3FDIA

Crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
161
Chain Sequence
QIIIAIGREFGSGGHLVAKKLAEHYNIPLYSKELLDEVAKDQDIAIRQFNFIRKKANEEKESFVIVGRCAEEILSDNPNMISAFILGDKDTKTKRVMEREGVDEKTALNMMKKMDKMRKVYHNFYCESKWGDSRTYDICIKIGKVDVDTATDMIIKYIDSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein from Eubacterium ventriosum ATCC 27560.
rcsb
source organism Eubacterium ventriosum
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 48
structure length 161
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13189 Cytidylate_kin2 Cytidylate kinase-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fdiA00
4AWXA 1G17A 3O8CA 3U44B 3W6OA 4JKIA 4KAXA 5H8WA 2ORVA 2O8BA 3HPQA 4GZMA 4RCZA 3WMFA 5FTNA 4CRWB 4DUGA 1PUJA 4I4LA 4E03A 1IN6A 1G3RA 4EAQA 4MH0R 3SQXA 1TEXA 1QG4A 3OHMA 1ZD1A 4MYCA 4A0HA 1P9RA 1DTSA 1ETUA 1T8UA 4QHYA 2W2VA 2ZSEA 2D2FA 1TQ4A 4P0TA 3LX5A 4GSYA 5C46F 2BM1A 4MKFA 2GCPA 3NBZC 2FE4A 4FN5A 3U3KA 4DHEA 4CZ2A 1NSTA 4M1KA 4D0NA 5LB4A 3KFVA 3EC2A 1WB9A 2GAOA 2IUTA 4URZR 5AUNB 2ORIA 1KY2A 1XTKA 2D06A 4BFTA 1QF9A 2JGNA 4A6XA 1KIMA 2JA1A 3GLHA 3I72A 1GTVA 4B35A 1IBRA 4B3XA 4TMTA 2GEVA 3FHTA 1SVSA 1KTVA 1TPZA 4FCWA 4DXAA 5KU1A 1J8YF 4URUR 4Q03A 4KJZA 2SHKA 4R2HA 4XJXA 1I4LD 1LS6A 2VF8A 2HT1A 1CEEA 1XEWY 2PMDA 1VIAA 4IDNA 4LPKA 4B3DA 2QL6A 4V0OA 1PLJA 4UJ5A 2NO0A 2QPTA 3H4MA 1T5IA 3P27A 1XCPA 3PFIA 3QENA 2P3SA 1WBBA 1EFUA 4WOPA 3RRYA 5HE9A 2QN6A 4V0LA 1U81A 1QHHA 2C5LA 3CNOA 4MUAA 4XOIA 3IPYA 4GT1A 4ZIRA 2F55A 5HCNA 4B3BA 3AP2A 4LK2A 4BFSA 1Z8FA 1HE8B 2O8CB 1AJEA 2CJWA 4PTLA 1XEXA 1CXZA 2RGXA 3U4QB 3KZ1E 3M0EA 2ATXA 3DO6A 3P4YA 1WF3A 1RFLA 3AKEA 4DCNA 4TZ0A 2WWXA 2DWPA 2R6FA 4OI0A 4QHSA 3RSOA 1KJZA 1W5TA 2QM7A 1VCNA 4BRUA 2YWEA 4ARZB 1Z06A 1VG8A 2D4HA 3AF4A 5EE0A 3DZ8A 2C77A 2W6IA 3RRNA 2REXB 3UWOA 4F4JA 4OKSA 2HT6A 1CS4C 3GD7A 2ECKA 4JVSB 2BOVA 3EZ2A 4O2RA 1S96A 3KTAB 3SBEA 3RS3A 4BZXA 5L3SB 2ZUDA 3GQBA 4KVGA 5FPTA 2CXXA 1WBDA 5C4GB 2YOHA 1NF3A 1YE8A 4TL7A 4JLKA 3U7EB 1KO4A 1EFHA 3QKTA 3VU9B 1KI6A 2G0NA 4FMBB 1KJYA 4F7WA 1MRNA 4JLVA 4LCBA 4L9WA 4DC9A 1EWQA 3DOEA 5DIFA 2GAAA 1N6LA 3TRFA 4BQSA 4EQ6B 3O8RA 3ZD6A 4HUQA 2V1UA 2IYQA 3CPJB 4ON9A 1JQLB 3CNNA 1OXTA 1OH6A 2PX3A 3V4FA 2IXGA 2RGNA 3AKDA 3NH9A 3EIHA 4P4UA 3ZJYA 4D26A 2ZSDA 4NONA 2LKDA 2CK3A 1XCMA 5EUMA 4CEIA 4Q4HB 2L0XA 2YV5A 4HLUA 3B2EA 1CJUC 5JWHA 3X1YA 1XTJA 3K9LA 1NVVR 4AYTA 1NVXQ 4PC2A 5EP2A 5BQ5A 4A0RA 3FDIA 3CM0A 4C0KA 2R8RA 3GJ6A 4B3GA 5AUOB 3GLFE 3ZYCA 1O87A 4K46A 3BB4A 1FP6A 4M9XA 4IW3B 3I5XA 1G4AE 1NG1A 4LJ8A 3UKDA 2O8EA 4KODA 3WBJA 3I1FA 4JS0A 3PUYA 4A9AA 2N42A 2A9KA 4IFEA 2AKYA 5L3QA 4S35A 1ZM4A 5KO2A 1LTQA 3THXB 2I3BA 3B1ZA 4OHYA 3EZ6A 3FB4A 3U7HB 2HV8A 5IHPA 2QENA 2QMUA 3K0CA 1E3MA 3HU2A 3ADBA 3OESA 1XB2A 5KPDA 1I4TD 1OFTA 4PHFA 2I1VB 5EZ5A 3W5IA 5AR1A 3CRQA 4F93B 3REGA 1G291 5HZHA 4DSUA 1Q0UA 1XP8A 2GXQA 3L8YA 4LX0A 1TF7A 1DEKA 1L4UA 4DSNA 3GJ0A 5KNBA 2OFWA 5FR1A 4G3XA 4PZYA 1N6IA 2REOA 4BWYA 1RYHA 1W0JA 1M2OB 2J7PA 1NG9A 3VNUA 3L0SA 4EJSB 4AI6A 3QXXA 3TR0A 1YZGA 4E09A 2P6RA 2QM8A 3CW2A 1F2UA 2RMKA 1QBKC 1Y63A 2VL7A 4DIEA 4TYNA 3K09A 4NYIQ 2BMFA 1UF9A 2ZYVX 1TX4B 1R6BX 1HE1C 3SS8A 1I2DA 1QHYA 2VTKA 5FFMA 2HCBA 4CEHA 2F43B 5G40A 1E9AA 2WPDD 5EJEA 2QBYA 1AGRA 1IXRC 4A2PA 4C0BA 4PO8A 1YU9A 1DE0A 1E1RA 5FH9A 2ZRMA 4KO8A 4W5WA 1P4SA 4Q1EA 3A37A 1DG1G 3LVQE 4JLOA 4LHXA 2C96A 1BKDR 3IPXA 4LJ6A 3V4RA 4JLMA 4Q9HA 5DHAA 4Q4JA 2ZRFA 3GPLA 1JALA 2CE7A 3IQXA 5DYGA 5AUQA 4HDQB 1E9CA 4GNKA 4HB4A 2WSMA 2DR3A 4MA4A 3K70C 2PJZA 4BRWA 2GJ8A 3K9GA 3UATA 3F0TA 2QGNA 4LC1A 2Z5FA 1E1RD 3PUXA 3WHLA 1E1QD 1YZQA 1N5KA 4XWAA 1Z29A 4ZI2A 1DAHA 2B7BA 4DSOA 2QUZA 5KNCA 5LB2A 1CLUA 3QXSA 1HQYE 1JJ7A 1Z83A 3HYTA 3RRZA 2UKDA 1S3GA 3BE4A 4QOSA 5DI3B 3LBHA 1DOAA 3Q7PA 1TQDA 3HU1A 3TUJC 1Z0KA 1ZUIA 2REBA 3IHWA 2O8FB 1F3OA 2NOAA 1AZSC 4KU4A 5EP3A 1ELOA 5HKKA 4OQNA 4GRAA 4HAWA 5IF9A 3QUSA 4KFUA 1XXHE 1E99A 1DS6A 2J9RA 4FCVA 2QORA 2DFTA 2FMXA 2RB4A 5A0FA 4CF7A 1FUKA 2J59A 3BOSA 4TN1A 2YOGA 4B32A 3A1UA 4EFNA 4II7A 2ZI3A 3DVLA 4LHZA 4M4SA 1HUQA 2PX0A 2V1XA 4URXR 1S2MA 3NVAA 2GTPA 4A15A 1CRQA 1EX7A 2Q3HA 1KO7A 4G5GA 5JI2E 2CL0X 2QRZA 3SU8A 1OW3B 2PLRA 4C7OA 4PO1A 1P2VA 3EA0A 3MWYW 1MOZA 2DB3A 4GL2A 4QGHA 2VSFA 3LNCA 4US1R 1L2TA 4D2IA 2CLCX 2WWWA 3B13B 2VSXA 4TTPA 1AK2A 1E0AA 2OXRA 1KMHA 4EIWA 2XJ9A 3MD0A 3KB1A 5CK4A 1CBUA 4WA7A 4RFVA 3K0FB 2IW3A 4RCYA 1KI2A 3KQLA 5F2EA 1G18A 3U6BA 3KJIA 5KDOA 3AVPA 4BUJA 5TDHA 1PLLA 4IOMA 3OZXA 5HZKA 2H57A 3ZQ6A 2R44A 4DBLC 4YDSA 5JS7A 1HA3A 3KKPA 3NKVA 1E0SA 1FX0B 1XMVA 3R8FA 3LW8A 1Q12A 3PITA 3B1WA 4JIMA 1RW4A 3PENA 1S0UA 5J5CA 3C7KA 3VMFA 4IOKA 2Q3MA 3KTAA 2ZRGA 4KSBA 2H5EA 1GL9B 5B57C 4QHTA 1Q1BA 3KL4A 1OXSC 2WJYA 3W6PA 5ELXA 3GLGE 3GJ4A 5EP1A 3FYHA 4PC7A 2EWWA 4M1MA 2GETA 2KBEA 2R65A 4P31A 2GJAA 2FWRA 2VPPA 1Z0FA 2ZI6A 4DDVA 1Z0JA 4LDJA 3EPKA 1NVUQ 4GP6A 4HAUA 3RWMB 2F1IA 2CCJA 4B34A 5K8LA 1E96A 3NHAA 3H86A 2FA9A 1QHIA 1JR3D 1II8A 4P3YA 1XJ0A 3QF4A 2IL1A 1I2MA 2HCJB 1P9NA 4C0SA 4NCJA 3QXHA 3KXKA 2J0SA 2OILA 1ZNYA 2CJWB 3RRMA 3SJZA 3GLGA 2Q9BA 3WRXC 3AKYA 2GCNA 1E9EA 