3OJCA

Crystal structure of a putative asp/glu racemase from yersinia pestis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MKILGLIGGMSWESTIPYYRMINQHVKAQLGGLHSAKIILYSVDFHEIEQLQAKGDWQTAAQLLSNAAISLKHAGAEVIVVCTNTMHKVADDIEAACGLPLLHIADATAVQIKQQGIDKIGLLGTRYTMEQGFYRGRLTEKHGIEVITPDDTDREAVNRIIYEELCLGIISETSRDAYRRVIKKLEAQGVQGIIFGCTEITLLVNAQDASVPVFDTTAIHASAAADYALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Putative aspartate/glutamate racemase
publication title Crystal structure of a putative Asp/Glu Racemase from Yersinia pestis
rcsb
source organism Yersinia pestis
total genus 85
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ojcA01
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ojcA02
5IJWA 5ELLA 2JFVA 5EVCA 3S7ZA 2JFXA 3OJCA 2JFOA 2W4IA 3UHPA 2DGDA 2JFUA 5HQTA 2GZMA 2JFYA 3UHOA 3S81A 1IU9A 2JFWA 3HFRA 5HJ7A 5HRCA 2JFPA 1ZUWA 3ISTA 5ELMA 3UHFA 4B1FA 2ZSKA 2DX7A 2DWUA 2JFNA 2EQ5A 3ISVA 2OHOA 2OHVA 1JFLA 2OHGA 2VVTA 5HRAA 1B74A 3OUTA 2JFZA 2JFQA 1B73A
chains in the Genus database with same CATH superfamily
1PJBA 4BFTA 5MGNA 4F91B 3PB3A 2ISCA 4EY5A 1MVNA 1DDGA 3N2LA 1VMDA 2ZB8A 4Q1CA 4UNNA 3V9AA 3D3WB 4N0QA 2W6MA 2ZJ2A 4RTLA 3LXUX 1G1MA 1XALA 5HMMA 1EFTA 5CB4B 5D3QA 3B78A 1I32A 2HYDA 3PE4A 1P74A 2FPLA 3CJQA 3QGMA 4L27A 4MYSA 2WJ6A 1BGXT 1CHNA 4KOEC 3X0DA 2CHQA 2ERCA 2B61A 2Q0SA 1WVIA 5IPFA 4HZGA 5IM5A 2VNHA 2VHCA 5T67A 2ERYA 3W2EA 4JCOA 2YRXA 1PJLA 2VWGA 2RHJA 3SC3A 4FFMA 2B20A 2MYNA 4B83A 4CKWB 1KSGA 1FDRA 4O4HF 3H65A 3C6BA 3T34A 3L7NA 1CU1A 3ZWNA 4DKXA 1PZEA 3Q0TA 3PDIA 4ZYYA 1RM4A 4KYTA 5K0NA 1DXHA 1FTYA 1V6AA 1XZLA 1U65A 1Y8CA 3TO5A 1JEAA 2YJ6A 1S1CA 4R3WA 4J9VA 4XSHA 3TQQA 1U8UA 2NWQA 1X14A 4FNGA 4RIFA 3VO9A 1E94E 1F0NA 3LL7A 1CQIB 3ZGYA 5B6JA 1EX9A 2GAJA 4YAOA 4BQIA 3GLFE 1XYVA 1KDOA 4XPZA 3VPDA 2Q2WA 3GPCA 2XB6A 4UVGA 1XJCA 4P08A 1JIVA 3TEJA 3V2HA 4EP1A 1Q0LA 2XB8A 4E22A 2WKRA 3P4YA 4IEEA 3ADCA 1R4NB 5KNCD 3WHKA 2EKPA 