA 2D1SA 3H2YA 1GNLA 4N0DA 4OH7A 1MV8A 1SHZA 3H2BA 4R1MA 3T3PB 4C76A 4WPGA 3B3GA 4JYBA 2CZQA 2SCUB 5JCJA 2KSQA 2G82A 1C1XB 2YXDA 3FHLA 3U4GA 1QGUB 1M8GA 2G6BA 5TSDA 4ARIA 1UJBA 2VF4X 1Z25A 4QPDA 5HGJA 1RVV1 1AV7A 4YAFA 5DM0A 1XEFA 4URVR 1XDZA 4MVJD 3SF8A 1J0BA 2G8NA 1UF9A 4RHFA 1C8KA 4M0CA 1UJ5A 4QBFA 2JLUA 2CJWB 2HIHA 1S2GA 2WLSA 3UB3A 1ZD1A 1VGRA 4HGYA 5A62A 1LS1A 5J59A 3VSCA 1A77A 2B34A 1M6VB 4FOOA 2ZRQA 5FKJA 2PYDA 3FNQA 5HR5A 4JYAB 2J41A 2FZCA 5AW0A 2XMCA 1T10A 3OD5A 1A9TA 2WHPA 1NBMA 2QN2A 1F38A 1KU6A 3ID6C 1P2UA 2ERXA 4LNUB 3VDNB 3C4VA 4N48A 3OLVA 3B3JA 3EW9A 2AVDA 2PR7A 4LDPA 2L0XA 4PX9A 3W9UA 3JQQA 1O97D 5C7OO 1P19A 3AUSA 2X8AA 4HAVA 4MPDA 4M1ZA 5AVYA 2Q2WA 2BUAA 3AFNA 3QG5A 1XZPA 3DKRA 1UBRS 1VHJA 4H1WA 3DZBA 1QU2A 1XJWA 4OXKA 5FDFA 1NF9A 1XNGA 2P79A 1J2JA 1UBGA 2ZJ4A 2HGZA 4FINA 4FMPA 3IUYA 1IRIA 4L15A 4YJFA 2CDCA 4WECA 3G1UA 4J0FA 1SXJD 1EP3B 1P9NA 1YU6A 4CM3A 1CETA 1R8JA 3KSBC 4AKGA 5CT4A 1BX3A 5DM2A 3CLRC 4QO7A 3A8TA 4UCQA 4PYIA 5TQ0B 4OHXA 3DBRA 3WLJA 3ORHA 1Z2OX 4J07A 2X4LA 1YA4A 3ZNNA 1YDWA 1GL6A 2X8WA 4KPEC 2HLPA 1PUXA 2TMGA 3FVRA 3AETA 4KDRA 4XUGB 2I4LA 5JW6A 1SXJB 1XWWA 1WCV1 3IDQA 2XR1A 3MERA 3SHQA 4G0UA 3WDKA 1Y0BA 3FTNA 2R2GA 3G7SA 3CZRA 3GJSA 1S02A 3DT6A 4XKJA 3DNMA 2O2SA 3WIEA 1EM8B 1BJRE 1BNCA 1L4NA 4MO2A 4MUGA 1W1UA 3ZCQA 1P2BA 1NTRA 4U8HA 2VBGA 2BGUA 3KP1A 3TTWA 1GRVA 2GR9A 2RJNA 5H4HA 1TFRA 2JKYA 4ZVNA 4AUMA 2R1ZA 5IXJA 1O95A 1BCRB 2WUDA 5HRAA 4UPEA 1W59A 3HBJA 4GU5A 1EFVB 1KAHA 4C22A 5U1PA 1QMGA 4AJNA 5IM4A 2C20A 2PBRA 1J8VA 1U1GA 4M86A 5DXAA 4FMCF 5CITA 3THXB 2WYOA 5LA6A 1X13A 4PO3X 3SEZA 4PSCA 3L7CA 2AC4A 3OKCA 3AWIA 5TNXA 4DLRA 5JXJA 4LFCB 5E9WA 1O0BA 4V1CI 4N0MA 4WXEA 1AMUA 2SKEA 4GIBA 4XGNA 4R8MA 2JHFA 1JIXA 4BU0A 4EP1A 5A9RA 1PX2A 2WNIA 4DBVO 1PL7A 2EFEB 5CXQA 4DQDA 3ZVRA 3OPYB 3PUHA 3VJMA 3LQYA 4AWXA 1U3WA 1Y6QA 3MMNA 3V48A 4D9JA 1JG4A 1QH8A 2HPAA 3HVJA 1DVRA 4GDMA 2G3YA 1R9JA 2PWPA 2V7GA 3NBYC 4HF7A 3SIWA 1ZBQA 2HADA 3VTAA 3OZFA 2WJGA 2RAVA 1S2IA 1Q1QA 2X58A 1Z4KA 4QBGB 4GKBA 3DE2X 3M5CA 4L5JA 1YIOA 3RODA 1MJHA 5MHTA 4PZZA 3WS7A 4RTLA 5KTRA 1SHKA 3PHIA 4DDKA 2BOVA 5MFPA 2Z58A 4Z1OA 1FFCA 1GPH1 5CJ2A 1M2VA 4IJQA 1PJLA 3ROEA 1DEOA 2R5FA 3A25A 3ESRA 1EIZA 4FYYA 1CTQA 1EWQA 2BN4A 2MU1A 2O8DA 1D9XA 4XVUA 5CFRA 3GV0A 3GLTA 3JQBC 4ZVPA 3GEBA 4AJLA 1E18A 1XOIA 1YACA 4MS4A 1Z37A 4N3NA 4JYPA 5CRIA 1RXCA 5HMMA 4MUYA 3DW1X 2NM0A 3HCCA 5T6MA 4KAAA 2J9YB 4R8RA 3UWSA 2C57A 2ZSIA 5T8KC 2IXAA 4B7CA 2P91A 3SLKA 1R4NA 2PHZA 5A5GA 1BDIA 4NCIA 1ZW1A 4P22A 1XFAA 1RWQA 2CBXA 3KSDO 3BH6A 3OZIA 2FPPB 3K4HA 2JJ1A 2XADA 2X0KA 4MJLA 5UKDA 4YI5A 2EQBA 5L95A 1GHTA 1VM6A 1L7EA 4E46A 4QWWA 3EPHA 3QYFA 3D0OA 4AKIA 3AERB 5DNWA 4OH1A 2AQKA 2BVNA 2CXRA 3NAZA 3W2GA 4CODB 1FFSA 1MBZA 3BTOA 4XVHA 3X1KA 4NFSA 5ERXA 1R4ZA 4D0RA 1ARZA 3K05A 3EFOB 1NYRA 4EYSA 4EITA 2CD9A 5T5QA 5J4LA 2IY8A 1ESCA 1LBHA 4HRAA 2IZ6A 2QR5A 2XEXA 3PTZA 5BPHA 1R0BA 1W46A 2XF2A 3SMQA 5B2FA 4XLZA 3TSCA 3VHXB 4XJXA 3HUUA 4DQXA 4LSWA 1PU2A 4CJXA 1ANKA 2X7HA 2O05A 4IS3A 4PN3A 1SVLA 2E5LB 1MW8X 2I7VA 3CU5A 5ITZA 3CNEA 4R2LA 4BBAA 2AC2A 4FWBA 5ADHA 4KW7A 5TQ2A 5HZMA 4M0PA 5AM5A 3RK0A 1YKSA 1DRJA 1YA6A 2GWRA 3H3FA 5EG5A 1IIRA 1E9AA 3ESXA 3KYBA 5CVDA 5LJIA 2PUEA 3MWFA 3UXMA 2XCQA 3B1FA 2FF5A 3IB3A 3ME5A 4E03A 2J3JA 1SXPA 1G2QA 3C3JA 3AV3A 1A98A 4Q12A 2J0QA 1P9LA 1OX5A 2C8JA 1KIAA 2WJ6A 3H5TA 1KP9A 1UBMS 1ZU5A 4L51A 3AW9A 4RVGA 3S2FA 5HOEA 5JCZA 4EEKA 5AQ1A 1N8KA 2K4MA 3OLQA 3TD6A 3OX2A 2DH5A 4HJRA 3DWEX 1L4GA 4YDHB 5F77A 1TAUA 1RE1A 5JCXA 1YFZA 4QM7A 3COJA 1ZI6A 1XX6A 3TE7A 1V9LA 4G36A 3PBKA 1G291 2CCGA 2H4JA 3G5TA 4GEGA 3ND7A 3IUMA 1YQWA 3BAZA 3JZMA 4NICA 2W2MA 4F5WA 5L3QA 2WJPA 1ABFA 3H4MA 1NBME 2ZRHA 3OC6A 5LD2B 3A6PC 2ZIUB 4A36A 2VDOB 4D4IA 5CNMA 5C8DA 2SKCA 3CLUC 1AHNA 4RKQA 2EL9A 3EVBA 2GEJA 2AL7A 2EXXA 2H7YA 2PZFA 3ENNA 4Q1BA 3TXXA 6AT1A 3LUPA 3VDRA 8MHTA 2V7QA 3I8OA 1A97A 5C1OA 2JLYA 5KDOA 1GUYA 2VAVA 3FW1A 5AW1A 1USIA 1N8SA 1E79A 2Q1XA 4DC0A 