1J99A

Crystal structure of human dehydroepiandrosterone sulfotransferase in complex with substrate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFLKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKTQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ALCOHOL SULFOTRANSFERASE
publication title Crystal structure of human dehydroepiandrosterone sulphotransferase in complex with substrate.
pubmed rcsb
source organism Homo sapiens
total genus 94
structure length 284
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2001-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j99A00
2JASA 2JIZD 3M1IA 4PFSA 3CRRA 4YXWA 4TYNA 1Z08A 1HT2E 1W4AA 5H68A 1FW6A 1ZC4A 1E6CA 3OIUA 1DG3A 2CHVA 1JB1A 5CYPA 4PAOA 3ZS9A 1NL3A 1E2JA 5IK2A 1VCMA 2ZQ5A 3P4YA 1XFAA 1Z6AA 3K0AB 4TTRA 3KKNA 4MKFA 2ATVA 1T9HA 4C0QC 4M53A 2P6NA 4MYTA 2MSEB 3GJ5A 3OHMA 2H16A 5KYKA 2N1BA 3SYLA 4PHFA 5K8TA 3G5UA 1KY2A 3RRZA 2E1RA 4G5QA 4Q4HB 4JVSB 4QBIA 4RVCA 2XNDD 1GM5A 1RIFA 2Q9CA 1T3LA 2FPKA 4TMKA 3R8CA 2BEJA 4WZBE 4D2IA 2ZE6A 4Q9IA 3GLFA 3QF4B 3T12A 1OKKD 4JLDA 3ZGXA 2QL6A 4DVGA 3G0HA 1TL7C 1P3JA 3B1WA 3AGQA 2OXRA 3HU2A 1S9HA 2DHRA 5D3MB 2FWRA 3P20A 2RHDA 3RNLA 4PZZA 3R7WB 4YXWD 2GNOA 1KDRA 4Q1BA 2C03A 2EWVA 2REBA 4M1KA 2FPMA 1NLFA 1UM8A 1VHLA 4CDGA 3BWDD 1XB2A 3EZFA 3ZQJA 1X1SA 2CBZA 3CRQA 1TADA 1K6MA 3FDIA 5IK2D 3DM9B 2XZOA 4PR0A 3RS0A 3U3OA 1MO5A 3UANA 1CBUA 2ZSAA 3ADKA 3LLMA 4XOIA 3NXSA 2HT6A 5KSOA 1KO1A 5AWFC 1O87A 1S3SA 4PQYA 3ZD7A 1G6OA 3IQWA 4IXNA 3B8HA 4BFYA 4XWAA 3KB1A 2OT3B 3AF4A 1OJLA 2NZ8A 4TL8A 3KQHA 2YHSA 2ZJZA 1OT3A 4PC7A 3EZ7A 1Q3HA 4CEJB 1KMQA 4IHQA 1MO6A 3F5FA 4L5BA 5FTMA 1D5CA 1EGAA 1VG1A 3A58B 4TMWA 4N1AA 1GTVA 2VTKA 4LC1A 2RHMA 2IK8A 2NZJA 2XJ9A 2VPPA 1KO4A 2O8EB 1T0HB 3C15C 3K9LA 3A1SA 3Q7PA 4KFTA 3NVAA 1GIAA 3NEYA 3TUZC 1G16A 2DCUA 3LLUA 3NBXX 1SZPA 3BS4A 2VYFA 2JLSA 3GFPA 1HH4A 1JI0A 3DHWC 3NH6A 4UKDA 4A9AA 3QKSA 2OAP1 3LBIA 1E2NA 1G8GA 4A8JA 1Z06A 2PLFA 4AD8A 3QBVA 1IJFA 3BIFA 1E94E 2ZVQX 5DH9A 1YRAA 2WAYA 1PLJA 4KU4A 3ZVNA 4L15A 2Y8EA 4HAYA 2OXCA 4R71A 1KI9A 2CL0X 2WPDA 1TEVA 1T4GA 2ONKA 3AGPA 3PITA 4FINA 2FZLA 2ZJAA 5FBQB 2V54A 1UAAA 1XXHA 2PEYA 3NBYC 5DLQC 2FJUA 4WZAE 1E1QD 2GEDA 5AJZA 4Q4JA 4DLXA 3ZH9B 5JRZA 4GFDA 3QPUA 3VMFA 1L8QA 3MJHA 5JS7A 1X6VA 1J99A 2YVUA 1JALA 1ESNA 1QVAA 1ZNXA 2BOVA 2VIIA 3ZDQA 4D81A 4HDOB 1KDOA 1MABB 1OFHA 2ZRDA 2OFWA 3TR0A 1N6HA 1N5KA 1XTSA 2B8TA 3CH5A 2WWYA 3B60A 1UBEA 3ZS8A 4HAZA 3BK7A 5GVSA 4DCNA 1SXJC 3FHCB 4PSKA 3B82A 3RLFA 1VYUA 4A2QA 3AVTA 1NMXA 2C77A 2FSIA 2FN4A 3OAAD 4NCNA 2GXSA 1KJZA 1NMYA 2QE7D 3U60B 1Q57A 2ZRFA 1OXSC 3BFKA 1KDPA 4EPXA 4UXIA 4Q66C 3UG6A 4D82A 4IFBA 3H0KA 4PAQA 4PTLA 4MKHA 3CNNA 1RE0A 3AVYA 1XMVA 1B23P 1NSFA 3U3MA 1M1YE 2WPDD 1E2DA 3AEZA 1DAHA 4D4MA 1Q44A 4KITB 3QE0A 1I4DD 3LVRE 5P21A 3RSLA 3TSOA 1GL6A 1DAIA 2WOOA 3GD7A 3VU9B 4B47A 2BHRA 2NTYC 4M9SA 1FMLA 3BXZA 2J7PA 3CRMA 3H4MA 4ARZA 4FW9A 3EPLA 3GLIE 3IPXA 3T06B 2A5YB 1E9SA 3RRYA 2G88A 2I1VB 3TH5A 1CR0A 4EPYA 1TU4A 4QJ3A 4OQNA 4NYIQ 4PO8A 5KDLA 4BLSA 3QPVA 2FV8A 2GCOA 3ZJYA 3FHOA 4JLPA 3K0CA 2JA1A 3C5HA 4N0DA 1PUIA 1NVUQ 1VPLA 1XZQA 2OBMA 2WWFA 3AB3A 4KI0A 4QJ4A 5JCZA 4MUBA 5HCIA 4QGAA 1P9WA 1KYIA 3SHWA 4EUNA 3CIOA 1GKUB 5K8LA 1X3SA 1YRBA 3PUYA 1CLUA 1GL7A 3A1TA 1YZUA 4Q19A 3GLHB 4LJYA 3CW2A 4HB2A 1L7VC 1RYFA 5G41A 5KSYA 4Q9KA 2F1HA 2QT1A 2ZS7A 4US0R 2GEUA 4DB4A 3I62A 3O8DA 3SBEA 4NZYA 4B3DA 2HF9A 2KE5A 5FOXA 5KDDA 5EE5B 3AVXA 3ICQB 3AKYA 4ACBA 4XIGS 2BWJA 4UJ3A 2OCYC 3KUCA 2C04A 2IL1A 1UEJA 1Z6XA 1LS6A 2RGBA 2AL7A 1VECA 1G8FA 2GJ8A 2OZEA 3ND8A 3VX3A 4BFTA 1RRCA 2ZAMA 2J7PD 1OLOA 4G0NA 5DNYB 1W36D 4AKHA 1IOZA 3BB3A 3L82B 1XD9A 3VHLB 3EA0A 4DLUA 1PUJA 3NBFA 1VCNA 5GJWC 1UBFA 1N25A 1T6NA 1ZU5A 1X8JA 4HI0E 1VTKA 2Z5FA 3U7EB 1GRQA 1WQ1R 2ZYWX 2VRWA 4GP6A 4ITRC 3A4LA 1ZINA 5CIQA 4NKRA 1FMJA 2IXFA 4AYTA 3GLGA 3X1DA 5HE8A 2OHFA 2LKCA 4LY6A 3K0FA 3M6AA 4IEEA 1XP8A 3EG5A 5JJKA 2ZE5A 4OQMA 3LXXA 1JR3A 4RKFA 2PJRA 2BMJA 3IHWA 4JSTA 5JFGA 3RWOA 2R44A 2ZYVX 1VCOA 1SVOA 3H86A 3NEJA 4MRPA 4NHOA 4ESVA 4S35A 4EAQA 1AS3A 5KPJA 4C0JA 1E9AA 3DZ8A 1ZAKA 2DBYA 5HZHA 5B2ZA 1IY1A 2NO1A 3K09C 3LW7A 4MRRA 1R0XA 5HPYB 4AWXA 2J0SA 1LNZA 5FR1A 3TRFA 3CKLA 3LW8A 2KB0A 1XWIA 4V0MA 4UNRA 2ZRAA 4TLCA 5AUQA 2GBLA 5KUTA 1CU1A 1V43A 1E0AA 1MV5A 2RH5A 3PG5A 4I1SA 3OFNA 2IUTA 5JHHB 3M4YA 1D2EA 3WHLA 1G9XA 1KSJA 1NP6A 3D7MA 2C9YA 4IEIA 4RCYA 2QMHA 3BERA 3C5CA 1Z0JA 4JVMA 3ZD6A 2PX3A 1P5ZB 1XTKA 2YWFA 2G3YA 3UMFA 2PCLA 4AY2A 4UNPA 3QOFA 4M8NE 4PAMA 4XSHA 1G291 2BM1A 3AP3A 4HATA 3K9HA 5JMTA 1NBME 4NCKA 3S1AA 1IQPA 4GOXA 3EIHA 2D4HA 3EC1A 3QXHA 5DN6A 4DLSA 1JR3D 3FGNA 2AK2A 1GOTA 3NKVA 1NVXQ 4GSYA 1DELA 4HZUB 5TV2A 4FN5A 1TAGA 2QQ0A 2ZRHA 4OI4A 3C7KA 4LJ5A 1G20E 1QRAA 2H7VA 4QBHA 4K81B 4A2PA 2JLXA 4AIIA 4QGFA 2Z0MA 1P2SA 1ZIOA 1J8YF 3L0IB 4FMCB 4XTCS 5A0FA 1T5IA 1QHHA 1W4BA 1NBMD 2G1KA 2VF7A 4M1WA 1KI8A 2F43A 2H8KA 2ZAOA 4IDQA 4MYHA 4AK9A 4URYR 2CLCX 4WVFA 2OG2A 3QXJA 1XJQA 2NO6A 4PPQA 1QHIA 1SKYE 1QZXA 3R9WA 8OHMA 1MRSA 5EUMA 4C3ZA 1E99A 2J9RA 3AKCA 3TUIC 4GOJA 3W9YA 2B7CA 