3THSA

Crystal structure of rat native liver glycine n-methyltransferase complexed with 5-methyltetrahydrofolate pentaglutamate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
283
Chain Sequence
b'VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine N-methyltransferase
publication title Differences in folate-protein interactions result in differing inhibition of native rat liver and recombinant glycine N-methyltransferase by 5-methyltetrahydrofolate.
pubmed doi rcsb
molecule tags Transferase/transferase inhibitor
total genus 90
structure length 283
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 3thsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3thsA02
3TR6A 3KPJA 3LBFA 3OE4A 3CJQA 4RSRA 2P3OA 1EAMA 2H1RA 2YTZA 3LDGA 3PVCA 4WXHA 3HVHA 3P9CA 8MHTA 5ICCA 3HVKA 4YV0A 3OPNA 1YF3A 5KS2A 2UYCA 3ID6C 3AXSA 3M6UA 1YUBA 4C04A 1INLA 3R0QA 3DLIA 4QVKA 1QAMA 2GS9A 5DM0A 4E2YA 4YUZA 3AY0A 4BLUA 1SUSA 5KYGA 1EG2A 4FT4A 1QAOA 3KPWA 3FPEA 4P58A 3FPGA 3REOA 2YQZA 5K0GA 3TLJA 3RW9A 4DZRA 5LQJA 3UJBA 3KR2A 3R3HA 4BP1A 5DX8A 4UOEA 3EVZA 3GNLA 3HNRA 3MGGA 5E1BA 4QTTB 5K0BA 2AOWA 2IDKA 5EEHA 5DXAA 5G02A 1EJ0A 5ICFA 1Y8CA 3M6XA 2HR1A 3MCTA 2HWKA 4E31A 3SSMA 4QTUB 5E9JA 1P1BA 4PYIA 2AVNA 2IP2A 1WXXA 3G8BA 2IGTA 1B42A 2OZVA 3LSTA 5GIPE 4RTJA 5DX1A 3C6MA 4HGZA 4C05A 3LKZA 1SQGA 3BKXA 4LG1A 1L9KA 1TPYA 4R6WA 4PONA 5E9WA 2BH2A 3EMDA 2BR3A 3HA5A 3ELWA 3TM5A 3NVMB 1NW6A 2UZ4A 2XYVA 4IWNA 4KWCA 4YMHA 2ONZA 1R8YA 2I9KA 2JJQA 2FHPA 1RJFA 4GUAA 3BGDA 4KDRA 3HVJA 1KPHA 3FUVA 3HVIA 1PRYA 3C3PA 1SG9A 3SGLA 2P1DA 3NDIA 2E5WA 2A14A 3QOWA 4U7TB 4DQ0A 3A4TA 2IIPA 3IEIA 2CMGA 2H11A 1RI4A 3B89A 4GEKA 4R8SA 4LWOA 5DSXA 1P39A 4OA8A 3R6TA 4A6EA 5K09A 1NW3A 2VZ9A 4PYKA 1AF7A 4ER5A 10MHA 4K6MA 4GOOD 5KQRA 3FTFA 3BUSA 4BLVA 4M7RA 3LDFA 5HZMA 3A7DA 3VSEA 3JWGA 3PB3A 1WY7A 3HCDA 2XYRA 5DTMA 4HRAA 3G88A 5EZSA 1X1CA 3I53A 4QDJA 4XUCA 2V7EA 5DTRA 4MHTA 3HTXA 1VPTA 3FYDA 2YUIA 1UIRA 1O54A 3B5IA 3EGEA 3OFJA 4OQEA 1KP9A 4MTLA 1NBHA 2ZBQA 1RJEA 5ICEA 2UYOA 3M6WA 5GM1A 4AZSA 2ZZMA 2NXNA 2CKDA 4LWPA 3VC2A 2CMHA 2AOUB 2P7IA 5LR6A 2ZTHA 2R6ZA 2I6GA 4F85A 1DCTA 2PX8A 2ZW9A 3QV2A 4V0QA 5DSTA 2IFTA 1R8XA 1M6EX 2AOTA 1IM8A 2DULA 5BP7A 1RI2A 3KQMA 2B78A 3KQTA 1KYZA 4EKIA 5K03A 3A7EA 1ZGAA 5GINE 5CD1A 3HA3A 1JQDA 3ERCA 4PYJA 2XBMA 1IY9A 5GM2A 1D2GA 2ZIFA 3OU2A 2ZBRA 2WK1A 4PNEA 4ER3A 3HA7A 2AN3A 5K0NA 1R74A 1HNNA 1VP9A 3E8SA 3BWYA 3LKDA 3NW9A 4Y30A 4C08A 4AUKA 4YUYA 3KPYA 4X61A 3CKKA 2IDJA 4M38A 3EGVA 3GU3A 2OB1A 4DF3A 1X19A 2I7CA 2ADMA 3G5LA 3EVFA 3FPJA 3KR0A 1G60A 2JHCA 2EJUA 3HCEA 5KVAA 5EIFA 3UFBA 2BR4A 3THRA 3I5UA 3PFGA 5DRYA 3HCBA 4HTFA 4YMGA 4CWAA 4PGGA 2ERCA 3DMGA 3JWJA 2GPYA 4JXJA 1AV6A 3LBYA 3U81A 3KQVA 2AVDA 3EEYA 4E33A 2XVAA 3E05A 2ESRA 4FSXA 4KDCA 2WA2A 4RVGA 2NP7A 3ANXA 3K0BA 5CVEA 3CBGA 3FPFA 1ORHA 5CCXA 3GIWA 3NJRA 5U4XA 3GRVA 1BOOA 2Q41A 1Q0SA 4E32A 5FUBA 2FYTA 3F4KA 4PIPA 2C7PA 3TQSA 3TFWA 3TM4A 4CKCA 3HCAA 4DMGA 4GF5A 1KPGA 1ORIA 1G55A 1YB2A 2OB2A 5CM2Z 5FHQA 5FA5A 1N2XA 5T6BA 1X1BA 4FT2A 4DCMA 3DXXA 2QM3A 3IHTA 3UJ7A 4GOLD 2IH2A 4RYLA 3V8VA 2C7RA 3GO4A 4P7FA 3UZUA 2LD4A 3KQSA 4EMSA 1KIAA 3M33A 3TPZA 3FUUA 1RI1A 3FRHA 5D1NA 4HC4A 4GC5A 5C0OE 3MB5A 1SKMA 2QYOA 1HMYA 3KQYA 3BGIA 3MTIA 5JUWA 2PVCA 3E7PA 5EVJA 4RVDA 4P7GA 2O05A 4RTLA 3FUWA 4CXMA 3MERA 4C06A 4QQNA 2OY0A 3MCZA 1NW5A 3SM3A 4ZTBA 4POOA 3DP7A 2PWYA 1XCLA 3DOUA 4FZVA 4HSGA 4X1OA 2YX1A 3L8DA 5DTQA 1VP3A 5EEGA 1BKYA 4GC9A 3S68A 2PSSA 3M6VA 3KKZA 1WZNA 2ZBPA 3DXYA 5LSAA 1ZHFA 4GOMD 2B25A 4PIMA 5LQCA 2UYQA 1JSZA 4YUXA 3SSOA 5DXJA 5DT2A 2ZLBA 3PTAA 5EMMA 2QRVB 1Z3CA 3GCZA 3VC1A 4E2XA 2IBTA 2PT9A 1L3BA 5FULA 1I9GA 2I62A 2VDWA 3GRRA 4H0NA 3P9NA 4FP9A 4M37A 1MJFA 4OBWA 5F2KA 2ZSUA 5FWAA 4BY9E 1F3LA 4MIKA 3HCFA 3AWIA 1BHJA 1TW3A 3C6KA 3Q87B 2C7OA 3O7WA 1R18A 3FUXA 1EJ6A 2YVLA 3G89A 3BKWA 3CJRA 2P3QA 3BZBA 2QY6A 2PJDA 3B3JA 4BLWA 5HIIA 2F8LA 2FK7A 1SQFA 3TOSA 2OPBA 3BWCA 4U7PB 1VLMA 3HCCA 5IKMA 3G8AA 4XUDA 3EVDA 3MTEA 4KIGA 1JSXA 3CGGA 3LECA 3I9FA 3QOXA 3ME5A 5EMJA 1JTEA 3IV6A 2PBFA 5DWQA 1JG3A 4KVZA 4RWZA 5IH3A 4ER7A 3DLCA 2G1PA 4PYMA 1NV9A 2VS1A 4RTPA 3OFKA 5K8VA 2P40A 5E2AA 5M5BA 3C3YA 3LGAA 2BM8A 1JG4A 3NWEA 5HFJA 5KQSA 2IH4A 2G72A 3B7PA 2R3SA 3DMFA 4E2WA 2JHPA 5HOQA 2NP6A 5LQNA 3FTCA 2PXCA 2UYHA 3KPUA 5EKUA 4XCXA 1VIDA 3PS9A 5HIKA 3DULA 3KR1A 4PYOA 4CTJA 2KW5A 3ORHA 3EMBA 5EG5A 4NECA 5DM1A 2ORED 3SXJA 3MQ2A 3UBTA 4GBED 4C03A 1O9HA 3DMHA 3LL7A 4MQ4A 3G2QA 1M0EA 7MHTA 3PX3A 1L3IA 5GP1A 3DXZA 3KQPA 4GOND 2PLWA 1FPQA 3K6RA 1L3CA 2FRXA 2ZZNA 2BZGA 4PYQA 5EIWA 1BC5A 2C7QA 1TW2A 1XDUA 3SR4A 4HGYA 3UJAA 1ZG3A 2HMYB 2NXCA 5ERGB 4DCGA 4YUWA 3DUWA 3EVCA 1XVAA 3LX6A 5DRTA 3NDJA 3RODA 1H1DA 1UFKA 1WG8A 3SSNA 1ZKDA 5P8WA 3MAGA 4IV8A 3GRZA 1NT2A 4PCAA 4OBXA 2GLUA 2NYUA 5FQNA 4C07A 4X41A 5T67A 4PINA 2QE6A 3SMQA 4RTRA 1I1NA 3EVGA 4M36A 4ISCA 2NXEA 2VDUE 2PGXA 3BWBA 1KHHA 5CCBA 1WS6A 3P97A 2VP3A 1M6YA 4HH4A 5HIJA 4E70A 4DA4A 2PX5A 2Z6UA 2IBSA 4ATNA 2NXJA 3G7UA 4LECA 4C4AA 4ER0A 5C9ZA 4RTMA 1YFJA 4RTKA 2GAFA 2OO3A 3HM2A 3OU7A 5EMKA 