4GNRA 4RQAA 3FMGA 4DV1B 3AC0A 1SUBA 1T25A 4YMGA 3RHTA 1ILEA 5FBKA 2ZUEA 3ZQ4A 4UUNA 2HZ7A 1V48A 3TUZC 2GBCA 1N6KA 2BV3A 1ORIA 4IDOA 4WVFA 3EQ7A 4MKRA 4U8GA 3WK5A 3CVOA 3QOXA 3QLVA 4MIKA 3WMEA 2WYVA 1ZA2A 2V0GA 2AKYA 4R6WA 4AQDA 4WZZA 4D8XA 4J94A 4XVCA 2EVWX 4ZYTA 1YFLA 3OQPA 5T7BA 2P77A 3R7SA 5D5QA 1SPXA 1NUHA 3FCSB 1X80A 3BFJA 5DGTA 3JQAB 2VNSA 5A7FA 1MCZA 2XAAA 2F62A 4BGIA 1F7UA 5BQ5A 2APJA 4I4CA 4ABTA 1LQUA 1P5RA 2WHQA 3L4BC 4GRAA 3A11A 4PXAA 3RIXA 3WADA 2Q7OE 3L8EA 1XD2B 1E3SA 1UKVY 3EVGA 3AB3A 3IBYA 3N87A 4XJVA 5TJ9A 4CXMA 3FNHA 3TK1A 2CNKA 4C21A 4MI1A 2J31A 3ZOZA 2RGEA 1E6CA 1H3EA 4C4XA 3G5UA 3OJFA 1ABBA 4EI2A 1X7YA 4RMHA 1QIHA 2PD3A 2XWJI 2K2QB 4LBWA 2WD7B 4KN5A 4FW9A 2Q3CA 2AVNA 2F43A 4HFNA 3TAXA 2OHXA 4F0JA 1KYWA 4KRYA 4JQSA 3LLMA 2OFPA 3UGQA 5EYPB 5K05A 1XROA 1RPNA 5A2GA 4BS9A 1NIJA 4MV6A 4Q24A 4X97A 1FUEA 4TV9F 2HBQA 2NZWA 2E49A 2C94A 3I9OA 3IXLA 1K5DA 2R1VA 1YS9A 3PXUA 3T99A 1UK9A 4IUCS 1WMFA 4LJSA 4JV5B 1RABA 2QQ5A 1VG0B 2IZOA 5JRJA 1KS2A 1I51A 4IXNA 5CM8B 4ZRMA 1U7XA 2GPJA 2ZYHA 4D9EA 4HWTA 1MDFA 1YJQA 3GELA 4I55A 1CF9A 2CFRA 3H4TA 4GWGA 4RXTA 4TXJA 3QMWA 4Q1VA 2OPHA 1CQXA 5HILA 1DARA 5I4IA 5IKEA 1I5EA 3ENWA 3TUJC 2OBXA 2O8NA 1BN7A 1KJZA 4WTOA 1T0PA 3PR1A 4MB6A 3ZCVA 3NRBA 1VL8A 4WSOA 1KDVA 4EJSA 4ZVSA 5HZGA 1TYZA 2FSFA 1NX9A 2V5UA 5LYJA 5TDHA 1UM8A 5EZ6B 5C5CA 2C96A 1BWQA 1TTTA 5AJVB 1C7JA 2RGXA 3QF7A 3DFIA 3GNQA 2W8BB 2OV4A 1NAIA 4RH3A 4KLZA 2DFTA 3CRRA 1GY8A 2YJZA 4B73A 3L06A 4EMTA 3N58A 1JJBA 3G0OA 1XCLA 4TN1A 2IUUA 1U28C 3CZMA 4N5IX 4C0KA 3EDQA 3P27A 5DBIA 2YXBA 1CB0A 4F11A 5DNAA 4P32A 1IHPA 1KEVA 3PLRA 2C42A 1H8EA 1C8BA 4GECA 2AN3A 3OM1A 1XTIA 3NTUA 3IUNA 5EWMB 1E4EA 1NOJA 1RHRA 1Z5PA 3HKCA 3HSYA 1JHRA 1JI3A 1OI4A 2YFQA 3Q7SA 4RF3A 2AV6A 1KP3A 3MYRA 4CKEB 3PUXA 1G8AA 2WA1A 5J1TB 4QTTB 4A6EA 3EUWA 2DKOA 3S2GA 1C14A 3FR8A 4HFJA 1GDHA 4FX2A 1P4SA 4NOKA 1MLDA 3R76A 3RVDA 4B43A 1QO0A 2I7XA 1SCJA 3DFFA 2ZJ0A 5JATA 1GQ2A 2O6HA 3LAWA 5H3HA 1NNEA 3WKCA 3LTNC 1A1SA 5B37A 3ZWOA 1IWBB 4TWRA 4D5EA 3CW2A 3RTAA 4B83A 1HT0A 2AZMA 4EKYA 3KC2A 3I0MA 4BKQA 2VTBA 3VU3A 2DPLA 5C8YB 2VH1A 3VKVA 4TKUB 4Y67A 4FK8A 4HQNA 4R2WA 3WGLA 3T34A 1YJXA 4X00A 4RSGA 5EZYB 1XG5A 1GZ6A 1RKUA 3EGEA 1DKRA 1M2WA 4PNPA 2BFPA 2FW8A 1N6NA 4FMCB 1JPNA 3AUJB 5TXGA 4ZHQB 2A9VA 5IZ4A 3JZAA 3CR3C 1VKJA 1NVTA 2PKCA 3L1IA 1Y1SA 3K09A 4F85A 3O8CA 4Z0TA 1E58A 4Q4AB 2COEA 1ZI9A 5HCUA 4KMOA 5CA1F 3AB8A 5I47A 2ZRAA 4RE6A 4GE3A 3HRKA 1P0FA 3H11A 2R65A 4M0UA 4NHEA 4BGVA 4CMGA 1Q3KA 1XQVA 3QMMA 2WWFA 5DBOA 4I36A 3RS0A 2XMSA 8AT1A 1BAPA 1PGQA 3I30X 1KMNA 2OOSA 1DTWB 1E4OA 3DPIA 1OSNA 4YT8A 1E1YA 2J9RA 2X4DA 5D1NA 2FDCA 4ZJYA 4C4TA 2HF7A 4A73A 3C6MA 3F78A 2A9JA 4HH0A 4B81A 1Z74A 5EVJA 1CIPA 1KMHB 1B1AA 2WF6A 4LMPA 4QQRA 4FFLA 5B64A 2G80A 4M0FA 1VA5A 2BSQA 1V41E 2ETVA 2OFWA 5JC1A 3G2HA 2AX4A 2ODAA 4IO1A 4L75A 1OAKA 2R6FA 4AO6A 2RC6A 1G2OA 3K5PA 3BWXA 1GV0A 2BFNA 2W2LA 3IT3A 2BD0A 1JVNA 3NHRA 3ZHYA 5AESA 2RHWA 3BMNA 3IEIA 1IY2A 4R5MA 4XVRA 1Q74A 4BC1A 4ZI2A 2XGJA 1TYAE 4NQZA 4M3NA 1CY4A 2P1DA 3H86A 1H9BA 2QRVA 3FHOA 1C3OB 3E82A 4GUDA 4PO8A 4TZ0A 1XZKA 3LUAA 4QOEA 3OCZA 2PS1A 4GC9A 2IXEA 4P4SA 1DMRA 3AM3A 4G1FA 4MYSA 1FS5A 2WTMA 2ZIXB 5HTKA 1GKIA 3R5XA 4CL8A 1B26A 1P3Y1 4QLAA 3PQ5A 5E38A 1I6WA 1SCIA 1ULBA 4BFLA 2EERA 2OY0A 3B2NA 3E7PA 3V2HA 5IJ9B 1GAXA 1FYFA 2BMAA 3FD8A 3U4QB 4W1SA 1GNPA 1FDSA 2BELA 4UVDA 3UCEA 4TTJA 1ODCA 4LI0A 1KPGA 4EFNA 2UKDA 3KKQA 3ZI7A 5KTTA 5EZQA 1FMLA 4M0EA 4TYQA 1N5JA 4PX3A 4BNXA 2HWXA 1B7GO 2B1QA 1I7PA 5F64A 1Z29A 4BQPA 8GPBA 3I9KA 1Z0AA 3ROFA 1IXYA 2WLTA 3URMA 5FTLA 4XM2A 4TV8F 4WLNA 2X3FA 4UUOA 1ZGJA 4PLWA 3E5HA 5D3MB 5FBHA 4CLXA 4EDFA 4LY0A 5IJAA 4C7VA 4N8SA 5I8PA 1S2LA 1VJDA 2GHIA 2K7ZA 3LA8A 3OFND 4JJ6A 4P83A 4YP1A 3TOVA 3WWCA 4EF4A 5JAMA 1UODA 2W6JD 1VPWA 1KAEA 3KVRA 3KVVA 1KBOA 1I1OA 1UADA 5AKXA 3V6LA 2PX2A 3LF1A 3Q3GE 2NOAA 2QP3A 2BGRA 4YREA 1NASA 5K3FB 2IHUA 1M6WA 2JKVA 4QBTA 4EY7A 8ADHA 4PZYA 4FJ2A 3VTKA 3EIUA 4X6YA 