1EUCA

Crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
306
structure length
306
Chain Sequence
CSYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
total genus 118
structure length 306
sequence length 306
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eucA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1eucA01
3QW2A 4ND1A 5EQFA 1Y6JA 5IAAA 3H9QA 2JAHA 1EK6A 1U5AA 1IULA 4CM4A 1YONA 1LQUA 2BGMA 2XOXA 1Z73A 4BNLA 4KUGA 5TX7A 4YDRA 2FZWA 3H5NA 3ZW8A 4LGVA 4KWIA 1E6WA 3MZ0A 1H6DA 4F6LA 3T4XA 2A92A 3H65A 2G82A 1E3WB 2RH8A 1WVGA 5DF1A 3R3SA 3HE3A 1RM3A 3DZJA 4PZEA 3L4BC 3AWDA 3L4SO 3NUGA 4IDDA 4RPKA 1WZEA 1GYQA 1A9ZA 3WJAA 1GPDG 1DHTA 3UH1A 1C3VA 3HUDA 5G2OA 3OF2A 2DBVO 1PJTA 4DC0A 4MKRA 3CEAA 1KVRA 3CSDA 3T7EA 3WWZA 3AM5A 1EUDA 1Q7GA 4DYVA 1LDMA 3H5RA 1WMAA 3VZRA 1JKJB 3JQ7A 4XYEA 1WWKA 4MIEA 1IL0A 1C14A 4DPMA 1SZJG 2EERA 4GAEA 2E6UX 3UUWA 2Q46A 1GZ6A 3WGHA 4ALJA 1LRJA 4Q3AA 3PLRA 4YVFA 4OIMA 1OZAA 2BGLA 1MG5A 2VZ8A 5IZ4A 3WGQA 5DBGA 4YT2A 2VZ0A 4WUVA 5CDSA 4CV3A 1G0OA 3M1LA 5F21A 4UULA 3GH3A 3JYQA 1WDLA 1E1MA 1Y5RA 2VUTA 1J5PA 3AM3A 2GYYA 4TZKA 3EDMA 3F5QA 4HFRA 1FXSA 1SCUB 4PFJA 5DNAA 3AU8A 3ZV3A 1GYPA 2UUOA 4PN3A 1T4BA 3BAZA 4MIOA 2VTDA 5ER6A 3GY0A 1JLLB 4NMHA 5DBFA 1GZ3A 2WD7B 2NTVA 5ILGA 4GQAA 4ALLA 5JBIA 4E2ZA 1QV6A 1HZJA 1SMKA 2VQ3A 4J0FA 1NFRA 1SCUA 4L9RA 1FDUA 4J43A 4ND2A 5F1OA 2HKIA 1BVUA 4FFLA 4YR9A 4C7KA 1NQOA 3DZKA 3MJSA 4ALIA 1Z7EA 3HHPA 4D44A 3ZU3A 4O1MA 4IJUA 3GZNA 1Z7BA 2AMFA 5CPBA 3OEWA 5IXYA 1SC6A 2GRAA 1CRWG 1T25A 2QQ5A 4EW6A 3PVZA 1YB4A 2PZMA 5B4VA 4NJOA 3JQ8B 2FPPB 3PLNA 5DDIP 3F47A 4IMRA 3T7CA 4BVAA 1B16A 1CYDA 4Q3BA 2C7VA 3V5NA 1Q0LA 1R15A 1KC1A 3OM9A 3GN2A 3UVEA 4QQRA 4II2A 4CUJA 1GTMA 1SB8A 4FPXA 5HWSA 2I76A 4Y6RA 1RPNA 3RSHA 1TA4A 1E7WA 2DUWA 4BO2A 4BMVA 4J2OA 4LCJA 2QRLA 3WGOA 1UP6A 2ZJ1A 3E9QA 3K9QO 1DAOA 1QLHA 4NH4A 1B8PA 1N1EA 1ZZEA 2SCUA 4E5KA 1K6IA 3QP9A 2GGSA 3NX4A 1DRVA 2LDXA 4TROA 1ZEJA 3Q3CA 3D64A 3VTFA 3COSA 5A05A 3GRPA 3PWKA 2HAEA 4JJGA 2ZCUA 3RUAA 3FN4A 2GZ2A 3ONFA 1TVEA 3RBZA 1S6YA 3E9NA 4KDEA 4YJGA 1QP8A 3K5PA 5TC4A 2NTNA 2WE8A 5H83A 3PIIA 3K73O 4ESOA 3ZU2A 4CLRA 4LK3A 1F17A 2Q1SA 5L4LA 4F6CA 4AJLA 3KSDO 3IL2A 4R41A 4U6SA 4CQMA 4UEKA 1GZ4A 1KETA 3DO5A 2AEFA 4N54A 1NP3A 2UYYA 1J49A 2OBNA 4XKJA 3ASVA 2VYND 3VVBA 4WK6A 4YAGA 2OOSA 2C07A 3JTMA 5JDIA 2QYTA 4WASA 5C5IA 3GDOA 2EGGA 4IDCA 4C7JA 2UV8A 3KM0A 4GX2A 2IXAA 3U4HA 4WOKA 2EHDA 2ZTVA 4YJDA 4BO3A 2C54A 4ZA2A 1OI7A 3IOYA 3NYWA 3WMWA 1C0PA 2DLDA 1K89A 3LYLA 1GEEA 4QUKA 4AFNA 4HNGA 3W6ZA 2WSBA 2VYVD 2NLOA 4UUNA 3JQDA 3LK7A 3S1LA 5BSHA 4KP7A 4J1SA 1HKUA 4CM7A 2AQKA 3TL2A 1HEUA 4QX6A 4CMKA 2CF6A 3CPSA 5F1KA 4P8RA 4D3DA 3UHAA 4RJTA 1WPQA 2VT2A 2E4AA 2QX7A 3BTOA 5EMHA 1K3TA 1QRRA 3BZUA 4LN1A 4JLWA 5B1YA 3LC2O 3JYNA 4MVJP 1EDZA 1CERA 4RPJA 4I9UA 1XA0A 5G4KA 2Z1MA 4CM9A 4XR9A 3RFXA 3AUAA 2PTGA 2Y93A 4EUHA 1B14A 3M6IA 3O03A 4D43A 2FSVA 3K30A 2X0JA 2X9GA 5FFFA 4XEHA 4OHUA 4P4LA 1O94A 4RVGA 4Z0PA 1E7QA 1YDWA 2GD1O 4PLZA 4IDGA 5KTKA 1YVEI 5T64A 2YQ5A 3OBBA 1AXEA 1DFGA 3KETA 5G0SA 3RU9A 4BGEA 1LTHR 5FEUA 3MJ4A 1DB3A 5DT9A 2YHIB 1UZNA 2VHWA 3GOHA 3L6OO 3LT2A 4EEXA 4J1TA 4BKUA 4ZQGA 3AI1A 1HSZA 3GNQA 4JBHA 4PLPA 3JQ6A 2BD0A 4M8SA 5TSDA 1I10A 4BNHA 1QXSA 3PHIA 1ML3A 1I33A 2DAPA 3RUFA 2HQ1A 5IZCC 1UH5A 4XYMA 1ADCA 1HDYA 1SPXA 1UUFA 4I1IA 3G1UA 5AXDA 4DLAA 2ZB4A 1NR7A 1E3LA 3HWRA 1R0LA 3QA9A 3FTPA 3I5MA 3IS3A 1XR3A 1ISJA 2Y66A 4P22A 4E0BA 1EFLA 3JQFA 4DL9A 1LDGA 1JAXA 3IKVA 4DBVO 5IN4A 2I99A 3NTQA 3GEDA 5I9LA 1E77A 4WLUA 4DQXA 1OAAA 1NVTA 4AJIA 1P0CA 4NFHA 4PLGA 2BMAA 2X5OA 1TI7A 1Y81A 3HSKA 4R5MA 4K1LA 3H5AA 2J3JA 2EGHA 1RWBA 2BELA 1MV8A 2XF8A 3JQBA 4WLFA 4E33A 1MC5A 4GH5A 3NGXA 5CAEB 1JWAB 1M67A 4GMGA 3OICA 1XU9A 1YXMA 4RLSA 1N8KA 4JIGA 1E92A 3A14A 2X0RA 4YRBA 4NJMA 2DTXA 4UREA 1GY8A 1P31A 1H2BA 1DJQA 3O38A 4LRSB 3S2EA 4I9HA 1ZUD1 4NR0A 4YT5A 4RL6A 1TB4A 3U4IA 1P1FA 3QJ5A 4JJIA 1E5QA 1LLDA 2DBZA 3SC6A 4BO4A 5L40A 4NU6A 1B0AA 2O4UX 1VJTA 5HBRA 1V35A 1U8XX 1PS0A 3KXDA 1Y8RB 3ETEA 4R3WA 1C1DA 3P2OA 3RJ5A 2DQ4A 2W2KB 3CZMA 4FFNA 5K9ZA 2O3QA 1UZMA 1A7AA 1O89A 2EW8A 3F3SA 1HE4A 1KVQA 4ALKA 2GPTA 3H4VA 2YDXA 4OH1A 5K6AA 3OJ0A 3R6DA 3ROQA 3I52A 2BFAA 3VPSA 2C7GA 1IZ0A 2VOJA 3TWOA 3LLSA 4PG5A 1LNQA 3I4CA 4XWYA 1EFKA 5CDTA 2ZIZA 3H6KA 2ZYDA 2W4QA 5I8ZA 2AQ8A 4JNKA 3DZHA 1LDNA 1E7RA 1B26A 1NVMB 4WECA 4AJJA 2AQIA 2P68A 3TF5A 1EUCB 1N5DA 2QW8A 3H9EO 2V6GA 3HFSA 3L6DA 4B7CA 5EIOA 1PZEA 1A4UA 3RWBA 4XJTA 1ZJYA 4J0EA 1TLTA 1GQYA 1Q7BA 1F06A 2JCVA 1PSDA 2X9VA 5AXCA 3O4RA 1XELA 1R16A 1NBOA 4AJNA 4CLHA 1C0IA 3JQGA 4MVJE 4PG4A 2Q2QA 3EY4A 1ISHA 2NU6A 1I3NA 1VJ1A 1LRLA 3ZDFA 4TZTA 3W1VA 3GF4A 2HMWA 2CSUA 4BGVA 4Q3EA 2CF5A 1PJSA 2YHIA 4NDNE 3GFGA 4ITUA 3FNHA 3PZBA 2NU7B 3WYBA 3D5QA 1ADFA 5A06A 1BGVA 1P1IA 1MFPA 1PJLA 4NFSA 3AY7A 5L7YA 2IRWA 4CL8A 1NWCA 3OJFA 1YB1A 3KEOA 4B4UA 1HRDA 1U2GA 1E0DA 3IIEA 2UDPA 5HTOA 3GVIA 4MVJD 2YY7A 4FOSA 2OXIA 4J1QA 1B2LA 3PYMA 2VNAA 1EZ4A 2GN9A 3F46A 4BNJA 1M66A 4CQLA 2XXJA 4MVJI 2IYOA 3GZ4A 4BNUA 