1J99A

Crystal structure of human dehydroepiandrosterone sulfotransferase in complex with substrate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFLKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKTQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCOHOL SULFOTRANSFERASE
publication title Crystal structure of human dehydroepiandrosterone sulphotransferase in complex with substrate.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 284
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2001-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j99A00
3THWB 4QJ4A 3K0CC 5IK2A 2FSGA 1RJ9B 1W4AA 3I72A 4M21A 3THYA 4MRVA 2C9OA 2YHSA 3HYTA 1DAHA 5EE9A 3AVVA 3B13B 4JBWA 2P5SA 3K0CA 1A2BA 1UPTA 1E6CA 2OV2A 1KI8A 1OV4A 4ARZB 4UJ3A 2ZJOA 4HLCA 3I8XA 4LUCA 4G3XA 2FGKA 1P4SA 1RFLA 2G9NA 3SYNA 2O8EB 1UKYA 2OM2A 3KDSE 1AZTA 1CTQA 3ZH9B 3PUWA 1Z6TA 4JLDA 1N0VC 2YOFA 1EXMA 3BC1A 1YZQA 3GFTA 3PEUA 3ZVMA 2YWHA 2JAQA 1EGAA 4TMZA 1UBCA 3BBPA 3T15A 5IT5A 1N5IA 3B1VA 1UAAA 3EZ6A 2RAPA 3I4LA 3X1YA 1FTSA 1I4LD 4TYYA 1II8A 1OYWA 1YKSA 1FFHA 3DMDA 3SEAA 4LYAA 1G3MA 1OFIA 3BIFA 1K5GA 1Q1ZA 3W5JA 2EFCB 2ZE8A 2VEDA 2Z43A 4ACAA 1W5SA 4EIWA 2XJ9A 4ZV4A 1G7TA 1KK3A 4WW0A 4Q4LA 2JATA 3KJHA 4BPBA 1NN5A 1SVLA 2XXAA 3UWKA 4CEIA 1Z5ZA 2H1LA 2MMGA 2GRJA 1NIPA 4M2LA 3B82A 4PAMA 2D7CA 4D80A 1W48A 1KSHA 2FH5B 2C9CA 4PZYA 1DAEA 2GCOB 2WJVA 1S8FA 1VYUA 2J0UB 2PLFA 4KFSA 3UATA 1NMYA 2GKSA 1JJVA 4IVRA 3UK6A 2D2EA 3LX8A 4G5QA 1NVWQ 2XNDD 1KMHB 4XSHA 5K8UA 1IJFA 2V4ZA 4F4CA 5FOTA 4FINA 3ADBA 1XEXA 2BMFA 4HB3A 5BN5A 1WBBA 1YHNA 2YNMA 3RS3A 1FQKA 5DSZA 1M2OB 3HU2A 1R8SA 1ZC3A 4NYMQ 2ZJ5A 2ZJ8A 2KWIA 3E5HA 3RS0A 2FG5A 2FU5C 5L3QB 3EA5A 1KO8A 3LXRA 1CRQA 2ZAMA 1U0LA 2ZE5A 3TKLA 4C0LA 4EJSB 5C4MA 2XZLA 4US0R 4EQ6B 3MFYA 1SULA 2CHGA 2Z6VA 2W2TA 2ONKA 1ONBA 121PA 1Q0UA 1KDOA 1Q12A 3U7FB 1AQUA 2D06A 3GLGB 1VG0B 1G9XA 4DVGA 5B30A 2IYVA 2ANBA 5EZ6B 3RRMA 1S96A 2AN9A 3UMFA 4A1FA 4V03A 5J4HA 3UIEA 1UADA 3T1TA 2ZS7A 2ZI7A 5FOWA 3D7MA 3ZS8A 4A92A 4C7OA 2J1LA 4AKEA 1S3GA 3B8HA 2PCLA 1TU3A 2CBZA 2PX0A 3T34A 1XEFA 1U99A 4KODA 1HYQA 1IN7A 4URYR 2EFGA 4DLUA 1WMSA 5B64A 2BEKA 2IYZA 2VP0A 2DFNA 1P75A 3G82C 5CK4A 4E03A 2QEQA 4F4IA 1G17A 1W49A 2CL6X 2BHRA 3EZ9A 3TMKA 1Z0JA 4P31A 4BECA 3U3JA 3EZ2A 4NONA 1NVVR 4XH9B 3FKSA 2C04A 1CR2A 4BLRA 1ZCAA 2V6JA 4GP6A 3B1YA 4MYCA 4LI0A 1T4GA 1T5LA 1WB9A 3ADKA 1E99A 2I1QA 2A5FA 4M22A 4CGZA 4C0SA 2EQBA 2OUKA 2I3BA 3BB3A 3NKVA 1J70A 4CEJA 1XMVA 1KI9A 1OPXA 1T91A 1U9IC 3D3QA 1VCNA 3A1VA 4G5OA 4MRSA 1Q1QA 4J0QA 1FPMA 3REGA 3TLXA 2Q3HA 2BV3A 2D7DA 3P27A 4JVLA 1IY1A 2BM0A 3X1XA 1NBMA 2H57A 4DSTA 4CIDA 1LV7A 4IW3B 1E69A 4B71A 2G0TA 3LO5A 5BN4A 3CZPA 4V0OA 4KBFA 4OI0A 1TPZA 4URZR 5J47A 5FBVB 2I4IA 1W47A 1IJEA 1D8TA 5D3MB 3QKTA 2YWFA 5AJZA 4AG5A 3IEVA 2GXUA 2GWHA 3PQCA 4EFMA 1UBEA 2J7PA 1HTWA 3BJIC 2ZR7A 3SOPA 4B34A 4DT1B 3KQUA 4DHEA 1R5OA 2VSFA 2E1RA 2X19A 1A2KC 2WKRA 4MGIR 2H18A 2ZM5A 1E2MA 2GF0A 1VIAA 4TYPA 3SYLA 4NMMA 2ZRIA 2DWPA 2ZS8A 4IOKA 4PPFA 3L0SA 4NBSA 4P4TA 1E1RA 4N0DA 1CRPA 1E2EA 3AF3A 3LA6A 3K70D 2ZUBA 1MABB 1OB2A 3PUYA 4WZBE 3IQXA 1QHGA 4EAQA 1R5BA 5TXGA 3QNUA 4NCKA 1G8YA 1S4QA 1KI6A 2HLDD 1M34E 4ZCMA 3R9XA 1YZLA 5DO9A 1JPJA 1SKYE 3AH8A 4IVQA 4XSGA 3ASZA 3FHOA 5FPHA 3TGPA 3TH5A 1XTQA 4QL3A 1NG1A 2A5GA 5H68A 4LBYA 2WKQA 3AGQA 1ZC4A 2FEOA 3EA0A 4G5RA 4IDNA 1KK2A 2XX3A 3L43A 4NYIQ 4F4JA 4TSFD 4QNRA 2VHQA 2ECKA 3DDCA 5KNDA 3TIFA 5CJPA 3RS4A 1O3YA 4HB4A 1II9A 3I8SA 2ZSAA 3CPEA 3CUEF 3NHBA 4K8OA 5JRJA 4MQBA 3TR5A 2CXXA 4TQ9A 2G6BA 1T5IA 3C8UA 5EZ5A 4BFZA 3TNFA 4JLAA 1U2RA 1X6VA 4B3DA 1NN0A 3LNCA 2RMKA 4M1SA 5FI0B 1SVWA 4HEJA 3A1TA 4B3CA 1FZQA 2ZRAA 1XD8A 1ZM3A 1Q21A 1SZPA 2A5DA 4M1WA 1NJFA 2PL3A 4LK2A 5JS7A 1N6NA 1OH6A 1KI3A 1KYIA 5CYPA 3U4QB 1E79D 2QRZA 1E96A 2QBYB 1WA5A 4H1UA 4DJTA 2ZTSA 2FJUA 1OJLA 3GFOA 4FXPA 5JFGA 4HLDA 1W0KA 2HCBA 3CWZA 2C5LA 1VPLA 4HUTA 3EPJA 2JGNA 1GDDA 2BM1A 5J4KA 1JR6A 2RGEA 2QZ4A 5C18A 2KI5A 4UKDA 5IRCD 5DE3A 5AUOB 1ZRHA 3PITA 5EUQB 1XD9A 4GMDA 2FFBA 4QGAA 4QBHA 5BWMA 2UKDA 2REXB 2PEZA 2FGJA 2AWOA 4AURA 1A82A 1G3QA 3RAPR 3X1DA 2O8BA 1Y63A 2X1VA 1QHIA 3W90A 2BMDA 2FNAA 3E2IA 1X1SA 1YVDA 4ZI3A 2BOVA 5IHPA 2ZE6A 1E2FA 2CHVA 4MYTA 2F1IA 1GWNA 2ODWA 2A2ZA 4CRWB 2RHDA 1AK2A 3NBYC 3SI7A 1RYHA 1T3LA 1VCIA 1KMQA 2Z4SA 5BW8A 4AG6A 4P4SA 1OH8A 4KYIB 5CLQA 5EE1A 5CIQA 2ERXA 4DCNA 3VR5A 4DLTA 2L0XA 3TK1A 1J8YF 2WOOA 3EARA 1XXHB 1QF9A 4OJQA 2DB3A 2QQEA 4V0NA 3IKJA 4ZDJA 2AXNA 2EVWX 2R6FA 3IGFA 3GLGE 1R5NA 2JDID 1AGRA 5JI2E 2C77A 5HPYB 4LV5B 1TX4B 4PO1A 3ICQB 2GA8A 3U60B 3PEVA 3CX6A 1OYYA 1AQYA 2V1UA 1S3SA 5FPSA 2IF2A 4I4LA 1EX7A 3FGNA 3U44B 1FOEB 3U3KA 1YR8A 1C9KA 2ZRDA 4ZKEA 3CNLA 2IYUA 1MOZA 2PH1A 4ASUD 1E9AA 4LJAA 1SXJD 5L3VA 3QEJA 1SXJB 1Z08A 1XB2A 3CW2A 2ZEJA 3KFVA 3L8YA 3QXHA 3KJEA 1T0JB 2BMJA 1WQ1R 1JQLB 5EP4A 4BFTA 5JJKA 1Z29A 3LY5A 1G16A 3KB2A 1EESA 1XD2A 3WNDA 2IK8A 4Q19A 3T06B 3I73A 1YZKA 3ZZTA 2QP9X 4MITA 1XPUA 3ZDQA 2GZDA 4Z1MA 4NCJA 2CLDX 4PX9A 4EFLA 3QEOA 2ATVA 1NSTA 2NO7A 3RC3A 1CJUC 3LBNA 1SHKA 1Z0IA 2AWNA 2IXFA 5KSOA 