1SHUX

Crystal structure of the von willebrand factor a domain of human capillary morphogenesis protein 2: an anthrax toxin receptor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
181
Chain Sequence
SCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthrax toxin receptor 2
publication title Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 70
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2004-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1shuX00
4Z7NB 4C2BA 4BJ3A 4UM8B 5KYYA 2VDOB 2VDRB 3GXBA 4HQOA 2ODPA 3FCSB 5KYNA 1N3YA 2ADFA 1PCXA 2ODQA 1YVRA 1FNSA 1XUOA 3BN3A 4M76B 4WK4B 4A0QA 3IJEB 3K72B 3E2MA 1JEYB 2O7NA 3K6SA 1JLMA 4IHKA 2XWBF 3T3MB 1LFAA 3IBSA 1BHQ1 5KYXB 3EFOA 1MJNA 1IDOA 4G1EB 3EH2A 3TW0A 1M2VA 2VDMB 2M32A 3TVYA 2VDLB 2I91A 3BQMB 1V7PC 1QC5B 4MMYB 4C29A 3F78A 3HXQA 1IDN1 3VI4B 3PPXA 1M2OA 2VDKB 3EH1A 1N9ZA 1NA5A 4CNBA 1T6BY 3EGXA 3TXAA 2NUPA 3QA3E 5HJ2A 1MF7A 5E6RA 1MHPA 5E6UA 1RS0A 2I6SA 4NEHB 2XGGA 1PT6A 5KYWA 3K6SB 1CQPA 1JEQB 3VI3B 4MMZB 4WK0B 1YVPA 3NIFB 1U0OC 2ICAA 3EGDA 3EFOB 2NUTA 3F74A 4IGIA 1RTKA 1RD4A 1SQ0A 5KYUB 4HQLA 2WW8A 2XWJI 5E6SB 4HQNA 4UM9D 3M6FA 3ZE2B 4CN8A 4NENA 3T3PB 1L5GB 1QCYA 1CK4A 3EG9B 3EGXB 1SHUX 1ZONA 2VDQB 3RAGA 4CN9A 5KYYB 4Z7QB 1ZOPA 2NUPB 3N2NA 5LN1A 3V4PB 4FX5A 3PPYA 4O02B 1TYEB 3ZDXB 3TCXB 1M1UA 3PPVA 3NIDB 1XDDA 3ZQKA 1FE8A 3NIGB 1AO3A 1RRKA 3HI6A 4C2AA 3ZE1B 4Z7OB 2VDPB 2VDNB 1IJBA 3ZDZB 5KYXA 4HQFA 1IJKA 5ES4B 4HQKA 1M2VB 1DZIA 1UEXC 4DMUB 1PD0A 4NENB 1M1XB 4F1KA 4IXDA 4WFQA 3ZDYB 1M10A 2WINI 3EOAI 4G1MB 4PN7A 1DGQA 1MQ9A 5E6RB 3FCUB 4MMXB 4UM9B 1ATZA 2QTVA 5E6UB 4JDUA 2I6QA 5HDBB 3EOBI 2NVOA 1XDGA 1T0PA 1MQAA 1Q0PA 1JEYA 1JEQA 1ZOOA 1SHTX 1PD1A 1U0NA 4WJKB 3V4VB 1JV2B 2VC2B 4WK2B 5KYWB 5BV8A 1U8CB 1MQ8B 3EGDB 1BHO1 5KYUA 1OAKA 4F1JA 3Q3GE 2NUTB 3ZE0B 5E6SA 1QC5A 3HXOA 2B2XA 2X5NA 3PPWA 3BQNB 3EG9A 4XW2A 5HGJA 1AOXA 3K71B 1AUQA 2IUEA
chains in the Genus database with same CATH superfamily
4YRAA 4ZVPA 2JF0A 3KB1A 4G26A 2IYFA 1OHHD 1Q1BA 3QW4B 4MUBA 4OAQA 3TMYA 2JCXA 5B55A 3W5AA 4KR9A 5HUHA 1MT3A 3RGGA 3B6JA 4F4IA 5EQFA 3DVAB 4EKIA 3NBUA 1Q7BA 2QZPA 1J8MF 3IT3A 3MQFA 3PKJA 3TQTA 4CKWA 2ZUDA 3CLUD 3L0IB 1XPRA 4RAOA 4M2LA 3RRMA 4ALLA 4ZDIA 4DQKA 4RSMA 1AHIA 4J1QA 4EG0A 2CLCX 5K5EA 4W5NA 1D0SA 1XSEA 3JU3A 3EW7A 1P61B 1AKTA 2H9YA 3TSWA 2P9ZA 4R71A 3Q3JB 3OPXA 1XU4A 3PITA 4GM1A 4F04A 3UT0A 2J5BA 3HJAA 3QNUA 5AK5A 3JQ8B 1WNTA 2VPWA 2PKCA 4YB8A 1T0UA 4XPZA 4CV3A 2V9ZA 3D59A 2AD5A 2WABA 2J67A 3RK1A 3V46A 4HSGA 4RK7A 1XTVA 2OBBA 5HJ2A 4IFIA 4MV6A 5LQRA 2VUSA 3II6X 4GRDA 2PS0A 3G0GA 1VYVA 1K0FA 3A1WA 4ZVNA 2QVYX 1GILA 4UOEA 3E70C 1SKAA 1K4YA 4P3YA 1U5CA 1D2GA 2DBQA 3C6MA 1QM5A 3AETB 2ANBA 5KYVA 3RJMA 3MHTA 3ERCA 3F5FA 3K5IA 5ADWA 4G6ZA 1SC3A 3DLCA 3S2FA 1E18A 2W83A 1CUXA 1RVDA 1PTJA 2ODAA 4ISBA 5TDHA 5LZ9A 4HV4A 4LF6B 2HV8A 2K2WA 2XYQA 4DV1B 1OXUA 5H3CA 2R8BA 1JLSA 3E23A 1B15A 5A4FS 1G3QA 3QF4A 2M6KA 4Z4CA 1GL7A 3E18A 1IIBA 2BDEA 1JHZA 1KAEA 2I67A 1ZWLA 4KWTA 4GYYA 1V2HE 3DJYA 2PBFA 1GCIA 2FFQA 3AUSA 2WJGA 4JBLA 4HK4A 3B1VA 1KJNA 5I3CA 1T36B 4DC0A 4FJ0A 2H6EA 1I13A 1G8JA 3DE3X 3R7WA 1BWQA 1YU6A 3JQ8A 3EDOA 2BTOA 4QUHA 2QE7D 3QXHA 2IZ0A 3H11A 4L5AA 4LHVA 5TB5A 3WZMA 2VATA 4DMUB 2H31A 3MOIA 4P7FA 1VGVA 4I1UA 1NJ8A 3I12A 2NMVA 1AXEA 1BXRB 1TA4A 5B3JA 1TMYA 1N0UA 3QPDA 2XE8A 4GYWA 4LOKA 4C4ZA 1C50A 2ZWVA 3R0IA 5A5DA 1HYEA 4S2EA 5BYKA 5FEUA 3UKJA 4A3SA 2EKDA 3IMKA 1ZFNA 4HRVA 4RJLA 1JDNA 2JASA 5DDIP 3GY0A 2LWIA 4OIMA 5DCLA 2JGAA 3KJNA 3OFVA 3R0JA 2ZVJA 3AETA 5HKBA 1GVHA 1W0CA 2W5UA 2TECE 4FE4A 2QIPA 2QD2A 2RHMA 1QRRA 3HB7A 1TGYA 1U8CB 2LDXA 4OBWA 1O0CA 3H9JA 1TO1E 2YYSA 3IT0A 3IVCA 3QXJA 4NOLA 4NICA 2PXCA 3R5KA 4MQFB 2C4HA 4D9GA 1B6GA 1NUTA 1PW7A 3D4LA 4EPTA 3G68A 4DRYA 4E1AA 1VA4A 2R1VB 4GPTA 3CF2A 3GJZA 1U0SY 1Z28A 4MP8A 3ROZA 5BV0A 3MTBA 4PC6A 2GDZA 2QAIA 3OICA 1W0KA 1XDZA 1X8JA 4BNMA 3NHJA 2PXHA 3VOTA 3UMGA 2G5CA 4B7ZA 1RIFA 1BC5A 5AVQA 3KQWA 4X20B 2NZUG 1J09A 3G8CA 3OCVA 1NM5C 2WTAA 4HXGA 3VKGA 5DSXA 2XOKD 2CZGA 3KT0A 2PD3A 3OIWA 3QXCA 4LVCA 1ZL0A 2O1SA 4TTTS 4HNGA 1TQDA 1V9LA 1D2RA 3ASYA 2HWKA 3Q3IA 4PO9A 2XT6A 4TS4A 5EKDA 3TVYA 4D8UA 4N41A 1XZNA 4UHFA 4XUEA 3ESZA 4RY0A 2QVLA 4M1ZA 1W4LA 3MUNA 4B46A 5JV5A 3J7AC 2QTFA 1BXRA 1SC9A 4IEFB 3TRJA 3OJEA 3TTSA 4EL5A 1EI9A 2FSGA 4FEGA 3DOOA 2FW9A 3QG1A 3VDNB 2B94A 1KYXA 1Y1PA 1YI8A 1PKXA 3HO8A 2P1ZA 3M3PA 5A05A 5SZIA 2BF7A 3PQFA 1F0PA 1UT5A 2A88A 3ECSA 1VLQA 3N6VA 3DL4A 5AKEA 5FBQB 4BB5A 3A7EA 5CEFA 5LOVB 1FNNA 3N76A 4TZTA 4JLOA 3WHPA 3ZY2A 1T4BA 5I51A 2FPIB 1MOSA 5KJEA 1TMGE 4G65A 1UKYA 1WDMA 3AR8A 4BBZA 8OHMA 1KO8A 5IKPA 1NIPA 1XXHE 4NNPA 3CH6A 2ICAA 4JDPA 4Y1RB 3WA6A 4LDJA 4JIMA 3WL8A 2ZYWX 3U56A 1TVMA 1TKCA 1Z4QA 4KACA 5JXIA 3O1HB 3HK2A 1GDDA 2DPXA 5F9MA 1JXAA 2QMOA 4NULA 1TDJA 3H3JA 3IAM6 1YC5A 4N8DA 4PQGA 3WDKA 3X2SA 1HNZB 5KYYB 2R1VA 3UC5A 5FJIA 1H6CA 3NH6A 1JH8A 2J3IA 4ZIRB 821PA 2H29A 2Y67A 3K0CA 4PQFA 4JJZA 4DQXA 5HDQA 5JISA 3H4IA 3PPYA 1L7XA 1AQNA 4P92A 4LJLA 1XEXB 2ZTMA 2FCAA 2IODA 3TTTA 4A9AA 3VJKA 3ZQ6A 