2DAPA 1X70A 3FY4A 1L4HA 3I05A 1TD1A 2CFTA 2F1KA 2X19A 4YRCA 4KLRA 4KV7A 4TKLA 1SVNA 4WOPA 4EYQA 2NUTA 4D41A 5KTOA 3K92A 1FU7A 2G1AA 2P4HX 4FONA 4R1LA 3CISA 4Z49A 3RJ5A 3K9GA 4HMPA 4I3GA 4RVNA 5ETJA 2YHIA 1ISJA 1IJFA 3MB5A 4R1TA 1OT5A 4A2CA 3NHFA 4D98A 1ES9A 2I87A 2EJVA 3GRCA 2GHTA 1XRJA 5I9MA 1Y9JA 1W36C 2D3TA 4C3VA 4LPKA 1L5VA 1OLXB 3IO3A 3MRSA 5A4DA 3AHDA 2RKWA 2IUFA 1BXRA 4R2XA 4XQ0A 4BVLA 3D7NA 4ZYUA 2YVKA 3GN2A 3T3EA 1ZBDA 4I1UA 4DEYA 3IV9A 3QPBA 5L7TA 3DCYA 4RLSA 1Q7BA 3NTVA 5FULA 1HFKA 4DA9A 3ET5A 3I09A 1R9GA 3GMTA 2P68A 1EG7A 1K8YB 2IZ1A 2QB5A 2Y1EA 2DETA 4KSBA 1HFWA 4JZKA 3RJTA 3RRZA 2P40A 3I23A 2MYNA 4N65A 5DH9A 3U4IA 3E4DA 1UOOA 3SVZA 4Z2AA 2JJQA 2YCLA 3GVPA 4P80A 2X7JA 1KSGA 3RWOA 3JASA 4BECA 1T5SA 5FPPA 4KQ1A 3SFVA 2QGZA 1SVUA 3Q0IA 5TR9A 4HEQA 2RGNA 4DCSA 2PTHA 3C7CB 3Q8WA 1MRZA 3GJ4A 3ZIUA 2LXNA 1BX1A 4CM9A 4YYZA 4YMIA 5CX1A 2A1UB 4Q9DA 2P2ZA 1SM4A 1EXNA 1LDNA 2IHJA 3IP7A 4WFQA 3CCFA 3FZEA 1TB4A 2EWMA 3U13A 1XALA 4HNGA 4OXNA 4Q19A 3WL5A 4AJPA 3K9FC 2G5CA 1SBIA 1DAFA 3E9DA 4BNFA 1IWPB 4MARA 3FMFA 4GMFA 5JS8A 4IUDS 3NZEA 2YOFA 3NKFA 3W4JA 4BYMA 5ED4A 2P9JA 1FW6A 4WCFA 3NU1A 2XNCA 3WA6A 2YRFA 5KOHA 4MV9A 2KW5A 2AQ8A 1EX7A 2F3QA 4AY4A 3VPDA 5JR3A 3WRXA 3JWJA 3FPCA 3STVA 1RIFA 4CM8B 2GA9A 2I3ZA 4LE1A 4URUR 3EQ9A 2ZM6B 4JCCA 3VU1A 4DA8A 1V4VA 4JI5B 1G9XA 5IUNC 1FFHA 1QIIA 3E9MA 4BU1A 2EYUA 3CM0A 3AR4A 3CVWA 3QUAA 3F6CA 3VR0A 3G8CA 3UJHA 5GQSA 4DCNA 3L49A 2WJAA 2B61A 3CRMA 4XEUA 4YIKA 1XVAA 3WQRA 2IVFA 3NAMA 2Q49A 1L8QA 3HABA 1U94A 1XEXB 2J6HA 5LP6F 1KDYA 3DZ8A 3GL9A 1B2RA 4FUQA 2N3ZA 4E2WA 4RFSB 2OV1A 4OAOA 2C3YA 4KHPB 2JHAA 4FGZA 1FNNA 2HA5A 2MSEB 4WXPA 5AK3A 1KQOA 3SYLA 1OVGA 2NYRA 5COAA 4IAOA 3VPFA 2HDHA 2PNFA 1N32B 1P3JA 3HHEA 6Q21A 5DNYB 3BD9A 3MJVA 4LHEA 1FY2A 2QJRA 2VYVA 4ZPJA 2PUHA 2QIOA 2FUEA 1DIBA 4FGUA 4TMYA 2UUPA 4G2NA 5D7BA 2GF2A 3NWOA 1KZHA 3UPTA 1HO3A 2C84A 2QXTA 1VYHA 4HJXA 1YQ9A 2A0XA 4A2PA 5BNZA 4DLYA 1NF3A 1WZIA 4HQRA 3AH8A 3ICVA 3QUSA 2X22A 2QVZX 5DOZA 3WK6A 3IIMA 4C4RA 5HYVA 2P6MA 2WMDA 4D4GA 4GLLA 1XTTA 3ZE6A 4L5CA 2AK3A 5ENZA 4DSZA 1ZXBA 3G59A 3F3KA 1CHNA 1IZYA 1KHTA 3N0TA 3WYCA 4A91A 4XD2A 1QCDA 1KY2A 1VA4A 1T0IA 2VXBA 1Z56C 1JJVA 1WPGA 3M0EA 4WZAA 1V8DA 3QKSB 2ZPUA 4F7DA 4ZVLA 5LQNA 5G40A 1E2KA 3F7OA 4FXOA 4QTYA 1TZMA 3HCAA 3UMGA 5KX5A 1S1MA 1JFTA 1OZAA 1IRXA 1WU7A 3H5VA 1OIXA 4GNKA 1NVEA 3U4CA 3ABZA 1GZ3A 3QA9A 4WQMA 4DQKA 4JR2A 3OX4A 3T7RA 3NEYA 5AW7A 4MW2A 2CLFB 3HV2A 1Z8HA 3E9QA 4KYUA 1SBQA 3F2IA 5ITWA 1BGXT 3C4QA 3GUVA 2AI1A 3D4OA 3LXUX 1FB5A 1JTFA 3EN0A 1KE2A 3QJGA 1N2HA 2VLIA 2XWQA 3IMGA 1DUIA 5E4YA 3THOA 2VYNA 2VDJA 2V5VA 1IM8A 2Z4TA 5MGBA 3EVTA 2ID8A 3IPLA 3WYFA 2FV8A 1IUKA 1VZ3A 3DL7A 3C8UA 4PG7A 2PVPA 3LP5A 5CVJA 1HYHA 4EFKA 3L6BA 3MTBA 4ESHA 1P77A 3SF0A 4C20A 3IKTA 2VP9A 4MVJP 4O0MA 4BDTA 5C7YA 1T2CA 1TUBB 1U3UA 3Q5GA 1CJSA 4K88A 4G85A 3N9IA 1S8OA 3VYRB 5CLGA 4NG5A 2A9OA 3WHPA 4H2DA 1LPMA 4P81A 3GFTA 5C31A 3QE2A 2IE8A 4UUBA 3T7KA 3ZXYA 2WTUA 2OLKA 2CWDA 5ES4B 4B3TB 2JK1A 3QM1A 3P94A 1SELA 3PFWO 3ZLVA 1RM3A 2D5BA 4GP7A 4JNKA 4PGFA 2XB4A 1C81A 2GD1O 2JZCA 4ZO7A 5CA1B 5L3SB 5AUQA 3GLGA 3KOOA 3AHJA 3TNDA 5DASA 1UUFA 3R7BA 1FP2A 1P75A 5FH9A 5KTSA 2ZJYA 4YUAA 1KO1A 3D2BA 3PHHA 4ZI3A 2YWGA 2Q2VA 3KB8A 3KWLA 5IC6A 1OKKD 4KV9A 2G1PA 1XR3A 2YIJA 2Y9MB 3NNNA 1ZVQA 1B6GA 2WSSA 5JISA 4LQCA 4YCLA 4ZZIA 3UJ3X 1OB2A 2OSBA 1LH0A 2LPMA 4QJ3A 1U9IC 4R8KA 5IHPA 3HZZA 3LDGA 4F9EA 3UUEA 2QTLA 3GMDA 4HPJB 2Z1DA 4QZVA 5JFOA 2WW8A 1GPKA 3ZBPA 3OP4A 3PTLA 3OMXA 2ACVA 1ND5A 4KQFA 4KQMA 4EF5A 1CU1A 2J48A 2OAEA 2QUHA 2ZSFA 2TSYB 5CCEA 3WQHA 4ENWA 3LC1O 3ETCA 4TKMA 4JSYA 3HO1A 4KRFA 1MG0A 4WK4B 4EABA 4V0KA 4R9VA 3L7LA 1XSEA 3DFMA 1N2ZA 4DR7B 4LI3X 3D6VA 4G2TA 1IQ0A 2BFEA 3B7WA 3F97A 3I6MA 3NWBA 4PG6A 1KVTA 2RHLA 3CCCA 3HUFA 3TJRA 3ZY4A 5BMVF 6REQB 3OOYA 2YFHA 3ZJ4A 1C9KA 3UV3A 2ZTSA 3ELWA 4WBXC 3FTDA 5K0LA 3TNJA 2OD2A 3N2GB 5KYGA 1RRCA 3M9LA 2DE0X 1TIKA 2FUCA 3IOCA 1HF3A 3FWHA 3KUUA 4AW9A 4EKDA 