2IYRA 2VLIA 4KV9A 1US8B 2VSOA 2QP3A 4IDPA 1E32A 3HDTA 4PC1A 4M1KA 5TY0A 5CB6A 1B23P 4D4KA 5LBIA 1CJTC 4R9UC 3RS7A 4Q4JA 5G53C 1UJ2A 1YR7A 4YDHB 4LGMA 1E9BA 2HYIC 4UXIA 3RSOA 4DLWA 1OXXK 5JWRA 4QC2A 3VHLB 4EPVA 4QJ3A 3P26A 2AFHE 3U6KA 3W8RA 2D3WA 2WBLC 1LF0A 3B7GA 3KB1A 3NIBA 1I2MA 4M9XA 4C0AC 3Q7PA 2E9SA 3ASYA 1RZ3A 3DO6A 4TMKA 5L8VA 3CKLA 3CH5A 3SS8A 4D81A 3ZD6A 1P72A 4C0JA 2A9KA 1KK0A 2NPIA 3V00A 1S2MA 2YC4C 1F2TB 2UVQA 3KUDA 4PSAA 2VP4A 3RHFA 1TTTA 2PBRA 1G6HA 3N70A 1LY1A 5FOSA 1VTKA 1ANKA 1M7HA 4C0BA 1YZTA 1B0UA 2JJ2A 2ZRGA 4DSUA 4GL2A 5L3SB 2JLYA 3F5FA 3CF6R 2CDNA 4D4MA 3I5XA 4DDVA 5JS8A 2OFOA 3EG5A 1RC8A 1F2UA 4ESVA 1XTJA 2FX3A 5IF9A 2R65A 4GOJA 1OFUX 2XZOA 1LTQA 3MMPA 1XU4A 4LV6A 2H8KA 2KB0A 4AYWA 3GP8A 1ZD8A 3BK7A 1KIMA 1N6OA 3Q5DA 2FZLA 4P3YA 4BZQA 2VTKA 4HLQB 4QGFA 4GI7A 4X8HA 3QKSA 1NRJB 2GILA 4JBYA 3GLFB 5BQ5A 1ZINA 4OK6A 3OZXA 4DLSA 2XTZA 5DISB 2CK3D 2FV8A 2OT3B 3CNNA 3HYRA 2ASEA 1KTVA 4O2LA 4MDEA 1E94E 2JEOA 1TADA 2XTMA 3BERA 1HT1E 3SC3A 3TW4A 1EWQA 4ZIRA 2OCAA 3QIAA 4NP6A 1Z22A 4ZCIA 2PT7A 1KJWA 2OILA 4FCTA 1VYVA 3ZZ0A 1QHHA 3QPWA 1BYIA 4II7A 1IQPA 2C03A 2GEVA 3U3MA 3D6TB 4QM6A 1NMXA 2QAGB 2P2LA 3CPJB 1SHZA 2D2FA 1IOZA 3DPUA 1TQ6A 1W4BA 2Q9CA 1S9DA 4PSVA 2F3TA 1KOFA 1FX0B 3LD9A 2N42A 2WSMA 4Q1CA 1S1MA 3QJYA 1TF2A 5K8IA 1NVVQ 3QBVA 3R8FA 2DCUA 1Z8FA 4JLJA 3AUYA 5DN6A 5AUQA 3GLHA 1E2GA 2HJGA 1XMJA 2BKEA 4B75A 3KL4A 4KVAA 1P6XA 4JVMA 4DEXA 1DBSA 3FWYA 2NG1A 2VYFA 4FMDB 4LHXA 4CEHA 3H1TA 3WP0A 4PXAA 3CNOA 2JJ8A 4JLOA 4NTZA 4KSBA 3TE6A 2GXAA 1W5TA 3JZMA 2IEZA 5E4FA 4D6PA 5KNCA 1HE8B 5A5GA 3C15C 3IBYA 1BMFD 1ZUIA 1Q22A 4RJLA 1Z06A 2CJWB 1ZP6A 1AKYA 1U0JA 1ZD9A 3EX7C 2WSSA 4D26A 5HE9A 2J0QA 2BC9A 4XJXA 3H4MA 3CH4B 1GSIA 1EFCA 2OG2A 4MUBA 4GMXA 4EPXA 4L4UA 4TWZA 1N0UA 1XXHE 2XNDA 2N46A 3I61A 3SJZA 4I1OA 5D3QA 2QT0A 3Q85A 4EJSC 1S1CA 2QL6A 1ZW6A 2ZUDA 1E2IA 2ZQ5A 1HV8A 1SVIA 2REBA 3P4XA 1KNXA 3X2SA 4Q4HB 1PJRA 4NZYA 1DG3A 2H5EA 2G83A 4LHWA 3OAAA 3AB3A 3EIQA 3A6PC 4DCTA 5KSYA 1IM2A 3R7WA 1CS4C 5FH9A 2ZVPX 4D82A 4AYTA 1TAGA 2QP4A 4JJZA 2PLRA 1HQCA 3ZIAD 4IRUB 4IHQA 2VO1A 3K1JA 1BIFA 1SXJE 4FI3C 4GRAA 2BBOA 4LCBA 3C16C 2FPMA 4Q1FA 1GL7A 4ZCLA 1N3BA 4DUGD 1U98A 4BGDA 1FNMA 2QMEA 1A4RA 3Q72A 3IPXA 1CU1A 1E9FA 1KJZA 4YMTA 4RD3A 2OAQ1 4Q9KA 1JB1A 1G4AE 5TMPA 3C4JA 1E2HA 1XMIA 3A1UA 1SVSA 1MKYA 5DI3A 3VX3A 3NDBB 1C1YA 4M1MA 5B58C 1Q44A 2Q9BA 4XOIA 1DPFA 2FSIA 1W0JA 1DADA 2JJ1D 5E7MA 5HCIA 1HA3A 4DLYA 1R8QA 5G40A 1NP6A 3CRRA 2G1KA 4LC1A 1ZVQA 1PLJA 1H8ED 3ADCA 3QVUA 5JJLA 4TT3D 4XWOA 2CE2X 3TAHA 5EE0A 2FMXA 5FBRB 3AP1A 1JNYA 4Y0AA 3MAAC 3RRYA 2ZIAA 4X8LA 1K5DA 2OHFA 2BJVA 2WICA 2XB2A 3AVUA 1WCV1 5J5CA 4MYHA 4NL4H 4G1UC 3GCGA 3K0FA 2YWGA 3EWSA 1XPOA 2QENA 4C2UA 1X8LA 1M7BA 1NY5A 1XCGB 3TUZC 4DB2A 2G77B 2O8CA 1TUEA 2SHKA 4B33A 1QDEA 5CB8A 1G291 2YYZA 3U3OA 5J4YA 3WYAA 3VKHA 2GVDC 4POAA 2O0JA 4NH0A 3FFBA 4UXHA 5KSPA 4DIEA 3UG7A 1NVUQ 3Q7QA 3DKPA 5EP1A 1T8TA 2Z5FA 2BVNA 2WWGA 1JXMA 2RGXA 2XZPA 4PQFA 3T1VA 1OHHA 2OBMA 4OJKA 4CDGA 1H8HD 4DT1A 5DLQC 4HZIA 3DZDA 4FW9A 4PO9A 3U3RA 5KOYA 4JYBA 3K70C 3U7EB 2ZI3A 5JZVA 4PHHA 2ZROA 2QSYA 2WPDD 2IWHA 4DZZA 4PC2A 4KHZA 1AKEA 1E9DA 3K9HA 1R0ZA 2VHJA 3I32A 3GFPA 2G1JA 3VU9B 1XCPA 3I92A 3AP3A 3O8DA 4ZKDA 2CCKA 4MKHA 3MLEA 4DRZA 3KTAB 4S35A 3X1WA 4EPWA 2OLJA 1LS1A 2PCJA 1VYTA 2PX3A 3K09C 2WVJA 3GLFE 4Q7KA 1MO5A 221PA 3K09A 4PC6A 1XZQA 2W2VA 3FYHA 4C3ZA 4JMPA 3PFIA 1P9RA 1JAHA 1Z2AA 4HB2A 1TL7C 3QKUA 4Q18A 2VRWA 1XJ0A 1U0HC 2AHOA 2DR3A 3S1AB 1XEWX 4B6EA 5GJCA 4I99A 1KK1A 2X2FA 4DLVA 5LD2C 1D6JA 4QRHA 2BBTA 4I1UA 3OEHA 1RE0A 3FTQA 2IS4A 4JLBA 5FBLB 4A2QA 2GTPA 4K46A 4ON9A 5JHGB 1ZU4A 4DC9A 4E09A 3UWOA 3TSZA 4HDCA 4G5GA 2OCBA 1KY2A 5FTNA 1KNQA 2W00A 4KFRA 1P62B 3WP1B 3WRYC 1EWRA 1W1WA 2QPAA 2WWIA 4C2TA 1JEDA 2H17A 2P6NA 1W2HA 4XIGS 2FFAA 1NG9A 1T3SA 5FUXA 2IEYA 1IN6A 4TMVA 4A6PA 2F6RA 2IYWA 5KNBA 3GLIB 1E79A 4X8MA 1JALA 2VP6A 1TQDA 3WMGA 3OF5A 2N1BA 2JIZA 4NCNA 2BKUA 2WOJA 1P2UA 3OIWA 1YU9A 2REOA 2C95A 3GD7A 3HWSA 4LHVA 4RZ2A 4QKQA 2C99A 1DEKA 4JLPA 1UBGA 2IA5A 4XWKA 2ZU0C 3ONWA 4QHYA 3NC1C 4OHWA 3O8RA 3QKRA 3KKQA 3K0AB 4HZUA 3RYTC 1VG8A 1QHSA 2ZJZA 4AYXA 2ZITA 4L9WA 2X77A 5EP2A 2AK3A 1LF5A 1AN0A 2XJ4A 2GAAA 1I2DA 3NHAA 5FTMA 2W6JD 1OIXA 4RCYA 3RANA 2O0KA 1XBTA 3QXJA 1X8KA 3OHMA 4R98A 5J4LA 1Z6XA 1FP6A 2CL7X 4A36A 3VNVA 4HLUC 4B47A 1XZPA 3ND8A 4Q21A 1YE8A 1KI1A 3W6NA 4IDQA 1Z6AA 5KO2A 1GKIA 3L2OB 3MWLA 4HLUA 2QI9C 4MGYR 1E1QD 1CLUA 1ZNZA 5C4GB 3VMFA 1KJYA 3AKEA 2GF9A 5BYKA 3VR2A 2AD1A 1FL9A 3P32A 2NGRA 1EFRA 3NC0C 2XSZA 1W4RA 2V9PA 3QI2A 1R0XA 2IX3A 3BH6A 4WBSA 1QBKC 1QRAA 2RHMA 3LFUA 3ZS9A 2OZEA 5KHOC 1F5NA 1GL6A 2W58A 3REFA 1MH1A 1RRFA 1U9IA 2I1VB 3A8TA 2CHQA 3MCAA 4ITRC 1G8PA 2V55B 4WZAE 2IUUA 3BOSA 1XF9A 4CT5A 3U6BA 3LH5A 5TVKA 4LZZA 3QG5A 2OO7A 2IC5A 1ZIOA 2OAP1 1E2PA 1L8QA 2VF7A 5BN3A 3HR8A 1YRAA 3IDQA 521PA 2F55A 2O8FA 1P9WA 1G19A 2QGZA 3CX8A 2A78A 2OCYC 4UJ5A 2O8DB 4TYWA 4UQOA 2B7BA 1IBRA 2ODNA 1IXZA 3BB4A 5IK2D 1O87A 1ZMXA 4Q7MB 4TLCA 4ASUA 2WKPA 2ZYWX 3THYB 4TTPA 4UNNA 2IT1A 2B7CA 3IIMA 5CM8B 1NJGA 