1HXHA 2GBGA 4A0RA 4C78A 3AKZA 4TTSA 2Q3JA 1BDIA 1DXOA 1KWKA 2Y0PA 2Q1WA 4NABA 1RJFA 1U28C 2B4YA 3K2EA 5SY6A 4HY3A 4NYJQ 4R3NA 3W6OA 5ADUS 5FBKA 1W5BA 2V9PA 1ONPA 3MRSA 1PYGA 1FPQA 1JDPA 3FUXA 2ZWIA 2J9GA 3KVOA 1JE0A 4G25A 4KX3A 4YCDA 4NBWA 3O5AA 2O52A 3DWEX 4X95A 4X1KB 5J5CA 1NQXA 4OKSA 1M33A 2D2VA 2P11A 1ZIPA 4PIVA 1GGJA 1N5OX 2XA1A 2XW6A 2REOA 3B70A 1CWUA 3MRVA 2ZIAA 3AT1A 1U2DC 3H4TA 3NBZC 1W0JA 1AA6A 4JEMA 2VYVA 4ACAA 1X7HA 3DBLB 1YZLA 4BFXA 2UZ4A 1JA9A 1SQ5A 3WMEA 3SPXA 1DIBA 2PV0A 3M5WA 3EOBI 3W1EA 4TV8F 4AL4A 1GYQA 1QYIA 5IVPA 3EVDA 3VO9A 5I45A 4GVXA 3FDIA 2H17A 4KRGA 1WUIS 2AG0A 5AKLA 1AKEA 4JD5A 4Q15A 4B9EA 3L8GA 4BLRA 4F92B 4FMCB 1PRYA 2YHIB 2PH5A 4U63A 4RIIA 3PIRA 4IJKA 3B7GA 1CP3A 3AKYA 3E35A 3PHGA 4H7DA 2FI1A 3FSGA 1J6UA 4AWXA 4E5PA 4CM9D 1PFGA 4AMUA 4DHWA 3EEYA 4F9EA 4JGGA 1X86B 1TXGA 4HOYA 5AXDA 5KYYA 2WQZA 3FBTA 1Z0IA 3AP1A 2IV2X 3DZKA 4ZIRA 5CCDA 1R0YA 2J3MA 3NWJA 1ZS9A 4I2VA 2B3DA 1QQAA 3L8MA 1VA5A 2O0MA 3EJ6A 1HDOA 1XEXA 2IZ5A 2GBIA 1XZ8A 1ZD8A 3ASVA 3NUGA 4XE5A 4BZWA 4EVQA 2UXDB 1X7ZB 1Z56C 2ZREA 2IFTA 3SQDA 4ECAA 4GM0A 2JDIA 3B8HA 3JRNA 4EA6A 2QQ0A 2C4TA 2V7PA 2WSBA 5I7RA 3I9KA 2XGSA 4XFDA 3OTQA 1DPGA 1IOWA 1UFQA 2BMJA 3BIWA 3CSUA 3JZFA 5L6LB 2D6FA 1LFAA 4RABA 2JCYA 5A04A 2Y76A 1QUFA 2GESA 3WGOA 1VTKA 1LWOA 4OGFA 2NSDA 1D7OA 1PJ8A 1J8VA 2D2EA 2QTGA 2E5FA 3LWDA 4JLSA 4UFOA 2ADMA 3AEXA 1NBIA 4ISCA 2FZ4A 2XAAA 1YTUA 3CKMA 4PLWA 3B6IA 1Y9EA 1GCAA 4BWFB 3TX6A 1JQ5A 3ZI4A 3DBLA 3NKVA 4HKTA 4EUFA 4MRRA 3W2HA 1I4DD 4AO6A 4PHCA 3H1PA 2REXB 5TNXA 3DV0A 4M22A 2QJWA 5FTMA 1JJFA 4CHTA 1DKMA 4FMDF 1FP7A 2WUWE 4XASA 3NTXA 4F86A 5EKXA 3LFUA 4BKRA 1S5PA 2PANA 1KC3A 2HBYA 2Q5HA 3IXLA 1H2WA 1IJFA 1YIOA 2BTQB 3OLYA 1G6KA 4DGQA 1G21A 3CKYA 3DPIA 4JT4A 4ETNA 4I46A 3RJ9A 4IIJA 1CZKA 4LMPA 1U90A 2VDWB 4PPYA 1HGXA 2PMKA 3VDXA 4UCQA 1LV8A 5AH0A 4KVZA 3WYBA 1I4EB 1QCYA 2PX2A 3T7EA 4DNOA 4U9HS 4XXHA 5H3HA 3RAGA 2IXDA 4YGYA 4LJ6A 4QM7A 1I51A 2SKEA 4BB0A 2QRKA 2DCMA 4G5RA 5JNRA 3WFJA 4KXMA 4GEKA 3INRA 2WYIA 3VYUB 2HV9A 1BRTA 5E2AA 5IK2D 1GRRA 2ZUSA 2BKXA 3W4JA 2BMWA 1GNQA 4WZAE 3RYIB 1UIMA 2I62A 3QVTA 2JAXA 1RI5A 4KQ6A 1UODA 3A2NA 3U6KA 2A58A 1A96A 4DIKA 4GOND 4BGEA 4BCBA 5H02A 1C8KA 5IVHA 1UDBA 4WCVA 1ZNWA 2CVPA 2R9VA 5AM4A 5IXJA 3JALA 1Y7LA 5ERXA 4YX9A 1QIIA 5FI5A 5KUTA 1NM5A 3LUJA 2FCRA 3LK6A 3R3JA 5J2UA 4YECA 2ROQA 1OAOC 1PL6A 3LA6A 3C3WA 4M98A 3L01A 2PYDA 3KZVA 3RFUA 2E82A 4IJ5A 5FI0B 3P45A 1JPUA 2PSEA 2W58A 1I4WA 1QG4A 1THMA 2IDMA 2ZJAA 4NRDA 1FYXA 1K9SA 2PG3A 3WR5A 3FYDA 4R2KA 1A8UA 2OMKA 2JHAA 3E9YA 5AT1A 3H0CA 3KJQA 5DLYA 5K3DA 3O75A 1HZJA 4DDVA 1NW5A 1OLXB 2DQKA 4CMIB 3Q10A 1GHTA 1VJ1A 1IUKA 4NC9A 1I1HA 1HEIA 2VDWA 4DIUA 2D8MA 5F76A 3ETHA 3BS4A 3N1UA 3ZWPA 4R51A 3ZHQA 2FUKA 3EXHC 2NSHA 4Z7NB 4U39A 1SMKA 5ESRA 4B8ZA 1RRCA 1GV0A 4M0KA 2FUG6 2Y1KA 2PSDA 3HB9A 3MGGA 4ZAXA 4BKUA 3GFOA 3KJIA 4IZIA 1QVWA 4DIBA 3MWDB 1WD7A 5JZOA 5L45A 3SN6A 1CQXA 4CL0A 4REQB 3ZZMA 4R01A 2AN4A 3HXPA 3HJCA 3ZY5A 2GZ1A 4A0QA 2ETVA 2YV2A 5C4GB 2UKDA 1AHNA 3D7MA 3IQXA 3RYIA 3EAGA 3RV3A 3QMMA 1HNWB 3FSRA 1T4GA 3PQ4A 4HG2A 1UPUA 1TAQA 4BB6A 4JYCA 4F4JA 5AUOB 1ZUD1 4FN4A 2BOVA 3M5DA 2QSJA 1M66A 1PW5A 2ONYA 4R7GA 4JI6B 4F38A 1CEXA 3DEAA 2MSCB 2Y2VA 5IDVA 4ZDKA 2H0AA 1UMDB 2AKYA 5DBHX 3W90A 3T5DA 5BSEA 3KQHA 3RIHA 1Z4NA 1U7ZA 2NNWB 1GR1A 1LBSA 1V26A 1BMFD 1X7YB 4WLEA 3W8RA 2AEFA 4BMVA 1LUAA 4Z4IA 3L7MA 2DULA 3L7YA 4RQUA 1GAJA 5JAUA 2GPYA 3BB4A 1S1CA 3T9BA 1PQPA 2IZ7A 4GXNA 3B3GA 1THZA 4KPUB 1I80A 5TXGA 2H1HA 3GYGA 3QQ5A 4FYPA 3ZXYA 2LZ0A 5BNIA 2FN9A 1P19A 4KG7A 5B6IA 4ZMBA 5HKOA 1U2DA 1YD7A 3NTRA 5A03A 2GRAA 1NRXA 3B82A 4CMIA 2V4UA 1WX1A 3O3MB 3IJRA 4XOUA 5BYBA 2OMEA 2CWDA 5IDWA 3EQZA 3GIDA 5E4YA 1W29A 2IOFA 4BP8A 4M83A 4PYQA 4CLOA 2IOFK 1QZZA 3WLLA 2Q49A 1JFSA 2BFDA 2JIMA 10MHA 2HQRA 5CX4A 4WXRA 4E0BA 2OA0A 1Z6ZA 3MWDA 3BWXA 2FZWA 3OD5A 2WHYA 4QHTA 1V5FA 4REQA 3A1NA 1X2EA 1PJRA 4JJ6A 1YS1X 2X6TA 4WMLA 4N03A 3JQQA 4H9GA 5FBZA 1V6AA 3T7TA 1E3TA 3UWPA 2EBUA 4Q7EA 3LX8A 1IN4A 1N5JA 2DUUA 1RRKA 4FZVA 4KLCA 4RKQA 3VDMA 2P0EA 3WYDA 4C2AA 3LPNA 4S1NA 3PQ5A 3E9NA 4MP3A 4CTKA 3PFIA 4Z4FA 1K5HA 4O2BF 2W6QA 4BVLA 3EVTA 5EYPB 2HDNB 1QIEA 2YUTA 1UEXC 2WWHA 1W25A 1IQUA 3OQVA 5DYTA 4BTEA 5JYBA 2UUCB 4YV0A 4M4SA 3P96A 5IABA 3RF7A 1X7YA 1VLJA 2HRBA 1CQZA 1FS5A 1RXIA 1Z8NA 3NNNA 3OMXA 2AEJA 3B12A 3GH1A 1D6SA 4YMGA 1SEVA 4FYJA 4MUXA 1M6NA 3E7PA 2O07A 1ULBA 3NALA 3FNRA 3LOQA 4KPUA 1N4AA 1ZSNA 3V6LA 1FVOA 2PQMA 1E1QA 3VPBA 2PVCA 2WTBA 4KRYA 5C5IA 2PRIA 3WLIA 5GWXA 3JQPA 3GFPA 1QJ4A 5GM2A 3VR5A 3KB2A 5EHNA 5CDGA 1MAUA 1ODKA 3U5TA 5EESA 1EQUA 4XFJA 3AM4A 5A5GA 2EZ4A 1BHO1 4EGCB 3TD2A 1UOQA 3BXZA 4J0IA 1L5ZA 4ON9A 2X8LA 4N47A 4DW8A 2W6CX 2ZJZA 1TJNA 4D4MA 4W9MC 4MUAA 4J0FA 4QLAA 3LAWA 4QFBA 4YAGA 4K8OA 4IDNA 1M2NA 1K92A 2O3SA 2X6RA 4Z4HA 1FY2A 5FWNA 1UAYA 3CCFA 1M2WA 3NP9A 1RBQA 4X84A 5F35A 4KXQA 4ZT4A 1Q0UA 2ADFA 3OF5A 4WRRA 4DCGA 5A06A 3K9FC 2ZJ5A 2QTVB 1V5IA 3GL9A 3S3TA 1IEXA 2JGDB 4J9VA 2C04A 4WINA 4BO2A 2PTGA 2J31A 3OY7A 3AKDA 4OK6A 3HEMA 5L7YA 2E4UA 2YQZA 3EXHB 3OH8A 4NK4A 