3FDIA

Crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
161
Chain Sequence
b'QIIIAIGREFGSGGHLVAKKLAEHYNIPLYSKELLDEVAKDQDIAIRQFNFIRKKANEEKESFVIVGRCAEEILSDNPNMISAFILGDKDTKTKRVMEREGVDEKTALNMMKKMDKMRKVYHNFYCESKWGDSRTYDICIKIGKVDVDTATDMIIKYIDSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Eubacterium ventriosum
publication title Crystal structure of uncharacterized protein from Eubacterium ventriosum ATCC 27560.
rcsb
total genus 48
structure length 161
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13189 Cytidylate_kin2 Cytidylate kinase-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fdiA00
1JR6A 1P60A 1U0HC 2ZAOA 5AUNB 1XJQA 2FV8A 1MH1A 2XEXA 2ZRJA 3P1JA 3QXSA 2GNOA 3RS0A 1VYTA 2IYYA 2QU8A 3EA0A 5GJCA 1K5GA 2OBLA 2R62A 2G6BA 1E9DA 2UVQA 2QTVB 2A5YB 1CU1A 2F1IA 3K8YA 4I1OA 4Q5IA 1A7JA 4IEEA 2QROA 2QORA 1KMHA 5CLLA 2EU8A 3CPJB 1DAIA 1DAMA 2CMKA 1C1YA 3BXZA 1G17A 4HAUA 4KFSA 1KI1A 2OESA 3DO6A 4DSNA 2XZPA 3LX8A 3GJ0A 3NC1C 1NSFA 1PLJA 1NKTA 3GLFA 4MYUA 2V6JA 3TH5A 1R0XA 2WJJA 4D0GA 1RJ9B 3WP0A 1XX6A 4BGDA 2PCJA 5FBWB 3GLHA 3LD9A 4W9MC 2VTKA 5KNCA 4MRPA 2ORVA 1Y63A 2I3BA 2X1VA 5FFMA 4MDEA 2AKAB 3I1FA 1DPFA 2W6JA 4ZIRB 2IL1A 3SHWA 3ZZUA 3BIFA 4HDQB 1X8KA 2PT5A 3KKPA 3TUIC 2HCJB 1VG9B 3E2IA 2GETA 1MO5A 4HATA 4JLKA 4UNPA 1YR8A 2OZEA 4R71A 4IOLA 1WA5A 1R4AA 1NVVQ 3C15C 2QPOA 1XFAA 1WBBA 3GJ7A 1AGPA 4ZKDA 4LBYA 4XJXA 2QG6A 3RS5A 3ZS9A 1OXSC 1L4YA 1KHTA 4JLMA 1JR3D 3DZDA 2JLWA 3FOZA 3LVRE 4M8NE 3SJBA 4GMDA 4CT4B 4Q00A 1ZIPA 4TL8A 2VHCA 1DE0A 2MMGA 2C99A 3B1VA 3QENA 4IOJA 2CEAA 1IN8A 1KKMA 2CNWD 4DCTA 3U3KA 4TYYA 3HYRA 3VR6A 4MGYR 5HZKA 4NU0A 2ZRFA 3MFYA 4PPQA 1Z47A 2IS6A 4JLAA 1Z3IX 5TB5A 2QAGA 3CH4B 1VECA 2VP4A 4BUJA 2I1QA 2QP4A 3DL0A 4Q9KA 4TTRA 2GXUA 3QBTA 4MRNA 4BFZA 2IW3A 4IRUB 1GOTA 1QVRA 1R10A 2KJQA 2GZAA 2ZJYA 2QEQA 1I4LD 1GWNA 3KZ1E 2FZLA 5JSZA 4O2LA 1UBFA 1S2MA 4HI0E 1SXJC 1JAIA 2QPTA 4AG5A 3RABA 3UG6A 5BN4A 3TIFA 4LJ9A 2KWIA 121PA 5AUQA 4AK9A 4WVFA 1E1QA 3SHFA 2PT7A 2ZRNA 4PAMA 4DZZA 3RC8A 3KXLA 4CEIB 1LS1A 3WNDA 5SZKB 1Z2CA 2YOFA 2GCOA 3CWZA 4DDWA 3MGCA 4XVUA 1YHNA 1P2SA 2O0JA 4PO8A 2OBNA 5CYOA 1P4SA 4DB2A 2W58A 4HAXA 3GD7A 4F93B 4QNMA 1SGWA 1KSGA 4AYXA 1G21E 4DUGD 3NHAA 2ATVA 2CCJA 2VP0A 4FMBB 4AWXA 2XTZA 5JS8A 4BFVA 1IY0A 1FUUA 5BXQC 1UEJA 3PUVA 4ZDKA 2ZAMA 5IRCD 1K8RA 4D80A 2AK2A 2QAJA 4RCZA 4C0AC 2WIAA 1E2MA 4GSYA 2OSBA 4ON9A 2ZE7A 5TARA 3EA5A 1F3OA 5FPYA 2RGDA 4C0HA 3MRSA 2VP9A 1GFIA 2IA5A 4RD4A 2P5TB 3ADBA 3J81k 3B6EA 3NBXX 4X8MA 2GEUA 4EJSB 1Z0AA 3DKPA 4TQUS 1KO1A 2L0XA 1U0LA 2VIIA 2ZETA 3WRYC 3MAAC 1N25A 1NVXQ 4DDTA 1U8YA 1MRSA 2WMOB 1VYUA 4JZKA 2WWFA 4NYMQ 1H8HA 3TE6A 1W0KA 2ZSBA 3TVDA 3LX5A 2REBA 5TDHA 5EP3A 1XXHB 4ARZB 3MWKA 2WV9A 3G82C 3KKNA 5EP2A 1G5TA 1AKEA 4KSCA 1FX0B 1JXMA 3LLMA 2GEDA 5BN5A 4DB4A 2OFOA 3LNCA 2J46A 3L0PA 4IVQA 1NVUQ 1M1YE 1R0WA 1RRGA 1JQLB 1SXJE 2ZSFA 1KZGB 1AQUA 2J0VA 3DVLA 4P33A 1I2DA 1R0ZA 1U94A 2ZYVX 3PJRA 5KHOC 5E3HA 1OXXK 4WZ6A 4PFSA 4XWAA 2WJIA 5FOSA 4QJ4A 4LBVA 1II9A 5TXGA 5FL3A 2HXYA 4M1MA 2EYQA 3WMEA 4FWTA 2YKGA 1K5DA 3KDSE 3AF0A 1RRCA 3T1VA 3TJZA 4IDPA 1KYIA 1VMAA 1WP9A 4GOXA 4N0DA 4JVNA 1WDTA 1DG3A 4GZMA 3QPWA 3T1QA 2A2ZA 2B7BA 4A92A 4CT5A 1T91A 3AF2A 1WBDA 4E5UA 2E1RA 3O8DA 5IT5A 4C2TA 4YMWA 4XVRA 4Q9LA 1US8A 1ZM7A 3D3QA 4HLQB 3W8RA 1GM5A 1GDDA 5FUVA 3WP1B 1PUJA 3IHLA 4JKYA 1ZD8A 4QXAA 2VQSA 1P72A 2KBFA 3U4QB 4RD1A 3ZS8A 3EW9A 3SZRA 2BMEA 4H9GA 2O8CB 2C96A 3H1TA 3GLFB 3PFIA 4EUNA 1DOAA 4UXIA 5L3RA 3PEYA 4G0NA 1G7SA 1UDWA 1P3JA 1OHHA 3IHWA 4TMKA 1AS2A 1G41A 2FG5A 1N0VC 4LJ7A 1J70A 3TRFA 2XSZA 2IWRA 3H86A 3TW4A 1TQ6A 5K8LA 5KYKA 1ZRHA 1GL7A 3ZZ0A 3P4YA 1N6OA 2IK8A 4KU4A 4BECA 4DRZA 5CM9C 1XTJA 4DT1B 1OF1A 1JECA 3LA6A 1E4VA 2CK3A 3QPUA 3V00A 1OFUX 3EPLA 2WM9B 2ZJOA 1HQCA 2IYRA 3RLFA 1F6BA 1FOEB 3ZVLA 1W2HA 2OBMA 1XZPA 5LD2B 4TT3D 1Q1BA 4K8OA 2GKSA 4MRRA 4V0MA 3ZVMA 2QM7A 2VYFA 3N2EA 4OI0A 3EZ2A 4PC6A 2QE7A 2FSIA 3QSYA 4WIAA 3Q5EA 3TAUA 4KI0A 3T35A 2XNSA 4LCBA 3EARA 3EC1A 4N1AA 1VG1A 3GFOA 4M22A 1DARA 5CJPA 1HE1C 1CRPA 4TT3A 4HZUA 1KO8A 4FW9A 2ZS8A 1Z28A 3KJHA 3LWNA 4TSFA 5J4VA 1SVLA 1QRAA 2RGBA 5D3MB 4G01B 1HT2E 3D31A 2JJ8A 3ZQJA 2IYXA 1S1CA 3CX8A 5C1BA 4GRAA 2FEMA 3GLIB 4DEYA 3HPQA 3KTAA 4LHYA 1JQJC 2B6HA 5FOTA 3Q9LA 2F1HA 2PJRA 2HLDA 5LBIA 2R8RA 2FFBA 3NIBA 4CEIA 1UBGA 4TL9A 1NI3A 3FE2A 5JFGA 3EPJA 4TYQA 3ZIAA 2Z43A 2CLCX 4RZUA 3KFVA 2P3SA 3C4JA 4KBGA 4DKXA 3MMPA 4A8JA 1OH7A 2IXFA 2WZQA 4NCHA 3RAPR 4OJKA 2VLIA 3NDPA 1D2EA 4FMDB 1TF2A 3K0AA 1QHNA 2BMDA 3N5CA 4C0LA 3M6AA 3LXXA 2RAPA 5JCPA 2FSFA 3SQWA 2PZGA 4YXWD 3WYFA 4LC0A 2GK6A 4GI7A 1OIWA 3Q7QA 3TUJC 5KSOA 1ESMA 4CRWB 3SE0A 2QNRA 2HJVA 1OSNA 5J5CA 3GJ4A 4IDHA 3OAAA 2QAGC 1PLLA 2WSMA 4V0LA 4HLCA 2WPDD 3VMFA 1T9HA 3T1OA 4DIDA 3GFTA 8OHMA 4MKHA 3KJGA 2N1BA 2MMCA 1BYIA 2FPMA 5KO2A 4X8OA 5FI0B 3NXSA 1KSJA 4TWZA 5EXSA 4PC1A 2LKDA 4LJ8A 2ZRHA 2OILA 1VCNA 5FUXA 3CF6R 4D26A 1YR6A 2GJ9A 4DLUA 3MCAA 2H57A 4JKIA 1KI7A 4IXNA 3O8BA 4R9UC 2GVZC 4KHZA 4TLDA 3TR5A 4CZ2A 2OO7A 2RB4A 3GJ8A 2JIZA 4BFSA 2C98A 5C4MA 4GDFA 2C9CA 3U6BA 2B8WA 4M1SA 