1J99A

Crystal structure of human dehydroepiandrosterone sulfotransferase in complex with substrate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
b'SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFLKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKTQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCOHOL SULFOTRANSFERASE
publication title Crystal structure of human dehydroepiandrosterone sulphotransferase in complex with substrate.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 284
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2001-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j99A00
2ZAMA 4J0QA 2CHGA 5KUTA 2FE4A 3C14C 1F2TA 2EFCB 2AXPA 1E9AA 4D4KA 2FFHA 3NIBA 3RSLA 3SBEA 3ZVMA 5DO9A 3PV0A 2GXSA 5IK2D 5C1BA 2QM7A 3BD9A 1SZPA 4PPNA 4TLEA 3DM9B 5LDDC 4URYR 3QG1A 3DEFA 3WBJA 4IDOA 3RAPR 3O8CA 1N5JA 5JBQA 2RKOA 4BFSA 4PPFA 1T5LA 1N5IA 1G3IA 4CEJA 1QHHB 2IYWA 3K0AB 2O8FB 3VQTA 1Q1BA 4D2IA 1C9KA 4TLBA 1AIPA 1LV7A 1QBKC 5EP3A 3PUYA 5E3HA 3IEVA 1IY1A 2NPIA 3QUSA 5AWFC 3AP3A 3KQNA 4JBYA 2D4HA 1W2HA 3UWKA 1Z63A 1MO4A 1T6NA 4LYFA 1MOZA 1YZUA 2W6IA 1VCMA 2FDCA 1QG2A 1RKBA 4OQFA 1Z07A 3NXSA 4RZ3A 2W0MA 4Q9LA 4MRNA 2VHUA 2OBMA 3MMPA 1DO0A 1G6HA 3IKJA 3GLHA 4KFTA 4A15A 3EZ2A 1IXSB 2EFGA 2F43B 3FTQA 1G8FA 2FF7A 4EAQA 4QHYA 4US0R 2R6DA 1E2JA 4ESVA 4C0BA 1P9WA 4KLNA 3HR7A 2RGAA 1ZAKA 2OLKA 2FPMA 2GVZC 4JLAA 2QSZA 4LHVA 2WJVA 2HF9A 1XP8A 2QQ0A 3IIMA 2REOA 1U0HC 2GXAA 2PZFA 2XSZD 2C04A 1O87A 3BB4A 5EP1A 1H8ED 1AKYA 3K0CC 1Z3IX 3TVDA 4BLPA 2EVWX 2OCAA 5A5GA 1EFHA 5HZKA 2CCJA 4DJTA 1CXZA 1VCOA 2CDNA 4L9SA 1GAJA 2JLWA 4GMXA 2DWPA 2G0TA 5JECA 2VP2A 1RYFA 3NG1A 2CL7X 1FNNA 1P6XA 2GK7A 3I73A 4DCTA 3Q7PA 2GK6A 3LQRA 1MV5A 1UAAA 3L0SA 3K0CA 1GVNB 3U44B 3QKSB 2BMJA 3B9QA 3EZ9A 2GETA 4OI2A 3EXAA 2G3YA 1E79D 1QHYA 4UKDA 1S0UA 1AA9A 1R5BA 4LK2A 2WBLC 4PPQA 2GCPA 1GNQA 5G40A 5EXPA 3A36A 1QDEA 4YQFA 1HTWA 4O2RA 4Z8YA 2ZRPA 1NMXA 4NCJA 4DT1B 1JBKA 2QQEA 4JJKA 3N5CA 1W46A 1DPFA 3ZD6A 3FKSA 5KSZA 2CVFA 2MSEB 3KB1A 2O8CA 2ZI3A 4TYPA 3FGNA 1FP6A 2AD5A 4TTQA 4IHQA 1N5LA 4WXPA 2CXXA 3QKTA 5FPTA 3T1TA 2IYXA 3THYB 1QG4A 1Z6XA 1Q44A 2P3SA 3D8BA 4Q47A 2C9YA 3UMFA 1E9FA 2RGEA 4PHFA 1GNPA 2FWRA 4AYTA 4BEJA 3I5XA 1OHHD 4JKYA 4F7WA 3R7WB 1YHNA 2ZITA 1SGWA 4JYBA 4A4DA 1VMAA 1G64A 1TPZA 1HURA 1E2NA 4RD2A 1JEDA 3AP2A 1M6NA 1RW4A 3K0EA 2FOLA 1ZNWA 1G4UR 1ZUHA 2JDIA 2WWYA 3KQUA 3W9YA 1KOFA 1X3SA 4Q4HA 1EXMA 1ONBA 3EC1A 5DGXA 1KI7A 1UBFA 2NO7A 3HYTA 5CIQA 5JS8A 1GKUB 1LFDB 4ZKEA 2HJGA 1TQDA 4PZZA 3EWAA 3QPUA 5CITA 3KB2A 2RGNC 2WJYA 2XTZA 4A0GA 4YC7A 2Q9CA 2Z4SA 3PQCA 4GP7A 3CZPA 1W0KD 2ZSBA 1COWD 3MD0A 1UDXA 2E9SA 2WPDA 2OT3B 1G17A 2C5LA 2B8TA 4EPTA 1E9BA 1G7TA 3LW8A 3CIOA 3KJEA 2OCPA 3GEEA 2ZIAA 2RGGA 5J5CA 3A4NA 2ZRJA 2R8RA 1NLZA 2W58A 1Z6GA 4L16A 1OXTA 1NVWQ 3SEAA 3G0HA 3TUZC 1R5OA 2RGNA 4IDHA 3KQLA 2V3CC 2WTUA 1AJEA 5FPYA 1NVVQ 5HCNA 2O8DA 3HP1A 4LYJA 1OJLA 2ZRMA 4QXAA 5GJVC 4CW7A 3NHAA 2DFLA 3T5DA 5AJZA 1ZC4A 1M34E 4EPVA 5DN6D 1WBDA 1KJYA 1QVRA 2ZRAA 1OH6A 2ZRLA 2X2EA 4LV5B 1N6IA 4GMDA 3MUFA 4JYCA 5EXSA 3IDQA 1YZKA 2XAUA 4DLVA 1OFUX 2JLVA 1FUUA 4I1SA 1GRQA 1N6PA 3LXXA 2QRNA 4D0NA 3L2OB 421PA 1UKEA 3ZVLA 2LKDA 3HYRA 3ZH9B 1UEIA 1G8HA 2WAXA 1ZM4A 1KHTA 2GILA 2UZ3A 2ZI5A 2Q21A 3ADDA 1XMVA 3L43A 5FOXA 4MGIR 5HTKA 4ABYA 1D2EA 1YZNA 4KVAA 4XD7A 3U61B 2VSXA 1JXMA 1HQCA 2F1JA 3R9XA 3B1ZA 2ZE8A 3NC0C 1E2QA 1UKVY 2LWIA 2WKPA 1KI6B 1OYYA 2XJ9A 1NMZA 1KAGA 4B71A 4XOIA 4CZ2A 4B3CA 3CNOA 1P2TA 4B74A 1GITA 3B7GA 1A2BA 3K70D 4RKEA 4OKSA 3HU2A 2D06A 3QENA 5AUPB 1M7HA 4IVRA 3JVUA 3BWDD 1KI1A 3ADKA 2RHDA 3W3AA 5GJCA 3U5ZB 1KJWA 2TMKA 1JR3E 1FPMA 2X77A 2ZSAA 2NO1A 4B32A 4G5QA 1Q1ZA 2NO9A 4TMTA 5JLJA 2ZM5A 2I3BA 3NBYC 4GRAA 4UNNA 4Q66C 3GLFA 4MKIA 1T4GA 4OYHA 4D82A 2J0VA 2VP5A 1BOFA 2BEKA 2DPXA 2FG5A 3VR2A 4RD3A 5FPKA 2J41A 3IIKA 4QJ5A 2HYDA 1KK1A 1AM4D 4OHWA 4UNQA 1VHLA 1FMLA 3RWOA 3I92A 3U6BA 5HKKD 2ZI6A 2YWGA 3K53A 1TUIA 3QSYA 2AWOA 3QKRA 4DCUA 3THXA 2ZANA 2JLUA 2C96A 2W0SA 3ZLJA 4D25A 3BRWD 3R20A 2VHTA 1G3MA 4PC7A 3REGA 1F2TB 3IBGA 5JFGA 1VDZA 1XXHE 3D31A 5KPJA 3V9PA 2GCOA 4WZAE 4Q5IA 4CF7A 3KJHA 1GIAA 1GKIA 2I1VB 3P1JA 3DZDA 1E6CA 1E9RA 5FTLA 1OIWA 3B1XA 4LC0A 1L8QA 3T1OA 2WVJA 4BLSA 3BAFA 5DSZA 4B3GA 2AFHE 5HZHA 2WWGA 3WNBA 1E0AA 3X1YA 1Q57A 1Q21A 4LBZA 2YC2C 2CCGA 2REXB 5KDLA 4DBLC 3UG6A 3L8YA 2FA9A 3HU1A 3EZFA 4D81A 2H7VA 4FMDF 621PA 2ECKA 2ZRIA 1GTVA 3ICQB 2B6HA 3ZVRA 4C7OA 2V7QA 4A6XA 4NYJR 3VAAA 4ERNA 1KK2A 3O47A 3Q3JB 4OQMA 3KKPA 2IYTA 2IYYA 2CK3D 3K9LA 4QBHA 4DDWA 3L8ZA 1N6RA 5KTYA 3BE4A 3KL4A 2IA5A 3W90A 2VTKA 3GLHB 1T8TA 3QPVA 3D3QA 4DLYA 1XCGB 1ZINA 3CNLA 2X8AA 4D4MA 2IYRA 1R0ZA 1F2UA 2Q0HA 3WYFA 4NU0A 4JLBA 3K0AA 1MABB 3TQFA 2JJ2D 1HYQA 1G8PA 2XB2A 3RSOA 1DELA 5DIFA 1II9A 2P67A 1ZVQA 1G6OA 1XJQA 3FVQA 4PHHA 5SZIA 3UKDA 2ONJA 4AYWA 4C0HA 3JZAA 1UPTA 3NTUA 2QTHA 2ZRFA 3OIYA 3U3MA 1GM5A 1ZUIA 1EFRD 3ZQ6A 4QBIA 2CVHA 1UADA 1AQYA 4BUJA 2VPPA 1LVGA 5LD2C 4UJ3A 1RPZA 4M9XA 2JA1A 4YLGA 3R8CA 4PO9A 3RS5A 3T12A 2FFBA 4DWJA 4Q00A 4Q9KA 1P5ZB 3LV8A 2EYQA 4BFZA 4FWTA 