1JKMA 1MEEA 2OBMA 3MFYA 4HLUC 2Y71A 3OE1A 2ZIXB 5JD6A 4NBTA 1VFNA 1N2CB 2ZPAA 2IXEA 3BA1A 5EYPA 3HN6A 5HF5A 4FHCA 2JH9A 3LBHA 3ABOB 1V43A 3FA2A 4ZVOA 3CY6A 1GY8A 1XN1A 2QYOA 4PLTA 4JI0B 4XDZA 1RYDA 1QV7A 5SZJA 4L4SA 3GJYA 2BMVA 4BJHB 5LQUA 5AMXA 5A4AA 3MWEB 1ZD3A 3KJXA 4YJKA 4Y9UA 3L1UA 2CUZA 2XVZA 2ZPUA 3GFSA 4KRXA 4OI0A 3A1VA 2AXQA 1WPGA 2F9LA 2PH7A 3KC2A 3W5DA 1KMHB 4MQUA 1WO8A 3IXMA 4GQBA 1OAOA 3LYAA 4DCJA 2DEUA 2XZTA 3BMOB 3NRBA 3P9XA 3TI7A 1JG4A 2VOEA 2MT9A 5FPHA 1SPBS 1WLSA 2AD1A 2WUDA 1ZLXA 3B7PA 4RENA 4UU1A 3TOZA 4V0NA 3D8UA 2R4UA 4NI5A 1SCIA 2YIMA 2NAFA 4U5XA 4UNRA 4HVCA 4CF5A 4D8TA 2ONKA 3EIEA 4JENA 4BAUA 4AJKA 1GSHA 1Z2AA 2O0KA 1GA6A 1QVAA 2VRWA 2JGDA 5CB0A 2X1MA 1Q14A 1M67A 2HK6A 2WJAA 1ESDA 3M8KA 5TMEA 2X0EA 5KTSA 4NYJR 3OECA 1JZTA 2AZDA 2ZSEA 4K88A 4D9MA 5DN9A 2VXOA 1ZK1A 4OX9Y 2FPRA 3EXHA 3NDIA 1ML3A 3O03A 5CVCA 3DWIA 1IXYA 4YAJA 4Q9DA 1IM8A 1O6ZA 1P9LA 1RKVA 2ZIXA 3RVBA 3ZX5A 5DK6A 2YVKA 2O06A 5KDLA 1H93A 3IS3A 4HEJA 2C96A 1QDEA 1XFDA 1ABEA 3DFKA 1MNQA 3U39A 3Q0TA 5E2BA 1P1KA 2GBLA 3OZFA 3KYDB 3PEEA 3CW2A 4U7GA 5CA1B 4JMPA 3PUXA 2XDQB 1ECJA 3ANSA 4TWAA 5FYQA 4Z4EA 5ALUA 4HATA 4HQ0A 1Y5LA 2AZMA 2C31A 2DWUA 2UVQA 1QYDA 3MWEA 2WI8A 1OROA 4UNIA 3W79A 3OEYA 4ARSA 4MV8A 2DWOA 1WZCA 2B5VA 3JASA 3QW2A 2JHCA 2RIPA 2AE2A 4V0RA 1JVNA 3EZLA 1DQYA 1ZXBA 3KQSA 5AM5A 4S1TA 1XL1A 3QHPA 3BRWD 5JRDS 1XRRA 1FLDA 3FKSD 4AD8A 4NCXA 3K1AB 4KE8A 2GMWA 3AM1A 1YTLA 4FYWA 4HWKA 1XCGB 1H1DA 3NHAA 3BMOA 2VSYA 4BWVA 1Q16A 2W4QA 4J1SA 2WILA 4BFVA 2JCGA 4M8LA 4AB1A 3UGKA 2UYOA 3ZZ1A 1NATA 2HPZA 4M1MA 2GZ2A 4I1PA 3P27A 2NUBA 3IBGA 2XB8A 4WVLA 4CKBB 4ZJZA 5J23A 5AW0A 2JIZD 4YUYA 4AY6A 4LV5B 4B6PA 1U94A 1YI0A 3F5DA 4QEZA 2NYAA 3AC0A 4JYZA 4P0TA 4EYSA 4MWGA 4N0DA 3RSQA 4GL2A 3WWYA 3JRWA 2J46A 3DS8A 3U7QB 5FPKA 3OC0A 3RIEA 2ZRKA 1O08A 3NVMB 1SU7A 4Y2RA 2VPXA 4FFOA 4I9HA 5AKIA 2C2BA 2CF5A 3GUUA 2OK8A 1N9GA 2QM0A 1S3FA 5ANRB 2VJLA 2JBAB 2XWSA 5E3IA 5HCIA 1ZUWA 4OQEA 4YCAA 2VPTA 1GPDG 4HPJB 1OYVA 1XEFA 2GKOA 4JNKA 3KYDA 5CA1A 3WY9A 1SUSA 5BNZA 2I3DA 1NU6A 1KFBB 3PPXA 3OM8A 4Q6WA 4DM4A 3WGNA 3CUTA 3HB4X 1JIXA 2A7XA 5FOVA 3CHYA 3EIQA 5GADl 4RH1A 1SCBA 3TD6A 4BNHA 2G5GX 4G4IA 3P9KA 1ODTC 3Q3EA 4UAUA 5D5QA 4ZI7B 1QO0A 1DCFA 2YV4A 2IGTA 3FWKA 3ED5A 3K1AA 1DKNA 4BMZA 4QAQA 4FE7A 5IT5A 3L9XA 1XZEA 2B1RA 1VPTA 2EZUA 2WJIA 5IZCC 2IH5A 2OGTA 4EY3A 2FA9A 1NT2A 1JJIA 3GLGB 3C87A 4NMHA 3H9GA 1PT8A 3LVRE 1I6MA 5E4JA 2O6LA 4AYWA 1NULA 1UF9A 1F3LA 1ILWA 4R3WA 4Y0NA 2AS0A 2OYRA 3E5MA 2M6LA 1Z0UA 3ADBA 3KQMA 2I7DA 1TC1A 1TIPA 3HN7A 3ZWYA 3RWOA 4A36A 4LYDA 1KJ9A 4D9KA 2ID9A 3DZJA 3U7QA 4AUNA 4YA6A 2VHEA 2ZSUA 4FYMA 2GX6A 4QGAA 4LHEA 1BE0A 1W6RA 4F2DA 2WAMA 4JQYA 3IJPA 2Q9UA 3RRBA 4EJFA 1UINA 1OX4B 4MI6A 1QPBA 5KAPA 4WLUA 3RHSA 4EPXA 3AFIA 2XX3A 2JBAA 3DO6A 4LWOA 4P81A 4WXYB 4HT3B 1WUYA 1YDFA 3UB3A 1B8NA 1OVGA 3T4PA 2Z30A 4MAMA 3VKWA 3X2EA 2QR5A 2C2KA 3ZW8A 4F60A 5LZ8A 2A9OA 3E22B 4EVRA 4F1KA 2M9MA 1P4AA 3H8JA 3BFPA 3ESQA 1ZYUA 1GPMA 4Y2YA 1K75A 1U98A 5EA2A 3S5JA 4GNKA 3Q0IA 1RR6A 1G8FA 2H4YA 3PWTA 1T6XA 4G37A 4HMOA 4OV6B 4BVEA 4I36A 1FNDA 1QDLB 4AKIA 1JDZA 1KI2A 2C0PA 4UAGA 4HTFB 5EMNA 3S1LA 1T0PA 2LP4Y 2O4UX 4ND8A 3HU1A 1XA0A 5FOQA 3KETA 3AUYA 3WDMA 3B6MA 2FK8A 2HRDA 3T9DA 1EXDA 3V8QA 3P9QA 1MQ8B 2FPMA 3GLGA 5LJLA 5T67A 2A5GA 3S2IA 5IJ9A 2B35A 1CQWA 1QV9A 2DPMA 2ZJ6A 3I9V1 4HEA6 1Z33A 3IUJA 4MPDA 4MI1A 4ZU1X 2X5NA 1MABB 4MICA 1AH2A 4UC0A 4CV2A 1EVZA 4KQMA 4ZOCA 4BMDA 3PT9A 2GKSA 2B37A 4C6RA 1I6WA 1OXXK 1SR8A 1ZW1A 2MOKA 1RCFA 3EISA 2R87A 2VHTA 2ZYSA 3HSKA 3OZXA 4HLDA 1M2JA 4ILKA 4IMJB 3W7VA 3U37A 3RABA 4MJXA 4HMPA 2N75A 4YASA 4GLJA 1OX4A 2JFQA 1YJ5A 3TEFA 2X5KO 4U0KA 4ZCRA 3CW8X 4CF3A 4OU4A 3I64A 1R0KA 5G4LA 3HVHA 1JR3E 2R6JA 2FMXA 4IUCS 4ZT3A 4NF2A 2M32A 4X61A 3ENWA 3A6LA 1A7AA 2HEGA 3E7DA 2ZT5A 5FL7D 3M9XA 1I5RA 3AHJA 3IB6A 3H04A 1KVQA 5ALGA 3RVJA 1EVKA 1PQYA 1KKLA 4YRTA 3T3IA 2IY9A 5CGQB 3D6NB 1AUPA 3FPAA 1OFTA 1EDDA 4JFRA 1PWXA 2NUPA 3ETGA 4O8CA 2Q4DA 1RPNA 4IQFA 5IKEA 2NNLD 2X8AA 3G2KA 1QWSA 4E12A 4WZAB 4V3CA 5AESA 3RCBA 4FKMA 3OEEA 1X39A 2BZSA 4WNAB 4MVJH 4ALJA 2RBKA 3DZGA 4CEHA 3JS5A 3KUCA 3KZNA 5FTWA 3WHKA 2WQ7A 1WP9A 1ZY2A 4ZREA 1C2TA 2BPOA 3VI3B 4UUOA 4CFYA 4KDRA 2JI4A 3U7EB 5KO2A 1RM5A 1KDTA 2WJ4A 2ZSBA 3ZIDA 1DUIA 4W4TA 1SNYA 1MABA 3AFMA 1TNDA 1V0JA 3LT4A 4JLPA 5E6SB 1TEZA 4LXIA 4NV1A 5TR9A 4HTAA 2ERCA 2YVUA 3C3XA 1ZLYA 1K08A 1ZN2A 2FJPA 2JCSA 3DEZA 3L8FA 3QWAA 4MR9B 2CJPA 3E2IA 2MSEB 3I92A 5FYDA 3A9RA 3B2NA 4D4HA 5JZBA 4XEHA 4BXOA 2VUIB 3SKVA 4NVRA 5GGYA 5F9FA 5T3YA 2ZJOA 5FUWA 2CXHA 1IZ8A 1HDXA 1N5DA 1OLSB 1NAHA 2VDUE 1WABA 1XVVA 2D7CA 1YUBA 3WGJA 3QPUA 2IDZA 3Q8WA 1WS6A 2PZJA 2VSQA 2QTBA 1T8UA 3OJCA 1TCUA 2QZZA 1GCGA 3RWBA 1BMTA 2P3LA 3PCTA 1MQSA 3O4JA 4K2AA 1TT5B 1T25A 3HBMA 4K9MA 4U9IS 3SSMA 1DE0A 1MG0A 4MI9A 2AN9A 3W9UA 5ALPA 3ESBA 1TA9A 2ZI9A 3D9QX 3JWEA 4WZAA 5GJVC 3LCRA 4NU6A 2XKKA 2GVDC 4BLWA 3CRMA 4IKOA 1A5TA 2QW0X 4BEVA 4JC4A 3RT9A 4HCJA 2C83A 3M6WA 1ZM2A 3H86A 2VF4X 3PQCA 2UZ0A 2V6JA 3VPXA 3TBFA 4NU5A 3ZCPA 4YROA 4R9RA 5C8ZA 8LDHA 3KV1A 