4B75A 1SQ5A 1JB1A 1E2HA 3SFVA 2NO0A 3B1YA 4II7A 4TMTA 2R6FA 1XDBA 1YKSA 5KPJA 4OI4A 4DLZA 1W36C 4MKGA 4Q18A 1XPUA 1W4RA 3R20A 4IDQA 1AKYA 1MRNA 5DNYB 4Q7MB 5IDVA 4V0NA 3TVTA 1O87A 1CXZA 1YZTA 2QBYA 5FUYA 1EESA 2CVFA 1XP8A 3E5HA 5A5GA 2W83A 3EX7C 3ETLA 3M1IA 2ORWA 4PPNA 3QIAA 2JLXA 1T0JB 2LCFA 3CF2A 1ZP6A 3HU3A 1S96A 4B76A 3X1XA 1G4UR 1TL7C 3THYA 3BC1A 3ONWA 4QGFA 4D4MA 2D62A 2BIFA 3ECCA 3TSWA 4Q9JA 4B3DA 2BCJQ 3CZQA 4DEXA 2FGJA 4NBSA 1GKYA 2JJ2A 3I5XA 1EWRA 3ZYCA 4GOKA 1HEIA 3ICQB 2P5SA 1M7HA 1SVMA 5LB2A 5AJZA 3GJ5A 3C14C 2F1JA 3EASA 1IN4A 2GWHA 1KIMA 3AKCA 4DDUA 1KO4A 1BKDR 2ZSDA 4FIDA 2Q9BA 2A30A 4UQOA 1KY3A 3UANA 2VSXA 2QY9A 2PX0A 5KUTA 3V4RA 3WXMA 2HEIA 2TMKA 2W0MA 3W5IA 4TMXA 4C4PA 1YR7A 2Z4RA 4Z8YA 3U7HB 1JBKA 1RZ3A 2ZI9A 1GNQA 3FKSD 4DBLC 5AUOB 1FFHA 5FTJA 4Y0AA 4TL6A 3BD9A 4NDZA 2GJ8A 4CDGA 2W2XA 3VKHA 1GNRA 3K9LA 1G3MA 1CR4A 1WXQA 4C0QC 4AKIA 4GP7A 1ZIOA 1RE0A 3TK1A 3K70D 5G53C 1LNZA 2OG2A 2FDCA 5FPKA 2UZIR 1OHHD 4AC9A 5CB8A 4MH0R 2JDIA 3BERA 3PENA 1II0A 2QGNA 1W0KD 3GEEA 3ASYA 4DXAA 2ZR9A 5JZVA 2G1KA 3BB4A 1M2OB 2J3EA 4M1TA 4HSEA 4URWR 4M9QA 5B2ZA 1JPJA 5K8UA 5G41A 4PSAA 3TW8B 1MO3A 2W6ID 4ZCIA 4ZDWA 3VR4A 1F60A 2XB4A 3H2YA 3EIQA 1KI6A 3Q85A 4DCVA 4XVQA 2O0KA 1XPOA 4TTQA 1A4RA 4FWIB 2AD5A 5FPHA 2VHUA 3C8UA 4A1FA 3OE7A 3KFXA 1KO7A 2PH1A 4TYNA 4KYIB 4NH0A 1X8JA 3U61B 4PC7A 5CDFE 3KQLA 1N6IA 3MSXA 4HB2A 4RFSA 3W9YA 4LSGA 1UJ2A 3CRRA 4PQYA 5A4JA 2GJSA 3I72A 1AA9A 4EPXA 3R8CA 1TUIA 2VEDA 4NYJR 1G8GA 2ZJ2A 3UKDA 4W7SA 1DEKA 2ODBA 2ZI7A 2VF8A 2W00A 2ORIA 4TLCA 5P21A 4Q1BA 1E9RA 2YWGA 2V55B 1ZUIA 4WOPA 4BQSA 4GOJA 2ZANA 4F38A 4M1KA 2BHRA 1XD9A 3NG1A 3DKVA 1GP2A 2GHIA 2QSZA 3CRVA 1W48A 4HLUA 1DAEA 3PEVA 5ANRB 3QPVA 1X86B 3UMSA 1FQKA 1RYHA 2C9YA 1QDEA 4F7WA 3NEYA 2UKDA 4L16A 1EGAA 3GFPA 1DAGA 2P2LA 2GXAA 5J4YA 3LDAA 3K09C 2PEYA 2JLUA 2G83A 3BH6A 4B6FA 1NIJA 2HJGA 3ND9A 2XTNA 1BS1A 3BFXA 4JBWA 2Q3MA 1ELOA 2A5JA 5EUMA 2IUSA 2CVHA 4M9SA 4TQAA 1CEEA 1OIXA 3FFAA 3ZH9B 1N6LA 4V0ME 3CW2A 3LBNA 3HP1A 3VR2A 4NCNA 5DHFA 2H7VA 4QC2A 1XD8A 3AVVA 3QKUA 2YWEA 1CULC 3UWOA 3WBJA 4AI6A 3U7GA 2JLZA 5EXPA 3PXGA 1IJFA 2WWIA 1M7BA 3IPYA 4ZDJA 2XOKA 2SHKA 3CZPA 3SQXA 4XTRA 2GXQA 4XTCS 1RJ9A 2A9KA 2WBLC 3A1SA 3T06B 4HAZA 5EUQB 2HXSA 1DAKA 3CX7A 1A5TA 5TV2A 3RVBA 3U3RA 2RKOA 2QZ4A 1P5ZB 1IXSB 3THYB 4TZ6A 4DHEA 4FMCB 1T6NA 1LB1B 1NSTA 2WVJA 3F0TA 2RGNA 4HZUB 3RRMA 5CLQA 4ZPXA 3VR1A 5H70A 5FOWA 3TKLA 1J2JA 3AF4A 3Q5DA 2GJAA 2DFKB 4RZ2A 1Z5ZA 2A3RA 4AKHA 1XMJA 1GL6A 2BWJA 2XSZD 1W47A 4D0LB 4IDOA 4MGIR 1E32A 1G8YA 1QF9A 3O47A 3KXKA 5GJWC 2F1RA 1NJFA 3BAFA 3K53A 2Q21A 3WYAA 1WB9A 3VAAA 4ERNA 2WJGA 4KFRA 2V6IA 5J4HA 1D2MA 1Q57A 2A5DA 2DR3A 4DT1A 3JVVA 4RFVA 3FHTA 4N0EA 4J0QA 4MKFA 2J0UB 3UG7A 3K70C 3B1WA 2WKQA 4B47A 2ZVQX 1E79A 4L4UA 2JATA 3QG1A 1B23P 2JDID 4P0TA 5DI3A 1M74A 1NBMA 4RY2A 2BC9A 5L3SA 5HE8A 1GIAA 4ACBA 1CJVC 3GPLA 1P75A 1AZTA 5FBQB 4D4JA 1W5SA 3A4NA 1W36B 4A2WA 4YDSA 2BMJA 4IVRA 1COWD 1KDRA 5DSZA 2XXAA 5BYKA 2ZVPX 4JSTA 4B3XA 1U90A 2JCSA 1OKKA 4N3NA 2O8FB 4D82A 4C2UA 1KGDA 1Q3TA 3LO5A 5AJWA 2QMOA 4HLUC 3IEUA 1VIYA 2VHJA 1CS4C 4YQFA 4JBYA 4NKRA 1KAGA 4Y0VA 1ZC4A 3SU8A 2CDNA 2X8AA 1HH4A 4PZZA 3MWYW 3BWDD 4B71A 4EAQA 3ZQ6A 1DS6A 3FMPB 2QTFA 5AJVB 5FL7A 4KSBA 4F4IA 2VSFA 1GNPA 3W8NA 2X2EA 1T3LA 1R5OA 3AVUA 5EZ6B 4BASA 2WJVA 4QM7A 1KI8A 3S1AA 4GMXA 1U9IC 2OAQ1 4CYMA 4PQRA 2F43B 4JLOA 3B1ZA 1KJWA 2ONJA 1G19A 5J4LA 2ZXUA 4OHVA 1PVOA 2AXNA 4NYMR 3BBPA 1TEXA 3DM5A 2EWWA 3ASZA 4QBGB 3CO5A 4US1R 3KJIA 4OK6A 2NO7A 4CW7A 2ZM5A 1Z08A 4LWZA 3REGA 1Z83A 5EXTA 4BPBA 1KY2A 2NOAA 1GRQA 1RKBA 3PG5A 1II8B 1L2TA 4W5JA 3KUDA 5AJXA 2CLDX 2EW1A 1PJRA 2BEJA 2CHQA 2P6RA 3K70B 2GF0A 1G3RA 2RGXA 2VF7A 3IIMA 4TMWA 3VX3A 1X6VA 2XGJA 1E96A 1KK1A 2NO6A 3KQKA 1XD2A 5EE9A 2IX3A 4V0KA 4I1UA 5JI2E 2PLRA 2YWHA 3PQCA 2W2VA 4FMDF 1LFDB 1M8PA 4EJSA 2AXPA 1NMXA 1GITA 1Z6GA 1NKSA 2LKCA 2IUTA 1Q20A 3HR7A 2HT1A 3HPRA 3HU1A 1G5PA 2DWOA 4DLRA 2Z6VA 4HAWA 5EE3A 1T8UA 3OIYA 1V43A 3I61A 4C30A 1U98A 5JLJA 2B21A 4Q7KA 3ZJYA 2IHYA 1ZM3A 2HT6A 2H8KA 1SXJD 1JJ7A 3I8SA 4TMZA 2EFCB 2IYVA 2YZ2A 5GJBA 1W0JA 4LDJA 1NNEA 4O3MA 1N3BA 3NKVA 5JSZB 1N6HA 1E2QA 2DCUA 3GLIE 1N5LA 1RRFA 2B8TA 2C78A 4UXHA 4EJSC 3N70A 4OYHA 2ODNA 5B30A 2HF8A 1H8EA 4NE2A 4CIDA 1NJGA 2F9MA 1KJZA 4LX0A 1V5WA 2NGRA 2JASA 3VR3A 4QJ3A 1T0HB 2IYTA 3HJNA 1G20E 3GCGA 2F55A 1FNNA 2NZ8A 2WTUA 1W4AA 2J7PD 3THWB 5AUPB 5FTLA 3ADKA 2XXAB 2PMDA 5K8TA 3BH0A 1W44A 1DTSA 4IFBA 2RGNC 3QF4B 4E03A 1CR0A 4JBXA 1Z22A 5KSYA 1SVOA 3GLGE 1ZM9A 3ZDQA 4HLDA 4PHTA 4Q4LA 3I62A 4CVNA 4FXPA 1IY2A 2CE2X 1GILA 4HYYA 1BYUA 2WJHA 1LS6A 4BFYA 3KQUA 2D3WA 2O5VA 3OEEA 4YMSA 221PA 4Q1FA 1YZLA 3Q8XB 2AX4A 4M21A 5F9FA 4QGHA 3QKSA 4BEBA 1NF3A 4UKDA 4A0HA 3WNCA 2GDJA 4ASUD 1OPXA 2BKUA 1OKKD 2ZUDA 2REXB 3EWAA 1XCPA 3E1SA 3NBYC 2CE7A 2PZEA 1DO0A 3LLUA 1YE8A 3EXAA 4LV8B 2RCNA 1E0JA 4ZDIA 4M4SA 5JJKA 1X1SA 3EAQA 1SVIA 2DBYA 3OIWA 4Q48A 2BBOA 3HYTA 3TR0A 1ESNA 1SKQA 1XXHA 4ARZA 1OXVA 2R44A 2XITA 4P4SB 5CITA 1OH6A 4QM6A 1ZD1A 4JS0A 3I8XA 4MITA 1N5JA 1ZNWA 2X77A 1P6XA 3A37A 1HYQA 4B43A 1M6NA 