1Y3AA 3C4JA 2IA5A 3UANA 3IEVA 4Q00A 1W2HA 1UDXA 4PHHA 3EPJA 1FUUA 4DLYA 1KKLA 1BOFA 4DDWA 2YNMA 4AG5A 5J4HA 3PEWA 3FKSA 4TWZA 4YXWD 1GP2A 5JEDA 1V5WA 1KK0A 4OQMA 3QVVA 4RY2A 4GOJA 3OFNA 5HR5A 2DBYA 1B23P 1KYIA 4EPWA 2KBFA 2F9LA 1R10A 1JAHA 3KJHA 1T91A 4W9MC 3SC3A 3WNCA 1NY6A 3FHCB 1E2DA 4EDHA 5LD2B 1R0ZA 5BW8A 1NIPA 4DDTA 3VX3A 2QU8A 3CX8A 2FGKA 4QBGB 4MGYR 4H1VA 4YONB 1Z0DA 2WM9B 3LH5A 2ZSFA 2WBLC 4F92B 3R9IA 5CLQA 1IN5A 2RKOA 4CGZA 2OCYC 5CM9C 2N46A 3SFZA 2R6GA 1N25A 1U0JA 1VMAA 3UWKA 3E1SA 2VP9A 5HE8A 1OKKA 1Q1EA 1N6PA 2O0JA 3LXXA 1E9DA 2O52A 3AUYA 4AYWA 4TL9A 2WOOA 1SVWA 4Q7LA 5JMTA 3THWB 4B71A 2H16A 4MYUA 2R6AA 2RGCA 1UM8A 1IN4A 2Z6VA 4KYIB 4ZV4A 2MSEB 4RVCA 3BFKA 3IIMA 1G3UA 4W5HA 1E4VA 4JT4A 3TGPA 2DHRA 4HATA 3DKPA 3RHFA 3FPAA 2CCKA 3AVVA 2DPXA 2C04A 2XNDA 4D25A 4XD7D 2IC5A 4GOXA 3Q5EA 4JJKA 1VKJA 2VHQA 2JIZD 1NVWQ 4DUGD 1KDRA 4S2EA 3UPUA 1N0VC 2EQBA 1U8ZA 5JS8A 1IN7A 5AWFC 4WIAA 2J0UA 4Q1AA 4Q9KA 5LPNA 2PLFA 1E9FA 5CDFA 4PZLA 3ZZUA 3DHWC 3G5UA 5FOTA 3ZZ0A 4AK9A 4B74A 2W58A 5EXXA 5CLLA 3FKSD 2QA5A 4OI1A 4C0QC 1GFIA 1JBKA 1KI8A 2BCJQ 4V0MA 4UJ3A 3K0FA 1OB5A 1ZW6A 3FMPB 2OCPA 1ZU5A 2QAGA 3KUDA 5IK2A 2HYIC 1E9SA 4B2PA 2P65A 3MG9A 1SVIA 1N5LA 2VHUA 3ZZTA 1I4DD 5J40A 1W49A 5K8IA 2QAGC 1US8A 5FI0B 2OBNA 2YJTD 4OK5A 3FTQA 3A1VA 1SHZA 1US8B 1JB1A 3QXCA 1SXJE 4Y0VA 3NTUA 4HI0E 1R0XA 1SKQA 2ZI4A 3CRMA 5TARA 3CH4B 3B82A 1SULA 4BECA 5M04A 1N6RA 4GMDA 3T61A 2FJUA 5FOWA 2WJIA 3MFYA 2IYYA 2XTZA 2AXNA 2VP0A 3BFVA 3OEED 1NY5A 4AY2A 3AVWA 3O8BA 5TXGA 4ZPXA 5EXPA 1XEFA 4RKFA 3NEJA 4UNRA 2WJHA 4MRRA 4RKEA 2ONJA 4DCTA 3JVUA 3VR6A 2OHFA 1BIFA 2AD5A 4YDHB 4RD6A 5KUTA 4MDEA 2MMCA 1S9DA 3AF0A 3DM5A 3K8YA 3A4NA 3C41J 1UKEA 2C95A 2CHQA 2VF7A 1OFHA 1XFAA 1OJLA 3DZDA 3T15A 3QKUA 5DI3A 5E7IA 1CR2A 2XNSA 2OO7A 4QM7A 4Q1FA 1IM2A 4URWR 5EXTA 2GXUA 2RHDA 4G5SA 3MGCA 3SYKA 4TQAA 1E79D 1M7GA 1XTQA 2B8TA 4BZPA 2OAP1 2QNRA 1VHTA 2HJVA 5AJVB 3T1QA 3T1OA 2FFBA 3LQQA 4Q4AA 5FI1B 1W36B 3BJIC 5G53C 5KOYA 1S8FA 3TSWA 5DN6A 2QPAA 2VA8A 4OHZA 3LAWA 3RS7A 2G83A 2IF0A 2XTNA 2BVNA 4HAVA 4JL5A 2FSIA 1N6KA 2ZS9A 4DEXA 4KYUA 1FQKA 3PQCA 3TJZA 1HT2E 4ASUD 4M1WA 2IEZA 3L0OA 1G6HA 4RD2A 2QPOA 2QSYA 4TMZA 1XX6A 5G3YA 2DFNA 2JLQA 2H8KA 5EE1A 3IBGA 3GJ5A 2ZJAA 4M9SA 4Q01A 4TL6A 2GVZC 5D3MB 1JQJC 1OF1A 3EZFA 3OAAA 4WBSA 5CB8A 2EFGA 5IK2D 4QJ4A 4B44A 2VHTA 2IK8A 3MMPA 5FTLA 2XXAA 3ICEA 3CZPA 3GJ3A 4M1SA 1F2UB 1VG9B 4CEJA 2A7QA 3PUZA 5FTMA 4EJSA 1E98A 3G82C 1E4YA 5EE9A 3RVBA 3DEFA 2ZRLA 1ZC3A 2VLIA 3TVDA 2EVWX 1WP9A 2Z4SA 1U99A 4EJSC 2FNAA 4MRSA 1DAIA 3CF2A 5JZVA 2Q3FA 1GM5A 6Q21A 1YQTA 4EPVA 5J47A 1TEVA 1U8AA 3SOPA 1IY0A 2NZ8A 2AX4A 4IJMA 2F3RA 3L82B 2EW1A 2R6CA 4RZ3A 2ODNA 1E0JA 3ZVNA 1R8QA 5BN3A 3SHWA 1NMZA 1SVOA 2ZE7A 1G3QA 1OYWA 3ZIAA 4M21A 2ZU0C 1XMSA 1KDOA 5C1BA 4NYJQ 4HAYA 4EFMA 2XZLA 4WAUA 2XSZA 4M2LA 5FUVA 4DCSA 3QPWA 1OFIA 2NPIA 3N2IA 5DGXA 4F4CA 4DLUA 4OHVA 3NDBB 2J7PD 1W4RA 3A1TA 2GBLC 3RNLA 2XGJA 4A8JA 4UXHA 5IRCD 1XNJA 2BBSA 2RGBA 3THOA 3R9WA 3AEZA 1OFUX 1UDWA 2RGAA 4HAZA 4DDUA 1KHTA 1MKYA 1VECA 4ZKEA 4NCHA 3K1JA 4KFRA 4H1UA 4TZ6A 4DZZA 3KFXA 2CE2X 2KJQA 2PEZA 4NPHA 5FPKA 5BN5A 4ERNA 2CBZA 2W6JA 5DI9A 2P5SA 1RPZA 3BH7A 4GP7A 1KO5A 2CMKA 4POAA 5FTKA 3SDZA 1Z28A 2Q9AA 1ZM2A 2XOKA 3B9QA 3LBIA 4DCVA 4HAXA 2J3EA 1G20E 1GRNA 2HF8A 5FL7A 4D81A 1OH5A 4QC2A 2WWYA 3PG5A 1KGDA 1SVKA 4KLNA 3ND8A 1GRRA 3AF1A 5EZ6B 1GKIA 4TQUS 1FP7A 2VP5A 1P72A 3CRVA 4NBSA 1DAEA 5EUQB 1KDTA 2AFHE 3QBTA 1K5DA 2GXSA 1AQYA 2ZAMA 4HDCA 1FQJA 4NCKA 4D0GA 2FSFA 3IEUA 3QNUA 3U3JA 1W36C 2FFAA 3K0SA 4V0NA 2WJGA 3LBNA 3D8BA 4US2R 1P6XA 1IQPA 3CRRA 4B73A 3ZLJA 3GLHB 1R5NA 2WSSA 4HLCA 4Z54A 4C4PA 2LKCA 2IYZA 4B48A 3I92A 1U94A 2RCNA 3TMKA 1P62B 5FUWA 4MGKR 1N2CE 4Q4LA 5FPSA 1UPTA 2GK6A 4ARZA 1U9IA 3IIKA 4B33A 2GNOA 2ZANA 5TMPA 1LB1B 1Q3HA 2QRNA 3HYRA 3LLMA 3ZS9A 3CR7A 4HB2A 4A6PA 4YMSA 4MITA 2HF9A 1Q20A 2ERXA 3U4QA 2PZGA 2ZR0A 2QT1A 2G9NA 3SYLA 4BLPA 3U61B 4L9SA 4AIIA 3KJEA 1P3JA 3X1DA 4OQLA 1Z5ZA 4LBYA 5E7JA 2LCFA 1COWA 3AF2A 1RKBA 5KPJA 5SZJA 3T1VA 1B0UA 4JLDA 1R4AA 8OHMA 4NYJR 3ASZA 4NMMA 2F3TA 4FMCB 3QXJA 5FOUA 3T34A 2GESA 2NO9A 4IVPA 5CYPA 4EUNA 1CULC 4AD8A 1KI4A 2CVFA 4TYYA 1G8FA 4MUBA 3MCAA 3LWNA 5LDDC 4F38A 1KDPA 2B6HA 1HYQA 3I3SR 4Z1MA 2HDNB 1ZIOA 5FL7D 1G5PA 3SE0A 1ONBA 1E2QA 3LD9A 4MQBA 4NL4H 4P4SB 3LRPA 2NG1A 1JXMA 4XVQA 1XPOA 2FPMA 3ZQJA 2OAQ1 4HLQB 4UNNA 4FW9A 2F43A 2ZQ5A 4CEHB 3OEHD 821PA 1OHHD 2WIBA 1Z47A 4P4TA 4WZAE 2NGRA 4V02A 4E07A 4XSHA 5CITA 1Z0AA 2Z4RA 1PUIA 2FFQA 2BIFA 1JR3A 2P0EA 3HJNA 4ACBA 1GL7A 3UG6A 4C0LA 2J45A 2OBMA 1OT3A 1VYTA 2EYQA 2VRWA 2XOKD 3CWZA 1XTIA 4JL8A 3DM9B 2EYUA 2VHJA 1YVDA 1E0KA 2NQ2C 1BYIA 1O3YA 4B47A 1DAGA 3I73A 2MSCB 4Q1BA 2AKAB 3K09C 1Z63A 4Z51A 2F7SA 2J7KA 1LY1A 3BRWD 4Q4AB 1PLKA 1T5LA 2JLRA 2FEMA 2ZUCA 2AR7A 4Q9IA 4IDHA 3H84A 2QP3A 3GJ8A 4JSYA 5J4YA 4HLUC 1UFQA 2OUKA 4LJ7A 5CM8B 1M7HA 4C0HA 1BYUA 1GKUB 3N2EA 3WY9A 3MWJA 4QBFA 1YZTA 3L8ZA 1GAJA 4TSFA 1X6VA 2ZJZA 5B2ZA 4JLBA 1U90A 4PFSA 1W36D 2O8FA 3QQ5A 3WNBA 1UAAA 2WOJA 2BKEA 2BEKA 3NIBA 4WVFA 5H70A 4JVNA 1T4GA 2ANBA 2X19A 