3FHCB 1MRSA 2GEDA 1DG1G 5JSZA 3KXIA 2AKYA 3HJNA 4V02A 4NU0A 2QMHA 4RCZA 3VR6A 4A82A 3GJ7A 3MUFA 5FR2A 3AVXA 3RRNA 4B3XA 3CONA 2JLVA 1AZSC 4B44A 1NI3A 3VR4A 5DHFA 3SE0A 5A0FA 3THXA 4BFWA 5JWHA 1P7CA 2GBLC 4A2WA 3KX2A 2HT1A 2OFWA 2A5YB 2AR7A 1G7CA 1N6HA 1II8B 2HYDA 5FOXA 1YR6A 4LBVA 2FFHA 2AFIE 4Z8YA 2ZSFA 4P33A 4JL5A 4RFSA 1ZBDA 2CVFA 1DVRA 3A36A 3CRQA 1XDBA 1G18A 4IFBA 5JMTA 1YRBA 2GJSA 2NQ2C 1IY0A 1D9XA 3CPHA 3OEEA 3Q5EA 4LBZA 2XXAB 1JPNA 4CEIB 1P2TA 4DCVA 1IAQA 3CIOA 2QRNA 4AC9A 4PC3A 1KHTA 5FL7A 2QGNA 3WRXC 1CJKC 3O8BA 3R20A 1PLLA 4WIAA 1DAKA 2WMOB 4LYFA 2WIBA 4US1R 3BXZA 1COWA 1F48A 1R0WA 1QHYA 2ZRNA 2FE4A 3FDIA 1CJMA 2A30A 3DOEA 2IF0A 4KLNA 3OIYA 5DGXA 1XEXB 4NKRA 4M1OA 3KKOA 5DNYB 1VIYA 1T6NA 1TMKA 1V5WA 4PAQA 3IILA 2WWFA 2VA8A 4B2LA 2IBMA 1HH4A 2YC2C 4O25A 4A4DA 1JR3D 3L82B 3SR0A 3HU1A 2JLWA 4R2IA 4UNQA 1ZD1A 2FSHA 3M4YA 4LOAA 4W5HA 3FMFA 3EAQA 1FTNA 2ZETA 3HU3A 4OHXA 3W3ZB 3AF4A 1BOFA 1UKEA 1VHTA 4PZZA 2IYYA 4LBWA 2R6GA 3H0KA 4RKEA 3MG9A 1HURA 3GJ8A 2O0HA 5JECA 3KJGA 4CW7A 1XWIA 3LVQE 2GETA 3CF0A 1VECA 4XVUA 3NVAA 5EUMA 4A0RA 1M1YE 1XFAA 4BFSA 5SZJA 1KI2A 2J46A 4C7OB 2HCJB 3EPLA 4OHVA 2GHIA 3AKCA 4C9BA 3R9WA 4KFUA 5ANRB 2YOGA 3ZZUA 3U7HB 1SVMA 1Z0AA 4N1AA 4NCHA 4X8OA 5LB4A 3F3YA 3GJ0A 4GBMA 4BFXA 1E2NA 5J4VA 2QAGC 3N2IA 4KYUA 2AD5A 5JHHB 3CR7A 1G1MA 5AJYA 4Q4AA 3T61A 4DSNA 5P21A 2OXRA 4CZ2A 1E2JA 4HAVA 5FTKA 1FNNA 1DS6A 2R6CA 3FKSD 2CNWA 2X8AA 1NKSA 1CIPA 5GADl 3GLIE 4QXAA 1G4UR 1QVAA 1AGPA 3O47A 1W36C 3AVYA 1RPZA 3QSYA 4AKGA 4LY6A 3QPVA 1M7GA 3BH7A 3PENA 4B6FA 1DTSA 5GVRA 4G0NA 2LWIA 2LKCA 2BJWA 4HDQB 2ZR0A 4B3FX 4AI6A 4TL6A 4CEJB 621PA 2B92A 3KQNA 1JAIA 1U81A 1G8HA 2DFLA 2ZYTX 5HKKA 2MSDB 4YXWD 4QHTA 4MDFA 1TQ2A 3QF4A 1DAMA 3QBTA 2W0SA 5UKDA 4Z54A 1NBMD 4A9AA 3HPRA 4DLRA 2G3YA 1JJ7A 3L0PA 3JVUA 3ETLA 4Q00A 5J40A 1X1RA 1AS2A 5CK5A 4GSYA 4AD8A 2ORWA 1BMFA 5DHAA 4EUNA 4KCGA 4MUAA 5C1BA 1DARA 4GT1A 1OSNA 1T9HA 1H65A 2OBLA 1I4TD 1KDPA 1DELA 2C8VA 2ONJA 5AJVB 2J7PD 1FP7A 2IL1A 1ZUHA 5GVSA 1TUIA 1XCMA 2FWRA 2J87A 2ZRKA 3IHLA 4ZO4A 4YMSA 4BLQA 2VBCA 3L0OA 3UMSA 1OFHA 2F1RA 4BLOA 1Z47A 1VG1A 4DDTA 1E1RD 4YDSA 2D74A 5EXXA 3LBIA 1KGDA 1M8PA 2Q0HA 3KKNA 5CDFE 1LS6A 2P6RA 2F43A 1GRQA 4IXMA 4HUQA 3ZVNA 3NXSA 1J99A 2ATXA 3TQCA 1KI6B 1NLZA 3B2EA 4Q1EA 1JECA 3EXAA 3DM9B 3AGPA 4LJ6A 5LB2A 1NL3A 2FOLA 4LJ4A 4B2PA 3TAUA 1BH2A 1WE2A 2CVHA 1W2GA 2EWWA 2QE7A 1Z0KA 5FPYA 1NIJA 3OIUA 4HAZA 1D2EA 2FZ4A 3ECCA 3E1SA 4JLMA 4PAOA 1N25A 4BUJA 1WP9A 2WV9A 2R9VA 3T35A 4B3GA 4RD0A 5CLLA 1RKBA 3E70C 5H8WA 5JWOA 4MYUA 2QQ0A 4A8JC 4ERNA 5JI3E 1K6MA 1N5JA 3OFND 2ERYA 5KDDA 4OI2A 2QU8A 4C0HA 1XTIA 3OE7A 3AVOA 5B57C 1QHNA 3NDPA 4YMWA 2G0NA 1KO4A 5KSZA 4A8JA 1FMJA 4IFEA 3CX7A 3IQWA 4LPKA 3SBDA 2JJ1A 1KI7A 1NVXQ 4QBFA 5L3RA 2CCJA 1MT0A 4UNPA 2QNRA 2XEXA 4QNMA 2HT6A 1RRGA 4JS0A 1MO6A 2WAYA 2C2HA 2DPXA 3ADDA 2GCPA 4MRPA 2ZI5A 3CF2A 3TVTA 5EJEA 2VSXA 3OIVA 4PTLA 1W0KD 3IO5A 3ND9A 4JKYA 3RWMB 4OYHA 1NMZA 2BIFA 3N5CA 2ZS9A 2RB4A 3GJ5A 4ZDWA 2HEIA 1ZNWA 3THWA 2P0EA 4OI1A 2B8WA 1RJ9A 2CCGA 2ZJYA 2ZRPA 3DZ8A 1OE0A 5JRZA 2ZRCA 5FUVA 2ZRHA 3H86A 2RGCA 3SJBA 2NZ8A 4RZ3A 1OH5A 3VTKA 2YJTD 3FOZA 2PZFA 4ARZA 1UBFA 4CT4B 2V8OA 2O8BB 2CLCX 2O8EA 1TNDA 1GRRA 4WZ6A 4DDUA 3BFVA 4JL8A 3PEYA 3MWJA 4B35A 3U2QA 4BQSA 4DDWA 5FFMA 4D4LA 5LDDC 4TQAA 1U8ZA 5DH9A 1D2NA 5BYJA 3ZVRA 3LQRA 4JIMA 4MRRA 5E7JA 4P4SB 2V3CC 1UFQA 4HATA 1PV4A 4C0KA 1Q1BA 4JBXA 1OXSC 4TL7A 4EKDA 3SQWA 2DHRA 4ACBA 2ODEA 3CM0A 3IBGA 1JR3E 1NLFA 3I1FA 1GILA 3FVQA 421PA 2QUZA 1YZUA 2MSEB 3WBJA 3WHKA 1E0SA 3A4NA 3RC8A 1T0HB 4TLEA 4R71A 3NBXX 4U5XA 1Z83A 1E4VA 3ICEA 4DCUA 3KZ1E 1J90A 3AV0B 2RGAA 3EC1A 2GCOA 5F9HA 2J0UA 2R44A 1V43A 2VQSA 4PANA 1PUJA 1E2QA 2GJ9A 4PFSA 3VR3A 3VKGA 2Q9AA 1R7RA 4LWZA 1CBUA 4OHZA 1KMHA 5FOVA 4JSYA 2YZ2A 4PPNA 3WY9A 2VHTA 3IEUA 1RW4A 3SHFA 2F1HA 1OH7A 5SZIA 3A58B 1XD2B 4DCSA 2ODBA 2VIIA 2OE2A 5E7IA 2WJYA 4XVRA 2J59A 1G5PA 4D0GA 5L3QA 4Z1MD 2ZJBA 5EP3A 4EJSA 3B9QA 2WWYA 3MD0A 4JLNA 3B60A 3GEEA 2V7QD 4JJKA 1LW7A 2B8TA 4XTCS 4C4PA 2GK6A 3DOFA 4HYYA 4EQ6A 3EPHA 3ZVLA 4E22A 1XTSA 5KDLA 2DWQA 3GLGA 5E3HA 2R8RA 2VH5R 2XOKD 4JVNA 1L4UA 2KSQA 1KKMA 4DB4A 1N2CE 3C7KA 4ILEA 1NY6A 1NBME 2RGNC 2GDJA 4LYHA 5HR5A 4JL6A 4GOKA 4XVQA 4Q4JB 3KQLA 2RCNA 5CJ2A 2Z83A 1AS3A 3EW9A 4QM7A 1E9EA 3C14C 2OFXA 2RGNA 2C98A 5IDVA 3UXMA 1NN1A 3MRSA 3BGWA 1ELOA 4BLTA 1NN3A 1Q20A 3K53A 4PPGA 1NF3A 4URWR 2YWEA 2A3RA 3BE4A 1F3OA 1VG9B 1KSJA 3HR7A 3K9LA 3RSLA 3EZ7A 4EPTA 1G3IA 2W6ID 4RY2A 2W6JA 1HE1C 2WIAA 3FHTA 2VP5A 4H9GA 4JKIA 1R10A 2EFHB 4TMWA 1N5KA 1ZYUA 2IHBA 2W2XA 3K0EA 4WVFA 4C0QC 1P60A 3LVRE 5M04A 2BBWA 4KBGA 2QORA 1GG2A 1P73A 4HAWA 4LRWA 5HZKA 3B1WA 1UKVY 1OKKD 3A1WA 2IYTA 1W46A 4FIDA 4YC7A 3UG6A 4O0MA 1LFDB 3AVTA 4RVCA 2FA9A 3ZQ6A 2HXYA 4EFNA 2C78A 3UMRA 3C5HA 2VL7A 2IYLD 3ZD7A 4IDOA 3PIRA 1ESNA 1F2UB 4W9MC 5TV2A 1GAJA 4FWTA 1UDWA 1AA9A 1TF7A 2PT5A 1EFUA 2AXPA 1FMLA 3L8ZA 5TARA 3AKDA 4TL9A 1G41A 3A37A 1N6IA 1ETUA 1YQTA 1XEWY 3K8YA 4IOJA 4E07A 5EXTA 3BRWD 1KAOA 2PMKA 4V0ME 4BZXA 5KTYA 3QKSB 4Q01A 1VHLA 3NG1A 3P4YA 1DE0A 2WJGA 