1C1XA 2G0NA 4DJAA 3G5TA 4ERXA 3MILA 1NV8A 2OORC 3A2NA 4PLZA 5FUWA 4IGEA 5IH7A 3TZLA 2R5WA 1V9SA 1L4EA 2WOOA 4AO6A 2QJRA 2UVQA 4L9AA 4OQYA 2EWWA 2FX3A 4RDIA 1QTRA 2O5VA 4DMUB 1YVPA 3C8DA 1L3IA 3RK1A 1KHTA 3Q9SA 2GUGA 4NDAA 4NV1A 3TG2A 3RVNA 3L0OA 3ONDA 3R5HA 2QN1A 1IWBB 4MTCA 1UC9A 4EPWA 1MVLA 4JOCA 4PIVA 1RPTA 4K88A 4RXTA 2YHUA 1Z7GA 1T10A 2PSEA 4MMYB 5J4LA 2FOIA 4GKJB 4DLRA 1GPUA 3MHTA 4TT3A 3RC7A 3AZOA 4WOJA 1SXJD 5SY4A 4IVRA 4U9IS 5ADUS 2AJDA 1GZDA 1TK2A 3IALA 1XT6A 4Y2SA 1DKMA 2SNIE 4D8YA 4RTOA 1P2GA 4FEEA 1JEQB 4L74A 4R9RA 2J0VA 1VKNA 1UDXA 2D7CA 2HJVA 3KJIA 4HC4A 3AVTA 4TZ6A 4HGZA 3ZIDA 4P8RA 3U3XA 2FCRA 3GEDA 1JSCA 2FSIA 4RPKA 4DG9A 4F4JA 2XRZA 3DFZA 1ZXBA 2YMQA 1T2VA 1EJ2A 2I0FA 3VPFA 1DJLA 2ZXEA 1UZMA 4EO9A 5DGHA 3H5VA 1ZNWA 3EEQA 2I91A 3I32A 1W6UA 1JQKA 1KEVA 1B6RA 1NFFA 2BHNA 1Y63A 3NHBA 3OKCA 4RE5A 5DM60 3DGEC 5EVCA 2OLKA 5A6SB 2QYOA 2FKNA 3SOZA 1GG2A 4BGVA 2JVKA 5AJTA 1TOAA 5BV1A 1WAMA 5FX2A 1C0EA 4AY5A 2PWBA 4MV8A 4ZQGA 3C5WP 1E6KA 2E4VA 1VFPA 4U2KA 5LUBA 4Y9TA 5AI0A 5ICEA 1FJ2A 4F86A 1Z75A 4R68A 5JIBA 4DWJA 2IW1A 3PWZA 4Z4EA 1FNNA 1W5FA 1ZM9A 4WDRA 2XA2A 4E1VA 1F48A 3TYXA 2PQMA 5HX7A 2C2ZA 1CUJA 2J32A 5TQ0B 3HJRA 1J24A 1V39A 1ETHA 2IV3A 4U2CA 5IF3A 1DX6A 2LUOA 2IXFA 2NSLA 4C14A 3K9WA 4LGCA 3GUZA 4YDHB 4BZQA 4GZ3A 1J9ZA 1U0HC 3EDQA 3GT7A 3NAGA 4DLZA 2P91A 3WK9A 3NT2A 521PA 1RAIA 3LNCA 4RMGA 4ZYUA 1UK7A 4HP8A 2Y9MB 2WA2A 3NP7A 4URWR 1MABA 4D45A 4MV4A 3DQZA 3OIDA 3OESA 2DPHA 3V4ZA 2HXYA 1DMSA 3NIBA 3WQSB 3DEFA 2IHKA 4DA0A 1XMIA 4UNSA 5BSGA 4X65B 1WZ2A 5C18A 4BO0A 1LPNA 1XLTC 2MSEB 4PPNA 3B52X 4H08A 5AFSA 3CUSA 4IIDA 1JQDA 3KR2A 4X3OA 2QMHA 4N03A 1TIKA 1EFVA 1MUUA 4QWMA 2W0SA 4AZSA 3MLBA 3LT5A 4KVFA 3RT1A 1IHYA 3S40A 1WETA 1QVAA 2Z1MA 4ZT3A 4AF8A 1LFAA 3SEFA 5M3BA 2P8JA 3GOQA 4F2DA 4M0DA 5FOVA 4WT7A 5CT8A 5BUCA 5ALIA 3BMCB 1P7ZA 1UBFA 3I76A 5JEEA 1N1EA 3QA9A 3L7MA 1SWWA 1QAOA 2Z58A 3HB7A 2Z2XA 3ITNA 3ITKA 3IBCA 1QGOA 3FB1A 