3NMUF 5LQKA 1NBIA 5ICGA 1AQIA 1RI3A 1XTPA 2PV0A 2ONYA 1KXZA 3GJYA 1QYRA 3GRYA 3GXOA 3I58A 4R05A 5CVVA 5HIMA 3V97A 5HILA 2GB4A 3NVKI 3FZGA 3VYWA 5CVUA 4F86A 4MWZA 1V39A 2IPXA 4OX9Y 3UJCA 1RJGA 4PGHA 1RI5A 2JHAA 1G6Q1 1KYWA 5CIYA 2G71A 3FUTA 5DPMA 4OA5A 3R24A 2P35A 4FR0A 3G2PA 2BM9A 2OBFA 4QPPA 4KW7A 5DM2A 1P1CA 3ELYA 1KR5A 4O29A 3P2EA 2AZTA 3UJ6A 2P8JA 3AXTA 1N7IA 1NV8A 5K01A 4QDKA 3DTNA 2B3TA 5HEKA 3D2LA 2XYQA 2PWPA 1SVUA 3EVEA 3TMAA 2PXAA 3PFHA 4P7JA 2HNKA 3KQQA 4RVFA 1XDZA 1EQAA 4FS8A 1RJDA 3BGVA 3M70A 3R9XB 2CWWA 5EZQA 2YXDA 1FP2A 2EG5A 3A27A 4DKJA 5EC8A 1F38A 2FK8A 5GOZA 4CKBA 2Z6QA 3T7SA 1T43A 4FGZA 4EK9A 1AQJA 1D2CA 1JTFA 3JWIA 5E1OA 5DLYA 4QVGA 3HP7A 4Z2YA 4AZWA 1JQEA 1R00A 4R6XA 3T7RA 4YV1A 5DX0A 4FSDA 3MHTA 2AN5A 4R8RA 2AN4A 2OYRA 2PX4A 3IYLW 2YXEA 5DM4A 5LQUA 3OCJA 3TKYA 5FQOA 2ZZKA 3UA4A 3LHDA 5F2OA 1R6AA 5JR3A 1D2HA 2EX4A 2PT6A 5LQAA 5BW4A 1QANA 2FCAA 3P2KA 3TKAA 4RX1A 4AZVA 3DH0A 1JQ3A 3NTVA 3P9IA 1MHTA 1QAQA 1G8AA 1YFLA 5EPEA 2O57A 4WVLA 4CTKA 4YV2A 2FPOA 1G8SA 3EGIA 3AJDA 5MHTA 5CVJA 3KPVA 2JG3A 3C0KA 3SX0A 4OQDA 4E30A 3OZSA 2AOTB 3G2MA 2ZWVA 2PY6A 5E8JA 5K0EA 2OKCA 3FYCA 2NNWB 3CC8A 3KHKA 3CJTA 3UA3A 4KIFA 1JG2A 5K0JA 5E8RA 2O07A 4G56A 5CVDA 5E1MA 5FWDA 1G38A 5D1HA 3BT7A 2JH9A 2P41A 2PXXA 2EFJA 3SVZA 1FBNA 3E23A 3LPMA 4RTNA 4CKEA 1JG1A 3GWZA 4RVHA 5K0CA 9MHTA 5K0FA 2ZIEA 1XXLA 3CCFA 3H2BA 4GQBA 5FCDA 4RTSA 2Y1XA 3X0DA 4ER6A 3A25A 3G5TA 2ZULA 1XCJA 3P9KA 2G70A 1NE2A 5BXYA 1L1EA 5E9QA 1FJXA 3I64A 2CL5A 3UJ9A 3WSTA 2AS0A 3NWBA 2K4MA 2ZFUA 2YXLA 3OE5A 3UWPA 4YUVA 2JH8A 4F84A 1U2ZA 4PWYA 3P2IA 4QPNA 1OR8A 5EOVA 3GRUA 5EMLA 3FTEA 3PLAE 3LDUA 5C1IA 4RTQA 2PX2A 3T7TA 5LQRA 4XUEA 5CUQA 2GA9A 3FTDA 1VQ1A 1IXKA 2WA1A 2G8NA 1VBFA 4X63A 4EVIA 2AOVA 3OZTA 4HTFB 5FHRA 4B17A 3ER9A 3Q7EA 1VL5A 2DPMA 1NW7A 4X60A 2ZWAA 2QRVA 2ZVJA 3KQWA 4A6DA 4KRGA 3GDHA 3LCCA 2HTEA 4PYNA 4EQZA 2HV9A 3PT9A 3OU6A 3ELDA 3BWMA 4L7VA 5GWXA 2PKWA 1QZZA 4PYLA 5K0LA 5EHGA 3B3GA 3GGDA 2AR0A 5K05A 4PCLA 4P7KA 3LCUA 1WXWA 2ZCJA 5EQJB 1DUSA 1FP1D 3UJDA 5FA8A 3KU1A 4EKGA 5FADA 1ZQ9A 5F2NA 2N47A 1N7JA 1NKVA 3TRKA 3ER8A 2P7HA 1SUIA 3FPHA 3UJ8A 2EJTA 2H00A 1YZ3A 4RV9A 2AOXA 3THSA 1UWVA 2B9EA 4QQKA 5EHIA 5GIOE 3EEOA 1YZHA 5E1DA 2O0LA 3LCVB 3G2OA 2BR5A 3CVOA 5FTWA 4IKPA 1ZGJA 3DR5A 5EKXA 3A26A 3B3FA 3OZRA 3O4FA 2AOUA 2B2CA 5T64A 2YR0A 2O06A 3ELUA 2P3LA 2Z6AA 1XJ5A 1P91A 3BXOA 1I4WA 1PJZA 3EPPA 2OXTA 4AX8A 1JR4A 1X1AA 1Q0TA 3RIEA 1KPIA 2V74B 5BW5A 1DL5A 4DM3A 3M4XA 1NW8A 1XDSA 2XVMA 3P71T 5B1SA 3EVBA 2Y1WA 4E2ZA 3T0IA 4Y2HA 5E2BA 3HEMA 4RTOA 2GH1A 3P8ZA 5H02A 2IH5A 3O31A 1X1DA 2ZIGA 3KQOA 4IV0A 1O9GA 3JWHA 3KR9A 4BP3A 3PX2A 1EIZA 4V0RA 1VE3A 2VDVE 4HG2A 4AZTA 3EVAA 5EGSA 3FRIA
chains in the Genus database with same CATH superfamily
5J5AA 1GKIA 3QLTA 4QUGA 5SZKB 3U26A 1E32A 1UDWA 2R96A 3EJ6A 5JZOA 4RIEA 1NDUA 3WHPA 1SA0A 2QJRA 2VF8A 3B1VA 5AKJA 1IHXA 3WFIA 4BFCA 5A4KA 2FKNA 2HIMA 4CQLB 3X2EA 1EWQA 4I50A 3RF7A 2WVGA 4Q7EA 2W2LD 4IJKA 4BLUA 3SZ3A 1DQRA 4G5RA 1OH8A 1QGYA 3PR1A 5HGJA 1E99A 1FOEB 1M34E 4G6ZA 2IK8A 2WJJA 4L28A 4UVGA 3KR2A 1DQPA 1SRRA 2UZ3A 1RXWA 2PU7A 3HU1A 1D4ZA 1V7CA 2HMAA 4B9EA 1UXHA 4DREA 3UH1A 4DYDA 2AFVA 4KXQA 2J09A 3KNZA 1AOXA 5JY1A 3TEJA 1OLOA 2AMLA 2J08A 3HKCA 2WNSA 5KYXA 1L4MA 3FSGA 1T9HA 5E9JA 1KIMA 1PGNA 2ZJZA 2B4QA 2PH7A 1M6VA 4EQ6A 2QNBA 1IBSA 3E9EA 4GMHA 4LRTB 4LRSB 5GMOA 2FMUA 3DTVA 1QF6A 1HG0A 4C05A 4CKWA 1DOAA 4I1IA 4KHPB 1JMVA 2P2NA 3DOFA 4MQMA 5A9RA 3S8MA 4KPUA 4UJ3A 1CNMA 2ZIAA 3EMDA 1POXA 3M9XA 2WU4A 4BFYA 3ESQA 3EAGA 3LWBA 4LNAA 2B92A 2ONZA 5C8YF 3USES 3MIIA 4MOWA 2WMYA 3WYBA 3QZUA 3QBVA 3NTQA 1QKIA 5ALNA 1D09A 2Y6VA 4TMVA 4YALA 1XZCA 2P27A 4GZ6A 5B7NA 2I4MA 1ZM7A 5IJWA 4X65B 1G2IA 3PPVA 4GWKA 4O4JB 3QRWA 1JKJB 2FX3A 2YIVX 3B89A 5JSZA 1TTPB 3A3PA 3G79A 3P9SA 5CB4A 1MENA 5K09A 1KZYC 2C82A 5JO9A 1ZJYA 4JQOA 1NOKA 2IYVA 4K9OA 3EIXA 4NV3A 1Z7EA 3WYNA 3JPYA 4RVNA 1DBVO 2GO7A 5EERA 3H17A 5FPPA 1J2EA 1I51A 1S7GA 4YLEA 2XYRA 3K6SB 4WLUA 1CRLA 3G88A 5E7QA 5BYBA 1ACMA 5M04A 2JJ2D 5EJAA 4KITB 4MHTA 4LV6A 5FV4A 3VFDA 1VMEA 1IUOA 1KAOA 1SHKA 1Q5PA 3OJLA 4IIFA 3IILA 4CQMD 3A9VA 3BMOB 4C43A 2ZBQA 1RJEA 3OJ0A 3BTVA 3M81A 4MV3A 4JL8A 4UE2A 4UREA 2RH9B 3DCNA 4EA9A 1SU7A 1XL0A 3KHTA 5ADVA 3QWHA 5A04A 1Y9AA 2ZTVA 2VXBA 3U7GA 5FX2A 3K70C 2YVAA 2D5IA 1WZIA 2ZB2A 4QUEA 1X7XA 1ODJA 4NE7A 2NMVA 3G0GA 2QI9F 2OD7A 4QFBA 3GLHB 3I34X 4RD6A 5EXPA 5AH0A 4D6PA 1ZD9A 1CT9A 3FGOA 4ZTZB 2ZR7A 4OLBA 1JQDA 2H2WA 2JFPA 2AXPA 1T5BA 4ENRA 4TYWA 1T8PA 1G17A 3O38A 2RBKA 4MZXA 4UFPA 2XUDA 3C8UA 1E3SA 1N5MA 2ZBRA 1YZNA 3DF9A 3ETEA 2ASEA 3I9KA 4WQMA 1V9SA 4Z0PA 5I8WA 1OV4A 1AHIA 1W4AA 3HA7A 1IOZA 4NMLA 3RKRA 3C70A 2J5BA 2W2LA 5J40A 1XKQA 1Z7BA 1CUWA 3VVCA 3TECE 5HQJA 1R8QA 2DPYA 1ODKA 1S1MA 1N2IA 3OH8A 1YRBA 3HADA 3U4DA 2DLNA 2LCFA 4S1OA 4Y1FA 3WGUA 3QPCA 1E2FA 5L6MB 4X61A 4E4YA 1AM4D 1TO6A 3VRHA 1WDTA 2NVOA 4QPJC 4I50B 1DU4A 1TJ5A 4ZU3A 1SIWA 1GT91 2I6FA 3C4QA 4Q66C 2GK7A 3PWZA 3RANA 2ZETA 2DHDA 5EXSA 1PJ4A 3VPDA 4OIFA 3THRA 2Y76A 3A1DA 2RKBA 2V6BA 2A5DA 1DIOB 3DMNA 5BSFA 1M2GA 2CEKA 3Q3HA 