3AQ4A 4HAXA 5D3MA 5EXPA 4JVSB 4M9QA 4RFVA 2JLSA 3KQHA 3FMIA 4JLVA 2NO0A 4Q1BA 3SFZA 3IO3A 3SZRA 2GESA 4AKHA 1KO1A 3SNHA 1JI0A 2IW3A 5DIFA 2IS1A 4ZIRB 4CVNA 2XAUA 4JLKA 1FUUA 1OXTA 2HF8A 2RGDA 1Q3TA 5G3ZA 1QHHB 1KZGB 2CLSA 1MABA 3EZFA 1VKJA 4HAYA 2V6IA 4FMCF 2CE7A 4M0LA 5JEDA 5H70A 1W4CA 2D4HA 4B74A 1E98A 1ZM9A 2QTFA 2FSFA 4IJMA 3NBFA 1IHUA 2WWXA 3Q3JB 1AIPA 3DKVA 4GOXA 4YLGA 5DN6D 2HLDA 2OESA 1ZAKA 5CYOA 5FBWB 1Z6YA 3NTUA 3GLHB 4B76A 1YR9A 3AP2A 4KU4A 3AF0A 1GL9B 4DLZA 1Y3AA 2GJKA 2NTYC 3U61B 4G01B 1GVNB 4CYMA 4BWYA 4GPTA 4CEHB 4PPQA 1ZNYA 3D31A 3V4RA 2ZAOA 4K81B 1LVGA 4E5UA 1IY2A 1ODFA 3M0EA 4TSFA 2WM9B 2QTVB 3WNBA 3RLFA 3H84A 4P32A 4HDOB 1XMSA 2QROA 3W3AA 2RH5A 2ZANA 2IS6A 2ZREA 2GCNA 1XTRA 4JYCA 1U90A 4XD7D 3C5CA 2EFDB 2FFQA 4LC0A 2Q21A 1XJCA 3GJ3A 2WSSD 2YVUA 4P0TA 3SBEA 4N0EA 2JA1A 5F3WB 3DEFA 1KSFX 4O2RA 4KI0A 4ZDIA 1G5RA 1GTVA 3WYGA 1UEJA 2ZRLA 4QG7A 3VX4A 4BRWA 1IN8A 4BRUA 2CL0X 1IN4A 3DMNA 3LAWA 3BH0A 4NYJR 3U4QA 3W8NA 4D2IA 1XPRA 1WF3A 4F38A 2QBYA 2VHUA 2A5JA 2NO6A 4W7SA 3R8CA 3GEIA 2QAJA 4W5JA 1YZGA 1E3MA 5AK0A 5JCZA 3SHWA 2IYSA 1TEXA 4MGKR 4JT2A 3NEYA 2FPKA 2ZU6A 1KO7A 3MSXA 4DBLC 3ZLJA 3CZQA 2EW1A 3OAAD 4AY2A 5JJIA 4OQNA 3G0HA 3MGCA 1JR3A 1P2SA 3R7WB 2WHXA 3UANA 5FUWA 2J7KA 3P20A 4PHTA 4HB0A 2RGBA 2JLXA 1GNQA 1CR0A 3SYKA 3I62A 2JLUA 1DAFA 2ZVQX 4U02A 3T1QA 3C41J 3TVDA 3ZGXA 5EXSA 2ORVA 5JBQA 3W6OA 4B43A 1BO6A 1G3RA 1P5ZB 3AVQA 4Q1DA 2QMOA 1AS0A 3DHWC 4EPRA 3EIEA 3LW8A 3QVVA 1U8YA 1UDXA 2P5TB 1P2VA 2J0VA 4OL0A 5DI3B 2GZHA 1ZJ6A 4PR0A 5TB5A 3PCRB 1C4OA 3GQBA 1XXHA 3MJRA 2B6HA 3NH9A 1W0JD 4LJ7A 4NDZA 5GJBA 1N6PA 4IVPA 3NH6A 3T5GA 1Q3HA 1L4YA 2IXGA 3RS2A 3AEZA 1G21E 3HPQA 2P6UA 2XNSA 3PR1A 4DEYA 2JDIA 3B9PA 1CR4A 1GOTA 2D62A 2JLQA 3QXSA 4B73A 1Z2CA 1F60A 2BWJA 2NZJA 5AJWA 4BASA 4A0GA 4DSOA 4U7DA 2WZQA 4KLZA 4D0LB 3KFXA 5KDOA 1BYUA 4MKGA 4I1SA 3R9IA 4HI0E 1IXRC 3U44A 4URUR 1QG2A 2QG6A 1SXJC 1E9SA 2ORIA 3UPUA 1GIAA 5KPDA 3KKPA 4A15A 3AVPA 4KAXA 4Q9IA 1NKTA 4YXWA 4TMXA 1N6RA 3K0FB 4OBEA 3TSWA 4DKXA 1SXJA 1OB5A 1OT3A 2JCSA 3BORA 1G3UA 4H1VA 2J41A 2O8CB 2HUPA 3BS4A 2DFKB 3ZQJA 1DAGA 3GPLA 1R6BX 4BEBA 1G5TA 1G8FA 3JVVA 5E95A 3RVBA 3PVSA 4AWXA 1CEEA 3KJIA 5LPNA 1I4DD 3FPAA 1OHHD 1E0KA 3NWJA 1Z3IX 8OHMA 5FPTA 1GNRA 4DIDA 1IN5A 2XB4A 3CRW1 4RKFA 3NBZC 2AX4A 1YZNA 2FDCA 2KBFA 4TTRA 4LJ9A 2OBNA 4L5BA 4LDJA 3VNUA 2WWHA 2V1XA 4Q9JA 2QN6A 3QG1A 4OK5A 3KXKA 4MH0R 2GVZC 1FUKA 2GBLA 4LJ8A 1RIFA 1US8A 1Z0FA 2ZI4A 4XWAA 2R6AA 4BFYA 3FKQA 1A5TA 3K70B 2NO1A 1F6BA 3THOA 4F93B 1DOAA 1MRNA 4FMCB 3LX5A 3A4MA 1DAIA 2VF8A 3BB1A 3I3SR 3NEJA 4WXRA 1E0JA 5AUNB 3CRMA 4JT4A 3QXCA 2MMCA 4PSKA 5A4JA 3X1ZA 1LNZA 4KITB 5JLJA 5K8TA 1A1VA 1ZM2A 1ZIPA 3LRPA 5CITA 1G7SA 3OESA 4Q66C 1GKYA 4GZMA 2ZI9A 3BFXA 3PG5A 4M9ZA 3EPKA 1R2QA 3GMTA 2F1JA 2Z0MA 4NHOA 1KI4A 1E4YA 4LX0A 4OKSA 1QHXA 4R2HA 1CF4A 4V0MA 5DYIA 4YMVA 1XX6A 1F2TA 1GFIA 2ZRMA 2FEMA 3OEHD 3LXXA 1E9CA 4GDFA 2P3SA 4OQFA 3K9GA 3CWQA 5HTKA 2C96A 1E0AA 2ZJAA 5JCPA 5LD2B 2DY1A 1BS1A 5L3SA 3OFNA 2R62A 3CO5A 2F9LA 1XJQA 2EYQA 4ZI2A 2ZI6A 2DBYA 4FMBB 4BFUA 1Z6GA 5FR1A 3GLHE 1CXZA 2WMNB 2GJAA 1CULC 4YQFA 2W0MA 4KXFB 4WA7A 4BEJA 1MR3F 1SKQA 2LKDA 5K8LA 2PZEA 4B3BA 4MKFA 5H1YA 4DXAA 1S0UA 2JASA 2JIZD 1JQJC 3LDAA 4BLPA 4Q5IA 5C2JB 4MKIA 2FPLA 3AF2A 3GLFA 4Z8XA 2VHCA 4Q9HA 5SZKB 5FI1B 2H92A 1RVDA 1DO0A 2HJVA 3F0TA 2GZAA 3CBQA 3P1JA 5GJVC 4D25A 1MV5A 2HV8A 3B6EA 2PJZA 4I1VA 3QKRB 2CK3A 4L8GA 1LB1B 3DVLA 4HZUB 4TQUS 3CR8A 4RSGA 4GZLA 4US2R 4TMTA 4TZ0A 2XGJA 4TLDA 2QT1A 1GZSA 1CP2A 2X2EA 4FWIB 3AM1A 5F9FA 2RGGA 1EFHA 4KO8A 1GNPA 3FFAA 1OFTA 2ZYVX 3TUIC 4URXR 3MJHA 2ZSBA 5FPKA 2QAGA 4P4UA 4UNSA 2ZPTX 5KU1A 1UEIA 3TSOA 4LHZA 1FX0A 3BD9A 1R4AA 1T8UA 4F7WA 1G64A 4BE7B 1KKLA 5CM9C 1M74A 3I5YA 5KYKA 3VKWA 2UZIR 3DL0A 5DI9A 1NSFA 1EFRD 3IIKA 2XSZD 3LV8A 4JSTA 2EWVA 2GXQA 3TRFA 4FMDF 4PHGA 2VP2A 1OIVA 3M1IA 1E2DA 2CMKA 2ZRJA 3PUVA 4LV8B 2JLRA 4LYJA 5F2EA 3T1OA 4TYNA 1S9HA 5JEEA 2C9YA 1MO3A 2HXSA 5AWFC 1GRNA 3WXMA 3RDPA 3V9PA 2NOAA 1P9NA 2GJ8A 4OI4A 1D5CA 4LJ5A 3W34A 4QFMA 1PUIA 2GXSA 1OIWA 2CJWA 2GNOA 2J5XA 3SJAA 3O8CA 2O52A 2O8FB 3TBKA 2UZ3A 4V0KA 4UNRA 4WOPA 4NE2A 3KUCA 1KDTA 4OQXA 4TL8A 3TQFA 1ZCBA 2WAXA 2R2AA 3QENA 4IEEA 2BCGY 2P67A 1GKUB 3GJXC 3VHXA 2NPFA 1NNEA 1P3JA 2WTUA 2IYXA 3GEHA 1RRPA 3SQXA 1N6KA 1OW3B 1VMAA 1TU4A 2QPTA 2IWRA 3TW8B 2FN4A 2WJJA 2WJHA 4QBGB 4NYMR 4B32A 4M53A 3KQKA 4ZPXA 5JSZB 2PMDA 5AUPB 3MWYW 4RZXA 1TQ4A 2IUTA 4IOLA 4L16A 1KSGA 2BEJA 4A0FA 3DM5A 5BXQC 3QXXA 4U00A 1GM5A 2VPPA 2PJRA 1OF1A 2RKOA 4Q4HA 2XTNA 2OEPA 4RD6A 1OXUA 3THXB 1NLYA 4QHSA 2V7QA 4GNKA 4MRNA 3L0IB 1D9ZA 1U8AA 2ZXUA 4MA4A 2NO9A 5C46F 4PZLA 3RS5A 3WMEA 2BMEA 2GK7A 2ZSEA 4GFDA 1AM4D 1PVOA 1XTKA 3ZIAA 1VCMA 4OQLA 5EE5B 2MSCB 2XOKA 3TR0A 4M4SA 4RFSB 2EU8A 3H2YA 2F9MA 4M1YA 2IYQA 4I81A 4RD1A 5GJWC 3WNCA 3U7GA 2NIPA 4Q7JB 4QGGA 4TLBA 3SN6A 3OEED 1UM8A 1E2LA 2LCFA 4PQRA 4KSCA 3WYFA 1N0WA 4DUGA 2QM7A 2ZUCA 1G20E 2NMVA 4TZ6A 5FL7D 4OK3A 4WAUA 4C30A 3LW7A 4NPHA 2O5VA 5TDHA 3RWOA 4AIIA 1QZXA 4Q02A 2W6IA 4HAUA 2J0SA 4PQYA 4BFVA 1QG4A 4YMUA 5KPJA 2KBEA 