5JY6A 2FW1A 2O2XA 3UO8B 4C0XA 3QE0A 4C7KA 3TSOA 5JSKA 2HPVA 3JZIA 1E9SA 5FRDA 4I4CA 4DNQA 4GI1A 4CEIA 3ZGOA 1DIGA 1PFUA 1MQAA 2YWHA 2REQA 1VPLA 1RW4A 2ODBA 4GRAA 1DWUA 2FWIA 4YFVA 4O5OA 4YHBA 2DB3A 4UFPA 5IK2A 1TU3A 3I05A 5T4FA 4M89A 2B21A 2WD9A 3FWKA 3KFVA 4UNRA 4TVOA 1PNQA 5KWJA 2P5YA 2Y2VA 3LYLA 5K01A 1SQGA 3T3OA 1L3CA 5BVHB 1JHQA 5EMKA 3UA4A 3Q2IA 4B44A 4C05A 4UZEA 2WB2A 4XYEA 5FL7A 5JXIA 1Z12A 2NSJA 3UMYA 2HCJB 3VX3A 2HU2A 4RA9A 3W5CA 1NE2A 3AOEA 1OU0A 4Q47A 4MYHA 2BM0A 4I8XA 4K2AA 3LUDA 4L4SA 1QRDA 1J0XO 3AR3A 4R2JA 2O1XA 4ARZB 4BTEA 2V4UA 2JI6A 5EKXA 5IJXA 5AKKA 2NUBA 4YDSA 2HWYA 2PL9A 2D2VA 2FZWA 1EFKA 1CRWG 3TFWA 4CL8A 3RQSA 4AU1A 3DB2A 1GL9B 5CW2A 2XGSA 2RB5A 3FLAA 1AA6A 4KFTA 1CZHA 2BKEA 2IXEA 2EGGA 1MB2A 5KNDD 5ITVA 2WM3A 1HFJA 1LQUA 2XMBA 3FPSA 2GZ2A 3GC6A 4IM7A 2O8DB 1XP8A 5FTJA 1L5WA 2C9MA 3ZJYA 3E1SA 3N2EA 4D82A 3L77A 1RD4A 4P2GA 5EZYB 4BJ6A 4CM9A 4CXMA 3STWA 4F8EA 5AW5A 1IVYA 1Y80A 2JAXA 2OFWA 4BFCA 5KNCH 2KW5A 1QE3A 3GGGA 3IEXA 1KZ9A 1MRNA 1A97A 1K7XB 3B82A 1PUXA 3VU1A 1JP7A 5IC5A 1GJRA 5IDYA 2NU8A 3U81A 1S4QA 3WWZA 1TKBA 2AR0A 3G0BA 5GTDA 1DTSA 1RYDA 2C5LA 4DIBA 1JBEA 4P81A 3MZ0A 1Q22A 4BQFA 4XVUA 1N7GA 3T3EA 5I45A 1C8KA 4EX7A 4MS4A 1NU6A 2B2XA 1SCDA 4LVCA 1V3TA 3I64A 4BNLA 5BURA 1C0IA 1X9IA 1KMNA 2W2NA 4M49A 1KY4A 2OD2A 4AM8A 2J9YB 5HGXA 3L8GA 2ZYTX 2J6HA 3RU2A 3LXXA 4DPLA 2YBDA 1FS5A 1AU9A 2GJAA 4MCAA 1JAYA 2AC7A 1JTEA 3C3KA 5JSFA 1CEXA 1DKRA 1U31A 1X1AA 1IE3A 1DBQA 2Q4BA 5AM4A 3Q12A 2KMLA 3GNSA 3Q5DA 5CVJA 1C7EA 5E4FA 4AMZA 3F2VA 2WPNA 1RAEA 3GP3A 2WT9A 3QSGA 3NDBB 3RE1A 2J6IA 3E61A 4NAVA 3NM5A 5LB4A 3ASVA 3U2QA 1FDVA 3PQEA 3B6JA 4MWDA 2QTVB 2ZBGA 3CTMA 4FNMA 3KUXA 1O95A 1PZFA 4MS3B 2WNSA 1YHZA 2CE7A 3INNA 4OATA 4HZUA 3SBEA 1XZFA 3PUVA 4UVEA 4BLOA 3AP2A 2A0WA 5F1KA 3JASA 2QM7A 2ZAYA 1DBWA 3KQMA 4OGGA 1IXKA 2CW5A 5CMLA 4KV9A 3TQOA 3T9FA 2VUTA 3D64A 3FBWA 4M8SA 1GPWB 2DF8A 4X63A 2KB0A 2C83A 3VOTA 2NYVA 1R37A 2PBLA 