5L3VA 5B64A 4LWZA 1DADA 4MKHA 3SEAA 2VH5R 5TY0A 1OIXA 2X2EA 3AB3A 2G0TA 2JLYA 3FFBA 3VR1A 121PA 4PQRA 4TYQA 1N0WA 3OIVA 2ZJ8A 4IFBA 1P2SA 2Q0HA 1PZNA 2D62A 2XJ4A 3GFPA 3HWSA 2ODEA 3DOFA 1J70A 3LX8A 1XPRA 5P21A 4D4MA 1Z22A 4Q4HA 2WJVA 1Z08A 3U5ZB 1OV4A 4EFLA 4DLRA 5FOVA 4A4DA 3T5DA 4RFSB 2GKSA 4WXPA 1AS2A 1M34E 2ZR7A 3U2QA 1GNQA 3NXSA 3A1SA 1R0WA 2KE5A 5CB6A 4N3NA 1KSJA 4KBFA 4HUQB 3GLGB 5GJWC 1M7BA 3A1WA 3RABA 2QBYB 2KWIA 1NI3A 3NH6A 5EQTA 1ZNZA 2FN4A 5F98A 2ZRNA 2D74A 3GFTA 2XNDD 1NMYA 5CIWA 2A5JA 1IONA 2YKGA 4BFZA 3AVXA 1H8EA 5KDLA 4BLQA 3Q9LA 2V9PA 2HJGA 2QY9A 3JVVA 3SQWA 2QE7D 4UNSA 2GHIA 4KXFB 1G7RA 3FVQA 5JHGB 2CLDX 3KQKA 1XTSA 4G5QA 2F1JA 4GBMA 1NJGA 2C9YA 2GZDA 1XDBA 2W0SA 1KNXA 4BFXA 3SHFA 1UEIA 1W0KD 4JBYA 2RH5A 3H2YA 1TUIA 1GWNA 3WYFA 2X8AA 1H8HD 5A4JA 4YMWA 1DELA 4CDGA 1EWRA 1QVAA 2BJVA 4YMVA 2ZS7A 2QE7A 2H7VA 3GLIB 4CYMA 2JLWA 1KMQA 2H1LA 2JLUA 4WW0A 1JR3E 2E1RA 2FG5A 3Q7QA 1FZQA 4QJ5A 4M0LA 4BLRA 2CDNA 1E2FA 1KK2A 1CJMA 1ZINA 2ZSAA 3UMFA 1ZD9A 4QRHA 1AKYA 4C2UA 4TLCA 5EE3A 1P7CA 2JIZA 2HLDA 3BB3A 3T35A 3CX7A 1XEXB 1KMHB 2VIIA 4OJQA 2W6ID 3EPHA 1KJWA 2OT3B 4IOLA 2O8CA 2ZREA 1WXQA 2ZRHA 1GKYA 3CPHA 1CP2A 2JJ2D 1KZ7B 3BB1A 1OXUA 2ZRIA 2DFLA 4A8JC 3DMNA 3LQRA 4OI2A 3GCGA 4LPSA 1MV5A 2BDTA 2VQSA 3HP1A 2J5XA 4KLZA 2A5YB 2JASA 4XVRA 1DO0A 2YC2C 1M1YE 4HZUA 1RE0A 4M9QA 4Q5IA 5D3QA 2N1BA 4US0R 1E2EA 1QZXA 1SKYE 1UJ2A 1DAMA 3EIEA 4TMVA 5BWMA 5JBQA 4X8OA 4QG7A 2OCBA 5JRJA 4RZ2A 1N6NA 1JPNA 3LA6A 3OIUA 4OK3A 4CIDA 4LGMA 2YWFA 3QG1A 4B6EA 4QGAA 5HKKD 3W3ZB 1OKKD 3NC0C 4KFTA 4PC6A 1XU4A 2CHGA 1NP6A 2TMKA 2ZJOA 3AQ4A 3PXGA 1S3SA 3JZAA 5B30A 421PA 4W7SA 3TW4A 5J4VA 1KI3A 4GI7A 2HLDD 3I8SA 1CKEA 1L7VC 2PL3A 3C8UA 3Q8XB 5KHOC 2XAUA 2YHSA 2ZE6A 3MJHA 1Q57A 1DBSA 3X1WA 4DVGA 2QSZA 3VR4A 2WAXA 4Q9JA 3AV0B 2XSZD 1KO8A 3VR5A 4ZDKA 2WMNB 3QEJA 2W2XA 4NE2A 3BXZA 4G0NA 3F5FA 2IYRA 4D4JA 3OE7A 1NVVQ 1ZBDA 4C7OB 1J99A 1K5GA 1XJCA 2A5FA 3NBXX 3OIWA 4HEJA 4DLWA 3QPVA 2ZM5A 3NHBA 1W7AA 4I1SA 2GZAA 2IXFA 5JWRA 3EZ7A 2RAPA 3KKQA 2FSGA 5HCIA 2EFDB 1Q1QA 4OQXA 1CJTC 1P61B 3BS4A 1TAGA 3DDCA 1Q22A 1FW6A 5CYOA 1WA5A 2QTHA 5G41A 3F8TA 1U9IC 2HXSA 1YZLA 5GADl 1RIFA 2CK3D 5AJZA 1X8LA 2XB2A 2QMOA 3IQWA 4XTCS 3CX6A 3PUVA 1JEDA 1OB2A 3U7FB 4BLTA 4MKIA 5AJXA 4UQOA 3KKMA 1SXJD 1V43A 2X77A 1KAOA 4CEIB 5J4LA 3TKLA 3V00A 4PHTA 1E2LA 1GVNB 1S9HA 4RD4A 4ZDWA 4LV8B 4FMDF 3P26A 1DG3A 1EFRA 4EPXA 1VG1A 4MYHA 3SJCA 2ATVA 2Q21A 5CIQA 1F2TB 2IX3A 2BEJA 2BMDA 4Q48A 3B8HA 1TL7C 3T5GA 1NJFA 3L43A 5TB5A 5UKDA 1ZIPA 3I62A 4HUTA 2GZHA 4NTZA 4TLEA 1C9KA 4JT2A 4M9ZA 2LWIA 3Q5DA 2VSOA 2VYFA 2C9CA 4I81A 4LHVA 4E22A 3GEEA 2GF0A 3U3RA 3I61A 2AL7A 1Z6YA 4M22A 1ZM9A 4C30A 3THYB 1XBTA 2XITA 4YXWA 4UKDA 2IHBA 4JMPA 1G6OA 3MWKA 2MSDB 3EARA 2DCUA 2D3WA 3EPLA 1WRBA 1EFTA 4AC9A 4KV9A 1Q3TA 1XWIA 3CBQA 4R9UC 1G7CA 3VFDA 2WWIA 4M1YA 3EC1A 3OAAD 3PUWA 1UKYA 3OE7D 1UADA 4ZCLA 3AP1A 4UNQA 4ZCMA 1EFCA 1OSNA 4TT3D 4A8JB 2J46A 5BYKA 1ESMA 1SXJC 1FOEB 4HB0A 4BLSA 4AKEA 3B9PA 3WBKA 2IWRA 1UBCA 3V9PA 1G9XA 2BM0A 4PSVA 2C2HA 5FR2A 5ANRB 3BBPA 4IDPA 1JNYA 4LC0A 2ZPTX 2PT7A 3B85A 2GA8A 2DYKA 1QRAA 2HEIA 2FZLA 2QGZA 4OJKA 3QKSB 5DSZA 2OV2A 1CU1A 3ND9A 1YZKA 1NLFA 2F6RA 2IHYA 2ZI7A 2HXYA 3FMFA 3CUEF 4ZI3A 3R7WB 2GK7A 3VHXA 2YOFA 2WKPA 3C5CA 3TLXA 1XEWX 1A4RA 1KI7A 2IYSA 3KDSE 5FPHA 2ZAOA 4O2LA 1FPMA 2AXPA 3P20A 2IYXA 4ZDIA 1NKSA 1ODFA 2IXEA 4XIGS 4LRWA 5E4FA 3TE6A 4TYPA 2H92A 3KJGA 3QEOA 2YINC 3VX4A 4QJ3A 5DYIA 2HUPA 5AJYA 2C98A 2WWGA 2ANCA 2YYZA 4ABYA 1CRPA 3A58B 2Y8EA 4BFVA 2EFCB 3ZGXA 2IF2A 3ADKA 2PMKA 1RZ3A 1U0LA 5H1YA 3IIJA 1NNEA 2VEDA 4PR0A 3TQCA 4URYR 2GCOA 1MT0A 3ADCA 1GL6A 4N1AA 3HU3A 4HZUB 1CR0A 3QKRA 3SZRA 2IS1A 2ZRDA 1DPFA 4WZ6A 3W90A 2OE2A 3Q85A 1XD8A 2B21A 3HR7A 2QQEA 3LW7A 4JKYA 4LJ4A 4F91B 4EPRA 3QPUA 3VAAA 3AGPA 3ONWA 4GZLA 3W6NA 5E3HA 1AA9A 1OYYA 1G5RA 1GIAA 4FINA 3U60B 4TMWA 4BZQA 4P32A 5H68A 2PZFA 3WMEA 1VCIA 1IY1A 1GOTA 5FL3A 2AK2A 5KTYA 3SFVA 2JDID 3TBKA 4NYMQ 3RC3A 1R5BA 5C18A 2D7CA 1E6CA 1MO6A 1S1MA 4TYWA 3VQTA 1IOZA 1D9ZA 3KQHA 4V03A 3B60A 3JZMA 1G8PA 2CVHA 2ZE8A 1T3LA 4UNPA 1KK1A 4G5OA 3GLIA 3G0HA 3QOFA 4L4UA 2W00A 1TUEA 2ZRJA 5E95A 5L3QB 1MO5A 4LYHA 1OLOA 1Q1ZA 2NMVA 1HY3A 3RS5A 4N0EA 3L0IB 1NIJA 2DY1A 3PEUA 5F9FA 5GVSA 3AGQA 2YC4C 1M6NA 1D8TA 1TQ6A 2ZRBA 4DB4A 4QGGA 4Q19A 1LFDB 2FU5C 2PZEA 2ZI5A 3KXIA 1PJRA 2EFHB 3AVUA 3A36A 2OZEA 2BJWA 1ZAKA 4XD7A 2ZJ2A 2YZ2A 1E9BA 3ZS8A 3BD9A 4FD2A 4HDOB 1W2GA 1S1CA 3UK6A 2V6IA 1LVGA 1A7JA 3ZVRA 2BWJA 1HTWA 1HV8A 1MH1A 1W47A 1VYUA 4WZBE 5TV2A 3SJBA 1LF0A 5GJVC 3ICQB 4DRZA 4NDZA 4HYYA 4GOKA 1E9RA 4LBWA 3THWA 3C15C 1VTKA 3U3OA 3BAFA 4IDOA 2GXAA 1TU3A 1AKEA 3GLHE 3K70B 3MJRA 1SZPA 1R8SA 4KFSA 2J0VA 5FBRB 1TNDA 2FX3A 4ZKDA 3AM1A 3FKQA 1COWD 1J90A 3VNVA 3R8CA 1N5JA 2F1HA 5DN6D 3KXLA 4LY6A 1FMLA 2BBOA 1W1WA 2R9VA 3KKNA 1D5CA 4Q47A 4GDFA 2HYDA 4O0MA 1IAQA 2G77B 3W8NA 4D4LA 4AURA 1E2NA 4C3ZA 5BYJA 1II0A 2GRJA 2G1JA 4TSFD 5FBWB 1N5IA 4MGIR 4D6PA 1TF5A 3FE2A 1F6BA 1IJFA 4DEYA 5GJBA 1MRSA 2KSQA 4NZYA 3AP3A 1T8TA 2ZR9A 1BMFA 1VG0B 2I4IA 2ZVPX 1E2JA 4MDFA 1IXZA 3QF7A 