1EUCA

Crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
306
structure length
306
Chain Sequence
CSYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 118
structure length 306
sequence length 306
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eucA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1eucA01
2I9PA 4MVJA 4K9DA 5LDGA 5FF9A 2CVOA 2RHRA 2WYWA 4MKXA 3EUWA 3ZWPA 4GQAA 3KVOA 4H7PA 4IXWA 2CF5A 3W8DA 1ZZEA 3GHHA 1Y5RA 3RUIA 3UH1A 5LC1A 4D45A 8ADHA 2DUUA 1K89A 4TRNA 3T7EA 2Z5LA 3GMDA 8LDHA 1EFLA 3BTVA 5CEEA 1PGJA 2J3HA 1WLYA 5L4LA 3AUSA 1LDEA 1DO8A 5G0TA 2BGLA 3GR6A 2VWPA 3IL2A 4UVIA 1SOVA 1BMDA 1GZ3A 2YV1A 1D8AA 1P74A 1JKFA 5B4TA 1GUZA 4CM6A 1EQ2A 5H83A 4RVUA 4NFHA 5ENDA 3OQBA 4BNMA 1QLHA 3MJCA 1F14A 2C54A 2GRAA 4O59O 3BMQA 3ON5A 5BNTA 4HUJA 2HRBA 1VE9A 3GNTA 4JJIA 1IYZA 3BIOA 3AY6A 2IODA 1EVYA 5K6AC 1VC2A 4RLHA 4CR6A 1I8TA 5EINA 4ALMA 4XX0A 1XQ1A 2Q1TA 4BNIA 5AOVA 1UDAA 4IQ8A 3R3SA 4K1LA 1I3MA 5EN4A 3R6DA 2Z1MA 3DMYA 3WXBA 3N74A 5JMWA 4FOOA 4GX1A 1HSZA 4RZIA 1QXSA 1HDZA 2QRKA 3JQFA 1PQPA 4S3MA 1Y8RA 2P91A 3MCVA 3AM3A 3I4CA 3U4IA 4FJ1A 1R16A 3DONA 3PWZA 1ZXBA 3K96A 4UVDA 1UXHA 5DCUA 4E2ZA 3IDSA 4DPMA 1O8CA 1LDYA 2X8LA 4BO9A 3W4JA 1K6IA 1SB9A 2C59A 3W8EA 1QV6A 3U49A 1OC4A 5KVQA 5F5NA 4CR8A 3DBVO 1MP0A 3M1AA 3KLPX 2X9NA 4DLAA 2JCVA 4GSLA 4I5DA 1UUFA 1U5CA 4J0FA 5TX7A 2PFGA 1XGKA 3JYOA 1Q7BA 4MJLA 2YUTA 3AU8A 2X23A 2NQTA 2NQ8A 4MO2A 3F1KA 5L45A 1CDOA 1HYEA 4YACA 2WD7A 3WIDA 1ONPA 5IZ4A 3FWNA 3PYMA 1NQTA 1YVEI 3HFGA 4A10A 3NGXA 4XQEA 3WFJA 4F3YA 1GDHA 4Z9XA 5BSGA 2VTDA 3QJ5A 3NJ4A 4IIVA 4BKRA 2EW2A 4J1QA 5GY7A 4J7CA 3S8MA 4LMRA 4OL9A 3WIEA 5HS4A 1IOLA 3DL2A 2EP7A 1OBFO 3DEYX 4DQXA 4W7IA 5HTOA 1H6CA 4XB1A 4B4UA 4FQ8A 2GCGA 2VYVD 3P2YA 5AQ1A 3PPIA 1U8XX 1HDOA 1ZSYA 3JD0A 3NDIA 2BFPA 2W4QA 1GQ2A 1XSEA 2W2KB 3WSWA 1YDWA 4J1NA 3ZWWA 4PG6A 2FPGA 2XOXA 4FPXA 3WQQA 2AHRA 4DC0A 2NVUB 1B3BA 3RC1A 4OAQA 4ONEA 3FHLA 4NJMB 3NT4A 2A4KA 4N54A 2YFQA 3EZLA 4GPD1 1HDXA 3KYCB 3WJAA 1V0JA 1S6YA 5JCJD 5I7EA 1JAXA 4ID9A 1PS8A 4FGSA 4U6QA 4IDGA 1XLTA 4F46A 2AEFA 3SC4A 1B8PA 3WMXA 2DUWA 3AOEC 3D64A 3FR8A 3JQBC 1NASA 2Y0EA 1G0NA 2FHSA 3OQ6A 4Q3AA 3MTJA 4ZJUA 1HEUA 2AW5A 3DMTA 4R68A 4NFYA 1JN0A 1EUCB 3PJDA 3RU9A 2BRUA 4JJFA 2EJWA 3U09A 3LF2A 1J6UA 3L6DA 4ALIA 2PZMA 4NG5A 5T67A 3GG2A 3ZI0A 1IULA 2CSUA 2IZZA 1ADGA 1LLCA 1LUAA 4R54A 2JFFA 1TLTA 4EBFA 1H6DA 4BNZA 1B16A 5KTKA 4HP8A 4BQPA 2BKAA 4M8SA 3FNGA 2D5CA 4UVHA 4BV9A 4BNWA 5A03A 4XKJA 2OZPA 5CDTA 3MTGA 1I5RA 3WG9A 4BNHA 5A5EA 6ADHA 1ZVMA 3GMSA 4CMHA 2B4RO 4YEDA 4CJXA 4HNHA 1PGQA 3NV9A 3UW3A 5HRUA 4XA8A 4DC1A 4J7UA 4PFJA 4EJMA 4DPKA 4XIJA 1HE3A 3AI2A 4Y98A 4PN3A 4BO6A 3WLFA 3CMCO 4MVJH 4NBRA 1E7WA 5L53A 5CG1A 2GYYA 4UREA 2PH3A 3UCEA 1QMGA 3BYZA 3R0IA 4Q3NA 5FWNA 3ANNA 4JGBA 1YXMA 4B79A 4DQUA 1YL6A 2B5WA 1PJ3A 3ITKA 3JYLA 1AGNA 4J91A 5THKA 3SJUA 4Y6RA 4L4SA 5HS6A 5C37A 4RVSA 1ENPA 4CMJA 2VUSA 3F47A 3L4BC 4M55A 1GZ4A 1LRJA 1DJQA 2QYSA 4N18A 2F00A 4UUMA 3OHSX 4FJ2A 1E6UA 1LDGA 1H0KA 5KWEA 1LSOA 2X0NA 3D5QA 2ZB8A 3WGHA 3WYBA 2VUTA 3OECA 3X2EA 3CTMA 2AXQA 2E37A 4LCJA 5U1PA 1EVZA 5CG2A 3ZU3A 3TZKA 4BO2A 1CETA 2XXBA 1EUZA 5DOZA 2VHWA 4J1SA 7MDHA 3GVIA 3VVCA 1MFPA 4WASA 2NUAA 3KB6A 2VWGA 3MWDB 3CMMA 1OAAA 4Q3EA 3K73O 2UYYA 3ZV5A 3K6JA 4RF2A 1P9LA 4XD2A 2VNSA 2NU9A 3GEMA 3SEFA 4EW6A 1FDTA 2XAAA 1P3DA 3WDSA 3FSRA 2YZ7A 3I6QA 3I9KA 1KVTA 4IGFA 2HAEA 3BMCB 1CQIA 3L6OO 3ROMA 3U9LA 5G0WA 3JQCA 3WTCA 4BS9A 5C7LO 1XWFA 4NNJA 2CUKA 3RC7A 1OFGA 4RV9A 3KSUA 1LA2A 1H2BA 1M2WA 1P0CA 4Q3BA 3JQ9C 4LRTB 4YJFA 5G0SA 4ROSA 3TL3A 3H9QA 2PD6A 3PK0A 1LC3A 1OMOA 3DBLB 3ETEA 4A0SA 2GN6A 3LVFO 1T2FA 3WTBA 1GYQA 1JKJB 4BIIA 1PJBA 1VPDA 4J9UE 4CLHA 4BB6A 1A9YA 2DLDA 1YQGA 2JHFA 5I9LA 4XYMA 5DF1A 4CQLB 1RM4A 2HU2A 1BHSA 3QWIA 1T24A 3PYLA 3VPXA 1TVEA 1CIVA 1EDOA 4O1MA 3ROQA 3EGOA 2GN8A 3DOCA 4INAA 3H5RA 4D44A 2G82A 3UICA 4GL4A 3CXRA 4Q3DA 2PNFA 2NU7B 3CE6A 3HDYA 4MVJE 4II2A 5C7OO 1XU9A 4KTVE 1QYWA 3ZWMA 2Y1EA 4KWHA 3DAGA 1PGPA 1T1RA 3F9IA 3I23A 1EVJA 1SO8A 2VT3A 3BMOB 2Y99A 3B6ZA 5GZ1A 2FSSA 3DTYA 1C3VA 4GMFA 4CM4B 4CQMB 2EGGA 4RO0A 3WGYA 3SLGA 1KEPA 4OJNA 3TOZA 4G5HA 3I9JA 3TF5A 2DTDA 3PZRA 4CL8A 4WOJA 2FOIA 2W2LD 2DVMA 3INGA 4N5LA 5COBA 3GRKA 3P7MA 5EPOA 2BI8A 4PVDA 4XYEA 3V1TC 3ZNQA 1IY8A 1WXDA 4WCFB 3QVWA 4EUEA 2CVQA 4RVFA 1ID1A 4J3FA 4HFNA 3QY9A 4WKGA 4BGIA 2DBQA 3HFSA 5JAQA 5TF4A 3PP8A 3EHEA 1PZGA 4Z0PA 4FFOA 4XQ9A 2V7PA 4B4VA 3MJTA 2CY0A 1KVSA 4CLXA 1ADBA 1ZIDA 5I7SA 2Q2VA 1DSSG 4EITA 4QO8A 3ANLA 4WE3A 1NVTA 1SPXA 2FY8A 3VPGA 5JPIA 4WECA 4B8WA 4C7JA 3MOIA 2GR9A 4UUNA 1PJ4A 4TSKA 5IZCA 2VCYA 1NWCA 1C1DB 4PLVA 1PR9A 4HX5A 5TQVA 2P9EA 3W8FA 1LJ8A 4CV1A 3GPIA 2WSBA 1P1KA 5EERA 5DN9A 4Q39A 5G4KB 3SLKA 4HWKA 3QP9A 2ZTMA 3RBVA 3PHGA 1I3NA 3PQEA 5A9TA 1I33A 1JU9A 3PI7A 5A3VA 2D4AA 4E6PA 1P1RA 4NBUA 2J3JA 3UXYA 1CYDA 3K2EA 4I08A 3VH3A 3GZNA 2RAFA 3WJ7A 4ZICA 1LX6A 4GX5A 2DFVA 2OXIA 1WVGA 1RM0A 3JYNA 2AE2A 3D0OA 1P44A 4W9NA 2JCYA 4R5MA 3OF2A 1FJHA 2TMDA 1KEWA 1KOLA 1K6JA 2DBZA 1ZNQO 3CIFA 3LC2O 