3FDIA

Crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
161
Chain Sequence
QIIIAIGREFGSGGHLVAKKLAEHYNIPLYSKELLDEVAKDQDIAIRQFNFIRKKANEEKESFVIVGRCAEEILSDNPNMISAFILGDKDTKTKRVMEREGVDEKTALNMMKKMDKMRKVYHNFYCESKWGDSRTYDICIKIGKVDVDTATDMIIKYIDSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of uncharacterized protein from Eubacterium ventriosum ATCC 27560.
rcsb
source organism Eubacterium ventriosum
total genus 48
structure length 161
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13189 Cytidylate_kin2 Cytidylate kinase-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fdiA00
5CLQA 4PQFA 2CDNA 2CVFA 2OAP1 2AR7A 4TLDA 1Q1QA 5KHOC 2IHYA 5F98A 2GEDA 3AF0A 5FUYA 3KQUA 1QHYA 2ANCA 5HKKD 4B48A 3N2IA 3QG5A 1X1RA 1T3SA 1D2EA 2IK8A 2NTYC 1W0JA 3KDSE 3A1TA 4A0FA 4PAMA 1E2HA 2G0TA 1XD8A 2QAJA 1KDOA 3A1SA 2QP3A 1SVLA 2BKEA 3OEHA 3PUZA 4DLRA 4W9MC 2J0VA 1OXTA 3CUEF 4H1VA 1WCV1 2ZRPA 2YYZA 4UXJA 1ZMXA 3IIKA 2H57A 4C7OB 3LLUA 2C5LA 5K8UA 4BEBA 3UIEA 3AH8A 4BPBA 1G9XA 4LJ9A 1SGWA 4GRAA 4Q02A 2QGZA 1NVUQ 2GCOB 2GRJA 3MAAC 1VYUA 3EA5A 1EXMA 1I2MA 2OT3B 4B2IA 3TJZA 4G01B 3NWJA 4NPHA 4HZUA 2ZRDA 2QZ4A 1YHNA 5FPSA 1HURA 4LJAA 2QORA 4LSGA 3WMGA 4UXIA 3ZZTA 1IQPA 3U7GA 2B7CA 2GA8A 5LD2C 1E2NA 1SQ5A 5HZHA 3GD7A 4IDQA 4Z8YA 1P2VA 1X8JA 2IEYA 3M0EA 3C4JA 4F7WA 2A3RA 1Z83A 4QGFA 2PL3A 3BORA 3ZVNA 2QRNA 1T6NA 4NCHA 1E98A 3FGNA 3EPLA 3DDCA 1BMFD 4HLUC 1KSJA 2GJ9A 4KYUA 1IOZA 4TZ6A 2GEVA 4Q1CA 2QE7D 5K8LA 5KDDA 2ZI9A 4RFSB 2ZJ5A 1W47A 2KBFA 5DISB 4C0BA 3KKOA 1Z2CA 4ZI3A 2BWJA 2GF0A 2X2EA 3EPKA 3CRMA 5K8IA 1Z28A 3FHCB 1E2GA 4XOIA 4O2LA 3SJBA 3RSLA 1RRGA 2GILA 2GZHA 521PA 2ZROA 2GNOA 4B35A 2OBLA 2H8KA 1IN4A 1MRNA 2W83A 4TL7A 1E9FA 4CVNA 5AJWA 4UNNA 4C7OA 4JKIA 5C46F 2BCGY 1AA9A 2GVDC 4ABYA 3DPUA 1KZ7B 1N3BA 3PVSA 4PFSA 3BBPA 1KY3A 1KAOA 2GCOA 1QVAA 4OQXA 1OT3A 2WIAA 2NGRA 1E2JA 3SHWA 2JJ1D 1T8UA 4URVR 1OIWA 1L8QA 2WWWA 4KFSA 5HCIA 4L15A 3UKDA 1XXHB 3SS8A 3BFXA 4PC6A 3VMFA 4M9ZA 3QKSB 2YWEA 1N6LA 3W6NA 4NP6A 2GBLA 4BFYA 4BFUA 1OB5A 3FMPB 2E9SA 1JR3A 2CK3D 1DADA 2W0MA 1XX6A 1W4BA 1SKQA 1UBEA 4YMWA 1OE0A 4FMDF 4O25A 3QUSA 4ZIRB 2AD5A 2WWGA 3RWMB 2RGAA 4KI0A 5L8VA 3K8YA 1LS6A 2WMOB 1T8TA 1XEFA 5EUQB 2P6NA 2ERXA 2GDJA 3RS4A 2BKUA 3UK6A 2IYUA 2N1BA 2QAGC 2D3WA 1CR4A 2IYZA 3LX8A 1Q44A 4RFSA 1MT0A 4PC7A 1HYQA 1R8SA 1UM8A 2ZU0C 2ZJ2A 3Q5DA 4ZDKA 2O8CA 1VG9B 2EW1A 4KO8A 1CU1A 3OZXA 2BBTA 4NYMR 3GMTA 3WP1B 3KUDA 3FDIA 3HU2A 4PZLA 4G1UC 1DAGA 2BBOA 1RKBA 1TQ4A 3CRQA 5LD2B 4XH9B 1AS3A 1O3YA 2D2EA 1RZ3A 4HLCA 2DPXA 2WPDA 2IF2A 1M7HA 3HP1A 4B33A 3TIFA 2GJ8A 3TK1A 1GKUB 2J87A 5SZJA 3LBNA 2H16A 3P4XA 3WBKA 5AUQA 1NMXA 5C4MA 4E09A 4QM6A 1NN5A 2GJKA 3KQHA 1G17A 3BJIC 3BK7A 2GXSA 4QGAA 1AS0A 1OW3B 3GLHB 4AWXA 4B2LA 4JLMA 2ZPTX 1WDTA 4CEJB 3QKSA 1XMIA 2HCJB 2WTUA 2HYDA 3G5UA 3O8CA 1N0WA 2HT1A 1IXRC 1AIPA 2YV5A 1HUQA 1T3HA 2AK2A 2Q9BA 4RVCA 5EE5B 4AY2A 1VG8A 3GJ0A 3BC1A 4BZQA 1E1RA 4ZIRA 4KBGA 2WJHA 3LW8A 1KDTA 2KI5A 2R65A 4PHFA 3ECCA 4QM7A 5B30A 1IY1A 4BQSA 2ZXUA 2XZOA 4HB4A 1YRBA 4IFEA 4DLUA 1XPOA 2DHRA 2RGXA 3OEED 4KBFA 5F9FA 4TN1A 1LVGA 1DAEA 3T34A 3DMDA 1F3OA 1NG1A 3NBXX 4GI7A 1SKYE 2RGBA 1XTRA 3DOFA 4LJ8A 2OE2A 4QGHA 1GNRA 1NRJB 3BFVA 4EPTA 5CB6A 2H17A 1N6NA 4V02A 5FUVA 1Q3HA 1W36D 2J7PA 1DBSA 1Z0JA 4QNMA 1CRPA 4TMVA 1G3UA 1VG1A 2KJQA 3BERA 1BIFA 3U7FB 2W6IA 1X8LA 1IONA 1XD9A 3IUYA 3ZQ6A 1X3SA 1OIVA 2WHXA 5UKDA 3WYAA 2Z6VA 4HDCA 4MKHA 3U3MA 4EIWA 1UAAA 1W5SA 1H8ED 3IO3A 3EG5A 4PZZA 2VHUA 5FH9A 1AN0A 2FE4A 4DCSA 3H0KA 3X1DA 1VHTA 4HLUA 2EFHB 2REOA 4C0KA 3X1XA 1FMJA 4FWIB 4A2WA 3IEUA 3K70B 3T06B 4ARZB 4JLJA 2QAGB 1GVNB 2HEIA 3MMPA 3GLHA 2AX4A 4CEJA 2FFQA 2O0KA 5B57C 4NH0A 4TWZA 1Y3AA 4P32A 4X8LA 1ELOA 1KNQA 3MWJA 4DLSA 1ZM4A 2FGJA 3LBIA 4B74A 4XJXA 3QKRB 5LDDC 4QJ3A 1MH1A 3BH0A 4Q9HA 1ZNZA 4JIMA 1UBCA 3GJXC 3K0CA 3THYB 4F93B 1QHNA 3K0FB 5TVKA 5C2JB 1ZU4A 3FFBA 1W46A 4DLYA 3OEHD 2BDTA 2FU5C 1ZIPA 121PA 2DBYA 3NH9A 2X2FA 2R9VA 3UG6A 3M1IA 3ZGXA 5A5GA 1ESMA 3OFNA 2C96A 3AEZA 2VP5A 4Q4LA 5FR1A 1J8YF 3RS7A 1VIYA 4QHYA 1GL7A 1KTVA 1HT1E 4NYIQ 4R2HA 4KYIB 4HB2A 1Z0IA 2V1XA 4M1MA 1NY5A 3VFDA 2GKSA 1Z29A 5CK4A 1U94A 2IC5A 3RC8A 1L7VC 1NJGA 2IEZA 2WJVA 1T4GA 1MO6A 1SXJC 1GWNA 1ZYUA 2WICA 3W34A 2W6JA 4OI1A 2W2XA 3U3OA 2VP9A 4LYFA 2FEOA 2IYLD 1NN1A 4AYXA 1MO5A 4EKDA 4TYYA 1KI1A 2OCYC 2ZSEA 2Q0HA 2F1JA 621PA 5GVSA 1SXJE 2ZI3A 3P4YA 1XJQA 2A5JA 3GLIE 1DAIA 2ZRBA 3PV0A 4RCZA 2RGNA 1CRQA 2XTZA 1D9XA 2WWIA 2ZYVX 2QAGA 2FNAA 2LCFA 5TARA 3E70C 1TF2A 4ARZA 4FCVA 3P27A 2DFNA 4D80A 3NDPA 4NKRA 3IHWA 1KK3A 3KXKA 2ZUDA 2QM7A 2ZRGA 3AF3A 5FTNA 3EC2A 1ZM2A 4KJZA 1XD2A 3U61B 2AK3A 1L4YA 3AM1A 4IVRA 3SYLA 4G5SA 3TR5A 3QKRA 3ZJYA 4UNRA 5KYKA 2O0HA 1JALA 4ACAA 2MSDB 2UKDA 1D2NA 1RYHA 3K09C 1NIPA 2O0JA 2OFWA 1XBTA 4UQOA 3KUCA 5IK2A 4A2PA 5E7IA 1ODFA 2A7QA 3K0FA 3OESA 4BGDA 1KO7A 1VYVA 1FNNA 1DAHA 3D6TB 2FX3A 4NDZA 1I2DA 5EQTA 1RRCA 1X86B 2XOKA 5CDFE 5JCPA 3PEYA 2KB0A 4RSGA 2PX3A 2Z43A 4PQRA 4JLBA 4QBFA 3QF7A 1PJRA 4ERNA 2AKAB 2R2AA 4GP7A 1EFUA 3NEYA 2VL7A 5FFMA 3T1QA 4ZCIA 1ANKA 2I4IA 4EJSC 4W5WA 3MWKA 