2J0UB 3RDPA 1YZUA 2C03A 3ADDA 4NH0A 3EASA 4HZIA 3A6PC 2IYLD 4EPYA 1AS0A 3WP0A 2A30A 4AKIA 1JXOA 1G8YA 1L4YA 4L16A 1ZU4A 5L8VA 2WIAA 4FWIB 3CNLA 1GNRA 5FBLB 1Z6TA 1BMFD 1R0YA 4YQFA 2VHCA 2RGGA 4LJYA 3RSLA 1T0HB 4H9GA 2G88A 2PEYA 2WV9A 2ZYWX 5JECA 4MRPA 2Z83A 3KQNA 1E32A 3GFOA 1G7TA 3QF4B 1ZUHA 3B7GA 4NYMR 2F1RA 1UKZA 2OESA 3GEIA 3U3MA 3FMIA 3C5HA 3IO5A 3KB2A 4RSGA 3U44A 2CHVA 1CIPA 1A1VA 3L2OB 1NN1A 2FPKA 1ZMXA 4TLDA 2JJ8A 2GJ9A 2QAGB 4IDQA 2BKUA 4TTRA 3C16C 3P32A 4OYHA 4EQ6A 1E2KA 2O8DB 1C1YA 1GG2A 5G3ZA 1QG2A 3M1IA 2OXCA 1YZNA 2AK3A 3SYNA 1UBFA 3UMSA 3VU9A 2JLSA 5SZIA 1ZCAA 5JCZA 3RLFA 1SVMA 3ETLA 5JSZA 3BH6A 1XMJA 2ZETA 3QE0A 4L5BA 4IXNA 1RRGA 5DHFA 1XCGB 1W4CA 1D2NA 2AWNA 2FFHA 4CT5A 2J87A 1BO6A 2Q9CA 4PAQA 2KI5A 4Q1CA 1G1MA 4B2LA 3WP1B 5FBVB 2QAJA 4LSGA 4PSAA 1ANKA 1GDDA 4R98A 4PZZA 4Q02A 1KI1A 1W5SA 2CLSA 2GWHA 2V3CC 3AVYA 2EU8A 1GZSA 2EFEB 3CONA 3H0KA 4L8GA 1E69A 1OE0A 2ZRCA 1S4QA 1MABB 4UXIA 2OM2A 5FOXA 1XRJA 3ZVMA 1EG7A 4I1UA 4LBZA 1E94E 3WRYC 5DLQC 4N0DA 2CCGA 1D2MA 4MGZR 4HB3A 4R2IA 2P67A 3QI2A 4JLPA 4JSTA 2IYUA 3T12A 2XZPA 5LD2C 3AUXA 3LO5A 4AYXA 1R7RA 1F5NA 1KSGA 2NO6A 1CJKC 1N0UA 3C14C 3WMGA 2G3YA 1F48A 3BWDD 1T0JB 4ZIRB 1Q21A 3GJXC 2O8EB 2B7CA 1Z2AA 2WHXA 4LHYA 4OHWA 3RWOA 1J8MF 4FIDA 3DKVA 1QHHB 4DIDA 4DCUA 2OFOA 2OLJA 1HH4A 1SVLA 2JLXA 1RYFA 3B1VA 4KHZA 4LHWA 3OEEA 1SXJA 4QM6A 3UIEA 2J41A 2IYWA 2QZ4A 1KY3A 1T3SA 3TW8B 3PV0A 2P5TB 3IO3A 4NP6A 2QEQA 2C9OA 4BFUA 2NO1A 2ZSBA 4B6FA 1EGAA 4A2QA 3CRW1 2VO1A 2NPFA 5B58C 1D9XA 2E9SA 2V7QD 4BE7B 1Z2CA 1ZYUA 2VP4A 3K0AB 3AH8A 1QDEA 3H1TA 2E87A 1DAKA 1E2GA 1GUAA 4PQYA 3TH5A 2FDCA 4FI3C 4X8LA 3TK1A 1ZC4A 4FCTA 4PC1A 3B1YA 1WQ1R 5EXSA 1YR7A 1RRFA 2W6JD 3ASYA 5FBQB 4HSEA 3F3YA 4MRNA 1XPUA 3EAQA 4Q21A 2XEXA 3T06B 2PBRA 1BH2A 1AN0A 1ZUNB 3UG7A 3GMTA 4XVUA 2IUSA 5JJIA 1KOFA 4JZKA 1R2QA 2ERYA 2W0MA 3EIQA 4JLJA 1CJVC 4PAMA 3EW9A 3FWYA 4Q9LA 3CZQA 3N70A 4ZDJA 4Q18A 5BXQC 2J1LA 3L0PA 1EK0A 2JAQA 1NLZA 2ODBA 1W0KA 2A5GA 1W4AA 2Z43A 3GLIE 3NBFA 2IEYA 1GRQA 2W83A 2BCGY 2IS2A 1OXVA 4LV5B 1FNNA 3O8DA 4RD0A 2FZ4A 2BBWA 4DLTA 1G8HA 3CKLA 1GSIA 1FMJA 1AZTA 2O5VA 1E2MA 3ECCA 1SHKA 4U7DA 2ZEJA 3PCRB 3EWAA 3FMOB 3PVSA 4X8HA 5CJ2A 3VKGA 2A3RA 3ZH9B 1MABA 1P2TA 3SJAA 2V4ZA 4GFDA 3BK7A 1YRAA 2X2FA 4BPBA 4Q66C 2QQ0A 3A4LA 5KSYA 4ESVA 3GJ7A 2WPDA 4OK6A 1TADA 2J0QA 4E5UA 4PANA 2QP4A 1SKYB 1OXXK 1KSFX 4TQ9A 1NKTA 2IWHA 2BV3A 2QMHA 2DWOA 2FGJA 721PA 4QL3A 4TLAA 1VIYA 4IEIA 1G7SA 3THXA 3TAUA 1TF2A 2ZYUX 1G21E 3TUZC 3KX2A 1RRCA 3CF0A 2PH1A 2OCAA 5KSOA 4I99A 3K70D 1A2KC 2R2AA 4ITRC 4DKXA 4DLZA 1TTTA 1HT1E 2ZJ5A 2AWOA 1NL3A 3NWJA 1L8QA 1WDTA 2I1QA 2QROA 2H17A 2WSSD 2ZRKA 4XSGA 1OIVA 4PPQA 1GNPA 3AVQA 2WWHA 1RJ9A 2BMEA 3QBVA 4IVQA 4I1VA 4B43A 1R5OA 2QMEA 2YWHA 3DPUA 4RFSA 1G41A 4JL6A 2BHRA 3CWQA 4J0QA 3MLEA 1OPXA 2G1KA 1AGPA 1J7KA 1GILA 4W5JA 3K0AA 4KITB 3BORA 1M8PA 1OH7A 4EKDA 1KNQA 3MSXA 5KSPA 2IS6A 2NTYC 3AVOA 1XD9A 1ZJ6A 1G16A 1D6JA 4L15A 2QTFA 4IHQA 4U5XA 1U98A 3UXMA 1TQ2A 3QVUA 5J4KA 3IGFA 4KBGA 4A82A 4FMDB 1KSHA 4XH9B 4LJAA 2JCSA 3WYAA 5KSZA 1P75A 2OSBA 4R7ZA 1HEIA 3GLFA 2DFKB 3SR0A 1II9A 1SGWA 3HR8A 3I8XA 4JVLA 3E70C 4LYAA 4MYTA 5KNDA 1JECA 5E7MA 3ZVLA 4BLOA 4TT3A 1E2HA 2ZJBA 3J81k 5GVRA 1RVDA 1XZPA 1IN8A 3RS0A 621PA 1YR9A 1XF9A 2CL6X 2QI9C 1W0JD 3OFND 4PPGA 1X1RA 1Z07A 2JATA 2UZ3A 3GLFB 2RGEA 1XTRA 1KAGA 3K53A 4PPFA 2O0HA 3U6KA 3AVTA 1XZQA 2P6UA 3VR3A 4KVAA 1F60A 2JEOA 3LVRE 3LXRA 5FTJA 4QBIA 1E2IA 4LOAA 4D0LB 4YMTA 4XWKA 1G3MA 4Z8XA 2W2TA 3NBYC 3IILA 1OHHA 1SQ5A 1X1SA 2D2EA 1LW7A 1UKVY 2GVDC 4O3MA 1FTSA 1Q44A 1J2JA 1LV7A 2JJ1A 4LUCA 4BFYA 1MR3F 1DO2A 1JEEA 2C8VA 3P1JA 3D3QA 4XWOA 3W34A 2OBLA 4OBEA 3EA5A 1P60A 1VHLA 3RANA 4MRVA 2RGNC 1MO4A 2NIPA 5FPYA 3X1XA 4D4KA 4R71A 3IBYA 3CR8A 3VKWA 2Q6TA 4D80A 3EX7C 2C99A 3TNFA 4Q7MB 5BN4A 3NG1A 4QNMA 1D2EA 2V7QA 4ILEA 1C4OA 4JBWA 2PCLA 2ZRAA 1JI0A 1GITA 3PIRA 4O25A 4JBXA 4YC7A 2QP9X 4A92A 2FOLA 3RS4A 2QT0A 3SNHA 2A78A 1YJ5A 4AKHA 4LJ5A 1WE2A 2CNWD 3MRSA 5GJCA 1YRBA 3MUFA 1X8KA 1ZNWA 5FOSA 2D7DA 3REFA 4GPTA 3BIFA 1ZM3A 3X2SA 1WCV1 1G8GA 5DH9A 3LV8A 4C9BA 1JPJA 3A4MA 2ZITA 2G6BA 3CF6R 1W48A 1QVRA 2IS4A 4RD3A 1XJQA 1FL9A 4G5RA 4TMKA 4TTQA 2FEOA 3RYTC 3ZIAD 1QHGA 4GMXA 4DLVA 4LJ9A 5SZHB 4RZXA 1RC8A 2CL7X 5JWOA 4B3FX 3PJRA 2KB0A 1KKMA 2NZJA 4DB2A 3LFUA 1OIWA 4QXAA 5JI3E 1ZCBA 1E2PA 2BC9A 2QG6A 2ZYTX 2GEDA 4G01B 2A2ZA 2PCJA 1YHNA 5A5GA 1IHUA 2ZROA 1G3IA 3RS2A 2CEAA 3I5YA 4TMXA 1Z0IA 3VHLB 3X1ZA 2GCOB 1W46A 1T3HA 3K0EA 3THYA 4TLBA 4AKGA 4CEJB 2WJJA 5DO9A 4AG6A 5CDFE 1Z6AA 2RHMA 2RGDA 3Q3JB 2DWQA 4MKGA 1ESNA 5L3RA 3S1AB 3UMRA 5KDDA 3N5CA 1YR6A 3B78A 4U02A 2GJSA 2P6NA 1NN3A 1W44A 3HDTA 1XMIA 1K8RA 2H18A 3GP8A 2AHOA 2JDIA 4I1OA 4JLNA 4HLDA 1KI6B 2V54A 1XXHB 5AK0A 1IJEA 2FV8A 5LBIA 3U7GA 3CO5A 1H8ED 5F9HA 4IEEA 4PX9A 4XTRA 2Z0MA 5IDVA 4KSCA 3T1TA 1FTNA 2WICA 1F2TA 1DARA 5L3SA 4BEJA 1T9HA 2OEPA 3QJYA 2WTUA 5C2JB 3R9XA 1CR1A 1EX6A 2NO7A 3W9YA 2ZTSA 1G64A 2AFIE 1QHSA 2ZRPA 4PC3A 4CW7A 1ZRHA 2ZVQX 1UBGA 4V0ME 5SZKB 4CVNA 4B75A 1VCOA 3IDQA 4UXJA 4Y0AA 3BC1A 1JR6A 4NCNA 3BFXA 3SN6A 3FOZA 