3F3YA 3MCAA 4IDPA 4W9MC 4X8HA 3GEEA 1Z63A 2DFNA 5FUXA 2QORA 4Q1AA 2FFQA 2RGCA 1QDEA 2HXSA 4F91B 1W46A 1W4RA 4AC9A 4WW0A 4DEXA 3KXKA 5DISB 1KK0A 4G01B 1GZSA 4US2R 4NCHA 2WHXA 4Q48A 5KU1A 1Z83A 1ZD1A 3X1WA 4Z1MA 3QKSB 4URZR 2RGAA 2W6IA 2WWWA 3IDQA 2WM9B 4A8JB 5DN6D 2WAXA 3RYTC 3X1XA 1XRJA 1FUUA 1U0JA 2AD1A 4LI0A 4A0RA 4XVUA 2ZJBA 3QKTA 4R2IA 3GCGA 3IPYA 4A1FA 4PPGA 5JJIA 3DZDA 4HLUC 4F38A 1VG0B 1SVKA 4OKSA 2CEAA 1E9FA 1JPJA 2ZPTX 2FDCA 3HR7A 2J0VA 2XTZA 2VBCA 2G0NA 2UVQA 3MUFA 3CR8A 4PSVA 4US1R 3PUZA 4DCVA 4KV9A 4Q4JB 2EWWA 3CX6A 3BE4A 4LJ4A 2FA9A 3BD9A 4U5XA 3KQLA 2ZRJA 4IVPA 2B21A 1QVRA 3VAAA 1Q21A 1BMFA 3CZQA 1E2KA 2WSMA 1MOZA 3C41J 5HE9A 2GJAA 3UWOA 4B34A 4DDWA 4R2HA 4F4JA 1LV7A 2GJKA 1NN5A 2H5EA 4Z1MD 4IDOA 2W6ID 1QHYA 3EPKA 3WNCA 1UFQA 4PZLA 1UDXA 4JBYA 3Q5DA 1UPTA 2KJQA 3UXMA 2P6UA 2PX0A 5CJ2A 5FH9A 4J0QA 4WXPA 2J5XA 3CRVA 4Q7LA 5CLQA 1M8PA 4LHVA 4PC2A 1G4UR 4CIDA 3MMPA 4KSBA 2R6FA 4BEJA 3CONA 5DHAA 1WBBA 5HR5A 2GETA 3HWSA 4ZIRA 1G7RA 2WWXA 2HF8A 4B2IA 4LJ6A 1W36B 4DDVA 4ARZB 721PA 1E0JA 4NH0A 2CK3D 3OF5A 4UXHA 3CLVA 1R5OA 4TMXA 4PXAA 4K8OA 2C96A 2QPAA 1AQYA 1JJVA 3Q85A 1NNEA 2WTUA 4AKIA 1BMFD 1X86B 2BVNA 5JEDA 2JLQA 1KAGA 3VR6A 1P2UA 2GCOB 3GFOA 4DJTA 3SI7A 4F4IA 3I5YA 5TXGA 4Q1DA 4D0NA 1A2BA 1OH5A 5FL3A 1X1RA 2CCJA 1JXMA 2ZI7A 3SJAA 1M74A 2CDNA 2F7SA 4IOKA 3P32A 5CK4A 5J4LA 4ZDIA 1JJ7A 2ZVPX 5DIFA 4WZ6A 2IYRA 4OK3A 1E2MA 4LJ9A 3E1SA 4CEHB 2W58A 5FUVA 1OF1A 3GJ3A 4HAXA 1WE2A 4C0HA 1ZUNB 2JLVA 1OE0A 4M22A 4WA7A 1HEIA 1KOFA 1ZD8A 2FSGA 2VP4A 2GVZC 5E95A 3QXCA 5UKDA 1CXZA 3QKUA 5G53C 2Z43A 2IYSA 4E03A 1QG4A 2GKSA 1P7CA 2UZIR 4NYMQ 3CPJB 4IXMA 2ONJA 2F1IA 3WP1B 1KI6A 4DCTA 3RRNA 5H8WA 3Q8XB 4I1VA 2ODEA 4Q18A 5A4JA 2ORWA 2BBTA 1F6BA 2OM2A 3JVVA 3MRSA 4OHYA 2DWPA 2R6CA 3Q72A 3WRYC 1R0ZA 3EWAA 2WOJA 3NH9A 3OIWA 3QUSA 2DY1A 4JLMA 3TQFA 4DLWA 5EP2A 4X8LA 1RRGA 2YV5A 3PUXA 4Q9LA 4IVRA 3GLGB 1ZM9A 1P9RA 2IA5A 2CL7X 3K0FB 4LHWA 4BWYA 4MDEA 3MG9A 3U3JA 2VL7A 1Q1EA 1S4QA 4LBYA 4QHYA 1Q3TA 3W90A 2FF7A 3O47A 1TTTA 4PZYA 5LD2C 3F8TA 4KSCA 1CJMA 5EJEA 1F48A 5EXXA 1N6KA 2QY9A 1GRNA 2V7QA 1CJTC 1JECA 2V6JA 3FYHA 1U8ZA 2VLIA 1OB5A 5IF9A 2D2FA 4B43A 4EFMA 1G8YA 1E0SA 1MKYA 1IXSB 3HDTA 3CB4A 4KLZA 2C5LA 2GXQA 3D31A 3H84A 3LV8A 3B9PA 3W6OA 4DIDA 3PEVA 2XZLA 1EESA 4V0OA 1KZ7B 3WBJA 3U7GA 5DI3A 1CULC 3F0TA 1OH7A 1OIWA 1YR7A 5E4FA 1LVGA 3TR5A 2IXGA 1BKDR 1C9KA 2D2EA 3VR5A 2HUPA 1ZM2A 4CF7A 1MO3A 3R9XA 2ZRGA 2ZR9A 3GMTA 4IOMA 5EE1A 5F2EA 2BKUA 5KSPA 3RS4A 3E2IA 4LYHA 4JMPA 3L43A 3TSZA 4TLDA 3S1AB 1M7BA 1DOAA 2ZRNA 3JVUA 5FI1B 4IW3B 4L8GA 1TF5A 3IGFA 4L4UA 3U5ZB 3EARA 3KJGA 4MITA 1BS1A 1TX4B 1U94A 1ZJ6A 2CHGA 3LQQA 1NLYA 4TYPA 5JI2E 1SVLA 1T3SA 1TEXA 4LHXA 4EJSC 2ZJ5A 1UKYA 3IIKA 3CPHA 5FTKA 2V7QD 3SYNA 2V6IA 1DG1G 2IYVA 2GF0A 1R4AA 1OXXK 2YWGA 3SN6A 1N5JA 1AA9A 1M7HA 1QHHB 2X1VA 4TL7A 2F43B 2FFBA 4DSUA 2D3WA 5DE3A 1G3MA 2V1XA 2W83A 4EPTA 4ZDKA 5JWOA 3AF2A 2CNWA 4OI0A 1F2TA 3GLHE 2QTFA 4JBWA 1SXJA 4G5OA 2OLJA 1ZCAA 5DYGA 2PZEA 4C2TA 2EVWX 121PA 2IEZA 1KI4A 2X77A 5KO2A 2KI5A 4Q9JA 1JQLB 3AVVA 3Q5EA 1TF2A 3GJXC 3IIMA 2HEIA 3E5HA 1Z6TA 4JYBA 3VKGA 2ZREA 4WXRA 1XTJA 4FD2A 3SJBA 3TBKA 2F1JA 1W1WA 5CLLA 1RC8A 1EFCA 3UATA 2R2AA 3ZYCA 1OYWA 1XEWY 5DHFA 5K8IA 1AGPA 4CT5A 3LNCA 1JBKA 3LX5A 2BKEA 3MFYA 4TMZA 1VG9B 3BORA 3B7GA 4UNSA 1E9CA 3A36A 1W0KA 4D26A 5FPKA 1Z0IA 2W2VA 2WJYA 4MYCA 2FGKA 2VO1A 4GDFA 1S8FA 1P2VA 1YJ5A 1HTWA 1OIVA 5BXQC 4A2WA 3WBKA 4F93B 3REFA 3K0SA 2YOHA 4BFVA 3TVTA 4DT1A 5L8VA 3KUDA 2WBLC 2CNWD 3QVUA 2VSOA 4JJKA 2QTVB 2PLRA 4F7WA 1SXJD 3P26A 3CRW1 4P4SA 3EPHA 5JZVA 2QPOA 1SHKA 1VYTA 3UMSA 5EXSA 4ESHA 3U44A 2QP3A 2JGNA 1U0LA 1VG8A 2C95A 4QBGB 4WAUA 1RFLA 3KFVA 4M9XA 3WMFA 1W5TA 1DO0A 4NPHA 2Z83A 5LPNA 4HLQB 4JT4A 4OK6A 4G5SA 4NMMA 3IBYA 1XJ0A 4D0LB 1E9BA 3LQRA 1RVDA 3V00A 3BGWA 2N46A 3AVUA 4FWIB 1A2KC 1ZM7A 4YMWA 2C78A 1Z2CA 1F5NA 4NYIR 2PEZA 1W0KD 3AVWA 1N6NA 3QXSA 2VHTA 4OK5A 1N6RA 2P0EA 1OHHA 1TQ4A 4XVQA 1SVMA 4AYXA 4TLAA 5HKKA 2G0TA 3A6PC 1XD2A 3CH4B 4ZIRB 4M0LA 2CHQA 4PHGA 1R8QA 3HPRA 5LB4A 2RGXA 2CMKA 521PA 3U2QA 2V4ZA 4TZ6A 1YR8A 4DDUA 4FXPA 4HAUA 1GRRA 3D3QA 2AXPA 3KXLA 4PHHA 1CRPA 1IBRA 1W5SA 1XMSA 4DSTA 3RC8A 3K09A 1XDBA 1L2TA 3CNLA 1FPMA 4ZCLA 3BFXA 2VA8A 5FTJA 1Q1QA 1U98A 1N6IA 3WMEA 4R7ZA 4C7OA 1Y63A 3DL0A 3H1TA 1NLZA 3HPQA 2WV9A 2BBSA 3OIVA 1F3OA 2E9SA 1DBSA 4A0FA 3EZ6A 4TT3A 3TLXA 4EQ6A 4O0MA 4OJKA 3ZLJA 4DEYA 3L8YA 2XTMA 2H57A 4OL0A 2RGGA 4RFVA 3THXA 2Z4RA 2EYQA 4LJ8A 5J40A 5J47A 1OHHD 3A1VA 1O3YA 5HKKD 2VHCA 3T1VA 1YZTA 1ANKA 3GQBA 1TQDA 5FOTA 5BN5A 2YC4C 1KI6B 2OLKA 1OH6A 1XPUA 1XMJA 1Z0FA 2IUUA 3AVQA 2PBRA 3B1VA 1N2CE 2V8OA 5LDDC 4UJ5A 1KI3A 2GXUA 1E3MA 1W2HA 3DM5A 4Q1CA 3VNVA 1P60A 3PUWA 3LWNA 4LOAA 2FG5A 1VIYA 1RKBA 4NONA 1P6XA 4S2EA 1CF4A 3B1ZA 1HE1C 4DLVA 1S0UA 4LJAA 3NC0C 1II8A 1WXQA 4OI2A 4Q1FA 3IHLA 3RANA 2DFLA 4BFXA 4RZ3A 1KJWA 4BLOA 4H1VA 2AWNA 2C98A 3AH8A 4BGDA 1RRFA 3LX8A 4D6PA 1UADA 2XB4A 1GKYA 3GJ4A 3ZZUA 3ETLA 2X8AA 2YYZA 4QL3A 4TN1A 4RD4A 5FL7A 4JLKA 2JLZA 3LBHA 4TT3D 2IYUA 1EFTA 5EE9A 4IDNA 4JKIA 4OJQA 1BO6A 1QHXA 