5GJWC 2JASA 2OE2A 4URUR 2FU5C 4TMVA 3WMEA 2G6BA 2WWFA 1IXZA 4H1VA 3C16C 1VYVA 1Z6AA 1ZBDA 5HE9A 3U7EB 2EYUA 1GFIA 2A5JA 1ZP6A 3FFBA 3PUXA 2JLQA 2P2LA 4TTRA 5AR1A 4ACAA 4R98A 1C4OA 1N6OA 4B2IA 4E09A 5CDFE 1NBMD 4KAXA 3MG9A 3EPJA 2ORVA 3EWSA 1SVMA 4WW0A 1N6LA 1P9RA 2BHRA 2EU8A 2VP0A 3O8RA 1FL9A 3I32A 1VG9B 1WRBA 2O8CB 4LJAA 3BBPA 4URZR 3H2YA 3ZIAA 3MFYA 3DM5A 1KSJA 2CLSA 1IONA 4MITA 5K8UA 2XJ4A 1D5CA 3EPKA 1MRSA 3RC8A 3CBQA 4Z1MD 1T0JB 1YJ5A 2JATA 2VLIA 4RZXA 4ZCIA 3KKQA 4X8HA 2XB4A 1TQ6A 3HU3A 4DSTA 3TJZA 2HXSA 3EX7C 3G5UA 2D7CA 2IK8A 2GVDC 4DIDA 4ZDJA 1DG3A 2QAJA 5BYJA 3DOFA 2Z43A 1XTRA 1N0WA 3SJZA 2ZR9A 3MWJA 1S96A 4IOJA 4PQYA 3R8FA 4E22A 4H9GA 2WWHA 3B1WA 3VX3A 2DHRA 4BFVA 4NCIA 4DT1A 4Q4HB 4GT1A 5EE3A 5JEEA 3U3OA 2QY9A 2VBCA 1U8YA 4FCVA 5DISB 1U0JA 3LX8A 1TEVA 2PX0A 4LJYA 3QQ5A 5JJKA 2C2HA 3X2SA 2AHOA 2WOOA 3PUWA 2ERXA 1P7CA 2FV8A 1CULC 4DSNA 1XXHA 2NMVA 3CR7A 4TMWA 1F3OA 1RRPA 2H92A 1YRBA 5AUOB 4AKIA 5FBLB 3PENA 2DFNA 1TMKA 3SJAA 2Q6TA 2WWWA 4C30A 2ZPTX 2ONKA 3V4FA 1TTTA 2ZSDA 4NPHA 1YVDA 3AUXA 3AVTA 5E7MA 1SVOA 4ZCMA 5K8IA 4A2PA 3C41J 4DCNA 1XD2A 3SU8A 5HPYB 4LJ7A 4IXMA 4OBEA 2DCUA 5EP4A 5JI3E 3LA6A 5DI3A 4CDGA 1WE2A 2NZ8A 2O8DB 3WYAA 1U90A 1N0VC 2ZEJA 3B1VA 4PC1A 4CVNA 5B57C 3J81k 3OE7D 4MRVA 1K6MA 4ZKDA 2FSFA 3SZRA 3FWYA 4RFSA 5E7IA 4UQOA 5G3YA 3ND9A 5KNDA 3L82B 3TK1A 4DB2A 1BYUA 1WQ1R 3C8UA 4LOAA 3LBHA 5CJPA 1SKYE 4RY2A 2ZS7A 1S1CA 2PBRA 3VMFA 2PJZA 2V6IA 1A2KC 3NKVA 3QPWA 1DAFA 3P26A 4PHTA 4EPYA 3EC2A 1H8EA 3FPAA 3Q85A 4TZ0A 1UKZA 4LY6A 1E1RD 3RS4A 4JL6A 3Q8XB 4WIAA 4FXPA 2BBWA 2BV3A 2OCBA 4Q9JA 2QNRA 2NGRA 2ZS8A 121PA 2SHKA 2K5UA 5G53C 3FDIA 3EG5A 2GZAA 4TL7A 4ZPXA 4C4PA 3MSXA 2IHBA 3EARA 2F9MA 2CLDX 3OHMA 1Z0DA 1W5SA 1G7RA 4M1WA 4GOKA 3TKLA 2CNWA 3QF4A 2VYFA 1H8HD 1P2UA 1II8A 1S2MA 4LSGA 5KHOC 1Z2CA 2CL0X 1KZ7B 2DWOA 3GLIE 2O8EA 3E1SA 5DI9A 1IJFA 3AVYA 1X86B 4KITB 1W0JA 5LBIA 2ZREA 4K8OA 4RCYA 1ZW6A 4US1R 4AURA 4II7A 4JLMA 2OAQ1 1XEWY 4IEIA 4BGDA 2JLYA 1MO5A 2ZJYA 3G82C 1AKEA 1KTVA 3KDSE 4YONB 4ZDWA 2ODNA 1SXJC 2BWJA 3GEHA 1GRNA 1T3SA 3GJXC 3GLFB 4BRUA 3GFOA 3I8XA 4P3YA 4BZXA 4OHYA 3THOA 4N3NA 1GZSA 1U94A 5CDFA 1OW3B 2QMOA 2WIBA 4TT3A 1YR7A 1Q1QA 3Q7QA 1MKYA 1OPXA 5EE9A 1X8LA 3W8NA 4YMSA 3RRZA 2ZUBA 2H17A 1E0JA 3TSWA 1N3BA 4DDTA 1DS6A 3HWSA 4JVNA 1YZGA 4U00A 2MSCB 5FPSA 1SXJA 2D62A 4B43A 4C0JA 2ZI9A 1PV4A 4CYMA 1N25A 2WJGA 1HA3A 3AKDA 4M22A 2GCOB 4AG6A 4IVPA 5FR1A 1GOTA 4LJ9A 4X8OA 2D7DA 6Q21A 3RWMB 4LI0A 1E1QA 3N70A 3VKWA 1G21E 1Q20A 2F3TA 3IEUA 4MYHA 3E2IA 3LWNA 2IXGA 3QF7A 2JJ1A 3VNUA 5FOWA 2IEZA 3EAQA 1D8TA 2W6JD 4F4IA 2QSYA 1NSTA 1COWA 2HF8A 2H8KA 3CH4B 4PO1A 4CEIB 4Y0AA 1J8MF 5K8LA 2RGDA 4RFVA 4URXR 5GADl 1ODFA 1FTNA 1UDWA 2ZE6A 1PLKA 1LW7A 4NHOA 4YXWD 3NDPA 5JWHA 5TARA 5GVSA 3BJIC 2HDNB 2NO0A 2QP9X 2XTMA 4Q7JB 4C7OB 3UXMA 1XTKA 4IEEA 4JIMA 3DKVA 3THWB 5SZKB 3GJ4A 4XWAA 4Z8XA 4W5WA 5H1YA 3AH8A 3RYTC 2DBYA 3WYGA 2ZUDA 1T91A 4V0LA 2RGCA 1E94E 1I2MA 1T3HA 4A92A 2XNSA 1R7RA 4LJ5A 1F2UB 3RRNA 4QKQA 1XB2A 2ZI7A 4HLQB 1SHKA 4KFUA 4G01B 4KBGA 2C03A 2VH5R 4HAXA 1J2JA 1NG9A 4A6PA 1VG1A 1SVSA 1VCNA 4B3DA 2BIFA 2PLRA 5J47A 2JGNA 4K81B 1DVRA 4ZV4A 3A1UA 1ZIOA 5L3QA 3TSOA 2JIZD 5DLQC 1US8A 4ITRC 3K70C 4PHGA 4I4LA 3HPRA 1YZQA 1NJGA 1OKKA 5J40A 1G5RA 4RZUA 1XNJA 3U3JA 3UG7A 4GDFA 2P0EA 1J90A 3AB3A 1F6BA 3NH9A 3QVVA 3RVBA 2ZJ5A 4G5SA 4FMDB 4QGGA 5J4VA 2VP9A 3UK6A 3T15A 1NBME 4DVGA 4A0RA 4TTPA 2FZ4A 1MABA 2HUPA 1G3RA 2AKYA 1DAKA 4P0TA 4QGFA 2IS4A 1Z08A 1KAOA 3LAWA 5AJWA 1BMFD 3NWJA 1R0WA 3DZ8A 1DTSA 1WXQA 1LF5A 5LD2B 2D3WA 4ON9A 1S9HA 3KFXA 1U98A 2ZUCA 3D6TB 3IHWA 4Q1BA 5FOUA 3LD9A 5GVRA 1AS2A 2C9CA 2UVQA 3B82A 3CNNA 3OFNA 4PSAA 4S35A 1G19A 1W48A 2ZRCA 1RVDA 5FBRB 1NY6A 5D3QA 5FFMA 3SYKA 5BWMA 3K9HA 4DEYA 2O5VA 2F55A 2JJ8A 1KIMA 3OEHD 1P4SA 1FX0A 1YZTA 3PUVA 3B85A 4OJKA 4P33A 3WNCA 1QRAA 2QM8A 4NONA 1X8JA 1R0XA 4TYQA 5KDDA 2GXUA 2IYUA 3SN6A 3BOSA 1A5TA 3CB4A 4P32A 4DLRA 4UNSA 2FZLA 3CM0A 5LB2A 1E9SA 1G8GA 2O0JA 1W2GA 1XF9A 2VHCA 5CB6A 1KI2A 2DYKA 3PXGA 2GDJA 3MWKA 3TRFA 4TYYA 2IYZA 4PC3A 3SC3A 3AKCA 2EFDB 4B48A 2OUKA 4F91B 5FUVA 3FB4A 4KJZA 4B47A 2UZIR 4OI4A 4ESHA 4V0MA 4QC2A 4BFXA 4TQUS 1VG8A 2J46A 4B3FX 4NP6A 3H84A 1D2NA 1W36D 3VR3A 2B7BA 4DEXA 5UKDA 3AVVA 3QG5A 5AK0A 1XXHB 2J1LA 4D26A 4M1KA 1JAHA 5H68A 4BQSA 3DMNA 3ZGXA 2WSSD 3VNVA 2C8VA 4V0OA 1T8UA 3F5FA 4MKGA 4MKFA 2GF9A 1MO6A 3U3KA 1N6HA 4ARZB 4LGMA 4Q7LA 5DE3A 2GAOA 2ZR7A 4WBSA 2RHMA 1XD2B 4HLUC 4G5OA 2AK3A 4XVQA 3PEYA 1KNXA 1U8ZA 3AF0A 2V6JA 3VKGA 1AK2A 1N2CE 5DI3B 4PFSA 5IDVA 1CJUC 1QVAA 4R2IA 4XVUA 2GKSA 4RJLA 1DADA 3EZ6A 1R10A 3ZQJA 1CRQA 2GWHA 1NN0A 4N0DA 1G5PA 4JL5A 5J4KA 4O0MA 3NEJA 5KU1A 4F4CA 821PA 3FMOB 4RFSB 3A1SA 3TUIC 4Q1CA 3MRSA 4Y0VA 4DZZA 1NKTA 3LY5A 2KSQA 1YE8A 4HLUA 4NZYA 2A5FA 3LX5A 1Z83A 2HT1A 1XCMA 3QVUA 4GP6A 4LUCA 4M4SA 3WNDA 3VKHA 5JMTA 5B58C 5D3MA 2OXCA 1OT3A 4A2QA 1J7KA 5CM9C 5FUYA 1EFRA 5BXQC 1DAMA 2C78A 1JJ7A 1X6VA 4PSKA 4TSFA 5DH9A 4HAYA 3A37A 1NLYA 1RIFA 3BFXA 1Z47A 4UXIA 2AKAB 1B0UA 3T1VA 4AG5A 4MDFA 1TL7C 2YJTD 4BFYA 1W47A 4MGKR 4DLXA 3KTAA 4LPKA 3QF4B 