3FDIA

Crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
161
Chain Sequence
QIIIAIGREFGSGGHLVAKKLAEHYNIPLYSKELLDEVAKDQDIAIRQFNFIRKKANEEKESFVIVGRCAEEILSDNPNMISAFILGDKDTKTKRVMEREGVDEKTALNMMKKMDKMRKVYHNFYCESKWGDSRTYDICIKIGKVDVDTATDMIIKYIDSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of uncharacterized protein from Eubacterium ventriosum ATCC 27560.
rcsb
source organism Eubacterium ventriosum
molecule tags Structural genomics, unknown function
total genus 48
structure length 161
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13189 Cytidylate_kin2 Cytidylate kinase-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fdiA00
4N1AA 3KB1A 3C4JA 2IWHA 3MLEA 3L43A 1MOZA 1EFCA 1QHIA 2D62A 4W5HA 3LWNA 2ERXA 4K46A 3WBKA 1AA9A 3CZPA 1OKKA 1R4AA 2KE5A 1CEEA 1ZM7A 3GFOA 3UMFA 3U2QA 3PEVA 1IXSB 1D8TA 4KU4A 3VKGA 5CM8B 1FUUA 1KAGA 3FKSA 4HAUA 1R0YA 3B82A 2GESA 1PLJA 1AS3A 4NCKA 2OT3B 1NVVR 1Z28A 4G5GA 2AL7A 3FFAA 4ON9A 4LGMA 2ZUCA 4KCGA 2ZAOA 3PEYA 1QG4A 2GHIA 4L9WA 3VKWA 4ESVA 3EZ7A 2GXSA 3SR0A 1L8QA 2IWRA 1G8FA 2FJUA 2IL1A 2QZ4A 2YV5A 2MSEB 1R6BX 4RZ3A 2W58A 2QE7A 4L8GA 2X2EA 1CF4A 5FTKA 1W0KD 2XTZA 2LKCA 4RD3A 2GVDC 4A9AA 4ZV4A 3TUZC 1R5NA 1E6CA 5G3ZA 5CJPA 4C0QC 3C5CA 2R65A 1DO2A 2CHQA 2ZANA 3HWSA 4PAOA 1DO0A 4RY2A 2YVUA 2YYZA 4KFUA 1P73A 1SVIA 3DM9B 1BMFA 2EYQA 4LPKA 4PC3A 4TZ6A 3OAAA 2G1JA 5HPYB 1HEIA 2NO7A 3AVUA 5LB2A 1HY3A 5G40A 5LBIA 4TMVA 1E3MA 2BOVA 1DG1G 1U9IC 4JT2A 3UANA 1XFAA 3D31A 4LCBA 1T91A 3THOA 5CJ2A 3ZS8A 3QXCA 1COWD 1KI3A 1TQDA 2IC5A 2ORWA 4GI7A 3WMGA 4BLOA 2AFHE 5DSZA 5EZ6B 4N0EA 1W0JD 2QTVB 3B1WA 4NPHA 3VMFA 1KTVA 2FDCA 4GOXA 2G88A 4JBYA 4LYFA 2VHJA 1W2HA 2ZS9A 3GLHA 3S1AA 3RSLA 2VIIA 5P21A 1UBEA 2QPOA 2XITA 3CONA 3DEFA 3MUFA 4TLDA 4A0RA 4JZKA 2HLDD 4DSTA 3B1XA 2CL7X 1S1MA 3L8ZA 3GJ5A 1Q44A 1LW7A 2RGXA 1X8KA 3MWJA 4MYCA 3A6PC 4TSFD 4US0R 1G4AE 3W5JA 1S8FA 3K09C 2VF7A 3ICEA 3DMNA 4A36A 4V0OA 1GRQA 3EZFA 3MJHA 4AK9A 2W83A 3B7GA 2VP0A 3CPJB 2D7DA 2F9LA 2F55A 2ZI9A 2QGZA 1LFDB 4DLRA 2O8EB 2LCFA 1EX7A 4MRSA 2EVWX 1KDOA 5E95A 5DHAA 5J47A 3PUYA 2IYYA 3SJZA 1E2LA 521PA 1KSHA 4NCIA 4I1OA 3B5JA 2CCKA 5CLQA 2B8WA 1N5KA 5CIWA 3DO6A 5EP2A 1CXZA 5CM9C 5FPSA 221PA 4E5UA 4M0LA 4NE2A 2R44A 1JXMA 4HAWA 4B75A 4BFXA 1KI8A 1Z22A 3W6OA 2B7BA 2GCOA 4GMXA 1IXRC 2D06A 2FE4A 3ZD6A 4ITRC 1NMZA 2VL7A 2EU8A 3TQCA 3H4MA 4BEBA 5GJBA 5CYOA 3KQNA 1JECA 4D80A 5FI1B 1K8RA 1GITA 2AKAB 1BIFA 5DYIA 4URXR 3SJBA 3THYB 3PEWA 3O8CA 2DWOA 2GF9A 2REOA 3P32A 1G18A 4BECA 5JHHB 3VQTA 5HTKA 4M1TA 1YZQA 2KBEA 2ZI7A 3RABA 4ZIRB 2PJRA 3NBYC 1A82A 1TUEA 3B85A 3ZIAD 1KI6B 2AWNA 1G5RA 4PPNA 1UJ2A 1D9XA 1XPUA 1AN0A 4DLTA 3LW7A 4JLOA 4M1MA 1B0UA 1XU4A 3K0FB 3ZJYA 5EE0A 2W6IA 4NKRA 2B7CA 1P7CA 5TVKA 2IYTA 1UM8A 4WXPA 5DI9A 2CLCX 5B30A 2ODEA 3UMSA 4O25A 1Z06A 1E0JA 2C9YA 2YZ2A 3RC3A 5JEEA 5KSZA 4UQOA 1KO4A 2XJ9A 4QBHA 3P20A 3PUVA 5FR2A 2KSQA 4DDWA 5JI3E 2YWEA 3ICQB 3VX3A 1N0VC 2GKSA 2P3SA 1HT1E 3GJ4A 3ZGXA 1DAKA 5DNYB 3UWKA 4F38A 3X1YA 5GVRA 1XXHE 4NP6A 1HYQA 2GWHA 1OE0A 2WJYA 4Z51A 1GL6A 4Z1MA 3CNOA 1E2JA 1NBMD 1NN3A 3LAWA 2FSGA 2FSFA 2PLFA 2QPTA 2C78A 3EA0A 3AVXA 2AXPA 3CF0A 1I2MA 1KJWA 3OE7A 2V54A 1ZNYA 3ZZ0A 1PUJA 2W6JD 4TTQA 5GADl 4P31A 1R0ZA 3MSXA 1HE8B 3WRYC 4XVUA 1E94E 2RGNC 3N5CA 1VG8A 2GK6A 1FQKA 2F3TA 1Q21A 1G8YA 1E2MA 3ZZUA 1KO7A 1T5LA 1JBKA 3KKOA 1E9DA 1GNQA 4IDQA 4LV6A 5EUMA 3EPLA 1XJ0A 4MKIA 1H8EA 1FTNA 2Q6TA 2QENA 2ZRCA 3AF4A 4JYCA 2R6DA 2DR3A 4LV8B 1E2NA 4DUGA 1YR6A 1II8A 2J3EA 3CO5A 4IVPA 4LBYA 1C1YA 3LW8A 4RD6A 4QXAA 4OBEA 2BEKA 1KO8A 1UDXA 2DCUA 1XXHB 2PT5A 2CEAA 5JFGA 4HUTA 1T0JB 2OCYC 2QEQA 1ZUIA 3A36A 1W47A 2ZYWX 3IPXA 2BEJA 2AHOA 3SE0A 5G3YA 2C03A 4MGIR 3KFVA 2RGAA 4IDOA 3O8DA 2PZGA 3EZ6A 2WWXA 1ZVQA 3AKDA 3GEIA 1CJUC 1G16A 2ZJ5A 4IKEA 4JLBA 1LB1B 4UNNA 1XEXA 1OYWA 3QF4A 1TEVA 3V00A 4P3YA 3IO3A 4B35A 3GLHE 2D2EA 2Q3FA 2JLXA 1DAHA 2AK3A 3KUCA 3RS7A 4DLXA 4BFVA 2V6JA 2ZTSA 3KJEA 4B3FX 2AK2A 3AEZA 5L3QA 4DC9A 3LBHA 4PX9A 1JJ7A 2ORIA 3T12A 2ZJ2A 4JIMA 5JCZA 4TYQA 1IN7A 1XTRA 3KKPA 2ANBA 1GP2A 1XNJA 1TU3A 2PLRA 3NXSA 5AUPB 4HB4A 5FTMA 2JJ2D 1NN0A 3WBJA 1F6BA 1F2TB 3RS4A 1ZINA 3EG5A 3LFUA 5JRJA 2OM2A 2QU8A 1X1SA 3BBPA 4UKDA 4WW0A 3AM1A 2C99A 2H5EA 1SVKA 3AKCA 2VH5R 3A1UA 5DGXA 3M4YA 4Q1DA 2J0QA 1CIPA 2G83A 4TL6A 2O5VA 2CLSA 4KI0A 4TMZA 4PSVA 4DCUA 1OXVA 1K5GA 2UKDA 4LJ4A 2J45A 4EFMA 3FOZA 1VIYA 2QM8A 3EZ2A 1U8AA 1KK3A 1MABA 1R0XA 5FBWB 4ACBA 3IQXA 3GLHB 3LY5A 4WZAE 3S1AB 1OIXA 5JSZB 4LHZA 4H1UA 3ZQJA 2R6GA 3I8XA 4R7ZA 1KSGA 2DHRA 5H1YA 1D6JA 4OJKA 1S3SA 1RJ9A 1ZUHA 2WJHA 5BQ5A 2FH5B 2I1VB 2N42A 4JBWA 4ERNA 4IW3B 4I4LA 3A4MA 1MRNA 1E98A 3IGFA 3GLFE 4NYJR 2VSOA 1XX6A 1SKYB 1T3HA 2YKGA 3AKYA 4TL7A 1KAOA 3I8SA 1CJKC 3O8BA 1GNPA 5KPJA 1E9SA 1EFRA 3U3OA 5B64A 4NYIR 5DISB 4PSKA 1KI9A 1Y63A 2C9CA 2QNRA 3LH5A 4Z8XA 2IYWA 1YZNA 4Q9KA 5AUQA 3W6NA 5BYKA 1DVRA 4CT4B 5L8VA 3D8BA 4QM7A 1BS1A 3QBTA 1E1QD 1SXJC 3AUXA 2V7QA 2GJ8A 4JL8A 2V1UA 1E2KA 1QDEA 4HB3A 4UNRA 2FSIA 3WYFA 3MMPA 1SVWA 1SKQA 2QQEA 3X1XA 4F91B 4TMKA 3DKVA 2WIBA 2FWRA 3PG5A 3PIRA 1V43A 4NCNA 1OH6A 4AC9A 3IHWA 