3BH7A 3D6TB 1S8FA 4EIWA 4A0GA 1Q1ZA 4Q66C 1E9AA 4TSFD 1WQ1R 4JL5A 4PPFA 2HYIC 5FOXA 3X1WA 3AVXA 3K9NA 3CRMA 3QXHA 3FMFA 4ZI3A 3UMRA 2WWYA 5LPNA 3K9HA 4ITRC 1S1MA 1O3YA 1T5IA 2QRNA 2YYZA 4RZXA 4LJ4A 4BEJA 4Z54A 3NH9A 4LHZA 1AS0A 2OCPA 5HCIA 3IDQA 1XTKA 2BDTA 1CJMA 1MKYA 4URYR 4BLSA 2JIZD 1HQYE 4P32A 4TMVA 3MG9A 5E7MA 2PEZA 1W5TA 3RRZA 1KI2A 2BVNA 1MABB 4MYHA 3VKWA 2PX3A 5LD2C 1P2UA 3EPHA 3SR0A 5CB6A 1N5IA 4RD3A 1W49A 4LJ6A 1PUIA 2MSEB 3A4MA 4LV6A 5JHGB 1N5KA 1UDXA 1FP7A 1E99A 2CCKA 2WSSD 1JR3E 1G7RA 3PUZA 3CKLA 4P4UA 4XSGA 3UATA 1SHZA 3PV0A 2F3RA 3IIKA 3VHXA 4H1VA 1G3UA 2YJTD 1Z0DA 1E2JA 4DVGA 4S35A 2IS1A 1JEDA 4WA7A 3WYGA 1F48A 4A8JB 2WWWA 3CBQA 2NIPA 3CONA 1NN1A 1RRPA 3EG5A 3QG5A 2PCLA 2DHRA 5C18A 5CYPA 5F3WB 4C7OB 1JALA 2GAAA 3L0SA 4R2IA 4IOKA 4BLOA 4MDFA 3C16C 4QKQA 4PC3A 1XEWY 2P67A 1G7TA 1JR3A 1TU3A 3X1DA 2YHSA 1E9EA 1X8LA 2BMFA 2KI5A 4RKEA 5EP1A 3TSZA 3O8RA 3H84A 1OXTA 4P3YA 5DISB 4JMPA 1J90A 2JJ1A 3EIHA 1KDPA 3KXIA 5CDFA 3P20A 1OH8A 2FNAA 1TU4A 3SDZA 3CUEF 2QSYA 2QL6A 4YDHB 5DGXA 2FFAA 3CH5A 3PEWA 3SYLA 3AV0B 4UNNA 3M4YA 4KYUA 1BMFA 2HUPA 1FTNA 1UKYA 5FUWA 2DY1A 1U9IA 1P7CA 4I1SA 2A5FA 4LGMA 2PMKA 4IOMA 1GL9B 2FFHA 2Q3HA 2OM2A 3A1UA 3DEFA 5IK2A 3U44B 4CEHB 1AGRA 2VHTA 1YU9A 3RSOA 2PJZA 5DHAA 4BFWA 1NY6A 2H92A 4LV5B 3KJEA 3TUZC 5FOVA 2ZREA 2QAGB 1EK0A 2ANCA 2G1JA 1TAGA 3BORA 4LRWA 5E7JA 3U7EB 1NLFA 1IY1A 4LPSA 1XF9A 4CEHA 2WMNB 1XCMA 3THXA 2JJ1D 3AH8A 5KPDA 5GVSA 1HURA 4DLWA 3REFA 3NDBB 3I3SR 3K09A 4PHGA 1S3GA 4NCKA 4D4LA 1NVWQ 5EE1A 2J59A 3VTKA 1YRBA 3B82A 4MRSA 4P4SA 4EDHA 3C7KA 1HV8A 3S1AB 3WMGA 2JJ2D 5DI9A 5CIWA 2RGGA 4KFUA 3A6PC 3PUYA 4KODA 1TX4B 2XNDD 3GJXC 4ACAA 1AN0A 4YMUA 4AYWA 1RIFA 1IM2A 3P4XA 5AJYA 5H8WA 2J0UA 2IYSA 4QBFA 2ZJZA 4EPRA 1PLKA 1ZUNB 3D7MA 1E1QD 2DB3A 5JWHA 4IXMA 2EFDB 2GA8A 2O8DB 3T12A 1XEFA 1Z0KA 5JEDA 4BWYA 3ND8A 2QGZA 4A2QA 1G3IA 4Z1MA 1ZUHA 2YC2C 1ZYUA 4LJAA 3CIOA 1II8A 1CJTC 4M9ZA 3V4FA 3PITA 4DUGA 4BLTA 4EKDA 2R6DA 2QP3A 4UJ5A 2WKPA 3X1YA 3UK6A 1FP6A 1AJEA 4Q19A 4KVAA 4DCNA 1NN5A 2O52A 3F3YA 4DLTA 4TLAA 3U3MA 2N42A 5E4FA 521PA 4URVR 4XIGS 3GLFE 1Z63A 5BW8A 3FMIA 1ZMXA 4OK5A 3FYHA 2O8BA 2O8EB 2DFTA 3I73A 2LWIA 3DDCA 1UM8A 2JLVA 1EFCA 3RS3A 1MT0A 3T5DA 3A36A 1Z06A 2CL6X 3L8YA 3W34A 3GJ6A 4BLPA 1N6PA 2WOJA 4IVPA 4UJ3A 5CK5A 5GJVC 1QHIA 2V3CC 5BQ5A 3Q7PA 2VH5R 1GG2A 1I4DD 2RGEA 3TAHA 1P62B 3L82B 3BB1A 3TLXA 3KKOA 2RHMA 5EXXA 2QT1A 3A8TA 2C5LA 1XB2A 1QHGA 2ZRAA 4PSVA 3O8CA 2C77A 2YINC 3B78A 4QL3A 3IUYA 3SFZA 2ZRBA 2OV2A 2GZHA 1M34E 5FI1B 3CF0A 2YWFA 4B2PA 1NVVR 2VRWA 1T5LA 3AVYA 5KTYA 3SBEA 4URUR 4BZPA 3B85A 4DSOA 4Q1CA 4MKIA 1KSHA 1BH2A 4JYBA 1QHSA 2ANBA 2IYUA 4AIIA 2D4HA 3AVOA 2R65A 3KUCA 4XH9B 4NMMA 4CEJB 2MSCB 3KQNA 1G16A 4HUTA 5HZHA 1E3MA 2RGCA 5FBRB 4ZO4A 4HUQB 1G5RA 3WRXC 5JRJA 1P9NA 5F2EA 1HTWA 5BYJA 1XXHE 1E1RD 4O2RA 4DJTA 4D25A 3B7GA 2NG1A 3SS8A 4XD7A 1OV4A 1TEVA 3FMOB 3NEJA 4I4LA 2BCGY 3I32A 4PX9A 3D8BA 1T8TA 2GTPA 4MYTA 3W90A 3H0KA 5KOYA 4Z51A 3VR5A 2XTMA 4QBHA 2NZJA 4US0R 3U4QA 4RD6A 2P6UA 3RS4A 3T1TA 1G6OA 2KBEA 3FFBA 5JJLA 1E1RA 4BFTA 4K81B 2UZ3A 3U44A 3WY9A 1L7VC 3OF5A 2B92A 1IXZA 1NG1A 5C2JB 3DOFA 3OFNA 3RRYA 3B2EA 4Q9IA 2ZQ5A 3U5ZB 1TF7A 4OK3A 1P9RA 5CJ2A 4PO1A 1S9DA 1ONBA 5L3QB 3QXXA 4B3CA 3AVTA 3KB2A 4JLPA 4Q01A 4WXRA 2IEZA 1FZQA 2BJVA 4HAVA 3BGWA 3QKRA 4B3GA 4F91B 2JLYA 1FMLA 5J40A 3I92A 5JHHB 2ODEA 1A82A 4UNRA 4C9BA 2OHFA 4B34A 5TMPA 1HE8B 1I2MA 2REOA 1TMKA 2V7QD 5EE5B 1EFRA 4ABYA 2RH5A 4POAA 1OFHA 5HKKA 2JA1A 5ELXA 3EWSA 1E2LA 1IJEA 1F2UB 3LXRA 1BOFA 1JI0A 1BMFD 2ZSEA 1ZU5A 1RC8A 4YMVA 2Z0MA 3K0EA 5HE9A 1G3QA 5FL7D 2FSHA 1CBUA 5CM8B 4M2LA 2GF9A 2QMEA 1E2FA 1EWQA 1UBEA 2GAOA 2V7QA 3WHKA 2YC4C 4EFMA 1F2TB 3FGNA 1Q0UA 2YV5A 1Z6AA 1M7GA 2JLQA 1WRBA 3VHLB 3ZZTA 2H5EA 4LYAA 1UKVY 3ZD7A 2BBTA 4KVGA 3TBKA 4G5SA 4JT2A 1DG1G 3MJHA 3SOPA 3VX4A 2VO1A 5JMTA 2CBZA 2O8CA 2QRZA 4NP6A 3Q3JB 2EWVA 2FFQA 4RD0A 4A6PA 2AHOA 1Q3HA 4U02A 4E07A 3W6PA 5J4KA 2JLRA 1LW7A 5HKKD 1WE2A 3LBHA 1N6RA 4C0JA 3NTUA 1COWA 4G5OA 4KBFA 4MUAA 3B9PA 2D74A 1CRQA 1W2GA 1XMVA 2WSSA 4RZ3A 2NMVA 2V54A 3T34A 2J5XA 3FWYA 1UAAA 2FE4A 3BE4A 4M53A 5A0FA 4Q7JB 4JYCA 2H17A 4B48A 3IBYA 2IF0A 3F5FA 1J99A 4QGGA 4KLZA 2GZDA 1NL3A 4PZLA 3SEAA 1ZAKA 4C0KA 3LQRA 1SKYE 5B58C 3HWSA 2Z5FA 4A9AA 3H4MA 1X3SA 2W6IA 4C0BA 1YRAA 2CHVA 3DHWC 1SHKA 2ECKA 4B32A 3K0CA 2IEYA 3WNBA 1UF9A 1Z6YA 2OAP1 2O8FA 1S0UA 5DYIA 2IWHA 3TGPA 2Q3FA 3TSOA 1E2PA 3UPUA 3CM0A 2O8EA 2A7QA 3RC3A 5EJEA 3IEVA 3SBDA 2OLKA 3EZFA 1XPRA 4NYIR 1JJVA 1QG2A 4NYIQ 4B3BA 4OQFA 3ZLJA 4PANA 5KDLA 4B35A 4QGAA 2ZPTX 3UXMA 2WIBA 3ZIAD 3K0AB 1XTRA 3QF7A 1MOZA 1T3SA 3TNFA 3SYKA 2JGNA 3U60B 3LV8A 4MYCA 5L3VA 1LF0A 4DC9A 3BOSA 5DO9A 3UIEA 2D7CA 1Z8FA 2ZUBA 3THXB 2F6RA 1EFHA 1Z6XA 2ATXA 2Z4SA 2OT3B 3AUXA 2BJWA 2ZUCA 1IOZA 4OHWA 4JJZA 4WZAE 4R2HA 1DAHA 3EPKA 3RWOA 1EG7A 1G64A 1TNDA 3FHOA 1E9SA 4HDCA 3IO5A 3RDPA 5M04A 4LYFA 5FPSA 4ESVA 1N0WA 1FPMA 2AWNA 3SJCA 2QUZA 3I4LA 1YVDA 4M1OA 4YMTA 4Q4HA 1OT3A 1SXJB 4LJYA 1IN7A 4JSYA 1RW4A 1RVDA 2CXXA 4FN5A 3ZVNA 3EC2A 2ZYUX 2V1XA 3NHBA 2QENA 1VPLA 3QEJA 1GTVA 