1XEXA 2NO6A 1II8B 2GNOA 4JLVA 4HB3A 3QY0A 2O8EB 1AQUA 1EX7A 1SHZA 3T1QA 3W6NA 1TNDA 3DVLA 4A0HA 1A4RA 2CEAA 3TR0A 2Y8EA 2W83A 1S3GA 1ELOA 3O8BA 1MO3A 2QI9C 4MYUA 1S8FA 2J45A 1OXSC 2IXFA 2QT0A 1NBMA 3H4MA 4FMCF 4NYMQ 5JSZB 3O8DA 2F7SA 3L0OA 4LX0A 4LHWA 2BKUA 3T06B 3W6PA 4KI0A 3SHWA 1CR2A 2V9PA 3QIAA 5JI2E 1KDOA 1X1SA 3PITA 1LS1A 1RFLA 2IYVA 3A1VA 2ZXUA 4MRPA 5JCPA 2YC4C 1GL7A 2ERYA 2VHJA 2QPAA 4L5BA 3ZZUA 4DLWA 4H1UA 1MR3F 3DMDA 1OB2A 1N0UA 4BZPA 4Q4AA 3EPLA 4X8LA 1VG0B 2MSDB 4PXAA 3KUDA 4QRHA 1DAHA 2W6ID 1ZCBA 3CRQA 5FBVB 1E4YA 1L4UA 3WMGA 1SXJB 2EWWA 5FI0B 5KOYA 4HLCA 4JBWA 4QGHA 4HEJA 4LJ8A 5FI1B 3RNLA 1J8YF 3K0SA 2FEOA 2CJWA 1OE0A 2I4IA 2HYIC 1N5KA 4MGYR 5TMPA 2ZVPX 2OEPA 2FN4A 5JWRA 2IW3A 2G83A 3K9NA 4I81A 3AVXA 2REBA 1XEWX 4M21A 1AZSC 1NN5A 5FR2A 3MJRA 2FPLA 5DHFA 3GFTA 3PEWA 4JVSB 2P6NA 4CT5A 2XITA 3UATA 5G3ZA 3VTKA 5JHHB 1E9CA 4QG7A 1SULA 1KKLA 1K8RA 1EFUA 1KI9A 2VEDA 5FTMA 4NYIR 2P65A 4TZ6A 3IGFA 1JQJC 4IOMA 2QAGC 2GZHA 2GJAA 5CYOA 1U81A 1G20E 3AVOA 4YDSA 4EKDA 5SZJA 4XSHA 2PJRA 4JS0A 4DLUA 1QHIA 4QM7A 1AN0A 2KBEA 1OYWA 4A82A 1WBBA 4POAA 2IT1A 3CO5A 2GJ8A 1OFTA 3B13B 2OCYC 1LTQA 1OLOA 3Q72A 5JWOA 2EFHB 2BBTA 4TL6A 2KE5A 4F38A 4TLAA 4XSGA 2GF0A 1NVXQ 4OI0A 2ZRGA 1II0A 1RJ9A 2F3RA 1XEFA 2YV5A 3BB3A 2QAGA 4OL0A 3CRW1 1FQKA 1E99A 4DSOA 2R6FA 1GDDA 4IXNA 4LDJA 4V0KA 1JECA 5CB8A 4CEIA 4ZDIA 4FCWA 4TMKA 3X1DA 1I2DA 1ZC3A 1OH7A 1CR0A 5HE8A 2XNDD 5L3QB 3OIUA 2XOKA 2GCNA 2CL6X 2AX4A 3MAAC 2QP3A 3BK7A 1US8B 4KO8A 4LV8B 3OEEA 4MQBA 5TDHA 2YKGA 3FKSD 2BEJA 4AWXA 2BMFA 1WB9A 3W6OA 3JZMA 2O0HA 1ZM7A 3TAUA 2DWQA 1Z22A 3THWA 1NL3A 1J70A 4M2LA 3LW7A 4M9ZA 1YU9A 4XWKA 4OHZA 5E7JA 4E03A 2D2FA 5KSOA 1TQ2A 3BIFA 4NDZA 3QXSA 4FW9A 1H8HA 2BCGY 1UBGA 4BFTA 3RABA 1XDBA 1Q12A 1JNYA 1XMJA 1P62B 2HLDA 1DEKA 4C2TA 2R9VA 1YRAA 3U7HB 3K70B 1TF5A 2QE7D 1NLFA 3NC1C 5BW8A 4MYTA 1KDTA 1I4TD 1KY2A 1Z29A 3TLXA 3QBVA 3WXMA 2CMKA 1W4RA 4Q4JB 3UPUA 3TNFA 2JDID 3IUYA 2J9RA 3LBNA 3SFVA 1JJVA 4PR0A 1ZU5A 1KMHB 5KSYA 3SJBA 1FP7A 3OAAA 2EQBA 1XPRA 5F3WB 3TH5A 1N6NA 4DC9A 4A1FA 1WP9A 4PQRA 1KYIA 3CF0A 4GPTA 2VSOA 2QRZA 4PQFA 1CP2A 2V55B 1FX0B 3AGQA 1OXXK 3RS3A 1FNMA 3K8YA 2WPDD 2ZROA 1AZTA 4GL2A 1DAEA 1NY5A 8OHMA 3WHKA 2QENA 4M1OA 3SOPA 1XZQA 2OSBA 5BN4A 1XBTA 5FBQB 1X1RA 4AKHA 1XJ0A 4HUQA 3CRRA 3L0IB 2IEYA 2QROA 3UMRA 3T5GA 5F2EA 2IYQA 2KBFA 2RAPA 4ASUA 1GUAA 4JJZA 4L15A 1MRNA 1BH2A 3CPJB 4Q21A 4W9MC 4BPBA 2X19A 1CEEA 2YWHA 4LBYA 1IAQA 4HZIA 2VIIA 1QZXA 1P61B 3FOZA 5FL7A 1L7VC 2W6JA 1RRGA 2QP4A 2YHSA 2BBSA 1KSFX 3NVAA 4WVFA 3A4LA 4P4TA 4I1OA 4X8MA 4DB4A 1JR3A 2PMKA 3FMFA 1E69A 1KZGB 3CRVA 1KY3A 2ZE5A 4KVGA 2A5GA 1KI8A 3ASYA 3B9PA 4EFLA 1KO4A 5B2ZA 4QNMA 1ZJ6A 1U0LA 1IY2A 2BDTA 1S9DA 2A7QA 5JS7A 2YYZA 1IN5A 3CWQA 4TQAA 3SQWA 3CX8A 3CX7A 2ZRDA 3QXXA 1G18A 1JXOA 4EFMA 1R8SA 5IK2A 4YMTA 1KI4A 4PC6A 3NBXX 4NCHA 2ODEA 1Z2AA 1FTSA 1QHXA 1QHGA 2Z83A 3WRYC 4CIDA 2N1BA 4JZKA 3QXJA 5FOTA 3TBKA 2JCSA 3T34A 1XPOA 3WP1B 1Z5ZA 3OIWA 3U7FB 5CK4A 4D0GA 1S1MA 2ZSFA 2ATVA 3CPEA 2RGBA 2ORIA 1TF7A 1NIPA 5KO2A 1P2SA 2ZYVX 4IDNA 4HDOB 2CBZA 2JIZA 1ZD9A 2OHFA 5D3MB 4ARZA 3DL0A 2FH5B 4JBXA 3CKLA 4PPGA 4YDHB 4Q7KA 1E9EA 3CF2A 3GFPA 1NRJB 1E2EA 2OZEA 1XMSA 2W2TA 1KO1A 2B7CA 2WICA 3BFVA 1FUKA 2FSGA 2ZTSA 4RD4A 1XPUA 3GMTA 2OILA 2FPKA 2ZYUX 2IUUA 4D4LA 5C4GB 3KKMA 3BB1A 1IHUA 4B76A 1BO6A 2KB0A 2BOVA 3KTAB 1XEXB 1JB1A 2JAQA 2R44A 4OK3A 2QPOA 3VR5A 4DHEA 3TE6A 4RD1A 2ZJZA 3B8HA 1NVVR 2BCJQ 4EQ6A 4HI0E 4B3XA 1W7AA 3WRXC 2DFTA 3WY9A 4C0SA 1BS1A 4ZIRB 3C5CA 3OZXA 2QPTA 4JLJA 1A82A 2XSZA 2W2VA 3BC1A 2ZRHA 3DHWC 1DAIA 4LWZA 5EXTA 3KXKA 5JHGB 3DOEA 1KK3A 3IPXA 3KKNA 1TQ4A 1LY1A 2FGJA 2FSHA 2WZQA 3CPHA 3M6AA 4GSYA 4AKGA 4RVCA 4TMXA 3M1IA 3GCGA 4LYAA 4Q9IA 3ZDQA 3I62A 1XJCA 4ZO4A 2WSMA 3WMFA 3A58B 1DO2A 2BBOA 2ZR0A 3W34A 3KJIA 3P27A 3DDCA 4F93B 3SJCA 4PX9A 3REFA 2AL7A 1JPNA 3F0TA 1ZD1A 4LBVA 2V7QD 4Q4AB 1GRRA 1E79A 3L0PA 2OAP1 3W5JA 1UEJA 4M9QA 3A6PC 5DYGA 4EPRA 2W00A 3K09C 3KJGA 2OBNA 3UIEA 4EIWA 3RDPA 1Z6YA 2QA5A 3TVTA 3U7GA 2IHYA 1VYUA 1CR4A 3LQQA 4O25A 2J87A 5JSZA 4C9BA 2AN9A 3RS2A 2XTNA 4BLTA 2PT5A 2CJWB 4A9AA 2AXNA 1CRPA 4PAQA 5FTJA 1RRCA 4Q03A 2D2EA 4JT2A 3SBDA 1PLJA 4D80A 4NBSA 2BM0A 3K09A 4M8NE 1ESNA 2QMUA 1IQPA 5CYPA 3RHFA 4FMCB 2WSSA 3BGWA 1OHHA 3EIHA 3WBKA 1U99A 2C9OA 1S4QA 2AR7A 3EA5A 3P4YA 5C2JB 1T9HA 1ESMA 1C1YA 3B60A 2MMCA 4PAMA 4PZLA 4DRZA 4FIDA 2IBMA 4NL4H 1NJFA 2FMXA 1VYTA 2FNAA 1JR6A 3PEVA 2GJSA 1GWNA 1ZMXA 2AD1A 2G9NA 1E2FA 2QORA 4QHTA 5IT5A 4LC1A 1T5IA 4TLCA 5H70A 5JCZA 1KMQA 2Q3HA 4W5JA 1GL6A 1HQYE 1P75A 4P4SA 1EGAA 4GZMA 4P31A 4V0NA 4FWIB 3KQHA 2VSFA 1U8AA 3IHLA 1G41A 5JJIA 2ZETA 5F9HA 4PAOA 1E32A 3MGCA 1AS0A 1RJ9B 4M1MA 1IN7A 1JEEA 2YNMA 2XGJA 4QJ3A 2QAGB 1W0KA 1VTKA 5FTKA 4BZQA 2ZU6A 4AD8A 4GFDA 4OQXA 4C2UA 4AIIA 2IYSA 4XTRA 4KCGA 1G4AE 3LNCA 4HZUA 1E3MA 2IUSA 1S3SA 3RRYA 1T0HB 1UBCA 4FINA 2FSIA 4TMZA 1YR6A 3FYHA 3W8RA 3ZIAD 1F60A 2KI5A 3GEIA 4G0NA 4XIGS 2ZRBA 4FCTA 1FZQA 1WF3A 1HUQA 1JPJA 2R6AA 2F1HA 5ELXA 1NP6A 2OBLA 4MUBA 3F8TA 2JLSA 4Q01A 2X2FA 1M1YE 1QHSA 2NQ2C 5DN6A 1JAIA 1NG1A 1R0YA 