3THSA

Crystal structure of rat native liver glycine n-methyltransferase complexed with 5-methyltetrahydrofolate pentaglutamate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
283
Chain Sequence
VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine N-methyltransferase
publication title Differences in folate-protein interactions result in differing inhibition of native rat liver and recombinant glycine N-methyltransferase by 5-methyltetrahydrofolate.
pubmed doi rcsb
molecule tags Transferase/transferase inhibitor
total genus 90
structure length 283
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 3thsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3thsA02
2B2CA 4NECA 1KIAA 1L3CA 2C7PA 4HH4A 5LR6A 3BGDA 3SX0A 5M5BA 3ORHA 3E8SA 1R00A 3FUXA 3K0BA 4FT2A 4R6XA 4BLWA 4CKBA 5K01A 2UZ4A 3V97A 5KYGA 5ERGB 3CJRA 4XCXA 3C3PA 3R9XB 3OZRA 3LCUA 2PV0A 4IWNA 2HR1A 3EVDA 3THSA 3TM4A 4QVKA 2P3QA 2VZ9A 1ZQ9A 5EVJA 3JWIA 4H0NA 4HTFA 4V0RA 3TRKA 4YUYA 5K05A 4LWOA 3VSEA 3I9FA 4DMGA 3JWGA 5CCBA 2BZGA 4QTUB 2HTEA 1TW3A 3OFJA 5EC8A 5F2NA 4C08A 3EVBA 1QZZA 2G1PA 1NV8A 3GJYA 4Y30A 5CIYA 3CBGA 3I64A 5EG5A 2GAFA 1EAMA 2QM3A 4CWAA 5LQNA 4AX8A 1HMYA 1I1NA 4PCAA 1KYZA 3FUTA 5E1DA 4E2XA 4AZTA 2IP2A 4R6WA 4PYJA 2WK1A 2NXEA 3E05A 3E7PA 1SQGA 4GOLD 5FQOA 2BM8A 1U2ZA 1ZGAA 3EVEA 7MHTA 3NMUF 3FYCA 4BP1A 1ZKDA 2GA9A 2H11A 3ANXA 3MCZA 3UJ7A 4BY9E 2NXJA 4YMGA 5MHTA 2AN3A 3G5TA 3SSMA 2IH2A 2G72A 5DX8A 2PXXA 4E2YA 2AOTB 1M6YA 4MIKA 2JJQA 5CUQA 3C6KA 5LQRA 2OY0A 3BWYA 3CCFA 4OBXA 4PYKA 3SVZA 3PTAA 2QRVA 2PGXA 2UYOA 3OE4A 3B3JA 2E5WA 2G8NA 1QANA 2R6ZA 3OU7A 5DM4A 2P3LA 3P8ZA 1BC5A 5CVJA 1JG3A 1PRYA 3NVMB 5DX0A 4A6EA 3I53A 1WXWA 1OR8A 1VQ1A 3I5UA 5GM1A 1MHTA 4FR0A 3FTFA 2QY6A 4EMSA 4GC9A 3EEYA 3MGGA 4FT4A 5EHIA 3X0DA 1XCJA 3Q87B 4EKGA 3NJRA 2PY6A 3PX3A 3A7DA 5EKUA 3ER9A 3ELUA 1EIZA 2IGTA 3BWCA 2ZFUA 4PGHA 5DLYA 5GWXA 3G5LA 4RVDA 5EIFA 4YV1A 3GIWA 4YV2A 2PT6A 3P97A 4KIFA 2VS1A 4KWCA 1O9HA 4RWZA 4DZRA 5U4XA 1Z3CA 2ONYA 2ORED 2YR0A 3LCVB 2EJTA 1RI1A 3MTIA 1WY7A 2XVAA 3ME5A 1EG2A 3BWBA 1JQDA 1WG8A 1MJFA 2HV9A 3LDGA 4AZVA 1P1CA 5DPMA 1JQ3A 4KIGA 2C7RA 4X61A 4YUVA 5DRYA 2YX1A 2Z6UA 1R8YA 4C04A 4WXHA 4E2ZA 3EGVA 3B7PA 3UJ8A 1X1CA 4V0QA 1BOOA 2AVDA 5HIKA 4PYOA 2ZWVA 4ER0A 3DMHA 3BZBA 1L3BA 1XTPA 3DMFA 2OBFA 3LKZA 3M6XA 4PYQA 1KP9A 3MB5A 3TM5A 4RVHA 5KQRA 4F85A 4RTKA 4Z2YA 1IY9A 3PT9A 2JHCA 3FYDA 2AS0A 4QDKA 1L3IA 2PT9A 3TKAA 5ICEA 2O0LA 2I9KA 4DA4A 2VDWA 2ZVJA 1AF7A 4E70A 2AOXA 5JR3A 5D1HA 5DM1A 4F86A 4CTJA 3LSTA 3V8VA 1RJGA 2BR3A 3HA7A 5K0CA 1ORIA 3G2PA 5ICFA 3UBTA 3GNLA 3HCDA 2OB2A 3LL7A 3KPVA 3K6RA 4LWPA 3SMQA 5LSAA 2Z6QA 5F2KA 2CL5A 5E9WA 4FP9A 1UWVA 2PX4A 4GQBA 5E1MA 3GCZA 5C1IA 5P8WA 4GF5A 4FS8A 4RX1A 1TW2A 4PONA 3UJCA 4DM3A 2HWKA 4RTPA 4R05A 5E2BA 2ZBPA 5HILA 2UYQA 3GXOA 5HIJA 3NDJA 2OZVA 4DCGA 3CJTA 1QAOA 1XCLA 5FULA 3NVKI 3IV6A 1M0EA 2NXNA 1HNNA 5LQAA 2P41A 3HA3A 2FHPA 3I58A 3SM3A 5EIWA 1T43A 1JG4A 1QYRA 4C03A 1VL5A 1SKMA 1SUIA 5K0JA 3G2QA 2BH2A 5D1NA 3CGGA 3BWMA 3M6UA 5FADA 3G8BA 3B89A 3IYLW 3EVGA 4A6DA 3QV2A 3R6TA 2AOUB 1JG2A 3M33A 2I7CA 5DSXA 3OFKA 2PJDA 5K8VA 4KDCA 1D2HA 1VP9A 5CVVA 3JWJA 2ZTHA 3UJ9A 2PWYA 5GM2A 1BKYA 3FZGA 3NWEA 4P7JA 2ZWAA 3C6MA 3HVIA 1PJZA 1YZHA 3GGDA 3HA5A 3KPJA 4MQ4A 1SUSA 1FP2A 4PCLA 3HM2A 2GPYA 4FGZA 5DTMA 1KXZA 2ZIEA 3Q7EA 4OQDA 3HCFA 3HP7A 1NW7A 1QAMA 1XVAA 1YF3A 5HIIA 3H2BA 4AZWA 5FQNA 4MWZA 2FK7A 3R0QA 1ZGJA 4K6MA 4DQ0A 3HVHA 3A27A 1P39A 5K0LA 1DCTA 1JSZA 2B78A 3BGIA 3SXJA 2OXTA 1VIDA 2B25A 4ISCA 3EPPA 1JQEA 3DOUA 3AY0A 1N7IA 3HCAA 3EVFA 3U81A 4AZSA 3HVJA 3KQVA 1N7JA 3P71T 3ELWA 4HC4A 1RJFA 3FTEA 1SVUA 3IEIA 3KR0A 1WZNA 1EJ0A 3DH0A 2IFTA 3O31A 5EEHA 1R74A 4CKEA 4E31A 3LCCA 1FJXA 2IBTA 4RTRA 3FPJA 1G8SA 1UFKA 3EVCA 3KQPA 4U7TB 1WS6A 3ERCA 3FUVA 3ID6C 4IV0A 4QQKA 1JR4A 1X1AA 2JH8A 4DCMA 4ATNA 5BXYA 4X60A 3HTXA 3FPGA 1QAQA 3T7RA 4P58A 2YXEA 3UWPA 2ZIFA 1V39A 5IKMA 2UYCA 3P9NA 1VLMA 2ONZA 3PX2A 4RTJA 5HEKA 3DUWA 4YUXA 9MHTA 3NDIA 3M6WA 1KYWA 1XDSA 1XDUA 2OYRA 4DF3A 3UJAA 1XDZA 2NP7A 3O7WA 1FP1D 1SG9A 2AOTA 3PB3A 3BKWA 4FSXA 3VC1A 4CKCA 4CXMA 2VDVE 5T6BA 3DULA 3KKZA 2O06A 5E8RA 2EFJA 2ZLBA 5T64A 2ERCA 2I6GA 4UOEA 2A14A 4PINA 2NYUA 2XYRA 5E1OA 5ICCA 1G38A 5HZMA 1RJEA 3FUUA 3EVAA 2P7IA 4X63A 3T0IA 1YFJA 3GRUA 3FTDA 5FHRA 2FYTA 3FPHA 3GU3A 5LQCA 2N47A 2GLUA 1H1DA 1O54A 4E2WA 3C0KA 4GUAA 5LQJA 1JTFA 1NT2A 2VP3A 5EMMA 5FWAA 1AQJA 1F3LA 5EEGA 2BR5A 4C4AA 3LX6A 3UJ6A 2IBSA 3P9KA 1TPYA 4RVFA 4RTNA 2LD4A 2DPMA 2AOWA 1FBNA 2EX4A 3KHKA 2AN5A 3BGVA 5K03A 2JH9A 1VE3A 3THRA 2P40A 4E33A 1YFLA 5K0EA 2B9EA 2PKWA 2PX8A 5DXJA 3VC2A 3FTCA 4FSDA 4GEKA 10MHA 4X1OA 1P91A 3OU6A 3ER8A 4WVLA 4KDRA 2YQZA 4M36A 4EVIA 2FRXA 3JWHA 3PS9A 3EEOA 3RIEA 5DM0A 5E1BA 3SGLA 1VP3A 1EQAA 4EK9A 5BP7A 1XXLA 2IDJA 3KQSA 2CMGA 2XBMA 2ZZKA 5K0BA 3B5IA 5CVEA 3VYWA 1I4WA 5FA8A 3S68A 5E9QA 5B1SA 1KHHA 2G70A 4XUDA 1G8AA 3PFGA 5HFJA 3RW9A 3A26A 1Q0TA 2YXDA 3TKYA 5KS2A 3A7EA 3QOXA 3OZSA 3L8DA 1YZ3A 2H00A 4QVGA 4L7VA 4Y2HA 3G88A 4GOND 1RJDA 3IHTA 4KW7A 3DXXA 5IH3A 4POOA 4JXJA 3AXTA 3TPZA 3CKKA 