3KKMA 1COWD 3SJCA 3B85A 4O3MA 1UKZA 3GJ6A 3N2EA 3GJ4A 3K9NA 4Q1AA 5HCNA 1J2JA 3Q8XB 4TTQA 1ZUNB 3AVWA 3B78A 3BAFA 3LWNA 2YOHA 4A0HA 1H8EA 1N6LA 1KAGA 1W7AA 1SVOA 1Q1EA 4TT3A 2YKGA 4JZKA 2KJQA 2YINC 3AF1A 1D2MA 3T5DA 3VQTA 1OKKA 3V4FA 1WDTA 4NYJQ 1JEEA 3QF7A 1KY3A 4FD2A 4N3NA 3FMPB 4L9SA 2ZR9A 4KVGA 2QMUA 1QVRA 4V0LA 1TF5A 1YJ5A 4IKEA 3Q9LA 4AKIA 2YV5A 3WHLA 4B48A 1KO5A 1N5LA 3QE0A 4L15A 3BWDD 4CF7A 4Y0VA 1TEVA 1ZM7A 2WWWA 4QOSA 5G41A 1A7JA 4MGZR 2Q3MA 2QPOA 3IUYA 2HF9A 1MO4A 4URVR 3RRZA 2OCPA 4NCIA 4M9SA 4PO8A 2IHYA 3CRVA 1II0A 2W83A 4Q7LA 2K5UA 3IIJA 4M1TA 1H8HA 2AKAB 4QJ5A 2ZRFA 5HZHA 1WBDA 3K0SA 3EASA 1G7RA 1Z0DA 3ZYCA 3W5IA 4FCWA 4LSGA 1Z07A 1CKEA 1ZNXA 2J3EA 3RNLA 2XITA 1FW6A 2ZYUX 4A2PA 3W6PA 3AKYA 1K8RA 1IXSB 1KDRA 3QUSA 5FOUA 2ZSDA 2WPDA 4Q4AB 2H16A 1SVKA 2Q6TA 2CNWD 4OHYA 4TYQA 3VU9A 2PEYA 3HP1A 1XRJA 2QY9A 4HSEA 4WXPA 1SGWA 3WMFA 1GP2A 3IPYA 1R0YA 5F98A 3KTAA 1EX6A 1X86B 2DYKA 1J7KA 3D8BA 3EIHA 3FB4A 4LJYA 1Z28A 2H7VA 4RD4A 1GITA 1W36D 1AJEA 3B1ZA 3FE2A 1RYFA 1W36B 4NYIR 5CIWA 3W9YA 3B5JA 2OLKA 3WBKA 4RD2A 5HKKD 2ZE7A 3PUXA 1RRCA 2AK2A 3FMOB 4KJZA 4DLXA 721PA 1FQJA 3QF4B 4D4JA 1L2TA 1G6OA 4Z51A 4FCVA 3S1AA 4LPSA 2ZJ2A 1L7VC 2QTHA 4IDHA 5HE8A 4EDHA 4IXNA 4F91B 2Z4RA 2PZGA 1WRBA 4IEIA 1Q57A 4BLSA 3KXLA 2IXEA 4F92B 1XP8A 4XD7A 1EK0A 2DWOA 1BKDR 4GP7A 3LQQA 3VR1A 1XNJA 2FF7A 3QY0A 4OQMA 3QQ5A 5EE3A 2R6DA 4FN5A 2B21A 5FTJA 1ZU5A 4ABYA 1CR1A 4TN1A 1JBKA 4Q48A 3SU8A 4Q03A 3QOFA 5FTLA 4YONB 3A4LA 1X3SA 2ANCA 1VCOA 3AUXA 2BDTA 3U5ZB 5B2ZA 5AR1A 1G8GA 3GLIA 1KZ7B 1PZNA 4QBIA 3UKDA 1J8MF 1UF9A 2QSZA 3CB4A 4QGHA 3SDZA 5FUYA 3B1XA 3F8TA 821PA 3PJRA 4PC7A 1CJVC 1M6NA 2HDNB 3T12A 4D0NA 3QPUA 1EFTA 1HEIA 2F43B 2P65A 2V54A 4HUQB 3M6AA 2BCJQ 2ZRBA 3PV0A 4B2IA 2IUSA 4DWJA 3PUZA 3K0AA 3PXGA 2KE5A 2CEAA 5FL3A 4UXJA 1HT2E 5DYGA 5AJXA 1GUAA 4ESHA 3BFKA 2QE7D 3CLVA 3LLUA 3VAAA 2Q3FA 4KFTA 5FBQB 3LBHA 2F3RA 1OXVA 2J9RA 2QM8A 2IS2A 1T3HA 2GEUA 1VDZA 2WJIA 1W44A 1SQ5A 1ESMA 1Z63A 1HQYE 2EFEB 4PHFA 4EPYA 4Q9LA 3RABA 1EG7A 3VFDA 1HY3A 4R7ZA 2E87A 1E1QA 2TMKA 1OLOA 5KUTA 2JJ2D 1IONA 3IHWA 1WXQA 3LLMA 3PEWA 1E2KA 5EQTA 2OSBA 3G5UA 3OE7D 3SFVA 2J45A 4IOMA 2DFTA 4S2EA 6Q21A 4A8JB 2JLZA 4XTRA 1U94A 2Y8EA 2G88A 2OXCA 1ZM4A 1P61B 1PLKA 5SZHB 4BZPA 3JZAA 4G5SA 1HUQA 1E9RA 2GAOA 4W5WA 3EWAA 2EYUA 5ELXA 5CDFA 3EC2A 2QA5A 1JXOA 2F7SA 5G3YA 2A7QA 4TLAA 3TUJC 4LHYA 2BBSA 2VP9A 4ZDKA 1DO2A 3MWKA 2AL7A 4AK9A 1SKYB 3TJZA 3ZJYA 4A6XA 2O8DA 1X8JA 4Q47A 4M8NE 3A1SA 3J81k 4RZUA
chains in the Genus database with same CATH superfamily
3JVDA 5KWIA 2JFFA 3K0CC 5IM4F 5BWLA 5IK2A 3FYUB 1W4AA 1AHIA 2AFIB 2FK7A 3QVOA 3AZPA 3FMVA 4N47A 3B3JA 3TQRA 4DWOA 3D7RA 1R0RE 2BR5A 2C9OA 5HKLA 2P9BA 2YYAA 3VNQA 5EE9A 3AVVA 3B13B 4HQOA 1K4KA 1UPTA 1E6CA 1QIJA 2QN8A 4YBRA 5BWOA 3UJBA 1GNLA 4OKNA 4ZVNA 3R3XA 1FJ2A 2FGKA 3COZA 3SYNA 2Z2KA 1HZZA 1PR2A 2RHLA 3KDSE 3ZH9B 3GT4A 4YAEA 1Z6TA 1INLA 3NORA 3SX0A 1X19A 3EEQA 2YWHA 2NVOA 3KAQA 4R01A 3BBPA 1OBFO 1UBTS 2J9ZB 2NAFA 1U0SY 2WJ6A 2QTRA 5G0WA 5HF5A 1FRVA 2HOQA 3F9RA 1FTSA 4TYYA 3A3OA 3O2JA 3SEAA 5B3JC 2A0FA 1OFIA 3BIFA 1K5GA 4JJIA 4MS3A 2EFCB 3V8VA 2VWQA 2Z43A 3R0XA 4QEKA 2VDLB 4ACAA 2G07A 4ZV4A 4NJMA 3S6JA 3MJCA 1FFCA 2F8LA 1YZFA 2I2WA 2Y1EA 4MSUA 3ZQKA 3T3DA 5ALFA 2JATA 4BPBA 1AO0A 1NN5A 3PDHA 2OP1A 2XCIA 4BNNA 1T2CA 1E1LA 1I80A 4I9UA 3VR0A 2IHKA 1WF6A 4B7XA 2J6CA 2J3MA 3B6MA 4M2LA 4GWLA 4Y2TA 4WSOA 4WFIA 2D7CA 4LVNA 1X92A 5LR6A 3QU9A 5EUCA 3LY8A 5CURA 2G9UA 1EP3B 4RZHA 1SK9A 2FH5B 3RRFA 1EUYA 4WLOA 8AT1A 2PUVA 3X3HA 5F23A 3SKYA 1CUJA 3KVYA 1K3FA 4XQEA 1N92A 4D9GA 2C7QA 2P2YA 2D2EA 5LZ4A 3ETEA 1VP9A 3IHTA 2DQKA 4G5QA 5TPWA 3HCRA 1P2BA 1XU7A 2Q2WA 2XNDD 1NM5A 1XTTA 5T3YA 1LRKA 3CEAA 4F4CA 3PXDA 3ADBA 5T5QA 3PNSA 2O7VA 5BN5A 4M7RA 1WBBA 1YHNA 2YNMA 3T7SA 2I2CA 3COSA 3UA3A 3EUEA 1R8SA 1BA2A 3KHUA 1U0GA 1EVYA 1FMFA 2EQ5A 5A1JA 3TFOA 3DOOA 3E5HA 3P0EA 3BXGA 4YLYA 5L3QB 1D3AA 3ZI0A 5HKBA 3HCEA 1KO8A 3SBXA 4WVLA 1BZYA 4R8MA 1TAHA 3TKLA 4R1LA 3JS5A 3U26A 4EJSB 4TS3A 2FOIA 5H4GA 2YICA 4US0R 1TUBA 3NAGA 1FDUA 3MFYA 1U6IA 4MI6A 4D98A 5KTNA 4MDHA 3T6KA 1D0SA 1Q0UA 1KDOA 2OPBA 2PGJA 4HH4A 3WV5A 1IAVA 1G9XA 4DVGA 2IYVA 4TTVA 2CNOA 1OBVA 2AN9A 1PS8A 5J23A 3SS9X 1V16B 3ILYA 1USIA 3G7SA 1R15A 4A1FA 5J4HA 3VZQA 1WKVA 2XPCA 4CPDA 5C3MA 4KX3A 1AVTA 3T1TA 1U1GA 3AONB 2FX2A 2NQTA 1EZ4A 3ZS8A 3X1JA 3L7KA 2BF7A 1YJCA 4DL9A 2Z3WA 4H15A 1WX1A 2PX0A 4NQRA 1AF4A 1D1QA 1U3GA 1ZXBA 2LPMA 1O94C 5I5GA 1U99A 4KODA 1HYQA 5AOBA 3WA6A 1JLKA 1WHTA 2EFGA 3K4PA 3OQIB 4IF6A 3OZSA 3MJVA 2QVBA 4DLUA 4ISBA 4OP2A 4JXKA 1P75A 4C4YA 3DMGA 4MOWA 2TMDA 3WHPA 4AUKA 4BBPA 3EZ9A 1W49A 4OOFA 4W82A 2QV0A 3QFFA 2G5TA 1S2GA 3U3JA 4U9UA 1W88A 4FFSA 2AXQA 3JWGA 2PKQP 1JDBB 3A1NA 5IC6A 3ZLTA 1FC0A 4R8SA 1MFPA 3DUFA 5AICA 5L51A 3FYSA 4GP6A 1TFUA 3B1YA 1KQGA 3JQ9A 2JG3A 4RVHA 2G08A 4TTIA 1T5LA 3RSCA 3SHOA 3ADKA 3EXEA 3Q7SA 3ZWOA 2IDMA 2A5FA 3AXTA 4BATA 5T4BA 1PJCA 5FWNA 1WR8A 4G5XA 3BE8A 3NKVA 4YCSA 1VPVA 1KI9A 5ICGA 3TG8A 1YUNA 4ZARA 5IF3A 1UBHS 1AQIA 2HIHA 4G5OA 4MRSA 1DQRA 1Q1QA 1U6JA 2ZWIA 4J0QA 