2VL7A 1Q0UA 4TN1A 4HUTA 2FJUA 3A4MA 5EQTA 4O3MA 4OQLA 2A3RA 2QGNA 4GOJA 4LBWA 4UNPA 2PZEA 3AF2A 4KODA 3QKUA 1A7JA 4TQ9A 1DAGA 3LLMA 1Q22A 2EFEB 2QEQA 4DDVA 3KQKA 1G9XA 1HT2E 1LB1B 3GJ5A 3NDBB 4OHXA 3S1AA 4A2WA 2CLCX 4CEHA 1GG2A 2D74A 2RMKA 3CRMA 1SVLA 1PLLA 4JKIA 4M53A 4MKHA 4HSEA 1G3UA 3ZJYA 2P6UA 3MWLA 2J7KA 3KFVA 1IXRC 1M7BA 2XZLA 1VPLA 2OV2A 2MMGA 4NYJQ 3IILA 1CJMA 1BYIA 2QTFA 4A36A 4Q18A 4QHSA 3FFAA 3QNUA 4M1SA 4IW3B 5LB4A 2ZSEA 1R5NA 3FKQA 3QXHA 4QFMA 3FMIA 5EZ5A 3SE0A 1Q1EA 5A4JA 4Q1DA 1XWIA 5FUWA 4G1UC 1NKSA 3IBYA 4C0KA 1IM2A 5JEDA 1IY0A 4Q4LA 4Q4JA 3CONA 4N1AA 4HUQB 1E2MA 3DO6A 5DYIA 3QXCA 3AVUA 2A78A 4HATA 1TADA 2PL3A 2P6RA 1KMHA 3BFKA 1ZM9A 4MDEA 2OESA 1Y63A 4PZYA 3GLIA 4TYNA 3K0FA 3MCAA 2V4ZA 1L2TA 2F1IA 3TGPA 1CBUA 2ZQ5A 1Q3HA 2ANBA 1G7CA 1E9DA 1XRJA 2CCKA 2QN6A 3VU9A 1EFTA 2GEDA 1EFCA 4TL9A 4U02A 3BERA 2WMOB 3I61A 1M74A 3BS4A 4ZDKA 1TAGA 1WCV1 2BM1A 1NIJA 2FFQA 4BFWA 1G5TA 5HKKA 3ADCA 4P4UA 2WHXA 2OFXA 4AC9A 3LRPA 3QEOA 4DLZA 3GLGE 3SNHA 2GTPA 3ASZA 2F1RA 2V54A 4EFNA 1XCPA 2PT7A 2QMHA 3TQCA 4A0FA 4XJXA 4Q19A 4AKEA 4K46A 4DXAA 2V8OA 4BWYA 1FOEB 1XTSA 3QOFA 5HCIA 4PTLA 2AK2A 2CHVA 4W5HA 5CM8B 4HLDA 3ZS9A 4G5GA 4DCVA 1DG1G 2B92A 4Q1FA 4M1YA 4QNRA 4IDQA 4LPSA 2CNWD 5TY0A 4DLSA 2NTYC 3ADBA 4IOKA 5EE1A 1XD8A 2BJWA 4MYCA 3AVPA 4D0LB 5JRZA 4B33A 1UBEA 3B6EA 1ZM3A 1F48A 3LBIA 1DARA 3GLFE 1M2OB 4KSBA 1EX6A 3GP8A 4I1VA 3KUCA 1L4YA 3M4YA 4KFRA 4I99A 1TEXA 1ETUA 5FTNA 3ICEA 1W0JD 5EP2A 5EE0A 5FOVA 3VR4A 1H65A 3NBFA 2BMDA 4DUGD 1VKJA 2XNDA 1NNEA 2BJVA 1PVOA 4LHXA 1GNRA 2PCJA 4CRWB 1IN6A 2WKRA 2ZU0C 1OH5A 2QTVB 3EASA 1GKYA 1G8YA 3ZYCA 4XWOA 1QF9A 5AUQA 4HB2A 3BH6A 3H0KA 2CK3A 2JEOA 3DKPA 2J7PD 2XZOA 1KKMA 3C7KA 4PSVA 4EDHA 3FMPB 4HDQB 4L9WA 2YOFA 5IRCD 4EPWA 3GJ3A 1UM8A 3CWZA 3A1WA 3F3YA 4TT3D 4RCZA 4DIEA 4AK9A 1XMIA 3DPUA 4CGZA 1Z6TA 5B30A 1W5TA 1F5NA 2AWNA 4S2EA 3R9IA 2QE7A 2JJ2A 4BE7B 1ZD8A 3SI7A 4EQ6B 1GILA 3SHFA 5DNYB 1K5GA 5B64A 3U4QB 2O8BA 2P5TB 3TSZA 3TIFA 1E96A 1SXJD 2BVNA 1TX4B 1JQLB 4D6PA 4FD2A 2QGZA 3GJ7A 3PEUA 4IVQA 1CJKC 4TL8A 4EJSC 3ZVNA 2XEXA 3C5HA 1E1QD 2R62A 1OSNA 2EW1A 3TW8B 3GPLA 1LS6A 3LDAA 2IS6A 2IWHA 2JJ1D 1WA5A 4RD0A 5L3VA 1MH1A 1FQJA 1Z0AA 1P2VA 3M0EA 3MJHA 3VHXA 5L8VA 3AF3A 2XZPA 5AUNB 1W4CA 1HV8A 2J0UB 1OH8A 5BQ5A 1PUIA 3IO3A 4MA4A 4E07A 3ETLA 1M8PA 1Q3TA 3C15C 5CLQA 4B44A 1N6KA 1R4AA 3FHOA 4EJSA 1FMJA 4V02A 2X1VA 5CIWA 4YMWA 2GZDA 2J0QA 5E4FA 2W2XA 5C46F 5LPNA 2Q9BA 2OXRA 3TR5A 4ZIRA 3VFDA 2YINC 3VX4A 2HEIA 1LF0A 3LVQE 4BECA 5J4YA 2HXYA 1EWQA 1I4DD 2VP4A 2R2AA 2YOGA 4KFSA 4OQNA 2QU8A 4QOSA 3HPQA 2G0NA 4AYXA 5IF9A 1K5DA 4KSCA 1ZNXA 2ZYWX 4KLZA 5H8WA 1GL9B 2VO1A 2VA8A 1Z0FA 2O52A 2NIPA 4GBMA 3PJRA 4WXRA 1SQ5A 1W36B 4Z51A 1E2DA 5FL3A 2HT6A 3I8SA 1GSIA 2WMNB 3ECCA 4M0LA 1W49A 4Z1MA 4FN5A 5F9FA 4A8JC 4WOPA 4NCNA 3AM1A 2O0KA 2GA8A 2IL1A 5DHAA 1VCIA 4LHZA 2PX3A 2LKCA 2WV9A 2ATXA 2DB3A 5FBWB 3KXIA 3BXZA 4UNRA 1OKKD 1KDRA 3E5HA 4B75A 1NSFA 3PG5A 3EIQA 3I1FA 4OJQA 3EA0A 3OIVA 4B35A 5SZHB 1ZNYA 3AQ4A 4NTZA 4QL3A 4A8JA 3Q5DA 1V43A 2ZYTX 2ZRKA 4Q48A 1P3JA 4P4SB 3GLGA 1XU4A 2JLRA 4FI3C 5E95A 1U9IC 2GHIA 3ZZ0A 3EZ7A 2J3EA 3BH0A 3ZZTA 3H1TA 4NH0A 3GQBA 4FMBB 1JALA 2ZI4A 2H1LA 1SVWA 2PMDA 4LJ4A 5FPHA 2XXAA 4HZUB 4IFBA 1XD9A 4HAZA 5KYKA 3T61A 2WOJA 4HAVA 3OFND 4PC2A 5L3SA 1YZLA 3GJ6A 3SR0A 1KJZA 2GEVA 1U9IA 3OF5A 2F6RA 1BKDR 4BLRA 2QBYA 4C3ZA 4Z54A 3U6KA 2OFOA 2VF7A 3IIJA 1CLUA 2H16A 2ZAOA 5EXXA 4CT4B 5C18A 3I5YA 1CJTC 1XFAA 3OE7A 3GD7A 3R9WA 2CHQA 4QBFA 5IHPA 3VHLB 1A1VA 2HCBA 1RE0A 4KYIB 2OM2A 3CX6A 1NI3A 1R8QA 1NN3A 1XTIA 1XZPA 4DKXA 1W44A 1CS4C 1E2HA 5KNCA 2QMEA 1RC8A 4JLNA 1ZIPA 1ZUNB 4NMMA 1EG7A 2YVUA 4MH0R 4BLOA 1OXUA 4B2PA 3PFIA 2WKQA 2GBLC 4WA7A 2H18A 1Z06A 1E1RA 3S1AB 1I4LD 4C0AC 2RH5A 4CEHB 2BKEA 5G41A 1OIXA 2Q3MA 4Q9HA 2GXQA 2QT1A 1B23P 1OFHA 1IN8A 1SKYB 1KGDA 1NF3A 2WAYA 4R71A 4CEJB 2PZGA 1RZ3A 1Z28A 4AY2A 1UF9A 2BC9A 2LCFA 3H86A 2PLFA 2OLJA 1QHNA 3D7MA 3B5JA 1Z0KA 3PR1A 4TLDA 2PH1A 4W7SA 1OB5A 2GBLA 3UANA 2B8WA 3I4LA 1UFQA 3NBZC 4QBGB 4RD6A 2G77B 4WZ6A 4LYHA 4ZCLA 3P32A 2H57A 3EIEA 3LH5A 4LV6A 4IKEA 3HDTA 4PANA 4E5UA 4US2R 4I1UA 1HT1E 1ZCAA 1R6BX 1OIVA 4U7DA 1NMYA 3NEYA 1LNZA 3GLIB 1D2MA 3LFUA 4B3BA 3K0FB 4JLKA 2C77A 3QJYA 3OESA 4KV9A 3HJNA 1DBSA 4LRWA 4ACBA 1Z8FA 5J4LA 2IYLD 3LXRA 1D9XA 5TV2A 1QHHA 4Q1EA 5KSPA 2O8FA 4R2HA 3VU9B 3ONWA 1DOAA 4C0QC 1CR1A 4JVLA 1VECA 4QJ4A 3FHTA 3LO5A 3RANA 4N0EA 4JLPA 3A8TA 2VRWA 2FX3A 2RGXA 1W1WA 4OK5A 4B6EA 1CF4A 1OFIA 2CE7A 3AF1A 3PIRA 3KX2A 2YWFA 1OV4A 1V5WA 2P5SA 3CLVA 1IOZA 4TSFD 4EUNA 2R6CA 1DE0A 2VP6A 3B1YA 1J99A 3K1JA 5CLLA 4RZ2A 3EPHA 1ZM2A 1KSGA 2GESA 1ZU4A 2FFAA 2F43A 1E98A 3UMSA 3PUZA 4B6FA 4IRUB 1ZNZA 3SS8A 1XTJA 3NHBA 3CUEF 4C0LA 2DY1A 1E0SA 4KXFB 3CR8A 1Z0IA 3BORA 1E2LA 1IN4A 3TUJC 3K9GA 4R9UC 4URWR 221PA 1TU4A 1D9ZA 4KBFA 4KYUA 5F98A 4LZZA 4YXWA 2NOAA 1AS3A 3HR8A 5TXGA 2ZJ2A 3VR6A 5KNBA 5FUXA 1IJEA 4MRSA 2NZJA 1HE8B 3QE0A 2NPFA 2KWIA 2Z6VA 3B78A 3CZQA 3QI2A 1PUJA 4LJ6A 4XD7D 4ZI3A 2WJHA 2DFKB 3KXLA 3N2IA 3WP0A 2ZJAA 3N2EA 4MGZR 1SXJE 2ZJ8A 3Q9LA 4L4UA 721PA 1P72A 5EZ6B 