4XD7A 1UFQA 4HLQB 2FEMA 2J0QA 1EFRD 3KTAA 1XU4A 3WRYC 2BEJA 3NHBA 2VF7A 4OKSA 4I4LA 1VCOA 1Z0DA 1G7SA 2ZTSA 3BAFA 4DUGA 3IQWA 1J70A 3QE0A 5JLJA 5HCNA 1G5TA 5BWMA 1T5LA 4DRZA 1EX6A 1UKVY 4GMXA 5FBRB 2AD1A 4XSGA 1US8A 2CHQA 3Q8XB 721PA 3O8BA 2CL6X 1GILA 1N6KA 3X2SA 1W36C 1MR3F 1M7BA 3B1WA 4NU0A 2FV8A 4J0QA 3KB1A 3F0TA 1YRAA 2RHDA 4D25A 1IY0A 1FNMA 3NTUA 5KPJA 5CLLA 2GK6A 2A2ZA 5F9HA 3UPUA 3KFVA 3PUWA 2ZU6A 3H2YA 1NBMA 3I73A 3GJ6A 1A1VA 3OIWA 2OO7A 3LW7A 1E2PA 2A5YB 1CLUA 4LX0A 4MUBA 4I1SA 3RLFA 1G20E 2GESA 2IBMA 2QI9C 2ORWA 1FW6A 5GVRA 4HATA 3GFTA 4NCJA 1E9RA 4WW0A 2V54A 2WOOA 4OK3A 3BOSA 1YKSA 4UNQA 2WIBA 4V0MA 4WZAE 2ZAMA 5JCZA 5KOYA 1SULA 4QHTA 2WPDD 2ZJ8A 3QG1A 2C2HA 3EA0A 3BGWA 5EXSA 5H1YA 2BHRA 2C99A 1T0JB 2WV9A 2ONKA 2ATVA 3QI2A 1JQLB 3MD0A 2QP4A 1Q0UA 3CPHA 1W0KA 4IVPA 5EP3A 3EPJA 1P75A 1AQUA 4YMSA 4OHXA 4L16A 2PH1A 1GOTA 2VP0A 5K8TA 4GOJA 1NLYA 2YWHA 2ODWA 3MCAA 3LQQA 4DVGA 3R7WB 1MV5A 3BH6A 5HE9A 1KOFA 4L9WA 1JAIA 1ZJ6A 4M9XA 4MRNA 4OHZA 2QN6A 1CIPA 3UG7A 5KSZA 1CR0A 3LO5A 5L3QB 1Z0AA 3QIAA 1T91A 4KAXA 1P2UA 4MDFA 3T1VA 3KKPA 4UJ3A 3BXZA 1T3LA 3QENA 1ZM7A 3U2QA 3W5JA 4A36A 4XTCS 2P5SA 3GEHA 3NEJA 4PSVA 4YC7A 4EJSB 3C8UA 1CJKC 1FUKA 2P67A 3SN6A 1EFTA 1VECA 4AC9A 4DEXA 4NYJQ 4R71A 4TYWA 1Q22A 4R7ZA 5AUPB 4W5JA 4B34A 1G8FA 4A1FA 4DCNA 4PAQA 1TEXA 1Q1EA 4RD4A 2J7PD 1YZLA 2GETA 2J1LA 2IWRA 1JR6A 4JJZA 1NVVR 4QFMA 4A4DA 3ZH9B 1GSIA 3KQLA 2QMHA 1TUEA 4LYJA 1XTJA 4KFUA 4NBSA 1E9SA 2PMKA 1M74A 3T61A 2OBNA 2NZJA 4F4CA 1KI2A 3VX3A 1XFAA 3ND9A 1CJMA 3VKWA 2OBMA 1DOAA 3L0IB 3C41J 2CE2X 1HE1C 3F8TA 4KVGA 4XSHA 1WP9A 3I8SA 4B6EA 2IL1A 3W8NA 1A2BA 4FMBB 2WAXA 2ZI5A 1P60A 2ZI6A 3ND8A 4D26A 2RGDA 1C4OA 4EPWA 1P5ZB 3K09A 1JJ7A 1EGAA 3R7WA 5FOTA 4HAYA 3B6EA 2G88A 3H4MA 2YC2C 2BMDA 5SZKB 1B23P 3KJIA 2J5XA 4PC3A 5L3QA 4JJKA 3VR4A 2O5VA 1SVOA 2H7VA 1R2QA 2B8TA 3AF4A 4AKEA 1ZD8A 2E1RA 2FWRA 4IHQA 1LF0A 4E03A 2JLQA 1U81A 4EJSA 3K9HA 3B2EA 3RRYA 3U6KA 3V4RA 2PJRA 5DLQC 5DO9A 3VR3A 1DS6A 3ETLA 2JJ2A 2AHOA 2D06A 1NF3A 3VNVA 1F48A 2FPLA 2HJVA 4PQYA 4RJLA 2AWOA 1FMLA 1KMQA 5J47A 4IDPA 2XEXA 1NN3A 3W9YA 3IGFA 4P0TA 4CT5A 4MQBA 5EE9A 1L2TA 4X8HA 2JLYA 3KXIA 4LBZA 1N0UA 4IOKA 4Q47A 5JHGB 1JR3E 4DT1B 1UKYA 2GAAA 3TW8B 3S1AB 2C77A 3A58B 1OKKD 2GZDA 2W6JD 3AVPA 3HDTA 1R5NA 4TYPA 1ETUA 1X8KA 4CGZA 2JLVA 4LDJA 1IJEA 4IOLA 4M1KA 2B8WA 1UBFA 4OHVA 3N70A 1KO1A 2BVNA 1GTVA 5L3SA 3AP3A 3LAWA 1P73A 4B44A 3NDBB 1II8B 5FR2A 1I4DD 1S4QA 3REFA 3NBYC 1XZPA 4E07A 3GJ4A 4I99A 3RNLA 3K70D 4LPKA 3BB3A 2ZJYA 3SQXA 2PT7A 2LWIA 3ZZUA 2O8DB 3QXXA 1FTNA 4JSYA 4MYHA 4Q21A 4EPVA 1C1YA 1NJFA 3LV8A 3TBKA 4V0LA 2G83A 3RRZA 4DEYA 2CLCX 4EPXA 2G3YA 2VO1A 4B76A 4DCVA 4OQNA 3IKJA 4W7SA 3AVVA 4IVQA 3H1TA 1U0JA 2HT6A 1R0ZA 2OSBA 5EP2A 1JJVA 5ANRB 2G9NA 4ESVA 2VP6A 2D4HA 3DVLA 3EASA 1E9EA 1QF9A 4HYYA 5IK2D 3N2EA 1EWQA 1XMJA 4OBEA 1RJ9B 2ZE6A 3MG9A 4URZR 4WZ6A 5JECA 3Q5EA 2IUTA 2VF8A 2VPPA 3N5CA 2HF9A 5DSZA 4MGKR 1OH7A 2XOKD 3EW9A 1E6CA 1SVMA 4HB0A 3WP0A 3U3RA 5DHFA 5HTKA 1YR8A 2JLXA 3ICEA 1R6BX 5L3VA 1Q12A 2C03A 3LXXA 1AZTA 1PLJA 2VHTA 3TUJC 4Q9IA 5DIFA 4KODA 5JI2E 4O3MA 4EUNA 1L4UA 2NZ8A 1LNZA 3W3ZB 4DT1A 3F3YA 4L4UA 2D62A 3S1AA 3GFOA 4DUGD 3KX2A 3RS2A 4Q4JB 4RKEA 3GEIA 2DFTA 1OIXA 2HCBA 5FTMA 5LPNA 3AVOA 1II8A 4OJQA 2QNRA 1G1MA 2ZRMA 5G3ZA 4C4PA 3THWB 1KI3A 2P6RA 1WBDA 3FWYA 2JAQA 3QOFA 2O8DA 2ZE8A 3AGQA 4JLKA 2IYVA 4XTRA 2YVUA 1IXSB 3UATA 3UANA 2BOVA 3ASZA 1AKYA 3T35A 1ZCBA 3R8FA 3NH6A 4FCTA 2V7QA 2JLRA 1NBMD 1I4LD 1NMZA 2QGNA 4TYNA 2QPTA 2FSGA 2QL6A 3PENA 5J4YA 1A82A 1D8TA 1D9ZA 1E1QA 3LX5A 2KE5A 2XTNA 1TMKA 3TKLA 1FX0B 4NHOA 1ZM9A 3P26A 1A5TA 1RJ9A 2HV8A 2DY1A 2ZR7A 3VTKA 4DSOA 1TEVA 1LB1B 4MA4A 4LRWA 3ZS8A 4DWJA 3QJYA 3CNLA 2VP4A 2GTPA 1LV7A 2PBRA 2AKYA 3HPRA 2WSSA 3W8RA 2A78A 3IIJA 3I8XA 2BM0A 3GLHE 3IBYA 4Q9LA 3SJZA 1E0SA 3B1ZA 1OXXK 3K0CC 3I5XA 3LFUA 2GXAA 1RVDA 3ZS9A 3BFKA 3C5CA 4JL6A 4MGZR 3PXGA 1W0KD 3OIVA 4MKIA 3CNOA 4TMKA 4CW7A 4D2IA 2IYWA 4Z1MA 3V9PA 4EFLA 2XGJA 3FHOA 4Q4JA 5H8WA 3BIFA 2I1QA 3BH7A 4HSEA 3R9XA 4DDVA 3WNBA 1OXUA 3I3SR 3FMOB 4BRUA 5F2EA 4JLDA 4LV8B 2P6UA 1PUJA 1Z6YA 2XZPA 2FF7A 3L43A 4YLGA 3I5YA 1ZD1A 1Z07A 2C04A 1HQYE 3THWA 1RYFA 2FH5B 2KWIA 3L8YA 1C9KA 4A8JC 1PVOA 2NO9A 1FP6A 1XEXB 2WJJA 3LQRA 1U9IC 4LHVA 1II9A 3C7KA 2J7KA 1DAMA 2Q3FA 1E2EA 3GLFB 4KLZA 3B60A 5JWHA 1GDDA 4GSYA 1HV8A 1ZU5A 4QBIA 1SXJD 1TPZA 3HYRA 4NL4H 2RGNC 4XWAA 1ZNYA 3K70C 2BC9A 3EPHA 1FX0A 2J46A 2W00A 4WXRA 3R9WA 2AXPA 5SZIA 3RDPA 3P1JA 4TLAA 4NTZA 4OL0A 1KIMA 3Q7PA 1CS4C 1GNPA 4YONB 3A6PC 1XPUA 1KAGA 4LWZA 1E0AA 4B3DA 5JJIA 4C9BA 3E1SA 4LYAA 5F3WB 4DB2A 5AK0A 5G40A 1I4TD 1OFIA 4DB4A 1YR7A 4GDFA 5DI3B 2PT5A 3CRRA 3ZIAA 1OHHA 3ADCA 1IJFA 1NY6A 2QMEA 4Y0AA 2BBWA 3AKEA 2YC4C 1JQJC 2ZVPX 1N6HA 3EZ7A 5JWOA 4JYBA 1KI9A 5G3YA 5FOXA 2PJZA 2XX3A 3EZ2A 4AI6A 2Q9AA 1XB2A 4GOXA 3L0PA 4MRRA 5CITA 2JEOA 2A9KA 2ZYTX 4OK5A 3VR5A 5TV2A 3AF2A 1OSNA 4RFVA 4A6XA 2ZS8A 2CCGA 3O47A 1XXHA 3P20A 1S1CA 4C0JA 3EX7C 5M04A 3TMKA 1EX7A 1XTIA 2IA5A 4XVUA 2OCPA 4WVFA 4ESHA 2GXQA 4BEJA 3T5DA 4DIDA 3ICQB 1IHUA 3QPUA 1XEXA 1XTQA 4ZI2A 