2ZJ5A 2CXRA 4NMHA 2BSQA 4IXTA 4KR2A 3ZD7A 4OB8A 1T9AA 2FB9A 1T3LA 1XA4A 3SN6A 3RREA 1FFHA 5AI4A 3E5RA 2G63A 2ZDGA 2G06A 1YS2X 1D9ZA 3QXGA 3CZRA 1X8XA 1KKMA 1U8YA 4TXHA 1P0CA 3KK0A 2FSFA 2H4YA 4MVJA 5JQGA 1SQ5A 1YH3A 3TXAA 4WZAE 4YRAA 1M6VB 1KEUA 5C8YA 4U6SA 2PUCA 4DDHA 1N7GA 3FSJX 1HFWA 3DTVB 4IUCS 4RETA 1FTGA 2PL1A 2TMYA 4B4OA 4CKWB 3KQUA 1NLUA 3GX1A 2IV3A 4QZVA 4DIKA 1JPVA 1YKGA 3MRSA 3IE0A 3VKVA 4X97A 1GCGA 1II8A 1L4YA 4I1RA 2JI6A 1Q7EA 3ZE7A 4RHYA 1P7CA 3WLOA 3BREA 3NCTA 1NJ6A 3C6XA 2PUWA 4DLAA 1YQWA 4ZVQA 4FDVA 4EMSA 2N75A 5K2OA 3AF2A 1O6BA 3FUUA 4MUBA 4R81A 4CKEB 3NBAA 3NHMA 2H6EA 4JU9A 4WRRA 2QYOA 4P38A 2DR0A 3KV1A 2D0IA 4H6WA 4DANA 3LFHA 5J9FA 1OB5A 2O05A 3SJ7A 4QQRA 1KK0A 1MC8A 1MPXA 4MUXA 5DYGA 2Z4RA 1R0WA 2EBWA 2WU3A 4QQNA 3MCZA 4WECA 2JJ2A 3JQRA 4NP6A 1YDEA 1YOVA 3ZOZA 3QFHA 5DTQA 1T2VA 2ZQ5A 4WASA 4QLBA 1NUPA 3V9PA 1Y1RA 3CISA 3P20A 7YASA 1ZHFA 2FZWA 1JDBB 3BJIC 1AZWA 3FCXA 1E8MA 1SXHA 4Q4DA 1NSYA 3EXG1 3LX4A 1KO5A 4O2BF 3SSOA 3TN7A 1YFKA 4DM4A 1Y4UA 4GPAA 5LKRA 1DXHA 9ATCA 1T1GA 1HETA 1TAHA 1FDOA 3LY7A 2UZ1B 1MJFA 3L0CA 4KLRA 4BY9E 2G5CA 4RVOA 2RCNA 3H9CA 4JBXA 1ODTC 1HE1C 4UARA 2ERYA 4YCMA 3G89A 1K75A 4AJIA 1CJSA 3CJRA 4NXNB 4KPEC 1X7XB 4JITA 1LH0A 3W5UA 4DXHA 5A6VA 4HAUA 4EGCB 5BV1A 1VLVA 3E0QA 3KZXA 3IKMB 3QYAA 1FMTA 1UDAA 1K5DA 1UR5A 4Y9TA 4DGQA 4JI7B 4ALIA 4ROSA 3DVRX 1FRZA 1ZD8A 3I9FA 3IV6A 1GCOA 3V00A 4TOIA 1I3CA 3KSZO 1Y8AA 2YFKA 4QC2A 2CNDA 1WETA 3W2EA 1RAAA 3D3WB 3MLBA 1NRWA 4PZAA 1ZUHA 4EHKA 1QE3A 4B6EA 1MRZA 2F67A 3BZUA 3SQLA 1D1PA 2DUJA 4R5HA 4BAUA 3FDIA 1DIAA 4PNZA 4JLMA 4BNLA 2CW5A 4GSLA 3HZZA 3K5HA 5KREA 1F2DA 1IEXA 3S2FA 3UK1A 4GX1A 2ARKA 3CX6A 5COAA 5IBQA 4IOMA 1NVFA 2WP8J 3FB4A 1C3XA 2I54A 3UMJA 2IHBA 3ONFA 4JFRA 2WWGA 5I47A 1TYZA 1GZ4A 1GM5A 3DDWA 3KSDO 3N8GA 3FVVA 1P75A 4MEAA 2C7QA 2VHZA 1ZSNA 4OP2A 1FXUA 2HMYB 4NMXB 3RHSA 3DUWA 4PO3X 4Q00A 1T36A 1JWBB 3ONEA 4KGXA 4BVKA 1JJIA 1J8VA 3UG6A 3OM9A 5I4BA 5JDIC 5C8YB 1RD4A 4TYPA 2PSEA 2DR3A 1ZJ5A 1OBFO 3ZDQA 5BV8A 2ZJ0A 4X41A 1ZMOA 2JZNA 4EG1A 4FE4A 4N03A 1M1UA 2GAOA 2DBYA 3BORA 4ISCA 4DLXA 1RRPA 4DBLC 2HJGA 4WCFA 2D0PB 1P9LA 1V1RA 2C9YA 4F4FA 1S7CA 4WIAA 1YDGA 1SIOA 4XDHA 2GF0A 1K89A 4KFTA 4CLDA 3MJDA 1PT6A 4ZGBA 2NXJA 1SBTA 2CB9A 2QRKA 5DIZA 521PA 2ZE8A 5C9ZA 3NNDA 5E4YA 5BR4A 4A1OA 3MD0A 2FQWA 3A2KA 1B8NA 1C3EA 3NMUF 2OFFA 2XOEA 1G98A 3O8QA 3PJRA 5EJEA 1NBOA 4HGNA 3V97A 4QXAA 4FE3A 4NH4A 3EW9A 1CFJA 4IZ6A 3HWWA 2WJIA 4NZOA 2ZAMA 4EHIA 2H4JA 4X94A 4IXNA 2OORC 3PK0A 1RE1A 1U9IC 2FMHA 1A2KC 4UTVA 3TDKA 3FUTA 1YOVB 3JAKA 1DAKA 2Z1MA 2WUDA 2XCIA 3JPWA 1XMXA 3R0IA 4Q82A 2W2QA 3UAVA 2OBFA 1XNGA 3F49S 4YEDA 4CQMB 3IVXA 1OASA 3Q9SA 4JNKA 2V7XA 3F46A 4IVNA 5TMPA 2JAHA 2NIPA 2GEUA 2P9HA 2YV1A 2FPKA 3AKZA 3S55A 3EHDA 1UBMS 2Z8ZA 3ECAA 4B79A 4CMIA 5CYGA 4OSOA 2GASA 4DPLA 1WP9A 3ROXA 2H07A 3Q1LA 3OZFA 3KQQA 2IPLA 2QL9A 1XDZA 3QGMA 1DO8A 2I7DA 2PG3A 3P0EA 3E7XA 4RQTA 1OWLA 2CHVA 2CD7A 1HT2E 1T5LA 1T9BA 2ORVA 2X5NA 1P7PA 2E4VA 4IIVA 4PRYA 2EG5A 3A27A 5LQNA 3OESA 5DN9A 3O2NA 2VRWA 4YJ2F 2Z6QA 3AEXA 4Y1GA 1CUUA 3WWCA 2FEPA 1NBMD 1E20A 3FVQA 3RU3A 1OZHA 5JMTA 3GMTA 1JQEA 3M6AA 4P8RA 3T7RA 2IITA 3LC2O 4QQ8A 3O3MB 4AWXA 3IP3A 2QQEA 3QLUC 2JD2A 3HO1A 1F9AA 1U0NA 1IB6A 5A03A 1FXSA 1PNTA 2YASA 3FCEA 2WUWE 2HSZA 3VOTA 1QGUA 3OF3A 1QQ7A 2CBXA 1D2HA 1GO2A 4M49A 5AWFC 1E1MA 3I1JA 3V4SA 1U99A 5KJCA 3TKAA 1N2CA 1L4NA 1ZN9A 2ONCA 5G0WA 3FF4A 3WNQA 1I7NA 2ZROA 4TM8A 5LZ9A 1VE7A 1C1DB 3UXHA 1RXYA 3WJAA 2GX6A 2JGAA 2CJWA 4A10A 3L4JA 5G4LA 3UCFA 5AM3A 4K2HA 4PTLA 2BHRA 3IAEA 3O8BA 2PUGA 3M4NA 2RE8A 4MSUA 4OHYA 3OZSA 3T12A 2AOTB 3UKDA 1DXYA 3GDWA 5BT9A 3N07A 3LT2A 2OKCA 4IS2A 3TO5A 3RUEA 3UA3A 2QUKA 2JIDA 3F0TA 1S3GA 2LIPA 2Q62A 5FWDA 5K3SA 3S3TA 2JH9A 3DUFA 3QJ5A 4FX2A 5IC6A 1QORA 2ATIA 1DRUA 3CUVA 4US2R 3ZLVA 1T8RA 3DO5A 1JGTA 1P4SA 4FNOA 2WAOA 3WTBA 4QGAA 4Y2JA 1DBPA 4DSAA 1UQUA 4F8YA 5CMLA 1YE3A 2Q2QA 1VI5A 2YV2A 3H5VA 3KAPA 3OX4A 1NE2A 3Q6MA 4M0CA 5JV5A 1T36B 2CSXA 2WWFA 3RWBA 4U3JA 1WXEA 4QJBA 3FPCA 2A3NA 1X39A 3L4BC 2OWDA 5SICE 3EA5A 2AB0A 4QPNA 2XEXA 2ZPTX 2PO5A 5C1IA 5MN5A 1E3QA 1ENZA 4KO4S 1L7XA 4LOKA 3IR5A 4Q93A 2RHWA 4X8MA 2GD1O 3E61A 4HHEA 3H0CA 3R4VA 2I2BA 2AOVA 2BJWA 3KHUA 4WCFB 4G0QA 2HSEA 3OIUA 5TY0A 1VL5A 2IPNA 4KSCA 3RK1A 3GYBA 4HX9A 2QMUA 3N39C 4PE5B 1R5OA 5B4UA 4N5MA 1UXJA 1N2BA 4KP7A 4GGOA 4D8TA 2PEZA 4MLZA 3BWMA 4INZA 2VWHA 4AMYA 3HPQA 4LV5B 4L7VA 5KJ1A 3RT1A 1S2NA 3GH3A 3FMGA 4Z1OA 3PR2B 3EXHC 5K0LA 3HYNA 4Y2PA 2IV2X 1NMEA 2CDRA 2WBLC 4O2BB 4DYHA 5K05A 3WIOA 3D6JA 2Q6OA 1WW2A 5MFZA 3MT7A 1ADYA 3A1WA 5IT4A 4LOHA 3JAKB 4FHGA 4M7WA 4ND8A 2N47A 4EUKA 4KLAA 5IDYA 5HQTA 2P7HA 3B6MA 4L76A 4COOA 1UKZA 2Y4OA 2JJ1D 3GT0A 3HACA 3ISTA 4YACA 4BMNA 4KOAA 5JXIA 1GG9A 1HRDA 2VBCA 5GIOE 4P0QB 2NW6A 3W8FA 3R3ZA 4LE2A 2XODA 5HK8A 3PIRA 4Y6SA 2I5PO 3GH1A 4MVJM 5FD8A 2QS9A 3TQFA 4BE4A 3HB4X 4CMIB 2AKYA 3DHWC 5CFQA 4UUPA 4F2WA 4NVRA 1NBMA 1E7QA 4PC3A 4BVLA 3WC4A 1BWSA 5K3OA 2WQZA 1P8JA 5LC1A 3PC4A 1TECE 2HHCA 2NV2B 4UHJA 4MJLA 3FPKA 1I4WA 1I10A 4QX6A 2C2OA 2J0UB 1EQ2A 3EIFA 1T5HX 3LXRA 1JHVA 