5AUNB 5EXTA 2RGBA 3I4LA 3GLFB 1KNQA 2QY9A 3CF6R 5CDFE 2XEXA 1Q3TA 4CYMA 1GL9B 1YR9A 1M7GA 2RHMA 3KKQA 2Z6VA 1RVDA 4EUNA 2KBFA 1KSFX 2F43A 3B78A 4U7DA 2IYXA 2JA1A 2OILA 1MO5A 1ZJ6A 4XIGS 3HPQA 2Z83A 2G1KA 1J2JA 1RW4A 1UBGA 4ZI3A 3EC2A 4RZ2A 1S1CA 1QF9A 1Q22A 4YMTA 4C0BA 4Q19A 5JECA 5GVSA 1U0JA 4B3GA 1DELA 4DB2A 4C0HA 1KMQA 4L15A 1OB2A 2BKUA 5CK5A 1D5CA 4B74A 3VR2A 3SBEA 4JJZA 3SI7A 1ZM9A 1II9A 2IA5A 4P4SA 2Z4SA 3K9NA 4G5QA 3TE6A 4V0KA 1WB9A 5KPDA 5J4LA 1KK1A 4TMTA 4TZ0A 2YOHA 2BKEA 3CF2A 2P6RA 2W2VA 3MD0A 2PBRA 3OEHD 1A4RA 4BFTA 5J40A 3GLIA 1VCMA 4X8LA 4PPGA 5EE9A 2P6UA 2F6RA 4US2R 5AR1A 3PUWA 5FFMA 3FMIA 5FUVA 3LX8A 4EPXA 3U6KA 3GLGE 4JJKA 4FCWA 1OKKD 3T15A 2JLWA 3LXXA 2VA8A 2H1LA 4M9XA 1G9XA 3MGCA 4JVMA 3A4LA 4KLNA 4MH0R 5AWFC 5JS7A 3EPJA 1OYYA 3ZYCA 1XTQA 4GRAA 2WAXA 2WVJA 2FPLA 3V4FA 2IK8A 2J59A 1YZLA 1CR2A 4I1VA 3U44A 5J5CA 4FWIB 2IYVA 3QOFA 1KIMA 4GBMA 2XOKA 1KZ7B 3TQFA 5CYPA 2GEVA 3M0EA 4Q1FA 2ZSDA 3BH6A 2XGJA 4LUCA 3PQCA 4PAMA 1FP7A 1ANKA 5EP3A 1OB5A 2J0VA 3Q7QA 5A4JA 1J99A 2IYZA 3E5HA 3LX5A 4IRUB 1WF3A 1TF7A 3Q7PA 1KK0A 5FL7D 5D3QA 1W4RA 1XZQA 2QE7D 3BFKA 4B6FA 1XEXB 2B6HA 3G5UA 2QTFA 3GLGB 1N6KA 1NLYA 2JGNA 3EIEA 3FWYA 3PENA 2OBMA 1ZAKA 3C15C 4D4MA 5AJXA 4NH0A 1DADA 3CNLA 4WAUA 3TSZA 4A82A 1ZNZA 1Z2CA 4JSYA 1D2MA 1HTWA 1W5TA 4YXWD 4ZDKA 4LJ6A 4A0GA 2ZI4A 1YU9A 4CT5A 2JIZD 1EESA 2DWPA 5CITA 2F7SA 1GKYA 1BO6A 3K0CA 2PCJA 2J41A 4NHOA 3PCRB 1F5NA 3OEED 3NVAA 3X1ZA 3VNUA 4NBSA 4UNPA 3ZVRA 1Z2AA 4BZXA 5C46F 2RGDA 2PX0A 3EWAA 1EG7A 4HEJA 4LOAA 2IBMA 2DWQA 2QROA 3TR0A 4A2QA 4DZZA 2BBWA 3TAUA 2VSXA 1MABB 1MRSA 4HDOB 5HR5A 2CNWA 1U8YA 2FN4A 1E2FA 1J90A 1Z8FA 3TBKA 3SC3A 4OHYA 3QNUA 5BN3A 5HCNA 5FH9A 1RRCA 2G3YA 1KI4A 1M1YE 1EX6A 1AS0A 3FMOB 3T34A 1TMKA 4PFSA 5H70A 3FMFA 5JWHA 1OT3A 2WWFA 4HATA 3K70C 821PA 4Q4HB 3EZ9A 2J0SA 5FPHA 3WNBA 2JLSA 1D2NA 3ND8A 5KYKA 3HU2A 2WPDA 1KJZA 2G77B 4HYYA 4OQFA 1MT0A 3Q8XB 4BFYA 4PHFA 5FOSA 5F9HA 3K0AA 1BH2A 1DPFA 1P9RA 1XTJA 3SU8A 5CK4A 2CK3A 2ZJ8A 4NCHA 4JLJA 4D6PA 4L9SA 1Z07A 1OF1A 3RANA 4Q9JA 3R8CA 4QBIA 2Q3HA 4KFTA 3SFVA 2GBLA 1CU1A 3T06B 1SXJD 3BK7A 2WHXA 2EFHB 2YINC 4Q00A 2OLJA 3IO5A 1E79D 4LWZA 1KYIA 4XD7A 4BFSA 3CUEF 2J1LA 2WKRA 4V0MA 1OW3B 4WA7A 4A0FA 1GAJA 4HLUA 2BHRA 1ZNWA 4Q48A 2NTYC 3ZS9A 1K5DA 2GVZC 3OIWA 4FN5A 5EXXA 2IS6A 3NHBA 2NQ2C 2BM1A 4IVRA 1F2UA 1XDBA 3BJIC 5KO2A 1LTQA 1N6PA 2QGNA 1CBUA 1RIFA 4IFBA 2W2TA 4ASUD 2E1RA 621PA 2YWGA 1L2TA 4HZIA 1LY1A 1E96A 4QGGA 5FI0B 4DDVA 3LRPA 5AUOB 1XCGB 4GFDA 3T1VA 4C0SA 3GLIE 4TYWA 2YOGA 2W6ID 5FBLB 2EW1A 2VF8A 3EAQA 2JJ1D 3TNFA 1CRQA 1QHXA 2V8OA 1XMIA 2V3CC 1J8MF 1FNNA 2RGCA 4JLKA 5BWMA 1NY5A 1RFLA 3KKMA 4C2TA 1UEIA 4TYPA 4HSEA 4C7OB 1QHYA 4IXMA 2NG1A 4OQMA 1ZD1A 4YONB 2GCPA 1CS4C 2AD1A 4XVRA 4B47A 2QMEA 4ESHA 5CIQA 1NJGA 3O8RA 1YR8A 2DFNA 4ZKEA 1DE0A 3B6EA 4QRHA 1ESNA 2HT1A 3W90A 121PA 3RHFA 1XD2B 3LA6A 5C4MA 4JT4A 4QBGB 5JJLA 3I72A 3MWYW 3U3MA 1Z6TA 3BFVA 4YDSA 1HE1C 2ZI6A 3CR8A 1E2GA 4QJ5A 4LI0A 3VFDA 3GLIB 4GMDA 4Q1CA 3LQQA 2C96A 3QQ5A 4KYUA 1E4YA 3X1WA 4KFSA 3MG9A 4FMDB 2ZETA 1P60A 1Z5ZA 1X86B 4BASA 3KJIA 3SEAA 1S3GA 1NG9A 1XXHA 1U0HC 4B2PA 1G21E 2BVNA 2GAAA 3R8FA 4KXFB 1PVOA 4POAA 4DUGD 5C2JB 1DAFA 1G7CA 3NKVA 3W9YA 4ZDIA 2GXUA 1W36C 2JEOA 4HAVA 3ZLJA 3MWKA 3R7WB 4HDCA 4O2LA 3U44B 1D2EA 4KVAA 1LV7A 2A2ZA 5FUXA 3U5ZB 2FF7A 4OL0A 3QXSA 2WKQA 1KJYA 3KUDA 3CPEA 1LF5A 1J70A 4N3NA 1G20E 2D3WA 2J5XA 4O2RA 3QKRA 4G5OA 4KLZA 1Z0FA 3L2OB 3SHWA 4AIIA 3KQLA 4EAQA 1N6IA 1WP9A 4URWR 3TUJC 3QJYA 3A1VA 3UKDA 3SQXA 2N46A 2WJJA 4NYJQ 2HDNB 3HR8A 4DIEA 4TL8A 4YC7A 3TW4A 3KZ1E 2WICA 2HCJB 4D26A 4U5XA 3ZVNA 2PCLA 3B1VA 1G7TA 1NL3A 2O8CB 4H1VA 4KO8A 1E99A 4EPWA 1F2TA 1NKTA 4ZPXA 4NYIQ 5DN6A 4RZXA 4IOMA 4EJSB 2WTUA 2QQ0A 2GJAA 4NCJA 2ZYTX 4JVSB 1FZQA 2ZYUX 4M21A 3CLVA 3B13B 2WSSD 3FB4A 4FINA 3Q3JB 2A5DA 5AJZA 4PPFA 1IJEA 3DHWC 1ZM4A 2O8FA 2HUPA 3K0CC 1OH5A 4GDFA 5JSZA 3FVQA 1OPXA 2XZOA 3W5IA 2YWHA 1E9RA 1FMJA 3G82C 1WQ1R 2A9KA 3CNNA 2PMDA 2PH1A 4RD0A 1OFIA 4OQXA 2VHQA 4C0LA 4CEIA 1B23P 4WZ6A 3LLMA 1JEEA 3IILA 1AS2A 2X77A 1GG2A 3SNHA 1T3SA 3RRNA 1MO6A 4TTRA 4DLVA 2VBCA 2CDNA 2J7PA 4TT3A 4ZDJA 3Q72A 1SVMA 1E0AA 3WYGA 2HV8A 1T4GA 4V0ME 3VHLB 1JR3A 3K70D 3QEJA 2J46A 3PITA 4OJQA 4FIDA 3ZDQA 1P9NA 2HXYA 4P32A 3KFXA 4QGHA 1AKYA 3AF2A 4OHVA 3VKHA 1ELOA 2NOAA 2XTMA 3PR1A 1AGPA 1N6OA 1P2TA 1JB1A 4Z8YA 2IYLD 2NMVA 1IM2A 2QI9C 3RYTC 3LVRE 2R6CA 3K0AB 4TLCA 2RGEA 3LBIA 1S2MA 4P4TA 4L4UA 1SHZA 2WZQA 3ADBA 2IS1A 3EX7C 5LD2B 2ECKA 1VG0B 2QP4A 3D7MA 1GIAA 4TMWA 4EQ6A 1ZD8A 2G9NA 3RS2A 3SFZA 2QT1A 3B2EA 2RH5A 5UKDA 5C4GB 1K6MA 2V7QD 2O0HA 5JHGB 3SBDA 2IT1A 3Q85A 1W4BA 2B8TA 4M22A 3GLFA 4M53A 3TSWA 3AP3A 1I4LD 2R6FA 4AYTA 4ZI2A 4DLZA 1ZUNB 4HLUC 1W4CA 4Q03A 2OCPA 3ADKA 3WNDA 5G41A 1ZM2A 3QG1A 2C2HA 1W49A 2FZLA 4HDQB 1KI7A 1F2UB 2DFTA 2IW3A 4MKGA 3W34A 1E9CA 1VIAA 2ZSEA 4MYUA 4B33A 3O47A 4PXAA 2NPFA 3CIOA 2WAYA 2NZJA 4LPSA 4Q5IA 4Q21A 3LLUA 2XSZD 4JLPA 2BIFA 2ZRAA 5EUQB 4QL3A 1E2EA 1R10A 3KQHA 3AP1A 1LS6A 2IEYA 3K0SA 1IQPA 1N6LA 4KFRA 4BEJA 2PEYA 1N3BA 3K9LA 1P5ZB 2OO7A 4RD1A 4RVCA 4BRUA 