1EUCA

Crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
306
structure length
306
Chain Sequence
b'CSYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 118
structure length 306
sequence length 306
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eucA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1eucA01
1NPTO 1EVYA 1LSUA 3KO8A 3BHMA 3PTZA 2PTGA 2FPIA 2XXBA 4OM8A 2HK8A 3JQGA 3K2EA 1LDYA 2IEDA 3UH1A 3GG2A 4TVOA 5GY7A 3DMYA 4GGOA 1N1GA 4L9RA 5KVVA 1KY4A 2F00A 3DWFA 3VDQA 2D0IA 1Y7TA 4GX5A 4XRRA 3GFBA 3INGA 2NVWA 3FR8A 1A27A 2NQ8A 3KEQA 5L95A 1NXQA 5DCYA 4BGIA 4AFNA 5IZ4A 4OXNA 5L7TA 3WGIA 2NTJA 1N7HA 5JC8A 1PJ3A 3WMXA 5IAAA 5CG2A 3DZFA 4BL5A 1A71A 1U1IA 1YXMA 5LC1A 5IZCC 5I7SA 2RH4A 4BUCA 2YYYA 1OC4A 1WP4A 2DBQA 3L6DA 4ILKA 3WNVA 3H2ZA 1NP3A 4DMLA 2DQ4A 4CODB 2EF1A 4KUHA 4YCAA 1N5DA 1Y8QB 1PS9A 3GQVA 1DIAA 1R4NA 3EW7A 1R4MB 1DSSG 3ICPA 5F5LA 3HN7A 3PLRA 5G0TA 4BKRA 2D1YA 4MIEA 1SO8A 2PWZA 2NVUB 3MWEB 2I99A 3QY9A 4RPGA 3GT0A 4OOEA 1E92A 2B83A 1NR1A 3E9QA 4M87A 5F1OA 5C37A 4CLEA 1K6XA 1NVGA 3HWRA 2UAGA 2V7PA 3E5MA 5C7OO 4WUVA 3GMSA 1KC1A 4E2ZA 2BELA 3OP4A 4IJKA 4A03A 3QV1A 3ZWPA 1DIGA 1H9BA 7MDHA 2I65A 4KQXA 4DPLA 1H9AA 2O4CA 4UVHA 4DXHA 4WECA 2C29D 4PLZA 2GCGA 3WJAA 3DZBA 1EVZA 5FF9A 2P2SA 1I5RA 1MFPA 1WW8A 3F1LA 2BGLA 4LISA 1A9YA 5JE8A 1JAYA 3RFXA 4A5OA 2WMDA 3L4BA 1VM6A 1ZSYA 2VWQA 1NPDA 3RBVA 4BO3A 3PQEA 3GMDA 2WSBA 4IDCA 1T26A 3TQHA 4E6PA 1LQTA 4FC6A 2Y0EA 1I0ZA 1G0OA 1N9GB 3EGOA 3IUSA 4FD3A 5GZ6A 2I3AA 1T24A 4B79A 2GRAA 4CM1A 3DHYA 4RLHA 2FPIB 4NH4A 3GAZA 3Q9UA 5AYVA 1D1SA 4YTEA 4Y9DA 2AG8A 1GYRA 4FOSA 4CV0A 4CMBA 2I3GA 4MKZA 2HMTA 2X6TA 2AE2A 1XSEA 5LDGA 2H9IA 4CM3A 1OI7A 3LT4A 2PZMA 3ZU4A 1YB1A 3UOGA 4ALJA 2UYYA 1PJQA 2YV3A 3JQFA 1DLJA 1PJBA 3K31A 2POQX 4YJHA 2AHRA 3E8XA 5LCXA 5CDUA 1QV7A 3PJGA 1LA2A 3D4NA 4LGVA 2H6EA 4DMMA 2PY6A 2VWHA 3B1FA 3U09A 3RIHA 2IXAA 5T57A 5CEFA 4B3IA 2SCUB 4OSPA 4YACA 1TA4A 3OIFA 1XIVA 2BLLA 4W9NC 1VC2A 5TGDA 2YV2A 3WFIA 1QSGA 3M6IA 4AJPA 1XA0A 1E3LA 1KYQA 5DF1A 2HMVA 4CQMB 3D3WB 3AUAA 4CUKA 1YL7A 1KVUA 5AXAA 4H7PA 4NJMA 4JROA 1QYDA 4DL9A 2HLPA 1GEGA 1SEPA 3EHEA 1VJ1A 4U6QA 4A73A 4EEZA 4RF2A 3DO5A 2R00C 4KTVE 2Y1EA 5F1PA 3V2UA 4B3JA 1NAHA 3HFGA 4IUYA 2EXXA 1ZCJA 4R68A 1U8XX 2DPGA 4MOWA 4L75A 1G6KA 4CMHA 4D44A 4ITUA 1W6UA 3GAFA 4C7KA 1ONNA 3WGTA 2C54A 4JP2A 1J4AA 2EJWA 2DTEA 4J91A 1UXHA 1MXFA 4IXWA 3EZYA 1KIFA 1PZEA 1FMCA 3GHYA 4BNXA 1WXDA 4CQLB 4PLPA 1NHWA 1CERA 3W4JA 3MJVA 3D64A 4KWHA 1V9LA 2CMDA 4B4WA 1W4ZA 1EUDA 1H93A 3SJ7A 3WJ7A 5TF4A 5JO0A 2RHCA 2WM3A 2V6BA 2QW8A 1GQQA 5JW6A 2EKLA 4GBJA 3D5QA 4F6LA 4BO9A 4QX6A 1UXJA 3HDQA 2AW5A 2ZKLA 1M6WA 3JYLA 1BMDA 4L4XA 2XPCA 4MVJI 3NTRA 4BOYA 5KKAA 3IDSA 2Y99A 4GMFA 4CLRA 3D3EA 4JJGA 1VI2A 2DU8A 3OJFA 5EESA 4EZBA 4PZDA 1M67A 3TZKA 3MOGA 3AI3A 3WGYA 2PV7A 3KETA 3PGXA 3VOSA 1Y5RA 2RIRA 3RKRA 3ADOA 1NQ5A 2YQ5A 1E3WA 1X15A 3LU1A 2W2LA 1DLIA 1NFRA 4KQWA 5TIIA 1RPNA 2ZTLA 2B35A 4WE3A 2X5KO 2VHXA 2WTBA 3HDHA 4YJHB 2Q2VA 1TLTA 4ZQEA 4YR9A 2EG9A 1AE1A 2X0NA 3OSUA 2FY8A 1KBZA 3OIDA 3PFWO 3X2EA 1AXEA 4HX5A 4UEOA 3FTNA 3K73O 3V2HA 3E9NA 3UUWA 4Z0TA 3BMOA 1SAYA 3F3SA 1UXGA 5AXDA 2R2GA 1K2WA 1DC5A 1ADGA 2HJRA 3DXFA 4QXMA 1KEUA 3I1JA 3I5MA 3ZU5A 1I33A 3A4VA 1V8BA 2B5WA 1K6IA 4TRRA 2PGLA 4NBTA 4I8XA 2IXBA 2D59A 3ULKA 3WSVA 3PHGA 3I9NA 5JO9A 3SXPA 2Y1FA 2FSVA 3D1LA 4CMCA 3M1AA 4D46A 1AUPA 4XWYA 5JCJA 1DRWA 1E7QA 3R6DA 4RDIA 5BSEA 2NADA 3F1KA 2GO1A 2ZB8A 3LQFA 3QWAA 4ZU3A 1P33A 2FMUA 3AUSA 1NQAO 1J6UA 1TI7A 4MP3A 4OAQA 4ZQFA 3VVCA 5JAIA 1U7TA 5KJ6A 1KEWA 4LMRA 1Z82A 4N7RA 4E5YA 2X0RA 4B4VA 5ADHA 3PYMA 4I9NA 4WNIA 5A9SA 2DM6A 2QIOA 5CPFA 3MJ4A 2G82A 3DFZA 4NG5A 3WGGA 1W73A 6ADHA 4DBVO 3L4BC 2VHWA 1I2CA 2QZZA 5FFFA 3DBLA 1JW9B 2JFGA 3KZVA 3TN7A 1I10A 1LDNA 3UFXB 1LRJA 5DULA 2AEMA 3AM5A 3CKYA 3EC7A 3DZGA 3JQ8B 3AW9A 4FFRA 3RQSA 3FBGA 3LT2A 3OEWA 1PJTA 3W6ZA 2RAFA 1U3UA 3O8QA 3K92A 4MVJG 3CUKA 4NFYA 1PEDA 1R15A 4DRYA 4CLRB 4XR4A 4JP3A 4E0BA 2O2YA 4XB2A 4B7CA 3IS3A 1YL6A 1K0UA 2EKPA 1U3WA 1OBFO 3QLJA 4L74A 4CPDA 3O4RA 2P9CA 3Q0EA 2J3JA 3H3FA 4OL9A 3JQFC 2C5EA 3CMCO 3LC1O 4WASA 4TRNA 4QTZA 4ZVVA 4M55A 2VTDA 5ITWA 5TT1A 3PVZA 3H4VA 4MJLA 4O5OA 1V3VA 3VKUA 1X1TA 1I2ZA 1J5PA 3W8DA 3AOEA 4OXKA 3VTZA 1TB4A 4R51A 5T67A 3RD5A 1DJQA 3JQAA 2JFFA 5G2OA 2ZB7A 2FZWA 1Y8RA 2HMUA 4RPKA 3MJTA 3DAGA 4J1QA 2ZYAA 2AMFA 2FWMX 2B4RO 2H5LA 4CMEA 3FPLA 1W8DA 4FOOA 1HDOA 3AWDA 3FWZA 5A9TA 3TZQA 1UDCA 4JN6B 3ETDA 4L76A 3CTMA 1VKOA 1GCUA 2BI8A 1YO6A 3ITKA 1MC5A 5JCXA 4YAJA 2O48X 1E1MA 3H65A 1JVSA 1ZKMA 1ONPA 4PGFA 4H3VA 2EP7A 3EDMA 1PZHA 1TEHA 1P1IA 1Z45A 3BMNA 2HMWA 3QWHA 1XG5A 4NK5A 1BW9A 4LN1A 1U7HA 4BS9A 2NTNA 3RJ5A 2NU6A 2GNAA 2DFVA 1S7CA 1I01A 2LDBA 4N5NA 4WEOA 4YAIA 3C1OA 1KS9A 5AXBA 1ZO8A 3W1VA 1MA0A 4OGWA 4YAKA 4TSKA 3ZI0A 4YB8A 2OORA 1IHXA 3T4EA 1T4BA 1GV1A 2PK3A 3PXXA 3R3SA 3DZKA 4DPKA 1RJWA 3DOCA 1Z74A 1CETA 4UUMA 3WWYA 4EJ0A 1ISGA 1HZJA 3RC1A 1NWCA 1V0JA 3NEPX 2G76A 3HE3A 5DBIA 4RVFA 3TWOA 3U0BA 2VYVA 1BXGA 1DIHA 4MIOA 1LX6A 2PZJA 3Q9NA 3WTCA 