3C24A 4O59O 4YALA 3REGA 1FXWF 1W85B 1IY1A 3X1XA 1ZI6A 3FROA 1VL2A 4CIDA 3ZXIA 4IW3B 1D4FA 1E69A 3MAGA 1J4AA 3AV3A 1IUKA 1DKUA 3TJMA 5KINB 2DFDA 5LLTA 2G0TA 2QUAA 2I29A 1GTMA 3CS3A 1TPZA 3QEBZ 5J47A 1WOYA 4DLPA 4JC8A 1U9JA 3DE5X 3WL3A 2BSAA 4C4OA 4QJBA 4W7IA 4LF4B 4QWWA 2HNAA 3QKTA 5AJZA 5K03A 3PQCA 2X0KA 1UBEA 3BJIC 4B34A 4GEKA 1R5OA 2VSFA 2X19A 3TDMA 4KQMA 2C1XA 4MGIR 3NB0A 1T5SA 2Q4BA 5EIBC 4AN0A 5JSUA 1E2MA 2AG6A 4K87A 1VIAA 2X5XA 4TYPA 1PT6A 4LZAA 2GBIA 3BN3A 3UMGA 2ZS8A 2A35A 3LHFA 3L0SA 3O92A 2PJDA 2C57A 3JCZA 2RONA 3MRXA 3IUNA 4RZQA 3DAOA 3K70D 1BKYA 3EN0A 4M7PA 3GLRA 5E3IA 5IUJC 1C4XA 2OCKA 1NI4A 2B5WA 3SF8B 1QHGA 3JRNA 4QDJA 3QNUA 1PFKA 2OOKA 4FE7A 1Z4IA 4MW6A 5JSFA 1EVEA 1U3TA 2A9PA 2X3FA 1QP7A 1NWCA 1XRRA 1KI6A 4M55A 3VPDA 1L5OA 2IIPA 3M1AA 3MTGA 4NEGA 1IBLB 3R9XA 1I3KA 1IRIA 5DO9A 1SCBA 1JPJA 3VUFA 2GM4A 4IVQA 1H9CA 3ASZA 4ARBA 1FUYB 1TJ4A 5LMUB 2NYRA 3LQYA 4M8KA 4Z53A 1C3OA 4JITA 4QL3A 2A5GA 3QBEA 4XFJA 5H68A 3GN2A 4MHOA 2H07A 4IDNA 1LC3A 2XX3A 2ZBDA 2XQVA 2H51A 4X62B 2B5VA 3ONEA 2GERA 1J8DA 4QNRA 2VNKA 4Y9RA 5K3FB 4R6WA 2AJTA 1M2HA 2X6QA 4IIFA 3PE4A 4FHDA 1UPXA 1X7ZB 4MVJP 3DBOB 4WACA 5CJPA 3IDOA 2EGGA 3DMRA 2PBFA 3CLTD 3FSGD 3KG2A 3KTFA 4KE6A 5ECYA 4OKIA 3CN9A 3CPEA 5ETJA 3F5QA 2PWBA 2BE7A 1CSEE 5A3VA 3HL4A 5B7NA 4ABTA 3OCVA 2NU7B 7REQA 5EZ5A 3I9JA 2R00C 1U3DA 2AGVA 4L0QA 3TNFA 3AWDA 1U2RA 1ISFA 2JB9A 3QLEA 1GSAA 4QUGA 4B3DA 3LNCA 1KZ1A 2SECE 4RIEA 5DM1A 4LFCB 3TEMA 1JG6A 5I01A 2BP7A 4L9RA 4TVKA 4IKOA 4B3CA 4Z4QA 1XD8A 5CT9A 3WDSA 4W5TA 1SZPA 2CZQA 1LCIA 1RPJA 1N6NA 3RUPA 5CYPA 3JZIA 4Q24A 3TNJA 3C3XA 5EWMB 3WGTA 4J0EA 1EYZA 1FTWA 4HNHA 2PBZA 5TPZA 4DQLA 5K8CA 4RTNA 4DJTA 3ND6A 2FJUA 1TA4A 1URPA 2W4MA 4FXPA 4MLCA 3R6WA 3MMSA 2VQ3A 3DLIA 4I0WB 4LMBA 5CW1A 1LBIA 3CWZA 2O9JA 5JXJA 3LL7A 2WNIA 3STUA 2QAIA 2EHJA 2BM1A 5T6MA 5J4KA 3ETHA 2Z8ZA 4YGYA 1XA3A 2RGEA 2QZ4A 1RPZA 3BILA 1ZN2A 3D59A 1M75A 3ZU6A 1HT3A 1ZRHA 4ZJPA 3JU3A 2XB6A 2UKDA 2ROQA 3I01A 1IZ8A 3EA4A 3CNQS 1JDPA 2PEZA 1GO2A 1W4ZA 4XIFA 2I54A 2WWTA 5E6UB 2AWOA 3PIDA 4AURA 1PGPA 2O8BA 3ABOB 4EZEA 1UUFA 2F00A 4ITUA 2GUWA 1U2PA 1ZR4A 4CCAA 3W90A 1YVDA 2X9NA 4ZI3A 2CWWA 3HSYA 4TOIA 4V1CB 1WTAA 2DX7A 5E6RA 4QQNA 4UHJA 4CRWB 2RHDA 3A9RA 2HIAA 1KDZA 4UOEA 1T3LA 1B2LA 1VCIA 2MR6A 4YASA 2NU6B 3GZTB 3IYLW 4P4SA 3TRJA 3F90A 2FEKA 5D85A 5EE1A 5FNVA 3GGSA 3SX2A 4CM6A 2X8LA 2H0AA 1D6NA 3A11A 3FCOA 4WBXC 3K71B 3THWA 3DS8A 3HCNA 1ZH2A 2DB3A 3GCZA 1RYYA 1PWEA 3HKCA 4O4HF 5DN9A 2EVWX 1JLLB 1T2DA 2R6FA 3IBCA 3E7XA 3R5TA 5J2TF 3U09A 3LDFA 1JR4A 2JFVA 2JDID 3KKEA 1TCVA 1Q0ZA 3RR2A 2WF9A 2IE8A 2YWJA 3EGCA 2J31A 1H9BA 1TX4B 3LVFO 4PO1A 1UJMA 2Q2OA 3S2FA 2CNLA 5H3CA 3U60B 4OUDB 4H7JA 1UBOS 4C4AA 1LPSA 1U1FA 4YCAA 2V1UA 1Z8HA 2H5LA 1QC5B 2XCUA 1P1RA 4Q16A 2Q6KA 4XM1A 2HA4A 2I34A 3R76A 5D51S 2NSLA 1MXFA 3FDJA 3CG0A 3CNLA 5THQA 3I12A 5FBZA 3TL3A 4WERA 3OCUA 4EQZA 4BV8A 1HG1A 1V5EA 1AUOA 2P3OA 1R12A 1Z08A 1HFEL 4KO4S 4ENSA 2AOTA 3CW2A 4CV0A 3G88A 3L8YA 3RIMA 3QXHA 4P34A 5LXTF 1JQLB 3FBTA 4BFTA 1Q7TA 1U2ZA 1S3IA 3KB2A 4XGNA 5LA6F 4M76B 4LW8A 3D7NA 3VKFA 1WD5A 2IK8A 1ECCA 3T06B 1EE2A 1VIMA 2GFQA 1X1DA 5GV8A 8ABPA 3LUAA 4KQFA 1U65A 2VBFA 4JBLA 2C4UA 4LA4A 1UXJA 4D9CA 2GZDA 2B4KA 4Z1MA 1DKRA 4MVWA 1NMEA 5LBTA 1YCFA 1E18A 2PZBA 2EKLA 1RI4A 2Y93A 4N12A 1L7EA 1GPBA 3HRKA 1YJAA 2NO7A 2XKJE 2LP4Y 3EF0A 2H63A 3RO7A 3WQQA 1WWKA 1CJUC 1HEUA 4CIWA 5AW1A 1TLFA 4KO2S 5LQJA 2AWNA 1LWNA 1RHRA 1GTG1 3HYNA 1ZL0A 4N48A 2E5FA 2VDOB 4Q6WA 5BV0A 2IXDA 3L0DA 4IDPA 2LUOA 5HZGA 1XFDA 3V8NA 4D4KA 1CJTC 4MQUA 1ISSA 1REQB 2YHBA 1U8UA 3CVXA 3G9ZA 2Q5HA 1L7QA 5A03A 3SQDA 1VL0A 3Q15C 4NULA 5D7NA 3V1TC 1OXXK 5JWRA 3L7YA 4QC2A 3L0BA 1ENZA 4QJ3A 2RAUA 1Q92A 3P26A 1PI3A 5DM2A 2JHAA 1YB7A 4P7BA 4DV0B 2BM9A 1ZWLA 2WBLC 3EVNA 3HSSA 2RH8A 3LL4A 1LF0A 3B7GA 4DR5B 4N5NA 3OFSA 5ENVA 3M4ZA 3ASYA 1S2DA 3CKLA 1DEOA 1TUGA 1NURA 3F6EX 3SC4A 1ZI9A 2IYPA 4KR0A 4AJOA 1G42A 3V3KA 1S2MA 2EDAA 2YVKA 2XAAA 4B3SB 3CG4A 1ZA2A 1DKMA 4DG9A 4N7MA 1CNMA 5F4BA 2EDCA 1T5HX 1GKLA 5FOSA 5C8VA 1ANKA 4C0BA 3VPHA 4GL2A 4FGJA 1A9XB 2WWRA 2ZWPA 1VMEA 2GPAA 3C70A 2JLYA 1NQWA 5G4KB 5TSDA 4BCDA 1X1EA 3EIOA 1W5EA 3I5XA 2OBXA 2QZZA 3EG5A 4PLCA 1U28C 4ZV7A 4QPNA 4MV0A 3V5NA 5I3ZA 3K1TA 2Q9UA 2R65A 4DV5B 2GPNA 1EGMB 1LTQA 3P2JA 4WZBA 1R4MA 1R8JA 2AI3A 4WFKA 5EFOA 4AYWA 2CF6A 1IB6A 3T9AA 3BK7A 2Q3DA 1UIMA 4EHBA 1QZ3A 2VTKA 1BKSB 1Q7RA 4YRSA 1JJBA 2VT6A 2WAMA 4X8HA 3S8EA 1NRJB 1M34A 1HSOA 4QXMA 5BQ5A 1IZ0A 2ZJ7A 1T3GA 5KBYA 5L6LB 4YAWA 3OZXA 1XP5A 2G67A 2XTZA 1OMOA 1PJAA 5F5LA 2OT3B 5DRYA 1OC2A 1T8SA 3RB8A 3A1SA 2ASEA 1Q19A 2JEOA 1JI3A 3SC3A 4RSHA 3KCQA 2C88A 1IOVA 4JDUA 1J6UA 5CA0A 1JHMA 1P1FA 1QGOA 2XUKA 1IDN1 3Q8KA 2I6GA 1I4OA 3QMMA 4JLUA 1B15A 4BNTA 2Q6LA 3THSA 5HQTA 2CFRA 3GRPA 2PT7A 4UBMA 4IH9A 4JWTA 3ZBQA 2YQZA 1BYIA 4EHDA 1AGNA 3PDJA 2C03A 3TBFA 1OV6A 1W5BA 3NM4A 4M49A 4Y6PA 2G9VA 3CPJB 4R83A 1SHZA 2D2FA 5D6NA 1F20A 3DPUA 4IS3A 1KAMA 1UP4A 2Q9CA 3ZBTA 1S9DA 3UXEA 3DUWA 1QTRA 1S1MA 3QJYA 2YV3A 3ZEAA 5K8IA 4DR1B 3PDCA 3R8FA 3LX4A 1Z8FA 3AUYA 2F17A 3IV9A 3NTLA 4JZYA 