1EUCA

Crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
306
structure length
306
Chain Sequence
CSYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
total genus 118
structure length 306
sequence length 306
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eucA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1eucA01
1E6WA 8LDHA 4XQ9A 2PZLA 3S2EA 1EVZA 4K6CA 4IGFA 1KETA 2GYYA 4GI2A 1E3WA 1GD1O 4WECA 5LC1A 3Q2IA 4KUEA 3OIDA 4OKIA 4ND4A 3H9GA 2QYSA 3LT2A 2DT5A 4EDFA 1MA0A 3GOHA 1R4MB 3LC1O 5F3RA 1ZJYA 1Y9EA 3GZ4A 1KOLA 2A92A 3OMLA 1BWSA 1BSVA 4WLUA 4B7XA 3IP3A 1PZEA 4RVUA 5A1TA 2QQ5A 4BNMA 4JGBA 3UXYA 2RHRA 4JJFA 3WQSB 3PLRA 4R9RA 5A03A 3RUCA 2X9GA 3KYDB 3TJRA 5K6AC 2DPGA 3GVCA 3TOXA 1U9JA 3TFOA 5A04A 1R0KA 1EVJA 3GN1A 1X0XA 2NM0A 4G81A 1RM3A 1TA4A 3ZWOA 4IQ0A 1B26A 1C0KA 2OL4A 2GZ2A 4UEOA 5GY7A 1EDZA 2NACA 2VT3A 3LK7A 4XGIA 4GL4A 3EDMA 1GZ3A 3PWZA 2YDYA 1DDOA 2VHYA 3C7CB 1HZJA 4PG6A 5TT1A 1LNQA 2NVWA 4DL9A 2HRBA 3K92A 2I5PO 1LRKA 3WG9A 4ZHSA 4ILKA 4HY3A 4U0KA 1YE3A 2W8ZA 5C7OO 3LU1A 3ZV4A 4J2OA 3GMDA 2PGLA 5T67A 1HDXA 1NHWA 3WGIA 1YB1A 4TROA 1EK6A 5ITVA 5C7LO 1YBVA 2YV2A 2D3TA 4NFSA 2X5OA 4E13A 2IEDA 3OEWA 3K96A 2VRCA 4MVJF 4MVJH 3L6EA 1DJNA 1NWHA 3B1KA 4IDDA 4WLOA 1GTMA 5L7WA 4RPKA 4WOJA 4CMBA 2Q4BA 2Z1NA 3QE3A 1Q7GA 2XF8A 1HYEA 4RO0A 1LSUA 3E03A 4PZDA 1E3JA 3JQGA 5FWNA 1PZHA 4HFMA 3TPCA 4U7WA 1WDLA 4ZQBA 5G0SA 3U4DA 1LI4A 2BLLA 1VKNA 1G1AA 3HSKA 3GNTA 2O3TA 5EJ2A 4R4JA 3E9MA 3N74A 3RBVA 3N7UA 2Q1WA 3DHEA 1E7SA 2G76A 4J7UA 1DC4A 1H2BA 3BXXA 3TL2A 1PJ4A 2A4KA 4M1QA 1EUDA 1K5HA 2UAGA 4HWKA 1VSVA 2Q2QA 4R3NA 3IOYA 2PWZA 1KEVA 4DA9A 4D42A 4JBHA 3JQGB 5IDXA 2DBQA 2CY0A 2J3JA 4AG3A 1P3DA 2CUKA 1ZVMA 3C24A 2UUOA 2EF1A 3WOHA 4PVDA 5BNIA 2X0IA 3WWYA 3AUSA 2NUAA 3GNQA 3P5SA 1CYDA 3DC2A 1CQIA 5CEFA 1VI2A 2FMUA 3ZWBA 2CDCA 4E31A 2FPPA 4BKRA 1SCUA 3K30A 1ZSNA 3O03A 1NBOA 4R3WA 1KVQA 3AY6A 1B8VA 1M6WA 1WP4A 1WW8A 3E9NA 1U4SA 3OQ6A 1NQAO 3COSA 3WQRA 1P0FA 3H2ZA 4NMHA 5TJHA 1RKXA 4F6LA 4L73A 1U3UA 1CF2O 2PD4A 2X5KO 1CETA 4DBVO 2PK3A 5JDIA 4J2HA 4LGVA 2VZ0A 1PZFA 4IINA 3GLQA 2R00A 3JQAA 2I3AA 2QHXA 3H6KA 3F4BA 3JQEA 4KTTE 3HZZA 1SCUB 4EI2A 1N9GB 2QZZA 1BTOA 4QX6A 4MKRA 4AJ1A 3WGTA 1KC1A 3TN7A 2CDBA 2IXBA 2XOXA 2Q3EA 4A7PA 3OA0A 1WDMA 2HSDA 3JQBC 1HSZA 5JSFA 4O6VA 4NH4A 4CLHA 4F6CA 1PX0A 3OBBA 1AXEA 3UFXA 1GU7A 4S1VA 1ISFA 1XDWA 1YO6A 3DHNA 1DC6A 3K9QO 4KUGA 1EEHA 1Y9AA 2IYOA 1ZSYA 3GGGA 1T2CA 4MDHA 2YW9A 4BO1A 4OQZA 1VM6A 4LSWA 3VVCA 5I8ZA 4RVFA 3M1AA 4UVDA 2HDHA 4OH1A 3ZU4A 1Z45A 4DPLA 2RHCA 5L45A 4YAKA 1YOVB 1GZ6A 5JDCC 3BMNA 1Y5RA 1LDGA 3FNHA 4IUYA 2I76A 3GEDA 2XPCA 2C59A 4HADA 4XQCA 1WLYA 3OEYA 1R12A 3LYLA 4BKPA 2AHRA 1GV0A 4E12A 4NI5A 4R1UA 4RVGA 4GLOA 4D3DA 4HUJA 5FFFA 3KSUA 4BO7A 4E32A 1QKIA 4C4OA 4PG7A 3EK2A 2EP7A 2SCUB 4ZRMA 4IS2A 2CMDA 4OM8A 4D41A 1Y8RB 3A28A 4I5DA 3TNLA 3WSVA 3BMNB 4DVJA 2XXJA 2AG8A 4DWVA 1T1SA 1W8DA 3EY4A 3ASUA 2EXXA 3EZYA 4B7UA 2V6FA 4YACA 4B4OA 2PKRA 1E1NA 1EDOA 2UDPA 1JDJA 3GDOA 4XQGA 5ADHA 1I5RA 1U28A 4RZIA 3V2UA 5KWEA 3F46A 4DC1A 3BIOA 4XEHA 1LX6A 5TQVA 4CM1A 1I8TA 3L9WA 1Z6ZA 1CIVA 1R16A 1V3VA 5EESA 2Z1MA 4RVHA 4FGSA 1Z74A 3WIEA 2GO1A 5L3ZA 4UREA 2ZTMA 1IHYA 3W8DA 5B1YA 4XRRA 3BHIA 4TQGA 3JTMA 4GQAA 2WD7A 4E5PA 1C1XA 4WUVA 2LDBA 3ZNPA 1FDTA 3OSUA 1SAYA 1JLLB 1EE2A 2VRBA 1M2WA 2B36A 3JQ9C 1HSOA 1LDYA 1PGPA 3NT5A 4QTZA 3SLGA 4AL4A 1GQ2A 5JLAA 2ZTVA 5EERA 4HNGA 4ND2A 4YRDA 4J1TA 5EIOA 3LC2O 4BO4A 2EGGA 3HE3A 1JVSA 4ALLA 3OA2A 4O5OA 3KZVA 4MKZA 4XA8A 4Z9XA 1PGNA 3NX4A 4YRBA 5CEJA 4XR4A 4CR7A 4Q39A 4BNZA 3TF5A 3ETGA 1U7HA 3DAPA 3DL2A 3GVPA 4J7XA 1F12A 3LT0A 3H4VA 2YQ5A 4N5NA 4NFYA 3DMTA 1U3WA 2GSDA 5DBFA 3L4SO 2NVUA 2C2YA 4QSMA 2DPHA 5K0ZA 1DFIA 3K31A 4WCFA 4CM9A 4JX8A 4I9HA 2VHXA 1N7HA 1PU2A 2DTDA 5I9NA 1NFFA 3ENKA 3Q9NA 4GWGA 4NBUA 1X1TA 2B37A 3CZMA 2RH8A 2RBEA 4GVLA 3G0OA 5F5LA 5G4KB 1B15A 3K2EA 1V3TA 3CINA 4PZCA 1ZKMA 4PRLA 1NASA 2V6MA 5JCJA 5CDYA 1GCUA 1SB8A 3U3XA 3RCBA 3FSRA 3FCOA 3VZPA 3L4BC 3F5SA 2CF6A 3HDHA 1CWUA 2O48X 1N7GA 1ONOA 2Y68A 3WXBA 3VH2A 4IQGA 4A26A 3HUDA 2VHWA 1PS8A 3BTUA 2A9FA 2AQHA 3GGOA 1Y6JA 2AQ8A 5ICSA 1EBUA 1Z7BA 4L0QA 3RFXA 3WBFA 1X1EA 1J0XO 1ZW1A 3AOGA 3JCZA 3SC4A 3EMKA 4M54A 5K9ZA 4YPOA 4B8ZA 4E2WA 2PR2A 2GZ3A 4DPMA 1EFKA 3DBHA 2W98A 3GC6A 3D5QA 4K28A 1PTJA 3NJ8A 2IXAA 4PIVA 4ALNA 2HRZA 4ZD6A 2FP4B 4S3MA 1YDWA 3WBBA 2NTVA 4MVJD 1NTOA 4R16A 1E6EA 3CH6A 2BFPA 2VYVD 4XCVA 1LRLA 3GA0A 4GGOA 3OIGA 4N18A 3AI2A 3A1NA 3GDGA 4TMFA 2YV3A 5DULA 4PLVA 3GGPA 3PP8A 1Q0HA 3U5TA 2VTDA 2XXBA 1K2WA 4E3ZA 1AN9A 5JE8A 3H9QA 2I67A 4PLZA 3ZNQA 2BH9A 2H9IA 1QYDA 1QYXA 1KEUA 4J91A 2FPIA 4NU6A 1PL7A 2RH4A 3ZCXA 5HM8A 2A35A 4ESOA 5L95A 3JQCA 4GPD1 3Q6IA 1CEQA 2BMAA 1BHSA 4HBGA 3VH3A 2DUWA 4UUPA 2O3UA 3ZZNA 2P4HX 3QVSA 5AXAA 2AEJA 3I23A 3E18A 1C0LA 4R1SA 3RIHA 3ROKA 4P22A 5A3JA 4II2A 1K6IA 4DUPA 1JAYA 1E7YA 1V35A 4P4NA 2FPIB 1O6ZA 1VJ0A 2Q2WA 4ALKA 3INGA 1H2HA 3DFUA 1VL6A 1ISMA 2O2YA 2ZKLA 4UVHA 1DFHA 1PSDA 2FZWA 3RASA 5CAEA 3T7EA 2OP0A 1C0PA 3L6DA 1GPJA 1OBFO 4WLEA 