4PWYA 2AN4A 1NW6A 4F84A 2F8LA 3DP7A 5C0OE 2ZIGA 1DUSA 3AXSA 3G2OA 5E2AA 5E8JA 4PYNA 5DM2A 5EGSA 3FRHA 5E9JA 5EOVA 2GS9A 3LBFA 4P7FA 4YUZA 5C9ZA 4AUKA 1NW8A 4QQNA 3UJDA 5EMLA 4MHTA 3OE5A 3NW9A 2JHPA 2CWWA 2DULA 1JTEA 5DX1A 1IM8A 1NV9A 4E32A 5JUWA 3UZUA 2AVNA 4GOOD 3ELYA 3G8AA 2HNKA 3BUSA 2FCAA 2HMYB 1BHJA 2AOVA 2IIPA 3CC8A 3DXZA 4HTFB 3WSTA 4PYIA 5GIPE 2PX2A 1INLA 3GRZA 3FUWA 1NW3A 2EJUA 1KR5A 5FCDA 3MCTA 3UA3A 1B42A 3BKXA 3EGEA 5CM2Z 1L9KA 5EMJA 5BW5A 3M6VA 3REOA 2ZBRA 3DLIA 2ZZMA 3NTVA 3KR1A 2O07A 5FHQA 4YV0A 3TLJA 2IDKA 3KQQA 5DWQA 3P2KA 3EGIA 1G6Q1 2ZW9A 4R8RA 3LECA 1KPIA 3DLCA 3HNRA 3LGAA 3HCCA 3GWZA 4HRAA 5EQJB 3B3GA 2O05A 2OO3A 4IKPA 3EVZA 3MHTA 4XUEA 5CCXA 1L1EA 2ZULA 3GRRA 2QYOA 2Y1XA 5BW4A 2JHAA 3BT7A 3G2MA 2I62A 4ER7A 3OU2A 1KPHA 1YB2A 5DRTA 2AOUA 3G89A 1KPGA 5FTWA 5GINE 4YUWA 3HCEA 3LHDA 4P7KA 1O9GA 5EPEA 2QRVB 1D2GA 2YUIA 3UA4A 3KQOA 5GIOE 2YVLA 4QDJA 4BLUA 3KQTA 4M37A 5LQKA 3D2LA 3KPYA 3C3YA 3MTEA 4OQEA 5G02A 2C7OA 4HG2A 3LPMA 2QE6A 3OCJA 1RI2A 4P7GA 4PIPA 3TR6A 3PLAE 3AJDA 2PLWA 2G71A 4EKIA 2ZCJA 3FPEA 3GO4A 4RTMA 5CVUA 3LDFA 2VDUE 5KQSA 3P2EA 1NKVA 2ESRA 2IH5A 4PIMA 1IXKA 2AR0A 2YXLA 3FRIA 3G7UA 3DXYA 1AQIA 4M38A 1X19A 3DMGA 4U7PB 5EZSA 4R8SA 2PSSA 3LDUA 5H02A 4RTLA 2ZZNA 8MHTA 3TQSA 3GRVA 2XYQA 4M7RA 3SR4A 1X1DA 1G60A 3A25A 1P1BA 2PVCA 3DTNA 2H1RA 4OBWA 3LBYA 2CKDA 3P2IA 1Y8CA 1N2XA 2WA2A 2R3SA 3MQ2A 3MERA 4IV8A 4LECA 5FUBA 3KQMA 3TMAA 2NP6A 1X1BA 3KR2A 3TOSA 2Q41A 5DTQA 3DR5A 4RSRA 3HEMA 4X41A 1UIRA 4PNEA 2P3OA 5F2OA 3UJBA 4QTTB 1R18A 3R24A 2FPOA 4GOMD 2YTZA 5FWDA 1ZG3A 2B3TA 3EMBA 5EKXA 4KRGA 1JG1A 1NE2A 3HCBA 4PGGA 2NNWB 2PWPA 3BXOA 4G56A 3KR9A 2PXCA 2JG3A 2IH4A 3LKDA 4OA8A 4C06A 2ZSUA 5EMKA 3A4TA 1ORHA 4HGZA 3SSNA 1RI3A 2UYHA 4ER6A 2ZBQA 3P9IA 3CVOA 3OZTA 3B3FA 2PXAA 3FPFA 1ZHFA 2V74B 3EMDA 5HOQA 2WA1A 4RVGA 1JSXA 3R3HA 2V7EA 5DT2A 4C07A 1F38A 2KW5A 2P8JA 5KVAA 4OX9Y 2EG5A 2GB4A 2P35A 3NWBA 5GOZA 1SQFA 5FA5A 4HGYA 3QOWA 2PX5A 1VPTA 2OPBA 4PYMA 1NBHA 1YUBA 5EHGA 5LQUA 2C7QA 3KPUA 5GP1A 1WXXA 4EQZA 5ICGA 3CJQA 3KU1A 4RTOA 5CD1A 4ER3A 1FPQA 3KQYA 4OA5A 5DSTA 2OB1A 3UFBA 1VBFA 1R6AA 3E23A 3F4KA 1RI4A 3PFHA 1D2CA 4QPPA 2PBFA 4RV9A 1EJ6A 2BM9A 1M6EX 5K0NA 4QPNA 1G55A 2XVMA 4PYLA 3TFWA 2FK8A 4KVZA 3T7SA 4ZTBA 4B17A 3OPNA 4XUCA 1Q0SA 5DTRA 1NBIA 4E30A 4DKJA 2XYVA 3ELDA 2OKCA 2Z6AA 4GC5A 5T67A 2O57A 3O4FA 3M70A 4CTKA 4RTSA 1NW5A 3HVKA 5HIMA 2CMHA 4LG1A 3KQWA 4RTQA 2Y1WA 1AV6A 4YMHA 3MAGA 4MTLA 3M4XA 3PVCA 1I9GA 2IPXA 2P7HA 4GBED 2P1DA 1R8XA 5DXAA 2K4MA 4O29A 4BLVA 3SSOA 5EZQA 5K0GA 3T7TA 4RYLA 5K0FA 2ADMA 3GDHA 2BR4A 3KPWA 4C05A 4ER5A 1RI5A 3P9CA 5CVDA 4BP3A 3RODA 2GH1A 1DL5A 1XJ5A 5K09A 2NXCA 3GRYA 3AWIA 4FZVA 4HSGA 2AZTA
chains in the Genus database with same CATH superfamily
4NECA 4IQGA 2UXDB 3VTFA 4LYHA 1JKFA 4B0PA 3C8MA 4IIYA 4PSDA 2JGEA 1XD2B 4YONB 4CEJA 1BA3A 1QKJA 1JEAA 2YN4A 3DXFA 4BLWA 4P3OA 1K2VN 2P9HA 2WD7A 3CNNA 1FYEA 3VR0A 5JZSA 1YV9A 1SXJC 2AKAB 2FWJA 4GYKA 5AW9A 2X2EA 1QJ4A 1EFPB 1U2PA 1JXOA 1KARA 2OK8A 4LXUA 4XSGA 3JQDA 4BQRA 5EVJA 1WY5A 2RJ3A 1DFHA 2Y77A 2W93A 3TRKA 4C22A 1GKYA 3TL3A 3OURA 3GUCA 4II7A 2YXNA 5KPDA 1XTQA 4N49A 3L6DA 4HNTA 5FFNA 1L5VA 2VI5A 1G8GA 4KWHA 3CBGA 3GLFE 1VJ1A 3R74A 4RHTA 5D6NA 1NQVA 2JW5A 4RJIA 4PCAA 4WXRA 3SXUA 1YQDA 2Q99A 4R6WA 1BYUA 2YV2A 2NXEA 2BGMA 3BBLA 4K5QA 5G1NA 3QZUA 1OX4A 4TSFA 5AHRA 4F92B 3GRCA 1FS5A 4M1TA 4S1OA 2ZGVA 3NMUF 4DPMA 1JDPA 1NBOA 3NGLA 1C1YA 1OVMA 2I78A 3HABA 4WIAA 4DJFC 4EAAA 2WKSA 1KTIA 5F1OA 2OBXA 4RZSA 1VHJA 4R0MA 4NG4A 3BJZA 4DV6B 4GPTA 4RNCA 3LA6A 4XQCA 5DX8A 4DA7A 4DMRA 4G0VA 5JFTA 1P2UA 2Z1MA 1DAFA 1LF5A 4HGRA 3D8BA 1ZY2A 3KL2A 2GDJA 2HF7A 5T8KC 3OJCA 1U8EA 4BJHB 4ZA2A 1TJNA 3DV2A 1H2XA 1JEYB 2HWUA 1Q21A 4I1YA 4M1SA 4B81A 4B0OA 2GN0A 3H1PA 3KT8A 1YMUA 3D6TB 5CVJA 3M4YA 4MVJE 2O7QA 4LSWA 5THQA 3ROZA 3DBLB 1DXHA 2DUWA 3OQBA 4J9VA 3N59A 1Y8RA 1LLQA 3WJ7A 1MNQA 2JFYA 1KSGA 3MTDA 3G6KA 3GI1A 3QU5A 3PPXA 1Z5UA 4QU0A 2CXUA 4NSNA 3RTCA 1XTKA 5EKUA 3A8TA 2D1SA 5LA6A 2QLJA 1NTRA 4CUZA 1OHHA 1H65A 3LP6A 2UZ1B 4KIFA 1NDUA 2PKEA 3QXHA 4K8RB 4KWTA 2E7ZA 3GBPA 1NP3A 4DRXA 1FRNA 1X3LA 2XZDA 4HGNA 4YXFA 2OAEA 2R1TB 1EVJA 4NULA 5L6MB 4GXNA 1FXWA 1OWMA 1VCNA 2HEGA 1WNTA 2FW8A 1PDWA 2VJMB 3KTOA 4KPEC 1NVDA 3I28A 3FCXA 1FFCA 2X8JA 3WSWA 3BMCA 1HO3A 3FI9A 2YRWA 1W5EA 4UULA 5JH7B 2VJAA 4FXOA 1PL8A 4IICA 5AXDA 2INGX 2BFCA 2KQUA 4YT5A 1KRHA 3K5IA 2MMGA 3D6MA 1A8SA 3LC1O 4JJIA 1BOOA 4U7JA 3V9AA 5A2QA 3V8PA 1SVIA 4MAAA 1OA0A 3BE5A 3DMHA 2CK3D 3BZBA 2WB4A 3H4TA 3LKZA 4TM8A 4ZARA 4EQ6A 4WBSA 4Z4HA 4YPVA 3LHFA 1H2ZA 3FDXA 1D04A 3D59A 2I87A 2WPDA 1A88A 4TS4A 3TBHA 4R3WA 1E7MA 4ID9A 4FD3A 1BMTA 1WUKS 2AS0A 2WJWA 3FM9A 3K09C 4P53A 4RNDB 1SKBA 2F1KA 2EFDB 1I2MA 1R15A 4U8HA 3X44A 5C1DA 5DHTA 2HJRA 1S1CA 2A0KA 2XQFA 4C7JA 3OKPA 3D3QA 3PF8A 4F1JA 4BB6A 2N75A 1J2TA 1DTSA 3D31A 3ESZA 1WNFA 3LF1A 3PQ8A 5ULLA 3D0QA 1ZXLA 2J3EA 2I1VB 4GMDA 1P60A 2FEKA 1RJGA 3CEJA 3FFXA 3WGNA 5EJGA 5T3UA 4B43A 4E46A 2YY5A 3GNLA 4C4SA 3BK2A 3WKDA 3KE9A 4AY2A 5L3QB 1EM6A 1OFUX 1O96A 4AC9A 2Y27A 3SNHA 4H7IA 3H2GA 