1QIEA 3PT5A 4EDFA 5JYDA 1XMJA 3PVZA 2YW9A 4J0GA 5A4IS 1EVLA 4JOSA 3FIUA 3PD1A 3P9YA 3WGVA 2NG1A 1SZJG 4FMDB 1JHZA 3SLGA 3WP0A 4KXNA 2NUTA 2XYPA 4RF4A 3BRQA 3WAJA 3A6HA 1FSFA 2J3HA 2HDWA 3NEAA 1W5TA 3QPBA 3T52A 4QYSA 4B45A 4D6PA 4DCCA 4ZMRA 5KNCA 5FEMA 3UB3A 1HE8B 2M32A 2VT7A 1SOVA 4NMLA 3MWGA 4BTLA 2CXOA 3IBYA 1ZUIA 4D5EA 5C7LO 1I1QB 2M98A 1KMNA 2JGRA 2P91A 1APBA 3FUUA 1EHCA 4W8OA 5HE9A 4XGRA 3RC2A 4C2BA 2X3UA 3T99A 3H4MA 3HB0A 5IDQA 2PAAA 1I0LA 1SUPA 2OG2A 4O4LF 4GMXA 2EZ9A 1MB4A 1HNWB 2ENUA 3FNEA 1S8AA 1RM3A 1RYNA 2MINA 3OY2A 4RK7A 3IP5A 1XAJA 4MQ6A 4BMZA 2P9JA 2N46A 3V42A 3NRCA 3CJTA 1YIDA 1WSAA 3AUFA 2X0JA 3PJDA 1VCHA 4P3PA 4RXMA 3UW3A 2ZCUA 2C07A 4ZYLA 3QEMA 1XVTA 1S1CA 4BUZA 3F4KA 4RSRA 1ZW6A 2ZQ5A 1RM0A 1HV8A 2QT9A 1YA6A 3LQFA 1EDOA 1KNXA 2ARKA 2J4FA 2VKTA 3KKKA 1OI4A 2UV8A 5FX2A 1BQ4A 1DG3A 1PJZA 5GOTA 1MX3A 2GBGA 2QX6A 5F77A 3LKDA 5AVYA 4BUCA 3I01M 3JX9A 3FDZB 4F2PA 1IM2A 2I76A 1CS4C 3UMJA 5AVWA 4P92A 5KSYA 4AYTA 2REQB 3C3KA 3DFFA 2PLRA 4JJZA 1Z39A 1QYVA 4IRUB 4IHQA 3T7DA 5J5VA 4BX3A 1BRTA 4KQJA 1NZFA 4P3NA 1SC1A 5FORA 5BP7A 2GLUA 1BIFA 1I1NA 2BZ0A 3INTA 4NESA 4OJNA 1EBUA 4R16A 2JJMA 1PZHA 2X1MA 2BHTA 3RTBA 4DQ0A 5ISMA 3UCEA 3OU7A 4LCBA 4Q1FA 5HBGA 3WYEA 4ZCLA 3HCDA 4DUGD 1KAQA 4P83A 3F97A 3S7TA 5BNZA 1FNMA 1TOAA 3Q72A 4FSHA 4H08A 1KJZA 3LC1O 1UEXC 1MX1A 2OAQ1 3BMQB 2WIDA 1XOIA 2DT8A 4HADA 3ZDYB 3ZXXA 5TMPA 4DSZA 2CVPA 2QJTA 1DPGA 4I4NA 1CP3A 2M2IA 4LTMA 1LBHA 1Y1KE 2JZOA 3NDBB 2V6FA 1EK2A 4M1MA 3BTOA 4FMPA 2IW1A 5CD9A 1Q44A 2VS1A 3AR4A 4HQFA 1Z4LA 3I0NA 1XMXA 1DADA 1UPUA 3MRTA 1ZH8A 1Z4PX 3PFWO 3ZUPA 1QO9A 1YS9A 3K15A 1RMQA 4UBKA 5KYWA 5ESXA 1I13A 4PAWA 1BA3A 2P41A 5FHQA 1H8ED 5CB4A 1OTHA 1PR5A 3ADCA 4CL2A 2P9CA 3UFXB 2JHGA 3A2NA 4AG6A 1RP1A 1RBYA 2CE2X 3W04A 2B9EA 4MIOA 2D59A 3MTBA 5FBRB 1U9ZA 3NT2A 2EXXA 4EM6A 2O2ZA 5H82A 4DKJA 4ZYUA 5CCDA 2X5KO 2ZIAA 4X8LA 2OHFA 3AVUA 2XH8A 4JP1A 3CGGA 3QFRA 2KM1A 5J5CA 3CX3A 4E33A 4MYHA 1LGYA 1KJJA 3IPRA 4YN3A 2YDYA 1UKBA 2N9UA 2VBIA 2YWGA 3BQ9A 3NTXA 4Q4CA 6GPBA 1E7WA 4Y1RA 1M7BA 1J06A 4KXWA 1YJBA 1WXWA 2G77B 2SHKA 4ZC1A 5E1OA 5DM60 2C2BA 5LOVA 3BFJA 5KSWB 4Z6KA 5T8KA 3LWZA 2GVDC 3FFBA 4UXHA 5KSPA 1PTJC 5IMBA 1M8GA 3TLBA 1A7UA 3FSRA 2Q4OA 3BSSA 3VM6A 2O59A 1QYRA 3RAEC 4QWMA 3S2IA 4IH1A 3RYHB 4OJKA 1H8HD 1F17A 2E4AA 5JNWA 4ETNA 5BV7A 2PFSA 2VAPA 3RW9A 4AUNA 2E18A 3HXKA 4HDNA 4KQEA 4P7JA 1QHEA 1XTPA 2XIQA 3U3RA 5JAZA 4KVFA 1JMKC 1T8YA 4JYBA 3W4KA 2JCVA 3KVVA 3S81A 4HH0A 4EARA 1YR1A 2ZI3A 5JZVA 4PRZA 2WKSA 2QSYA 5JSQA 2QRUA 5ERGB 1MJ5A 4KHZA 3L4BC 1PG2A 4C7JA 1QJCA 3H1PA 2OZVA 4LEIA 2VHJA 1EGHA 4I1YA 1XCPA 5IWAB 4ERXA 4ZKDA 4GPAA 2WFAA 4ZQCB 5DGCA 3SLKA 1OLXB 2CCKA 2K4MA 1CRWG 2HSEA 4ONEA 2LIVA 4MKHA 5ALIA 3G2NA 2EJUA 1DCKA 4S35A 3WYDA 4F7DA 3H97A 1XF1A 3K09C 1X0VA 3GLFE 1KP3A 1RM4A 3C5EA 1K89A 3S2EA 1MIHA 4EITA 1D0VA 1OX4A 1AKNA 1C3LA 1H4QA 1Z2NX 4IZIA 4W8GA 2W2VA 5IC4A 2HRQA 4JMPA 1EKXA 3PFIA 2XW6A 2H31A 2R3SA 1FTGA 3A9UA 2D2IA 4CKEA 4EVQA 4LF8B 4NENA 3VJRA 1FQOA 2V58A 4F9FA 1U0HC 3HB1A 2DR3A 3AR3A 2XE8A 4B6EA 4IIJF 4DLVA 4P08A 4JUCA 3ZE6A 5MN5A 2BBTA 4DYHA 2F64A 4I1UA 3WADA 3FTQA 1XA4A 5LYYA 3OJFA 4JLBA 3IP6A 4K46A 1YZYA 1ZU4A 4DC9A 4ZGWA 1M2FA 3K30A 3VRHA 1WZCA 3UWOA 4HGYA 3ZWBA 1EGQA 4HNSA 3SYMA 1ISMA 3A7DA 3SSNA 4B80A 5K0JA 5LWHA 1DX9A 4CV2A 1QB7A 3BF7A 2AH5A 3USZA 2XQGA 3AY7A 3WRYC 3FWKA 3GP5A 5EMHA 1U9CA 5JOQA 2P6NA 3D4LA 1W2HA 2A7XA 3KD2A 1DDGA 2FFAA 4XIGS 3ESAA 1BJRE 1WAMA 2GKOA 4QYIA 5JY6A 3ET5A 1YJ8A 4IMRA 1CUSA 1ETHA 5EZQA 3Q98A 3ZY2A 5AOVA 1P9LA 3PNPA 5EMNA 3S1SA 2EX4A 3BWXA 1CCWA 1E79A 4R68A 1JALA 2VTDA 1TQDA 3O0TA 3OF5A 2VRNA 4PWZA 4XQGA 1HQKA 2N1BA 3ZCVA 4PN3A 4RZ2A 3VR5H 1SKBA 4NH4A 3WKEA 3AHGA 3VI4B 1P7ZA 5AKHA 1JKIA 3ONWA 1G5QA 2QMZA 4RHCA 3PI6A 3KKQA 1SCIA 3K0AB 4HS4A 2PYDA 1T1GA 5L7YA 2ZJZA 1C50A 2XRMA 2X77A 3CNHA 4G84A 5KTTA 2J07A 3GLFB 3W5BA 2G71A 3NHAA 1AV7A 1PGQA 5D86A 2ZUSA 2ISSD 1DC8A 2ERCA 3ED5A 4JFRA 1U7PA 3V3TA 1Z5PA 5HDQA 1XZJA 1A71A 1I5EA 1TD9A 1FP6A 2CL7X 3IEKA 4N03A 4P4GA 2ZAYA 4CQLB 2EBHX 3V2HA 2XUIA 4P7FA 1T10A 1JSZA 4YROA 4LI3X 1Z6AA 3WS7A 3Q2IA 3FDFA 1GKIA 3IR5A 4HWSA 3RYFB 3HUUA 2WQ7A 1T9AA 1ZNZA 5D3KA 3VMFA 4PNPA 2HO5A 4R1SA 3PNVA 4QLOA 1O08A 2PS0A 1PL8A 4IL5A 4BO4A 2OBFA 2H6EA 4MR9B 5B6PA 3H5TA 4YP0A 2ZT6A 1NW4A 3P32A 2NGRA 4CUZA 4ADSG 3P9CA 1W4RA 5EIFA 2V9PA 3TTSA 2PZKA 2IOFA 4GYWA 3WGLA 3WGKA 3ZX5A 5B7QA 1MIOB 1SOUA 2CUTA 1OZAA 3FZEA 1WUJS 2RHMA 3E3MA 2YRWA 4WFJA 4CF6A 2AV6A 5B4VA 4P6VF 1GL6A 3UC5A 4QBKA 2B4AA 4B6QA 3AINA 3WLNA 3U6BA 3BOSA 5CDYA 5DNAA 1M6WA 5ITZB 1FJGB 4F6RA 3QG5A 2OO7A 2PS9A 4AKSA 4EMTA 3T3NA 1KGSA 5B7PA 1RJEA 3BXFA 3OCWA 2VF7A 1YRAA 3IDQA 521PA 2HDOA 4LJKA 3VZBA 3W06A 3CX8A 5KX5B 1O96B 2NVUB 2BFFA 4UHEA 2DSNA 1N8TA 1H3EA 1GZ4A 2HA2A 1IBRA 3EFOA 3VSAA 4YIHA 1X14A 1KJQA 5IK2D 5GZ6A 4URFA 1Z5NA 2G1UA 3AHDA 1UFKA 3NV9A 2CJPA 3H9EO 3I0ZA 3MK31 4TLCA 3UQYS 4ASUA 1NBIA 3PFNA 5JEDA 4YRRA 4JC0A 3OQBA 3EZYA 4L5CA 2XT9A 1MRSA 1DG1G 3A28A 3KXIA 4S1VA 2V7EA 4V02A 3JQGA 2IPXA 3ESQA 5K3OA 1X1AA 3B1JA 4B82A 1QZUA 5AW4A 3MUFA 4GVPA 1MRZA 2EGUA 