1J99A

Crystal structure of human dehydroepiandrosterone sulfotransferase in complex with substrate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFLKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKTQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human dehydroepiandrosterone sulphotransferase in complex with substrate.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ALCOHOL SULFOTRANSFERASE
total genus 94
structure length 284
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2001-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j99A00
2YJTD 1WXQA 1Q1ZA 1NRJB 3THYB 4P3YA 4LZZA 3TRFA 4V0LA 2BC9A 1OW3B 4FCVA 4ARZB 2HUPA 1ZIPA 1VG8A 2GF0A 2Q3MA 4OHXA 4V03A 3EZ2A 3CRVA 4HAYA 1Q1EA 2V1XA 3ZIAA 1OFIA 2QTHA 5CLQA 5KPJA 1G5RA 3DMDA 3OIVA 1DEKA 5IK2A 1G3MA 5B30A 1II8A 1R0XA 1FUKA 2R6DA 5CITA 1OFTA 2BKEA 2ATVA 2CMKA 1X3SA 1SVWA 1VHTA 2P65A 721PA 4TQAA 1TADA 1NMYA 4V0KA 1K8RA 3FKQA 3K09C 2PBRA 3HR8A 2H1LA 3TJZA 2ERYA 2DFKB 1OIVA 4RD0A 3EXAA 3EPLA 1WBDA 3VTKA 1OKKD 4ACBA 2LWIA 2QBYB 4G5SA 3DM5A 4IW3B 3GFPA 4M4SA 2YC2C 4AKEA 2IYYA 4DLWA 4C0LA 2O0JA 2CHVA 2O52A 2A30A 4IOMA 4PHTA 1XMVA 3RWOA 2WTUA 2WBLC 3N70A 3IKJA 1JJVA 2WJYA 5KNCA 3O8RA 3THWB 4Y0AA 3CRRA 5C46F 4B3BA 4FI3C 1KAOA 1E32A 1E0AA 3EWSA 5JS7A 2FV8A 4TL9A 3R20A 3K70C 1R0ZA 2A5GA 2KE5A 3VU9B 4UXHA 4XVRA 3PUZA 2JIZA 1XF9A 2OCYC 1SXJD 2QU8A 4JLOA 1E9CA 4PQYA 5FPTA 1BYUA 4KCGA 4UNNA 3WMGA 3U6KA 5IRCD 2GEUA 4RKEA 1KKMA 5DLQC 3IGFA 4TLBA 4QNRA 5H1YA 4BFYA 2FF7A 2RAPA 1N3BA 1EWQA 3D6TB 1NBMD 4ESHA 3NKVA 4B44A 1RFLA 1P9WA 1P73A 2OCBA 3PIRA 2ZSEA 4LPKA 4P4UA 1X8JA 3RWMB 1ELOA 1NNEA 1IN8A 2FGJA 2RGCA 2IYWA 4NE2A 4W5JA 4PHGA 2O0KA 3P4XA 5SZJA 3TGPA 1W48A 1NKSA 3QEOA 4JLKA 1SHZA 5TDHA 2HDNB 2ODNA 4A4DA 2C77A 1OYYA 2JJ2A 5FOTA 1F2TB 3WRXC 1VCNA 3AKCA 1IHUA 2FEOA 1IXZA 4OQFA 2AKYA 1XBTA 2Z0MA 4BLQA 3U7HB 1K5GA 4X8LA 3X1DA 1VG0B 4JVSB 1HT2E 2PL3A 2C8VA 5C2JB 1WE2A 2JIZD 1WP9A 2Z43A 2WPDD 2ZUCA 4DCNA 4TT3D 4RSGA 4JSYA 4IFBA 1US8A 5FBWB 3U61B 1N0UA 2WWXA 2XTNA 4K8OA 4PZLA 2O8DA 1KI2A 1RZ3A 2ZYWX 5BXQC 1W46A 1UPTA 1OXXK 4HLDA 4C0AC 3FMIA 4C0HA 1MO3A 1N6OA 4LV8B 5EP4A 1N6PA 4OI4A 4URUR 4RFVA 2BBSA 3SYKA 1TU4A 1YR9A 3AVPA 3GLIA 4JS0A 3NHAA 3L2OB 4CEJB 3Q72A 4FCTA 5CIQA 3ZVLA 3A6PC 2VSXA 3C41J 2PLFA 3GJXC 1PLJA 3P32A 4LYJA 1ESMA 1YVDA 3DM9B 3W5IA 3A4LA 3CPHA 2IS4A 2IHYA 3GLGE 1FW6A 5JWRA 4NL4H 4GSYA 1ZUIA 3M0EA 4ASUD 1UKVY 4E07A 1QDEA 1GRNA 1F60A 1NJGA 2N1BA 2J7PA 1AKYA 2IF2A 3A58B 4V0MA 1UEIA 2ZR9A 5KOYA 3HYRA 2ZROA 2GCPA 3K0EA 4TL7A 4Q9LA 4GP7A 4L5BA 3ZYCA 2J0SA 4DLYA 1G20E 2CK3A 1T8UA 2J1LA 4PHFA 2VBCA 3RDPA 3ND8A 2X19A 2J0UB 4NYJR 1OXUA 3N2IA 4DZZA 1OH6A 1E96A 2IYZA 2Q9AA 5FUWA 1G7SA 3QG5A 4FMCB 2C9CA 3NBFA 2V6IA 4O3MA 3NHBA 1UBEA 2DFLA 1VIAA 3PENA 2BJVA 2G1KA 5E7MA 3ZLJA 1G7CA 3P27A 4DSTA 1U9IA 2IXFA 1ZVQA 4UNPA 2GXSA 2AD5A 5J4KA 4WBSA 4BZXA 3ICQB 1CR1A 2J41A 2YZ2A 4Q1DA 5ANRB 4BZPA 2VHJA 1UJ2A 1DVRA 4U02A 4DDWA 2CL6X 2FA9A 1E2KA 1YZKA 2F3RA 4GOXA 2GA8A 2OV2A 2QSZA 4M1SA 3VHLB 4HAUA 2JLSA 1K5DA 1EFUA 1LFDB 3OE7A 2LKCA 2AFIE 3TVDA 3X1YA 1T6NA 2A78A 2JATA 2V8OA 1R6BX 5CYOA 5DHAA 5FR1A 2VP4A 2ZI7A 4HAWA 4TZ0A 4YMWA 5CK5A 1G41A 5FPSA 4Q4AB 2LCFA 5D3MB 4ZV4A 1MO4A 1XD9A 4TQUS 3T15A 1NVVQ 5JI2E 2XB4A 5IK2D 5TMPA 3VAAA 3RNLA 2WZQA 1V43A 1XCGB 4Z8YA 3GPLA 1Z22A 3AVYA 5FUVA 4MITA 4GDFA 3MRSA 2J5XA 2GEDA 3CX8A 1EWRA 3GLHB 1OXTA 4TYPA 2QPOA 1LTQA 4B74A 4HZUA 4PX9A 1VECA 4KJZA 3ZZ0A 3SDZA 1I2DA 4MQBA 1FTSA 1RRPA 3CZQA 3H86A 3LWNA 3WHLA 3WYAA 2WSSA 4I1UA 1SXJE 8OHMA 5G53C 4Y0VA 1E9AA 3REGA 2Q9BA 3LXXA 4Q4HB 5E4FA 2YYZA 2PCLA 2HF9A 1JR3A 1GNRA 4POAA 3CR8A 3CBQA 1COWD 2GESA 2REBA 5SZHB 5JLJA 2JDIA 1VHLA 1ZM2A 2ZJYA 4NCIA 5TXGA 2ZRBA 4DLXA 4IDNA 2V3CC 2ZANA 1Q3TA 3X1WA 1T0JB 2OFWA 3ZS9A 4MDFA 5JECA 5KDLA 5KPDA 4QG7A 5FPHA 2IUSA 2YC4C 1ZRHA 4N3NA 1XFAA 2N46A 4BFVA 2EQBA 3O8BA 4JL8A 3PUWA 2QTFA 3KKQA 2ZM5A 1C9KA 2AXPA 1EFHA 3CH4B 4JBWA 4AI6A 3CONA 4OBEA 1LF5A 2YWGA 2ZRHA 2G83A 5FTNA 2AD1A 3KXLA 1FNMA 2HJGA 3B5JA 1KIMA 5FI1B 1YJ5A 1J2JA 1PUIA 1CBUA 2C03A 2IX3A 4XIGS 3KKOA 2KI5A 1JI0A 2XNDA 4KFSA 2G1JA 3DOFA 4MYTA 3GD7A 1VG1A 5TV2A 5DIFA 1Z63A 2R8RA 4BWYA 2FEMA 2XZOA 3BGWA 2CJWB 3SJBA 3AKDA 3ETLA 1RIFA 1YKSA 2JA1A 3PUXA 1DG3A 5H70A 4BFZA 4NPHA 1KAGA 1M7HA 1DAFA 4LJ5A 1QRAA 1PUJA 2ZPTX 3SQWA 3UXMA 1IN5A 2MSEB 4ZIRA 2ZJ2A 1JQJC 3BRWD 1KO7A 2AXNA 3A4MA 4D82A 5EXSA 2FDCA 3G82C 1E9BA 4A2QA 1NI3A 1UKZA 1IBRA 4RZUA 3QPUA 5AWFC 3LW7A 3TSOA 2OILA 5JRJA 3QSYA 4GI7A 1TUEA 2QM8A 3UWOA 1ZM7A 2JLWA 2Q6TA 4TMTA 1JEEA 3RLFA 1E2DA 2EWVA 2H17A 5F9FA 4MKIA 4A15A 1F6BA 1CRPA 4Z1MD 2C2HA 1GM5A 2YWEA 2O8CB 1KO1A 4MRSA 4MA4A 3FVQA 1L2TA 4AY2A 2WPDA 4P4TA 3AP2A 1G19A 4WA7A 1GRQA 1E1RD 1BH2A 4AC9A 4TMWA 1Z29A 3CNLA 1FX0A 1E9FA 3KJHA 1KJYA 2I3BA 2LKDA 1YRAA 2V7QA 3M4YA 4DT1B 4ZCMA 2QENA 3NBYC 2C9OA 2Q0HA 5HCIA 4C4PA 1QVRA 3WYGA 3LQQA 1SVOA 1HQYE 4Q4AA 2ZAMA 5KNBA 5JWHA 4FWIB 2A3RA 4QHTA 2DWOA 2EFCB 5EUQB 1NVXQ 2QORA 2K5UA 4JLAA 1W4BA 3U3KA 2WSMA 3AF0A 1EFRD 2NG1A 3VKGA 4KV9A 4DXAA 4EUNA 1U0JA 4UXIA 4IOKA 2ZAOA 4Z1MA 5TVKA 