2OILA 1ZC4A 3CWQA 3CZQA 2N46A 4LPSA 2ZRIA 2WVJA 3GJ5A 5J4LA 2BV3A 4MYCA 2KBEA 2GF9A 1AZSC 2JJ2D 2PEYA 1E99A 2WWFA 3QPVA 4HI0E 1Z63A 3GLFA 2F9LA 3NVAA 2F9MA 4DC9A 1N2CE 2OLKA 2X77A 3PITA 2C9YA 3THOA 1XWIA 5FPTA 4PPFA 5KPDA 2VYFA 4G5QA 1UEJA 4PPQA 1XTKA 2PZGA 4EPRA 4JSTA 1ZNXA 4X8MA 2DWOA 1U8YA 1HTWA 2IUSA 4CZ2A 3Q85A 2Z0MA 3G82C 3AB3A 2FSHA 3Q7QA 2GXUA 3MWLA 1JECA 4XIGS 4EAQA 1CULC 8OHMA 1P9NA 2FA9A 4A0HA 4OQLA 3CWZA 1W2GA 5HPYB 3HJNA 1ZP6A 4A8JB 1KK1A 4C0AC 1HA3A 5DI3A 5BQ5A 3CM0A 4EFNA 5CIQA 2QENA 2WJYA 4POAA 4URWR 5CYPA 4B6FA 4BFXA 1NBME 1P9WA 2V1UA 3MGCA 3DO6A 4DSNA 1DE0A 4MH0R 5DGXA 4RZ2A 4DJTA 2P65A 2HLDA 4YXWA 3AUXA 1P7CA 2ZI4A 4YQFA 2OFXA 4TL9A 2ZUCA 2IYRA 3CH4B 2MSCB 3TSZA 4EDHA 1ZUIA 2B21A 2V3CC 2D2FA 2XAUA 2ZSAA 1FQKA 3BRWD 3DM5A 4V0ME 1Q1BA 2K5UA 1NKSA 4LJ6A 3RWOA 2RAPA 3CR7A 4UJ5A 4LCBA 4AG5A 5HR5A 3IDQA 4QRHA 1KDPA 2WAYA 2WKRA 2RHMA 3FYHA 4IRUB 3WYFA 2YWGA 4B3FX 4OQFA 4NCKA 4AKGA 2NQ2C 1UJ2A 4A0RA 4F91B 2F6RA 3W90A 4AURA 2FPKA 1DPFA 1CR1A 2ANBA 3AVQA 3R9IA 1W0JD 2ATXA 4BECA 1IXZA 4LHYA 3B1VA 4KXFB 2XB2A 4IEIA 2JGNA 4XWOA 3OHMA 5IHPA 3LDAA 3QEJA 4Q1EA 4W5HA 2CE7A 2XSZA 4JZKA 4TYQA 3I32A 5GJCA 1JI0A 5E3HA 2CLSA 4HLDA 2JIZA 2FPMA 2EVWX 1ZIOA 4S2EA 3ZD7A 1P4SA 2R62A 3CKLA 1M7GA 3SEAA 2IS2A 4KU4A 1Z8FA 2QG6A 4A8JA 2BMJA 4CYMA 3VHXA 2ODEA 4HEJA 3VAAA 1K5DA 2DWPA 1BOFA 1U9IA 5J4VA 1AM4D 1ZUHA 1FQJA 4PXAA 4TSFA 3TVDA 4KLNA 2ZRNA 5AUOB 1EFHA 5G53C 4ACBA 4DDUA 4LJ5A 4KSCA 2O8FB 1E9CA 4HUTA 2GVZC 2AFIE 1XDBA 4IXMA 4QG7A 3U60B 3GJ3A 2DFLA 4L8GA 3AP2A 1KSGA 5JWRA 3FVQA 4LV5B 5FTKA 3TRFA 1R0XA 4ZV4A 1HQCA 2V7QD 3MJRA 2XNDA 4D81A 1BS1A 3HR7A 3ZYCA 1IAQA 3DZ8A 4TMZA 1NN0A 1E1QD 3ASYA 2ASEA 2Z4RA 3T1TA 4CRWB 1JBKA 3VHLB 1G3QA 3IPYA 4QOSA 5KO2A 2XB4A 3QY0A 4DKXA 4MRPA 4NYIR 1F2TB 2SHKA 4Q03A 1OFHA 1SVWA 2BCJQ 4Q7LA 1OPXA 1LTQA 4JLNA 5TXGA 3UWOA 1E9DA 2QA5A 3THYA 1KI7A 2H1LA 2WSSD 3A1UA 2BEKA 4TMXA 4ZCLA 421PA 1G4UR 3I1FA 2OXCA 4JL5A 5FPHA 3PIRA 2NMVA 5B2ZA 5CJ2A 4TQ9A 4JL8A 3TGPA 1UKEA 4YMVA 1P2SA 1TL7C 1IN8A 4DLXA 1G5PA 3KQNA 2BM1A 5KDLA 4Q7JB 1W4CA 1ZCAA 4Q1FA 1NMYA 1K8RA 2IYXA 3B7GA 3AF1A 1JPNA 1UEIA 3IO5A 1TF5A 2CJWB 4Z1MD 3QVUA 1G3IA 2OESA 4P4SB 4D6PA 1P9RA 4ZDJA 3OIYA 4Q48A 1MO3A 3FFAA 3NXSA 4RD1A 1CJUC 4KVAA 4K46A 1KO5A 3KKQA 1CJTC 4URXR 3O8DA 3GJ8A 1RFLA 2CHVA 3FMFA 2G1JA 3VR2A 3VU9B 3CNNA 4Q1AA 2O8FA 5DHAA 3RS5A 2QUZA 1JR3D 3FPAA 2NO7A 3BB1A 1E2MA 3HYTA 4WA7A 3TQCA 4JVLA 1JEDA 5JEEA 1II0A 3C5HA 4FXPA 4Q7KA 1DVRA 3PUYA 4B3GA 2IYYA 1QDEA 2R6FA 4EQ6B 1G4AE 4HAXA 3AV0B 2WMNB 2QPOA 4JBXA 4RZUA 2IS1A 1RRFA 1WB9A 4YMTA 4XWKA 1QBKC 2YINC 5CM9C 4LJYA 3A37A 2VLIA 4G5RA 1CEEA 2ZRFA 2V6JA 4OK6A 3QXSA 4X8OA 4D0NA 2B6HA 1F2TA 3MFYA 4N0EA 3RC3A 4GPTA 4M53A 1M8PA 2ZE7A 3BWDD 1G7TA 2PZEA 5FI1B 2NPFA 1E0JA 3KL4A 5EE0A 1GRNA 1N5KA 3RABA 3JZAA 3P32A 4RD3A 1D2MA 1QHHB 1G3RA 3A8TA 3M6AA 4A82A 4JMPA 1D6JA 2A5FA 3I72A 4HAZA 1Z47A 1Z08A 2VP2A 4PX9A 3ZIAD 4P31A 1GFIA 1YR6A 5E95A 1ZNWA 4DIEA 3LD9A 3ADDA 1E2KA 4OI2A 3SFZA 2IYQA 3VX4A 1G5RA 1YZUA 1ZW6A 2NPIA 4P4SA 2XXAB 4IOMA 1T9HA 5IDVA 2DFKB 2ORVA 4IDHA 2R8RA 1XRJA 2J45A 2HXYA 3QXJA 4ILEA 4I1UA 1COWA 4BRWA 3TW4A 1KJWA 1Q20A 3VU9A 3B9QA 3KB2A 2FZLA 2J0SA 2L0XA 1ZD9A 5CJPA 4KHZA 5TDHA 4TLEA 4FI3C 3GCGA 4P4UA 3QEOA 5FPYA 2YOHA 4QGGA 1E1RD 1M1YE 2CL0X 5DYGA 1SVKA 1ZUNB 1RC8A 4AIIA 2ZITA 4FMCB 4TQAA 5E7MA 5HE8A 2WSMA 4BWYA 4EQ6A 2B7BA 5JSZB 5AJXA 1G6OA 3CPJB 1EG7A 4CIDA 2WKPA 2ZEJA 2ZRJA 2YOGA 4U02A 3CX7A 4JVNA 3ZQJA 1NVWQ 4PPNA 4V0KA 1AGPA 3JVVA 3SOPA 1CJVC 1GKYA 3WYGA 3I62A 2CLDX 1NLZA 4ITRC 4KFRA 1SHKA 2V4ZA 4IEEA 1F2UB 2Z5FA 4M22A 3QVVA 1GNQA 4AYWA 3TLXA 1EFCA 1NLFA 1W4RA 3TQFA 4Q66C 4RY2A 1OYWA 2F3RA 4US2R 1NSFA 1PLKA 3QSYA 3Q9LA 1QHHA 2VRWA 5EE3A 4O0MA 3A4MA 4O2RA 1VKJA 3TNFA 4D4LA 1UDWA 3PJRA 1HEIA 1W5TA 2W6ID 3CX8A 1XCMA 2DCUA 4M1TA 5JJLA 5JMTA 2G1KA 2RB4A 1QG4A 1Q21A 2W2TA 4M1SA 3CH5A 2QSZA 4FW9A 4BZXA 2HLDD 2VBCA 3RANA 2ONJA 1N0VC 1OH5A 1NG9A 4FINA 3C15C 3NC0C 3U6BA 2OEPA 4D4JA 3MUFA 1H8HA 1YR9A 1M34E 4TMTA 3PUXA 1BYIA 4V0OA 3EXAA 2NIPA 4JLVA 4JLOA 4B43A 2P5TB 3EWSA 3MWYW 3WMEA 1VIAA 2CMKA 3THXB 3SE0A 3EIQA 1XCGB 4GZLA 4NYJR 2LKCA 1SHZA 3QF4B 2D7CA 4M4SA 2O8EB 2AXNA 4HDQB 5HZKA 1XTSA 2PLRA 2CVHA 2F1HA 4A6PA 4B47A 2QTHA 2JCSA 2C78A 2PX0A 4QXAA 4D82A 3GLGB 5CB8A 2EQBA 1KHTA 3QXHA 1Q57A 3WNDA 4HB3A 4RZ3A 3HPQA 1TUIA 2G0NA 5JSZA 4N0DA 2V6IA 1UADA 4D0LB 2P2LA 3AVWA 4BFZA 3IBGA 3SI7A 4KITB 2GCPA 3MLEA 1S8FA 4JYCA 4Q01A 4Z8XA 3CO5A 3VR6A 3OFND 4IXNA 5DI9A 2XSZD 2Q3HA 2VIIA 4PHTA 3KJHA 4TLBA 4DSUA 3LLMA 2VTKA 1GG2A 1WRBA 3L8ZA 2QPAA 1F2UA 2JIZD 3SYKA 3TH5A 1U98A 1J8MF 1N6OA 1TU3A 1KSHA 1ZVQA 1ESNA 4K8OA 4PANA 4UNSA 1Z22A 1S3SA 4MKFA 2QRZA 1CBUA 2O52A 3M4YA 4QC2A 2BIFA 1GUAA 4WOPA 5EZ6B 3U7EB 5BN5A 3VKGA 3ADKA 3PFIA 4TSFD 1Z6XA 5DE3A 5KUTA 4AKHA 5FUXA 4TZ0A 2RKOA 3RAPR 3DOEA 3UXMA 2F7SA 2YWFA 3SR0A 4I81A 2OLJA 5FBWB 1Z5ZA 2WWYA 2O8BB 2R6GA 3FKSA 4IKEA 2QBYB 2QMUA 1P61B 4QBGB 5KSOA 1E94E 3K0EA 4GP6A 4C30A 2XJ9A 2XNDD 5C1BA 1E9AA 3KFXA 5BXQC 4RD6A 3PEWA 3SNHA 4JT4A 1R0WA 5EE1A 1KI8A 3THXA 2J9RA 2J41A 2IYSA 4MRSA 