3AWDA 4TWRA 2EWMA 1R0LA 4A2CA 3EZYA 1OOEA 3AI1A 2AQIA 1X0VA 2VOEA 4A5OA 4IUYA 4J90A 3RCBA 1YB1A 3V2UA 4BO5A 2VWHA 4IQGA 4RGBA 1PS9A 4QT0A 2VHZA 4TMFA 1U7HA 4Z9YA 3HB4X 4CL3A 1O95A 3OQ1A 3H9UA 2PWZA 3TRIA 2J6IA 1PS0A 2YY7A 3NDJA 4IPTA 1DB3A 4PZDA 1DHTA 4ZRNA 4CLOA 5JDCA 4CM8A 1JVBA 2NSDA 3DHYA 4NR0A 3ORFA 4BO1A 1M67A 3O38A 3RKRA 3ZWAA 4ALNA 3OEYA 4A27A 1XCBA 5CDUA 2F1KA 2PY6A 2OUIA 4P4NA 4MP6A 4RQUA 4BKOA 2DBVO 4OQYA 1NPYA 1EUDB 3Q2IA 2OHXA 4Y8VA 1I01A 1A7AA 5K0ZA 1LLUA 2OORA 2O4CA 4MP8A 4AJJA 2BELA 5C5IA 1N9GB 4OYRA 5JO9A 1NAHA 6LDHA 1PQWA 1KERA 1W4ZA 3CH6A 4AG3A 4HV4A 3JQGB 3JD1A 5JE8A 1EEHA 2GZ2A 3VDQA 2DTXA 3UFXB 4XDYA 3H3JA 2VRCA 1QP8A 1ZO8A 1SB8A 4N7RA 1NFRA 1X14A 1EMDA 4U7WA 1E7QA 1ZK3A 5TGDA 3AK4A 1HL3A 5JYEA 1RM3A 1P1FA 3KSZO 5DOVA 2EG9A 3UUWA 2J8ZA 1G0OA 1I32A 3LT1A 4K6CA 3D3WB 2X0IA 3H9JA 1HDRA 1WP4A 4FS3A 1VSUA 1VRWA 2HO5A 3JTMA 1JW9B 1M6WA 3K30A 2I99A 5CEJA 2JJYA 2I3AA 1GUFA 4JP2A 4WPGA 3JD4A 2GDZA 2Q3EA 1DRUA 4IZIA 3BTOA 5KJFA 3IKTA 1NYTA 1HLDA 4DMMA 1H6AA 2HMWA 5T5QA 2XXJA 1A71A 1MUUA 3WICA 3BXXA 3VH4A 1QYXA 1PGNA 1PQUA 4H3VA 3H9EO 3E9QA 1B15A 4GI2A 1HDYA 3BZUA 5I7FA 1O5IA 3D1LA 2DQ4A 2ZK7A 3BMNB 2B36A 3Q11A 1TEHA 4NIMA 3RFXA 1K3TA 1ML3A 4LMPA 1HWYA 1E5QA 2FZWA 2V6BA 1H9AA 2O3JA 4N5NA 1YL5A 1ZXLA 1X0XA 3ROKA 1SZJG 4OIMA 1X7GA 4LK3A 5HWSA 4EJ0A 4MINA 3U4HA 1CWUA 1YKFA 4R01A 2EJVA 2VYND 3F46A 1PR3A 1SEVA 1ULUA 3G1UA 3GK3A 5C3MA 5AXCA 1BXZA 4ZQBA 4P22A 5JAMA 1E3JA 3NYWA 2CNBA 4OXNA 4AJ1A 3ZV6A 4FBGA 5CPBA 1KY4A 3BHJA 4CODB 4PLZA 1AXGA 3VZSA 5IZCC 3O8QA 5JAZA 3RIHA 4RF3A 3AFMA 1GD1O 4WEQA 2H6EA 4CPDA 1QKIA 1Q0LA 2X9VA 2W98A 3PLNA 2OMEA 4CMEA 3JQ8B 3JQAB 3TSCA 1X1TA 1TT5B 1PJTA 2J5QA 4XWYA 3KTDA 3Q3CA 2FN7A 4CLRA 3IJPA 4CLRB 3FD8A 3FCOA 5DULA 2H9IA 3GVXA 4D0RA 2FPPB 2OP0A 2WMDA 3KEOA 1E5LA 1T2EA 4YJGA 3QVOA 1DFGA 1R4MA 1R4MB 1KS9A 4TVOA 1PU2A 1Z73A 1RYEA 4GSKA 3RD5A 5CDSA 2I67A 2VHVA 2PKQP 1DOHA 2ZTVA 4I9NA 1E1MA 3GRPA 5TS3A 4DQVA 2FP4B 1IE3A 3ENKA 1E3WA 1Y9EA 4J1TA 1R4NA 5HA5A 1M76A 5U4QA 4J4HA 1I2ZA 2P2SA 2O2YA 2C5EA 4LSMA 1Q2XA 1ZKMA 3LSYA 1LEHA 1BWSA 1KC3A 1U9JA 4MKZA 4XIYA 1QYDA 2WYVA 2GZ1A 3S2EA 2IXBA 4BO4A 1LU9A 3EMKA 4XYBA 3QHAA 2D3TA 4L0QA 4YJHB 5CAEB 3E9MA 2DU8A 2Y0CA 3JQDA 5L3ZA 1GPJA 1ONOA 3LZ6A 4GKBA 3DDNA 4EUFA 4P4GA 4IY1A 3B1KA 5JYDA 2LDXA 4LGVA 3W4KA 3T4EA 5H82A 4I9UA 2V65A 1CF2O 1R15A 4E2WA 1I2BA 4AJPA 4JXKA 2ZCVA 4R9SA 3DZGA 3PIDA 1QR6A 1F12A 1GCUA 3I4FA 1E3IA 3OICA 2JHGA 3NDRA 1GFSA 1Y7TA 1GPDG 2VWQA 2HKIA 3V2HA 1HZJA 1QYCA 4ITUA 5COAA 4D3SA 5TIIA 1D1TA 2DPGA 3BHMA 3W4IA 2YFHA 3WMWA 4ZQEA 3U3XA 3WR5A 2FPIB 3QWAA 4P8RA 2VZ0A 3H8VA 5ICSA 1DLJA 1LDMA 3GEGA 4E31A 1N2SA 1GTMA 1R66A 1DLIA 2CMDA 3JQ7B 4UUOA 3TOXA 3PRJA 1YRLA 2PZLA 3F5SA 1I3KA 1X13A 4JLWA 2UAGA 3ENNA 5KJ6A 1UH5A 5JC8A 3TWOA 5KKCA 1FDSA 1Q7GA 1SEPA 2EKPA 3RUCA 2X0JA 1OI7A 1DIGA 4MVJD 4B7CA 2HK8A 4IBOA 3SJ7A 2D5AA 4E5PA 1PJQA 1C1XB 4E2YA 4YAIA 2OGUA 1X7DA 2CZCA 2HDHA 3HN7A 4XZ3A 1VSVA 3ZZNA 1EQUA 5CDYA 4IS2A 3PGJA 1VL6A 2GD1O 1C0IA 4NDNE 3I1JA 3TZ6A 4UUPA 1NM5A 1CEQA 1ENYA 1E6EA 2NADA 3NJ8A 2EKQA 1BW9B 3GNQA 4E5KA 1E77A 1UJMA 1MV8A 2BLLA 2IEDA 1NWHA 4ZVVA 4LVCA 4WEOA 3RFTA 4CMGA 1N5DA 4YXFA 2DFDA 4AJHA 5LDHA 2AEMA 3GVPA 5IF3A 4CMBA 1K0UA 3I83A 2PKQO 4BNXA 3I5MA 3OJEA 1VKNA 5L40A 1PL6A 2BH9A 4YBZA 5JFOA 1DIBA 2I5PO 2RH8A 4ALLA 2FR8A 3LT0A 1L7EA 1EK5A 3LC7O 3TL2A 1BXGB 1HSOA 4R4JA 1DHRA 4WOKA 3DZFA 4MIOA 4UVEA 4AJOA 1PJCA 4OXYA 3JSAA 3WNQA 1MC4A 3EVNA 4GLOA 5JMPA 2HUNA 3RWBA 2ZTUA 4PLFA 3CUKA 3E48A 1DEHA 3ZU5A 3GUYA 1XHLA 2FRDA 4GWKA 4Y9DA 3RU7A 3DZIA 1OZAA 4A73A 4BKPA 1LDBA 1JTVA 1NPTO 5F1PA 1NR7A 3GN1A 3C3XA 5JCXA 4XRRA 2E4AA 4BNJA 2NU8B 2C29D 3ZNOA 4LCEA 1YBAA 3FTPA 2HJSA 1TT7A 2OOSA 1V35A 2O3UA 2HCTA 3AM5A 3F5QA 3IKVA 2W2KA 4PVCA 3OETA 1E1LA 3PYXA 4NJOA 3TFQA 4XRGA 1YS4A 1PZHA 1A5ZA 4FIZA 3RJ9A 2ZJ1A 3LC1O 1F06A 2NVUA 5BNFA 2FR1A 2GPTA 3QSGA 4R41A 4NJMA 1U1IA 1DRWA 3B1FA 3M2PA 1GV0A 1LLQA 5JO0A 1KEVA 3H6KA 4IJWA 3KYCA 3H2ZA 1BSVA 1GCOA 3LT4A 4YAKA 4TZTA 2VZ8A 3HSKA 1O0SA 1E3SA 3OA2A 2Y1OA 1FDUA 1T2AA 4I9HA 4ND4A 1L7DA 1JLLB 1AHHA 4QQRA 1ONNA 4ND5A 4DYVA 4E30A 4E5MA 2G76A 3CSDA 3UAGA 3NX4A 1N1GA 1PL7A 2OBYA 1EUCA 4BMSA 2VQ3A 2YDXA 2YW9A 3AUUA 2H63A 2PZJA 1LTHR 1MG5A 1B8VA 5BSFA 4O63O 3QVSA 1ZCJA 3IJRA 4YRAA 3VPSA 3ETGA 3HDQA 4A26A 3WQSB 1C14A 3K2BA 3I52A 2UVDA 1EZ4A 3VHRA 1B8UA 2XF8A 2Y67A 5A3JA 5JW6A 1UZLA 2HMTA 4NBWA 2V6FA 3K5PA 1LRKA 4ESOA 4BO8A 3ZU2A 4OSPA 4GVXA 5A4DA 4DXHA 2G1UA 4YRBA 2ZYGA 1E3EA 3PGXA 4BOYA 3DHEA 5ILGA 4DA9A 3W6ZA 3B70A 3DTTA 1FDVA 3GVHA 3Q2KA 1UDBA 2SCUB 4XGNA 5ER9A 1E7YA 4GGPA 4IDBA 1XELA 4K28A 2FWMX 4IINA 4FJ0A 3IIEA 2JAHA 2UUOA 4R16A 2VZ9A 4TROA 1KVUA 3NEPX 4BVAA 3H7AA 2WE8A 3LLSA 5ICMA 2NNLD 3WGOA 2YHIB 4R1SA 4XJSA 1PJLA 5JSFA 1BDMA 1ISIA 2J5RA 4ZQHA 2ZCUA 1Y8QB 4RDHA 4EEXA 2PZKA 1PL8A 3BTSA 3MJSA 5FI5A 2W90A 3U0BA 3UHAA 3KLMX 2PKRA 1Z7BA 3HQ4O 4L8VA 4GVLA 1UP7A 4B3HA 4CM3A 2VN8A 4JBIA 1KIFA 2O3RA 2Q45A 1UR5A 1AUPA 4CMIB 4L76A 1P33A 3FTNA 2B4QA 1LBEA 3JQFC 5A06A 3DOOA 1ORRA 3G1TA 4KQWA 