2EKQA 1DSSG 1ZJZA 2YQ4A 4FDAA 1P1IA 1MG0A 4UUOA 3OJ0A 1RM5A 4IBOA 1ZH8A 4W7IA 2NU9B 3NGLA 2X22A 3CMMA 4EEZA 1T25A 3DO5A 1DO8A 1A72A 3PHJA 1AHIA 1O8CA 2ZB8A 1PR9A 2JHGA 4YJGA 2AQKA 3ITDA 1VPDA 1BXKA 2O3SA 4OSOA 5KJ6A 2Z5LA 1LU9A 2JFGA 4H3VA 1X7DA 2B69A 5B12A 1U5CA 3LC7O 2X0NA 1LSSA 3KOUA 1PJQA 3RJ9A 1T24A 4ALMA 3WGOA 4CM7A 3GZNA 2PGJA 2O3JA 2BFMA 2VNSA 1XG5A 5HWSA 1P1RA 4ZICA 2HMTA 1IPFA 3WFIA 1SO8A 3JD4A 4ND5A 4CLOA 3WLFA 3ON5A 2OUIA 3UHAA 4RQUA 3OICA 2B0JA 1EZ4A 1ZUD1 3QIVA 4IDAA 1PWZA 2NADA 3F6YA 2QRJA 4PVCA 1NFRA 1F06A 4UUMA 3FR8A 3B20A 5U4QA 4BKOA 1H9BA 4GSKA 1GAEO 2EW2A 4AJNA 5T57A 2CNBA 2NLOA 3ZWVA 4CMAA 3M1LA 5THKA 3RI3A 5G4LA 3TL3A 2VRCD 3WIDA 4OXYA 1I2CA 3K8ZA 5TF4A 3WGGA 2P5YA 5KJFA 3U4IA 4CL3A 1CQJB 1A71A 1XYGA 4CMEA 4CLXA 4E2ZA 2O4UX 3RC2A 4L8VA 1U2DA 1HE4A 5EQDA 5I7VA 1WPQA 1QRRA 2ZJ0A 4J6FA 4RPHA 1NAIA 3T4XA 2IZ0A 4ZN6A 4AJLA 3JYLA 3PEFA 1I3KA 2D1YA 4J49A 5DCYA 4OJNA 1F14A 4MIYA 3QLJA 2R2GA 1HDYA 4HV4A 5IN5A 4CM6A 1VC2A 3TZHA 3UCEA 1DC3A 4JJGA 4LMRA 2ZB7A 1T4BA 5JFOA 5A5EA 3U09A 2P68A 3V1TC 1N1EA 1FF9A 4CLRB 1SB9A 4AJIA 1U1IA 3WWZA 1PWXA 1ZNQO 3PDJA 3M6IA 4XR9A 4FIZA 2GN4A 4E5NA 1XWFA 1DLJA 2B5VA 2V65A 3ROQA 4J4BA 5ES3A 2JL1A 5U9CA 1ZZEA 4PLPA 1HLPA 3KYCA 3PGJA 4YAGA 2B4TO 3E5MA 4I5FA 4JN6B 1P45A 3KUXA 3C8MA 1JA9A 2YZ7A 1W0CA 3ONFA 2W90A 1U4OA 3E8XA 3MOGA 4GBJA 1J6UA 1LA2A 1U8FO 1R4NB 2P5UA 5A9TA 2OP1A 3PFWO 1B2LA 4HX5A 4ZQHA 3CEAA 4CM4B 1ZXLA 2UV8A 4MVJP 4I9UA 1U8XX 4GX1A 4HNHA 3TWOA 3VKVA 1DIRA 3CSDA 1DHRA 1VL0A 4DQVA 2JFFA 4BGIA 4BO9A 4PFJA 5KJ1A 4OGWA 5FF9A 5JAZA 2C5EA 3ZWCA 3PQDA 1I33A 4O0LA 5A05A 2E37A 4Q3CA 4O63O 1NXQA 3WB9A 1LLQA 4EJ6A 5U1PA 4E0BA 4NFHA 1GV1A 3L0DA 1M6HA 4WE3A 4A27A 2ZJ1A 4M8SA 1I10A 1SOVA 2VTEA 2CD9A 3BMCA 2D59A 1A7KA 4OAQA 2EP5A 3BHJA 1DXYA 3FTPA 3STHA 1ENZA 5B37A 1JKJA 1A9YA 3OECA 3MJEA 1EUZA 2ET6A 2VT2A 5BSHA 1IYZA 2NTNA 5FYDA 5KIAA 2EV9A 2O4CA 1NHGA 5CHEA 3GN2A 2FOIA 5ILGA 4CJXA 1EQ2A 1TT5B 1O94A 2FN7A 1MGOA 1N2SA 4IDGA 1UDAA 2HMVA 3NKLA 5GZ3A 1GZ4A 3DZBA 3HB5X 2PY6A 3WYEA 1AGNA 1XGKA 4M89A 1ADGA 2EG9A 1E5LA 2WYWA 4NZ9A 1GL3A 4OXNA 4OMUA 1JKJB 1DPGA 4P38A 3ZU5A 1KYQA 2BFOA 4G2NA 1LSOA 1RPNA 2ZIZA 4XB2A 3WYBA 6LDHA 4KTVE 1DIBA 5CDUA 4K9DA 2ZQYA 5GZ1A 3CUKA 3Q1LA 4FS3A 4E2XA 1ZK4A 5LDHA 1MFZA 3D4NA 4MVJM 4LN1A 4BGUA 2GDZA 5C7IO 1X15A 2O3QA 3UKOA 3I9MA 1X7GA 2QG4A 1NPDA 2GUGA 1JWBB 4J0FA 3QY9A 1GYPA 4TWRA 1E3LA 3WNQA 2Q1SA 2ZYAA 3VPFA 3JQFA 3VC7A 2DTEA 3S2GA 2OO5A 2Y1OA 1YWGO 2R6JA 4NQZA 1B8UA 5L4LA 3RFTA 3DMTC 4TVOA 5CPFA 1ENPA 1QYWA 4RPJA 1XHLA 6ADHA 1TVEA 4WCFC 1JKFA 2HJRA 3QWIA 3NTOA 1EMDA 4MVJG 3E82A 4W9NA 3IIEA 3EW7A 3HNPA 1D1TA 4OSPA 4R9SA 5EQFA 4RVSA 2FY8A 3QVWA 1E3WB 4EJMA 2B4RO 1NFQA 3G3EA 3KLPX 1I36A 3PRJA 1ML3A 5F21A 3EAGA 1CJCA 3GMSA 3DR3A 3AM3A 4R51A 3D0OA 4XIYA 5JC8A 5DCUA 1ISHA 5L4NA 3I4FA 3ZNNA 1W4ZA 8ADHA 3PLNA 2ZATA 4OIMA 5COAA 3ZDFA 4QUKA 4AVYA 3ZHZA 1T4DA 3EGOA 4YWJA 1H9AA 2Q49A 5JPIA 4L76A 1TLTA 3OFSA 2IODA 3DXFA 1HTBA 3G49A 5BT9A 4EITA 4CMHA 1U7TA 2IYPA 4CM9D 5EL0A 3S2FA 4MVJI 3FPCA 3P7MA 4GX2A 3PHLA 1FK8A 3SVTA 1UXHA 3HDYA 1YBAA 5IDQA 5HS4A 1OFGA 3TSCA 1WXDA 4CM8A 3K2BA 5G0VA 3U4CA 4YAEA 3ZU3A 1ULSA 4B7CA 1HYHA 5JCJD 1I01A 3JQ6A 3WR5A 3LVFO 4MP3A 5JAIA 4C7JA 2PNFA 1KY5A 2VYNA 4QQRA 2FZEA 3JYPA 3PJFA 1DRVA 3INRA 3WDSA 1BVUA 4RJTA 5JNLA 5EINA 3WJ7A 1ARZA 1D1SA 4TZKA 1NYTA 4CM8B 4MP8A 4F3YA 3KV3O 5KVVA 4YYZA 4KUHA 1YL6A 4FFMA 3MTGA 3PTZA 4BNFA 3UICA 4J4TA 1ENOA 4ONEA 5JYDA 1LQUA 5L7TA 2VWPA 3N58A 3RQSA 3MWDA 5L53A 5ICMA 4E30A 5I7EA 4J90A 2P4QA 4Z9FA 2YV1A 4K6FA 1ZK0A 4CUKA 2I3GA 1B0AA 3WGZA 4JLWA 5H81A 2X8LA 2ZB4A 4BO5A 1ONPA 3VTZA 1SZJG 4BGVA 3AY3A 4CL8A 3BHMA 5B4TA 5CFZA 4GKBA 4RF3A 2Q45A 4YJDA 2ZYGA 3ZWMA 4AJHA 1E3EA 1OC4A 1Q7CA 4FBGA 3ADOA 1EUDB 3AU8A 1BG6A 2NU7A 1ZK3A 4TKMA 3KBOA 1FDSA 3TZ6A 3QWBA 1TI7A 3ICPA 3LLSA 2BF7A 2NVBA 3D7LA 2J6IA 3DFZA 3U62A 4D45A 4WASA 1GUZA 2Z95A 5F1PA 4XYMA 3AM5A 1Q1NA 2J8ZA 3LQFA 1MP0A 4M87A 1G0NA 2NUAB 3GF4A 5IXYA 1DAPA 2OGUA 1CQIB 4IZHA 1WAMA 2FPPB 1KIFA 1NR1A 1SOWA 2NU7B 1C14A 3UGKA 4H16A 3ROMA 1A27A 4FJ0A 1SNYA 4NDNE 1K0UA 2Y0EA 3IKVA 4A0SA 2NTJA 3WGYA 3BA1A 2OFPA 5AYVA 5B4UA 3RVDA 3QV1A 2VUUA 3FR7A 2CSUA 3Q2KA 3D3EA 3RJ5A 1E1MA 4PN3A 1HDRA 3GG9A 3RKRA 2P9EA 3JQAB 1XCBA 1O5IA 7ADHA 3DAGA 2WSBA 3VZSA 4I9NA 3E5RA 3PJEA 1LUAA 1F17A 2NSDA 3H3JA 1QLJA 3EZLA 3GRPA 4J4HA 1GADO 5IDYA 3S2IA 4BGEA 3D64A 3NEPX 4NR0A 4W4TA 4XWYA 3I4CA 2EJVA 4IPTA 4EEXA 4IXWA 3UFXB 3EYWA 4W82A 4WEQA 1NM5A 1LSJA 3GVIA 4BNYA 3PHIA 5JAQA 4XYLA 4NK5A 4DLBA 4E2YA 3PJGA 3VH4A 1UDBA 4J0EA 3BMQA 4NBRA 1PJ2A 5IZCA 2WEKA 3VVBA 1Q0QA 4IMPA 4BQRA 3QVOA 1EUCA 1NR7A 1X7HA 3P2OA 3TZCA 1T2DA 1V3UA 4CMEC 3GQVA 1DAOA 4XKJA 5BNFA 3I9KA 3H5NA 3IL2A 2CF5A 4NIMA 4R54A 2Y67A 1RM0A 3FTNA 3BMQB 2C7GA 4IM7A 3H8VA 2OMEA 1H93A 4ND3A 2PZMA 4PLYA 3JYOA 4KZPA 1G0OA 2C2XA 1UXKA 1ENYA 1H6DA 1V6AA 4URFA 3VZQA 3TZQA 1UXIA 2PKQP 4JROA 3ZWPA 2C54A 4PGFA 2ZYDA 2YHUA 2GZ1A 1KVRA 4YVFA 3SJUA 3AOEA 2HMSA 2PGDA 1KVSA 1PIWA 2WYUA 4DIOA 3ZI0A 4NJMA 2O50A 1JWAB 1BXGA 3MJCA 