3B6ZA 1JVSA 3DEKA 3I28A 3OLZA 4B3XA 5MGNA 3N76A 2JLVA 1AZSC 2IKSA 1P9OA 1NI3A 4RVNA 5K2MA 4P98A 1AA6A 4JYZA 3MCVA 2SCUA 1A5AB 1E5LA 1QP8A 1C8BA 3OJCA 4JEIA 2IBTA 4KQ9A 3HGMA 1HR0B 2A5YB 2AR7A 3HA7A 4EEZA 3DTYA 4JYPA 4U6QA 4JP8A 3SWWA 1ZIYA 3VDNB 2IVFA 4J0IA 2FTKE 4LBVA 2FFHA 1ZGHA 2AFIE 3ONNA 4LZPA 1TIKA 1RXUA 3MN1A 2WI8A 3CRQA 4NJMB 1QCDA 1XDBA 7ABPA 2DUUA 3DE7X 5EJ9A 4MA0A 1GQRA 4MO2A 4OGLA 2H3EA 4DARA 1D9XA 2FLKA 4OX9Y 3R3UA 3UEOA 2H2WA 3QHAA 1ENPA 4RHFA 1P2TA 3CIOA 1DIRA 3IT3A 7AT1A 3FRIA 1KHTA 2BZGA 3A1FA 3CNEA 3UK7A 1OOEA 2R7LA 3RV3A 5MN4A 3ASUA 3CSDA 1A5ZA 5ALEA 3ZGYA 2EERA 4HEQA 4J2HA 2XB9A 2VT2A 4L3WA 4ARCA 2WIBA 1ABBA 4PFJA 3W05A 1XV5A 3WB2A 5TPWB 1IN1A 2ZRNA 1OVMA 2FE4A 4QUJA 3QQPA 4WCDA 5JYBA 2IOYA 1CQIB 2CJYA 2O7QA 2NQ8A 2VVTA 5JSYA 3MPUA 2YNMD 3CUUA 5BN5B 4J16C 3LBYA 3TQSA 5JAUA 4W9RA 3KKOA 5DNYB 4G0QA 2PMBA 3D6HA 4XWWA 2UXBB 5AOAA 3IJEB 4CKWA 3EDCA 3HKEA 4DRXA 2WWFA 4B2LA 2VRCA 3VO2A 2Y76A 2NT3A 2E48A 3C3YA 2CLMB 2IXTA 1EUCB 2ZB4A 3LPNA 4PX2A 4ZAGA 1TUBB 1WTCA 3EIUA 3L6RA 3Q2OA 2E3JA 2O7NA 3FOFC 2FPGA 3AEQA 1E89A 3KBBA 3L82B 3OIFA 4JK3A 4UUAA 5L7WA 5K3SA 1ULSA 3L0CA 4W5HA 3M4YA 2PGAA 1DSSG 3AG5A 5DVZA 4FSXA 4RSMA 3ZNNA 3FCYA 2WHEA 1CY2A 4I66A 1BOFA 2QJWA 1AD2A 4LBWA 3GJ8A 1I94B 2O2GA 4K2AA 5JECA 1H42A 3M4NA 4CW7A 2IXAA 2GN6A 3GAMA 4MV8A 3IQZA 2Q5FA 1HLFA 2FXIA 1KC1A 5EUMA 3LPAA 1XFAA 2FWMX 4Q7QA 1KI2A 2J46A 2JEYA 2HCJB 3MIZA 5C0OE 3C3CA 5E2AA 4JFAA 3X1KA 4LDNA 1SBTA 1AQLA 2JFYA 1WHTB 3DWFA 4DA9A 3EVGA 1A2OA 5KYYA 1VLJA 4D5GA 4X8OA 4I1RA 5C34B 3BUSA 4XUGB 1ZI8A 2JBWA 2WM8A 4C01A 2QAGC 2BHLA 3TTTA 4KYUA 1TE2A 3VOBA 1FUEA 2Q4DA 4MQEA 3CR7A 4EG1A 2RKWA 3RU9A 2QD1A 1G1MA 5AJYA 4DSNA 2KLBA 4CV1A 2OXRA 2ZAIA 4CZ2A 3R6TA 5B1EA 1UT5A 1CJBA 2POCA 2R6CA 1W88B 4QELA 2X8AA 2XUGA 4ED9A 4MGHA 1G4UR 1QVAA 2H9AA 3O47A 3EXG2 4MP8A 3DUFB 5GONF 4IQ8A 4A0SA 2WNHA 2IUEA 3AJEA 3G7NA 5KEIA 3PENA 1HNZB 5ES3A 1E3QA 2XMRA 4V0SA 2GM5A 2LKCA 3EXEB 1ECBA 3HUTA 3NI2A 1AMNA 2BJWA 1JX6A 1H3FA 2GM3A 3I04A 4IUCS 1C5KA 4TL6A 3WGZA 5KB3A 4JUFA 3VKUA 4F2GA 3OX2A 3JYNA 3V8PA 2ONCA 2ZYTX 3O8NA 1E7RA 2MSDB 1L3IA 3RFVA 5JZOA 4QHTA 4MDFA 1TQ2A 5I9SA 4Z4GA 1MC5A 4F9EA 4JNKA 1JJ7A 1ZRNA 1GPLA 3ZR4B 1G4HA 1OWLA 2FJ0A 2I2FA 3L0PA 1VJ0A 1WPRA 3L7DA 2CLFB 4YT5A 5JAHA 2Z2IA 4R1PA 1D1SA 3PJGA 5FBKA 2HLPA 3OQMA 3LLVA 5BSMA 4GT1A 4L02A 1T9HA 2OBLA 5EXEA 3U1VA 1IJKA 4D4IA 5DIZA 1DJOA 5AJVB 1W6RA 1T6ZA 1JDNA 2IL1A 2ZBUA 4FX2A 4INZA 3RAFC 2VATA 4NDAA 3PQ5A 1Q2UA 3D6AA 1DX6A 2VBCA 4TM7A 1OFHA 3UMSA 4TS4A 2C4TA 3I8OA 3ZI4A 4D6XA 2HF7A 1WB5A 2BLLA 1ZICA 2OHXA 1OASA 3PUHA 2X76A 1A9RA 4LVOA 4LF7B 2WMDA 4YDSA 1W30A 3UWMA 2D74A 4GP9A 2C3YA 3E1GA 1IHYA 2VUUA 5B5SA 1XJWA 1CZHA 5M34A 2Q0HA 1UDCA 1DMRA 2P77A 1NI4B 3F9CA 3I45A 4PQGA 2F43A 2G5PA 4MCHA 3DPSA 1SUIA 3L3BA 4Y2PA 3S2ZA 3ZVNA 1TK2A 4RKWA 4D45A 4FJ1A 1J99A 2I6TA 1NRXA 4IJQA 1NATA 3ROTA 1ML3A 1KI6B 2WU8A 4Q1EA 1E0DA 4RANA 4YP5A 3R9KA 3SSAA 3AGPA 3R9XB 2FOLA 4BQOA 2RHOA 3LO8A 4EI9A 2WSYB 1A9YA 3ANTA 3UV6A 1WPXA 2FX5A 3TAUA 3BYZA 4FYHA 5JY1A 1WE2A 1Y8CA 1DQNA 4YV7A 1TA9A 1QSGA 1DT3A 2EWWA 5JNUA 2QNIA 2YW2A 3PC8A 3IDFA 3BG5A 3U4GA 3R5HA 2PRZA 3OX1A 5AW3A 3E1SA 2ILTA 1DIOB 2VFAA 2H9IA 2XZTA 3VO9A 4YUWA 4CHTA 1SXQA 3QOWA 2GM9A 3PB3A 1KPHA 3D64A 5CLLA 1RKBA 4IR7A 4YCMA 3DE0X 4C6RA 1SKMA 4A8JC 3EDMA 2EP7A 3D1VA 3LK7A 1JIXA 1N5JA 7REQB 3LYAA 2ID7A 3MBKA 3P4UA 3PC4A 2QU8A 3GGDA 1L3BA 4C0HA 5B57C 1O6BA 1QHNA 1NBAA 1T9BA 1V2HE 4YMWA 3STHA 1A9ZA 4IFEA 3CX7A 3FB1A 2BP7B 4LDZA 1J42A 2ZIFA 3OQHA 3PE3A 3SBDA 4C21A 2BF4A 1NVBA 2ZOSA 1NUAA 2HRRA 3IPLA 3Q3EA 4TS9A 3C8DA 4DXHA 2H29A 3H2ZA 1X42A 1M1NA 3PNQA 4ZO6A 1EX9A 1RADA 3VOSA 4R0NA 1KBQA 2ZI5A 3BMNA 3STTA 5IDXA 4B4WA 2UUAB 1BMQA 4PTLA 5IU6A 2NXEA 2B34A 2HU8A 5CTAA 1C3EA 3IO5A 3EGOA 1VGRA 3C3WA 2JI7A 3COVA 4AQYB 3KEOA 4LVCA 4OXNA 4UM8B 2NYVA 2IZOA 5F1OA 4CBVA 3BJEA 1NMZA 3VR6H 4AJ4A 3IDZA 2I4LA 4FC7A 3QVTA 5LJIA 2P2DA 3BD6A 2FSUA 4NPAA 3R5KA 1GQYA 1MDFA 1RJ9A 1LX7A 2ZBPA 4UC0A 5BRNA 2RB5A 4AFNA 1YR2A 4OOEA 5JRZA 2P1RA 5LQDA 3V2IA 2GMWA 4ZGBA 3JAKA 2QVGA 3RRJA 4WK4B 1UK8A 3VA7A 1UBFA 2GN4A 2JH3A 3LT4A 3OLVA 3OUZA 1UZAA 4FFMA 1MZVA 4GG1A 2O8BB 1XHLA 2O8EA 4JJ7A 1BMDA 5IYZF 5CB0A 3BFVA 4B4KA 5CUQA 3GRCA 1IHXA 1BWQA 4DDWA 3K05A 1C14A 3WLMA 4ZQGA 5LU8A 5LDDC 2CT8A 3DDZX 1FTQA 2Q6OA 5E6RB 4YO7A 2BHSA 4AROA 4E5UA 5IJWA 3T4XA 3WYNA 1M6YA 5BYJA 1ESZA 2COKA 1QIMA 3LQRA 4JIMA 5CX4A 5E7JA 4G1MB 3F96A 4P4SB 5FNVB 4HATA 1BD4A 3H5RA 3FOWA 4KIUA 1R9GA 1KZ6A 4NBLA 4C0KA 4DPKA 3MGGA 4IKPA 4RLFA 1WMAA 4KEAA 2PXCA 1L9XA 3LUHA 3K6RA 4G37A 4HQ0A 4Q4DA 3CM0A 4CV3A 3GRAA 3HKCB 3K35A 3IBGA 1BQ3A 3TCXB 1I10A 1SBCA 2GPYA 3PNMA 5C1PA 2ECQA 421PA 2QUZA 2D8MA 4M99A 3UQZA 1JSXA 3AILA 1Z35A 1N0HA 4NRDA 4KQXA 3HHEA 4S0XA 4C7VA 2ETVA 3WHKA 4UFPA 1E0SA 4ML3A 1T0HB 3ZLBA 1SFRA 1JFLA 1FDRA 2WVGA 4IIYA 3SIWA 2C7VA 5CH3A 1MPXA 2W2QA 4DCUA 1CZOA 1TT5A 4CKCA 2Q1WA 3DWIA 4WRRA 2HU2A 3DDHA 1P4GA 1BN7A 2NWQA 4EABA 4Z5XA 5F9HA 1T8PA 1FNDA 2V7WA 4PANA 1Q11A 2BFEA 1E2QA 2GJ9A 1JTFA 3VR3A 4FB5A 2AT1A 2Q1XA 4LX8A 4DF3A 1LX6A 1WW8A 1EFDN 4GEG