3VH1A 5CP8A 3RQSA 4QX6A 3GH3A 1GY8A 2P5YA 1EFKA 3C1TA 5A9SB 1XG5A 1YB4A 3DAFA 1H94A 3MWDA 2GNAA 3WYCA 1GR0A 3VZQA 3MJVA 3LDHA 4R3NA 4ZRMA 4TRJA 5G0VA 1LSUA 3FBTA 1T4DA 4CMCA 1RJWA 2WD8A 1GUYA 4J7XA 5DBIA 4ZQFA 5JXWA 4IDFA 3WWYA 1ZW1A 1Q0QA 1IPFA 2BGMA 1JA9A 4AJLA 1L1FA 3BMCA 4BV8A 1FF9A 4HFMA 4MKRA 1EBUA 1EE2A 2YJZA 3ST7A 3VDRA 1GYRA 4YQZA 1R0KA 1GYPA 5C7IO 4UAGA 3GGOA 4Z6KA 1OC2A 5EESA 1U7TA 3D4PA 4FOSA 4BO7A 4E32A 2WEKA 1IUKA 2P4QA 5DCYA 2AG5A 3PXXA 4QXMA 4JROA 1ADCA 3UOGA 3GFBA 3DBLA 2IZ0A 3WS7A 3H9GA 3MJEA 1JKJA 2VNAA 3EW7A 4LVUA 2NVBA 3ZDFA 4ND1A 4NU6A 1A9ZA 4TVBA 5DBGA 3GUCA 4PLTA 4TRMA 4MVJF 4B4WA 4CQLA 1IB6A 4WNCA 5ADHA 5KIAA 4NI5A 1Q0HA 2GASA 4I5FA 4NH4A 4YT4A 3AM4A 3SBOA 1AHIA 2E6UX 4Y6PA 4A03A 4CLEA 1M75A 5L7YA 4BNUA 3DR3A 4K26A 3T4XA 2G17A 3GA0A 2VOJA 2NU7A 5A9RA 1N7HA 3DBHB 4KUEA 2WJPA 4HFJA 4NHEA 2UDPA 2Y68A 1E6WA 3E8XA 3DXFA 1SMKA 1V6AA 2IZ1A 3EDMA 4AJ2A 4UEOA 1A4UA 3BMOA 5I7VA 2AQ8A 2J5KA 4JQCA 5TRTA 1E1NA 4CM4A 4CQMA 1P1IA 2X58A 3DMTC 4IZHA 5TT0A 4EGFA 2DKNA 2VHXA 3CKYA 4DIFA 1NHWA 1UAGA 2JD2A 2GO1A 4KQXA 5IDWA 3L77A 5DDIP 3VTFA 2B83A 4GH5A 2AA3A 1H93A 4XB2A 1G6KA 2B5VA 1VJ1A 2Q46A 2X9GA 4WCFA 5DP1A 4LN1A 3WGTA 5JDIA 4ZHSA 4Z9FA 3QV1A 1PTJA 4BNFA 4YCAA 2B0JA 4IDEA 1VL0A 5K9ZA 2G5CA 2X7HA 4RDIA 3WBBA 2IEBA 1BRMA 3E1KA 3IUPA 3IMFA 1NPDA 1KEUA 4OKNA 5B4UA 3RUEA 1LI4A 4CM5A 1DC3A 4YDRA 5BR7A 2HMSA 1P45A 4RVDA 3ZWOA 5MDHA 4PG7A 3H5AA 1LRLA 4YWJA 3RJ5A 3JQ6A 1C1DA 2CF6A 2Y1CA 1LQTA 3DFZA 3TNLA 2OBNA 2EKLA 4AJ4A 2ZB4A 2JKVA 2WM3A 3AW9A 1K6XA 3R3JA 1WMAA 2EERA 3GGPA 4XYLA 1HDCA 5JLAA 4IGEA 1Y1PA 3P2OA 4I5EA 1A72A 4MP3A 5G4KA 4FDAA 2VUUA 3SC6A 3PJGA 1YWGO 4YJDA 3ZHYA 1P1HA 1Y9AA 2JFHA 3FI9A 1O89A 2NU6B 4E13A 1QG6A 3C85A 3VKVA 2R2GA 1K2WA 4RZHA 2WE7A 2ZYDA 1BG6A 5DT9A 5LCXA 3N58A 3BAZA 3RVDA 5DNAA 1LQUA 4AVYA 1ISHA 3V2GA 3HUDA 2B37A 3ICCA 4J4TA 4WLVA 3ZV4A 3AU9A 3ULKA 1E7MA 3MWEB 2WYUA 2C20A 3IOYA 3PTZA 3HADA 4IJKA 1V8BA 2QW8A 2RCYA 2NM0A 3C24A 4NK5A 2ZJ0A 3DC2A 4RPJA 3KO8A 1YH3A 4ILKA 4ZN6A 1FK8A 4KZPA 2X0RA 3EK2A 4RL6A 4BNKA 4NFSA 2X22A 3FRJA 3QE3A 3ZGYA 3GF4A 1HYGA 4D3DA 3RKUA 3ASVA 1R0SA 3G0OA 4XGIA 3NTRA 1DIHA 4BMVA 4F6CA 1ISMA 3EYWA 1DIRA 1MFZA 3DZKA 3MJ4A 3IP1A 4BO0A 5I9NA 1SCUB 2C5AA 2E82A 5JY1A 3OJOA 1JWAB 3OM9A 3RFVA 2H5LA 4CR7A 2DTEA 1T25A 1T1SA 1ZK2A 4BGVA 1E7RA 3LU1A 5CFZA 3V1UA 4PLPA 4PG4A 4NU5A 2P4HX 4UULA 4ZD6A 1EUDA 2P68A 3KXDA 1ISGA 1M6HA 4BKUA 3Q9UA 4EDFA 3I9NA 1CRWG 2QX7A 4E0BA 1N9GA 3GOHA 2EV9A 2X86A 1NX6A 4YT2A 1PZEA 3RC2A 1MG0A 3GGGA 5MGBA 3KOUA 3FBGA 1X1EA 1T26A 1CERA 3JQGA 3UFXA 2BHLA 4I5GA 1T2CA 3AI3A 1I10A 5JNLA 2D1YA 3NTOA 4WLFA 4JK3A 2DPHA 2Y1GA 1KVQA 3QLJA 5F21A 3ZW8A 5KVVA 1SOWA 3CINA 1I3LA 3D3WA 4X54A 5COQA 3STHA 3UKOA 3DHNA 4DLLA 1XU7A 1LSJA 2YHUA 1DXYA 3HNPA 4M86A 4DBVO 4YPOA 3B1JA 3DBRB 1SNYA 1LLDA 1YOVB 4DBZA 3ZNPA 2DT5A 3KYDB 3LF1A 2P5UA 1CJCA 4BB5A 3OP4A 4J0EA 3GVCA 4DIOA 5T8KA 2YDYA 5IN4A 4DWVA 5KOIA 3OIFA 3E18A 3VKUA 4U6SA 3GPDG 1KETA 1S7CA 2A9FA 1Z74A 4XJTA 2VRBA 3L9WA 3KRTA 3Q1LA 1YB5A 3BMNA 3JQEA 4WUVA 4ALKA 5A02A 1B26A 1VL8A 3GDOA 1SAYA 1WW8A 1GEGA 2Q99A 4MIYA 4J43A 2VRCD 5JDIC 5JS6A 5K6AA 3A1NA 4QSMA 3QRWA 4PG5A 3JCZA 1Q1NA 3WGQA 3UCFA 1PEDA 2JCXA 4HY3A 4W4TA 4CV2A 4BUCA 2PR2A 1U2DA 1YQDA 2Q1WA 2X5JO 3A28A 1RPNA 3OMLA 5BSHA 4BGEA 5ES3A 1AN9A 3RBZA 4CUZA 4DUPA 1BXKA 3A06A 4NZ9A 1XYGA 3F4LA 4IDCA 2EEZA 3HDJA 2TMGA 3OEWA 4GX0A 3EY4A 1SBYA 3HZZA 4E12A 3I9OA 1H6BA 2O3SA 3GZ4A 4W6ZA 1IZ0A 1NVGA 3PVZA 2Q50A 3KSDO 1KYQA 4L4XA 1UAYA 3JQ8A 4BKQA 3JQAA 4IJUA 3C7CB 3PQDA 1TT5A 4RPGA 2HMVA 1AXEA 1D1SA 3QVXA 1WMBA 2QRJA 3K31A 3V5NA 5JAIA 2BF7A 3TZHA 2NTNA 2ZTLA 3TZCA 2BFOA 4B7XA 4CV0A 3KHUA 4CM9A 2IDZA 2FPPA 1GQYA 4D3FA 2BI7A 3F3SA 5IFLA 4KMSA 2JL1A 3NT2A 4YVFA 1UDCA 4PLWA 3T7CA 4B3JA 4D46A 1LC0A 3GAZA 5EQFA 5A04A 4XYGA 2HMUA 4DTIA 4PZCA 2AMFA 2CVZA 4M1QA 1GQQA 5F3RA 4W99A 4IQ0A 4DGSA 5H81A 3D4OA 1RKXA 4IIUA 3AY7A 4BNYA 5L51A 4JIGA 4W9NC 4D0SA 2FP4A 1ZSVA 4FFNA 3WQRA 1WDKA 5CEFA 5IJZA 5L4NA 1EE9A 4BL5A 2AEJA 1VKOA 2R6JA 4RJTA 4CUKA 1HKUA 1NFQA 3GAFA 3M2TA 4PCVA 4NPCA 2FMUA 1F8GA 1DC6A 4GWGA 2FR0A 1N8KA 1C0KA 2NV6A 2O50A 3GDFA 4YJHA 1XEAA 5CAEA 5ITWA 1H9BA 1B0AA 5JDCC 3NT5A 3WOHA 1LDNA 3ZW9A 2B35A 4Q9NA 4KP7A 3GEDA 5DCWA 4RVHA 2ZKLA 2H1SA 1J5PA 4HFRA 1JWBB 1LXCA 2RH4A 1XQ6A 1NR1A 3H65A 2QIOA 2Q49A 3AOEA 2C2YA 3A4VA 1V3VA 4XEHA 3JQBA 4PGFA 4F45A 5CHEA 4MVJP 3AJRA 1DFHA 4YA6A 4L9RA 3VZRA 1DC4A 2FPIA 2BFMA 3ZH2A 1W8DA 5B4VA 3PWKA 5HBRA 1ZBQA 2NVWA 3B20A 3MEQA 2O48X 3PHJA 3OFSA 3HG7A 1N92A 1J4AA 3JQ7A 4GBJA 3WGZA 4BNNA 2C82A 1I2CA 1V3UA 3F6YA 3GG9A 1TXGA 5FEUA 3HJAA 4BNGA 1DBVO 5FYDA 3K92A 1YGYA 3WB9A 4DVJA 4CLDA 4AJKA 2ZIZA 5L9AA 4RCVA 3L9XA 1C1XA 4BNLA 4BHTA 4RPLA 1FXSA 4PRKA 4KDEA 3NKLA 3JV7A 2NTVA 5T8KC 4PLCA 2IYPA 3ABIA 3DOJA 4O6VA 4R51A 3WFIA 1VM6A 5FI3A 1HLPA 3QWBA 4O5OA 4MPDA 2C0CA 3NRCA 5IXSA 4DMLA 1F8FA 3ZCXA 1BW9A 3GN2A 3MZ0A 1Y6JA 5IDYA 3PHHA 3DZHA 3DZBA 2I3GA 1QYVA 1ZFNA 1YJQA 3M1LA 1A4IA 3OH8A 3AUTA 1GL3A 2X4GA 3BMQB 3N7UA 5IXYA 3GQVA 1MXHA 4CM7A 