5J9FA 1ZUNB 3VPXA 3DXXA 2C4WA 1U3DA 1C30B 5B57C 2CVHA 2GVZC 2Y92A 4HDQB 1YS7A 2JL1A 2ZZKA 4DLPA 4OJNA 4Z53A 2PD6A 1CIJA 3H5AA 2PTGA 1NBWB 3H9JA 3NPAA 2Q41A 3Q3JB 4TQUS 4TV8B 5FNVF 4C6TB 5B55A 4YMLA 3P2KA 2Q1WA 3E8XA 3JWPA 2G1KA 3AJ8A 1PZMA 4EB6B 1U11A 4KAFA 1TAHA 5EPUA 3T5CA 1DJOA 1PR4A 3DP9A 1F6WA 2XGSA 3KEGA 3HJTA 4IM7A 3KKEA 4Q34A 3A9UA 5FI0B 5KNBD 1UZMA 2XDAA 3PNPA 1Y9ZA 2V74B 1V37A 1SIBE 3DZHA 2WAMA 3CN9A 3L92A 5IYZF 2HK6A 2OZPA 2REQB 3O0DA 3SJZA 1NC3A 1O2DA 1ZJWA 3WLFA 1C2YA 3CLTC 3ZG6A 1MXHA 3QKWA 4I9NA 1U8ZA 3U7HB 2QUJA 4ZGGA 2HT1A 2YRWA 3JTMA 4CUZA 4ZEVA 2C0QA 2QW1A 1EUZA 3BA6A 2C98A 2YS7A 3MOIA 3NV7A 1U0NA 2I54A 4P3XA 5D51S 2FRXA 1SQ6A 2YDXA 4FD2A 4QUIA 2QQ0A 2FX5A 2WWWA 1WVMA 3T9DA 3VC7A 1MOZA 2J3DA 1BDHA 3KXPA 5JQGA 3URKA 3TQHA 3GA7A 2IGTA 4IPTA 5A5FA 5K01A 1NE7A 2G83A 3AUYA 3IEPA 2IOFA 3LT1A 4C4SA 2V97A 3FOWA 4CMBA 4EB3A 3PC7A 5CLQA 4DUGA 4N0PA 1EQ2A 2GGSA 2QL6A 3MJSA 3HEAA 1ADFA 1J0CA 4FXPA 2A3RA 5GVRA 1QJCA 1SC3A 2O2GA 3Q3IA 2CMDA 4V2UA 3C1AA 3BGDA 4FFVA 3BK7A 5A06A 4R51A 1ECCA 5LOVB 1VIVA 2IXBA 3IAS6 5EIBD 1A5AB 1GD1O 2DP4E 2GN2A 1C1YA 3FKJA 1J06A 3LZDA 4YC7A 1I10A 1ZUWA 2UVDA 3JAMA 3L7NA 2OQ2A 4FZJA 1F2VA 2J87A 3PFKA 2LDBA 5E6UA 3B9RA 1XTJA 2FEMA 3F8TA 1ZL0A 2JI9A 4P4NA 2QIPA 4UBIA 4XIJA 3FLEA 4LJ7A 5G41A 3C5EA 4O2AF 1GVNB 4KPGA 3U09A 4QGBA 5EHQA 1TD9A 3IJ5A 4RA6B 4ONEA 2Q5QA 3FCCA 4YCDA 1SMKA 2VLBA 1QDUA 4YDSA 1QUEA 3DT9A 1QV6A 3T95A 1H9CA 2QT1A 4WE3A 2DFPA 1J1IA 2Q4RA 3QX7A 3MWDA 1LLFA 1QRUA 2BRUA 3WGNA 4NNOA 4WZAE 3KIPA 3V8NA 4F86A 1MC4A 5K8LA 1QKKA 1KJJA 3CV3A 4KXFB 4BVJA 4DARA 3DS8A 3FLMA 4DLZA 4QKQA 2PG3A 1NW5A 2BGLA 3D6TB 2O2YA 4OU4A 4BQIA 2R6ZA 1VPVA 5KWEA 5GVSA 1QYWA 1JR6A 5DXJA 3FNIA 3M33A 1U5BA 2JLBA 2WHRA 3E15A 3NM6B 3RVRA 4OYHA 4C08A 1BXGA 2GXAA 1J8MF 1SUSA 4YPVA 1GPUA 2VH2A 4NU8X 3DAPA 4DDWA 1H66A 2XNDD 5REQB 5JJKA 4ZXPA 1ST2A 2D1RA 3I1IA 4QEKA 4C0QC 1XHFA 4UM7A 1W4BA 2JLZA 4CCYA 3EFBA 2GN0A 5EMKA 4PLYA 2O1EA 2L82A 1U6JA 2C95A 2VNHA 3GVIA 4MWOA 4HMOA 2XBUA 2G71A 1AZTA 5ILQA 1XCPA 1J70A 3AFIA 3DL2A 1BCSA 2RHOA 3RVBA 3WDLA 3PC3A 4Y7DA 1EJ0A 1T26A 4YGYA 2ATXA 2F9LA 2AHRA 4FKMA 4GPZA 4UHKA 1ND6A 2ZJ5A 4CDRA 3W6ZA 1TQ8A 3O8OA 4YRBA 3S81A 3LFUA 2C77A 2Q27A 2Y93A 1Y4ZA 1QH1B 3ENZA 4KJZA 3TIGA 3WGQA 1BMQA 4IIGA 2EJBA 5BN4A 4F93B 4R1NA 1DC5A 4EHDA 5D2CA 3FSJX 3A10A 1C50A 4H7FA 2ZTUA 2P3QA 1KVRA 4I5EA 5LP6B 2HBYA 2CXXA 1FVOA 1JHZA 2HXGA 1YZYA 3Q2KA 3AESA 4O63O 1CE8A 5DTIA 1DELA 2QTVB 4NC9A 2IYEA 4GPIB 2PD4A 4PLTA 5D00A 3RGGA 5IAOA 3GLGE 3WIDA 3DMGA 4YBZA 4AF6A 4BUZA 1EFHA 2H92A 3R0QA 1WMSA 1Q20A 2BTQA 2I6QA 2BISA 2MSLA 4ACBA 3S1LA 4Q1FA 3QFRA 5TT0A 3BC1A 3OEYA 2A0WA 1T4GA 3W04A 4B17A 1NUSA 1ZM7A 3OWOA 1Q2XA 1XA0A 2B2NA 3O4RA 2X2EA 4WX2B 4A0RA 5J4KA 1IBSA 1W5SA 2QD1A 2VWPA 4R9NA 1HQYE 4Q3NA 1ACLA 3ZY6A 1VLMA 1QHFA 4AB1A 1I30A 1TZBA 1CQIB 1UXOA 2FH5B 2P62A 3H4VA 4L73A 4X95A 5DBEX 5FJIA 3L01A 4UHCA 2HCFA 2ABWA 3ZQJA 1H0SA 1I01A 1QTRA 3FIUA 3HJNA 2HFKA 1YB6A 2DLDA 2WWVD 4Z9YA 2IL1A 3WAKA 4W1PA 4YJ3F 1PJBA 4GQBA 1H5QA 1R00A 3AEKA 3IDAA 3NH9A 4LOKA 1KJ8A 1IUOA 2WZCA 3G1WA 4LPSA 4E12A 1MKYA 1VCIA 4HVCA 1QH0A 3A6GA 5EXTA 2NTYC 3IB6A 4BNIA 1DKOA 1E5XA 4PCLA 4DJAA 1T5IA 1BJKA 2MR6A 2FXVA 1WE2A 2QX4A 3LP6A 3PDIA 4WADA 4XUDA 4H15A 9LDBA 5IHXA 3GCWA 3L79A 1KOGA 5ENVA 2ZDQA 1B6SA 4FGSA 5LR6A 2AOWA 4R3WA 3TRDA 1ORDA 2YV3A 5TVKA 3PC6A 1WOYA 4DS3A 5A9TA 4C88A 5JANA 1FFYA 2YUIA 3WLMA 5KNLA 4UARA 1R0XA 1YAHA 3DV2A 3BIJA 3M81A 4B3HA 4EHJA 1EGHA 1ZM9A 3T3NA 4Z8XA 3FCAA 3AR6A 4P3NA 4CI0B 2AFHA 3D5TA 3TDNA 2HTEA 3HZRA 4QVGA 3ZCXA 3R9KA 4JMPA 3JAWA 3DEIA 5IUJC 4OB6A 3RB8A 1DC3A 3DHEA 4AIRA 1ZR4A 2C78A 1RQNA 3G82C 4W8GA 3V32A 5IJWA 5MFZA 1QP0A 2UV8A 1F1BA 3Q3HA 1YZKA 3QY0A 2ADMA 4O59O 1W4AA 3VZDA 2FSGA 4B6EA 4Q02A 2AD5A 2OYSA 1SBHA 1QHHA 5EIXA 5BRJA 1QC5B 1ZRSA 2G1UA 3KYCB 5LZ5A 3WMFA 4AD8A 1SCQA 1PTJA 3RBZA 3ZV3A 3PQ7A 1EWVA 2EBWA 2V8OA 4RH0A 4J1TA 2R66A 3AVQA 3IVCA 1OASA 1TVMA 2YYAA 1S96A 1XZAA 1VCMA 2FK8A 3CUYA 4C4OA 