4DXAA 1ZIPA 1XPOA 4WOPA 4GP7A 4L9SA 5EZ5A 3GEHA 3K1JA 1RRPA 2QRZA 2ZXUA 4D0GA 1NIJA 1I4TD 4C30A 4DSOA 2RGNA 4LX0A 2O0HA 1U0HC 5DI3B 2ZJYA 2D62A 4NCIA 3MAAC 4QKQA 1OFUX 1TPZA 1W0JA 5BYJA 2D7DA 2WIAA 1HY3A 1W7AA 5AUPB 2ZRIA 5FTLA 2GRJA 2HJVA 1P4SA 3EASA 3EIEA 4HLUA 2LKDA 1S2MA 5JHGB 1XX6A 4DKXA 4H9GA 2AFIE 3NWJA 4Q4LA 1KO8A 4DWJA 4A6PA 3B6EA 4HAVA 3KKPA 4L16A 4JVLA 5DI9A 4DHEA 2XGJA 2EFHB 2WIBA 4QHSA 5KDOA 2OCBA 3RHFA 5E7JA 4L9WA 2IYLD 3DOEA 1P2TA 1COWA 3AVPA 3K0EA 3QIAA 5AUOB 3U7HB 3GJ6A 2H92A 5GJVC 3RABA 4LSGA 3PJRA 2FFHA 2WWIA 4P3YA 1R8SA 3IBGA 3B2EA 3WP0A 5AK0A 3AV0B 1V5WA 2NPIA 3U3RA 3PR1A 4I1UA 2XOKA 4JZKA 5AJVB 2IS1A 4BECA 1E2PA 1XF9A 3HYTA 4W5WA 3C4JA 4BZQA 1ETUA 3CF6R 1F2TB 2ZR7A 3PQCA 3QKRB 3DOFA 1SXJB 1FTSA 3LXRA 3SFZA 2VQSA 2H1LA 4Q7MB 3A4MA 1YZKA 4TL9A 1N3BA 1JXOA 1W0JD 4FCVA 4XJXA 2A5FA 4O3MA 1GAJA 2Q0HA 1DARA 1AQUA 1RJ9A 1Z29A 3EPJA 4LJ7A 4RFSA 3RS5A 4LV8B 1Q1ZA 1FQJA 5GVRA 3QNUA 3CF2A 5JJLA 3QI2A 1NN1A 3W8RA 4EDHA 5C1BA 3BAFA 3FKSA 3FB4A 3GJ7A 3TUJC 1KI7A 3VR4A 2QRNA 2Z6VA 4A6XA 5B64A 1P75A 5JWHA 1GNPA 1QHNA 4RD0A 4C0BA 1BIFA 1DO2A 2IYQA 4MRNA 1EWRA 1ZNWA 3ZZ0A 1Z6YA 4BASA 2QA5A 4O2RA 4MQBA 4PSAA 2AFHE 3LY5A 4PHTA 4ABYA 4DUGA 1DAFA 2GK7A 5CIWA 2IS2A 4NCJA 3WY9A 3GLGE 3PCRB 4DRZA 5EP3A 1X8KA 2OO7A 4QNRA 1LB1B 3DKVA 3ASZA 1JR3E 2BC9A 2EFDB 2YNMA 3OESA 1P62B 2XOKD 1ESMA 3LD9A 4QBFA 1R6BX 4P33A 3SNHA 3T1OA 3THWA 4DT1B 1GNRA 1A7JA 3Q3JB 3GLFB 5CDFA 1AKYA 1FL9A 4V0NA 3GFTA 2QQEA 1ZUHA 4P4SB 2HT1A 1H65A 2HCBA 2IWRA 4A15A 2O8BA 1FZQA 1L4UA 4NU0A 4V0ME 3TVDA 1DADA 5JECA 3U44B 1JNYA 2EFCB 5FBLB 1XZPA 2RCNA 2LCFA 3VTKA 2GZAA 5J4VA 3EW9A 3MLEA 4MRVA 4Q02A 4HEJA 3EA5A 5HCNA 5CJPA 2Q3FA 3KJIA 2HYIC 4V02A 1E79A 4XVRA 1IN4A 3FOZA 1G7CA 5GADl 4OHXA 5CB6A 4FMDF 2CCKA 1QHGA 3FKSD 2YKGA 4PPFA 1N5LA 2RB4A 2OEPA 5B30A 1J7KA 1IN7A 5SZHB 3FFBA 2F1RA 2NOAA 1VIAA 2A7QA 4UXJA 3UG7A 3C8UA 5TARA 4M1TA 2A5JA 2FSHA 4DUGD 1E0KA 3PVSA 3TAUA 1E9DA 3NDPA 3PFIA 2ZSDA 1KZGB 4HDCA 2IT1A 1DTSA 3OFND 1XEWX 3VHXA 5H1YA 1XD2B 2ZI9A 2JATA 5FPTA 3UPUA 5FR2A 5JRJA 2ORVA 3I3SR 5TMPA 1ZM4A 1E9RA 4TTQA 4F92B 4KYIB 4URWR 1AM4D 4KBFA 4LK2A 2BMEA 1S9DA 4XH9B 1JEEA 2FSFA 1NG1A 2RKOA 1H8HA 4FI3C 4B33A 1WMSA 2RGNC 4TLEA 3AQ4A 3KTAA 2D06A 2AWOA 1WRBA 3R8FA 3W34A 4EPRA 4YC7A 1NVVR 4QGGA 4BLTA 3ZVRA 2GF9A 1ZD9A 2NPFA 5F3WB 5FTNA 2VP0A 4TMTA 4C7OB 1E79D 3KQNA 2A78A 1HE8B 4NYMR 4ZI2A 3KKOA 1S1MA 4OQFA 1HA3A 2QG6A 3G82C 4B32A 2UKDA 2QGNA 3P4XA 3HR8A 3BH0A 4JLVA 5F9FA 1JR6A 1KK2A 3K8YA 4QM6A 1IXRC 3A37A 1K5DA 1XXHB 4LHYA 2QEQA 1ZMXA 5SZJA 2OBNA 4R9UC 3T1TA 2V3CC 2FH5B 3THXB 5JLJA 2ZR0A 4A0HA 3CBQA 2IC5A 2ZEJA 3ND9A 4E09A 4Y0AA 2K5UA 5FI0B 4DLTA 2JLYA 4D25A 3DEFA 2PJZA 1SVSA 1AZTA 1E2IA 2R6DA 2ZUDA 1TU3A 4LYAA 5FOWA 1MRNA 2GDJA 4AKGA 2WZQA 3RVBA 3AP2A 1H8HD 3C16C 1UBGA 5EQTA 4EJSA 4MGZR 1XU4A 3EIQA 1OW3B 1TQ6A 5E3HA 3KB2A 1E9EA 1DEKA 1C4OA 3DMDA 5KTYA 1II8B 1P72A 4DDTA 1PLKA 4GNKA 4AG5A 2G83A 4OHZA 2BCGY 1R7RA 1S3GA 4PX9A 1IY2A 1YZQA 2J41A 2QPTA 2XAUA 2A3RA 1SVWA 2GHIA 1ZC3A 4U02A 2R6AA 3KX2A 1DAEA 1BYUA 5DO9A 1KI1A 1Z0DA 2ZI3A 2GESA 2QTHA 1RYHA 1YZGA 3PIRA 2FEMA 1I2MA 4OQXA 1AS2A 1EK0A 4MKGA 2QN6A 4JS0A 1VHTA 4AYWA 1KAOA 2HV8A 2O8CA 2OE2A 1MT0A 3AF0A 4JYCA 2BIFA 2PZGA 4F4CA 4CEIA 1E98A 2DFKB 4QJ5A 4GBMA 2HYDA 2W2TA 5ANRB 2QSZA 1ZNZA 1G3IA 2ERYA 3RRMA 3B1YA 2Q3MA 2IEYA 4KBGA 3K70C 3SQWA 1N5IA 2ODNA 4WBSA 5LBIA 1Z47A 3JZMA 4M21A 2GVDC 1NN0A 2BV3A 5M04A 2A5DA 1U81A 5JCPA 3KJHA 2BEKA 1FTNA 1JQJC 4Q47A 4DIEA 3TAHA 1KK1A 4Q5IA 2PT5A 2Z4SA 4M1OA 4RZ2A 1NN3A 2OFOA 3LDAA 2QAGC 2QU8A 2O8DA 4FIDA 4B3BA 4PO1A 3T15A 4KXFB 5BW8A 2WJVA 1OXTA 2R65A 3VX4A 5C46F 4ZCIA 3U6BA 1PVOA 5KNBA 1D2NA 5LB2A 1JAIA 1YHNA 4P32A 1NVVQ 4CZ2A 1Q1BA 4ZO4A 2DWOA 2ZS9A 1TUEA 1ZUIA 4KAXA 2JDIA 4YONB 3UIEA 4URXR 3WHKA 3FFAA 4DZZA 3AF1A 2C9CA 2Q21A 4Q00A 4E5UA 3PEUA 3K9GA 3SFVA 2KWIA 5L3SA 3R9IA 2ANCA 1ZNYA 3QENA 3IEVA 4BFWA 1VDZA 5AJXA 3N5CA 4MGYR 4E22A 2ZSBA 4YMUA 2WKPA 2ZI6A 5TY0A 2DR3A 2EW1A 1NJGA 2B8WA 2YINC 4RD3A 3CM0A 4EPVA 1GG2A 1W48A 1BYIA 2ZE8A 1XJCA 3I8SA 4A36A 2QAJA 4PC6A 4Q1EA 3WYFA 4DSNA 2QP9X 2ZSEA 3HJNA 1HQYE 1GSIA 1RJ9B 4JLOA 1U8YA 5IDVA 4RCZA 4JIMA 2O52A 1TNDA 3MWYW 2ZUBA 2JJ1A 1GVNB 3KDSE 2ORIA 4RZUA 4HYYA 3DMNA 5DSZA 4Z51A 1RPZA 3RWMB 5A5GA 1GITA 5BN4A 3WNDA 1G3RA 4I1OA 1NRJB 4RZXA 2OSBA 1Z28A 2GCNA 3CF0A 3NHAA 4OBEA 2WSSA 2JDID 1R5NA 3BH6A 4YLGA 5BWMA 2YOGA 5BN3A 2AR7A 2BCJQ 5FOUA 5C18A 2CL6X 2DPXA 2RGDA 1MH1A 621PA 2XB2A 4ZCMA 1XEFA 2QUZA 2ZETA 4RSGA 5G3ZA 3CWZA 4HB0A 3X1ZA 5L3VA 1G4AE 2XZPA 1Z2AA 2B7BA 1IM2A 3THWB 3VU9A 5FUWA 1D2MA 2QBYA 3ICEA 3CR7A 4TMVA 3NIBA 1UBCA 1XD8A 1XPRA 2X2FA 4B6FA 2ANBA 3N70A 1GDDA 2G9NA 2J0UA 2F55A 1XEXA 1XBTA 4KVGA 1U90A 4FMBB 4LBVA 2YWHA 2IS6A 2O8BB 2AKYA 2L0XA 5C2JB 1WA5A 1KJYA 4C2UA 2F9LA 5FPHA 1RW4A 2P5TB 4KYUA 4C0SA 1WDTA 2X19A 4ERNA 3AVOA 2C2HA 2REXB 1EG7A 1IONA 5HZKA 4YDSA 2JJ1D 2FE4A 5FPYA 2I1QA 1OYYA 1NSTA 3LBNA 4IRUB 4DC9A 3IO3A 4B48A 2XXAA 2WKRA 1UDWA 3DPUA 2EFEB 4UNNA 2VP6A 2ZSFA 4NBSA 1L4YA 1ZP6A 2HLDA 3W8NA 3ZIAA 3VR3A 4PQRA 2WSSD 2AN9A 4N3NA 5BYKA 4CT4B 