2O8EA 4L5BA 1JB1A 2UZIR 3NC1C 3GLGA 1OB2A 1YZQA 2OG2A 3EAQA 3FB4A 2QM8A 3D3QA 2AN9A 4AD8A 2PLFA 2YHSA 4U7DA 3A36A 4URYR 2IXFA 2QEQA 5JHHB 4FWTA 1E4VA 1GKIA 2YOFA 2FOLA 2Q3MA 4WZBE 2P0EA 3Q72A 4BZPA 1ZM3A 2F55A 3T15A 5BN4A 3TSOA 4G5GA 1S1MA 5B58C 1X1SA 1OV4A 1VPLA 2H92A 2CNWA 3B9PA 3CBQA 3SBEA 2ZVQX 2Q9CA 1P62B 1XXHE 3EWAA 1VTKA 4R9UC 4XD7D 2OXRA 3ZVRA 2G77B 2IXEA 4AG6A 4BE7B 2W58A 4E5UA 1Q3TA 5EJEA 4LBVA 2CHGA 1YVDA 3TAHA 4NCNA 4B32A 1H65A 4PC1A 4UNPA 3AQ4A 1A7JA 1XMVA 1CR2A 4PO8A 4P4TA 1QHXA 3GLFE 1FUUA 2O8BA 2WWHA 4M9QA 1FPMA 1DO2A 3SU8A 1S96A 1G19A 2QBYA 1BKDR 3TE6A 2CL7X 1KYIA 1SVIA 1FOEB 2ZSFA 1T5IA 5ELXA 2ZJOA 4HUQB 4LY6A 1R7RA 3LBHA 1OF1A 4MKGA 2F1RA 3CF2A 1XJCA 2C95A 4DLTA 1N25A 4WXPA 3FOZA 1N6RA 4Q9KA 1KI4A 1AJEA 2NO0A 2CEAA 2G6BA 3TUIC 4PSAA 3D8BA 4M21A 1VCNA 1ZC3A 3T5GA 2WZQA 4QHSA 821PA 2W2VA 2AL7A 3G0HA 3K9NA 1DO0A 4PPGA 3B1XA 5FI0B 2ERYA 5FOUA 1TQ2A 1DARA 3W5IA 2XNSA 2EFDB 4BLRA 2B92A 5BN3A 1G8GA 5G41A 1W48A 2ZRHA 4HZIA 1U90A 4PC2A 2JJ8A 2DWQA 4ON9A 2FDCA 2BMEA 1E2FA 5EXXA 3QBVA 5KSPA 2I3BA 5TMPA 3LNCA 4PR0A 3KJEA 2NG1A 5KNBA 5L3RA 1GP2A 5KSYA 1F6BA 2ZANA 3JZMA 4B75A 1ZINA 3EZFA 3D31A 4AKIA 4N1AA 4LYHA 4GFDA 4OI0A 3AGPA 3SZRA 3C14C 1OXVA 2I1VB 1GZSA 3AUYA 1TADA 2R44A 3DEFA 1VDZA 1UF9A 4QBHA 3RHFA 3RYTC 2BMFA 1IM2A 1ZBDA 1P72A 1KJYA 1R5OA 3CZPA 1MRSA 3LY5A 2O8CB 4TT3A 1S9DA 3A4LA 1COWD 3B1YA 3GEEA 1FZQA 3AKDA 2V9PA 2ZR9A 4BFWA 4QKQA 5FL7A 2J3EA 5IF9A 1G3MA 2UZ3A 3EZ6A 1LY1A 1U0HC 1KI6B 3KQKA 2FZ4A 2VHJA 3H86A 2ZM5A 4HUQA 1M6NA 4Q9JA 1RW4A 4UKDA 4PHGA 2IYTA 2ZJAA 4ZDWA 4RZXA 3W6OA 3CB4A 1E79A 2A30A 4M1YA 2OUKA 2OFOA 4JKYA 4EFMA 2ORIA 1EFRA 3LXRA 1W44A 5J5CA 4YMUA 4Q4AB 2Q6TA 4LC1A 1CKEA 2GEUA 2WBLC 4Q19A 2XTMA 3I61A 2NO1A 2RGGA 2XJ4A 5GJWC 4NYMQ 1IN6A 3X1YA 2QY9A 2R6CA 4N3NA 1CF4A 1RE0A 2HJGA 2ZSBA 4M9SA 3REGA 5KU1A 3QKUA 4V03A 3BD9A 2RGEA 4WBSA 4NMMA 4LJ7A 5EUMA 4FMDB 2BJVA 2ZR0A 2PCJA 4UXHA 1W49A 4PZYA 1JPJA 3ZD6A 1NNEA 4JS0A 3AVXA 1GRQA 1XEWX 2HUPA 2A5GA 2CXXA 5J4HA 5KDOA 1P2TA 2REXB 2OM2A 1EWRA 2QROA 3K1JA 1QZXA 2NO6A 4GT1A 1J7KA 2W0SA 5AWFC 4ZKDA 4DCUA 1YZTA 1KSFX 1TQDA 1H8HD 1O87A 1WMSA 1IN7A 1KMHB 1AKEA 3PEUA 3X1ZA 2TMKA 3PQCA 4I1VA 4AYTA 2QU8A 1S9HA 4TMWA 2EFEB 4TL6A 5FBQB 3NBFA 1SVSA 4S35A 5AJVB 3SC3A 4H9GA 2ZRLA 3B82A 3J81k 1J99A 5A0FA 2QT0A 2VA8A 4LI0A 1AGRA 3WMFA 4BLOA 1KI6A 1OH6A 3ONWA 1X6VA 3DL0A 3T12A 1NIJA 2ZAOA 1U2RA 4HDOB 4D4MA 1E69A 1N6PA 1S0UA 4F38A 2D7DA 1NP6A 2NOAA 3WHKA 5D3MB 3VNUA 2IWHA 5CM8B 5DN6A 1MABB 2AFHE 1DELA 4ZKEA 4DHEA 1ZAKA 4M0LA 2D74A 5DNYB 5BYJA 3WY9A 1P6XA 1Y63A 4Q4AA 5JEDA 3X1WA 2RCNA 1UDXA 1B0UA 1OH8A 2BBSA 1J90A 2WJIA 3CIOA 4LV6A 1E9BA 3BS4A 2HF8A 1VCMA 2OHFA 3K0SA 5JJKA 3U44B 3JVUA 3GQBA 2DR3A 4I1OA 5EZ5A 4B2PA 2GK7A 1YZGA 4BASA 4DSTA 2VHCA 3CF6R 1QHIA 2JASA 2EYUA 4LUCA 5FL3A 1KJZA 3L0OA 1HH4A 1KY2A 2F1IA 3K9GA 5FBVB 3U3KA 2C9OA 1JXOA 2FJUA 4ZO4A 3L2OB 3DKVA 2C9CA 3WRXC 4D0GA 2YKGA 2N42A 2UVQA 2FSIA 2X19A 2HDNB 2QTVB 3HWSA 2RGCA 3AVTA 3FKSD 2FFAA 1G291 2ZS7A 5CK5A 2ZYWX 4MYUA 3L0SA 3DHWC 4WAUA 3RS0A 1ZRHA 3AVYA 4K81B 5FOWA 4XVQA 5BYKA 4C2UA 3RVBA 3AKYA 4MGIR 1KMHA 1VCIA 2AWNA 4JLAA 4KV9A 3B5JA 5LBIA 1G7RA 1SZPA 1GIAA 2VSFA 4Q18A 1K5GA 2RH5A 2QQ0A 1E2IA 4LZZA 5FTLA 1QG2A 1KZGB 4BFVA 3IIMA 1XP8A 4ASUA 4OQMA 5D3MA 2ZJZA 3NG1A 3B8HA 5EP4A 3WNCA 5GJBA 1G16A 1MABA 3NHAA 1E32A 3ZZ0A 5JRZA 221PA 4MRVA 5C18A 2Y8EA 4XVRA 4DDWA 2ZI7A 5DH9A 3I92A 5H68A 2H5EA 2CNWD 1GRRA 5JRJA 3U44A 3U7HB 3E5HA 2VEDA 2EYQA 4DBLC 5EXPA 1JEEA 2ZIAA 3SJCA 2JLUA 1GL9B 3E2IA 3CF0A 3RS3A 2WKQA 4Q7MB 1TX4B 1XD2B 2PZFA 5JBQA 1G41A 4TTQA 3A1VA 3CR8A 3QPWA 1KGDA 4LHXA 4B3XA 3KJGA 3Q3JB 3W3AA 2J59A 5SZHB 4EPYA 5IT5A 1FFHA 2OV2A 1BO6A 4OYHA 1OYYA 4DLWA 3R20A 3A1WA 2REBA 2GJSA 2F3TA 2Q21A 1HT2E 4BFTA 2IUUA 2GJAA 3ZLJA 4AK9A 4C0HA 1WF3A 3VR1A 4Q4HB 5E7JA 3EARA 2PCLA 3U3JA 3AP1A 4RD0A 3OIUA 2XITA 4YDHB 2IX3A 3NIBA 1GM5A 1NVXQ 2YZ2A 2QP9X 3CLVA 5FPKA 1F60A 2GZAA 3DZDA 2JLZA 5J40A 3KTAB 1AQYA 2ECKA 2QMOA 3GJ7A 3K9LA 1G8PA 5E4FA 1R4AA 1YU9A 5KNCA 1E2QA 4LGMA 2H18A 3BB4A 2FFHA 3LWNA 1OKKA 1U8AA 1N5IA 3OE7A 1TNDA 2JDIA 3CX6A 3IPXA 5B64A 2F43B 4C2TA 1US8B 3BE4A 4KCGA 1MO4A 1SKYB 4PO1A 4C0SA 4G0NA 2OCBA 3LRPA 3U4QB 1PLLA 3OAAA 3B13B 3LVRE 4IDNA 5BW8A 1K6MA 2WWXA 4B73A 3RSOA 1W1WA 1WXQA 3IEVA 4MUAA 3PG5A 4A92A 1LW7A 4M1OA 4F4JA 3B85A 1JNYA 2VSXA 4C3ZA 3WBJA 4TL8A 1RPZA 4CEIB 2XZLA 3PUVA 1KO4A 3F5FA 1CP2A 4US0R 1N5JA 2DYKA 1TAGA 2FGKA 3U5ZB 5LB2A 3O8RA 4QNRA 2PEZA 1TQ6A 1EK0A 4IW3B 3A4NA 4M8NE 1U8ZA 4R98A 3ZVLA 1G8HA 2ZUBA 4TT3D 5FUWA 1NSTA 2C8VA 3V00A 3QKTA 5FL7D 3FKQA 4GZMA 2QT1A 1G6HA 1WA5A 1AS2A 1R5BA 4Q4HA 4BUJA 2VSOA 5HKKA 1TU4A 1Z6AA 1A2KC 3FHTA 1S3GA 3WHLA 4Q1BA 4NONA 4G3XA 4OJKA 4Z54A 2ZRCA 1GAJA 1LF5A 2VHQA 4NZYA 2EU8A 4US1R 2KSQA 1E79D 3HU3A 3IQXA 4BFSA 3UMFA 1Z3IX 3K0AB 4JLPA 1E0KA 2ZJBA 2OAQ1 2QSYA 4JBYA 2IS4A 5CIWA 1QHGA 4GOKA 1NKTA 4Y0VA 6Q21A 1AK2A 3HU1A 4QJ5A 1Z6GA 1OXSC 3KKMA 2IHBA 3ZDQA 2J0UB 5C4GB 1M2OB 2FG5A 2F43A 3IHLA 4LJ4A 2CBZA 2IXGA 2VH5R 5GADl 1XNJA 1Z0FA 4FIDA 1DTSA 2C98A 3U4QA 2ODBA 1DEKA 5AJYA 5LB4A 3SQWA 