2CL0X 3AB3A 1NBME 3K0SA 3THWA 2X2FA 2C9OA 3KKQA 3OIUA 4JLBA 4Q4JB 1F2UA 1OFTA 2OCAA 1UEIA 2JLSA 4M1YA 2Q9AA 5TVKA 3KQHA 5G40A 4KAXA 4A15A 2QI9C 1ZBDA 3BFKA 4AKEA 4BRWA 3A1VA 3K0FB 2DFNA 4IDNA 5DH9A 1CP2A 1E79D 3LQQA 1KK2A 3LFUA 1E2KA 2C03A 3L43A 4I99A 4GBMA 1F2TA 1E98A 3ICEA 2WKRA 2ZU6A 1U81A 3LY5A 1Z0FA 1G1MA 1JXOA 3ADCA 4KLNA 2IYWA 3DOEA 2J7PA 4UNSA 3R9WA 3IGFA 4DCUA 1R6BX 1EFTA 2FMXA 3QE0A 4PPGA 2ZRKA 2N46A 2ZROA 3SN6A 1R5NA 2Y8EA 1AQYA 4XWOA 1E2EA 1W4CA 2QN6A 4G5RA 4NYJQ 3L0IB 4DSTA 421PA 4PXAA 2B7CA 1FMJA 2R6AA 4JJKA 1DBSA 2W6JD 2A5GA 4MRVA 2OFXA 3A4LA 1XEWX 4Q21A 1SVSA 3AEZA 2G77B 5E7IA 4F4CA 4NZYA 2CJWA 3SJZA 2ZYWX 2E9SA 4XWKA 2IS2A 2ZJAA 4M0LA 1ETUA 3OIVA 1VCIA 3QKRB 5D3MA 1N6KA 1FTSA 3NC0C 1EX6A 4OQNA 4G5GA 5FBLB 1G7CA 2KE5A 4A4DA 1U8ZA 1YQTA 3AKDA 2XX3A 1CJKC 2ZIAA 4HEJA 2I1VB 4X8HA 3BS4A 3LW8A 4KITB 4TN1A 1D2NA 1LTQA 2IC5A 4FMCF 1H8ED 1XU4A 3B5JA 3W5JA 3P32A 2PL3A 2FGKA 5DI3B 4BLRA 5FR2A 2XZLA 1KNXA 2WJYA 2ODWA 2ZE8A 3QUSA 5K8IA 3VKGA 2X19A 4AY2A 2I4IA 3RRNA 1QHHA 3K1JA 1N2CE 4RSGA 5AR1A 2GCNA 2GK7A 2IUUA 4LOAA 4QNRA 4DSUA 4FCWA 3HR8A 2G0NA 4JLJA 1XTIA 3L0OA 4IJMA 4EPVA 1ZNZA 3NBFA 1XWIA 1UFQA 2J9RA 2C2HA 3B8HA 1KDTA 3KKMA 3QVUA 2O8BB 2RMKA 5C46F 2BBSA 1A1VA 1KTVA 4H1UA 5FTNA 2BKEA 1PV4A 1HA3A 3NH6A 3EZ9A 3R8FA 1Q22A 3VU9A 2FH5B 3OEED 2AR7A 3X1ZA 1CR2A 2PZFA 4W5WA 3UMFA 2XB2A 4DDVA 3RYTC 4OHZA 4OBEA 2BBWA 3SJAA 621PA 1CKEA 1OYWA 4L9WA 1MO6A 3T5GA 4FD2A 2ZRLA 1XJ0A 3GJ3A 3PEUA 1ZNXA 1OE0A 2ZE5A 1IQPA 4Z8XA 2FOLA 3GLHE 1OIVA 3L2OB 4I81A 4FCVA 4B2IA 5BN3A 4A82A 1KOFA 2FPLA 4V0OA 4HB4A 2FU5C 4AURA 2ZJ8A 3LRPA 4WXPA 5L8VA 2FSGA 3U3JA 2AKYA 4D81A 2OE2A 5CK4A 3CPHA 3AP3A 3U2QA 1LV7A 4GT1A 3VNVA 4GNKA 4V02A 4Q1EA 4LI0A 1G8PA 1ZU4A 1UKZA 1F5NA 2K5UA 2XOKD 4EFLA 5JRZA 1AZSC 4Q4HB 5FH9A 1TPZA 1L4UA 2WWHA 1Q21A 2WAYA 1D9XA 2PBRA 4LK2A 1DO2A 3AKEA 1OYYA 3TMKA 2WWXA 5HTKA 1MO4A 1NMZA 4G3XA 1NY5A 1XD2B 2XZOA 3R9XA 3E70C 2OUKA 3CPEA 4F92B 3MUFA 3C5HA 4EPYA 2J7KA 1KMHB 5B57C 4A2PA 1IXRC 2FZ4A 4TLBA 3P27A 5JBQA 1E9FA 2W0SA 2Z83A 1KJYA 1VIAA 3LVQE 3NBZC 3FTQA 4C3ZA 4TL7A 4QOSA 5DIFA 1BIFA 1D6JA 5EE0A 2FEOA 4PQFA 4L5BA 1J7KA 1U2RA 2ZRMA 3OZXA 4BLQA 1YZQA 4IKEA 4OJQA 4ILEA 4QHYA 4EQ6A 2AK3A 1RFLA 1UKEA 2R2AA 4OQLA 1CLUA 5E95A 4D2IA 4JL6A 4LHVA 2WWGA 4D0NA 4LYJA 4URZR 4F4JA 4C7OA 2VSOA 4KV9A 1XBTA 4BZXA 2HCBA 3AKYA 1ZM4A 1G6HA 2R9VA 3KB1A 5FTKA 5FR1A 2ZI3A 3SNHA 5G3ZA 1ZVQA 1X1RA 1XEXA 3ZGXA 5F9HA 1LVGA 5DLQC 5H1YA 4ZIRA 1NLYA 1KDOA 4RVCA 4CGZA 4OHYA 4B74A 3GP8A 4RCYA 1QHXA 3CR7A 4A8JC 2GXSA 3DM9B 1MR3F 4JLDA 4QRHA 5KU1A 1P73A 4XSHA 4US2R 3IO3A 1E2NA 4Q02A 1NMYA 1OXUA 1U0JA 1NRJB 4L8GA 2ZEJA 3CNLA 3GLGB 2ZYTX 1Z0IA 3JZMA 3OESA 3T15A 2IT1A 4IEIA 4KCGA 1VTKA 3OFND 1T3HA 2NPIA 2QPAA 1W36D 4MGZR 2E87A 3F8TA 3DZ8A 1NP6A 1TF5A 1AS3A 5GADl 3K0FA 5CIQA 1UADA 6Q21A 2J45A 3L8ZA 1GVNB 1R0YA 2J87A 1KMQA 3AF3A 5SZHB 1VG8A 2IXEA 3B13B 1VHLA 4NCJA 1Q12A 3UWKA 4OQXA 4DLVA 2Q9CA 4OHXA 4GL2A 1QZXA 1R8SA 5LB4A 2JEOA 1Q44A 3WHLA 3SYNA 1XNJA 1P2VA 2YVUA 2GVDC 4DLSA 1GRRA 4LHXA 2A78A 2VP2A 2BEKA 2EFHB 4QJ5A 2GCOB 3SI7A 3AVWA 2RGAA 4KJZA 3QQ5A 3GLIA 2IYZA 4KXFB 3OEHD 5EQTA 1EXMA 1G8HA 3B1XA 1J8YF 2MSDB 1IONA 2G3YA 4LHWA 3RNLA 4AYTA 3WBKA 5HPYB 2XNDA 3FDIA 1XMSA 4EPTA 4LBZA 1CR1A 3QNUA 1P61B 5FPTA 3B9QA 1E9CA 2EFEB 5L3SB 3RWMB 1GRNA 3PCRB 2VP6A 4UXJA 5KNDA 1SULA 3A1WA 1KNQA 4CEJA 3IPXA 1WF3A 3FVQA 2OCBA 2ONKA 2R6GA 1E0AA 4Z1MD 2QE7D 2KSQA 3Q72A 1N6NA 1TQDA 4ESHA 1XTQA 3QBVA 4JVLA 1KI9A 2G0TA 3QKTA 2GEVA 3R7WA 1RYFA 2V4ZA 2NO9A 2F3TA 3NWJA 2H18A 4EPWA 1KAOA 1EFUA 4B44A 4B3FX 1N0UA 2FA9A 3R9IA 4DWJA 1E0KA 1MABA 2OFWA 4OL0A 1XZQA 4NTZA 3U7FB 4AD8A 4Q47A 2XJ9A 2JAQA 2P65A 2RHDA 4EQ6B 3OE7D 4DLYA 2H16A 1NN3A 3JVUA 4HB3A 2FPKA 5JECA 3PVSA 1CIPA 1R8QA 1P2TA 4U7DA 4PZYA 3LH5A 1L8QA 3CRW1 4XOIA 4YLGA 4PO9A 3VU9B 1S9HA 4LJ5A 2D2FA 4LC1A 4HB0A 3HU2A 1ZM2A 2YOGA 3KTAB 821PA 2CL7X 3QY0A 4BZQA 4JVMA 2CNWA 2VHQA 4MQBA 1WCV1 2WOOA 3K0CC 1P9WA 4RKFA 4E09A 1SZPA 2W2TA 3MJRA 4YXWA 1U99A 1GZSA 3FHCB 2KB0A 5HR5A 1JEEA 3MWLA 2ASEA 1AM4D 1E9BA 1IN6A 2QQ0A 2V8OA 3RHFA 1Q1EA 2OEPA 2FX3A 4P4TA 5DYGA 1ZCAA 3OAAD 1Z0JA 2O8DA 1SKYB 4B2LA 2Q6TA 3CNOA 2DWPA 2ZI4A 2P6NA 1NIPA 3BJIC 3PUXA 2IF2A 3CNNA 4AG6A 3AVQA 4GPTA 4MA4A 4V03A 1QVAA 4PAQA 1E2DA 1QHYA 4FI3C 4KO8A 1KZ7B 2ZRCA 1Q1QA 4LY6A 2HDNB 4HZIA 2WAXA 1W7AA 2D2EA 3AGPA 3RS7A 4W5HA 3A1TA 1VCOA 1TQ2A 4DLXA 3VNUA 1KO5A 5HCNA 4HDOB 4D4KA 721PA 1R7RA 4Q9HA 1W4BA 1OW3B 2GBLC 1IAQA 1TADA 2G88A 3A58B 4ASUA 5BWMA 4QFMA 4FINA 2CHGA 3DMNA 3QI2A 1US8B 5JJIA 1VDZA 4ZKEA 3BB3A 4G5QA 1ODFA 1ANKA 2EQBA 4R7ZA 1E4YA 4WW0A 3B60A 2ZITA 3FKQA 2C8VA 3OHMA 2QQEA 3T61A 2EYUA 1B0UA 5L3QA 4LPKA 4LUCA 2VPPA 4IFEA 1G8FA 1XEXB 5SZIA 5JWOA 3AF1A 1UPTA 1SVWA 5B64A 1CJUC 1RPZA 4I1VA 5JEEA 1IN5A 1Z07A 1Z2AA 3QXJA 2R6CA 5SZJA 1VKJA 1PZNA 2NPFA 1FL9A 2CCGA 4JT4A 3QVVA 2EFGA 2PLFA 1OB5A 2OLJA 4QG7A 4WAUA 2GESA 1GKUB 4BFXA 1W46A 3BFVA 3DMDA 1SVKA 3GLGA 2QBYB 4OKSA 4IHQA 2IBMA 2P0EA 4GFDA 1JAHA 4Q4AA 2FF7A 2GILA 4A0FA 4JLNA 4TLEA 3QOFA 1A2KC 4B6EA 2C04A 2DYKA 1G4AE 3MLEA 4GZLA 3U6KA 2V1UA 