3R20A 2F9MA 4BGDA 1AIPA 4RZUA 5JSZB 3CB4A 4QNRA 2FF7A 2PT5A 5JHHB 2WKQA 3TQFA 5C4MA 4IVRA 3RC8A 3EG5A 1AS3A 3CIOA 4D82A 4QKQA 1U2RA 4LBVA 2IYTA 2O8DA 1ZM7A 3A8TA 4EPTA 2GBLA 4A36A 3KKOA 1N6HA 3OIYA 1RRPA 1VDZA 3MWLA 1DAFA 3TSOA 1E1QA 3VR2A 1T6NA 1XD2A 1YKSA 2V8OA 3B1XA 1NN5A 4JYBA 3IKJA 4NU0A 4OHXA 2PJRA 4Q1DA 1X86B 1II8B 1KO1A 3CPEA 4Z8YA 2QTVB 1KI9A 1ZNXA 3BERA 4RD1A 3ZD7A 2ZXUA 4A2WA 4FMCF 2O8BB 1H8HA 3CLVA 3K0CC 2JLZA 4KCGA 4DJTA 2IYVA 3O47A 1DVRA 2ZIAA 4IOJA 3SBDA 2WKRA 3W8RA 3W5JA 1U8YA 4IXMA 1PVOA 4IKEA 5JEEA 5HPYB 2CNWA 1CF4A 1G4UR 2WAYA 1A82A 3D7MA 2IBMA 3AF3A 4FXPA 1P9WA 4RJLA 3RAPR 4NHOA 3LY5A 3B5JA 3VTKA 5DISB 1FX0A 1M74A 3WXMA 4Q7KA 3TR5A 3FFAA 1CR4A 3OEHA 1LNZA 2R62A 4U00A 3E2IA 4A0FA 5DNYB 1HQCA 1H65A 3D31A 4PXAA 4ZCIA 1P5ZB 2ASEA 1NRJB 1PV4A 1KK3A 3OF5A 3PR1A 4PQFA 4PPNA 3IHLA 3M4YA 1NBME 1AQUA 2GJKA 4JLAA 4OQFA 4PHGA 4A1FA 2ZU6A 4F4IA 3I4LA 3KUCA 1X3SA 4DWJA 1MO3A 5DE3A 3EZ9A 3ZDQA 2FH5B 221PA 4Z1MD 1VPLA 3KQUA 1LF5A 1RJ9B 3NDPA 2GEUA 2XXAB 1NBMA 4Q7JB 3IUYA 1UBEA 3HPRA 4QBHA 3Q72A 1LS1A 5K8UA 1IXSB 3DL0A 3MAAC 5D3MA 1P73A 3EWSA 4LV6A 3WNDA 2AD1A 3S1AA 5AJWA 4K81B 1P2UA 4DSTA 4K8OA 3BH0A 4WXRA 2XTMA 1QHNA 3NEYA 4NCIA 5CK5A 1AM4D 5AUPB 3TIFA 5IT5A 4X8MA 3QG5A 2EWVA 4NKRA 5EP4A 3TVTA 3TUIC 5JRZA 2ODWA 4PAOA 2AN9A 1HURA 3PEVA 4LI0A 2YVUA 4G1UC 4OL0A 4ZO4A 2WMOB 1UEJA 3QKSA 2VP6A 1KZGB 4JVMA 2V55B 3K9HA 2WVJA 1VYVA 1W4BA 4DT1A 1IY2A 4DLXA 5K8TA 3GEHA 3SI7A 3B6EA 5JJKA 5JJLA 2ORWA 5EE5B 4C0JA 3WHKA 4KI0A 2XB4A 2B8WA 4YMUA 4DLSA 2IUUA 4LYJA 2WWFA 5JLJA 1N6OA 1FNMA 2A5DA 4IRUB 2GDJA 2VBCA 1NBMD 1EXMA 2ZS8A 4DT1B 4M1TA 1EESA 4M53A 1Z6GA 5FUXA 4BASA 2O0KA 2R6DA 4JJZA 2VP2A 521PA 1U0HC 1A2BA 4ASUA 4C2TA 4A0GA 1WMSA 3P4XA 5KYKA 1VCMA 4ACAA 2FSHA 4JYCA 1OH8A 2X1VA 4V0KA 4Q4JB 1JAIA 4YLGA 2JLVA 1NLYA 2ZE5A 1Z3IX 3M6AA 3CH5A 2JJ1D 2IT1A 1FFHA 2ONKA 1XD2B 2GF9A 2UVQA 2UZIR 2ZJYA 1E79A 4URVR 5F3WB 1G5TA 2P2LA 2YWGA 3PEYA 1BS1A 2GILA 3EXAA 1A5TA 3DMDA 1X8JA 3LLUA 2WZQA 4B2IA 4M1OA 2BBTA 2B92A 4BFWA 3E5HA 3QKRB 1NMXA 4TL8A 3NC1C 1N3BA 3AKCA 2OLKA 4FWTA 1TMKA 3FGNA 1TU4A 2MMGA 1NSFA 2XZOA 4CT4B 4BEBA 3LDAA 4C0AC 1G19A 2ZUBA 4QGFA 3W3AA 1JJVA 3QSYA 1K6MA 4P33A 4LYFA 2XX3A 4B76A 4P4SA 5JCPA 5FUYA 3QIAA 1YR8A 4OI4A 1NN0A 5JFGA 3K9NA 4LZZA 1SXJB 1Z6XA 2BMJA 1XXHA 2K5UA 2ZI9A 2OFXA 4NYIR 4PO9A 5TVKA 3TAHA 4ESHA 1QHXA 3VKHA 2OG2A 4B3CA 1EFRD 3QY0A 4PSKA 1ZVQA 5CJPA 3BGWA 1ZD8A 3TSZA 3R7WA 3FHOA 2V6JA 4M8NE 5HTKA 2FPLA 3WYGA 1ZP6A 4QFMA 2C78A 2JJ2A 3I32A 3D6TB 1CTQA
chains in the Genus database with same CATH superfamily
2D8AA 2XIQA 4IV8A 5EKUA 4KAXA 2GBFA 1TKRA 3PL5A 1W30A 3G9QA 4YJDA 1DJLA 5AM4A 3GT3A 1E92A 2VZ0A 3QPAA 4G0OA 5AI8A 1PUJA 5FTNA 5BR4A 1EP1B 4UZSA 4EB6A 1JQKA 4E1AA 1JKJA 2HRRA 3E0QA 1JEQB 1NFRA 2PIAA 3EGCA 2JVIA 5KDDA 4IINA 5ENZA 3UT0A 1AVTA 1U2ZA 1ZD1A 3GCDA 4IMRA 5IAOA 2NT4A 1SRRA 1NKVA 4UAVA 2O2JA 1SKUA 3RC1A 2WHYA 5BSKA 1DTSA 2VT7A 1YFLA 2QW1A 5ICCA 2ZSEA 5LNK1 1GTRA 3ITNA 3LX5A 2BM1A 4MKFA 4J0EA 3IMKA 1JKMA 1NQXA 2VSYA 4CXMA 3HY6A 4I36A 3FXAA 4ZD6A 4CZ2A 4DHEA 2QSJA 3A9CA 4M1KA 1CPYA 3D8NA 1T5SA 4BVGA 5LB4A 4D0NA 5BV7A 5KYVA 4DQKA 2GAOA 2JGFA 4URZR 4I4TB 2ORIA 4IG9A 4AUKA 1QF9A 5KNDH 5F3RA 4IJUA 3NM6B 4MLCA 1YJAA 3PXXA 5AW1A 3EULA 4B35A 1IBRA 4PZEA 2X58A 1TZBA 2GEVA 3FHTA 3CVJA 2Q3DA 1SVSA 1KTVA 1BX0A 4FCWA 5KU1A 2SHKA 5CLGA 4XJXA 2HT1A 1MB2A 1NXXA 2PX8A 3W8DA 3PKZA 5B3KA 2Q45A 3KKLA 1RLMA 4JT9A 4FHCA 2PL1A 4A23A 1PLJA 3IE2A 4HFNA 4MR8B 1UP7A 2NO0A 2QLTA 2QPTA 3BWCA 1N5MA 1XCPA 3QENA 1UEXC 2P3SA 3MTAA 4N5DA 3PKJA 4WOPA 2YUIA 4RVHA 1ZOPA 4V0LA 2AT1A 4UUBA 1QHHA 1UZLA 3H0EA 2EFJA 1UPCA 1XZGA 2JGDB 4MUAA 1ORDA 1O0BA 4GT1A 3HU5A 4DNXA 5FWNA 3BDVA 3F78A 3JYQA 1PU2A 4PCAA 1Z8FA 4FU0A 4BQQA 1AJEA 1HRDA 3W8EA 1WXIA 2FP4B 2R8PA 4BNHA 2IIPA 4EF6A 1EUCB 3TD9A 1CXZA 3D5EA 4PBTA 2ZT7A 4BV3A 3LHSA 3M0EA 3DO6A 2VJBA 3P4YA 3TQSA 1WF3A 3HJRA 3AKEA 4MVJG 1BFKA 3CH7A 4Q3CA 2H4ZA 2JFVA 4KUGA 4CMHA 4UBNA 4TZ0A 4GL4A 4MGHA 1AKNA 3KCQA 3P5BA 1Q7BA 2ZKLA 3QWIA 1KJZA 1A72A 3G9UA 4RENA 4WERA 5F21A 4BRUA 4CM4A 1Z15A 3G5LA 3R3UA 3W1WA 3FFWA 1VG8A 2D4HA 2C3UA 5HIKA 4OQDA 1CQJA 4DIOA 3DZ8A 3L7DA 2HR1A 5BPFA 2FW0A 7MDHA 1P3DA 4K0KB 2WA2A 4WCFA 2REXB 1W88B 2PLAA 4L73A 3WMWA 4HBZA 1BRMA 2QRMA 5CHEA 5G0UA 1ODLA 3SBEA 3UY4A 4RZQA 1LBTA 4E4RA 3AI1A 5DM2A 3WSVA 4O4JB 4BZXA 4P22A 5L3SB 1YMQA 2ZUDA 4KVGA 4YAFA 2CXXA 2RIRA 3E03A 2YOHA 3FNBA 4IHJF 4K3UA 4B0OA 3ESBA 2CFRA 2FLKA 3FM9A 3U7EB 4H1HA 1KO4A 1JI3A 4KMOA 2X13A 3BF7A 2P9EA 2YMQA 2VDVE 4YMLA 2IU4A 2PMBA 2WLSA 4JU9A 1G6Q1 3WGQA 3LT4A 1KJYA 4NZMA 1DG9A 1FVOA 1MRNA 1HOTA 4JLVA 2A0KA 1XZFA 1EG2A 1XKTA 2E0IA 3A2MA 4ID3A 1B8NA 4NLLA 5DIFA 3O0DA 5F5LA 3TRFA 3U7QB 3O8RA 1I0IA 5DMXA 2V1UA 2I7XA 1THMA 2W6CX 3HYNA 4LNHA 2VPWA 4ON9A 3TI7A 4D44A 5BSFA 3CNNA 1XSEA 1OXTA 1O95A 3OKFA 1QV9A 1ZK1A 4N9QA 1Y9AA 4RDHA 5IKMA 3E23A 2IXGA 2HZBA 3AKDA 2ILTA 4P4UA 3RUEA 3WLLA 4IXWA 4OLHA 4CI0B 3WAGA 4DC1A 3E7DA 3HEMA 3CSDA 4G1EB 5EUMA 1SQ6A 3DMYA 3KFLA 4Q4HB 1CJUC 4KO1S 1QAMA 1XTJA 4AZWA 3DCIA 1NVVR 5LXTF 2I1LA 4I6EA 4CHTA 3A9SA 4ZCTA 