4C4PA 5E0OA 1XZMA 3GCZA 4MQBA 4H4DA 4Z1MA 3OPXA 3WNQA 3L6CA 1P1JA 1EG7A 3CUWA 1QB8A 1RIIA 3KCNA 3MT8A 2AX4A 3NVDA 4CHGA 1T2EA 4GUDA 3FJ1A 1UPAA 1RTTA 2ZI5A 3AEYA 3RHFA 3IX7A 3SF8A 4B71A 2BI7A 4EECA 2QUHA 3FMOB 4FGUA 1R6TA 4KQMA 2WM3A 4RACA 3A1UA 1GQRA 2V5VA 4J07A 2M98A 4Z54A 1LS6A 3D64A 1PO7A 2DUJA 3PL5A 4UHCA 1YOBA 3HI6A 2ZSBA 2HDHA 1V3TA 5EIWA 2BP7A 5CURA 1Z82A 1D07A 4PNZA 2I4LA 5T41A 3H8VA 4FHGA 3SYNA 1F1BA 2Q07A 4G09A 4I8XA 3B89A 3GHHA 5DM70 3GJTA 2CC2A 4XW2A 4KDCA 2ZUUA 4NYMQ 2DFTA 4FHDA 4L2IA 4G0PA 4MWOA 4QPDA 4BO1A 4E09A 2VPZA 5G0WA 3NLLA 3HVIA 4UKDA 1HPLA 4GL4A 4QNRA 3WWZA 2HC9A 3LLUA 1XEXB 3L77A 5AHOA 2IUUA 3GFOA 5LZ7A 3AVTA 1DMSA 3HCFA 3DHWC 1A27A 1YU6A 3H5VA 2D5BA 3WYGA 4HVLA 4YP1A 1L5HB 3INNA 1A7AA 2C4VA 5B64A 5SYAA 1GL7A 1MFZA 2Q2OA 3FR7A 4JYPA 1SVMA 3N0XA 1HL3A 3KEGA 3INTA 4TTIA 1OW3B 1EP3B 1JQEA 3SE0A 3UK6A 1N7IA 5A6VA 3EVFA 2VHYA 3HBNA 3AUKA 3L18A 3O1IC 2C83A 2H7CA 1YK0A 2PT7A 4R41A 3P2MA 3P71T 3UHOA 9LDBA 5AW6A 1VTKA 5I7EA 3HFGA 1R4MA 1RJFA 3T4UA 1J2JA 1IY8A 1SVUA 2I99A 4I1IA 2FETA 4BE4A 2VSQA 3EQ9A 2RI0A 3SWWA 1CRLA 2UDPA 3OUZA 1FFEA 3WP0A 3QJGA 4G1BA 4KDEA 2WWHA 1KAQA 2I3DA 3E84A 3FB1A 2YDYA 1GTVA 4XJVA 1ZWKA 2G9QA 1WO8A 2CEKA 1P9LA 1XZQA 3CKLA 1Z2CA 1E3QA 2IX3A 4FDUA 4R1SA 1MGPA 4FONA 3ZCTA 1E1YA 3T7RA 3GFQA 3H1BA 2JPDA 2ZIFA 5CIQA 5G0UA 3V4SA 3VZPA 3K70C 2ONZA 1GZ3A 2RHWA 3KKLA 4OMFG 1CF2O 2VBFA 4YBZA 4KC0A 1OIXA 3SZUA 1XEAA 2RI1A 3BXGA 1QFJA 2OYRA 2C82A 3N75A 2PMKA 3VBEA 2JGKA 2V55B 4LGVA 2HI0A 4JJ6A 3GLIB 5T6BA 3AUAA 4ZP1A 1RD4A 2O06A 3S55A 2ERCA 2VH2A 3UBMA 5ICCA 4XLZA 2HBQA 1EFLA 1IXZA 1DOHA 2POQX 2ZRPA 2ZJAA 2M6KA 3TZQA 5AW8A 4FYMA 3ILHA 3TLBA 5FHRA 2FYTA 1KQFA 5D5QA 1KI3A 1DKNA 1K5DA 3CEMA 1GUBA 3NHJA 1KMNA 5FWAA 4WXEA 3TLAA 5EEGA 2FVYA 3U3DA 5EJ2A 1YVUA 3FHJA 4KTVE 2P9CA 3DVRX 4D74A 2DPMA 4K05A 1FRQA 4KACA 4EEKA 5EHNA 3CRW1 3DL7A 1HT3A 2JHGA 3SHVA 4LXHA 1RVDA 2GTPA 1XZFA 2PJUA 3LQ4A 4QHSA 4H27A 1ZJYA 3A05A 1JGTA 5CDGA 1SRQA 1T8PA 3GCWA 1UZUA 2W6QA 5LQDA 5TLSA 1LBHA 3FTCA 5AQEA 3IFSA 3QKRA 2HK9A 4H7JA 2JI9A 4EF5A 4MR8B 1SKYB 2C92A 1VFNA 3WC4A 4Q37A 2H31A 1YZVA 3DHNA 1P19A 4JQZA 2I91A 2XCIA 4KK4A 1X2BA 5IJAA 4J76A 4Y18A 4B44A 4D8UA 2QRUA 3WP1B 2ZI4A 3JD3A 1WB5A 3AFGA 4AWAA 2JLYA 4I5EA 1X9GA 3GBSA 1PG2A 1CF9A 3ASZA 1ZVMA 4HH0A 4PNHA 4ZRNA 3B1VA 1WV0A 2IBMA 5IN5A 5LMUB 4OLBA 1RJDA 2IYEA 2WZCA 3DS8A 4NV1A 1CK4A 4HEA6 1CZKA 2BOVA 2IJGX 3FDZB 4C3UA 1A98A 1VCIA 2VP6A 4ZOQI 4Z4IA 4CUKA 2EXXA 4LMPA 3UPTA 2AN4A 4U2FA 1YJQA 3C3MA 3C5CA 2F8LA 3LM8A 3ASUA 4WBNF 1U3UA 4P7BA 2Y9PB 1SB8A 4L16A 4P0QB 4GI3A 1OLOA 1N0VC 3KC2A 1MPXA 2B37A 3IVCA 4GX2A 4TXHA 5DH9A 1W4LA 4DMUB 3C2QA 2IE8A 4CKBB 3TUZC 3IL2A 1YR1A 3ORQA 1IH8A 1NW9B 4JP8A 4N8SA 4DV7B 5AM4A 3MJFA 4R16A 2E4WA 3ZCQA 1J24A 4E5KA 4K0KB 2ATXA 2HCTA 2PIDA 4OOFA 4PHFA 3ZE8A 2H4FA 5TT0A 1QV6A 4TXNA 3BGSA 4N6OA 4NARA 1YZTA 4NJMA 1M8PA 1DO2A 1SUCA 5AJYA 4BUCA 2AD1A 4GP6A 1NFQA 3GB9A 3VHLB 1FNCA 2OD7A 4ENPA 3LQ1A 1URPA 2I4RA 3JX9A 4UBNA 3A1CA 4D82A 3DPUA 2P9YA 3H5RA 2DWUA 4Z4CA 5AI8A 2NT4A 2F3TA 2OBYA 4QTZA 4B80A 2EKBA 2Y4NA 3VDRA 1M1ZA 1TM7E 4I9UA 5EQJB 1DC3A 4JKYA 4Q3CA 2V7PA 4LE2A 5I9TA 2BJHA 2ZT8A 3ETHA 4L3VA 1PUXA 4S3MA 5AOAA 4EI7A 1VHQA 4TVKA 1EKXA 3TZCA 3G2MA 3BT7A 1WTCA 4RDHA 1OPXA 5H7XA 4DXAA 2NVUA 1GNSA 2G5TA 1LBSA 1NJSA 3T5TA 3OWXA 1MOQA 4JASB 5C3UA 3UXYA 4EG7A 5CB4B 5JY1A 1V41E 1QC5B 3HCEA 4P7KA 5AKJA 4H1WA 2QU7A 2EV9A 3OVMA 3ZIUA 3QLUC 4FNGA 4IAOA 4O4HA 3ZCRA 4QDJA 4C0KA 5LN1A 4N1AA 1KYVA 1B8PA 2QPAA 3JQ7A 3RAGA 1F17A 3OHSX 5T6MA 1EHYA 1N6IA 1JDJA 3BAZA 1AGYA 4I36A 4P7GA 5KQGA 1OYVA 1C3XA 1PGQA 3HKCA 3PEWA 1RXSA 4O4IA 4J9UE 1KI7A 2GA8A 2A92A 3EBPA 3M6IA 4RK1A 3WLMA 3L9XA 3DW1X 4N7RA 5FI0B 4BBAA 4JELA 1V3VA 2GJSA 1FUYB 3ROEA 5A4MS 4CIYA 4MR7A 2GAAA 5F4ZA 5E4JA 1E9BA 4LCJA 4UNSA 1N7GA 4XGQA 5FUXA 3HH8A 4AJOA 1WETA 4R8SA 2CHGA 2IXBA 2OCIA 3W06A 3NIWA 3SBEA 1W96A 4LTNA 2ZRKA 4DIDA 2E4VA 3LP5A 4M0DA 3IO3A 3FZYA 1TZ2A 3Q10A 421PA 2FTKE 5B1HA 1J99A 2D54A 1KS2A 1SXJB 1K8ZB 1QCCA 4HQLA 3ZQJA 2PVCA 4G25A 3SZ3A 5ES4B 1RMTA 1P7VA 2WA2A 1IZ8A 2R3SA 3DEFA 4IV8A 5EFZA 1N2IA 2O8NA 4RS3A 4DBZA 1S3SA 4R54A 5CAEA 1KR2A 1UCFA 1FZQA 2D2FA 4YFVA 1X77A 3TF5A 3WLFA 1NA5A 1O97D 1C3OA 1ESMA 4GMHA 4GZ5A 4RY0A 3THYA 5I01A 4NMWA 2QTBA 3R24A 4N9QA 1KEVA 2ZYGA 4ZYZA 5IZCA 4FXPA 4TWJA 3RVPA 2FUG1 2JFPA 3IP1A 1M54A 4UARA 1EP2B 5A3QA 3WMFA 1H4QA 4CEIA 2PXCA 1ZGCA 2QN8A 3G7NA 4LSMA 4PRLA 4W6ZA 2RBEA 3VPAA 1YZQA 3FKSA 4ZVOA 4EHNA 3PFWO 1NF3A 1RYNA 2X0IA 1DO8A 1GNQA 1NVEA 1RKUA 2UYHA 3RYIB 4HLUA 4JL5A 1Z22A 1GUDA 1I3OA 4M22A 4E13A 3TTSA 1EFAA 3EMDA 4M49A 5GTDA 3MWDB 2Q9CA 4GX1A 4EYQA 1IBLB 2CLFB 4YJHA 5DASA 3NRJA 1KYIA 2VDWB 2EJWA 1T2AA 4WA7A 4K9LA 2J0UA 3GVCA 5FA5A 3H6KA 2QTMA 2A5FA 2IW1A 2YNMD 3NIBA 4RL4A 2VP9A 4N3NA 3Q2OA 1GYRA 1Y9JA 1JHPA 1U2RA 1Z36A 3QVLA 4KLNA 3GMDA 4R1MA 4OAOA 3DOFA 4Q9IA 4CLEA 1HNWB 4I9FA 1GU1A 1TCCA 5ICGA 2R7KA 4OKIA 1U0EA 2ZAGA 2E3JA 5MN5A 1VYVA 4MPRA 4V0NA 4P0PB 2PGJA 1ZRSA 1L7MA 5G2OA 2OFWA 5ESRA 2XUAA 3VTZA 4BMZA 5LP6B 3JVIA 1G3QA 4K0RA 5KO2A 3OQMA 4NJEB 3PFHA 5JSZA 1HDOA 1ZIOA 5BNZA 