1YO6A 1UXIA 3KZVA 3BTUA 2CDBA 1ZMTA 3QIVA 5G2OA 1FDWA 1U28A 4OQZA 4XX0B 3RROA 1Y5MA 3C1AA 3L4BA 2C2XA 4JJGA 3ROPA 5AXAA 4LRSB 2B4TO 3FNHA 3FR7A 2EIHA 3NGLA 4O0LA 1XIVA 5I9MA 3HE3A 1BXGA 2PA3A 2D0IA 1ZEMA 3TQHA 3ZWCA 1Z75A 3OIGA 1Y8RB 1NVMB 3PDJA 2NTJA 4XDZA 1I24A 5DP2A 4IM7A 1NQOA 1ZH8A 3ZU4A 5T57A 1BVUA 5AYVA 2I65A 2VYVA 2Y0DA 1P77A 4RF4A 4CMEC 4L74A 4DREA 2NLOA 4RLSA 1KBZA 3A9WA 1KY5A 2Q4EA 1R37A 1T4BA 2CD9A 3RI3A 4KTTE 1HYHA 3DQPA 3PFFA 4DLBA 4AFNA 1GADO 1A7KA 1YQXA 4K6FA 4YT5A 4F6LA 4E33A 2HLPA 3ETDA 2NU8A 4XQGA 2I66A 1PWZA 1D4FA 5I8WA 1R6DA 3VC7A 4ZQGA 2WD7B 2WWRA 1I0ZA 3INRA 5JCJA 3OJLA 1RYDA 4BQRA 4B7UA 1DIAA 2YQ4A 4OOFA 5KKAA 2HK7A 5IDXA 3H5NA 5BQFA 4YAJA 1WAMA 1PWXA 5B37A 4AJIA 4QO7A 1IHXA 3PQFA 1GEEA 2NWQA 4FN4A 3JQ9A 4XCVA 4XR4A 3VPHA 1NBOA 5IG2A 4LW8A 1KVRA 4L73A 4BNVA 1BDBA 5L7WA 2PGLA 2Y93A 5TT1A 5TLSA 3DFUA 5A1TA 1XKQA 1HRDA 2EXXA 5THQA 2X5OA 4Y6SA 1JLLA 4N5MA 4CMAA 3O4RA 4YRDA 2QZ9A 3D4NA 3HN2A 3IUSA 4M49A 5KNLA 2FPGB 1NQ5A 2AE1A 2GLXA 2EGHA 2YYYA 3V1YA 4I1IA 3E82A 3VTZA 1HZZA 1ZEJA 2EHDA 2Q1SA 2RHCA 3COSA 3E03A 1YDEA 4HBGA 1E0DA 4J16A 3DB2A 2ZATA 3FNEA 4OXKA 4R1NA 4FFLA 4U8GA 5I8ZA 4YB8A 3S2IA 3VH2A 4WLEA 4YAGA 1X7HA 5IN5A 4OM8A 5G0UA 1DPGA 3TN7A 4ALJA 2CDAA 1NNUA 3KBOA 4GAEA 2O4UX 1GU7A 1DRVA 1WZEA 3CZRA 4GKVA 1O9BA 4OHUA 4MVJG 1QSGA 2O7SA 5BSEA 2RIRA 5ITVA 1UXGA 2SCUA 1X15A 1DDOA 2QHXA 3UVEA 1FMCA 1EBFA 1RWBA 2O7QA 1QRRA 3C1OA 1J49A 2DM6A 2YHIA 1PSDA 4J49A 3RUDA 4KUGA 4R69A 2VTEA 4JN6B 4H15A 2ZB3A 1Y8QA 5JC1A 3GFGA 4W82A 1Q7CA 1M66A 3D3EA 3BA1A 4LISA 4QECA 2D59A 3JD2A 3PDUA 3P5SA 4QUKA 4WLOA 1HT0A 1IHYA 1JKIA 3S2FA 3VOSA 4NBVA 3RUFA 2V6GA 3O9ZA 3IS3A 3C7DB 4MIEA 3SXPA 2J3IA 4TRRA 2YV2A 4CMIA 3FWZA 4YR9A 3LT2A 5IDQA 2OP1A 2XPCA 2Y1DA 3U4DA 1C0PA 2ET6A 3S55A 3AUAA 4OOEA 3LYLA 3GC6A 4U0KA 1MXFA 1ZJYA 5A05A 3ZV3A 4A7PA 2POQX 3C7AA 4WLUA 4G65A 4IMPA 2V6MA 3M6IA 3DO5A 5A9SA 4R1TA 4JBGA 5EJ2A 4JNKA 2GGSA 4CM1A 1YBVA 3QWHA 3OJFA 4G2NA 3KEQA 2AQHA 3MOGA 3ZHBA 1R12A 3H3FA 4JCOA 4D42A 5BNIA 2PD3A 3RASA 4E21A 2R00A 4GMGA 4YQYA 4FFRA 3TJRA 3S1LA 1MA0A 4JX8A 4ZGWA 4WNIA 4BO3A 3PHIA 1WZIA 5L95A 4PLHA 2QYTA 1W73A 3E6AA 4QTZA 3WBFA 3U4CA 3WSVA 4OMUA 4MVJI 4UEJA 2NUAB 1Z6ZA 1E7SA 1MB4A 1K5HA 4NK4A 2JFGA 5T64A 3TPCA 2C07A 2PGJA 1YE3A 1XR3A 4OO3A 3RC9A 4JP3A 2E49A 4RPHA 1ZMOA 4I8XA 2JD0A 2WTBA 2NU9B 1UP6A 3F4BA 1MC5A 1QV7A 5ER6A 1GAEO 1O6ZA 4OGWA 4KUHA 3GY0A 3OBBA 4EZBA 3OJ0A 4GLLA 1CQIB 3C8MA 4M89A 3W6UA 2EW8A 1NQAO 3U5TA 4Z3DA 1VI2A 5TSDA 3ANMA 3JYPA 3A14A 3ASUA 1JVSA 5GMOA 4HKTA 5L4SA 1YL7A 4UEKA 2O3QA 4DIBA 3IP3A 5EMHA 4G81A 1E1KA 4YJFB 3WWZA 2HJRA 4MOWA 3OIDA 4FSHA 4QEDA 3ZHXA 3PZBA 1MX3A 4E5YA 3DBHA 3PIIA 1PJ2A 1Z45A 1HTBA 3INTA 2W2LA 3TFOA 1ARZA 1W0CA 3LLVA 1ISFA 3RBXA 3QWFA 1ZJZA 5EIOA 3WX0A 1TA4A 4U5QA 4WK6A 2HK9A 3I3OA 1ISJA 2AQKA 4NBTA 3DZJA 4DL9A 3ICPA 2IE0A 4IXTA 2BMAA 1YBMA 1HE5A 4CMKA 2IRWA 4ND3A 2GN9A 4IDDA 4TKLA 3TDKA 4ZA2A 3I9MA 4UVGA 4E3ZA 3I6IA 1SC6A 4E4YA 4W7HA 5CDGA 4TZKA 1CQJA 3ZWXA 4AL4A 1CQJB 1W6UA 1XDWA 5J23A 1B3RA 4EEZA 3G3EA 3ZWBA 2OL4A 3GNSA 5AXBA 4Z3KA 2JAPA 2PD4A 2QRLA 4WJZA 3WGGA 2CDCA 4Q3CA 1U5AA 4FGWA 4NMHA 1IL0A 1NAIA 1NXQA 5L7TA 1U4SA 2Q2QA 2GSDA 3L0DA 1BGVA 3S2GA 3V8BA 4D41A 3IQDB 1UXJA 2D8AA 5TNXA 3QQPA 4OKIA 3CZMA 1ULSA 4ZU3A 1NFFA 1JQBA 2Z1NA 4FFPA 5KCZA 3KETA 2D2IA 3SX2A 4Y67A 3Q6IA 5KJEA 4Z0HO 3ZN2A 3W1VA 3FPCA 3VAZA 1VJ0A 2JD1A 4IJVA 4CQMD 4FD3A 1UP4A 4CV3A 3VVBA 3LQFA 3GT0A 4FR5A 1U3WA 4R3WA 3L4SO 1U3TA 2PV7A 1YONA 4NQZA 9LDBA 2GUGA 1JAYA 3RUAA 4R9RA 2NU6A 4PIVA 4M87A 5GZ6A 4YYZA 2J3KA 3WYEA 4U0JA 1DFIA 3CEAA 1P0FA 1U4OA 3BHIA 4J2OA 4H16A 1U8FO 2NACA 1Z7EA 4XR9A 5ILOA 2Q1UA 4EI2A 3D5TA 1P31A 3QA9A 2Y05A 3MWEA 1VLLA 4S1VA 4GGOA 1V3TA 2Y66A 5GZ3A 2YV3A 3KM0A 1DJNA 1LSSA 4J9VA 3U62A 4IDAA 2ZQZA 2X6TA 2WDZA 5F1KA 1XA0A 3FN4A 2EF1A 1E3LA 1HETA 1ZK1A 1WDMA 4XGKA 4DPLA 4PG8A 3L6EA 3GZNB 1E92A 5B12A 2PK3A 4L4RA 4JBHA 3F1LA 1TB4A 4XQCA 2BD0A 3ADOA 3G49A 2R00C 4GX2A 2HSDA 3Q9NA 4AJEA 1AE1A 7ADHA 1SCUA 1O94A 3VZPA 3D7LA 4D43A 4QFCA 3RUHA 1C0LA 5CPFA 5AVOA 1MLDA 5DBFA 2GF2A 2B69A 5JY6A 2EP5A 3PLRA 3AFNA 3I9LA 1BTOA 3JYQA 5IAAA 3IC5A 3DWFA 4CUJA 1N1EA 1QORA 2AG8A 4IS3A 3PWSA 3K8ZA 4C4OA 3PJEA 4CLOB 3NUGA 4CM8B 4HXYA 3JD3A 1H2HA 1UZNA 5KJ1A 5U9CA 2Q4BA 1HE2A 4MDHA 1PJSA 2O23A 1MGOA 2C7VA 4R5HA 4E5NA 2CFCA 3OA0A 3UF0A 1DC5A 3RAJA 2Z95A 3WGIA 5JBIA 1IZ9A 5T6BA 2X5KO 1D3AA 1HE4A 4RVGA 2Y1FA 1N7GA 3P19A 5HM8A 2OO5A 1EK6A 4WGGA 3K9QO 1I36A 4FW8A 4ND2A 2X1HA 3KUXA 3DBRA 2PTGA 1YOVA 2O3TA 3KYDA 4J2HA 2C7GA 4J4BA 1GV1A 3FPLA 1P1JA 3ZWVA 1ADFA 4II3A 4L75A 1BVRA 1H5QA 4OH1A 4YTEA 5TJ9A 2W8ZA 4DYDA 1NP3A 1ZK4A 1EDZA 1TI7A 4WCDA 2GN4A 4B4OA 4PLGA 4PRLA 3RSHA 2VYNA 1WDLA 2PLAA 5ENVA 1WPQA 3UN1A 1WNTA 2QQ5A 4MVJM 3TZQA 4WCFC 2FZEA 3DAPA 5B1YA 1NTOA 3ONDA 4Z0TA 3PJFA 4P4LA 4FC7A 3Q0EA 1U3UA 3NAQA 4FC6A 3WNVA 3ZWNA 3PHLA 4AJNA 2O2SA 4RQTA 5KVSA 1PX0A 3QW2A 1PZFA 1VJTA 2PH5A 4AICA 3GLQA 5G4LA 3CPSA 3HDHA 3ZWYA 1ENZA 1A27A 2HQ1A 2ZB7A 3HHPA 1U3VA 5BT9A 1ZSNA 3H4VA 1V9LA 1I30A 1DAPA 4BGUA 