1OLOA 1DADA 5JWRA 5GVRA 2FWRA 1EFRD 3BK7A 1KK0A 4U00A 3ZVRA 4DIEA 2J0QA 1KK3A 1XRJA 4RD2A 3ZD6A 4HUQA 1R5BA 3M0EA 1ZNYA 4K46A 5DE3A 3JZAA 1NBMD 2NQ2C 1VG0B 3CR8A 1ZINA 2YNMA 1YJ5A 1GSIA 1ZJ6A 4QHTA 4RFSB 4CF7A 3GQBA 1VCMA 1YZGA 2F9LA 4OQMA 3GEHA 3CX6A 4MUBA 1MV5A 2V9PA 3PIRA 1ZCBA 2EVWX 4TQ9A 1TUEA 3C5CA 1DAFA 1C9KA 4R98A 1XMIA 2AFIE 1E94E 4TZ0A 4XD7D 1QG4A 5FOUA 3VQTA 4Q1DA 3HDTA 4NCIA 3AP2A 1S4QA 1NLZA 2QM8A 1IHUA 1E2IA 3TQCA 5JS7A 1HY3A 4UNQA 1AK2A 3W6OA 3QXCA 4E22A 1XJCA 2XJ4A 1T4GA 1EX7A 4YC7A 1OB2A 1TQ4A 1YZNA 2OXCA 1KI3A 2WPDA 2ZSAA 2DFLA 4PHHA 3IKJA 3CRQA 3OEHA 2J41A 2F43A 2Q0HA 2ZRPA 5FTMA 4QHSA 4MGKR 2GRJA 3AVPA 1TTTA 1E0SA 4C0SA 4Q4JA 1E6CA 1G291 1OH5A 1KI4A 3N2IA 5DN6A 5EZ5A 1GUAA 4LBWA 1YZUA 1QBKC 2ZRDA 4BRUA 1D9ZA 5KSPA 3K9GA 2ZRGA 2GBLA 4JIMA 2J0SA 2C95A 2HLDD 1XTSA 4JVSB 5IK2D 3AP1A 4TYWA 3WMFA 1SXJA 1VYVA 5J47A 2ZJBA 3G5UA 1I4TD 2H1LA 1OFIA 2ERXA 2IXGA 2ZJ5A 1NN0A 5C4GB 5DN6D 3GLHB 3AGQA 4P31A 1W1WA 1E69A 1BO6A 2IHBA 2VL7A 3NVAA 4L15A 2QTHA 3PR1A 2HYDA 3EZ7A 2AL7A 3GMTA 4PAOA 3R7WB 2ZRIA 2HV8A 4AKGA 3CWQA 1HT1E 4L9SA 3QKSB 1Y3AA 3QJYA 4PSKA 2QMHA 1FQJA 1FUKA 1HUQA 1ZD9A 3KX2A 2QP9X 2ZI5A 3RS2A 2YOHA 5JCZA 3AUYA 2OCYC 4Q03A 3IQWA 3W6NA 5KNBA 3DPUA 2ZI6A 5LDDC 2ZR0A 4S2EA 2WHXA 3FB4A 4TYPA 1JNYA 2CLSA 2VBCA 1ZW6A 3QF4A 1FW6A 1OJLA 2O0HA 3QEOA 3IILA 3AQ4A 1KSFX 4WBSA 5D3QA 2FN4A 3W3AA 4JL8A 5G3YA 1C4OA 2ZTSA 4O25A 3THOA 3C41J 2ZS7A 1E2GA 3IIJA 5IHPA 3MD0A 4B33A 4KFTA 3P26A 3IBGA 2BM0A 2NTYC 4PHFA 4NHOA 5JI3E 3PUWA 5AWFC 4NPHA 5F98A 3X2SA 4EFNA 1S3SA 5AK0A 2ZR7A 4ZCMA 2G9NA 1W0JD 1WMSA 3ADDA 2GJKA 2QMUA 4GP6A 4YONB 4NONA 4D6PA 2ERYA 4ZV4A 2IYLD 5TY0A 3EIEA 5UKDA 2AD1A 4B73A 2VA8A 4BFUA 2AFHE 3I5YA 3FPAA 4DCSA 4A0RA 5EP4A 5KDOA 5KSZA 1D8TA 4RJLA 2D06A 3EZ6A 4TTPA 1KI6B 1Z29A 2FJUA 3CB4A 1NG9A 1GKIA 2XAUA 1XCGB 5KDDA 4M1WA 2BM1A 2DWQA 3MWJA 4PC2A 4U5XA 1DVRA 4Q4AB 4QBIA 3VFDA 3GEIA 3AM1A 1K6MA 2VP5A 4URXR 1U8AA 1J8MF 1FNMA 4ZCLA 2D7DA 2HF9A 3IQXA 3RANA 4NL4H 2ZE6A 1D5CA 1GAJA 5H68A 2F7SA 1Z6TA 4M9XA 3KL4A 2IYQA 4X8LA 2CJWB 2IS4A 4FCTA 1DELA 2AWOA 1LF5A 3BRWD 1H65A 1G18A 1JPNA 4OI2A 4IW3B 2DPXA 4OI1A 3TQFA 1YR9A 4LZZA 4A6XA 5FBVB 4WZBE 4Q1AA 1FX0A 4A36A 2GCPA 1H8HD 2OXRA 3SC3A 2ZU0C 3LW7A 2BV3A 3LAWA 3LBIA 1UBCA 1G9XA 1IBRA 2WICA 4O0MA 2NO1A 5IF9A 4LYHA 4Q7LA 1LY1A 4G1UC 4HAYA 4JLVA 1A2BA 2QT0A 2CK3D 1KKLA 1R2QA 4ZI2A 3U3OA 2J1LA 3FKSA 1ZC3A 2BOVA 3V9PA 3W3ZB 3G0HA 2ZS9A 2QA5A 1QHHB 4PR0A 2AN9A 3CLVA 4BE7B 3RSLA 4PTLA 1CF4A 1YZKA 1AIPA 1CTQA 1VHTA
chains in the Genus database with same CATH superfamily
3EFOA 1U0HC 4OHFA 2ZAOA 4NOLA 4IHJB 5LYJB 1YGYA 3M89A 4CQLB 3QXSA 4NCBA 2GNOA 4IQ4A 3RS0A 3PFNA 1WCIA 4BYMA 3ONVA 2PBFA 1K5GA 3OX2A 1WCYA 4TRMA 4DV3B 2I03A 3K1AB 4D9CA 2UVQA 2GI4A 1VRWA 2FKAA 2NTEA 1AC5A 2NUTB 3B53X 1CU1A 1JG2A 2WI8A 3ESCA 4K2AA 3ZJ4A 2AI1A 2W2KA 3MGKA 1QH1A 2QORA 4YCAA 1N5MA 1ZGZA 2EU8A 5CLLA 3CPJB 1DAIA 2CMKA 1C1YA 5K99A 5E3JA 1RI4A 4WMLA 3PQ5A 5KQLA 2QLNA 4LE2A 2I76A 2GLUA 1I0LA 1GR1A 2Y9PB 2ZBPA 4EVRA 3NTOA 1HE2A 4L8WB 5U1PA 5HOQA 1NSFA 3ORYA 3V55A 3EXHA 1GV0A 1F14A 1SCKA 3GRFA 1C29B 1TZ2A 5CDTA 3FF4A 1XAJA 1EP1B 3JATB 3WP0A 1XX6A 3CMCO 4BGDA 2EZ9A 2PCJA 1PUXA 2FVXA 3O2JA 1GAXA 4FYMA 5HZGA 1HF3A 1Y4AE 2HHCA 2YRFA 4MS1A 3GLHA 3RTDA 5LXTF 1EBBA 2GD1O 2JBAB 2ORVA 3LQFA 4MRPA 4N3AA 1Y63A 4WKGA 4YDRA 4RV9A 4MDEA 5FFMA 3WAGA 2AKAB 3E82A 4QDXA 4CM8A 3GVIA 4JP1A 1JKFA 3MD9A 1K4YA 3O1IC 3M6LA 1YS1X 5F7OA 3JAWA 1EZZA 1X8KA 4HDQB 2PO7A 2PKQP 3GYBA 3OA0A 4RPHA 2HCJB 4DYVA 2J33A 3E2IA 2GETA 1MO5A 1U5CA 5BVGB 4CKWA 4JJ7A 5HK9A 3PC4A 1CUXA 3G2JA 2YMMA 4R71A 2HA6A 2O2CA 4G4SO 4IOLA 5FJIA 5LQSA 4FDTA 3QX3A 3QEKA 5EFZA 2BI8A 3AO0B 1CEQA 3M7IA 3PR3A 1DC8A 2C2KA 3ZGOA 4CU2A 1JH9A 3ZHOA 1F9EA 1PR2A 4LBYA 4G8DA 3RS5A 3EPRA 3SX4A 2MR5A 3M82A 1L4YA 2YQ4A 3UAYA 4JLMA 2G36A 2A0XA 3AWDA 1JR3D 4Q3CA 3DZDA 1UJBA 5JVDA 2JLWA 2M32A 4HOYA 1X94A 2H1HA 1H1TA 3GCDA 1ZS9A 4C89A 4GMDA 1N2CA 3C8HA 4LY0A 1FS5A 4CT4B 4YXFA 3DE2X 1JWLA 4HXFB 4BVFA 1Q83A 2O2JA 3LPLA 3QENA 1JWAB 1BEZA 1FQOA 4WADA 5JJ5A 3QPDA 3F90A 2QF7A 3O21A 4KN5A 1GUBA 4TV8F 3UHJA 3CN7A 3ZDDA 5T57A 3EEOA 4H0CA 4Y2HA 4QVIA 4TYYA 1RPJA 4ZVRA 4DCOA 3VR6A 1KRHA 4FC6A 4CG3A 5HZKA 2CD7A 4NU0A 2ZRFA 3MFYA 4QDTA 4FFLA 3K6KA 3DE6X 4BGVA 3BFPA 2DFVA 1VECA 2VP4A 4MB2A 2JVKA 3A9WA 4BUJA 1HRKA 3ZHYA 2B3TA 2CEKA 1NZJA 2VF2A 3G13A 3ADOA 1ULTA 3ITKA 5JZ9A 1HLDA 4OGLA 3ZWDA 2HLHA 1FDOA 3TLEA 1R0KA 4BFZA 1DGQA 1LPAB 4AKSA 3WYCA 1J2YA 1FMFA 2KJQA 2GZAA 3GGCA 1Y3BE 2X15A 3BK1A 3IVCA 3DT9A 3HGMA 4ZVKA 3MNFA 3GFBA 3KZ1E 2R1VA 5HF5A 4I1IA 3HU5A 1ZDMA 1IZ9A 2OKCA 4ZOLF 1VMIA 1ZZEA 4CDMA 2R7MA 1CY0A 4MXDA 1K2WA 2X9GA 3L6RA 3RNOA 5KKNB 4YRPA 1YVPA 2FKNA 4AG5A 3TZKA 3I4FA 5G0VA 1X13A 3TNJA 5EGSA 3WYDA 3ZH2A 3DAFA 3EVGA 3I9NA 3L8EA 1DCKA 5IDQA 1YS4A 3BWYA 5IH3A 2ECPA 3LNTA 3RC8A 2PM8A 3IRVA 3VU0A 5KVVA 3QU7A 3QMPA 1TK2A 3T4XA 2YY7A 1WM1A 2GPYA 2OQIA 4DDWA 4XVUA 3MS7A 1JVNA 1ADFA 3PX2A 3FPGA 2XT9A 4PO8A 4EY4A 3F6SA 1L7PA 4J1TC 4NBLA 1RCUA 1QH1B 2YL2A 1JG4A 1T24A 4R1LA 4KO1S 2YWRA 1SGWA 4WKCA 1KSGA 1G21E 4AYXA 