5FTNA 1P72A 2WWHA 5DLQC 3KXIA 5DHFA 5CDFA 3RS3A 2OCBA 3EWSA 4DCTA 1BYIA 2C9OA 3NG1A 3HJNA 3JZAA 3QE0A 2V4ZA 4G3XA 1TF2A 4C0KA 3U7HB 1M34E 1YZUA 1R8SA 4V0NA 3AVYA 2RMKA 2ZROA 3K9GA 3NIBA 1M8PA 2IUSA 4F92B 1G1MA 3DKPA 4Q4LA 4EKDA 5J4VA 5HE8A 1KOFA 3KX2A 3C5HA 5FPTA 2WWWA 4DRZA 5CB6A 2OCAA 4RCYA 1QHSA 4LJ8A 3ZQ6A 1CR0A 3DZDA 3VTKA 1LS1A 4FWTA 3NDBB 4WBSA 1FOEB 4EIWA 2FG5A 3V4RA 1SGWA 4IDNA 1Z29A 1A5TA 3E70C 2C5LA 1W1WA 2JASA 1RZ3A 3AVWA 2Z0MA 1O3YA 1UFQA 2J9RA 2BCJQ 2QRNA 1JAHA 2ZXUA 2YHSA 4M4SA 4IOKA 3KTAB 2QAGA 4G5RA 5DH9A 1E2QA 2Q9BA 3CRW1 3IDQA 1W36D 2ZRIA 4B73A 2W2XA 5CB8A 3THWB 1XPOA 1CJVC 4HZUA 3UG6A 2XOKD 1KKMA 4CEJB 1SZPA 1XMSA 2AN9A 2CCJA 4OHWA 1Z0IA 2HEIA 4W5WA 4CEHB 2BDTA 2WOOA 2ONJA 2ZAMA 4ARZB 4D82A 1VG1A 1G19A 3PFIA 3SOPA 3WYAA 3GLGA 2BBSA 4HB2A 4JYBA 3QKRB 4KYIB 1FPMA 4IEIA 3CX7A 4LHXA 4LC0A 5JZVA 1W5SA 2ZVQX 3N2EA 1R0WA 3SYLA 4LJYA 4B71A 3QUSA 4JL6A 1Q1BA 3GEHA 4PSAA 2ZRGA 1KO5A 2HF8A 4HLDA 3U60B 1W0KA 2C8VA 1HH4A 1CULC 2XTNA 2Z4RA 421PA 1KI2A 1LVGA 2JATA 2MSDB 5FUYA 2WIAA 2AX4A 5DIFA 1ODFA 2ASEA 2SHKA 1BOFA 4V03A 2Z43A 4A92A 2O8BA 2WM9B 3GCGA 1ZC4A 4LX0A 3CKLA 4WXRA 4XTRA 1JR3E 2ZSFA 2WV9A 4BZQA 3G0HA 1E4VA 4FMCB 3EIHA 2FU5C 1UDWA 3E2IA 4NU0A 5L3RA 5B58C 1FP6A 1XWIA 4NTZA 2EYUA 1M6NA 2JLQA 1PUIA 4QKQA 2NO9A 1ESMA 4DT1A 3NC1C 4DVGA 2O8FB 1XMVA 1Q1EA 5DE3A 2JDID 3Q5EA 4LSGA 3AGPA 1NMYA 2FNAA 1Z0JA 1W0JA 3ADCA 3QKTA 4JLDA 3PJRA 1VG9B 3F0TA 1RYHA 4GNKA 1TQ6A 1GSIA 4BLSA 1IONA 1KO1A 1X3SA 4NYMQ 3I5YA 4CEIB 2CNWD 3U61B 4KAXA 4Q7JB 4Q4HA 2IYRA 5HE9A 2ZJOA 1R5BA 2OEPA 4EFLA 1AKEA 1XD8A 3OIVA 5IRCD 1IY2A 4V0LA 4URYR 5DYGA 1XD9A 4OKSA 4DWJA 4URZR 1OHHD 4TSFA 4A2PA 1SXJE 2QRZA 4AURA 2ZM5A 1TADA 2BMEA 2P2LA 1ZCBA 4KODA 3GJ3A 4NL4H 1AGRA 4D0LB 2YOFA 5D3MB 1E1RD 4KBFA 1A2BA 2WPDD 3AF0A 1ZIOA 4JL5A 4LY6A 2XZLA 1EGAA 2GK7A 3KKNA 2OV2A 1ETUA 4A8JB 2CK3D 4XJXA 3I1FA 4KVGA 1AIPA 3B60A 4AI6A 3IQWA 1G7RA 2RAPA 3P1JA 3VR3A 4PO9A 4B3XA 3MCAA 1R5OA 1JQJC 1RYFA 3DDCA 4YDHB 1OLOA 2QP3A 4AWXA 2VP4A 5KDLA 3CPHA 5KOYA 4EQ6B 2PEZA 2QA5A 4TLEA 2ZS8A 1E2PA 2JLUA 4MQBA 2EFCB 4MRPA 4XD7D 4TTPA 3WNCA 5IHPA 1KGDA 1C9KA 1GOTA 3KL4A 3FPAA 4PO8A 4LDJA 2AKYA 4IVQA 3QG5A 4B3DA 4LBZA 4HLQB 2CVHA 3TW8B 3L82B 4JLNA 1ZRHA 5FR1A 3OZXA 2ZRBA 1JR6A 1G6HA 4K81B 1OFUX 2ZI3A 2ZRJA 2ZRHA 4G01B 4QHYA 3VR1A 1NF3A 1NVVQ 4DSNA 2PX3A 1PV4A 2HT6A 2BWJA 1TQ2A 2EFEB 2GTPA 2IYSA 3BB3A 3IUYA 3KQUA 4AKEA 3NHAA 1OIVA 3X2SA 1US8B 1IY1A 2QAJA 5AK0A 3OFND 5TMPA 2QG6A 3IKJA 4C7OA 3AVVA 2QSZA 3AV0B 4A15A 1AZSC 1G3MA 3QXXA 4D4KA 1UPTA 1AM4D 2P5TB 1KDPA 1J8YF 2DYKA 3WMFA 3P4XA 4WIAA 5KU1A 3CX6A 2B21A 2DY1A 1IOZA 4TWZA 2QP9X 1XD2A 3QXJA 3RVBA 2FEMA 4DBLC 2A3RA 1NN1A 3CWZA 2ATXA 2IF0A 5TY0A 3K1JA 3SS8A 1RKBA 2WJVA 2KWIA 3FFBA 3T5GA 2XNDA 4FMBB 5DO9A 5TB5A 4OQNA 2GEUA 2GXAA 1ZNXA 5FBQB 5JWRA 3FYHA 2CVFA 3BERA 4NZYA 1ZMXA 1I4DD 1NBMA 5C18A 4ZCLA 4JLMA 2VHUA 1ZM3A 1JPJA 4US1R 4GSYA 4LYHA 4QGAA 1Z6YA 4MA4A 4I81A 3C7KA 3FHCB 3TAHA 1II0A 4A0HA 5BXQC 2CE2X 1ZW6A 1Q1ZA 4B43A 5L3SA 4QOSA 4OQLA 3R7WA 1G4UR 2QTHA 2IF2A 1GFIA 3LD9A 3T35A 4Q7LA 1SVSA 3FKSD 1OJLA 3AQ4A 2P6NA 4PAQA 4XSHA 2W0MA 4MGYR 1OXSC 1KY2A 2QAGB 1FNMA 1YZTA 3GP8A 1W7AA 3BH0A 3HDTA 1S4QA 2HJVA 1AK2A 2Q9AA 3ZH9B 1XP8A 1UEJA 4A1FA 4PTLA 5IF9A 2ZRDA 4RKFA 4E07A 1G8GA 4HZUB 4KHZA 5EP4A 4D4LA 5FOTA 3MRSA 1GTVA 1NLZA 1TL7C 3TRFA 4LJ5A 4M1WA 4MYHA 3MJRA 1SQ5A 3JVUA 4M1SA 3UWOA 2HF9A 2O8CA 2OLKA 4Q1AA 4LRWA 2GILA 2JAQA 2ZQ5A 3BGWA 4DKXA 4FMDF 3AUYA 4EJSA 3AVOA 4OI4A 4I1SA 1DAGA 4QJ4A 2Q9CA 1BMFD 3RNLA 3ADDA 3OAAD 4AG6A 3F3YA 2FPKA 2RCNA 2QMHA 2VPPA 3NEJA 2IUUA 5DN6D 4Q01A 1EFHA 4PHHA 4F4IA 5B2ZA 1WCV1 1N5LA 2OXCA 1QBKC 1OH7A 4RFSB 1ZIPA 4MRNA 2O8BB 1QVAA 4RJLA 1VHLA 1DBSA 2E87A 3MWLA 4BLRA 3ZVMA 4GP6A 1YVDA 2JJ2A 1NIJA 2TMKA 4IDHA 4GL2A 1U9IA 2ZVPX 3FHOA 2ZE8A 4HAZA 1XTIA 1EWRA 1G64A 2O52A 1E9BA 1M7BA 4P33A 3RS0A 5EJEA 5FUWA 3CRMA 2I1QA 2VSFA 2BV3A 1DAIA 4DT1B 3NH6A 5E3HA 1U0LA 1XJQA 5FOUA 5ANRB 4RZUA 1VDZA 3GPLA 4QNMA 3ETLA 3VHXA 4WZBE 2C98A 4KBGA 4YMWA 2RB4A 4TN1A 1RRFA 3GJ8A 2PJZA 4Q47A 2EFGA 5AJWA 3TLXA 2E9SA 5KDDA 4TT3D 5KSYA 3UATA 1VCIA 1NJFA 3NTUA 2ZRFA 3TSOA 2NPIA 4Z54A 3PEUA 3VAAA 1N6RA 4CVNA 2GDJA 2ZREA 3W3AA 5KHOC 3K09A 3ZVLA 3AF1A 1FFHA 3K8YA 3JVVA 4JMPA 4ZCIA 2CHVA 3UPUA 1IAQA 3EPKA 2WWYA 4URVR 4C0AC 2VHCA 1Z0AA 4OI2A 4Q02A 4B76A 3NBFA 5LDDC 4PR0A 4W7SA 1R2QA 3AF3A 3A58B 5FBRB 3VR4A 1Q12A 4I1UA 3A1WA 3A4NA 4OI1A 3U3JA 4ZDWA 1NKSA 2VHTA 3ZZTA 1FTSA 3RC8A 1XEWX 3QKUA 3CZQA 2KB0A 1MV5A 2I4IA 3UMRA 1U8ZA 1HQYE 4RD2A 4XH9B 4TL9A 3EW9A 1YE8A 1CTQA 2XNSA 4II7A 1XEWY 4R9UC 1RRGA 3QI2A 3QPUA 3NDPA 3LVQE 2QBYA 4MRVA 4D81A 2GA8A 3C16C 4PC6A 5JJKA 4Q1EA 3BXZA 3HYTA 5F9FA 3EASA 3OIUA 4LK2A 1VTKA 1T8UA 4DIDA 1P4SA 3KJHA 4EPVA 1SULA 4X8MA 2CCGA 2FFAA 1G3UA 5EE5B 4B32A 1HQCA 2YC4C 1M2OB 2ZE5A 2JLZA 1GKIA 2JCSA 3BB1A 5TXGA 4Q7KA 4URUR 1HA3A 2W00A 1NBME 4A2WA 3THXB 1I2DA 1NVWQ 1TNDA 1WRBA 4CZ2A 2HXSA 1P75A 1OSNA 1Z08A 3EPHA 2O0KA 2J87A 3GJXC 3D3QA 1DOAA 4UJ3A 2AR7A 4GT1A 3FMPB 2NGRA 1W2GA 3BRWD 4QGFA 4YLGA 4C2UA 1YZKA 3R9IA 4MRRA 3WP0A 2FFBA 3FKQA 4Z1MD 4AKGA 