4V0NA 2GHIA 2EWVA 3UMRA 4ZDIA 3AKCA 1CXZA 1GITA 2Z4SA 1N5LA 3I4LA 3LVQE 4BLTA 4A2QA 1KDRA 1PUIA 3H84A 4BLSA 1JAHA 2QTFA 2WM9B 3NKVA 4PSKA 4CF7A 4CEIA 1OHHD 3B78A 1P3JA 4PTLA 1E2DA 5JFGA 4Q00A 1OFTA 3GLGE 5JS7A 1KKLA 1BMFA 4IDOA 2OCAA 2RMKA 1UBGA 2CJWA 2ZS9A 2Z83A 4CEHB 1SXJB 3GLIB 3KZ1E 2QE7A 1XMSA 5JS8A 5FOVA 2ZE5A 1R0YA 3TSWA 4DLVA 2ZSDA 1WE2A 2EFCB 1VYTA 2IS6A 3PR1A 1HY3A 1R8QA 4A9AA 1W7AA 1T0HB 4BLQA 2GAOA 2VQSA 3HR8A 4MITA 3SFVA 1MKYA 4L9SA 4H1UA 5DN6D 3QNUA 4QJ4A 4FN5A 4LHWA 1OLOA 2R6DA 2QQEA 3SYNA 1OJLA 1HE8B 2PMDA 2JLSA 1U99A 3K0AA 4LHZA 4U00A 2FSFA 4PAOA 1DAKA 4PO9A 2ZREA 1Z06A 4DLZA 1LFDB 3DM9B 1FTSA 1KKMA 3K53A 1IBRA 3QBTA 3R8CA 2YNMA 4C0LA 1XCPA 4FMCF 3OF5A 2P3SA 3MSXA 1NVVQ 4Z51A 5A4JA 1A4RA 1E96A 2J0UA 4Q1DA 4C0QC 3ADBA 1NL3A 2EWWA 4R2IA 4MGYR 1EESA 4IFBA 2WJGA 1XJ0A 2JJ1A 1Z2AA 2FMXA 2ZYUX 3GPLA 5FOSA 3W6PA 4URUR 1KK0A 1D5CA 1UPTA 3EIHA 4DDTA 3DKPA 3RRMA 2CCKA 2EFGA 1DG1G 2CK3A 4A15A 1QVRA 1UKZA 1IY2A 3FMIA 4JT2A 4IOJA 2ZETA 2IF0A 2GWHA 1DAFA 3IILA 2JA1A 3MJHA 4U5XA 3TVTA 3UWKA 3EIEA 3CW2A 2ZRAA 1RRPA 2WOJA 3UMSA 5CYOA 1E4YA 4CEHA 4MYTA 4TTPA 4YXWD 1SXJA 3GLIA 3L82B 3FE2A 2R6AA 4JVMA 2XXAA 1QRAA 5AR1A 1V43A 1S2MA 4LBWA 4DZZA 5JZVA 5DYIA 5AJZA 1KNXA 5IRCD 2A5DA 4M1WA 4GNKA 4YDSA 3V4FA 4GL2A 4ASUD 4RD2A 3SJAA 1LS1A 2BJWA 2JLWA 2LKDA 4OI4A 5D3QA 1G64A 1W36B 4LK2A 4TLCA 4M2LA 5TB5A 1KK2A 4B3CA 3MRSA 3KKNA 2FFBA 2X8AA 5KNDA 3SHFA 2HYIC 1BH2A 5L3SB 2OZEA 3C16C 4LC0A 5JI3E 5H70A 3LA6A 2X1VA 5GJVC 1VMAA 1OFUX 4QL3A 1YZKA 3EC1A 4TTRA 1E2LA 4LOAA 4JVSB 2ZQ5A 3NBZC 5EP1A 3SBDA 5CDFA 2IW3A 3VQTA 4KFTA 2HXSA 3CRW1 5FTJA 1YE8A 1XF9A 2MMGA 4P3YA 1TF7A 2IT1A 3T1OA 5AUNB 1J2JA 4BLPA 1CTQA 2FN4A 1GL6A 3CPEA 1VHLA 1XEWY 1V5WA 1W4AA 1WQ1R 2YJTD 1Q1ZA 3QQ5A 3QXCA 1N6IA 4CT4B 1G7CA 1PV4A 4NE2A 4F4IA 4NCIA 4FCWA 4B71A 4OHWA 1W2HA 3VKHA 2GBLC 3EZ9A 4II7A 3DMNA 4HAUA 1XZQA 3SDZA 3PCRB 4WIAA 3WXMA 3OEEA 1IN5A 1DG3A 1U0LA 4DCTA 1Z6TA 4ZCMA 4D4KA 4MDEA 4E22A 3GP8A 3D7MA 5J4KA 1ONBA 1G21E 3GFPA 3RRNA 1YJ5A 1WBBA 1FL9A 4OHYA 5P21A 1XPRA 3TR0A 3ZVMA 3QF4A 3AVUA 1RIFA 3CONA 3OE7D 5EXTA 2JDID 4Q5IA 3TAUA 1E3MA 1YQTA 2ODNA 4F92B 2GCNA 2CCJA 1YZNA 1FP7A 3OAAD 4HAWA 4HZUB 4CDGA 1H8EA 1KO8A 2V55B 1TTTA 3PEVA 4KSBA 4LBYA 1BYUA 2MMCA 5KTYA 1G18A 1QHSA 4FD2A 4RCYA 4B3BA 4ZPXA 4G5OA 1JXMA 1Z0KA 2DB3A 1F5NA 4IJMA 1NI3A 1MOZA 4PHHA 1PZNA 2ZRKA 3TUZC 4HAVA 2E87A 4A0GA 2V8OA 4P33A 1G8YA 3LH5A 1R10A 4GBMA 4GMDA 4RKFA 5FBLB 5TY0A 2MSEB 4JBWA 3KXLA 4DXAA 3FTQA 1VG0B 4TQUS 2JATA 3CRVA
chains in the Genus database with same CATH superfamily
2B4AA 4J91A 2CDNA 4NFSA 1OA1A 3I2FA 4TLDA 2WVGA 2ZWMA 2Y76A 3M81A 3L1KA 3C6YA 2DSNA 4HRAA 2GEDA 3CJTA 5FUYA 3KQUA 1QHYA 4ND8A 1EP1B 2I99A 3LUGA 5C34B 3RHTA 5FULA 4F12A 4F3RA 4B48A 3N2IA 3QG5A 5HKKD 2PO5A 4JOSA 4FNOA 4UHJA 1D2EA 1C8KA 3EIFA 1W0JA 3FCXA 3KDSE 5JAIA 4PAMA 5K8IA 4RTPA 1QKIA 4GECA 1JLLB 1W88B 2BKEA 2QRJA 3DB1A 3DEHA 3OEHA 1DUVG 4UCFA 3VYVA 1CERA 2CFOA 5ADUS 2IY9A 1YKFA 5LKAA 1T5TA 3RQSA 3RG8A 3A28A 4H1VA 1WCV1 2OAGA 5JS1A 4ZT5A 3HVRA 4QAJA 4UXJA 1IG0A 3MB5A 1NASA 2GCIA 4K28A 5K3SA 3LLUA 2EF0A 1RPAA 2C5LA 3KQTA 3OWHA 4HGYA 2HV9A 5LQNA 1JDPA 4IG9A 5LZ5A 2V45A 4IJWA 1P31A 3RODA 3A6EA 2J9YB 1VYUA 4INJA 3DZHA 2HU5A 1D0VA 3L1JA 3FD8A 1T8SA 2A9RA 3G9UA 3TJZA 5DTJA 4J0DA 1YHNA 3D7SA 3VKUA 1BQEA 3WK7A 2A0WA 3ZZTA 2D13A 4PQGA 3PD0A 4DKJA 5MN5A 3DR3A 3L41A 4EI2A 1R0LA 3VNAA 2UU9B 1DRUA 1SQ5A 5HF8A 5HZHA 2E48A 3GD7A 3ZWKA 4V24A 3V2UA 4DZRA 1I7SB 1R4ZA 1QC5A 1X7WA 2IEYA 4C29A 2VH1A 2UYGA 4XM0A 3CINA 5CFZA 4F7WA 2OKGA 3Q6MA 1XMQB 3L1UA 1Z83A 2PL3A 2FUNB 2WDPA 2Q5JA 3E9NA 1CRZA 1E98A 3FGNA 3PNKA 4ZGGA 4PS0A 4BEWA 2GJ9A 3ZI0A 4KYUA 1IOZA 2WUFA 4GX5A 1DKLA 3OZ7A 1GFWA 3IXLA 4RA6B 2PVSA 3I9KA 2PNJA 3RIMA 2H2HA 3WX0A 2X1MA 4E15A 2XCTB 2ZI9A 2HWYA 2ZJ5A 3N6XA 5DISB 1B1AA 1USVA 1K88A 1Z2CA 4L8WB 2G1UA 3RWBA 4ZI3A 2X2EA 1LJLA 1ABEA 4HNSA 4XQEA 2PS1A 2ACVA 2QLFA 3LU1A 3OMLA 3PXXA 4ZQIA 4RSMA 4C06A 2GILA 3G2MA 4WMLA 4EI7A 2CHFA 3QOWA 1HDCA 3S40A 3O1IC 2GNOA 1DAOA 2Q5CA 1U2DA 2JCYA 2OBLA 4GKBA 4HQOA 4K6KA 4OL9A 5EYPA 3UAYA 5DW0A 2NP6A 1FRNA 1BH6A 1V39A 2RG7A 2ZYSA 2PZ8A 3AJAA 4M9UA 4KIGA 3HHEA 4ZQEA 2Y6VA 3T7AA 3SVTA 4Q4CA 3HV2A 2YNMD 5TT1A 1N7JA 8GPBA 3LY7A 4L78A 2A92A 4JKIA 2BCGY 2BEVA 2P35A 2HDWA 3DCYA 1SQGA 1WPXA 3CSSA 5AKJA 1N3BA 3IUJA 3PVSA 4PFSA 4YJGB 5EI5A 1DV2A 1H2RS 1DCMA 3IAEA 1KAOA 2I71A 2H54A 4L5JA 4RWZA 2FJPA 3HJCA 1TC1A 2WTAA 1NR5A 5LJLA 5F7JA 3O26A 3OFSA 4HDMB 4RTNA 1QZZA 1EUDB 1T8UA 2CF6A 2HF2A 2JJ1D 3DDUA 4URVR 2JVJA 4NBWA 2X0RA 1DT5A 4QXQA 2D1TA 3TKYA 3BFXA 2YY7A 2E37A 2V97A 4D9HA 4BFUA 3MXOA 1OB5A 3FMPB 4GYKA 1JR3A 4IH4A 3DDSA 1ODCA 2NZUG 2J32A 4EJ0A 5KX5A 2VATA 5IJ0B 2EBHX 1W4BA 5JADA 4I50B 1GPBA 1XRMA 4JB3A 4L95C 4WZZA 3QUSA 1I33A 4ZIRB 5JS6A 1IUNA 2WWGA 4UMFA 2O8VA 2VNHA 4KI0A 3M6VA 3PFGA 4NAHA 4WJLA 4IEFB 3I0MA 3HVHA 3QU7A 4Y2HA 4YACA 1G4HA 3FDZB 4WDRA 1FRVA 4CV0A 2Q3BA 2DGDA 2I7TA 2IYUA 3UK6A 1PKEA 2GCEA 2QAGC 3BJZA 1XKLA 2IYZA 3B89A 4RFSA 3DEKA 4XKJA 4R54A 5FTWA 1E1YA 1GXSB 3BFJA 3RJ9A 1HYQA 4UEWA 1R8SA 2JZNA 2QPLA 3WYDA 