4N9QA 2QAIA 1K1EA 1QGED 4Z4FA 2V6GA 4DNQA 1TIPA 5F5LA 5IG2A 4IFIA 1Y4UA 1OXBB 3SJAA 4F4FA 2QHXA 2CLKB 2ZYUX 5EWJB 2Y0BA 4EJFA 2Q1UA 1LKZA 1ZJ6A 2VJMB 2WP8J 3NTOA 1PSWA 4BE4A 2JIOA 4U2FA 3GJ7A 3H7IA 1T2VA 1YAJA 3MN1A 1BROA 3PUWA 4QXRA 4Z4IA 1M2KA 3UUWA 1SQSA 1YCDA 2Z8YA 4MLDA 4XWTA 5A0FA 4D02A 5I8ZA 2VAXA 4EO9A 1Z36A 1ZCBA 2WJVA 2OWDA 3ZXSA 1PKEA 4YFVA 2XNJA 3WR5A 3GJXC 4HZUA 4WN9A 2IYPA 3MTGA 3AJEA 2BR5A 2VTDA 2DQ4A 3KOUA 1M74A 3G0CA 3PEUA 4HQKA 4H7PA 5DSZA 3H5WA 3PL1A 3TTUA 1ZIXA 1KYTA 4QOIA 2P0YA 3SDSA 1N7IA 5CD1A 2FEOA 2NMVA 4X90A 4JLVA 4TXLA 1KGDA 1PDVA 1V8OA 3A9RA 1C7IA 4HYEA 1NQWA 4KE9A 5TLSA 3R40A 3BERA 2OE2A 3HI4A 3K5IA 3SAJA 3TZLA 1P4RA 2H59A 2QTWB 4RACA 3SC3A 4BOYA 2POQX 2PSFA 5DLYA 5AW9A 4CL3A 2ZXFA 3H8VA 3IKJA 2PS9A 3GXOA 1F1JA 2FVXA 3WNDA 3TPFA 3RSOA 4BX9A 3KE8A 3UJAA 2Q28A 3SQOA 3TSOA 1Z0UA 4QBIA 2ENWA 2XTZA 3IIKA 3L7JA 4QWMA 3O75A 4DA0A 1QRTA 4G4GA 4JHLA 3BH7A 2WSIA 5L8VA 1BS1A 2X0IA 4O1MA 3BWDD 2DWCA 2FZEA 2QS9A 3VSBA 1UFKA 4CQLB 1VXOA 1IXZA 3VPCA 4O2BA 1MX3A 2VSOA 3EASA 3KKNA 5JD6A 4MDHA 3L5KA 5KYUB 2LKDA 3B6MA 3L05A 2YWCA 1UKYA 4GOJA 2FGJA 4O4LB 2VC2B 4ZFNA 4G81A 4P0TA 2L2QA 5EESA 2JCGA 1DFIA 5JWOA 4W8HA 4OEHA 3DONA 2O8EA 2YJ5A 2W83A 1T1EA 5B3JC 3OCJA 5IYZB 4NZMA 3F74A 1YA8A 4ITVA 4G0WA 5KYXA 4PNHA 2GF0A 1RAHA 1H1TA 5JH7F 3LPAA 1FJGB 3B60A 3MJFA 4GSKA 1GGMA 1MNQA 3UZUA 2KQUA 8ATCA 4IGEA 1KEZA 1ECJA 1P5ZB 1D2HA 1CUSA 5I9TA 4KGDA 3ZIAA 4EZEA 5EXEA 1MA3A 1Z12A 4DLNA 1SH7A 4FDVA 1VL0A 2IYRA 4EYEA 4A03A 4GYKA 1AN0A 3MK31 4FZVA 2VJLA 4IF4A 2B1GA 3MM4A 4Z9BA 4Z1MA 3LUGA 5KNBA 2Y6VA 1G19A 1M2HA 3AOEA 3TN7A 2DKFA 3OT5A 4UEWA 4DUPA 1XLVA 3QF4B 2R97A 1P1FA 3O90A 4NK5A 1FU4A 3GLVA 3UKDA 2MYPA 1WMBA 4IXMA 2VHEA 1XGKA 2JGLA 1TZKA 1RKQA 5HEKA 1ZIDA 4NCNA 3RT9A 1X9IA 1DRKA 1RXEA 4LDRA 4LYEA 2FG7C 4TUYA 5M3BA 2AFVA 2W8ZA 4U9UA 5DXFA 1EVYA 2XKAA 4L8LA 1VE6A 2NU6A 3U7JA 2JJ8A 3IKVA 3K35A 4N0EA 3UJ6A 1JS1X 3U4AA 4DJFC 4H08A 4ZVKA 1IK4A 1U8FO 2VRCD 3NBFA 3LPLA 2O2JA 3VAYA 4OA5A 4IIJB 2FNAA 3D3EA 3WYNA 1N2GA 1LBSA 3QVOA 4KKXB 4AMGA 4YJ2A 1GQYA 5IH7A 2F64A 4QOHA 1J39A 2BFMA 3HJRA 3NVMB 1NWCA 4TTQA 5SYAA 1P61B 1ETUA 1FVHA 4ZMRA 4O3MA 1VB3A 3EH2A 3JAKB 1E69A 2CW5A 4PYOA 2RGWA 5EOVA 1XMOB 2OXEA 3UMFA 3CSDA 2PRJA 3MT9A 2VNIA 2ZR7A 3B8HA 1B0ZA 3GEDA 3PCXA 5L7WA 1ZWKA 2W6QA 2FPUA 1WV1A 4MNTA 4C4YA 3PITA 3NKVA 5HE8A 1JIJA 3EBOA 5SZHB 2QX9A 3GQBA 1J2EA 2O57A 4P2BA 2ZRDA 3HKBA 5ELMA 3QVGA 1E3JA 4Q7MB 4F1JA 4PCUA 1E3WB 3FGZA 4WW0A 2UYYA 3EQ6A 5GZ6A 3VXKA 1OU0A 1CP2A 1Y3CE 4U2EA 4MQ4A 5IBCA 1H1LA 3DQPA 1XZBA 3WZMA 2OPBA 3EA0A 1V8ZA 5JBIA 2ZSUA 4GOKA 5JECA 2VZEA 3N2NA 2AFHE 1NATA 4FHCA 5EE3A 5EUQB 5HPYB 4HS4A 1FUIA 3KAJA 5EIWA 3ND8A 5E6RB 2HIAA 1NBAA 5M34A 1L5ZA 1N3BA 1XCJA 4KPUB 5TARA 1M6NA 3TMKA 2FSHA 4EG7A 5CEFA 3OO1A 2YRXA 4JGGA 1GA4A 1PK8A 1QTIA 4TTVA 1AJEA 5BYKA 2HU5A 2ONZA 4ZTZB 1CNEA 5CYOA 2VEDA 5FOUA 4OUKX 4WBNA 3AM1A 3CB4A 4MAFA 5FTMA 2DCMA 4KFRA 4ZOEA 5DM1A 3VISA 4DCMA 2PUDA 5IANA 1JA1A 2DSTA 2OTCA 2ZCVA 3SJCA 1QIGA 4JH0A 5FPKA 1F20A 3K4PA 5BRNA 4DR3B 1LBTA 4G67A 1CF2O 1PLJA 3DP7A 4GLFA 3W2EA 1KL7A 2NO9A 1WCWA 5B6IA 2PX5A 1XRQA 1WQ3A 3G3EA 1NZDA 4IIFA 5HK8A 4K3VA 2FZLA 4H60A 1OYVA 4FCVA 1XKLA 4FP9A 5LDGA 3HKDA 2BFWA 4MQLA 4F4HA 3K8OE 2JAOA 2WNHA 3SD7A 5ALIA 4BV8A 1JHMA 4YS6A 4EMBA 5CH5A 4KL8S 2Y1KA 4OGLA 5LFAA 1GZDA 3DB2A 4X1IB 1KWKA 5EXSA 4Q18A 5JHGB 4MB0A 1N9GB 1NXVA 2HJGA 1O96A 3I8XA 4HNTA 2NP6A 3G13A 3VPHA 4B9AA 3OQMA 1XPJA 2GA8A 3F6EX 2X1LA 2PXCA 2ESRA 4WINA 2FPGB 3AEQA 1JKFA 1M0TA 4I8XA 1E2HA 2Y3IA 2ZB2A 1CR4A 1UDRA 3D6MA 3GJYA 4M1OA 1Y1TA 4W6QA 4DQLA 4IXWA 2OQVA 2P9GA 3UCFA 4ZO9A 2Q07A 2VDWB 4YJ3B 1NSYA 1UC9A 2VCEA 3DE3X 4BZPA 3SQXA 2HK7A 3Q72A 4JD5A 3NNDA 1DWPA 1T15A 1XZLA 4ZIRB 4X54A 1ABEA 4M6WB 3DBHA 1FRNA 5J23A 3RS3A 5BURA 1KVUA 3K70C 1ULTA 1NDUA 4AJJA 1Z6ZA 1VFPA 3I9V1 1JG1A 3PQEA 1OXTA 4UCWA 3R7WB 1MD9A 1VPEA 1J22A 1IVSA 1MVNA 3L9XA 2QUKA 3EXHC 4KR2A 1U0BB 2IU6A 3K30A 3WQSB 4KKVA 3R6GA 2A59A 5AK0A 5TE9A 