1KC1A 3FF4A 1DAOA 4KOAA 2HRZA 5DZSA 3AOGA 4PZEA 3WLEA 3ZHZA 4M54A 4TKMA 4E2XA 5F5LA 2DAPA 4URFA 2GZ3A 1QLJA 2P9GA 4KDFA 4RPKA 4QFDA 1UXKA 1HF3A 1D7OA 1JDJA 1T2DA 5KJCA 3KYBA 5TC4A 4FFMA 5F1OA 1WWKA 2ZQYA 2I6TA 3G17A 2DBRA 5EQDA 3O8QB 2VHYA 1PIWA 2IYOA 2PGDA 1U2GA 2QG4A 4YAEA 4BMNA 3UCXA 2ZYAA 3NTQA 4PLYA 4TQGA 4C7KA 1ENOA 4HNGA 1HDGO 3PEFA 4IMRA 4B8ZA 3SVTA 4J6FA 1J0XO 3GDGA 5EL0A 4DRYA 1F17A 3E5RA 1RM5A 3HB5X 4EUHA 1Y81A 3EC7A 4D7AA 2Q2WA 1YJ8A 2RBEA 4HADA 3LK7A 3EAGA 3ADPA 3JQAD 1B2LA 1B14A 3ITDA 4FCCA 4YJGB 2DC1A 1IPEA 1Z82A 4P38A 3ZNNA 4BNTA 3ONFA 4R1UA 2QZZA 5TJHA 1G1AA 2UUPA 5A5FA 2BGKA 4OSOA 2BFAA 4LSWA 3AY3A 2A35A 3E5MA 4CM9D 2OFPA 1E3WB 1R4NB 2LDBA 3IAHA 4B3IA 4FB5A 4YT8A 5KVCA 1NHGA 3ONEA 3FNFA 9LDTA 2ILTA 3QVTA 2FSVA 1GZ6A 2A92A 2IXAA 2GERA 3L07A 1ZK0A 4WLNA 2VT2A 3EVTA 2P9CA 3VPFA 1HXHA 3E9NA 3HWRA 2I76A 3PFWO 4EJ6A 3X2FA 2UV8A 2E48A 2G0TA 2YQ5A 4KWIA 2A94A 1F0YA 1ZUD1 4D79A 1PGOA 3R1IA 5AXDA 1B7GO 1UZMA 4RF5A 3KV3O 3GHYA 1LNQA 4EYEA 3OSUA 4RORA 3O03A 3O26A 3G79A 3UGKA 1EVIA 3H2SA 5FFFA
chains in the Genus database with same CATH superfamily
2I9PA 3QF4A 4MVJA 4TSFA 4U7GA 4DMHA 4K9DA 3V3TA 1XRLA 2Z56A 1HFKA 2CVOA 1RVDA 2Q9CA 2AFHE 2RHRA 2VAMA 5EUBA 2ZIXB 1A8UA 2GXAA 4H7PA 4IXWA 2NAFA 3LA8A 3CUEF 4H0NA 1Z4MA 2D2FA 3GHHA 1UADA 4ARZA 1I1NA 2ZETA 3BRWD 3N07A 2Q4TA 1VDZA 3BTVA 1OH5A 4P92A 2AN9A 1PGJA 2X8JA 5TF0A 3S3TA 1D0VA 4NS4A 3HU2A 5FPPA 5AW2A 2DUMA 3EGEA 5L4LA 1NZFA 2W4IA 2BGLA 4UVIA 5HUQA 1BMDA 3DR5A 1KEEA 4DS3A 1E6KA 2YV1A 3WGVA 1JJ7A 1P74A 3BFVA 3DXYA 1EFRD 2ETVA 1J42A 1F4VA 2R1VB 4DLWA 3HU1A 5B4TA 3CVWA 4W5TA 4BLWA 3W5BA 4NFHA 5B55A 5BRAA 1UQRA 3ONWA 5K3AA 1N2ZA 3QVVA 2GEBA 4LKOA 1DO2A 2WR8A 3EFOB 2P1ZA 2ZYIA 3WRYA 3QTTA 1C41A 3MA0A 2YV5A 4L0MA 4YP9A 1Z25A 3ON5A 4OQPA 5BQOA 5KX5B 3QVGB 4MEJA 5BNTA 2HRBA 4JB2A 3GNTA 3H5VA 3P9QA 1IYZA 5EWJA 5KTSA 3AY6A 5J2TF 5KEIA 2Q9BA 2CMKA 4B83A 2XE6A 3TVTA 4HVTA 1KJQA 3DLAA 5EINA 4XX0A 2C7PA 1GPUA 1OVGA 3I5UA 3ES9A 3GCGA 3JRNA 4IQ8A 4TXHA 3AUKA 5DYGA 4KR2A 2ZWMA 4K1LA 4FFDA 2WB2A 4RJJA 3R6DA 4JC0A 2CNOA 4TXMA 5E7IA 4QUAA 5EKSA 4BX9A 5IHXA 5JMWA 1UMKA 3I8XA 4QATA 4OIFA 5IS2A 4NCAA 1TM2A 2KLBA 2QRKA 1JXAA 1HDZA 3ZZMA 1PQPA 1FBNA 1Y8RA 3UAWA 5ICEA 3RRJA 4DWJA 1CY0A 5K3CA 4YRNA 2ZJZA 2BFFA 4E6EA 3DONA 3CEPB 3PUIA 4B2YA 2CV0A 4XGQA 1Q92A 1SVOA 1XHEA 4DCVA 1P5ZB 3IDSA 5CA0F 1LDYA 4FDMA 5KNDD 1K6IA 2ZR0A 1U6IA 3H11A 3H11B 2AFRA 1OC4A 4ZTBA 5KVQA 3DBVO 1MP0A 3M1AA 3EPKA 2HYDA 4DAOA 1IXRC 1CK4A 3ZVLA 2MHCA 4BLSA 1GAXA 1TJYA 3EPPA 2H52A 4OPMA 2G70A 4ZALA 3BQMB 3MTIA 3TZLA 1UUFA 1U5CA 2OCBA 4GBMA 4PAMA 4RD6A 5JNWA 2PXXA 2PEZA 3C8UA 3MNFA 3EW9A 4AS2A 5DTMA 3EIOA 1OXBB 5LBIA 1F6DA 4PZUA 4PYKA 1LF0A 1Q0SA 2WD7A 3E9DA 4HMOA 4WXYB 4C14A 2A0KA 5ERXA 1IN4A 1NQTA 2BPOA 3F90A 2N75A 3HFGA 3WYGA 3WFJA 1CULC 4DIUA 4F3YA 5BSGA 1XDZA 4WZAB 3SIWA 5GY7A 5HW0A 1ZZGA 4U8HA 3R7WB 3MN1A 1XRMA 3PHCA 2CJPA 2F8TA 4B4DA 5EVCA 5F3WB 3HV2A 3DL2A 3OZBA 3HJUA 2EP7A 3LXMA 3PWTA 3DEYX 3QLUC 3B6EA 2B8NA 2M9MA 3AEZA 5T4HA 1H6CA 4XB1A 2VJLA 1STOA 2YJ4A 3KQVA 1TA9A 1Z28A 2Q5JA 3PPIA 1M0EA 1IONA 4N9WA 3TOSA 3FTEA 1ZSYA 3FJYA 1SUCA 3JD0A 4ZC1A 2BFPA 5C8ZA 3W5DA 1TW2A 2Z4TA 3VX3A 5CB4B 4QSHA 1BEUB 1VYVA 4BBZA 1YDWA 2J9XB 3GD5A 4FE3A 1D2RA 2XOXA 3QI7A 1J9ZA 5H3LA 3NP9A 2AFIE 2AHRA 3C2QA 4DC0A 1YB6A 5C5EA 4OAQA 1J99A 4NJMB 3ZLTA 1CR6A 2P6PA 3EVZA 2QTMA 4PX9A 2J0SA 4I1UA 4X44A 5EJGA 3WJAA 5JCJD 3NVDA 4B5LA 1G5FA 5E9AA 4ECEA 4Y9TA 2A9RA 2B8JA 3O1JC 4U6QA 4IDGA 1FSGA 1QB7A 3AUYA 3U7EB 3B2EA 1JT9A 3FJ1A 4LV6A 1B8PA 4LYEA 4F8EA 2I2WA 2BR4A 4P5PA 1UBRS 1DX6A 1MIHA 1JHUA 1D2EA 1V2GA 2P8JA 1YNOA 1O6FA 3JQBC 1R0ZA 4ZO7A 4JT2A 2W58A 4G0NA 2Y0EA 1I80A 2FHSA 3AF5A 3OQ6A 4K9NA 4UM9D 2AW5A 3RVJA 1CIJA 5BVGB 1PG0A 2Q0HA 3GWGA 1JN0A 3PJDA 2BRUA 2QLNA 5FLKA 5LXTF 4YIHA 3U09A 1BMTA 3DUWA 1AMUA 5F78A 4J0CA 1YFJA 2UZIR 2QUAA 2QVYX 4ILEA 1N6LA 4OY3A 2G9ZA 4MW6A 5HTKA 1V6CA 1LLCA 3H2HA 5CT5A 3T9FA 3P94A 1T2VA 3WLPA 4CEIB 1B4DA 2WAYA 1TLTA 1XZ8A 2H4HA 5FUBA 1FTSA 4BNZA 3K8QA 1S2DA 4HP8A 4BQPA 1C29B 2BKAA 3CR3C 4FILA 4XLTA 1JLSA 4LBWA 3FNGA 4RTNA 3T1HB 3AKDA 4UVHA 4B76A 4BV9A 5KQSA 4S04A 2OZPA 3AT1A 4OHKA 3WXMA 5CDTA 2CCKA 1VB3A 1FY2A 2FCRA 4K2AA 4R2HA 3WLQA 4C87A 3EA5A 1UMCA 1P7ZA 1WTAA 3SEZA 4YEDA 3V34A 1NVKA 4TV9F 1G5HA 5AOCA 5JQGB 2G6TA 2VTVA 2YFYA 1Z2CA 1PGQA 4O2LA 1ULZA 3UW3A 3ENVA 4XA8A 1FX0A 3UT6A 1C9YA 2IIBA 2YWJA 1V1RB 4J7UA 1ECPA 4QFMA 2JVIA 1SQGA 4JJ7A 4M6WB 4QVGA 4D6YA 4Y98A 4DPKA 1M2NA 4PN3A 4UTRA 3R7FA 1KFJB 2Z8XA 3CMCO 1XCGB 1E7WA 2JCGA 3DOHA 1YB2A 4HWPA 4P98A 1K8YB 1PWYE 2FPLA 2VPWA 4ZKEA 3UJAA 1UBGA 4FE7A 5FWXA 3R7AA 3C39A 3UCEA 1U8YA 3CCBA 3KJNA 3HJFA 4IIJB 3VU1A 1OYOA 2IF0A 3ANNA 3G2JA 5IULC 1BEEA 1YXMA 2R1TA 1CIPA 2BTQB 2WHRA 3C6YA 3IBSA 4QVKA 3RS7A 3T4PA 1RPZA 2BISA 1KK0A 3K9NA 4E2FA 3C8ZA 3DKIA 1H2FA 1XF9A 2BEVA 2EX4A 3NR2A 4GR4A 4YXWD 1T15A 4RHYA 2I4RA 5THKA 3SJUA 2GCOA 4L4SA 4FKZA 1RADA 1FVXA 1V45E 2FMFA 2Q6TA 4X7RA 1E89A 2QUIA 4XUGB 1GZ4A 2DPMA 1DJQA 3P96A 1UJ2A 2CVHA 2F00A 4N18A 3OHSX 4FJ2A 3AERA 