2W98A 1ULSA 3FPLA 5G0VA 3RU7A 4QT0A 4E5MA 4TVBA 3WYEA 4EJMA 4CR7A 4FS3A 2I3GA 2SCUB 3CKYA 3HJAA 3KYBA 2H6EA 2O4CA 4OKIA 4IJKA 5B12A 2YYYA 1EBUA 3FSRA 3I83A 1C1XB 1PWZA 5CPFA 4ALNA 1R12A 5JYEA 3HDJA 4R1TA 5CDYA 1PGQA 4R16A 1J0XO 3BHJA 4J16A 5BSGA 3S2FA 3ENKA 3GAZA 4MVJH 4IDBA 3UW3A 1KYQA 3AOEC 4JBIA 4OGWA 3OETA 1LQTA 1P1HA 3RBVA 1E3SA 5COBA 3ITKA 3QLJA 1R4MB 4AVYA 3INRA 4FFRA 1T4DA 3E82A 3WS7A 1C0KA 4L4XA 2BI8A 3MWDB 4YBZA 3IAHA 4BOYA 2IZZA 1QYXA 1AHHA 2CVZA 2JFHA 3Q6IA 4ALMA 4DQVA 1V3UA 1F12A 1IY8A 1ZXBA 3PQEA 4YPOA 1BMDA 2ZB7A 1LXCA 2G5CA 2BKAA 3KHUA 4XA8A 4BIIA 3KZVA 4BNFA 2FPPA 1BXZA 4WEQA 4XD2A 2BFMA 4YEDA 3QWAA 3I9NA 4ZRNA 3ROKA 2VWQA 4LSMA 4R9SA 1JW9B 3PXXA 4CMIB 1ZSVA 1YL5A 1E1KA 1H0KA 1A71A 1LDBA 4M55A 4J4TA 4UVIA 1X7DA 1P45A 3U5TA 2RAFA 1U2DA 4E3ZA 4MO2A 4AJOA 4AJKA 4Z3KA 4XRGA 1QR6A 3HQ4O 2PY6A 1XQ1A 1Z74A 4RZHA 4DXHA 5L7WA 3EZLA 3LT0A 1PL6A 1YQDA 2EEZA 3D3WA 3QWBA 5CEEA 4W99A 1VPDA 4J6FA 4OSOA 3ZWPA 4IXWA 3GNTA 4TRNA 2V6FA 4TVOA 1QLJA 4NPCA 2VZ9A 1HXHA 1SEVA 1TT5A 3NJ8A 5T8KA 4UVHA 1CQJB 1LU9A 4P38A 2NVUA 1IUKA 3ST7A 3EUWA 2HO5A 4CQMB 2BRUA 3I3OA 4TMFA 1MXFA 4NIMA 1U3WA 3ONDA 4E6PA 3PHGA 1ZNQO 5AXBA 4NU5A 3PQDA 4IS3A 1A27A 3OSUA 4M87A 4U0JA 2HMTA 1PL7A 4BL5A 4JGBA 1H93A 1FDVA 2AA3A 4BUCA 4WCFC 1NXQA 4J1NA 3JQ8A 2HJRA 4DMLA 4YWJA 4M1QA 5U1PA 2GDZA 1OC4A 1DIBA 1LC0A 4CUZA 2V6BA 3BMNA 3JQFC 3EW7A 2IEDA 3SJUA 1Q0HA 5KNLA 1KEVA 2P5UA 3NKLA 1KOLA 3E5MA 2C5EA 4GWGA 2JL1A 1JVBA 4BQPA 2EXXA 3IMFA 4E4YA 4FC6A 3VZSA 1H2HA 4IJWA 4YYZA 2EF1A 3DHNA 2H1SA 3LT4A 1LA2A 4A0SA 2ET6A 1P1KA 2CFCA 1LC3A 4U6QA 2QHXA 3FF4A 1IHXA 2H5LA 2HK8A 3W4KA 3FWNA 4UVEA 2WWRA 4B79A 5IDWA 5A03A 1LI4A 4MVJM 3LT1A 4JK3A 2B83A 4M86A 2ZTLA 2NM0A 4FJ1A 4AJPA 4YT4A 1SNYA 1U3TA 1CIVA 2RIRA 1YOVB 4R01A 5A02A 1WDMA 1P0FA 4C4OA 3P19A 1YS4A 1HE2A 4DIOA 4Z3DA 3MJCA 2OFPA 4B8WA 1HDRA 4J2HA 4WNIA 4GKVA 2HU2A 1HDGO 2VRCD 3DBHA 1JKJA 3JQ7B 1OMOA 4IDAA 4CM5A 4B3JA 5JLAA 1GEGA 2O3UA 4CLOA 4WLOA 2E48A 3D4NA 3RC7A 6LDHA 3KO8A 2I5PO 4MIYA 4DQUA 5CP8A 3VPHA 1EEHA 4BNWA 2BH9A 2C0CA 3TDKA 2NU7A 1HLPA 4IDFA 5L7TA 5IF3A 3ZWXA 3I6IA 1VKOA 3PYXA 4IJVA 1E5LA 3VH1A 4MVJA 1BWSA 1PJCA 3GHYA 3WGTA 3GVHA 2W8ZA 2OL4A 3WFJA 2PD4A 3ANMA 3QVTA 5TJHA 4FOOA 5BNTA 1GADO 3PHLA 2OP0A 3HG7A 3WDSA 3WSVA 5A3VA 5KIAA 4YT8A 3W8FA 4XQ9A 1V8BA 4L4SA 5JO0A 4Z6KA 1ADGA 2I3AA 3NV9A 1PGPA 3LDHA 5GY7A 2NNLD 4M89A 3NTOA 4R68A 4DMMA 4BV8A 1F8GA 1GU7A 2CD9A 1NHGA 2D0IA 2Y0DA 3I9OA 3KLMX 2FR0A 1I0ZA 2Z1NA 3AY6A 2EV9A 4DREA 1ZFNA 3W6UA 2VRCA 3E18A 1GYRA 3LF2A 4BO8A 1DFIA 2EWMA 5KJEA 3S2GA 1IZ9A 5THQA 5G0TA 3DBVO 3WBBA 5CDUA 1E3WA 1ISFA 1DC5A 2AG5A 2J8ZA 1VI2A 2G1UA 3FPCA 2OGUA 3GEMA 4LVUA 3WICA 1ENPA 3I9KA 3PZRA 2JHGA 3ANLA 1R0SA 2O48X 3IC5A 4IQGA 4JP3A 1PZGA 2OUIA 1NPYA 2X5KO 1HSOA 2YQ4A 4OAQA 3DL2A 4OO3A 5DP1A 4ZHSA 1VC2A 4BB6A 1GCUA 2FMUA 3D3EA 4G5HA 4CR6A 4K26A 1O5IA 4W9NC 2YDYA 4Y67A 4RF5A 5KKCA 1XLTA 1C0LA 1GCOA 1QYVA 1ISGA 4PRLA 4OJNA 1RYEA 3BMCA 5F3RA 3ADOA 4N5MA 1OFGA 3GGPA 3GRKA 4CMIA 3VZQA 4CR8A 3ROMA 4W9NA 3GLQA 2JHFA 1J6UA 3PK0A 3RC9A 3KB6A 5B4TA 2JFGA 4WPGA 4WGGA 4CMJA 3QWFA 1BXGA 3UICA 4I5GA 3D1LA 4J7CA 4R1UA 4B4OA 4BNYA 5ENDA 5U9CA 4OMUA 3WQQA 2JKVA 4CMGA 1A72A 1CEQA 1SOWA 1LUAA 4P4NA 2CUKA 3MCVA 4XCVA 3LQFA 4INAA 1DC4A 1FJHA 1V3VA 3AI3A 3KUXA 2J5RA 4KZPA 4WKGA 2NU6B 3RCBA 4RVUA 1V9LA 3GPIA 3NDRA 3RUCA 3LC1O 1BW9A 4YQZA 1DC6A 4ZQEA 1T2FA 1XHLA 4WCFA 3ORFA 2D8AA 3CINA 3D7LA 2GERA 3C7CB 4IIVA 1QYDA 3L9WA 3EMKA 3S55A 1SO8A 4CV1A 3PI7A 4DUPA 1V0JA 5A9RA 2WTBA 3BMCB 2YFHA 3E48A 3KLPX 5A9SB 4J9VA 4O5OA 2FOIA 1B8VA 1NQAO 3G3EA 4A73A 3AM4A 5KJFA 4BNNA 4RCVA 2FP4A 1HETA 1P1RA 5HM8A 3MWEB 1IOLA 3DTTA 3ZHBA 4HKTA 4CODB 4R1NA 4YAEA 3PGJA 3RFVA 4XB2A 1XSEA 2RHRA 4XYGA 1M6WA 5JY1A 4HWKA 4FFOA 3RUIA 3BMQB 1HDXA 3TRIA 1YWGO 1RJWA 3R3JA 1PIWA 4RVSA 1PJ4A 2PKQO 4YXFA 1BXGB 1BRMA 5I9NA 4QFCA 5DCWA 5EESA 1IYZA 2F00A 1OBFO 1E7YA 2B4QA 5TT1A 5IG2A 2PZJA 3ONEA 3F9IA 3PWSA 2CZCA 1FDTA 3BMOB 3H3JA 1YB5A 2C82A 3PWZA 4P4GA 4PLWA 4EEZA 1ZK4A 5K6AC 4RLHA 3AJRA 2JD0A 5T8KC 2Y68A 4XYLA 1GQ2A 4L74A 4ONEA 4BO9A 4TSKA 2WM3A 2AEJA 3I9LA 3ITDA 5L45A 3WGIA 1PX0A 2X6TA 1HWYA 3C1TA 1ZK0A 3ZWYA 3OMLA 4KQWA 4F3YA 1M2WA 1JTVA 5F5NA 3OP4A 1ZEMA 2P2SA 3GNSA 3CMCO 3EGOA 3IKTA 1PEDA 4RPGA 3RI3A 4L8VA 2EIHA 3LC7O 4XDZA 2RCYA 4AG3A 4EZBA 3ADPA 4PG7A 3TN7A 3U3XA 1YO6A 4TKMA 3TFQA 1VL8A 4YTEA 1E3EA 4NBUA 2W2LA 5AVOA 1C1XA 1CF2O 3PDJA 4LCEA 5HS4A 4DIFA 1WLYA 1YE3A 2DVMA 5F5LA 2PGJA 1JVSA 4QSMA 2FPIB 5DBIA 1U4OA 3RBXA 1NM5A 3DZFA 1UDAA 1D7OA 1WZIA 1LEHA 1O8CA 4OXKA 1X7GA 1UZLA 4ZJUA 4BKQA 1N1GA 4EJ0A 4WLVA 4HNHA 3MTGA 1R0KA 3OIGA 5KVCA 5JS6A 3F5SA 3SC4A 3JQAB 1BXKA 4FFPA 4CM6A 2B5WA 5I7VA 4RPHA 4ND3A 4CLEA 5I7FA 2Q50A 2Y99A 2NUAA 3F4LA 2FN7A 5JE8A 4D3SA 1RM0A 2EKQA 4BGUA 4KMSA 3IJRA 5C7LO 4CMBA 2PWZA 1TEHA 4RVFA 3KYDB 2AQHA 3QVWA 1DOHA 1D1SA 1GUYA 4MVJF 4GPD1 1HE5A 4NQZA 4G81A 3OQ1A 3NT5A 4WCDA 2VT3A 3QVOA 1VSUA 3ZNNA 3UCFA 2WYWA 4Y6SA 4E21A 1VL0A 5F1PA 5JC8A 5BT9A 3ZU5A 1YJ8A 4D46A 1YJQA 1EE2A 4N5NA 3BTVA 1X1EA 2X9NA 