4QM6A 3TW4A 2NO1A 2ZI6A 4P33A 1JXOA 3EC2A 2BDTA 1T3LA 5FOWA 5DI3B 3AGQA 1NBMA 4C0BA 2JJ1D 4B76A 4IDQA 1C4OA 3V00A 1E9SA 3KJEA 4CT4B 3SFVA 5A5GA 4DEXA 4PFSA 1SGWA 1GL7A 2J59A 1W5SA 3D7MA 1JAHA 4DBLC 4F38A 2IWRA 4QBHA 1GL9B 2F1HA 1HEIA 2ZJOA 2WHXA 2J3EA 1P2VA 1XTIA 2ZRFA 3FE2A 1L7VC 4EAQA 4NMMA 2BMJA 2QT0A 3TKLA 1X6VA 4M0LA 4XWAA 3L8YA 1YQTA 4M21A 3SHFA 4RCYA 5EQTA 2ZSDA 1Q57A 4DDUA 1H8EA 1U9IC 1IN6A 1II9A 4QRHA 5JWOA 1P2UA 3SU8A 4KYUA 4IXMA 2HJVA 3H84A 2JLRA 2WKQA 2RGGA 4I99A 4Z51A 3G0HA 2A2ZA 2ZITA 3ZVNA 2WOOA 4RKFA 4CW7A 1M7BA 2A5YB 1NN1A 3UK6A 4KBGA 4URWR 2WWGA 2C99A 4DLUA 1JAIA 1LNZA 3U3MA 4BEBA 5EUMA 3GJ3A 2CHQA 2JJ8A 1KY2A 2CLSA 4GRAA 1GNPA 1SVLA 3GLHE 4Q03A 1UBCA 5BYJA 4QHYA 1Z0JA 3WMEA 3UMFA 1ZU4A 3ZIAD 4G5RA 4D4LA 1NY6A 2P6RA 4JJZA 4LUCA 1R0YA 2ZREA 5J4HA 4PTLA 4DLVA 3H1TA 3DHWC 3KJGA 4OHZA 4QKQA 1EFRA 1RKBA 5JJLA 3C8UA 3MLEA 5EE3A 3FHOA 2G88A 2QMHA 2QUZA 3BIFA 3B9QA 3OAAA 1XJ0A 3LDAA 2B8TA 1JNYA 1HQCA 1NSFA 2VA8A 4W7SA 4C3ZA 3IEVA 2I1QA 2IEYA 4HB2A 3FOZA 1QHYA 2QY9A 1GFIA 5FH9A 3T34A 2IUUA 2QE7D 2RHMA 2JLZA 4HLQB 3K53A 4IEEA 3AB3A 3EIEA 3QXCA 1I4TD 5JJIA 3K9GA 4NYJQ 2HXSA 3KXIA 5FBLB 3QKRB 4FIDA 4M1OA 1LS6A 5B64A 2GCNA 4MGZR 3A36A 1U8ZA 1XEWY 2ZEJA 2G0TA 1UM8A 2BBWA 3KKPA 1BYIA 4FN5A 1GUAA 1ZMXA 2DWPA 5E7JA 1CXZA 4C30A 2CBZA 2VHQA 5JSZA 2CNWA 5H8WA 1VYUA 3AEZA 3VMFA 4YXWA 1W4RA 5EE0A 1NF3A 2IK8A 2PLRA 3CPJB 3QUSA 4AURA 1XMIA 3QY0A 1KNXA 1YZTA 1CJKC 1Z0KA 2ZI3A 2AKAB 1IOZA 3KFXA 2BWJA 2R9VA 4XVQA 4WXRA 5FTLA 1OHHD 1HURA 3DKVA 3GJ5A 3PEWA 5EE5B 3QXHA 3RVBA 1XJCA 1G17A 1RRFA 5JRZA 1AS3A 2GTPA 4G01B 4NTZA 3U5ZB 2ORWA 5JBQA 3T5DA 4IDOA 3VQTA 1FP6A 3OEED 1IY1A 1ZNZA 2G3YA 1S3GA 4XSGA 5FTJA 2XTZA 1W2GA 1UADA 1Z08A 4D0NA 3AUYA 4DT1A 4DC9A 1RE0A 1ZUNB 1ZC3A 2GJ8A 2VQSA 3I4LA 3IO5A 1GIAA 4L8GA 1E2IA 1QHHB 1E0JA 4HB3A 3OE7D 4GMDA 4ZO4A 3KXKA 4LJ4A 3IPXA 2O8CA 3RS2A 1SVMA 4JBXA 2EWWA 3BBPA 5JJKA 3ZZTA 3CRQA 1JR3E 1O87A 4JLDA 5BN5A 3R9XA 5JMTA 4LPSA 2Z4RA 4JYCA 2WJGA 5JI3E 1TF2A 1ZM3A 3W34A 2IL1A 2IBMA 3AKYA 4LC1A 4RFSA 4F93B 2CVFA 2OZEA 5FTKA 3UKDA 1IONA 2DFTA 4F91B 4C7OB 4QFMA 3LH5A 1SVKA 1XPUA 2BM0A 3K9NA 4DEYA 5K8UA 4Q1CA 3VR1A 3MWJA 4JKIA 5FL3A 2C04A 1HE8B 2OE2A 5DN6D 2QBYA 2FE4A 2WAXA 4PPGA 3UMRA 2VRWA 3QXJA 3THWA 3C7KA 1YR8A 1E98A 2CDNA 1XCMA 1E99A 3BK7A 1JR3D 4EPYA 4XD7A 2VYFA 4M1KA 2NO9A 2OBLA 2GAAA 1W0KD 2V4ZA 1VMAA 3T1QA 2WOJA 3H4MA 3UWKA 3EA0A 1NN5A 3OF5A 4JVNA 4NYMR 4RY2A 4LHZA 3HP1A 3QIAA 1GWNA 3QG1A 1EG7A 2AK2A 4Q7LA 1ZBDA 1NG9A 2FJUA 5KSYA 4LDJA 3GJ0A 4ZDJA 4QXAA 2QMUA 4GPTA 4LI0A 1O3YA 1XEXA 1DELA 1VYVA 2YWFA 2P0EA 4C0SA 4KITB 3MWYW 4JSTA 3D3QA 4MKFA 3LQRA 4AK9A 2OFXA 2ZSBA 3PXGA 421PA 5HKKD 3LLMA 2L0XA 3CUEF 1KI8A 4YDSA 5EP2A 3KKMA 2AR7A 2RGNC 4P32A 3U44B 1Q3HA 3CF2A 2QZ4A 1W0JA 1VDZA 2Z83A 4XWOA 4QJ3A 1KZGB 4QC2A 1F2UA 1ZC4A 1P75A 2W6IA 1BOFA 4D26A 2MSDB 3A1UA 2YHSA 5FOUA 1A1VA 1PLLA 3NC1C 1G18A 3QENA 4CF7A 2WJIA 2RGBA 3ZGXA 3O47A 1KK3A 3QPWA 1KSJA 2PZGA 2QAJA 3OIUA 2VLIA 4PC7A 1FZQA 3K9LA 1W0KA 3P26A 2PEZA 4AKIA 4OK5A 3CR7A 1E94E 4HB0A 1G8GA 1QHIA 1VTKA 2IYVA 3GQBA 1KI6A 5AUPB 1U8YA 2A9KA 2XJ9A 3Q5EA 3G5UA 1D2MA 4U7DA 3PEYA 2GWHA 2YOFA 3EW9A 1GKIA 3NTUA 2KBFA 2Q9CA 2V9PA 4HEJA 1RVDA 5TARA 4R2IA 4F92B 1DO2A 3E1SA 3RYTC 5HPYB 3EASA 4DIDA 4JYBA 2RGXA 3QOFA 1MR3F 2CCGA 3OIWA 1T8TA 3UIEA 3VR3A 3KQNA 2J45A 5J4YA 2KB0A 3I32A 4OK3A 1OH5A 2QGZA 5EP3A 1Z6XA 4B43A 3U3RA 2D2EA 5EE9A 4NBSA 3GJ7A 5EXTA 5DE3A 2IS6A 3K0CA 2OO7A 4PC3A 4CEHB 4X8MA 1LVGA 2V54A 3C5HA 4F4JA 4DUGA 3ZD7A 1US8B 3X2SA 4N0DA 2GBLA 2X2FA 5LBIA 1NBME 1P60A 2IYXA 4YMTA 3FMOB 4QHSA 4D25A 4JZKA 2FOLA 1E2LA 2ZSAA 4M1TA 3B1YA 4R71A 3NEJA 4BZQA 1UKEA 4O25A 3GLFB 1F48A 1QHGA 1W5TA 2IYTA 5AJWA 1WMSA 1TX4B 1JR6A 5DH9A 4EJSC 4OQNA 1E2NA 2WJJA 1TU3A 4ZPXA 3W5JA 1N5IA 1GKYA 3WMFA 3AVUA 1ZUHA 3SEAA 1Z83A 1XZQA 2AHOA 4HDQB 4HAXA 3B1XA 4YXWD 3QKRA 4V02A 3TSZA 3WYFA 2CNWD 4W5HA 4DCUA 5JS8A 5AR1A 1R4AA 1D5CA 1NKTA 3LA6A 5CB6A 3N2EA 3VU9A 3I73A 2CLDX 3SN6A 3BFKA 3W3AA 4A1FA 3JVUA 3PR1A 5AJXA 2IWHA 2CXXA 4KVAA 2YNMA 3GLGB 1YZUA 3WHKA 2VO1A 4PSVA 3QKTA 2B8WA 2W0SA 4IEIA 3QE0A 4NCNA 4LOAA 1KI4A 2KWIA 3PEUA 4IDHA 4DDTA 4ZCIA 2FSIA 2FFHA 3GEEA 5JFGA 2PJRA 1ZU5A 3QQ5A 821PA 5JHHB 1KDTA 4R98A 2WMNB 3UATA 4CIDA 3PCRB 2QG6A 3KTAA 2DYKA 4LX0A 3QXSA 3LVRE 4AG6A 3HR7A 4XWKA 1VPLA 4KU4A 2ASEA 3I72A 4BLSA 3THXB 1Z5ZA 2FSFA 1KI7A 4ABYA 3VKWA 4JL5A 1G5TA 1NVWQ 2W6JD 4QBIA 4FMCF 2FWRA 3FHCB 4MYHA 2WVJA 3ASYA 4I1SA 3Q8XB 3DPUA 1RRCA 5B58C 2XZLA 2C78A 4NCKA 2ZRLA 1PZNA 2D7CA 4DVGA 4PAOA 3T1TA 2RHDA 1Z28A 2W00A 1SKYB 1V5WA 4NP6A 4BRUA 1XEXB 1EXMA 1AJEA 2F6RA 2ZS8A 1Z0DA 4TN1A 3RS0A 4JKYA 2GHIA 3ZZUA 2IYSA 1DBSA 4Q4HA 1UDWA 4HI0E 4Q21A 5BN3A 5FBQB 2QRZA 2CL7X 5KO2A 5DN6A 1J90A 3W6NA 4IXNA 4D2IA 4LRWA 5CDFA 1P4SA 1R8SA 2MSCB 4OI0A 2ZUBA 4B3CA 1Z2CA 3EZ9A 4NU0A 2OLKA 1XCPA 1E0SA 4II7A 4TLAA 2PT7A 2PX3A 3I5XA 5KSZA 4JVMA 4G1UC 1DO0A 1F5NA 1I4LD 3QEJA 3LFUA 3AUXA 5LD2B 4BASA 3EWAA 3IUYA 1WRBA 5D3MA 3AM1A 4EQ6A 1ZYUA 1IY2A 1W1WA 3TH5A 2ZUDA 2PEYA 1CTQA 1S9HA 4A92A 2QN6A 4B34A 3KX2A 3Q7QA 2NQ2C 1J70A 3KB1A 