4M9QA 4BE7B 1FMLA 2GJ9A 2H92A 2ZU6A 4BZPA 4DXAA 3OE7D 3H84A 3WY9A 1HURA 2WMOB 2OFOA 3OESA 2W0SA 2GCNA 4G1UC 4R2HA 2OZEA 2GETA 3QSYA 1H8HA 3OEHA 4DLUA 2RHDA 2VTKA 4PHTA 2B92A 4XWOA 1ZCAA 2VO1A 3R9WA 1JEDA 3KTAA 2DB3A 1FX0B 2GAOA 1H8ED 2D74A 2UVQA 4M1YA 4PQRA 3REFA 3THWA 2KI5A 3CRVA 1GILA 3AP2A 3IEUA 5IK2A 5L3SB 3P4YA 4MGZR 1WA5A 3EIQA 1M7HA 3CRQA 4UNQA 1KSJA 2GF0A 4CEJA 3HP1A 2ODNA 4CF7A 2WJIA 4KJZA 3REGA 4CEHA 2XJ4A 4ARZA 1MKYA 2IUTA 1YHNA 3B1ZA 5DI3B 2NO6A 4CGZA 2IHBA 2P65A 1Q0UA 4LJ7A 5AJYA 3AKEA 4UNSA 1P9WA 5F98A 5EE3A 1TAGA 5EXPA 1PZNA 2D7CA 4E09A 4C3ZA 4Y0AA 3HYRA 5BN4A 1OXXK 4E03A 5FBVB 2F9MA 1RRPA 1W36B 3I92A 4AY2A 3HU3A 1HV8A 2KJQA 4PQFA 1M74A 2GZDA 5SZIA 3DZ8A 4GZMA 1FQJA 4ZO4A 2R8RA 5K8TA 4EJSC 1N25A 3VU9A 4P0TA 5FL7A 4F7WA 1XEFA 1HUQA 4JLVA 2JJ8A 1U81A 5KNCA 2O8DB 3GD7A 2R2AA 3OF5A 2Z5FA 1NG1A 1OXUA 2R62A 3A1SA 1J7KA 3IIMA 3CH5A 4B48A 2IX3A 3C14C 3CH4B 2ODBA 4RFVA 3W3ZB 3LQRA 3BORA 1GM5A 4MGKR 2BMDA 4CDGA 1UKEA 3QVUA 1KMHA 1N6NA 1E2HA 2C04A 1KDRA 1JXOA 4QHTA 4YXWA 4G0NA 1DAEA 1G8HA 4R2IA 1XMJA 4C9BA 2JIZA 3I73A 3SQWA 1AZTA 4MUAA 3N2IA 4M1KA 4EDHA 4WOPA 4JBXA 2QORA 4PZYA 3A1TA 4GP7A 2ZRLA 4RSGA 5JJIA 4LZZA 2ZJYA 3BC1A 3KDSE 1ZC3A 4TYYA 2VRWA 3OEEA 2WWIA 2QUZA 3TR5A 1QHHA 2QM7A 4TQAA 3TUIC 2EWVA 4MDFA 1P61B 5TDHA 3WRXC 2X2FA 1XRJA 2FV8A 3TVDA 4QBFA 1WXQA 4N0DA 4A6PA 4HAXA 2VYFA 5D3MA 2ATVA 2F1HA 3NBXX 4FMCF 2ZYVX 2QMUA 1NVXQ 5TV2A 2BMJA 1IN6A 4A8JA 4QC2A 3V9PA 1P3JA 4JVNA 4U02A 3RLFA 1EFRD 3TK1A 1IXZA 5LD2C 2CJWA 2UZ3A 3DMDA 3SYNA 2ZR9A 1R8QA 3CWQA 4JKYA 2CMKA 5HCIA 3BIFA 2ZSBA 3HU1A 2GBLC 2A5GA 3F8TA 5KTYA 1BYUA 2AFIE 5SZKB 4OI0A 5FTLA 2WJGA 4YMSA 1WBDA 4O3MA 1XCMA 3CBQA 3UXMA 5KUTA 2IXFA 1SXJA 4DCNA 1KY3A 4DDTA 3K53A 1YRBA 1YZGA 1E79A 4Q66C 4GOJA 4Q4AB 2Q21A 2ZIAA 3ZD7A 1P62B 5EZ5A 1QRAA 4DLWA 5K8IA 2QBYB 4AKHA 2P67A 2ONKA 5BW8A 4GZLA 4Q4JB 1KHTA 1KI1A 2GJKA 3DL0A 1KKLA 3H0KA 5HKKA 1A1VA 1S9HA 4KV9A 1US8A 3T61A 1N0UA 4BFWA 2MMCA 4QJ3A 5KNBA 5M04A 2J7KA 3CRRA 4F4CA 2D4HA 1GRRA 3BD9A 3RWOA 3TMKA 1GDDA 5JRZA 4BWYA 2V1XA 2QSYA 3MFYA 4ASUA 1NIPA 3QVVA 1Q57A 3ASYA 3QENA 3DM5A 2IYUA 3IPYA 2ZITA 3SZRA 1X8LA 2JLRA 3IHLA 1N0WA 2JJ1A 2OFWA 3U3RA 4PPQA 2HCBA 2BBOA 3MAAC 1MH1A 2NO1A 3GJ7A 2ZE6A 3FTQA 2CL0X 4G5SA 3SHFA 4AYWA 3W8RA 1EWQA 2AWOA 1P2VA 3OIYA 1LF0A 4JVLA 2CBZA 3ASZA 4PQYA 1NN5A 1E69A 5JCPA 5J4HA 5TARA 3I32A 3I5XA 1DARA 3BFXA 4EPRA 2IS4A 3E1SA 1N6HA 2ZPTX 3GFTA 2XNDD 4OYHA 1WBBA 4UXJA 1OH8A 1G41A 4B6EA 4DB4A 1TTTA 1TX4B 4HAYA 2XB2A 2F1JA 4IXNA 1S0UA 2A78A 2DFLA 2NO0A 2P0EA 1UBCA 3QKSB 2MSCB 2FGKA 2OAQ1 4AKIA 2QT0A 2V55B 3B9PA 4M1OA 3UK6A 2FA9A 1SHKA 1BKDR 2A5YB 3ECCA 3I61A 2XXAA 2A5FA 1Z6GA 2Y8EA 3R20A 2C95A 4XTCS 4F93B 1IN8A 1Y3AA 1TF5A 2XZPA 1Q20A 3SYKA 3C8UA 1IHUA 2H16A 1XTKA 2VP2A 4JKIA 5A0FA 5E4FA 1G7SA 2ZSAA 3LBNA 2X1VA 4XSGA 2BBTA 4DDUA 4IHQA 1JI0A 3UG7A 1G6OA 1CJTC 4AG5A 5AJVB 3D6TB 4M9ZA 5JLJA 1GZSA 4ACAA 3P26A 2GNOA 1EK0A 4HLCA 1T8TA 2IYQA 1ONBA 4K8OA 1JAIA 1VYUA 2ZI5A 1T6NA 3F5FA 4DLSA 1OFHA 4JS0A 4MUBA 2FOLA 4GPTA 5A5GA 2Q0HA 1W44A 1N5IA 1NY6A 1Z63A 2ZJAA 3EARA 1L4UA 1YRAA 5J4YA 4D25A 4ZKDA 2F1IA 1C4OA 1EFUA 1U2RA 1SVOA 1T0HB 4EPYA 1EFTA 4L5BA 3HPRA 4BQSA 4DJTA 4Q9IA 1EXMA 4RFSA 3QPVA 3VU9B 2CL6X 1NNEA 3OHMA 1JNYA 2FZ4A 1XCPA 2MMGA 3LO5A 3I3SR 5E7IA 1L7VC 3CX8A 4FCVA 3QIAA 1F60A 4XOIA 4BGDA 2D2FA 4Q1BA 1GL7A 2QL6A 4LJ9A 1DTSA 2OE2A 2K5UA 3U7GA 5EQTA 5IT5A 2WOJA 1ZYUA 3GMTA 3A8TA 3DVLA 4ZCMA 1KMHB 2WSSA 1KZGB 3QF7A 2WMNB 1COWA 1QHGA 2OXRA 1NVUQ 3GJ0A 1IJFA 3KQKA 5E7JA 3L8YA 1DS6A 3IBGA 4XWKA 1UBFA 1SKYE 2FX3A 3PUZA 1GKUB 5L3VA 1H65A 1WMSA 3T1OA 3NEYA 2NZ8A 4BLTA 2A5JA 5FPKA 1O87A 3PVSA 1XZPA 2F3RA 3SJCA 3RAPR 3RRMA 1TEXA 5FOWA 3SN6A 1S9DA 2H7VA 2HLDA 1NI3A 1QHHB 2FPMA 4IOJA 4LC1A 4OK3A 4C0JA 1DAMA 2LWIA 4PC7A 5GJVC 3L0OA 4GOKA 1NLFA 2O0JA 2RKOA 4BRWA 4CW7A 1UF9A 1SVLA 1JALA 1JJVA 2Q3MA 3KXLA 4H9GA 5LB4A 721PA 3U4QA 2FGJA 3RWMB 3PXGA 2REBA 1ZD9A 2IXGA 4W5JA 2XB4A 3R9XA 3SDZA 2DBYA 4D0GA 2CXXA 1Z0KA 3BE4A 1IBRA 4A8JC 2UZIR 4DSUA 2OAP1 2BJVA 2OUKA 2R6AA 2QPAA 2LKDA 3NC0C 2ZR0A 4DLYA 2HJGA 1NSFA 2ZRKA 3FE2A 3JZMA 2G0TA 1F3OA 2A30A 2OBNA 3T5DA 1Z0DA 2CJWB 2FMXA 1XB2A 3FDIA 1AJEA 1E32A 1UKYA 3IIKA 2JLVA 4OK5A 2DFKB 4PC2A 1F48A 5SZJA 4A6XA 1XJCA 3BAFA 3T1TA 1G3IA 1W4AA 4PHGA 1RPZA 1I4TD 1MR3F 2YNMA 5JWOA 1SXJB 3AGQA 4AYXA 5C1BA 4BFZA 5FL3A 3K9HA 1VYTA 1VHTA 5GJWC 2GCOB 4U00A 1CJMA 1OV4A 3IBYA 3Q5DA 3C41J 1T5IA 2ANCA 2F1RA 4R71A 1U99A 3M1IA 3AVTA 2A7QA 5EXSA 3ZIAA 5JS8A 4HI0E 3THXA 2HYDA 2OHFA 2OBLA 4HUQA 2PZEA 1E0KA 3WP1B 2CE7A 1W46A 4BLQA 2CLDX 2H18A 4TQUS 4TYNA 2GZHA 3U7EB 1XF9A 1YQTA 2WKPA 3VNVA 4IOLA 1N2CE 1P2UA 1U94A 1VECA 1VPLA 2ZUBA 3L0IB 4M9SA 1VCNA 1X8JA 5FPYA 1UAAA 2P5SA 1FL9A 4YMUA 1X6VA 1E9EA 4LHVA 5EE1A 4Q9LA 5BYJA 4AD8A 2VP6A 1R7RA 4FCTA 4YQFA 5IDVA 2ZJBA 4IDPA 2PL3A 2XSZA 3NH9A 1YJ5A 5JBQA 4D4JA 4W9MC 1IN4A 1P6XA 4RCZA 5FOXA 4QM6A 1CRPA 3LDAA 1D9ZA 3TH5A 4PZZA 2YWFA 1Z6XA 4DEXA 1YR7A 4M8NE 4KSBA 2H57A 4V02A 4MYTA 3U6BA 4BFUA 5H68A 3BB4A 3Q9LA 3TJZA 2J0UA 4LJAA 2I3BA 2PT7A 3CW2A 4B2LA 3EXAA 1NP6A 2JLYA 1FX0A 1S96A 