2IWRA 1LI4A 2GVDC 5CG1A 1G5TA 3M49A 3DO6A 1MH9A 1J90A 4LVOA 4BFYA 4D82A 2FPMA 3DVRX 3RAPR 3C6KA 5J43A 3PUZA 1QB8A 4H9GA 1GPWB 4DYVA 3JPWA 3ZLTA 3K0AB 1RMTA 4FQ5A 3OG9A 4FCTA 4X3OA 5EI5A 1WUTA 3D6NB 4GI7A 1JDBB 1PEAA 3BM5A 3ACDA 4LYYA 2O8CB 1K97A 2W43A 5LPNA 1WCYA 2BLLA 2NT4A 1I0ZA 2YL2A 3V80A 1RZRD 4Z4EA 4UMVA 2FX3A 2QD5A 1IXRC 2ZEJA 4PPNA 3EZLA 1XTQA 3A4NA 3RUDA 1OX4A 3SIRA 3FPFA 2FW1A 5FWYB 3HGMA 4H18A 5LQCA 3W5JA 3FTEA 4L0MA 4U7JA 3OPQA 3RAJA 3CUWA 3SMVA 3ZE9A 1ZZGA 3SBDA 4WESB 4MQEA 4FWTA 4RK0A 3D3WB 3RRMA 3R5TA 2MIIA 4UQPA 2JIZD 3NMUF 1T13A 2ZM5A 1K63A 2B25A 4R4JA 3ZGYA 2P90A 3KU4A 3RSCA 5HQJA 3K8YA 2DWPA 2J67A 2VT7A 1ZWLA 4HX5A 4RDIA 4KX3A 3ND6A 5U4QA 2IV2X 2E55A 4B3IA 3I8SA 4HX2A 3K0KA 4J4HA 4EW2A 5JBNA 5KB3A 1EUQA 2OBLA 1ZNQO 1X42A 1N3LA 2I55A 1E4YA 4DIOA 1Y5IA 5EEHA 1Q2UA 3DMPA 3QPDA 1VL1A 2H1CA 2ZIVB 4WZBA 2QSYA 3AVVA 2IE0A 4CM7A 1D6MA 4N0QA 4YCJA 2ES4A 3F5MA 1QR6A 1SRRA 4LF6B 4AJEA 3LKBA 3O4FA 2JI8A 3OF5A 4GZLA 2ZE7A 5PNTA 4EUNA 4JA2A 2FFRA 4HSEA 2BGTA 3DKVA 1CJTC 4EO4A 1ORRA 4AO7A 3NIBA 4B82A 3R3VA 4Q6BA 4B4VA 5KNCD 1P2SA 1C3XA 3R09A 3CEJA 4PFQA 2GXUA 3P1JA 3VPAA 1TE2A 4F3YA 4RSHA 5BQPA 3EGDA 3WMRA 1VDMA 1IN5A 2P9ZA 1DSSG 2HU8A 4MHTA 1V16B 2AOTA 2WBLC 4BUCA 4Z0PA 4FSHA 1J56A 1M7GA 3PLNA 4Q9NA 2IF2A 4ARSA 1BEZA 3REQA 1FTQA 1NUAA 2RKOA 4Q3OA 1EU1A 3NONA 4RZXA 4UQOA 2Z2JA 5DRYA 2O07A 3X44A 4UAVA 2M6RA 4M38A 1DBIA 3IESA 1KETA 2D1FA 2QRGA 4QXAA 2GM4A 1OQAA 1AQJA 4AROA 4N3AA 3Q8LA 3W1VA 4DPMA 1Y3IA 4MPRA 4CTMA 4LCEA 1QVVA 3HB9A 4EJMA 3JD0A 3BDIA 1T2EA 4YJDA 2YWJA 4YAOA 3LRPA 3HYSA 4CLDA 1C9JA 3P0IA 3L6EA 2XYVA 3HDGA 1DEXA 3LUKA 3B70A 1DEKA 2CXPA 1NT2A 4N12A 1EJ2A 1L5OA 2WG2A 3HVKA 1JDTA 4RVDA 3SQWA 2QXUA 4FNAA 2A1TS 4ZO8A 1ONSA 1M8FA 4CMEA 2EU8A 4PHCA 1JTVA 4E2FA 6ABPA 1ZRHA 2PBLA 4IGFA 2RH5A 4JQYA 2VAWA 4L7VA 4WLEA 2DBQA 3H5OA 5KINB 2GHQA 2D1TA 1FP1D 4YP7A 4E3ZA 4Y2HA 1QLWA 2SKDA 4RDXA 3NHYA 5C0OE 1E3MA 1PDOA 2HY7A 2WUGA 3ABOB 2AQHA 2FJ0A 1R6UA 3WHIA 5DGXA 5LL6P 4BO9A 3PGJA 3VV2A 4RPLA 3BRWA 2NQ8A 1ETHA 1XJQA 2BT4A 2BGKA 4QPPA 4RQTA 2WE8A 2CMGA 2WM9B 3QFFA 3EA5A 2Z83A 3OPVA 4J03A 5CLFA 4HTFA 2ZAIA 4WXRA 3TW6A 1XPRA 2PZBA 5TQVA 3LUCA 3PVSA 1GT91 2PZEA 2KX7A 1FNMA 1NL3A 1N25A 1ONNA 2JFVA 3GAMA 2YJ3A 1A4RA 3OZXA 4K05A 5AHRA 5H9WA 1WTAA 1JUDA 2HA0A 1TUGA 2A5LA 3QPAA 4I1PA 3BGOS 1N2CB 2O2EA 4TM8A 3WHKA 4DFDA 2FW7A 3AM5A 1YBAA 3O5AA 2PXHA 4LJ4A 3PC2A 4AT1A 3ESYA 1ZICA 2VYQA 5FUXA 5HSGA 2C3PA 1L5HA 2Q1SA 2BMWA 4AQYB 1NVVR 1ZD3A 1TA4A 2O48X 4JL5A 4KJXA 1UC4B 3GCDA 4FR5A 4X64B 1VE5A 1Z2AA 3NI2A 4NI5A 1EINA 5DMHA 3P32A 1ULUA 1LNSA 4HI0E 2Y1FA 3H6GA 1CP3A 1JEQA 1RYHA 1K5GA 3OETA 3UG7A 1GLNA 2B8TA 3A9SA 2DEUA 1FXWA 1NXXA 1GSAA 2AE2A 1U4SA 3JR7A 2C2ZA 1I7DA 5JEDA 4PC1A 3L4EA 2P8SA 3GGPA 4TMFA 4C0WA 1OH8A 1VBKA 4YP9A 2PO7A 4YAGA 3PR3A 4HQFA 2BONA 5E7MA 2ONYA 3NHSA 2XYRA 4RPGA 1GGJA 4UTPA 1CHDA 4DM7A 1L8LA 3NHPA 3BXEA 4CIAA 1F9AA 4IMJB 3JQ8A 4UNSA 3GRAA 1V11A 2XE4A 3LK7A 2GJ9A 3NG1A 2VDRB 3SE0A 2PGIA 4ZJUA 1ZPDA 2FG5A 3R6LA 1L7AA 3LXMA 4FFRA 2FPXA 2ZBQA 4BL5A 4OK3A 2ZLBA 3OA0A 3IT2A 1EFPB 2ZROA 2ZB8A 4MZXA 3VPSA 3QU7A 4XUEA 1J0DA 1UMDA 3A1TA 3LK6A 4XWOA 2O59A 5E6SA 4GP9A 4HLUA 3RV3A 5KOIA 3CHYA 1N9KA 2OT3B 3QU2A 4IHQA 3GJ0A 4NAHA 4PLFA 2J33A 5F9MA 2IX3A 3F1LA 3BORA 3I6BA 1UMBA 4H1TA 2X0NA 1X39A 2JFFA 4I1YA 4R54A 4TKVB 2AGVA 4B6GA 2YZKA 3OX1A 1E6UA 1BHSA 4BJ1A 4EGCB 3ZCSA 3HCFA 5IM4F 5CW2A 1MVLA 3ZJYA 3EDMA 1G6Q1 1JEOA 1P8AA 1PGPA 1HLDA 2MTBA 2W4MA 3EZ9A 3O8NA 4K81B 4M54A 1JG2A 5AK5A 1PD0A 5LA6F 3UA3A 4ZZ3A 4IV8A 4KXVA 4UNNA 3QFSA 2WAOA 4MV5A 5IAGA 1YZ3A 1A5BB 1K8XB 2BI8A 3MOSA 5JIBA 2F55A 1ZINA 5K6RA 3VNQA 4GMDA 3EXG1 1VYTA 1Q84A 4KXQA 1HKUA 4D81A 3CXUA 2TMYA 4LC0A 3EZFA 3DWFA 3A58B 3MFYA 3SYMA 1NVVQ 4LE2A 2PMBA 4MP3A 2HJ9A 3IPAA 1ZCFA 3K2BA 3VYWA 3H19A 4W5TA 3N53A 3KJZA 3CZAA 4QELA 3WLQA 4BVAA 1ZONA 2QL9A 3IQEA 1UM9B 2CVOA 3SXJA 2BYTA 4F97A 2EBFX 1RFLA 1MC5A 1J07A 2JEYA 1G66A 3UFBA 5ALHA 4GL4A 4DREA 1YI0A 3C1TA 2AQIA 