3O1HB 3WG9A 1BWSA 3ZGLA 2C2MA 5K7SA 1VMEA 3FDIA 3CM0A 3E1KA 2R8RA 3GJ6A 3CEJA 4Z0HO 2P3QA 4B3GA 3KQOA 5AUOB 1EVJA 2ZBVA 3GLFE 2WDPA 3BWEA 1MC1A 2NV2B 1T6XA 4EMSA 4EYSA 2AFHB 3B5IA 4IW3B 3U56A 3O74A 5F7ZA 2WUGA 5CH5A 1XDWA 1QYIA 1V6CA 3I1FA 4XYMA 3L46A 3UHFA 4D8UA 4RAQA 3OTQA 5I8WA 3PUYA 1CEXA 2A9KA 2Y1DA 3WWPA 1RMYA 3L06A 3N3BC 2OHGA 2A1IA 3V1UA 2PPLA 1ZM4A 3P9CA 4EA9A 1NOJA 3SD7A 2VHXA 1HKUA 3B1ZA 4AJEA 4FQ7A 1DQPA 4L4XA 5BSUA 2PGDA 3WTBA 4P98A 3U7HB 2HV8A 3CZCA 3IVMA 3NAMA 4GPEA 4ZOBA 1VPDA 5FADA 2BDEA 3VOTA 1EP9A 2J9FB 2QRUA 1L5FA 4C5CA 2C94A 5KTTA 1I4TD 2VDWA 3NYQA 4CG3A 1QTIA 3S2ZA 2QRQA 3RO7A 1TRKA 3CRQA 5LP1A 1JHDA 1ZCJA 4G1MB 4GD3Q 3WI7A 5ALVA 5KWSA 1XP8A 4HWOA 2VDRB 1LW6E 3L8YA 1W76A 4XI9A 2PGNA 1DEKA 4HMOA 1L5HB 4L8FA 5KNBA 4F2GA 1M2VB 1MD9A 3OSZA 3MUOA 1FS5A 3AL0C 5KYTA 1N92A 4WLUA 4DIUA 1E58A 1QCDA 2G72A 2IHKA 2REOA 2GFQA 2OHJA 2Z8ZA 2NU9A 4D4GA 1VOTA 1O9GA 5DXAA 1F1BA 3QLVC 1W0JA 1M2OB 3E5NA 3ROPA 1A8QA 3L0SA 5KC8A 3QXXA 1KVTA 3TR0A 1CUFA 1YZGA 1AQNA 2ZJ3A 3AX6A 2HCFA 1F2UA 3DZJA 3VSCA 2QX7A 5IVPA 2V96A 4RWEA 2WSIA 3K09A 1G0NA 3V8QA 4TYNA 4ER6A 1HE1C 2E37A 3MT7A 1PN3A 1WVIA 2PGIA 3OQIB 4JP1A 3VHQA 5G40A 4ILKA 4MVJM 1M6EX 1M6WA 3L93A 5LA6F 1BQ4A 1TGVA 4A26A 5AI6A 3AFOA 4MYRA 1GSAA 4PO8A 4ED9A 3WNVA 1CUJA 1E1RA 1ZHHA 3TEFA 5FH9A 4KO8A 1P4SA 2RGWA 2ZVJA 2ZWMA 4Q1EA 2YS6A 2A5LA 2C96A 2FPIB 3NW9A 4LHXA 4Y1GA 5CBPA 3V4RA 4Q9HA 3JYOA 4OB8A 4Q4JA 2VAMA 3A2LA 3ZNNA 4JX9A 1AH2A 2XADA 3TJMA 3NAZA 4YWHA 4G4JA 2V5VA 3WV4A 4DSNA 2X3UA 1I14A 3RIHA 5LU9A 3PHGA 5AM5A 3RTDA 2OL4A 4ZVPA 3F0TA 1KYYA 3IBTA 3BM5A 3K5HA 1R0CA 4UTVA 5C51B 2FW8A 2Z5FA 3A3YA 2NYUA 2YNMD 4OKNA 3BJEA 1JW9B 4TYMA 1YZQA 1QOZA 3VDQA 3GL9A 4ZI2A 5EGNA 1QK5A 3N0VA 3PQ8A 2C5GA 1EXDA 2GN4A 2WAOA 3DMTA 1Z88A 5KNCA 3QXSA 2OZPA 4UREA 1VBNA 2A0UA 2DF8A 2P2NA 3IQHX 2OZVA 1RYZA 1ZO8A 4I4TF 2UKDA 3BE4A 2Y1GA 5DI3B 4Q1VA 2QD4A 4RACA 3Q7PA 4DMRA 2WU3A 1QAQA 3NEAA 1KJNA 3SJ7A 3TUJC 1ZUIA 2UYGA 2REBA 3WLAA 1F3OA 2X42A 1W35A 1EQAA 4IP0A 4Z3KA 2R66A 5HKKA 2ADOA 5TVGA 4QELA 3SQNA 2IH4A 3F3SA 4ZI5A 1ZJZA 1C2TA 1YCFA 4BJ1A 1VPWA 2J9RA 2WAMA 3I9KA 2Y1CA 5BY2A 5L7TA 2DFTA 2FMXA 2ZYSA 3A06A 4I9FA 3TLGB 3UH1A 2J59A 4CF7A 3MTQA 4JI6B 3OPQA 4TN1A 3MTBA 1TFUA 4E94A 4B32A 4FLFA 4EFNA 1Q14A 3LQFA 3EIOA 4F3CA 3KT0A 4URXR 3AIOA 3K96A 1E20A 2AOUA 3ZKWB 1E8NA 2I1WA 2ILVA 2GAJA 1M1NA 1KPIA 1EX7A 5K0ZA 1B0AA 3LY9A 5F51A 2PUGA 1KO7A 1P44A 1BD3A 3SIXA 1H0RA 2I7VA 2Y1FA 4XYGA 3RIXA 1M83A 4W6QA 4INAA 4B81A 4BP3A 4C6SA 4BTVA 4RK5A 5E1BA 4PO1A 4YV2A 1F0NA 1P2VA 3QE9Y 3MWYW 2CDRA 3IH5A 4HQKA 4QGHA 2VSFA 5HVNA 3AEUA 3FTNA 3IEKA 1A9QA 1QGDA 1S8OA 1LV8A 1FX1A 2CLCX 1J2YA 3BMOA 3P7MA 1EBFA 4RAOA 4CDNA 1AK2A 5BR1A 2AHRA 1E0AA 2WF8A 1H85A 2FRXA 4FYVA 1DC5A 2G0AA 4OHRA 4EIWA 2XJ9A 1YU6A 2BI8A 3LXMA 1V7QA 3K0FB 4RCYA 4ZHQA 1N77A 1E3JA 3EFEA 4PY2A 3KQLA 5F2EA 5PGMA 4EVSA 5C5IA 1C4WA 3VPHA 3MK31 3U6BA 1U3TA 3CQ9A 3JATA 1OYVA 3OZXA 2IU6A 3ZQ6A 1Y89A 4PF1A 4FZJA 2VDNB 3MLAA 2YV2A 3GLSA 5FXMA 1XMVA 4BIMA 1Q12A 4ZZ0A 3UMCA 5FX2A 1T3GA 4A6EA 3OETA 4R83A 5BSEA 5GQSA 3C7KA 4EG6A 2ZRGA 2QZZA 3P9ZA 2H5EA 3FDJA 4H0CA 4K0RA 4QHTA 1BDBA 3AHEA 2B8EA 4TV8A 3UTDA 4G2NA 1JHZA 3GJ4A 3GLGE 2JFBA 2V59A 5CCDA 4R84A 1EP2B 1WVGA 4M9RA 4M1MA 3G1UA 4UZEA 4DPKA 2P2GA 2R65A 4P31A 4DDVA 3EPKA 1SXIA 1Z0FA 1I13A 1Z0JA 4V3BA 1NVUQ 4ALMA 4HAUA 3RWMB 1VHJA 2FZWA 2VWPA 2QMYA 4JR1A 4BQRA 4EG1A 4W5OA 3EXFA 3O2SB 1WPGA 3VYSB 1Y3CE 3HYLA 1U80A 2H00A 2CCJA 4NDNE 3C7CB 3WWCA 4CKBA 4E5SA 5K8LA 2B4QA 4OJTA 3KR2A 1CUZA 3EGOA 3G88A 4LX8A 1AQIA 5BSTA 5K3OA 1I6KA 1II8A 2C4MA 4NOMA 3A6HA 4IJKA 3V8BA 3EISA 2PL5A 3QFCA 4ICIA 5F64A 5TNXA 3WXBA 4AM8A 3ECAA 3OLVA 4KFCA 2DJIA 3CW8X 2XQVA 3AESA 4MINA 2CXNA 3B52X 2Q9BA 5T5QA 3WRXC 5KOIA 1TUBB 1C1XB 4KGVA 2GHTA 1OI4A 3KNZA 3RT9A 1NI4A 1XP5A 4YO8A 4UUPA 3AR9A 4ZEOA 1A8UA 1KBZA 2H8GA 4Q00A 3ACBA 4MVYA 1W2HA 4AUMA 1COZA 3EPJA 1P2BA 1VKZA 3N8HA 4HY3A 4BMOB 2YNMA 2D2XA 4DLYA 2AC4A 2ZJ7A 3H19A 5DBFA 5DW3A 5J4HA 1G2OA 2O9JA 3LUHA 1R0KA 4CJXA 4H0FA 1V5WA 1P1IA 5COBA 3GWGA 2W42A 1XDDA 1JLRA 4LDAA 2DBYA 2WUFA 1PZFA 3A6JA 1HDXA 4D8VA 4U9IS 3KJHA 3QX7A 1DFHA 2AV6A 4UMEA 4GXNA 3C3KA 4PYQA 3SFTA 3BQ9A 3G2JA 4MROA 2VPZA 1NPYA 4W9RA 5E4YA 3SC3A 3WNCA 2SKCA 5IFLA 1OLXA 1KRWA 2D1SA 2G76A 3CG0A 3C74A 2VOEA 2V7VA 4QTUB 3WYCA 4A8HA 3QUQA 1JE0A 2CXHA 3QELA 3TW8A 1JTFA 1QU3A 3KOZA 3OM9A 2BEVB 2PKQP 4YFYA 1XDZA 4QBGB 3Q8WA 1QCCA 1Z62A 3QBDA 4BKUA 2I03A 2WUEA 2WBLC 1TGYA 2BR4A 4BMCA 2RKOA 2N46A 1QOQB 3HWWA 2XKAA 3E1SA 5BQ3A 4UUAA 3JYNA 1DC8A 2X9NA 5CX1B 2VP9A 3OH8A 1OKKA 1Q1EA 4GLOA 2WG1A 3HBNA 2O0JA 1HXHA 2HSZA 2O52A 3RG2A 4L5JA 2PANA 5AXBA 3BMNB 1DCFA 4R5MA 4C3UA 3CLRC 1H2AS 5EN4A 3TZ6A 2RGCA 1KAEA 2Z6VA 1WB6A 3HRHA 1KP3A 4MUHA 4TTSA 5REQA 2PQ2A 1ENOA 3B7WA 1H9CA 3BFKA 2F00A 2YXPX 1M2NA 4G23A 3AETB 1E4VA 3Q0EA 4UTZA 4W5HA 4HATA 2JJYA 1RFGE 3OD5A 5NLLA 3AJRA 2CCKA 3X2FA 1T4MA 5CFRA 3W5SA 2DPXA 1PR6A 4Z2YA 5AVQA 3EXFB 1XC7A 2IY7A 3OT1A 5JNVA 4B2YA 4MQLA 1LBQA 4GOXA 1KMNA 5HDBB 3A2NA 1GZDA 4JC8A 2WNHA 4EEZA 4MI1A 3NRBA 1QJCA 4IMIB 4QLAA 5LQJA 1KDRA 1RLIA 