3QBTA 1KNQA 4NE2A 2IF0A 4OI1A 3P4XA 4U5XA 3RS7A 1SVIA 4UJ5A 4JL8A 3U44A 2YZ2A 2UKDA 1X8KA 3QKSA 3B2EA 2IXEA 2BMEA 2GEUA 1E2PA 2C95A 2IUTA 3E70C 1M7GA 5EJEA 2O8BB 3C4JA 3RS0A 4YMVA 1CJVC 2J59A 2PEYA 1E2IA 1T3LA 3AEZA 1MT0A 3X1WA 4Q1AA 4XH9B 5AJXA 2RB4A 2ZS9A 1E2KA 3AVWA 1YKSA 3T35A 2Z0MA 1NVUQ 2A9KA 3QEJA 2E1RA 1CU1A 2IS1A 2R6GA 2R65A 4WZBE 1KO7A 2KJQA 1O3YA 5C4MA 3THYA 3CF6R 2J0SA 5BN3A 1WDTA 2WIAA 3GJ8A 4IFEA 1KSHA 3RRMA 3GJ0A 3SYLA 3A1TA 1U2RA 4IDPA 3U3RA 2WWIA 1JI0A 4V03A 1GP2A 4NCKA 5EE5B 2HV8A 4ZI2A 1ZYUA 2Q9AA 4B2LA 2OG2A 3R7WA 2ZJOA 2C99A 4LCBA 2Z4RA 5M04A 2WJJA 1KK0A 3ZS8A 4EJSB 2N46A 2QL6A 4HB0A 3U4QA 3U60B 1TUEA 1VHTA 3X1ZA 5BYKA 2HJVA 3AP1A 1BMFA 1VIYA 1YQTA 2FEMA 2VF8A 4IJMA 1KDPA 2YOHA 4YMUA 2IC5A 3SFZA 1PZNA 4QGAA 2H5EA 4DCSA 2G1KA 4G5RA 1W4BA 3SDZA 3ND8A 4TWZA 1UJ2A 1SKQA 5P21A 3X1XA 1KI3A 5KDOA 3FHCB 5AJYA 4B73A 2WWXA 2WM9B 3UWOA 5KPDA 2QG6A 5ANRB 3OEHA 3JVVA 4QM6A 4KU4A 2HCJB 4HYYA 2ORWA 2J0UA 4NYMR 2YWEA 2ZRNA 3ZD7A 1PJRA 4RKFA 3GLHE 1EWRA 5JRJA 3IPYA 3AKEA 1FW6A 1R2QA 1EK0A 1XX6A 2XOKD 2JLXA 1KO8A 2OFWA 1W36C 3OEED 1HY3A 4ILEA 1HH4A 2F9LA 4Q7MB 4JLDA 4HAWA 2G88A 2L0XA 3AF4A 3PVSA 3I72A 3KKOA 3P20A 3I3SR 5EUMA 2I1QA 3MLEA 2GJKA 1RRFA 2EWVA 2J5XA 4OHVA 3RC3A 5GJBA 2Q3FA 4A8JB 4JT4A 1E2GA 4BASA 2CE2X 4RSGA 4EPXA 3PCRB 2B21A 1YR8A 2HLDD 3GLGB 1ANKA 1G7SA 1XTQA 1P73A 1Y3AA 1HEIA 3U2QA 5TVKA 2JLZA 3AVQA 2VHQA 5AJVB 4GI7A 5HR5A 4OK6A 5K8TA 3MWYW 4O2LA 4JVMA 2QZ4A 2VQSA 1AGPA 1D6JA 2IWRA 4D4JA 4URVR 3AGPA 1SVKA 3V4RA 1WMSA 4BRWA 1ZRHA 2A2ZA 4JMPA 4DUGA 2OO7A 2ANCA 2DR3A 2XXAB 4NKRA 1P60A 5JJLA 2ZE7A 1G291 3OAAD 2A5DA 2GJ9A 4MRRA 5L3SB 1KO5A 3W5IA 3V00A 3W3ZB 2AFIE 1OF1A 4M9SA 3VR1A 2QBYB 3AV0B 1TU3A 1OXVA 1P9NA 1IBRA 2J7PA 5J4HA 1KI6A 2NG1A 4LHYA 5CJ2A 4GOXA 3LLUA 4GZLA 4JLOA 1EESA 4KHZA 4GNKA 4XVRA 3CH5A 4M1TA 2V1UA 4TYWA 1HE1C 3BH7A 4HB4A 4JSYA 1BIFA 3CW2A 5EUQB 3TAHA 4HAUA 5L3RA 1TF2A 1CTQA 1RYHA 1VIAA 2ZVQX 5A0FA 5TB5A 1YR9A 2GAAA 2ODWA 3TW4A 2RCNA 3IQWA 3NH6A 4V0ME 1Z0JA 2PEZA 4IOLA 2C98A 3QKRB 2WJIA 3THXB 3SYNA 2PCLA 2IX3A 2IF2A 4B34A 4JSTA 2GRJA 4BLQA 2ASEA 2E87A 521PA 5FH9A 5FOSA 4UXJA 4BEBA 5CK5A 1G1MA 4ASUD 4F4JA 4DLTA 3Q5EA 3IQXA 4Q02A 3FE2A 3RLFA 3WHLA 1G16A 2XX3A 3AKYA 5JZVA 1NN1A 3EW9A 4R7ZA 1G3QA 4HDCA 3LVRE 2Z5FA 1CKEA 5BN5A 4L8GA 4BFUA 3TMKA 2IS2A 2N42A 4NYIQ 4PO8A 5FL7D 2QUZA 4MUAA 2ZJBA 4UXHA 3AUYA 4DDUA 1CIPA 1E4VA 1JR3D 1E0KA 1UKYA 2V1XA 2FGKA 3KZ1E 4G3XA 3SQXA 4AI6A 2A5YB 4DSUA 3IO5A 4WAUA 4F92B 4XTCS 1W4AA 2A30A 2ODBA 1FFHA 1AGRA 2G1JA
chains in the Genus database with same CATH superfamily
2VAWA 4RLFA 4Z4QA 2AG6A 2FE4A 4OSOA 3QX8A 1E9AA 1NJ2A 2FFHA 3NIBA 4P7KA 4J2OA 5DO9A 3FM9A 1C9MA 4GICA 4OFBA 4QG3A 3DDHA 1NVGA 4YRRA 1YULA 3LXUX 2CXQA 3VU3A 2QN7A 9MHTA 2Z5LA 3A1DA 4LQ4A 4REQB 4TLEA 3ZV7A 4HRAA 5K51A 3RHTA 4M0KA 3OI7A 3SM9A 3UHPA 4PIVA 4URYR 4PNPA 4ME6A 2P69A 1CUZA 3WGNA 1KMCA 3D02A 1YB1A 3GLRA 1IYZA 4OJYA 1L7PA 4PPFA 1VL0A 2L19A 1NRWA 2F9FA 3K0AB 2QTBA 2QQFA 3VQTA 2DOKA 4TLBA 4RULA 3D59A 3IOEA 4JU9A 3TM5A 1AIPA 2G28A 3A14A 3TZBA 5E3HA 4EHAA 5J1SB 3KPWA 3IEVA 2D5CA 3KQNA 2C8JA 2D4HA 3JALB 1ABBA 1Z63A 1M2FA 5D3ZA 2DJ5A 2A0KA 3I83A 4JODA 1T1EA 4FBLA 3PRHA 3CVXA 2FDCA 1UMBA 4ZOLA 5K3BA 4EA8A 1V7CA 1DB3A 1RKBA 4RZ3A 3THSA 1EFAA 2W0MA 4WCFA 4Q9LA 2RIPA 1BJRE 3CXRA 3GLHA 3O4VA 1DRUA 2MSKA 3RYHA 1R9GA 3AB7A 4UOZA 2ENWA 1IXSB 2F1KA 3HYCA 3FTQA 3ANMA 3D3EA 1WVGA 3F5DA 3CS3A 5IARA 1G8FA 3KJNA 2PS1A 3JYQA 1EVQA 4US0R 2R6DA 2VK1A 4K05A 1I32A 4Y6GB 1CS0A 2OLKA 2RGAA 2FPMA 3GZTB 3K72B 4G09A 2WJVA 4CTMA 4RPCA 1GU0A 1KJJA 4CG0A 2IPNA 1SVUA 3TOZA 2PZFA 3BB4A 4JOBA 4BTVA 3CC8A 4MJLA 1WPRA 2IXAA 4FLEA 3WDKA 4F2PA 5HQJA 1NJ5A 4HNTA 3T3NA 3U81A 2EVWX 3MTGA 4R84A 1EFHA 5HZKA 3PFGA 2JK1A 3AEYA 4I8DA 1V41E 5AM4A 1EVLA 1YOVA 1M8FA 2WHQA 4AY6A 2G0TA 2V5AA 5JECA 4GWGA 1GQ2A 3BHNA 2E2WA 2IDKA 2VP2A 4D6XA 1RYFA 3T5TA 3WS7A 1FNNA 1P6XA 5KC9A 2GK7A 3I73A 4TTJA 3KWMA 4UE6A 1MV5A 4FR5A 3HY6A 2OCXA 4CKCA 3SDBA 2H2AA 3U44B 1ESEA 5EMNA 2AC7A 3B9QA 3ILSA 1VJ1A 3K1AB 4OI2A 3EXAA 1E79D 1KJNA 5B58T 2A57A 3OMLA 3HDGA 2GCPA 3QFSA 1GNQA 1MV8A 3EEQA 3TIVA 1RHUA 1RAEA 2GEFA 3NO4A 3AJ8A 3ZHSA 4FM9A 3B5IA 4YQFA 1HTWA 4DKJA 1ZICA 2YIVX 1KQFA 2ZRPA 1FDRA 1PFWA 1Y1KE 2FXIA 4NPAA 2GZ2A 5K3SA 1DJNA 4QE3A 1F8UA 5KCMA 1U2ZA 4NFSA 3ZD6A 5KSZA 1GV1A 4GDMA 4DJFC 2H2FA 5ERGB 2QD1A 4C5AA 4CTNA 1RPTA 5C53B 1J0BA 4R0VA 3BHIA 4G9GA 4L6AA 3WKAA 2AD5A 4TTQA 3U19A 1N5LA 3QKTA 1WXWA 4ZU3A 5B53A 4BYMA 2BAGA 4K88A 5IN5A 3D8BA 4Q47A 5IVHA 1DAPA 3UMFA 2PNJA 3WRYA 4PHFA 2FWRA 1BU8A 1OHHD 3EVDA 3R7WB 1FDUA 3PDCA 1LSOA 3FYUA 2RC5A 3FNRA 3RI3A 4DBVO 4Z49A 4MCHA 5D5PA 5CBPA 2ZZMA 2GTIA 1E6WA 1YL6A 2OAGA 4K9PA 3RYIB 3OP4A 1JEDA 4B0PA 3QE2A 1JN0A 2FOLA 1ZNWA 1ZGJA 2IDMA 3GFSA 3OWXA 1FNCA 4A16A 1D1PA 1Y5IA 2WP0A 3OQMA 4J1QA 1E5QA 5TS3A 2JDIA 3LKVA 4DNOA 1JJFA 1KOFA 3UAZA 3W9YA 1X3SA 2B6NA 1EXMA 3A9VA 3DVAB 2Q28A 1MG0A 4HNGA 2QZ9A 3LBYA 1KI7A 2NO7A 3HYTA 4BL5A 3C1TA 1Q17A 3JAWA 3VPDA 4EKNB 2RC6A 1LQTA 3R0XA 1F8FA 1V5IA 4PZZA 5AOVA 4JEMA 2WJYA 4DIOA 3K9CA 4RMIA 1R50A 1UC9A 1SC6A 