4R5HA 3DZGA 3WG9A 4S3MA 1NWHA 2QYSA 4K6CA 1HYEA 2HMSA 2HJSA 3HN2A 3E8XA 4BO7A 1XQ6A 3DBHB 1Z45A 3GVPA 3PHJA 1EUZA 3DWFA 3F1KA 4RVDA 1GR0A 1PQPA 1VJ0A 3PJEA 5G0UA 1NAHA 2QRJA 3WIDA 1EUDB 2GLXA 1VE9A 3ZNPA 1I8TA 2BFOA 1MX3A 2V6MA 2Y1CA 3OQBA 4YRAA 4DPKA 1XG5A 2PKRA 4U8GA 2GN8A 4J7UA 4MKZA 1T2DA 3HB5X 4A2CA 4AJEA 5BSFA 5JSFA 1R4NB 1PGOA 1U7HA 2VHYA 4CMEC 4IMPA 4I08A 1QV7A 1ZCJA 1YQXA 3JD2A 1NTOA 1AGNA 2GN6A 4E5NA 1DLJA 1E7SA 3H2ZA 4CV0A 1LDYA 3ICPA 3GVCA 4FW8A 4E32A 3EAGA 3N58A 1L1FA 3DR3A 4KUEA 5JDIC 3HADA 3DB2A 3WMXA 2W90A 1HE3A 1MB4A 3G1TA 3OHSX 2OBYA 4IBOA 5MGBA 4YB8A 5J23A 1GUZA 4IZIA 2ZCVA 3B6ZA 3FWZA 1JLLA 3IQDB 3C1AA 4GX0A 1ZIDA 3FNGA 1ONOA 2PH5A 3WTCA 1Y9EA 3H3FA 5TIIA 2O3SA 3JYPA 3Q2KA 3E03A 2PA3A 2PFGA 3EVTA 2POQX 3HZZA 2HUNA 2VN8A 1U5CA 3F4BA 5DZSA 1VSVA 4ZICA 5KCZA 5TQVA 2AXQA 5LDGA 2I65A 5TRTA 1TXGA 2WJPA 4CMAA 1H6BA 2VHXA 1ZMTA 2IE0A 4RZIA 3U62A 4PGFA 3JQCA 3G79A 2D59A 3AOGA 4JJFA 2NVUB 4D79A 5G4KB 1HT0A 1WAMA 1MC4A 4A5OA 1X7HA 1ISMA 5DOZA 5TGDA 3DHYA 3OA0A 2X0NA 2FZEA 1BVRA 4LMPA 3GEGA 2JFFA 3T4EA 1DIRA 2VHZA 2QIOA 4YCAA 1G6KA 4TWRA 4ZGWA 3GVXA 4TRMA 1BDBA 2W2KA 4YJFB 2A35A 3AU9A 4ZQHA 4GGPA 5A3JA 2BGKA 3EHEA 1F0YA 4FBGA 2DBRA 1K6JA 4D7AA 4FFMA 2DM6A 1DAPA 4ROSA 3K6JA 2AG8A 2JD2A 5JYDA 4DLLA 1LLQA 1UXKA 2UUPA 4KTVE 1HZZA 1T1SA 3JD0A 4NZ9A 4Q3NA 4TRJA 5G4LA 2X23A 2QG4A 3NJ4A 3O9ZA 5JW6A 5HRUA 3ZV4A 1GUFA 3KTDA 3NEPX 1O95A 1K5HA 2NVBA 1OOEA 1M75A 2V7PA 3K31A 2Q45A 1Y8QA 3ZWWA 4CM4B 5ICSA 4GWKA 3K2EA 5EL0A 5FI5A 1UXGA 1KVTA 3VKUA 2B36A 2P9EA 1H94A 3IUSA 2JD1A 5AXAA 1GAEO 3AI2A 3BHMA 3D4PA 3OA2A 1Q2XA 4PLHA 1W6UA 4KTTE 3FD8A 1ONPA 3H9UA 3EVNA 3GUYA 1AXGA 1MFZA 2PR2A 3IP3A 4GSLA 5B4UA 5L95A 1R4MA 1O9BA 3TZCA 3C8MA 1DIHA 4PG6A 2Y0CA 5JAMA 3DTYA 1EQ2A 5CHEA 1FDSA 3CH6A 5KJ1A 3RD5A 4Z0HO 4E2YA 2Q2VA 4HFMA 4Y98A 4BO0A 4E2XA 4CM3A 1ZH8A 1PJ2A 3QHAA 2DFVA 4Q9NA 2B37A 5DCYA 4OSPA 3K92A 4EJ6A 3NAQA 4Q3DA 5JAIA 3A1NA 3SVTA 4RF2A 4DC1A 5CEFA 1DBVO 2DBQA 3ASUA 1KEUA 1WNTA 3HDHA 3LSYA 2A94A 4QO7A 2Y67A 2BHLA 2RBEA 3IUPA 3A4VA 1EVIA 3IP1A 2IDZA 4KDFA 5TNXA 3LF1A 3PFFA 3C1OA 1ZSYA 1KC3A 1PR9A 1NASA 4E13A 4URFA 3B1FA 4CLDA 1ZK3A 1NX6A 2GZ1A 4RDIA 2P5YA 4BQRA 4IUYA 2FR1A 1D8AA 3GMSA 3RKRA 4CQLB 5AQ1A 3WBFA 4NI5A 4UEOA 1I2CA 2ZB8A 4BKRA 2J3KA 4IS2A 3ZHYA 1KY5A 2AHRA 2Z95A 2HMUA 1BW9B 1LSJA 5EJ2A 2NU9A 1FK8A 3OH8A 3WLEA 4HUJA 3O26A 3VDRA 3V1UA 4L4RA 3VC7A 4EUEA 3PGXA 2NU8A 4CM8A 4F46A 3PHHA 4Z9XA 4XQGA 5IDQA 2X22A 1WXDA 1HL3A 2FP4B 3HNPA 5I7SA 3EC7A 3BHIA 5DOVA 3MOGA 3QIVA 1RM4A 4CMEA 4ID9A 5CFZA 4OYRA 2IYPA 3AW9A 1W73A 1Y7TA 1O0SA 4PLFA 5IFLA 4QXMA 2ZTMA 5HA5A 4MP6A 4FR5A 1HDCA 3VH2A 3W4JA 4HV4A 3W8EA 1DPGA 4LISA 5JO9A 1PTJA 3P2YA 4MJLA 1ENZA 2EW2A 3EYWA 3FNEA 1QG6A 1XU7A 4TRRA 5LC1A 3S2IA 4RORA 1HDZA 3W8DA 1QKIA 4OXYA 3WGGA 3PJFA 3G49A 5CG2A 4II3A 4MP8A 4HXYA 3OEYA 4JROA 5JMPA 4EITA 2X4GA 3WWYA 3DC2A 4W82A 3BTSA 4Z0TA 4S1VA 1LDEA 3SJ7A 4BGIA 1PZFA 3OJOA 7MDHA 2I9PA 3RASA 2Y1OA 1BG6A 4IZHA 4QFDA 1E1LA 1I3KA 1PL8A 1L7DA 1LJ8A 3I6QA 4AL4A 4MVJG 4OQYA 3ZWOA 4L76A 5JCJA 3FI9A 1VKNA 3WGZA 1KEWA 3WR5A 5A5EA 3RIHA 3ZI0A 4XIJA 1HTBA 4I5FA 3B1JA 4KWHA 4DWVA 3AFNA 4A27A 3JQ9C 3QRWA 3KVOA 3MEQA 1MLDA 4OOFA 1XYGA 3UKOA 2QZ9A 3TOXA 5A5FA 3UCEA 1LLUA 1M6HA 2RHCA 4D41A 5BR7A 4KUHA 2ZQYA 1WW8A 2J3HA 4E5YA 4IM7A 5KJCA 3BYZA 1LSSA 1Q0QA 1KVUA 5JAQA 1P1JA 3L6EA 4MINA 1DLIA 4J49A 3V1YA 3V2UA 3JQGB 5LCXA 4BNZA 5JNLA 4J7XA 1LSUA 4BV9A 2BLLA 4WCFB 1I2ZA 2FWMX 1T1RA 3A9WA 8ADHA 3EK2A 4NJMB 2P9CA 3QV1A 4BNTA 2NTJA 2EKLA 4DPLA 5COQA 5CAEA 5JXWA 2ZYAA 1QMGA 1CWUA 1QSGA 1Z82A 3GR6A 3VH4A 4OQZA 5FYDA 3FTNA 4GVLA 5BSEA 3KOUA 5KVVA 1PJBA 1EVJA 2Q99A 5IDYA 4R54A 2X5JO 4ZN6A 2P9GA 3GN1A 2WYVA 4HP8A 3SEFA 2GNAA 4OKNA 4J4BA 1X0VA 3TZKA 3WTBA 3ZH2A 1E7MA 1B8UA 4XQCA 1UXIA 3ETGA 3I1JA 5AOVA 2DPHA 5EERA 4R1SA 4XB1A 1SAYA 1DRWA 4QECA 1K6XA 1UAGA 1GPJA 1DC3A 2Y0EA 4NBWA 2J5QA 1E6EA 4DIBA 2JJYA 3DOOA 1U8FO 4D3FA 3RUDA 4DTIA 1N9GA 2GO1A 2YZ7A 3WLFA 4X54A 2DU8A 1P33A 2UAGA 2ZTUA 1UP4A 2O3JA 3KYCA 3GT0A 2G0TA 5EQDA 3RC1A 3ZCXA 3GA0A 4UEJA 3DAFA 1FMCA 2QZZA 4FC7A 1N9GB 2O2SA 2V65A 1QORA 1ONNA 1HLDA 1O6ZA 3ZWAA 3PJGA 2A4KA 4FCCA 3AUUA 3UOGA 5BQFA 3INGA 4D42A 5JPIA 1IB6A 4KOAA 2PKQP 1MA0A 4RV9A 5I8WA 3ANNA 4TKLA 3ZN2A 1X14A 3L77A 3O8QA 4IQ0A 1F14A 3DOCA 5IXSA 4WLEA 5C3MA 1B15A 1YH3A 1WMBA 4MKXA 5HS6A 5EPOA 3JV7A 4PLTA 4CUKA 1G0NA 5BNFA 3U4CA 5G0WA 2VTEA 4B4WA 2GF2A 4NHEA 5ES3A 4WE3A 1IPEA 4Y9DA 1YOVA 3E9MA 3GMDA 4IDEA 4UVDA 1UAYA 5TS3A 2B4TO 4BKPA 3Q1LA 8LDHA 3M2TA 3DFZA 5L3ZA 3VOSA 1I3LA 2X7HA 1GD1O 4G65A 4IY1A 3FR7A 3VAZA 4PZDA 5THKA 3NRCA 3LVFO 3WSWA 3DOJA 3RQSA 5GZ1A 2UVDA 1MGOA 4ZRMA 3GK3A 3MJVA 3JYLA 4I9NA 2Q1WA 4A10A 4J4HA 4PVCA 1EVYA 4OL9A 4BMNA 5FF9A 1P77A 1UP7A 1X15A 3C3XA 1NHWA 1BSVA 2C20A 3M2PA 3N74A 4BNKA 4CL3A 1X13A 2GN4A 4Z9FA 1I5RA 3DBLB 3L07A 1T24A 5TF4A 3GC6A 4NBVA 4XRRA 2P4QA 3WFIA 2HRBA 5L53A 2X58A 3D3WB 4XGKA 2PLAA 4W6ZA 3NDJA 3ON5A 1I36A 5IJZA 1GDHA 2DTEA 3JYOA 4PVDA 2ZKLA 1U7TA 2R6JA 2A9FA 5L51A 3UAGA 2D2IA 2YJZA 1CJCA 1JDJA 4LSWA 