4ASUA 2W6JA 1YR6A 1UEJA 3BORA 5JZVA 4QJ5A 1Q0UA 3VKHA 3T5GA 1KK1A 3AVQA 4TMZA 2B7CA 4LYFA 1OB5A 1GZSA 1JQLB 3X1XA 5BN4A 1D9XA 1OLOA 4RCZA 5B57C 3AQ4A 3B7GA 3EZ6A 4Q4JA 1E9DA 4I4LA 1FNNA 4RZ3A 5JCZA 5FL7A 4D80A 4PO1A 2UKDA 3F3YA 4BFXA 5GADl 3BH6A 2OSBA 1E1RA 3LX5A 4AYXA 4EPXA 4ON9A 4EQ6B 4Q02A 2GJAA 1FTNA 1P2SA 2OEPA 4MUBA 1ZM4A 2J7KA 4BEJA 1OFUX 2B21A 4LWZA 3D31A 4OHVA 4JT4A 2DPXA 2GK7A 1DG1G 5HR5A 3ZH9B 4K81B 4RD1A 1N6HA 5LB4A 2X1VA 1ZNWA 1AN0A 2XSZA 1ZNYA 1U98A 5FL7D 1KSGA 4WIAA 1P2TA 3TSWA 1WA5A 2BVNA 4YMUA 3TMKA 2FFQA 3TK1A 2R62A 1VCMA 3E2IA 3IO3A 1A2BA 2DBYA 1TNDA 4PXAA 4NYMQ 4QJ4A 4ZIRB 2QGNA 3PV0A 4PR0A 1M6NA 1FQKA 1E79D 4BGDA 2XZPA 3Q5DA 1CJTC 3CM0A 1EX6A 2JLQA 2ZS7A 3LX8A 5FOVA 1Z2AA 2WKRA 3CO5A 4CVNA 2UVQA 5FPYA 3ICEA 1CRQA 4YMSA 2BKUA 3K0CC 3QF7A 4V0ME 4TYNA 4KHZA 3U44A 1H8ED 2J7PD 1ZD8A 3GLIB 3Q7PA 3OHMA 3RC3A 5AUNB 4KFRA 4RD4A 4ERNA 3BB4A 3SJAA 1SVSA 4C0JA 1EFTA 1GKUB 1HYQA 2OXRA 3PITA 3RS4A 4E03A 4Q7JB 2P2LA 4OI2A 4B75A 3D8BA 2XSZD 1S4QA 2ZRJA 1ZCBA 2WWFA 1KI1A 4DB4A 3U7FB 2D4HA 2ZYVX 4W5WA 2O8EB 2E9SA 1EGAA 3E5HA 3J81k 1YRBA 1OIWA 3BH7A 1P62B 2A5JA 4IOLA 4TWZA 1EFCA 5TB5A 2FFBA 2R44A 2CL0X 2IUTA 3ZS8A 1UAAA 1OV4A 4BLTA 4XOIA 1DPFA 5D3QA 4ESVA 4D4JA 2QP4A 1ETUA 5J47A 3L8ZA 3FGNA 4M22A 1P3JA 2CE2X 1IAQA 4AYTA 2GXAA 2VP6A 4ZDWA 3SHWA 1GNQA 2IS1A 2WSSD 2EYQA 3PUVA 4X8OA 2J9RA 1FX0B 4KLZA 4LHWA 4XH9B 4B32A 1MH1A 2HF8A 2OAP1 4XTCS 4QGGA 5L3QB 3NDBB 4QOSA 2D06A 4WZBE 3VX3A 4B2IA 2ZI4A 4BFUA 1YE8A 3HWSA 3TR0A 4EFMA 4L9WA 1E2EA 2WWYA 1XTSA 3MAAC 3ZDQA 3OAAD 5CLLA 4R9UC 3KQHA 3PUYA 2OCAA 4RD2A 1PV4A 1G8YA 4OHWA 1XMSA 1E1QD 1XNJA 2ZRNA 2OESA 4IFEA 3PG5A 3DDCA 3R9IA 1JB1A 4CGZA 4AKHA 3T06B 1JBKA 3U2QA 1T4GA 2DFNA 4TQ9A 2JLYA 3TAHA 1TF5A 4G5GA 3TQFA 4BRWA 4B6EA 3Q3JB 3BH0A 1FL9A 3K9HA 1AK2A 3K0SA 4B33A 3GJ8A 2XNSA 4G5OA 2BJWA 1U99A 4NONA 3R8CA 1Z0FA 1DAGA 3BB3A 2VH5R 3EPKA 3MD0A 4E22A 3C5CA 3O8CA 1U90A 2KJQA 3EG5A 3QBVA 1Z8FA 1HE1C 3LLUA 3LO5A 3AF1A 2H57A 3VR5A 4B3XA 4HUQA 4DSNA 4XD7D 1NIJA 3WNDA 3B82A 1CKEA 5G3YA 2FSHA 4NYIQ 2I1VB 4I1OA 1XEWX 2DWQA 1G8FA 2ECKA 2YKGA 4D6PA 1P5ZB 3A1TA 4US2R 5CJ2A 1MKYA 1XMJA 2G0NA 2DY1A 2JEOA 2GDJA 2D3WA 3AVXA 3B13B 4EPTA 4DDVA 2ZJBA 3TVTA 1FQJA 1H8HD 2ZRDA 2GILA 2G9NA 4Q7KA 3CH5A 4US1R 1XPOA 3OESA 4A82A 1I2MA 2UZ3A 2ODBA 1OXSC 2P5SA 2QA5A 2QL6A 1NG1A 3NWJA 3A1WA 4PC6A 4B35A 3CF6R 3UPUA 1XTQA 5DYIA 3HPQA 4A0GA 4G0NA 1TQ6A 2VF7A 2ZE8A 4DRZA 3A37A 1QG2A 1JJ7A 4MRNA 3C16C 1E4VA 2J0UA 1GVNB 621PA 1WF3A 2VPPA 4OQXA 1SKQA 2FN4A 1S1CA 1OPXA 4GL2A 1GSIA 3QPVA 3SBDA 4CEJA 4CYMA 3CWZA 3HPRA 3RRZA 3ZVRA 1FMLA 1T5IA 4TYYA 4A9AA 1PVOA 1Z0AA 2GAOA 1IQPA 1VIYA 1Z6YA 3RANA 1BIFA 1KY3A 1Q21A 3QKUA 4WZAE 5CJPA 2ATXA 1YZGA 2V7QD 1SZPA 3JZMA 4H9GA 4UXJA 4XTRA 3SNHA 3NG1A 3THYA 2AK3A 4JLVA 4PAQA 4PQRA 3DVLA 2CCKA 3FB4A 4BFTA 4BE7B 2XOKD 4TSFD 2MMCA 3SFZA 4AIIA 5L3SB 1N0WA 2JCSA 1XTKA 3AVWA 1T0HB 1KJWA 4Q9IA 2GBLC 3B85A 4JMPA 1M1YE 1R2QA 1ZW6A 3F8TA 3WNBA 4G5QA 3SR0A 2GF9A 2PX0A 4D81A 1X86B 2Y8EA 3U7EB 4BFSA 2UZIR 1E2QA 3M1IA 1N6RA 4P4SB 5HZKA 1QG4A 1XPRA 3I5YA 1F2TA 2ONKA 1TEVA 3DOEA 3IILA 1IN7A 4A0HA 4WAUA 1UBGA 3U4QA 3FYHA 3GJ6A 1Q1BA 3FMFA 1Z6GA 5IF9A 2XTMA 5K8LA 3AF3A 4Z8XA 5KDDA 1PLKA 4BLPA 1OYWA 1G7RA 2BBOA 2H7VA 3T35A 5CDFE 3FTQA 5G3ZA 3ZJYA 3ECCA 5AJZA 1XZPA 4M53A 5JEDA 4C2UA 4C7OA 3B9PA 4MRVA 5L8VA 2VF8A 2O8DB 2KSQA 3K0FA 4OJQA 1GP2A 2IS2A 1A2KC 2P5TB 1A82A 4RZXA 1EESA 4AD8A 4LSGA 3B8HA 4JLBA 3GFOA 4FINA 4Q5IA 4WXPA 1G4AE 2XXAB 2JLUA 4TMVA 2NMVA 1UKYA 4RZ2A 3VX4A 5IHPA 2ZE5A 2VHCA 3K0AA 4MRPA 4QL3A 2CVHA 2PCJA 3W90A 4BECA 1AM4D 3CIOA 2HLDA 2X77A 3RABA 1TEXA 2J87A 3U4QB 1WB9A 1KZ7B 4DIEA 1S2MA 1OH8A 4BPBA 1OJLA 5C18A 4MGYR 1NL3A 3CX6A 4E09A 2WMOB 2NZ8A 2XX3A 4NCHA 5EZ5A 2W2XA 4EPRA 3R7WA 2GKSA 4FW9A 2JDID 3ZD6A 3Q9LA 4H1VA 3MCAA 5JSZB 1P72A 2ODEA 2HXYA 5KTYA 1P61B 5B2ZA 1N6KA 1E9RA 1GAJA 1W44A 2F7SA 4PC2A 2R2AA 2HCBA 1Z6AA 4UNRA 2REOA 3MWLA 1P9NA 1N0VC 1COWA 3HU3A 2R6AA 4LYAA 5EP1A 1B0UA 3RAPR 2O8BB 4D0GA 1FMJA 1FFHA 3KZ1E 3LNCA 4IVRA 1NMXA 1XTRA 2GRJA 5P21A 1DE0A 5HE8A 4Q01A 4A6PA 4HAZA 5J4VA 1QBKC 2E87A 4YDHB 5GJBA 2H16A 4Q1FA 4QBGB 3EC1A 4PQFA 3KL4A 4OK6A 4LBZA 1A4RA 3HU1A 3UG6A 2ZYUX 4B3DA 2ZJZA 3U3OA 3EX7C 1J7KA 2G6BA 2BM1A 4S2EA 4DLSA 1W36C 4MUAA 2FNAA 5GVSA 2OAQ1 4OI1A 2ODWA 4I1VA 5KU1A 3NVAA 3T12A 2OG2A 1CULC 1D6JA 1OHHA 4M9XA 3VFDA 1MRNA 6Q21A 3B1ZA 3MJHA 3TNFA 2JGNA 2ZJ5A 2YWHA 2E1RA 4A8JB 1RJ9A 2GZDA 1II8B 3EZFA 3TW8B 4JL6A 2BEJA 2ANBA 4ILEA 4ZI2A 3IIJA 5C4GB 4A2PA 1OH7A 3C4JA 4OYHA 3KDSE 1RW4A 2O0HA 4M8NE 2XJ4A 3A1VA 4KSBA 1M34E 4B47A 1XD2A 2ZQ5A 4N1AA 5IT5A 4FMBB 3QBTA 3RRNA 3ND9A 4ACAA 3ADCA 3P1JA 5LPNA 3FKSD 4C0QC 3B60A 1G3UA 1R7RA 3S1AB 4DSUA 3FWYA 1MO5A 1E2MA 5FR2A 4QGHA 1LY1A 3GLHA 1TUIA 3RS5A 221PA 2P6UA 1XXHB 2WJVA 2AL7A 4LYHA 1XB2A 3PEVA 2VP2A 1IXRC 1OFHA 5DI3A 1KSFX 1G6HA 2IW3A 1ZD9A 2Q3FA 1TQ2A 3T1OA 1AGPA 2EFHB 3NH9A 1KMHB 1GDDA 1D2EA 2VP5A 3I8SA 3FHTA 4MGIR 2J46A 2ZVQX 3KKNA 3L0OA 3V9PA 2VP9A 3K0FB 2IYUA 2V1UA 4GZLA 4QGAA 1E79A 3NIBA 1TF7A 3K1JA 2VSFA 2H5EA 2XITA 3NDPA 1DAKA 4JT2A 