3IAM6 2WM8A 4FDAA 1JW9B 1QHYA 4KFRA 4EGJA 2O48X 2HK9A 3TNFA 5JS1A 1GGJA 1H6AA 2VSOA 1X8XA 2FQYA 2PANA 1NNUA 1JYSA 4MV9A 1Y5RA 2M6KA 2WJ4A 1Q92A 3D54D 5DX1A 4C7OA 1T5LA 2PZJA 3O93A 4Q05A 1YS1X 2WJGA 1PX0A 1O94A 2IYPA 2UZ0A 8ABPA 2YMMA 2WAYA 3O2JA 1Y8AA 5FNZA 1FUIA 3JW8A 5AUNB 5KKAA 3G13A 4XX0B 3GFGA 4YUXA 2BZ1A 5ESWA 3H8VA 4RK6A 2I6QA 4M9UA 4YJHB 4EGSA 1SK9A 1YA4A 3QRWA 1FW6A 1XPJA 8AT1A 4NESA 4YCAA 2JEZA 3ZWOA 4NCBA 3UK2A 1E1KA 1VBMA 1XCBA 4JBGA 3GCDA 3G3EA 3P9IA 4B0PA 5CFRA 1M5RA 4PAWA 5SZIA 121PA 4XD2A 4JDUA 3PEWA 1UK6A 2VYQA 3BE4A 5BOVA 5IT9A 1J00A 1ZJWA 1OXBB 1TO2E 3JQAA 2JC3A 1Z08A 2V6FA 1UMDA 1E2IA 2RHCA 3IKMB 2X2FA 1KE2A 4ZKDA 1LPMA 1P18A 1X7ZA 2LGJA 3LECA 4JJAA 3LP5A 3LC0A 5DU2A 1AHPA 1J23A 1II9A 3VH4A 1MAUA 2EIXA 2C58A 4ZALA 2GEKA 1DG3A 2F3QA 4ARSA 5IFKA 3OQPA 2DVMA 1KZ6A 3ZYZA 4EELA 2O4UX 1NXTA 5DASA 4JBWA 3SZRA 1OLUA 2CZGA 2HUPA 1CERA 4RX1A 3VYTB 3M6FA 1U02A 4WZBA 4ZKEA 4JLNA 1OWNA 3A6KA 1CK4A 3Q72A 1JFLA 3N8DA 3IELA 3WGZA 3I9MA 3C5VA 1E3WB 1IPFA 4DCMA 1XBTA 5GJBA 1EVKA 1G63A 1N6LA 1UM8A 4OMUA 4R54A 5DBOA 2FR8A 4ZQHA 3W8RA 2B83A 1JQ5A 5DTEA 2Q0QA 3TGPA 5HZKA 2K7FA 2W8BB 4RAOA 4RPJA 1RPZA 1VJDA 2JD0A 3EGDA 4E2WA 2BFMA 2VDJA 3TJRA 5L95A 4NH4A 1A5SB 1CS0A 2FUEA 1WZIA 2IYTA 3REGA 5HS4A 1S2IA 4OQXA 4TL9A 1KYQA 1F5NA 4L57A 1HZZA 1BEEA 2ZE5A 4NJEA 3OE5A 3E58A 3HMQA 3V8VA 3HG7A 4NBRA 5JYBA 3AMVA 3IUYA 3AVUA 2ZRKA 4RWEA 1SVMA 2BGWA 1W1IA 3UT5B 4LMAA 4NE2A 3IYLW 5J23A 2PBRA 1T2NA 4I6EA 1NBWB 2C9DA 2X42A 1ZIDA 1T3TA 3KJGA 4JXZA 4YJFB 3GG2A 4FSXA 1GRCA 1C0KA 1WCYA 1ADJA 5G40A 4KMSA 3UMSA 2Z6QA 2QEQA 4URYR 2P30A 2Q1TA 1WVMA 4IIJB 5JZSA 1U9IC 3EZNA 1SBTA 5JD6A 1LD3A 1VE6A 3KYDA 4AN0A 3Q6MA 4BEVA 1WPXA 1GPAA 2C3UA 1YE8A 5BN1A 5CA1F 1GNSA 3PCTA 2ZJ7A 5JPIA 4KRXA 3TD6A 4YCLA 4D97A 3T12A 4PLGA 1W1UA 2G70A 5KNDH 2GF9A 3B70A 4OQQA 2WNHA 2O8FB 2OPBA 4WHMA 4ZVKA 4EFKA 1T3GA 2JLXA 2XXAA 2VDRB 2Q4DA 3WWDA 1U3VA 3F1LA 3U3MA 2DTXA 4BE9A 4N18A 1II8B 