4GL4A 4ZYUA 3H18A 4ZAZA 3PDJA 3Q5DA 1OUMA 4ZDKA 4JBNA 1UPXA 1CU1A 2O2ZA 4BVAA 3WKBA 5CT9A 5CDTA 4HVCA 1MZPA 4NYMR 1E5DA 1P1FA 3FDIA 3B5IA 1DAGA 4CI0B 4FJ2A 1KYYA 4NICA 5ABPA 1HZJA 5AVXA 1RLOA 1AS3A 1AKUA 2AYYA 4TKVA 2D2EA 2EL9A 1C7EA 5F64A 4HDSA 3OTGA 3NETA 3HP1A 3X44A 2R1VA 5MF6A 2IZ0A 4AZ3B 1GPAA 1Y6QA 3FNGA 4LWPA 4AB1A 1VHQA 2HJ9A 3H2KA 2QDXA 3OT1B 3P4XA 4MVJF 1JQDA 1DKPA 4EI8A 4QM6A 1I1NA 2XCSB 1XG5A 4ZPJA 3ILHA 2QZPA 3T5AA 4RZSA 5DDIP 5EKSA 3DQZA 1NQAO 1G17A 2AW5A 3BJIC 2GXSA 3EGCA 3JQ8B 3Q9SA 4L28A 3ZGZA 1AS0A 3D6NB 5E3JA 4ZAGA 1M0TA 4CEJB 2ZPTX 3WB2A 2C4WA 2CFCA 4HS4A 2MYNA 3EGIA 4HFMA 4YUAA 1JHAA 1IXRC 4BMPB 4N48A 1IJKA 3LKDA 5CNKA 1M67A 3ITNA 1D09A 3OIFA 1VG8A 3GJ0A 5E8RA 3HEMA 2Q4OA 4ZCPA 4BZQA 1JSZA 2WJHA 2RJOA 4QM7A 4QDKA 1MAVA 2AHRA 4DLNA 4JQCA 1BE8A 1BXZA 1D6MA 1EIWA 1FA9A 5A3JA 4R8SA 1L5WA 3P2KA 1XPOA 1QFXA 3OEED 4B17A 3HDVA 4UFPA 1E3JA 4TN1A 1V45E 2ZJFA 4H60A 4YAUA 4UVEA 1PJ2A 3UT0A 3RADC 2A58A 4L4XA 1YTLA 2P1RA 1SKYE 2RGBA 2WMDA 4MOWA 4LJ8A 2RK3A 3NTXA 3S44A 1YRLA 3I58A 4NZPA 5FB3A 3V97A 1KJNA 2DTXA 4U2CA 2NUTA 1W36D 3VM6A 2CFIA 1DKUA 3TTTA 1ZA2A 2XKJE 4KMSA 5JD6A 3OUUA 1IONA 2XMBA 3IUYA 1KE2A 5A9SB 3ENKA 5EIAA 1XN1A 2WHXA 3EGOA 10MHA 1NA5A 2NYAA 4MKHA 1EE1A 3U3MA 1H8ED 1YE3A 2W43A 3U9TA 1QP7A 3OZVA 3TG8A 2FE4A 3Q40A 2YIJA 2FMKA 5KYGA 1GV0A 3O0DA 4E2YA 3W3AH 1K92A 2E1PA 4EG6A 3VDRA 1OLUB 4L76A 1FMJA 4E2XA 2J6IA 3EIXA 4UHCA 3K70B 4CCYB 4FE3A 4AG3A 1E1CA 3KE8A 4MB2A 3ZEAA 1GVNB 3DKRA 5CAEB 5AXCA 4MR9B 5A6VA 3ANNA 1SBHA 3EZYA 5LUBA 4C1BA 4EX7A 2PMBA 2VQ3A 1CQPA 3I52A 3LUFA 4JC8A 3GFGA 4XWWA 4ARCA 5CCEA 2AE1A 3GCZA 3F5DA 3QU2A 4J0IA 5GIPE 4J9UE 3VU0A 2FRDA 1M66A 4DLSA 1MB9A 4PG6A 4DXDA 2OGUA 3CFYA 4F9EA 3RFCA 1JQAA 1XHLA 1GEGA 2V7GA 2V7XA 4BU1A 4QA9A 4LDNA 4XJXA 1EK2A 1Q0PA 1I51A 4Q9HA 1TTPB 4JIMA 2W4MA 2E6UX 2H0AA 4UBJA 1WZCA 3K0FB 5C2JB 3UCFA 2WAMA 1C30A 3L46A 4GLFA 2JEYA 4IIXA 3EVTA 5F51A 2OB1A 1YF3A 3MVEA 3NH9A 4H3VA 2X2FA 3ZGXA 1AK1A 2W2OA 2YXLA 5A5GA 3DLIA 2X22A 4FD3A 3IP7A 4NOKA 3RUIA 2VP5A 4EB6B 3F7NA 1J8YF 5FR1A 1KOGA 2ADMA 2W71A 4U8GA 3FPCA 1AY0A 4QHYA 1KTVA 3LOQA 4QYXA 4NYIQ 5E7QA 2DUJA 2QU7A 1Z0IA 5C35A 2HJHA 1NY5A 2ZJ3A 3I6IA 4GOOD 3R7LA 2OSVA 3RIEA 5KVAA 1Z29A 3RTGA 5CK4A 1B15A 5DHQA 2IEBA 1VXRA 1NJGA 1KYTA 1ZKMA 1PKXA 4NEHB 1T4GA 1N2CB 4MYDA 2CHUA 9LDBA 2PSSA 2JLCA 1ZYUA 1FTWA 3LWDA 3C3XA 3GJZA 1E8MA 3D2CA 4R1LA 3JAMA 4L5AA 1NMEA 4KDFA 1Y3DE 4QTTB 1JKJA 2VDMB 2P4UA 3DT9A 3OC0A 3PNYA 1G2OA 4YRJA 4HZGA 1A95A 1JIQA 1SXJE 2ECQA 1A8IA 1DAIA 3HKBB 5I4IA 5BRJA 3ZHRA 2XTZA 2IOFA 1HLFA 3I8OA 4ARZA 4DWWA 2UZAA 5TARA 1PQ4A 4DV4B 2GI4A 1ABBA 2G04A 1SEPA 4D80A 3QH4A 2X9VA 3AR6A 2D1QA 3A6GA 4NKRA 4OQPA 5BP7A 2C88A 4IIJA 3D8HA 1NDQA 4KJZA 4I46A 3SZMA 2K7FA 4JV5B 3U61B 1QU3A 2AK3A 4MPPA 2NTEA 5CDHA 2CKMA 2YASA 3AM1A 1I1OA 1QS0A 4G5SA 1V8PA 3NHWA 3MRXA 4WASA 3ZJYA 1KARA 2O0HA 5AI0A 3G5AA 5T6MA 1M6WA 3K09C 1Y89A 1ECBA 2JI9A 2UKDA 1NPTO 4PYKA 3MB8A 4UQOA 4F3KA 1W96A 1XBTA 5IM4A 3KUCA 2BYTA 1M6VB 2ZUEA 2B35A 2ECPA 3RARA 2MT9A 3IJ5A 4FOLA 4TXJA 1SBIA 5EQTA 2VT3A 1X38A 1R6UA 5HBRA 1RRCA 5FLKA 4KYTA 1X86B 1EJ2A 3FNFA 5JSKA 2BUAA 3PEYA 3PRJA 4BO8A 3M2PA 2XT9A 5DP2A 4J0JA 3E0QA 2WZCA 1RYMA 2E4VA 3T1QA 2VS1A 2I4IA 4XFJA 3U3XA 5K0NA 4C21A 4V1CA 1OYOA 2EFYA 5FHQA 4XD7A 1YIOA 4S0ZA 2FEMA 1EFRD 2N75A 3G9ZA 1UXGA 4M0MA 2ORYA 1UZNA 1XU4A 2PFGA 1M5RA 1UMBA 2BEJA 4OY3A 3KETA 1Z68A 1I2BA 1LWOA 1Z0DA 3ME5A 1X1EA 3QE0A 5TE9A 3NI2A 3RB8A 4D9MA 5JLJA 1BHJA 4OXQA 5BWMA 2XODA 2G07A 1UKVY 3T7DA 4CMJA 4TXHA 3PNOA 1VLHA 2CHQA 4YX9A 1TJ5A 2C4HA 5HMLA 5BVHA 3TDNA 2CL6X 1GILA 1RYEA 3ICVA 3HZRA 4H7KA 1SC4A 4H77A 4RU1A 1JFVA 4KSYA 3UM9A 3X2SA 1CCWA 3IDSA 4OSPA 1KZHA 3NHYA 1M7BA 4P4GA 3B1WA 1FW8A 4NU0A 2FV8A 4QVGA 3U40A 3RVLA 3GGPA 3TXYA 1YRAA 4D25A 1PJZA 3NX4A 3V1TC 4DQ0A 5E0KB 3NTUA 5AK5A 2VYND 5KTRA 1YDFA 2JAOA 3PQ4A 3B12A 1E62A 1PD1A 2A2ZA 2Q4EA 3JAKA 3RVJA 2AOUB 3VU8A 4XD2A 3UPUA 1Z73A 2DQYA 3WBBA 3SZUA 1NBMA 1A1VA 1KAEA 4UBMA 4YNBA 1I6LA 4XFKA 4Z4CA 4O3FA 5JFTA 1E2PA 4RHTA 3UO8B 4FGKA 4I1SA 2Y1DA 5B1DA 2XUDA 4JA2A 5K3OA 4B5LA 2IXBA 1B6GA 1Z5VA 4G1EB 4HATA 3USZA 4LDQA 1J24A 1OZAA 7REQA 1GGEA 1U0RA 4MRMB 4DNPA 1A9PA 3EXIB 4FYXA 1C3XA 4OK3A 3PGMA 2RH8A 3BOSA 2ZW9A 4WFKA 2AS0A 3DZBA 4WCFB 3RU3A 1DJOA 3WWOA 4PX5A 4KX5A 2Q5IA 5CTJA 2IVZA 4YCBA 3QG1A 5D1NA 3QOXA 5JNUA 2ZUFA 4J6EA 3BGWA 2WYOA 3KU1A 4TUYB 3WGNA 1N1DA 5EXSA 2BHRA 4ZZ0A 1VPWA 1J1IA 4G2NA 1AK9A 4RC9A 2ATVA 3TOZA 2A1UB 2C2MA 1JBQA 3U0VA 2VAXA 3GIDA 1BDIA 2ZUWA 3A10A 1SBCA 5B1EA 1R3DA 4JHLA 1H4QA 3UH1A 2Q8PA 2XDYA 1AQUA 4YMSA 5F4BA 2PVPA 4OHXA 4D6YA 4L16A 4MR8B 3RU2A 2VP0A 2C59A 2ODWA 2WIFA 3P96A 4JJGA 8ATCA 5C5EA 4N5HX 2D1YA 3FCYA 4A23A 3LCUA 4H7HA 3OSUA 1KOFA 3T3HA 4L9WA 2Q0SA 1RACA 2BFOA 4O4HF 3R8XA 1IBKB 1C8LA 3T0GA 5A71A 4MRNA 4DGSA 4D9FA 3DOUA 4YT8A 1E1NA 5AHXA 1CIPA 2Z08A 4LWQA 1CR0A 4DIKA 3TIVA 1GJRA 1Z0AA 3GUCA 3QIAA 5J9FA 4DE5A 4NHEA 3T1VA 1WEKA 3KKPA 5GOZA 3BXZA 1A9SA 1T3LA 2JI6A 3KWFA 4MHSA 4OHBA 2ISSD 3IP9A 3U2QA 1J0CA 1UFVA 4EVRA 2P5SA 5DX0A 4RYDA 3NEJA 4PSVA 4RE6A 4RESA 4YC7A 3C8UA 1FUKA 