4ZKDA 4BPBA 3E70C 2NO9A 1Z6GA 3ZQ6A 3CPEA 1AN0A 2OV2A 2WKQA 4XTRA 4QXAA 1KGDA 2GXAA 4B73A 1E2GA 5H70A 1S96A 3I8XA 1UJ2A 3Q9LA 1DAKA 4RKEA 4Q03A 4QRHA 3MSXA 1KHTA 2O0JA 4GL2A 1AKEA 3KFXA 3NHBA 2P5SA 2G1JA 4QFMA 2O5VA 1HURA 2XNSA 5LD2B 5B57C 1H8EA 2AHOA 4D4LA 3ASYA 1US8A 3KTAB 4OQLA 3T61A 1E2HA 4M1YA 1KO7A 2NGRA 2KSQA 5L3QA 2R9VA 4IKEA 3FHTA 2IS4A 1G5PA 4BLPA 4DBLC 4W7SA 1SXJE 3WYAA 1CR2A 4B3XA 5EZ6B 1N6PA 4JL5A 3T5DA 5J4KA 3FWYA 1W44A 2QMUA 2RAPA 2IWHA 5HTKA 1EX6A 4AI6A 1HT1E 1E2QA 1U2RA 4Z8YA 3V4FA 2HLDD 3TIFA 3ZIAD 1IN6A 1F60A 4BFZA 4JT2A 2ZRMA 1SGWA 4I4LA 3SBDA 3THOA 2PZFA 1G7SA 3OE7A 4M4SA 1ONBA 2RMKA 1A5TA 3R20A 4QNMA 2IHBA 1AK2A 2HDNB 1XTQA 1A82A 2KBEA 3DDCA 3GPLA 1HV8A 4BFUA 4UQOA 1DAMA 5KHOC 5FFMA 2Q6TA 5KNDA 1Q12A 4X8MA 2H18A 1EFRA 3TGPA 2JLUA 4A4DA 4N0EA 1W2GA 2VHJA 1XTRA 4FWTA 2J46A 1H8ED 2QSYA 3SHFA 4EJSB 4G1UC 1EWQA 1AZSC 3OEEA 2QENA 4A0GA 4LPSA 4BLRA 3I32A 3GLFE 2GTPA 2B92A 2GILA 1KTVA 1JPNA 5SZKB 3NC1C 1IN5A 1J90A 1G21E 1U9IC 3A1WA 3RAPR 1AS0A 3SE0A 3OEHA 5CITA 3B5JA 1NJFA 4QGHA 3AF3A 3O8BA 4NTZA 4HZUA 3NG1A 1XCGB 5FOSA 1G5TA 1CS4C 4XSGA 5KOYA 2IX3A 4JLNA 2O8CB 3PEWA 1G18A 4ZPXA 2DYKA 4ZDWA 3LVQE 2V55B 3W3ZB 3OE7D 4CEIB 1CEEA 4M2LA 1FP6A 1K8RA 2CVFA 3VNUA 2PH1A 5F9HA 2Q3HA 6Q21A 1NF3A 1CJVC 1XNJA 2GA8A 4K46A 1E1QA 1J8MF 1XCPA 4PO9A 4B3CA 4BQSA 3L0OA 2OCAA 5FUYA 4YMTA 1W49A 4JJZA 1LFDB 4LBZA 4Y0VA 1LS1A 3EZ2A 1EFRD 4IOLA 4V0LA 2J87A 2QZ4A 4C4PA 3KZ1E 2CE7A 2J0QA 4LZZA 3GJ8A 3OEED 2O8DB 1FQKA 2IYWA 1C1YA 3RS7A 1ZW6A 1WCV1 5FBRB 2ODBA 3FMFA 1Z8FA 1KKMA 1FP7A 1NIPA 4GMXA 2OUKA 1KSFX 3J81k 1Z0AA 3OAAA 2NMVA 2QT0A 3BH7A 3OEHD 2QE7A 4OHVA 2FMXA 5EE3A 1G41A 1WP9A 2XITA 3SOPA 1EX7A 3TSWA 2W2XA 1NVWQ 1K5GA 2Q9AA 4DCUA 4JLJA 3BFVA 4KHZA 1KNXA 1OSNA 4JKYA 3QF7A 1R2QA 1FNNA 5JEEA 1F2UA 1AJEA 1X8LA 5L3SB 3VKWA 221PA 3TJZA 2MMCA 2OBLA 2CXXA 1GFIA 4LDJA 2ECKA 4TYWA 2BJVA 3A4NA 3LFUA 3T34A 1Q22A 2QNRA 4MDFA 1NY5A 3VR1A 4M1MA 2NO7A 1J70A 3KKQA 1CTQA 4EKDA 3U3KA 1XXHE 5IHPA 1E32A 5C4GB 3KXIA 4I81A 1U99A 4U7DA 3I92A 5F98A 1D9ZA 1W4CA 2FFAA 2I3BA 2CCGA 3BJIC 3PENA 4V0KA 3X1YA 3ZVMA 4EFLA 3LA6A 3SZRA 4GI7A 5G3YA 2YOFA 4MGIR 2WVJA 2FGJA 5JSZA 4DB2A 1T91A 1RZ3A 2ZRCA 1DAGA 2PMKA 1ZBDA 1G17A 4TSFA 4ASUA 1IXZA 3GLIA 4GZMA 4JLBA 4TQUS 3EZ9A 2AD5A 2IW3A 1SQ5A 3QEOA 1E96A 3QXXA 2IYYA 2ODWA 4PPNA 2O0KA 4M9QA 5IRCD 1PJRA 2JLWA 3SC3A 3ZZTA 3VKHA 1FX0A 2FOLA 2OFXA 4URVR 5JS8A 5JWRA 821PA 1KSHA 2BDTA 1A4RA 2AXNA 4JVNA 3OIYA 1OFTA 1YZNA 5FOVA 2DB3A 4G5GA 4LPKA 2ZROA 1N0UA 4W5JA 5AJWA 1KIMA 4O2LA 4LC0A 4BEBA 3EX7C 2QBYB 2QP4A 3HU3A 5KPDA 4MGKR 4C0AC 2ZM5A 4XWKA 2J0UB 1EFHA 4AG6A 1XEXB 2ZYUX 5FPSA 2IYXA 1DE0A 5E7MA 4GPTA 1E4VA 2Q9BA 1E2FA 4Q7JB 5DYIA 1NG9A 1E1RA 4CW7A 2GWHA 4P31A 3W6NA 2A30A 3KJEA 2R8RA 3FVQA 5AJYA 3K53A 4HZIA 3O8RA 2O8FA 4IOJA 3N2IA 2B6HA 2QI9C 1ELOA 5FL7D 4GMDA 2CJWA 2ERXA 3KQUA 2XSZA 3NDBB 2R62A 4TL6A 1U8AA 2WJGA 3HYRA 2XXAB 4TSFD 2YWEA 4ASUD 2HCJB 1N0WA 2IF0A 4B3FX 4C0KA 3QY0A 5JI3E 1KKLA 4B74A 2QMOA 3QBTA 1YU9A 2IBMA 3I72A 3MWJA 5EE0A 4LV5B 3SDZA 4EFNA 4R98A 4D4JA 4EPWA 2N42A 4CEHA 2W0MA 1VKJA 4AURA 5GJBA 5TVKA 1G8HA 5C4MA 2EU8A 3CNOA 4Q21A 3B85A 2I4IA 3SEAA 4Q4AA 2BMDA 4TYQA 5AR1A 4MUAA 5CYOA 3D8BA 5EXPA 3WNBA 2ZJ8A 1MR3F 1D6JA 1FOEB 2G77B 1YKSA 4B35A 4IJMA 3SJZA 3SR0A 1PZNA 3SJCA 2ATXA 5KNCA 1R0YA 1US8B 1KK3A 3B1XA 1E1RD 2A5GA 4KLNA 4AKEA 1OH8A 2IF2A 5L3QB 3LH5A 4G5RA 2ZRLA 3X2SA 4RD2A 1ZVQA 4MYUA 1M6NA 3RC3A 3FKQA 3KKMA 3OZXA 1PV4A 1COWD 4YMSA 2A9KA 3THYA 4DLYA 2XSZD 2QM8A 4XWOA 3SQXA 2JJ8A 5EP4A 3O8CA 1N6OA 2AX4A 2JLRA 2VP9A 4LGMA 3W5JA 4I99A 1T0JB 1LF0A 3BRWD 4TWZA 2VEDA 2P2LA 3QVVA 4B2LA 4A8JC 4W5HA 2ZIAA 1Z07A 4FMDB 2F9MA 2KBFA 3GJ0A 4QOSA 3PEYA 1NBMA 3DKPA 1G19A 3FMIA 4P4TA 2DWQA 2FNAA 2WWHA 4PC3A 3LRPA 2QAGA 4B71A 2HXYA 4FCWA 4LBWA 5CM8B 1AIPA 3EC2A 3U4QA 4HSEA 2ZU0C 3PV0A 4HDQB 1G6HA 2IYTA 1M2OB 4HUQA 2WWGA 1VYVA 2G6BA 3AP1A 3IUYA 2F3RA 4KFSA 1II9A 3V4RA 1NKTA 3AUYA 1I2DA 4TYYA 4PANA 2WJHA 3WRXC 421PA 4RD6A 1D9XA 4B2PA 4IDHA 1IJEA 1KO5A 2J7KA 2QMEA 4KFRA 5CDFE 1CR1A 2BBOA 4D80A 4B3GA 1BH2A 1YR9A 4KVAA 4QC2A 2BMFA 3P1JA 1XMIA 4TTPA 3TE6A 3BOSA 2JJ2A 4YMVA 4B75A 2ZYTX 3MD0A 4GRAA 3K70D 1OIXA 2BBWA 2WJIA 4POAA 1N6LA 4QM7A 4LYFA 4CVNA 4ON9A 2LWIA 3HP1A 5B58C 2QROA 1HUQA 1UF9A 4ZDJA 3GP8A 1E4YA 1ZYUA 2P65A 3A8TA 2PMDA 3I4LA 2ZRPA 2W00A 4LYJA 4BRWA 1Z0KA 5J4YA 2P6RA 3QQ5A 3TW4A 3AKEA 4DLRA 4CGZA 1FNMA 4BZPA 3TQCA 2MSCB 2WMOB 3DO6A 1KMHA 2FEOA 1IN8A 4V03A 2FPLA 4XD7A 4QHTA 4Z8XA 3SYKA 1D8TA 1R0WA 1HYQA 1YZLA 3I1FA 1TUIA 5TB5A 4HUTA 4RD1A 2OAQ1 3LO5A 2F3TA 1W36C 1I4LD 4U00A 1E2EA 4MKIA 4M9ZA 4FMCF 1CJKC 1YE8A 2YZ2A 3TKLA 3FTQA 3UWKA 1VCIA 3L2OB 4Q01A 1EXMA 1Q0UA 3NTUA 3I61A 4EQ6B 1SVIA 3H2YA 3W5IA 1GL9B 3U61B 2XX3A 1KI2A 1KNQA 2D74A 3PXGA 3CZPA 4QG7A 1QG2A 3RSOA 1NMZA 4X8OA 3ADDA 3K0AA 4JL6A 1MO4A 2D7CA 2JCSA 3K0CC 3FMOB 2VH5R 2JJ2D 3IILA 2NG1A 3B13B 2VSXA 2GCPA 1TQ2A 2V1UA 4KFUA 5KSZA 1LTQA 4KJZA 4BE7B 1CIPA 4CRWB 2XTNA 1G3UA 1ODFA 4JSYA 3DVLA 4BFSA 1YVDA 4Q4HA 1F2UB 2W6JA 1G1MA 1NKSA 2MMGA 3IEUA 2ZRKA 4JBXA 5K8UA 1J2JA 1DVRA 2JEOA 