3KSDO 4HWKA 4P22A 3GUYA 1LTHR 3NTQA 4YVFA 4NMHA 3F47A 1ZFNA 2FR0A 3U5TA 1AGNA 3DMTA 3IQDB 5IF3A 1WPQA 3O9ZA 3E9MA 4CMAA 4XX0A 2FHSA 1HF3A 3H9EO 5HTOA 3F5SA 5DBGA 5A02A 3KSUA 2X23A 4MVJD 5B1YA 3H9JA 3ZWYA 5TT0A 1PGQA 3PWSA 1GV0A 3VPSA 1B8VA 4BO6A 5JPIA 2DTDA 5ER9A 3CE6A 3IKVA 1HE5A 4ND1A 2O3SA 2D4AA 4BB5A 5DP2A 1B2LA 4J1NA 3NT2A 2CF6A 3WLEA 5DCUA 1A72A 4Y6SA 2YJZA 3S2EA 3LLVA 5F1KA 2B36A 3UW3A 4B4UA 3A28A 5T5QA 2YFHA 1YDEA 4Q9NA 3SC4A 1GPDG 4J1SA 1CDOA 2DFDA 2NQTA 3PZRA 4NDNE 2AG5A 3QWIA 4MKXA 1YQXA 1WDMA 2VRCA 3V8BA 1ZXLA 4CJXA 2J5RA 1OAAA 2D5AA 4XYLA 4XQEA 2WEKA 3BYZA 4GH5A 4C4OA 4H16A 4TWRA 4P4NA 4CLOB 3C8MA 1GD1O 4NI5A 4D45A 1L7DA 4Z9XA 3VC7A 4Y6PA 3T7EA 4YPOA 5B12A 1MGOA 3ZWCA 2PD3A 2PH3A 2IODA 1PGOA 4FJ2A 1I36A 3BTVA 2EW2A 4D42A 1NHGA 3H9UA 1QP8A 1ADBA 1UP4A 1WDLA 1X0VA 4Y98A 1E6UA 2I6TA 3R0IA 4NJOA 1GY8A 1ZVMA 1Q0HA 4IQ0A 5G0SA 3EYWA 4J6FA 1EZ4A 4CMJA 1BVRA 2J3IA 4FIZA 2VHYA 4G81A 2CY0A 2DBZA 1YBAA 3LZ6A 2ZYGA 3A1NA 1TT5B 1FXSA 1OOEA 1WWKA 3GGOA 3PYXA 2C5AA 2BFPA 4IY1A 4CM6A 1YQGA 1E1LA 3ROQA 1BXZA 4II3A 1JKIA 2DC1A 2TMDA 4I5FA 4J7UA 1P45A 5A05A 3ZWOA 3RVDA 4YWJA 2ZK7A 3LC2O 1BTOA 1PJSA 4G65A 3ZHBA 1ZK2A 4UUOA 2P9EA 1VJTA 3GGPA 2UUOA 2FPGB 5KIAA 3PQDA 4Z9FA 2VHZA 4XX0B 3WGOA 4Q3EA 1H2BA 5A1TA 4R69A 1VSVA 3GZNA 3JD0A 4FS3A 4W6ZA 2JCVA 4RPLA 5JAZA 1IOLA 5CFZA 2DBVO 3NV9A 1TT7A 2PA3A 1DC6A 3PJDA 4WLVA 3OFSA 1YE3A 5C7IO 3ZV3A 2FOIA 1Y1PA 5F21A 4W82A 5TS3A 2EGGA 2PD6A 4W7HA 4W99A 3DHEA 1MB4A 5G4KA 3LF1A 4N5MA 1CYDA 3AOEC 5CAEA 1EMDA 2VZ0A 2O7SA 5C7LO 4GSLA 3L4SO 3GG9A 1C3VA 1QR6A 2G17A 2X5JO 3GDGA 5EIOA 4LRTB 4R01A 4S1VA 3AFNA 3JD1A 5U1PA 1HYHA 2HAEA 2V6FA 1I3MA 2XOXA 4R16A 4URFA 4CMEC 2OHXA 4UVEA 3LT1A 1IUKA 3COSA 4UULA 1G0NA 4GKBA 4LSWA 2GN9A 3I52A 3SVTA 4I9UA 4ID9A 3L6OO 3OQ6A 1JKJA 2AE1A 2X9VA 2BRUA 5KJEA 4EI2A 3C7DB 3KYDA 5KKCA 1SNYA 2B0JA 4D41A 1E3JA 4CM9D 3LLSA 4NBWA 1PIWA 3A14A 5GZ3A 1M76A 1T1SA 5IFLA 1Y6JA 1RKXA 5CDTA 1LRLA 4J7XA 4BMSA 3GVCA 3Q11A 1IE3A 4QSMA 5L53A 2ZTMA 3I6QA 5L51A 4NBVA 4DVJA 3QVTA 2BH9A 1RM3A 4HFMA 1FDWA 1Q1NA 4QT0A 5BT9A 4A26A 1DEHA 2FR8A 2GSDA 1PSDA 2UUPA 2WYVA 3L9XA 4FFNA 3VDRA 4BNMA 3WX0A 2A4KA 3FRJA 5EQFA 1LDMA 2W2KA 3SLGA 4RO0A 1LC3A 4DIBA 3L07A 3BZUA 3WTBA 3KYCA 3DR3A 1ZK4A 4OYRA 2HU2A 1PZFA 4M54A 1PL6A 3DHNA 5K9ZA 3JD4A 2ET6A 2J3KA 1OFGA 1UJMA 3FSRA 4IMRA 3WSWA 3WBFA 4FGSA 4DYDA 3IOYA 4CLXA 4XD2A 1IB6A 3DMTC 3PHIA 2P9GA 4XCVA 1AHIA 1KC3A 3SC6A 4U5QA 3RJ9A 4FFMA 3N7UA 1G1AA 5JDCA 1CEQA 4YT5A 3Q1LA 3RU7A 4CLHA 1UUFA 2YDYA 4RZHA 1CQJB 4HFJA 3WIEA 1D3AA 4BNJA 3ENKA 1DAOA 3E1KA 4IDEA 3PJEA 4N5LA 5FYDA 3ROMA 4BIIA 1JKFA 2Y67A 4IS3A 4ALIA 1YBVA 4J0FA 4Y6RA 5EQDA 3BMCA 5CDSA 4K28A 3HB4X 4BMNA 4MVJH 4U7WA 4YQYA 1IZ0A 3E82A 1UP7A 4DIFA 2FP4A 1ZK3A 2GR9A 3HJAA 8ADHA 1Z7BA 3UICA 1ULSA 3E5RA 3JD2A 3KRTA 2WE7A 3RKUA 4L73A 1XR3A 4C7JA 1PR3A 1HWYA 2VRBA 2PH5A 4R9RA 1GFSA 3EAGA 1P44A 4HKTA 5GMOA 2DUWA 1P1FA 4IBOA 4B8ZA 2IEBA 4XKJA 4JIGA 4RF4A 1C0KA 1E77A 1LRKA 2QG4A 3OICA 4CR6A 4XYGA 3ANLA 3QE3A 5TX7A 5B37A 4AJ2A 5FEUA 1LEHA 2HMSA 4OKIA 1HRDA 4BNYA 3HB5X 3QWBA 3DOOA 1B15A 1FJHA 1U5AA 2X1HA 4PG5A 1KERA 3EZLA 4PLCA 3G79A 3W6UA 2YHIA 3AUTA 4BQRA 1HSZA 1VPDA 1LLUA 4I5GA 3ZWAA 3RUHA 1WVGA 4E4YA 2CVQA 4IJWA 3KYBA 3U49A 3L0DA 1CQIA 4TROA 4J0EA 1GADO 2NU9A 1DHRA 1EDOA 2RCYA 4NU5A 1SBYA 4UAGA 3OECA 3AU8A 2YHUA 1KEPA 1LJ8A 2QZ9A 1N1EA 2ZIZA 3D4OA 3OJLA 3KYCB 2NU7A 3LVFO 4DLLA 1C0PA 1Y9AA 2IYOA 3OJ0A 4R41A 1K3TA 3HUDA 1R12A 1YB4A 2I76A 3TOXA 1HKUA 3CZMA 1GQYA 7ADHA 1PJ2A 4XYBA 4AL4A 4IQGA 1I3KA 1PWXA 3JQGB 3K96A 3DL2A 4J4TA 2Q50A 3TZCA 4UUPA 4J49A 1PGNA 4KP7A 5L7WA 4BGVA 3IMFA 5A3JA 1YKFA 2GERA 3H9GA 4XDZA 4GAEA 4PRKA 4NU6A 3DZJA 4IMPA 2ZCUA 1FF9A 4BKPA 3ABIA 2Z1NA 2X0JA 4K9DA 3C85A 1MC4A 4GI2A 4PFJA 2HRZA 4DGSA 1F17A 2I9PA 3FWNA 3WMWA 3NKLA 2YY7A 3GC6A 3OH8A 5IN4A 2AA3A 2JCXA 4R4JA 3I9JA 5CDYA 4IIUA 1E7SA 3I9OA 4QECA 2G5CA 2PD4A 4E5MA 2FP4B 1F8FA 4A27A 3E6AA 4IDBA 2EP5A 3VH3A 1R4NB 3DBRA 4TRMA 3U3XA 1QKIA 2PLAA 1HE3A 1R37A 3RASA 2Y0CA 4I5EA 2AEFA 2CVZA 2JKVA 3AU9A 1IHYA 4M86A 5JMPA 3MOIA 4QFCA 4BHTA 3WBBA 2YFQA 3RUFA 4YYZA 3IL2A 2VUSA 4WGGA 4P38A 4DQXA 2VZ9A 1T2FA 3GLQA 1E0DA 1SB8A 3BAZA 5ER6A 3FHLA 2XAAA 3RWBA 5MGBA 3MWDA 4KDFA 3F9IA 3NRCA 5ILGA 5IG2A 4KMSA 3TSCA 3S55A 3JSAA 3C7CB 1LUAA 4BNWA 4GVXA 3OJEA 3WOHA 3V5NA 4Z6KA 5KTKA 4U0KA 3ANMA 4B4OA 4TZTA 3QVXA 4WEQA 4CM8A 1D1TA 1GUZA 2VNAA 4LW8A 1CIVA 4YA6A 3ITDA 4CQMD 4IJVA 2HJSA 4RQUA 1LLQA 4BMVA 1XLTA 2HK7A 3K2BA 2GDZA 3DBVO 2NU9B 1E7MA 3I23A 4HFRA 2O7QA 3VHRA 4O63O 1HLPA 4D3DA 1W0CA 3DTTA 2EKQA 3SLKA 8LDHA 4GWKA 2GZ1A 2JD1A 2OFPA 3GDOA 5T6BA 1P0CA 5KNLA 5IJZA 3ZNOA 5BSHA 4BB6A 1I32A 1HZZA 1HYEA 1Z75A 4KZPA 1VL8A 3ZV4A 2Y68A 4OJNA 2OZPA 4X54A 3PQFA 1BG6A 2X5OA 3NAQA 3V1UA 2UVDA 5JDCC 4A10A 5EPOA 3GVXA 2X7HA 4PZCA 3ZW8A 1HE4A 4BNZA 4HY3A 3V1TC 1H6BA 2Y93A 4JX8A 3VPXA 4CL3A 1WZIA 3H9QA 2FRDA 1QLHA 3GEMA 4KUGA 4EITA 4RGBA 4E31A 4IIVA 2A94A 4JBGA 2GGSA 4TQGA 5C3MA 1F14A 4ND2A 4YJGA 3B70A 5ICMA 1H6DA 4J9UE 3P5SA 2OP0A 3LDHA 1B7GO 2J5KA 