4Q05A 3G0OA 1UFRA 1VHDA 1XWWA 5BR8B 2CDCA 1JEDA 1GSOA 2XVMA 5JT1A 3R76A 1KHTA 3NX4A 2FF5A 1BVRA 3FNGA 3DAOA 2XZTA 3OE1A 4QHTA 2XBLA 1VECA 1ESEA 3STXA 3EUAA 3QF4B 1P5ZB 1KQGA 1IUNA 2GTHA 1Z7EA 2PMDA 3DTVB 4L5IA 4ZOEA 2WKWA 3QFHA 3OZUA 1U3TA 1XDWA 4EPWA 4HUQB 5CA1B 4YFYA 3KOMA 3NHZA 2QZ4A 2QP9X 1FDVA 4A2QA 1AKYA 1ZXBA 2C5AA 1P3DA 1RAIA 3CZPA 1RRKA 2IOYA 3GJ3A 3H6GA 2IX9A 5JDIA 1ZJZA 4DLLA 5CDHA 4AQ7A 5TQ0A 2BR4A 3B78A 3OEYA 3NHKA 4XIJA 3JQ8B 2P62A 4W8HA 3IALA 4MW9A 4LYGA 3VHXA 4L4ZA 1KDVA 4KSBA 5TGDA 5B30A 2FOLA 1KI4A 5I9MA 1BXGB 1XMVA 4TSRA 3AOEC 4AKHA 3WLQA 4P4NA 2OVFA 2VYQA 3E5HA 4LMAA 1XQYA 5FEMA 4RYDA 1RHRA 5I7UA 1TM3E 3G7SA 3NAGA 3QI7A 4FT2A 4MQFB 1M5UA 4I5GA 3JPYA 4OYYA 3ZK9A 5JCXA 1CUJA 1BCRB 4XD7A 2ZS9A 2G7MC 5DWDA 1YVPA 4TZ6A 1ST3A 3BFVA 4JI6B 4HXFB 3BIFA 4IWNA 3GAFA 2CUTA 2XODA 3LXUX 1PR4A 3K9WA 3OQOA 3F0TA 1DQZA 2P3QA 2EZ4A 3DMDA 4FMBB 3N2IA 3FSGD 4JI3B 4NNOA 2OV4A 1TW3A 2QUAA 3ET5A 2QD2A 3T94A 1XPJA 4QAQA 3QEBZ 1UJ2A 4TUYB 3OIYA 2XQGA 3E48A 4DKXA 3IGFA 3W7BA 5E6RA 1P44A 3F2VA 3OJFA 3QBEA 4KYUA 3SLGA 1YJBA 5DHSA 4BS9A 1PE0A 2YWDA 3VR6D 2UVPB 3KAQA 2Y1KA 1UMBA 3MAAC 4IDBA 3VJKA 3O8RA 1GTMA 4X94A 1XA4A 5H4HA 1TM2A 4CBVA 3L07A 4INOA 3JTMA 1KERA 4N0MA 1GPJA 2Q2QA 1I7NA 4UDYX 3SEFA 3KOXA 2MOKA 3TL2A 1WJGA 3EG9A 3ER6A 1DBRA 3LXXA 1VE7A 2CSUA 3DCJA 1YOVB 2BBWA 4ZHSA 5LQRA 3BWYA 1YI1A 3RRJA 2XHEA 3BS4A 4JITA 5AWFC 4XVUA 1ZD5A 1S2MA 2DQSA 2E89A 4L95C 2JGNA 1USVA 4QUJA 2W2PA 4S2EA 4BNZA 2YVQA 1ZIXA 2A1UB 4AMVA 3OJWA 4NCXA 5UKDA 4KR0A 2V7QA 3NVMB 3OQIA 3VKFA 2HDWA 4CM8B 1TMYA 1DHRA 3B1YA 1T0UA 3C3KA 1Q3TA 5IM4A 1K0UA 1U0JA 1ZEMA 4FBMA 2WIAA 4LVCA 4MVJP 1BX1A 2QZPA 4CQMD 1GPMA 3IKTA 3MWYW 4DZZA 3LQYA 3B3QA 5I8PA 5A1TA 2XWJI 1UC5B 1X7YA 2A1TR 1MMFB 3UHAA 3FYTA 4PZEA 2X13A 4MQEA 4DMFA 4D8VA 4DIBA 2FW6A 3LQ2A 3DTYA 4NFLA 4HQNA 1E7WA 3L0PA 4KQGA 4B3MB 5EIBC 3IILA 3DMTA 4QUAA 5IAJA 3WK4A 1Z15A 3JD2A 3PCTA 4XQ0A 1J07A 5BYJA 2FQQA 5JQWA 2OEPA 2VWPA 4JEHA 3MILA 1JS1X 3N7TA 3PYMA 3F6YA 1GRNA 4Q9NA 4IJ5A 3PK0A 4BOYA 5JYCA 3DDSA 1ZVJA 4UASA 3HU2A 2FZVA 1TJYA 5P21A 3T9EA 3ZBUA 1GA1A 4UUMA 1P72A 4H17A 5TF0A 3B7PA 2YINC 3VR3D 4ARZA 4EYEA 3PDCA 4F8JA 5KTMA 5AI9A 5JPIA 1U6JA 1M67A 1XTPA 2QI9F 3DWGA 2I7TA 3JRNA 3KZNA 1PQ4A 2WW8A 3AEUA 4F85A 1HZZA 2DR0A 4D0NA 1WE2A 3JARB 2HW8A 4A8HA 2WAMA 2JJ1A 3UHJA 3U16A 1PV1A 4RVNA 2XXBA 3EG5A 5JSHA 5KAMA 2PSFA 2XADA 3I5XA 1KSHA 1J5PA 4Y9TA 3PIIA 4LY3A 1PNQA 1YJ8A 3K2IA 3CX7A 4EFDA 3HEBA 4R5MA 1SCBA 1YQEA 5FOSA 3MPUA 1ZGHA 3LSTA 3JYNA 5G3YA 3HUEA 2BR3A 4MGEA 5LM3A 1KVQA 1ZGZA 4BYGA 4JT2A 3NEJA 4ZI7A 4ZDKA 1MQAA 3NBAA 2BFOA 2IXTA 4HX9A 4XWWA 3MCVA 1C81A 2FPLA 1QH1A 2VYCA 1L7NA 3CLVA 1SOMA 4RD1A 2AZXA 2G17A 2VK1A 1ZN8A 1RQNA 1CE8B 3ADPA 4FU0A 2YBEA 5DYNA 4DNPA 3EFOA 4NRDA 1ZCFA 3OD5A 4EO4A 1I3MA 1ZO8A 5T7BA 4I9NA 2ZE7A 4KJXA 5HQTA 2YYZA 4JIGA 1MGOA 1EXNA 2A9PA 1GCAA 2VYND 2YXBA 2Z04A 1OV4A 1NATA 4IH4A 1VL5A 4PX2A 4C03A 4GDMA 5F2EA 2JFXA 4YJ3A 4EYOA 3BWMA 4X1IA 1AHPA 4N82A 2DPLA 4HEA1 2F43B 3OH8A 1U8YA 2VDMB 4RZ2A 4RETA 1JFFA 2QRQA 2YMQA 2QG6A 3NO4A 3DG9A 4K9SA 3O03A 1E0SA 3MTQA 2A0WA 1ZHOA 2WMYA 3M2PA 2BMFA 1HH4A 2PWYA 3MYRA 3DEIA 1CQXA 1KK1A 1U11A 4UAGA 3YASA 4F1KA 2PUEA 4LJ4A 3BFJA 5CXSA 4GXQA 5KWJA 3PNPA 1TECE 1E5LA 5HW0A 4HAOA 1K68A 3JQGA 1Q7EA 2OL4A 3H2BA 4AZWA 4RIEA 5LB2A 3PQ5A 3CX4A 4RXUA 3BD9A 1ZGJA 2J4FA 4ZZIA 5KYYA 1ZHHA 3BGIA 1UFVA 2PX3A 2TS1A 3NHSA 4UAJA 5EYPA 4W1RA 5NULA 4EFKA 1R4NB 4KUGA 3STWA 1NY5A 2Z2ZA 2YJTD 1NDHA 2AHOA 2ENUA 1ZUIA 3EIUA 3GPCA 3KDPA 2GKSA 2YOHA 3ETCA 4HWKA 4BVEA 5ITZA 1YSCA 3NHWA 1FJXA 2IFTA 2ZEJA 2C00A 1GFWA 2VJQA 3EXIB 2P4UA 5DI3B 1X80B 3DAHA 1XTSA 1RRCA 1DO0A 1QHHB 3FPBA 3N70A 2YVAA 16PKA 1QIGA 1SUWA 3BSWA 1NVVR 2A58A 2GRUA 4GM1A 4IV0A 3L92A 4EPVA 4XRRA 4J94A 3SJCA 1EFKA 2OV8A 1CY7A 2PQ2A 3EIOA 2IXFA 4HZGA 4U02A 5FTMA 1M1UA 4CG1A 1FL9A 2VVTA 4Z86A 3QUSA 2DCUA 1MZPA 1VZ2A 3VZDA 3LFUA 1JLLA 1DQNA 2IA5A 2IHJA 1YJ5A 2X40A 3BQMB 4DLSA 4AMYA 4E2FA 3F97A 1ONPA 2BE9A 1CUDA 2I7VA 1V16B 1MVLA 3I23A 3OT1B 2NZUG 2XH8A 4OJQA 2C9OA 3DZDA 4B2PA 3WJ2A 3X1DA 5BT9A 1M2JA 1TYBE 2EFJA 4IMIB 2QTVA 2HDOA 2R48A 1YUNA 5SY9A 2XYRA 4KQ1A 4JODA 4E1BA 4RU1A 3V46A 1A4RA 1GV0A 3FTDA 1FJHA 1I5OA 3GF4A 4YAOA 3IAUA 5EZ6B 5HA5A 2CXHA 2DLNA 2FUCA 3E7WA 4I46A 5LQJA 3AEZA 1WVMA 2ZRHA 3FF4A 3PQCA 3AY3A 3FMIA 2PTGA 1XTIA 2XNKA 2IBSA 3KTAA 5JHGB 1XMPA 3IBYA 4RA6B 1Q7RA 4MDYA 4TN5A 5A9TA 4UNPA 2EX4A 2Q2VA 1U0FA 2FEWB 4U2GA 5K03A 4DIFA 4DDUA 2FWPA 5AICA 3S70A 3WGJA 4FSHA 1W2HA 4ZEXA 4FW9A 3OEWA 3BD7A 3T1NA 3F90A 1KZ1A 3IAHA 1JMYA 3KJIA 4G1CA 2QOEA 1WBDA 1S0UA 1JALA 4MW5A 4RVSA 3Q7RA 1LVHA 2D0DA 5JDCC 4A6PA 2QQGA 2HIAA 2QLMA 1RQPA 3GV0A 4J03A 4BEBA 4EVRA 3LW8A 2DJ5A 3VNAA 4UUAA 1XXLA 2XTAA 4YYEA 2CMGA 4D8WA 4BUZA 5K0BA 4V0OA 2QRLA 1CP2A 1DADA 1YU9A 3PC3A 4IGFA 1WQ1R 4NBNA 4ND1A 4W82A 3FLMA 4Y8VA 4ZQHA 4MPDA 1ZR4A 1E8DA 5KS2A 2X19A 2R7NA 3S2IA 3UMVA 3MF4A 3PJGA 3WIVA 1D7AA 3AJAA 3EZ7A 1MDFA 4KBYA 1DZ3A 2HQ1A 2JL1A 3SM9A 3AXTA 3TPZA 4X8MA 1U02A 1BU8A 1ACLA 3GR6A 3RI3A 1EM8B 3LHIA 4IQ0A 4TTTS 3WFZA 2AN9A 1TYAE 2FOXA 1J6UA 1NSFA 2XDQA 