3VDRA 4IJVA 1B14A 1DLIA 3Q3CA 2YYYA 4AJPA 4BNJA 4FFOA 4FOOA 4JK3A 2AEFA 3AFMA 4Y9DA 1H5QA 3O9ZA 1MX3A 4PLCA 2E48A 2EHDA 1UAGA 1YRLA 4OXKA 5TT0A 3ETEA 3LF1A 3L07A 1AHHA 2WTBA 3P19A 2WMDA 1AE1A 3DZFA 4CMIA 3G79A 2FR0A 1BXGB 2XAAA 2WD7B 1U3TA 3RUHA 2CVQA 1C1XB 1AUPA 3B1FA 4LVCA 3AUTA 1XIVA 5JYEA 3PHHA 4RF4A 4EW6A 4BNKA 4WLVA 5ER6A 5TX7A 1UAYA 4AICA 4WLNA 2D0IA 2Q1TA 3WMXA 1YL7A 2HK8A 5EMHA 4GKVA 2DBRA 1DIHA 3QQPA 2Y1CA 1YQGA 1BRMA 4JQCA 4LISA 4CMKA 3D1LA 3UCXA 5IG2A 1YXMA 4I5EA 1JQBA 1K89A 4IXTA 4XDYA 5A3VA 1X0VA 3H7AA 3ROPA 1C1DA 2AA3A 4XYEA 5THQA 3SXPA 3WGQA 1PGQA 4M49A 3WYCA 1BVRA 3WTBA 4BKUA 1BDBA 3AI3A 4GWKA 4DQXA 1IUKA 1GQYA 1YH3A 5T5QA 5HA5A 1F0YA 3ZW9A 3O26A 1YS4A 2NU6A 3LF2A 1QV6A 3CE6A 1HDGO 1DRUA 2NVUB 5AXBA 1EVIA 1KVUA 4WCFB 3PVZA 2FR8A 2PD3A 3B70A 5ITWA 3QWAA 4G65A 3I52A 3V8BA 4B4WA 4CODB 3OJEA 3I9OA 1PJ3A 3V5NA 1N8KA 1LC0A 3QW2A 2BRUA 4Z3DA 3T7CA 4FQ8A 4ZVVA 2JCVA 2NU6B 1GR0A 1TXGA 2YFQA 1E77A 3FPLA 4RZHA 4DTIA 4XIJA 3SX2A 3QWFA 4O59O 1MC5A 3R0IA 7MDHA 2C5AA 2VN8A 1K3TA 2OZPA 2JAPA 4KQWA 1UH5A 3TRIA 3V1YA 4I1IA 3OIFA 1ONNA 3WSWA 2H63A 2EEZA 5DT9A 4Q9NA 3ONDA 4BV8A 2GASA 3GPDG 2W2KA 3GHYA 3MJ4A 1I24A 3JQFC 4KOAA 2GCGA 3U9LA 2X58A 3GHHA 1RJWA 4R1TA 3KTDA 1I32A 1HWYA 3C7AA 2WE7A 2X4GA 3ZV5A 1H6CA 3DBHB 2D5AA 4EJ0A 3LZ6A 4GH5A 1UZNA 4WPGA 4XYGA 4D3FA 3PIIA 4D43A 5IDWA 3D3WA 4CV0A 2PZKA 2VZ9A 4W9NC 5CG1A 3KLMX 3KETA 3AK4A 1DFGA 1I0ZA 1HDOA 2BGLA 2VQ3A 3ITKA 3QVXA 3SC6A 4AJOA 4TKLA 1HDCA 5JY6A 3O38A 4QEDA 1X13A 3OQBA 4CMJA 4D3SA 3EC7A 1Y81A 3W4JA 1DIGA 4GX0A 4XX0A 3RUIA 1XQ6A 4WEOA 9LDTA 2EGHA 4RV9A 3JV7A 2B4QA 3H5RA 4W7HA 3DBRA 1QV7A 2J5QA 1WMBA 3L6OO 4GMFA 3FBGA 1YBMA 4AJKA 4Z6KA 1B3BA 3RC1A 4C7KA 1U2GA 1A4IA 1AXGA 4YJHA 1GUYA 1LQTA 5FI3A 1YJ8A 4O1MA 3ZWNA 1I3NA 4XX0B 1QORA 2GN8A 3GPIA 1ISIA 3CZRA 4YQZA 3ICCA 4J43A 4XQEA 4J1QA 3VKUA 4CM3A 5L51A 3GAFA 3RBZA 4WNCA 4U0JA 2EJWA 4NJOA 1PEDA 3JYNA 4JXKA 5CAEB 1E7RA 2HKIA 3WTCA 3PI7A 3AM4A 3UVEA 1HE5A 1JW9B 5DOZA 3CMCO 4Z0TA 3X2EA 3AU9A 4KQXA 3OM9A 2JD1A 4ZGWA 1IULA 3DZIA 3G1TA 1HLDA 4YJFA 3HDJA 2DUUA 3QSGA 1QSGA 4BOYA 5CDGA 3WMWA 2ZQZA 4YJGB 4JCOA 2RAFA 4R41A 4N54A 3RFVA 4YBZA 4TSKA 4U6QA 2YHIA 3DB2A 3DBVO 3EVNA 3IJPA 3OJOA 2I66A 4IJKA 1IZ0A 3KSZO 1HE3A 2AE2A 2C07A 3GZNB 3H9UA 2O7QA 2HCTA 3BZUA 1E1KA 2I6TA 1P31A 3GUYA 2BGKA 5DF1A 3LT1A 5TGDA 3IDSA 2C29D 4CLOB 4ZRNA 2Y05A 1P33A 3HADA 3UUWA 2Y93A 3JD1A 4UVGA 3E48A 4IMRA 2YHIB 1GYRA 1ZSVA 2BKAA 4J1NA 2HU2A 3ABIA 3WLEA 4P8RA 1VJTA 3DDNA 1D7OA 1HXHA 1ZXBA 2X9NA 3NAQA 2VUTA 2Y0CA 4B4UA 3G1UA 3O4RA 2B5WA 3I1JA 1GCOA 3WX0A 1UP7A 1Y8QA 3PJDA 1NPYA 3SEFA 3DHYA 4DQUA 1I2ZA 3FNGA 3LT4A 1QYCA 1ZMTA 4IDBA 4DREA 3KO8A 4OHUA 5KKCA 4I5GA 5JDIC 3R3JA 1PJBA 4N5LA 2P9CA 2R00C 2VOEA 3KEOA 4NBTA 2GGSA 1H94A 1ZIDA 4JIGA 4Z0PA 3NV9A 2HUNA 4CMGA 1E7WA 1Y8QB 4MINA 4CR6A 2PFGA 2DFDA 1M76A 4N5MA 4MPDA 3FHLA 1Q7BA 2Y1FA 5L7YA 1E1LA 2FRDA 3MWEA 1DC5A 2WJPA 2Y0DA 3A14A 1I3LA 2J3HA 3F3SA 1UDCA 1BMDA 3RSHA 3DZHA 2C20A 4CMCA 1PZGA 4NPCA 4PLHA 1F8FA 2J3KA 2ZTLA 3I9JA 5JXWA 3PQEA 4YAJA 3DBLA 4FCCA 4KMSA 4NBVA 4QFCA 1MXFA 3GK3A 4M55A 1SEVA 4CQMA 3W6ZA 1VRWA 4E5KA 1UJMA 3WS7A 4RDHA 2E49A 4NG5A 3I9LA 3CTMA 2GRAA 3V2HA 1NQOA 4E6PA 5KCZA 2OBNA 4YRAA 4RORA 2BFAA 3JQAD 2Q46A 1M75A 2X23A 1ADFA 3W4KA 3FI9A 4EUHA 4H7PA 4R5MA 4BO8A 4QECA 3KYCB 5IZCC 1FDWA 4CQMB 3H9JA 5KTKA 4TRMA 5ILOA 4IDCA 1A7AA 1EE9A 2QYTA 4FSHA 4IDEA 3VHRA 4CR8A 2BD0A 3SJ7A 4BNLA 1ADBA 3DOOA 4UEJA 4A2CA 1HL3A 2ZK7A 2DU8A 3JQDA 3KEQA 1Y5MA 2JJYA 3T4EA 4U6SA 5DNAA 4AFNA 3V1UA 1RWBA 5AQ1A 1S6YA 2PTGA 4OOEA 5KNLA 2DQ4A 2IZ1A 1P1JA 1IL0A 4FFPA 4UULA 3RUAA 4H15A 2HK7A 2HO5A 1DB3A 3ZWXA 5ENVA 3JQ7A 5BQFA 3PGXA 2FSSA 4F46A 1JTVA 2VWHA 3AUAA 3EUWA 2PKQO 3L9XA 3AOEC 4FR5A 4BL5A 1IE3A 3L77A 2E82A 4BIIA 3FBTA 3BMCB 3GRKA 4BHTA 1KEWA 2V6BA 2ZCVA 5IFLA 2ZCUA 3ZWAA 3VPSA 4UUNA 1UUFA 3ZWYA 3GG2A 1T2AA 2DKNA 4WCDA 3PFFA 2E4AA 1ZCJA 3PK0A 3JQ7B 5JO9A 3NT4A 4HP8A 3VPGA 4BO3A 3GUCA 4EUEA 1JAXA 2I99A 4YQYA 2VCYA 2FR1A 1KERA 2Y1DA 4KP7A 5MDHA 1LLDA 2QRLA 4A10A 2UYYA 3B1JA 3I83A 4QFDA 4DMMA 3ZHBA 1BW9A 5CEEA 3HHPA 1NPTO 2PD6A 3KHUA 2X86A 1TT7A 3W8FA 4MVJE 5BNTA 4GLLA 3C1TA 4DC0A 1YJQA 1SEPA 2NU8A 3ZNOA 2ILTA 4CLDA 2QZ9A 4FPXA 4BMVA 4MIEA 3IC5A 2CZCA 1P1FA 4NNJA 4HFRA 3RC7A 3DAFA 5JO0A 4PG5A 1BW9B 1GEEA 3HWRA 1D8AA 5IZ4A 1KEPA 1DIAA 1M67A 1XU9A 3S1LA 3LDHA 2H5LA 1V9LA 4Y6PA 5HS6A 4WNIA 1J5PA 5TS3A 1R4MA 5JC1A 3HN7A 2NU8B 1VLLA 4DXHA 3ANLA 4WOKA 3MJVA 1E5QA 2G1UA 1PL6A 5COBA 5HRUA 3DZGA 1LTHR 2Y1EA 2YDXA 2YJZA 3BTSA 4EZBA 2UUPA 4I8XA 3Q0EA 1YVEI 5JMWA 1LDMA 2PH5A 3KYDA 1PJSA 5I9LA 4FC7A 2J5KA 2VWQA 2EERA 4HXYA 5L40A 5AVOA 1TEHA 4L9RA 3HFGA 5GMOA 4IIVA 1IY8A 4HFNA 5T6BA 2B83A 1HDZA 3RWBA 3ORFA 4OQYA 4CUZA 1MB4A 1Z73A 1QXSA 3RAJA 2DFVA 5IJZA 5DCWA 5L9AA 2O7SA 2DM6A 1L1FA 1FJHA 3IAHA 2VOJA 1HZZA 2Q99A 4IZIA 1JKIA 4PZEA 3ASVA 1S7CA 3GT0A 3UH1A 4RLSA 4B3JA 5IN4A 3VPXA 5A02A 1WNTA 3UAGA 2BI8A 1JVBA 2PH3A 2JAHA 4QO8A 2GLXA 4BNTA 4GGPA 3KSDO 4GVXA 2DBVO 1NVGA 1O9BA 3PYMA 4IJWA 5DBGA 3IQDB 2AXQA 4N7RA 1E6UA 