3WX0A 1P44A 2DC1A 3ZHZA 4XX0B 3Q9NA 1JAYA 4RF3A 3U9LA 3K2BA 2ZQZA 3TSCA 4PLYA 3TPCA 1ORRA 4ND4A 4CLOB 3JQEA 1GV1A 2GZ3A 1E3IA 4D0SA 2GUGA 2O3TA 1K2WA 4FGWA 4WEOA 3LLVA 1Y8RA 4AJHA 2OO5A 5A04A 4XX0A 1SEPA 4UVGA 2B5VA 5JCXA 3D5TA 4BS9A 4GL4A 3VKVA 3RKUA 4LRTB 4BNVA 1OC2A 3MTJA 2VUSA 2C2XA 4L75A 1VLLA 3GZNB 3KSZO 3OQ6A 3KEQA 4HY3A 1R66A 1ENOA 3FBGA 3HB4X 2IZ0A 1NR1A 3D0OA 1ZW1A 3AFMA 3RFTA 3Q9UA 2J6IA 4CMCA 3VHRA 4NK4A 2NQTA 3PP8A 2B35A 3V2HA 4XIYA 1SOVA 4IGEA 1D3AA 1DIAA 3PJDA 2EG9A 4NNJA 2PZKA 2WD7A 1GQQA 1W0CA 4M54A 1IE3A 4FSHA 4YJFA 4D45A 1KVSA 3IJPA 4CM8B 1EK5A 2PH3A 4B7XA 1PQUA 2CNBA 2R2GA 4CQMD 4J91A 3UXYA 3JSAA 1EUCA 1R37A 3HDYA 1JKIA 4I5DA 2Q1TA 4EGFA 4ND5A 3MJEA 4CV2A 4NK5A 1UDCA 1MUUA 2AE1A 1YKFA 4Z9YA 5TT0A 4MP3A 3MWDA 2HCTA 3AY3A 2LDBA 4R3NA 1LSOA 5T57A 1E1NA 1Y5MA 4LVCA 2I67A 4GX1A 3U4DA 2D4AA 2FSSA 3X2FA 1PGNA 3CE6A 4I5EA 1LRKA 3CIFA 3CUKA 5KOIA 3DDNA 2JAPA 3PPIA 2WDZA 4YJHA 3PDUA 4UUOA 4BO1A 3GDGA 1U4SA 4HX5A 5AYVA 3ZWCA 1ZMOA 5LDHA 3KSUA 2TMDA 5BNIA 2VYNA 1D1TA 2IODA 3JD1A 5DULA 2ZATA 3BXXA 4XR4A 3DMYA 1JU9A 3QVXA 4XQEA 1K0UA 1UR5A 4YA6A 1FDWA 2R00C 5ITWA 2BF7A 2FPGB 1JWBB 2HLPA 3INTA 3U0BA 4BO6A 1RM5A 1SB9A 1Y1PA 2VWGA 2HRZA 3AUSA 4BMSA 2OORA 5DP2A 3ZWVA 5I9MA 1YBMA 4FB5A 3FBTA 4O63O 3ICCA 2R00A 3PYLA 2Y1FA 3EZYA 7ADHA 3G0OA 4OOEA 3V2GA 1H9BA 4U0KA 2FRDA 5CG1A 5H81A 1KBZA 3AUTA 3VVCA 3ZZNA 2EKPA 3JCZA 3ZWBA 3QVSA 5H82A 1X0XA 1ZK1A 3TNLA 1L7EA 1ZKMA 3ZWMA 4B7UA 4BNXA 2C29D 2RH4A 4JN6B 2G17A 5MDHA 1NQ5A 3I9MA 1A9YA 2C2YA 5FI3A 3ZNOA 1PQWA 5JC1A 5T6BA 4IIUA 5GZ6A 5ADHA 3U49A 3NGLA 1CQJA 1EE9A 1XGKA 3FR8A 1HYGA 4HBGA 1I01A 3H9JA 4YQYA 5A9TA 2PD3A 5K0ZA 4WOJA 5A1TA 3WXBA 1PJ3A 4CPDA 4O59O 4A26A 3WQRA 1FF9A 1GFSA 3MJTA 3K8ZA 5EN4A 3PTZA 1I2BA 1DSSG 1BDMA 1AN9A 2B69A 3TOZA 3I4FA 2YHUA 4M49A 1P3DA 1NAIA 1CDOA 3UFXB 1KS9A 3DBRB 1Z6ZA 3I23A 4RQUA 4CM1A 3F1LA 1B3BA 4TQGA 1JQBA 3NDIA 1R4NA 3ETDA 3H8VA 1GL3A 3KYCB 2NU9B 1VRWA 1CETA 4B4VA 3V8BA 5ITVA 1HYHA 3Q0EA 4GLOA 3TZ6A 2WEKA 1SBYA 2NQ8A 1ZK2A 3OECA 4DBZA 3JQBC 4FN4A 3JQAA 4YJGB 2IXBA 4LW8A 3NT2A 3BMQA 3V1TC 1EBFA 4BNIA 2PK3A 3DBRA 1P9LA 2YW9A 4IXTA 1NNUA 3PEFA 4K6FA 4QEDA 1PWXA 4ZQFA 1DFHA 2IEBA 3M1AA 4WNCA 5KVQA 2O7SA 5TJ9A 1DXYA 1P74A 1KY4A 5L9AA 1D4FA 3RVDA 5JY6A 1V3TA 3TZHA 1YL7A 5IDXA 1XCBA 1NQTA 1YRLA 2CVQA 4JBGA 4DRYA 2QRKA 1KEPA 1PU2A 1UXJA 5CEJA 2WE7A 2AE2A 4PLVA 1XEAA 1J4AA 2PZLA 9LDTA 4QO8A 1CQIB 2X8LA 2Q3EA 4N5LA 3UCXA 3KYDA 4CMHA 1F8FA 1T2EA 4DA9A 2B4RO 2C59A 4AICA 3UGKA 1H9AA 3DFUA 4RO0A 3OIFA 1N7GA 5GZ3A 1TT7A 4RDHA 5KJ6A 4GLLA 3C85A 3FCOA 2NWQA 4GX5A 1B3RA 3D4OA 5KKAA 4L0QA 2DFDA 3ROPA 3I9JA 3GHHA 4K28A 4GVXA 5JMWA 4CJXA 1ZXLA 2ZK7A 3DZIA 4MOWA 2EP5A 4ZQBA 3KBOA 4FD3A 4GBJA 5B37A 3QWIA 2IZ1A 4JXKA 3WOHA 4NBTA 4XDYA 1RKXA 2G76A 1ENYA 4H16A 4FDAA 3Q11A 1VL6A 3WB9A 4A03A 3C24A 2XXBA 4DLBA 5KVSA 2VUUA 5T5QA 3DAPA 3IDSA 2CMDA 4W4TA 1ZVMA 4BO5A 2D5AA 2FY8A 1S7CA 1X1TA 2XPCA 4AJ1A 1YBVA 1Y9AA 4ZD6A 4XJSA 4GMFA 2HSDA 2C5AA 4FIZA 3A06A 4NG5A 4EYEA 3OJEA 1QYWA 1YQGA 3VDQA 6ADHA 3ULKA 4K9DA 2HMVA 1DHRA 1NFQA 3AOEA 1ZJZA 5JDCA 2BFPA 1JA9A 4WLNA 2WMDA 3MOIA 1DIGA 2CDAA 2D5CA 1NPTO 2DPGA 3SLGA 4XZ3A 3DBLA 3H9GA 2GSDA 1YDEA 1NVGA 2E37A 3E1KA 1GV0A 1A7KA 1W4ZA 3DQPA 3L9XA 4F45A 4XGNA 1IPFA 3JQ9A 4YAJA 2CDBA 3SLKA 4GI2A 1H6CA 3QY9A 3CZRA 5ILOA 4Q39A 4AJ2A 5U4QA 3HFGA 5JCJD 3PRJA 3DZBA 2FHSA 3TQHA 5CDGA 3FHLA 4R9RA 3TFOA 4GSKA 2FPIA 2YV3A 3HDQA 3RC2A 4D0RA 3R1IA 3C7AA 1WP4A 4Y6PA 2OZPA 1HDOA 4FGSA 3PFWO 4PLCA 5ENVA 2P4HX 4R69A 3MWEA 3WQSB 2PV7A 4CM9D 1ZSNA 3ABIA 4PZCA 3OFSA 3K96A 1DEHA 2PD6A 5C7IO 2EJWA 4OM8A 3GG2A 4O6VA 4CLXA 3G17A 3JD3A 4H3VA 2HK9A 3A28A 3W4IA 2NACA 2H63A 4GGOA 4HFJA 3VPGA 4MPDA 3GDFA 4PG8A 1DRUA 4IINA 2FPGA 1AHIA 1VM6A 4BNGA 1H6AA 2J5KA 1PGJA 5IZCA 1PJQA 5T67A 4BHTA 1JN0A 1LBEA 4HADA 2O2YA 3KV3O 2YV1A 1N2SA 2BI7A 2D3TA 2DTDA 3UN1A 4B8ZA 4RF4A 2AW5A 2VWHA 2GASA 3VPXA 4E2WA 4FJ2A 1KIFA 4YJHB 3GAFA 1I3MA 1PS9A 2YFQA 3ZW9A 4RVHA 4BB5A 2O23A 1IHYA 1U28A 2X86A 4DYDA 4J3FA 2I66A 4ILKA 2VNSA 3ZV6A 3H2SA 1BTOA 3GG9A 2VWPA 4W7HA 2PNFA 2JCYA 3S8MA 2FR8A 4R4JA 3KRTA 5ICMA 4KQXA 2I6TA 1PS8A 2F1KA 1NPDA 1BHSA 4CLRB 3CTMA 3DONA 4UUPA 4AJ4A 2VHVA 2ZB3A 4DVJA 3RUHA 1N92A 4WJZA 4PIVA 4E31A 3QQPA 4HFNA 2O3RA 4H7PA 4B3IA 4JP2A 2Y1GA 4NBRA 1ISIA 2B0JA 1EVZA 2Y1DA 2J3IA 5C37A 2CY0A 2NV6A 3CMMA 3RUEA 3L4BA 1MXHA 3WJ7A 4EUFA 2NADA 3DXFA 3QE3A 1I24A 4NFYA 1MG0A 3DHEA 2PGDA 1H5QA 4XYBA 3RJ9A 1EMDA 5FWNA 3QWHA 3ZWNA 5KWEA 3OJLA 1I30A 3E5RA 3OIDA 2E82A 1PZHA 2WD8A 3L0DA 4RQTA 3SBOA 2Q4EA 4J90A 1YL6A 3DMTC 1R6DA 2W2LD 3BA1A 1ARZA 2VYVA 2NU8B 1HF3A 3P7MA 1QYCA 4QTZA 1XDWA 3BMOA 4E30A 1EDOA 2ZJ0A 3PQFA 2NVWA 1U9JA 2VOEA 3DMTA 3ZU4A 3ZV5A 3WNVA 4GKBA 1KERA 1XKQA 2Y1EA 3C7DB 3O8QB 2Q4BA 5I7EA 1N7HA 4FQ8A 2VCYA 4L73A 1U1IA 1LLCA 3B20A 1U3UA 3JD4A 5C7OO 1YBAA 4ZU3A 2D1YA 4IGFA 3H7AA 1G1AA 4B3HA 1T2CA 2EP7A 2DT5A 2XAAA 2OP1A 1B7GO 3ENNA 3RROA 3LZ6A 1DDOA 2EJVA 3FNFA 3DEYX 4RPLA 2HK7A 2YV2A 1XIVA 3B1KA 3N7UA 1RYDA 3GPDG 2OHXA 3NTRA 1YGYA 2E49A 1C1DB 1AUPA 4PRKA 