5SZHB 4PANA 1JPNA 2W6JA 1Z47A 1A2KC 1JQLB 3PUXA 4PC1A 4X8HA 1Z3IX 1N5JA 1H8HD 1ZU4A 4LV5B 1QVRA 4L16A 1GNRA 2GEDA 3QXHA 4Y0VA 3KB2A 1Q3HA 3B9QA 1IN5A 5FOVA 2QAGC 4UXIA 2XXAB 5DI3A 2GJSA 2AD5A 1YKSA 5IK2D 2XAUA 1TQ4A 1VMAA 4OHXA 2ZUDA 3TGPA 3CR7A 5H8WA 2IXEA 3FHTA 2BC9A 2PZFA 3WMEA 2ZU0C 4C4PA 2QN6A 2VEDA 3CB4A 2XX3A 3LNCA 5E7MA 3RRYA 5ELXA 2VP9A 4Q9HA 1RE0A 1T3LA 1LNZA 4LHYA 1II8B 4JLAA 3DOEA 1E2IA 2BCGY 3ND9A 1G8PA 4TQ9A 4OHZA 3RS5A 4LYAA 4R98A 1CR1A 2ZRNA 2H17A 4ABYA 2PMKA 3GJ6A 3UIEA 1NSTA 4BUJA 6Q21A 1G17A 4I99A 4UXHA 5F2EA 3U3KA 1ZBDA 4NDZA 4UJ5A 3HR7A 2O8DA 2OG2A 3L0PA 5JEDA 5JI2E 4KITB 3W8NA 3WHKA 1Z6AA 3P27A 2ZRMA 2ODWA 1PJRA 3FGNA 3I62A 1PLLA 5KSPA 8OHMA 1OIWA 1PLKA 2GZAA 3H86A 4DSOA 4Q18A 5KSOA 1CKEA 2RGGA 2ZS7A 3QF4B 3W6PA 3B8HA 4PO1A 4RKEA 3WHLA 5KDOA 1NMXA 1G5TA 4QFMA 2YC2C 4M2LA 4FW9A 3WXMA 2REXB 1TUIA 1TPZA 4B3BA 5J4KA 3CM0A 3EA5A 4FXPA 5L3QB 2BMFA 5K8UA 1MO4A 4ILEA 1E0SA 4MITA 1WE2A 2AXNA 1ZP6A 1GUAA 2L0XA 3IIJA 4EPTA 4IFEA 1G291 4S2EA 2FFQA 2IEZA 3GQBA 4RD4A 5F3WB 1G3RA 3H1TA 4S35A 2FFHA 1VYVA 3BH7A 1GWNA 2BJWA 4IEEA 4TLBA 3X1DA 2ZRPA 5EP1A 4B44A 4KSCA 1TU4A 1U90A 5GJCA 4B3CA 4DHEA 1E9AA 3RDPA 1E2DA 1Q1QA 2X19A 2JDIA 3AVPA 1XBTA 4OK6A 1QG2A 4PZLA 4TMXA 2J7PD 3KXKA 3NWJA 4JSTA 2R9VA 3AB3A 3TVTA 4X8OA 3ONWA 1JR3D 3M6AA 2X8AA 1G3QA 1UADA 2OFXA 1DG3A 4IJMA 2ORVA 4LBVA 4QG7A 1MO3A 3TIFA 3GFPA 2C77A 2CHGA 2G6BA 2WWGA 4XVQA 3T1QA 5B57C 2V6IA 3QPWA 1KNXA 1KK2A 1UKVY 4FI3C 2VLIA 1AQYA 3PV0A 3U4QB 2O8EA 4C30A 3H2YA 1QZXA 2NIPA 1UKZA 2WSMA 4MDEA 1RJ9B 5FTJA 1OHHA 3K70B 1RC8A 2G0NA 4BPBA 1CP2A 4B2IA 1OFTA 4WVFA 1T9HA 1E1RA 3AH8A 1HT2E 2FEOA 3BWDD 4F4JA 4E22A 3EC1A 1CLUA 2IHYA 4TLAA 4HB0A 2OSBA 1XPRA 3DPUA 3LV8A 2H8KA 3L0SA 3SJAA 4YMVA 1E1QA 3IEVA 2GXQA 3BOSA 1U98A 3BS4A 3J81k 1L4YA 4Q4AA 1XTSA 4D2IA 4BLPA 3THYA 2QMOA 3QBVA 1GRNA 2EWWA 4Q4JA 2N1BA 3B1YA 3TKLA 4Q7MB 5JMTA 5KNDA 4J0QA 1AQUA 5HZHA 2HYIC 1E9FA 3NBZC 4P4UA 3RRZA 4ZIRA 3AVQA 3K0EA 3LXRA 1VCOA 4DCVA 2IS2A 1NRJB 1G5PA 1GVNB 1KI6A 2ZEJA 4LBWA 4A4DA 5HKKD 1IY0A 2GRJA 2OESA 4HUQB 3K0FA 1A7JA 2BM0A 3RSOA 3KJGA 4B34A 5LPNA 3VX4A 4DEYA 3QEOA 4QNRA 4MKFA 1DEKA 4D0NA 3A37A 5G53C 3N70A 4NYMR 1X1RA 1KDTA 3DOFA 3VR5A 2FSHA 1Z83A 4LHWA 3QY0A 2WBLC 2F43B 2EFDB 3U7FB 1FW6A 2ZR7A 4NMMA 3OFNA 5HZKA 2EQBA 2VQSA 1V5WA 4CRWB 5CLLA 1OXTA 4FD2A 2VP5A 1ZU5A 4QHSA 5K8LA 1FUKA 5BN5A 1CR4A 1W48A 4DCSA 1WDTA 4XWAA 2ZJZA 2ERYA 2DPXA 2ZE7A 1QHNA 4CIDA 2V9PA 3QKSA 2J0UB 1P2SA 4P4SB 3GEEA 4NONA 4LYJA 4EFNA 4O0MA 2YJTD 3VR6A 2RGNA 1VKJA 4MKHA
chains in the Genus database with same CATH superfamily
1CZHA 1XT6A 3KB1A 2Q5FA 3GELA 3MLEA 3LSYA 1GPMA 2E7ZA 2Q5CA 2AYYA 1QHIA 2O4CA 3GB9A 3OE4A 3LWNA 2ERXA 4FFWA 2GNAA 4YP7A 4N0QA 1M6EX 1TECE 1KYYA 1P17A 5AW8A 4UBOA 2JC3A 2I4LA 4YP5A 1ZM7A 1ENZA 3CCFA 3HWRA 1GDTA 5M29A 3B3FA 4DJJA 4RW0A 4Y8VA 2KW5A 5IDQA 2NYUA 3MOSA 3U2QA 1CUUA 1NUPA 1D8TA 3TPFA 3C3PA 3UJNA 3GQVA 2Q7XA 4LE0A 1KAGA 2A5LA 2PMCA 3AU8A 5B1SA 4DREA 1AUQA 3BIJA 4QBKA 1UBRS 5KEIA 2II6A 2QTBA 4YV2A 1DQPA 4G5GA 4XPZA 4BO4A 2AL7A 4ON9A 2WF9A 4ALIA 2H2AA 1NQTA 3TRDA 4FSHA 2YMLA 5CFQA 2YZKA 1Z5UA 3SR0A 4ES6A 2R84A 5MFZA 2XXBA 4RYDA 5REQB 1NQ5A 2P27A 3RUAA 3VM6A 7REQB 1EJBA 2W58A 1I32A 2X2EA 3IV7A 5FTKA 4KR7A 1AUVA 2HDHA 2GR9A 2J6IA 2LKCA 2GVDC 3U37A 4D4IA 2H5LA 3PGMA 2P6PA 3FCOA 1YQQA 3OM1A 2BFCA 3OTIA 4FS3A 1QP4A 4W9NC 2LTAA 2VNSA 2NV0A 3FR7A 3DM9B 1Q7BA 2IHUA 3QQPA 2XBUA 4HADA 4AQDA 5L95A 2GDZA 2ZYRA 5LB2A 1C0LA 1O9GA 3CEAA 3K8QA 4IDAA 4C1BA 2MDTA 1V16B 2R5NA 4TMVA 1PBNA 2NUBA 4ZZ0A 2AOXA 3BDAA 1XZNA 1JKFA 5SY4A 1BDMA 1UODA 5BSGA 5IXJA 4RHCA 4GX2A 4ESEA 4WGGA 3HN7A 5FNVF 4H7EA 2AE2A 4ID3A 3I2KA 5CJ2A 2PSJA 1TQDA 2AG1A 1QQ5A 2IC5A 1FLDA 3C5VA 3C70A 1I36A 3WMGA 1HDXA 4ZVNA 5GVRA 4FEAA 4A73A 4CMCA 1B14A 1RBMA 3GQBB 4NPHA 1YOBA 1U1GA 2WTAA 3LIIA 4JODA 1NNI1 2E48A 2G88A 4GOXA 2VHJA 3JQFC 4UHDA 3TCXB 3DO8A 3GLHA 4Q34A 2VIIA 1NBEA 3NM6B 4UHKA 5HF5A 4YREA 3S1AA 2ATEA 1YZHA 4PM4A 4CLOA 3CONA 3C7AA 4TLMB 4H18A 5EKTA 5ELMA 2IHKA 1GFSA 3MUFA 2CXSA 4TLDA 1X0VA 3CUWA 4RE6A 4JZKA 4ZVTA 4KVZA 5HJ5A 1NTRA 3B1XA 2A0WA 4TKVB 3L8ZA 1J8VA 1CDDA 5IJXA 1X8KA 5GZ3A 3JQDA 4BPRA 2WQZA 5BMOA 3SIPA 4D3SA 3UKOA 5IAOA 1RT9A 1VCHA 1VPTA 4L0QA 5HGJA 3DC2A 3TLGA 4V0OA 3F3KA 1E77A 4WZZA 4ZEOA 2W83A 3WJAA 4AK9A 4BGUA 2XF2A 4C7VA 1ZDMA 1KU6A 4OP1A 3S2YA 4D4GA 3JYNA 2QGZA 2Y76A 3CY6A 5FXMA 3VDRA 2LCFA 3RUPA 3M49A 1KDOA 2E4WA 4WHMA 4OMDA 4ZN6A 3IA7A 3KYDB 3KNZA 3I1YA 4Y6LA 3SJZA 4F97A 4CKZA 1KSHA 1FJXA 3B5JA 1F8FA 5CLQA 2QT9A 5EP2A 1ES9A 2AS0A 2D5LA 1X1TA 1MJHA 2Y68A 3FDZA 4B85A 3AO0B 3KLPX 4L8YA 4XXHA 5CVEA 221PA 3U3XA 4M0LA 4E5UA 1ONSA 1JXMA 2R44A 4B75A 5GTDA 5IG2A 2TMDA 2NUAA 4FLEA 1L7EA 4GMXA 1IXRC 1IQRA 2JAPA 5AHOA 2NVUB 4UHJA 4V3CA 2JL1A 4LVNA 4O4IB 4GRIA 4BEBA 4UUMA 5B7GA 3FFTA 3THYB 4YY3B 2IELA 5DYIA 3PFKA 2A9FA 3PEWA 4FZVA 4EABA 3O8CA 3RJMA 5FRDA 3I04M 5TLSA 4KQ1A 3FFXA 4BECA 4ARVA 1CV2A 3G8DA 2ZI7A 1ISIA 3O7MA 2MHCA 5DFAA 3PR3A 3MQFA 1CVRA 3PIIA 3TTSA 3A3YA 5LP6C 4JI7B 1T2EA 1A82A 1J2YA 1PP4A 3B85A 3MYRA 1G5RA 2PRJA 4M0DA 1UJ2A 1MD9A 3ECAA 