4JVNA 4JR0A 1MX3A 3THOA 4J0QA 4LJKA 2ZRAA 3PE3A 4M98A 5FIUA 5FTKA 1FQWA 4J9UE 1K8ZB 5KAMA 4DLSA 4L22A 4O4HF 1OX6A 4JR1A 4BYMA 2XNDD 1YDMA 3B52X 3SC6A 5D7NA 1EIZA 4PG8A 3SICE 2OE2A 4MR9A 1QGUB 5CEFA 3R8XA 4NQZA 1SQ6A 3KPJA 1KL7A 3BZWA 4HN9A 3L82B 2HLDD 5L3RA 3FDFA 6YASA 1MB4A 1Y3CE 1UDRA 1ZGGA 1IWPB 2YTZA 5FJIA 4JC4A 4F4JA 3AVYA 1GTMA 4LK2A 1CVLA 3HUDA 4DJEC 2O48X 2YHUA 3PQ3A 3PFFA 4KBFA 4WHMA 3UT5A 1Q84A 1F8GA 1Z6XA 1TM3E 3K92A 3NB0A 1Y9JA 3DT6A 2PRJA 3PBKA 1AURA 1JU3A 1E2IA 1SVKA 4KGVA 4WEQA 4YN3A 3SZRA 1EP1B 3EARA 1NG1A 3QUQA 3SXPA 4QU9A 1AQUA 2C59A 3TX2A 4DL9A 4YQFA 4CMCA 1I7SB 1A5BB 3AUJB 3DUFB 4BEVA 3M4JA 4J2HA 3GNLA 4FZRA 3TE6A 1JH9A 2OBBA 3OJEA 2VPTA 2W6NA 4IY1A 5ICFA 4D4LA 1BEUB 1R6VA 4RSHA 5KB3A 4R01A 1X3SA 3W5DA 2D5BA 3IPLA 2BH9A 1V3QE 3DZKA 1RP7A 1TYAE 5TQ2B 2YWBA 1LX7A 4GMGA 2OZVA 4EA6A 1YIAA 3GFPA 1TYDE 3AB7A 2YWFA 3BJRA 3C6MA 5FOTA 1JR3D 3LAWA 4KQ9A 4KN5A 4NI5A 2J41A 5B37A 1XZFA 4QXRA 5EUBA 4EP1A 3NVMB 1HYGA 2OQIA 2XUAA 2JJQA 5AVKA 4GUAA 3QV1A 3BMCA 3K96A 2BGMA 2ODEA 4MULA 1P5HA 4WXEA 4Z8YA 4WBXC 1FMFA 1GA6A 2PH1A 4S2EA 1YASA 5IMBA 1Z47A 5CH8A 2AC7A 4YYZA 4MUAA 1LDGA 5CJ2A 2COKA 3AI7A 3RM3A 2R6R1 4AW9A 2XNHA 4K8RB 2IYTA 1T25A 5H5JA 4CIWA 2A5YB 1RQRA 2B98A 4HMOA 1V16A 1FYXA 3Q7RA 1SKBA 4W6ZA 1KYTA 4HS9A 3IV9A 4KMOA 2EWMA 2WOJA 4L51A 3AW9A 4QRDA 5DLEA 3N2LA 2RHRA 4ND8B 3TLMA 1G59A 1Y37A 3L1JA 2PJRA 4BECA 1BMDA 3I53A 1AJEA 4YJ2B 2AJLI 4FHCA 3AQ4A 2NTNA 2ZWOA 2ANCA 4MVJH 3AVVA 1MPTA 2ZUVA 3DDNA 5CK5A 5FUQA 2Z2ZA 2XEDA 3GVXA 4J0EA 1W49A 1DAFA 3EIWA 3QUBA 3FWKA 2G9RA 4AZSA 2B4KA 5HKLA 1PFKA 2HSGA 2A5FA 3WGVA 3A2NA 1YC2A 3AGPA 3PYXA 4O4HA 4A92A 4HNUA 3UF0A 5REQA 3ASVA 4WZBE 2ACEA 2C1XA 3DAYA 4V0QA 3NOQA 1NBEA 1V9LA 3CT4A 2CMKA 2R47A 4S35A 1QSGA 3PEFA 2XKJE 4NPAA 4XYMA 5HXAA 1CLUA 1VE5A 1YZLA 3MRTA 1H8ED 4N39A 2SKEA 4EKIA 5GZ1A 3DL2A 1EVKA 3BCSA 4FFVA 1C29B 2ZDHA 2HLDA 1TVKB 4GKVA 4YBZA 4JBLA 3B38A 3HLYA 1ZL2A 2QPAA 3AP3A 4IMRA 2FJPA 4OXQA 2AG5A 4WBNA 2OSVA 3Q3EA 3UW1A 5MDHA 5JBNA 1T5OA 1A50B 3P9YA 1WDWB 5JDCC 3W2GA 3LBAA 4X8OA 2XMQA 1OLSB 2FW7A 1MRNA 3A2MA 4P35A 5B2FA 2P5YA 1T0IA 5E3JA 2FEOA 2HWXA 2HGSA 2ORYA 4TTPA 4EO9A 4LI0A 3DWIA 5A4AA 1L5FA 1PWHA 2JHCA 1N5IA 4YX9A 3GUYA 4HB0A 1M2KA 1DC8A 2JB9A 1D1QA 3L02A 5EIFA 2O1EA 4J4BA 4C0BA 3EZ9A 3PFGA 3R20A 2QJOA 3E9ZA 3ESRA 4PR0A 3SZMA 2ATXA 2X9QA 4PGGA 5IW8A 1S8NA 3VUEA 3EQ2A 2PUJA 3TDMA 2GN0A 3L7JA 1JLKA 1Q83A 3P9PA 1M2EA 1XZQA 4FOPA 3RRJA 3BXXA 4G8CA 1IVNA 4HD8A 4V2IA 1GL9B 3QEAZ 1OC4A 4YMSA 3R5KA 1UCFA 5H8WA 2IP4A 1ZBQA 1GRNA 2UU9B 5F3WB 3KUKA 1JR3A 3K0BA 2RGWA 2OMEA 5AVTA 2P2ZA 1QQTA 1R6DA 4UMVA 3RIHA 4CU2A 5HKAA 5JAUA 2GBPA 1P1FA 1SZCA 2D7JA 2D1RA 1Q0SA 2R2AA 2Z9CA 4MUGA 2GCGA 4MWSA 4Z9YA 4I36A 4CT5A 4LVNA 1KY5A 4B1FA 5CU7A 3MLAA 1E4OA 4LF6B 1FMCA 2QMQA 2HK7A 2VXYA 1X1BA 1JQ5A 3LV8A 1FQKA 1CHNA 1NN5A 2Q5QA 3BWDD 4TV8F 1Y6FA 2DFTA 1KXJA 3CPJB 4GRIA 4FYVA 1N75A 4LC9A 1P17A 5HQ3A 4L27A 3PD0A 1YS1X 3BMCB 3KQSA 2BMDA 2HU7A 5AW2A 1XXHE 1OMOA 3V7FA 4DSZA 1RI1A 3SEZA 4NESA 1WSAA 1YJ5A 2FSPA 1I2DA 4II3A 4C0WA 2GYVA 1Y8RB 1YK1A 2JLQA 4LMPA 5JXWA 3Q6IA 3ZD8A 2IYSA 4AY4A 2QTVA 4YFVA 4D79A 5C7YA 1AO3A 1KVQA 1I94B 2X1VA 4OJTA 4OHPA 3MMSA 1V16B 1ZUNA 1MG0A 3DEAA 4H6XA 4ZTBA 5H83A 3ZUGA 1VMKA 3E22B 4HSGA 4A15A 5B12A 1D9XA 1QWOA 1WZCA 4Q4HB 1G3UA 1RQNA 2GXQA 1BKYA 1C4XA 3N7AA 1ILWA 4R84A 3AM1A 1OA1A 3U4GA 4CODB 2ZBPA 4ZGGA 1D1TA 1WMFA 2DUNA 2X9LA 1HMPA 2QGFA 1ZGCA 3Q88A 4CDNA 4JJEA 1YDHA 2A7XA 3W6UA 2ECKA 1GDDA 1JL3A 1QH1B 4N0EA 4CMEA 5BRAA 2TECE 4X24A 4MV9A 2BFAA 4MW2A 2CDCA 2QP3A 5KQMA 2DXIA 1I9GA 1SN7A 4GX5A 3BRSA 4HUQA 1PEKE 3FSEA 4FP9A 4UEOA 2V0GA 1L7RA 4LHYA 1BAPA 2HNAA 2HM7A 1H8EA 5HW0A 2PV7A 3LVQE 2AHOA 5F4BA 1Z8NA 2Z5LA 3DDUA 2DGDA 4CN8A 3V33A 2I76A 3V80A 1DC7A 1FBTA 5HIIA 2FK7A 4OKNA 3O2JA 1KS9A 1NVEA 3KFXA 1N8NA 2EF0A 2DBQA 3HXMA 2QRUA 3O1IC 3QELA 1D07A 3G2JA 1VIYA 3BBPA 5ALFA 3TZHA 1LLCA 3U7QB 4IIJF 3QWIA 3G0BA 4KBYA 4RWZA 5K8LA 1TIBA 1YS6A 4LY9A 5HBRA 1ZVVA 1U4NA 5KYKA 1CV2A 1LI5A 1Y5NA 4J1TC 1G2OA 4E5DA 2CXOA 5M5BA 3ZTWA 4BMDA 2H51A 1EX9A 2OCAA 3MCWA 1LUAA 1F6DA 2MHCA 3B7PA 3QVLA 4M9SA 5DBEX 2WLSA 4OOFA 2H1IA 4W7HA 3WICA 5C8VA 2J0SA 2JHPA 3BWXA 3ILYA 3RTDA 3H9QA 3GXBA 3A9CA 4I3GA 4WJKB 1SCDA 3RIGA 3KPUA 4KRYA 1YBMA 4ENVA 3SNHA 3LF1A 1JAIA 1XI2A 4JT8A 5COBA 3BFXA 4XJXA 4IIDA 3WWDA 1BYUA 2R00A 2B8TA 2ZT8A 4JQSA 1SHJA 3G13A 2YV4A 5JPDA 5J4HA 5K99A 3L8ZA 4AECA 3JWEA 1OH6A 4F3TA 2JEZA 4CIXA 2EJWA 2JI8A 4GOND 3F2IA 2JLVA 2ZJ1A 2UVDA 4PZYA 5D00A 3P1JA 2DFPA 2FUNB 1DE0A 4PYQA 4OXRA 4O4LF 3M2PA 1NU8A 3Q7SA 4MP3A 4OIMA 4BNHA 4TV8A 5DRTA 4IH9A 4ZJYA 3HKDA 3RODA 4F7DA 2QUIA 1TLTA 5AK3A 4KV9A 1EK5A 2OM6A 3DV0B 4D8VA 1E9BA 2VXOA 1PS0A 1ZIOA 4Z7QB 4CETA 1L2TA 3EMKA 4JXKA 4A8TA 3SMQA 4ZYLA 1R0LA 1ORVA 3RS4A 4M89A 1AZLA 2VRNA 4JYBA 3N8DA 2YHBA 4R9RA 3U9SA 3IUNA 1A9RA 1RIFA 2OCLA 1GQYA 4PG7A 1JWLA 4JAVC 4JBGA 3SKYA 5ELMA 5HQ3B 1N6LA 1Y3AA 2ZUUA 1Z73A 2PX5A 3TNFA 1RNLA 2IBSA 3C3BA 1M76A 3G7UA 1JNXX 3GLIE 2XCTB 3A6GA 2G04A 2IYRA 3A9UA 3K2BA 1FP4B 1Z39A 2OYRA 2XBMA 1A95A 4XR4A 2WD9A 4LHXA 1D8TA 3NM6B 1AGXA 1R4ZA 