1KBZA 4WKGA 4XB1A 1M66A 3IS3A 4TZTA 4FFNA 4J1SA 3GDFA 2TMGA 3H65A 1B3RA 3Q11A 3V2GA 4QT0A 3SLKA 2C82A 3VAZA 3FWZA 3GAZA 3OF2A 5KVSA 5HBRA 1NQ5A 3NUGA 4FFRA 1W6UA 4GMGA 4HKTA 4JNKA 4XYBA 1K6XA 1P1KA 3FNEA 3BMOA 3CXRA 4RL6A 2EIHA 2V7PA 1YB4A 1P9LA 3MOIA 2EKLA 3PZRA 2C7VA 3PDUA 3OH8A 4INAA 5KJEA 1PJTA 4PLFA 3CKYA 4JJIA 2Q50A 5B4VA 3GVHA 5TNXA 4BNVA 1LDNA 3KRTA 4XRGA 3CPSA 1DRWA 1PGJA 3OETA 1KC3A 3AJRA 4RGBA 3ANMA 3RU7A 1HKUA 1ZK2A 4IJUA 5ER9A 1YONA 5AXDA 5J23A 1MG5A 1OZAA 3BMOB 4L4SA 2QX7A 3F1KA 1T2EA 1WWKA 2HMUA 4ITUA 4P4GA 3MWDB 1N5DA 3FN4A 4X54A 1L7EA 1LC3A 1YQXA 2X6TA 1P0CA 4WLFA 4D7AA 4LW8A 2FWMX 2OBYA 4K26A 1IOLA 1WMAA 4CV3A 3VDQA 2D4AA 4AJ2A 2NWQA 1MFPA 2I9PA 4PLTA 4D79A 3D4PA 3I5MA 5I7SA 2OOSA 5G0WA 1C0IA 1WDKA 2BI7A 5JMPA 5LCXA 3RD5A 3IP1A 3KYBA 2X7HA 2O23A 4F45A 2GNAA 3HDQA 2JFHA 3EHEA 1ISGA 3HJAA 2IZZA 1MLDA 4NBWA 1QYVA 3C85A 3R3SA 3WFJA 2GR9A 1B16A 1N9GA 3AI1A 2HK9A 2DC1A 1PS9A 2DVMA 4LCEA 3MJSA 5JW6A 1FDUA 1XELA 1CRWG 4TRNA 1XEAA 1MV8A 3ZN2A 1SC6A 4RCVA 3RUFA 2H6EA 3I6IA 3F47A 1I3MA 1ZEJA 2HQ1A 1IPEA 5IF3A 3GEGA 3A9WA 4RF5A 1GY8A 3BAZA 4YTEA 1ZEMA 4DYVA 3DWFA 3KVOA 5ENDA 5DP1A 3VZRA 4GX5A 1GPDG 3FF4A 4XD2A 4B3IA 4TVBA 4XJTA 1XU7A 4XDZA 1SPXA 1YOVA 5BSFA 3I9NA 2UVDA 4BO2A 4FD3A 4NHEA 1GYQA 3U49A 1EQUA 1XR3A 1A5ZA 3RUEA 2GERA 4UVIA 3GEMA 4W99A 3DTYA 3I3OA 2W2LA 3E6AA 1KS9A 3TOZA 5TRTA 5DDIP 4TRJA 3QWHA 1GFSA 4OL9A 2VNAA 2SCUA 4A03A 1QR6A 3ETDA 2CVZA 1Y8RA 2B35A 4J9VA 4Q3BA 1NQTA 1ID1A 3C3XA 4BUCA 4RDIA 3JD0A 4XJSA 5C5IA 4ZA2A 3H5AA 3NRCA 4II3A 1PR3A 1YB5A 1PL8A 4LRSB 3INTA 4PLGA 3U4HA 4Z9YA 1EUCB 5T8KA 1Z82A 4PG8A 1ZK1A 2OORA 3DQPA 4UEKA 3AW9A 1FDVA 1ORRA 5EN4A 4BNXA 4FC6A 3DOCA 4ZQGA 4ALJA 1HETA 1IB6A 3GH3A 4YA6A 5GZ6A 1E3SA 4B4VA 3HN2A 1NNUA 1O0SA 2P91A 1OI7A 5FI5A 2VHVA 3RROA 3VTFA 3G17A 5TJ9A 4L74A 4Q3NA 2X1HA 3UF0A 4L75A 2Y66A 1BXZA 2Q1UA 2O3RA 4K1LA 3ZGYA 1V0JA 4BNGA 1G6KA 2WE8A 2G17A 1JU9A 4P4LA 1E7MA 1UZLA 4DIBA 3ONEA 3PWSA 1Y1PA 1JLLA 4L4RA 1R6DA 4IS3A 2CVOA 4Y6SA 4QXMA 4BO6A 1NVTA 4BO0A 3B6ZA 4BMSA 5JAMA 3OHSX 2D8AA 4AJ4A 3CIFA 1BGVA 2JD0A 4NJMB 3NGXA 3ZH2A 4FOSA 4IIUA 1VL8A 3E9QA 4CUJA 1NWCA 5H82A 2JD2A 4G5HA 4MO2A 4ALIA 1ULUA 5A9SA 4DMLA 4MJLA 3SBOA 5CP8A 5IXSA 3ZV3A 1LDEA 1H6BA 4R68A 3DONA 3PPIA 1YDEA 4RQTA 1Q0LA 5CG2A 4XGKA 1RYEA 3VPHA 1L7DA 2AG5A 2Q4EA 1LXCA 3QJ5A 1UP6A 4WJZA 4Y98A 4CMIB 3PYLA 4YCAA 4DBZA 2P9GA 2EW8A 3RKUA 1Z7EA 5G0UA 2CFCA 4CQMD 5IAAA 4JP2A 5A9SB 4U8GA 4B3HA 3F5QA 5L4SA 3MEQA 3UOGA 1QP8A 1YL5A 3KM0A 3PHGA 1VSUA 3LLVA 1V8BA 3UCFA 2OHXA 3IKTA 3KXDA 4BNHA 2HLPA 1Q2XA 4LCJA 2RIRA 5G4KA 1JN0A 5BSGA 1MUUA 4RPGA 2O2SA 1T26A 2IE0A 4J7CA 3DOJA 1E0DA 4KDEA 5LDGA 1CERA 2J5RA 1BDMA 1PQWA 5MGBA 4R69A 5C37A 3ULKA 1C1DB 2JCYA 4OYRA 5JS6A 1EK5A 2POQX 3WJAA 3GFBA 4KWIA 3IUPA 3JD2A 4PG4A 4WGGA 3F9IA 1U5AA 1D3AA 4FN4A 5K6AA 9LDBA 2G5CA 4BVAA 4YT4A 4D46A 4D0RA 4ROSA 1EBFA 2YY7A 4BNWA 4LMPA 3RUDA 3H3FA 4FW8A 1EFLA 5CPBA 3NDIA 4EYEA 1MC4A 2JCXA 1QMGA 2C0CA 2FP4A 5JBIA 1P44A 4FJ2A 3FD8A 4BB5A 4J3FA 3W4IA 3BTVA 1ISJA 3PQFA 2BELA 2YFHA 4LK3A 2BGMA 5KKAA 4TRRA 3M2PA 2AE1A 3TZKA 4OKNA 4RF2A 3BYZA 1FMCA 3NDJA 1UXJA 2WM3A 2IDZA 3WICA 1PGOA 5KVCA 1HEUA 5F5NA 5FEUA 2GPTA 3S55A 3GR6A 1T1RA 4FJ1A 4AJEA 5TLSA 3OQ1A 2WWRA 3ZHYA 2W2KB 4Q3DA 4CLEA 4Z3KA 4B8WA 1XLTA 2LDXA 3NT2A 5G2OA 3GVXA 3K5PA 3I6QA 4YT5A 2VZ8A 2DBZA 2FHSA 5DOVA 2AMFA 1KVTA 4YXFA 2WDZA 1HT0A 3HG7A 4E33A 5AOVA 1IHXA 5F1OA 4IGEA 1YGYA 2Y1GA 4XZ3A 3D3WB 3ADPA 4LRTB 2D5CA 2NQTA 4PLWA 1HF3A 3P2YA 5CDTA 1Y7TA 1NX6A 1ZFNA 2F00A 4IQ8A 3DMYA 2EWMA 2YUTA 4DGSA 3KB6A 4DIFA 1DOHA 5AXCA 3IJRA 1FXSA 3W1VA 5A4DA 5I8WA 2NU9A 3W6UA 4FGWA 2I65A 4E5YA 4ZQFA 3DBRB 3F1LA 2G0TA 3ENNA 1SMKA 2PZJA 1QG6A 1P1HA 1WZIA 1X14A 3C7DB 2E6UX 3PWKA 1DBVO 3PXXA 2P2SA 1B8PA 3DEYX 2AW5A 4YJHB 2HMWA 3X2FA 1YQDA 1UXGA 1EVYA 4BQPA 1HRDA 4AJJA 4JP3A 1ADCA 5H83A 3H9EO 3QHAA 4BS9A 1ZMOA 2QIOA 3UW3A 4YB8A 4M86A 4YAIA 4R1NA 2TMDA 1ZBQA 5A5FA 4U5QA 3IMFA 4EBFA 1GUFA 1J49A 4YT2A 1DEHA 4ZJUA 3PIDA 5F1KA 4MP6A 1NAHA 2Q2VA 4QO7A 3ANNA 3C1OA 2VWGA 5DP2A 5DN9A 5T64A 1B7GO 4XGNA 1H6AA 1NVMB 2QRKA 1XKQA 4YJFB 2DAPA 3RBXA 4D44A 4EUFA 4D0SA 3NJ4A 1I30A 3JQBA 3VH1A 1PQUA 2OXIA 3HFSA 5I9MA 1VJ1A 2DTXA 3DTTA 3R1IA 2VYND 3TFQA 3ZU2A 3OP4A 3PYXA 2W4QA 2IEBA 3WNVA 5TIIA 3S8MA 1XSEA 3A4VA 5EPOA 1MXHA 4OOFA 4I08A 3QA9A 1GQQA 3NYWA 1VKOA 3M2TA 3JYQA 5C3MA 4CV1A 5A06A 1CQJA 4J9UE 1T2FA 5JDCA 4IY1A 2RCYA 3MCVA 5DBIA 4Y6RA 4YR9A 4KDFA 1N92A 4ID9A 4UVEA 1HYGA 1R15A 1DHTA 4R01A 4WK6A 5KOIA 1R66A 3JQ8A 4EGFA 4CM5A 5BR7A 3AFNA 1RYDA 3TDKA 1P77A 4L4XA 1CDOA 3AY7A 4IDFA 4HFJA 3GFGA 3D5TA 4R5HA 1D4FA 1LLCA 3DZJA 4DLLA 4JBIA 1HE2A 1RM4A 2HAEA 1C3VA 4Z0HO 2ZTUA 4CLRA 3JQ8B 1F8GA 1E92A 4B79A 1KY4A 3ST7A 5DZSA 3LSYA 4BNNA 1NP3A 4E4YA 1I2BA 5I7FA 1W73A 4YT8A 2VUSA 4ZU3A 2GN6A 1LEHA 4ZQEA 4E5MA 2PV7A 1Z75A 3K73O 1O89A 3JD3A 1OOEA 4Q3AA 3WQQA 3UN1A 4MIOA 3DZKA 4GSLA 1YKFA 3AWDA 2QW8A 3HB4X 5COQA 3MWEB 1E7QA 3BTOA 3AUUA 4FFLA 2V6GA 5CDSA 1R0SA 4A5OA 1U3VA 2J3IA 2GF2A 3NDRA 1R4NA 3MJTA 1DJQA 1UZMA 1J4AA 2FSVA 