1BH6A 1O57A 5KWEA 1M6YA 2X0NA 3D5QA 4GOKA 1Q77A 2PGNA 1HY3A 2VEOA 2ZB8A 1OFUX 3HVUA 3T1NA 3VR4D 2BEUB 5HJ5A 3QHQA 3O47A 1A9QA 1PUIA 2Z83A 2AXQA 2E37A 2OHOA 3CTMA 3AKEA 1R6BX 1EVZA 4A0GA 4P82A 1Z7GA 2GRUA 1IEWA 2M6RA 3M4XA 4BO2A 1SOAA 1Z4QA 3EIUA 3F8TA 4A15A 4UD2A 4CN8A 3CZAA 1KJZA 1MOZA 3N1UA 221PA 4XPIA 4MW5A 5ESWA 1EX7A 3GVIA 1QE3A 3E0QA 3VVCA 1LBIA 4IX1A 4M7PA 5FOXA 4S0ZA 3MWDB 4PHGA 3KDSE 4FYHA 5E6SA 3OQMA 4B46A 1MW8X 3JVUA 4QPCA 2UYYA 1OZHA 3ZV5A 1WVMA 2W71A 1NYRA 1WPRA 1P9LA 5KSOA 1W0KA 3CJTA 3K4HA 3SEFA 5KNBA 4R2IA 2WV7A 3G9QA 2C88A 4X63A 3KQLA 1JXMA 1FQJA 1P3DA 2YZMA 3LY7A 1GARA 3HJGA 3IDFA 5A6VA 4DLUA 1H0SA 4LC0A 1JEYA 1VPVA 5AJVB 3GB9A 3ZDBA 3L6OO 3V48A 2SBTA 2IYAA 3NFRA 4JBWA 1XAIA 3JQCA 1MRSA 3WTCA 4BS9A 2PVPA 4HMQA 1G6Q1 3T0FA 3AXTA 3VNVA 4I14A 4GP6A 5ALVA 1X1CA 2YWCA 5J2UB 2G07A 2BDTA 2NO4A 1KY3A 2PAFA 2M32A 4PYQA 1P0CA 4YJFA 2HCFA 4ROSA 3GLUA 1TQ2A 3TFWA 3SU8A 3L8DA 2K7ZA 1QE0A 3N8DA 5AW6A 3DBLB 3U7JA 1S1CA 2CT8A 5JJIA 1RC0A 1MTZA 3WTBA 4EX7A 4XWOA 1CKEA 1XJCA 2F3SA 2FSIA 4P86A 2W6ID 4PAWA 2GM4A 3GQBB 2WZCA 2PKWA 5EIAA 4P33A 3ID6C 1P4GA 1QP0A 5DF1A 3UA3A 3A2LA 4OHPA 2G5TA 3L0OA 3WE7A 2ODBA 3PYLA 3VPXA 2M6KA 1CIVA 4DANA 5CM2Z 4KK4A 2GN8A 1AK2A 3KFXA 4ZI3A 2VXBA 3U6BA 2BC9A 3SSOA 3HCOA 3CXRA 3GMTA 4G5OA 4Q3DA 5HG0A 3ZXYA 2I6FA 4RIFA 5CH8A 2ZIWB 5C7OO 2ESRA 4LNUB 1XU9A 5FA5A 2C99A 4M0EA 1QYWA 1GQFA 3E05A 3CV3A 4KWHA 3I23A 1T1RA 3SYKA 1YHNA 3D6FA 4ZYXA 1U8TA 4X1KB 1WUHS 1FYXA 1XU4A 2VT3A 2C2WA 2Y99A 3B6ZA 2PRZA 2GEDA 3TRKA 4GMFA 3HEAA 2O1XA 2EGGA 2OM2A 4YV7A 1IZYA 3RVNA 1KEPA 1P4JA 4IP0A 5D8DA 4KZKA 3T8YA 3T3DA 1ISPA 2Q9UA 3TOZA 5HDQA 3U17A 3QEJA 1SKUA 3QEAZ 2AZMA 1J25A 2CNDA 4CKEA 3R9XA 4IRMA 3ESAA 3R4VA 2WFLA 5TVGA 3ZDAA 3TAHA 3TAXA 2LNDA 2CVQA 3WZ2A 4TVKA 2A9KA 3A9RA 2I1VB 2BTOA 4HFNA 4EYSA 1F8XA 2GA8A 1JDTA 1A8PA 2RGDA 4B09A 4WKGA 3WK5A 5AVZA 1TCCA 3SHOA 5LOVB 2IIVA 5HP4A 2EHJA 5JAQA 1TRKA 5TF4A 5DEOA 3BORA 4E03A 2W0MA 3OFKA 4LRWA 3EHEA 4QOFA 4LJYA 4R0MA 2P7IA 3G0DA 3LRTA 3LWDA 4KVGA 1TECE 4JI5B 4BIMA 2CY0A 3KQWA 4BMXA 1ADBA 2GBLA 2PX3A 5LNK1 1GRVA 5D5HA 1II0A 2B7LA 3ANLA 4YDQA 1NVTA 2FY8A 2QUKA 3TSWA 3JSXA 4WECA 5LN1A 5D3QA 1QO0D 4Z2AA 1PJ4A 3D3KA 4CHTA 5IZCA 4BLUA 1NWCA 4PLVA 4QBTA 4HX5A 4XM1A 2EZ4A 4GI5A 2F1JA 3GPIA 4Z99A 3G0BA 5HSGA 3ZY5A 3T9BA 3VYSB 4Y7DA 5G4KB 3QP9A 4N0DA 1ZAKA 2DH5A 1I3NA 1W46A 4IHQA 5FTWA 3WRXA 4HUQB 2Y1LA 4P3XA 1NQWA 5CLHA 1JU9A 1UPTA 4XGRA 1N78A 2D4AA 5CLIA 5AJXA 2NO9A 1GP2A 4P83A 1RIIA 1ZM7A 2Z3WA 4MGYR 5ALYA 5A7HA 4CIXA 3KQKA 1JU3A 4D25A 1VFPA 3WJ7A 2DHDA 4PV7A 3GD7A 4ZICA 1L5RA 3AG5A 1V9CA 5LJLA 2YASA 4GX5A 4I1SA 2QRVA 4C06A 1T3ZA 3Q3JB 4U2CA 4US0R 1RZVA 1RWKA 3W5AA 4X6LA 2IBTA 3U4MA 4TMKA 4CGYA 2AE2A 2JW5A 1CE8A 4W9NA 1UJNA 5JAOA 2KBFA 1KEWA 3ZDQA 1FYWA 1K6JA 4AC9A 1I5OA 2DBZA 1ZNQO 3IUYA 1YC5A 2QJTA 3AWDA 1C7IA 2YXDA 2R6AA 3HLYA 5JLJA 1THMA 4K7JA 4KJXA 3OP1A 3QM1A 3V2UA 5AI9A 2DSNA 1JJIA 1RBQA 3EY9A 1SXHA 4XLZA 4DR2B 3EZ9A 1TD1A 3CZ5A 1WW3A 2QJOA 3IODA 4CL3A 4G0WA 2NO1A 1O95A 3DWEX 8GPBA 2HB6A 3KELA 4POAA 1U1GA 4BMPB 3OIUA 3DL0A 4NP6A 1DIOB 1PS0A 2YY7A 5K1ZA 1P6UA 4K9OA 5IUJC 3QU7A 3DHYA 2OO7A 2IYSA 2P7HA 1Y4ZA 4ZVMA 5JSKA 2GB4A 4JYAB 2FPRA 4EB0A 5AM4A 3O38A 1J9GA 3RKRA 1CUUA 2EF0A 3F7NA 4MUFA 3I37X 2PBZA 5ARDA 4E51A 1FFXA 1XDGA 1MVNA 3A11A 2RKWA 2PY6A 2FP3A 1Y89A 4MJ7A 1E1CB 2PJRA 1XMVA 3KTAA 4YP1A 1K8QA 1NYLA 2YVQA 1ZHOA 4B34A 3A2MA 4M46A 3ZY3A 1AS3A 3IVGA 4OJYA 1A7AA 4KLCA 3S1AB 4FB4A 2O4CA 2BELA 2DE0X 2V7XA 1T9GS 2QY9A 1NBMA 1XEFA 2CXXA 2ZI6A 4MCIA 3H9BA 2V7BA 2VF2A 1W47A 2XBUA 2VBFA 1PQWA 4I1RA 2NP6A 4MMZB 1JEQA 2O2IA 2Q5OA 4R6WA 3JQGB 4YDHB 4YMHA 2I9KA 5F7ZA 1CRZA 1VLVA 3GJ8A 1TAUA 2QLFA 1VIAA 2HQBA 1SBCA 3H3JA 3MW8A 4BLQA 1M1XB 1WUJS 1WP9A 1KI9A 1KS2A 1SB8A 3IP8A 1T9AA 3IULA 3PQ2A 4N7RA 2AX4A 1T3LA 1X38A 1GAJA 4HLUC 3GJ0A 2FZVA 1RM3A 3AF1A 5DM2A 4Y0VA 4YCCA 4KR3A 1UC8A 1G0OA 1I32A 2N46A 2XT0A 3LT1A 1PF7E 1HQDA 1MO3A 1XZQA 3AJEA 3D3WB 3H9JA 3KPUA 4H1VA 1I7DA 3L7MA 3WKCA 4DJ5X 1U2RA 3EXG2 3DL7A 2HO5A 5EI5A 1XVVA 2SKDA 2GHTA 1COZA 5JECA 4CG1A 5KWIA 2FHPA 5LQCA 5LZ2A 3ICWA 1BE8A 1NQUA 2QLBA 2R97A 1DRUA 3U4GA 2AR7A 1Z7YA 1QH0A 4BWFB 3IKTA 1NYTA 1A9XB 2JJ2D 3DNMA 3NC1C 1JQJC 1AS0A 3HCDA 3UYKA 4DMMA 1PHRA 2XDQB 1E2IA 4RH3A 3R3UA 3CU5A 2IH5A 1GKUB 2OZVA 1JHDA 1IOZA 1O5IA 3IEKA 1YRBA 3FPSA 3Q12A 4PAQA 1ZX1A 2B36A 5EHGA 5FOVA 5KTTA 1GGMA 3M5CA 3IAAA 3UB3A 1PL0A 3IEPA 3RU2A 1BU5A 4NMLA 1K3TA 1KH2A 3UMCA 3W8EA 2GHQA 4LMPA 4IGAA 4M21A 4MKHA 2AMYA 3KT3A 1P9NA 3A04A 1V4BA 4MVWA 4N5NA 1YL5A 2NAPA 4Y2YA 2C8LA 2ZULA 1IMJA 4K6GA 1MMFB 3ZWDA 3NHUA 1SZJG 4L4YA 1Z6PA 4OIMA 2Q4RA 5HWSA 2XB9A 2ZM5A 4MROA 1X7WB 3TUJC 1T13A 4ZIRA 1B41A 2Z2ZA 1XZFA 4MB2A 1YKFA 2XCIA 2OV4A 2EJVA 4GXTA 1J8FA 3B78A 2BZ0A 3HC7A 5CK4A 8ATCA 1NVXQ 4F97A 3UJ9A 1FW8A 1XQ9A 1B1CA 4ZQBA 1C2YA 1E3JA 3NYWA 4EW3A 4EELA 2ZI9A 3HS3A 5DGTA 1WW2A 4OXNA 3ZV6A 3IBYA 2XLCA 2RAUA 5CPBA 1KY4A 3HCRA 1R8YA 4LA4A 4PLZA 4CKBB 5IZCC 5JAZA 4MUBA 3BQ9A 2R44A 2WU8A 1GD1O 3EXEB 1UFKA 1ZH4A 4HNAA 4KE7A 1C4XA 1FDOA 