1X7ZA 1QONA 4FXPA 4WK2B 1D2RA 3ZDZB 4YS6A 4B3TB 4ZCQA 3ABOB 2WYHA 4G8BA 3EF1A 5CVUA 3S7ZA 3G8YA 3U44A 3JQ8B 2JFXA 3KWMA 1OUMA 4M1EA 4X8HA 1ZR2A 4MAFA 2HI0A 4TL7A 4WKGA 1RAFA 1G64A 3H5WA 3HUTA 4KI0A 3UJ3X 4WY8A 4CIBA 5JDIA 4C7XA 4F96A 3SFVA 5G0VA 2BM9A 2JFYA 4QPPA 4I19A 1P1CA 4AULA 1KMIY 4O29A 2AZTA 1K7FB 1ACJA 3I01A 5A3VA 1KEZA 3OQIA 1CR0A 2AXNA 1YL5A 3QEOA 4BFUA 4ZP1A 5LB2A 2CNOA 4FC6A 3W2HA 3TMAA 2Q1SA 4BFWA 3WV4A 1QJCA 3N5KA 5KTOA 3PC2A 4FNMA 2J1LA 1LS1A 3TRIA 1SEVA 2XZTA 2YXDA 4IIJA 2ZI4A 3BDIA 1YVDA 5T7BA 3E2MA 2JVKA 2Z43A 1JTFA 4AS1A 2WYUA 3ESYA 5BSMA 3R9IA 4R8LA 5L6LB 1SR8A 3U4HA 1FNSA 2FZKA 4P0TA 2QQ0A 4YNBA 2Y1LA 1COZA 1VA4A 2I65A 2RMKA 1Q22A 2X4DA 1PD1A 3MAJA 1H93A 1A1SA 3QELB 3WAGA 3T1HB 1E0AA 5KKCA 4URVR 1PNQA 4D46A 4DA0A 3AM5A 3V46A 1CZOA 2J6HA 1MO5A 3D7NA 3IAAA 4HX2A 3V9AA 3WMFA 4D6XA 4BVJA 1L6RA 4L5IA 2PIAA 2R0QC 4AZVA 4LC0A 5JZVA 3OMWA 1FNDA 3OEHD 4ILKA 1BGVA 1OKKD 4TTIA 4DLUA 2XDWA 5FBZA 5FPQA 2BY4A 5KWJA 1NPYA 4MINA 5MHTA 2QR2A 4GECA 4O4LA 1EK0A 1BXRA 1GZSA 2M1XA 4A5OA 1SHUX 4OYYA 4IDDA 2ZWVA 1M2NA 3DMRA 2QLTA 3MTQA 4HYEA 3RBVA 1G6KA 3FYCA 5L53A 5A3SA 2BZ0A 3RSCA 4A5SA 5DM60 3CRMA 2QN6A 5I01A 1DUIA 3KLMX 2P41A 2PXXA 4JELA 1VKHA 5FBQB 4RHFA 1R9MA 1NVBA 1U6IA 2OVFA 4F8JA 4WGFA 4GL4A 1Q1AA 1PTJC 5CNIA 3W05A 2RIPA 5ALTA 2UV8A 3V3KA 3X0DA 4TV8B 3G5TA 2VK1A 4QECA 1G7SA 4OHUA 5DHFA 1IHOA 1MVOA 1XVUA 3DKVA 3HKDB 1RBZA 2HF9A 2NAFA 2FPSA 1FJXA 3OCUA 2JH8A 2J30A 3WXBA 1D1SA 5IUJC 3C1OA 3OQ6A 4RK0A 1PR3A 4LFBB 1G8YA 3A3YA 1LLQA 4A82A 3A4VA 3QYJA 2G8NA 1WUTA 2W2MA 4JASB 1IVSA 3D4NA 1U8TA 2G7ZA 1WP4A 1PL8A 1TTHA 5TF4A 4R7GA 1SB9A 4BMZA 1XOIA 5FA6A 4PYNA 4MKIA 4EQZA 1F8FA 1AHHA 1ZEJA 2G9QA 4KVGA 1U2GC 5IBCA 1QDUA 1IBRA 3JQBC 4ZAWA 1J9EA 1UMDA 3TAUA 1DELA 1IXSB 2C9OA 1OVMA 3JRNA 1X7ZB 3ZWYA 3JQDA 5ALRA 1G2QA 2Q1TA 2Q99A 3B3GA 4IG4A 1EDDA 3VJLA 3U44B 3AVTA 1WXWA 4M1OA 5EQJB 1GXSA 4FDAA 4RPGA 5AW4A 1P9WA 2NZ8A 2AJBA 4RFSA 4RORA 4C4RA 4WDRA 4XI9A 1FS4A 3EF3A 2ZBDA 1DFIA 1K4MA 1SVSA 1JHUA 2HWUA 2GLXA 2OFPA 1M9NA 3COWA 2X2EA 3D4LA 3OQVA 5CIWA 2QK4A 2B9EA 3OQIB 3LY8A 1KFBB 4QQKA 4ZVTA 4GPBA 4MR8B 4IIXA 2HMWA 1R66A 3OECA 3LCVB 3WKBA 3NRBA 3OQPA 2CXNA 2VJYA 1E6WA 2BHLA 3B3FA 3ROQA 3TQOA 1U0OC 4GNRA 2G17A 4YJDA 2QAGC 3JD0A 4GPZA 3ELUA 2ZRLA 4IIJB 3RTBA 1SXIA 4U5QA 4IM7A 4JUBA 4BBPA 5JBQA 4XYLA 3RIEA 2J67A 4ZO6A 5E95A 1EQUA 1ZC3A 2WWHA 5DNVA 1NQXA 1UP7A 1XDSA 2QROA 3EFBA 3MWDA 4TMTA 2P9EA 3CE9A 1AXGA 3TCKA 3ZE1B 5IF9A 5AKZA 1MNAA 3JQ9C 1NQAO 4M1QA 3HRIA 3LMKA 3T9FA 4ED9A 1SC9A 2GHRA 2BFMA 3CEMA 2FSGA 5EJ5A 3JWHA 4DTIA 3RQSA 3LFUA 3OEHA 1C7RA 4DLZA 1OKKA 1P19A 3VM6A 4ACBA 3GL9A 1XGKA 1S9DA 3VR3D 4R68A 3TZQA 2ZITA 2M6KA 3STWA 1NW9B 4DCUA 2P3OA 4MDEA 3DGFC 4UTRA 3GAFA 3VNRA 4KU4A 3UHAA 3WWOA 4W5NA 1GNSA 4RZIA 3MTGA 1JN0A 1B1CA 3AOEC 4YRNA 1GN8A 5DM0A 4Y2VA 1ZINA 4D4GA 4TVOA 1BXRB 1ZNZA 1NYQA 3GLKA 3QH4A 4JIMA 4BTVA 1OFGA 4PS0A 2Q0QA 1KI8A 2XQVA 4AN0A 2XNJA 1PBNA 4RY9A 5FI5A 2KMLA 3UXMA 2A67A 2VRCA 3SY8A 2VJBA 2VQ3A 3PDIA 3A1VA 3PJGA 4GM1A 1PT7A 2A0YA 2BKXA 1XZBA 4M1WA 1PX0A 1TI7A 1EJ0A 3AFHA 3VQTA 4QYIA 1US8A 5LP6C 4BOYA 3DV9A 4BAZA 2ZYDA 1QPZA 4OEHA 1MGPA 3L5OA 4I2NA 4DGSA 2BFFA 2WFLB 4ZOBA 5DNCA 4I08A 3O5AA 2E55A 2FOXA 2XWPA 3MTBA 4TTVA 5DB4A 2WU0A 5FL7A 2GVDC 3U19A 3ZU5A 5A0FA 3ZNQA 1UJCA 2ZYUX 2H54A 3E5HA 4WTOA 4B2YA 1NNLA 2ZJBA 1C8KA 3ZVLA 1C7JA 2OLKA 1C50A 2QUBA 2VHTA 3C6ZA 1K92A 3TL6A 5HKBA 3TM5A 2IV7A 3F8TA 4J8PA 1X0VA 2XYVA 2RGEA 3DLTA 4C29A 4FQ7A 4Q3AA 2CXSA 2WICA 3ENQA 3HVJA 4B9AA 1VE6A 4TLLB 4ZRDA 3E03A 2BAGA 1V96A 4L2IB 3K4QA 3KJNA 5AUPB 4G4JA 3E9YA 4HZUA 4DQ0A 1CUCA 1PCXA 5ALOA 1VKOA 1NJSA 2FE4A 1RI4A 1Z33A 1NZFA 2OHIA 2FSVC 3BAFA 2Y8EA 4K3UA 4W9NC 5EIBC 4CI0B 1FFCA 1E2UA 4CM7A 2OAEA 3E8XA 5HKOA 4GDFA 5AW0A 3DOOA 3D43A 4KN6A 4C0SA 5IKPA 3ONDA 3WLJA 4DSUA 2PO7A 2NSHA 2O4UX 3D1LA 3LDFA 2QPTA 3QE0A 1N6NA 1P1IA 5WRFA 3BS4A 4F2DA 1M5RA 1HLGA 1M1YA 1ZCBA 2GEVA 3WZLA 3HYRA 4XUCA 4O1IA 1XO1A 1QGDA 4OAOA 3A0UA 3KVYA 1GCAA 2VHCA 4EO4A 2AQHA 3EFOB 1M34A 3ZS9A 1R1DA 3JQGA 1SWVA 2VTKA 5CT5A 4NX2A 5B4VA 1JVNA 1K8XB 2JCBA 4MYCA 4PLYA 1QZUA 2EKLA 5BR1A 1M6EX 1W8IA 2GDZA 3WKCA 4WNCA 3MWDB 1L7AA 1Y7TA 5ARBA 2Q6LA 1HZJA 3EAQA 1LPAB 2ODTX 3R5JA 5CD1A 4M9RA 1A8IA 2IXAA 1J5XA 2Y05A 3BIOA 1ZVMA 5EA2A 2PX6A 1H42A 2REQB 2YV5A 3LIPA 5GM2A 2Q5FA 4LGMA 2WSBA 3AP2A 2HA7A 2C4WA 1XHFA 1JQLB 2H0QA 2WK1A 4JJ6A 4MA4A 4NU0A 1MQ8B 2FN9A 4L50A 2AN3A 4R8VA 4Y9RA 1VP9A 5JO0A 4OCZA 1IBMB 3LKDA 1CYEA 4ZOCA 4RWEA 2HRRA 1KETA 4HUTA 2ZIZA 3ZHBA 4MTCA 1SJ9A 5F3RA 1MDFA 2PE5A 3RFVA 1LC3A 3D3NA 4DYVA 1ESMA 4XIJA 1JDZA 5AKIA 2UUCB 2OB1A 4N18A 1X19A 2I7CA 4FGJA 3R9KA 2UXBB 1RZ3A 1S6YA 4KQMA 1KU6A 4XIYA 3FCSB 2CHGA 4CCAA 2F55A 3OPYI 3HHPA 2FPWA 3DNPA 3I01M 4NOMA 2I3DA 1U9CA 3I5UA 4C6TA 4IINA 3HCBA 2A5JA 5LWHA 3K5WA 3BX1A 5HOEA 3KJEA 2JVJA 4JXJA 2JLYA 3HJFA 2PZFA 3NI2A 2V45A 1QU3A 4MV5A 4W1RA 5AW9A 2D06A 3DD1A 4YMVA 5JCZA 3K9FC 3K3PA 3DYVA 1W35A 3IQXA 2XVAA 2RHTA 3KWFA 4KDCA 4OHBA 2Y1CA 1Y5LA 4ZVLA 2W6QA 4QYIB 1US8B 3ETGA 4ZCIA 1D8AA 4IQ8A 3GIWA 4QXOA 1O6FA 3GRVA 3A6LA 1K6JA 1DAHA 1XBTA 