1IC6A 1UL1X 2Y6VA 3IIJA 1RBQA 5SV2A 1P9NA 3HKDA 5EOVA 4BDTA 4BGDA 2QPLA 4LHWA 3NNSA 4PLFA 4TV8A 1P1IA 1CWUA 4IQ4A 1DKQA 1SG0A 3QPAA 3TD2A 4B87A 4C1BA 3LC7O 4KFTA 1XRMA 1DCMA 1W75A 4N6NA 1CC1S 3KO8A 2XCSB 1BA2A 4MGHA 3SC3A 2Q9UA 3JQ9C 4C43A 4H9GA 1THGA 4DEYA 2ST1A 5JAOA 2FCAA 3H5OA 4FEEA 4DG9A 4DUYB 1DXQA 3RD5A 1ONNA 1ZMXA 2WZDA 4O4JF 2QHXA 3RABA 5A6SA 4MP3A 1NW3A 2EJUA 3E9DA 4WD3A 3E22A 1VKZA 4NR0A 3VUFA 4W5WA 1DP4A 2ZPTX 4MHOA 1PGPA 3L0IB 4K2HA 4ALKA 4FE7A 4B3JA 5GY7A 3EFEA 2RMKA 2O07A 1K75A 2L69A 3WGVA 4QLBA 3DMNA 3QNMA 1IHXA 1WLYA 4URHA 2PPLA 2NSYA 1CUFA 1PFGA 2G09A 1C7ZA 1SCUB 3ZUGA 3DHEA 1GPUA 2WU3A 3HPRA 4KAAA 3IESA 4RDIA 2ALJA 5EJAA 3QMWA 4LGCA 4LV8B 5CDFA 3L3BA 7MDHA 4I9GA 3DO8A 3AL0C 1GFSA 3DQZA 5CNJA 1QOZA 4X5OA 5IP5A 4MUAA 1HKUA 1CTQA 5EESA 5J3JA 3D4LA 4B3XA 2Q5EA 3FWKA 3HI4A 2PT5A 2FY8A 2KWIA 5B7NA 5E7IA 1IUPA 5B37A 3ZIAD 2BFMA 3R5FA 3UVEA 4E5SA 4R1PA 1UK9A 4H1VA 3V4FA 2P0YA 5TPZA 3PXGA 3URKA 5I9BA 1JNXX 3NBZC 5KTOA 4MRPA 3HDTA 1X1QA 1Q1NA 2QE6A 1RZ3A 3EZ6A 4QDOA 2I2XB 1J0BA 4HDNA 3ZZ0A 2XUIA 3I4CA 1CZRA 3DYVA 3ESBA 5ICSA 2PH3A 4DCPA 1VHWA 3RFXA 1AKRA 1PWHA 3P2EA 3MWKA 4FLFA 3DJYA 1NKVA 1NQUA 1NQXA 4X8HA 3T5AA 3Q7PA 2VAXA 4IKEA 1TZBA 2F1OA 3QW4B 4HH3C 2ZYVX 2ATVA 3CXRA 2Q3JA 4OYRA 4R8VA 4OU5A 4F38A 1CBUA 1Z33A 4QD3A 1I3LA 3WGYA 4EGFA 1T15A 2NUPB 3PXCX 1J2YA 3CH4B 1Y4DE 4GQAA 2C3YA 4DL9A 1E59A 2SBTA 3PJEA 5CD9A 3OQNA 3Q5GA 5ITWA 1DSSG 2B94A 1MW9X 3FNIA 3KQMA 3MERA 4AQYB 1IHUA 1UBMS 3WIBA 3ZJYA 4PC6A 4D46A 4RGVA 1NRIA 2KYRA 4BEJA 2C0PA 3F71A 3PQ7A 4WNCA 4ADSG 2APJA 2AG1A 4PGGA 1NE2A 4JJ4A 2YIDA 1H0HA 4LJ6A 2AC7A 4RF4A 3M6MD 1FYFA 1ECGA 1D5WA 1ZYUA 2GFIA 3VPXA 4CT0A 2H1HA 2ZSUA 5EMKA 2ECFA 2XT0A 5TY0A 3CRZA 3NM6B 3K8OE 1KAGA 1MC4A 1YRYE 4RDCA 2X5KO 3NUZA 1R2QA 3I52A 4QOEA 4C2TA 4B45A 3B6JA 4RF3A 3U40A 3DMPA 1RC8A 4ZYYA 1PGJA 2PQ6A 4MIOA 5HOQA 2GRJA 1QUEA 3ZJ5A 1JQBA 1KOFA 1OAOA 1R4AA 3COWA 2OHOA 3N7AA 3O9ZA 4I1SA 1KAEA 2P35A 3FNQA 4C29A 2G8LA 1WA5A 2R7AA 2V6GA 4BASA 5JYDA 3CONA 4XIFA 1G18A 2N1MA 2ZTMA 1JEOA 1Q7TA 4IVPA 2AQKA 1RXIA 2YWGA 4NCHA 5FORA 1SXGA 4P4SB 3ZDAA 2C9CA 3ET4A 4TL9A 2F1HA 3VU9A 5FWXB 5JNUA 1OZAA 4H4CA 3N6XA 4MMXB 4E11A 2FMKA 4QSHA 4G5OA 3MRTA 2HBYA 2QD3A 3NETA 1I6MA 1VBFA 2W6NA 3A37A 4QUBA 4A5OA 1U9CA 3GPDG 4H18A 5AUOB 5TSDA 3UIEA 1A2OA 2F48A 3LO8A 1IB0A 3Q9SA 1SHZA 1LY1A 1E5VA 2W42A 1MVNA 1G0NA 4KSCA 2FK8A 1Z5ZA 1NX9A 1E5DA 1P2GA 3ILVA 3SIWA 3QKSA 2I2AA 2Q5QA 5CDFE 3TG8A 3EPKA 1KFKB 2V6JA 1OREA 1P45A 2PS1A 4JVMA 4TZTA 4ZVUA 3DE6X 1AQNA 1K88A 5CT9A 3BB3A 4QUHA 2V98A 3MLEA 3ZV4A 4JS0A 5F1KA 3UKJA 2WE7A 4ZT4A 2JASA 5DXAA 5CLJA 2B9VA 2H2IA 4OFWA 2WJPA 5IVIA 2M1ZA 1G8JA 2VJOA 3P9CA 4J1NA 3G82C 1J56A 1RADA 3A2MA 3BDIA 2V3WA 2PBRA 2NU6B 1QHEA 1ZM9A 4YJGB 3HACA 3CR7A 3EHEA 1UJ6A 3S0JA 5A7FA 2E48A 3F5QA 2D00A 2AW3A 1P0PA 1V25A 3COVA 3ROGA 3ROKA 2CB9A 2XB2A 4CV3A 1E6KA 2I1LA 1OE0A 4Z4FA 1S96A 1CDDA 3PSHA 1DX9A 5H68A 3ZKWB 4RGBA 4G0NA 3Q3CA 4BO6A 5CDTA 2O2ZA 4TMZA 1LLDA 2BI4A 3IOCA 1TO1E 3NEAA 1GJRA 3R9XB 1O89A 3QPVA 1R6VA 4MVCA 4ZVVA 2JK0A 2GD6A 2H9IA 5D6OA 3TUJC 3L8FA 1ODLA 3OF3A 4KCGA 4ON9A 4TLAA 2QX9A 3LAWA 3VSEA 1BKDR 1DTEA 4TKVA 3CPHA 1UJNA 4PAMA 4WY5A 2X0EA 3WK7A 1Y3FE 2AX3A 4GE0A 1OGJA 1VDMA 3ITDA 1XZIA 4BYMA 1OV6A 2PRZA 3DVAA 3L8CA 4Y30A 2G83A 3P5SA 1HRDA 3RQSA 2FQYA 5JW6A 2HSDA 1PT7A 2C59A 3PUYA 2BFBB 3TZEA 4HXEB 4Z4EA 1HMYA 1I1NA 1M7GA 2ES4A 3OLVA 1N4DA 3NYRA 1PZNA 2VTBB 1ZL0A 2XOKA 3MWLA 2J7PD 3FOBA 2SICE 4GOLD 3WYEA 4K40A 3R5KA 5EIBD 4ZJYA 2ID9A 4B3TB 1XP8A 1PNVA 2NXJA 2OBLA 2W2KA 1BE6A 1T0BA 2W4IA 4OIFA 4DLTA 1N5DA 4S0XA 2XD9A 2C4HA 4Q4HA 2A0XA 7ADHA 1Y9ZA 3OIFA 3H5WA 1H0SA 1SGWA 4NXNB 4OXNA 1GZ6A 1QIFA 5AM0A 2JD1A 1POXA 1HDXA 2C1XA 3LE8A 4MUHA 4GPZA 4JI4B 4LGMA 3I45A 1QRTA 1JU4A 3WRYA 1BC5A 1YGYA 2ASEA 2WT8A 2XNDD 2VUIB 3X43A 5LMNB 1MQSA 5DX0A 1MHTA 1WXWA 3B1WA 3E03A 4HB4A 1H5UA 5HF8A 1SHTX 1WAMA 4PZ0A 1OT3A 1K06A 5KSOA 5A7GA 4PLVA 4FT4A 5J1SB 1XP5A 1NXSA 4HYYA 1T9AA 5HF5A 1FP4A 3GZNA 4ALIA 4B2LA 1VOTA 4TROA 4HPJB 5I7RA 5JS7A 1PL6A 5L7WA 1JIXA 2PT6A 5A9SB 2GUGA 1IK6A 3AJEA 2FEPA 2RCYA 4HCJA 1K4MA 4XLLA 1SBQA 1KXJA 3DAYA 2YWFA 3CISA 5U1PA 3MT0A 4OH7A 2HV9A 3ND7A 3IPRA 5SZKB 3ZXYA 4D7AA 4CIBA 5CGQB 2F90A 5KHOC 3K9FC 3DCYA 3FFWA 4KIGA 4YP7A 2Y1DA 1XELA 3RNLA 3UAZA 3SQWA 2ZRAA 4K9NA 2OCKA 4JROA 4XPZA 1KC3A 4JMLA 3UJ8A 2JKZA 4W8GA 5JVDB 4U7WA 4DLKA 2Z43A 3U4HA 8AT1A 5AVJA 3HXPA 1C80A 1UOPA 1KP9A 3FCCA 5H9WA 2NTJA 4RVHA 2ATCA 4L9AA 1GDDA 5MFPA 1W76A 4H77A 4JI1B 2REBA 4H1HA 4FR5A 4WUVA 1JQ5A 2RGEA 1VPWA 2X0JA 2FFHA 4LRSB 3DMYA 4EJSB 2PT9A 2GBIA 2IDMA 3OQ1A 1A4IA 3LQFA 1C7IA 3ROPA 5U9CA 3OFND 3BGWA 4NQRA 1L8AA 4GOJA 5JXWA 4X1YA 3OOEA 5K0CA 2Q5OA 1J1UA 4S1NA 7REQB 4Q3KA 1AQYA 3F5FA 3NIFB 3KPVA 3ORSA 3PUIA 3SMQA 3UQYS 1NYLA 1SIWA 4DRZA 5IFKA 3RK0A 3IAFA 2VHXA 4ZKEA 1AIPA 1B6RA 1N5JA 1TQ2A 4WZ6A 1VIAA 4MH0R 4QDTA 1Z5GA 3BFXA 3EDYA 1HLGA 3I9V6 4HN4B 5HJ7A 4R05A 4R2XA 4NMLA 4PRZA 1JQAA 5TT1A 1LPOA 1YS2X 2PG3A 4JI8B 5HMMA 2ZTSA 3ONDA 3LUCA 5DN6A 3NKVA 2Q6TA 3RR2A 2FHPA 3TQFA 2QUZA 3C3JA 1R10A 1VMIA 1JG4A 2PAAA 4RSGA 4CTMA 