3B78A 1GKIA 4YQFA 3BB1A 4WIAA 5JBQA 4PQFA 3IKJA 3VFDA 4LRWA 2PT7A 1OV4A 4C0LA 4E07A 4NYJR 2MSDB 4OI1A 3QF4A 2CK3A 4EIWA 2VHUA 3BBPA 3RS3A 4BRUA 3KQKA 2EQBA 4RY2A 4XD7D 2IHYA 2C99A 1G5RA 5IT5A 2ZI4A 2RGEA 2VSFA 1VMAA 2GJ9A 4HB4A 4YDHB 5D3MA 3TMKA 4IVQA 4P4UA 2BM0A 1GNQA 3R7WA 1IY0A 2P3SA 3EWSA 3GEIA 3BB4A 5JSZB 2VP5A 2ZANA 2FX3A 4HLDA 4A92A 3GLIB 1CJUC 2EFGA 3IIJA 4ILEA 3ADCA 1Z3IX 2ZE7A 1YR6A 3AM1A 2AK3A 1FFHA 1FX0B 2CE2X 1SULA 1IHUA 3U6KA 1T8UA 1P9NA 2QM7A 3FPAA 3WYGA 2NO0A 2W6JD 1S1CA 3SU8A 1OPXA 4CEJA 1P61B 1W47A 3V9PA 1ZCBA 4BZXA 2ZU6A 1DS6A 1G3QA 1JAHA 5FBVB 1LY1A 1KSGA 2J1LA 3L8ZA 3RDPA 2C8VA 4Z54A 2E87A 3QG1A 2R6GA 2X2EA 2FU5C 1G64A 3ONWA 1OFIA 2CLDX 3MWLA 2O8EA 2GBLC 2H17A 2QGZA 2J59A 2V9PA 4D4KA 2WICA 5G40A 2WJJA 3CX7A 2ZJOA 2YJTD 4LV6A 1CP2A 3QPWA 3NBZC 1OB2A 4NE2A 2EYUA 2O8FB 1QHSA 2GK6A 4GT1A 4TQ9A 4B6EA 4LHZA 3QSYA 2CJWB 2VHQA 1NY6A 4B44A 3AKDA 1LF5A 2F6RA 4MA4A 1JEDA 2ZUCA 1IAQA 5DGXA 2ASEA 4ZI3A 1R5BA 4BLQA 3MWKA 3W3AA 3I73A 4HLCA 4A82A 1TF7A 4DLZA 3T1QA 1UKVY 5GJCA 1GP2A 4H1UA 2ZTSA 1TMKA 3T5GA 4TQAA 3REGA 2GAOA 4GZLA 4Q4AB 4JLAA 4G3XA 2YC2C 4KO8A 1P73A 3W6PA 3C14C 4OHWA 4BUJA 3A1UA 3RS2A 1LW7A 3WXMA 4JL8A 4RFSB 1U9IA 3ECCA 4P0TA 4RJLA 1UKEA 1MABA 1KY3A 2ZI5A 1XTIA 2IYZA 1HQCA 1ZM3A 4NDZA 4URUR 3FMPB 2CVHA 1ZU4A 2FZ4A 2ZRBA 3WMGA 1UKZA 4Q9HA 4C9BA 3L0SA 4NYJQ 5CM9C 3QG5A 1SKQA 4LWZA 1A1VA 2BJWA 3VR2A 3MJRA 1T5LA 2TMKA 1N0VC 3CUEF 1QBKC 1R10A 4M1SA 2OESA 3UKDA 1AGRA 2C9OA 2ZITA 3TW8B 3THYB 3AUXA 4ZV4A 5EP1A 2REOA 2ZJ2A 3LAWA 1GILA 3SS8A 1XCMA 5SZIA 3K70B 1B0UA 1G8PA 3B9QA 4TLBA 4MRSA 1M7GA 3MGCA 2IUSA 2GAAA 2DFTA 5EUQB 4B76A 1M34E 3TK1A 2NQ2C 3CO5A 4OYHA 5ELXA 1WB9A 1DPFA 2QAGB 3I5XA 2SHKA 3CWQA 3U4QB 3UK6A 2OCPA 1CRQA 2GZDA 4FCTA 1BOFA 2GZHA 2XEXA 3ADBA 1GWNA 3T35A 3P27A 4DCSA 4CYMA 2ZS8A 5CB8A 4HUQB 4GOKA 1UEIA 1SHZA 3JZAA 4Q7KA 2PL3A 4II7A 1Z22A 3FE2A 2IXEA 2JIZA 1EFUA 4UNQA 2JAQA 1CKEA 2J3EA 5BQ5A 3D6TB 4TZ0A 5J5CA 2XJ4A 1QF9A 5D3QA 4IFEA 2J45A 3CX8A 3HU1A 2HJGA 2A2ZA 2VP2A 5FBWB 1G7TA 3IQXA 1CR4A 2CLSA 3TNFA 3GLHA 3Q7QA 2PCJA 4LCBA 2P67A 1SKYB 1II0A 3UMRA 1NI3A 4HAWA 3VQTA 3QEJA 4NL4H 1GUAA 2VF8A 1OXUA 2WMNB 1FUKA 3M0EA 1Y3AA 3EXAA 5TDHA 1E2LA 1KDTA 4HB3A 5AUNB 1T3HA 1Z5ZA 3QJYA 4PC1A 2GEVA 4LUCA 3ZVLA 5J4HA 5EXTA 1Q20A 3N2EA 3U7FB 2NIPA 4ACAA 4MH0R 2XNDA 3K9NA 3L0PA 3BC1A 2OILA 2AKAB 3IO5A 4KODA 2W0SA 1T8TA 4NP6A 1YQTA 1ZRHA 1WF3A 3KL4A 2UZ3A 1WBDA 3EAQA 3QKRA 1OKKA 1KMHB 5L3RA 1OXVA 5CK5A 3PUVA 4KCGA 2GJSA 4O25A 1PLLA 1E69A 5E7IA 4ZKEA
chains in the Genus database with same CATH superfamily
4XFKA 4XPIB 3K6SA 4KJXA 5CA1A 4DSAA 1C2TA 3HM2A 4TZTA 4L72A 4K2HA 5A2QA 4Y67A 6LDHA 1HT2E 1DDOA 1F8UA 4IO0A 2HU2A 3G13A 1LSOA 1ESEA 1TK3A 1Z9BA 3THRA 4B4VA 1V1MB 2E5LB 4HYQA 1EI9A 1W1UA 2EKLA 3BWVA 3Q41A 1P80A 1NL3A 1Q15A 1NZDA 5I7RA 2P41A 1VCMA 3KQQA 2ZQ5A 3P4YA 1XFAA 1Z4LA 1Z6AA 3BEDA 2ZGVA 4E2YA 5B7GA 1UXHA 3KKNA 1JLMA 1BWPA 4C0QC 1M72A 1K7CA 1RM0A 2P6NA 4MTCA 2VDPB 1VL8A 4MKZA 3RROA 4XJTA 1JEOA 2N1BA 4FGUA 4ZALA 3A4IA 3ELYA 1SM4A 4NENB 3B6IA 3UHFA 1PKEA 3NIFB 4Q4HB 1JWLA 2XRZA 1PX0A 5C9ZA 2PKCA 4DABA 3G1UA 3KUXA 4RVCA 2V6MA 4O4LB 1FC0A 4B7UA 3L6UA 4LTNA 1GM5A 4B31A 4G0XA 2FJ0A 3PL5A 4CQMB 1A2QA 3Q9NA 2FPKA 2QUIA 3R24A 4GXTA 2XY4A 2ZE6A 4Q9IA 3ESXA 3KOXA 3K9FC 1OKKD 1P74A 4JLDA 4EJ6A 2RH4A 3PQ4A 1SBHA 3H5AA 3I04M 3B1WA 4KNWA 3FNEA 1Z2OX 1DX9A 2FXVA 3D7LA 4RV5A 5HJEA 2OXRA 1S9HA 1AKNA 1UJNA 2DHRA 4S24A 5H3LA 1BWQA 5IJ0B 2QX7A 3R7WB 3FJYA 3T9AA 2WUFA 1FSPA 1IAVA 4MRAA 2P9ZA 2I7XA 4Y7DA 2EWVA 4A73A 1UM8A 3ISTA 4CDGA 1P8JA 3RB8A 3TOCA 4DNXA 4FKMA 1SBTA 2HA7A 3G2PA 4HDKA 4X7PA 4JKOA 5JXHA 3RS0A 1MO5A 1BQ3A 1VMDA 1CBUA 2G07A 2R6R1 5A03A 5LZ9A 1OI2A 1P5FA 2ZCJA 1LNSA 2HT6A 2YW9A 3CHYA 1S3SA 3O4HA 4ENRA 3DA8A 2V7BA 2WF7A 4XWAA 2P6OA 3KB1A 3AHFA 4BVKA 1EP3B 4F21A 3NCHA 2H3HA 1OWPA 2ZJZA 4EK9A 1OT3A 4EY3A 3EXHA 4ND1A 3AC0A 2P5YA 1XZDA 3KPJA 1KMQA 3TE7A 3L04A 5AM3A 1MO6A 1ZXLA 3PR2B 2Z08A 3OQBA 3I28A 4L73A 4L5BA 4MEAA 1X15A 4C6HA 1BSVA 4PFKA 5CM2Z 4X7BA 1GTVA 2FP4B 3A1EA 4QTYA 4HNVA 5H80A 3FZYA 3V8RA 1RS0A 4XOUA 4XIIA 2AVDA 1TYAE 1T0HB 4WN9A 3SXUA 3Q7PA 2O8EB 3B48A 4A23A 3ZLUA 3UHAA 3NBXX 2O2SA 2VYFA 2JLSA 1O94A 1SCQA 1JI0A 3DHWC 3N07A 4V0SA 3EWNA 3TXAA 4A9AA 1PQYA 5BN1A 2OAP1 3LBIA 4MS3A 2V03A 4JLWA 1Z06A 3MA0A 4LKOA 3LUKA 5G0TA 1NVMB 3WIEA 2Y0PA 3MXOA 2UYCA 4OIMA 2FRXA 3BIFA 4TLMB 5K03A 2RAUA 1E94E 3FSGA 5DH9A 3ZVNA 4NU8X 1XZMA 2PZLA 3CX3A 4L15A 2P8SA 3R3YA 4HAYA 4M86A 1RYEA 5F9MA 3D8TA 3T3DA 3RU2A 3ELDA 5FHQA 1KI9A 2WPDA 1HYGA 5AVOA 2ID4A 4FINA 4YXFA 3PX3A 1B6GA 4ZVLA 2P27A 1UAAA 3DZBA 4EB6A 3TRIA 1YS7A 1UC4B 1QS0A 1XXHA 3CURA 5LJIA 4DV1B 1N92A 2CN1A 1WTCA 5BSUA 1FJGB 3PXUA 1AGXA 5JRZA 1WB4A 4HSGA 3QPUA 1NULA 4IJ6A 3MJHA 4PTZA 5A4DA 2PS9A 4DJAA 1E6EA 3ZWYA 5IJWA 1SUPA 1D04A 1JALA 1ESNA 1FXUA 3JPYA 4GKAA 3LS2A 1H2YA 3ZDQA 4D81A 3EVFA 2OHJA 4G0WA 1RKVA 3GJQA 1MABB 1EEXB 3QX8A 3ABZA 3N7UA 1PI3A 1CZUA 3CH5A 3U81A 3WI7A 2WWYA 1UBEA 4BMXA 1NU8A 5SYMA 4ILKA 3TZLA 3O1LA 3LG2A 3AG6A 2V8BA 3HRHA 2FZCA 1N1MA 5C31A 5GVSA 4D4IA 4DCNA 1IWPB 4Y30A 