4KRYA 4TTSA 3N2ZB 5F52A 3CZPA 3CLUD 3PRYA 1F1BA 2VJMB 3MD0A 4FE7A 3QVJA 5L7WA 2BFBB 2OT3B 2Q4RA 1ZVVA 2C5LA 3KTFA 1E9BA 2P77A 3LW8A 2YV2A 3GEEA 4PLCA 1VI2A 4LECA 3E3OA 1J8DA 5J5CA 5LOVF 4DDMA 2ZRJA 3PUKA 2IDZA 4A6DA 4L16A 1V45E 5DBGA 4CLRB 1OXTA 1NVWQ 2DWCA 3OECA 1R27A 3BL8A 2PKXA 3C5VA 1QB8A 5LCXA 1KEKA 3TLKA 4RS3A 1LQUA 1H2EA 1V26A 2DBZA 2C42A 1NVVQ 1QIFA 1CQJB 5HCNA 4DARA 1PYOA 1T2EA 3P9PA 4QUJA 1OJLA 1P80A 4UDNA 2ZRMA 4DUZB 1EEXB 1WXDA 3IDZA 3T5DA 2GM3A 1XROA 4OP1A 5DN6D 2XCSB 3KK0A 4HN2A 1OH6A 2ZRLA 3ZE9A 3FNBA 4LV5B 1EFPB 3MUFA 4GMDA 4JYCA 4MUHA 4EGFA 2W6MA 3NHRA 1YZKA 1DG9A 1LDGA 1TA9A 2XAUA 2WG0A 4M8LA 4UM9D 3PPWA 4Y2UA 5CT9A 3I2JA 5DYTA 1GRQA 3TEJA 3ZZMA 3KOMA 4J0KA 3U3ZA 1BVHA 2R1VA 4GOLD 2BGNA 2Z2JA 2IOHA 2QRHA 5KNCH 4K2AA 3P0HA 4LMAA 4DR5B 1GKKA 2AJ8A 4R1PA 4C4XA 3GJRA 1D2CA 2F00A 2GBCA 4B85A 4ENRA 3EAFA 2OD2A 3HL4A 3JASB 1M6VB 3HN2A 3BXXA 5FOXA 3DR3A 3EVCA 2TS1A 5K2OA 4KVAA 2R6JA 2RHLA 2BLLA 1HL3A 3ZDDA 2GJ4A 3DR5A 1K7CA 3INRA 1FJHA 2J3DA 5TJ9A 4B0OA 3KAJA 2MSLA 2XJ9A 3U7RA 1YDMA 1ZNQO 2HU2A 1RHKA 2NUTB 4OQQA 4YT8A 1NMZA 1KAGA 2WQ6A 4XOIA 4B7CA 1AH2A 4B74A 3B7GA 4EX6A 4H31A 1XVAA 2G25A 3HCRA 3L49A 2PHZA 5K1ZA 3K70D 5AICA 4KIWA 1NNUA 4G6ZA 1UFRA 3V97A 2H31A 4BMZA 1VLZA 9LDTA 2CB0A 4NENB 5GONF 5ULLA 2CXUA 2NT3A 3UWPA 3Q8MA 4B7XA 5K05A 5SYMA 3DMTC 1O6ZA 1J56A 3ADKA 3E1GA 2HSJA 3W3AA 5DF1A 5GJCA 2ZSAA 1J2RA 4B32A 2W2MA 1H05A 1Q1ZA 2EZ4A 3MVEA 3OE5A 2BR3A 1KP3A 3AJ9A 3T0FA 3NBYC 1TJNA 4UNNA 3ROKA 4G0ZA 4MOWA 3ZUGA 4OYHA 4DRXB 2QX7A 5ITSA 2EJUA 2AEEA 3AV3A 3WJAA 3MEQA 2VP5A 1NW3A 1BOFA 4IO1A 4MR8B 2DPXA 1XLTC 4Y9RA 3M34A 4OLFA 5EVJA 5FPKA 3FOFC 3IIKA 1IDN1 1H2YA 2Z9DA 1U3CA 2HYDA 5AXBA 5DU2A 4EEKA 1TZMA 1NBHA 3PNPA 5JJBA 3AZOA 3ZBQA 1SVNA 4CL8A 5JAPA 1UXKA 4UNQA 1VHLA 3Q8WA 1KL7A 2O2ZA 2ZRQA 4BWFB 3U6BA 1VE9A 4D8UA 2H5JA 4WZBB 3VPFA 3THXA 3HXQA 3QEMB 2A0FA 2C96A 4B4KA 4D3SA 1B3BA 4A0SA 4GX0A 3ETHA 2VHTA 1G3MA 3R20A 4PC7A 1F2TB 2ID9A 4GR4A 1L5HB 2R00A 4BX9A 5JFGA 3D31A 5KPJA 4WT7A 3V9PA 3E4DA 5LQRA 4ZP1A 4KXMA 4J4TA 1EWKA 2JGIA 1ISHA 3OMXA 4L02A 1V16B 4J29A 1E9RA 1E7WA 1IMOA 2KLBA 1C1HA 4C4TA 3B1XA 4HH1A 1L8QA 1PKXA 2CLMB 4G0YA 4LC0A 2WVJA 4XX0A 5HUHA 4X1YB 4HMOA 1C5KA 4QULA 4WADA 3V1UA 2AFHE 5HZHA 2WWGA 3DHNA 4TUYA 1QUEA 1ZR2A 2PWZA 1XRSB 1Q57A 1OX4B 3AI3A 3D8HA 3ZCPA 4JI2B 1B93A 1OXMA 5KDLA 4DBLC 1G2PA 3UG6A 2IIBA 3L8YA 2GARA 3EZFA 1NPDA 4O4IF 5DYNA 3RFUA 2YV3A 4CUJA 5K5EA 3T3OA 4RNCA 1K1EA 1YVEI 4FR0A 2QV0A 2I6GA 4P2BA 4NF2A 2RI1A 3ESCA 1E3JA 5F2KA 4UTZA 3ZVRA 4RBNA 3KKPA 4UU8A 4A03A 4DDHA 1WQ3A 4Q9AA 1X7WA 1YQEA 4AF7A 2IYYA 2O9JA 2B1JA 2CK3D 3KO8A 4QBHA 1CJBA 2BEVA 5I7HA 5HXAA 3M6VA 1FB5A 1OBCA 3KL4A 4LNUB 4XD2A 3W90A 3HACA 1Z7WA 1T8TA 2JGMA 2O4CA 5CYGA 1MDFA 2VQDA 5FX2A 1XCGB 3C3CA 1EFVB 2Q8NA 3CEJA 2X8AA 4D4MA 2J5QA 3MELA 5G02A 1RC1A 2Q0HA 3S3TA 5KWEA 3TLAA 2W90A 2VTDA 4NU0A 4PGFA 1STOA 3K0AA 5IH3A 5JS6A 3TQFA 2PX8A 4Q3AA 3TD2A 1A8SA 1F6DA 4MUYA 2PLWA 2J8ZA 1PS0A 1C1XA 2WV7A 1XJQA 4R1TA 2X3UA 1IK4A 3O26A 5SZIA 1E3WA 4AYWA 2W8BB 3NDJA 3NTUA 1AY0A 1NJSA 2ZRFA 3C6XA 4ISCA 3RRFA 5IANA 1GM5A 3ZN2A 2XRFA 4J1TA 1MU0A 4QBIA 1SH7A 1E58A 2CVHA 1AQYA 1J23A 1RXEA 4RPIA 16PKA 1LVGA 1QGDA 3ZU3A 5LD2C 1RPZA 4M9XA 1YUBA 3W5DA 1RP1A 1THMA 4L4SA 3TNYA 3LV8A 5CH3A 3CN7A 5CPBA 2XVXA 4XA8A 1C9DB 4NK4A 1XZBA 1OX5A 2OE2A 2FU5C 2WG2A 4JROA 3FTNA 4CKBA 4KACA 4L1KA 4PG7A 3L1UA 2G80A 5THQA 4DR3B 1A27A 5LQDA 4UEOA 1VYVA 3VTZA 2R6ZA 4QEDA 2OENG 4R41A 1FYXA 3L5OA 4UEKA 1RZRD 3BKXA 2AF3C 3A4IA 5CT8A 2OSVA 3L40A 2HJ9A 3AIKA 4HQ6A 1H5QA 1LPSA 4WESB 3U7EB 3L7IA 3WJ7A 1SKMA 1GFIA 2A5JA 1C7JA 2RHBA 5AR1A 4M1QA 4HJXA 1N6OA 3AHHA 3QX7A 4IS2A 1NBMD 3EPJA 4BVBA 2ORVA 2GAJA 3PC4A 2WSBA 2E21A 1NGSA 1ACJA 1FL9A 2BEWA 3RUFA 1P8AA 3PLAE 3H2YA 4TS4A 4PINA 2VK4A 3DM5A 3LRXA 4ZYWA 4MITA 4ILKA 3A2LA 5HBGA 2X5JO 2RK6A 3H5LA 2FDXA 4KQ6A 3EPKA 3H4TA 1MRSA 3Q11A 4MV0A 4UUAA 3SKYA 5ICGA 3H87A 1T0JB 3J80A 2Q4BA 1JA9A 2C8LA 3EIFA 2LCQA 4RVDA 2RJNA 3WK4A 4CL3A 4DADA 2VDNB 3JWGA 4ZCIA 4AW9A 2O54A 2VAPA 4DSTA 4MQ4A 3K1AA 4KOEC 2H1HA 2OXIA 1LNQA 2IK8A 2GVDC 3CTMA 3DZKA 3TNDA 4DIDA 1H6BA 4ZDJA 2OORC 2QAJA 4DHWA 4X6UA 4D9GA 4RYDA 1XTRA 1RLJA 1N0WA 4A3SA 1HE5A 4JBIA 5ALLA 1PJCA 1KEEB 2NYAA 2ATIA 4H9GA 4L07A 4C08A 4E22A 3PX3A 1Q1NA 3ZQKA 4Q4HB 5EE3A 4DA8A 1U0JA 1AX9A 3CSSA 4D9HA 1TK9A 4FFOA 1RM3A 1XCBA 3SS7X 4N41A 4ZCRA 5JJKA 5HGJA 1O4WA 2AF4C 1YBVA 1Q6YA 4FYMA 1P7CA 4R3UC 3KYIB 1XXHA 3AR4A 2OO3A 3ZD8A 1TAUA 3BWYA 3QLUC 4HQRA 4LWQA 5EGNA 1WHTA 5FUMA 4N7RA 1H2FA 4Y2HA 3C39A 2DLNA 2PKYX 4FHGA 3V4FA 2ZSDA 4YMLA 1YVDA 3EGOA 4R9VA 3WWYA 2ZJFA 5K8IA 1L5ZA 1XSEA 1ULTA 1XD2A 2J5KA 5EIBD 3G5MA 2NN3C 5IAJA 4KNYA 4KIFA 4OBEA 2VNHA 4BC0A 5DTJA 3H0CA 3PBKA 3MWEA 4J3NA 5JI3E 3B6ZA 2CWDA 2LTAA 3Q1LA 1OWLA 5IT0A 2NZ8A 5ECDA 2NYUA 3RREA 4FNMA 4YBRA 3C98A 1U90A 3WYAA 1DKPA 1HI9A 1SIWA 4BBPA 2EERA 1Y1SA 4MR7B 4D8TA 4XYLA 3VC2A 2HLNA 2FSFA 3SZRA 1TK3A 1U4OA 1YBFA 1LDEA 1Y8QB 2PL9A 3D1LA 1B76A 4U7HA 2Q5FA 2YVQA 4F2HA 1IG3A 1YQGA 4W5QA 1JDJA 1QO9A 3OJLA 1IHYA 2X14A 4YYZA 4GX5A 3LYAA 1XKTA 2PJZA 1FMFA 3EXHB 2JGFA 