4ETIA 4KDFA 1DEKA 2ZR9A 5HM6A 2QZSA 1YB6A 2J7PA 2BISA 3QW2A 1NN3A 1DEAA 2G0TA 3SYMA 2GD2A 4MQ5A 1FU7A 1AV7A 2DHEA 2EQ5A 2QTGA 3D4NA 3P19A 2XY4A 4LK3A 1NY6A 2HBRA 1RSZA 2B1RA 2WTMA 2GD1O 1P1RA 2VL7A 4FFOA 5DVZA 4DIEA 1Y3IA 4P7JA 2H59A 3J81k 4M86A 4JUBA 1NAHA 2CVHA 1SCKA 3KPJA 4LZJA 4NABA 1T9KA 4FMDF 1FVHA 3P20A 1OAAA 1H9BA 1TYZA 4WERA 5JECA 3H0KA 1A72A 2RHJA 4HBZA 4JI2B 3TR5A 4LOAA 1MG0A 1T4CA 1DRVA 2OCLA 4L5BA 3TGLA 3I04A 3LU1A 2IYAA 2O6HA 2ACVA 3F8WA 5EGNA 4DQ0A 1E6UA 3LA8A 2OXTA 2XTJA 3AUYA 3EZNA 4IDPA 4C0HA 1YI8A 5FDFA 3TGPA 1J9ZA 2YYAA 3I9OA 1CS0B 4I6EA 2H8GA 4TOIA 2XUKA 3BAFA 3QITA 3ESQA 4M4SA 4RLHA 4C88A 4A4DA 1GQQA 3ZHOA 1NI4B 1RNLA 2UUOA 4LSZA 5LBUA 5C5CA 3RUAA 4FZRA 4J6EA 4LOJA 5F2NA 4LJ7A 5B2EA 1SUPA 4NI5A 5D5HA 2WUDA 3WB9A 5THKA 5IT4A 1Z4PX 2OCBA 4ZOLB 1TD1A 1DIAA 5F1PA 4X60A 3B51X 4ZD6A 4C0BA 1SQSA 1WV1A 3AEQA 5IDYA 5C4MA 3O94A 3EDCA 5BN1A 1IIBA 3KKNA 3PR2B 4IFEA 4MW4A 1GM5A 1K5PA 2HSEA 3B1FA 3PZRA 9MHTA 4LBVA 1KMMA 2J9YB 4I55B 1QZXA 4UBOA 3TR0A 5JAMA 1ECBA 1VSUA 2PMCA 3FETA 5DBGA 3CW9A 3ZJ4A 4EHIA 3T5BA 1FP1D 3N7UA 1FVXA 2C96A 3ZQ4A 3EZFA 2QRJA 2VDVE 2H4XA 3T52A 1HGXA 1R9MA 3OWOA 3TB4A 2DHRA 3OIWA 3BHIA 4CM1A 4OUKX 5HNKA 2GBLA 2NQ2C 2RHMA 3EVAA 4KPUB 4RMIA 1YFJA 5REQB 4F6CA 3FPHA 2TMDA 3GU3A 1RRMA 3SHWA 2DM6A 4YNBA 4IHQA 2E5FA 3UYLA 2VWQA 3N6RA 4FN5A 4CNQA 5FBVB 1R8QA 3D02A 1UWCA 3IUBA 3MOSA 3ZYCA 4YDHB 4O2BB 3KYIB 1OBHA 3R3XA 3SJUA 1V8DA 3EN0A 3OFNA 4KQ6A 3M3PA 4RH1A 3UJ6A 1C1XB 1LPSA 1YHNA 2O8CA 2AOWA 3OY7A 2NU8A 3R09A 1Q84A 3G85A 4Y1GA 3AERB 1F2DA 1BDHA 4O3FA 3TIVA 2PSJA 1D9XA 3AM3A 2EP7A 4RHEA 4CCAA 2P65A 2WJIA 4Q4LA 4REOA 5EQTA 4EYGA 2EU8A 3DFZA 4S1VA 4N7JA 3OU6A 5K8JB 3IMKA 1QTNA 4EP1A 5HQJA 4P6VF 5F9HA 4ZVSA 3TB6A 4PQFA 4DT1B 4BVBA 2Y93A 2XBMA 3RV4A 4CDGA 3RUEA 5EERA 2E18A 3NIDB 4LJ5A 3A28A 3K2EA 4OQNA 2XJ9A 1WVGA 1D09A 1VIVA 2OP1A 3KYDA 5IUJC 2SECE 4C0JA 3L4KA 1Z88A 3AF5A 3DCNA 3ENQA 5TRTA 5C1PA 1UBEA 1T6ZA 1E2UA 3CF4G 3PXXA 4EPXA 5TVKA 1B23P 3LQQA 4DBLC 5F51A 4KXNA 5AXBA 3UN1A 1XNHA 1MX5A 2I9PA 5JXJA 1U7ZA 4GS5A 2VYVA 2NTEA 4FDVA 1GQSA 1KO8A 4Q93A 3U37A 3A70A 5HP4A 3DP7A 3WQSB 1U3VA 4G36A 3RIXA 1C7EA 1FMLA 2AQ8A 1SVNA 2C29D 3HRIA 3N0TA 4NOJA 4UE2A 5CHEA 1PFWA 3F73A 2VHCA 5JG7A 4YUAA 1NVXQ 3M9WA 4JHLA 1JU3A 1D2MA 1AGNA 5K3OA 4KX3A 3QWAA 4MLPA 2QM7A 2OMKA 3USCS 2AEFA 4C2AA 4CMEA 2VP4A 2RAUA 2GM3A 4MQLA 1R3DA 4B6RA 5E9AA 4MP6A 3V8BA 1T5DX 1ZK2A 1K8YB 3V1TC 3S5UA 1EB9A 3KKEA 4OP1A 4B6QA 1DOZA 4GO1A 4MITA 4MVWA 2PGLA 1QGUA 1PDOA 2HCBA 1WQ4A 5FD8A 3AVUA 4TV9F 4YPOA 2YRFA 5ECWA 2YQ5A 1FTYA 1VJCA 5AKEA 8GPBA 2EZ9A 1IWPB 2IRWA 1U7OA 3HLKA 4WMLA 5EMJA 4UBLA 1BJTA 1LLUA 2EX0A 4AICA 4E5PA 1ZM7A 2G25A 1ZOIA 1D6MA 3L0SA 4LOLA 2H06A 4P38A 5LXTF 3SHQA 2VJYA 3T1OA 2W7TA 4DIMA 4HNAA 4ERXA 1S02A 1S8NA 3KQQA 1CSEE 2ZS8A 4QC2A 5TX7A 3WYBA 1QMGA 4BP8A 3MYYA 1P77A 4JLVA 4U0JA 1NP6A 5JNSA 2PSHA 3C39A 3D5QA 4TS1A 1TA0A 4EJ2A 4J4BA 3K0FB 1Y5RA 4L3WA 5CB4F 1ZICA 1OFIA 3R40A 5AJTA 4Z0HO 3RE1A 4MDEA 1RWVA 3BH6A 3VR2A 4D9HA 1JAZA 3AUSA 3BILA 4Q21A 4DS3A 5LLDA 4GWGA 2VZ8A 4DA9A 3PYLA 5GV7A 4LVNA 1SEPA 4K6CA 4NQZA 1PD1A 1J8DA 3FA2A 4V0SA 5BOSB 2VZ0A 2FSVA 4R0VA 5AT1A 4AS3A 2QRVB 3TNDA 3GJ7A 4KQEA 4X24A 5GIOE 3HU3A 3WHKA 4HDSA 4IJMA 4P80A 4HDKA 1FDTA 3LY8A 4WBXC 4YEDA 2ZJFA 4CLDA 4OB8A 4BVFA 4D81A 4IZOA 4A1FA 3HSKA 4MO2A 1I2ZA 4IUYA 4NMMA 1PYOA 1A5SB 3HB5X 3HWX1 4B6FA 5IZ4A 2ZCJA 1UKYA 4ARIA 4CFSA 1GCUA 3EWNA 4DEXA 4BXOB 1Q6YA 5AJHA 4ZO9A 1MB0A 2A78A 2A9OA 3DDNA 3N1UA 4PIMA 4YJ2F 4Y3UA 4WXPA 5C8YA 2BGUA 3HYNA 4ZQEA 3W7VA 4BATA 2Z2XA 4L08A 4RTLA 1E9FA 1Z06A 3IT2A 5DGCA 1QQ5A 1GVHA 2CHFA 5E4FA 1ZXXA 4LHVA 3FKJA 1TB4A 5BSEA 3EC1A 4RELA 1F0PA 2B99A 1QRDA 1U8XX 2I03A 3GT0A 2NXWA 3RYCB 2D5IA 2Q6LA 2D7CA 1ZAYA 1HBJA 4FNMA 3UGJA 3PIRA 4NZ9A 5EL0A 1MPTA 3VTKA 3LUGA 1TVCA 4FJ0A 1G2PA 1KZYC 1JNYA 3CNHA 3H5NA 3NT4A 4GT1A 4V0LA 5EKXA 2EP5A 4R2KA 5JMWA 4CZ2A 2BHLA 5GVRA 1LGYA 5IG2A 2PWPA 4TTSA 4OQ4A 5JPDA 2QX8A 4F2DA 1NDQA 3K6SA 3E9EA 3JQ6A 2IYOA 5KAPA 1FPMA 4L22A 2BEWB 3E18A 1OVGA 1TVKA 3VU8A 1CUWA 1B1AA 1DAHA 3MUNA 3P0IA 4L75A 4MXDA 1N3LA 4M7PA 1F14A 2ZTUA 3PI7A 2XXAA 1CXZA 4IIFA 3MWEB 3T34A 1BTOA 3JAWB 1DBVO 1S2DA 5K3FB 3FBTA 4I50F 4I1OA 3VX4A 5C8DA 3IURA 4RHFA 1JA9A 1W35A 2PX5A 2FMTA 5FFFA 5LP6F 3KPUA 1AMUA 4NBTA 1JMKC 1TRHA 2HTFA 4WN9B 5CD1A 5AK3A 2LIPA 3DNPA 1L4LA 2ERYA 2DG2A 3E23A 4Z0NA 4BBZA 2V65A 1YFZA 2FPGA 3N2GB 1XL1A 1U1GA 1OBFO 2GXQA 3VNUA 4AX4A 1TLFA 1XTUA 3NP7A 1SXIA 2JDID 1DXYA 4FOLA 5JNWA 4N8DA 1NZDA 2XE7A 1QH8A 4BNVA 3PGMA 1NPYA 3E4CA 3ZDBA 1P6XA 1AY0A 2C4NA 2ODQA 3QY9A 1DKLA 4RHYA 5ENVA 1OGIA 2QU8A 4E21A 1KKMA 5LYJA 3HVKA 2JFOA 3OE7D 4IHJA 3W9SA 1Z0AA 5BT8A 1TCUA 3OZ7A 3DE4X 2FB9A 5HHTA 4B4UA 2RK3A 3Q3HA 3LOPA 2LIVA 2GEJA 3TQCA 3IUQA 3UMRA 2IPOA 1I4EB 4OUDB 1MORA 4ECAA 2EGUA 1ULBA 1CLUA 3DA8A 5C7IO 1QYXA 4C05A 3UMMA 2DF8A 2WYOA 1QCYA 2EW8A 1HQDA 2OO7A 2Q62A 2VQEB 2FR8A 1NYQA 4DMKA 4I7EA 3G17A 2PLNA 3U4GA 3UMBA 2B2CA 2BVNA 3GRFA 3RT9A 4RD6A 3WL5A 3R5JA 4QXOA 1L3CA 2OFFA 3RTBA 1PVOA 1DCFA 4AP9A 4NMXB 1SURA 2Y0BA 3O47A 3SDBA 1N36B 1SCNE 3QXCA 1S7CA 