3D8SA 3ONNA 5K2MA 1NI3A 4KACA 3D4BA 1XVVA 2FK7A 5FUQA 1OC4A 1GA1A 4MR9B 2HA2A 4NCJA 1Z47A 4X1OA 3GP8A 1H42A 1UEJA 2Y2VA 3C6ZA 4AG3A 1DIGA 1O6GA 1YR3A 3GU3A 3RIHA 1KAQA 4NYMR 5B2ZA 4H0CA 3WLIA 1UKAA 4PC6A 4HL6A 3H8SA 4U6SA 1US8B 4PHHA 4M2LA 4BV9A 1Q6YA 4NH0A 4LF5B 2OMEA 1PL6A 1GGNA 1QRDA 5AW3A 4NJOA 4B4UA 3PWKA 1QKJA 2EKZA 2ZAMA 1N8TA 3A1FA 3T7DA 5LLTA 4LJLA 4JUDX 3ILYA 4DLKA 1IBRA 1G1AA 5EMLA 4DB4A 3RVKA 3KR9A 2Y76A 3PXBA 2C4VA 3RYHB 3RFCA 1KPIA 1QQ6A 5EFZA 4XYMA 5DNVA 1MABA 2ZS7A 4P7FA 2VBCA 1W75A 3MT8A 3F7MA 4LRSB 4CU2A 1ZJZA 2UUBB 4OYLA 4ZTUB 4P7GA 3JXEA 1QQBA 1XWIA 2XZPA 1K6MA 2QRQA 4EHBA 5AVZA 4OKIA 2V45A 1U8YA 3IHLA 3WWDA 1RBZA 5LXTA 4H0FA 1G2IA 3GZTB 1D6NA 5DSXA 1PHPA 4ILEA 3VR2A 3WNQA 4DXDA 5ICSA 2W2QA 4HAOA 4J91A 2IWHA 1BKSB 3LHFA 1II0A 1YUBA 1E9CA 2Y1OA 3K2IA 1UDCA 3NOOA 2E4VA 4N6GA 5IBPA 5T4EA 7ABPA 3I3OA 3I2FA 4NRDA 2GPTA 4D42A 3C3WA 2D4HA 4MUMA 1Q7GA 4IDDA 1RZVA 2WPDD 4Y98A 1BWSA 3MSXA 2NYVA 4FGJA 3TIXB 2QE7A 4K9PA 3X1YA 5CG2A 3I92A 4GW3A 1BEUB 1L7MA 1S7GA 2VP3A 2YYSA 3IH5A 5DLDA 4W9MC 4PWYA 1TQ2A 1UFVA 2G04A 5KUTA 1AQYA 3O9ZA 5IS2A 3ZE8A 4EUKA 5DEOA 3IVMA 5DHRA 1CQPA 2QD3A 2RGGA 4YMVA 4R0MA 1KRHA 3NBXX 1URPA 1U2GA 2ZFUA 4F71A 2CLEB 2YJNA 1SN7A 1U1EA 4OV6B 3RSLA 3LLSA 2FYTA 4E2ZA 5LMCA 3V3TA 3IGFA 3BJRA 5IAJA 2Q3JA 3U61B 4E6PA 2WIBA 4QU0A 4Q93A 2Q5FA 1W85A 4UTXA 4NYMQ 2ZXUA 3ONVA 3LX6A 4K03A 3EGIA 4OHFA 4Z54A 4CBVA 3NDIA 3EDRA 2XUKA 4DIFA 3GDHA 1DRWA 2UUOA 1B73A 1FDRA 2QMHA 3PZBA 1E3EA 3IAHA 1RAFA 4Z7JA 1OROA 1COZA 2B7LA 3GEPA 4F06A 5A1TA 3SFTA 3GFFA 5KIAA 1P4GA 3GZNB 4WERA 3RTEA 5T4BA 5C35A 3L6UA 3H5NA 1B74A 1BD4A 2YNMA 3OLCX 3QUTA 2A9PA 5EPEA 1DJLA 2CLSA 3FXAA 1RCTE 4Q0MA 1OC2A 1NI4A 2PA3A 3L9WA 2P9FA 4YRQA 1LFAA 3EOBI 4MV7A 1NQ5A 3K9QO 1CRQA 3LBNA 4YHBA 1A9RA 4C1NA 1NDQA 4JUAA 3M89A 1FJXA 2O4CA 3STWA 3EUEA 2VWQA 4L22A 5INTA 3EEOA 4RGYA 5TF0A 5IX8A 1UMCA 5CPBA 1Q92A 4AZ3A 4X91A 2WKPA 1Z0JA 4E5YA 4ZVTA 1B14A 1F9EA 2OOKA 5DNDA 3W5DA 4YXWA 4FOPA 4WLUA 3MWYW 1T2NA 2HA4A 4HDAA 4OJMX 5CVCA 5GP1A 1R5OA 3N70A 4XTCS 3HYTA 4BQSA 1QFJA 3NNSA 1LD3A 3HSKA 2RHCA 2PKQP 4UVHA 2ZR0A 4YMTA 1QJ4A 1XWFA 3U4MA 3F5DA 4P4UA 3EFEA 3DD1A 4KVAA 4Y2GA 5EFOA 1FFXB 1LJLA 2OK8A 3C39A 4MW1A 4F8EA 1PG0A 2PM8A 4POOA 1T9DA 5IJ0B 1SC1A 5I4BA 1L4BA 1DRVA 1E1CA 2I9KA 1CSEE 1SG6A 1WXWA 5JCJD 3U60B 3ZCRA 4KFSA 2MSWA 4ENSA 1M8PA 1DIRA 3QEMB 2OWEA 2O8VA 3M6IA 3SS7X 1N5KA 3F3SA 4IGIA 4UATA 5TPWA 3W3AH 2MT9A 3ZK9A 4RH1A 221PA 2M6LA 3U6KA 4QYSA 3B9QA 5CHEA 3IHWA 4BN0A 1SOAA 2FRDC 4RF5A 1I1NA 3C14C 4MUBA 1GKLA 3K8ZA 3E0XA 3SHFA 1AUQA 4OXIA 3UATA 3B1ZA 4NNPA 4IJKA 2P1RA 2CLHB 4HRYA 4DA6A 4DKXA 4R0NA 5BR7A 3UJPA 1GCGA 1H2XA 1H94A 5FQOA 4BXOB 3K9CA 4G26A 4WNYA 4UM8B 4DJ5X 4KFCA 4AQ7A 1YDGA 4X5OA 1UH5A 2BY4A 4I55F 3V4RA 4LGCA 1W1WA 2HNAA 4RPIA 4JI6B 4B47A 1PTKA 1F7VA 4OYYA 2WIDA 3MZ0A 4NH4A 4ESOA 2BH9A 4TS4A 1FTNA 3QELA 1J99A 4PYQA 1YNOA 3KJEA 1OZHA 2AYXA 2Y1WA 1I5RA 3KPUA 1KR5A 4B6SA 4BKMA 1F8XA 5E8JA 5HFNA 4ES6A 1IULA 3HVRA 2NAFA 4YR7A 2P0EA 3C0KA 4BWFB 5LYJF 4GR9A 1IJEA 1U0HC 1Y5MA 2R2AA 2ZAGA 4EH1A 3W9SA 1T3HA 2WR8A 1GL3A 2QLBA 4QUBA 2CLLB 5T3YA 3B6EA 4JJAA 3WL8A 1V1MB 1KO5A 1FUYB 3ANXA 4YJFB 4O29A 1ZG3A 4RPHA 1RW4A 2D2FA 1T9BA 2X3YA 3DE1X 2VXYA 4R1PA 1XTBA 4WNAA 3WIBA 1DPGA 1NP7A 2WA2A 3BHJA 3NJRA 6PFKA 7MHTA 3WLAA 4RY0A 3CZCA 2QW0X 4R3UC 3PYMA 3QLVC 4W5HA 3VKHA 4F91B 3HM9A 2QSUA 1B8NA 2PSHA 4CTKA 2ATIA 3MXTA 4RS4A 4MS3A 3RIYA 1O95D 3ZZUA 5ALVA 5ED0A 4G5QA 4KE8A 1IL0A 5DIFA 5K8CA 1DIHA 4Q47A 5FO0A 4RD3A 1MQAA 2VQDA 4FFWA 2C92A 1GEGA 1F48A 1K86A 1TM1E 1Y3AA 2XVAA 3JPYA 4JSRA 1CY2A 5KCMA 3TW0A 5JNSA 1N0HA 1RJGA 4X7MA 3OU2A 4D56A 4L85A 2NAPA 1JAXA 1T6XA 3RKSA 1QM5A 1TRHA 3ACCA 1BZYA 5AKEA 1NOIA 1Y1PA 5JNVA 4C4ZA 1MB9A 2VP2A 4CIYA 1F2TA 2GPSA 1DXHA 3WKEA 1IATA 2GFHA 4XGIA 4GPEA 5KNDD 2W4QA 2WUEA 1GSHA 4DRXB 1IOLA 1JJIA 2RI6A 1PUIA 4EFLA 3MBOA 1W5TA 4FOLA 4TKZA 4MGIR 3COSA 4UE2A 1JP7A 3H1AA 2AR7A 3O1HB 4IH4A 4CM4B 1RHUA 2QUBA 2PAAA 3HNPA 3OIVA 4ENTA 