1D9XA 4Y6RA 1H1TA 1AN0A 1XPUA 3HDYA 2ZZKA 4LOLA 4DBVO 2RE8A 4KV7A 4JLOA 1B0UA 2O3QA 5JLAA 1LX6A 2EJWA 3G2LA 2LPMA 3G2PA 3PQEA 5EE0A 3ZJYA 4F5WA 2ZXFA 1BD4A 3I5UA 5AXDA 3TZBA 1ODLA 2ODEA 2JLBA 3H5IA 5LU9A 2YZ2A 3AEYA 2R6HA 3EMBA 4BQQA 5KSZA 2VNHA 4JNKA 4RUKA 3HM9A 2D1YA 3C5EA 2B2CA 4OUDB 1KO4A 2M6LA 3B89A 4L4ZA 2KSQA 2WUGA 2YWEA 4ER7A 2B25A 2GKSA 1YR2A 3F1LA 2AW5A 1YJBA 2EXXA 3H7AA 4MQ5A 3ZGLA 1A5AB 4MUGA 3GJ4A 3W2HA 3ZGXA 4BAZA 4C5BA 3DW1X 4JXZA 1I9GA 3KQYA 2AYZA 1D7AA 3BRWA 3GVXA 3KE9A 3AINA 4GLJA 3X1YA 3TD9A 2HMVA 2MYNA 5E6UA 5JSFA 4OFZA 1OE0A 2JFHA 2G7ZA 1XLVA 3FYUB 4R1NA 3E5MA 5I5GA 4Z1MA 4Z51A 2CMFA 4X84A 1NBMD 3HKEA 2QYHA 4RQAA 2FSGA 3R7AA 4ND8A 3BXGA 1PJQA 4ND7A 1C9NA 1JBQA 1ETHA 1LLQA 3CF0A 4GPEA 3L7IA 4LGYA 4LMRA 1J9EA 1PYOA 4Q05A 5GADl 4P31A 1GA6A 3KZCA 1EUDB 3MJ4A 1CETA 3F4KA 3FF4A 3MSXA 2H9YA 3O21A 1KIFA 4RWZA 5CVJA 2DRIA 2RGNC 3N5CA 1WUTA 2GK6A 1FQKA 2DUNA 4HGQA 3WTCA 3A6JA 1E2MA 3D6HA 4E32A 3RVQA 2HWUA 4YBZA 5K0BA 3D5QA 2J9ZB 4OIMA 4DILA 2Y6UA 1JQDA 3D3WA 1JWLA 4LHEA 3E3AA 2QENA 2W48A 2ZRCA 3HY3A 4PR3A 4MHSA 2XZTA 2JGDA 3DKRA 3KOMA 3A2KA 4QULA 4DF3A 4YAFA 3LW8A 3ZD8A 4RD6A 5BQXA 1JIIA 1JJIA 3AQIA 3OZAA 1RAIA 2WAMA 3M3PA 3F9IA 1XXHB 2CEAA 3UJHA 5JFGA 2FPIB 5DCLA 1JDTA 4B17A 4EZBA 2IU3A 3O90A 2QEQA 2XNCA 4ZZ2A 1Z6QA 4YRJA 3W2GA 2AOTA 3SC2A 4FK8A 3TZ6A 3BXXA 4XYLA 4BVGA 2AHOA 2RI6A 2PT9A 5D5HA 5G3YA 2P2YA 3SE0A 5JPCA 4P0QB 1DRWA 1ZWLA 5CFNA 2WWXA 4IKEA 1QNLA 3ZCSA 2ZJ5A 4CXMA 4CFZA 3MXTA 3QF4A 3V00A 1O08A 1R64A 2B0CA 3PC8A 1ML3A 4PCLA 3SBOA 3GLHE 1VLQA 1FYFA 2HMAA 1HT0A 3DDSA 2WYUA 2D2EA 3KU4A 4N7RA 2AVNA 3N7TA 1AE1A 4I36A 3ZY2A 1H0HA 4DQDA 3DAOA 2BJHA 4BFVA 3NONA 4L85A 2V6JA 4YRZA 1CVLA 3KM0A 4B3FX 4DIFA 1I7SB 3AEZA 3WK4A 2JBWA 1RC0A 3BWBA 5DHQA 2Y1GA 2HDWA 1JWBB 3QE2A 4PAGA 3WWYA 2HSEA 3HXTA 3W04A 3C4QA 4CCYB 1GP2A 1XNJA 1TU3A 4YP6A 2YHUA 3ZR4B 1DRVA 1E92A 1NN0A 2JJ2D 3IUQA 3WBJA 1Q0QA 2PT6A 3DEJA 3EG5A 4PBSA 4EMBA 4CF4A 3EVNA 2FZEA 1N8TA 2VH5R 1SK8A 3A1UA 1Z26A 3OC0A 4PF1A 5DGXA 5CCDA 3M4YA 2H2IA 1CIPA 2G83A 4H7KA 2O5VA 3NR2A 2ZB8A 1W88B 4R8VA 1YJAA 1QV9A 2I5PO 2VHEA 3JY6A 4PSVA 4TMZA 4UD6A 3QFTA 1FTYA 3LECA 1L8AA 3D8RA 5LFAA 2Y4OA 1UXGA 1RXEA 1RZUA 2UKDA 3FJYA 2QM8A 2IEIA 2M6KA 3EZ2A 1ZGJA 4MV8A 2YCLA 4OHRA 1RCTE 4RA6B 1R0XA 2E3JA 3LY5A 4LHZA 2C4VA 4E2XA 4J9UE 3K96A 4G26A 4NJMB 3AUUA 1AHPA 1Q0TA 3WGUA 4LQCA 4LZJA 5JXJA 2A3NA 5ESRA 4MVJA 5C9ZA 4INPA 3D4OA 5KX5B 1EVEA 1O9BA 2AMLA 3EDRA 2PKCA 1S3SA 1RJ9A 4KUHA 2WJHA 5BQ5A 2ZT8A 4NZNA 1DQSA 2JIDA 1KQ3A 2OGWA 1YQGA 2O05A 2XCRB 4C4RA 3OCZA 2D8AA 1GPUA 1UK7A 4IW3B 3A4MA 1JVBA 5F4BA 1QE0A 3IGFA 2M6SA 4TXHA 4C21A 1SKYB 3EVAA 3S1SA 4LJKA 4MMYB 1T3HA 2YKGA 4TL7A 3VR4D 3GVCA 5JQGF 3JD0A 1XDGA 1KP3A 2FSPA 1CJKC 4NIMA 4C5CA 1VL5A 3LCCA 4YRPA 3OQMA 3V4OA 4YP0A 1EFRA 3M83A 3U3OA 5TQJA 5DIZA 4W8HA 1R6UA 1T9GS 4DQXA 4E51A 4UVHA 4A7PA 3VBEA 2C5FA 2HHCA 1L0BA 4PSKA 1Y63A 3SQOA 4TUYA 4WZAB 3RHSA 4QM7A 5AESA 3VDNB 4EO4A 2RG7A 3C1OA 3IEXA 2BZ1A 2V7QA 2GJ8A 3L7KA 4OOEA 4ZWNA 2VS1A 5CJJA 2OD2A 3ORYA 1E6UA 4K9LA 1JFFB 1F3LA 3M6FA 3OZCA 4DG8A 2PANA 2WU1A 2P4UA 1OOEA 4D99A 4D9EA 3I9V6 2QQEA 1SKQA 4YRFA 3RD5A 3DKVA 2WIBA 2FWRA 4WFKA 4EVIA 3F2IA 2A4KA 1V11B 3IHWA 5AUNB 5EXTA 2RGBA 2ZBQA 5FA5A 3W2FA 3OP1A 4AZ0B 4ENUA 3GLFB 1KNQA 1X15A 1ISPA 3EN0A 3T5MA 2WT4A 5DYNA 3UBTA 1ISGA 1Q3TA 4FUQA 4I1YA 5GMOA 1QH0A 1GL9B 4CR7A 4BMZA 1IJKA 3ACCA 4DYHA 1M7GA 3KKQA 1BQEA 1ZN2A 2W11A 3GX1A 5AHKA 1NVFA 5I7RA 1JN0A 3PD1A 4LXIA 2JA1A 3NNSA 2AX3A 1I1OA 1H1LB 3CSUA 2G1KA 1HDZA 3BMNB 4ZI3A 2X5KO 4DE5A 3K4PA 5HA5A 4RZIA 3OTHA 1TU0A 4PBTA 5GVSA 1U0JA 3GGSA 2R3SA 1YDMA 2O1SA 3C8MA 1JIJA 5E9JA 4DB2A 1E7QA 3AG6A 1PHRA 1KMQA 4C0HA 4DDKA 3GRCA 5AOBA 1IWPB 3ZEAA 4F4UA 3AHIA 2BKUA 3TZHA 3ZOZA 1ZI9A 4DG9A 2PUDA 3LOUA 2CLMB 4YLYA 4Q4DA 3UCEA 1H6CA 4AO7A 5ELLA 5AM3A 3AETB 4JJZA 2HEGA 3JQ6A 1TDJA 1V7CA 1ZM9A 1JQ3A 1II9A 1MX5A 4NK5A 3WJ7A 1AHHA 3I9KA 3K9NA 1DGQA 3GVIA 4TZ0A 2FKAA 5IM4F 2BI8A 2BKEA 2C3PA 2I7XA 3D2AA 5BPHA 1WZIA 2FN8A 2BHNA 3H0CA 4MMXB 3MVEA 5CPBA 1E3QA 1JXAA 3OEHD 3PJEA 1WZUA 2X14A 4KRGA 3KUKA 1C8LA 4J49A 4AJPA 2YRFA 5LDHA 1MVLA 1Y8QA 1ZUWA 2HGZA 3I9FA 3LQYA 4KAAA 4WLEA 1VI6A 2BMVA 3N6RA 1O94A 3D6NB 1N2IA 5FFMA 3V55A 3DEHA 4GVXA 2BM9A 3GVPA 2FSUA 3ZV5A 2Q5EA 1U2PA 2VPQA 2PSSA 3V1MA 1OKKD 3G9XA 3NCHA 3LXXA 2XB8A 3TD2A 3MGCA 1R6DA 1YAHA 1Q5PA 4FBLA 4IH9A 5AWFC 2CMGA 4GRAA 4DCPA 1ZN8A 3ZJ4A 1VGVA 4EM6A 2WVJA 1D6MA 1S02A 3EY4A 3Q3CA 1CHDA 1EFPB 4YQZA 3ZK7A 1CR2A 1JP7A 2A7XA 5ECGC 4GE0A 4KWHA 1G4HA 2FJPA 3UOWA 1OZGA 3WBBA 5A1TA 5C8ZA 3QOFA 5E6SB 1KIMA 2RHGB 5BV8A 3M34A 4BXOA 4NNOA 2XOKA 2NP6A 3ZV4A 4MWCA 5DEIA 3BH6A 5CH5A 1IEWA 2JGIA 3H11B 4LUCA 2H0RA 4ICIA 2VK8A 2WHEA 3IBSA 4N03A 2Z8ZA 5EP3A 1KOLA 4KRFA 2PXXA 2RC6A 1AB5A 4PS1A 1KRWA 3E03A 4AULA 4LYEA 4I9GA 1JG2A 3LX5A 2FG6C 6REQA 1WF3A 4FD3A 3CR3C 1ZA2A 5BPFA 4MTCA 4KJXA 2QE7D 3BFKA 2YWCA 1XEXB 2HK9A 5I48A 1TVEA 2QTFA 1JFSA 2R00A 3LUBA 4ZCSA 4TMYA 1FFDA 4F4FA 1LCIA 1N6KA 1NLYA 1TZ2A 2XUDA 3IAAA 2I4NA 2QG4A 5JC1A 5AXBA 2OBMA 3DE7X 4KIFA 4K9RA 2PXCA 1L1EA 4D4MA 2NTJA 1MB4A 2O2HA 4N18A 