3C6MA 3K7EA 1Z5WA 5BSEA 2JGNA 3I34X 4NBKA 1HEYA 2G83A 1ZK0A 5A05A 5C9ZA 5HW0A 1XXHB 3PUHA 3WLHA 4JYBA 2A9QA 3OOHA 5CVDA 5KPJA 2IGBA 1FUUA 2IK8A 3JWEA 3LQKA 3LUJA 3GLGB 4ZHSA 1MMFB 3T7JA 1UXOA 3IOBA 1YZQA 2CNDA 4I08A 4Z99A 4B82A 3C45A 2FMUA 1YACA 2Q27A 2WDZA 3NZEA 4Z9YA 4I1YA 3SKVA 1X8LA 3U4DA 5ISMA 3NCTA 3WAJA 2P4UA 3FGPA 3IXLA 3IHTA 3ZJ5A 2IYRA 4C22A 3MUOA 5KSWB 1T43A 2SKDA 1A4RA 5IVHA 2BMJA 1JF8A 4QGSA 5AKXA 2PDAA 1Z25A 1KVQA 4OBBA 1P7VA 3LDAA 4NG4A 1LDMA 3ZDBA 1IQPA 4GPZA 2MOKA 2ZRCA 2WILA 1VRWA 1XDUA 2GCGA 2X1HA 1DWQA 2XTJA 2QM0A 3GIDA 2JEOA 3KYBA 3PD0A 4P9NA 2YMLA 4Q7JB 1B6SA 4CCYA 1KY3A 2XKJE 1P39A 1NSYA 2NZ8A 3PJEA 4AUKA 3C7CB 2WZBA 2W83A 3AESA 3JQ8B 3JD3A 1S3SA 4X1IA 3V46A 3VDMA 3UK1A 4B87A 2H11A 3IAEA 1I0LA 4P7KA 4QDTA 3U13A 1QPGA 4PFQA 1I5EA 1ND5A 3MWEB 3NJ4A 1XVIA 3TNYA 1FNSA 2BKXA 3AFNA 3AIKA 3NEPX 4CMEC 1L4GA 1K4YA 1V7ZA 3KD3A 3EWAA 1XTPA 2ZCUA 3L82B 4FYYA 4O2AA 5GQSA 3UOGA 2DFVA 3OX3A 4AO7A 5K03A 2JIOA 5JNWA 3QU5A 3PG5A 1SPBS 1W19A 2CL6X 2XBLA 3BOSA 4E4YA 3WGGA 4L28A 2HX1A 3GJ8A 3H5OA 2TSYB 4YBZA 2LBPA 3WQQA 2PA3A 4IDCA 5ILOA 5JJLA 3W2TA 2WHPA 3PK0A 4LVUA 1IN6A 1JDSA 3UFXA 2AQ8A 1KBOA 1Y98A 1FYWA 2VHXA 2ZSFA 4GXNA 5A4DA 2FEPA 3EEFA 5BSRA 1XEFA 3NVDA 4QTZA 4AXXA 3BL8A 2EQ5A 2GXUA 2Z30A 3PPIA 2Z95A 2L0XA 4HQOA 3VPXA 4BUCA 1WQ3A 3E7DA 2AWNA 4DLBA 5J2UF 1DJNA 1EVLA 1YU9A 2E48A 4K3UA 1ZJJA 1Z5NA 2QRVB 5JLJA 3QOWA 1GL7A 2DFDA 1GV0A 4ISCA 2CV1A 3IULA 2C3PA 2B8NA 2J8ZA 4F5EA 4MDYA 2CHFA 4RY8A 5A4AA 4DLAA 1NW6A 5JVDA 3LQQA 1QHGA 2GJSA 3CE6A 4MUEA 4Q4AA 3OX4A 5JBNA 4XJTA 4RFVA 3FCAA 3NKLA 3SYRA 1H2HA 5FBHA 2H7XA 1Z0ZA 4HLDA 4I1PA 3AWDA 2DY1A 9MHTA 2BFBA 4ZI7B 2R5NA 4BOYA 2X23A 3P9PA 5JECA 2HRDA 5BUQA 2OM2A 5AVZA 4MQMA 1I2ZA 4P22A 1NBAA 1KJIA 2P0YA 2HQBA 2IYQA 1UJNA 3N2GB 3HTXA 2WWWA 2ZBRA 2JI7A 4C1BA 1UWVA 4BQNA 2BJVA 3TJMA 4X20B 3C48A 4FOTA 3I0NA 5F4BA 1KOLA 2ZBPA 3GFPA 3OPMA 1S8OA 4WCFA 1UR5A 3I09A 1YV9A 4ILEA 4OBEA 1NPTO 2IYEA 