2YOHA 3IBGA 5FOXA 3U60B 2OUKA 5JHGB 1Q44A 4LHXA 2IA5A 4IVPA 1II0A 4IHQA 4E5UA 3EPJA 4BUJA 2C95A 1Z6TA 3IBYA 4Q66C 1QVAA 3R9WA 1X1SA 4GOKA 3VR2A 5E3HA 1VYTA 1G8HA 1G3IA 1ZAKA 3V4RA 4Q4LA 4M1MA 4ZCLA 1XTJA 2PZFA 1HTWA 5SZKB 4LY6A 4S35A 5LDDC 2GCOB 4Z54A 1W36B 4A36A 2QM7A 3ADBA 2ZRKA 4PSKA 2EU8A 3VHXA 3KTAB 3B2EA 3CLVA 5EXXA 1OKKA 5JEEA 2IEZA 2OM2A 3AVTA 3TUJC 4EKDA 4URVR 1U81A 2ZRAA 1RJ9B 4LHYA 2ZRPA 3IDQA 3NC0C 2OHFA 1HT1E 1ZNXA 1GTVA 1J8MF 2PZEA 1W47A 3PJRA 3GFTA 2W2TA 1F2UB 4TSFA 4HAVA 3K09A 5LD2C 2EFGA 4R7ZA 3W6OA 1KDPA 1IJFA 1NP6A 1ONBA 1SQ5A 4LBYA 5BQ5A 2JJ2D 3GCGA 4Q1EA 4Q7MB 2REXB 2R6CA 1U0HC 1HUQA 1YZQA 3CF0A 1KJZA 4JLJA 5FBVB 2JLVA 1KTVA 4M9QA 4MYUA 3W8RA 3THXA 2GCOA 4KLNA 4Q19A 3CKLA 3LVQE 4Q48A 4QGFA 5AUOB 1E2GA 1QHSA 2ZR7A 3CPEA 3H0KA 4LJ8A 3A8TA 2XB2A 3FFAA 4GOJA 2W83A 1LW7A 1YHNA 4NKRA 2QPAA 3P20A 1H65A 4MKGA 1CLUA 1G7TA 2OT3B 4V0NA 4DUGD 2BCGY 4M2LA 4Q1AA 4NHOA 1XJQA 5DYGA 4TTQA 2RMKA 1AA9A 3CX7A 1KYIA 4PSAA 4PZZA 4BLRA 1NMZA 2FG5A 3REFA 3EZ7A 3RHFA 4TYWA 1JALA 1ZJ6A 2HYDA 2WWWA 1JXMA 1XDBA 2ZR0A 3GJ4A 2IF0A 4DCTA 3ZQ6A 5AJVB 5DO9A 2VTKA 5CM9C 1D9ZA 1CJVC 4UNQA 2ZI9A 4O2LA 3UMSA 2MMGA 2WIBA 3H2YA 2A5DA 2XOKA 4W9MC 3LXRA 3WRYC 4PO8A 1CU1A 1YU9A 4TT3A 1K6MA 3OZXA 2EYUA 4PO9A 3FDIA 2ORIA 4TLDA 3RSOA 4WZ6A 1RYFA 1N6IA 2TMKA 3IHLA 3T1VA 2C5LA 2V55B 3ADKA 5DNYB 1N5KA 1GITA 3CNNA 4FXPA 3WXMA 5GJCA 1SXJB 2PMKA 1U0LA 2JJ1A 2QAGA 4KYIB 4DHEA 2F3TA 1LF0A 3AV0B 4US0R 3UG7A 1N6LA 3DEFA 1KHTA 2ORVA 1IXSB 3HU2A 2NPIA 3O8DA 1KGDA 4XVUA 4ZI3A 1S0UA 4XSHA 5K8TA 2PT5A 1N5JA 2FPLA 2RGDA 4XJXA 2XAUA 2NO0A 1KK2A 3MUFA 4DLTA 3Q85A 3X1ZA 2NIPA 1T91A 2A7QA 2HCJB 1QZXA 3FPAA 4DSOA 1UBFA 1MV5A 2VSOA 3NBXX 4URYR 2VIIA 3DO6A 4PAMA 1E9EA 4LCBA 2F55A 5L3VA 2GJSA 1WDTA 3TUZC 1H8HA 4OJKA 4UJ3A 4M1YA 3WBJA 2GNOA 5C1BA 2H92A 1SXJA 1BO6A 2ZTSA 4Q00A 3BERA 4UKDA 1KI9A 1KDOA 2QAGB 4PPNA 4B73A 2DR3A 3BC1A 1CP2A 2C98A 2ERXA 3QJYA 4C9BA 4A6XA 4B3FX 4CT5A 3UANA 3DKPA 4MDEA 1SULA 2ZS9A 1XU4A 4IOJA 4JLNA 121PA 1X1RA 2ZJAA 3U3JA 4L9SA 2O8FB 2ZU6A 5EJEA 3I3SR 4HUTA 3LV8A 3SYLA 2QI9C 1DAEA 3VR6A 2OLJA 1IJEA 4P0TA 3AP3A 1NLFA 2P67A 5LB2A 4EIWA 4OQLA 1N6NA 1NN0A 2CJWA 4KBFA 5G40A 1MABA 1Z3IX 3QKSB 1ZIOA 4PZYA 3SE0A 3BFVA 4GT1A 4Q18A 4IVQA 4QBFA 4YLGA 5BWMA 1J8YF 2A5FA 1W0JD 4A8JC 1T3SA 2GVZC 4IDPA 2J0QA 2BIFA 2GXUA 2O8BA 2OBMA 1OT3A 1XXHA 2WAYA 1UDXA 1SVIA 1GOTA 3GLFE 1DS6A 2R6GA 2JASA 1I4DD 4PPFA 1M8PA 4TLCA 2EW1A 3OIYA 4GP6A 5L3RA 4ARZA 1CJUC 2NZJA 4ITRC 3NXSA 5SZIA 4ZDKA 2V6JA 1DAIA 3EPHA 4CZ2A 1E2JA 1LS1A 3W3ZB 5BYKA 3W9YA 3IPYA 1KKLA 4YC7A 2EVWX 4JVLA 3I61A 5DHFA 5KSOA 5FOSA 2FX3A 4HLUC 4LBVA 2X8AA 1KOFA 2OBNA 4U5XA 3EAQA 4KFUA 3TAUA 4P31A 1NLYA 2WM9B 2HT6A 2AWOA 2ZVPX 4KO8A 4C2TA 4Q47A 2BCJQ 1Y3AA 4GBMA 4MGKR 3CRW1 2D62A 4TYQA 2EFDB 2QNRA 4WOPA 1R5BA 3CNOA 4CEIB 1Q22A 1XX6A 2FPKA 3AVOA 1KO8A 521PA 4EFLA 4URXR 1IM2A 1WCV1 2CE7A 3I1FA 1L4YA 4HDOB 3SQXA 3I62A 2WV9A 1KNQA 3NBZC 4TMKA 3L43A 4RVCA 3KB2A 2VP0A 4GNKA 3ONWA 2RKOA 2FGKA 3THOA 3BJIC 1AZTA 2IYLD 3L0SA 4AYWA 1W49A 4HLCA 1L4UA 4EFNA 1JPNA 3B1WA 4AWXA 1L8QA 3CRMA 2ZU0C 1MABB 4PHHA 5UKDA 2AN9A 1S96A 1YZNA 1ZCAA 2WICA 4M9ZA 5FPKA 3SOPA 1Z07A 4AG5A 3L0PA 1IY0A 2DCUA 3BOSA 1M74A 1NVUQ 2H8KA 2IYQA 3AF2A 1W36D 5CB8A 4MH0R 2GZHA 2I4IA 3QVVA 3IQXA 3OEEA 5EE1A 3A4NA 3QI2A 1CIPA 5FBRB 2Q3HA 3KUCA 2NPFA 1KMHA 2W6ID 3GEHA 2IT1A 5FUYA 3IEUA 2D2FA 3LD9A 4TZ6A 3WY9A 4JLMA 2GXQA 1G9XA 2EFEB 3IHWA 3WBKA 4J0QA 2NO6A 2BBTA 3FMPB 4U00A 3RS3A 5KNDA 4NYIR 1G1MA 5AUQA 3VNVA 5HKKA 2W2VA 4L16A 1DAMA 2QP9X 2DHRA 3BS4A 2FZLA 2IC5A 2Z6VA 1NVVR 4KFTA 3WP0A 1E2PA 3IIMA 2QQ0A 3VNUA 2RGEA 1AZSC 4X8HA 4A2WA 5EXPA 1X8KA 5CK4A 2JLXA 4RJLA 5CYPA 1DOAA 4GMXA 3OEHA 3V4FA 1ZM9A 3SI7A 5GJWC 1OSNA 4DCSA 1X8LA 2BMEA 2QE7A 2IYRA 3I92A 3NH6A 2ZE7A 3U7GA 2Q21A 1DARA 4AKGA 2C9YA 3AP1A 3MWKA 4KXFB 4DKXA 2SHKA 1AGRA 1LV7A 4F4CA 1TPZA 2VHUA 3JVVA 1G5PA 4EJSA 2XGJA 1R10A 1OB2A 3DL0A 4HLUA 2GJKA 1F3OA 3I8XA 2ZIAA 3SJZA 2BMDA 2BHRA 5FUXA 4MYCA 3A1SA 1U2RA 1Z06A 1A5TA 2JAQA 1SHKA 4HZIA 4JIMA 1XD8A 2YVUA 2CEAA 3HYTA 2XNDD 4YONB 3SS8A 1XXHE 1W2HA 2HEIA 3BWDD 2F1RA 1HY3A 1OE0A 2R65A 1XP8A 1YR7A 3OFNA 1FUUA 1GILA 5HTKA 2P3SA 5GJVC 1T5LA 2IHBA 1GRRA 3QF4B 2YOGA 5HZHA 5F3WB 1ZINA 4A0RA 1AS2A 1NJFA 1PJRA 2WKPA 2ONJA 4Q1BA 1W7AA 5F9HA 3KQKA 2BMFA 5KYKA 1LB1B 4A8JA 4GZMA 2AWNA 1NSTA 3TBKA 5JCPA 3CW2A 3OEHD 4DB2A 2NGRA 3KQUA 3FKSA 2NOAA 4LV6A 1A7JA 1VCOA 4RD3A 4B6FA 1B23P 1AKEA 4HYYA 2F43B 4G3XA 2IXEA 4WVFA 3W6PA 4O2RA 1G291 1S8FA 1CR4A 5A0FA 2QEQA 1S3SA 1ESNA 3BE4A 2GJ9A 2GEVA 4MRRA 5E7IA 1MT0A 1G8PA 2F9LA 4RD6A 4URZR 5DISB 1TAGA 2BV3A 1AS0A 3M6AA 3QVUA 4IRUB 5G41A 5J5CA 2QMOA 1Z47A 1FOEB 5CM8B 3P4YA 5AK0A 1W4CA 4LJ9A 3RC8A 3K8YA 4KVGA 3GLFA 4LHVA 3PQCA 4DLRA 1DADA 4NDZA 1TQ4A 1Y63A 3AKEA 4FD2A 1NIPA 2ZYTX 5AJYA 1OXVA 3EIHA 4Q4JB 1ZD1A 1JPJA 2OFOA 5HCNA 1ANKA 3SJCA 4BFWA 4DLZA 4FCWA 2GK6A 4V0OA 3E70C 3W8NA 3MMPA 4HATA 3B1VA 1KMQA 1VG9B 5H68A 2F1JA 4UNSA 4DJTA 1IN4A 1HH4A 1RRGA 2XEXA 2ZRIA 4R2HA 3TLXA 3IIKA 2QT1A 3LY5A 1D8TA 5KDOA 3IQWA 5M04A 1N5LA 2B7BA 3HJNA 4IKEA 1E3MA 