3DBLB 3E1KA 2PLAA 4UAGA 1PJLA 4W6ZA 3ZW8A 2H1SA 2X0JA 4MOWA 3ZHXA 1LBEA 4CM4A 5HTOA 3JQ9A 4DPKA 1OAAA 2NV6A 4DYDA 2X5JO 1TB4A 3U0BA 3MZ0A 1XA0A 3RU9A 4BNIA 4A73A 2Y99A 4YEDA 2X9VA 2GN9A 4YDRA 3D4OA 5KVQA 3OJFA 1R0LA 3FNFA 5TSDA 2AEMA 1O95A 1PQPA 2WYVA 2GD1O 2G82A 1GDHA 3GNSA 3GY0A 3IUSA 2WD8A 3QVTA 4LVUA 2F1KA 1N1GA 1PJCA 5T8KC 3QRWA 4PCVA 1A9ZA 4BV9A 2JHFA 4Y67A 3TQHA 2IRWA 4NK4A 1XQ1A 4ND1A 4CQLA 5A9RA 1UP4A 3HQ4O 4CV2A 3ZV6A 4MKXA 1TT5A 1QLHA 3ZWWA 1OC2A 1OMOA 4BB6A 2BHLA 1WVGA 2W2LD 1P74A 3FRJA 5TC4A 1A4UA 3JSAA 3Q9UA 4RLHA 3NTQA 1LDBA 2PA3A 5BSEA 3QP9A 4PRKA 4JBGA 2VHZA 4NU5A 2AQIA 3H2SA 3VOSA 3A06A 1E3IA 2JKVA 3EVTA 4CQLB 1ZO8A 2X0RA 4MVJA 2ZB3A 2FPGA 3L4BA 2VYVA 1LLUA 3O8QA 2NNLD 4LSMA 1PS0A 1SBYA 3RC9A 5JCXA 2D2IA 3WGHA 4E21A 4FB5A 4DRYA 1K6JA 2DLDA 4J16A 4GAEA 3K6JA 5KJCA 4RPLA 2HJSA 2EKPA 3F4LA 3MTJA 1LRJA 3C1AA 1IZ9A 2FPGB 3R6DA 5G0TA 1R37A 3W8EA 3O8QB 1GEGA 2CDAA 4OO3A 3FWNA 4KWHA 4Y8VA 1LJ8A 4BMNA 1VE9A 4BKQA 3NTRA 4Q3EA 1H0KA 4CPDA 1UR5A 3PZBA 2A94A 4BNUA 4DLAA 5JY1A 2NQ8A 1WZEA 3OJLA 4RVDA
chains in the Genus database with same CATH superfamily
4FMDF 3ESCA 4IX1A 8LDHA 4HEHA 2XTAA 4D6YA 3PS9A 6NULA 4DLSA 1RC1A 4IIJA 1L9XA 1KETA 4Q4HA 4TN1A 1A69A 2QTVA 1BGXT 3LI2A 4GI2A 2ZUBA 1E3WA 2ZEJA 1T9ZA 2FUEA 4GXRA 5A2GA 1ESNA 1N2XA 5HX7A 4ITRC 3OIDA 4DEVA 2MSEB 3SS9X 3G59A 2HD4A 5JR3A 4EFNA 3EOZA 3HC7A 1VHTA 2Q4OA 2Q5OA 5ABPA 2F8MA 5K2OA 2IBSA 1R4MB 3GNLA 4UOQA 1ZJYA 4BASA 2E4UA 4C03A 1ZC4A 3GZ4A 4NEGA 2A92A 2PA0A 1BSVA 3OZFA 4B7XA 4E5SA 1T4CA 2BFCA 4ZANA 3L1UA 4BNMA 3WQHA 2RHRA 3WQSB 4TLMB 2KS6A 2X9GA 3A1EA 2P4EA 4XB6B 3TJRA 5K6AC 2DG2A 3CN9A 4MS3B 3TFOA 3L7JA 1Y1QA 3SXUB 3FMVA 3L84A 3SK0A 4JR1A 2H0AA 2ILVA 2VEDA 4ND8B 2GHTA 4RHYA 5G40A 1RM3A 1VIAA 1E1RD 3B7GA 3RRNA 4CL2A 5CCDA 3Q0TA 4NOKA 1RI4A 3GLIB 2GZ2A 4UEOA 3IDFA 4WOBA 4X7RA 1MZPA 2FLKA 3LK7A 4FCVA 2XXAA 2QUHA 1EGVB 1VE3A 2W6QA 2W2OA 2YDYA 1X7ZA 3C7CB 3HABA 2ACWA 4F6RB 4PSDA 1RZUA 4I9GA 3LP5A 2NVWA 5B30A 4CKBB 2QDKA 1BOOA 4HH1A 4NOLA 4YO8A 2ZIWB 2AB0A 1T9DA 4CQNA 4HY3A 3CHYA 1U2QA 4U0KA 4V0NA 3WLKX 5C7OO 3QNWA 3ZV4A 1NMQA 4QTYA 3C16C 1U0JA 5F35A 2WY2D 2A7QA 5TS2A 1S2IA 1U99A 1UJBA 3SQXA 2WTEA 3EGCA 1OBCA 2OFWA 2MHCA 1NHWA 4IL5A 1YB1A 1KA9H 1NI4A 1WD7A 2X1LA 3RVQA 4QXQA 1EK6A 1U0EA 4G4IA 4ZKEA 1YBVA 1PYDA 4NFSA 5ITVA 3L8ZA 1GM5A 1ZXXA 2FEKA 4PHGA 1M8KA 1N6LA 5HCNA 3WKBA 4AO7A 5J4LA 4MVJF 5L7WA 3L6EA 1DJNA 3B1KA 3V1NA 4MCHA 1GTMA 1MAHA 3CLSD 3R8XA 4CMBA 1P60A 2Q4BA 2H1RA 4OH7A 5BMVB 2LIVA 1HYEA 1K27A 2VK2A 3EXG2 5CA0A 3EZGA 1E3JA 3JQGA 4ZV9A 4HFMA 2BM1A 5LNK1 2W5UA 2BLLA 2NO7A 4OHRA 5KQLA 4TSFA 3S2ZA 4CCYB 1RP1A 1S8FA 2FOXA 3E9MA 4GZMA 4C7XA 1X1BA 3DR5A 3RFCA 2OFFA 4JUFA 3N3AC 5KS2A 4MRSA 4GOJA 2HMAA 3TJMA 1FS5A 1DXQA 1H2BA 1H2WA 3VO9A 4M1QA 3PVSA 2C3PA 4LBWA 3HCEA 5G02A 1IN1A 3SQMA 3GFTA 4O8ZA 2PWZA 1KEVA 2YXNA 4QHYA 4F5EA 1R64A 4JBHA 4ETNA 1IXZA 1HG1A 1ZD4A 3HBAA 4IUBS 1F8XA 5IDXA 2DBQA 2V7QA 1A76A 5BURA 1A82A 5EEGA 1P3DA 5HE8A 2OYCA 3TMKA 2DEUA 3PICA 3G9TA 4FOTA 2AVNA 4PVDA 5BNIA 5AKLA 1C7IA 1QFJA 2YX1A 3V3KA 3ZLVA 5BV1A 3RAEC 5CXUA 2C97A 3GNQA 5DYIA 1TM5E 3DC2A 5JCZA 3R8CA 2AJ8A 3IUBA 4E31A 1RXSA 2WU1A 5F23A 1CZRA 1SCUA 2PUCA 2QSJA 2ZUWA 1EIWA 2JFXA 1WB9A 1WXEA 3THXB 1M6WA 1FVHA 3BXPA 1PV2A 1CR1A 1U0GA 3I6ZA 4MUBA 1NZFA 3OQ6A 4D0GA 2X42A 1P0FA 3H2ZA 2AV6A 3OPYB 1PG0A 2BWJA 4YP5A 4R81A 1D2MA 4L73A 4EGAA 1U3UA 2PD4A 4DLPA 1PYGA 1CETA 4R84A 2PK3A 1K0FA 1LLFA 4LXUA 1KL7A 1YT5A 3D1JA 5JH7A 4IINA 3GLQA 2HPHA 2OFXA 5ALZA 3H6KA 4KTTE 3NONA 4PR3A 4JH0A 4Y9SA 3DM5A 4QJBA 2D6FA 1O4WA 3P45A 1GT91 3L4EA 2UUCB 1Z4IA 3RJTA 1ZR2A 1KC1A 3TN7A 3ZHVA 2Q41A 5ECWA 2Q3EA 4TWIA 3OA0A 3CJRA 3JQBC 2V54A 3OKFA 3UJHA 5EKUA 5JSFA 3ZXXA 3BWCA 1XZAA 4CLHA 3TKLA 2J5BA 4W5NA 4F6CA 4BZZA 2OPHA 3WJ1A 1AXEA 3T5BA 2Z4TA 3G9XA 4KUGA 3T06B 3CNLA 3W78A 3S5UA 4G8JA 2ZDHA 1CFZA 3E0QA 3TAXA 1T2CA 3ZY5A 2APJA 4F3KA 1N3LA 1KYWA 1DKNA 2XH8A 1VM6A 3AV0B 3BWBA 3MUOA 3UJ6A 1JJAA 3VVCA 4POAA 3IUJA 3MA0A 3M1AA 4EKIA 3OZDA 2AFVA 2IT1A 2B4AA 4L7QA 4I6EA 4R8VA 1B6TA 4TKVB 4DPLA 5HF6A 5L45A 3SQDA 2E5FA 3EAQA 4YAKA 2PS3A 3LWNA 2JFWA 1D2RA 2YZNA 4LC0A 2DWCA 2OM2A 4HX9A 5IWCA 3GEDA 1Y8CA 1GFWA 2XPCA 2C59A 4HADA 4O2BF 3HYTA 3IHWA 3MAAC 4BFWA 1X8KA 2NT3A 4C4ZA 3IKMB 4Q7LA 4RVGA 3AETA 1Y89A 3LX8A 2NYUA 5AKYA 4BO7A 4E32A 4QTXA 5IM5A 3KJIA 3QUTA 2ZYSA 4O4IA 4NCJA 1E32A 2SCUB 4IS2A 3MUNA 1W52X 4ZRMA 3SSMA 4K7JA 1YR6A 2Z83A 2FPUA 1CJKC 3K9GA 4G0XA 4I5DA 5J2UA 3N28A 1AA9A 3BMNB 4EX7A 1IRIA 4KPGA 3KP1A 1GZDA 1GZUA 2XYQA 2PTHA 1RZVA 1YFKA 2AG8A 5T4FA 4Q1CA 5CA0F 1W8DA 4FW9A 2GO7A 1DADA 1Y63A 3VSDA 2FJPA 2H4JA 4ND6A 4YACA 2FRDC 2NZVG 3AGQA 1E1NA 1EDOA 1JLKA 2AN5A 3K94A 4MVWA 4X92A 2UDPA 2CZGA 3WLIA 3SFTA 1C7EA 3IAUA 2XD4A 3AHIA 3LOQA 4BRZA 5E8JA 4C3OB 4DA8A 3PNMA 4DMRA 1JDNA 1W29A 3F46A 3OJCA 1Z22A 4JI3B 1LX6A 3PQ8A 2GXQA 1N2ZA 4ZDKA 4M8KA 1H65A 1C4XA 3GD5A 1I8TA 1BRTA 2EZ9A 1YAHA 1DU4A 5E6RB 3WIUA 2XMDA 1HG0A 2W42A 2Z1MA 3ABRB 3FDZB 1ZI6A 3ACCA 4RVHA 4QT4A 1MB2A 3R41A 1IBCA 3GGDA 5FFMA 3DULA 2V6IA 