4DUGD 2CCJA 1PFYA 2IU0A 3ZDBA 4IMPA 1NFQA 2XTZA 3L7IA 1L7XA 4L8YA 4BTEA 3H11B 5JNUA 3D1JA 4MVXA 1MB4A 8ABPA 5JS8A 3KKEA 5BXQC 1UEJA 3JZDA 2F1OA 5JARA 4GYWA 3F98A 4GECA 5T4EA 3HBNA 3O2NA 3AJRA 5DP2A 2QAJA 4RCZA 1VBMA 1TK9A 1E2MA 2CFSA 3AR7A 4ON9A 3CVYA 3IR6A 5K0FA 3Q0TA 3DZFA 1QIEA 3EN0A 3KK0A 1DTWA 3LYAA 1TRHA 3HYCA 1WHTA 1YRLA 1GFIA 1JIIA 1KWKA 2P5TB 5A6SB 5DBGA 2I7VA 3GRKA 2ISSD 4QUJA 2GEUA 3RKRA 1Z0AA 4BVJA 4TQUS 4CTKA 2PRKA 4MR9A 2CVOA 3I2GA 4F5WA 4YT2A 1NVXQ 2QN8A 1JILA 3FSGA 2WMOB 2QR2A 2WDPA 5F7JA 5CXQA 2ZSBA 2QX6A 4R7GA 3LX5A 3TVDA 5EA2A 2AJCA 3D7KA 5EP3A 5TDHA 1VHDA 3E6AA 3MWKA 1P81A 3R3WA 4RFLA 5T6MA 3ROKA 3U7QB 2D59A 1V3VA 3MCVA 3WGKA 4I55F 2GEDA 4CKBB 3TEJA 3WL5A 5BN5A 4ZHQF 3LNCA 5CPFA 4LHSA 3DOIA 3WDMA 1NVUQ 1M1YE 5DT9A 5IYZF 1H94A 1SXJE 4GGOA 5LN1A 2J0VA 1AQUA 1I2DA 1XMQB 3PSAA 5JCXA 1NAHA 3GXBA 1Y9JA 4WZ6A 2WJIA 3B3QA 4FX2A 4INOA 3MJFA 4QJ4A 4LBVA 1II9A 3RLIA 4C4RA 2B2XA 5ICEA 5JQGB 4CMHA 2BZSA 4MVJP 2P5YA 1O58A 4GVLA 1C9JA 3AF0A 2I2XB 3NONA 4S2UA 5TQJA 3WGNA 2PT9A 2ZRQA 4RA9A 2QE6A 4B7XA 1KYIA 1LZLA 2X1MA 4DC1A 1EB8A 2WD7B 5FYDA 1DWOA 1Y3CE 4J94A 3H17A 4I2VA 3ZWCA 3Q6IA 4B4WA 1KARA 3SSAA 3T1QA 4EGAA 3FLMA 1PEKE 2WQZA 4DLBA 4CT5A 1LK7A 1T91A 3AF2A 3F5SA 3HKDA 4AL4A 3FJOA 2E1RA 2PWAA 4CUKA 1NQWA 4LSZA 4YV0A 5B1EA 1T5SA 5IT5A 3DLIA 4DIMA 4M60A 5J2UB 6CHYA 1US8A 1YU6A 3D3QA 3IEPA 1YIDA 2IQIA 1GM5A 2C59A 1C0KA 2DAPA 1NUTA 1GDDA 2FRVA 1U5AA 4CIWA 2EGUA 2AFIA 3SQOA 2DQKA 2BFOA 2Z1NA 3T3DA 4EUSA 1PZFA 4ZQIA 2KBFA 1L8LA 3LC2O 4K8RB 2UUCB 3EW9A 4GXTA 3KAJA 1KIFA 1LPMA 3GUYA 3GLUA 1E6MA 2O8CB 2HJHA 2WR8A 4L9RA 2QD2A 1I3KA 3F7MA 3UJNA 4UXIA 3N2GA 1E60A 1G7SA 2X23A 4JOQA 1J07A 2D6FA 1UDWA 1OHHA 2Z08A 3EHEA 4IZHA 2BISA 2D5LA 5CFQA 1TVCA 2CSXA 1J00A 3RFUA 4CMBA 4ZC8A 2Q3JA 1EWKA 3RE1A 3PRYA 1J70A 1UXHA 1X7XA 1F3LA 3QMMA 4FSDA 3ABZA 3TRFA 3EDRA 2AEFA 4J7UA 4KLCA 5C8VA 1JQBA 2X40A 1ZRHA 5C80A 1HR0B 3P4YA 2IPOA 4BECA 5HK8A 4JB8A 5IBCA 3GPBA 3KLMX 1OF1A 1JECA 1S2NA 1E4VA 4MUMA 4YH1A 2X42A 3QPUA 3EF3A 1OFUX 4JUCA 3F9CA 1O08A 2X5KO 3BYZA 2O1EA 2IYRA 1X7HA 3LL7A 3S8YA 4DEVA 3A11A 1QQ7A 3JCZA 1F6BA 3OJFA 1FOEB 4MP8A 4UEJA 4XARA 1W2HA 2NUAB 5A04A 4GYKA 2ZG6A 4J6EA 3DWFA 4RXUA 2BGJA 2HA5A 4YAWA 3WLIA 2HGSA 1MJGA 3GVXA 3AJEA 2VYFA 3N2EA 4Y6SA 4ETWA 2HMVA 1W4LA 4ZJPA 1TO1E 4EY8A 1RXIA 1ZBQA 2QE7A 3N8GA 3P5BA 2BELA 4HPJB 4NEQA 3QSYA 3UA4A 1TUGA 4KI0A 2XNSA 2R7NA 3EJ6A 4F5EA 1JG7A 4ZT5A 1O8CA 1LI4A 3ROFA 3K2EA 3ELUA 1HE1C 2O07A 3Q88A 3VI4B 4PZ9A 3O0TA 4NY1A 1M6HA 2XUHA 2I22A 2CB9A 3HM2A 4BWFB 3DT6A 1NR7A 3DSRA 4TSFA 2NXWA 2RGBA 2Y1OA 3BF7A 4JENA 3OIGA 1PWZA 3UT6A 1HT2E 2ZULA 3D31A 3PXAA 3LSTA 1ZKMA 3PT9A 4QFCA 3CX8A 4D98A 3EYAA 2K7FA 4GRAA 2FEMA 4B46A 1WVIA 4HGZA 1QK3A 2E6UX 1I3OA 1VI5A 3Q9LA 2F1HA 1O4VA 2O6LA 3MMXA 4G24A 4JSRA 4LNAA 2R8RA 2FFBA 3NIBA 4NBKA 5AKIA 1GFSA 2WU1A 5LBIA 3ER8A 4F8JA 1JSZA 3LKZA 1JLKA 1NI3A 2CDBA 2Q1XA 2NZYA 2P27A 4UW9A 4Z1OA 4EB6B 2P7IA 4O5OA 3ZTYA 4A8JA 5KOJA 1OH7A 1PGPA 3ESAA 4MHSA 5I4IA 2WZQA 3RAPR 4MAMA 2VLIA 3KYJB 3NDPA 3EUEA 4BN4A 1L7EA 4FOSA 3R5TA 1ND6A 3DXYA 1CV2A 1VBNA 2JHPA 2O7VA 3ANSA 4P3OA 3UO8B 1ISJA 1YMVA 3O3OB 3SQWA 4KR7A 4JYPA 1KOLA 4D0SA 4K2HA 4K9OA 5LLDA 3V4ZA 3WYFA 2GK6A 1MT3A 1FDWA 4RPIA 5JH7A 3FROA 5T8KA 3A7EA 4AQ7A 1TI7A 2EV9A 4RVUA 3GUCA 3HGQA 3KXDA 4ZJUA 4NAHA 1J39A 2XMCA 1OSNA 3KYDB 2WQ7A 4W1QA 2VF5X 3OAAA 1Z7YA 5ENZA 3WR5A 2R7KA 5CLFA 3SKXA 4PCLA 4V0LA 4X65B 4C4XA 2WPDD 4LWOA 3TFWA 4G8BA 1T9HA 1FW8A 3T7KA 3GFTA 1WX1A 4OIFA 1Z4NA 2ZTVA 4R68A 3OPXA 4MKHA 7ADHA 8OHMA 2BTQA 2N1BA 3JQPA 2FPMA 4P34A 3QUTA 3RAEC 5EXSA 1MG5A 1UT8A 4PC1A 2H7CA 3SCZA 1S02A 2QVCA 2HA4A 3BHNA 1M3SA 2ZRHA 3ZCQA 2VNIA 3RIXA 4EGCB 1XK6A 2PPLA 3MJDA 4IGEA 5C53B 1VCNA 5FUXA 3IMCA 2NN3C 3OQNA 3TLZA 1QP7A 3AMVA 2W2PA 1UK9A 4KWHA 4QPNA 4V39A 4ZT2A 4KLAA 3CLUC 3N2NA 1QFYA 5KNLA 2Q8QA 3RG2A 4MX8A 1LGYA 2DUNA 1QF6A 3W6ZA 1KYTA 4WLNA 3HN2A 4TLDA 3TQQA 4CZ2A 1BQEA 3IH5A 1VHJA 4ZCTA 1EDDA 1LSSA 1TUBB 2O48X 2R751 4WOJA 4OB7A 3UUEA 1WXFA 4C21A 4CMCA 2C98A 4CIXA 4D3SA 4GE0A 3G68A 3QELB 1U7XA 3FAZA 1U0TA 3OETA 2QRPA 4B75A 2HDOA 1IHYA 1SQ5A 1JB1A 2PKYX 3STTA 1M10A 4II7A 4MIYA 1G2OA 1VYHA 1DQPA 1XDBA 1YKSA 2EBWA 2NU8A 3A1DA 1Z25A 4DGQA 3S27A 4MKGA 5KPJA 3W77A 4Q18A 1FMTA 4X7PA 2CKMA 2G1AA 1AKYA 2R8BA 4IQ0A 4U2EA 4BNHA 4OKIA 4V0NA 3MWEB 2WTAA 3WGUA 1N2XA 5KYYB 3BXHA 1B0AA 1KY5A 3ETLA 4HZGA 5AO9A 5IKPA 2ZM6B 4C7KA 3VKFA 1OTYA 2WHYA 1GZ3A 3X1XA 1G4UR 4B76A 2D2XA 5J2TB 4IEFB 3ONWA 4D4MA 1E1NA 2DUJA 1ISHA 2D62A 3R9XB 1B8VA 4MR8A 3W78A 4EB8A 1NBHA 1WZIA 3PJFA 2FGJA 4U2GA 3AJAA 4IDAA 5EI5A 5LQJA 3I5XA 1XZGA 3DZIA 4TXJA 5CCDA 4HLNA 1Q0RA 1GPLA 1QRDA 1SVMA 5HJ5A 1RD4A 3OURA 5AJZA 2F1JA 3EASA 5EOVA 4NCAA 1KIMA 4JUBA 1NTRA 1YHYA 4FIDA 1RQPA 3G0GA 3N28A 3RCBA 4RABA 2A30A 2E21A 4A8TA 5C1IA 2ZJ4A 4HH3C 3PK0A 4M38A 1B6SA 3Q3VA 4FU0A 3U9LA 2TMKA 5LLSA 4WK2B 2H54A 1HWYA 3Q11A 4TMXA 4ZU1X 4EG3A 3U7HB 3AUJB 2V7TA 1RZ3A 1GNQA 4XIYA 5I51A 1FFHA 5FTJA 4LFBB 4ZTBA 4TL6A 2WUGA 3X3HA 2Z8YM 3K9LA 4MUYA 1ORTA 3G88A 1UMCA 1USGA 2ABWA 4AKIA 1RE0A 2WLTA 1BHQ1 4TN5A 3TK1A 4ARCA 