1YI1A 2IOQA 1Z62A 1NHWA 1MGOA 3FI9A 3O9ZA 3R3XA 4PG6A 4Z1MD 2RB4A 4XWAA 2NOAA 3TFWA 3UMRA 4EJMA 5BQOA 3K73O 5J2UF 5JDCA 1NOJA 2GN1A 4JP2A 3RRMA 1RLUA 1JNYA 2OBNA 3LVBA 4HGRA 1ORDA 1AU9A 4KWEA 3C7CB 2R8YA 4Q37A 5T6BA 4I4LA 1VBNA 3MPUA 4FT2A 3NGMA 4WKNA 1TUGA 2GCEA 2H52A 2BP7A 2J33A 5IYZF 1BEZA 1GR1A 4BZZA 2RG1A 4X44A 2I2CA 4HAIA 4FYJA 4P7FA 2YJ4A 3O4JA 1NLMA 1XELA 2FWRA 1AGNA 4XJTA 4XRRA 3T7DA 3F3KA 3UM9A 5JISA 1I6KA 4LXUA 5ICSA 4UTNA 1I3NA 2G5TA 5EY5B 2FWBA 1B0ZA 1HDCA 2XX3A 3GBVA 2VTBB 3RFFA 2OK7A 5HUQA 1RTKA 3VZPA 2HBQA 2FVXA 4RF3A 5FOQA 3TL3A 1GU7A 4DIEA 4EMBA 4H31A 1W2HA 2VPYA 3M1YA 4YRRA 4ARIA 3ROPA 3N58A 2OYSA 2XYHA 4WCVA 3RAJA 2IA5A 1IY2A 5KC8A 1V9CA 1ZUIA 3N0VA 2O7QA 3CCBA 5DBOA 1ZXLA 2FSIA 3OLXA 4UTXA 4AWBA 3T61A 5IMSA 3GGCA 1M1YB 1YJCA 2NXWA 5JFGA 1RCTE 3GI1A 5MGBA 2OHJA 2XVYA 1L8AA 1TZ2A 1OXSC 1VBKA 2QTCA 3U0BA 4ZREA 1ZU4A 3LUBA 4NTZA 4URZR 4WKCA 3NFRA 2D4AA 1PWYE 2FUEA 5HDQA 4E2XA 1U0JA 2ZYAA 4PAWA 2F43A 2XUGA 4G1CA 5FULA 3K71B 4WY2A 3GRKA 2IVFA 5JNTA 3TTUA 5EL0A 3HCPA 3BHMA 4GI1A 1Y7IA 4INOA 2DJ5A 2HDOA 1NVDA 2RI0A 1ZH8A 4I5IA 4UU1A 2H4HA 3TLGB 1SPBS 4Y1RA 4BEWA 2O2IA 1K08A 1ZX1A 3KOMA 3D8BA 2PJDA 1DEXA 4C0JA 1TUIA 2XUZA 1DKPA 3TOSA 3MSXA 2OPBA 2PKEA 5AM2A 2JGDA 5FPYA 3ILHA 4RKQA 3EIEA 2DP4E 4AG6A 2BMFA 3K94A 4G8JA 2XBUA 5C8XA 4WZAA 4MRAA 2OBMA 3A4NA 2ZAYA 1D2AA 1MO3A 4BLOA 3BVPA 4BFLA 4MGZR 4NCJA 1FDSA 3E3MA 1MH9A 1ZI9A 2LWIA 4UEJA 5G4KA 3YASA 3ZTYA 4BKPA 4GEGA 3AGQA 3AM4A 1LBEA 4C4OA 1Q1BA 2IH4A 4AO7A 1EEHA 1IY0A 1TF7A 2R3SA 2RGYA 3PCXA 4S24A 5BR7A 4CV0A 1ORTA 3P4UA 3NWOA 5ILGA 3KUXA 1DV1A 1W30A 3FVTA 1Z6TA 1Z0KA 2ET6A 2O6HA 3FBWA 2XTAA 4XCXA 3DF7A 1KC1A 2FF7A 3DULA 4OF4A 5DW3A 5JNWA 1P1KA 4HQ6A 4N41A 4IXWA 4N0MA 4D99A 4KOEC 3T3HA 5ITVA 1K7XB 3RVQA 1Z8FA 3BGWA 1XYVA 5TRTA 3WJ7A 5ALQA 1KI7A 2EYQA 1HL7A 1L3IA 1W94A 2NV6A 2XAAA 2Z30A 3GP3A 3KZVA 4HEHA 4I1UA 3ZVRA 5J2UA 3T52A 4MYDA 5BV0A 1HV8A 2VTEA 2IT1A 4EY7A 1DDOA 4C3OB 4JUFA 2WJAA 4KQFA 1G21E 5ERGB 3V1KA 5HZKA 1TU0A 3EVCA 1XVAA 2ZKIA 2M32A 1R9JA 3FLAA 1YA8A 2ODPA 5BWNA 2X86A 4MNTA 2GJ4A 1OAAA 3KFVA 5D5PA 3V7UA 5LDDC 4CGZA 4NU5A 3EJWA 5BYJA 7AT1A 2O9JA 4NYMQ 1GRCA 1RXUA 2XT6A 3EVGA 4HO1X 1QE0A 4IZOA 2MYPA 4M36A 2FE1A 2PZAA 2EEZA 2BP7B 2PRSA 4QYXA 1JEQB 3ZGXA 4HH4A 1ES9A 1E3IA 2CJYA 4A8JC 5EIXA 4IWXA 2ZGVA 4I1VA 2XF8A 3PA6A 3UAXA 2AN9A 1PK9A 2BL4A 2VP9A 1HE3A 1LTKA 4N4AA 3ZDXB 4FK8A 4G5YA 1AZSC 3ODPA 2IBMA 1UQTA 2GPWA 2POCA 4C4TA 1N6KA 1Z5OA 1OWOA 4RJTA 2O8CB 3V4ZA 3HGMA 2DFLA 4UDNA 3VYUB 1Y4AE 4OQQA 5L40A 4YP6A 1W1IA 1C5KA 1QYWA 3O6VA 4LZLA 4ON9A 5EP4A 3CH7A 1D7AA 1K8YB 1ULSA 4W5HA 2WHYA 1SH7A 1OBOA 2WWIA 4AXBA 2X3FA 3KKOA 1LF5A 3QMMA 3NBQA 4GQIA 3AVXA 1MJHA 3AOGA 3LFTA 3QWBA 3N53A 2C5HA 4I5FA 4FC7A 3AXTA 4MV4A 5JPIA 5BN5A 4RPJA 4OI2A 4X6UA 5COQA 2W6IA 1NVVQ 3GRPA 3NVDA 4PPNA 3DEZA 2W22A 1XVIA 4DDMA 1XK7A 1I7QB 4BNXA 2DC1A 1SVUA 3UQZA 1UMBB 3AESB 1PJTA 5BW6B 4B6RA 2F43B 3PWKA 3WBFA 3ZXXA 1SFRA 1LJ8A 3EXFA 3PJEA 4BFSA 2JLZA 3IP7A 5EZYF 5HRCA 1Z6AA 2BFBA 1N4AA 3CW2A 2C2GA 3OZIA 3DDHA 3T7SA 1T43A 5IX8A 3QX3A 3A58B 5KTRA 1D2CA 2FDCA 2ZAIA 2J3LA 3M34A 3PQCA 4OUKX 3BCRA 3IP1A 4FPXA 2EBHX 1FDRA 1E5TA 3D6FA 3R0JA 1SIUA 2JGDB 3DXFA 2D1YA 3LT0A 2Y1GA 1UBUS 2DFKB 1S2IA 4IKOA 5CX1B 3GRAA 3I05A 1WXGA 2IE8A 1IJEA 1K7SN 1TLLA 2JATA 2HWYA 4JGIA 4CLOA 3I3OA 2W6MA 5G4KB 3FOFC 4DIBA 2V1XA 1QHNA 1XZHA 3G82C 5HTKA 4HFJA 5IXJA 4XWGA 3AHDA 4M22A 3ED5A 5J5CA 3FOWA 1YFLA 4Y9DA 2D54A 2X8JA 3N0XA 1LWOA 3AU9A 1MHPA 4FJ2A 4TLMB 5FL3A 2L0XA 3D3JA 5JI2E 4X95A 3FGZA 4ZO4A 3RYHA 4MYHA 4DWOA 4C7JA 1W36D 1LF0A 1MOPA 3RGGA 3TS1A 1E3JA 1C9YA 3M6MD 1ZNYA 1ITZA 2Z3VA 3JU3A 4N12A 3QU5A 1UQRA 3Q5GA 4BQPA 1A4IA 3NC0C 2WHXA 4UUBA 4UULA 2PTHA 2BN4A 3B70A 3K05A 1KMHA 3JR7A 4J03A 4B75A 1W88A 4LGCA 5J2UB 1KI4A 3E23A 4PTZA 4B4WA 5K0CA 3O93A 4QVIA 4RTNA 2R7NA 5J47A 5K0FA 5IAAA 2FHSA 4IFIA 4PSAA 1H05A 3WOHA 4NONA 1OXKB 3ND9A 1VXOA 3MQFA 3X44A 3S2UA 4EGFA 5IYZB 3MNFA 3V5NA 1OFVA 1R4AA 2VUIB 3NBFA 4NAHA 4URXR 1V2GA 2PSFA 2K4MA 3E9NA 4H1TA 3T3OA 1XMIA 1ZK0A 2A35A 2J07A 4H7IA 1C2YA 4C1BA 4G37A 4EJ2A 4OX9B 4ABTA 3GFGA 4K81B 1SKUA 2AQKA 2V6IA 3FSRA 4F1JA 2YJZA 1Y1KE 4EVIA 4BLQA 1ZWLA 3W2IA 3ZY5A 1FSZA 1O0BA 4TX1A 3V8PA 3IEMA 1REQA 5FBRB 1KH2A 4QO8A 2WE8A 5DHQA 4CM4A 1VYUA 3GDHA 2FZVA 2GDJA 4D43A 4HNSA 2VJMB 3A9RA 1HLDA 1D2EA 1MV8A 5TT1A 3ZV5A 3B13B 1T8YA 3N8NA 1AY0A 3QVGA 4NEGA 4GXRA 3QG1A 3ZDDA 1U4SA 3IA7A 1YR3A 1E2EA 1XZMA 3FD8A 4IHJF 5DLPA 2FSSA 2PKWA 3OBIA 5E4TA 3VJKA 1PTJA 1EX1A 2J9FA 1LPBB 2VQSA 2WDZA 4IDEA 4Q7MB 2MYUA 4ZANA 5FUVA 5CB0A 4PEVA 2IY9A 2R6JA 5TPZD 2JW5A 2NUTB 3RC7A 1O8BA 1U9ZA 4G85A 5HVNA 1CDDA 3ZY6A 1TQ4A 2IHUA 2R751 1GNTA 2BGGA 1ISJA 2C8JA 3L4SO 5EZYA 4N5HX 3TRKA 1C1XB 1XTTA 2CCGA 4PC2A 4PLZA 1X1RA 2TS1A 2V6MA 1JS1X 3AR5A 4RV9A 3CLHA 3OBBA 5SZHB 3V4PB 5CLHA 3RJ9A 3U80A 5J1TB 2W6OA 4PRKA 3IP6A 5LP6F 2BR5A 3CVOA 4EB6A 2UAGA 1XMVA 4BUCA 3DR5A 1CUIA 4HY3A 3H2IA 4DM7A 3FCAA 4LJRA 2GJ9A 3UW3A 3MUOA 2A9JA 3S5JA 3TNYA 4EW2A 2VOEA 2BFBB 4URUR 1E79A 4AX8A 4UTPA 1FSPA 3SC4A 4GPIB 3TZEA 3D6NB 4AKTA 1TFRA 1R15A 1QYIA 1C7IA 