2XSZD 1PNRA 4RSMA 2VH5R 1KYXA 1KZ9A 1UK6A 3EXFB 3LBFA 3NIWA 1VI2A 5J2TA 4HWRA 1GYPA 3OEEA 1EA5A 3BAFA 1N0VC 1JLKA 2VJCA 3T61A 4NR0A 2NVWA 4H7DA 1ZZEA 3SEFA 2CL7X 3DBOB 3PLAE 5BV1A 2EJWA 1RAAA 3WBKA 4FFOA 5AXAA 3EDYA 4E5PA 2QZPA 1H22A 1MOSA 5D01A 5AKHA 3GPDG 1C0LA 2X6QA 3EXIA 1EK0A 3R3JA 1WHSA 3SNHA 1L3IA 3CG0A 4LV6A 3D3KA 3TAHA 3TZBA 3UJBA 1VJGA 1KYVA 4FHGA 2B7BA 5BNTA 2O8DB 1W36B 1R1DA 2QG4A 1ZH2A 2RKBA 2XB6A 2QD2A 2JGAA 3SZMA 3JQBA 4JVSB 1DINA 1PLLA 521PA 1Q91A 2BM9A 1QQ7A 2QORA 1YMQA 2EFDB 3JQCA 3ETLA 1E1RA 1PW5A 4KSYA 4MS4B 3SICE 3U7QB 2A9QA 5A3JA 4Y3UA 1JDUA 4L6CA 1RQRA 2CLOB 4F46A 2GXQA 2VHQA 3PE6A 2WNSA 4HQLA 5AYVA 5BVHA 2C1ZA 2JJ1D 4LQLA 5KKCA 4UQLA 3OAAA 4YJHB 4E22A 1Z8DA 2JVKA 4E5DA 1SD5A 1N6HA 1EUCB 1TK3A 2EWVA 3FBTA 4B4DA 4M21A 3VGPA 5CBKA 3RYFB 5LDHA 4IINA 1XRMA 4QFDA 1WY7A 2ZJ7A 3CWQA 3A70A 2FQ1A 1MB3A 5K3DA 5J40A 1VL2A 3CONA 2OG2A 3WGOA 2ZP1A 4A8JA 4ZHSA 1FQWA 2DHDA 2GD2A 3GCZA 3O4IA 4U7DA 4P3KA 4QYMA 2I9PA 1W581 2FSVC 3L8YA 2DPMA 5EJGA 4ND6A 2HOQA 4W5JA 3U1VA 2WVHA 4NU0A 2EP8A 4ZQFA 3IT0A 4DV2B 2Q8NA 5AUPB 1GT6A 3NOQA 5JCOC 4K3UA 4RZIA 4QX6A 1E6MA 1V5WA 2ORYA 1GJRA 1K75A 2OYRA 1YK1A 4AZVA 1LK5A 4PC2A 3HN7A 4S0ZA 2BCGY 3CLVA 2FP3A 1N78A 3N8GA 3ORYA 2PMFA 3QRWA 4F7WA 4HNAA 5MN6A 5JBQA 3EJWA 1JILA 4FDAA 1ZSYA 2P4EA 1HM5A 1X7ZB 5ITZB 3ASUA 1GP2A 2ORED 4TWZA 4AF7A 2IODA 4AUEA 2XQIA 2H7VA 5AKIA 1GADO 3HB0A 5TQ2B 2X5XA 2C07A 4FU0A 4TQ9A 1CK4A 3HTXA 4DILA 1O9BA 3OF3A 1J21A 4GLOA 4JVLA 4ZARA 4N47A 3RWBA 1PGNA 4HGPA 1C9NA 3VX3A 2D6FA 1ZNZA 3HU2A 2QZ9A 1CY7A 1FK8A 1M67A 2PWAA 3HVUA 2IOFK 1CZHA 1UKZA 2GYVA 2IUEA 2C7GA 3E61A 1DAHA 4YROA 1HE2A 1ZUD1 1SQ0A 3GG9A 4CF5A 3ZD9A 1L1EA 4PGHA 2IEZA 4RS3A 1XEWY 4EG8A 3LS2A 3R7NA 5MN5A 2NZYA 4A8HA 3ZWDA 2JLRA 2A78A 2CT8A 1ZKDA 4CKZA 5KTYA 4D3FA 3OOSA 4OYRA 4CT0A 4E7PA 4NFLA 4BO0A 1L5RA 5L3QB 2ONKA 1R0RE 4X0EA 3A26A 2B4QA 4B8WA 3FKQA 1E79D 1H93A 3B1YA 1P7WA 1I2AA 3TS1A 2HCTA 2PA0A 3DR5A 1P5JA 3U4HA 4B4KA 1SCUB 4ZI7A 4P98A 4U4AA 3T5DA 3ZLBA 4WI1A 3SYNA 4D3DA 1T5TA 4C2UA 3KM0A 1HL3A 1J33A 2E4XA 2HWKA 4YFYA 1JT2A 1ZMXA 1THGA 3EHDA 2I2XB 4MKFA 5B1HA 1KZ1A 2JAQA 2ZJ2A 1X1TA 1CUGA 1KU0A 4TL9A 3W1EA 1XN4A 2XGOA 1G8FA 2P9HA 4A6PA 3QE3A 1M0SA 4AL4A 5BSEA 1D0SA 2OAP1 3FOCA 4P7JA 3ADCA 3A4TA 1OT3A 4A6XA 1ICEA 4R05A 3NVKI 2P3OA 3BWEA 4Q37A 1EGMB 5EAIA 1Z0DA 3S68A 2B5OA 1GTMA 2NACA 2DWQA 4J9UE 4ZOAA 3MBKA 1O0CA 3AJDA 1WMDA 3AJ9A 3W3AA 4JUFA 4ZC8A 1ZD9A 2Y2UA 1HORA 1U90A 1YC2A 4D8TA 1XMQB 4YRRA 5AI6A 3AI1A 1U0OC 3PGA1 3OZCA 4JVNA 3SQNA 3GLUA 2PJUA 3R9XA 3DF9A 1Z08A 2WWHA 3DVSX 3N59A 3L7IA 4TRNA 3OURA 4QFCA 1XHEA 2GXSA 2ZYSA 3DGFC 2Q7DA 4FR2A 3CF4A 4I46A 2QX7A 4KGVA 1XTRA 3MRVA 2HF8A 4PRYA 1DDGA 4RQUA 1IHDA 4AN4A 2QMZA 5HIJA 3L4BA 2NU8A 2AOXA 3ZUPA 3C3KA 1QONA 2EGUA 3NTQA 4D9GA 1OXVA 3LBIA 3FAZA 2HGSA 2ODQA 3C6XA 2D54A 3CH5A 4TX1A 3DEFA 3GDGA 5F2KA 3NJ8A 1N1DA 2GZ1A 1X77A 4LX0A 2QX8A 2F17A 3FPSA 2QGNA 1X7YB 4QXQA 2QRHA 2DR3A 4TS9A 1S2DA 3KFLA 2F43B 1WP4A 5ENDA 3D8UA 1OI2A 1HFJA 2D0PB 1P44A 1HYQA 1E2MA 1REQA 3CEHA 3KNZA 1NMYA 1SU4A 2C97A 4L72A 2NTJA 5H68A 3TE6A 2H4ZA 4IRUB 5G1NA 2R60A 5K3OA 1IOZA 3KPVA 3RIGA 3OZDA 4ZJPA 1GTG1 3G2IA 2DXIA 5G0UA 1UFOA 4TRJA 3F7TA 2YWXA 5IEJA 3KQLA 2F4VB 3Q5EA 2J08A 3ZE0B 4YK7A 3FRJA 2VATA 1WBJB 2RCYA 2A4KA 4FN5A 4JENA 2AOUB 3SJBA 1M1NB 2EX0A 1KI6B 3LCVB 1L4UA 4D4KA 5DN9A 2XWBF 4WLVA 3K1ZA 4GICA 1E94E 4DW8A 1M1YA 3MWEB 2E18A 4UASA 1CS0A 1NQAO 1I3MA 3DAHA 3SPXA 1TMYA 3FG9A 4JDPA 1INLA 1H2ZA 4LY9A 2VZ0A 4HAIA 1Q5PA 3ZHXA 1CFZA 1FFEA 3HA5A 2CUZA 3DZFA 3JD2A 2G5PA 5EIHA 4EJSB 4EGAA 3ZDCA 2D00A 3NW9A 3T7IA 5LYJB 1O77A 3EF1A 2W2NA 1EHCA 1H8ED 3QWBA 5KYWA 1ZAYA 3BFKA 5GOTA 3LO5A 4FIZA 2XDYA 1MENA 4KE7A 1GUDA 2ZBPA 2YWHA 3ABIA 4MQ5A 4GPBA 3SBOA 3TD2A 2VUSA 3UMYA 3LH5A 1TEHA 2WHEA 4H3VA 5KX5F 2JFBA 1EFUA 4ZODA 4FKBA 2P5UA 3OEHA 1HK7A 1TC2A 4M0MA 4P93A 4F21A 1QYDA 2NV2B 2DY0A 3CX6A 3ZU2A 4G5SA 1KS9A 3O0TA 1QO0D 1L7OA 2OBBA 1NRWA 2IUYA 3HB5X 4QM6A 1QIMA 1QHSA 2XEDA