3KQPA 1PL8A 3ROKA 4QWWA 3COZA 5AKEA 3VOBA 4B4VA 1USGA 5A6SA 7ADHA 1V3UA 1P3Y1 1OVMA 4LC9A 2F62A 2JZNA 1TXGA 4WIAA 4Q1AA 3UJ7A 1CUIA 4L0QA 2CUZA 2PT6A 3EWIA 3GGJA 4N39A 5CCXA 2PLFA 1WSAA 3LKVA 3E9ZA 4JI1B 3RSHA 5A9TA 3H16A 3B2QA 4LZNA 3D81A 3DWGA 5ICFA 1L4HA 1UJ5A 3ZHUA 3IAM1 4MHTA 2W58A 3B9BA 3HUTA 4KQWA 4ZAFA 2RKWA 1E3QA 4DIMA 3G8BA 3DBHB 4H18A 3UVEA 3V42A 1JBKA 1KI8A 2QX6A 2X1MA 1MIHA 4NU5A 4QOGA 4UJ3A 3K0FA 5EPOA 3TLKA 4FSDA 5JTUA 3FMPB 2EZ4A 1ZU5A 3A7EA 4FGZA 2HRZA 2QAGA 3HVJA 3OU7A 3ZXUB 5IAAA 2H7CA 1VJDA 2J5QA 1DO8A 2OHIA 4C04A 1J23A 3EVBA 3H5TA 4RK0A 4UM9D 1GLVA 1T9GR 1I4DD 1T8WA 2WM2A 3BMOB 1FF9A 3HSSA 5J40A 4U3JA 2QAGC 2IEGA 2VK2A 2REQA 2VEOA 5EIWA 4UE6A 4YCNA 4RV9A 3C7TA 4Y0VA 1GZ5A 2YIMA 1BFDA 1R0XA 3A3NA 3KOOA 3OE1A 3CRMA 4NG5A 3RE1A 4ZXPA 4QPDA 1NZDA 3TX2A 4CKWB 2I91A 5E8RA 3T61A 2DSNA 2FJUA 3CLUD 1SHTX 1M6VB 2J09A 2IYYA 3ETNA 1Q7GA 2IHTA 2B9EA 3EMVA 4HLNA 4PIVA 2AXNA 3LFHA 2J6BA 1OGJA 2CZGA 3AVWA 3K2QA 1FPQA 3E58A 2NUAA 2DCMA 2PVPA 1BTOA 3PDWA 3VVCA 3NEJA 1WCIA 4UNRA 3KAJA 4ZJZA 2JHGA 4MRRA 2WC1A 4ZVQA 5KKAA 4GSKA 3NHMA 3RUCA 1OLSA 2YBDA 2QN8A 5C8YA 1DC6A 4JJAA 3U5TA 4OPMA 5FIUA 5LR6A 1HFWA 2RFLA 2QXYA 1JAXA 1JWAB 1TYDE 3WWOA 4JI2B 5HOQA 1EM8A 3K8YA 4BWGA 1DKOA 2C95A 3AFGA 4O8CA 4REMA 3GLVA 1ODIA 3DZDA 4DR3B 1Q1NA 4Z1OA 5DI3A 1WEKA 3DDSA 2GD1O 2YWBA 3RYIA 2XNSA 5K0GA 1IY9A 4QM7A 4Q1FA 5PNTA 2CD7A 4OY3A 2DULA 3HRKA 3MNFA 3ICVA 2GXUA 2RHDA 2CNOA 4G5SA 3C85A 1YIDA 3ACDA 2PIDA 3NAQA 4FS8A 4LVOA 4YB8A 4BZPA 2QNRA 1ZI9A 3HACA 4MQ4A 4B6RA 1EDZA 1RU3A 5G53C 3CGWA 3IULA 1FFSA 3F98A 5DN6A 4DBLE 2QPAA 2VA8A 3WB9A 2BVNA 1EE9A 1WW2A 2C2YA 5I7SA 1H2BA 4IJ5A 4KYUA 4YCCA 1I0LA 4X3PA 7GPBA 1B8UA 3OO0A 1HT2E 2OB1A 1X7XB 4ASUD 2H59A 3L0OA 5L6MB 2C9MA 4L8YA 4BV2A 2I5PO 3EA4A 2YNMC 3F2VA 1BA3A 1XHLA 3PL1A 4MDYA 5IN4A 5F35A 5L6LB 2DLNA 4OHUA 1E4EB 2CXPA 3GJ5A 4M9SA 4Q01A 5EWJB 3QEAZ 1L4BA 4FFNA 1TYZA 2CFCA 4RTSA 5JS1A 3AL2A 1EWVA 2EFGA 3GRAA 3INGA 4U2BA 1T3ZA 3MMPA 3OC6A 3A6KA 3ICEA 3GJ3A 1F2UB 3U37A 4OXNA 2A7QA 3PUZA 3ZJ4A 4LVUA 3DTYA 1OXKB 3VJRA 4YHHB 4EJSA 1E98A 5DASA 4FEGA 3SIRA 4XSVA 3I39X 2PA0A 1AURA 3DEFA 4KR9A 2WD7B 2VLIA 4F7DA 3E84A 1WP9A 1HQDA 3E9NA 3N2KB 3T7KA 4JYMA 1GM5A 4ECAA 1PP4A 4R2JA 3WICA 1YQTA 4OJYA 6Q21A 2R8EA 3RGWS 2WKSA 3HL0A 1JFVA 1U8AA 5LZ4A 5DIZA 1ZLYA 3AUUA 3BXGA 5AK4A 2RAFA 1E0JA 1FFXB 1W5EA 4LVNA 4Q3BA 3UB4A 5K0TA 1F0PA 1I1NA 2W2QA 2Z3VA 1H0HA 3HSKA 1UWCA 4NYJQ 3JQDA 4EFMA 1WPQA 3K8QA 4L5AA 4NDAA 4V1CA 3ZXIA 1ML4A 3N2IA 2O6LA 5DCWA 4EZBA 4MQEB 4OHVA 1U5BA 3G5AA 3NYIA 3ZD9A 1BNCA 1K0FA 2J7PD 3JY6A 4EHKA 5L4SA 3SVZA 4L7QA 3QTBA 3WIVA 4EMBA 1KY5A 3E6AA 1B4DA 2HREA 3UHAA 1LKZA 3MILA 5A7GA 5P8WA 2FWJA 1YBAA 3L8CA 4LFAB 2D5AA 5FLXA 2RGAA 5IT9A 3B9RA 2K7ZA 4M1ZA 1MKYA 2UZ4A 4DCPA 4YAOA 2VXYA 4GWKA 1Z7WA 4H1UA 5IUKC 4XIIA 1QB7A 2CY0A 3PWTA 2CE2X 2PEZA 1PZHA 3DTVB 3D6MA 4PG5A 3W9SA 4D6YA 4ERNA 5BN5A 2W6JA 2XUJA 3QW2A 1RP1A 3V9AA 2P5SA 4GVLA 2XRFA 1RPZA 2LW7A 3OM1A 3JQ8A 4GP7A 1GZ3A 2JFQA 5CT6A 3IA7A 5EKDA 5JSQA 3Q2KA 1XVTA 4DZTA 5J23A 5FTKA 4M0PA 3VUFA 2C0PA 1ZM2A 3B9QA 2AEEA 5KTSA 1T4CB 1N8TA 3DQZA 3FF1A 3HJTA 1GRNA 1PGOA 2Q3LA 4RZHA 5G1PA 5TJ9A 3ZI7A 2CFSA 4XE5A 3RSGA 3DAOA 3LL7A 2FB9A 1XA0A 4ZVSA 3ZU5A 3ND8A 2HU2A 1Q74A 1B0ZA 4DQLA 1EDEA 3USZA 2X7XA 1QQ6A 3G0CA 5D86A 2NT3A 3FCAA 2DUJA 1FP7A 2VP5A 1IEQA 2E18A 2A9FA 1R3UA 5LJIA 5TT0A 3F1KA 1F8XA 1FDRA 2A9VA 2WTBA 4IO1A 1F9EA 2GXSA 4FYPA 2PT9A 2ZAMA 3PEEA 1JG2A 1IE3A 1KMMA 3QBEA 1BMDA 2RCYA 3U17A 3IEUA 2PAFA 3U3JA 4ZYXA 4HKTA 5KVVA 1GNTA 1UM9B 3LBNA 2CJPA 2ODTX 5CJJA 4US2R 1IQPA 3UCEA 1ZD3A 3ISTA 1NOKA 3DJFA 3GLHB 3JQBA 4LYDA 3KWFA 2CXUA 4C03A 5CMLA 1EINA 4Y2TA 4B48A 1GUBA 3LVBA 4OUDA 5D3KA 4MO9A 3WLPA 4CL0A 6LDHA 4K6MA 4ZCSA 1J6UA 4M7WA 4PSDA 1KEWA 3UJ3X 1N2CE 2PE5A 4Z0TA 5FPSA 4DMFA 1KE1A 2Y1LA 3L6CA 3PQ6A 2GNOA 1F8FA 3IT2A 3HNRA 2PGXA 1RAHA 4FOTA 4WXHA 1Q3HA 3QV1A 3TOCA 3UFXB 3ZZNA 3HYRA 4Z4EA 5HBRA 4HB2A 5DX0A 1G2QA 3ZS9A 1P9LA 4RMHA 1Q20A 5TRTA 3P2OA 4IIJB 1V5GA 1ZI8A 2NV6A 4YRPA 4S0XA 3H4TA 1GU7A 2CVPA 1K08A 4BLPA 1NASA 4U2FA 3AR8A 4OQLA 2X22A 4WINA 4H17A 3TM4A 1R9MA 4YP9A 1T10A 1Q1AA 1JLSA 1MORA 1L4NA 2GK4A 1JPUA 2OR3A 5SZJA 4Y98A 3B20A 4CLHA 3ZOZA 1B0UA 1WU7A 1R4AA 1NP7A 4BO1A 3B36A 1ECFA 4NYJR 1J39A 3VZPA 4NMMA 2QGFA 3QXJA 5FOUA 2I4MA 4DG8A 3T34A 2GESA 2YW9A 4IVPA 5ITSA 3L1KA 4HDNB 1Z2PX 5CYPA 2L42A 4EUNA 5AW6A 4I4CA 3F97A 2IFTA 2CVFA 4TYYA 1G8FA 1REQB 3PB3A 4NEQA 2W2PA 4EEKA 2XCQA 1M0TA 3D2AA 1AHHA 3TTUA 2B6HA 2HRBA 4L3VA 1HYQA 3FCEA 1J2UA 3U4GA 3GIWA 1G5PA 3LIPA 4W82A 2F4NA 2B94A 4D97A 3OZDA 1KZHA 3QV2A 1E1LA 3FCYA 4P4SB 2R6ZA 1PGQA 1YS4A 4NU6A 1YCGA 4AF7A 2NG1A 3ENZA 1J20A 4XVQA 1XPOA 5CDTA 4E08A 1ECGA 2X6TA 4XJSA 5G4KA 3BKWA 4II2A 2ZTUA 2ZBGA 4UNNA 2PUFA 3DVSX 3KE9A 1XUOA 3NHLA 4INJA 1PZEA 2DHEA 3NUGA 3IERA 2P1ZA 3OQIA 4RV5A 4EENA 1NSYA 5CR9A 821PA 1SHLA 2NVOA 3MTEA 4DMHA 4DEVA 2AZXA 5FNZA 5C1OA 4B3TB 1H9AA 2BFNA 5JD6A 4TVKA 4BTEA 1ULBA 5HUJA 1NU6A 3DKRA 2Z4RA 3IKMB 1PUIA 4G4GA 4QTYA 1WMAA 3I6MA 2ZCJA 1M72A 1XZKA 2P0EA 2BIFA 1JR3A 3HJNA 5TPWA 5K2OA 1GL7A 5E2IA 1ULAA 