5COAA 3TZQA 1XWFA 3GFBA 3UFXA 1JKFA 5A9SA 4IQ8A 3BIOA 1NFFA 4JX8A 4O0LA 1PR3A 3VTZA 4DGSA 1ZO8A 2O50A 4EBFA 5EINA 3STHA 2CDCA 3VH3A 4I8XA 4XGIA 5GMOA 4OXNA 3CXRA 3P5SA 4IPTA 2NUAB 4UUMA 4E5PA 5JFOA 5JDCC 1U3VA 2X1HA 1E3JA 3U09A 2ZYGA 5DN9A 3ZGYA 1M76A 3SX2A 2Q2WA 3VZPA 4RGBA 3F6YA 2DKNA 1DO8A 1MP0A 1UJMA 4Q3CA 4R51A 3ZHXA 1Y8QB 3HN7A 1LX6A 4YAIA 4UAGA 3ZNQA 2TMGA 3FRJA 3PIDA 3SXPA 2P91A 5ER9A 2PGLA 3TJRA 3TL3A 5IN5A 4E12A 2YUTA 2VRBA 4U7WA 4EI2A 1ADBA 4YRDA 3B70A 2ILTA 3GGOA 3RAJA 4U5QA 1A5ZA 1AE1A 4LMRA 1A4IA 1WDKA 3WIEA 1W8DA 3R0IA 4BNMA 5A4DA 5L4SA 2DUUA 1T26A 5JAZA 2CVOA 3Q2IA 4JQCA 3GGGA 3X2EA 1CQIA 4YAKA 2WYUA 1NYTA 1UDBA 4Y8VA 3DAGA 3GUCA 4G2NA 3QSGA 1ID1A 4BKOA 1Q1NA 1ULUA 1UXHA 2HDHA 3WNQA 5L4NA 1E6UA 2AEMA 3WYCA 2H9IA 2NSDA 4N18A 1DJNA 2OMEA 4ZVVA 1I32A 3BMNB 4YACA 4PCVA 2X0IA 2GCGA 2Y05A 4H15A 3WGYA 3LU1A 2GR9A 1Q7CA 1V6AA 1Z75A 1T2AA 3AK4A 4JCOA 4N7RA 4A7PA 1ZBQA 3BTUA 3E6AA 4FJ0A 3UF0A 2Q49A 3JQAD 2Z5LA 2JCXA 5DCUA 2Q1UA 4EDFA 5TLSA 4MDHA 3GQVA 3VPFA 1EQUA 4W7IA 3NT4A 9LDBA 1TT5B 2O7QA 4J9UE
chains in the Genus database with same CATH superfamily
2HU5A 2XCRB 3QW2A 4IW3B 1Y6JA 4IIDA 2JAHA 5CJJA 2GM4A 2GK4A 2LVBA 3FDJA 3WL7A 1T36A 3JQQA 3AV3A 1LQUA 2PUGA 3FPSA 1G7CA 4H9GA 3VC3A 4YV2A 2PS1A 2QR2A 2XOXA 4JHLA 1F20A 1O3YA 4KUGA 2EOAA 1IZ7A 3CUUA 4RX1A 4C0SA 2FZWA 3B7WA 3H5NA 3ZW8A 4LGVA 3OZXA 4KWIA 3UXMA 3MZ0A 2BCJQ 2HEGA 4CIXA 1BROA 2A9KA 2W6PA 3TL6A 3T4XA 1D2HA 4U4AA 1DAKA 3QTLA 4XIFA 1QB8A 1ZMRA 4PF1A 3JW8A 3FPGA 2XNDA 3FM9A 3ZCVA 1EDBA 3VR4H 4JV5B 3G02A 4U3JA 4ZC1A 4QUGA 1JFTA 1RNLA 1QK3A 2V9CA 2AWNA 1RM3A 4H17A 1W4AA 4PZEA 4JL6A 3QM1A 3HZHA 3ZEAA 1LW6E 2JGNA 1N36B 2F59A 1C7EA 4HMOA 4LI3X 4MPJA 3ZHCA 5KI6A 1T4GA 4Z4QA 5FOVA 2ZI9A 1VRVA 3Q6NA 2XAUA 3E7WA 4OBXA 4Q9LA 5REQA 3WRXC 3FKQA 3LZCA 4B3TB 3N76A 3CEAA 4LXGA 4P54A 1AKNA 4FDMA 1EUDA 1Q7GA 2VP6A 3LTEA 5FIUA 1LDMA 1TF2A 4IRUB 4K3VA 2QEQA 1WWKA 3STVA 1FRQA 4R1QA 5DJ5A 5K5EA 4DPMA 2I78A 3NIGB 4TV9F 4WZ6A 1XPRA 1CC1S 1QNLA 1XL0A 1NN0A 3WGHA 2CL7X 5AKLA 3GRAA 5K8VA 5SZJA 3FOBA 1JUDA 4OIMA 2ZSJA 1MG5A 2VZ8A 5DBGA 5EGSA 1FTNA 3RS5A 2ZSIA 1ZD1A 1LBSA 2G63A 2VEOA 3M1LA 4UULA 4EA9A 5J3JA 5LYJB 1GPAA 3T3GA 4IILA 4EM6A 3RVSA 3NB0A 4GHWA 4TZKA 5KX5F 2R8BA 2XQJA 3EDMA 5DNAA 1Y7HA 3D6NB 4EMBA 1CUEA 1S7GA 1EM6A 4AB1A 2P69A 3JATA 1LQ2A 1ZOIA 1UMDA 3BAZA 4MW4A 5ER6A 3GY0A 2O8CB 5ILGA 2GTPA 1UFVA 3OY2A 3FCYA 2HHHB 4ALLA 1XL1A 4R8MA 5JCOA 1MN6A 1HZJA 2VQ3A 4CTMA 5KNDH 1FDUA 4IG9A 1OWNA 2V7WA 4J43A 1JJIA 5AM5A 1JEDA 1LKZA 2I34A 1T0PA 1U0NA 4NATA 3K8QA 1JXQA 4YR9A 1B42A 2WKRA 4U2KA 3LI2A 4I1YA 3FLAA 2XSZD 4RKRA 3MJSA 3BBPA 1QG2A 3LP8A 1XDSA 5C4IA 1U0BB 1H05A 2YINC 1UBJS 2FUG6 1NT2A 2X6QA 2XCUA 3P2EA 3HHPA 4A8JB 4O1MA 2J48A 3WLOA 1SHTX 3GZNA 4Q37A 5F77A 1Z7BA 3SAJA 2AMFA 1W9MA 3R6TA 4Q12A 2GBPA 1S02A 1CUZA 5L3SB 3ZK7A 1T2VA 1SC6A 2IHKA 1M3SA 2ID9A 2GJKA 4MS4A 3RKSA 4EW6A 1YB4A 1JA0A 1BCSB 2PZMA 1VG8A 5KJFA 1UQRA 4ZCSA 3JQ8B 3A25A 3F47A 1POWA 2P79A 3LUBA 1B16A 4HGOA 4N65A 3O1HB 3V5NA 2ORED 4JEUA 4WY8A 2W37A 1KC1A 4AD8A 3GN2A 2W6JD 2WIGA 2YBEA 5A3QA 1SKYE 4QQRA 3RS3A 4A1OA 4DRXB 1J5XA 3KALA 4FPXA 3UHPA 4JGIA 2PH7A 2I76A 5HWSA 3T1TA 1MT3A 5AJTA 3P0FA 3D3QA 5LU9A 5GM1A 3P2KA 1TOAA 4LF4B 2WFMA 3CW9A 3K0AA 4IKOA 1CB7A 2RGNA 3O7MA 4BMVA 4Q6WA 2YXBA 2E87A 4J2OA 2WF7A 3V6LA 3ZHUA 4WZBA 3W04A 1P17A 1DAOA 1AQNA 2E9SA 5DHFA 3TK1A 4C7BA 1B43A 1N1EA 1MHPA 2ZRCA 5BMOA 5BXQC 3W5HA 2PX6A 1ZZEA 3C45A 1Q17A 3W7BA 4E5KA 3S2ZA 1K6IA 3DDCA 1ID8A 3FFXA 4TS1A 1DRVA 2P3SA 4TYNA 2IUSA 1XMIA 3D64A 3Q3CA 2ZZNA 5E3IA 1CUDA 3OZEA 2HAEA 3DL4A 3Q40A 3T8YA 4FQ7A 4DCCA 1OR8A 2ZCUA 3RUAA 3FN4A 3UWPA 3LNCA 2QRMA 2WWHA 4JJAA 3MHTA 2GUWA 4JJ7A 1TVEA 3RBZA 1W5BA 4OQDA 4JT4A 4TMYA 4S1TA 1SG6A 3K5PA 2NTNA 5DBEX 5H83A 3I30X 3IVGA 1T8RA 4UMFA 4PC2A 2AYXA 4QLOA 3I5YA 1HOTA 1KSJA 3VX4A 1TJPB 4H7IA 2FDRA 4ZJYA 3TBFA 4QVGA 4KLAA 3HNOA 1PHRA 1Z8NA 3IL2A 1GZ4A 1UF9A 4FXPA 5GONA 3SC2B 2AEFA 2OG1A 4QEZA 4LOAA 3SM3A 4XKJA 5K0EA 3HFJA 2GEKA 2AJBA 4PQEA 3IMKA 4F2GA 2OOSA 4EHBA 2FZ4A 2C07A 2QVCA 2YOGA 2QYTA 4JCCA 4BZXA 3TLKA 3QI2A 5HDBB 2I4OA 1DKPA 4D3XA 4BV2A 1D6JA 2E1RA 4IDCA 4ZT4A 1K98A 1Q14A 3CX4A 3CUYA 4GX2A 5AP9A 3P26A 2Q6IA 4YUXA 2O0JA 5DGTA 3OOWA 5DTMA 1EK1A 1HMYA 1OI7A 1AURA 4GXQA 3WMWA 2RGEA 3DS8A 2G08A 5KVAA 3C5CA 4KXVA 1YK1A 3G9ZA 1UKVY 1K89A 2PSEA 3HI4A 3ZGVA 3H2YA 1ZM2A 5LDDC 3NEJA 2Y3IA 3RLIA 3W6ZA 1HTTA 1YOBA 2WSBA 4R0NA 1JJFA 1V8FA 4NKRA 2LNDA 4UUNA 1C5KA 3JQDA 1QMPA 1N34B 1F8XA 1NOIA 4KP7A 1SHKA 4CI9A 4CMKA 4GP6A 4JLBA 4DV4B 5F1KA 2QTGA 1M8FA 2ZI6A 1DCFA 3F3KA 2ZRJA 4MWBA 4RJTA 2VSQA 1RYBA 2VT2A 1QR2A 2QX7A 2VAVA 1XALA 4RDCA 5F35A 3FVTA 1DTSA 5B1YA 4LN1A 3FJYA 4GLBA 4XM2A 3KJQA 4TYYA 1XRQA 4D4GA 5MF6A 4I9UA 1DAGA 1GPUA 1XA0A 5G4KA 3IELA 5ALHA 4EW1A 3OLVA 5TMDA 2FQYA 2FRDC 2P27A 1MO6A 2N1MA 5BYJA 3IAUA 3RSQA 5AUOB 1EFAA 2Y93A 1YS2X 1KKMA 3M6IA 4TN5A 5TEVA 4EQZA 3SC2A 3E4DA 2FPRA 2YJTD 3O03A 4Q4AB 4BVBA 2X0JA 4XIIA 4Z7QB 4XEHA 1ZJ4A 1JQ3A 1YDFA 3WRXA 2FUKA 1F2TB 2H2GA 3B1XA 1O94A 4RVGA 1YDWA 1QVRA 