4LTMA 1OFTA 1RWNA 1GG9A 3W8DA 1U81A 4IW3B 1SG6A 1Z3CA 1R2QA 1UMCB 2A8YA 3JTMA 3G2LA 1RBQA 4GQAA 4RKWA 3X43A 3TW6A 3ZNPA 4M76B 5HGJA 5INTA 5HMMA 3V1LA 1JLLB 2CJWB 1JIKA 4HDMB 2Q6IA 1OH5A 4OJMX 1VLJA 1V4BA 2TMKA 3FDXA 2VRBA 3UMBA 1NF3A 3JQ9C 2BGRA 3QG1A 1HSOA 2Z8YA 2XCOA 3I12A 1GQ2A 1F5NA 2AOTB 4QUJA 3SLGA 1RADA 1LS6A 2QJWA 3ZC3A 2R8ZA 2P9JA 3HA5A 3U4GA 5EERA 2QSUA 3WV5A 4ZRDA 4YX9A 4QYSA 5CTJA 3PR1A 4DLWA 5CYOA 1E2JA 3PE6A 5HJ5A 3HE3A 2W2MA 4V2UA 1D1PA 4ALLA 3OA2A 1X7XA 2DGDA 4QLAA 3KZVA 1PGNA 3U0VA 4C29A 1E2QA 5CEJA 2HLNA 1P9RA 1AKYA 2RHMA 4IWXA 4X1KB 4DB4A 4BNZA 2HHHB 1HEYA 1WSDA 3DL2A 3DAPA 3T35A 3N5CA 3OUTA 3PCRB 3R5HA 1M2VB 2C92A 2WF8A 1Y48E 2XV1A 4GI3A 4NU8X 1XMPA 4XAQA 3VPCA 2FMFA 4K6HA 4UARA 2C4WA 4FYXA 2YL2A 2AI3A 3Q72A 3L0OA 3L0ZA 2I2AA 2Q5HA 4KR7A 3OJXA 2NVUA 1JJFA 2O1SA 1XTRA 1B6RA 4BQOA 3LUCA 4OFXA 2IS6A 1I94B 1OX4B 5D6OA 5FOWA 2OSBA 1TOAA 1F6BA 4JX8A 2ZVQX 5EMKA 1JIIA 4I9HA 5PGMA 3SHWA 2DTDA 3ABSB 2QLTA 1NFFA 3ENKA 4GWGA 1UKAA 3VUFA 1X1TA 2B37A 5B1DA 2RH8A 3RS7A 2H1VA 3A6DA 2AFRA 2V0CA 3IVRA 1NASA 2V6MA 2IZ5A 3TIFA 2JIMA 3VKWA 1GCUA 1ZUWA 4Q15A 1Y3AA 3SYTA 3U3XA 5B7NA 2QZJA 3FSRA 3FTEA 2WUVA 2CF6A 3HDHA 3JSXA 1UOOA 2ZSDA 4A5SA 3ENZA 1N7GA 1MENA 4Q4JA 2W2VA 3AKZA 1IM8A 1YZFA 3IBGA 3O3NB 5ALOA 1PKEA 4G6ZA 1XZNA 3KUKA 4IQGA 2E87A 4YLGA 4HR7A 2HFJA 4A26A 1M1YE 2YJGA 4Y2QA 2VHWA 5IAJA 4FM9A 1M2EA 3BTUA 4ATNA 1GLNA 3GGOA 1Y6JA 1EBUA 4L0QA 4MLCA 1IQPA 3UK7A 3QEAZ 4YRTA 1J0XO 1XYVA 2XE7A 3AOGA 2H7XA 4EH1A 4NH0A 3CXUA 2UXCB 3NHUA 3QYJA 1HR0B 2WPNA 4DNPA 1W0KA 3LY9A 4OFZA 1UBKS 2IHYA 4UHHA 1RWOA 2GZ3A 1EFKA 3DBHA 3GC6A 3NBFA 4GE0A 1A9XA 3NJ8A 2NO4A 2JGRA 1GGHA 1RVV1 3UFBA 1LPMA 1REQB 1XVAA 3ACDA 4S3MA 1AQ6A 2C96A 5D1HA 4ZD6A 3WBBA 5HR5A 3A58B 3EQ6A 2A6PA 3MCUA 2OKCA 1BYUA 4GXQA 4R16A 1RT9A 2IV3A 4E70A 1RIIA 4ZCTA 4QNNA 4N18A 3AI2A 5KOHA 1XTUA 2D54A 3A1NA 2BKLA 4JLBA 4PLVA 3HFRA 1NNI1 2AZ4A 3ZS9A 5I7WA 1Q0HA 2VTDA 3DWGA 4X90A 1KYZA 1XCGB 4YMWA 1KZ6A 3GXOA 4QXOA 1W5FA 2WWYA 2H9IA 4L02A 3C7TA 1KEUA 1Z2PX 1UCFA 2RH4A 3ABOB 3CGWA 5CLLA 4DLVA 3ED1A 4KE8A 4I46A 2XKKA 4XWTA 3GRYA 4LJ5A 4CCSA 2IL1A 3O8CA 1MJFA 3WBKA 1FTWA 1SA0A 2WWXA 4GE3A 3LHIA 1EFRD 1ORDA 2OHHA 4DFDA 4RTMA 5FPQA 2P4HX 5AXAA 1N5IA 1QP4A 5IVHA 5D84A 4P22A 2ZAIA 4II2A 4KLAA 4RFSB 1TUIA 3EISA 1A8SA 2IX9A 2X5XA 2AN4A 4X6LA 5FWXB 1V35A 1XZIA 2M6KA 1BE1A 4GWLA 2HRQA 3ZJTA 1O6ZA 5KYWB 1C1YA 3TB6A 3TW8B 4UBLA 2PS9A 4HUQB 3INGA 1H2HA 3AONB 1MA3A 3IMCA 4GZ5A 2WMYA 3BERA 3H75A 1PSDA 3LE8A 3HYRA 2WJAA 3Q7PA 4FFBA 2YMLA 4G5GA 4TS9A 5AW1A 4GOND 1YUMA 1LPBB 1OBFO 1T6BY 2W6NA 3WGNA 3M9WA 4ADSG 1JXAA 4GOKA 2JI7A 4L22A 2I3BA 2G77B 5AK5A 1P4RA 3C1UA 3LDGA 2IXGA 5E0OA 3CMMA 5AP9A 4RZUA 2CNWD 4MR8B 3VR6A 2COUA 3DNPA 2Q7DA 1RXWA 3ZZUA 2ZBDA 3A9TA 1K63A 3USZA 3LTEA 3KSMA 4GRDA 4RTOA 1O8CA 3HACA 4MRNA 4MZDA 1K5GA 3SSOA 2WIFA 3W7AA 3ITDA 4K3UA 5IAEA 2O3SA 3O9MA 3VBCA 4TZ6A 1PJAA 5TARA 2FGKA 1CB0A 3E9CA 1GTVA 4H3VA 4J76A 2X0NA 4KN6A 1IBLB 1PT7A 1BEZA 2C42A 3DTVA 2BFMA 3ML1A 3MFQA 5BQPA 2VNSA 1CX9B 1DTWA 4G5OA 2H48A 1EA7A 2VF7A 3MN1A 1YZKA 1CQPA 5K3BA 2GH1A 1AUVA 1ODJA 4NBLA 4D97A 4D1YA 3PDHA 4CLOA 3WLFA 5ARBA 4Q37A 1C2TA 1P75A 4IDAA 4QXRA 1CDEA 1ZUD1 3RIXA 3SR3A 1PWZA 1UOEA 1KFEB 4AF6A 1ECCA 2PX3A 1Q21A 4HUTA 2PZGA 2I6XA 2XUHA 2C3OA 4PVCA 2CMHA 4EY7A 3B9BA 2RGWA 4WX2B 1F06A 1N57A 3QU9A 2JPDA 4QDXA 3ZJ4A 4KBGA 1C7ZA 3PUVA 5U4QA 4JJ6A 1FUIA 4V02A 1GTL1 4BKOA 1JKMA 2G4CA 3G2HA 4AJNA 1CUAA 2OVBA 1G20A 13PKA 3WL8A 1NY5A 2VTKA 1VSTA 4RIHA 2NLOA 1QHNA 3SC2B 5LB2A 2HN9A 2CXNA 3IAXA 3JW8A 3P5BA 1V45E 4KWEA 4L3VA 4YI3A 5DTQA 3K8ZA 5G4LA 3SHTA 5IASA 3DFFA 3HU3A 5H80A 5KJFA 1F2VA 2NSYA 3H2HA 3O93A 4MGYR 1NE7A 3OKCA 4GPBA 4NYMQ 1A71A 2GKGA 4U7HA 1XYGA 3MD9A 4DCNA 2WB2A 1LPPA 3N2GB 1HE4A 1YS2X 4O4JA 5EQDA 3K9LA 3O4VA 4C1BA 4TMZA 1HC7A 2CXHA 2ZYHA 5I7VA 1WPQA 5HW0A 4N7JA 2ASEA 4MWSA 3VTAA 1P6XA 1NAIA 2CZQA 1FPMA 1NW5A 3T4XA 3T1QA 4ZN6A 4WL0A 2D1YA 5FOUA 4X63A 1S4MA 1KOGA 1CUJA 1XTZA 4K5QA 3CURA 2FG6C 2UZ3A 4KIGA 5EE3A 4B84A 3R0XA 1V8FA 2XGOA 3S1AB 4S05A 2E5WA 3HA3A 2FYTA 3PITA 3KJHA 3U1TA 1DC3A 1YB2A 2C0PA 2CJFA 1WB4A 2ZB7A 3H8JA 3QVGA 2P68A 5JFOA 4PBRA 1KTVA 1CR6A 5LQMA 5E9QA 4CLRB 4AJIA 1U1IA 3WWZA 1PWXA 1FFSA 2EJTA 2ZFUA 3OF5A 3TPFA 1MAAA 3FHOA 5EZYB 3PDJA 1DQZA 2HU8A 1L3CA 4LXGA 3ZXSA 1AHPA 5EY5B 5LM3A 1XWFA 2V65A 2WUDA 3UQYS 3GDWA 4OHKA 2OYRA 1SXJB 5U9CA 2N1MA 1HLPA 3Q2OA 4QUGA 3MB5A 1P6UA 4B35A 4DV6B 1ZN8A 4IDOA 3AL3A 1TVCA 5H4GA 4AW9A 4G8BA 1TF2A 3EPPA 1W0CA 2PH1A 4OK3A 2QXUA 1E2HA 4RLFA 4AZVA 1OZ0A 3OURA 2L82A 1J2RA 5K7SA 5KREA 1KF0A 2EU8A 3VUEA 2NXNA 3E8XA 3MOGA 1J6UA 3A1VA 1LA2A 4L08A 4KYTA 3JATA 1U8FO 2QVCA 5CXXA 1Q7TA 1L4HA 2RCNA 2RD2A 1UBJS 4HX5A 4X8LA 3MTQA 2W0SA 4ZQHA 3RT1A 2ZJBA 4CM4B 3GPBA 1II8B 3NEAA 5LZ7A 5JCPA 3TWOA 1BCRB 2OESA 4C2TA 4DQVA 3EDQA 5ADWA 1CQZA 2Z9CA 4PFJA 1RXUA 1AX9A 1MT3A 3ZWCA 1Y42X 2RHDA 2PT9A 3AFGA 3NQ41 5JSHA 5BVGA 4HNTA 1M1UA 4XFDA 4O63O 3WB9A 1XVIA 2XQJA 1H2AS 4O2LA 3LWZA 5AICA 4Y2JA 4E4TA 3UWOA 2XE6A 5KSWB 4S12A 3I0MA 2VTEA 4EMUA 1NBME 