2V4UA 3SN6A 4XSVA 1OBCA 1VECA 3RREA 3C7DB 5KNDH 1MGOA 1U4SA 3ZC3A 4R71A 5EWLA 4O5AA 4AQYB 4PIMA 2DLCX 2OL4A 3MGKA 1V48A 3OPYA 1VIVA 1G8FA 3ZGLA 4J3FA 1XZNA 2IW1A 4Y0NA 1OBOA 4I55B 1T9GR 4D44A 2J7PD 3DWFA 2FQ1A 3GEGA 4N6OA 1YZLA 3AI2A 3BUSA 3AZQA 2SBTA 4MP6A 4DG9A 1NONA 3DVAA 3WIDA 4L7QA 3U62A 3O90A 2GM4A 1FJGB 2VNJA 5G2OA 4RTJA 2OUIA 2D2VA 2I7DA 4PFKA 5BN5B 2YV2A 4K26A 1PGQA 4XQCA 1YIAA 4IIBA 3T61A 4EDFA 4RMNA 5CLJA 3WGIA 5AT1A 1JMKC 1Y6ZA 5EIWA 1AGNA 1RM5A 5DASA 3VHQA 1KFKB 3LQYA 3L7MA 2X0EA 4EJFA 3VKWA 2F48A 7YASA 1ZD2P 3AEQB 1QWSA 2PZAA 4E51A 2CE2X 2E6KA 1NURA 3OD5A 4JWTA 4E0BA 2IL1A 1ND6A 1A2BA 3W8NA 2C82A 2V03A 3DBHA 1YZFA 3O95A 5AK4A 2OWEA 3ND8A 4MQMA 4GKAA 1UEXC 1A2QA 3QUTA 5GM2A 2I3GA 3CCBA 5FOTA 2HQRA 2G88A 2Q2VA 2QZZA 1CS0A 3H4MA 4K9DA 5EIOA 5A3VA 3HCEA 2GH1A 1B23P 2J5XA 3BJMA 4PC3A 5DULA 5L3QA 3W3AD 3AERB 3EXHA 3KIPA 1SVOA 4CTOA 4IO0A 1U2SA 3G0DA 3DWEX 2PANA 1YJ8A 2E1RA 5LZ2A 4HDNB 5CPBA 1LQ2A 2HMWA 4V0QA 1PVDA 2VVTA 4YJHB 1PR2A 2JLQA 3R9KA 1U81A 2PS0A 4L8FA 1MG5A 3FSJX 3K9HA 4Q3OA 3SYTA 2DC1A 4W6ZA 3VR3A 1DS6A 2CVZA 4OXNA 4C4YA 1BQ4A 4PYQA 5ICSA 1T9AA 2D06A 4BV8A 4RJLA 4UVIA 2H3EA 4HWOA 3VGPA 5AI4A 3WRYA 4HFRA 1N33B 1FMLA 4J4BA 1O89A 3HMQA 1XRSB 2XEXA 1NN3A 4FYVA 3WO0A 3IGFA 4MQBA 2Z58A 1L2TA 4HADA 4DREA 5BWNA 5JC1A 2HB6A 1H2XA 2JAXA 4PX3A 1RAFA 4MXDA 4C2BA 4LBZA 4IOKA 2JLYA 5DWDA 1WY5A 1E8DA 4C3VA 3WNZA 1RXWA 4ZGWA 3VSCA 2ZIUB 1KEKA 4NXMB 4MWZA 4GX1A 4QYSA 2C77A 3S1AB 4YPOA 1OKKD 2W6JD 1VSBA 1V11B 4LDJA 4IOLA 2B8WA 1E66A 3BT7A 1RU3A 4LRUA 1AQJA 1BX3A 4RVSA 3RRBA 1T6XA 4AN4A 4N7MA 2AC2A 1RS0A 2A3NA 4UFOA 5DHRA 4EKEA 5FR2A 1QYXA 2AZDA 3REFA 2Y1OA 2A9VA 3K70D 5DN9A 3K92A 1P7VA 1A5BB 2PT7A 1ZLYA 2X5OA 2J6HA 3UFXA 2O8DB 3NTLA 3V8QA 1L4NA 4EFMA 3TI9A 5KQPA 4ID3A 1S3IA 2PQ0A 5JV5A 2EAUA 4P3OA 4BLWA 1Q0TA 2H4JA 1RAAA 4V0LA 3V9AA 1MT3A 1S8AA 2OGSA 5HIIA 4EATA 3IOYA 2PV0A 1L3BA 3RRZA 3PC8C 4NVRA 4F1WA 2DSTA 1X7GA 4B76A 4WACA 1OY1A 1QTQA 4GMKA 4W7SA 1WXGA 1K8YB 1QVWA 3N5KA 3FA2A 4JHXA 4EKIA 2N9UA 2OSBA 3F5SA 4QODA 5CW2A 2OTCA 4X1KA 1V5EA 2G9NA 3DVLA 3OZCA 4HYYA 2JD2A 1XNHA 3U4GA 4FU0A 2B1RA 1RJ9B 4PF1A 3VVCA 4YO7A 4ENRA 2F67A 3N5CA 1A7UA 2IH5A 5H3HA 4HB0A 3PHBE 3SHWA 2ZSHA 2OVFA 3ABRB 5HTKA 5IJXA 3JYHA 3TTXA 1O6GA 3MHPA 3TFQA 4M0CA 3HRKA 3O1LA 4ZGBA 1L7AA 3V1UA 2QRHA 3KALA 1XRQA 3AI1A 3D8NA 1G9TA 3I6ZA 3K5IA 5BSTA 3T9AA 2Q8QA 1DMSA 1U9CA 5G02A 3A70A 2G36A 3A04A 3A2NA 1DRJA 1P6UA 3C3YA 3IAXA 4PLCA 2IEGA 2P5YA 4K6HA 2ZPAA 5LIPA 4JROA 2AF3C 2BCEA 3F3YA 1BN6A 4CR6A 4OH7A 4OXYA 2ZTHA 2Q62A 3UWPA 4BQOA 3HS3A 3KX2A 1UCFA 4XOUA 4M0FA 3KJQA 1TA4A 4LAFA 2I4RA 2HCBA 2O0MA 5KYWB 5K9ZA 4TN5A 1LI4A 4RM3A 4IJQA 3U4DA 1JU4A 1UQUA 4OJQA 5H16A 2C9BA 5A3SA 1N5MA 1QH8B 2XNHA 1B16A 1PYDA 4O33A 1BMDA 5F77A 3THWB 1XQWA 5GQSA 3BXHA 3UJCA 3LM8A 3LX6A 4M99A 4QEKA 1FUIA 2JAQA 1ARZA 4WESB 4FDUA 3AGQA 3E03A 4XTRA 2YVUA 1OGYA 4B7UA 1PL0A 2BOVA 3ASZA 5ICFA 3DCIA 1M0EA 2ZSIA 1A4XA 1YVEI 2VQEB 3GP3A 1ZCBA 3AHGA 3WGQA 3ZZMA 4I3HA 2CZGA 3CSDA 5A4IS 2V7QA 1BFDA 4LZJA 4H0FA 3ZXUB 2HQBA 4TYNA 2QPTA 1LZLA 3ESCA 2QL6A 3QVKA 2QKYA 2DUWA 1A82A 1YNOA 4RIHA 4TTTS 2FPSA 1LPAB 1ZWKA 2IHJA 1D9ZA 5H5JA 4EB3A 1QPZA 3TLZA 1TMKA 3TKLA 2Q4DA 3MWDB 1ZM9A 2VPIA 3GEPA 3P26A 4GH5A 4L4SA 3WGGA 1M75A 1ZIXA 4KDEA 2WFAA 1C2TA 3KOWA 2O2CA 3FROA 4G26A 3O38A 4MA4A 4OMCA 4Y6OA 2AH5A 4Y7DA 3FWKA 2DFDA 4WKBA 1YZHA 5E1MA 4LE2A 1ESEA 2DEUA 1YQDA 1CSEE 1YWGO 1GPKA 4NFYA 3HPRA 2QN8A 3G7NA 3OY2A 5FNVB 3DOCA 3M3HA 2R79A 1J2TA 3DF7A 3VJKA 1B6SA 1E0SA 1ZWLA 1K8QA 3CLUC 1GARA 1CDDA 1KYXA 3R5XA 2VP3A 3K0CC 4F72A 3LFUA 2VJAA 3BFKA 3HKEB 3HYNA 3USCS 2IZOA 3CLRD 5U9CA 3INNA 4OGFA 2IPOA 1NWCA 1W0KD 2GT1A 1Y6JA 2QQGA 4J0EA 5BQOA 4CW7A 4Z1MA 3K7EA 2BONA 2O2JA 3GZNB 3V9PA 5AKKA 4P38A 5LYJA 3DH0A 2VHYA 1FDOA 3KJFA 4RTQA 3WNBA 2FN9A 4BNFA 1W6UA 1CUBA 4UU7A 1JYSA 2H5LA 3GFFA 4JLDA 4JWKA 2A7XA 2XZPA 4YT5A 5F2EA 2FF7A 3IAS6 1PTJC 3THXB 5COAA 4R8LA 1UH5A 1HQYE 4BMXA 1F7UA 2YQ4A 2KWIA 1JIVA 1EFVB 3NTVA 3S1LA 4ECEA 1UJ4A 1O94D 2I29A 2ICAA 4HMPA 4ZC8A 4NBTA 4D02A 3PPWA 4N6NA 5BUCA 2CF5A 2JVIA 3UAVA 1GR0A 3C7KA 3UT6A 1EK5A 3BXXA 4DA6A 1QWOA 1DAMA 1L5RA 1T8YA 1S2DA 2GN0A 2V9CA 3GLFB 3LKBA 3B60A 4ZU1X 5JWHA 4GSYA 4F5WA 3D3WB 1TM2A 4OHMA 2GKGA 1NYRA 4RGQA 4XE5A 3W5SA 4MPJA 3HEAA 4NL4H 1GAEO 3CMCO 4NJOA 3K2QA 1OTXA 4YCSA 5JVDB 4WXRA 1B76A 5DBOA 2AXPA 4H18A 5SZIA 3SJUA 3V1KA 3VR5H 4E5YA 4KE6A 4BB0A 3UUWA 5DK4A 1KIMA 3WKDA 3IEMA 3Q7PA 2Z6AA 4UBLA 4YAOA 2PA3A 2Q3EA 1XZCA 3MCVA 2X0NA 3P94A 4G67A 3V2HA 4E70A 4I6JA 3L8DA 1DWQA 3NV7A 4NV3A 2P9CA 3W2FA 2C8JA 5JJIA 4J43A 5J2UF 1T8WA 5FJJA 5IJAA 3E1SA 4LYAA 3WSWA 4AMYA 4E32A 2VJDA 4F6CA 5F3WB 4XX0B 5AW3A 5KNDD 4DB2A 5G40A 3SY8A 1DHRA 1XRRA 3C8ZA 3GRRA 1DTEA 1SRRA 3M6WA 4DB4A 3CRRA 3F4LA 1KZ4A 3K0HA 3ZIAA 4O4IB 1N32B 1NY6A 2QMEA 1ZL2A 2BBWA 3E05A 4Y0AA 4AQDA 2YC4C 2ZVPX 1CEEA 3OA2A 1N6HA 2IGBA 1ES9A 2OBXA 1NXOA 3EZ7A 4MP3A 3TD2A 3ZDCA 1C9JA 2ZYDA 3BRQA 5FOXA 3Q0IA 1ODTC 2BFDB 2QZJA 2Q9AA 2XX3A 1JFSA 1CY7A 4GOXA 1KS2A 5EKUA 3KBBA 3JR7A 2QAIA 1EWTA 3OKCA 5IC4A 4JOBA 5TV2A 4DMMA 2UUBB 3AF2A 