4E5NA 2FDCA 2FW0A 4YCDA 2YIMA 4N3CA 2X1LA 4DG5A 2PKRA 3QEBZ 2CLHB 4ZVUA 3IDFA 3BERA 3PENA 4HADA 4K6MA 4WNCA 2VQ6A 1RWQA 4XB6B 2VCYA 4DXAA 1ZGJA 3MHPA 3OMLA 4V3CA 2N1MA 5FF9A 4CUZA 2J31A 3S3TA 1H0SA 3TD2A 3SZMA 5G41A 5H3HA 1J24A 1AKWA 3TW8B 2W6ID 3RSSA 3PGA1 3VR4A 1Z6QA 2K87A 3U44B 4X1YB 4D8UA 4HUTA 1EFPB 1GPH1 3GZJA 3OM1A 1S89A 4E0BA 2QTWB 3EEQA 2NVUA 1YQUA 1LX6A 5MN5A 1YTLA 1TAHA 2BTQB 4M8KA 1NRWA 1LNQA 2VJAA 2VHUA 1G20B 4W5NA 3PXCX 5AKLA 1MOPA 3B9RA 1GAEO 1ZSVA 4E46A 1XC7A 4KYIB 4NH0A 3ES9A 1TJ5A 2QSJA 1T9GR 1UBSB 1P1CA 3IQHX 4TWJA 4UVDA 2GPJA 3SP1A 2ZJFA 2FK7A 4HB2A 3VR4D 4F3NA 4LSGA 4RNDB 1E64A 3G5TA 2IXTA 1UJ2A 4WXYB 1NI4B 2V7WA 1UWKA 3E7PA 3E3MA 2YBDA 4IL5A 4TXMA 1ZGCA 2OTCA 3EMVA 4YJHA 3R7SA 2OK8A 3U0VA 2QD3A 4AWBA 1LRKA 3QIVA 2VEDA 3RUFA 3PCTA 1WLSA 5C1OA 3PTZA 3FM9A 4X61A 4BEWA 1L1QA 5CTAA 4HTAA 2VF8A 2W00A 2A0UA 3RTCA 3RFCA 1Y3IA 1CZKA 4WHMA 2PSHA 1WMBA 1ZUIA 3OY7A 2CFTA 3H4VA 5D5QA 4DNPA 4F38A 1MAWA 1RZVA 3MLBA 4AZWA 1QB7A 1MQAA 2BHRA 1XI2A 1K6XA 3NG1A 4I4NA 3CG4A 1X1AA 1NPTO 1GYQA 2GHIA 1WNFA 3LI2A 4H18A 3CRVA 1W48A 1DAEA 3EMKA 5BOSA 3QPVA 1JLSA 4J76A 2ZIXA 4BJHB 1V8FA 1Y1RA 2TYSB 3KSRA 4HGRA 2XIQA 5EIFA 3ZHQA 1H2HA 3NEYA 5IJZA 4FP9A 4I9GA 1T3TA 1BD3A 3RJ5A 2COUA 2GXAA 3LDAA 3K09C 1E7YA 2PEYA 3SYRA 3DAOA 3EDQA 5A4KA 2FG6C 3H1AA 3ND9A 4HWSA 4EAAA 3OCWA 5DTJA 1RKVA 2A58A 2Q5OA 2NQ8A 5JISA 3HDJA 3LGAA 3ZC3A 2F90A 1V4VA 3IXMA 1U7DA 2NP7A 2WMYA 3FFAA 5IM4A 3K5PA 3A31A 4V0ME 1JYEA 3VR2A 1F0NA 4NCNA 3VPCA 3V1KA 1BA3A 2G63A 3ND7A 4UVHA 3TS1A 3TW0A 1R00A 1RM3A 3C70A 3WBJA 1G8JA 4AI6A 2O1SA 2QXYA 2XD9A 3B20A 3CE6A 3NAMA 4M76B 1Z8DA 3CCBA 3EXG2 1Z15A 4CV3A 4XVHA 3RD5A 1DTEA 1RYMA 3BEOA 4G5XA 4ZDJA 2XOKA 4XIJA 3SQXA 4NBVA 1UBLS 5HYVA 4I8DA 2JC3A 1RJ9A 1RJGA 2P9CA 3DXFA 4XTCS 5TVGA 3A1SA 5LSAA 1RWXA 3T06B 1YGPA 2PSDA 1YASA 4W7IA 3R44A 4INAA 2RKOA 3THYB 1BXKA 1PV2A 3NHKA 1QMPA 3MB8A 4FMCB 4ENRA 4LXTA 1U2EA 1NSTA 2WVJA 4OJTA 3AETA 3CC8A 4HZUB 4NSNA 5ALDA 4KR3A 1VE6A 2GZ2A 3MXTA 1GTG1 1J2JA 1JE1A 2W2KB 3AF4A 3CLRC 3BMCB 2DFKB 3I6IA 1GUYA 1XZDA 1Z5ZA 3L02A 1HLPA 3FNQA 1RAFA 1YJBA 3H04A 4J16C 3P9KA 1O5OA 5H80A 1XMJA 3X1MA 1TECE 2B2NA 2FN7A 2XSZD 1RIIA 5I3CA 1E32A 1QF9A 3O47A 1QG0A 1DT5A 2F1RA 5BSHA 2M1XA 1BWRA 4AXXA 1X1BA 2XVAA 1HMPA 1UC9A 1W6RA 4J49A 4TUYA 3VAAA 4ERNA 2GTHA 1QRUA 4YLEA 4AO6A 2YRXA 4HGQA 1B2LA 1XZEA 4X7BA 1NVMB 5KQSA 5J4HA 1N2IA 3M49A 2WMDA 1GPYA 4JEUA 2A5DA 4DT1A 5FHQA 2CF6A 3R0IA 3PNLA 3FHTA 2Y1GA 4J0QA 1H4VB 4RDIA 5I7UA 3OLXA 2PGNA 3NTLA 4MKFA 1G0OA 3VV2A 3IOBA 3PGMA 4RC9A 3OOEA 4RSHA 4I50F 4ZZIA 1EFAA 1ZN2A 3ZXSA 4JXJA 4LDZA 2JATA 1HEYA 2BSQA 3DLPX 1M74A 5HM8A 4ARIA 5HE8A 1GIAA 1JSXA 1N7JA 3EIWA 1UJ5A 2Y1DA 4KQ9A 5LQCA 3RYCB 3GPLA 3I01M 2OY0A 4B87A 4YDSA 2GUWA 2N75A 2BMJA 3M4NA 4IVRA 3WK8A 5DSZA 4F1JA 4NV3A 3F73A 4IHKA 5BYKA 4IJVA 2C4HA 1U90A 4L2IB 2O8FB 4Y2UA 1KFBB 4NV1A 2XGMA 3N2KB 4QO8A 1QYDA 2MJLA 5JDIC 3TOXA 3SC4A 2VHJA 1CS4C 1GQYA 4YQFA 4EW2A 1W94A 4JBYA 4JBIA 3UJDA 5HS4A 4KPYA 1TM3E 2VTVA 1RFGE 3DWEX 3BWDD 3MWYW 1R9MA 2IGBA 1S8NA 1L4EA 2X0RA 4XKJA 3RKUA 4JC0A 5D7BA 5JBIA 3CT6A 5KMGA 1CIVA 3OQBA 3HV2A 4DCJA 2J5BA 3X1KA 3DO8A 4P7FA 1L0BA 4M0CA 1GNPA 1SHTX 1CQWA 1G8KA 1YT5A 1L5LA 1SEPA 4IILA 4HBGA 5IXYA 3U4HA 2WM3A 1R5OA 2C0PA 1GNLA 1AF7A 1QPBA 4BASA 1ST2A 2HWWA 3D4PA 1KI8A 3ANLA 3O73A 5CVDA 3IP8A 3S1AA 5JE8A 3COJA 1E5VA 2B6NA 1X1DA 1FYVA 2OAQ1 4GRIA 4KL8S 4LDQA 3QV1A 4YI5A 1ZD4A 4AW9A 4PQRA 4CYMA 1A8IA 2FX5A 1J1IA 2JH9A 4JLOA 4U6SA 1Z5NA 4EG8A 5J4LA 3AM3A 2BTEA 3NHUA 3P9XA 1UBRS 3RB8A 4CKWB 2UAGA 5TMDA 1PVOA 1L4NA 4I36A 2QLTA 1P91A 4NYMR 6REQA 1GTMA 2AH5A 5KX5A 3QITA 1JQDA 2RARA 4K05A 2IJGX 4M0KA 1RJDA 3E9CA 4AUKA 3UCXA 2Q2NA 5LKAA 1CNFA 5K0ZA 4RTQA 4BVEA 1G66A 1Q14A 1CZNA 4H7IA 2C2WA 1VP3A 2ZUSA 1REQB 1P6QA 4KDFA 3HI4A 4UCXA 4GNRA 5CD1A 1RADA 2C2ZA 2EFYA 2EKDA 2CLDX 1B2RA 4EF6A 1PJRA 3C3XA 1UK6A 2WHEA 2ZWOA 3ENZA 4ZVQA 2P6RA 4JB3A 2P2DA 2GF0A 4KYTA 5HF8A 5HILA 2WJ3A 2H1SA 2RGXA 5TE9A 4CR7A 5CCEA 5CEFA 1JDBB 3BMXA 4BB0A 5LR6A 4Y7DA 2XGJA 1E96A 1X2BA 5AJUA 1UPCA 4D9HA 4OQDA 2JCVA 2PKXA 4ZYTA 2IX3A 4V0KA 4G2TA 2K2QB 4LSWA 4LF5B 2PLRA 2XTAA 4BTLA 3NNDA 2W2VA 1DB3A 1L9KA 5CAEB 3HHEA 1NMXA 1GITA 2ZWIA 3IBTA 2C4TA 2LKCA 3TFQA 4AZ0B 5KJ6A 1JEYA 5ALMA 1I6MA 4F9TA 1MD9A 4QXMA 3HU1A 2HT1A 1G5PA 2CYCA 2PZ8A 4MVWA 4AZ3B 2Z6VA 4M46A 4HAWA 5TNXA 5DNCA 4GI5A 2IZ7A 1V43A 4B7UA 3I61A 2WV7A 4G0PA 4C30A 5B7NA 1MJNA 5BRJA 1BCSB 1BDBA 2VYQA 4BV8A 2B21A 3QWAA 5IWCA 1ZM3A 2H8KA 2HT6A 3W5VA 1KYXA 2F3SA 1SXJD 3Q0EA 2Y76A 3HLYA 2F1KA 4P81A 3L7DA 4LNUA 4TMZA 5IDXA 2EFCB 3R3SA 4D9EA 2O3JA 1K98A 2HCTA 1CY4A 1GQ2A 2R1VB 5TT1A 3NKVA 1E2QA 1SAYA 5A7GA 1V11A 3GLIE 3D8SA 1RRFA 2VWHA 2NU9A 3N70A 2AVDA 4OYHA 3UICA 1RAEA 1H8EA 2HF8A 3DL4A 1JPUA 3TXAA 3SIRA 3ZLUA 1XTBA 4LX0A 3HNRA 1KVUA 2NGRA 3QOWA 1KDVA 1UMBB 3QFFA 4QJ3A 5M5BA 1T0HB 3WGMA 2FQYA 3HJNA 3OTHA 5CVJA 4M9RA 5DW3A 3W05A 4V1CI 3ZGZA 4DNXA 4RHFA 5FQNA 5TLSA 2F55A 2WTUA 1MC5A 2EKZA 1W4AA 2GASA 1A9XB 4REQA 5BSVA 1GDTA 4YY3B 4OFBA 1RQNA 4K86A 3ANXA 4L0QA 2YXBA 4E03A 1CR0A 2Z1DA 4F8YA 1IC6A 4XEHA 5BR7A 