2ZTVA 1EEHA 1JWBB 3JQ6A 4PVDA 3AM4A 4LK3A 4WNCA 5THKA 1GZ3A 2WD8A 3L6EA 4GL4A 5COBA 5U4QA 5L4LA 3TFOA 4DLAA 1GYPA 3G0OA 5EN4A 4R3WA 3ENNA 4CUZA 1WMAA 3DBRB 2DT5A 1P31A 4NJMB 1HDXA 2NACA 1LQUA 1PR9A 3FBTA 4D43A 1KVTA 3U4DA 4AJ4A 1ZEJA 2DKNA 2UV8A 4FN4A 4S3MA 2GN8A 2BI7A 1Z7EA 4YJFA 2C0CA 4CMKA 3T4XA 4EUFA 2CVOA 1P9LA 4K6FA 4BNVA 4R1SA 1B16A 2PNFA 1PL7A 4RORA 5U9CA 2EEZA 5HA5A 4CV1A 4J4BA 3WICA 1I8TA 1C0IA 4I08A 3G1TA 3JQ9A 1ORRA 1NAIA 4HP8A 4M49A 1B3BA 1YL5A 4JBHA 1NVTA 4JBIA 1KVRA 1Q7BA 1YS4A 2HSDA 1U3TA 2GPTA 1U4SA 4FR5A 5A04A 3GN1A 1A4UA 5CEJA 2W90A 3HNPA 2VCYA 3F4LA 5BNIA 4MVJA 3NYWA 4BO7A 3H7AA 1EUDB 1EE9A 4E5KA 1J0XO 1EVIA 2D2IA 4DUPA 4XYMA 4WJZA 3CH6A 3DZIA 1N8KA 2C82A 1GEEA 1LLCA 4CMIA 4GPD1 2NTVA 2GASA 4LVCA 3OA0A 2ZJ1A 2CDBA 2CDAA 1ISIA 1EK6A 2OMEA 4IPTA 4Y8VA 4TRJA 2FR1A 4E5NA 3RBXA 3ROPA 1XEAA 3C1AA 5I7FA 5KCZA 3UCFA 1LDEA 1PZGA 1XKQA 2NU8A 2P4QA 3K6JA 2Z1MA 4BNFA 1VKNA 1DRUA 1E3WB 3INRA 3GFGA 1GR0A 4U0JA 4IDFA 3ANNA 4G2NA 2NM0A 4Q3DA 4IM7A 5G0WA 5DT9A 1YGYA 5JY1A 2C7GA 4FCCA 2Q45A 2Y05A 1X7HA 1F12A 1ZK0A 3EUWA 4GKVA 5BNFA 3PIDA 5JDIA 5JSFA 2F1KA 2Y0DA 2OUIA 3ASUA 3PWKA 3H5AA 1DOHA 4JJIA 3BMOB 5JAQA 1AXGA 4OSOA 2V6GA 3LT0A 5KWEA 3DONA 2JCYA 4F46A 1ID1A 4OHUA 1UDAA 3AFMA 1Y5MA 1MLDA 4N18A 2PZKA 4E2WA 1XCBA 3RAJA 3GY0A 5K6AA 4ZGWA 4XEHA 4WCFA 3NGXA 3PZBA 4O59O 4ALKA 2JFHA 1GZ6A 3OF2A 5CP8A 2Q2QA 3ONEA 4A2CA 2IZ1A 3F5QA 3WGQA 1XWFA 5BNTA 1PQWA 2OO5A 4HXYA 3HN2A 1Q0QA 4BVAA 5JFOA 4JGBA 4L0QA 1YONA 4II2A 3WYBA 3STHA 1XQ6A 4XRGA 1ADFA 4E30A 2PKRA 2X9NA 1HDRA 5L3ZA 3E03A 5A9SB 3P2OA 1WMBA 3QQPA 5KJCA 5H82A 5CHEA 1GQ2A 1NBOA 4J2OA 1F06A 1H6CA 1ULUA 3PI7A 1IZ9A 2RBEA 3UF0A 3DBLB 4U8GA 3DC2A 3AM3A 3ZHYA 5L9AA 4QO7A 1X7DA 3K8ZA 4Q3CA 4RDHA 3GVIA 3IJPA 3JQEA 3AUUA 2OL4A 4R3NA 4R1UA 3ZW9A 3MTJA 3L9WA 4MIYA 2HKIA 3RC9A 3NT4A 1B8UA 4KDEA 3PDJA 3SJUA 3GA0A 2WYWA 5TRTA 5DDIP 4ND5A 5F3RA 3ZNQA 2VOJA 4D3SA 3O8QB 4NBUA 5HWSA 1O95A 3CINA 3GEGA 1VL0A 1BVUA 1NASA 4FW8A 1ISJA 1PJCA 1H94A 4JNKA 3ZN2A 1MG5A 1Z73A 4ZQBA 3DBHA 5ES3A 4HUJA 1LSSA 4L8VA 4E2XA 3IKTA 4QFDA 4CM4A 2Z5LA 1XHLA 3VZPA 5BSFA 4PLTA 4PVCA 3RC2A 3WQQA 4ALNA 5L40A 3GF4A 4GX2A 3DEYX 2BFAA 1C14A 4FFOA 4PG6A 2ZTUA 1GAEO 4RPJA 4NFSA 4MVJE 2CNBA 4CM9A 1RM0A 4GX1A 3IAHA 3HADA 3JQAB 5LDHA 1YQDA 2LDXA 2OBYA 3S2IA 4IDGA 1O6ZA 3CXRA 4BQPA 1E7YA 1Y8RB 3NT5A 4M8SA 4HFNA 2NLOA 2VZ8A 4G5HA 4UVIA 5T8KA 2E48A 4EGFA 1QV6A 3U4HA 4EUHA 3ZWXA 2CZCA 2AXQA 2CFCA 4BNKA 4WOKA 2O3UA 3VH4A 4XQCA 1LLDA 1R66A 4AJHA 3ZWBA 5TLSA 1JVBA 1GCOA 3FPCA 2HRBA 4XB1A 1UP6A 3RBZA 3RU9A 3RFTA 3EY4A 3PEFA 5HRUA 2PKQP 3BMNB 4Z0HO 1DIBA 1BW9B 1KY5A 1MUUA 3KVOA 3ORFA 1YDWA 1D7OA 4OXYA 3TRIA 2NU6B 1U8FO 4NIMA 2JJYA 4U6SA 2Q2WA 1VSUA 1HETA 1P1HA 4XGKA 3WIDA 4Q39A 3S8MA 2QYSA 3NDJA 2A35A 3WS7A 3QIVA 1QLJA 3QRWA 4K6CA 2PZLA 2BKAA 1HT0A 3GK3A 4N54A 4BNGA 3ZWVA 4NQZA 1XQ1A 2ZQYA 1I3NA 5KOIA 3NTOA 3ZWMA 3GVHA 5JLAA 3IJRA 3DAFA 5I7VA 3OQ1A 2BFMA 2C7VA 1PGJA 1C1DA 4BKUA 1BXGB 5L4SA 4ZD6A 3FF4A 3HFSA 2JHGA 3KLPX 3OA2A 3RUCA 5CDGA 3I9LA 1XU7A 1O0SA 4DA9A 4DPMA 4O0LA 3VH1A 1H5QA 5EERA 2HDHA 3AI2A 2BMAA 1QYVA 1T2AA 3EVNA 3O26A 1P77A 1P3DA 3GEDA 2NNLD 3GUCA 3MZ0A 3C1TA 4EDFA 4Q3NA 4B7XA 3B20A 2B4TO 4XJSA 1P1RA 3RI3A 1M75A 3ZNNA 2QRLA 2O3JA 2AQKA 1BDBA 3DBHB 4AG3A 2GYYA 1FK8A 5TJ9A 2VOEA 5B4TA 4UVGA 1X0XA 1JQBA 1ZNQO 5ITVA 4YAGA 4YEDA 3SEFA 3PDUA 3KV3O 2QQ5A 2QHXA 1GDHA 1E7WA 2ZB3A 3KB6A 4FJ0A 4BNIA 4E13A 3WNQA 2Y66A 3R3JA 4PCVA 1ZJYA 2BF7A 4QEDA 1DAPA 1YVEI 3GNSA 1I3LA 1CJCA 1UZNA 4RL6A 3QP9A 4DTIA 1NWHA 2FN7A 3S1LA 1BGVA 1QYWA 1P0FA 1V3TA 1ISMA 1Y81A 3R1IA 3ZHZA 1GL3A 4TVBA 1ENPA 1PJLA 2NUAA 3PIIA 2V65A 5A5EA 5IXSA 1RWBA 2VUTA 4WCFC 4W9NA 4YT8A 5KJ1A 5DNAA 3I83A 4PLYA 4XQGA 1R4MA 3BXXA 3C24A 1QYXA 3TFQA 3NUGA 4KUEA 1JDJA 4J7CA 3MWEA 3L77A 1L7EA 4ZJUA 1H0KA 4MKRA 2IZZA 5EINA 2Q1UA 1UH5A 1JTVA 2QRKA 4RV9A 1T2EA 1E5QA 1EBUA 1Q2XA 3DDNA 1KVQA 5AOVA 4Z3DA 2R00A 2EJVA 4YT2A 5EL0A 3VKVA 2J8ZA 3GDFA 3U9LA 1IPEA 1QG6A 4AJEA 2HO5A 1LBEA 3GGGA 4JJFA 3I9MA 1E5LA 3O03A 3KTDA 4R1NA 3ZU3A 4OH1A 1ZUD1 2ZQZA 3D5TA 3F46A 3NDIA 3W4IA 1K89A 4ONEA 3D0OA 3WYEA 4E2YA 2Q1WA 3HQ4O 2AQIA 2EW8A 3KM0A 3NGLA 4RVSA 2FSSA 4AVYA 4ZHSA 2WD7A 4BKQA 4KWIA 2VYND 3QA9A 1GZ4A 4J3FA 1O89A 2GF2A 1JU9A 3GNTA 4CR7A 2JHFA 2GD1O 3G1UA 4D3FA 3JQDA 1FDUA 3QVWA 1N9GA 5KVSA 1RM5A 3WGHA 2QRJA 1WAMA 3BTOA 2HUNA 3GZNB 3PRJA 4WLFA 4XIYA 4E21A 1DFIA 1DFGA 4RVUA 3EK2A 4RZIA 3B6ZA 4AJLA 1R6DA 4IDAA 2DTXA 4K1LA 5BR7A 3UAGA 1NR7A 4UUNA 3KLMX 3KEOA 3ZV5A 3GRPA 2I67A 4K26A 1V3UA 1B0AA 4UEKA 1PU2A 5G4KB 1B14A 5CAEB 3FCOA 4OKNA 3B1KA 3BHJA 4NBRA 2ILTA 3OETA 2O23A 4W4TA 3TJRA 4RLSA 5T8KC 5COAA 4ROSA 3RUDA 2Y1CA 2CDCA 1YJ8A 2C20A 3EMKA 2OBNA 2EIHA 2SCUA 1EQ2A 1HEUA 3TF5A 1ZMOA 5A5FA 2Y1OA 1HDZA 4NHEA 3JQ7A 3I3OA 1OZAA 1JKJB 4CQMA 2NUAB 3D3WA 3P7MA 3T7CA 5ENVA 2O2SA 2NV6A 2XF8A 3A06A 4CLDA 3KYDB 3Q2IA 4P4LA 1YH3A 2DLDA 2GLXA 3RFVA 3UVEA 3S2GA 2TMGA 4A7PA 2AEJA 1I24A 3JYOA 4IGEA 3JTMA 4I5DA 4MVJP 4PLVA 1ADCA 5K0ZA 3KHUA 4AJNA 3NX4A 1LDBA 1C1XA 1BDMA 4Z9YA 2YV1A 3ZH2A 