4YK7A 2QAGB 1YVEI 2PGAA 3L7YA 4MPRA 4B2IA 3DZCA 3QX8A 1A2BA 2YQ5A 3LS2A 1QVVA 1AXEA 5D1HA 5G0SA 2VSNA 1LTHR 1G4HA 2Z2JA 4UFOA 4WOPA 1DB3A 2HA5A 2SKEA 3EEIA 3IODA 5HGXA 3GOHA 5JRJA 4FFSA 3T3PB 4J1TA 1CUAA 5EXSA 4PZUA 4J2TA 5FUYA 3GNQA 3IOMA 3ZZMA 1K08A 2ZR8A 3LKVA 1TJ4A 1Q7TA 4OHVA 1K63A 3HJBA 4WVLA 1OWLA 1N2CB 5FKJA 4QYMA 5LM3A 3PHIA 3RHSA 1I33A 4UBIA 3TR0A 3G68A 3EZ7A 4BLQA 2HQ1A 4EKDA 1G5HA 2MYPA 4FHFA 1UBUS 4JLPA 5LWQA 1SPXA 4Y18A 1UUFA 5TPZD 2B8WA 3G1UA 1ACJA 4DLAA 3BE4A 5DX8A 5EQTA 4BX2A 3FTPA 1SXGA 3IS3A 1XR3A 1ISJA 3O8NA 2L19A 4PNHA 4DUGD 2Y66A 1YNSA 2J5XA 2QUBA 4E0BA 2JZCA 1G5QA 4LXHA 2X3FA 3IAXA 5I9LA 2R84A 4JLNA 4LFCB 1II8A 1NVTA 2QRGA 1P0CA 4PLGA 1AZTA 1MPXA 1Z2PX 4I55A 3TNJA 5C2JB 1TI7A 5C1PA 5JZOA 1IU9A 4HLNA 3V9AA 2D6FA 1Z7GA 3HSKA 3H1PA 4K1LA 1K27A 3EDYA 2PRYA 3H5AA 5ADUS 2J3JA 1N5MA 3JQBA 2PVSA 3B9PA 4GH5A 3OTIA 5IULC 3VU8A 3BIJA 1E2FA 3V8PA 3E7PA 2AYYA 1XU9A 1PN3A 4JIGA 4MEJA 4C6TB 3VHXB 4XVUA 4ISBA 3AF0A 4RFLA 5KOJB 4NJMA 2DTXA 3AH8A 4UREA 4WY2A 3QPWA 5IUJC 2X9LA 1XAHA 2JIQA 5IBRA 3O38A 4LRSB 3CKMA 3DMFA 2BI4A 3EAQA 2A8YA 4I9HA 4Q1AA 4D2IA 1UEXC 1FYFA 3P9NA 4RL6A 5KTOA 3CF6R 1D2NA 1E3TA 2IYXA 4MGZR 3S27A 4RWZA 3UMMA 1ANKA 1SXJB 1WUIS 1E5QA 1LLDA 1P6XA 5EQJB 3ME5A 3LAWA 3SC6A 4BO4A 5L40A 3A1FA 3MCTA 4DJTA 4E15A 4NU6A 3K6SB 2O4UX 4OB8A 2VC2B 1DI0A 1TVKA 2Q1XA 3L43A 2JJ8A 3KXDA 4IV0A 2IEAA 2X40A 1L5GB 5FX2A 2F3UA 3DE2X 5U4XA 3PVCA 2DWQA 1SXJA 3RJ5A 2W2KB 3CZMA 1HA3A 1LB1B 2CVFA 2RBGA 3GCGA 2PL5A 5DHAA 4G1VA 1HE4A 2PZ8A 5JBQA 1KVQA 3UQZA 2BCGY 2YDXA 4PO9A 1K92A 2PUBA 4YCCA 3D8BA 4PX5A 1QU2A 5AVXA 1SUCA 4EFKA 3VO9A 3ROQA 2ISSD 2WPDD 4S1OA 1EHYA 4B6PA 1LNQA 3V55A 3H1TA 2C2KA 1Q16A 4RCYA 3QVGA 4BFVA 4U7TB 2FSHA 4I3GA 3HJCA 4JNKA 2A9QA 3F6RA 3TFWA 2Z5GA 2C4WA 1QTIA 4YX9A 1TM2A 1KMCA 4WECA 2QUJA 4O1IA 3GCXA 2ANBA 4XWOA 3WL8A 3M4YA 3W7VA 3UPTA 1LPBB 3JARB 4J03A 2V6GA 3CUSA 3HFSA 1WW2A 4YRGA 9GPBA 5MN4A 1F2UB 3K4QA 3R5JA 4MH0R 4YRZA 2YHAA 4O02B 1CE8A 4AWBA 4J0EA 4BX8A 1GQYA 4GL2A 1J2TA 1Q7BA 2PKWA 1DQZA 1QBKC 2RKOA 3NIWA 3OF5A 2PBLA 2VYQA 3QPAA 4NMXB 4RE5A 4CKBA 2VDKB 5K8LA 3IAM1 2QOEA 1Y5LA 5DLYA 2XMPA 2PM8A 2LWIA 5B3LA 4RA6A 4FYKA 2J0VA 4FBLA 4KWCA 4QFBA 5BV2P 1PV4A 4FYIA 2PL9A 1ISHA 2RAVA 2VPIA 2I8LA 2EBWA 1D2CA 4LXTA 2R6FA 1KIAA 5CIQA 1T3ZA 4P5PA 2EFHB 2HMWA 1RYFA 4EL0A 2L0XA 2P65A 4TT3A 4I1SA 4NDNE 1P0MA 4GPZA 1CDEA 3SE0A 1I4WA 1KO4A 1TD9A 2NU7B 3IQEA 4KACA 4P93A 4YJ3A 3WYBA 3ZI4A 2ZWVA 1BGVA 2X5NA 5FNZA 1PJLA 3EXHC 5LXTB 1QP7A 4MKGA 2CFIA 4RJKA 5L7YA 3A3PA 1Y3DE 1W2GA 1C80A 2ZBPA 4RTJA 4KAXA 1HRDA 5C52B 1E0DA 2QT9A 3IIEA 1FXUA 2UDPA 3TR6A 5JZMA 2PUVA 3L5OA 1QFYA 4NCAA 3F3YA 4J1QA 2PUCA 1MVNA 4W9RA 2WJ4A 3GZTB 1VMEA 3OEHD 2GN9A 5CT4A 4M99A 2RD2A 4R31A 2X4LA 3PEEA 3WSTA 4D81A 2XXJA 4L8YA 1D2GA 1NBIA 3LBIA 3MF4A 2XMRA 3AUKA 1IK6A 2W98A 3KKMA 5KQGA 1ULSA 1QIJA 2TS1A 4TMXA 3FPLA 1GSHA 1OGJA 5G0VA 3MWLA 1RMYA 3OZIA 4QT0A 1V11B 3H9BA 4RIIA 1PEAA 3S3TA 1X7YB 3W6NA 4KSCA 5GINE 1F2DA 1X6VA 2CHQA 1JMKC 2GB4A 3PNVA 3KYBA 5B12A 3BG5A 3FSRA 1XEWX 5K45A 2E2WA 2OAQ1 1PYOA 1ZN9A 1PFYA 1C1XB 3P4XA 3PD7A 1VL1A 2ZSEA 5JYEA 3W6OA 1GHTA 4N8DA 5CDYA 4GR9A 3QF4A 4J1TC 4R16A 1RKUA 4WV3A 1J0XO 2JCSA 5BSGA 5K01A 3S2FA 4QTYA 5HRAA 3UW3A 2WF9A 4L8FA 3G2OA 1YQWA 4JBIA 1JZTA 2FW8A 3RBVA 3C43A 3AKZA 3KB1A 1IOWA 5COBA 3IKJA 3S8EA 4GOXA 4ER5A 4UXHA 2ZPAA 3OQJA 4P3OA 3INRA 4FFRA 2E0IA 1UBFA 3VM6A 1O6CA 3E82A 3FHJA 1GGHA 1G5TA 2XODA 5EOVA 3MWDB 3TEMA 4KR6A 2JBAA 2VH5R 1E4OA 1SWWA 3CWZA 4YV7A 1O0BA 1QG4A 2JFHA 1V2GA 4DQVA 3DL0A 1ABFA 1FYEA 1YR3A 3L0IB 3QPVA 5DLEA 4V02A 3ZWDA 4I8IA 1Q12A 2C1ZA 3N0VA 4IJQA 4UCXA 1QQ6A 3KHUA 1NJGA 1XUOA 1QC5A 2VDMB 4BNFA 1BXZA 2HM7A 4EGJA 3WGKA 2FW1A 3I9NA 2GN0A 2VWQA 4RJIA 5FP0A 3L92A 1W0KD 3UAWA 3IGFA 4ES6A 1UBEA 4O4JB 1IBSA 3M6AA 4XM1A 2IIQA 1A71A 1KU6A 4WOBA 3WE7A 4R71A 2IITA 4M55A 1D4OA 2H0RA 4NLLA 4UVIA 4QAJA 2C94A 2Q9BA 2JA1A 3CV3A 3ZXXA 4OL0A 3VR3D 5KREA 4UNRA 1JHOA 1R9MA 1CQZA 2H4XA 1I0IA 4ARZB 1T8SA 4FU0A 1T6ZA 3MLBA 4UBLA 4YMHA 1OLUA 5B1IA 3B2QA 4L8LA 4DXHA 5CBPA 4D9BA 1N8SA 2AOWA 2PGNA 3RB8A 1PL6A 4AWXA 2R1VA 3QWBA 3D3WA 3KELA 3MMZA 2JAWA 4W99A 5LFAA 1SK8A 4OSOA 4PPNA 3TOSA 1NY6A 3GRRA 4IXWA 2CWDA 3AUXA 1OHHA 2IV7A 2JVIA 4ISCA 4TVOA 3S81A 3UWDA 5JRDS 1QLJA 4NPCA 3U3OA 5ERXA 3CZ4A 2Q6VA 3L6BA 4FIDA 4LSGA 5F2OA 3OE7A 1VHLA 3IDZA 2NO1A 1UJBA 2IGTA 4HX9A 3QPBA 2EKBA 3TEFA 1SUPA 3CNNA 5KNBA 3ST7A 3SS7X 3WV5A 3JRNA 3GJSA 2HO5A 5FQNA 1IM8A 1KAHA 2BRUA 3I3OA 4QPCA 1D0VA 4TMFA 5BSMA 3F8WA 1WHTB 3OM0A 4M0FA 4NIMA 1C9DB 2AZDA 3FPHA 4EO4A 1ZNQO 5JHHB 3TM4A 3PQDA 4IS3A 1A27A 3H19A 4M87A 4U0JA 3UT5A 4JXXA 1H93A 1FDVA 2A58A 1J33A 2CMFA 3B89A 4OQPA 5C34B 1JEYA 1EYZA 1U7OA 4YJ3B 3RSCA 1ZL2A 3JQ8A 1KMIY 1Z6YA 3S4YA 2ZTHA 1QO0A 2G40A 1X86B 4M1QA 3ROTA 3C3PA 1OC4A 3CYFA 2VPXA 3E2MA 3EOZA 4WQMA 1IK4A 2V6BA 2P9QA 2IOFK 2J67A 2VDRB 3ND6A 4JT9A 3TE7A 3BMNA 4M0UA 3G5LA 4C06A 4DN6A 5C18A 1WHSB 3EASA 3PX2A 3HEMA 4KO4S 3LHDA 1KOLA 2C5EA 2GAOA 3PDIA 1T35A 3PNQA 4GWGA 4J7AA 3WQHA 4P0TA 1FJXA 4Y1RB 4JLDA 3SIPA 