4OKSA 5DSZA 3CWQA 4HB4A 2WWHA 3BXZA 1EK0A 1G4UR 2X2EA 4LBWA 4DWJA 4YQFA 1CR2A 2FSGA 1MOZA 1QHNA 1VCIA 2D74A 4GFDA 2RH5A 2VEDA 2ZXUA 3SYNA 4QM7A 5FFMA 2O5VA 4KAXA 5GVRA 4I81A 3AF4A 2BEKA 2YINC 2QAGC 2QSYA 4P4SA 3TQCA 4B3GA 1G3QA 2DB3A 1ODFA 1GL6A 2KBEA 3SC3A 2QP3A 1G16A 2QMEA 3GLIE 2CHGA 2GZAA 1DAHA 4PANA 2FPMA 1G3RA 2Z4SA 1VKJA 3BFXA 4CEIA 5L3QA 3N5CA 3RRMA 3K70B 4HSEA 1TTTA 2F43A 2ZRCA 1CEEA 4H1UA 4HDCA 5BW8A 1E4YA 5F2EA 1R8QA 3KQLA 4MKHA 1CF4A 5ELXA 5IDVA 4LK2A 1XEFA 2AFHE 3AGPA 1Z0IA 3SBEA 2RGAA 1HA3A 1W4AA 1M7GA 1R0WA 2C96A 4Q9JA 3MG9A 3HDTA 5HE9A 2Z5FA 4ZKDA 4KODA 4B2LA 2ZI5A 1GG2A 2W58A 4NH0A 3AH8A 1WQ1R 1D2NA 1KO4A 2N42A 3GEIA 4OL0A 1FP7A 2PMDA 2CK3D 5DI9A 2CLCX 3OFND 4C0KA 1Q1QA 1MRSA 2ZJ8A 3LBIA 4D0LB 4WW0A 1JEDA 4OQMA 4YMVA 2BOVA 4TL6A 4LJYA 1KI3A 3JZAA 4LV5B 3ZQJA 1C1YA 4ZDIA 2WIAA 2H18A 2RB4A 4LGMA 2ZRGA 5L3SA 1NY5A 1E6CA 3KFVA 3MSXA 3TIFA 4F7WA 3QKSA 1RC8A 2HT1A 1S1MA 2O8EA 3TR5A 2FFAA 1E1QA 2QPTA 1KSHA 3CB4A 1YZLA 3L82B 4B48A 1Q20A 1EX7A 1XWIA 3PVSA 3QF4A 2P6NA 3GLGA 4D4MA 4K46A 4FMDF 2F9MA 1E2FA 4B2PA 1R5OA 1P6XA 3GP8A 1FPMA 4TMXA 3LBNA 3GMTA 1U8AA 2VHTA 3AVVA 1BKDR 1OIXA 2PJZA 3LBHA 3DZDA 4NZYA 3R7WB 4EPWA 4HUQB 2R6FA 2NO7A 3LRPA 2O8FA 2QRNA 4BLOA 1ZP6A 4TTRA 1QHHA 1AQYA 1T9HA 3BAFA 1S9DA 5FI0B 3NEYA 2W0MA 1J99A 4F4IA 3C15C 5DGXA 2ZETA 1MO6A 3RRYA 2NTYC 5J40A 1QHXA 3VR4A 5KUTA 2OCPA 3B6EA 1Q12A 3F0TA 4LJ7A 3CZPA 5J4LA 3ADDA 3DZ8A 3K70D 4UQOA 2OXCA 1RYHA 3EARA 4RFSB 4CEHA 3LAWA 2XXAA 3ASZA 2ZSFA 1TMKA 3BD9A 4B71A 4O0MA 4KI0A 4CDGA 5E95A 4A0FA 1JECA 3K0AB 1KK0A 4M1WA 2PH1A 3TE6A 1E2HA 3L0IB 4HZUB 3RS7A 3ZVMA 3T61A 3SZRA 2QROA 5EZ6B 4DCVA 4BQSA 1SXJC 4CRWB 3EIQA 2FMXA 1NN3A 3DMNA 4PPQA 2WWIA 1OF1A 2CCJA 1HV8A 4TL8A 2FZ4A 4Q9KA 3QXXA 4Q9HA 4D4KA 1G6OA 1KO5A 4LC0A 4EPVA 1E0KA 1BMFD 1P9RA 5K8IA 4UJ5A 2ZRMA 1BMFA 1AQUA 1UF9A 3F5FA 4L15A 4FWTA 1T3HA 3B78A 2VL7A 2D7DA 1N25A 1SKYE 2G77B 3MJRA 4LJAA 3TUIC 2QQEA 1E69A 5KSPA 3LW8A 3S1AA 3PFIA 1P7CA 4M9SA 1CR0A 1AIPA 3RSLA 5KHOC 4QNMA 2B92A 4N0EA 3KJIA 2FU5C 2GETA 4TTPA 5FTMA 1NLZA 3WP1B 4JLPA 1CJMA 2ANCA 4LJ6A 2WJHA 1XD2B 1XRJA 1TQDA 3MFYA 2J0VA 2F1IA 2RGNA 4IJMA 2FH5B 4TLEA 5CIWA 1WBBA 1BS1A 3R8FA 2IXGA 1RPZA 2GVDC 3EA5A 5C4MA 4KSCA 2HV8A 1KDRA 1N2CE 4FMDB 4JJKA 4PC1A 4OHYA 1KI6B 3QNUA 2AX4A 2B6HA 1R5NA 2HLDD 5F98A 4JBYA 1TL7C 2RCNA 2HYIC 5TY0A 1U94A 4NCJA 2YV5A 4ZKEA 2ZE6A 1M2OB 1CS4C 1G21E 3KUDA 1UFQA 3C14C 4EDHA 3MGCA 1DTSA 5A4JA 3BB1A 3FFBA 3U6BA 1QF9A 2QTVB 3WNCA 4L4UA 1G64A 4EJSB
chains in the Genus database with same CATH superfamily
2CMDA 3EEFA 4QDZA 1Q1ZA 1NRJB 2OSVA 3NVKI 4LZZA 2Y0EA 3U4IA 1ACMA 3QPCA 4R8KA 4Z86A 2B4YA 4HD8A 3KJQA 4MR9B 2HHJA 4OHUA 3PNVA 4WN3A 1OW3B 3OX2A 4KQ1A 4RABA 4ARZB 4Z3OA 5AKEA 3VH4A 4KC0A 1ZIPA 1RTTA 1VG8A 2GF0A 2JCXA 2Q3MA 2RHCA 3EZ2A 1GG9A 3PFKA 4FILA 4JI1B 4WVLA 3H4IA 1Q1EA 1XQ1A 5AK6A 1DRWA 2V1XA 1NXWA 4YRJA 4P3KA 3VO2A 1OFIA 4FLEA 5TC4A 4JR2A 4UDOA 4HDSB 4AF6A 5IK2A 3PDIA 4B81A 1KMCA 4RESA 5C32A 5B30A 4DV1B 2O7QA 3TPCA 1FUKA 1G5QA 4R9SA 2R6DA 4GXQA 3K9FC 4IWYA 4RK6A 1NXQA 3P9KA 5AK4A 2LGJA 2X13A 1R0CA 2XQGA 5JIBA 2CMKA 4RJIA 1VHTA 1WW8A 2P65A 4AMUA 4TQAA 1TFRA 1JQKA 1TADA 2XNHA 4V0KA 5HOQA 3X3HA 3UYLA 1JHAA 3FKQA 3K09C 4UVGA 2DWCA 4G5XA 4FE3A 1B1CA 1GFSA 2O2JA 5CGQB 2H1LA 4DR4B 3HKDB 1W0CA 2ERYA 1LBHA 2Z8YM 2FKAA 3EXAA 1D04A 4HCJA 4ACBA 1JPUA 1NUTA 4HF7A 4K8RB 4U1RA 2OKCA 4H7IA 1Z6PA 1Z68A 3MGKA 2CDCA 3GFPA 4M4SA 4AKEA 1PR3A 2GFQA 1KH1A 3M9XA 4KXLA 4C0LA 4D3YA 3AJAA 1YTUA 1ISMA 4IOMA 4ARAA 4MR8B 3IDFA 5MHTA 2ZRQA 1JJVA 3IKJA 5H3LA 4D98A 3AHCA 2C7VA 3O8RA 3CRRA 4IIBA 3E35A 5CT9A 1HMPA 2PBZA 3B12A 3BRCA 5T41A 3TRDA 2I3AA 3G3EA 3EXHB 1E32A 5KTPA 3U19A 3RU7A 1E0AA 1GEGA 3K70C 5LQDA 2KE5A 1LDGA 2E5LB 4FDAA 4PQYA 4I9UA 4UNNA 2Z1NA 4O4LF 1J09A 1NVFA 1QSGA 1ZLYA 1I1QB 4Z2YA 2PUDA 4KTVE 5FV7A 5HW0A 2P41A 5H1YA 4BFYA 2Z5GA 5AW3A 2G9VA 2GASA 2QTGA 2RAPA 1HL3A 2XKAA 1PE0A 5G02A 3VH3A 3F90A 2VWPA 2XDQB 1RHQA 1XYVA 3HNRA 3BWVA 2NP6A 1AKNA 9LDTA 1NNEA 3INRA 3I09A 2BN4A 4EQZA 4D9GA 1IN8A 4WKPA 1W5AA 2FGJA 2GR9A 3O94A 1D2HA 4ZO6A 3W5BA 4NE2A 3M6FA 4OV6B 5FYQA 2BEVB 2FQXA 2O0KA 3OF2A 3ELUA 5SZJA 2Q49A 4S12A 1IWBB 1GLVA 1TK3A 3E5RA 3QEOA 1I2AA 4QTZA 2HY7A 1SHZA 2EARA 5TDHA 2JJ2A 3EQ9A 3GVCA 5CIYA 3WWZA 2AFRA 2ZBUA 1VCNA 1WLSA 4YWJA 1CY1A 1IHUA 2FEOA 2QDXA 2R4UA 2W2KB 1XBTA 4KXXA 3VJMA 4BLQA 2FSSA 3U7HB 1UEXC 2XQKA 2YXNA 1VG0B 2FQ1A 3AETB 3RIGA 1A4IA 3X1DA 2PL3A 3ODGA 5C2JB 1E1NA 2GCEA 1GA4A 1Y7HA 3PRJA 2QVBA 4AFNA 2VXBA 4YCLA 3D6AA 3WGLA 3QPBA 4MP8A 4MW1A 4JSYA 1N0UA 2I2FA 3H5AA 1JJFA 2ZQZA 3IVRA 1Z18A 3UK0A 1NASA 5F7XA 1K2WA 1RZ3A 1M75A 1QIMA 2ZYWX 1G5FA 3O3OB 3L4BA 1K7YA 5EIWA 5ICFA 2X1MA 5LYJB 4ER6A 2F3SA 5DTJA 3I5MA 4C0AC 4HLDA 2O19A 1CEXA 1RXCA 2WV7A 2Q62A 3MMXA 4E1BA 2X5NA 4PIMA 5CBPB 2BBSA 5HXAA 1PAUA 4E7PA 4QSMA 5JCJA 1RHRA 4D8TA 1KYZA 2I4TA 3GHHA 4B46A 3OQNA 1J20A 3MTJA 2WA1A 1KYYA 3FYUB 3GAMA 3L2OB 4IJ6A 1KR2A 1KQPA 2VZ8A 4BO0A 3BXFA 4CEJB 1ZGZA 1C4XA 3H7IA 3KJNA 3N9IA 2VSXA 2Z9BA 2HWXA 3C41J 3CUTA 3KQMA 3GJXC 2Q3EA 3P32A 1MLDA 1LSSA 4CMHA 1F2VA 1EFVB 