4OI1A 2ORWA 3ZW7A 4F4FA 3OCXA 1EWQA 3FPHA 3UUGA 1RAIA 1GNTA 3STHA 4F8YA 4WN3A 3THWA 3KWJA 1JKJA 3OECA 1U8EA 5SZJA 2WF7A 1EUZA 2ET6A 3C3AA 3T1NA 1YJBA 5JD4A 1D9ZA 3OTOB 4R8LA 2C04A 2O4CA 3GN2A 1K8QA 1H8EA 1WZNA 3W3AH 4BEJA 4CJXA 2R6HA 3BRSA 1WG8A 4QYMA 5CT8A 4MV7A 2QZ4A 4UCXA 1MGOA 5EIHA 4EL0A 3B3QA 4DOMA 4FDUA 1GZ4A 2D2EA 5A62A 3WGMA 5H9VA 1DC7A 2CMKA 1WNFA 4M89A 1B6GA 1DUVG 1KAQA 1C41A 4NZ9A 4BP9A 1DMSA 1MAVA 3Q3EA 5KZMB 5EGNA 3PL5A 1U0NA 3KB8A 1Y5LA 3ZU5A 1KYQA 3QEKA 1K5PA 2BF4A 4MK4A 1JLRA 4KC0A 4Z4CA 1OVGA 2ZIZA 3ZHSA 2VH5R 3DZCA 3ZDBA 1DIBA 5CNIA 2JZCA 4O4JF 4K9DA 2ZQYA 2C98A 2XDQB 3Q1LA 3RVKA 1E79A 2BKVA 4MSUA 4U4AA 3OQIA 4E11A 5JZSA 1T4MA 3UK6A 1ZK4A 5EKSA 4LN1A 5K0SA 1WVIA 1JA1A 2GDZA 3IEIA 3BMXA 1TUGA 4W63A 4IOJA 4TV9A 3IUYA 5AW7A 3M3PA 2NUPA 2CFTA 2B3TA 4I50B 1NPDA 3UY4A 1YVUA 1JSRA 2D7CA 3JPYA 1LD3A 3OESA 4U9IS 1GYPA 2HQRA 1NVEA 5HYVA 4BFSA 3WNQA 1SU6A 3M8KA 2C9OA 3MNFA 4Y2UA 1C4OA 1WDWB 3GP3A 3MERA 3MOSA 3MGBA 3TBKA 3VC7A 5BW4A 4PC6A 2ZITA 3WWCA 1GN8A 3PGMA 3GJSA 4G36A 4N82A 4U2DA 3DMTC 4FDLA 3RVNA 3RG2A 3OZTA 1R9GA 1JHYA 1SC3A 2FSFA 2POCA 4DJTA 1ECBA 2TECE 4PSKA 3ZWKA 1JEQB 1QYWA 3E0XA 4DKXA 2RB4A 4DXDA 4DABA 1XD2A 6ADHA 1NGSA 4AG6A 3BX1A 4V1CB 2JJ1A 2C9ZA 4KIFA 4WIAA 1OLXB 3QWIA 4NAVA 5IUKC 3PFKA 1EMDA 3P9PA 4MVJG 2AZTA 1X80A 5K3DA 1FFBA 1D2HA 4O2RA 3IIEA 3NOQA 4RK6A 1N2JA 3F74A 4K8RB 1ZI8A 1MNAA 4DA4A 4OSPA 4JJ8A 1XMQB 3TM4A 2UZIR 4CKZA 2J0SA 2FY8A 4B87A 1QHXA 1UBHS 3HCWA 1U2SA 2PFKA 4UU7A 4AX4A 4EJMA 1CXZA 5KWJA 4BX8A 4FLFA 1E9SA 4IP0A 4NZOA 2EATA 4Z2AA 3EVBA 7REQA 1GU0A 2QX4A 1W88A 3EGXB 1CJCA 2VEOA 3RQIA 2O07A 2BW0A 2FP3A 2ABWA 4RGYA 1A88A 4YMTA 1ISHA 3ID6C 1BE6A 5REQA 1W4ZA 4G8DA 3DG9A 5COAA 1D6SA 3Q7IA 3T5DA 1XNJA 3UMRA 1T4DA 2VNHA 1LJLA 3OFND 4JEHA 4HDQB 1U0FA 3P20A 2IODA 2GZDA 3DXFA 3TQOA 8GPBA 4DCPA 4R0NA 1LY1A 4YYEA 1KI2A 4JT9A 4ZMBA 2IYPA 1SCAA 3UAYA 1RNLA 1VDMA 3FPCA 2VJBA 4GX2A 3E2PA 1JALA 3SVTA 2C3UA 2PO7A 5AR1A 2XRYA 1VCIA 4KQFA 4OYLA 4DCVA 1ZM7A 1WXDA 4DA6A 4CM8A 2XTZA 5G0VA 2P3LA 2FSGA 2IY9A 2ZRLA 1FU7A 3KS9A 3HKBA 1HYHA 5BT8A 3PDWA 5AVUA 2BEJA 4R0MA 2O8CA 4KO8A 4AC9A 4TS1A 1CG6A 1VL1A 4OLJA 2FZEA 3PJFA 1BVUA 4BLPA 3WLMA 5JNLA 4BX3A 4OQDA 2ZBPA 1YIDA 5EINA 5T7BA 1M0SA 2KPOA 4M0PA 3S5JA 2QBYA 1NYTA 4NBNA 2K2WA 3N8NA 2JGIA 3ILVA 2X40A 3KCNA 3O4JA 3OOHA 1NQVA 2XQVA 5TVKA 1N6HA 4PX3A 4RETA 3KV3O 2O2IA 1K7EB 4BX9A 4KUHA 1BDJA 4LOJA 2ZJAA 4MX8A 1TO1E 3BOSA 3L7NA 1FFGA 2ZSFA 2AN1A 3UICA 2XBMA 2CHUA 2QUKA 4YRNA 3I92A 4NTZA 2VWPA 4PCUA 3T52A 3AF4A 3OD1A 3QI2A 1RWQA 4Y2YA 3OCJA 1FLNA 1CRLA 1YS6A 1F2UB 2O7RA 3MWDA 3SD7A 4E30A 3K0FB 4EMTA 3H5WA 4YV1A 3GBPA 5I7EA 2P4QA 2FUKA 3WRYA 3Q9SA 2DUMA 2BEUB 2CXOA 4MHTA 1B0AA 3DE7X 3SYLA 4WBSA 2PXXA 1YZTA 1L8QA 5ERGB 5E7MA 1Z35A 5EMJA 4C0QC 3KVYA 1V5GA 2EJCA 3KZXA 4MJXA 4BGVA 1SZJG 1F7UA 3AF0A 5CFZA 1WOYA 4NZZA 2Y92A 2YWHA 4RF3A 1Z6YA 1MVOA 1JBQA 4GM4A 4LFCB 1A2OA 4W9RA 3ZWMA 2CXPA 1NDHA 4LJAA 3QY0A 1OC4A 1Q7CA 4FBGA 4PC3A 3HL4A 4ZO7A 3S28A 4DA0A 1EUDB 3ZOKA 2QEQA 3I76A 3WRXA 3DEIA 1BG6A 4C7MA 1ZUIA 4LTNA 1EX6A 4AU1A 2ZXUA 3AHGA 4TM7A 3UQZA 4UHEA 1Q0ZA 2JLUA 4M9ZA 4EB6B 3O83A 4N3BA 2J6IA 1PBTA 4K0KB 4HMQA 2VJOA 2Z95A 2BT4A 1QOQB 4DIKA 3TRJA 4ZYUA 5FA8A 4MTLA 4ZODA 1TM1E 3F7OA 2WB4A 2OGUA 4WY2A 3ZWDA 1LTQA 3HZOA 4E09A 2FPPB 1LVGA 3MWFA 4FCTA 2Q62A 1JSZA 2NU7B 2XDWA 1C14A 3WLTA 1N1DA 3Q0IA 2Q29A 2V5AA 2ZS8A 2NXWA 1N5OX 1NW3A 3QU7A 1JJVA 1K0UA 4C6RA 3IKVA 4YDSA 3BA1A 3WGYA 2IOHA 5F7ZA 1ZRHA 4U2CA 2JAOA 2RAVA 2LR0A 3ES9A 3Q2KA 2B7CA 2AX4A 1Q84A 3RJ5A 3ITNA 4ANFA 1E6MA 1KZ7B 1BXRA 3R9KA 1L6IA 1T9GR 2M1XA 3DLTA 3JQAB 3LO5A 3MLEA 1E66A 1N0HA 1G2OA 4M8IA 5ALWA 2WSBA 2P9ZA 3TR6A 5E7IA 4L5BA 4LDPA 3VZSA 4DMUB 4NEQA 3U4QB 3PJEA 2CBXA 1MW9X 2D3WA 4M1MA 4UBIA 1F17A 1ZUNA 3B8EA 4KX3A 1ZICA 1LPSA 1M7HA 1MX1A 1WHSA 1RR6A 4KIUA 4PE5B 3HO6A 5DSTA 2Z56A 3D64A 3PXGA 4DDVA 3I4CA 5F7OA 2A7XA 3CSSA 4HSGA 4IPTA 1J9GA 3J81A 2OV8A 3EYWA 4W82A 1GTSA 2JAQA 2PUAA 1NM5A 1XALA 3UEOA 4UNNA 4HGYA 5JAQA 4BNYA 4EZIA 4NZYA 3PJGA 3RT9A 4L2IA 1AT1A 1SIBE 3BSFA 3ZLTA 3BMQA 2FEMA 3BGDA 1IN6A 5IZCA 1OR8A 2EKZA 4B80A 2Z2KA 4MYHA 4C4YA 4IMPA 2JGDB 4OXXA 4FE3A 4V38A 5E1MA 5ED4A 1X7HA 4LOAA 1YGPA 2B92A 4CMEC 3M4YA 1QUFA 1F3OA 3GQVA 4Z1MA 4MV0A 4OSEA 3DVRX 6CHYA 3FZEA 3U9SA 3J7AC 3O73A 4A23A 1KZYC 2CF5A 2OWEA 521PA 2PQ6A 1RM0A 2IV2X 1FYEA 5CX1B 3FTNA 2IS2A 4G24A 1D07A 2C7GA 2B5OA 2F8LA 3H8VA 1Z8FA 2HU5A 4GGMX 4IM7A 4TQUS 1RACA 1TVKB 1GO2A 4PLYA 1U1FA 1O6GA 4IX9A 4KZPA 4H1WA 2QY6A 3F6CA 4GI7A 2C2XA 2Q4RA 4JOQA 1JTFA 5I9IA 2CHQA 2JH8A 1TO2E 4WXRA 2XMBA 3GW8A 4KVGA 1VPTA 4JYCA 1UKYA 1UEIA 4Q66C 1Y7HA 1UXIA 1MQ8B 2PKQP 3IMKA 5KDLA 3WDLA 5KAMA 2GZ1A 2IP1A 1CD5A 1CEEA 2HMSA 1C3OB 2DHEA 2PGDA 3HWWA 3K2QA 2BGIA 3G9QA 5BPFA 1OZFA 3FX2A 4Z4QA 3MJCA 1WUYA 5K20A 2WKRA 4IJVA 1B14A 1QRTA 4YS6A 2YYYA 2R4QA 3QE9Y 4FFOA 1YZHA 4FOOA 4HS9A 4JK3A 1PFYA 1S3SA 1UL1X 3SFVA 4DADA 2VAMA 2JLBA 2J0VA 1RCTE 2VZEA 1Z33A 2P78A 4JJ4A 1NXTA 4EGSA 5LBTA 3PPWA 4EJFA 2IV7A 1PDVA 2JBHA 1GT6A 1OZHA 2YN2A 3BC1A 4TQAA 1Z39A 