4JQOA 3T3GA 4RFVA 5KJFA 5A0VA 1ZHOA 4LVOA 2Z57A 4LW8A 5M34A 3VUEA 4XUCA 4RTOA 1DINA 3H2ZA 5HF9A 2EKQA 2BFBB 4HT3B 2P75A 1HPLA 1TVKB 3O83A 2VJNA 4ESHA 3VBCA 2QSUA 3CT6A 1Z16A 3QW2A 4O2BB 3ICQB 3MQ2A 5LZ4A 1JYFA 1MEJA 3OEYA 2YWRA 4GE0A 1XEXA 1QIHA 4ZTUB 1LDNA 3NEAA 3O9MA 4FXOA 4Y2UA 1H93A 2WVJA 4S24A 4MYCA 3KKKA 1U7XA 2GF9A 1AZSC 2JJ2D 3NWPA 2WU3A 3SOZA 1GG8A 4JXJA 4YAGA 2F9LA 3ODPA 1N2CE 2OLKA 3CG4A 2PL5A 3KEFA 1XWIA 2EBWA 3QRWA 5KPDA 3IESA 4G5QA 5BPFA 3D4NA 1K66A 3AY0A 2V6GA 1JE1A 4MNTA 4RADA 4FHGA 2C7QA 1E3QA 1DO8A 1QLWA 4HCJA 5JY1A 5E6RB 5FPPA 4TV8A 2G5GX 3UJHA 4OG2A 4EPRA 1S5PA 2Y92A 3F8SA 4I66A 2DWOA 4U3JA 1HTWA 1FJ2A 4F06A 5FWAA 4CZ2A 5KWVA 4LRTB 2BEUA 3G82C 1JECA 4XASA 1SXHA 2JARA 5C53B 2YMPA 4KOEC 1P9NA 1PEAA 2FA9A 3CNQS 8OHMA 4GLLA 4CQMD 1QRUA 4EVSA 3HJNA 3C8MA 1ZP6A 4U63A 4A8JB 2C2YA 3LVFO 1U7TA 1KEZA 1HA3A 2GYVA 1HDRA 1O9HA 1UT5A 3B70A 5BQ5A 4EFNA 3JX9A 2QENA 1Q83A 2P9GA 4OOFA 5EJMA 2HCRA 2XIJA 1P9WA 5CA1F 3MOGA 3E1KA 4BP8A 2MINB 3T3EA 5AW5A 4MH0R 3KO8A 2VJKA 3GLKA 3I2JA 3EF1A 3GDWA 4Z7JA 2OFXA 5E1DA 4ZI5A 5GONA 3BBLA 1KKUA 3CH4B 1RT9A 3L4BC 2XRMA 3SD7A 4TZKA 3TSZA 3FBTA 2HPZA 3KR9A 4LZPA 1KXZA 3IBTA 3LXMA 2Y1FA 3QYAA 1N3IA 3G9TA 3BRWD 1FQKA 1H3EA 1CQJB 2R6HA 4FTWA 4O2AB 4YUVA 3RSQA 4MVYA 4LCBA 4CM8B 1MJHA 2JAUA 4QRHA 1LXCA 3WGHA 2E85A 1U9JA 4HJXA 2YMMA 4IRUB 1IM5A 2YWGA 5B7NA 3E9ZA 1ODSA 4IIUA 3RHSA 4F91B 3H13A 3VC2A 2F6RA 1R4MA 1DPFA 1ZVJA 5AJTA 1RWNA 1W0JD 1RWPA 1JLHA 1TJNA 2ZBFA 4H59A 1L5NA 3OLWA 3I1JA 4RETA 4BECA 4E2FA 4AMBA 2NUBA 3HWX1 3PFWO 4BN0A 3ZY2A 2XB2A 4RJTA 3U9LA 3SSNA 4G1BA 3LDAA 1LC0A 4U6SA 4HQFA 1VLVA 4LOHA 3ZHZA 2CLFB 2B1GA 4UEJA 1GFZA 2AFHB 3I12A 5E3HA 1H1LB 3K73O 2VCYA 3NJ8A 3QU4A 1I5OA 4ER7A 5IPFA 1B41A 5I9LA 3R7FA 4NU6A 2ZDHA 3O4JA 5AYVA 3S4YA 4AM8A 3G79A 3CKLA 4CU5A 1M7GA 3G3EA 1J00A 2J67A 1PIWA 2H9IA 1H0HA 2BMJA 2FK8A 3IB6A 4FOPA 1K0FA 5K05A 1FP1D 1FSFA 4KTVE 1U9IA 1AM4D 1ZUHA 1FQJA 2PUTA 3PQFA 4F1KA 1WB6A 2ZRNA 2PH7A 1EFHA 3MELA 1E3TA 1WSDA 4R01A 1IXKA 4YA6A 4JJ7A 1ZO8A 3R0JA 3ORHA 5G53C 4YWJA 5ALQA 2BMWA 5PGMA 5IFLA 5K4HA 1KVUA 3H6HA 3FYSA 3U60B 1KR5A 2MU1A 3GJ3A 3UOGA 3BE8A 1WVIA 3WWZA 1OLUA 4GI5A 2WJAA 4AZVA 3FVQA 1YS1X 3VUFA 1R0XA 3HN2A 4BVBA 2FWMX 4ZVUA 3GA0A 4DG5A 1XGKA 2I76A 2FHPA 2GASA 3PVCA 1V1MB 2PWAA 4MR9A 4FLFA 3W8EA 4C7JA 4TMZA 2PRZA 3ASYA 2OA0A 2Z4RA 5JCZA 1DKQA 1JBKA 1PEKE 4NY1A 4QOSA 4R69A 3EF3A 1YBMA 4MLDA 4NYIR 1M2VB 1VOTA 4OXIA 4IUDS 2JFXA 1XCBA 2GK3A 3JWEA 4CTJA 1KEVA 3S5UA 1LTQA 2PAAA 5TXGA 4JDPA 1Q19A 2Q6OA 3A1UA 1K7EB 1HNWB 421PA 3DBLB 3IIIA 1G4UR 2F64A 4A8HA 5LUAA 3I1FA 3T41A 4ANFA 1YCHA 1FDTA 4JL5A 5FPHA 1DJMA 1NJ6A 1SBZA 1CZHA 2HTFA 2JC3A 1T2EA 3WFIA 2VJMB 3A11A 2AX3A 2H1OA 4JL8A 4H2DA 4OP2A 4YMVA 4PFQA 1NVEA 5FBKA 2E55A 1G5PA 3KQNA 3DBRB 4Q7JB 4CG0A 1ZCAA 4GLBA 1NMYA 1PZEA 4IGEA 4RK0A 4KPEC 1P39A 5I7AA 3N3AC 3TX2A 3JYNA 1JUDA 3IO5A 1TF5A 4RH1A 3WLIA 5I7EA 4L8YA 5EN4A 2OESA 1Q74A 3L6DA 5FUBA 1HE5A 1N7HA 4WERA 3ZJVA 3FFAA 3NXSA 1CJUC 4K46A 1V5FA 2CXUA 3GJ8A 3GO4A 2HA5A 3AUFA 3FMFA 5FWYA 2B20A 2P7HA 4IIYA 3GRVA 4TM7A 5DV9A 3QIVA 4YRAA 1MAWA 3HXMA 3AJEA 3RS5A 1NVMB 1JR3D 1UC4B 1C81A 1QH1B 1MW8X 4E5MA 3R3ZA 2AQIA 4R9SA 3A6LA 2IYOA 1JEDA 1U04A 5JEEA 3T94A 4YROA 5TS3A 3Q8KA 5KJ1A 5NLLA 5CT6A 3DVSX 2B5WA 3KNZA 1JR4A 3P0HA 5C32A 1A9XA 1T24A 2R6FA 1KP9A 2G06A 4JI8B 4IHAA 1MORA 4R7GA 3VTFA 3AKZA 4RZUA 2NADA 1RRFA 3T3MB 1V5IA 2RHJA 1WB9A 4QO7A 2YFYA 4YMTA 1CF9A 2VUHB 3KYBA 1FYVA 2IDKA 2E0IA 2J3KA 1YTUA 4OJMX 1VIDA 3A37A 5FUMA 3DMHA 1RJFA 4BPRA 1PUXA 1DCFA 1Z7WA 4N0EA 3AWIA 4PWZA 1IPFA 2JJQA 3H65A 3GRYA 3QWHA 1M8PA 2ZE7A 5EQFA 5G0WA 3IMEA 1RQPA 2NWQA 1DEOA 4G25A 5EE0A 4I19A 1J97A 3RABA 4RD3A 1Z5PA 4H15A 2XQVA 3ENZA 4GVPA 3HK2A 3DOOA 3OLCX 1QHHB 1G3RA 2DUUA 3A8TA 4MULA 1FXSA 4ZVNA 4YRBA 1ZGCA 5JCXA 1L5HA 1YMUA 4JMPA 1R15A 5EHGA 1TT5A 4FGJA 4LZWA 4IS2A 4EHFA 1OU4A 3BSWA 1DIOB 4P31A 4CLEA 3PNBA 1UWCA 2IYAA 5E95A 1ZNWA 4PLZA 4YRPA 1BN7A 3RIGA 4Y30A 1ZKDA 2XVXA 4LCEA 3L8FA 1B6TA 1DKMA 1JEJA 2FFRA 2VNIA 3FPKA 4FFSA 4NV0A 3TTWA 3ADDA 4PFJA 1U9YA 4L6IA 3TUZC 2Y67A 2EJWA 3VR5D 5C81A 1IXYA 2CLOB 4P4SA 5I4KA 1M2WA 4A27A 5IDVA 4IDHA 3L7LA 4PYLA 1CY2A 3FGZA 3R77A 5IBPA 1R3UA 5JMWA 2QOEA 1KP3A 3DL7A 4P22A 1XI2A 3BGVA 4DV7B 3KDPA 1Y7PA 2IIVA 3EBPA 3AFHA 4K86A 2B3DA 2E7ZA 5ALKA 4WOJA 3DLHA 3VU9A 1TK3A 4AZTA 3V6MA 3B9QA 1WUJS 3HJAA 2AJCA 4B0PA 4IFTA 3IDOA 5CJPA 4DR1B 4KHZA 3KXDA 4GWKA 4LZAA 4D4GA 4FI3C 4K9PA 5HS6A 1JU3A 1PTKA 4CKBA 1W2WB 3VC1A 3RIHA 2CUNA 5HNKA 3EFEA 4LQLA 4JI7B 4QUAA 1SVKA 3LVBA 1ZUNB 2ZITA 4FMCB 4ZVRA 4TQAA 5A4KA 4BWYA 5LZ8A 2XQIA 4MSUA 3PX7A 3MILA 2ZEJA 2ZRJA 3HL4A 1JGTA 3U17A 5EXEA 3CX7A 1HRKA 4FR0A 2AOUA 1VL1A 1Q0LA 4TWAA 3JSXA 4LNHA 4EGAA 2OO3A 2QNBA 1R50A 3G5LA 3JVVA 3SOPA 3WYGA 1P1HA 3HY3A 3DW3X 2OV1A 1NLZA 1HNZB 4BQQA 3RQIA 3WXBA 5BR7A 2AYXA 3VOAA 4IEEA 3F9IA 2Z5FA 2JGEA 3QYFA 4M22A 4OJNA 4YP7A 1EFCA 3M8KA 1ONOA 3NS7A 4US2R 2XCOA 3P45A 3DE5X 4EY4A 1Y4DE 3MD9A 2QTGA 3PGKA 4G0OA 3YASA 3D6AA 3A4MA 4PXYA 1DQZA 3TNFA 4HJRA 3PJRA 1T1GA 2O4CA 2G7ZA 1DWOA 3CX8A 3EXIA 5IAAA 5BV2P 1GCAA 1VY