1TVEA 5E6UA 3UA3A 2J45A 5GIPE 3ZCUA 2E4VA 3CWZA 3PQ5A 4U9UA 4POOA 2W2NA 1ABBA 2EYUA 1VXRA 1YVDA 8LDHA 4ALJA 2A9OA 3FF4A 4ARSA 4B47A 3FDZA 1NV8A 1MV8A 4Q1BA 3NTLA 3VU0A 2DQKA 1YI0A 2F7SA 3OKCA 3RTEA 2GZSA 1G98A 3ENKA 2YQ4A 3ZDBA 2JIDA 2VKQA 3BBLA 4IDHA 1I4OA 4W1SA 4LF7B 1XMOB 4WBXC 1RKUA 2WSYB 3D8TA 1XYVA 4BO9A 3BIWA 3TQQA 5EKXA 3M34A 5CM8B 1U0GA 4JOBA 4NMXB 1M7HA 5LZ7A 3RYIB 3PPWA 1BYUA 3N2EA 1X39A 4CMGA 1KAMA 1N5OX 4QBFA 1YZTA 4RWZA 4CM7A 3Q2IA 5JZMA 2VYVA 3Q7IA 1JIIA 3MA0A 3U4IA 1PWHA 2DBQA 4GLJA 4JLBA 1W36D 2O8FA 1A96A 3H11A 2AJTA 2ZAGA 2B3DA 3V4ZA 1UAAA 3R24A 3UAGA 1KQFA 2HJ9A 2ANBA 1TJPB 1VSUA 2X19A 4MR9A 5B64A 5L3VA 2HHHB 3WDSA 1HO3A 1YRWA 5EMMA 4HGZA 2VH5R 3BD6A 3SEAA 2P90A 4RM3A 1PFKA 4YEDA 1B76A 2CF6A 1XNQB 3DFUA 3PA6A 3Q9NA 3NAGA 2QN2A 3VR1A 5JLAA 3A9WA 3TKAA 4O63O 1P7YA 2YIDA 1XLUA 4YX9A 1YL5A 2IZ5A 1WKCA 1XK7A 2ODEA 1J70A 3DOFA 2M6LA 1XPRA 1NF8A 4BNJA 3S4YA 4PYOA 4Q4HA 1M75A 2WJVA 1YDGA 3QVWA 4ZHQB 5C1DA 1Z08A 2X0FA 5JASA 3SKYA 3U5ZB 1OV4A 1ZL2A 3NIFB 4JR2A 4ESEA 5ALGA 2SBTA 5FOVA 2IZ1A 3MERA 3I6QA 3EY4A 2B20A 2P9JA 4NABA 1ODTC 5ALWA 2ZR7A 1IEVA 3X2EA 4HWPA 5M29A 1R0WA 1QGAA 1PD0A 3IQEA 1OWNA 2AB0A 3RIEA 4C7MA 1FYEA 3MZ0A 1NJSA 4OJMX 3RFXA 5LQKA 3A1WA 2X0NA 1CFZA 2EGHA 4I0WB 3QNWA 1NI3A 5F2OA 4OG2A 5F98A 1CY4A 3NOXA 4N3CA 3ROGA 3WS7A 4BGEA 2C3PA 2DE0X 1WZIA 2A5JA 2EOAA 1IONA 4W8HA 4QPPA 3OECA 2BFOA 2WYHA 4FUQA 1K7YA 3FCUB 2QUBA 4EHLA 3HB7A 3P4UA 4U6NA 3MCZA 2V9PA 4HSGA 5JCOA 4L6AA 3O84A 3A1CA 4YDQA 1A4IA 2QE7D 2RDMA 2GHIA 2QXTA 2VCYA 4DABA 1MX1A 1G7RA 1ZGJA 3FVQA 3PFKA 4ZC1A 3RJTA 2XCIA 2VF5X 4DRYA 1GGFA 2GZDA 4R01A 2C2BA 3RK4A 1M54A 5J5VA 2QRVA 3LGXA 3EGXA 1W0KD 3H2YA 3O2QB 1GWNA 2X8AA 1H8HD 1GD1O 1C30A 4HQRA 3H3XA 4NICA 4OLFA 2JK0A 5D1HA 1EWRA 3NHPA 4C21A 4CDGA 2V6FA 5EJAA 4YIKA 3JAWA 4QARA 3A3KA 4BNNA 2JLWA 1IWPB 3PD0A 4GOND 1DZIA 2H1LA 2AJ8A 4B4WA 3C0KA 3OPVA 4PVDA 4QJ5A 1CUDA 1FZQA 3KEGA 3STWA 1PR1A 4XYBA 2CDNA 4KQCA 2OOKA 2ZSAA 5JD5A 1LC0A 2A4KA 1K06A 4LRXA 1VB5A 3E8MA 1IVYA 4C2UA 3VH3A 4ER7A 5KJFA 5EE3A 4NF2A 1MNAA 5DNUA 5L4NA 2JIZA 1XU7A 4GR5A 3BB3A 5REQB 3T35A 2JHCA 5ALDA 1NFQA 1P0IA 4OJQA 3WK9A 1SAYA 3EPHA 4TRJA 3KJQA 1RTKA 2OT3B 3JQEA 3V55A 4EEXA 5E2BA 5AKYA 4NCXA 1PGJA 1U1GA 4OIFA 3I53A 3L0YA 1CP2A 4KI7A 1NQAO 4K9NA 4YK7A 2H4FA 4D9FA 8ADHA 4P0PB 1R15A 3F96A 4OI2A 4LPSA 1NXVA 3LHKA 4H7PA 1WOYA 2VQSA 5E6UB 3RFTA 3AJDA 4WFQA 3AY3A 5HF9A 1YC2A 5D3QA 4INZA 1Z6PA 1TA4A 2C88A 3RU3A 2OM6A 2Q3EA 3K16A 1T2CA 1DAMA 1Z9BA 2FMKA 3EIEA 4TMVA 3U7RA 3GN2A 2AG5A 4ROTA 1FW8A 3ZNOA 5JRJA 1N6NA 2XD4A 3LA6A 3EBPA 3C5VA 3VR0A 4LGMA 2YJNA 3K5PA 3OQHA 4B6EA 3ENVA 4F8EA 2Q0QA 2QN3A 4QGAA 5G4KB 1AMNA 1RWXA 2P78A 5F7JA 2CHGA 3PVZA 1BWRA 2YYYA 4K9QA 1GXSB 1OR8A 2ZJOA 3CUTA 3PXGA 1S3SA 2FMTA 1TJ4A 3FCOA 3I1IA 4MIOA 1SU8A 1HC7A 4W7SA 1DBIA 4MQ6A 1QIKA 3NVMB 5TT1A 4PXYA 3W5BA 4YJ3B 1KI3A 2HLDD 3I8SA 2J3KA 4BLUA 5FPQA 2VWGA 3MJHA 2AA3A 2BTOA 4PNZA 1DBSA 3G1WA 4DVGA 1TLLA 3LY7A 4ZDKA 4H35A 2WMNB 3BXHA 4NE2A 4QXMA 5AVXA 3F5FA 1FDOA 2IYRA 3FWHA 1H66A 2XCOA 3JQ9C 1TMYA 3LZDA 1YL7A 5ALOA 1H93A 4EHAA 4WJLA 1NVVQ 1QR6A 2J3LA 3D3WB 3DAFA 3GA7A 3QWHA 4C7OB 3IDOA 3PT5A 1EUYA 4TS9A 1B74A 1XJCA 1B3BA 2A5FA 2P4QA 3NBXX 4HEJA 4TT8A 4UQPA 3PPYA 3V1YA 2ZM5A 3FETA 2BKLA 2WDZA 3DZHA 4JKOA 2IXFA 3RAJA 1JWBB 1ODCA 3EZ7A 1PV2A 1PT6A 2RG1A 3DE0X 4HGQA 5HCIA 3UK7A 1T4DA 3O26A 1SPXA 4BVJA 4RHCA 3OOWA 4NJOA 2COUA 3DDCA 4X93A 3IDAA 4O4IB 4DDWA 2GM9A 1G8KA 4X64B 2H7XA 4Q3DA 1WA5A 1JJAA 2QTHA 4OGGA 1L5RA 4MW0A 4V0RA 4J0JA 1PEDA 5AJZA 2W6OA 3UFXA 1X8LA 4U7GA 1I8TA 3MQ4A 1WNTA 3GA0A 1PFWA 3TS1A 4XTCS 2P11A 1SIOA 4YY3B 4MPPA 2NNWB 4ZQHA 1KU6A 4MK4A 2ZUFA 4M38A 5K3FB 1UFOA 2KLBA 3RUHA 1CZNA 1TTQB 1U1FA 5CB4B 1IH8A 4D41A 3U7FB 5HK8A 1OLUA 4MKIA 3ZWXA 1JHVA 2FY8A 2IUYA 1E61A 1V43A 1PDOA 2ZB8A 3OCJA 2CN1A 2R4UA 4W9NC 3TLCA 5CDGA 3V00A 1U2GC 3R0IA 1VIDA 2EKDA 3L7IA 3KLBA 5EHNA 5HFJA 4DNQA 3AF5A 1PBTA 1EFRA 1V45E 1LJUA 2XWQA 5CIQA 1F2TB 3I45A 2NUPB 3MIIA 5GAJA 5CT5A 5IYZA 3MCWA 4Q48A 2M98A 5F12A 1ZIPA 2A9JA 4Z9BA 3I62A 4HUTA 4UVDA 1KQOA 4IQ4A 3D1JA 1N2JA 2O50A 3O8NA 1LUAA 5IYZF 5HKLA 1OZ0A 1YGPA 3DEYX 1C9KA 3OLWA 4AP5A 4AZ0A 1TO6A 1ZLXA 3PNOA 5CDHA 4WNCA 1XTUA 1SU4A 1XZDA 3MW8A 4LHVA 2C7BA 1XHEA 1XRQA 1BVYF 3GEEA 4PPYA 3WGJA 3MCUA 4CFYA 1ZM9A 2X86A 1WCWA 3I37X 2GHRA 4L1KA 2XGSA 3ANLA 4A5SA 1OFVA 1JDBC 3MS2A 4UKDA 1UK9A 2LZ0A 3MMXA 3QLJA 1EEHA 4YNBA 4DM4A 3MWKA 5KJ1A 1WRBA 3IFSA 3JQ7B 3VZBA 4AC9A 1XWIA 2VLBA 2QLBA 4GMKA 4NFLA 3AIMA 3EC1A 3SXUB 3USCS 3C8MA 3OE7D 4ZOLB 5LP6B 4D9JA 4UNQA 4C89A 2AG1A 4H6PA 5LZ8A 3R9KA 3F67A 5H81A 3F8WA 2XMPA 2NTJA 2JHFA 1R00A 2J46A 5BW6B 3U7IA 4BX2A 2O8NA 3HGQA 4HB0A 1UZMA 2IDZA 1Q0PA 1TT5A 5TC4A 4AKEA 1CE8A 1LZLA 3GOHA 1A9XB 4MQEA 4PSVA 4PZ9A 1YA8A 1TYBE 1OTXA 1U3GA 5ANRB 5FR2A 2ZPTX 4E1BA 4MV4A 4C7JA 4CMBA 4DW8A 4DR5B 2DYKA 4YROA 3RROA 1L3BA 1TU0A 3KOUA 3NR2A 4DMMA 2C8JA 1KJQA 1O8CA 3QKSB 3ELWA 1CU1A 3PE3A 1V16B 4MWSA 4PNHA 4EYKA 4AX8A 5KNBD 3QNMA 2F6RA 2IHYA 2ZI7A 5J2UB 5KOHB 1GUYA 5BRNA 2HXYA 3SHVA 2PU5A 3EC7A 5HZGA 1XEWX 3NC4A 2IVFA 3KDSE 3VDMA 4O4IF