4P80A 2BZSA 1DAFA 2RBEA 3P26A 3KHSA 5KZMB 4G2TA 5EAIA 1CVLA 1E1RD 3RS4A 4N47A 1SY7A 3TCKA 5ALHA 5BV8A 2BV3A 1EX1A 2OHHA 2FWPA 3LUDA 2H4YA 3OM9A 4O2BF 4FS8A 4PCLA 3FDIA 4TL7A 1Z2PX 3H5IA 2EGGA 3U4AA 5JZOA 3A1NA 3UW3A 4C4PA 5HZMA 2IHBA 1Q0RA 3F71A 3PC3A 3TMYA 3OHMA 5FFNA 3H11B 1Z0DA 1W5SA 1G7RA 1N8NA 5MF6A 4FQ5A 1RAHA 4MKRA 4NI5A 4R7TA 3AUSA 1QU3A 1II8A 2JH3A 3FFTA 3ET5A 2WT9A 3QLVC 4MQUA 4LSGA 3RW9A 4YYEA 3ZR4B 1MEOA 4LX8A 2FE1A 2P79A 1QM5A 4MQFB 3VJRA 3E1SA 1USIA 1Q7TA 3LK7A 3ND5A 4OP3A 5CNMA 2YKGA 4EKYA 1N0IA 3AVYA 5LN1A 4WJZA 4N6NA 2PGAA 4KITB 5AXDA 3HUDA 1TA0A 1TQ8A 2YZMA 3DMRA 3FETA 1MB2A 3HA5A 3OJXA 3PFWO 4K8OA 3V80A 2YV4A 3UVEA 3WLRA 1P2GA 4O4LB 5DIZA 5H3CA 1DZIA 1EGQA 2FZKA 3ASUA 1NYQA 3JASA 1PK7A 2EW2A 2H2DA 2MTBA 2OAQ1 1WZ2A 1UP7A 4F60A 2UUOA 3D8SA 2CLOB 1XQWA 5LLTA 4H3VA 3KYCB 3L4EA 1ZD5A 1RQ2A 3EYWA 1NXTA 1SXJC 4ZDWA 1IXYA 3LPNA 2H2HA 4KLAA 4BZXA 3CNQS 1YQQA 3THOA 2D0DA 2NUTA 4OA8A 2JK0A 4Z99A 1U94A 4AO8A 2QMOA 4CQJA 2Q2NA 3ROQA 1VSUA 4F6RB 1SELA 1OPXA 4BRZA 5A05A 1TLLA 5TR9A 1E0JA 2RHHA 4DDTA 1DEXA 1DS6A 1O5TA 1T0PA 4OATA 2XNCA 2HLPA 3QP9A 1QJ4A 3AC0A 2WHPB 4JVNA 2WZCA 3MCZA 3NX4A 4ZEXA 2H3HA 4G0VA 1DIHA 3GAMA 3SHQA 4M8KA 1T8YA 2QTLA 2GCOB 3A9WA 3AKDA 1O94A 3LY7A 4CQMB 5FR1A 1GOTA 2JJYA 4FT4A 1RD4A 2GRUA 4X8OA 1CNFA 4LI0A 1E1QA 5F7ZA 4YPFA 3EGXB 4MVJH 1G21E 4RF4A 1KDVA 2F3TA 5I7SA 2X7JA 4UW9A 3E6AA 3LWNA 4E1VA 3AHGA 2IXGA 3QF7A 2JF0A 3RU2A 2C2BA 3A2MA 1KEZA 2YRWA 3ZU5A 4OYLA 1U7OA 5FOWA 2PS3A 1D8TA 5DI3B 2I2AA 2W6JD 3G2HA 3PFBA 1ZLYA 2JZNA 3KQSA 1A2OA 3ZW8A 1CIJA 5J59A 3I2YX 1WV1A 4EEXA 1E3EA 3E9DA 3AJDA 4F9EA 4CEIB 4Y0AA 2PXXA 4R54A 5I9NA 4MWZA 4KWHA 3SKVA 2OOSA 1PLKA 1LW7A 4HWSA 1R8JA 4NU6A 4WZBA 2Z8XA 4WKNA 1I5OA 3VR6D 5ILOA 5JWHA 3QEMA 2FN7A 5TARA 1M6YA 3BJIC 4FBGA 2VCYA 1D1TA 1YASA 4Q7JB 3L92A 4ZD6A 1Y7TA 1V6AA 4C4OA 4DMFA 5CCEA 5JCJD 1F4PA 4JIMA 1PR6A 3QFRA 3EMDA 5FAXA 4JJFA 4RC9A 3GJ4A 4XWAA 2LR0A 1V16A 1DZ3A 2Q99A 2VN8A 4LI3X 4QGBA 2M9MA 1B8PA 2C57A 2JGKA 3PEFA 2C31A 3SC6A 3TCNA 4A92A 1UOQA 3S1SA 3P8ZA 4LXUA 1F2UB 1OX4A 3OUUA 1XB2A 2ZI7A 4S1OA 4E6EA 1EM8A 4KFUA 1BQ4A 4G01B 1H2XA 4EHDA 4QT0A 2VH5R 5CJJA 3OPMA 1J2JA 1NG9A 4KGVA 1B43A 1SVSA 4QUEA 2W6CX 2XMCA 4B3DA 3O31A 5J47A 5ETJA 3S29A 4ZV4A 3U9SA 2I2DA 3H6HA 3F7OA 1Y0BA 1PV2A 4ZQCB 3T4UA 5KQRA 2HDHA 1A9YA 1KFEB 5MFPA 2FEKA 1R6XA 1US8A 3QOXA 1M34B 4PHGA 2LRHA 2A9RA 1MD9A 4DAEA 2HWUA 1YDEA 1U7XA 1IOLA 4IGEA 1DPGA 4Z4EA 1TJ4A 3GLKA 4XWWA 3BIOA 1G5RA 1OZFA 1MB9A 3NH9A 3QVVA 3WLJA 1UPUA 5HK8A 4EYOA 1GGFA 4EY5A 1LH0A 3H3XA 1Y3CE 1UC4B 4XIFA 2VVTA 4HNAB 4QGGA 4N76A 2VP9A 5ERYA 1EFVA 1AUOA 2H1SA 1J8VA 1ZI8A 4TXJA 3VUFA 2VPTA 4A0RA 2HA0A 2D6FA 1JSLA 3VR5D 3OX4A 4PW0A 1UK6A 4WKGA 1PR5A 5ALEA 1U7PA 2O07A 4AXXA 5L4SA 1G3RA 2AKYA 2EX0A 1E20A 5KJCA 1E5TA 2CXTA 2OB2A 3A0RB 3A26A 2VYQA 3ABZA 5E6SA 4CM8B 1SIOA 3H99A 4HPJB 2W42A 3DZ8A 1DTSA 5BSHA 1W0CA 1WB5A 2D3WA 3D6AA 5AHWA 4BEWA 2FG7C 1GQOA 3KAQA 1XDGA 2W8BA 4R83A 3ZJ4A 1KVUA 5CFQA 1Z45A 4X61A 3LD9A 4QPCA 3VDXA 4Y2PA 5IAAA 2C9CA 4RTQA 4W1RA 3W1VA 3HABA 2GR9A 7REQA 4ER5A 3B82A 3OFNA 3WLEA 3SCZA 4BVFA 5JPCA 4LQDA 4IJUA 2IU4A 1YIAA 4OX9Y 1R1DA 2ZRCA 4IDAA 4GXRA 4ALMA 5FFMA 4QLOA 2V7EA 4Y1RA 5DCYA 5J2TA 3A6HA 2G07A 4YP0A 4DEYA 5ALMA 2O5VA 4POOA 4D4HA 1C3VA 3JSXA 1EFKA 5IC4A 2O2XA 4Q7QA 4D3FA 1P4SA 4YS6A 4MO2A 1MPXA 1ZXXA 3FUTA 3RFFA 2BGJA 1C3JA 2CXHA 1HOXA 2RG1A 3LCUA 5HP4A 3KJQA 2PLAA 4TYQA 2B35A 3DAOA 4MWCA 1CSEE 3OT1A 4RUKA 3CB4A 3IUNA 1V3QE 1XWWA 2P90A 3O0DA 2FZLA 3RBAA 4AJEA 2OB1A 1FDSA 1HDYA 4LWPA 5CXUA 1XAJA 3CVVA 1SU6A 1PSZA 2AFIA 2EAUA 3L3BA 2O0JA 2WPNA 4GM4A 4WESA 5EKXA 2P6MA 1YBAA 4L2IB 4TQGA 4PNEA 2R2GA 4FGSA 2EBHX 4FVTA 4I66A 2ES4A 1HDCA 1QH1A 2NLOA 1E2UA 3TRFA 1CY4A 4TYYA 4AQYB 3AKCA 2EFDB 3I01A 2OUKA 3QE3A 5FLEX 5GY7A 5K0GA 1UJ5A 1UBRS 3FB4A 1ZJWA 4ZT4A 4FU0A 5TF4A 4V0MA 4QC2A 4TWBA 4XLTA 4ZT3A 2IBSA 3G89A 4JI7B 2RGYA 3SPXA 5C37A 4JGGA 4NOLA 5TMDA 3DQZA 4RHUA 2ZT8A 4YAEA 1PTJA 3VR3A 2B7BA 4GEGA 1UIMA 3SXJA 5UKDA 2FUG1 2PTGA 4Z4IA 5KVAA 2DUUA 1R6DA 1Q0LA 4WZAB 2PUFA 3ZY2A 3L6DA 4E51A 1OLSB 1ZY2A 3ZGXA 4MQ6A 4V0OA 4BKOA 1N9GB 2UYCA 2VT2A 3GRAA 3NQ41 4FDVA 1RQPA 3R24A 5AFSA 2GBFA 5AW1A 2F4VB 5DE3A 1Y6GA 4EA9A 2VUTA 4FFBB 1X1QA 1F0PA 2ZR7A 4NBVA 3SZOA 1JDBB 2H0AA 3DCIA 4HDKB 3UO8B 4ARVA 2HJRA 3I1IA 2HB6A 3MWFA 4G5OA 3STVA 3ZHYA 3GJQA 1DO8A 1F2VA 1FRNA 2J30A 2IVFA 3P71T 1G6KA 3AF0A 2TMGA 3IXQA 4NZ9A 2V0GA 1N2CE 1O96B 1D1QA 2Y92A 3BMQB 1K3UB 1PJQA 1XDWA 1LJLA 1QVAA 3IRVA 4J3JA 3X1JA 4AN4A 4DDKA 5CD1A 3M6UA 3EWIA 1RWBA 2LCIA 4WFKA 1N3YA 3K4PA 4QDUA 1J33A 4JL5A 4Q4CA 5SY9A 4XDZA 3RTDA 4A8TA 3A9CA 1C3XA 1R18A 3TUIC 1VBFA 1QOPB 3UHAA 3NNNA 4GPIB 4AY5A 2LNDA 2KSQA 4N5NA 3IBFA 3RSCA 5AM3A 1BW9A 3BWEA 3LHDA 3R5KA 4LGYA 5BSRA 2UUBB 2A5FA 2Z2YA 3BTSA 4EUFA 2FMHA 1GPDG 2XODA 1XCMA 2EKZA 2CHEA 3EZXA 3QVUA 4GP6A 4M4SA 2XE6A 4C20A 4BY9E 1U28A 4H77A 1ZI6A 3CG0A 4PZPA 5H82A 1J7KA 3C5EA 5CM9C 4YN3A 5FUYA 3TSYA 3W3AH 4OX9B 1KAHA 4C89A 2AOVA 5KREA 4J91A 1O4VA 1KYYA 1ORWA 3OLZA 4PSKA 3GZNB 2I7TA 3O6VA 4PZUA 4TSFA 3WGYA 5HSGA 1ESCA 4XW2A 1YB5A 1RIFA 