2C2MA 4GVXA 4P3XA 4L7QA 1N6IA 1BS1A 3KR1A 2RK4A 2BKVA 2GD2A 4X44A 4XTCS 4YJGA 4A3SA 4DCUA 1ZMRA 1AC5A 1E8DA 2O7NA 3P97A 1EUDA 2GM4A 1NXVA 4IRUB 4DMGA 5B12A 2APJA 5BN3A 5U4XA 4J16A 3PLNA 2GDJA 2QTTA 3HDTA 2QKYA 1GCAA 4YJ3F 5ICFA 4LS3A 3I42A 3TPZA 5LPNA 3GEIA 1CP3A 4I50A 4ZQFA 3WLIA 2PV0A 1JV2B 1GCOA 5JC1A 5IKEA 4L5IA 3VHRA 4MV3A 5LJIA 1R6UA 3A6JA 1GSAA 2IXDA 5L51A 1O6CA 3SM9A 4C08A 5B64A 3DLCA 1RVV1 1TNDA 3LUFA 4NJOA 4X91A 4XIIA 3DBRA 1GPYA 4OXXA 5E0KB 3R6LA 1KKLA 1GEGA 2N42A 1ORVA 1EIZA 1TQ4A 4WLEA 4X85A 3VXKA 4KXMA 1YFZA 3QG1A 3LHDA 3O38A 5JEDA 5EWLB 4MQ6A 4QDJA 3UMFA 4ARVA 3BWMA 4YUAA 4U7FA 4BY9E 3WR5A 1M2OA 3QENA 4B3TB 1MV5A 2A4MA 2R6AA 1UC4B 2O5CA 1LW6E 2OILA 3DEYX 3GRKA 4C7MA 5KTRA 4JI8B 1T4CA 4HQNA 3T8YA 5J5AA 3L01A 2C03A 3FBTA 1QE5A 3KC2A 4P34A 4Q12A 3IKTA 3G0CA 5CYFA 3EW7A 1I7PA 3M6WA 1QV9A 3QTBA 4EG8A 5FFNA 5LQNA 5LWHA 4KE9A 1HBJA 3GWZA 1ZR2A 1FPQA 4WESB 4MUFA 3OOJA 4JP2A 2D8AA 5DHSA 4GL2A 1D03A 3BTUA 4EUHA 1H42A 1PV1A 1YK1A 3JCZA 4P84A 3OZIA 3KVYA 1YQXA 1L8XA 3VSEA 4XRRA 4RK7A 4CUKA 2F1HA 4V0OA 1L8QA 2ZM5A 1JHXA 6NULA 3KETA 1ISMA 4CEHB 1R0SA 4S0XA 3V32A 1FFSA 3ZE7A 3QEMA 4WXRA 4PEVA 4KL8S 3EXAA 3Q5GA 4M7RA 1EEHA 3OECA 3SJ7A 3TMAA 1DTEA 421PA 2W0MA 1V8OA 3E1KA 3WZ2A 4J4BA 3NXKA 3CRNA 4UBOA 3V42A 3SR0A 2C98A 3E2IA 4HAUA 4FKBA 1P45A 1QIKA 4CMAA 1ZCBA 2GT1A 2DHQA 3OU7A 3L8DA 4Q9HA 4Y1FA 4DMLA 2EZ9A 5C7LO 1XDBA 4PF1A 1V6CA 2I4IA 4JUFA 1N2OA 2J5QA 5DZSA 1PU2A 1Y9AA 4JLJA 3S3TA 4BKMA 2EX4A 2XMSA 2JKYA 2F1RA 1HUQA 1OYYA 2GLTA 4G9BA 4PFJA 4JI0B 5TDHA 2QJTA 4C7BA 2RHDA 4KHZA 3SEAA 3QXSA 4MS1A 3FPGA 2PZEA 2PRKA 5EQDA 1XLWA 3UWKA 3ZJTA 4RO0A 4Y7CA 3MG9A 1XQWA 4GFDA 1SC1A 4DCCA 1ZPDA 5F9HA 1FXWF 3I37X 1G42A 2VP9A 1QHXA 4ETNA 4M9RA 3QW4B 1HETA 1UJMA 3D5QA 3EQ7A 3FCOA 3LX5A 3BDIA 3NGXA 3P2OA 3R6DA 4P7JA 5TMBA 3ZV3A 4CF6A 4C3ZA 3WGKA 2B5WA 2JAUA 3H9GA 4BLQA 2CXSA 1OZHA 3HABA 5FBWB 1IY1A 2RHWA 5EJ2A 3VJRA 5FP0A 1R8JA 3QYFA 4PNPA 1W85A 3DVRX 