4QXPA 3I9V1 4BXOB 3MWDB 1DL5A 3SSNA 3EFBA 5L9AA 3GRRA 2GXSA 5E7QA 1U0BB 1TYZA 2QE7D 1Q57A 4AY6A 1OBFO 2B30A 3X1JA 4MP3A 4I1IA 1PYDA 3HZHA 3FSGD 5F5XA 4D82A 1FDTA 1L3BA 1UBUS 4J75A 2A1TR 8ABPA 1XMVA 5DZSA 2OHHA 5AXBA 1NSFA 4MUNA 3YASA 4CCYA 1B23P 5BR4A 3U3MA 5DGCA 5H4GA 4O33A 2WPDD 1E2DA 4O02B 1XQWA 2NYUA 3G9UA 3AEZA 4G23A 1SB9A 1Q44A 1XZFA 2Q4RA 1RJEA 3LDGA 4P93A 4WJZA 1RC1A 3LVRE 5P21A 6REQB 1GL6A 2G9UA 2WOOA 2B4KA 2YZ7A 2J67A 2FQXA 4M9SA 2CWDA 2QQ5A 4YJFA 3HUFA 5U9CA 1YDFA 1PEKE 3H4MA 3V5NA 3GT0A 3BGDA 1LLFA 4YYZA 1OFUA 1NZJA 1Y6ZA 4WLOA 3EQ7A 1M33A 2RJNA 1A8UA 1E9SA 3TH5A 1CR0A 2JEYA 3ETNA 3GRAA 2X9VA 3D5TA 4OQNA 2SKDA 1OFGA 1UQTA 3MJCA 4I4TA 4BLSA 2A1UB 1MZVA 3DFZA 4ZANA 1HYEA 4EYKA 2FV8A 2IVZA 3A28A 5CFQA 3ZJYA 4V1CA 3ESBA 1VI2A 3QLUA 3DE5X 3GI1A 3KLPX 3ZOZA 3T5CA 4OY3A 2OBMA 1TJ3A 1U1IA 4QJ4A 4KI0A 4K5QA 4O1HA 1U5BB 1GSHA 3LGSA 1V37A 3RIXA 2BN4A 3T6KA 1ZVMA 2FLKA 1P9WA 1U7ZA 1GKUB 1JQBA 2DZDA 2Q99A 5B1YA 1QAOA 1X3SA 2UVPA 2WIGA 1MFPA 2QSJA 1H3FA 4DMCA 2BY4A 1XDWA 4Q19A 3GLHB 3LC7O 4HB2A 1H4SA 1WCIB 3E23A 4O6VA 1RWPA 3VNBA 4J76A 5JAZA 2DP4E 5DP2A 1MEEA 4KWCA 5GZ1A 4IJUA 2ZS7A 4US0R 2IXDA 5L3ZA 3I62A 5CYGA 4XGIA 5I3CA 3EUEA 1XG5A 4Q7QA 2HF9A 3UICA 4OQYA 1AKWA 3KHSA 3CSDA 3MLAA 5FCDA 1FBTA 2QSUA 1QNFA 2GM5A 2I65A 2OCYC 4UJ3A 1XMPA 2C04A 3UYLA 1FBNA 1Z6XA 4R8MA 1VECA 1G8FA 3AEQA 3II6X 3ND8A 4GLJA 3VX3A 3U62A 1RRCA 2ZAMA 4HZGA 3E7DA 4GD3Q 3GZ4A 2HDHA 2R7MA 4X85A 2CSXA 1JP7A 3OEYA 4GI2A 4NWIA 4TV8F 1ZX1A 2ES4A 1ZVVA 3C8ZA 1XD9A 2Y1KA 2P4EA 3RS8A 2OCLA 5BMOA 3ZGOA 5AVSA 3NBFA 1UBFA 1N25A 2JPDA 4COKA 3G5MA 2O2CA 1VTKA 3I0ZA 3T38A 2ZYWX 4ITRC 2VRWA 3DVSX 4PWYA 5TF4A 3A4LA 3M5DA 5T6MA 4NKRA 3ZHRA 1FMJA 1B41A 1WHTA 2DPMA 2IXFA 1DV1A 2ZQYA 4H7KA 4YUVA 3RSZA 4AJPA 5BSWA 1I7DA 4NOKA 3GLGA 2Z58A 5HE8A 2LKCA 1F1JA 3K0FA 1XP8A 1V6CA 3K6SB 5CA1B 5JJKA 3K6JA 4OQMA 3OHPA 3OQVA 4CLXA 1E3LA 2GKOA 2CBGA 3IHWA 3NGXA 5JFGA 3RWOA 3K3PA 2QL9A 2R44A 2WJ4A 3IODA 2PX8A 3N2YA 4H08A 2BISA 4CQJA 3A6KA 3H86A 4NHOA 5PGMA 3W79A 4S35A 4EAQA 4ESVA 5CHEA 5HZHA 5ER9A 3PXAA 3LW7A 5D5QA 3E3LA 5K0ZA 1JL3A 1PF7E 2GN9A 1CCWA 1PT7A 1NHWA 3U9LA 4AWXA 1JKJA 1WPXA 1KPGA 1QJ4A 2NYRA 3IUSA 4YA6A 1N2XA 4JMLA 4IIYA 4G0YA 3QHQA 3VZSA 4UNRA 1KPIA 1UK8A 4MV3A 3QMWA 4TLCA 3ZJVA 2GBLA 1HX7A 3SZOA 1CU1A 1V43A 1LI4A 2Q3BA 1E0AA 1NDUA 1X13A 3O4RA 4NOMA 2JLBA 2RH5A 3BXOA 1GUBA 3X44A 3VBCA 5DVZA 4C20A 2ABWA 3B6MA 4E5KA 1XTBA 3BGIA 3OZCA 4F2DA 2QMHA 3C3DA 3AWIA 3TLMA 1HORA 1IB0A 1XP5A 1P5ZB 5FAXA 1QGOA 2XD9A 3JQEA 2G3YA 2PCLA 1ULHA 1X94A 1WV1A 2YTZA 3HL0A 3QOFA 1OFVA 4M8NE 4PLYA 4ZJYA 2BM1A 1O58A 5FYDA 3NW9A 1EMDA 4HTFA 1N5DA 2Q4OA 1OA0A 2H6EA 2V0CA 3IT1A 1S8AA 1NBME 4CTNA 3DEIA 4GOXA 1IG3A 3D0OA 3RT1A 4C7BA 4Q24A 5DN6A 5EWMA 2W70A 3SC4A 1Z0SA 2AK2A 3KQTA 3HZRA 4FYYA 4QGBA 3FVTA 4GSYA 1E7RA 1R6VA 5TV2A 3K9BA 3D02A 3HK2A 2UZ0A 3LM8A 1PWZA 3HVUA 1Y3BE 2XUGA 5DHUA 5GZ6A 3L8MA 1G20E 1HM5A 4IR7A 4HDKB 4QBHA 1Z17A 4G4SO 4Y6LA 3UMVA 1D6MA 3NWBA 4XTCS 2BGTA 2COUA 1FMTA 1YDMA 4MVJH 4U7TB 4RPHA 2G1KA 3D5EA 1KI8A 3G49A 1IEXA 1SZJG 3DDWA 3ACBA 1JIQA 3LLSA 2OG2A 2OTCA 4MLCA 2ONYA 1QHIA 3GJYA 3A9SA 4PPQA 3E5RA 4UTPA 5AO9A 4NLLA 3P9NA 5LU8A 3EXHB 3R9WA 5HFJA 1L5QA 1NE2A 4GGMX 4LYYA 4XIFA 1B0PA 4C3ZA 1MUUA 4GOJA 5DSTA 1YK0A 2VPZA 1DDGA 1MAHA 1UMBA 2BFEA 1LQTA 2NACA 3GNQA 3IXLA 3KQPA 3KT8A 3BDIA 4X8HA 2QORA 5DBIA 3WJ2A 2DR2A 4AXBA 2FFQA 4WFKA 1QDEA 2IE0A 2HXSA 4TMYA 2G67A 1EFKA 2JFYA 3FDZA 3NB0A 4QUBA 4WN9B 5FHRA 5KCMA 3SXUB 3CUSA 1D0SA 4US2R 4I5IA 5KU1A 3LUFA 2P2NA 2PKXA 2LVBA 2RGAA 4MS3B 3KZNA 3BJMA 3IDQA 1IZZA 1KQPA 2F3UA 1NJ8A 2HWYA 2WAXA 4HQRA 1UFVA 5DN6D 1K9VF 1U0JA 2GRAA 3GG2A 3O4JA 3KSAC 1QVVA 4NXMB 2AD1A 4AWAA 4A0RA 4XVUA 2ZJBA 3VKUA 5CFNA 1HPLA 2Q3JA 4A1FA 5FBHA 2J3DA 4H60A 2PUVA 2X6RA 1PJAA 4LSWA 3ZHXA 1GQQA 1SVKA 4AUEA 5JJIA 1GL3A 2CEAA 1LZLA 2AC2A 2ZPTX 2X4DA 4GRDA 2J0VA 3SQMA 3HBJA 3SQDA 3C6QA 1OCEA 1DI0A 4EWLA 3V1UA 4I8XA 2WP8J 1SOAA 1LX7A 4EB6B 1M6VA 3IAM6 1QS0B 2TMYA 1T15A 1T0BA 2OAGA 2QS9A 2WUEA 3CLSD 1VHDA 3CR8A 3JRNA 3JY6A 1ODTC 4PSVA 4US1R 5TPWA 1A8IA 4ZHQB 4QYSA 1J22A 4KV9A 3AHHA 2EWWA 5AK6A 1N8KA 2QTVA 1JIIA 3F6PA 2WUVA 4DAEA 3NNSA 3BD9A 3KQLA 3I9FA 4DCJA 1H9BA 3E7FA 1QVRA 1SBNE 2EBWA 2XE7A 4F9EA 5EEHA 1GUYA 3L7JA 4NULA 3KC2A 2PSDA 1K68A 2FW6A 3GG9A 2WG2A 1WSAA 2FFJA 1ADJA 2FI1A 1YDGA 3I42A 3IE2A 3O93A 1SC1A 4YAWA 4DDWA 5KTRA 5M7EA 5AMXA 3M89A 3FLBA 5TMBA 4DCGA 3H2IA 3NHUA 4AY3A 3GU3A 3JQAA 1IBMB 5TMDA 1R6XA 1PFWA 2BH2A 1QHYA 4H7FA 4LDQA 1SHLA 2DQSA 4F6LA 4PZLA 1YB2A 1Z6PA 4R4JA 4CIWA 5JMOA 1V5GA 4ZOBA 3TMAA 2HUNA 2QD5A 2A3NA 1UPTA 3GEGA 3GDOA 4RF4A 3OTOB 2Y1XA 2FW0A 3PNMA 4NBRA 4CCYB 2P40A 1GGMA 1RHJA 2GAIA 3M5PA 4ODIA 3W5DA 3ZGYA 1QE3A 4EG6A 3H13A 1ZI9A 2UV8A 3QU2A 4ARUA 4CIDA 3UTCA 4ZC8A 1IBLB 1N7GA 3UK7A 1QJCA 2R6JA 3TRJA 1LTKA 4CN8A 4FJ1A 5HR5A 5AVJA 3HG7A 4YJFB 4Y2HA 2BUCA 2O4UX 4DDVA 3LVBA 3CLVA 4ERXA 1RWWA 3T9CA 1IJBA 1R5OA 4K87A 2QRPA 1RQNA 3OICA 4IIHA 3ACDA 5CVEA 2C59A 2QPAA 3HI6A 1NNEA 3DUWA 1XQ1A 1T3ZA 4I4TB 4G6ZA 3O6VA 1MC8A 1X86B 2Q1SA 4L4ZA 2WRZA 4R3UC 3GV0A 5HFAA 4V1CB 