4BQPA 5I7WA 3UV7A 5IABA 3IMFA 1XJWA 2IUFA 5CT8A 1DJLA 2Z04A 1TUIA 4ND8B 1FVHA 2H1IA 1HG0A 1VZ2A 5F33A 2QX8A 2WJGA 3T0GA 5JNTA 2Q0HA 4L3VA 4M0EA 3ZCUA 2VR1A 4AP5A 1LC3A 1QRUA 3PR1A 1CRQA 3EVFA 4REQA 1KE1A 2H5LA 2HK8A 4KAJA 1F51E 3FWNA 5IKOA 3W4KA 3NDBB 4BAUA 1T8UA 1XI2A 2WWRA 3FY4A 4A03A 4H6VA 4WBNB 5IDWA 1LI4A 1WDTA 5DXFA 4DR2B 3CISA 4JK3A 4EX7A 1E2LA 1L8LA 2ICAA 1J39A 3D5EA 2ZUTA 4M86A 2SHKA 4B43A 5JUWA 4FJ1A 1T91A 4YT4A 3KLOA 1QU3A 3L0OA 3K4HA 2J85A 1CIVA 1VG0B 3NTLA 5ETJA 2P2CA 4LV5B 4GEGA 3CLSC 2EQBA 2E6KA 1YS4A 1JBEA 1WZNA 2FMIA 3H9CA 4NMMA 4Z3DA 5K8JB 3DW1X 1U1GA 2M9MA 3KOOA 3LMKA 1U8CB 4KCGA 2A9OA 2HU2A 1HDGO 3DBHA 4Z8XA 4CM5A 4IO1A 4NJEA 4MWZA 2XWPA 3V3TA 1YDMA 1SG0A 1GEGA 2O3UA 3IUYA 4MO9A 5DM4A 2CLSA 2E48A 4MYDA 3U6KA 1NW3A 4UAJA 3ZDZB 4YH1A 3HKDA 3VR2D 3BRCA 1ZIXA 2I5PO 1RLIA 3NTXA 3U4QA 4BKMA 1I3CA 4BNWA 3U1TA 1HLPA 5TPZA 3TG2A 2VA9A 1PLKA 2HYIC 1VKOA 3PYXA 4OHCA 1JEQB 1JS1X 4NZNA 1YI1A 1EQAA 3BH7A 1BWSA 4QKQA 3KT0A 3RSSA 5KTPA 3GVHA 1W85B 2FLVA 2BR5A 1L4UA 1ZA2A 2EZTA 3TB4A 3ED5A 2XYPA 3O0TA 5TJHA 1QDEA 2FSIA 1JZQA 1NRJB 2XMCA 2I4NA 3OZAA 5BNTA 5HFJA 1GADO 3L6CA 3KC2A 3GYGA 3PHLA 3B6MA 3Q3HA 4KN8A 3STUA 4F11A 4MRPA 1ORTA 1YHYA 1HEYA 1QM5A 3AKCA 1M5TA 3OZTA 1Z6PA 2PXAA 1NJ5A 1JG6A 1LS1A 2OP0A 4KMOA 4XB6B 3UB3A 3UW1A 2YV4A 2ZWOA 2QVXX 3DUFA 3B2NA 4ZQIA 5C1OA 2C04A 1MABB 1F9AA 2G06A 4L4SA 1JJAA 2QAJA 2AN1A 3GYBA 4Z6KA 1APBA 1X7ZA 2OB2A 3NV9A 1PGPA 5GY7A 5HF6A 4BMOB 4RSGA 1W85A 4F8JA 3TRDA 3FYSA 5LWHA 5D01A 3KQWA 3S2UA 3ZKWA 2GCOA 4DMMA 4F2PA 1GU7A 1M1YB 1NHGA 2XCLA 4M9QA 4OGLA 1HC7A 3JR7A 4MUYA 1BN7A 3BE5A 3M6VA 3EULA 4COKA 1I0ZA 2G7MC 2EV9A 4KQJA 1ZFNA 1K06A 3FMOB 3NASA 4GMKA 3PVSA 2VRCA 1SCBA 3FDXA 3PFHA 4TXMA 3U81A 3ZBQA 3HI6A 4DY6A 1JWLA 1WB9A 1PRYA 3LF2A 1UKYA 5KJEA 2DSNA 2EWMA 1ST3A 1OB2A 1WQ3A 4YRPA 2XMBA 1U98A 1Z4PX 2P8JA 4NJEB 1V2HE 2QDKA 1SKYB 4X1IB 5EUMA 2IS4A 1Q1ZA 1DC5A 3G0HA 5EHQA 4II7A 2X4DA 1G41A 1TK9A 4GFDA 5CGZA 4P98A 3CVOA 4RZUA 4LBVA 3FOCA 4BP9A 2OGUA 3GEMA 4LVUA 1O6FA 3B6KA 4EG0A 2RG7A 3K2IA 3PZRA 4PC1A 4QPDA 5AKHA 4ZCRA 4B3RB 1R0SA 1YQTA 3HKCA 2RKWA 5I4BA 3FNIA 4IAOA 1PZGA 4A16A 2CXQA 1KHTA 2W00A 3GLVA 4BRSA 1NI3A 4OAQA 4OO3A 2E4UA 4ZOLF 3GFVA 2Q62A 3JWGA 5EVJA 3D3EA 4PGGA 1G7RA 4KSBA 5LP6A 2YDYA 4TSFA 4BP8A 4KE9A 3BRWD 4F38A 2IYVA 4GRDA 5KKCA 2HA6A 4MEAA 4KYVA 4RD1A 1P2VA 1RYEA 1UDXA 1XCMA 1Y6ZA 2BEJA 1T0UA 2ZVQX 4ZRDA 3D7SA 4N5MA 1A5AB 1PBNA 1XJCA 2P40A 1FVOA 4G56A 4WCVA 4C4SA 2XQGA 1C7IA 1V7PC 5B3JA 3AXSA 4IG4A 2M98A 1J2JA 3SMQA 4RK1A 1JHRA 2XCOA 5BUQA 2C7BA 5EPUA 2AI1A 3GLQA 1FUEA 4ZALA 3PK0A 2BJVA 3QLVC 4F93B 1BC5A 1QVWA 2H2AA 1PDVA 1OXSC 2Q5JA 2YCLA 3PDIB 2J1LA 2JFGA 4WPGA 4WGGA 3UHOA 3ZDCA 1BXGA 4I5GA 4ZKDA 4JBXA 3D1LA 1G7TA 2F55A 2I2CA 4YP6A 1G9SA 4G8JA 4J7CA 4LQDA 4R1UA 4Y1GA 1HOXA 4R1LA 2EBHX 1GR1A 3I53A 2PZEA 5ESDA 3ZD8A 1CEQA 1SOWA 4PYJA 1QCYA 3DE4X 3NHUA 2PWBA 4EPVA 3GH1A 2WAOA 4S2UA 5G3ZA 1XPUA 1FJHA 3AI3A 2Z2IA 3KUXA 4KZPA 1ZLXA 1WO8A 2NU6B 2M6KA 3G9UA 5CX1B 1ZQ1A 1N8NA 3AB8A 4NU8X 1OLXB 5TS2A 2PV0A 4NOJA 3Q4GA 3IAS1 3PDHA 1XHLA 2BMJA 4WCFA 3TW4A 2WKSA 3WMRA 4UNQA 4J6EA 4LXYA 4OAPA 3C41J 3C7CB 3SKXA 2GRUA 4MWCA 4FHDA 3L9WA 4YC7A 2JHAA 1Q3TA 3SNHA 5F3WB 1Y42X 2ZIGA 4R8LA 4E22A 4CV1A 4DUPA 3F97A 1NOKA 3U37A 1RD4A 2H8KA 4J9VA 2RHHA 4HAYA 1B8VA 1OFTA 3IYLW 4D02A 1TL7C 1TIKA 1R6VA 3G3EA 3HJTA 4JUFA 4GI5A 4CF3A 1VBNA 3AESB 4NNOA 5KNCA 5LP1A 4P0QB 3EIUA 3VKGA 2BHNA 4LY0A 3K70B 1VJDA 2H17A 4KX3A 5JANA 4IIXA 5G1PA 4JMPA 4R1NA 1JR2A 4TWAA 1WCXA 1PKXA 5JQGA 3CJRA 3RFVA 1RACA 1XSEA 2ZIEA 3DP7A 4LWOA 4EIWA 4FFDA 1XBTA 4FFOA 4HWKA 1GAXA 4G8BA 4QL3A 3WHPA 1F4VA 4KIGA 2J41A 5D00A 2IOYA 4G89A 3ZD6A 1PIWA 4UE2A 1PJ4A 1Z36A 1EINA 4INJA 4MLPA 3WKCA 2ZSHA 4JYBA 2F00A 2Q6LA 1OBFO 3MIIA 4G4SO 1WBJB 2B4QA 2BONA 4IDNA 3TUZC 2P6UA 5T4BA 5IG2A 2PZJA 4F6RB 5JZBA 2Q5EA 2X4IA 5EFZA 2I1WA 4BB9A 4I6GA 1QANA 1YRBA 4BFLA 2INGX 1UOQA 4L5AA 1XF1A 3EEFA 3BXPA 4ONEA 3KSMA 5HF9A 4TSKA 1FNNA 3PNKA 4G0NA 4NYMR 2XVMA 3EIEA 4Q48A 2QI9F 4UBOA 2AEJA 4X90A 3I9LA 2Z30A 1RJDA 3PRYA 1RHJA 4A8TA 3ZWYA 4F3YA 4Q7LA 3W2FA 3FRHA 1RYZA 1ZEMA 2P2SA 2XVZA 3B8HA 3CMCO 3Q5EA 4HB0A 3IKTA 4JT2A 4F5EA 5MFZA 5C9ZA 4ZDJA 3R3ZA 3SZMA 5LQDA 2Z8ZA 3EOBI 4UZFA 4U7DA 1YC5A 4AG3A 1DQNA 3ADPA 4PG7A 3U3XA 1ZQ9A 3RO7A 1KI1A 1ZL0A 4LZNA 3P9RA 3ND8A 4YTEA 5A4FS 1E3EA 1FBNA 2ZVPX 2GESA 3B2EA 3GLUA 2LUOA 5AVOA 1C1XA 3R7LA 3PCTA 3RIYA 3VYUB 1AGRA 3F9CA 4ZT3A 1HFKA 2GNPA 4L7QA 4AUNA 4O8ZA 5IBPA 1WBBA 2JI8A 4OTZA 4BVEA 3GMTA 4QSMA 1DWPA 1XTUA 1BRTA 1D7OA 1H66A 1LEHA 1NP7A 1V6CA 1WZIA 2I1LA 3FTDA 1JDUA 3I37X 4GI3A 4OXKA 5EA2A 3ND5A 3V97A 4F92B 3SR0A 4IP0A 4JQSA 1FEZA 1W46A 2HWXA 1XLVA 3P2IA 3FNQA 3WL4A 5AJXA 2GFHA 3JQAB 1O97C 5DRYA 4FFPA 4GM0A 1KL7A 2BWJA 4QXRA 3SGLA 1GPNA 3V80A 5I7FA 2VQFB 1VXOA 2Y99A 4HH1A 2H1VA 5IC5A 2BGWA 3F4LA 3K05A 4BQEA 4TL7A 5JE8A 2Z9BA 1SBIA 5LQKA 1HDEA 1ORIA 3O21A 2PWZA 3HRHA 5CA0F 4PXSA 1N2JA 4GSYA 1FP6A 2O06A 4YMGA 2C4VA 1TQ2A 2AQHA 2DY0A 1YZNA 1Z4OA 1D1SA 3H99A 3LCJA 4Y30A 4RS3A 3EIXA 4GPD1 3KR9A 3LUDA 