2WSSA 1S3FA 1KARA 3GOQA 1W4CA 3JQ8B 2WMOB 3PLNA 4NZYA 2OHIA 3CEMA 4UU7A 3THWB 4FOLA 1UC9A 4LDAA 3ZD6A 3TS1A 5FV7A 3KHSA 2PLNA 3GH1A 4MCJA 5HKBA 3QVMA 1KAGA 3LE8A 4N49A 1ZL0A 3OKFA 4DQ0A 4QJ3A 2FN7A 3IJPA 1CW2B 1W59A 3QMVA 1XQXA 3GVXA 3IQGX 3JATB 3GJZA 2HWXA 1XMJA 1E1YA 1N8SA 3AEQA 1KAOA 1G2IA 4ZC8A 2WMDA 1RP7A 2VHJA 2Q2NA 1A8QA 2A1UB 4B3GA 4Q21A 2EX0A 5DXFA 4LRQA 3QVOA 1T8RA 1N2BA 4ZAYA 1M9NA 3A1DA 1I4OA 1ZRHA 1PFUA 3C15C 3HN6A 1GHTA 3QVUA 1CUFA 2VP0A 1Z73A 2FEAA 4GR9A 1RYEA 4GPAA 4GSKA 3UQZA 2C2KA 5FEMA 2L0XA 2PKQP 1RXIA 3C3KA 3GRPA 3DGEC 2JLQA 3R5KA 3S5JA 1CY7A 3INNA 3VKGA 1XEWY 4U7JA 3OM1A 3VNUA 5CJ2A 4AYXA 2QLLA 4XVUA 4NG4A 2O2YA 1ZVKA 3F5DA 2C5EA 2YC4C 1Q57A 3I9V1 4P35A 4HH0A 1Y8AA 4HLCA 4JL8A 3QA3E 3FUUA 4DDWA 1RXCA 1QYDA 1IWBB 3HWX1 4NYIQ 4AUNA 1AGYA 2QGZA 2CV2A 2ZJAA 2D3TA 2XODA 3GFOA 1O95C 2H7CA 3T35A 4YY3B 1R6AA 1GPJA 1ONOA 5L3ZA 1VHQA 3DDNA 4UUAA 3D3NA 4P4GA 1WCWA 3IIMA 3IBCA 4XCQA 4MI1A 1PFWA 3STXA 3OTOB 1JXOA 2PMCA 4OBBA 4ZWNA 3KEMA 5SICE 5LU8A 1KH1A 1UEXC 3FYCA 1MX9A 1CF2O 3LOQA 4I9UA 5H82A 1S8AA 3CF4A 1KWGA 1Z6AA 3MSCA 4L28A 5LNK6 5ALOA 1VTKA 1NRWA 5ELXA 2JF0A 3FFXA 2WSLA 2H9YA 4M53A 2IZOA 4LE0A 2GN0A 1GCUA 3S29A 3LXUX 2BGUA 2WNHA 3DT9A 5D7BA 3SS9X 1T3SA 3EODA 3WKEA 4ES6A 5BV0A 2MCFA 4O4LA 1R10A 1VG0B 2HKIA 3L7BA 1P7WA 1T6YA 3P27A 5COAA 2MTBA 1KYIA 2DPGA 2F8LA 3BHMA 3TW8A 1Z33A 3RAFC 2O54A 4TYMA 1ZGZA 3U3XA 2GMWA 3HEMA 4Y2SA 5EIHA 4YUVA 3QMPA 4ZT7A 3B8EA 4FYMA 3E22B 5HKKA 1KH3A 1GTMA 3GA5A 2FSHA 1PT9A 5KKNB 1XDUA 3C43A 3PE4A 3KR2A 3NNSA 1B0ZA 1G8GA 2HA7A 1Z38A 4RFLA 4XI9A 1QPBA 3I5XA 4MWTA 3DTVD 2FW7A 4LJ4A 1YRLA 3F5SA 4JLWA 2UAGA 3KJGA 1ZUWA 4I55A 2JJ1A 1H0HA 1UH5A 1JPUA 2JIMA 1FYDA 5CXUA 1IRIA 1FDSA 1Q7GA 2PVSA 4ZVRA 1C3OA 1A76A 1OI7A 1OUMA 4K6MA 1QK3A 4PTYA 1MR3F 4IBOA 3K9BA 2V8OA 5AHWA 5E6UB 5EPEA 4A6DA 4UNPA 3LVRE 1LD3A 2JH9A 2DZDA 2ZSUA 3BIFA 4WKPA 2OXTA 1YZUA 1C0EA 4G63A 3HN7A 5EWLB 3RVPA 1P8AA 1ZC3A 1VSVA 2I8LA 1AUQA 3DZCA 3O9VA 1VYHA 3P71T 2ZUTA 2VRWA 3SM9A 3VSDA 3ZJTA 2XA1A 4IDPA 1GLGA 1K66A 4ENTA 3U44A 2XCLA 3HM2A 1NM5A 1OXKB 2H1VA 2NADA 1BW9B 3GNQA 1IWOA 4M1MA 1E77A 3L6RA 4PXAA 1TQHA 2F59A 3RFTA 1AQJA 2ZM6B 2SHKA 2JIBA 4YXFA 2O57A 3EXG1 1F2UA 2AEMA 3QEOA 4XE5A 1VHWA 4NZPA 2PKQO 2G9UA 4BNXA 3I5MA 3OJEA 1JEEA 2L17A 2VF4X 1MNQA 1R0BA 4HMPA 3B7PA 3FNQA 1A9RA 1DIBA 1TF7A 4UAVA 3GI1A 5FTMA 1UC4B 2FF7A 1QJCA 2RH8A 1VSQA 4G0OA 2FR8A 3NWOA 1A2BA 3HR8A 4PPGA 4LPKA 4AKGA 3LC7O 2J41A 1U81A 3NPAA 4OXXA 4DNQA 3UWSA 1HSOA 4PC7A 5I51A 3PX7A 4C2TA 1NW3A 2ACVA 4DDKA 1QGED 1PR0A 1D1QA 4FZVA 1QFJA 4R4JA 5FUVA 1DHRA 2XQJA 3G2IA 1HBJA 3MTAA 1PJCA 1J56A 4AJOA 4EG5A 5HPYB 5BN5A 3F3KA 4D80A 4KGDA 3EAQA 3EVNA 3GXOA 2VZLA 5FIUA 2F62A 1J33A 2IU3A 2OC4A 1PI3A 3LQ1A 3E48A 3KFVA 3NHYA 2OD7A 3N2GA 4PGHA 1FLAA 3OOHA 1BQ3A 2CB9A 2YIVX 1OZAA 1RWMA 3DZIA 4P54A 4Y9DA 4A73A 3K0FB 4BVGA 1NPTO 2CLDX 1IN1A 1KQPA 1NR7A 3FOEC 5JCXA 1NW4A 2C4UA 2E4AA 4RK5A 1E18A 1I4LD 4AT1A 1C9DB 4X71A 5JAPA 2CL6X 3TSAA 1FRZA 3FTPA 1JA0A 2QTBA 3KQQA 3OESA 3L2OB 4L2IA 4ASUA 3STTA 5B64A 4U7DA 1DELA 2HCTA 3AM5A 1RYHA 2RSLA 3F49S 3IKVA 3IHLA 3QTBA 3WK4A 3STWA 2XQKA 3L0IB 5EQTA 3DFIA 4NMWA 2GM5A 4DMCA 4NJOA 1T1GA 2XQGA 3IEVA 1AQ6A 1YS4A 3DWGA 4AKIA 5FRDA 2ZJ1A 2C97A 2QVGA 1F06A 2X8BA 4RWEA 4RTOA 1CJUC 3LUJA 5BNFA 4RADA 1RS0A 1U1IA 3B1FA 3CRZA 4C7OB 2PU5A 1GV0A 4AYWA 3CBGA 3EZGA 1Z5PA 2GCPA 2O6HA 3H2ZA 2PUAA 1GTZA 3RLFA 1QP4A 1OV4A 1BSVA 2XLBA 3IQHX 3LT4A 3OLQA 5FNVB 3SKXA 2VZ8A 1T9ZA 2O7RA 1PYOA 1G20A 2CHGA 2Y1OA 1T2AA 3ESZA 3OA2A 4I9HA 2FQXA 3OE1A 2FUNB 2VUHB 3MILA 4HNTA 3G8BA 3H97A 3NORA 3A3OA 4GOOD 3CSDA 2XMRA 4E30A 3BFJA 4BNDA 4CHGA 4YRCA 3NX4A 1XX6A 2DETA 2F4NA 2GPSA 1PL7A 3KU4A 2OBYA 4AJ9A 2H9AA 3KWLA 2FEWB 1NR5A 1G3QA 1MH9A 1TJ3A 4JC8A 3ZDZB 1ZH2A 3AHDA 4HNUA 1KOGA 2I2FA 2YDXA 4FD2A 2HLDD 3PA6A 4O4HA 4UM7A 4MR7B 1EFPB 4N6NA 2O8FA 1UM9A 4OKSA 1G21E 2C3YA 3MQ2A 2Q2OA 3IJRA 3VPSA 4HVAA 3ETGA 1G5TA 3SJAA 1ODLA 3Q3EA 4Z1OA 3HDQA 3LYUA 1C14A 4HQKA 2YINC 3QLEA 4QHSA 1EZ4A 4QPPA 1K5PA 2XF8A 4IH9A 4M8KA 3B1XA 3OPMA 5JW6A 2OO3A 3DV0A 1XJ5A 4HDMA 3TTTA 4Q02A 2FK7A 4J07A 1XFAA 4HDNB 4P6VF 3K5PA 4ESOA 2MSWA 3K1TA 2VLBA 3ZU2A 4NOJA 4OSPA 4GVXA 2H3EA 3D8SA 4B6RA 4DC9A 4RTPA 4ZOCA 4GXQA 2ODQA 4C30A 5FH9A 1DOAA 2G1UA 2FG6C 2VR1A 1MEJA 3NBKA 4YRBA 1Y80A 2ZYGA 3GBSA 1NRXA 1I4TD 1RRKA 4PTZA 1F0NA 2CLIB 5ILGA 2D0DA 1PJZA 2V3WA 3H8JA 4FHGA 4R8KA 3Q2KA 1UBNA 3HSYA 1K4KA 1H05A 1UDBA 2SCUB 4K28A 1P4HA 4BJ3A 1JQLB 1PKXA 1UM8A 3AB7A 3HRHA 3UMSA 4E14A 1B0PA 3UJ7A 5JYBA 2D0PB 4FJ0A 4XW2A 5AHXA 3B6KA 2UUOA 1ZD2P 3K9WA 5CLLA 2V55B 5F7JA 2J1LA 2Y1XA 1BWQA 3H7AA 3QELB 3KAPA 2HX1A 1JB9A 4N0MA 4LWZA 1BDMA 1E1DA 1ISIA 1JL3A 2ZT7A 1M7BA 4EA8A 4EPVA 4RDHA 5BN1A 3UMRA 4OHMA 2PZKA 1PL8A 4ZODA 4BVHA 4BB9A 3HI6A 4Q0MA 4ZI7F 4TZ6A 3U0BA 3UHAA 4QU9A 3KLMX 4KNVA 1Z7BA 4BCBA 1VA4A 4PWZA 1OXUA 3L84A 4R2KA 4TLBA 3V1KA 4GVLA 5K8LA 2E18A 2PT6A 1NM5C 1TIBA 2QX9A 3AGPA 4MRAA 2I62A 5EVJA 3NOQA 3IKLA 4QEKA 5B7GA 1WPGA 1LBEA 2B4QA 4FEYA 4QFBA 3GYGA 5DBEX 3JQFC 2RARA 3LQRA 3FH0A 3S6JA 