1G0OA 1LSSA 2ZRQA 1F3OA 2A1TS 3AI1A 1ZINA 2IIVA 2ZS8A 5DBGA 4LZAA 4H0NA 5TQ2A 4TRRA 3GYGA 1R3DA 1VB5A 1TKCA 4AX4A 1P2FA 2I2CA 3DW3X 2G7ZA 5LXTB 4D79A 2ODPA 5HXAA 2FPRA 3JATB 4CMGA 3I5AA 2JGFA 1FSFA 4U3JB 2RC6A 3GLKA 4PG7A 1Y34E 3N2KB 2RHMA 3QVGB 2OXRA 5FA8A 5FWAA 2BKAA 5LYYA 2CGEA 2I55A 2O19A 1W581 1QPZA 4IEFB 1EJ0A 1M0SA 2H2WA 3DULA 2P0AA 1EHCA 1R74A 1P8JA 1T9AA 2B36A 3CH4B 3EN0A 3O4HA 1J2YA 2OLEA 3IHKA 2V5UA 3Q88A 5C37A 2OGWA 3BSYA 4HRYA 2QP9X 3X2EA 1DXOA 4MUNA 1AN0A 3GAZA 2AL7A 2ZBEA 3K9GA 4YJDA 5C46F 2BI7A 5HK9A 3GPLA 3ORRA 5A0VA 3KS9A 2PUHA 3KDSE 3T7AA 4NQZA 2J9XB 4ZYZA 4CN9A 1W29A 1O5IA 1JSRA 3AG6A 4M99A 3G9XA 5F2EA 3G8YA 5FO1A 5IJWA 3DPIA 5JYCA 1TRHA 2C3YA 3SKXA 5HOQA 5DYWA 1KMQA 2XE7A 3B2NA 1R4MA 1HI9A 1RQGA 1G38A 2QE7A 2HREA 1YZFA 4QELA 5FFFA 5U1PA 4A7PA 4E2FA 2VK1A 2J87A 3AK4A 3B6ZA 4IQFA 1QVVA 4BWVA 4D0RA 2XA9A 3SVLA 4HAVA 2OKCA 3EPJA 2CNNA 3ANNA 1PK8A 4RD0A 2B9VA 2ZBQA 1E8MA 2J9GA 3BIXA 1N5JA 2VR1A 4LHEA 3DE4X 1ECJA 4MGEA 4JHLA 2XT6A 4D3DA 2WYOA 4BXOA 1J1IA 1D4OA 4TWAA 2P6MA 4TKLA 1I4OA 1BN6A 4Z8YA 4G0UA 1UMCA 1DCFA 4FOLA 2AT1A 3N74A 4N7JA 1J2RA 1JVNA 3CRW1 4FSHA 3SHTA 2JKVA 2VRWA 1KVTA 3D1JA 3MPOA 4MVJF 2VDWA 3A10A 3M2PA 2IELA 4TUYF 4LOAA 3LM8A 4Y9DA 5DDIP 2B4KA 4N1AA 2UXBB 4FOSA 1V6SA 2Q6OA 4W8HA 5EIOA 1E1QD 3PNYA 3GOHA 3MTEA 1R0YA 3FZNA 3O4JA 5DM0A 2CUKA 2J0UA 3BXZA 4ZJPA 3G8BA 2IZ7A 3MBOA 2JH3A 4AKHA 1VRCA 5AI9A 4UJ5A 1FBTA 3WKEA 4NIMA 3IDFA 1EXNA 3P45A 3TE7A 4D1YA 1NR7A 3LBNA 2A5YB 1L4UA 3IAFA 3FA2A 2QW0X 1SVKA 4IW3B 5DTJA 1TM3E 5HBRA 1K4KA 1UP7A 5AHXA 3COYA 4XH9B 3AUUA 4PSAA 4KW7A 2P1DA 5K9ZA 2WP8J 3N86A 1NLUA 1MFPA 3ND6A 1XNJA 3EVBA 2I8LA 4AWBA 4B6GA 4ZYWA 2HF8A 3BJEA 2GPWA 3S7TA 4FC6A 1Y8QA 3THWA 1JA9A 1CJMA 3P4XA 2VSYA 5FV4A 4HDOB 1QCZA 1D2EA 2HF2A 4AJ4A 1L6IA 1WOYA 3NX4A 4OGWA 4BN4A 721PA 1K88A 1Z6QA 1GITA 3RJZA 3VOSA 2P3LA 3PNOA 1SULA 3ISJA 2PR2A 1VP3A 5EQTA 2AWOA 1XF9A 3VHXB 4GLOA 4TTRA 4EATA 4ZOAA 2C2OA 4GE0A 