3DXZA 5TQ2B 4WAUA 3MSCA 3C98A 4JSYA 1HTWA 4YXWD 1U9CA 3ESBA 4YJFA 4JJFA 4CT5A 5H0IA 5LQJA 2JIZD 4EBBA 2DWPA 4JP5A 3AI1A 3RG8A 3TQSA 1NI5A 4I08A 5CITA 5IYZB 1BO6A 1V7QA 4OHKA 4C2BA 4ZGBA 2FMTA 3NXKA 1RRKA 3JQAA 3W5DA 1HNXB 3H75A 1K7FB 3ZE6A 4MWZA 5JTUA 1VP3A 2ZDHA 3PCRB 2IHTA 3KOZA 4MCIA 4PRYA 4W9RA 4ODIA 5DW0A 1F5NA 1SUWA 5L45A 5KYNA 2H1IA 3MINA 1WR8A 3X1ZA 2B1RA 4UNPA 2NTEA 4W1PA 3DE5X 4L78A 4BZXA 5J9FA 1HYHA 1PYGA 1MRZA 3EWAA 1XQXA 3S8MA 3BFPA 3IT0A 4MVJM 3X2EA 4EQZA 4QVKA 4TQGA 4UHEA 1XWFA 1TUGA 2ZYIA 2BBWA 1BW9B 4IDEA 1MABB 3I39X 2WAOA 2Z8YA 3DTYA 3KETA 5E1OA 5EEHA 1GPKA 3TBKA 1UBTS 2BL4A 1Q84A 2VQEB 1SBYA 3LC2O 4KDFA 4ZGGA 5JCOC 1BE1A 4LDQA 1E1KA 3TDKA 1ZL0A 2EERA 1BVRA 2A58A 3PKZA 4G1VA 4C07A 1AS0A 3T34A 3RU7A 3M5WA 5LNK1 3WC4A 2FOXA 4HATA 2YH2A 4Q4HB 2J0SA 2NU6B 4R5MA 1PR6A 4ZK6A 2ISSD 5KJ1A 1Y1RA 1D2NA 1Q0PA 3ND8A 1E7YA 2WTBA 3N5KA 4IV5A 4XDZA 4Z4FA 1KFKB 2VOEA 5FBHA 2XWSA 4MW2A 1FVFA 3BQNB 4OPMA 4P34A 5B6PA 4PHFA 5FOSA 1LK0A 3RAEC 4JP1A 2KX7A 1DPFA 1WMDA 2QGFA 3BCUA 4NECA 3G6WA 4JLJA 1DQZA 1JW9B 1A5ZA 1HKUA 2BGJA 4RNCA 5DSTA 1OF1A 2PRSA 1LJ8A 5D84A 3R8CA 4Z4CA 3MC1A 4QUAA 4HN2A 4QBIA 4S12A 5J2TA 1P1FA 1YB6A 1L5VA 4KFTA 1VSUA 2QN3A 4MO9A 4TLLB 2JFFA 2Q3LA 2TS1A 3GG9A 4H17A 4K6KA 4E5VA 1OPRA 2F59A 4EA9A 2WHXA 2ONCA 4RPCA 1UPAA 1QSGA 4V24A 4Q00A 1U1IA 2CVOA 4UU7A 4XGKA 4LWZA 1KYIA 1Z4NA 4BFSA 2WA2A 3CUEF 1OXBB 2J1LA 1AKNA 4ZAVA 1XJWA 3E81A 4QU9A 4V0MA 2D0OB 2CXQA 4P84A 4UAVA 3Q0IA 4BNWA 5B12A 4A0FA 3UQYS 2ZCVA 3R4CA 4HLUA 4HUJA 1ZNWA 4Q48A 3ZS9A 2LP4Y 2OKCA 1K5DA 1JEJA 2ES4A 3OQBA 2FEWB 3F3SA 3NHBA 3KL2A 4MW6A 3SYTA 2P2SA 3KOXA 2H11A 3F6SA 1LD3A 4HWRA 1LTQA 5BN1A 3DAPA 2QGNA 3LRXA 3JX9A 2J3JA 1CBUA 1X2BA 2X86A 2I9KA 3Q9UA 1RAAA 1UC9A 1NI4A 4ASUD 4TMFA 3MTDA 1L2TA 1X77A 2I76A 2ZAIA 1E96A 4H59A 1LLDA 4QGGA 4ER6A 4GNRA 3B1FA 1QAMA 3H04A 2EW1A 2CEKA 4UEJA 4XWTA 3PYMA 4U39A 5JZOA 3OO0A 1WM1A 1MEEA 2R8EA 1GTRA 1RXCA 1B26A 1KYVA 1PT6A 1NY5A 2QVGA 3KR2A 3KVYA 5A9TA 1DKLA 1GCIA 1Z38A 2WJ3A 1VXOA 1DJQA 5KVQA 5IFLA 3UJ6A 1GT91 4MAMA 2ZLBA 1CVIA 2X6RA 4HSEA 1QHYA 4C7OB 3I2IA 3DGEC 5B3JA 2NG1A 4OQMA 1UXIA 1ZK1A 1W25A 5EKSA 3UJ3X 2GCPA 1MHPA 4N3GA 3FPHA 4XVRA 1EI9A 4EMUA 2VQFB 1GSHA 2OV8A 4KX5A 4OFBA 1Q91A 1HYEA 1OBCA 4R83A 5CIQA 5DOVA 3T0GA 1NJGA 2FG7C 1QK3A 3D2BA 4ESHA 4R8SA 2BHTA 4MYDA 3GJZA 1CZUA 2DFNA 1DE0A 4XR4A 1VE5A 1ESNA 2V9CA 4GZ5A 3ABSB 3V2GA 3RM3A 3W90A 3USZA 4K1LA 4TTSA 121PA 1AV7A 3WGTA 1XD2B 3LA6A 4E1AA 2PLNA 3CQ9A 3I72A 1D2HA 1HO3A 2Y1KA 3MWYW 4PRKA 2I2BA 3U3MA 3CW8X 3BFVA 3D1VA 4ECAA 5K0TA 4BB0A 3HA2A 1WNTA 4Q1CA 1ORHA 3H4IA 4BN4A 3ZYZA 3K9WA 2XRFA 5TPZA 5ALPA 3OU7A 3BULA 4GQIA 2XXAA 2VJCA 3LT1A 4DIMA 4FMDB 2I54A 1XVAA 2ZETA 1P60A 1Z5ZA 3AIOA 4FYJA 3KJIA 4NFLA 4PG5A 4UD2A 3L7OA 4ALNA 4B1FA 3NFYA 1NG9A 2W2QA 5EPEA 1U0BB 4GC5A 1PVDA 1P2GA 4KXFB 3F6BX 5K0LA 4GGMX 1UIMA 4POAA 2PAFA 1RC1A 2NADA 4G1FA 5E38A 1L4LA 2PBFA 2WMDA 1CUIA 2JI6A 1G7CA 2HA7A 4BEWA 3GFRA 2XUFA 3SX2A 4PVCA 4HAVA 4HKTA 3MWKA 3R7WB 1JLLB 3HUEA 2I6SA 2A2ZA 3IP6A 4R54A 3U44B 3ND5A 4HEA1 1QHFA 1Z4QA 3DFFA 3NAQA 3VI4B 2QVZX 3O2JA 1BNCA 3AUTA 4N3NA 3SBXA 1PO7A 1G20E 1RAFA 2I62A 2VTDA 2IH4A 3QKRA 1ZXBA 2QTRA 4KLZA 5ALXA 3WVNA 4IRXA 5DLEA 4UM9B 2XRMA 1WP9A 4L50A 2N46A 2RHJA 2JFXA 2WJJA 5EZYA 5HFAA 3HR8A 4DIEA 2O5CA 1QYIA 2FYTA 1A50B 4D43A 3K05A 3O38A 3EFEA 5KMGA 2OCDA 3ANXA 3KZ1E 4HQKA 1EK1A 3TL2A 1RKQA 3ZVNA 1NL3A 4Z9XA 1J42A 2NYAA 1Q74A 1FS6A 3D5TA 1RWQA 1F2TA 2JANA 3MTAA 4OHOA 3PDIB 3KTDA 1X7ZB 2G04A 4ZPXA 2PZBA 1QGOA 3U9LA 5KC8A 3T9AA 4X93A 2WTUA 2NT3A 4OHMA 4MHTA 1A8HA 4DMUB 2VAVA 1DC8A 4M21A 3OWOA 2GKOA 5A3RA 2V03A 1KJIA 3B13B 3C85A 3QELB 2WSSD 4G36A 2YBDA 3E8MA 4EL0A 3JYOA 1L5QA 1TC2A 2Z5LA 2FUKA 1MAWA 2CXUA 3PX3A 2NPOA 4ENSA 1DKQA 1PYDA 1WZCA 1E1CA 4NV0A 3M6VA 1OH5A 4KVFA 1OPXA 1Y3BE 2GZ1A 2PIAA 3HDHA 4MA0A 5ENVA 4ZFNA 2QLFA 1WQ1R 1N2HA 4OCZA 4EB0A 4X1OA 5AI8A 4JHXA 3I2JA 2RH4A 4KXYA 3H8JA 2A9KA 2QXTA 3I6QA 4O3FA 2HHJA 3JVIA 5JCJD 4EWLA 4OQXA 4J0EA 3BZWA 2VHQA 3TZQA 1CNMA 2QDKA 4X85A 4WZ6A 4HC4A 3Q3GE 2VF2A 4LK3A 2PFGA 1UH5A 2BUAA 3DJFA 2DFVA 4L73A 3RJ5A 1GG2A 2NXNA 4D6XA 1T3SA 1F12A 1JIQA 3TOXA 3BMXA 3QPBA 1T2VA 2J7PA 2VBCA 1IHOA 4IMIB 5IBQA 3WR5A 1SVMA 3WYGA 2D1FA 3C8ZA 3VHLB 4V0ME 3V8RA 2E82A 2FEPA 4OJQA 5JSYA 4DWWA 3I34X 1H2AS 3HB4X 3IKVA 1NR5A 1ZFNA 1NVDA 2E89A 3IQZA 3OWXA 3AY3A 1ELOA 2AFHB 5ALWA 1AGPA 2IIQA 3ZDRA 4RK0A 3K5WA 1O6FA 2WR8A 5K09A 2JCXA 3K0HA 4IIFA 4Q3EA 2IYLD 3CRZA 2AJDA 3UWMA 2LBPA 2JCYA 3C24A 5DBIA 2R6CA 3K0AB 4F2WA 1VHDA 2MR5A 2X4GA 1E2UA 5K9ZA 1S2MA 4FE3A 4P4TA 2VKQA 4MIYA 3W4JA 1MBZA 2G71A 3DWGA 3H65A 5TS2A 2HW8A 2B5OA 5C0OE 3O83A 3ZCXA 4Y7CA 1ZD8A 3EIUA 4QYMA 1CYEA 3SFZA 2GI4A 2Y0CA 5C7LO 1XELA 5DNEA 1JA1A 1FRZA 4RK1A 1VBMA 3AZQA 2RKWA 3FVVA 3H9QA 1Z39A 4M22A 1XPRA 1GCUA 2HSJA 5IJ0B 5JD4A 3LT5A 5EVCA 3AP3A 1I4LD 4AYTA 4P22A 1VRCA 3G8BA 3WHIA 5AW7A 3CEPB 1LQ2A 1XYGA 4PG6A 4LHSA 2EBHX 4QNNA 2B30A 1W4CA 4KSYA 4Q03A 1M0TA 2OCPA 2A0XA 3ADKA 4K6HA 2Q5LA 1VSTA 2Y1OA 4WOCA 3OLVA 3COVA 1ZM2A 3TI9A 3QG1A 5D85A 2C2HA 1W49A 2Z9BA 4KBYA 2CVPA 3W34A 4K6FA 