1ARZA 5T3YA 2Z58A 2H3EA 3F2IA 4WWHA 1D4AA 2BI8A 5ALXA 5JTUA 1Q11A 3TM4A 4IX1A 4O6VA 1MC5A 1XRRA 4AKEA 5AVQA 1WDWB 4TMFA 4HTFA 1GDHA 1Q0QA 1SO8A 1UM9B 5CT5A 4FHEA 3P94A 4DR7B 2BZGA 1THMA 4OSEA 3B6MA 1L5RA 1VPEA 2QQ0A 1G64A 3WDLA 4B2YA 2HX1A 5DCWA 4BVLA 4HQ6A 4OHRA 3B2EA 1K2WA 2CLIB 2FG7C 3OQPA 2QM3A 4GECA 3WLLA 3MJ4A 4BMYA 5LQNA 1K0FA 4QIHA 4Q7JB 3VAZA 4B3GA 2BKAA 2PPVA 3KS9A 3U13A 4N7MA 4CIVA 4XPIB 5U4QA 4C21A 2ANBA 1GTZA 1GU0A 3K8QA 3UOAB 3AINA 4FQ8A 2NV6A 1IHOA 3CMMA 4FYHA 4NX2A 5ALMA 5EE5B 2JLVA 1GO2A 2NZ8A 3PR1A 1FFWA 4XQEA 4P1ZA 3QG1A 2PL9A 4Q9AA 4ZAWA 3SG0A 3VH4A 2PXXA 5BVHA 4YVFA 3JS5A 4TYMA 1OFGA 4TN1A 2FMHA 3GROA 4E7OA 2KHZA 2WEKA 4IY1A 1KYTA 1VIMA 2B2XA 3O4RA 3R9WA 1NGSA 3TYXA 2OUIA 2CCJA 2RGNA 4HS4A 3OE4A 2Q1TA 3G59A 5B2FA 2MR6A 4M7OA 2CY0A 3IBTA 1UT8A 2D1RA 2Z09A 1KZ7B 2MSKA 3NUQA 2RH5A 2D1YA 2LKCA 4HPWA 4ZRMA 4BWFB 1AKTA 3ED5A 1KJJA 1OH7A 2YS7A 3GW8A 2RGXA 4D92A 2O1WA 4JVLA 2V59A 1Z6XA 2F59A 3GH3A 3VH1A 2R6FA 4AZ3B 5EP4A 5J2UB 1OJ7A 4AYXA 1EIZA 2IGTA 1JPNA 2OZLB 4B7XA 4YV1A 1T6NA 4OCZA 4HPXB 1CV2A 4LDZA 3HB0A 3ON5A 2C42A 5B7QA 1XRLA 1BEZA 4KR6A 5E0KB 3GLKA 1NLFA 1I3KA 2CMDA 4R2WA 4E03A 2YY7A 1SU7A 1RRPA 5F5NA 1Z0FA 1HLDA 3HUFA 4LXXA 2B35A 2X2PA 5T4HA 3MJSA 1X1TA 3RJ9A 3GELA 4RIIA 1T4DA 3KX2A 4DMLA 2C7RA 3I76A 3BMNB 3I01M 2DWPA 4IKOA 3FOCA 4OHPA 3BWXA 1Q2XA 4RCVA 3EGVA 3PC8A 4GLJA 4EH1A 4FCCA 3NAQA 2WSSA 5DULA 5EWLA 5HIKA 4HO1X 3OOYA 1HNZB 4ZAYA 4RD0A 1ATIA 1K6IA 2ZAOA 2P5SA 4CDRA 3SQMA 5KOHB 1AQUA 2HREA 1L0BA 4YI3A 2G0NA 3F7MA 1I01A 3PT9A 4CN8A 4B84A 1P6QA 3TBFA 4AZ0A 5BWBA 4CIWA 3K0SA 4DV3B 1PV2A 1MFPA 3AFHA 2PVPA 3AB8A 4QBGB 1TQ6A 2Q5LA 2YFHA 4BAGA 5KSZA 2JI4A 2UVQA 4JR1A 3SFVA 1G1AA 2BGTA 1E89A 1CKEA 3GEMA 4ZJUA 2IPAB 4OHVA 1ISIA 3HSYA 5JTTA 2ZBVA 4Q6BA 1CUAA 1XXHA 2WSYB 1I5RA 4OHOA 5LDGA 1VMEA 5C8ZA 2IY9A 1LI4A 2OV6A 3EZ2A 3HUDA 4PLZA 1AJEA 4JSTA 4NENB 2JJYA 4IJUA 5LCXA 3VMFA 3B8EA 4J1SA 4UHEA 3BK7A 4GF5A 3O21A 2H2DA 3BCHA 3IHKA 4AIIA 4MVYA 2QGZA 4RD4A 2FH5B 3U7QA 2XQIA 1LFAA 4O2AB 3UWMA 4DCGA 2EKDA 1YS7A 3IULA 2P91A 2IU3A 3TIFA 4DM4A 1A9OA 4MUGA 3PIDA 5LQAA 2P41A 4RJKA 3IDZA 3JATA 4GPBA 2ZU0C 4M21A 3ZX5A 4BV2A 5KYUA 1L4GA 3RS0A 1ZD4A 4MEJA 1BVYF 3VGPA 3J81A 3J80A 2BH2A 2D8MA 2OG2A 1EZ1A 3IJ5A 3DDZX 3CO0S 4EHDA 3LW7A 1IQ0A 2GCGA 3DW3X 4J0GA 4JK3A 1I24A 1I3NA 4F60A 3KAPA 3WLKX 5ITVA 3LK6A 4Y6PA 3A10A 3EQ7A 1O5OA 1TCAA 4JB2A 1GG5A 1E96A 4ZQIA 5K3CA 1ZQ1A 4ACBA 4N5MA 5JC1A 5TIIA 2EP8A 3SC6A 1LI5A 5KDLA 1LSUA 4FFBA 2GBGA 1PT8A 1WCXA 5ALDA 4DMCA 3U7EB 1N1DA 4LZLA 2HZBA 2PZ8A 3C1AA 3IQIX 2J85A 1XD2A 4JSRA 2VT7A 4PLGA 4ZT6A 4TYQA 1PR2A 2H1VA 1FW8A 1F6WA 5JFGA 1GQFA 1SKUA 2BKXA 3HFRA 4HFMA 2GN8A 4NL4H 4UCQA 5SICE 6AT1A 4PS0A 4NJOA 1EFPA 3INYA 1CUYA 1LXCA 3CNBA 3IE1A 2BFFB 3GOQA 2W2MA 4UCWA 1N4AA 1UMDA 2WJZB 2QM0A 3FROA 4RH3A 4XARA 3WZ2A 2PGOA 4BKRA 3DWFA 2HF2A 4ZCMA 1PBTA 1RPNA 3FTEA 2WU4A 1GLVA 1MB3A 2PRIA 3R0IA 4QREA 4CL3A 2XT6A 3DQQA 1GQYA 5CU7A 1UFKA 1GNPA 4JVOA 4NEQA 1Z2OX 3IUEA 1JU9A 4DLVA 1ZK4A 5AW3A 2UZIR 5IJXA 4CCYB 3KJHA 1H2YA 3DEAA 3LIPA 3PGLA 5A06A 3AX6A 5HKOA 1TYEB 3CZQA 3B36A 2XUGA 3A9CA 5BSHA 2NWQA 1WD5A 4LJRA 2P4SA 1QONA 3P9NA 3U9TA 4UZEA 2X8BA 3O3NB 1M2KA 4FGWA 3NDIA 3M6WA 3BOSA 1XDSA 2PFSA 2WPNA 1G9XA 5AKKA 3UTCA 4DLWA 1CZUA 2C0CA 4L6CA 4OHZA 1E0KA 4TQ9A 2PM8A 1PL0A 3PB3A 1ZNWA 2ZUVA 2O52A 2XQKA 3AYXB 3FYUB 2PBZA 1UXIA 1M1NB 1RFLA 1ZC4A 3CZ4A 1E6CA 1QGED 1A9XB 3DOJA 3K2QA 3KK0A 4AY4A 1Y8ZA 1MAVA 4AS2A 1RBMA 4PG8A 5TQVA 3S81A 4X63A 1MJNA 3QVUA 4P8RA 5M3BA 1PEKE 1XXHE 2QLLA 3FIUA 4Q03A 2HRRA 2P6NA 3HZRA 1QTIA 2GLUA 3FSEA 5DZSA 1O54A 1R8JA 4D79A 3LCMA 3H1EA 3DBLA 1TPYA 3OUUA 3OBIA 4RTNA 1OA1A 2P0AA 1FBNA 4XGRA 1NULA 4QEZA 3KVOA 3ZHUA 1Q1QA 1RDFA 4Y2PA 4B31A 4E33A 3AQIA 3KSBC 1NMZA 4X84A 5EWMB 1AB5A 2ZTVA 1QPBA 3JQAD 3OM8A 3PEFA 5BRJA 3VC2A 4MINA 4YROA 2UZ1A 1IQPA 2V54A 4WASA 3RSFA 3QYJA 5JRZA 3WMGA 3KB6A 2JFUA 2R1TA 3OIUA 4JXKA 4HYTA 4Q01A 2OMEA 1R4ZA 3AILA 3DVQX 4W9NA 5BP7A 3FFTA 3GP5A 2XECA 1W93A 2VJMA 3LPCA 1D6JA 2ZT5A 2H29A 3KEOA 5H81A 3LQKA 1I4WA 3KSMA 1EEXB 5TQJA 1E0DA 2YJNA 4JJGA 5JH7A 4Q82A 4CHTA 3VKHA 3O8NA 3ECCA 4BUJA 1E20A 2WTAA 4EL5A 4DYVA 1RAHA 4Y2HA 4KB5A 4OFBA 5TMBA 5IBCA 1YQGA 2IHKA 1ZSYA 4P4UA 1J4AA 1SCAA 3FLBA 4G81A 4KFRA 4YP0A 4KQWA 1ZJJA 2RHBA 3MBIA 5THXA 4KOEC 3VR5A 1UM8A 4YP6A 4EHLA 1TVMA 4XB1A 1FDUA 1VSVA 4L76A 4DSOA 3FMPB 3KFXA 4OL9A 2XCRB 1R5NA 2O7NA 1SG6A 4KXYA 3BHNA 4YQFA 3GLRA 3W5AA 2IF0A 5KWVA 3TE7A 1JJFA 4ZJZA 4BX3A 1YK1A 4GXRA 5IBPA 3UOWA 4MVXA 4ZVPA 2ETXA 1QPZA 2OVBA 1RXEA 4YRJA 4F93B 1RBZA 3TPCA 2FR0A 5CCDA 3T61A 2JCVA 4PPGA 1PIWA 4UMVA 4WZAB 3IEPA 2GYUA 2ZIXB 1DWOA 1G4UR 2PKQP 3IB6A 3L0CA 1BHJA 4Y98A 3HJBA 1PYGA 3COSA 5L3QA 4H7FA 1DXOA 4Y1RB 1QP8A 4TWRA 5HR5A 1D0IA 1RRVA 1SHUX 1IU9A 2P9JA 3G1UA 1XEWY 5ES3A 3VPCA 4A6XA 3BKXA 3TSYA 4CGYA 2YOFA 3LWZA 1NSTA 3GEHA 2ZRIA 1YS1X 5CPFA 1YBVA 3TXAA 5HUHA 3SKYA 1V5FA 4DJJA 1U7HA 3PUWA 3BXHA 1OXKB 4X54A 2NMVA 3I4FA 4JC4A 4PG4A 2NSLA 4YV0A 5K45A 3ZU6A 2XRMA 2NQ8A 8OHMA 1QUFA 5LQMA 3DLCA 6YASA 1FUIA 4DA0A 5L3VA 1PJQA 4IJVA 1HG0A 2UZ0A 1RM0A 4KO3S 1ZITA 