4XDYA 4YQZA 1Q3HA 4TYQA 2QQ5A 5AW3A 3NAZA 5EIOA 4HBGA 1D2NA 1CQPA 4GPTA 5D87A 3AILA 1JSCA 1G4HA 2O50A 3UANA 4RHCA 2Q3JA 3L01A 4HKTA 5THXA 1N1EA 3H5TA 4NMWA 4CLOB 3IGFA 5EIBD 1RHQA 2KJQA 3GCXA 4CMAA 1O97D 2G5GX 4Q4CA 1OLUA 3G0IA 1XDBA 3F74A 1U3TA 1NVXQ 5DSXA 3X1DA 1I3KA 4CM1A 4O0MA 4URYR 1PU2A 3HVHA 3RG8A 4HJXA 4P81A 4YV0A 3GPBA 4WY5A 1IZ0A 4EEKA 2X8JB 4AMBA 1PQUA 2NPOA 5SZJA 3UEOA 1DRKA 4GSYA 4BMVA 5JU6A 4AI6A 1EB9A 1XRNA 3I5AA 5LKAA 2PM8A 1UBHS 3NONA 1QNFA 4YAUA 3REOA 1NLYA 1XRLA 4RXTA 3HN7A 4RIFA 1GAJA 1NSTA 2FMKA 2AX4A 3HFJA 4GBGA 1N9GA 5AK6A 1PFUA 1GRVA 4R2IA 1SU6A 4R1LA 5DX8A 4CR8A 1E1QD 5E1BA 3MW8A 3JQ9A 2B2XA 3UMGA 4ZA2A 2XCSB 5TQ0A 3PDUA 4N01A 1J09A 3TLYA 5CDYA 3RYIB 2QR3A 3S40A 1MO6A 5J2TF 5FBHA 4CM9D 1NIPA 1WDLA 1R9GA 4IRUB 4MVYA 4MGYR 4TQGA 5KWIA 2YHIA 3G9UA 1A88A 2WTNA 3A1CA 2W6ZA 5HBGA 4BNUA 1Q95A 4P2BA 2JKYA 1G63A 4Q4LA 3SR0A 3RUPA 2DPHA 4RMHA 1YULA 4PSCA 1UP4A 3AOEA 3I2JA 1PD0A 1C7FA 2QTNA 1U7XA 3N5CA 4IHJA 3TLEA 2YKGA 1NW6A 3CFYA 3Q7PA 4G0VA 4OAPA 3HXQA 1MEEA 2PUFA 1DTEA 1ANKA 1KPHA 2XR1A 3HVIA 3UPDA 4FE7A 2IRWA 5HZGA 2Q9AA 3KKMA 3W9YA 4ZO8A 2R6AA 2ATCA 1L5HA 1V5GA 1PG2A 4JJZA 1UPUA 1UOOA 2IUTA 2Q5LA 3L7DA 4XZ3A 4YAOA 4DWVA 1IULA 4ZVRA 4CF5A 3NT4A 3ZEAA 2FG6C 4LWOA 5E0KB 1ISPA 2W93A 4NYIR 3B1JA 1NW3A 1QHYA 2CKMA 4FEAA 1AA9A 4KUEA 2XCLA 3RD5A 1CB0A 2Q4OA 2LNDA 3LRPA 4ZC1A 5LP6A 1WLSA 1VGVA 4QARA 4F5DA 4XVQA 3HKBA 4ZKDA 3U1BA 3FMFA 4WXRA 3WX0A 4QM7A 1XLVA 5DTMA 2GXAA 5EZYB 1O96A 3G2HA 4X91A 1QG2A 3FOZA 3CU5A 1EFPA 3IAS1 2QVGA 1Y3IA 2O7NA 2XIJA 3ZD6A 2H2GA 3NGXA 5K8TA 4RJKA 2MSKA 1KAEA 3K8OE 4EB6B 3NIWA 5IANA 1M0SA 4G0UA 1ENOA 3ZZMA 3IODA 4X71A 1B6GA 1M1ZA 1X7WA 3ZNOA 3IBSA 3WL8A 2IEYA 3IE2A 1K8RA 1DCTA 2PX8A 4ZI3A 4JJ4A 3ZZTA 3UCEA 4B4KA 4L0MA 1CDZA 4PLFA 3GPIA 3E3LA 3KKLA 4LYFA 4W9NA 3TIIA 2OAQ1 3HU3A 5CTJA 1U2PA 1NVGA 3DE0X 5A0VA 3BIFA 5DCUA 1J70A 1FU4A 1QOQB 4Q24A 1J9ZA 2MSNA 1EUCA 3BK7A 3STXA 1SKAA 2QW8A 5I7FA 2HC9A 1ADJA 2HMTA 5T3UA 1JP7A 1TVMA 4QREA 1U2DA 2PKRA 3DBHA 3BWYA 4IEIA 2CHQA 1OLUB 3MF4A 3UHPA 2TMGA 3H16A 1W36B 2X42A 2QVBA 3RH0A 1JDTA 3IJRA 4HOYA 5DYIA 4AUKA 4WADA 2FEXA 3JASA 2FW0A 1GZDA 4B6PA 4CL2A 2IDJA 1JBKA 4CFYA 3EGVA 2VNIA 4EYGA 3KKNA 3VPBA 2ZWPA 2PD3A 1ACLA 1PX2A 3K9BA 3FWZA 3IIMA 4JHXA 4AG5A 2OHXA 2QN2A 4E1BA 5E4FA 5ENDA 4L8LA 3A4IA 1E5LA 2AG0A 4IVQA 3CT6A 5HJ7A 1XQ9A 2FNAA 1OWPA 3GVPA 5F21A 5C7OO 5CFNA 3ABRB 1MAAA 3IT3A 3VR5D 1E2KA 2YRWA 4D6YA 4KVFA 1N9GB 3H1BA 4PXSA 4RZ2A 4CM9A 4ENSA 3T4EA 2C78A 4ZEVA 2AVDA 2YNMD 3RT7A 1RMQA 3E05A 1W76A 1UBKS 5CVEA 3PFKA 3A32A 4G1MB 3GEMA 5TQ0B 1ORHA 4CIDA 2P2SA 1W9MA 3IT1A 4EMUA 1RWVA 2XNCA 4G67A 4JB0A 4WOBA 4R54A 4J7CA 4XX0A 2H17A 2W2OA 1ZJZA 2C5AA 2YHIB 2C7PA 1UXOA 1RXIA 3K0SA 5JZ9A 1B16A 3DNMA 4Y8VA 3DQPA 1JXQA 3BK2A 4HSEA 5E3IA 2R68A 4IHJB 2ODBA 4D97A 1HQYE 1O5OA 4B09A 3UJ7A 2IIBA 5BWBA 1N9ZA 1G4UR 4J3FA 4WZBA 2C7RA 3T7AA 1R6XA 1VDZA 4HDNA 4B35A 4EM6A 1CJBA 2JLAA 4E5YA 2QZZA 1IZYA 3WSVA 3C6QA 2BMWA 1PWZA 2DKOA 5DLQC 4F72A 1JT2A 2CNLA 3PC3A 3NAGA 3OZWA 1E6LA 4TZTA 4YCBA 1J0CA 1BW9A 3QI2A 4M83A 1ABEA 2D8MA 5A1JA 1ZH0A 3PCRB 2KB0A 3O47A 1YC5A 3IOCA 2P4UA 3OZEA 4KTVE 3M5DA 4GU5A 421PA 4ERNA 3K2IA 5LP6B 3A37A 4F2GA 2HEIA 5CA1F 4WERA 3H1TA 3HKBB 5A06A 4W6QA 1A69A 3V6MA 4BBZA 3PNKA 4E94A 3Q4GA 3KKZA 3IEPA 4YO8A 1VPWA 2Z57A 5LSAA 5JROA 3INYA 1C8BA 1O96B 1JEEA 2ZPAA 3KLBA 1NQUA 1NKTA 5CT8A 4PHHA 1N25A 1KH1A 2F4NA 2QD1A 2Q4DA 2EZ4A 1JG6A 1ZM2A 2HK9A 3EIHA 4K87A 4RD2A 4BB0A 1U8XX 4FOLA 4G9GA 4PC6A 5HCIA 3HXTA 5K3CA 4LNUB 2OBYA 2QSJA 4HWGA 3T3PB 5AI6A 3VC1A 1MO4A 5JI3E 4N48A 3LZCA 1PW5A 3TIVA 1U1GA 3LW7A 4MIKA 1RCUA 4CG1A 3AWIA 1BHJA 2BF4A 2Q3CA 3PVSA 4J4TA 1X7WB 3M4YA 3FFWA 4OFZA 5IZ4A 3ZJ4A 2V6JA 3MJEA 4MAMA 2AW5A 3ZDCA 1R0KA 1Z88A 2BMJA 4G8DA 1DQSA 3D0RA 3BFPA 1Y1TA 2J9GA 1E1RA 4U7PB 1USKA 1E3TA 1B0PA 2QTBA 3BEOA 2JGEA 2JGIA 3BMNB 3G8AA 3GJ6A 3HKEA 1FFEA 3LXXA 1J39A 1TU3A 1Z4QA 4MRVA 1P2SA 3MGAA 4DLBA 1EUCB 2QD3A 3O95A 5GONF 3NJ8A 1E2JA 3RHZA 4NPCA 1RM5A 4RYDA 3DBHB 4N7JA 1JG4A 3EZ6A 1QQ5A 3RJMA 4MQ6A 1TDJA 2BEVB 1DWPA 4WV3A 5FF9A 1U0SY 1UEXC 2R79A 5EKTA 5ERYA 4EPVA 3GVIA 2PXCA 2ZRKA 5JYEA 3LW8A 2YJGA 1CHDA 3VR5A 5JQGF 2E48A 4W1QA 4WFQA 1ZCAA 4WNAA 2PL3A 4GAEA 2VJQA 221PA 2FN8A 3AJRA 3MM4A 4LRUA 1GARA 1ZLXA 3WWYA 4OQYA 3OHPA 1U0FA 5BSUA 1E60A 4IJ5A 1JJBA 2BBWA 4JQCA 4E11A 5F3DA 5GP1A 3LWZA 4F9TA 1PZNA 5AKGA 3ZGOA 5C5DA 3MJCA 1V25A 1WNFA 3KZKA 5D6NA 4LDRA 2IUFA 3KELA 3SLKA 5IJ0A 4LRQA 4M0KA 3UJAA 4M3NA 3I61A 3PKIA 1W8DA 4B6JA 4G0YA 4RFVA 2GM4A 2A92A 1TA4A 1TM7E 1MX5A 1CLEA 2QD2A 3LS2A 3SSNA 3VR2D 1EUQA 1HDRA 2GZAA 2AE2A 3LF2A 4XX0B 2H1SA 3JARB 4LYJA 1WV0A 4C07A 3WGMA 3ZWVA 1DG1G 2VJPA 1TRHA 4WDQA 2CMFA 1L4KA 2WI8A 3DVAA 1FS5A 3JYNA 3LCRA 4WK0B 3WIEA 3CZAA 4FU0A 1NI4B 4UDXX 3QHPA 2Z2YA 3H3XA 4RXUA 5DOZA 4EEZA 2FSUA 4WINA 5FDFA 4HDNB 3VTZA 2OCBA 3NRCA 4H18A 1D3AA 3S81A 1B6RA 5K6AC 4FGSA 5CLGA 3J7TA 3OLCX 1RI3A 5CDFE 5KX5A 2ID4A 5EP1A 4AKEA 4K5QA 4X1IA 1XWIA 1M83A 4TWIA 4FILA 4TSFA 2Q3BA 2B8WA 1FTYA 1EK6A 3ICVA 4HT3B 4RHXA 1KYWA 1UXGA 1TYBE 4QWWA 1UXIA 1ADGA 4PSUA 1TF2A 1TJNA 3QFSA 