5GIPE 1E9CA 1J09A 3B2QA 2DECA 2NZJA 3JAMA 3QEBZ 1HL3A 5FEMA 4DM3A 4MW7A 4HX9A 5ECYA 4G8DA 2ZRAA 2NVWA 1TJ5A 3I64A 5BNFA 4JUCA 5IKPA 2CB0A 3KQHA 1OLUA 3C6BA 5KU7A 1U4SA 1P19A 1IQPA 3RFVA 1JFVA 4B6OA 2PEYA 1N3BA 2BGGA 1P5ZB 1RM3A 1M2VA 3DNMA 5K4GA 1YK1A 1TCUA 4UEKA 3HCCA 3OM8A 1MEJA 4OJMX 4E08A 2CC2A 4ZEWA 3NGLA 4G3XA 3W5AA 4G0QA 4P7KA 4QZVA 1UK6A 4JENA 4FC6A 1V41E 4B2YA 3PT9A 1GV1A 1IL0A 1TMYA 2ZCUA 3H5NA 4KN6A 1A2QA 3HCPA 4KTVE 1X1EA 2Q3DA 1RS0A 3WLSA 3O8LA 5LZ7A 3JASB 4CCAA 1FXUA 2BTOA 1JG6A 4EKDA 4AMBA 3T5BA 3QLUC 3PBKA 4CUZA 4EI8A 4EF5A 1KOFA 3KX2A 5CB6A 2GCGA 2OCAA 4BB5A 1DJOA 4JDUA 3DLIA 1TM3E 3DZDA 2C1EA 3FWPA 3CE9A 1LS1A 2G9QA 4QFCA 5CXSA 5COQA 4ETWA 4EIWA 2HRBA 4DMMA 3NIWA 1QCZA 2WP0A 5GINE 4FP9A 1RABA 3DDZX 4OSPA 4PBRA 1DBPA 3OOSA 5SICE 1UFQA 2BCJQ 2QRNA 4IZHA 3EGCA 3MERA 4C3VA 2KPOA 4NBKA 1P3Y1 3KTAB 3SQLA 4G5RA 2DSTA 4EUFA 5K01A 2AOUA 1E2QA 4TKUA 4IFTA 3RT1A 2G0AA 1HKHA 1FTGA 1T2DA 2C42A 1DBRA 2MCFA 5CB8A 4IUCS 2PL5A 3THWB 3MOGA 3UICA 3HJFA 3ZDAA 4WI1A 3R09A 4YXFA 5F1KA 4DA7A 4EGFA 4H2DA 3SR4A 5LIRA 1WQ3A 2Z56A 3A6HA 2K2QB 3HDQA 3NZEA 4XWGA 1JIKA 1IXYA 4U9IS 4OHWA 4W5WA 2HTFA 1V2GA 2WU4A 4WOBA 4J3NA 3V32A 2I78A 2IYNA 2WOOA 1G5HA 2I22A 4AMGA 4D82A 1DC3A 1VG1A 3SOPA 4JP2A 3WYAA 4E5PA 2BTEA 4HB2A 5CNJA 4BGIA 4IEIA 2XA9A 4XM1A 3QLTA 3BD6A 1KH1A 4LHXA 4AAYA 5AK6A 4F6CA 1N0IA 2BFDA 1DRKA 2BEUB 4GX1A 4LIPD 4GXRA 5FNVB 3C3MA 2RK4A 2ZRGA 3KJQA 2HF8A 2UZ1A 4MI3A 3RKRA 3T5TA 5LWHA 1HSZA 1W0KA 5HUJA 2XYPA 5G1PA 4RABA 2XTNA 2Z4RA 1ZESA 4PIVA 1FDSA 3GHYA 1V7ZA 1SK9A 3PHCA 2WIAA 5DIFA 2PQ0A 1YKFA 4Q3LA 1TYAE 2ASEA 4M46A 1BOFA 2XPCA 4PQGA 4MB2A 3GEDA 1WV1A 3V1LA 2Z6QA 2WM9B 3CKLA 1R6TA 3Q87B 4WXRA 1BEZA 1MIOA 3I2FA 4FHDA 1D7OA 2B98A 5EJ4A 3O94A 1P6QA 3FSJX 1PJBA 1V96A 2J30A 1EJ0A 2R6ZA 4IWYA 4NU0A 3LCMA 3G0HA 3E2IA 1ID8A 4AM8A 1Q19A 2XY4A 5B58C 3JAKB 1OUMA 1I4WA 2DWCA 3DFZA 3G8AA 3H5OA 3I0MA 3PDUA 4UMEA 1J97A 4ZGWA 1KBZA 1M6NA 5A0VA 1IBSA 2JLQA 3OPMA 1NW9B 2OVFA 3EDMA 4YBRA 1XTTA 4DVGA 1DCFA 4YN3A 1XMVA 4PYIA 5HZMA 4X66B 1B16A 3Q5EA 2DLNA 4WLFA 5DGIA 3RHZA 1WCXA 2RI1A 2FXVA 3AGPA 3OQIB 2FZCA 3ADCA 3PJRA 4JLDA 4IINA 1VG9B 2R79A 5K51A 1E3WB 1EZ1A 4MS4A 4JEIA 3MBKA 4GNKA 1QTIA 5JNRA 2PQMA 5K0GA 3NHUA 4BLSA 1IONA 2EW2A 1X3SA 2QD5A 8LDHA 3QV1A 3HKDA 1E3LA 4HD8A 5EJAA 3UAYA 2B1QA 2GBFA 1IH8A 2IYRA 1ZR4A 4XEHA 2ZJOA 3RADC 2OHVA 1ORRA 1DFIA 3VA7A 1XD8A 1IUPA 1GXSA 1LRJA 2ZBRA 5CAEA 3SZGA 3JYPA 3NJ8A 3DVAB 3FM9A 2V0CA 1P2DA 4HTFA 4PZ0A 1OFVA 3JD1A 2P9BA 1GQSA 3QHQA 4LZWA 3VYUB 4DCOA 4AURA 1OHHD 4MLPA 1F7UA 1QQTA 1TADA 2P2LA 3KWLA 2HRCA 1B7GO 5HMLA 4NL4H 3A9UA 4I8IA 4TTVA 2YOFA 3VH1A 5KYXA 1E1RD 2D1TA 4I8XA 3AF0A 3KJNA 5HOQA 4HBZA 3K6KA 4LRSB 4BO8A 1XZGA 3GA0A 4MOWA 2GK7A 2J3QA 3G2IA 1EXWA 3KKNA 2X5JO 3S3TA 3HJBA 5EIOA 2CK3D 1K7CA 3I1FA 2C2MA 4QVGA 3OOJA 3IQWA 3CUSA 2QUIA 3PGXA 4YI3A 1HE5A 1G7RA 4CFYA 4PO9A 1Y33E 4LF8B 1M1YA 2AYXA 2EZUA 4TZTA 4AP6A 3DDCA 5C4IA 4NXMB 2GN8A 5E0OA 4DCCA 4IH1A 4IUYA 3T5AA 4EQ6B 2IEAA 2IGBA 3K8ZA 3ZGVA 3CMCO 2WKWA 4IIXA 4OH7A 3DS8A 4XD7D 3WNCA 4G9GA 1GAXA 1GOTA 1T2UA 1BQ3A 1C7FA 2FF5A 2OV1A 4LDJA 5EYPA 2FSSA 3L4KA 4HDMA 3WWZA 4K6OA 1XTUA 1EPUA 3I4CA 4KDCA 3L82B 4C22A 4LRXA 5FR1A 3OZXA 2ZRBA 2BR5A 1G6HA 4RMJA 4C7MA 4K81B 1OFUX 3EISA 4G5YA 4I1IA 2YZNA 1M2OA 2G8LA 2ZRHA 3AEKB 3QOXA 3RE1A 1KZYC 2WD9A 4HAIA 2O4UX 1XNRB 5MN4A 1NF3A 3LKDA 1UPUA 3H1GA 3OZBA 2HT6A 1K6JA 2XNJA 2BWJA 2ZQYA 5CYGA 1IPEA 1NBOA 2EFEB 2GTPA 3WJ1A 1GGJA 1EDOA 1WUHS 3BB3A 3IUYA 3LE8A 4O4JB 4LCEA 3VR5D 3NHAA 3U4HA 3LPMA 3Q4GA 4TUYF 4AKEA 2I0FA 3LUHA 2AF3C 1US8B 1V8ZA 5AK0A 5TMPA 2LDXA 5FBZA 4FFSA 3ZJTA 4HDRB 4MR9B 5CPFA 3EVDA 1X9GA 3PPYA 2EZTA 3V8NA 1Y1KE 2XCSB 4PZEA 3QXXA 2B4YA 2H1FA 5LMNB 3VV3A 2P5TB 1KDPA 1J8YF 1HE3A 2RGUA 3A3OA 3KPVA 1SQGA 3E7XA 3NGXA 1Q7EA 3S4YA 3LUJA 1I8TA 2V5AA 3CX6A 1ORWA 2E5FA 3HGTA 3PFFA 5FFNA 3KUUA 3FBTA 2FEMA 2E5WA 4L27A 1FYVA 2ATXA 2IF0A 4D46A 1THZA 3EIXA 5B3LA 2O8VA 2VDRB 3SAJA 3ESAA 1RKBA 1Q0HA 4U3JB 3FFBA 5ESXA 4L76A 1DQNA 2BELA 1UDCA 4RPKA 5TB5A 2ORED 2FPPA 4OQNA 1O96B 3V8EA 3IRVA 4G85A 2VH2A 3QVKA 3FYHA 5BYBA 3SYRA 4Z4QA 1ZMXA 1I4DD 5C18A 5CU7A 4ZCLA 1KPIA 5B2FA 1ULHA 2VHUA 3LFTA 1JPJA 1WEHA 2C3OA 3Q8MA 3OMXA 2Z9DA 1R0LA 1UJ5A 1XZHA 1Z6YA 3TB6A 3PXEA 5BXQC 5F76A 2CE2X 4M7RA 4O29A 4RY9A 3GT4A 5E8JA 2B1IA 1Q1ZA 3RAJA 4KYVA 1ZRSA 2HJ9A 4B43A 4DV3B 3NUQA 4GBGA 2WVHA 2C8LA 1ODTC 4O02B 3ZTWA 5FWXB 1LTKA 5BO5A 3EJWA 2P6NA 4MKZA 3RV4A 2TRSB 2ZIVB 3IE0A 1P7YA 2W0MA 1OXSC 1EGMB 1FNMA 2D54A 2H0AA 2PGJA 1U3UA 3R2JA 3GP8A 1W7AA 1UBUS 4CF3A 1KZ6A 3E4CA 4A5OA 5HJEA 1BCSA 2HJVA 3GEBA 2QTNA 1AK2A 2Q9AA 2WSYB 1XP8A 3HLTA 3ZH9B 3H8SA 2ZRDA 4BC1A 1TFUA 4RKFA 2PX2A 2XQVA 3RVSA 2XWPA 1G8GA 4HZUB 4KHZA 4L8WB 4N3AA 3ER9A 2NT4A 3MRSA 3PQ6A 3AF5A 1PL0A 1THTA 3L40A 3EVGA 4U2DA 3RYIB 3TRFA 4MYHA 1NJ8A 5AKEA 3JVUA 1HORA 3UWOA 4UBJA 3ZZNA 1JDUA 2QV7A 4Q1AA 3LU1A 3BMQA 3PC8C 4LEIA 2VTBB 1ZVVA 3FF1A 1G21A 4LX8A 1E6EA 1X80A 1FY2A 3A70A 2BFOA 4EJSA 4IIJA 3QBEA 1MA0A 2IZ1A 2XDQA 5BV1A 1FQWA 4BVKA 1YV9A 5A6SB 3B9BA 3GAAA 3WWPA 4F3KA 2VSYA 4YS6A 4KQFA 5AK3A 3F3YA 1ESCA<