2PGAA 4DB4A 1U0NA 1ICIA 2I7XA 5AVXA 1PU2A 1XZHA 1JQLB 4I5IA 1N8SA 4RJJA 5ALQA 5LJLA 3P4YA 2QMEA 1EXVA 4G9BA 4LDJA 3R7DA 1MEEA 4LQ4A 3VKUA 2QD5A 4M98A 2YUIA 3TNFA 2DCMA 5EXSA 3IRUA 3WB2A 2YVLA 4TMYA 3R5SA 5CTJA 5LQKA 4BVGA 3PCRB 5G02A 5COQA 5GGXA 2FWRA 1N2GA 3AEKB 1U80A 2OLKA 6REQB 2FMUA 3ZS8A 1ESNA 4ZDJA 4M0KA 3SIXA 4LKOA 3PLAE 5ISMA 5FBHA 2G76A 3ZJTA 3K0CC 4II3A 3UC5A 1L5HA 2X1HA 1JPJA 2LE0A 4GWKA 4BLTA 3FI0A 3ESDA 5KBYA 1PS0A 2BONA 1GARA 1HTTA 2J3JA 4M9SA 4R81A 2JGMA 5BN4B 5KX5B 2I29A 4URFA 4DZTA 3ZCPA 2AE2A 2MU1A 4R1OA 4U7DA 1R27A 2F67A 3D7SA 4JLJA 1BQEA 4A3SA 1HDZA 4NV3A 1B3BA 2HU7A 1YDFA 1U6KA 2GARA 3IA2A 3P2IA 2RDMA 2ZT7A 1C8BA 4H7KA 4QICA 1HORA 4P2GA 2NYRA 3WG9A 1PVVA 2C8VA 2IQ5A 2P4QA 5BSMA 3HEMA 4PNEA 1UIRA 5M04A 3HJNA 1OTYA 3UJBA 4PN3A 4IGAA 3SAJA 5I9NA 1YD7A 2BKVA 3IRVA 3Q7IA 2CHUA 3SQLA 4NPHA 1VYHA 2G9VA 1JG1A 2IXGA 2K2WA 4G56A 4U5QA 2WIJA 2XWPA 3E9CA 4E3ZA 1PI3A 3HFJA 1TMKA 2UUPA 5K3AA 3A6FA 1ESCA 3ZWMA 3IVRA 1EMDA 1H8HA 1BHSA 2VHZA 2VTVA 4LRUA 4QWWA 4J2OA 5FI1B 4EELA 2GXAA 3MW8A 3GLIA 3AP2A 3AF1A 4DLZA 4HS9A 1J0XO 4C5AA 4CV2A 4NU0A 2X2OA 5CM8B 1T3TA 2AK3A 5KNCH 4NE9A 1I3CA 2QX7A 3NWBA 3NJ8A 3HUUA 2WAXA 2VJKA 3HBJA 1XCBA 1A95A 2O7RA 4H60A 2PQ0A 3EARA 1ZJWA 3L7DA 1QVRA 2DKOA 3DZIA 5GVSA 5DIFA 2XYGA 2CEAA 3CJQA 3MLAA 1MA3A 2ZYIA 1CPYA 3OUTA 3R4CA 4OMCA 5JNTA 5JISA 1MLDA 3PXDA 4G8BA 3RASA 4CR6A 1E9RA 3QLVA 4TGLA 1YVRA 1Q15A 4NFYA 4OG2A 4MCAA 4IBOA 2ZP1A 1ZMRA 4G1EB 2VTEA 4YLYA 1Y98A 5BV8A 3IOEA 4UTRA 4B74A 1KO5A 2BM9A 2JIMA 3WLAA 3H9EO 4TWZA 4AMZA 2VNSA 4MR8A 3HYLA 4O5AA 3U5TA 4QL3A 3N8KA 4WNYA 1SCJA 1Z4LA 2ZJYA 5BR4A 1TRKA 4HWRA 3IR6A 4UHFA 4XR9A 1BH6A 1GSAA 4PSAA 1E1MA 1NJFA 2XZPA 1Z39A 2XMBA 1ZZEA 4GC5A 3GNQA 1RWBA 4OGLA 1KVUA 1VHTA 2B7LA 3ZZNA 2B8NA 4JBGA 2OPHA 1E18A 2FP3A 2EBUA 2WFMA 4LX0A 2IHBA 3AI3A 3K3PA 3T3IA 4EKEA 5D3QA 3IIIA 4BNFA 2POCA 4KAFA 2KBFA 1JFSA 5IABA 2C03A 4QYMA 1USGA 5EKSA 1BU5A 5FA6A 2QUKA 1Y48E 4N3BA 1II9A 1P2DA 2FSUA 4I4IA 5H3LA 1LBQA 4CMHA 5MN4A 2V97A 2IUSA 2VFAA 3FDZA 1IOVA 2BUCA 5ALNA 1P6UA 4YRKA 1JWLA 4JQOA 1DJLA 8LDHA 1XYGA 1TQ4A 3QMVA 4I3GA 4PFJA 2XDAA 3FGNA 4CU5A 1JFRA 1DTWB 2DFNA 3NDBB 2RGWA 2GYVA 2C1ZA 5T4BA 3SE7A 4CKBA 3ZIDA 4URWR 3DPSA 3WAGA 3EWAA 4XCXA 5JAHA 3WYDA 3LCUA 2WSBA 2P9GA 2G3YA 3L8HA 1T9GS 5EE3A 4WW0A 3CVUA 2WF5A 1T36B 2VZ9A 2ODPA 5K05A 2XVZA 2BEVB 2JEZA 1PS9A 1AURA 1PSZA 2X1MA 3V1MA 3L7OA 2GEDA 3PD0A 3WWEA 2B36A 3CF6R 3LTNC 3ZUPA 3VYSB 1NV8A 3UWOA 2BM0A 5HKKD 3CMCO 1E3EA 5H0IA 5EG5A 4BQPA 3HXLA 4TM7A 4RD2A 3OTQA 4YYZA 4E5UA 2G5PA 3DBRB 1Z8FA 5A05A 3DTVD 2OA0A 3D3JA 1RAAA 4KU4A 3B52X 4IXDA 1TTTA 4Y1FA 3NR2A 3WK5A 2A4MA 2PZEA 3AUFA 2BM8A 3D0KA 1ZINA 2VP0A 1CRPA 1W0KA 4BY9E 2DPXA 1EE1A 4D5EA 4JV5B 4RKYA 1COWA 3GJ8A 5C5DA 1ISGA 2IEGA 5BPHA 2IH2A 1GPYA 4JYBA 3L8YA 1USUA 3WIEA 2FSPA 2DYKA 3OIDA 5JASA 3TDNA 4GPEA 3BXEA 5CB4A 3EX7C 3OQHA 4MVJH 5D7BA 5AVZA 5A5VA 4HL6A 1E4OA 3KUDA 1QC5A 2MHCA 1GPKA 3LLSA 5A0TA 3QWBA 4YCJA 4CKEB 3AW9A 3L5OA 4WCFB 1JBQA 1BSVA 2X3UA 1XEWX 1AXRA 2DBVO 1EWVA 3H3XA 3LFTA 2IF2A 1H23A 4EY3A 2I6UA 3KT0A 3I53A 4BZZA 2C54A 3CUVA 3SZLA 1HL7A 1UZLA 3HO6A 5IJ0B 3V4ZA 1EK6A 2QY6A 4EMSA 1N5RA 1O4WA 5I7FA 3NS7A 4TRNA 3FTFA 4RENA 2JIPA 1ZU4A 2NQTA 3MINB 4I19A 3GFFA 4PHTA 4UE6A 4WFKA 3WI7A 3CLSC 1EWYA 2QKYA 1Y5NA 5FLEX 5IT0A 1HE8B 4P54A 2FFJA 3UHFA 2ZFUA 3JASB 1SKYE 2ZJ4A 4FWTA 3GIWA 4OK3A 1I36A 3R7SA 4YJ2A 1Y1PA 2VS1A 1UDXA 2R7MA 3R7BA 5U4XA 3M5WA 1SXJA 1H2EA 4AJ4A 3IQZA 2CYCA 3EGDB 1PG5A 1V96A 5EIOA 3WIUA 4DTCA 4LI3X 2EJTA 4RPIA 5EJIA 3RYFB 1I4OA 4CL8A 1A77A 4G0UA 4G26A 1GA6A 1P1CA 4C7VA 5C18A 4KQJA 5FTKA 3KEMA 4JBXA 1TCBA 4F71A 1KZHA 3WWOA 1JT2A 1OLSB 1MO3A 1P7CA 2XD4A 2AI3A 2X1VA 4I1VA 1NQWA 1NVAA 1DEOA 1NYTA 1PEDA 2C3MA 3I72A 1L3BA 3Q0TA 4FLMA 2L17A 2R6CA 3OMLA 1TGYA 4JGBA 1J20A 2JFZA 2W6ID 3GCXA 3MB5A 2C4KA 4LQCA 2V3CC 2V96A 4RVOA 5CYOA 4KR2A 1D6SA 3T3MB 3UGTA 1L2TA 2P67A 3RYIA 5K2OA 2JHCA 4B76A 2Q5CA 3H84A 3DHYA 3PP8A 3O0TA 3AF4A 1X86B 1GKIA 1Y81A 3MWDA 3NIGB 3SHFA 4KKVA 2VDWA 2ZVJA 3NM4A 4IO1A 2RH9B 3VYUB 4HB2A 4M6WB 3K1AB 2ZJ6A 1G6OA 1DIRA 3BMOB 3QVGB 1BJKA 1W36C 4H3VA 4HDQB 1NRJB 3ACDA 3HA7A 3LKVA 4V0MA 5T8KA 3TK1A 2QY9A 4MUJA 2J07A 1PFVA 4PLTA 4XFJA 1X38A 3UUEA 3CWQA 4XIIA 1HETA 4NFSA 1ZD9A 2DQYA 3GVXA 5CLIA 4B9EA 4KMSA 1G21B 4BGIA 4B8ZA 5LP6A 1VPLA 2E1RA 3ILXA 1CYDA 2A5GA 4K46A 4N4AA 5AP9A 3TNYA 1F7UA 4NJEA 2JA1A 2EF0A 1TEHA 2JB9A 3PNMA 4KRXA 3FBGA 1XRNA 2PZKA 2ZBPA 3GXOA 4YDQA 3ZDCA 2G9NA 1W6RA 3V5NA 4XR4A 5F1YA 4KREA 3HA3A 4C4XA 1UBTS 3AL3A 1JJ7A 3PNQA 3QF4A 1F3OA 1Q44A 1RZUA 1CNMA 2OBNA 3S44A 3DTVA 3BCUA 2JFGA 3RLFA 3S29A 1DWUA 1GUAA 1DKPA 2Q3LA 4MV4A 3R7LA 4HUQA 5CA1A 2B20A 3NANA 5IWAB 3AFOA 4A6DA 2C2OA 1D8AA 4DR5B 1JVNA 3AKYA 5A5FA 1DX4A 3OFKA 5BV0A 2E37A 1XZBA 3KVVA 3NUGA 1EP1B 3OA2A 2JCXA 3TXXA 3S2GA 5K6RA 3GGGA 3JQ8A 1BWSA 1YKSA 1U2TA 3KKKA 4DG5A 2GPYA 3W9YA 1BXGA 1KI6B 3HP7A 2FDRA 1YF3A 3OO0A 2Q45A 2HPAA 3HN6A 4YXWD 1Q3HA 4MWZA 3QELB 4MQFA 3A9SA 1TU3A 4LJAA 1BCRA 1VA4A 1JSZA 4LJ8A 4QOSA 1AT1A 1N0UA 1Z12A 2BBSA 3DT9A 3EPPA 2ZSAA 4ZHQB 5I5GA 3HVJA 5IC4A 3S40A