4FB5A 3ETGA 5KVQA 5I9LA 4CV2A 5B4UA 1TXGA 2Q49A 4IXTA 2W2KB 3H5RA 3G17A 1ZJZA 4BO2A 4BO1A 3LF2A 1IULA 1SMKA 3AY6A 2ZATA 3IP3A 1EFLA 4WLUA 4EBFA 4CQLA 5DBFA 5DZSA 4JK3A 4M1QA 5THQA 1JN0A 4CL8A 3RUIA 1NYTA 2EGHA 1LNQA 4NNJA 4PLFA 3TNLA 1T4DA 1MXHA 1HYGA 2DUUA 3M1LA 5DOVA 4ZRNA 1AN9A 2WD7B 3VH2A 4PG4A 1YWGO 3GZ4A 2ZB4A 3AI1A 5CPBA 4FFPA 4LMPA 4PN3A 1DJNA 1UR5A 4Y67A 2D5CA 3CZRA 4L4RA 2DPHA 3H2SA 2OP1A 1PQUA 3CMMA 4NPCA 2VQ3A 4OOFA 3W4KA 5I7EA 2Q4EA 4PRLA 2QYTA 3IIEA 5G4LA 1H6AA 4TZKA 4GLOA 2D8AA 1NNUA 4PG8A 1ENOA 4ALMA 4GLLA 1UAYA 4MDHA 5L4NA 3LSYA 4ALLA 3U62A 1U3VA 5MDHA 3BMCB 3JCZA 3FI9A 3Q3CA 1NPYA 2W4QA 5CEEA 1VLLA 4OQZA 3DQPA 4WLOA 2VNSA 3ZCXA 4LVUA 4NR0A 5DN9A 1U28A 3LC7O 3KOUA 4UVDA 5L7YA 3ASVA 3MJEA 3INTA 4QUKA 1GUFA 1S6YA 2O3TA 3WQSB 4DREA 4F3YA 3CPSA 2X8LA 2VWPA 4ZA2A 3FR7A 4RF5A 3QVOA 2W8ZA 1A7KA 2WDZA 3VZQA 3JQ7B 3ZU2A 4DQVA 2B37A 4I1IA 5A9RA 3PPIA 4R5HA 1NQTA 1PTJA 1WZEA 3IC5A 2DBRA 5JYDA 3ZDFA 2GUGA 1EDZA 2IYPA 4GMGA 1Y9EA 3FNFA 3G3EA 4BV9A 1E1NA 5AQ1A 2RH8A 4MINA 3F4BA 1RM4A 2YHIB 4FSHA 4MPDA 1I30A 4DWVA 5ICSA 4RVGA 4BO8A 4IZHA 4CV3A 2O3QA 2BFOA 1DO8A 1DB3A 1NM5A 3I4FA 3KBOA 3OIGA 2BGKA 1C1XB 4J16A 4BO4A 5IXYA 1CQIB 1U5CA 3HDYA 4OIMA 4PLGA 3WYCA 1HDYA 1C0LA 2IRWA 4MP8A 4B8WA 4F45A 1M2WA 4RPHA 3PFFA 1BHSA 1YJQA 5JBIA 2OGUA 3BMQA 3OQBA 4Q3BA 2DVMA 1IL0A 3ZWNA 2NU7B 1MG0A 3DZHA 1M66A 1NTOA 1QRRA 1WDKA 1HDCA 3QW2A 5HM8A 1SEVA 1CWUA 3ONFA 5FWNA 5T64A 1O94A 1D4FA 2C07A 4ND3A 2X86A 3UFXA 3KXDA 1DHTA 1GUYA 3MCVA 2G1UA 4WLEA 5JS6A 5L45A 2ZCVA 1EE2A 3JQ8A 4YT4A 5A03A 1UXKA 1LSJA 1F8GA 2C59A 4AJ1A 4XR9A 4HNHA 1MFZA 1IYZA 3ZWWA 1YRLA 3O38A 2Q99A 2IZ0A 4YRDA 1GYQA 2P91A 1ZXBA 4AICA 1VL6A 2JAHA 3ZHXA 3FNGA 4JLWA 3W8FA 2EHDA 3RSHA 4GQAA 3UCEA 2WJPA 3WQRA 1EK5A 3MJSA 2A9FA 1T2CA 3V1YA 4XDYA 4EW6A 1M6HA 5I9MA 4CUJA 1X1EA 1UZLA 3PHJA 2X58A 3C7AA 4MVJF 5JYEA 2JD0A 2PGDA 3GR6A 3KSZO 4EYEA 2BGMA 1Q7CA 3GH3A 1L1FA 3GHHA 5DP1A 5COQA 5BQFA 3TDKA 3UCXA 4EJ6A 2E37A 1SOVA 3GRKA 5I8WA 1DC4A 1KETA 4RCVA 2J3HA 3JQBA 4J43A 1NX6A 4LSMA 5TQVA 5JY6A 4FFLA 1T2DA 4PIVA 4F6CA 4YXFA 3GVPA 1SZJG 3HDJA 4J90A 1SCUA 5FI3A 5CG1A 1BSVA 1ENZA 4NK4A 2QX7A 4YQZA 4YAEA 4AJJA 1DBVO 5JNLA 3MWDB 3S2FA 3ZGYA 2A92A 3ZV6A 2H63A 3JQCA 4H15A 4HBGA 3PHHA 4XA8A 2UDPA 4YRBA 2Q1SA 3TOZA 3QJ5A 5A06A 1DRVA 4E33A 2J6IA 2J5QA 4DIOA 3K9QO 1JA9A 2HQ1A 4CM8B 3SBOA 2GN6A 1A7AA 3HG7A 3WWZA 4XZ3A 2CUKA 5DOZA 2GZ2A 4FDAA 1AHHA 3WDSA 2B4QA 1QYCA 1X13A 2VT3A 5TNXA 1U4OA 3D7LA 4MO2A 1LC0A 3BMQB 3ST7A 1A5ZA 2AQ8A 1GU7A 1PX0A 3N58A 5IDQA 2YUTA 3KUXA 2VHVA 5H81A 4BNLA 1V35A 4EEXA 1A4IA 4AJKA 4LCJA 1KOLA 1KEVA 4FQ8A 5IN5A 4E3ZA 5ENDA 4ZICA 1KVSA 1E3IA 3WB9A 3RUAA 3WLFA 5H83A 4DC0A 1D8AA 4NZ9A 3H8VA 5TC4A 3JYQA 3UGKA 9LDTA 1LI4A 4TKLA 2FPPA 3JV7A 1PWZA 4BO5A 5EJ2A 1ZSNA 2Y1DA 1ONOA 3H6KA 3QSGA 4PG7A 5A3VA 4BNNA 4E32A 2IE0A 5JMWA 1FDTA 3ICCA 1VRWA 4R9SA 3PK0A 4GGPA 1ZH8A 3HSKA 3EVTA 2EERA 1R16A 4YJGB 1UAGA 3GN2A 4CR8A 4IINA 2BD0A 2VWGA 1XU9A 4PLHA 5KJFA 3M2PA 1JAXA 1XELA 2VN8A 3ETEA 2CF5A 3MTGA 4LRSB 4EJMA 4P4GA 2O50A 4BGEA 3OJOA 4HNGA 4M89A 3PWZA 3TL3A 4O1MA 1UDBA 3F6YA 2V6MA 4B3HA 3U4IA 1DXYA 2O3RA 3AY3A 3VTFA 2GN4A 1U2GA 3RCBA 1X7GA 4FC7A 3DB2A 1FDSA 2HK9A 4JCOA 4YJFB 2W2LD 4XIJA 3P19A 3IP1A 2VTEA 4TKMA 5IDWA 4L4SA 1JWAB 4RVDA 3W8EA 1SCUB 3LK7A 4CLOA 1FDVA 3TPCA 4AJIA 3UXYA 3BTUA 2CD9A 3G49A 3DOJA 1HE2A 1ZK1A 1A9ZA 1XGKA 2C2XA 4GWGA 4WKGA 3VZSA 1JLLA 1ENYA 2YZ7A 3QHAA 1E3SA 4GVLA 3WR5A 3VPGA 3RUEA 1BWSA 1E7RA 2B69A 1K5HA 3GPDG 4D7AA 4IQ8A 3BHIA 3TL2A 2HCTA 4BKOA 5TSDA 1IY8A 4DC1A 1N7GA 2E4AA 1OC2A 1EQUA 3UKOA 2P68A 1ZBQA 3U4CA 1B26A 4CMIB 1K6JA 1TT5A 1WNTA 3I4CA 5JCJD 3OBBA 9LDBA 4BGUA 1HXHA 1B3RA 4ZRMA 1CRWG 1HSOA 1U2DA 4LCEA 3PYLA 3VPFA 4PZEA 3PHLA 4OO3A 1YOVA 4XQ9A 3NDRA 1SPXA 3CSDA 4E5PA 4UEJA 1ISHA 2NU8B 1NQOA 3CIFA 2VT2A 1MV8A 2FPGA 3NJ4A 1O9BA 1U9JA 2X4GA 3K5PA 3BA1A 4GSKA 2FPPB 3DAPA 5AXCA 2IDZA 1EUZA 2YDXA 3OHSX 2Q3EA 3FNHA 1DIRA 1LSOA 4FGWA 2DAPA 2Q1TA 4W7IA 3X2FA 3PP8A 6LDHA 3M2TA 3H3JA 1Z6ZA 2NVBA 3LYLA 3ZNPA 1UXIA 1ZEMA 2E82A 5I8ZA 3I9KA 2YQ4A 1EVJA 5DCWA 3AY7A 3N74A 5IZCA 5KVCA 4YBZA 5B4VA 1ML3A 1LU9A 1YBMA 4UREA 4J2HA 4DQUA 4DYVA 5J23A 1EUCA 4TMFA 2CSUA 4ZQHA 4CM5A 1ARZA 1R0LA 3VZRA 4R54A 3TZHA 1HDGO 2BHLA 3JQBC 4Z0PA 1PL8A 1PS8A 1P1JA 4PLWA 4IS2A 1GPJA 4WCFB 4HV4A 1ZMTA 2C2YA 3MEQA 1PGPA 4P8RA 3JQ9C 5G0VA 3CEAA 3BTSA 4XJTA 1DC3A 4Z3KA 3GPIA 1DPGA 2VYNA 3PGJA 3Q2KA 1QXSA 3VPHA 4INAA 1HL3A 3UHAA 1MX3A 4O6VA 4D0RA 2ZJ0A 3VAZA 4BNTA 1BXKA 2I5PO 3BIOA 4KOAA 3JQAD 1SB9A 1SC6A 3NJ8A 3OEYA 4NFHA 1IPFA 4R1TA 4BNHA 2X22A 1E6WA 4CM7A 1TVEA 1JLLB 4FBGA 4WPGA 1EFKA 2JAPA 1O5IA 2G0TA 3DFUA 4XGNA 4R5MA 2GZ3A 1VE9A 1T25A 2Q46A 5I9NA 3GNQA 5IDYA 3B1JA 5JXWA 3HZZA 1GTMA 4JQCA 1HLDA 4J1TA 1H2HA 3RC7A 4BNUA 1X14A 3AK4A 4WK6A 4OQYA 2E49A 3UN1A 4ZQGA 3JD3A 1RYDA 2E6UX 5HS6A 2R6JA 2AQHA 2OXIA 4I9HA 3WFJA 1CF2O 1DDOA 5ILOA 1I2BA 3QWFA 4IZIA 1B8PA 1E1KA 3IUPA 1YB5A 2EV9A 2P4HX 4QO8A 5JC1A 4D0SA 3ZZNA 5GZ1A 1PQPA 4BV8A 4YRAA 3DTYA 1J49A 1YOVB 3WXBA 1P1KA 2PFGA 2W98A 2NSDA 