3GRZA 3LFHA 2VBGA 3IJRA 4B3MB 1P1JA 4FFBB 3E3OA 1ZM9A 1TXGA 1LI7A 2ZB2A 2B4AA 1E5DA 4HLDA 4EHHA 5IWAB 3KYIB 2RAUA 1DHTA 4JI6B 4CVNA 4D9BA 2C5SA 2GAFA 5JQGF 1V26A 4J0DA 2CUZA 2WF8A 3DHNA 3EYWA 2YMQA 1LS6A 2VCHA 2GO7A 2ORED 3N53A 4GMFA 4H0FA 4M0EA 5DDIP 1QWSA 3FPBA 2JIMA 3DBOB 4U7TB 4WJZA 4CMEC 5H59A 1G8SA 3HBMA 5JAMA 1U2TA 2J08A 3IBCA 5F9FA 1Q7GA 1MBZA 1Y8CA 2Z09A 4JU9A 3NHZA 4O63O 4EW6A 1U0FA 2W11A 3FR7A 4NBRA 1N36B 2CV1A 4JI4B 4DABA 5BN3B 1Y6GA 1Y89A 4O1HA 4ASUD 1U2QA 3H5RA 4DUYB 4XGIA 3SZLA 2CE7A 2PZEA 3C3BA 4HNGA 1CS0A 2R5WA 1TKCA 3U9TA 4KZKA 3SX0A 4DE5A 1YE8A 2DTXA 5HOEA 1HI9A 3UUWA 2D1RA 1KA9H 1OXBB 3SVLA 3T8YA 5JJKA 3DDOA 3TTWA 1ECGA 4BO0A 3H05A 4KTVE 4BKMA 2W6PA 1P29A 3OIWA 1AMNA 4MQMA 4YJGA 1T2AA 3FDJA 3TR0A 4ZYUA 2M1ZA 1T9AA 2R44A 3C7TA 4K1XA 4P4SB 1TVKB 1GGKA 2UVPB 1OH6A 2RHJA 3BEDA 3PHGA 3I8XA 3NV7A 3RO7A 2W70A 1YUNA 3A37A 1RLTA 2YS7A 1ADGA 2M6KA 5CHEA 4U2CA 5I7AA 2O3QA 3VU8A 3R76A 2EF0A 1ISSA 3GEDA 4IDGA 4QOIA 3UM9A 2CXNA 5F5XA 2B1IA 3SNKA 4A0GA 1K63A 2Y1LA 2HYIC 4TSFD 5JMWA 4QDOA 4E1VA 5KWVA 1CUFA 1R27A 3HM9A 5K3AA 3K9NA 3CRMA 3JSXA 3FMFA 3D4OA 3P97A 5B3AA 3UMRA 4KE6A 4R3UC 1CJSA 1T5IA 1T5OA 2QOEA 3GFQA 2GNAA 5HFAA 1DFGA 2YYZA 4LJ4A 2EC5A 3OP4A 2WD7A 1WG8A 2H08A 3IAHA 4UTPA 1AS0A 2OCPA 4UASA 5HCIA 2YFKA 2ACKA 2XF2A 1X87A 2BDTA 1ZOLA 4P6VF 1WB5A 1B3RA 1MKYA 2YXLA 3AJ9A 4BLSA 2RONA 5AESA 1AUXA 3MG9A 3I12A 3I1IA 1KI2A 2BVNA 3RRZA 4AMGA 3CEMA 3GQVA 3EQZA 2PX3A 5K3CA 1YQWA 2DRIA 3SR0A 2GEBA 5C34B 3L9WA 4EHJA 1NC1A 1QCYA 2BW0A 1PUIA 1M2GA 2IZOA 2MSEB 4GOOD 4LJ6A 1J22A 4LV6A 1UDXA 1Z26A 2PS0A 2WSSD 2KX7A 4P4UA 4DIUA 5JPCA 3CKLA 5GIOE 4BB6A 5HZMA 5IDYA 3MT0A 3GDWA 1WXEA 3FNIA 3A2NA 1TC2A 1Z0DA 2CJXA 3GLGB 1CZLA 4TXNA 4S35A 3LOQA 2IS1A 3WYGA 4UMVA 2SCUA 4JB0A 2RKWA 1RYZA 3VVCA 1RJEA 1TZMA 3CUYA 1X14A 3JR7A 2GFHA 2VK2A 1XWWA 1B14A 1RRPA 3SPXA 1OV6A 5ES4B 1UDBA 4F6RB 3QG5A 1C8KA 1UXIA 5PGMA 1BW9B 4UEOA 2HPAA 3DB1A 3UJ9A 1ZAYA 1M66A 2VF4X 2BHNA 2XODA 3L0SA 4JX9A 4IOKA 1H4SA 2QLJA 2VWGA 1KXZA 1XEWY 3X1DA 1TU3A 5TPWB 4QTTB 2BMFA 4RKEA 5EP1A 2CLFB 3O8RA 1OXTA 2WA2A 3BTVA 4CLOA 1IJKA 3FTEA 2PMBA 3N7AA 3K2QA 4BQFA 4LF8B 1ODLA 3C0KA 4YDHB 2QTVA 4O2BB 3CH5A 3DBHA 3PPWA 4QOFA 3VPGA 3Q8LA 2VSYA 4UNNA 2BHLA 4KYUA 3BJMA 3P9RA 3WA6A 3ZU2A 1NVFA 4BMPB 2R97A 3LDHA 4H6PA 4W9NC 3LL4A 2DY1A 2V5VA 4I1SA 3VNRA 5IW8A 3H5VA 1CUBA 2JZOA 1DBQA 3AXTA 3PDWA 1HT3A 3K0HA 1TMOA 3EWIA 7MDHA 1NY6A 1ECBA 3B5IA 3CPSA 1NVDA 4XGKA 3DP7A 3UV6A 1YDMA 4UUQA 2OQVA 2VEOA 5T6BA 2I1WA 2ZREA 5ALWA 3BORA 1AXGA 4LRWA 1TAGA 3N59A 5FOVA 1R74A 5LBUA 2EHJA 4EYEA 1KAQA 3OT4A 5LP1A 1FJHA 4DLPA 4RIHA 3D3EA 3FYDA 4CTMA 4DV2B 1GTZA 4BZWA 3G8DA 3R3XA 4JQCA 3FHLA 4GR4A 3REFA 1ULAA 1YE3A 4XM0A 3E9DA 1DNPA 2WB4A 3B82A 3VTKA 4MRSA 2OOSA 4P4SA 2OCDA 3BHIA 3D4LA 3CY6A 1HV8A 4GH5A 3OC6A 4X92A 1OBFO 1WDKA 1GNTA 1QK4A 2Q29A 2QQFA 4X1IB 4XX0A 4ZO8A 4H4EA 5DI9A 3UKJA 4GMKA 2HRZA 4LKRA 1TX4B 1TKBA 2WT9A 2XNDD 3WLMA 3WWPA 1MQSA 4YMUA 1RIFA 3P4XA 2WIDA 3BTOA 2PUTA 4DAOA 3D3NA 4J7XA 1NP3A 4AXBA 3CLTC 5K09A 4CF6A 1XDWA 1JHDA 2JFPA 4DJEC 3AI1A 1QRTA 1IHOA 3MJCA 1QP0A 3DGEC 4JUFA 2WUDA 1AV7A 1NW6A 5JAQA 4AJ4A 3DEKA 4LJAA 1Y8QB 2BGRA 2CLKB 3D4BA 4QYIB 4HTFA 1EQ2A 1FP2A 3CIOA 4G0VA 3BFJA 1II8A 1FFYA 4M9ZA 1KQ3A 3LC1O 5LP6B 3PITA 4KQ1A 2V7XA 4NAUA 2R6DA 4U2KA 2WKPA 4KXMA 4LOJA 4DCMA 3Q8KA 1ZH4A 2VYNA 1AJEA 4DCNA 4KVAA 3LC0A 3ZHCA 1TIKA 1E1CA 3ZZ1A 3ZJTA 2O52A 1U8FO 3D4IA 3AL3A 3U3MA 3BMNB 2QWXA 3BRSA 3CFYA 3Q7EA 1JMVA 4YUWA 1B8PA 3CGGA 4ROTA 2BFPA 5M3BA 3ZY6A 4XIGS 3GLFE 3FMIA 1ZMXA 4OK5A 1KE1A 4NWIA 3VSBA 3VUFA 4BP1A 5EG5A 4DIFA 4E13A 2P79A 4Z4FA 2DFTA 2O8EB 3I73A 3C43A 3CKKA 2B61A 1VLJA 2ZSHA 5LJIA 1UM8A 3SDBA 3W5DA 4KRGA 4MYRA 1YDEA 3T5DA 2NO5A 3OO0A 4V3BA 1SA0B 3C1TA 2JFWA 2IEBA 2WOJA 4IVPA 5E9JA 2VTEA 5CEEA 5GJVC 3L8DA 1ULUA 4W1RA 2WUWE 5FCDA 4EDHA 3Q7PA 5CW1A 5DYYA 4LCJA 1TZJA 3D54D 3TAHA 4IJUA 4AAYA 2H59A 1P62B 3BB1A 2QL5A 1ENZA 1B76A 1RJWA 4KO4S 1CK4A 4W82A 4R8KA 1GLVA 1XB2A 2RK6A 5J5VA 2BPOA 3EY4A 4W5QA 5HM6A 3LY8A 5EJ7A 3KT8A 3IUYA 4QL3A 3O8CA 4QGBA 3SYTA 1WSAA 2B5OA 2EDAA 3ZLTA 1ZW1A 1MRZA 4NFYA 4BOYA 3K71B 2L2QA 4WZAA 3ZIDA 3T5PA 2JGDB 5BT9A 3E27A 4C07A 2PS9A 1NVVR 2VRWA 4X64B 4ZTUB 4O08A 3LUHA 5KTYA 1M6YA 3D7SA 1XNHA 5CCXA 5CFRA 4NMLA 4QA9A 1LBSA 4KUEA 5KCMA 3TIVA 4Q1CA 2NXJA 4IF4A 3VDRA 1BH2A 4RE5A 5LZ7A 2GAIA 4RF2A 1E4OA 1QHSA 3NGXA 5F1PA 3WFZA 3MJVA 3AVOA 3I28A 1XVIA 2AT1A 5BV8A 1YKGA 2D13A 3PSHA 2E1PA 1RYYA 4IQGA 1MOSA 3IP5A 4PU0A 4BUZA 1E3MA 4DR7B 2RI0A 4BMYA 2FZCA 4HDSB 3BL5A 3UV7A 1HTWA 3PC8A 4X62B 4ZGGA 2MIIA 1J8FA 1ODIA 2R5FA 4N82A 4B79A 4DJTA 1MX5A 5ALXA 3B7GA 1PS8A 2XVZA 4E94A 5K8VA 2GMWA 3KQQA 3GQBB 4E33A 4OP3A 3RU9A 2A1UA 5BY2A 3F7NA 3CZMA 3A6LA 4R16A 1CQXA 2WG2A 3NEJA 4PX9A 4YV1A 2WIJA 4AROA 3D5TA 4YCBA 3W90A 4HNTA 1PSDA 4Z51A 1L5YA 2VT6A 1GXSB 5CDYA 2LV8A 2O2SA 4US0R 2C88A 4H1TA 4RK1A 2YFHA 4QJIA 4PCUA 3CUTA 4MINA 1HT0A 1UPXA 2BEUB 4F9GA 1NW8A 2KBEA 2QD1A 2UZ1A 3R5KA 4K81B 1AHNA 4DW8A 3R3HA 1L7VC 3OF5A 4Q16A 2AMLA 3OFNA 3RRYA 4FFRA 1O94D 3B2EA 2ZQ5A 3B1FA 1M67A 1EFKA 2WKSA 4Q9IA 4AIC