5JEDA 2JLQA 2IY7A 2B35A 4ZOQI 4HS4A 2R8ZA 3AI1A 1A1SA 2BEUA 4DMKA 5MHTA 4CM6A 3CVXA 1KZHA 3F49S 3G85A 1BMQA 4EUSA 1X1RA 5AHOA 2CCJA 4XWWA 5EMJA 2F7SA 4KRGA 3JQAD 4ZOLF 4DM7A 2VK8A 2AQKA 2WLTA 3P32A 3TOXA 5LXTA 2UVPB 4ALMA 3RRJA 5K6TA 4MQ5A 5K0BA 3HB9A 1UMDA 3W77A 4KVZA 1E2MA 2R7AA 4CEHB 2W58A 3ZC3A 5A3RA 1REQA 1OF1A 2JLVA 1YZHA 3NLLA 4ND6A 4XX1A 1KOFA 5E95A 5A5FA 4Z4IA 2EKBA 5TQJA 2QZZA 3QKUA 4F97A 5G53C 4RF5A 1CUBA 4BE4A 1BS9A 3LF1A 3V48A 3B1JA 3NXKA 4HAOA 2RJ3A 5DPMA 2LBPA 3ROKA 3WGOA 3WAJA 1P7CA 2UZIR 2FMUA 4NYMQ 3AEQB 1BVHA 2F1IA 2FWPA 1C9DB 2HMSA 2XIJA 4HH0A 3WP1B 4DJJA 4AJEA 4ENVA 8AT1A 3DHVA 1IDN1 1WO8A 1GARA 1ECGA 2Q2NA 4LHEA 3WKEA 4DCTA 3M49A 2A59A 1CVRA 2XADA 3NO4A 4DGSA 5IG2A 2H85A 4YP5A 1B26A 3SX2A 2DWPA 2R6CA 4DGQA 3HO1A 4OHYA 3O91A 3RQSA 3WSTA 3F8WA 1H6CA 5TC4A 3RHZA 2YX1A 3JS5A 3TQTA 4DLBA 4BX3A 4HWTA 4EHFA 4IM7A 1WHTB 2D1SA 4Q9LA 1D4OA 4HPWA 5BQFA 1XRNA 2OB2A 5GINE 3EH2A 3GLGB 2YV1A 1P9RA 2IA5A 2QRMA 1TZJA 4QDXA 3K0FB 5CCEA 1GXSA 1I3NA 1WB6A 4Q3AA 1FFAA 3UF0A 1NBAA 1USVA 2QDXA 3DDUA 1AURA 3GRUA 3U3JA 2EGHA 1V39A 2VL7A 4LMAA 2IH2A 3GLSA 1S4QA 4QHYA 4FFWA 3PFBA 4HD8A 1M1UA 1TTTA 4W7HA 3KPVA 4KSCA 2FWIA 1RXCA 2EZ9A 5EXXA 2PZBA 3V8VA 1V4NA 3JQDA 1GRNA 2NNLD 4TTSA 4BTEA 4CTKA 4P0PB 4ALLA 5FV7A 1QK3A 3AFGA 1U8ZA 1T9GR 4HWGA 4F85A 4DV5B 1YRWA 1JI3A 3OT1A 4J9VA 5EZYF 1R1DA 1JKJB 2AF4C 2YVAA 4S2UA 4ZEXA 3R23A 1UZUA 2ZWPA 3VVCA 4F2WA 2QRVB 2W8ZA 2XUDA 1AUPA 3UJ7A 2PZJA 2A94A 3H84A 3E27A 4DIDA 2PUBA 3N2ZB 4G2TA 4R68A 4WLFA 4R81A 1V16A 4V0OA 1DUSA 4RGYA 3U4AA 1KZ7B 4EGAA 4ROSA 3WBJA 1MP0A 1BRMA 1S4MA 5BOVA 1WR8A 4YI5A 3RQIA 2IP2A 5DI3A 2XIQA 1J39A 5ED0A 1OH7A 3GRKA 3OZUA 1YR7A 3KV3O 4G8DA 5E4FA 4ZV7A 4D99A 4XQ9A 3TR5A 5JZ9A 4NAHA 3SWWA 3RH0A 1BKDR 4OFZA 1SUBA 5IAGA 3DBVO 2R8PA 2WJWA 4OSPA 1UQRA 2W90A 1SC6A 3DTTA 1JLRA 1ZM2A 2YMLA 3VR5A 3WGUA 1GGEA 2BHTA 4U6QA 1Q0HA 4ETMA 3GMTA 3D81A 4HTFB 1CUIA 1E1DA 2C1ZA 4TXHA 4FOTA 4LYHA 5F2EA 4EQZA 5MGBA 1CYEA 3L43A 4TLDA 1I4EB 4TV8A 4IFIA 2FX2A 4BQRA 5ECWA 4IW3B 4L8GA 5EWMB 4O8ZA 4PWZA 1GVHA 1TAQA 1TF5A 3I53A 4YJHA 4F04A 2D3TA 2A84A 3OPYA 4C78A 3DL7A 3D3JA 3E1GA 3FTCA 3M2PA 3M6WA 4MITA 3ZEIA 1Y4DE 2OR3A 2PGIA 3KHUA 3ONNA 4TKZA 1U8XX 3VTAA 2YW2A 1T3SA 5JC1A 3JTMA 1NBHA 4EJSC 3AWDA 2ZJ5A 4LGYA 1G5QA 1VP9A 2XMPA 1T8RA 4I50A 3PX7A 1TD1A 3E9ZA 4CKBA 5IM5A 1OXXK 4A5SA 1M7HA 4TL7A 2X1VA 3ROMA 2V4MA 2NP7A 2FFBA 4EI8A 3ZKWA 2YFQA 3H5WA 3PNKA 2V1XA 2CSUA 3OCXA 1VLLA 2XCQA 4ZDKA 1M2KA 1X7YA 3V2IA 4I08A 1F2TA 4KKVA 2PRZA 4R0NA 1YFZA 1UZMA 2PZEA 2XQKA 2ODAA 2H4WA 4C2TA 2EVWX 4XYBA 2G76A 5GGYA 1UMBB 3QVGA 2BFEB 3CUKA 3WIOA 3SM9A 2PGNA 4GMGA 3TSAA 3VR5D 1D1TA 3FDZB 4REOA 1D8AA 3ZYZA 4C5CA 3RU9A 2YIJA 3JX9A 5L7TA 3M1YA 4X20A 4JYBA 4RTRA 3FB1A 2LCIA 3AM3A 3TBKA 2W6QA 3GJZA 3M8KA 1W1WA 1IXKA 4FR0A 4HGQA 3RG2A 4B3IA 1RC8A 3VPHA 4WESA 3T4PA 1ZD4A 1PYOA 4RL4A 5LU9A 2BGUA 2XOEA 4IF6A 3T7KA 1P44A 1EWKA 3LNCA 1U2DA 2BP7A 2F3SA 4TMZA 3JWPA 2FHSA 1X9GA 3G0GA 1QIDA 4NICA 2F67A 1E9CA 2P9CA 2RI1A 3W4JA 1IBSA 5I9IA 4P08A 1Y6JA 3PC8C 1NYLA 3HY4A 4Z4FA 1BJKA 3UT6A 2JGRA 4A2WA 2YY6A 2Q7OE 2G5CA 3MBIA 3GLQA 4XIJA 4AZ0A 3I6BA 1BDHA 1M6VB 1KH1A 2X13A 3F1KA 4YP0A 4WUVA 5TPWB 4IYJA 2C5AA 2YIMA 3PWSA 2EF0A 5A4AA 3WIUA 4R2WA 1ZJJA 2QTVB 2GT1A 4F7WA 3GN2A 3P26A 1VBFA 5F51A 1ZK4A 1VL6A 2H0RA 4FFVA 4BVLA 1VZ3A 5JZVA 2P79A 3CJTA 1E5VA 4FUQA 5E6SA 4EABA 5JXJA 1O96A 2C7QA 4GWGA 4Z7JA 3HJUA 1XQYA 1VG8A 4QBGB 1FJXA 1NF8A 3K72B 5CXXA 1YUNA 3HUDA 3PC2A 1ACLA 5EQJB 2BCEA 3I52A 3KFVA 4UU7A 3CB2A 4DV3B 1L7BA 4OLFA 2Z83A 3JQAB 3K1YA 3WLQA 4BWGA 1WIWA 5AVYA 3A6GA 4LXTA 4OK6A 5LPNA 1UZNA 4ZK6A 3WNZA 5EMHA 2I5PO 4FHEA 1NU6A 1W29A 2BI7A 3BGWA 4JI1B 3PC4A 4X61A 1USWA 4FYJA 2XXJA 2VZ8A 3UW1A 2F59A 1F5NA 1ZY2A 4NYIR 5I7EA 4JT9A 2OGZA 3Q7TA 2WUWE 3CVUA 3DOUA 4XVQA 5I9BA 4K0KB 3ESRA 3GGPA 7GPBA 5HKKA 1WDLA 2HJWA 1YQ9A 5E2IA 3TNLA 3R6GA 1I2BA 1XD2A 3UJBA 1T9AA 3WL8A 1CPYA 1EZ4A 4BV2A 4D43A 1TUGA 3QOYA 4N4AA 4PHGA 3JV7A 4HEA6 3HPRA 4DIKA 3CMCO 3E7XA 2RGUA 3PDHA 4IO1A 3ILHA 1DJNA 1J24A 2XF8A 5LLSA 1OWMA 2QLFA 4UEKA 1M5RA 1G6Q1 4CF3A 1IBRA 5CVDA 5D00A 5A1JA 2JKVA 2FX5A 3DPIA 1SURA 1UOPA 5F78A 2BEUB 2O54A 1ITZA 1KHHA 3WV5A 2LR0A 2NSJA 1O6ZA 1J2UA 4RNCA 1U3CA 4R7ZA 4UHCA 1J20A 1R0SA 1QP0A 2ZBRA 3DL0A 3H1TA 1NLZA 3PEEA 3GVIA 2XB6A 5K4AA 3L92A 3PXDA 3Q3IA 4DPMA 4KNVA 3WGIA 1H5NA 2JI7A 1K88A 4ZODA 1TVKA 1UMDB 1UP7A 4RMJA 3O3OB 4TT3A 5I7AA 4O0MA 4OJKA 3ZLJA 4CMBA 5EIEA 3M4XA 1REQB 3ODGA 2F1KA 2H57A 2RHTA 1S2LA 5ULLA 4JP5A 4CUJA 1RLMA 1V45E 3ORRA 2W4MA 4FT2A 2Q6LA 5J40A 1PSWA 1F2DA 2XDQA 3O9MA 4M8SA 2DAPA 5TNXA 4PLZA 3A0UA 5HKKD 1HOXA 3W0LB 2VHCA 4FEYA 4N12A 3GQBA 1ANKA 3RUEA 3NOQA 5AM5A 3DLCA 3PHBE 1L4EA 4P98A 2YC4C 1IUKA 5BN5A 1XI2A 4K0RA 3L1UA 4ZYTA 3FUUA 1XPUA 4F45A 3HO6A 3PFWO 2IUUA 1J5XA 1MT3A 3F5QA 3B1VA 3S27A 4MQEA 1N2CE 3JD3A 4C3VA 3ZCSA 3EGIA 1NPTO 1XXLA 4WWHA 3WWPA 1KI3A 4PAGA 5ADVA 5IKMA 4N5LA 2A4MA 1KC3A 4IH1A 3RK4A 4EHAA 2FG5A 1RKBA 4DG9A 1IBCA 3T52A 4AB1A 5EC8A 4S2EA 4G25A 1HE1C 2EEPA 2ON6A 4CKWA 1RQRA 1WXQA 1GXSB 3IHLA 2R00A 2ZCVA 5CLGA 1Z6ZA 4BFXA 2Q5FA 