2V55B 1AV7A 2JFNA 4GD3Q 1EEXB 4HR7A 3VHXA 3RYFA 1QX4A 2NZ2A 2R5NA 4EUEA 3DTNA 3NPAA 3LL4A 3SAJA 3REFA 2I6TA 2NYVA 5AVWA 3QVWA 4JL5A 4BLPA 1I4DD 2Q4RA 1SBZA 4FTWA 4MS1A 4A8JA 4F5YA 2PAAA 4OU5A 2G09A 1AT1A 1GOTA 2OGWA 3R1IA 4U2KA 4WKBA 3KD2A 3RC1A 1U8AA 3H8WA 5DOVA 5GONA 1W4BA 3VKGA 2OFOA 2ZRQA 3H3FA 3CRRA 3ICQB 3L05A 3TMKA 2GM3A 2KBEA 3EUWA 3UB2A 3ANNA 4ZCSA 1U7TA 4OQMA 2YWXA 1R00A 1SGWA 3JVUA 1VL1A 2IE0A 2I3ZA 2PPVA 3BYZA 3FR7A 1VCHA 4JODA 2AN4A 2QHXA 3HKEB 4P84A 3E70C 1UC9A 4TZKA 3JCZA 3VPSA 5HF5A 2XDQA 3AHIA 1EI9A 1FTQA 3H1EA 2VDLB 2ZZKA 1W44A 2JCGA 3HH8A 2ZEJA 4OBEA 1TC2A 1KR2A 1QE5A 2IZ0A 3GZTB 1M2OA 1BZYA 3HVUA 2QRZA 1KJQA 4M0EA 2PR2A 4XYGA 1H2WA 1VOTA 3GA7A 2QP4A 3NP9A 4L75A 4PZLA 2JFWA 4LZNA 5ALJA 3UV7A 1NOIA 5IKOA 1G8AA 4OQZA 4D8UA 4WVLA 4Y1EA 3WIBA 1A77A 2OHVA 1L4EA 2B0JA 3LPNA 4KODA 5K6TA 3SJCA 3IH5A 1T2AA 3K16A 3L7CA 4CBVA 4EKDA 3GLIA 3AR6A 5EYPA 2PUTA 3URMA 1JA9A 1PI3A 4JVSB 1LJUA 4N0DA 3Q15C 4U0JA 4D9IA 1QU2A 2VEDA 1VKJA 4L02A 1FS6A 3ZX4A 2YMQA 1CZLA 1QK5A 2Q29A 3HHEA 2YHSA 5CVDA 1X1EA 4FFMA 3R7FA 3IBYA 1PL7A 3IV7A 5D5HA 3R8FA 1RM3A 2YRXA 3OG9A 8OHMA 2G0AA 9MHTA 1JG1A 3R41A 4RVHA 1BSVA 4G5OA 3U4MA 1NRJB 2D7CA 2PX0A 1ZSVA 4V02A 2IQIA 1N0WA 1L4HA 1HZZA 3MN1A 5D51S 4E14A 3LLSA 1MF7A 1R6BX 4BVHA 2GVNA 5KSWB 2FMXA 2PMBA 2Q5JA 1QKJA 2O3JA 1I7PA 2V5UA 2OOKA 5IDXA 5LLDA 3ZDBA 3KBBA 2VZLA 4Q15A 4WSOA 1TZCA 3OZBA 4UUQA 5KVCA 4LHWA 4H2DA 2QM8A 1GQFA 3P2IA 4J0FA 3TLBA 1XTVA 4A9AA 1YTLA 2PX2A 3RK4A 5AJUA 4OKSA 4JP8A 5IEBA 3RC3A 2VWQA 4C0HA 4F5ZA 2I0FA 1JQJC 2R7KA 3A4MA 4HTFB 4L9AA 4YMWA 4FCTA 3S28A 4AN4A 3BD9A 5FXMA 1YZQA 1AS2A 3ITNA 4Q1FA 1E66A 3GCDA 4EKEA 2EX1A 5CA1B 4ESVA 3ML1A 5HS4A 4KAAA 4LDAA 4UBOA 1F0NA 2GILA 3BF7A 3DVLA 4KXNA 3DTYA 5A7FA 3NIFB 3DE5X 4QOJA 2AG8A 4EMTA 5FWNA 1OVGA 1T4BA 5JS7A 4LYAA 5EHQA 4X1IB 3NETA 2DQYA 5DNDA 2HJVA 4R8KA 1N5OX 4EHLA 1L6IA 3T7JA 1WD5A 2BCGY 2P9TA 1DUSA 3PJDA 3TGWA 1IHYA 4TV9F 5ISMA 2XH8A 3DBRB 4OHFA 5FR1A 1KIFA 4BVFA 2JBWA 1Z28A 3N70A 4DCVA 5E6RA 2PVSA 2H00A 1KY4A 1MT0A 2FWAA 4GYJA 3VHXB 5EQTA 5HK9A 3RYFB 1YZHA 5LIRA 2HEGA 3I4LA 3VAYA 5JARA 1GDHA 3EXIA 4MS1B 1NU6A 1PEYA 4UMEA 1Y4SA 4QFDA 4DQUA 1Y9DA 5C81A 4R40A 3II6X 1D6NA 3QVTA 4B80A 2QX8A 1R0XA 5GONB 2ZRDA 5DNYB 1CNEA 3ORRA 1JR4A 4J6FA 2YMLA 4OHWA 3ONVA 1WVMA 2XAUA 4L1KA 3F3YA 2A9QA 4R83A 3GGOA 1W29A 2C5GA 2VF4X 3HO6A 1TE2A 4P22A 3B9BA 4A0GA 4D45A 3BD8A 2DF8A 4AURA 1II9A 2NO4A 3OHSX 3LHFA 4FWBA 1COWD 1J20A 3ICWA 3UO8B 3VHLB 4NU8X 5ELXA 2XDQB 4XWKA 3UB3A 3PX2A 5JQGB 3PRJA 4V0RA 4JB2A 3GG2A 1M2OB 2B5WA 3W04A 1K63A 3FRIA 4YA6A 4FBLA 5ADWA 4L4XA 4MV8A 3N59A 4JR2A 1VMAA 2P65A 3CUEF 4YRLA 1UT8A 1HE5A 4MW5A 1AUOA 1PQWA 3ZKWA 4TTSA 2OCIA 2PGAA 3HL0A 5ICCA 4MEBA 4LXIA 4YMLA 2NSYA 1J23A 1H9BA 2GTPA 1XVVA 1XQ1A 5IK2D 4MGHA 5INTA 2HW8A 3HSSA 3I45A 3OT1B 3R7NA 3JYOA 3VISA 3K8ZA 5AI9A 4DV4B 1VI2A 3WHLA 4DXDA 5SY4A 4CG2A 1E9DA 1IU9A 1GCIA 1GGKA 3L84A 3ZPXA 1MABA 4X1KA 1B7GO 3UJBA 3R3HA 4LGYA 1NN1A 4KMMA 3UAWA 4EUNA 4JA0A 4BQIA 3V32A 1L5VA 1S3SA 4IDHA 5M3BA 4G89A 5TQJA 2I3AA 2CXXA 3ZXIA 2AYZA 4ZJPA 5KOHA 4F7WA 3J81k 4JZYA 3SIXA 1A8HA 3L0BA 2HWKA 1YXMA 3N28A 1QH8A 3MPOA 3RAPR 2FPRA 4F06A 4I55F 1DAOA 2GZ2A 5EJIA 1ZK4A 4DV7B 1N4DA 3AB8A 4LYDA 4EELA 2GCPA 5LMNB 4ARZA 1OBHA 3H2HA 5FPSA 1Q11A 2J3KA 2Z8XA 4DG8A 4CF6A 1B8PA 1F06A 3VC3A 5F9HA 5DJ5A 1WNTA 2QF7A 5B7QA 1JJFA 1L9KA 1XZLA 2WJHA 3D8SA 5E9WA 3TLXA 3WGZA 4Z99A 3NHJA 3A1SA 1DEHA 2TYSB 1HL3A 3TQRA 3ZY2A 1UFVA 4D98A 3PUYA 2UZ4A 5T4EA 3OI7A 1VLJA 1FY2A 2P1RA 1Q1ZA 1GUAA 4KXMA 4L6CA 1OBCA 2QTLA 2ZTSA 3UWMA 4AF6A 2PQ2A 3DOCA 3H5LA 1SCBA 1ZW1A 4TV9A 1J97A 3KUDA 3PQ8A 1WIWA 3SGLA 1SD5A 2PU5A 3QLVC 1CUEA 4G24A 4RE5A 5DWDA 4HB3A 2A14A 3WGKA 1GPUA 1GPYA 4NV0A 4Q34A 2O2ZA 3CW9A 3ENVA 2L2QA 3BXZA 3JYLA 1RLIA 2HPZA 2VZ9A 1N3LA 5DHAA 3W1WA 4B0OA 3PLRA 3PE6A 3N8IA 1LI4A 4JI0B 1MZVA 3VSEA 5IFLA 2X2PA 4TYMA 3V1YA 2OLJA 3F2VA 4KGDA 2MSEB 1M74A 1KE2A 5JCXA 1E8NA 2Y0DA 2QT9A 5CA0F 5E6RB 5JC8A 1B14A 2FCRA 2VQEB 4G3XA 4ZV9A 4DY6A 3ON5A 5BVHA 3HTXA 3UATA 5G0TA 1I14A 1Z63A 2QLLA 2UVPA 2XTZA 2DPLA 2SNIE 3UHJA 4BJ6A 1XTIA 1KDZA 4C0LA 4J0DA 1U3DA 2ZZMA 1F6BA 3CKYA 1PZEA 2D1FA 1Z0AA 3OETA 3H9UA 5DULA 1FUYB 5A5DA 2GPTA 1N33B 1YNSA 1HEIA 4WGGA 4NOLA 1KP2A 1KVUA 4G1UC 2QX9A 5FUXA 2I6GA 1COWA 4BO9A 4F85A 2F48A 3DKPA 4BN4A 2J4CA 3AKYA 3GFSA 2JK0A 4LVUA 4QYSA 2I55A 1V4NA 4IDQA 4BQEA 2R85A 3CZ5A 5FOVA 1GCUA 4G0WA 4TSKA 3CF0A 2B78A 3IVGA 2V3WA 2ERXA 2V6FA 4M8SA 4LSGA 5IVDA 4BZWA 1DKUA 2Y71A 4C7KA 5ILOA 5L3QB 4QODA 2RHBA 1IY9A 4YCAA 2QE7D 1SC4A 4IF6A 4JY7A 4EY4A 5HPYB 1NMQA 2UZIR 2JRCA 5AI5A 3D3QA 3CW8X 5DP1A 5EFZA 3WB2A 3BL5A 5A5VA 1QGAA 1B3BA 4Y2SA 1TF5A 3E8SA 4TLAA 1ULUA 5BWCA 3N75A 2MINB 1TGVA 1W85A 5GZ3A 1V4BA 1ZDMA 2EG9A 3AUUA 1AN0A 3FNIA 3GD7A 2C5EA 3D5QA 3GHHA 1ABFA 1QIHA 3OCVA 3ZKWB 4EGSA 1J0BA 3KPYA 1W2WB 1NVAA 3PXCX 3A9WA 1VDMA 1AGPA 2COEA 4NEHB 5EIHA 3C15C 2J9XB 3L1VA 2R97A 5JSKA 2P5UA 3RK0A 4AP6A 4NE2A 3SE0A 3ADDA 2QTHA 4B3IA 3EDCA 5IARA 1HOTA 5IU6A 3IKLA 4I55A 1UOEA 1UL1X 3BPSA 4YMGA 5DF1A 5GVSA 3CBQA 2OCDA 2BHNA 3BWEA 3I6MA 4KXXA 4RFLA