1Y1TA 3OD1A 3FI9A 4YCLA 2BFCA 3OPYA 4IVRA 2WUFA 1EFRA 2BKAA 1AGNA 1E9DA 5E6SA 5AYVA 1LZLA 2X42A 4CQMB 4RMGA 1EE9A 2EOAA 3I04M 4RTRA 3LUPA 5CDFA 3WLNA 1UP4A 4W7SA 3I2FA 1L9KA 5BN3A 3REGA 2Y0BA 1ZR4A 2CHUA 5IZCA 1GQFA 3G7UA 4LMRA 5BQOA 1PCXA 1T5DX 1HOTA 4V24A 1OLSA 1Y1KE 4GWKA 4YP5A 5FH9A 4NG4A 4LZZA 2VF8A 1WEKA 3LBIA 4KJXA 3WNBA 3GPCA 3V4SA 4R1UA 5IAEA 2C5AA 1GU7A 2JI6A 1PYOA 3CNNA 3QV1A 2W2OA 3FOBA 4UNQA 2WKSA 5GVSA 3EY9A 1SOAA 1FFAA 5CFOA 1VJ5A 4LMBA 4DAOA 3UKDA 1BEUB 2ZU6A 3WLAA 4CM3A 2YHUA 1TT5A 3GQBB 1U5AA 2NXWA 4DA6A 1B0AA 3ONNA 1EXWA 2H63A 3HVKA 1H9BA 2NVBA 4TMFA 2NLOA 4Z86A 3GPIA 4JSRA 5BN5A 1CQIB 3UMMA 1W7AA 4AI6A 1RC8A 1BDMA 5DW0A 4E5NA 5JC1A 3HS3A 5EZQA 3E9MA 5GM1A 1X74A 5KTRA 1OV4A 4X6XA 4ZTZB 4Z9YA 4OLAA 1NVBA 3K92A 3CN7A 4AS1A 1D4AA 1NBMA 3ORFA 2JI7A 1C3EA 4Q9KA 5IHPA 3KU1A 4HYYA 3PGKA 1EZZA 2AR9A 2RG1A 3CLHA 1OBOA 3EFOB 1P3Y1 4XYEA 4EPWA 3BFJA 1RQNA 5CUQA 3OM1A 2O8EB 3CF4A 3FCCA 3IO3A 1Z9BA 3TOXA 4IHJF 3WO0A 2FJUA 4Y2UA 2WKPA 1OA0A 2QAGC 3VKUA 2PQ2A 3NWOA 1O8BA 5IUJC 3TYXA 4CT5A 1HG1A 4DS3A 2WKWA 4B6RA 2DBVO 3WGYA 4P6VF 1EFLA 5BV7A 3VBEA 5LN1A 2O0JA 2PAFA 2C3UA 2QT9A 1M7GA 1EK5A 1NP7A 1HQCA 4MV5A 2ZR9A 1F0NA 4QULA 1NXTA 6ADHA 2WIGA 3MCZA 4FGKA 1GG5A 1WETA 4GKJB 1K7XB 3C3JA 1GTZA 3M6XA 5BR7A 3TB4A 4RELA 1PHRA 3ZBUA 5H59A 4EI9A 1ORIA 2V7QD 3CISA 3D5QA 3DC2A 4MHSA 2UYGA 1I7DA 5IEJA 3O2QB 3KKQA 2Q4BA 3ROMA 1BQ3A 1Z88A 5LQCA 1L4MA 3DOJA 2J08A 1EM8B 4UREA 5FBRB 4NAUA 3GQBA 3JAKB 5B30A 3EX7C 4TTQA 1BAPA 3AR4A 1VIDA 4Y18A 1I33A 1Z5ZA 2GHTA 1N8SA 3AIKA 3BORA 4RTJA 2Q5IA 5L3RA 3ZE6A 4X41A 2VPPA 1NMSA 2Q6KA 3ZZ0A 3ADPA 2IPMA 5DI3B 1C3OA 3RRJA 3HV2A 3WL3A 4CLRA 2SNIE 2H5IA 3FTQA 4CDMA 1J39A 1K3TA 1ONBA 3D6HA 4Y2QA 4COOA 3WB9A 5JDIC 3ND8A 2IS1A 2FN7A 3V1YA 2Z9DA 3F2IA 3SQWA 4IYJA 4LYEA 4XJSA 4XUDA 4Q47A 4NPHA 4TLMB 4CL3A 4UNPA 4MVJG 4YMTA 3ZBQA 2GTHA 5E7IA 2Y6VA 3HCBA 1FOEB 2EV9A 1PQ4A 3H84A 2C5LA 1EM6A 3MWLA 4C4YA 3V97A 3CZCA 4YRQA 2OXTA 5TARA 2I4TA 4IIJF 3HN2A 1OOEA 2I4LA 1RZVA 1W9MA 4RX1A 4LZOA 5C1BA 1BKDR 3K53A 3ZU2A 4Y1GA 5K8CA 5BYJA 2W6ID 5EG5A 5KNCD 3WVNA 1O0SA 5IBPA 2ZRHA 3GG9A 4D5EA 1DO0A 2PHZA 4O2RA 4GMKA 3T54A 3T94A 2XWBF 4P0QB 1EJ2A 4P3PA 2G0AA 4PGHA 1W76A 2HQSA 4KVGA 1CY1A 4FLFA 4AKEA 1XHFA 5ADHA 3MMXA 3KTOA 3I28A 3JAKA 4UJ5A 3VTZA 4UTXA 4O4LF 5AKKA 4TKLA 1XD8A 4QFDA 3EARA 2QTCA 4NFLA 1KK2A 1YO6A 4GKBA 4DANA 5JS8A 1T4CB 3UGTA 2GNAA 2IPXA 1ESCA 2UV8A 3EF0A 2BLLA 3WK5A 4IRMA 4E07A 3D4PA 4BNFA 9LDTA 5C8VA 3CUYA 1JALA 2RK6A 5J2UF 1WA5A 5BMVA 1G5FA 1UPCA 2XCTB 3MPUA 4E4YA 5BOSA 1S2LA 1PUJA 5REQB 4WCDA 4CTNA 2MMGA 5AK0A 4RVHA 5JFTA 5JRZA 3GPDG 3QU7A 4ER5A 4XVRA 4TVBA 3HJFA 2C5HA 2Q2VA 3BMCB 4KPYA 3NWBA 1AUXA 1ODIA 3PENA 2DPLA 4EMTA 5L53A 1NW8A 4OXYA 3W2EA 1C3JA 1LDEA 2CLDX 2ECQA 2G1JA 2QUHA 4YCNA 3OIYA 4LHSA 4R4JA 3MLEA 4RU1A 5HVNA 3LF1A 1I01A 5AJUA 1VXOA 1TW2A 1H9CA 1G42A 2KHZA 1XCMA 1T3HA 3LC7O 4H27A 1J0XO 5DCWA 5JLJA 2ODNA 3PLRA 4JYMA 4MRMB 5J4VA 1WBDA 1MFPA 3ZWNA 1HFWA 4BLSA 3U6BA 1Z4OA 2B83A 2Q6IA 1CUEA 2VT3A 4FINA 1NYTA 1UJCA 4BRZA 4PX5A 3SFZA 1GL3A 4GZ3A 2D13A 1U7UA 2AJBA 2W37A 3E2PA 2CJWB 6REQB 1GQRA 2AOTB 2Y0DA 1VPVA 2A9VA 2COEA 1YRAA 2QAGB 2WZQA 2ZI5A 3COYA 3HI6A 2ZAIA 3QI2A 5EXTA 1HE3A 4C7KA 1UADA 3KOXA 1EGQA 4XOIA 4RFLA 3ZDCA 3TS1A 5A1JA 1JR4A 721PA 1W5TA 1COZA 3MPOA 2QGZA 2VQ3A 2VF7A 3AEKB 3IR7A 1KJJA 1PD0A 2VA8A 4HZUB 1RMYA 4LNUA 5TQ2B 4ARZA 1O6FA 1T4CA 1QNFA 1BXGB 1S2MA 2VKTA 3BMNA 3PFFA 4GMHA 4W5OA 2PL1A 4PX2A 3C8DA 4J4TA 1ZUIA 3STUA 3WS7A 1FYDA 1S02A 5JJIA 5C8XA 4L07A 5CA0B 4EUKA 5JQGA 3GWZA 3C0KA 2IEAA 2VQDA 4XJXA 3WIDA 3ZV4A 1SCNE 1G8MA 1YACA 2Z3WA 3LGSA 3AL3A 4JVOA 5F5NA 5K09A 4ALKA 3VKFA 4PNEA 2W2TA 3MXTA 4XSGA 1MOZA 4BNTA 1ULTA 4AJPA 4K40A 1SXJC 1YJ8A 2GPJA 2CK3D 2SBTA 3ID6C 16PKA 1Y5NA 4YRDA 5K9ZA 1R0BA 1T4MA 3DYIA 2E85A 4OXIA 3AHEA 1QC5A 3ICPA 2JB9A 3WDSA 1Z29A 2IWRA 2RHOA 1I7QB 3KAJA 3I5YA 3FW1A 3ETJA 1KI1A 2P4QA 1YOBA 4I5EA 4JLDA 1XOIA 2HHLA 3EJWA 4QGGA 4MGHA 5FPYA 3WV5A 3EPLA 2Y1XA 1IWOA 1GGEA 3ZV6A 4P9NA 3F9IA 2O8BB 3J7TA 4X1YB 4ZYZA 4A16A 3AUTA 4HBZA 5F7OA 4FFDA 1FVHA 4ZJUA 1UMCA 5FWDA 1K66A 2F43B 3KCNA 2CJWA 3VZPA 4HUQB 2O5CA 4PO1A 4DSAA 4RCYA 2JA2A 5J2TF 2QAGA 3IJEB 4NOKA 5GPBA 4E94A 1G5PA 2A9KA 2GCPA 2WUGA 4HDNB 1GTRA 1R0ZA 1Y34E 2DPHA 1K89A 4UEOA 4BBPA 2XZLA 1OFUA 4DTCA 1CX9B 2OC9A 4G56A 3OJWA 3PQEA 1VQ1A 3RC7A 1JAYA 1AQIA 1GTMA 1ZRNA 2VDMB 3ITDA 4TLBA 1KBQA 3AEKA 4AN0A 2HZBA 1PVDA 2GASA 3HDTA 4HZUA 4J90A 4HWOA 1BXGA 2QL9A 3BTSA 3L9WA 1C0IA 4B2PA 1KP9A 4KIWA 1IJEA 2WKQA 3REQA 1FPMA 4JSYA 1NRIA 2I2XB 3GAMA 4U00A 5TGDA 3M6MD 4IH9A 3OE5A 2XD9A 3QXGA 3RC1A 2HA7A 3OY2A 1CUZA 2W2NA 1Y4SA 3FIJA 3LUGA 2RK4A 5DMHA 3RAPR 1IK6A 3F4BA 4MQEB 4ODIA 3OQHA 1P60A 1T8WA 1MGPA 1EAYA 1L7DA 1YJAA 2H92A 3HLTA 3BJEA 2ZE6A 1H2FA 1U2ZA 3LHSA 4Q1VA 3VSBA 3I3SR 5LMZA 2D0OB 4L02A 4TXMA 4X45A 1TL7C 1WCWA 4PZEA 3G7SA 2XNCA 5KYUB 4C43A 1FVFA 2UZ1A 4RJJA 5FO1A 5JDIA 3DEIA 1YKFA 5DIFA 1ZX1A 3OZWA 5ETJA 1ESZA 5HE8A 4KQJA 1L5GB 1I2DA 2I34A 3KPJA 1KFKB 4D4KA 3FCXA 2H1CA 1E77A 3KXKA 3KKEA 2O8BA 2XNJA 3GF4A 1T34A 3HWSA 