2PGJA 4RJTA 4RQTA 3ROKA 5TJHA 2JL1A 1NFFA 1P74A 4CM4B 1Q0LA 4EUEA 1NFQA 4WLNA 4J9VA 4JXKA 1F0YA 5FI5A 1CQJA 5JAMA 4XGIA 1E6EA 5JDIC 4XYEA 4KTTE 5HBRA 2VYVD 4FPXA 1BRMA 3OM9A 2Q4BA 3WGZA 5G0UA 1XDWA 2PKQO 4Q3AA 4MVJM 1V6AA 4ND4A 3E48A 1ZZEA 3ADPA 3ONDA 1R0KA 2FZEA 4MP6A 3Q6IA 2RHRA 1ZW1A 1UZMA 3V2GA 1Y8QA 2EWMA 1PS0A 3E18A 5K6AC 3AOGA 3JYNA 1EUCB 1ZIDA 4IDDA 4OMUA 4FJ1A 3GOHA 4DLBA 3MJCA 1R0SA 4IGFA 5HS4A 4J4HA 1DFHA 4YDRA 4BO0A 1XYGA 2WE8A 2Z95A 5C5IA 1SOWA 4ESOA 2ZYDA 3P2YA 2NVUA 4D79A 3VVBA 4ZN6A 3I6IA 3QVSA 1EBFA 1RYEA 3K30A 5A4DA 1N2SA 1E3EA 2OOSA 3WG9A 2VUUA 4YJDA 4E12A 2B5VA 1LXCA 3D4PA 3HHPA 2WYUA 1Q7GA 3FTPA 1LDGA 1VJ0A 2P5UA 5IDXA 4QQRA 4IJUA 1PJ4A 1T1RA 3FNEA 4WOJA 3SX2A 1ISFA 1N92A 3PJFA 3H5NA 2WWRA 1WLYA 2H1SA 2NWQA 2Y1GA 1MP0A 4A0SA 2X9GA 2VRCD 2YW9A 2D3TA 5F5NA 4WCDA 1OMOA 2P5YA 3AJRA 3FN4A 3OMLA 3C3XA 2O4UX 2I66A 4RF3A 5AVOA 3TZ6A 4AJOA 4B7UA 4DBZA 3RROA 3A9WA 1C1DB 1QORA 3FD8A 1QMGA 1O8CA 1ZSVA 2X0IA 3ON5A 4HADA 2XXJA 4CMGA 4GX0A 1HTBA 5BSGA 2JD2A 2PR2A 5EMHA 3JYPA 1NVMB 4RVHA 3PLNA
chains in the Genus database with same CATH superfamily
4GE0A 3KO8A 3LUPA 3K0AA 4KI0A 3PTZA 5C8YA 1V6CA 3AL2A 5JWOA 1NU6A 4JLDA 1QFSA 4RS3A 4CL0A 1ONBA 2HK8A 2Z5VA 4DANA 2ZZMA 5HZGA 4OAOA 1W30A 1KQ3A 1UBEA 2QENA 3H99A 3IAAA 3KP1A 3Q3JB 4O1HA 4RK0A 5K3DA 1QU2A 5ALXA 3UH1A 3GG2A 3L40A 1TGYA 3FJYA 3H2JA 3N2ZB 3RS3A 4MUEA 2YNMC 1FLAA 4AY5A 4K2HA 1F9EA 4IJQA 3DWFA 2F00A 3M33A 4Q24A 5E7MA 3NHJA 3KJIA 3R7SA 4IIBA 4DSTA 3FR8A 4TYYA 2NQ8A 5GOZA 3NCHA 5A4MS 1ZCFA 1W49A 1H2WA 3W05A 2GEKA 3SF8B 9MHTA 2GM5A 2OV8A 4I1VA 4YMIA 1S01A 1XTVA 2Y71A 3H9BA 1KO7A 1PJ3A 4F93B 4A5SA 2YS6A 1HNZB 5LC1A 5BSVA 4N48A 1CB0A 1P72A 2QR2A 3ZXIA 1XX6A 1EFTA 1OC4A 1WP4A 5FPSA 4DLTA 1PV1A 3VFDA 1NP3A 1SN7A 3LTEA 4MUFA 4ZOQI 5EJMA 4EOGA 1QVVA 1UPCA 4NDZA 5KI6A 3EXHC 1EXWA 5A3QA 5HX7A 2OAQ1 2EF1A 2JA1A 3PIRA 4OPMA 5FBWB 2X5NA 1N5DA 1Y8QB 2VIIA 2JH3A 2GXAA 1P4GA 1R4NA 3E23A 1SQ6A 3M6UA 1R4MB 1ZYUA 2W37A 1YZTA 3HFRA 3COVA 3T1OA 2I4RA 4AWAA 5AHRA 5KYWB 3PLRA 4X6UA 5G0TA 1PP4A 4R71A 3ILSA 3CWCA 3GFSA 4BYMA 1HE1C 5H4GA 3P9SA 4M87A 1IBRA 1M2VA 3V55A 3UWSA 3ZBTA 1M6VA 2XF2A 4PSUA 2Y3IA 3EIOA 1K6XA 1NVGA 2OCAA 4H0NA 3O5AA 3I04A 3GMSA 2D4HA 2FZVA 3TLMA 3H0EA 5JSKA 3OP4A 4G9BA 4B3TB 4P2GA 2RHBA 4A03A 4PX5A 5J1TB 4I1SA 2AZMA 1HX7A 2V98A 3DEAA 3MXOA 4X20A 4FM9A 2BGRA 3HSYA 3ND5A 2O4CA 3DAHA 3I73A 1RIFA 4QICA 4TLMB 1EXNA 4CTJA 3QUQA 4WECA 3UEOA 1CHDA 1KZ4A 2X76A 1OH6A 2GCGA 4BWVA 3W5BA 5CT6A 5LXTF 4GOLD 4NH0A 5IVPA 5J2UF 3FLAA 4AULA 1NF2A 1VI5A 1G2QA 1VSQA 1WW8A 2PH7A 2GH1A 2LV8A 4KG7A 4M53A 4O2LA 4LISA 4PHTA 3UWMA 5FBVB 5JE8A 3D2CA 3NOXA 3GUZA 3GWZA 1IJKA 3SIPA 2SBTA 2VS1A 4BO3A 3GMDA 5CVJA 4GR4A 5DNCA 5DISB 1XRNA 4D92A 2RHOA 1NUHA 2C04A 2MYNA 5K8JB 3FOBA 1L8XA 1I0ZA 4FD3A 2PAAA 3EC1A 4RPIA 5GZ6A 4B79A 1PT8A 5L6LB 2GRAA 1EWQA 5K4AA 3QBVA 3E7FA 3OE7A 4B73A 2OCDA 2IYXA 1D1SA 3DF9A 2CLKB 4AMYA 4FOSA 5FQNA 2DHEA 4CV0A 4LNHA 3OLQA 3QUTA 5DWVA 3I01M 5LNK6 4F0JA 2CV2A 4GUDA 1CUCA 2B98A 1W36B 2BEWB 3TAXA 5LDGA 2ETXA 4ER0A 4XVUA 1OI7A 5CBKA 5JSZA 1B74A 1YB1A 3UOGA 1JJIA 3OTGA 2J0QA 5IM4F 2AFHB 3Q3HA 3D8NA 1RRCA 1IJEA 1ODFA 1SULA 3E0QA 3PU6A 1DQNA 1F2VA 1L4UA 3DXXA 2CNOA 4IUCS 4MPTA 5HCUA 1W96A 2AHRA 4K0RA 2QDKA 2FGKA 2EDAA 2V7UA 4BP3A 1BA3A 5LCXA 3CNHA 1QV7A 1YBFA 1VQ1A 1GTG1 2OV1A 3D4NA 4LGVA 2H6EA 4DMMA 2OD7A 4MV7A 1EWYA 2DUJA 4MJ3A 1WSBA 1QC5B 2D7CA 3CUSA 3DW1X 3L8YA 4MQ5A 1LNSA 4MTCA 3M8KA 5KX5A 3RVLA 1YZFA 4GRAA 5FO1A 1C50A 1IY2A 3TAUA 4TMKA 3QVVA 5BUZA 3KPWA 5DW0A 5HKKA 4AJPA 4MYHA 1SVLA 1E3LA 1DQZA 1MABA 2HMVA 4CQMB 2KHZA 5FOUA 4YAUA 5HF9A 1YL7A 4BBPA 5KHLB 2YINC 3N0XA 1FRFS 4NJMA 1TFUA 2VK4A 3CUVA 4JROA 4DL9A 3QF4A 1GEGA 1SEPA 3I0MA 1XTSA 1IQPA 5EC8A 2Q1XA 4XTCS 3IE1A 3VC2A 3DO5A 2R00C 1YZQA 2FZCA 4LTDA 4N0EA 1NAHA 3HFGA 1GG2A 5F76A 4RTQA 1X87A 5C1IA 2EXXA 2QRGA 3L0CA 1S9DA 1TPZA 3CUTA 2WSSA 3LXRA 1DAEA 2GN0A 2GEVA 1JLHA 4OGFA 3E8SA 3SS8A 1ZAYA 2FPOA 3KHKA 3R6WA 4M1ZA 1Y37A 4R1QA 3OEHA 1U63A 2Y1XA 1C9KA 1KSGA 4X64B 4PZUA 5ALWA 2V0CA 3SQXA 1UXHA 2ZJ2A 2XR1A 3KE8A 3EZYA 1BYUA 3GJRA 3GHYA 1G8PA 5DMHA 4DLRA 5H1YA 1L4GA 1K8RA 3FZGA 4NNPA 1YHNA 2G1JA 3DOHA 3CVVA 4KQ1A 4OMCA 3D64A 2ENUA 4KWHA 1FL9A 2XW6A 2XMGA 1W44A 3LZDA 1RJFA 3X1XA 2B8WA 2WJ3A 1H2RS 3TMKA 2TRSB 1W1UA 1IHOA 4A0RA 3KD3A 1GQQA 2Q5IA 3EVCA 1N6NA 3PE6A 1JBQA 4OIFA 1YB7A 4LV6A 4Q66C 5JW6A 4MV6A 3K8OE 4QX6A 4XCXA 1M6WA 4I5IA 3NMUF 3T6KA 2XPCA 1QE0A 4ZDKA 5A6SA 4MVJI 5I9IA 2CCGA 2H1CA 5KKAA 1LBSA 3IDSA 1HLFA 4GMFA 1F1JA 3FVVA 4B0PA 1RYMA 1OD6A 3D3EA 5CFOA 3RVQA 4CLRA 5HOEA 4EZBA 4QC2A 1N3LA 3B53X 2QD5A 1W36C 2QTNA 2ZIVB 3SE0A 2CNWA 3PGXA 4LE0A 1BEUB 4ON9A 1Y5RA 2RIRA 4CIWA 3ADOA 3G7SA 3M9WA 5F4ZA 4PZZA 4U7HA 2YQ5A 4LIPD 1E3WA 2J31A 2RHMA 4V1CB 1HNXB 3K4PA 2NP6A 1VHQA 3MIIA 5JARA 2B35A 2B1GA 4O8ZA 3RE1A 2GHIA 1OYYA 3FHCB 2WTBA 4F11A 2UYQA 1D07A 1A5TA 2Q2VA 4X5OA 1X7ZA 1Z29A 2L82A 3T9DA 4DXDA 3LTNC 4YR9A 2EG9A 2MSLA 1AE1A 1CDZA 2AX3A 1W7AA 5THXA 4IHJA 2I6GA 4OL0A 2O1WA 2PSFA 2IT1A 1WHTB 3PEWA 2RGGA 