1AHHA 4TUYA 5C8ZA 1MKYA 4MWZA 3LXRA 2WMDA 2G63A 1HQYE 1SXHA 2ZUDA 2PT6A 3BZBA 3DZFA 1NTRA 3NHBA 4KBYA 4P92A 3RUHA 4CMIA 1DCMA 1U3TA 1AUPA 2M32A 1QBKC 3K32A 4NE7A 2IYQA 2VP9A 2WFLB 3BXGA 2AN3A 1E2MA 1Q92A 1XIVA 2GYVA 2ZRIA 3D4BA 2GPWA 3DXXA 3IAM6 4U7JA 4RF4A 1J2EA 4XX1A 5BSTA 1PVDA 5DEOA 5JY6A 1DJMA 4P83A 2M6RA 1Q0UA 2ZJ5A 3GYGA 3R4CA 4N6OA 2D0IA 2O5RA 5KYYB 5IS2A 2HK8A 1U9IA 3NIWA 5EMHA 3KPYA 1TCAA 1X6VA 2G6BA 2JIRA 5AO9A 1YQGA 4FEGA 5FOSA 4DDKA 1GCGA 2FRVA 2GB4A 4JQCA 4LISA 3Q3IA 4MB2A 3WZ2A 4CMKA 1MN6A 5IG2A 2P69A 1F20A 2KLHA 3AQIA 3HBMA 2IGBA 4IXTA 4BWYA 4O3FA 4XDYA 4OI4A 3S7ZA 5HNKA 2FSPA 3OI7A 6Q21A 2EG5A 3O4GA 3SXPA 1WB6A 4X7MA 2ZIVB 1PGQA 2ZSHA 4M49A 3DQZA 3WYCA 1M74A 2IUUA 3TZEA 4BKUA 3GLFB 2FN4A 1OX6A 1IUKA 2PKYX 1YH3A 5T5QA 3Q1KA 5HA5A 4ARZB 1W76A 3QUBA 2YIDA 1HDGO 4KLNA 2NZJA 1O94C 3TINA 4D9FA 3A6KA 2QT1A 5I9TA 3HYSA 4DSTA 2IEZA 2XQGA 2FR8A 4QYTA 2ETXA 3I5XA 4KFSA 4I4NA 5ITWA 2EYQA 2HO4A 2IYTA 3QWAA 1QBGA 1RLMA 2GUWA 4MUEA 3V8BA 3I9OA 2CLCX 1KAMA 3PUYA 1N8KA 4HDNA 3CCBA 4LDNA 4OQLA 5H8WA 3T7CA 1K7XB 2BRUA 3BCHA 4Y2VA 5ADVA 5IHPA 5CX4A 1GR0A 3HCAA 2A0XA 2QENA 4NYMR 1JH8A 3HPRA 2IY7A 5H4HA 4UTPA 5K8VA 3SX2A 2COKA 4R7ZA 1N7IA 4C22A 4MUJA 1FJXA 2JCBA 1QIMA 3R0IA 4ZVOA 2P0EA 3OOEA 3GLHA 3M5CA 4B31A 1CS4C 5KHLB 4JASB 2OZPA 4G1MB 3IV6A 4FHCA 4KQWA 3V1YA 4R6XA 1LTKA 1FJ2A 2ZUSA 3OIFA 4UM9B 3T54A 4Q9NA 2ZSIA 3A9VA 2QN3A 3ILSA 2X8AA 2O8EA 2GASA 1OPRA 3PC3A 4X8MA 4AO6A 2AFHE 3O75A 2PWBA 1LV8A 2QN1A 4MVCA 4AUKA 4P3PA 5FEMA 3PB3A 1AGPA 2OO5C 2O7NA 2IYVA 5H1YA 2ZPUA 4ASUD 4B3SB 5IC6A 3PG5A 3KTDA 4YI5A 4G5QA 4HLUC 1II9A 3ZV5A 4KWTA 4YH1A 3M49A 5ILQA 1UANA 2B21A 3B3JA 3NVAA 3O8OA 3SOPA 4OP1A 2D5AA 3CWZA 4MWOA 2QKYA 2JFVA 2XMPA 4AB1A 3ZQUA 4KJZA 5HE9A 4E51A 3EDOA 1QO7A 1IIRA 4XYGA 3L6CA 5AOBA 3TCXB 4D43A 4IO0A 3I61A 1IHOA 2OZVA 4UPEA 2ZPTX 5K3FA 1DO0A 1MTZA 1A98A 1XZEA 4H08A 1W7AA 4MQUA 1SFRA 2H85A 1HDOA 4OGFA 5HKAA 3D31A 5HILA 5KTTA 5T6MA 3OQBA 5B1HA 1KDVA 4CMJA 3TX2A 2HJVA 2IYRA 2PZBA 4FQ5A 3N6RA 5TPWB 1PDWA 3K0AB 2Z2JA 1WIWA 4TUYF 3S70A 3D6JA 2WKQA 1XQ6A 2YHSA 4PAWA 4WEOA 1KR5A 3RTBA 9LDTA 2QUIA 3GEIA 4RTNA 2EGHA 3CJTA 2JGNA 4IIHA 2YNMD 3VOTA 1KMIY 3VBEA 1LK7A 2HGSA 1E1YA 3P0RA 2QL6A 1OUMA 2J5QA 1WMBA 1CRPA 3GU3A 1J20A 3DDUA 2ZAOA 5ALHA 1B3BA 5DWDA 3RC1A 4DBLC 3RE1A 1U2GA 1AXGA 2YVAA 1K7FB 1K7SN 1HYQA 2G67A 4LPSA 3CLHA 3TVYA 4JHLA 5FI3A 3TDMA 1R27A 2GJ8A 3TG8A 1V7ZA 2OVFA 4FX2A 3CB2A 4TKUB 3O2JA 4KXYA 4XQEA 2GCPA 2WUWE 4J1QA 1J5EB 3DUFB 2JH9A 1A97A 1V1MB 4N0DA 3B7PA 1OY1A 4MI3A 5A4IS 5JAPA 3VGPA 1OGJA 2PPLA 4U0JA 3FA2A 3IQXA 2HKIA 4NS1A 4BJ1A 3JWPA 4LQ4A 2BE9A 1EJ2A 2QLMA 3P9CA 1W30A 1Q19A 3QOYA 1RRFA 5DOZA 2DWOA 3X2EA 1C8BA 4AMGA 1VYTA 1DG3A 3C98A 3ZTWA 2WFAA 3CLTD 2I3ZA 3BD9A 1IULA 5IKPA 2M98A 1VRVA 1NOJA 1HLDA 4OJTA 1CF9A 4YJFA 1K3FA 2D5IA 4FU0A 2J4DA 3ZIAD 1TDJA 5CDGA 1CHDA 1Q0TA 3N53A 4OB6A 3PEYA 1QHEA 4DY6A 1V8DA 3N0VA 1IXKA 3L8YA 1ZHHA 2WAXA 2RAFA 2JGAA 2C2KA 3KV1A 3PENA 4N54A 4B71A 4TX1A 2C5GA 2AJLI 4MEBA 4JLVA 2GPJA 3VR3D 3DB2A 3HB1A 3U26A 4C30A 2R7MA 3EVNA 3BGWA 5JVDB 4KQ9A 3WLOA 1PV4A 1D0VA 1JMKC 4XGRA 1HE3A 2ORED 5CVVA 3L5KA 2C07A 3KU4A 1P31A 3HN6A 2BGKA 3W3AA 2HIAA 3WFZA 4C0XA 4JU9A 5TGDA 3IDSA 1YS9A 2Y05A 1P33A 2LW7A 5FLYA 3E48A 2A9VA 2FCRA 4HAUA 2JIZA 2BKAA 3MTEA 3MRTA 4IG9A 5K8LA 1ZGHA 2QD5A 4R7GA 3BJMA 1WJGA 3W0LB 5C1DA 1YVRA 4DIUA 2ISQA 2BMDA 1KO8A 3BJZA 4LJKA 1A2KC 1G8YA 2VKQA 3O4RA 2V1XA 1JPJA 1Y8QA 2EP8A 4HLCA 3A0UA 3C4VA 1IQ0A 2GVZC 3OTHA 2VDKB 3TLXA 5EXXA 3CVUA 1SKAA 1I2ZA 3FNGA 2XUPA 2CLMB 4AUNA 4KE9A 1U8TA 3ESQA 3A2KA 1PN3A 2HC9A 4L72A 7AT1A 1N3YA 3VU9A 3KQLA 2O6HA 1L4UA 4BLRA 4D96A 3R3JA 1PJBA 1VLMA 5KSZA 4Y2GA 4NBTA 1W25A 4V03A 1H94A 2B1QA 4Z0PA 1FNNA 4CMGA 4DDMA 1E1QA 1ULTA 3FF1A 3FFWA 2IDMA 3HU1A 3O94A 4N5MA 1L4BA 4K9SA 5HIIA 4MPDA 3RVJA 3SIWA 3SJCA 1UBRS 3FHLA 1Q7BA 2Y1FA 5CVCA 1OYWA 1XA4A 5FKJA 4F4JA 5JQGF 4AQ7A 3FNRA 4WNYA 3AEKB 4IOMA 4A8HA 1P7YA 2FN3A 2FRDA 1DC5A 3MWEA 3A14A 1TIKA 1RE0A 1UDCA 4MUAA 4RH1A 2D2FA 2ZIXA 3DZHA 2C20A 1KK1A 2ERCA 3PD0A 3A1FA 4J3NA 4DCJA 4F5WA 2B6HA 4PAQA 5EJAA 2L17A 3I9JA 3KWFA 3PQEA 4B32A 1G8FA 4I55B 1ZMBA 2WM2A 1QGDA 2FMXA 4PX2A 3TQCA 1RRPA 3WNCA 3GK3A 1Y5IA 1SEVA 2VT7A 4M55A 1VRWA 4M0EA 5AHWA 1Z2NX 2A88A 3DHVA 2VH1A 3R24A 4JZKA 2ODWA 4MITA 3WS7A 1Q0RA 3I9LA 3RYCA 1ZMRA 5KCZA 1SVMA 4HD8A 2PG3A 1ESZA 2HREA 1XL0A 4MV9A 1ZCBA 4NENB 2P4SA 4FYIA 2X23A 3QLUC 2V7UA 3VYWA 2G9QA 3W4KA 1DEAA 5FBZA 4R5MA 3VO1A 4AN4A 5K4GA 3UENA 2F1HA 1X77A 4IRUB 3A11A 3CKLA 3SEZA 4QECA 2ZPAA 3QKSA 3VFDA 4BUJA 4RTJA 1FDWA 4FNOA 1Z25A 2FDXA 4RA6B 4KO2S 5KTKA 1H4SA 4PY2A 4R2LA 1QQBA 3PNBA 1EE9A 2MR6A 1IJKA 1QX4A 1ZD2P 3G2PA 4FSHA 3AZPA 1E4EA 1WLSA 5F52A 3VHRA 2ENWA 4CR8A 4Y0VA 2BD0A 1ZG3A 1KRHA 4DSAA 1NF2A 2Y2UA 3LJKA 4LXXA 4IHJA 1JB9A 3BDVA 1P4JA 4XCXA 5D3KA 4KXMA 4MW2A 4QBKA 3A1UA 1G60A 1Z5OA 3CH7A 5BQ3A 3JAKA 3M0EA 4I14A 2FFBA 4FMCF 4WFKA 1X3SA 3T7DA 4Z7NB 5K0NA 3T7IA 4WZAB 4OPMA 1Z6XA 2L0XA 2X41A 3DDSA 1RYNA 4AFNA 1K97A 3RSGA 3SLRA 3V1UA 3V7WA 2A3NA 2PTGA 4N40A 3C8DA