4X24A 4P35A 4X1YA 4EYQA 5CDSA 3GLKA 3RPEA 2BSXA 2VNHA 3HLYA 4GT1A 4YS6A 1OIVA 4HUQA 4WIAA 5DNEA 3U5ZB 1NZDA 3DCJA 1G8KA 1NW9B 1XDDA 1YB5A 2IVFA 1E99A 1KEEB 4HDNA 5AWFC 3ZJUA 3OWXA 4JLUA 3W8NA 4LE1A 2A5LA 1UBJS 3X1XA 1Y3DE 1HNNA 2VTDA 3I6BA 4GBMA 2GKGA 3EDYA 2I80A 3JWIA 4FEAA 5J47A 2FFHA 1ZP6A 1UT6A 1VHQA 1P80A 2DZDA 1GPH1 3GJ3A 5CNIA 3A04A 3TE7A 4B3CA 4JUIA 1KDYA 1K5GA 2H9AA 4PG4A 4CCAA 5A4KA 1DVRA 2VNKA 1ADJA 3H0KA 4ITVA 3RG2A 4I8XA 3DCIA 3L40A 4NK5A 1X1AA 3DVLA 2UXBB 4MVXA 4AJLA 4Y7DA 5CJJA 4EI2A 4BX3A 1CUAA 3FYSA 2OQIA 3KEGA 3CZ4A 2H4ZA 4MGIR 3ZHYA 4GVLA 1RKUA 2FOXA 1UFRA 2HAEA 2ZBRA 3IP8A 1H2XA 5DH9A 2TMYA 4EYGA 3U0VA 3FSJX 1Z45A 1GPAA 3D7SA 4MQEA 4B47A 3GLUA 2XMGA 1FYFA 4CIAA 4O3MA 2QPLA 4L8LA 3P0EA 4LI0A 3IHKA 1GRCA 3GVIA 3QVKA 1YBFA 4PTZA 4TQGA 2EKBA 1XTSA 2B1QA 2WYOA 3KVYA 5KYUA 4AUEA 4E2YA 1D07A 3M81A 2QW8A 3T61A 4MUGA 4BWYA 3DP7A 3I6MA 1OGIA 2DHDA 1KYVA 2NO7A 3N2GA 3W1VA 5ITZB 1O95C 4AN1A 2BEUA 1LPPA 5B3LA 1O5IA 3STHA 2GEFA 1XLUA 2QY9A 3WYFA 1SXJB 1K0UA 3ER6A 5B6PA 2C99A 1Z6AA 1SUPA 4C7OA 1NW6A 1RWVA 2ZW9A 5DFAA 2R0QC 2YC4C 1E2LA 5A3VA 1J7JA 4J0QA 3QLJA 3TR6A 1JLHA 4QUEA 2G09A 3NFYA 3BM5A 4OJQA 4ZEXA 4FCWA 4BO7A 5LQAA 4J76A 3FPBA 1P29A 3EEFA 3EXIA 5KYXB 5LMNB 2HMTA 1T6YA 1B8VA 2HJRA 5U4QA 1ST2A 1MH1A 3GGSA 1ZCZA 5H68A 2PUCA 4NZNA 1U9IC 1B4DA 2WT9A 1P45A 3MCUA 5JCJD 1KZHA 2R8ZA 3V8VA 4LV6A 4L4RA 4OFZA 3SIPA 1IMJA 2FG6C 3CX4A 1CUIA 1WY7A 2XUOA 1PFVA 4K9PA 2C59A 4MB2A 1QHYA 2HSZA 1PUXA 3DEJA 4GVPA 3WOVA 4PSKA 1G8AA 4FSXA 4KR2A 2QN2A 3K0KA 5F51A 1SC6A 3GNQA 4YJFB 1JR3A 1KY2A 3DKVA 4E5KA 1MJHA 4EG4A 1EQ2A 3G5LA 1EBBA 3ZWVA 4DTIA 5L6MB 3B3QA 4K6CA 5CYPA 4WK0B 4URYR 3F3SA 4TZ6A 3WNDA 1K6EA 2J41A 3OOHA 3KJEA 4QPCA 2WUEA 4IIXA 2O2EA 2JD0A 1D1QA 2FN4A 3A6GA 4XCXA 4V2UA 4XUGB 3BWDD 3MYYA 2I99A 4BE7B 1HX7A 2C7VA 5ITZA 1OB5A 4LA4A 1MGOA 4OI1A 5B5SA 3A28A 3ABRB 3I76A 1LGYA 1VPEA 2ZE7A 4BNVA 4UCWA 4DQDA 1SXJA 1TE2A 1FS4A 2A9RA 3SS9X 1N9KA 3UAZA 1CPYA 4NZMA 1ID1A 4H3HB 4DDWA 3FOWA 2A5YB 4YMVA 3I5MA 1FXSA 4QGHA 2VHJA 5K0LA 2ZIVB 3RS7A 4LYGA 3NIDB 3SE0A 1VI2A 2EERA 3QX3A 1P39A 4YCMA 5CCXA 3HJGA 4HHEA 1HEUA 1R8XA 4CGYA 3T1QA 4IXMA 4JI4B 1M6EX 3E7XA 1Z2NX 5KYXA 4XFKA 1JGTA 3HJRA 2H54A 5COAA 1E9CA 3LXMA 3ZHSA 3FPCA 2VYVD 3HKBB 3LBAA 3U4IA 4M46A 3UXMA 2ZIWB 2XJ4A 1AGXA 2Y1FA 1NJGA 4INJA 3NM6B 1ECPA 1KTVA 1RI3A 2QYHA 3OF3A 4IXDA 1Y3FE 4KPGA 4N7RA 1WV1A 4MUMA 3UCEA 4F8JA 4WNIA 3UHOA 1G6HA 4KGXA 1BW9B 1BGXT 3UH0A 4HDMB 1VMAA 1J4AA 1TCCA 2L69A 1EFCA 5FUVA 3TRDA 5AUPB 2X2FA 2IEDA 1NUQA 1SCDA 4EM6A 4TTIA 4YJFA 3GB9A 5CFMA 2QYTA 4RDHA 5DNDA 1CIJA 1ML4A 1JXQA 4U4AA 1WW8A 1ZOOA 2GN1A 4WJKB 2P27A 2XKBA 2KSQA 4LDNA 4UE2A 1DMRA 2AIRA 1KO7A 1WSDA 1XB2A 2EAUA 3ZE0B 2PWYA 2YXNA 4K9SA 3DDNA 3RLIA 1T3ZA 2WTXA 2Y1EA 2DFLA 5FPPA 5LB2A 3H99A 5AUNB 4DZRA 2WF7A 2M98A 4TV9B 3T06B 2C9YA 3FHLA 3ZGVA 1UWCA 3FAKA 2VJBA 3FWNA 1BG6A 1AJEA 2PCLA 1D03A 1Y80A 2H11A 3SG0A 1IE3A 2YZNA 3GEHA 4HX9A 4J43A 4C04A 4Q7MB 4AP5A 4CETA 1JDBC 1W2GA 1TZMA 1YL5A 2Y92A 3Q87B 3DH0A 5DGHA 3V5NA 3RU2A 3HH8A 5C1PA 1X1EA 1ZD5A 3BBPA 5D51S 3P52A 5KS2A 2JFVA 1U99A 1NFRA 4IQ8A 1NPTO 1KO1A 2ZIUB 2V55B 4QDZA 4FFPA 4MPPA 4FWBA 1J0BA 1I6LA 2ISQA 2RGAA 4ZT2A 1GL6A 5DISB 3KQVA 4UHBA 4LVNA 2WIDA 1C3LA 2IYTA 1MZPA 2QUZA 4HEHA 4JI8B 4OUDB 1GZSA 1BW9A 3Q6IA 4TRJA 5JATA 4TRNA 4HDMA 3MS7A 3RHZA 4YXFA 3DEHA 3F6SA 3EEQA 3MEQA 3A4LA 4UATA 3INGA 4F6RB 5JFOA 1C3VA 5L4NA 3G82C 3M4ZA 4ZVRA 1N2SA 2RJOA 1ZM7A 4Z4GA 1WWKA 1IC6A 1XRPA 2YYYA 2OESA 3JQRA 2EJWA 3QE4A 2OK7A 2PUTA 1YA8A 2WU8A 4MYDA 5C31A 2Q0SA 1Q7EA 1T9GS 3E48A 4OIFA 4YWJA 5KYTA 1EJ0A 4M37A 5LJIA 1PSDA 1Z8FA 2C9DA 3PFKA 4ALNA 3WMGA 3VR2A 2QTZA 2EP5A 3I2JA 4HB3A 3R6GA 1A04A 1DC4A 2KE5A 2CMDA 3BE4A 4O5OA 1LTHR 4NOJA 4QUKA 4F21A 3M6FA 3C3KA 2AJTA 4I9FA 5SZKB 4TV9A 3K09A 1AS2A 1XNHA 2M2IA 3JQAD 3QBDA 3GMDA 5B1IA 2GF9A 5KSOA 9MHTA 2PGOA 1N1GA 4QUJA 3WQRA 1G1MA 3PXBA 4N9QA 4XR9A 1DOHA 3A11A 5IC4A 4S1PA 5ALKA 1L7AA 1TA0A 2K7ZA 2P91A 4LHYA 1MLDA 1FS6A 1B00A 1SO8A 4RDIA 8ABPA 1GG9A 4YT8A 4AKHA 4FFWA 4ZMSA 2DSNA 5AM2A 5F1YA 3RV4A 1O95A 1XVUA 3H5IA 3KKKA 5DT2A 5A02A 5CITA 1JZSA 3DV9A 3DGFC 3LK7A 3W5BA 1K8QA 2WNSA 2K87A 3JD0A 1XZAA 1YFKA 3D6JA 4PO3X 4DHEA 4EG6A 4ETWA 3PX7A 2I4IA 2PGJA 1QK5A 1H2RS 4P7KA 1G5HA 1H6BA 4FU0A 3FMIA 3IQFA 4OUDA 4WCFC 1UQRA 3FYUC 2W2PA 1NV8A 2ZYGA 5JADA 5F2NA 1DQPA 3G9ZA 3EZ6A 3L8EA 1R50A 1QX4A 1P2BA 1G6OA 2O3RA 3O95A 3W3AD 1U9IA 3NVKI 1YR9A 2L18A 4C0SA 2QLFA 2ZLBA 2HBZA 1Q3TA 5ADVA 5I7EA 3GLFE 3JSXA 2NZYA 5K1ZA 4OHFA 3SYKA 3ZCQA 4IV8A 5KI6A 3WL4A 5HFAA 4A6DA 1V96A 5DBIA 1YQ9A 1DCTA 2IYXA 4WXPA 4AKGA 2RHTA 4HNVA 1AMOA 1PUIA 3SBDA 3PLAE 5C3UA 3MERA 3CEHA 3CO0S 4X7BA 1AUQA 2PRKA 1E1CB 2MYTA 2VLBA 3AYZB 1FVXA 4NJMA 1MXHA 2ZBEA 3DAYA 1UM9B 3GRUA 3GT0A 4RVUA 4EHKA 4ROTA 3OOJA 5JALA 1Z7YA 1SKYE 1KJIA 2G08A 2PQ0A 1M6HA 4X7PA 2AW5A 4J7XA 3MCTA 4GF5A 4R1OA 3GG2A 4E08A 5CDYA 2QD4A 1NIJA 1ZRMA 1UDRA 1GG2A 2Q2WA 3G7NA 3CIOA 1BSVA 1DWQA 2DFVA 2CLHB 3E15A 3SDZA 1C4OA 4LY3A 5B4TA 2NADA 1IQPA 3HXKA 4FYHA 4X65B 1MJNA 4R05A 4DUPA 3AEQA 3ONWA 3COJA 3BE5A 