3V2HA 5AVXA 4O3FA 2P9HA 1K2WA 1NBIA 2IXDA 2R2GA 3DXFA 3G13A 4QXMA 4V0QA 3V46A 4AK9A 1NVAA 3DL4A 3I5MA 4DDMA 1GGHA 1I33A 1MVNA 2B5WA 4QELA 2ZSHA 1MX5A 1X9IA 1K6IA 5ELLA 3D4LA 1P5JA 2LRHA 3RADC 3G2HA 1MAAA 4P08A 1G60A 2YY6A 4C9BA 3FDXA 3WSVA 3R0QA 2GD2A 3EQ8A 3LD9A 4FYPA 3RTBA 1ABBA 2JJ1A 4LDAA 1AUPA 4XWYA 4TMTA 1QX3A 2ZUFA 5TGTA 5LOVF 4I4TB 4ERNA 4F2HA 1A2BA 2QPAA 4JWTA 4RDIA 2R5FA 2GCPA 3ANSA 2ZUCA 3RAEC 2ODWA 3MHTA 4LHWA 2IYAA 2HXGA 2C98A 2IXFA 2WWHA 1IBLB 1KSFX 3AUSA 3B78A 1NQAO 2BBSA 1YS6A 4KAXA 1XZGA 1I94B 1XPUA 2F59A 2ZSDA 3KU1A 3V4OA 1RQ7A 1V11B 4OAQA 2YTZA 5JAIA 3MTEA 4HYEA 5KYXB 1PDVA 4FMPA 4MVXA 1G8KA 1YC5A 4QGHA 3PRYA 4KQ2A 4R3UC 4RADA 4IHQA 1AS3A 2DM6A 2Q07A 3AX6A 3WYFA 2UUCB 3DFZA 1AMUA 3T3HA 3S99A 4P0PB 1KZYC 4XGQA 2QN2A 4JC0A 4DBVO 4DJFC 1QGYA 1T1JA 2G5GX 3DBLA 3Q7PA 4FK8A 3S8YA 3VUEA 3RVSA 4YN3A 4C4TA 2YXEA 5IX8A 4BC0A 4JUAA 1LDNA 1NRXA 4GS5A 3E81A 1ULTA 2HMYB 4W5HA 3PJRA 3SEZA 1XV5A 3DZCA 3M82A 5AHWA 4K6MA 1YS7A 3AHIA 3JQ8B 1TMKA 3MHPA 3FBGA 3C8DA 3OEWA 4LGMA 3WNCA 4DDWA 5LQRA 3TMAA 1YJAA 1CUGA 3LPDA 2KX7A 2RAFA 4IHKA 1POWA 3SC3A 3O8QA 3K92A 4KXXA 3R2JA 1FNBA 1RHUA 3OPYA 4JP3A 3QLVA 4XB2A 1NJFA 1HLGA 1K0UA 2JAWA 1U3WA 4LQDA 4CPDA 3QLJA 4WBNB 4R1LA 3AQ4A 3B13B 2PAFA 3DKKA 1RXVA 4UEQA 2EX1A 2IY8A 2J3JA 4JI8B 4OL9A 1X1DA 2G72A 3CM0A 5K2MA 2ZR9A 3CMCO 5FUYA 1XZHA 1KA9H 2VEDA 4QTZA 1QYIA 1GAJA 2YWEA 4F8JA 5AI9A 4FSXA 1C2TA 4WWHA 1QIKA 5CRIA 3T4UA 3H4VA 2QU8A 4MJLA 2FW0A 4O5OA 1Y8AA 1X1TA 1I2ZA 1XYYA 4AB1A 1PJ8A 4EJSB 2J0EA 3KAKA 3CISA 3HY3A 4Y6LA 4FT4A 1TB4A 1O94D 2AOUA 2DYKA 3SC2A 1DJQA 3JQAA 2QTWB 3KFLA 5G2OA 5IKMA 4LDNA 4DMFA 2IOYA 2H48A 2HMUA 2O2HA 2FEMA 2DY1A 3A6LA 5CNMA 3UHPA 4CIBA 4ZI3A 1PTJC 1YZYA 1ZESA 1HDEA 1Q0PA 2AMFA 4N7JA 5ALLA 4CL2A 2VPTA 4G1FA 1IXZA 1AKVA 2H5LA 4CMEA 4S1PA 2Z6UA 1W8DA 3DD5A 4BVGA 3AF6A 1HDOA 2OFXA 3FWZA 4D4MA 2A0UA 1UDCA 5FTLA 4JVNA 3CTMA 1VKOA 1GCUA 5JCXA 4X41A 3WB0A 1MC5A 4G6ZA 3C7TA 3GPLA 3RHFA 1JVSA 1ZKMA 2EJCA 4BV2A 5AQEA 5ELXA 4MW5A 1N6LA 1WUTA 2G4CA 3GRFA 3O7MA 1CVRA 4G0MA 1XG5A 3HABA 5K7SA 1Z6QA 5GV8A 1C4KA 1PT9A 3AXSA 4BQQA 4YRMA 1U6KA 3RJ5A 3B9RA 3E9CA 3VYWA 3G02A 2CV0A 1I01A 2W2NA 5C5DA 2R79A 2OYCA 2J45A 4N5NA 3RTDA 4WEOA 5J2UB 4JENA 1MGPA 1E1RA 4TQAA 4G07A 1MA0A 5IASA 5KNDH 2FA9A 4P5EA 3HLTA 1M6EX 1RE1A 2OORA 1IHXA 2X8WA 2Z4TA 3TBKA 3P2EA 4B0OA 2VDNB 4CCWA 3BSYA 4F9EA 3SKXA 1OLXA 4UUMA 1TZJA 2ATIA 4Q48A 4C0XA 2NQ2C 1DQSA 2BFCB 4UHBA 3L4KA 2ZBGA 3GUVA 3DFMA 3L79A 5IARA 1QCCA 3ZC3A 4FUTA 2G76A 4M9UA 1QP4A 4ZVRA 4HRVA 3LPLA 1PVVA 3FUCA 4RVFA 1F2DA 2QLLA 3DCIA 1XDBA 2OHVA 5F2EA 1TO6A 1KRXA 1JYSA 2XNKA 2Z56A 1MX9A 3KQYA 3R8XA 3RTGA 4WSOA 5DKFA 4BCDA 5IFKA 4MS3A 1C9DB 2GJKA 4HWKA 4KN9S 4P22A 3HBNA 5CD1A 2W6CX 3FWPA 4EYGA 2IYLD 4U2BA 4QDUA 5BPFA 1O4VA 4FN5A 1GAQA 4KKXB 1RWNA 1Z08A 1CQPA 1V2GA 2ZT5A 2IEGA 1WPQA 1MPTA 3DMTA 3K72B 2XMSA 5IT0A 1TF5A 2PRKA 4KQ9A 3IELA 1Q19A 1UC4B 1SELA 3QU7A 4MVJD 4MI3A 1SUCA 3W1EA 1Q14A 3UMVA 1PGQA 3JU3A 1GV0A 1Z5GA 1RLUA 1N6KA 1UK8A 3EGDA 3QA3E 4FCTA 2VK8A 1XZPA 3EMBA 1U7WA 4Q47A 4ND1A 2WB4A 4DSNA 2FPUA 2O3SA 5HIMA 4BVBA 4BB5A 3HKDB 4XVHA 5FPYA 1UJ5A 4EJSC 1YFJA 4Q7JB 3UJAA 3NT2A 4MCHA 1FS4A 4XCQA 2TS1A 1F4LA 1TM5E 2HSGA 2YJZA 4Y6SA 3S2EA 4Z7NB 4ZV4A 1VMKA 4GU5A 4M22A 1SG0A 3EZNA 3A28A 3TTYA 1U0NA 2BR5A 2Q7XA 5JVDA 1V4BA 2YC4C 3IO5A 3W1WA 2YFHA 5JNRA 3UV6A 1YDEA 2OQ2A 4Q9NA 3FMFA 1LPSA 1QGDA 4UTOA 1CDOA 3A3KA 4HAUA 1BN6A 2DQSA 4UBKA 4MI9A 3UQZA 3IR7A 1DOAA 4KLNA 4G25A 1JHDA 4LQLA 2RD2A 5KMGA 1YQXA 2I7VA 1QGUA 2HSWA 4RK6A 1FLVA 1ZXLA 3AR4A 4QUHA 1L5GB 3VO2A 4CJXA 2D5AA 4XQEA 1OAOA 3QNUA 4CRWB 1J8DA 3CRRA 2HU8A 3GQBB 2QMEA 1HA3A 3HVHA 4GH5A 3UHFA 3DOEA 4P4NA 4CLOB 4RTRA 4MLCA 1GD1O 1L9KA 1ZAKA 3E05A 4NI5A 3SHVA 4D45A 4Q18A 4RH1A 4F2WA 3B3JA 4DMGA 1LPOA 1TCUA 2PH3A 4QQ8A 1R8YA 1AHPA 5IC5A 2WSYB 3MB5A 2PCJA 4D42A 4GMDA 1P5ZB 3TIVA 4Y98A 4NJOA 3K0SA 2X13A 2GHRA 3W5DA 1SCAA 2WRZA 1DQYA 1VBNA 2JGJA 2A7XA 1U0EA 1PWEA 3NWBA 5G0SA 3TR6A 4HWSA 2FWRA 2QGFA 2ZIXB 3CONA 4AYTA 5IVKA 4FWIB 1JMKC 4URHA 2NZWA 4ZCLA 2ASEA 4CMJA 3HKEA 1WV0A 4DDVA 4CKBA 1JLSA 4UU8A 1NW3A 1FX0A 2CY0A 2Z58A 3DB1A 4N01A 2CE7A 5BN4A 4G0UA 3BL8A 3D0RA 4OFZA 3A9RA 4YLEA 1WWKA 3GGOA 3BOSA 4TKZA 3NETA 4LWZA 3H5OA 4JMPA 3ZE6A 4CM6A 3W7VA 4FDMA 1BEEA 3ZE2B 1QFZA 1VPEA 4I5FA 4LRXA 4RY0A 5AT1A 1GNTA 4N1AA 5A05A 4BBZA 3RVDA 4YWJA 2JRLA 1PDOA 1W19A 4JELA 4R68A 1L5LA 4G65A 4U7GA 1YDMA 5BVGA 3F2IA 4UPDA 2EYQA 2IBSA 1ZUHA 2OXRA 5AM3A 3BJRA 5DXAA 3GGPA 4QHYA 1J2YA 1D9XA 1JG1A 1KMMA 4BDSA 3R7WB 2FPGB 3L1JA 5AJXA 3NHBA 3TE7A 5B53A 1LD3A 4UASA 4XX0B 4BKMA 5A1TA 1AS2A 1J23A 1CUFA 3NS7A 4R69A 1FCJA 1VSVA 2ZR0A 1GPYA 4W6ZA 2L17A 4URWR 2VBIA 2ROQA 3IUQA 4N03A 2VKTA 3SSOA 2OEPA 5JZSA 5CFZA 2ZUEA 1W581 4HUTA 1TT7A 3IDOA 1DC6A 4Q05A 1FVOA 1Q20A 4MS4A 3ESCA 2YXDA 1ZCBA 2X6RA 3TKAA 1R7RA 2OWDA 3CX3A 3ZV3A 3KAJA 4W99A 1J22A 3ZK7A 1W4CA 2CBGA 4N5MA 5FR2A 4EX7A 5F7ZA 3C3JA 5FV4A 3HKCB 1BKDR 1YOBA 2XBLA 3GG9A 1WZCA 5CM9C 3GDGA 2ZRDA 1E1QD 4FT2A 5HM6A 4KSBA 1G21A 5U1PA 3AG5A 1L5FA 4R16A 3Q87B 