1YVDA 2W71A 4LMAA 2CNOA 3A4LA 3UMJA 3CPHA 1PJAA 3ENNA 4ZP1A 2H54A 4DSAA 2I6SA 4TSKA 1FW6A 1T36A 1YZFA 4I5DA 5FFFA 5HDQA 4BBPA 4ZTZB 1B74A 2RC5A 1ZUIA 2WP0A 3IBFA 3R5XA 3ZXSA 4G1BA 1UKVY 1XVUA 5KCMA 3IVMA 4ONEA 3VZBA 1GRNA 1F60A 2N1BA 5FORA 2IF2A 4RDIA 4YCMA 1V26A 2F9FA 2OQ2A 4BX9A 1WM1A 2D0DA 2CXPA 1ZK1A 5DWQA 5KOJB 1JYFA 5C1OA 3GVIA 1OWPA 4GP7A 2HA2A 4DLYA 1G20E 2CK3A 1T8UA 2W4IA 3SQDA 3HACA 5FBHA 3EDRA 5EAIA 3RDPA 3R6GA 4UAUA 4D46A 2X19A 4I5GA 4QDTA 2OMKA 1GPAA 1OXUA 16PKA 2AMLA 4FYYA 2B1GA 1Y4DE 2PJDA 2Y76A 2P79A 3D5EA 1XXLA 1G7SA 4ZU3A 1RQNA 2C9CA 1IUOA 3NBFA 5F51A 2INGX 5AXAA 5EJFA 1QORA 2AZTA 3S2YA 4DMKA 5K0JA 4LIPD 5IH3A 1VIAA 1FEZA 2CWWA 1P4RA 2G1KA 4F0JA 4L7QA 1N92A 4PGGA 2PWBA 4X91A 3A3PA 2WHYA 1L5HA 1OTYA 1E5XA 4PYRA 4L78A 2HI0A 2GXSA 2XCQA 4FHFA 4BEWA 5FLKA 2AD5A 2OZKA 5J4KA 3ZPXA 4IIYA 4WKNA 4Q1DA 3B52X 1SD2A 3LM8A 3WGYA 2JKYA 2Z08A 3LCVB 5EKUA 4JDPA 2XBMA 2A9JA 1NW4A 4DARA 1A72A 1FRVA 2F3RA 4GOXA 3RIXA 2OV2A 1JSLA 5DTMA 3FHLA 4FFVA 4EKNB 3VHLB 3PQEA 1JG4A 4G86A 4UBIA 1NX9A 4CM6A 1XA3A 1L7EA 1ZIYA 3OE7A 2LKCA 3E8SA 3EXEB 3KSAC 4H4CA 3X1YA 2V8OA 3A2NA 5DHAA 3VZQA 2B5OA 1WHTA 3CLTD 1OQAA 1PJZA 3ADOA 5ALYA 3RG8A 4HAWA 3ETJA 3N58A 3RWBA 5L40A 4TZ0A 5CK5A 4Y6PA 1BDHA 4K9PA 1MO4A 2X7HA 3R44A 4WE3A 3T15A 3WK5A 2C0CA 2WFLB 1J2UA 1U9ZA 5TMPA 2JGLA 5AKKA 5JSYA 2AUTA 5LMUB 1ZXLA 4U2CA 5F5NA 3CQ9A 4FDMA 1XCGB 4J7XA 4NESA 2P27A 3CUSA 4MITA 3O03A 2O2IA 1JQ5A 1SG0A 2J5XA 2LCIA 3I2KA 4QDKA 5T8KC 1EHCA 1DKNA 3WMRA 1ODJA 2CEKA 2WJWA 2A35A 1DJNA 1JILA 3FSGA 1HLPA 1LTQA 3MB8A 4RA9A 5J2UB 1H2EA 1Y7TA 4LKRA 1TCBA 2P5YA 5CM2Z 3GL9A 5CBPA 3A4TA 1GPBA 3DSRA 4KJZA 3RSCA 2HA5A 3AI3A 4MCJA 4Y0NA 4YBRA 3P45A 4MQBA 1RRPA 3LWNA 3WKEA 1FMFA 3WYAA 2ZSKA 3WHLA 3LHKA 2WSSA 3LGAA 3UN1A 3KSRA 3TLGB 5AHXA 1IM8A 1SXJE 1T9GS 1L6IA 4IV8A 1R66A 3RVDA 1K8YB 4E2XA 2PCLA 2HF9A 3S5UA 3KB8A 3CBQA 1U1FA 4Q9NA 4B9EA 2GESA 4LRYA 3DXFA 5CMLA 1ZH2A 1ZM2A 4NCIA 4DL9A 2YR0A 2ZRBA 4X95A 1EFAA 5JUWA 1QFJA 1T1RA 4K86A 1K7EB 2OFWA 3D7KA 3T3GA 3ZGYA 5JECA 5DBIA 2IUSA 3LXUX 5D2CA 1Q16A 1QGZA 1ZRHA 4LYGA 4N3NA 4NJEB 3WK7A 1UWLA 4BFVA 3RYCA 4JL8A 3IHTA 4OXQA 4JR0A 3WB9A 4X1IA 4FIZA 4JBWA 3CONA 4YBZA 1LF5A 2ZRHA 1TA9A 2G83A 4KR0A 1PNVA 2GLUA 5FTNA 3VC2A 3ROXA 1Y3BE 4YO8A 4ZZ3A 1TRKA 3B5JA 1KH2A 1YJ5A 2WDPA 3LC0A 3HRIA 1CBUA 2G72A 2C03A 4HDAA 3ZHSA 4BC1A 5FDFA 4EK9A 4F9TA 4XIGS 2KI5A 1H5NA 5JAMA 1SKBA 2X6TA 3ROMA 1I0IA 4HQNA 3E84A 4AO7A 4OY3A 1XZKA 1YXMA 1VG1A 1EUCB 3A7EA 4Q3AA 1V3VA 1Z63A 1RC0A 4BWYA 1MORA 2COKA 1U8XX 3RFTA 4ZODA 1ATIA 2D5IA 1WZ2A 3ZWAA 5C8YA 2CJWB 3HJAA 1RWPA 7YASA 2XVYA 3OZAA 4JB8A 1U2DC 2FZWA 1RIFA 3SSNA 3NTXA 1YKSA 1H2FA 4BFZA 1TFUA 2BZ0A 1UBHS 4NPHA 1M7HA 1CUGA 1DAFA 1ORIA 1ECCA 5M34A 2WTEA 3EE6A 1EB9A 2YFQA 3FNBA 3QI7A 1ZI9A 1CDOA 2VCYA 3DWGA 4KQ6A 2AXNA 1XR3A 2NNWB 3HADA 1L5WA 3ZDZB 4U5QA 5EXSA 3IQIX 3NHFA 2VF2A 1A5ZA 1E9BA 1Y1KE 4A2QA 1W2WB 3GFVA 2IH5A 5SY4A 5EIOA 5JQGA 3F49S 3INYA 4BQIA 3VR4D 2QZ9A 2OILA 2QM8A 1U0RA 4YJFA 1KU0A 2JLWA 2Q6TA 5D85A 1AGYA 3IE1A 1Y89A 2VUIB 2WE7A 5A3SA 5F9FA 1YBFA 5LOVA 2Y68A 1CRPA 2C2HA 3DFZA 1QLJA 3MLAA 2YWEA 4M6WB 5DF1A 1SOWA 4MA4A 3R41A 4NMWA 3PLNA 2WPDA 3M6XA 2NSHA 3D5QA 3TDNA 3AP2A 4NBWA 1BNCA 4WA7A 2VT2A 5CVVA 1E1RD 4M8SA 5IX8A 1JF8A 1U7ZA 1U7WA 4G0QA 4IHAA 4IO1A 2ZIXB 4FFBA 4KRXA 3CNLA 1FX0A 3OVMA 4OU5A 4RA6B 2Q5OA 4JJAA 2I3BA 1YRAA 4DT1B 4ZCMA 1FBTA 3NBYC 1VDMA 5JVDB 1UBUS 3DVRX 1KMIY 3HCEA 4LDAA 5HCIA 2FRDA 2H2WA 3KOUA 3KZNA 4KLAA 5IC4A 3T0GA 3L6EA 1LLCA 2OP1A 1IMJA 4D9NA 2UXCB 2J5QA 4NENB 1PT8A 5EUQB 1XT6A 4IPTA 2PUHA 1B16A 3E9DA 2BW0A 2W8BB 3H9CA 3G2MA 3VC7A 2QLFA 4HN9A 3AF0A 2NG1A 3KSDO 1FVXA 1QGED 1FFDA 4ZGBA 1P80A 4DXAA 4R1SA 1IUNA 1NJ2A 4UXIA 4D79A 1AH2A 1T1GA 2CL5A 2RHLA 1EQAA 3Q11A 4ZCSA 1GQSA 1PJ2A 2NO1A 1SHTX 4P33A 3ESZA 2QJWA 3WLRA 2YN4A 1T3LA 2FEPA 4MPTA 4C0BA 3WB2A 2B3TA 2PU5A 3E7XA 3FNRA 2QN8A 3PX2A 4HAIA 1MW8X 3ZJVA 3GIDA 3KJEA 1MVLA 2ILVA 3EC7A 3L6CA 4J0DA 4TYQA 3TG8A 1GL7A 2J59A 1W5SA 3EIOA 4Q4CA 4DBLC 2ZJOA 3FCEA 1HEIA 5JYBA 3U5TA 1XTIA 1R8JA 2ZRFA 3FE2A 1AXEA 4O0LA 2RJNA 5EXTA 2BMJA 5DHPA 3TKLA 4EAQA 3C3MA 2ZWMA 1B93A 1WY7A 4XYEA 1YQTA 4M21A 3RJ9A 2NM0A 1Y42X 4A26A 1NM5A 1Q57A 1UK6A 4O1HA 1D7OA 3A4YA 5CJJA 1P2UA 4ZQCB 3SU8A 3T41A 3UT0A 2PGJA 4HT3B 1MTZA 1QKKA 2WKQA 3DYVA 4F60A 3CZMA 3STWA 3G0HA 1WNTA 2A2ZA 1CS0A 2B82A 2VT7A 3T99A 4I7EA 3ZVNA 2WOOA 3WGZA 1NC1A 2G7MC 2IEIA 2PR7A 1NUSA 3U3MA 3BSFA 2FCRA 5KVCA 3OZBA 3QELA 2CHQA 1YFKA 2R68A 4PSDA 5FTWA 1SVLA 3GLHE 1N2ZA 2SKCA 1UBCA 3K92A 2A9PA 2D2VA 4KRYA 3WMEA 4QJBA 4HSGA 3ZIAD 2IX9A 1Y8QB 3NHYA 3KPVA 1NY6A 3SY8A 1K97A 1M1NB 3HXPA 3ER9A 3RQSA 1R0YA 4DLVA 1CY4A 1RWQA 1V7PC 4D42A 1B14A 2V3VA 4B6OA 2Y0DA 4UTXA 1NJ1A 4R4JA 4OHZA 1KYQA 1V1MB 1C1HA 5JJLA 3C8UA 4FD3A 1QS0B 3ER6A 1OAKA 3LY8A 2QUZA 3BIFA 3B9QA 4KAFA 4M99A 1HTBA 2VA8A 1HQCA 3R3VA 2PNJA 4DW8A 4RS4A 1NV8A 3U0BA 1NVEA 5C8YB 4LS3A 3V8PA 4JLSA 2I6TA 3NWBA 3AUSA 4TRJA 4MQEB 4KHPB 1IN1A 4JU8A 3WGOA 2JLZA 1RZUA 1LQTA 4Q6BA 1JHVA 1DWOA 2FE1A 1CQWA 3H5NA 4FZVA 3ZYZA 1CZKA 1N1EA 2HXSA 3KXIA 2IU4A 4M1OA 