3M83A 3H2GA 4TXHA 1VPWA 3SYMA 3PVCA 4GKKB 1DC6A 1CKEA 4MS3B 1T2UA 4DYVA 2VK1A 3BDAA 2OP1A 2V59A 4TQUS 5KHAA 3BWCA 3MUOA 4G0XA 4DV4B 3R9XB 4XVHA 5HFJA 4BYMA 2FH5B 3PDWA 2H00A 1FNMA 4AC9A 3PC6A 1SCQA 1H2BA 3ASZA 1X7XB 2O2YA 5B1DA 2IW1A 3OF2A 5D5HA 5SY4A 3TUIC 3UWMA 2ORVA 3V6MA 3VU9B 3ILXA 3N8GA 3SVTA 1JHVA 1GZ4A 2GM4A 4EKGA 4E5MA 3K6SB 4D6PA 6NULA 1VB5A 4WQMA 1VIVA 2WTMA 2CZQA 3CT6A 3F3KA 4G01B 1G8YA 3PNVA 4JQZA 3STYA 4AJ9A 1EXNA 1WD5A 2RIRA 3H9UA 4IQGA 3ULKA 4H6XA 4I99A 5JECA 2RAPA 2H7YA 2V7BA 3KL2A 4QUAA 3UJ8A 4EB6B 4U02A 3COPA 5F9HA 4KQ2A 4GWGA 3HDJA 1CY7A 1SAYA 1U6KA 1M5TA 1UM9A 5TEVA 4N3AA 1JWAB 5KKCA 1CQJB 2CXPA 4ER3A 2C5EA 1N7GA 2YZ2A 3NH9A 2YWGA 1E0AA 1NI5A 1JYSA 2VNJA 3EGWA 2P6OA 1GGKA 3PSHA 4XGQA 2A84A 3OHMA 2INGX 1CRPA 4F7WA 2XRYA 1IATA 2ASVA 4PN3A 1Z5UA 3G2PA 2GFIA 3FNIA 2F7SA 2P8JA 2ZI4A 2V0NA 4XDGA 2VDNB 3LFHA 1SIOA 4PHTA 1JSXA 4RD4A 5K0GA 1QG6A 1J2EA 3GHHA 2FDXA 3QEMB 3ENZA 3I1YA 4IQ4A 3SXUB 3A14A 3BZWA 1LDMA 4MS3A 4LF5B 3CMCO 2D2FA 3FBWA 1I3KA 1QF7A 3PKIA 1P5RA 4JL5A 4Y0VA 5I8ZA 3R9XA 1NLYA 3KE8A 5ARCA 4DV3B 4KUEA 1NPYA 1Q1NA 3HR4A 4HXEB 3A1TA 4S1WA 3USZA 1XEAA 4CT0A 2WJZB 3AEUB 2GLUA 2PMBA 1X7XA 4G85A 3I72A 4DYDA 3CUUA 3PQDA 3FGNA 3VU9A 3JYLA 3OPVA 3W5IA 2F3SA 2FPOA 2I2BA 4CDNA 2ET6A 4RZSA 1E3JA 1AN9A 3GNSA 3V4VB 3P0IA 3ORSA 1CFZA 4IJVA 3SNKA 4YR7A 1C9KA 3IEUA 4WCFB 3Q7IA 3VTKA 4E22A 3IB3A 3FYUB 1POXA 5AKJA 1YBHA 2GAAA 3G49A 3OZUA 1YFLA 2Q28A 3EGOA 1X6VA 3TSZA 4NQZA 3NJ4A 4YAIA 1MDBA 1J1IA 2XMQA 1YOVB 1XNQB 1I4LD 2XYGA 5COBA 3K71B 3D4BA 1H5NA 1CQJA 2AYZA 3NOQA 2PKQO 1FC0A 1DQNA 1DRKA 2HCRA 1PZGA 3G2QA 4HGOA 4HH4A 2GQ0A 5MN6A 4FNGA 3OO0A 4YQEA 3H9QA 4TRRA 1WXXA 4KYVA 2BUAA 3CH7A 4W9RA 1QTRA 3LKZA 2Q62A 1A5ZA 4JIGA 5IVKA 1KI3A 5I9BA 1WZEA 4B48A 4CG0A 3R8XA 3FLBA 1JECA 4FOOA 1E58A 4TMYA 4W1RA 3FF1A 2IS2A 2QX8A 3FPHA 3P9YA 1ZOIA 2QPOA 1TYZA 3PDJA 3ZGXA 1EEXB 5JH7B 3RIGA 1H65A 1HKUA 4Y6RA 3VU1A 3QVSA 4EJ0A 5LZ4A 3AVVA 4PR3A 2DPGA 1NLFA 2WHQA 2BTEA 1Q7TA 2PM8A 2C61A 4PEVA 3O2JA 5KX5F 5H16A 1NMYA 1NR1A 2EFCB 3CWZA 3GFVA 4LDAA 4C6TB 2IEGA 4P98A 1R0XA 2JAQA 3BZUA 2VYNA 1LPOA 3SJBA 3KSAC 5JXHA 3C3CA 3IDFA 4G1BA 4JI7B 4D0NA 2QU8A 4DABA 3M6VA 2WIAA 1T1SA 2I4OA 1CIVA 4NY1A 5CT4A 3JQFC 2ZYTX 4KGDA 5JSHA 2PU5A 3M70A 4FLEA 4HAVA 4YJ2B 1XI2A 5EE3A 2B8JA 2Z8XA 4PX9A 2F9MA 3GRVA 2I2DA 3KOYA 4WCFA 2EDCA 5K3SA 4C7MA 3FYUA 3KYJB 5JAZA 3U81A 1NVGA 1X1QA 3S2ZA 1RTKA 4L4YA 3GCZA 3IDZA 4YK7A 1WV0A 2OO5C 1DPFA 2CFTA 1GNPA 1VSUA 1FUEA 1YOVA 4PG5A 4RQBA 4QXAA 2C8KA 1LBIA 2P7HA 1FFGA 5B1SA 3NAGA 1ONSA 2B2CA 3VGPA 3VR5H 5KWJA 2FPLA 1JKFA 2AKAB 3N70A 1Y63A 1JLLB 4YQFA 2I2CA 2APJA 5KB3A 2XODA 2XUIA 3RFCA 3ZTWA 1G4HA 2QMHA 3ZYZA 3F6YA 1PS9A 5HEKA 2AZ4A 4BKOA 3THRA 4DDHA 3D3JA 3DDSA 4FOPA 4MS4B 3EA5A 2VL7A 5EJIA 5DNAA 3LW7A 1NWCA 4CMJA 1KAHA 2XUHA 1IEQA 1SQFA 4KBGA 4WDRA 4UHEA 4Y6QA 1T5OA 3U48A 3VOBA 5AVOA 4K87A 3ACDA 1D4ZA 2EZ8A 3HA2A 4YP9A 4Y98A 5KOIA 4IKEA 2Q5LA 2VUHB 2X0IA 1E2FA 4IX9A 4E32A 3PB3A 5FPSA 3K0SA 1YGPA 3W5CA 3WXBA 2GA8A 2ZP1A 4D4LA 4LV8B 2GCEA 5ARBA 1E2BA 2C54A 1V25A 2XPCA 2YQ5A 4KWEA 2XDYA 4OGGA 4C06A 3MTIA 3FVQA 4BBJA 4YJ2A 3EHDA 1KK1A 2AC2A 3KJFA 5LZ5A 4QDTA 2YH2A 1NW4A 3KTDA 1I1OA 3HJBA 5BMVF 4XYGA 1JS1X 3AG6A 1HSOA 4RQTA 2VPZA 4YBRA 3RK0A 5K2OA 1JSCA 5E3JA 5HQ3B 1BO6A 2X0JA 4J0CA 1YZNA 3OFJA 4JYBA 2D00A 2XXAB 5GMOA 1FNCA 3NRCA 1W2HA 5JHGB 2SICE 3O4HA 2LXNA 1EP2B 2IU6A 2YWEA 4PBSA 1ZI6A 5IC5A 1ZAYA 3A7DA 4XM0A 4U6SA 3SR0A 2P5TB 2IHUA 4QXPA 3SC2A 4QGSA 2L0XA 2X5JO 4L3WA 1LPAB 1PFWA 2ARKA 4UM8B 5TGZA 2XB2A 4Q1BA 4MUIA 1VCOA 1JJAA 3K0BA 4Q4DA 4LF7B 1U7XA 3ZH2A 3D8SA 4X54A 3NOXA 3GGPA 5JMPA 3ROGA 2W0MA 5LU8A 2O54A 3BHIA 2JCBA 2H06A 3NUQA 1Z07A 4HR7A 5F73A 1GU0A 4EH1A 4MS4A 5G41A 1VHWA 4EJ6A 3LYLA 5IAOA 2EX4A 1F0YA 3FDJA 3HYTA 3PUVA 3HVJA 4TWBA 1ZCJA 3O4FA 2LGJA 4EO4A 3WJ1A 2RGNC 3AUAA 1YQXA 1V4VA 1AB6A 3C6KA 3PCXA 4L0DA 4EG3A 8MHTA 1QO0D 4D44A 4JV5B 3ELDA 2CHVA 5T6MA 4QT4A 3ANLA 1G3UA 3E8SA 1W4RA 1SGWA 2OD7A 2DQZA 4YUWA 1U8TA 5KEIA 4EENA 4JWTA 4KO1S 5BWOA 2GSWA 2IP4A 2ZSHA 4FE3A 1IHDA 2DT5A 1S89A 5JQGF 2HA3A 2W7TA 3BHNA 3OTGA 2CMKA 2HI0A 5HQ3A 4QT0A 1H0KA 2PR2A 2XXAA 1YKGA 4FJ1A 1HDCA 3M82A 2DHCA 1IBLB 1P77A 5AW5A 2F55A 4FXOA 1N3IA 2FPGB 2WM8A 3ANXA 3DL2A 3HB1A 3P1JA 3AL0C 4P93A 3R9IA 4O4IA 1II8B 2F59A 2HSEA 4MLCA 4WBNA 3L6EA 1NSFA 3F49S 1QF9A 621PA 3S1AB 1QGAA 3E3AA 2GTPA 3D8NA 1S2NA 3DAFA 2ATXA 3FLMA 3LHDA 3QJGA 3IAFA 4J16A 1IBKB 3ZQUA 3B78A 1Y81A 1U9YA 3D02A 3EWSA 4I4LA 4MARA 4O1MA 3VR3A 1ZC4A 3NGLA 2C00A 1CDDA 5HTOA 3ECAA 2JD1A 1L4BA 2R25B 3DWFA 4PGAA 3TVTA 2COKA 4N3BA 1E5VA 3L3BA 1UPXA 3STTA 3WQQA 4BRSA 4CM7A 3UFBA 1DUVG 1OWMA 3VC3A 4B44A 3IULA 1HDRA 1TW3A 1WB4A 2WICA 1E9AA 3D3WA 4HQKA 1H69A 2C9MA 3F9RA 3MTQA 4JKYA 2NOAA 3GLRA 4DLZA 2A1TS 1F2TB 4R1SA 4PLCA 3UJ9A 3DXZA 2CL7X 1M2FA 1U3UA 2WD7B 3HY6A 1AQLA 2Q0QA 1A2KC 1VDMA 5JEEA 1VC2A 2MYNA 1V8FA 3M2TA 3O94A 4Q4HB 3EOAI 1EVYA 1JWLA 3W5SA 4NCBA 2P1RA 1BH6A 4UOZA 3SF8A 1IHOA 1GT91 4FZRA 4G09A 2W6JA 2Y6UA 5DT9A 5T4HA 3FMPB 3ODPA 1LVGA 4ED9A 1JVBA 1XTRA 3MYRA 3LLVA 2NO6A 5HIJA 