3HXKA 5IF3A 2IBTA 3AU8A 3SGLA 2L69A 1KJ9A 4R0MA 1EU1A 3GPIA 3LX8A 3NP7A 2P77A 4NQRA 1GKYA 4RGQA 3MCVA 3WMXA 3ETLA 4FDAA 4RIHA 4QL3A 2OOSA 4H77A 4LCEA 5DNEA 1WNTA 4QUGA 3KETA 2CLMB 1QYCA 2NQTA 4RH0A 2WG1A 4HDMB 1OREA 1FNSA 4TT3D 3TZ6A 1X38A 2I3ZA 3HRKA 4CV2A 1ZD5A 3OT1B 2I1LA 3A6EA 3ZTWA 4C4AA 1QHXA 1UK9A 3BQNB 3OTQA 3CW8X 4F3CA 5J2TF 4ZOLA 1XCOA 1GFSA 2GD6A 4GP7A 4GM0A 4L9SA 4MA0A 4KX3A 4WOPA 3TRHA 3X43A 1P5HA 3PHHA 2ZXUA 4D0GA 1IOLA 2MSKA 1V16B 3FM9A 4OXKA 3V97A 2RGNA 5EJ5A 4G65A 4FFOA 2YFKA 1SUWA 5DI3B 3RREA 3LQ1A 4NCIA 1QFSA 1XCLA 1OFUX 4H1HA 4IHAA 2ZRIA 1L5NA 3HJGA 3BREA 3OKPA 2BKAA 2HJVA 5AW6A 3D4OA 4HLUA 1R4NA 4PG6A 1YFJA 5DHSA 4EB0A 4H9GA 3G1WA 3NWJA 3RBVA 2D1RA 1NMQA 2RGRA 3B6EA 3CE9A 3ZDZB 3HB0A 4QECA 4TV8B 4JX8A 3R3JA 3E9YA 3W78A 1EVYA 4H31A 2O2EA 2ZIZA 4HJXA 4YJHB 1OX4A 5BNFA 3SVLA 5E7JA 2K7ZA 4EITA 1COWA 4D6YA 4J2HA 5AUOB 2XUFA 1J06A 3GFSA 1XLTC 2PRSA 3LHIA 2H92A 2V96A 3JATA 2WWIA 4P3YA 1B15A 2GGSA 4L8LA 4EENA 2WF8A 3AO0B 3AV0B 3M1LA 4CKBB 4GM4A 3DNMA 4P4NA 4CKYA 4HNSA 1P0QA 4QQFA 4CU2A 4WOJA 5AJVB 3EVBA 2H07A 3H1PA 1MC5A 3B9BA 3ZKWB 5K51A 1SQFA 4GPBA 3EA4A 3NM6B 3QU5A 2EP7A 4BZQA 5JCOA 1X7YB 1F2TB 3TZKA 4Z4CA 4I4NA 4JYMA 4MWEA 1FTSA 2Z8YA 3NHPA 3LXRA 4PG7A 5KQLA 2WI8A 4EHHA 2H1LA 4TL9A 4B87A 1FP2A 3JWIA 4TTJA 4YIHA 3MTEA 3NTLA 1QRRA 1CZRA 3QVGB 4RKQA 4B6JA 2Q0HA 4KXUA 3Q88A 3I9KA 4MDHA 1KVRA 1F9AA 2P4UA 1UODA 3DWFA 4QASA 3GH1A 4LJ7A 4BN5A 5BNIA 1SU8A 1GNVA 5GVRA 2P1RA 3CEMA 1QPGA 4TKUA 3QI2A 4X20B 3TLGB 3OY7A 4EDHA 5C1BA 2IKSA 3G8YA 2HCRA 3FKSA 4YRJA 5CHYA 1G9TA 4LZNA 3CE6A 3DBIA 4WESB 4A6XA 4BVEA 4J29A 4L51A 1DJMA 5B1SA 1C7FA 2IYQA 1JQEA 1JSRA 2BP7B 5AI9A 4ZQFA 1HLPA 1X1BA 1Z6YA 1PTKA 1VBKA 3ZZ0A 4F06A 3LY5A 3G8CA 4E11A 1YZ3A 4IIXA 4IV5A 3WKCA 1YFLA 2AG6A 4I5EA 3OO1A 3OH8A 4DRZA 1AKMA 1C0KA 1ND5A 2M2IA 5JAIA 2OO7A 3FFXA 2R2GA 3C24A 1WDMA 3ASZA 1JR3E 2BC9A 2Q5LA 3CZMA 3I9V6 3OESA 4RW0A 3ZUPA 1K6XA 1ESMA 2IEGA 4U0KA 4AZWA 3HEBA 3A6DA 4P33A 3C3MA 3P9YA 3QBEA 1YO6A 1GNRA 1HYHA 4JAVC 4NH4A 3ZJ5A 4BN0A 3GLFB 2KMLA 4X3PA 1R37A 4ML3A 3BHNA 3Q3VA 1FL9A 3JYHA 4KGDA 4YIKA 3GFTA 1YL6A 1UFKA 3PXCX 2B82A 2JRCA 2IWRA 2JIPA 1FFSA 1J2RA 5E6SB 1E1CA 4H0NA 1O96B 4R1NA 4ZMRA 2DLDA 1KFCB 4V0ME 1DADA 4YRAA 4LXQA 1I0ZA 3CRNA 3WL5A 4IDCA 1W581 2HQOA 3K16A 2GZAA 4PZUA 3VTKA 2VNHA 3MLEA 1YCHA 4MRVA 4EYGA 3QVKA 1FP4A 1GADO 2RG1A 3IX7A 1OVGA 1T43A 5IANA 1KTIA 1G0NA 1SCAA 1IN4A 1KMMA 4GNRA 5IFKA 4OHXA 3LTEA 4WVLA 5ESXA 4ARBA 3FKSD 5CB6A 5GADl 2YKGA 1BG6A 3N3BC 1ADFA 1BFKA 3L4BC 3FWPA 2A1TS 1J7KA 1QYRA 1VIAA 4UXJA 2FOXA 1Y9DA 3G7SA 2E55A 1I1QB 1PR0A 4B6GA 1W5BA 2FSHA 3NM5A 5AW4A 5GIOE 3GCXA 3PVSA 3NMUF 3C6ZA 4N3CA 3U19A 3AETA 1O4VA 3ZV6A 5CA0F 2VTEA 3MCZA 4CM3A 5BW4A 4U6NA 1M1XB 3NDPA 2NV2B 3M9XA 1EUZA 4HDCA 3OFND 1JHMA 1XEWX 4OHCA 1UT8A 2VDOB 3DGEC 4MSUA 2QW1A 4CF4A 2HK6A 1XD2B 4FYXA 2PK3A 5FR2A 5JRJA 5MFZA 2ORVA 3L8HA 4TS9A 5DNUA 2IUEA 1H69A 3I3SR 4UARA 3TB4A 1C3VA 1LPNA 1YRLA 2TS1A 2VT3A 2PXXA 4NBNA 5FTWA 1Z37A 1PW7A 2N1MA 1G4HA 1U2SA 1WKCA 3OFJA 1CQIA 2E82A 3MTQA 4KBFA 2CJYA 1JX6A 3W5UA 5HSGA 2OVBA 3ZUGA 4D9FA 5T41A 1WJGA 4FI3C 3LA8A 1KEVA 1KZ9A 2AOXA 3VHQA 3PA6A 3TCNA 1WCYA 3KTAA 4E3WA 4OOEA 3ON5A 4JB0A 3RG8A 3UOWA 1BJRE 2AVNA 2FFRA 1CY6A 3BN3A 2EZTA 4RHEA 1TTQB 4IJKA 3ZVRA 1N5OX 4BLTA 2GF9A 5DK4A 5AJUA 5JBIA 2QAIA 3NI2A 4NZMA 4DQDA 5F3WB 1SUAA 3HUEA 13PKA 4TMTA 4EJ2A 1IM5A 1KU6A 4B85A 2A78A 4PX5A 1NUAA 4XB1A 1S1MA 1KEPA 2AI3A 3S8YA 3U16A 4DIUA 5KOHA 1JILA 2QGNA 1B0AA 2HRBA 3W2FA 5LCXA 1TVKB 5F9FA 4BNFA 4QM6A 4FNGA 4QLOA 3KRTA 1L8AA 1G8SA 4EEKA 4YRIA 3FMGA 4GRIA 4LHYA 3EMVA 3LPMA 4IPTA 2VS1A 1ST2A 3T1TA 2ZSJA 3A7DA 2V3CC 5FPQA 5JLJA 1YJBA 2FZVA 1KYVA 4IDFA 2Y2UA 5CURA 2XDQB 1K66A 4P36A 2ZEJA 4E09A 2CZQA 4Y0AA 3GQBB 3D7KA 5BN5B 4JA0A 3OZWA 4R1TA 5E0OA 1FFCA 1E2IA 2Z1DA 1BZYA 1TO6A 2O2DA 2YVQA 1BX1A 2SKCA 5CNKA 1YE5A 3C5VA 3CEPB 2R6DA 4BGVA 2P35A 3AJ8A 1MCZA 3FPSA 4MQEB 4BO5A 4O2AF 3EGXA 1T35A 1XNHA 1BAPA 1GV1A 2XTAA 4ND5A 1CUHA 2LNDA 2BONA 2WTMA 1O57A 5EQTA 4BNKA 2C83A 5CLIA 4ZA2A 3KB2A 5E3HA 4P3XA 1INLA 1E9EA 1GG9A 2PKEA 3DMDA 3IALA 5KTYA 2O8VA 5G1PA 3A11A 1PLKA 2QLNA 4NMXB 1SWWA 2OBBA 5K0EA 1H94A 4PX9A 3U1VA 4BNXA 1IY2A 2J41A 2ZVDA 5FO0A 4EH1A 4ZFNA 5BSEA 8GPBA 1DEAA 1QGZA 2DBVO 2NAFA 2V7TA 3Q3CA 3KX2A 1HFJA 2I7DA 3R5XA 1LNQA 4F9GA 5HM6A 4P9NA 3D2BA 5KI6A 3PHGA 1QYDA 1RYHA 3RC1A 4OQXA 4U3JA 3UUGA 2CFRA 5KKCA 2Q5OA 4Z86A 2AE2A 1AS2A 3VPBA 1VHTA 2BRUC 4PZEA 3BXXA 4ZTUB 1MT0A 3MC1A 3DNPA 3PI6A 4ZOLB 4D97A 2RI0A 1KC1A 2PA3A 4B80A 1NNSA 3FY4A 4F4CA 2DFKB 5AJHA 2HYDA 4RETA 1X7WA 2QSZA 1Y3DE 2WT4A 1JT9A 3AI3A 2LXNA 2AV6A 5KYGA 2Q3MA 1M0SA 3K70C 3PT9A 1U04A 5F2KA 2ODNA 4WBSA 4FGLA 4M21A 4KNYA 4MUGA 4EJ0A 3W1VA 3U48A 2B25A 1GR0A 6ADHA 4G36A 3KJHA 2BMVA 1FTNA 3ML1A 3WB1A 2J32A 4D9EA 5EUCA 3TAHA 2R97A 3IE0A 1R4NB 2X41A 3LBAA 4F6RA 3QGMA 3NBUA 3ME5A 4RZ2A 3LDAA 1SH7A 2QU8A 3IIIA 4B3BA 3GAZA 4KXFB 2FSVC 1C0EA 2O5RA 2R65A 2HRDA 1LSUA 4H7PA 4MHTA 1R9JA 3E18A 4RTKA 1SUIA 2XBUA 3BWMA 1KVTA 2XOXA 1OX4B 5B36A 2QXTA 5LB2A 4CV1A 1YHNA 1GAEO 2ZTUA 4Q4DA 4L7VA 4ZO4A