4EUKA 4LQDA 5BVGB 2GCNA 4P36A 4WBNF 4MGZR 4FXOA 1BDJA 5FI5A 3A36A 4P93A 2ZEJA 1RD4A 2UXDB 1UM8A 4AZSA 2QIOA 5IMSA 4Y2JA 4W4TA 3W9UA 2GAJA 3MERA 1TK2A 1CXZA 5F33A 4C30A 2CKDA 4A27A 4EA7A 5JCOC 1NVTA 1P7VA 2CNWA 4RK0A 2XE4A 3T5BA 3VMFA 3AEUA 4YXWA 1NF3A 3QUSA 1AUXA 1AMUA 1L9XA 1JDUA 3PT5A 1CJKC 2FPPA 3F7NA 3N8DA 1DQRA 2BWJA 2R9VA 3IPRA 4P58A 2BRUA 2BFBA 1MB0A 3GJ5A 2UYGA 3R75A 4DGQA 2YIVX 3T9CA 1M2GA 2FAXA 4TZTA 1JVSA 2C2YA 3D0QA 4I55F 5H81A 2HW8A 4IG9A 2X1HA 1X0VA 3DO5A 5JBQA 1GQYA 3AKZA 3T5DA 1W85A 4HNQA 1JDBC 2G3YA 1N57A 1S3GA 3LO8A 4XSGA 3ZJTA 1HYHA 5F52A 1ZESA 5CT5A 4DT1A 2XUHA 1ZC3A 4E5DA 3VNRA 3WLNA 1QHHB 1E0JA 3SMQA 3OE7D 1Y6JA 4ZVUA 1NWCA 3DNMA 5M5BA 3KXKA 2FRVA 4LJ4A 3IPXA 2BH2A 2O8CA 2J09A 1HDEA 1NU6A 4GR4A 1QQ6A 1SVMA 3A10A 4ZJUA 1ZUWA 5JJKA 4JLDA 2V7WA 5BN5A 2XNJA 1JQ3A 4ZAXA 3CVOA 4X66B 4RKQA 5JMTA 3QVSA 1T2CA 2P1RA 3KR9A 4P7GA 1RRKA 5JI3E 1ZM3A 3AKYA 3L49A 3Q87B 3QPDA 1R16A 4RFSA 2CVFA 3RYIA 1IJBA 1APBA 3SC2A 3WO0A 3K4QA 1FYEA 3A3YA 5DOZA 4F91B 5JATA 3PKJA 5LKRA 2TMYA 1MEJA 2J9XB 3EDQA 4X1OA 4AT1A 2Z57A 3DBRA 3OQOA 4Q1CA 4A36A 1QTIA 3OOYA 2C04A 1L1QA 2OE2A 5DN6D 4IYRA 4S0ZA 1BS2A 4X54A 1RQPA 4MLPA 4KPUB 2DR2A 1SA0A 4KGVA 2HPVA 2CDNA 1E98A 1GZ3A 4YECA 2GSDA 1XCMA 1E99A 4BUCA 3BK7A 1QXSA 3VI3B 2FP4B 2TECE 4GUDA 5AJHA 1EQUA 2HOQA 4XD7A 3T7AA 3F5SA 3RARA 1R4NB 2GAAA 1W0KD 2OBLA 4OHCA 4AX4A 4Z4FA 1EBFA 2PXAA 3KBOA 3P2OA 4MR7B 3UH1A 3NCTA 3EA0A 4MQEA 3OF5A 1G9TA 4RY2A 1SUWA 3QIAA 1B43A 1M9NA 3HP7A 2H0AA 4GGOA 3JQ8B 2OB2A 4BAUA 2HMTA 1WEKA 4GPTA 1L4KA 3FSGD 4LI0A 1O3YA 1RWXA 4KITB 2ZDGA 4C0SA 3KXPA 5GV7A 5U4QA 3D6UA 4FFLA 1L4NA 5IDXA 3IYLW 1T2DA 1BXKA 1TMOA 4D9BA 3QELB 3TNLA 3JRWA 4ZZIA 3PXGA 421PA 2I4OA 2Y1CA 3OMXA 1L3BA 1KI8A 4OL9A 1QPGA 3VPSA 4BJ6A 4HGRA 2AR7A 2DPHA 4P32A 2CDRA 4YJ2F 4WASA 2QZ4A 2LIVA 1VDZA 3OO0A 4YUVA 4TS4A 1DG9A 2QN9A 2C8KA 3LC7O 4EKGA 4XWOA 2D6FA 2WJ6A 1V7CA 4R6XA 4QC2A 3TN7A 1ZC4A 1AZWA 3O8OA 5L7WA 1E6MA 1P75A 2NTVA 2AFHB 3CKYA 1ZK3A 4P9NA 1Q7RA 2WI8A 3M4XA 2VPZA 2HC9A 4G8JA 5AW9A 2LIPA 5FOUA 3TOVA 3D8HA 2EGHA 3BTUA 3W9BA 1X13A 3JWHA 3F6EX 1SOAA 2CB9A 4PTYA 2WIDA 5F5XA 2FOIA 3QENA 1KF0A 2GZ1A 1Z2PX 3CU5A 4LZPA 4RSMA 2GM4A 1SG6A 3QPWA 3P19A 3T7SA 2YZ7A 5E7QA 4PC7A 3P26A 4YRNA 5KB3A 4Y6SA 3CR7A 4HB0A 1ML3A 1I32A 3M2PA 2YRXA 2DGDA 5EIEA 1N4AA 2XJ9A 1R12A 3VKVA 2RDMA 3Q5EA 4P80A 4ZVRA 1ZJWA 3W6ZA 1D2MA 2ID9A 3WZLA 1LVUA 5L4LA 1NF2A 2JBWA 3BF7A 5LIPA 2Q9CA 4RVGA 4HEJA 3DAPA 4OP2A 5K8JB 3PEFA 3PCTA 3OKCA 3I3OA 4GYJA 4GZ6A 1A3CA 1XDSA 3RYTC 4BB5A 5LLTA 4NBTA 3OWHA 3U1TA 1EE1A 4UE2A 1VI5A 1T8TA 5DULA 3UIEA 4L4SA 2QUIA 3ENWA 4X6UA 2HR1A 1ZMBA 2OAEA 3T3DA 1UBSB 2QGZA 1E6KA 1Z6XA 3RJMA 3EHDA 3MF4A 3MINB 5EE9A 3VZSA 3I30X 4MVJI 2BE9A 3NEPX 4EI9A 2OO7A 3RC7A 3LKDA 1N1MA 3PBKA 1ST3A 3V3KA 3CUUA 1QKIA 5A62A 3ZD7A 2VF4X 3HCFA 1US8B 1G42A 4J49A 1TM2A 3EUFA 2FOXA 2XCOA 5LBIA 4HH4A 4V2IA 1INLA 1X15A 1P60A 2ZJ7A 4L4XA 3TTYA 5G2OA 1P4AA 4MAMA 2QQFA 3ZD8A 4PYJA 2WA2A 1L4FA 4J0HA 1E2LA 2ZSAA 3NM5A 2JIPA 1HE3A 2BFBB 3B1YA 1C0EA 2JCBA 1N9GB 4RGBA 1S8AA 4PYNA 4GRDA 1UKEA 2RGWA 1OBVA 1OFGA 2IYTA 5AJWA 1OILA 3LL7A 1ACLA 1EK2A 4MWGA 3BMOB 4Y2HA 2JHPA 5DH9A 3TLAA 4BAZA 3FTEA 2Q99A 4ZA2A 4EYOA 4TKVA 5CA1F 4V24A 4WADA 1GKYA 1IJKA 3O3CA 3C6KA 4P54A 1ZUHA 1M66A 1HZZC 4BKUA 5K4HA 2ZYAA 3O7WA 1QH9A 4I9NA 1K3FA 3QKRA 2EZ4A 4LDZA 4V02A 2QF7A 4OGFA 1CQJA 2PRSA 4GLJA 2CB0A 3TSZA 1RYYA 3AM3A 1VHJA 2J9GA 3ADPA 1NTOA 1VHDA 1NKTA 2XWBF 3LA6A 1EXVA 2H1FA 3U7IA 1GCOA 3I73A 3SN6A 4A1FA 3W3AA 5LMZA 5HQJA 3MCVA 2FFRA 4Z4GA 2CXXA 2YNMA 3GLGB 1YZUA 3WHKA 1RNLA 3QMPA 1ISRA 2AJLI 2PGAA 2W0SA 4I14A 3TSYA 2XMCA 3QE0A 3ZLBA 3H2BA 4LOAA 2G0AA 3GJZA 3QLJA 1KI4A 4IIHA 3PEUA 4C05A 1JSZA 1Y9EA 2JRLA 3GEEA 3H18A 5FA8A 3VVLA 2Q9UA 5DN9A 5ALNA 1IPFA 2YN0A 3DMTC 3KAJA 3C6BA 4FSXA 4NNPA 3QQ5A 3ANNA 5AOAA 3IEVA 2FPUA 4CIDA 1IXKA 4P92A 3OWOA 4ZC1A 5REQA 2P0YA 3R76A 3KTAA 1XOIA 4RVSA 3PICA 1EFDN 3QXSA 2Q5EA 1R0BA 4TM7A 1ISSA 1W19A 2H4XA 2I9PA 1IMOA 3A7DA 1NT4A 3QBEA 3NXKA 2GVNA 2OV3A 3GCZA 3NV7A 4CQMA 1B0AA 1ODCA 3OUZA 1KI7A 7AT1A 3VKWA 4GKVA 1NONA 1G5TA 2W6JD 3Q0IA 5FUQA 5K3EA 4ABTA 2GMWA 1W8DA 4FMCF 4J3NA 3VV3A 4I1SA 3Q8XB 4I0WB 3DPUA 3KV1A 2PKQO 4PBRA 2VQFB 2OGWA 5B3KA 1XK6A 2OHXA 1IH8A 1YDGA 4INAA 3L0BA 1H94A 2D7CA 2OZPA 3BE6A 1EJ6A 4PAOA 3LOQA 1V25A 4DG9A 5IWCA 1DFIA 2RHDA 2XYVA 1V5WA 5C35A 5BYAA 2XQIA 4NP6A 1XEXB 1YJXA 4AZWA 4KIGA 1ZL2A 3RVSA 1DUVG 4KLCA 2IY7A 3ZLVA 1UBTS 3ZZUA 4N18A 3GF4A 3ELYA 1P1JA 5LYYA 1SC1A 1UDWA 4HX9A 1C2YA 3WO1A 2QRZA 2A1TR 3WKBA 2HCFA 4TWBA 4YT5A 2B2XA 4UBLA 3HKEA 1CYDA 4IXNA 4RTKA 2ZUEA 4NQZA 4EGFA 2PUVA 2XEDA 1OUMA 1C29B 1L7XA 3B6KA 4DYDA 2MSCB 3PRHA 3BYZA 1HOTA 3O26A 5AHOA 4NU0A 4BWFB 2V7EA 4Q6WA 2WYHA 1XCPA 2B5VA 1IQ0A 1THMA 2KM1A 2EW8A 4II7A 4P5PA 4UE6A 5JV5A 4BQPA 2PX3A 4F4DA 1UMBB 3EXFB 1F5NA 1VJCA 1I4LD 4CFSA 2DJ5A 3K0KA 3LFUA 2XMRA 2QLNA 2D1SA 4OQ4A 1SKAA 4A73A 4J91A 3L4KA 1AKTA 3SAJA 1ZYUA 3HBLA 3SCZA 3JVIA 4NFHA 5I8PA 3AI1A 3N7UA 2JGMA 1RXSA 1FLDA 1VBMA 2O2ZA 1J33A 1S9HA 1MC4A 1ZJ5A 5FAXA 4DCCA 3H1BA 5E8JA 1G2IA 3TM5A 1NR1A 3ME5A 