1RHMA 3G13A 1ADBA 3MSCA 1CJKC 1P0QA 2WZDA 4OXXA 4B3IA 1JV2B 3ADOA 4MW6A 1W59A 3X2FA 5TC4A 3KD2A 3F7NA 1SRQA 2NTVA 2V6MA 2FPGA 1RAHA 3KZXA 3OIGA 3OJXA 4JKOA 2IITA 1II8A 3JQFA 3VNVA 4HGNA 4AZTA 1CJUC 2DP4E 2LKCA 3G9QA 1Y1LA 1SD2A 4ZOQI 1RACA 5TS3A 1C41A 2D2XA 4B75A 3DTVB 5K0BA 1LNSA 2DJIA 3OLXA 4U7WA 2EEPA 1W35A 1KBOA 4LX8A 4QASA 1XCBA 2WFMA 1JVSA 2BH9A 2OO5A 1QNLA 1DV2A 1VCMA 4KDFA 4N18A 3H6HA 3KQQA 4ND2A 3EEOA 2IDKA 3O8OB 2EJTA 4IGAA 5JS1A 5KOYA 1A4XA 2JGIA 1CY0A 1L7OA 4OX9B 2OBXA 2VCEA 3NYRA 1O6BA 3H0EA 1NXWA 4US1R 4TSKA 3THWB 1J99A 2OSBA 4HYQA 5KNDD 2OZLA 1ZMXA 2O14A 5DHQA 4KLNA 3I9FA 2WD7A 5B58T 3N07A 4Q4HA 1XZCA 4NIMA 3QQPA 4NE9A 4C4RA 2NZ8A 5AVTA 1Z0FA 1UANA 4NEGA 4ZHQB 1A71A 4FX2A 4QDJA 1XA3A 2RGBA 1DELA 3B1XA 3PR2B 1TUEA 4BNZA 2IBSA 1G55A 4HFNA 1T8TA 4I7EA 2FB9A 4BO6A 3ELUA 5BO5A 3SQXA 2P4UA 1D2MA 1C0PA 2ZRNA 4NNJA 1ADFA 1MJGM 4I2NA 1NMXA 4RD1A 4BQRA 2DFPA 5KOHA 1XELA 1NXOA 3LCUA 3O1JC 2VR1A 1XNJA 3IE1A 1PNOA 5DNWA 3NONA 3DLIA 3KDPA 5E9QA 4DKJA 4LXHA 2H1FA 3KKOA 4YXWA 5TVGA 3P19A 5DYIA 3RHTA 5C1OA 4LIPD 2VSXA 1N2OA 3DTVA 3O4RA 4R1TA 1UP6A 3KV3O 3RI3A 1BEZA 1K5PA 4QBGB 4FX5A 2CCGA 1Z3IX 3Q8XB 2PCJA 3B89A 4X8MA 3BEDA 1QJCA 3WK7A 4XWWA 3S0JA 3I2IA 3U26A 2JL1A 1BA3A 4L9RA 3UJHA 4ZCMA 1QIKA 1XTZA 3O8OA 3VR6A 5H9WA 3ACCA 4OHCA 3Q1LA 1F6BA 2IYEA 3DOIA 3O26A 2OB1A 2NSYA 2R97A 5AO9A 4G0WA 3CZAA 4KLAA 3KBBA 3LBNA 3UYKA 3VYTB 4BAZA 5CB8A 4DNFA 3AF2A 4F2WA 1NMQA 4WN9A 4A8JC 3HGMA 3CNQS 1F4LA 2J9RA 2Q5EA 4S3MA 5AI8A 3LD9A 1K98A 3QBTA 1X7GA 2ZYVX 4JOCA 2FOIA 2I65A 4ZHQA 7ADHA 1O96A 3L1VA 4PYNA 3ZXSA 1FL9A 3CU5A 1G0OA 1FMJA 3CX3A 4R1PA 4XM2A 3ANYB 5IU6A 2RGNA 3UANA 1EFRD 1VL6A 1WQ3A 1NJ2A 1VRWA 2B82A 2HCFA 4IIGA 2GOYA 2ZB2A 5AXCA 1ZGZA 3R5SA 2PFKA 3ADCA 3LIPA 3IBFA 4A92A 2DUWA 2PO5A 3C3DA 3BGSA 1J9ZA 2PU7A 4RF5A 4YJ3B 4DJFC 3UMVA 1T9CA 1QZXA 4X66B 1VHLA 2B5WA 2FZ5A 1D2AA 2FSFA 2XMCA 4JLJA 2HWUA 5DHUA 4EO7A 1CLEA 4RLHA 1JDSA 4BIMA 3GXBA 4Y9SA 4DLRA 5TSDA 3FCSB 2FZKA 3ME5A 1RDFA 1W30A 4OA5A 2GK6A 5DYNA 4DJTA 2AWOA 4ENPA 1G5IA 1PZHA 1IHYA 3GLFA 3DMYA 2CMGA 2NYVA 2VZ8A 2ATVA 3VFDA 3UICA 4Z0NA 1JFLA 2AR7A 4Q05A 4OOEA 1VPLA 4PYRA 3CUSA 2AI3A 5EE1A 3ZLTA 4B79A 4CIYA 5GTDA 2OWDA 1CZLA 2QTLA 2W22A 1JG3A 4S1OA 3TFQA 2ZS9A 4AJ4A 2P69A 3CRW1 2Q1UA 1TTHA 3MJ4A 4GBGA 5TJ9A 3E8MA 2FMFA 1QGUB 4JZYA 1SBTA 3E7WA 2GZMA 1SBNE 2Q4OA 4S24A 1PJSA 3N7AA 3HUDA 2XNSA 1OYYA 2C9CA 3ORYA 4RIEA 1P2SA 1T0BA 1U8ZA 3A9UA 2WWGA 3IJ5A 3DAPA 2IXAA 4CKEB 4F4UA 3CLUC 1WPRA 1JG7A 5FI1B 4JJ8A 9LDBA 1R4ZA 1O8CA 2K2QB 4ENVA 1RXEA 2UYQA 2WMDA 3LC0A 1TYBE 4XARA 1Z2OX 1ZESA 2QJOA 2G40A 3C8ZA 4EL0A 2X4IA 3IMEA 3H1AA 4OHOA 1T9HA 2R6CA 4Q82A 1S4MA 4C0AC 5BR4A 4QODA 3IDOA 4K6KA 3EBPA 2C03A 3RT7A 4QYSA 2OCDA 3H4VA 4LOIA 3ZTYA 2O3UA 1NOIA 1Q7RA 1L5QA 3EVNA 2FW1A 4GLLA 1RD4A 4M9RA 2Q7XA 3OX1A 1AK2A 2FLVA 2HSGA 4UZFA 4DWWA 5M3BA 3V00A 4YAFA 4YT2A 1YJBA 1J20A 1LQUA 2IXTA 2QV0A 3TBKA 5K4GA 5KU1A 5IF3A 3C14C 3UOGA 2EHJA 4H16A 4OY3A 3GT4A 4JQSA 4BATA 4WKNA 2YV3A 4ZPJA 3UV3A 1BTOA 1DIHA 1KJZA 3GEGA 3MMPA 3P97A 3BAFA 1LVUA 4PLFA 5PGMA 4BX0A 2Q6VA 3E1SA 3QVXA 3AWIA 5DOZA 1CR1A 2QRGA 3LW8A 3BKWA 1V1RA 5EP4A 4P38A 1BVHA 4YRIA 1QGUA 5FA5A 5COQA 1H5QA 1TEVA 4NJEB 3WGMA 1KQNA 5AW4A 5JS2A 4L57A 1HZZC 2Q6LA 4RGQA 1NXPA 1F06A 1ZH4A 5KWVA 4RF4A 5FUXA 5I9LA 4FWTA 4OI2A 2DBZA 3OLVA 2PJDA 2CFIA 4AECA 4I1OA 4JEHA 3UBTA 2J7PA 4H4DA 4GM4A 3JQ9A 2GD1O 4TKMA 4WZZA 5A0TA 3ZWDA 3TRHA 3KTFA 3HXTA 4JR2A 4WLNA 2LD4A 2PVPA 4J7UA 3ER9A 3PJGA 2POQX 1R0RE 1WXFA 2WK1A 2QP3A 4A8JB 3EN0A 3RO7A 4ZHQF 3C41J 1RYFA 3LCCA 4LRQA 4RDCA 3D8RA 4N3NA 1RE0A 1MMFB 1F60A 2YJ6A 2R47A 3P0FA 3QX7A 1DBRA 4EF4A 2BR5A 4H0NA 1XROA 1TUGA 3GFGA 3INNA 5K0NA 4D3DA 2EXXA 4M9SA 2QG4A 2RC6A 1KOJA 1PTKA 1QHSA 4HH1A 4M9CA 5KOJB 1RPJA 4UMEA 3TQOA 3PTLA 4WY2A 3RUCA 5C80A 5A2GA 1XG5A 2D0PB 5BYAA 1Z7EA 2PJRA 1WVGA 1VLVA 3DNPA 4K9NA 4UCXA 2GYVA 4IY1A 3PDIB 5JAMA 1TQ4A 1XTUA 3R75A 2PLFA 1KPHA 3D1VA 2E4VA 1ADGA 3IEMA 1FMLA 5JO0A 1VZ3A 4R41A 3DTTA 4PSVA 4FGLA 4M8SA 3ZPXA 3ZY4A 3NC4A 4F0JA 2NN3C 3S4YA 1GNVA 3EUWA 4K46A 4MTCA 2W43A 3MJSA 3VVMA 3O74A 3P5BA 3W34A 2VDJA 3U19A 2XOXA 4H4CA 2DXIA 1Y37A 2G9ZA 2QY6A 2XMDA 1QHHB 2YCBA 3O8LA 1K1EA 3L4SO 3SEFA 4FW9A 1LA2A 2ISSD 1TM1E 4Z8XA 3B5JA 1Y3HA 3N9IA 3EEBA 5AKXA 4CKZA 5JWOA 3RS2A 2IBTA 2NP7A 1DLJA 4AF7A 2OXCA 1K7CA 4Y67A 1E3WB 2GZRA 1XEWX 5GGXA 4UHHA 2FFJA 1FRNA 3IX7A 3VAYA 1E2EA 3N0WA 3VHXB 5JY1A 5IJ0B 4B85A 1L5RA 2PV7A 2QNRA 1NY6A 3SZRA 1E6EA 3RODA 3P94A 1NJ6A 2JZNA 1B42A 2GAFA 2KWIA 3T3OA 2DFNA 1HFKA 3NX4A 4XQGA 4BU0A 1TVEA 1H22A 3GUZA 1GQ2A 3GJ5A 2C97A 4M89A 3SLGA 3OT5A 3CVOA 4FHDA 4PSAA 3EZXA 3IEKA 4RHEA 3ESYA 4BFTA 4A2QA 4C5CA 5J4KA 5KOJA 3OTOB 3U62A 4AG6A 1ACLA 2WW8A 4UM9D 3MIZA 5KKNB 1AGPA 2AUMA 3W5UA 5TVKA 1MZVA 1O54A 2D5AA 3PDIA 3UTDA 2QDXA 2ZZMA 2ATCA 5FUMA 1FNBA 5LP6B 1S01A 1A2QA 1XMIA 4BL5A 2R5FA 1U4SA 3ZGLA 1ODLA 1N6OA 5KTMA 3IKJA 1NQUA 4TLAA 1C7JA 1LSJA 1IVYA 1SZCA 1ZL2A 2EGGA 4HGZA 1MP0A 2G06A 3D6TB 3EBLA 1GAEO 1KIAA 4FDAA 5IBCA 2WZCA 3BF8A 1RP1A 4JLVA 1LPBB 2H2AA 3HPRA 4QA9A 5AI0A 3L6OO 1Y9ZA 