4V2UA 2B9VA 1OIXA 3LT1A 1U7DA 4ZRDA 5IULC 4FQ5A 2R5WA 4QAJA 3GLIB 3COJA 3QU4A 4HXFB 1M1NB 3WL5A 1RWOA 1XMSA 5FWXA 4ZZ0A 1VE5A 1JKJA 1WSDA 2AE1A 3RFFA 2PA0A 1XZ8A 3QMMA 1PUJA 2JJQA 1TQ6A 1V4VA 4N5DA 3HC7A 4DKXA 1IXRC 1QBKC 1UMDA 5I7WA 5KJEA 1A82A 3MPOA 4EI2A 4N49A 3BBPA 3D8UA 2ZWIA 2GTHA 4CM9D 4PFKA 2AH5A 3N2KA 4P93A 2G88A 5D87A 1M76A 1TU4A 1XFAA 3GFPA 3IAS6 3TD2A 3UWPA 3PUWA 1P3Y1 3FKQA 2RKOA 3WL7A 4BMSA 4FFBA 3Q11A 1IXSB 4C0HA 3T9EA 1Z4OA 2H0QA 3HCOA 3I6QA 4IG4A 5L51A 2R8YA 4NBVA 5TR9A 1KQGA 2FMHA 4INJA 4RH3A 4OG2A 3N2EA 2SECE 1Q1NA 5ERXA 4D56A 3A6JA 3R6LA 4MUGA 5BT9A 1T4CB 1XF9A 4N0PA 1DEHA 4A26A 2GSDA 5I9SA 5DLQC 4LHVA 2A4KA 2PDAA 3H1TA 1JIJA 5T41A 4FXOA 3ASYA 4Z9BA 1Y5LA 4OREX 4BEVA 1U0JA 1XTZA 3UAZA 1PZMA 3MT8A 2XUKA 4MQ4A 2ZCJA 1FU7A 3KYCA 3OZFA 2FMTA 5BORA 4QBHA 1MR3F 1W76A 4TV9F 3ESXA 4EKNB 4CEHB 1SPBS 2FUG6 2VRNA 2ET6A 2Z2IA 4EY5A 2J3KA 3REFA 1UJMA 4IF4A 3L1VA 5BSRA 4GSYA 3WBFA 3Q8MA 3HWSA 4FGSA 3G6WA 4B3CA 4YV1A 1VKRA 4CLXA 2NZ8A 1BMQA 1MCZA 2FF5A 3IA7A 1E2DA 4P84A 4N41A 5AW3A 1FU8A 4D9IA 2AXNA 1P80A 1CJSA 3B7PA 4GE3A 4L9WA 1BU5A 4OHZA 4FFMA 1Z4IA 4JMLA 4YMWA 4Z7OB 1Z2EA 4Y2YA 4KFSA 1IHUA 1U5BA 4FU0A 4IRUB 3UYLA 1AKNA 4CMKA 2WHYA 3M4ZA 5DPMA 2NUTA 1RAHA 1UUFA 3WSTA 3OOJA 4LY0A 1XLVA 1FXWA 1CTQA 5KYKA 1N5KA 3M3HA 5DLDA 3U4AA 1RKVA 3NDBB 4B3BA 3P20A 3RYFB 1DAOA 2G28A 5K8UA 3E1KA 4GOND 2P4SA 5EJ6A 1JKFA 3JARA 4UHEA 4CCSA 2P3LA 1JEQA 4IS3A 3FGZA 4Y6RA 2F4VB 3N0RA 3BMCA 2BBWA 5CDSA 5CCXA 1MVLA 3UK0A 2QT1A 2B7BA 1EINA 4K28A 4YK7A 1E2JA 3R09A 4MAFA 3WRWA 3X1YA 4BMNA 3P0HA 1IZ0A 4YGXB 2IPOA 4DIFA 1Z4MA 2LUOA 1QB8A 3R6TA 3PPVA 4LNUB 1J8QA 1JJ7A 3UICA 3E5RA 5ADUS 4GI5A 2WE7A 3R5FA 2IOFK 1OT5A 2NNWB 3GT3A 1JDBC 4F86A 1M2OA 3E3MA 3PI6A 4FKMA 5DT2A 4EGQA 2YHSA 3KVNA 5DIZA 4EIWA 1QO9A 1YS1X 1HWYA 4V0MA 2PH5A 3LLUA 1S2IA 4R9RA 3PC3A 1GFSA 3FWKA 3EAGA 3WQBA 4EO4A 4A9AA 1DCFA 3FMGA 1VYTA 1Z4NA 2CNKA 2DUWA 5J4VA 3N2NA 4IBOA 4JEHA 3D6JA 5SY6A 2GX6A 2IEBA 4XKJA 3RHTA 1E77A 4LJ9A 2HWWA 1Y4UA 2NT4A 1LRKA 1FS6A 1C7QA 1NUQA 2J33A 2PKCA 3KHSA 3LOQA 3OICA 4W1QA 2QRMA 4POOA 1TJ3A 1WF3A 3K1TA 2ZZKA 3VJKA 2HPVA 3E15A 1FSFA 1LEHA 3EEYA 3R6GA 5B6JA 3KJGA 1U6JA 2D06A 1L5ZA 3JASA 1G55A 3T5TA 1G66A 1HM5A 1B15A 5IC6A 4PG5A 2X1HA 3CZ5A 5CT8A 4A0GA 2DETA 1KERA 2YWDA 4TUYB 3EZLA 4DIDA 3CLTD 2YHIA 1C7ZA 2PXCA 3AUTA 3C6KA 4WXHA 3BGVA 2HR1A 1LLUA 2XECA 1VDMA 2ZBQA 2H54A 4ND8B 2CVQA 1FFGA 1I80A 5BN5A 5EIAA 2H85A 4KMOA 2ECPA 3L0DA 1CQIA 3FNBA 2A2ZA 3TXYA 1FP6A 5J4KA 5HJ2A 1WZ2A 2ZIWB 1DHRA 1W52X 1G21E 2RCYA 4NU5A 3RV4A 1P1BA 3O9VA 5BW4A 1Y0BA 5BV1A 4CKWA 1T10A 1XNRB 1DG1G 3QXHA 3D4OA 1L4HA 4EHJA 3WDLA 3FYTA 1W4BA 2NU7A 3R23A 4UAVA 4ZCQA 1Y9AA 4ENQA 1PF7E 3KKPA 5ALQA 4TMYA 1YKSA 1HKUA 3B89A 3CG0A 3TOXA 1SVIA 5FNVF 5FOWA 4BVHA 4GRIA 2ZIUB 2W9XA 3L7LA 3TZCA 5JPDA 1N33B 2ID4A 3IBFA 4EUSA 1JB9A 4IXDA 3NWPA 3K32A 5LN1A 2FZLA 3PCTA 3R44A 3EOBI 4TQ9A 1VB3A 3CXUA 5JCPA 2X1MA 3A6GA 3R0ZA 4UBIA 1T8PA 4YDSA 1NNI1 1VLJA 2WTXA 3IEXA 3P1JA 4AY6A 4O1IA 5B3JA 1YCDA 2QPOA 3ABIA 3BEDA 2WWFA 2Z1NA 1XZLA 2X0JA 2Z57A 5BSTA 4N76A 4B2LA 1ZD2P 4GI2A 1PSZA 4RZUA 2HRZA 2VF5X 4D8UA 2F48A 3DH0A 3FWNA 4V2IA 4IYJA 4M60A 1QH9A 3NKLA 5LZ9A 3N2YA 4Y7CA 2YY7A 2F7SA 3OH8A 1VBFA 2B5OA 3HPQA 5ELMA 5B1SA 4F4IA 3E3OA 3KOXA 3ORYA 4ZVPA 3ZXSA 4EFDA 4IH4A 3T95A 5DX1A 3EH2A 4DC9A 3RIYA 1E7SA 3BF7A 3NEAA 1B43A 2C5GA 1T9HA 1JG2A 2ZUWA 4S35A 1LTKA 2HEGA 3SMQA 3BWCA 2ZU0C 1R4NB 2EKDA 4U3JB 4B3DA 2E4UA 5EP1A 2PRZA 1G18A 1UADA 2DY0A 3BD6A 3RASA 1FQOA 2PKEA 4I5EA 2MR5A 4P6VF 7MHTA 2AG1A 1QLWA 2CVZA 4HAWA 5BWBA 1KHHA 3MOIA 4BHTA 2Q4TA 4GNRA 4H31A 4OI0A 1OPXA 2PMEA 3HJTA 2AOWA 2ODBA 2A14A 4NYMR 3HB9A 1M2VB 4U39A 5FULA 3UFBA 4ZMSA 1P5RA 1T9CA 2FCAA 3MGBA 3QX8A 4JLUA 4RTNA 1T2FA 2ZT8A 3CRZA 3LY9A 1E0DA 4HLQB 3BAZA 4Q7LA 4XM2A 4ZJZA 5JH7A 1Z4QA 2OK8A 3RWBA 5KDDA 3PQ5A 2G25A 1KJZA 1DBQA 1JSLA 3F9IA 1EWKA 4OXQA 5ILGA 3V7YA 5IG2A 2NYRA 4X20B 3TSCA 4O4IF 4FIDA 1SCDA 2JGDA 1NL3A 4FBMA 4X95A 5KYVA 5F7OA 5KTKA 3ANMA 1TPYA 4TZTA 4HEJA 3ROZA 1S2GA 1WJGA 2VNAA 4LW8A 4MLDA 4QOEA 1RTTA 3Q5DA 4MW6A 2ZDGA 3DXYA 3I4LA 1IZYA 1K4YA 4Q3KA 2HGSA 4RCZA 4RQUA 3F8SA 4KLZA 4E5DA 3W5SA 2GDZA 2G5PA 4X3OA 1HYQA 3RYTC 3SOZA 4V0ME 4O63O 1NMXA 4IV8A 2H08A 1AG9A 2FX3A 4TLEA 4TYQA 3DMDA 5ALRA 5HGXA 1JXAA 1BQEA 1S2OA 3MTAA 4L02A 4UEWA 3FG9A 2VDWB 3TTUA 4KYVA 3DCNA 1BWPA 1I32A 2HWKA 1W35A 1E58A 1HZZA 1HYEA 3AV3A 3HP4A 4KGZA 2OBMA 2QVLA 3HRIA 4PO9A 5E95A 2OC9A 3RRFA 3VSCA 2IOFA 2C9DA 1BG6A 2QK4A 3HMKA 3NAQA 4UNRA 2FN8A 5JDCC 1BN7A 1RSZA 2FFQA 3MTIA 4H6WA 2XNCA 4K6KA 4GDFA 2BHRA 3NHFA 1HE4A 1UT8A 5JSZB 2BDTA 2L18A 1H6BA 1X1BA 3H5TA 2Z8YM 4AROA 4M1KA 5A0FA 3CBQA 3H9QA 1QQTA 1BS2A 3AF0A 2ARKA 4RGBA 2A94A 2NYVA 2Q9UA 4LPKA 4Q3OA 1OGIA 4JBGA 2GGSA 2IQ5A 1DAFA 4YP0A 4YMVA 1YUMA 2CHUA 1KSHA 2QQFA 5CVUA 2DSTA 1NRJB 4I55A 4DKJA 2WVGA 3IEUA 2W2QA 1YBHA 1B7GO 3CKKA 3LDHA 4HG2A 1VL1A 3MS2A 4L9AA 2FWNA 1DBSA 2AN1A 4EVSA 5BR1A 1C2YA 4LK3A 1QH8B 2YMQA 1MABB 1GZ3A 2RSLA 3IDQA 5F9MA 3K9FC 5COBA 5L4LA 5FPKA 4PYNA 3ECAA 2XEDA 4R3WA 4LF4B 