1SXPA 1AHIA 1CUCA 5AM3A 1UEJA 5BVHB 3E7WA 1N32B 4K9OA 2Y67A 4B7CA 3FDFA 1KK1A 3HRHA 4XCVA 2ZWAA 1QWSA 2DU8A 4KGZA 1LW6E 3X1XA 3GDHA 3KM0A 1D9XA 3DDWA 1OLOA 3L18A 4LSMA 4FP9A 3C6ZA 1FNNA 2I67A 4YTEA 2VPQA 5DASA 4V0RA 1P18A 5FL7A 1QQTA 4ALNA 2EOAA 4V0SA 2UKDA 3H8WA 4OLJA 4D80A 4DYHA 1RXVA 2QUAA 4QYWA 5GADl 1L7RA 2WT9A 3I8OA 3LX5A 1MUUA 2FMKA 3GLKA 2D8MA 3BZBA 3LUGA 3N7AA 4MINA 2W48A 4NDNE 3NOVA 1M83A 5CW2A 4AYXA 3NMUF 2NVOA 1RAIA 1W34A 3ZJUA 3UW1A 3ZTWA 3A04A 4LVOA 3MCZA 2PUBA 3HFJA 2GJAA 5JANA 2OXFA 1N9ZA 1P2SA 2VNSA 4Y30A 1KEEA 1ZM4A 1JVBA 3O1HB 4B3JA 3T5CA 4TXJA 4XGQA 3W04A 4A2CA 4CG3A 4N03A 4EA6A 1TAHA 4HVLA 5I9IA 3D31A 2VHYA 4OHVA 4R2XA 3KYCA 4L22A 5T4FA 2P77A 5H4GA 3DVAA 2WUWE 3PRKE 3VH1A 4UUMA 5K8CA 4O5AA 4NCBA 2QVLA 1GKKA 3PXBA 3Q3VA 4UCFA 1U7TA 1KYXA 1N6HA 4RD1A 3OBBA 2II6A 2M1ZA 4M38A 2X0FA 1N3LA 1Z2DA 3BGVA 3A9VA 2JFBA 1AN0A 2P2NA 1MGOA 2DP4E 2D1YA 3DB1A 2Y1GA 3I6QA 1K6IA 2BVNA 4ZT5A 3TSWA 5HWSA 5JMWA 1E3EA 3EVEA 2FFQA 3C70A 1C7EA 3FZNA 5E2IA 5FYDA 3ORSA 2R6ZA 3FW1A 3DWEX 1A2BA 3IO3A 4U2BA 4CMAA 3HMKA 3BRWA 3PXCX 3G1TA 4B1FA 1UPXA 4QJ4A 2H7CA 1A8PA 5K2MA 1KQNA 5H9WA 3QV1A 1VGQA 4S1VA 3NDRA 2O50A 3GUHA 1SC4A 1E79D 4R5MA 3NORA 3IIEA 4Z4EA 3HWWA 1CJTC 1EXDA 1EX6A 1PYOA 2DQZA 1DBIA 1JU4A 2ZS7A 2CN1A 3IP9A 3LX8A 1WZCA 3AC0A 4DOMA 2WKRA 1EVKA 2IVZA 1X77A 2B4AA 1L4MA 1MAWA 1V8OA 3Q41A 5FPYA 3ICEA 2WIKA 1HDXA 4YMSA 3K0CC 5G4LA 5BSWA 4JXXA 2YJNA 4WK6A 3HVRA 3B6JA 5BRNA 5HM8A 1JHXA 2A94A 2WQZA 3ED1A 3RC3A 2PMFA 1QQBA 4GE0A 1T1IA 3DTVD 3SJAA 1GTSA 1I4EB 4C0JA 1ILEA 2A9OA 1HYQA 1GKUB 3PITA 2OXRA 1B73A 4XB1A 2VDMB 4ZVKA 3RS4A 3RVKA 1EX1A 4IIJB 1DZIA 5JD6A 2P2LA 5TGZA 4OYLA 2QJRA 3CRZA 2Q50A 2H2AA 4FKZA 4PRZA 3STTA 3V80A 2P68A 2VZ9A 4HVCA 4MP6A 1ZCBA 1QP8A 3AMVA 1EVIA 3RUEA 2ES4A 2PWAA 2ZYVX 4HX5A 2E9SA 2EZUA 4WWHA 2P90A 1EGAA 3QMWA 3GA5A 4BBJA 1YR2A 1BWRA 1FFXA 1SM4A 3OSUA 4H1HA 4K1XA 5BN5B 1DAPA 4PBTA 3GMIA 4KDEA 4RH0A 1EFCA 1X7YA 2FFBA 2R44A 3I2GA 4LCJA 5TB5A 4FDVA 1RE1A 3AG6A 5EINA 1DPFA 2FFJA 2ZIGA 3OCXA 1PCXA 4BLTA 3CSDA 4OXNA 3WRWA 5AI6A 2XT6A 1J2YA 4CKEB 4M22A 2X8JA 1X7WB 2VJBA 2Q2NA 2XT0A 4IJ5A 4AYTA 4ZDWA 5LNK6 4D44A 2PYZA 4NX2A 3V3TA 2EYQA 1E8NA 5F2KA 2UYOA 2J9RA 3AHDA 4LWPA 4PIPA 3FAKA 2ZSHA 2GI4A 3EXFA 1RC1A 4KLZA 4MQ5A 4XH9B 2G04A 1PDVA 1OR8A 4IFTA 4B32A 1A96A 3WL7A 2IH4A 3BJZA 5FV4A 5L3QB 4UM5A 4GW3A 4YV7A 2D06A 2QRLA 4HGYA 3O74A 1SBYA 4ZK6A 3VX3A 1VXOA 3H8VA 4BFUA 6REQB 1G21B 1DLJA 3HWSA 1FYDA 4R0NA 3LQ1A 1XDDA 4CMJA 4EFMA 4KNVA 2WWVD 5K6AA 1RHJA 5DJ5A 3DCIA 5CLLA 1P39A 2Q7DA 3KQHA 4NC9A 1YCFA 2ODQA 4NJOA 3RF7A 4RD2A 1P33A 2R6HA 2BY4A 1XMSA 4E15A 2PUFA 5CCXA 3PWZA 5JMPA 2B25A 4C4XA 3U2QA 3GUUA 4MV0A 5B1SA 5D6NA 2DFNA 1AHHA 4TT8A 4TQ9A 5L7YA 5IXJA 3TAHA 3LCUA 3MYYA 5DEOA 1DZ3A 3I6MA 2EX1A 2FX2A 2XI4A 3SC4A 2ZSIA 3PKZA 4XFDA 2WIFA 1XTPA 4MI3A 5TVGA 5AW7A 2WMYA 1XRPA 2YY6A 1VJDA 3UYKA 1U99A 3ZDEA 4CR7A 3HK2A 1DAGA 1C9JA 2ODAA 3EQZA 4MMZB 4CV0A 4R8MA 5K7SA 2KJQA 1RJWA 3IQFA 3DUFB 4RVFA 2CXSA 4ME6A 4BV2A 4Z0HO 3AF1A 2H57A 4GQAA 3VR5A 3DLAA 4DMHA 1F7VA 2BI7A 3H16A 2MYUA 4B87A 4GVLA 3ZN2A 1U6IA 3QWFA 1CKEA 4UEOA 5G3YA 2J6BA 4EMBA 2PTHA 1E7YA 4WT7A 3W4KA 2FLKA 1QH1B 3KZKA 2OB1A 5HFAA 1BW9B 1EINA 2ECKA 4BJ3A 4DG5A 2YKGA 4ZI7B 4FCCA 3PA6A 1XMJA 1LBIA 2DY1A 4PVDA 5A4DA 5EJGA 4LMPA 1MNQA 3JATA 3ANTA 2LRHA 3FWPA 4BNUA 1B6TA 2B69A 2G36A 2BYTA 4BCDA 3DMPA 1DRVA 2G4CA 2Q8QA 3K96A 1R6TA 3LQKA 4U6NA 4US1R 3KQQA 5B3JC 5FI3A 3KVOA 3OESA 2UZ3A 1EAMA 5H4HA 3H3XA 2FWMX 1VJTA 2QA5A 3GPIA 1NG1A 4B35A 3GLVA 1WTCA 1XTQA 4DV3B 1VLZA 3HGMA 4BNDB 1VRWA 4M8LA 3SQNA 3GJSA 4TVBA 3EEOA 4DRZA 1JZQA 2XCTB 1ZY2A 3A37A 2A0FA 3KB6A 4FZRA 3ZGVA 2FQWA 2V5UA 3D8UA 3IRVA 1DSSG 4C29A 1EG2A 1WF3A 3K6JA 2FN4A 1RRMA 2P11A 2AG5A 3JASA 2VXCA 2HZBA 1GSIA 2P2DA 3L93A 3NTVA 4PRYA 3IPCA 3VTAA 2K2QB 4BU1A 4CNBA 4DJAA 3AEQA 1RP1A 4H7FA 2G80A 4XR4A 1PVOA 2CNDA 3OZSA 3FA2A 4TTVA 2JGDA 1HE5A 3DT9A 4KN8A 3FKJA 1KY3A 1Q21A 4U2GA 5EI5A 1ESCA 1YZGA 2ZYHA 4H9GA 2Q45A 4GI5A 1TCUA 3FPLA 3NG1A 1L6RA 3QWHA 4JLVA 4E13A 1BFDA 3THYA 3PJEA 2YQ4A 2YNMD 2CCKA 1O5IA 4P83A 1NXTA 4UD2A 4BE7B 1XEAA 2XOKD 3JW8A 3NGXA 4TSFD 4AIIA 1F14A 1N0WA 3PL5A 3T4PA 1X3LA 3EVBA 3D1LA 3IE0A 1DHRA 3OH8A 4HWSA 2ZIZA 4LXXA 1ZCFA 4QU0A 4TV8A 4Q9IA 1AHPA 4OA8A 1PO7A 2ZBDA 4JMPA 1R2QA 2GM5A 5BSUA 3F8TA 4ZHQA 4JQSA 5KMGA 2GF9A 3EPRA 2VAWA 3OY2A 1QANA 4D81A 2Y8EA 1M76A 3RU9A 1QRTA 2IV2X 4QZVA 3QVGB 4LI3X 4FM9A 4G0ZA 2WUEA 3T3HA 2VP3A 4BHTA 1C7ZA 2PH7A 1U2GC 2O23A 5IKPA 3MIIA 4LHEA 5DBGA 4E32A 1QG4A 5H02A 1XPRA 4WPGA 1SN7A 2AEMA 2Z9CA 2R48A 3NTOA 5TQ0B 1H9CA 3W7AA 3DOEA 3BK1A 2OMEA 5HTOA 3HN6A 2QX6A 1IIRA 4GMKA 3WDKA 1UBGA 3M3PA 3U4QA 2WNHA 3CBGA 3FMFA 4MLDA 5IF9A 4GBED 5JVDA 1V6CA 2XTMA 4Q05A 1BU8A 5F1KA 3OLXA 3RYHA 1PLKA 2VPIA 4GMGA 1OYWA 1G7RA 3D0KA 4WNCA 3ZJYA 1QYVA 3U4CA 3PFBA 1FFCA 4PG5A 4M53A 5JEDA 2B2CA 4A10A 2VF8A 3CVYA 2QD4A 4G0OA 2AI2A 3LHIA 3A6KA 1A82A 1PR0A 3SZMA 1RZRD 3AZOA 5LZ5A 1EESA 1YGPA 4WBXC 3KG2A 3LCCA 3CW8X 2AG0A 4TMYA 3H8SA 1L5MA 1PYGA 4MI9A 3ZGNA 2WUDA 3ETGA 5LP6F 2G4VA 1STOA 4FINA 4Q5IA 1PS8A 4TMVA