3JZIA 2YOGA 4TWBA 3EFBA 2HFJA 4H7DA 2OYRA 2BMEA 2FPXA 1T36A 1LV7A 1WEHA 5CP8A 3RQSA 3WOVA 3GH3A 1Z6QA 3M6XA 2VJMB 4MYCA 4MYHA 1OX5A 3TRJA 1C7RA 1IY1A 1YUMA 3C1TA 4HWSA 4JYMA 4MXDA 5ALMA 3U80A 4G0UA 5M5BA 3T1YB 1H94A 4XUEA 1L7PA 4WZBB 1CBUA 2FR8C 2E4UA 1H85A 3GLVA 3LDHA 5G0VA 5AVTA 3FBTA 1MD9A 1G7RA 1T4DA 4LY9A 1SUIA 3ZIUA 1W88A 3DD1A 1CUJA 4HEA1 1FP4B 2N9UA 4IDFA 3DE0X 4G0MA 4EHKA 1Q0QA 1ORDA 1IPFA 3PX3A 4TZ0A 4ZXFA 3WLKX 1SC4A 3AHCA 2YJ3A 3BMCA 3Q3VA 5KO2A 2IPOA 1EBUA 1E2EA 1EE2A 4CW7A 4RE5A 4KQJA 2JBAA 5FO1A 4YQZA 3WIBA 1CVLA 1FVHA 1QKKA 1XEWX 3AFOA 4QLBA 3WAJA 1TVKB 4Z6KA 1OC2A 2OUKA 2WHPA 4LHVA 1ND5A 2P40A 5FOUA 4CEHA 2F43A 1Q5PA 1NBEA 2JCSA 3KDPA 3NGMA 4H35A 3FSGD 2FN3A 2FZCA 3W9UA 3A1UA 2AG5A 3P2MA 2ODEA 4JROA 1ADCA 1I7LA 1W85A 3TUIC 3Q72A 1DINA 3GFBA 2HBZA 2I6QA 4BYGA 3KD2A 5I4KA 5KYTA 3MJEA 1I5EA 3AM1A 3EAFA 1G64A 2J3LA 3EW7A 3N2NA 2O8BB 1YRHA 4JLKA 1GFIA 5IABA 4GP7A 1J8QA 5F1YA 3TDNA 1UBLS 4HDCA 2OAQ1 4I1VA 4TVBA 3SMQA 1LVHA 3QX9A 1SU6A 1D07A 1IB6A 4BO0A 2W2TA 1T8WA 3LX5A 3PTLA 4M83A 4NH4A 4QULA 3M9XA 4M9UA 3AM4A 3UFBA 2H11A 1E8NA 2EQAA 2GVZC 1AHIA 1CUVA 1V5EA 3IUJA 2GF0A 3OZWA 4KDCA 4UCWA 2FEKA 1YC2A 2E55A 3DR3A 2XQIA 1GTRA 4KLRA 1D6NA 1ECJA 2VOJA 4N01A 1RRMA 3PC2A 4BMZA 1FTYA 4CWAA 1HG0A 1N7HA 4KUEA 4O8ZA 3ER8A 4NCXA 1U11A 2HL6A 3C3JA 3PRYA 1OKKA 3U3MA 4NHEA 1N6OA 1WMDA 1E6WA 2AFHA 3E8XA 3KR1A 1SMKA 2XCRB 1E1RD 1WRBA 1A4UA 3W7AA 4D9GA 1XMIA 2VDNB 3OC0A 4J29A 4HUTA 2IY7A 2AQ8A 3OMXA 2J5KA 1E1NA 3OQPA 1NJGA 2SNIE 5FO0A 3N0RA 3DMTC 4MYRA 4QUHA 3CVYA 2L19A 2Q3FA 1YJAA 2J0VA 2AIRA 5TT0A 2DKNA 2HRRA 2ZBGA 2VHXA 4WDQA 2D2VA 5E9WA 1NHWA 1UAGA 2JD2A 2ZYTX 3NIBA 1N2IA 4E07A 5A5VA 4RGVA 3QOWA 5IDWA 4DUYB 2C4TA 3DM5A 3EGDB 4EFKA 5DDIP 5DNVA 5NLLA 3VTFA 4EMTA 3DSRA 4WBNB 3JWJA 1H2AS 2Z04A 3A9VA 5LR6A 1DBQA 3KZ1E 5BUSA 3MMPA 1RMQA 2YWHA 4DLTA 2IJGX 4WKNA 5JDIA 2JAWA 1G7CA 2FUKA 2VATA 2WWWA 3QV1A 4W5JA 3RRXA 1U7XA 3WQBA 1HNXB 2B0JA 2VNIA 2VJDA 2WFAA 1QH1A 2X7HA 2PHZA 3LA6A 4RDIA 3WGKA 4F4CA 4FDLA 1BRMA 3E1KA 3EFEA 5E0KB 2FVXA 1XVIA 3RUEA 1G8YA 2QD1A 4CM5A 4NYIR 4AULA 1W52X 5BR7A 1F3OA 1KTVA 1TIKA 3WWOA 4DCNA 5GIPE 3A25A 3M83A 1BZYA 2C8VA 2NXWA 3D31A 4PG7A 4JUCA 3HPQA 1J9EA 3TE7A 4YWJA 4RX1A 4PC2A 3RR2A 3FMGA 1LQTA 1X9HA 1S8OA 2AVNA 3G2HA 4BQSA 2YFKA 2EKLA 4AJ4A 2ZB4A 4AJLA 1DAGA 5KHAA 1T4GA 1YZHA 1K6XA 3AW9A 1GIAA 1NUAA 4YONB 3GUVA 1MDFA 2EERA 1HDCA 4FUQA 1PDWA 1Y1PA 1A72A 3SYLA 3M6UA 1KDPA 4MV9A 1DAIA 1D7AA 2FDXA 2VUUA 4NOKA 3WGMA 3CH4B 1VYTA 5AM1A 2JI6A 3T3IA 4AB1A 5C80A 2G0NA 3BK2A 3K8OE 2IUFA 2JGFA 4KWCA 5E4FA 2JFHA 3FI9A 2FLKA 3HUFA 4DG8A 4OFXA 2NU6B 1JE1A 1W2HA 2JGLA 3VU9B 4ZT3A 3DMGA 5CD9A 4RZHA 3KJIA 2R7MA 2ZYDA 1RAHA 2I7TA 3A58B 3N58A 5DT9A 3RVDA 5DNAA 1C9NA 4GYKA 4AVYA 4HJXA 4O4JA 4EQZA 1ECFA 4CTKA 4IF6A 4C0WA 3HUDA 1VMKA 1ZJWA 4ZFNA 2A30A 4RIGA 1QO7A 3ICCA 1E8MA 2A9JA 1JJFA 1FUIA 3QXGA 3ZQUA 3AU9A 1OFVA 1L3CA 1Y48E 4WY8A 5IT9A 2WHEA 4KIFA 1J22A 3Q3GE 1ZBDA 3T3EA 2F3QA 5FTJA 4D9CA 1GXSA 4OQLA 4IJKA 1Q84A 2QW8A 2QTNA 1CXZA 3P5BA 2ZJ0A 1E1QD 3B3AA 4QG3A 2HIMA 3DC2A 4RPJA 4UQPA 3LXXA 1GTJ1 1M2OB 3IELA 4DLYA 2X2OA 5JS7A 1THTA 3PEEA 1EFVB 1ZL2A 4BBPA 1RHJA 4C9BA 4EMBA 3H8SA 4HDRA 4KAJA 3ISVA 2UZ3A 1L4BA 2X22A 4RLFA 1P7PA 1TTTA 5ENZA 2YWEA 3H4IA 3L1JA 4OX9B 3U7QA 5I7AA 2R6HA 2PPLA 4XSVA 4XGIA 5EUCA 4P1ZA 2QSZA 3G5LA 1ISMA 1SCNE 3EYWA 4OMDA 3REFA 1L5MA 3M4ZA 3MJ4A 3IP1A 1YR2A 2C7QA 2QZSA 5I9NA 3SZUA 3RYHA 4OU5A 2ZXFA 3HCAA 5BNZA 3LKDA 2H5LA 1W1WA 2P67A 3RNOA 4CR7A 4EFNA 3IJEB 1E7RA 1QTIA 2C9ZA 2V5VA 3TTXA 3V1UA 2P90A 1NKSA 3V3KA 2XGJA 4CN9A 4E4TA 2P68A 1SN7A 3KXDA 3L4JA 3LYHA 2AFIA 3ROGA 1QGYA 1S5PA 2WT9A 3GOHA 4D9EA 1B00A 5DGXA 1JG1A 3E8MA 3PUXA 2XKAA 1J1IA 1NX6A 1RLOA 1RRPA 1UBTS 1PZEA 2R751 4GMHA 4IWNA 1MG0A 1ZUHA 1IEXA 4RS3A 5GM2A 5MGBA 3FLBA 3KOUA 3FCSB 3FBGA 3G59A 5B3JA 4DE5A 1G9XA 4AN0A 2X15A 1CERA 2LVBA 4IDHA 5FXMA 4JT8A 4AY5A 4HAWA 3HJBA 1R50A 3RVBA 3UFXA 3IAS1 1Z35A 3LUHA 4M7RA 4UZEA 1MAUA 1T2CA 3NHRA 3DD5A 5F2EA 4AURA 4K0RA 1VG1A 4H1UA 4LJSA 1GQOA 4JK3A 5D87A 3ZWQA 2Y1GA 4B6OA 4N48A 3RFFA 3CJRA 2ISCA 3F98A 3CWZA 2QVLA 4J0DA 3CINA 1I3LA 1P73A 1T9CA 4WUTA 4UNRA 2XITA 2XV1A 5H7XA 1L1QA 1LSJA 2DG2A 1L8QA 4M86A 2TECE 3DBRB 1HO3A 1JLHA 1SNYA 1KZ4A 1YOVB 4GYJA 4HEQA 4TTPA 4TS9A 5J1TB 4DBZA 4FGJA 5JASA 1S9DA 1K3FA 1CJCA 4QNRA 4Y1EA 4BB5A 2GAJA 1TCVA 4W1SA 5BN3B 3FYUB 3LQQA 2MMCA 3A4MA 5IN4A 2ANBA 1M0TA 2QL7A 3T52A 2GJ4A 2VHCA 4GOLD 4AM8A 4EA9A 3G23A 1SPBS 5CNIA 3E18A 3DQQA 1WMFA 4G5QA 2R9VA 1WO8A 1V16A 1KETA 4TXLA 4U9IS 2A9FA 2XMSA 4R9VA 2ZUVA 4U6NA 4S12A 2FWBA 3BMNA 3AR7A 1SIOA 4HEA6 3R24A 5CTJA 5A02A 2QXUA 2G4VA 5BN4A 2B1GA 5KDDA 4MIYA 2AK3A 1XZHA 4J43A 2VRCD 2WI8A 3OBIA 1SA0B 1CNEA 3H0EA 4V0NA 4QSMA 5FT9A 5JDIC 3QRWA 4PG5A 3QJGA 1Q1NA 3D6VA 1N4AA 4W4TA 3BA6A 3RODA 2DJIA 1U2DA 2E7ZA 2ID7A 3OMLA 3KSBC 1RPNA 1V8DA 4BGEA 1U2TA 1WE2A 3QKRA 4RU1A 1AN9A 3W7VA 5AHRA 3A06A 3O8DA 4CG0A 5KHOC 2HGZA 2VYQA 2TMGA 4NDAA 4HX2A 1KI8A 1VCHA 3B3GA 3D9QX 4Q9LA 3SFVA 4I81A 3BH0A 1DWQA 3CURA 4WXMA 4ZV7A 2HCBA 1YS6A