2FEWB 3HMQA 3GBVA 1EXMA 3K9CA 1ZD3A 3CW2A 1F51E 1XALA 3D6AA 4OJKA 4NJMB 1HDXA 2CUNA 2HL6A 4L6IA 1QFJA 2FQWA 3WLJA 1VLHA 2Q6OA 3QF4B 3QVGA 4FNOA 3PXAA 4RXMA 4YH1A 1FVHA 1KVTA 3ILXA 3AG6A 1T8RA 3JS5A 4P98A 1ZEJA 2DKNA 2UV8A 4DABA 4EZIA 5HZMA 4S3MA 5K51A 4MGZR 4TVSA 2BI7A 2KE5A 5D3QA 2RIPA 3BSFA 3WHIA 4ZK2A 1KBOA 1KI2A 4IX9A 3T4XA 4EGJA 4B6RA 5DGCA 4R1SA 3G9XA 2PNFA 2O59A 1A7JA 1PL7A 3DTNA 5HA5A 2ZYVX 3A6ZA 4J4BA 3WICA 4C7VA 5I4KA 4C0QC 1C0IA 4MQMA 4BB9A 4US2R 2XE6A 3TCNA 5ICGA 2I4IA 3VU3A 4GC9A 4JBIA 4FCWA 1H65A 1TU0A 4HH4A 1YTUA 3Q7IA 1KAMA 3P8ZA 2IYSA 2JW5A 5BNZA 3B1VA 2AJ8A 4ZEXA 1M1UA 1NA5A 4FGLA 1YQWA 3PITA 2X1LA 4IDOA 5LR6A 2VNHA 1E9RA 2QR5A 4K6GA 3K5IA 2XQJA 1PG0A 3FIUA 4HTFA 4MVJA 3TRFA 3BH6A 2E4YA 3WADA 3OIUA 4EELA 1L4NA 1EVIA 2D2IA 1DV1A 3UK1A 4O2AF 1NMSA 4MV8A 5HK9A 1CD5A 1PNTA 2XYQA 2WKPA 2B92A 2ZLBA 2ZPUA 3LL4A 4F3TA 4RZQA 4GPD1 2NTVA 2GASA 2OHFA 1V43A 1U99A 5G1NA 1MHTA 3OA0A 2MHCA 4HZUA 2PS9A 2ZJ1A 1Y9DA 5AKHA 1XVUA 5DXFA 5EEGA 5B6IA 4CN9A 1ISIA 2O9JA 1P2DA 3FKJA 3LAWA 2OMEA 4YAFA 3QPDA 2NXCA 4CIXA 2YR0A 3D4IA 1ABEA 1D03A 1Z5OA 5JLJA 5I7FA 1U0SY 5KCZA 1GPH1 1LDEA 1PZGA 2QYOA 3KX2A 5B64A 1CJVC 1G8SA 1E3WB 5BSUA 1GR0A 3B6IA 4U0JA 4PZAA 4LE2A 5EZYB 4ZCMA 2H00A 3Q7SA 3GBPA 4P2BA 3ADCA 5F77A 4JLPA 4IM7A 1X7ZB 2W70A 2WU1A 1AH2A 3UMFA 1BJTA 2C7GA 2XQVA 1MHPA 4ETIA 1MPXA 3R40A 1GAXA 1FFWA 1G64A 1V1RA 3AT1A 3PUIA 4GKVA 4GLJA 3KZOA 2F1KA 1UBGA 3UPUA 1QE3A 4L78A 3H5AA 3W2EA 4G0ZA 4PBRA 4IAOA 5E6SA 5CCBA 5IEBA 3ZZMA 1P2SA 1JF8A 1XRJA 2IGTA 2JCYA 4E46A 1MOSA 4B71A 4X3CA 4H6PA 1N2XA 3M3PA 4GZ5A 4AMBA 2HIHA 1QG0A 1Y5MA 1MLDA 1CZHA 1NT4A 4P86A 2AMYA 3D7NA 4MRAA 2A86A 3NEJA 5K8TA 3NGXA 2W7TA 1BC5A 1USWA 2PUJA 2VATA 5JZBA 5PGMA 5DNDA 2JFHA 1QV9A 2QP9X 2BKVA 4ALKA 2O5RA 5KYTA 2E5WA 3LGSA 4M21A 3T7IA 4EF6A 3OF2A 3AEQA 2Q2QA 3E1GA 2G5TA 1OKKD 1W0KD 1ZGHA 3EEIA 5D5HA 5CITA 3K71B 1SD2A 4HGQA 3T3MB 3WGQA 1XWFA 2P7IA 4D9HA 5BNTA 2EYUA 4O4HA 2AN9A 3HN2A 4HXYA 3NVDA 1YONA 1UBNA 3NIGB 2GF9A 4NL4H 4EW3A 1FDIA 5DI9A 5KU7A 2JLVA 2DJ5A 2KLBA 3LP8A 1EFCA 2I78A 4TXLA 1HDRA 2Z2XA 5AJZA 3WWCA 1ZICA 4C08A 1WMBA 4Y0NA 3DMPA 1KJQA 3R75A 3DDSA 4FFVA 1GQ2A 4Y0VA 1QVWA 4ZYYA 1ULUA 4EG5A 4HXGA 1WSWA 3D7SA 1E20A 3DBLB 4U8GA 3AM3A 1TDJA 2MSDB 4I3FA 1GUAA 4I50A 4QO7A 1P2BA 3GNLA 4RDHA 1WDWB 2GTPA 3QE4A 2DKOA 3AUUA 4ZMRA 2CV1A 4R3NA 3GCXA 2Q4RA 4MIYA 5HQTA 1AMNA 3SJUA 2PSDA 4D4IA 2JCBA 4TMXA 3C4VA 1GA6A 1ZD1A 4F4UA 1FJGB 4X1KA 2P41A 2VOJA 3O8QB 3NAGA 1Z0JA 4A91A 2I2FA 3CINA 4K9QA 4IL5A 1YASA 3OPYB 4MEJA 3FZYA 5AKIA 3WYDA 3ZCPA 1BVUA 1E1QA 1NASA 4FW8A 4ZC8A 4NBSA 3R8CA 1PJCA 1H94A 2H0AA 2IUUA 4F4JA 4JNKA 3B1YA 2B34A 3ZN2A 4D0GA 3JTEA 1Z5WA 2XGSA 3ITNA 3STUA 4HUJA 3S2ZA 1P6XA 2DRIA 5D2CA 1Q6ZA 4S04A 2K4MA 4GBMA 2FRDC 4Q4AA 4PY2A 3FMOB 3EMDA 5E0OA 3ZTYA 3GRZA 2WNHA 4BY9E 3GF4A 3C1UA 2BFAA 4MGKR 3A10A 3HJCA 4PG6A 5MFZA 3SR0A 2ZTUA 1PEKE 3EG9B 3OKAA 1GAEO 1T2UA 1GTRA 1WL8A 2C4UA 4MVJE 2F8LA 4K9MA 3VO1A 3PNBA 2OWEA 4CM9A 1QH1A 3SC2B 3WY9A 4ZV9A 3JQAB 4IDGA 2C84A 3CXRA 1E7YA 4Q12A 5T8KA 5K6RA 2NLOA 4G5HA 1KY2A 2ZI9A 1NNEA 2GCNA 2PVCA 3GJYA 4EGFA 3BFXA 2IYVA 4QVKA 3ZWXA 3C4QA 2IW3A 1U2EA 2CZCA 2R44A 4NICA 1KH3A 2I1QA 2R65A 1NXWA 2JIRA 1P0IA 2WJGA 1L7RA 3HEMA 1CY1A 3TD6A 4AJHA 2Z5GA 3ZWBA 1K97A 3NFYA 2ZI4A 3FPCA 2HRBA 4QIHA 4XB1A 1DTEA 2C4MA 2XGJA 1OLUA 1SUAA 1G5FA 1MTOA 3QPBA 1RBMA 5FI1B 5AVJA 4JOQA 1KY5A 3ORFA 4DA7A 4R9NA 2VJAA 2A59A 2XB9A 5FL7D 4QBGB 3W77A 3WE7A 1U8FO 4O08A 3HU1A 2P3QA 3MUEA 5KBYA 4NIMA 1GPMA 2YJNA 3AUXA 2AL7A 3I01A 5E1BA 2X19A 3EVEA 1NMYA 2COKA 5K4GA 1P1HA 3WIDA 3VNSA 3Q9SA 2OZKA 4HWRA 1F4PA 1NVVR 2PUHA 3NDJA 4JWKA 2Y2VA 3W6PA 2IF2A 1B1AA 1RAEA 1E0SA 3FWHA 1QLJA 2I4LA 2AJLI 3QIVA 4N47A 3ZDZB 4CXMA 3VJRA 1N5JA 2XE8A 3I45A 3MYRA 4MUMA 3ZD8A 1OLXB 2K5UA 3OZCA 2OVFA 1WHSA 4I2NA 2EARA 3GVHA 1M5TA 2OK7A 5JLAA 2EBWA 4D9FA 5FTKA 1J9EA 3OQ1A 2YMPA 2JGFA 3SBEA 3V32A 3NC1C 4UM7A 4BMZA 1JB1A 4B7ZA 1V8DA 4S0XA 4ZD6A 3FF4A 4BKUA 5L4SA 3FOFC 1ID8A 2PXXA 1MJ5A 1RYFA 1XAIA 1XU7A 2HA6A 2XAUA 4DPMA 1PVOA 1OY1A 3HY4A 5EIEA 2C77A 4KLAA 1V37A 4LXYA 5K0SA 2HDHA 3AI2A 4MQFA 3UJ7A 1EFPA 4YO8A 1T2AA 1UPTA 4E3WA 4ENSA 1RQRA 4GT1A 3GEDA 2FYTA 3ZCTA 2HGZA 3MZ0A 2Y9MB 2HD4A 3EIHA 2A0WA 3QIAA 3T7TA 2LXNA 4CI0B 3MBOA 1XJ0A 1AKEA 1QTQA 1Q1GA 4F84A 4UCXA 3ZNNA 4HDOB 1PFKA 5AICA 1IN6A 2G1KA 2WSIA 4NDAA 2GAOA 2QVGA 4OJYA 1B4DA 2GZDA 5I5EA 3KJXA 1GPUA 2R1VA 3AERB 2GYYA 2WYOA 1FK8A 1W88A 3G8BA 3OHPA 5DNWA 1JIXA 5TJ9A 1X0XA 2BEUA 4MITA 1K7XB 1Y7HA 2B99A 4G1CA 4GKJB 2EJBA 4A1FA 3LFTA 4H0FA 1JFLA 2NO5A 5K0JA 3AKYA 3SMVA 3SEFA 4EL0A 2QQ5A 2Z6VA 2IH2A 3D3KA 3LUJA 5E3HA 1E7WA 1LFAA 4ZQIA 5CCDA 3VNBA 3W5HA 2X0DA 4I46A 3WNQA 2Y66A 2ATCA 3GFQA 1C1YA 2JA2A 1XPJA 3BXPA 2BFEB 2ON6A 1I4OA 1I3LA 1QF9A 4LHSA 3EVBA 4DTIA 3FTCA 1W9MA 1QWSA 1NIPA 1OZ0A 2NXEA 3EA0A 1QYWA 3PICA 1CSEE 4O2BA 3B48A 3EZ2A 3UXEA 2XH8A 1O97C 4ZTZB 1Y1QA 1Y9ZA 2XVXA 1JFSA 5KMGB 3QK7A 3EIWA 5TMBA 1QGUB 2ZUBA 3R1IA 3C3AA 3FVTA 4GR5A 4HDSA 10MHA 3L84A 4DHWA 2V65A 4BLRA 5C1PA 2ZE7A 4MDYA 1II8A 2ZIFA 4X8H