1MHTA 2WQZA 1XL1A 1WP4A 4QYIB 2QVBA 2VNAA 5LYJA 4EWLA 4KN9S 7ABPA 1LI4A 1YF3A 1VJRA 4JCOA 2A9VA 2Z09A 3A6DA 3NTVA 1TL7C 2Z5GA 3AWIA 1L7BA 4AG5A 2W8ZA 5TGZA 4DV7B 2APJA 2FQYA 3GUCA 2I8LA 4ER3A 3LM8A 4LPKA 1XEXA 2NO6A 1ZPDA 2GNOA 2IQ5A 3PNVA 5BNFA 4MUIA 3ZLJA 1ZHFA 1ZD4A 2FSPA 1MC5A 4E5KA 3GRPA 1YR2A 3W6NA 2CNDA 2AOTB 1PSWA 3DVLA 4DLPA 3GROA 4Z53A 2GPJA 4YUVA 2QR5A 3A6ZA 1S3GA 1ELOA 4E1BA 1GRVA 4S1VA 3T9EA 1QNFA 3KR2A 4IQFA 4ZHQF 1SPBS 3OUTA 4EO4A 1R74A 2R7KA 4MYUA 1S8FA 1S2OA 1TC1A 3X43A 3NEAA 1HZZA 2YTZA 1RI4A 3PJFA 4C6SA 4BMXA 2VSYA 3L0OA 4HWKA 4EA7A 4H6WA 4AS1A 3IALA 4W5NA 3HCOA 4KI0A 3OQBA 5FLKA 3BULA 3L4JA 3QIAA 4BO1A 1X1SA 5BORA 3DHVA 3K30A 4O6VA 3A1VA 4IQGA 1MIOB 2ZXUA 2I03A 3TD6A 5KYNA 3C6YA 2GUWA 2OV6A 1JIUA 1U8CB 2CVPA 1S8AA 1YS1X 2B20A 1TRKA 4R69A 1VP9A 4L5BA 3FDJA 2R8OA 3ZDRA 4RA6A 5C3UA 4I7EA 4FGJA 1S2GA 1RQGA 1MR3F 1VLLA 2EF1A 2I2XB 1AU9A 1N0UA 4MQFA 2IDJA 4OHUA 3O4FA 3OU6A 4JJ6A 3TCXB 4EHLA 4F5EA 3KKLA 1NP7A 4BJHB 2G70A 1AKVA 2W6ID 4IJWA 1NQUA 1IIRA 5K0JA 1E4YA 1YJCA 4WBNB 4NCXA 4ZOAA 4UREA 1AK9A 1I14A 4BMOB 2HQ1A 4JBWA 3CX4A 1U8EA 2CJPA 2D1RA 2IYPA 3TLGB 4NV1A 2OCDA 4MWEA 1J8YF 1CQPA 3D8TA 1SBNE 2XKBA 5FHQA 4XGRA 4ZVVA 5L3ZA 5CLIA 5JIBA 1OE0A 2ZIXB 2C82A 2I4IA 2CJFA 5DMHA 3WL4A 5JH7F 1R0CA 1U8XX 3DHEA 5HK9A 1O0SA 4FOSA 1Y5NA 1JKIA 5LBUA 4G0MA 2FN4A 4S1NA 5JCOA 2G83A 3WJ2A 4I81A 3AVXA 5EWMA 4MUFA 3DBLB 1XEWX 4KVZA 2XVYA 3UK0A 4KMOA 3MJRA 2PG3A 5DHFA 3UJAA 3GFTA 4F6RA 1H85A 4P7JA 1NXVA 2IV3A 2P6NA 4QLAA 3R7NA 1HYGA 4P3XA 4AMBA 2XITA 3UATA 1DQYA 1PR3A 1QH8A 2BM9A 4M6WA 4QG7A 1V0JA 2W2LD 1BXKA 2ZSHA 2GT1A 2P65A 5JQGF 2XMGA 3IGFA 1E5LA 1NV8A 2WHPA 4IOMA 2GZHA 1JTFA 4CQLA 1U81A 4GKJB 1G20E 2DGDA 3AVOA 4EKDA 2E4AA 2ZLBA 3CV3A 4L0DA 3QBEA 5SZJA 3V8MA 3N59A 4ZYTA 2A9FA 2FP4B 2VJNA 4TKMA 1RWWA 4QM7A 5G1OA 3KLPX 4C1NA 1EK5A 1C41A 2R4TA 2V03A 2GJ8A 2OCYC 1OLOA 3FCCA 3H1PA 5JWOA 1DV2A 1P18A 1E6UA 1PWEA 2V59A 4Y2QA 5JANA 1KARA 4L5AA 4TLAA 4D5GA 5LIPA 3K2EA 1NVXQ 3AI2A 1QK5A 4GPAA 2ZRGA 4BJ3A 2YIDA 3ROXA 2F3RA 3BB3A 3RADC 2XNHA 2QAGA 3CKYA 4U0JA 5K4GA 1E99A 2O1XA 3OQIA 5ICMA 1AHNA 1QAOA 1U3VA 1V8FA 4IXNA 3ADOA 5KNLA 4CEIA 3PPXA 1G63A 2AZXA 5JO9A 4PFQA 1CR0A 1OH7A 2BTQB 1FSSA 4PYJA 1FBTA 2GCNA 1DEOA 4BTEA 4FHZA 5GZ1A 1ADYA 4UD6A 2FJPA 1LPPA 2QX4A 3OEEA 1KEWA 3KVYA 3B2NA 2DZDA 1GNTA 3FKSD 4KX5A 4WPGA 1AQ6A 1LJUA 3LIIA 4L78A 2NX2A 5BW6B 3W6OA 3TAUA 3KYJB 4BB5A 3I34X 3TRHA 1NL3A 2EHJA 2EKDA 2HK7A 1J70A 4F1KA 4CF4A 2AUTA 2B2XA 1RYEA 1APBA 2Z2KA 1E7YA 3BIFA 2V4MA 4AUNA 3QXSA 5CAEA 3MM4A 2XDWA 1H8HA 4N03A 4BFTA 2FN3A 1XDBA 3F8WA 5AK3A 1JNYA 4QPDA 4ZI7F 3HJUA 3SZMA 4C2TA 3NOQA 1YRAA 2IEDA 3QIVA 4C0XA 3K70B 2FVYA 4WFJA 3VMMA 1OU0A 4D8XA 4TS1A 4XFDA 3JQAB 3JVDA 2ZYIA 2BN4A 4MYTA 3K32A 1KDTA 1I4TD 3W8EA 5ADHA 5IS2A 1Z29A 1V39A 3UQZA 3O75A 3QBVA 3WXMA 3IAS1 1M6EX 3TNFA 3U39A 1T15A 1AZWA 1JJVA 4RTOA 4OJTA 2Y1CA 4LFBB 1GTG1 2ZQZA 3W0LB 5CT5A 4F8YA 5MN5A 4LXXA 5F3WB 1PEYA 2W37A 3V34A 4A1FA 1IEQA 4IHAA 1DU4A 1WP9A 4PQRA 2W2PA 1BD3A 1Y8RB 2ARKA 4FYVA 2UUAB 3EVTA 2V5VA 3PXBA 4P2GA 1C2YA 4HNAA 1WX1A 5F73A 1JX6A 3H5RA 4YDRA 2JA2A 5T7BA 1QC5B 3EISA 4PQFA 3F1LA 4X45A 1OXXK 2E4ZA 3NRCA 3K8YA 4BO4A 2WPDD 5LLDA 2ZROA 3V4PB 4GL2A 2QJWA 1NY5A 3MWDB 1NLMA 2ZSIA 4JI4B 1BWQA 3DDUA 2QENA 3UOWA 1SUEA 1VMKA 2PX5A 3GPIA 3I6QA 3JQFC 4HSGA 3UAGA 4BO0A 3U9TA 5BN4A 5HOQA 5F3RA 1P7WA 2Z3WA 5FBQB 3E3AA 1X1RA 3BYZA 4AKHA 2QSUA 1KU6A 3DTVD 4HUQA 4R51A 5EQFA 3OVMA 2YMLA 3CRRA 2DHEA 3BQNB 1FSPA 4K6HA 3LUHA 1CRLA 2N3ZA 1RT9A 2V0CA 5JO0A 3ROMA 1F12A 1CUAA 3EZLA 3V8EA 5AD1A 5H5JA 4F3CA 2CGEA 4BPBA 3DLAA 4RVGA 2I4MA 3O8OB 4G4JA 4D9JA 1CW2B 4G1CA 2YWHA 1IAQA 3ZWWA 3M6IA 2K7FA 4L9AA 4D74A 1OV6A 5AKLA 3ZGYA 2JHPA 1M72A 5A5EA 3A28A 1RRGA 2FWAA 1AXGA 2J09A 2YHSA 5CHEA 1IULA 3A4LA 5I3CA 3SVZA 4HS4A 1ESDA 3UXYA 4GQAA 1E69A 1KZGB 3DJYA 4ZARA 5FWXA 1LEHA 2BELA 3TSAA 2WRZA 3SP1A 1KI8A 5JU6A 4RPHA 2BSXA 4TWRA 2BDTA 2A7QA 1XRNA 3EZYA 2RHRA 3KZMA 1NXSA 3MTQA 4J9VA 3TTYA 5JUWA 3WICA 3D6UA 2PZAA 5BMVF 3NTQA 4I50B 3RVJA 4HO1X 3IDOA 3QXXA 4Y2YA 5B7QA 4N82A 5EWLA 1WZIA 3QY9A 5LU8A 4PC6A 4EW2A 4ZMSA 3OT4A 2FEPA 2ODEA 1Z2AA 3BGIA 1QHGA 3ZNQA 2Q5LA 2O6LA 3UJ3X 3WRYC 2N1BA 1C8KA 4CM9D 3WL8A 4DYDA 3EPRA 3O84A 2JD0A 4HF7A 4C0WA 3GUVA 2Q1XA 5HX7A 3S8YA 2AIRA 2JCSA 4DM3A 2CY0A 5TC4A 4RHTA 2VPWA 3R0JA 1PQUA 1XP5A 4R1QA 3H1BA 4UAVA 3WP1B 4CR8A 4W82A 5BSUA 5HBRA 1QKKA 4HNRA 4D0GA 1T6BY 3RC1A 1DX9A 2ATVA 4EUEA 4O02B 5D1HA 5JVDB 3QUCA 5KYXA 3PNMA 1MGPA 1G2IA 1NIPA 1TO6A 1FTQA 2JIZA 1IVNA 5C5EA 3WLPA 2OHFA 1JNXX 5JNWA 2QGFA 2IHZA 2Q3EA 2QTVA 4NZNA 4PPGA 3DEKA 4JK3A 1TIKA 1PYGA 2J3HA 1GDHA 2Y99A 1GZ7A 3GFPA 3NT5A 1USGA 1E2EA 2OZEA 1RPJA 4CODB 1XMSA 1GFZA 1KO1A 4M0EA 3PQ2A 1O96A 1T2CA 2WICA 2FSGA 3BFVA 3N2YA 3BDVA 5JPIA 5LIRA 1V8PA 3IQGX 3O9MA 2VHZA 3BB1A 4W1QA 2R84A 1BO6A 4QVKA 1RAGA 5F78A 3H7IA 3CTPA 4J94A 5K0TA 1J2TA 4NIMA 3O2NA 1F0KA 3V7NA 2JAQA 3O73A 4DHEA 3H9QA 3WTCA 2BCJQ 1KYVA 1KA9H 3WK6A 2IGTA 4KXUA 5D8DA 2CVZA 1KZ9A 3HN6A 5BSMA 1Z38A 5LQCA 1P6UA 4DAOA 4OAQA 3E7WA 4B4UA 1ZSNA 4XYEA 4ZIRB 2VZEA 3CJQA 1FRVA 4O59O </