3PD7A 4ZP1A 4CUJA 1TU3A 3T1HB 1XRLA 1M1XB 2C2XA 2DUJA 4PAGA 4LQCA 1RQ7A 2JAOA 1VP3A 2P40A 2CMHA 1XKQA 2G8NA 4W82A 4D97A 1Z7WA 3C70A 4TTRA 4MAAA 1UMBB 2NG1A 4J2OA 4JB0A 3QUBA 5DKFA 2R79A 5B4UA 3FD8A 3VHXA 5IJ0A 4LZWA 4TXJA 2Z2IA 1Q0SA 4J49A 3PTAA 4B87A 2RHWA 5F7JA 4WLFA 1OHHA 4QJ4A 2QS9A 3TW8B 1A50B 4DLSA 4GPEA 4ZAZA 1EWKA 3ZXXA 1O9GA 4PC3A 5I7FA 5K3EA 2ZI6A 1KI6B 4MUFA 5ICGA 1YB2A 1GWNA 3I83A 3QU4A 1A82A 1QYRA 2CNWA 2PGIA 3NWEA 4WLVA 3RUHA 3I04A 3SC6A 1ZVKA 2D1FA 1A9ZA 2Q3CA 4LYYA 1PNQA 3M2PA 1UPTA 1ESMA 1XALA 2OWEA 3G5MA 1N92A 4DA0A 1B3RA 3GN1A 1G38A 1RYHA 3FTCA 5BXYA 2X9VA 2B9VA 1QBGA 2OVBA 3LC2O 3LXRA 2UYHA 1RBYA 3WKBA 2H4FA 3EZNA 1NYQA 1DBIA 1YQDA 4YMHA 4TRMA 3ZC3A 2A0YA 3ESCA 1MKYA 1YDGA 2X9QA 1X9IA 3TXXA 1CS4C 1VJDA 1L7PA 1PGNA 2IKSA 4GAEA 5IVIA 3TVDA 2A5DA 2R6AA 3TW6A 2B4AA 4QUDA 1GU1A 1AMNA 2BKEA 5LYJB 3IC5A 3IQZA 1BDJA 3IV6A 1A4IA 1PU2A 2XEXA 2G4VA 3KR9A 3KX2A 5IT0A 5I7HA 3NASA 4EO9A 1C9YA 2XXJA 3B52X 1Y4UA 3D7NA 3R41A 4JROA 3U3OA 1JQBA 4KI0A 1RP7A 2H08A 4V2IA 5DHFA 3TJZA 1HQKA 5MN5A 1A9TA 3IQIX 4GLOA 3T38A 4UXJA 1KMIY 3PX2A 2QN7A 4O4JA 3U7JA 4NZPA 5IKMA 4AUMA 4I55F 2NZWA 3CLSD 1J24A 3IVMA 4I81A 4OHYA 1RLIA 1AE1A 1QGOA 2JAHA 3VNUA 4G5XA 4IDBA 1G8PA 4HGRA 2WIBA 1HZZA 2X1HA 2IDJA 2F00A 3IRVA 3QKWA 4X7MA 1KI6A 4YMSA 1BRMA 2ALJA 2D4HA 4WJZA 2GYUA 3T3DA 3DZCA 3F73A 4UCFA 2HF7A 2V7TA 4K9LA 5ELLA 4B45A 4KREA 3RH0A 3UA3A 4DE5A 2OCAA 5ITSA 3HNPA 4ZALA 1OFVA 3UT6A 2RAFA 4HI0E 3I2YX 2FQXA 3MGAA 4CODB 1Z08A 3O73A 4GOMD 5C81A 2QE7A 1IB6A 1R2QA 3M1YA 2L19A 4YRRA 2J0SA 1RAFA 2O3TA 2QG9A 1MXFA 1BN7A 3FDZB 5H3LA 1KORA 3PFBA 4CMHA 3FNEA 3EIFA 4H3SA 1KO5A 4LAFA 3LG2A 2IIBA 3D1JA 4K1XA 4OL0A 3UAWA 2HUNA 3CF4G 4FLMA 3OOSA 4L5CA 2PS1A 4MCHA 4R2HA 5M5BA 1MBZA 1I4OA 4QSMA 1TM5E 1L6IA 1M8GA 3ZU3A 1L4UA 2D74A 1Y4AE 2EJBA 4OD0A 2HHJA 4IV0A 2WD8A 1YDEA 1ZJYA 3FOAA 4HWGA 1R10A 4JJAA 1P3DA 1P74A 3ISJA 1NOJA 2BJVA 2YL2A 4MWDA 1E3MA 1VJRA 3TW4A 1QAQA 2AFHE 4EHAA 1MRNA 3VC2A 4D0LB 1GTVA 3BT7A 4DLVA 3DVSX 1RWWA 4H7FA 3WL6A 1U80A 5FWAA 4Q37A 4JODA 3U7HB 3VTFA 5BUCA 3IUEA 1K86A 4H7PA 3OZGA 3P2KA 1PK9A 3HV0A 4BGUA 1NR7A 2MSLA 3VNBA 4AVYA 4W1QA 3W8FA 1RVV1 4Z5XA 3JTEA 4OSPA 4QG7A 2PD6A 1E1DA 2J9FB 1PD1A 4X3CA 1ZPDA 5C2JB 1T0HB 1XDUA 1T5LA 2A5FA 2NVWA 1AQUA 4ABTA 4OMUA 3PXEA 1HORA 1OTXA 3EIXA 3PUIA 3SWWA 5CVEA 3OZ7A 3IA2A 4UEJA 2FN3A 2WAAA 3V7NA 1WB5A 2P6NA 3P2MA 2X8BA 4GPZA 5CLGA 1YHYA 2XOKA 5E0KB 5H70A 1RSZA 3E84A 3EASA 4ZAFA 1XV5A 3CNLA 4MKXA 5DW3A 3UG6A 4RNCA 1FMFA 3I0ZA 3QXSA 4WE3A 5EZYB 3H83A 3UAYA 3FDZA 4L76A 4XVUA 2QR2A 2BFOA 4BP9A 2W8ZA 5KPJA 1UC5B 2TMDA 4DUZB 4ARCA 4ZA2A 3JZAA 5EFOA 5I7OA 1ECLA 2V9CA 3CUVA 3ZJ4A 1L3IA 5JMWA 1KQGA 3CA8A 3QFFA 1ZJ4A 3RBZA 1QTIA 1W94A 1PJ2A 4P5EA 2CXXA 4UMFA 2LR0A 4MK4A 1XXLA 3PDUA 2IV3A 3TW0A 4OHXA 4TTJA 3A4TA 1Q1QA 3IESA 5JANA 3G6KA 3GQVA 4KWHA 4M6WB 5BPHA 4RADA 1KJQA 1QRAA 2CCKA 1QCCA 1SQSA 2Q8QA 3KEFA 4D9IA 2C8VA 4MCIA 4CKYA 2YHBA 3K0FB 1HG0A 4G0MA 1MR3F 2HPVA 4JOQA 1AKNA 1JPJA 3OUZA 1IY2A 4JT9A 1PV4A 1Z74A 1W9HA 4MW1A 1UZLA 2QQGA 1VKNA 1VE6A 1GAQA 1BX1A 1RU3A 2QJTA 1GRVA 4BGIA 4EHFA 4R0NA 2XYHA 4DR4B 2E18A 1C80A 2CT8A 3EA0A 4BQIA 2HQBA 2G67A 1WY5A 3A2MA 1CDZA 3ESAA 4Y3UA 5FFNA 9GPBA 4YIHA 1I0IA 3L77A 3IYLW 2Q41A 5ILQA 3W4IA 1UUFA 3IAEA 4C3ZA 1IL0A 4WNCA 1QIJA 2PYZA 2OV8A 2W93A 2YFHA 1SQGA 1RXUA 3BFKA 4MGKR 4Q1EA 2ECKA 5IDYA 3I09A 5JCXA 2ZBQA 4MYUA 4OMDA 1UBNA 4WEQA 5HTKA 2F8LA 2AX4A 1TF5A 3GT3A 3LNCA 2ESRA 1U1CA 5DU2A 5KSZA 4AAYA 5MFZA 3NBKA 5EZYA 3TO5A 2FEXA 3A6JA 1XEWY 1MJ5A 1VPDA 2J5RA 2XE4A 4Q4JB 4LJ5A 4IR7A 1GTG1 3ZS8A 3DB1A 4JKIA 2H1LA 4O2AA 5G02A 4CQLB 5TF0A 3CG4A 3RW9A 2HPHA 1OWPA 5DLPA 2NWQA 4YP7A 5TPZD 1PO7A 1Y8AA 2F9FA 4H3VA 2F3TA 1G291 1DG3A 4ZQCB 3T1TA 5FBWB 1U8FO 2ZKLA 3UXYA 3H2IA 4RZIA 3EIHA 5LUAA 2QUIA 2AK3A 2PR7A 1HR0B 4A03A 1PJZA 4L8YA 1LNQA 1SCUB 2E89A 3UMFA 4I1YA 3DOEA 2F17A 3IEPA 3QKRB 2Z6QA 2X8WA 1Q0LA 3ACBA 1CXZA 2QRHA 1EGHA 3SHTA 1M10A 3KSMA 5K51A 1UWLA 2IP2A 3FRIA 3SJUA 4CM9A 5I4IA 5LWQA 3RTBA 1YMVA 2ORWA 4KQGA 3FNBA 3HCPA 1VBFA 1AUOA 2RCNA 5CB4B 4K0RA 5A1TA 3PGMA 3OZIA 3ECCA 3BD7A 3UUFA 1KVUA 3WIOA 3DVQX 1ZJZA 2LRHA 2WAYA 2J5QA 2YOHA 1AZWA 3VC7A 2RHBA 3D7RA 1NW3A 1Q92A 2LIPA 1SXQA 2QRNA 2BEJA 1Z25A 3DOFA 1EWTA 2P9TA 2VJMA 5TPWB 3HXOA 2ZBPA 1DTWB 2KW5A 3L05A 1QHFA 1N36B 3PC7A 4INPA 5C32A 1AOXA 4LN1A 2Z6UA 1N8KA 5LZ2A 3EVCA 1C9EA 4KE7A 3LUAA 2H4HA 1GG8A 5B7GA 3R24A 5ER9A 4O4IF 1XCOA 3FB1A 2MINA 4TMTA 3P9RA 1L4FA 4WBNF 1G63A 3K9NA 4NBRA 2PH3A 1Q3HA 3LWZA 5B58C 3WK9A 1FBTA 1J5XA 2ZCVA 3CNHA 1UCFA 1ZI8A 2H51A 2J3EA 4NMLA 4D79A 2Z6AA 5C37A 2FW6A 4RV4A 4BC1A 5KC8A 4EHHA 3KT8A 5AI4A 2XGJA 3EGEA 3OETA 4AP6A 3U4QB 1YBMA 3ETEA 5C34B 4BLUA 3E53A 2XIQA 1E1LA 2X0RA 3AVQA 3K3PA 1SCUA 3GELA 4ENUA 1XQ6A 3M0EA 3FTNA 2VRBA 3KSDO 3ZYCA 5IDQA 1V1MB 1TZBA 4F4FA 3KHUA 2XLBA 1HEYA 2C2GA 2RGGA 4JYPA 1G3IA 1HYBA 3IAXA 4RKYA 6YASA 1SA0B 1P81A 3H2ZA 5KVAA 2C9BA 2IZ1A 1X13A 1OZ0A 2Z98A 5CB4A 1ES9A 4QBKA 4ANFA 5GV8A 5CD9A 2MWMA 4B17A 4O4HF 2IEYA 2JHPA 4B6SA 3IQGX 4DQVA 4XI9A 4E5DA 1DARA 1LJUA 5NLLA 3UAXA 1YQTA