1HE5A 1TO6A 1Z33A 1Z9BA 2I29A 3CLUC 3OQ1A 4G81A 3ZGOA 4I0WB 2Q5HA 4KODA 4MGYR 4PZLA 1VHDA 3ZTWA 4X8MA 4PNEA 4YRQA 4E7PA 1NW5A 1GCAA 4QODA 2R7AA 4EF4A 4Y6SA 5CUQA 2KSQA 3MOSA 5SYMA 3SNKA 5IJ9B 1U0LA 1E3QA 4U2FA 1J25A 1USGA 3WZ2A 3PF8A 1X77A 3X44A 1K4KA 4ZI2A 5IC6A 2QUAA 3BE8A 4X1YA 3KKEA 2W70A 1NBEA 2W4MA 3BFXA 1FW8A 4QHSA 4P3XA 1N32B 4QDXA 2WIBA 3ANTA 5EJGA 1KH1A 3OIWA 4A6XA 2C83A 2VA8A 5M2QA 3F1KA 2RGRA 1M8KA 4RVDA 5MHTA 4RA9A 3NXSA 3X0DA 1VJ0A 3PJEA 5G0UA 4RM2A 1NAHA 5F3DA 1EUDB 1L4LA 2GLXA 3IQFA 3JZDA 5LA6A 1I8TA 3ZX4A 1B1AA 2BTOA 3OQBA 3CGGA 2FPOA 1XG5A 5BSFA 4A2CA 2G09A 5CURA 5JG7A 5C1IA 5ALNA 1VLQA 3QUSA 5DXJA 1I3OA 3R8XA 5AW7A 3G2MA 5B53A 4F5DA 3R8FA 4IMPA 1EXVA 4C22A 4DRZA 4MKIA 1SHJA 1ZCJA 2PAAA 1YQXA 3NCHA 4LJSA 5CLLA 3I05A 4H6XA 1AGNA 1NXWA 1SOUA 2GN6A 1E7SA 4E5NA 4D74A 2DR0A 1ODTC 2XUGA 4AXBA 1DKQA 4PPFA 4KO1S 4PFKA 1L1FA 4ZAXA 1K9VF 4PANA 3HADA 3F0TA 1U3CA 3DB2A 5AKJA 4ZVKA 5BV7A 3R6WA 4LDAA 1UBSB 1MB4A 2VF2A 3G1TA 1RWXA 4RE6A 2OBYA 4DB2A 2VDLB 2ZUEA 3UG6A 4L8WB 3WGMA 2R7KA 2BOVA 2WUDA 4YB8A 1XDGA 1GUZA 1LPNA 1MH1A 3A11A 4B6OA 3BCSA 5DNVA 3WVNA 4IZIA 1C8BA 2ZW9A 4HRAA 2ZCVA 1E3DA 2YZKA 3DDSA 3UWOA 4Z53A 4UDXX 1K86A 3PRKE 1HDIA 2C4MA 2FHPA 1U0TA 1JLLA 4MITA 1UJCA 4CDGA 2A0XA 4GX0A 3FNGA 3QOFA 3DXYA 6REQA 2QLJA 5TQJA 4AUEA 4DBLE 5TIIA 5ELXA 1J2EA 4CQNA 1L4EA 2Q3CA 2PFGA 4GLFA 3CX8A 2POQX 3EVTA 1VKJA 4U2CA 4YPVA 3HZZA 2HUNA 2ZE5A 3OPYA 1RCUA 3F4BA 2XRZA 4TTVA 2Q7XA 3N2YA 1A9RA 2I65A 5EEGA 4JQOA 1N2HA 2OHVA 1AOXA 2G1PA 5JAUA 1CF4A 4FINA 3HZOA 1G8GA 1RW4A 4RZIA 2IH5A 1Y80A 3W9SA 4PGFA 3TIXB 4Y6OA 1JHVA 3JQCA 1S3GA 3AOGA 2NVUB 2AKAB 5G4KB 1WAMA 3PNMA 4N6OA 5HTKA 1TTTA 5DOZA 3PXUA 2QTLA 5JT1A 2PBZA 1OIWA 2CXUA 1GDDA 1QJ4A 2HDNB 3DUWA 3LECA 3SYNA 2ZT8A 3GEGA 4ND6A 4IFEA 1CUWA 3N8HA 1BJKA 1DIRA 2VHZA 3AEYA 1ORHA 4FUTA 4YCAA 2PKYX 5CNJA 4RGQA 3T0IA 4ARCA 1W4RA 2G07A 4G1UC 3LXUX 4BBJA 1V1RA 5IT5A 4EPRA 1EH5A 1EM8B 3DOHA 5E3HA 2HQBA 4JLKA 3AU9A 4BCCA 4GGPA 4P3PA 4XM0A 5A3JA 4Q3LA 3RSLA 2CNDA 3EHEA 3H3XA 2CSXA 7MHTA 4NCHA 4FBGA 4CF7A 1K6JA 1EBBA 1VE7A 3FLBA 3T7SA 4D7AA 1W96A 3V8RA 3PITA 4KU4A 1ZGGA 2P2NA 3D6JA 3NAMA 3V4VB 4KLZA 2F1OA 3E2PA 4ML3A 3VU9B 1SQ6A 2X7XA 2JD2A 3VMFA 1RJ9A 1Q2UA 2AOXA 5DM60 1EJ2A 4HXEB 3MAGA 1NVDA 2QT0A 4Q7MB 5B1DA 2J30A 3W79A 2AXEA 1LLQA 5G4LA 4KTVE 5CA0B 1T1SA 4NZ9A 5E2AA 5M04A 4TRJA 2PJDA 1FMJA 2QG4A 2OV6A 3ESCA 3QKTA 3F98A 1DBSA 3L0BA 3O9ZA 4NSNA 4CG3A 3ILXA 5C7YA 3FTCA 5JW6A 1RZRD 1GUFA 2MHCA 3NEPX 4OA8A 1T8WA 3ZPXA 4CM4B 5IVKA 1H4SA 1M75A 4AI6A 1NNEA 1OQAA 4RL4A 3B9BA 3H4IA 5EL0A 1CY7A 3DTVB 3FSGA 3OM8A 2PS0A 3IHWA 1P61B 3IP5A 5A4MS 1GGVA 3FI0A 2P6RA 4R1PA 2BGJA 4PLHA 1UWLA 2HFJA 4DCGA 3FD8A 5AW9A 4AMVA 1ONPA 1P2FA 2P6MA 1AXGA 1YR9A 2IY9A 5L95A 1K88A 3TZCA 2VRWA 1DIHA 4PG6A 721PA 1ECJA 1J09A 1O4WA 5BWCA 3BN3A 2DETA 1NLUA 1QHFA 1Z0KA 3DTYA 1XRNA 2B8JA 2JRLA 1N6LA 2QKYA 3ICOA 3ESBA 3D3NA 4OA5A 4Y9TA 3TIIA 4BYGA 2GPBA 2J9ZB 3VR6D 1KO8A 4F06A 4NOKA 3K9GA 2BPOA 1G98A 1X80A 5EMLA 3HO1A 1NL3A 3PXDA 4OSPA 1TEZA 1SKBA 2IEYA 1SOAA 1X39A 3H7IA 4Q3DA 2GAIA 5JAIA 3A1NA 2PQ2A 4YFVA 2W7TA 1WB4A 2BCEA 1M34A 2DBQA 5C1DA 1HYBA 1WDWB 2VHQA 1ZH0A 4I6EA 4MUKA 4BB0A 2DYKA 4DXDA 4O3MA 3AESA 1DJPA 2RBEA 2BGUA 4K05A 4UBMA 3UJ9A 1DV1A 4CYMA 3IP1A 3P96A 2DLNA 2FRXA 2P9FA 5TNXA 1X8KA 3PFFA 4FYXA 5FUWA 1ZSYA 1KC3A 4KGXA 4MW1A 1NASA 4BC1A 1L7PA 4ZMSA 2GZ1A 3V6MA 3RVRA 1C29B 4IUYA 1D8AA 2QTFA 4S35A 4OUDA 3B36A 2QR5A 4IOJA 1GL6A 3Q3JB 5DBOA 4GP9A 3KDAA 2ZB8A 1NKSA 4IS2A 1KY5A 2WJHA 2YCBA 3PR3A 1JSRA 4HNUA 1GLGA 1OLXA 2XT9A 4EKYA 5EJ2A 1FK8A 4MV7A 5LXTA 3JPYA 4HUJA 3O26A 3QX9A 1YZ3A 3GCWA 3P94A 4L4RA 4MULA 3D2CA 4Q00A 1T0JB 1KEEB 3VC7A 4BLUA 4EUEA 4UFPA 3PHHA 3VA7A 2WI8A 3KJIA 4RMGA 5ALMA 4HNTA 1C2YA 2Q0SA 1G4UR 2APJA 4X91A 4MYHA 2CNWA 5HJ7A 2ANCA 5LMCA 2ES4A 1RXWA 2O8EA 2X22A 5ALQA 1KI9A 5ICGA 1O9HA 3FGZA 3HNPA 3LX8A 3OCXA 3BAFA 4DV7B 3VYRB 3NHPA 2QSZA 2XNKA 2YMPA 1E1RA 2OB1A 5AW4A 3MRSA 1Z56C 5E6UA 3LIPA 5GONB 4OYRA 3AEQA 4C5AA 2BV3A 2AZ4A 2COEA 2OM2A 3DTVD 3K9BA 1Z88A 3ROGA 4ZK2A 5BVHA 4S2EA 1MX1A 821PA 1R4ZA 4CCSA 4J76A 3X2SA 5FV4A 4FR5A 1TTHA 3W4JA 2GEFA 4NPHA 4WKPA 5F7JA 3W8EA 4P4TA 4HV4A 1QZZA 3EOAI 1ZH6A 3LYUA 3VU0A 1W88B 3DP9A 4KH0A 1JDBC 2FJPA 4DIUA 1B00A 1PYGA 4FYJA 1XU7A 3O4GA 4ACAA 5ALVA 6PFKA 2WSYB 3N2ZB 3W8DA 4AX8A 5CYGA 2JJMA 1N2EA 5T3UA 3WGGA 3TVTA 3K70C 3BGWA 5CRIA 3FJOA 1RI3A 1DBQA 1JL3A 3I8OA 1RZVA 3WWYA 2VK4A 4EY6A 1PJ8A 2D2EA 4TSRA 1X1CA 4A15A 3BD8A 5BN5B 1RU3A 1ZONA 1GAJA 2ZAIA 2TSYB 3C3EA 4RCZA 2NTYC 1N57A 5KCMA 5SYNA 3T4UA 1WCIA 3GLHA 2XB4A 3OKPA 1W25A 3DBOB 5IAJA 4MIKA 4N3CA 4QNNA 3ZE7A 2PWYA 1WA5A 2GEBA 3LUHA 5DN6A 1A1SA 1N4DA 5JCJA 1EP9A 5K8IA 3KTFA 4IR7A 3WGJA 1HQCA 3IUMA 3F5MA 1GG8A 3EISA 3NUZA 4E11A 1UC4B 4IIFA 4DVGA 1MLDA 4OOFA 1XYGA 2OD9A 2GCOB 2WU1A 5A5FA 4ZC8A 4D9HA 1U9YA 3G2IA 1G38A 2ZQYA 2PWAA 1D9ZA 2B6HA 4E5YA 3ZWQA 1A9TA 4DA0A 5JR3A 5LQRA 4CHTA 1Q0QA 1KVUA 1Z35A 4FHGA 1RXCA 3LKZA 1Q15A 2WRZA 1RBQA 4TKUA 3NVMB 2HRCA 4BV9A 2A1TR 2BLLA 2JC3A 2WVAA 5TF0A 4QWMA 5HUJA