2CMKA 4RACA 2LV8A 2ZU6A 5BYAA 4EKGA 1FNMA 3EXG2 2IP2A 3C4VA 3GNTA 1AD2A 3RHSA 1PJTA 5AR1A 1LI7A 5SYNA 4O4LB 5BWOA 2G9UA 5FUMA 4MSUA 3O8DA 5EXXA 4DM4A 5JNLA 5JS6A 2YASA 1ZN7A 3WLNA 1SM4A 2I2FA 1RPAA 2RG1A 1FMJA 1TJYA 1VC2A 2QSZA 3R3ZA 4RH3A 2K4MA 3ETLA 1NZDA 5CCXA 1PL8A 3GUUA 2ZSHA 3FPEA 3IIEA 3KE8A 5E4YA 1OHHD 4YDQA 4CEJB 2BC9A 4KPYA 2Z3WA 4PS0A 1V41E 4YT4A 1FP1D 1RIFA 1KO8A 2H2AA 2VNIA 3LCVB 1E2UA 3LDFA 4ESHA 2ADMA 1Z2PX 2J7KA 1JDVA 2ZRBA 3AKCA 4MNTA 2WYVA 4NONA 4BP9A 4YQZA 2GHRA 4ND4A 4D25A 4FGJA 3RS5A 5CD9A 4A0HA 3IMGA 4OQEA 4YAEA 5E8JA 4FMDB 3BXPA 2ZKLA 1EX7A 4KACA 2JARA 3QX9A 1E2PA 2HADA 5E7JA 3ZYCA 1FMLA 3K9HA 3UV7A 3DCNA 4JC4A 5EEHA 5EYPA 2H1LA 3PIIA 5EESA 5IUKC 4E6EA 5K20A 3BHNA 2EATA 5TLSA 3SYTA 5GPBA 1OT3A 5IXJA 1JIUA 3BB4A 4HDMB 4P3NA 3UKJA 4Q4JA 1T36A 2XXJA 5JWOA 5KYXA 3NDIA 4XVQA 1YB5A 1EZ1A 4K05A 3AF5A 4V0SA 3H3FA 1NVMB 3GLIA 4YAFA 1X7XA 2BBSA 1MD9A 1RAFA 4PCVA 5CFNA 3KZXA 4I5EA 1RADA 5EKUA 1RPNA 2IVZA 4JJZA 3HJGA 2EHDA 1QO7A 1E64A 2FA9A 2BI4A 3B3FA 4HEA6 4IV5A 5HKAA 2DAPA 2QAGC 4PG4A 1J90A 3V8QA 4LHYA 2W2TA 4PTYA 1NI3A 3B12A 5FWNA 2WTMA 3BWEA 4PHCA 1PL6A 3VC2A 2ZDHA 2ZIXA 3MTBA 3MCTA 4R0NA 5PGMA 2V65A 4EIWA 4W63A 3HGTA 4D9JA 1M2VB 4US0R 3PT9A 4CIWA 1Z6GA 1C4KA 1J33A 3A14A 3QUSA 1VSVA 3QNWA 4HD8A 1SKBA 3FF4A 2QTFA 3HSKA 3BIJA 1IUPA 3WDMA 1ZMTA 4D8UA 2GK3A 1Y5IA 3TCXB 1PK9A 3SEZA 3ZG6A 5AM0A 3C24A 4XWOA 3WK7A 1XSEA 1LSUA 5JCXA 5K6TA 1KEWA 3GFOA 2PRIA 2X5KO 2UXDB 1X77A 5ENDA 1JNXX 1USKA 3BCUA 1QFZA 2MU1A 2QT0A 3AL3A 3LWBA 3OPYI 2FMXA 1YDGA 2IBMA 1M76A 1PR0A 1U8YA 2XX3A 4RVFA 1O58A 1OXMA 2EBUA 2YFYA 3SIWA 2Z08A 3BZUA 1N1MA 1XRSB 2QYTA 4PX9A 4UUPA 3A3NA 3CSSA 5FOXA 4MKZA 4JI3B 1L9XA 4NZNA 1JHVA 4DYHA 4XGIA 4BX8A 1CQJB 4DCTA 1GDTA 3DMFA 2CJWA 4M1TA 4WZBE 3F2IA 3Q3CA 4M8LA 1CG6A 5CP8A 5JQGA 3VH3A 4KN8A 1GFWA 2ILTA 2O0KA 1T2CA 1COWD 3H4IA 3EIOA 3QXGA 2JBHA 2DPXA 5FPQA 4IIYA 3TTSA 5ICMA 3P0RA 5JCJA 3EXFA 4G1VA 3TUIC 4JBHA 1SUCA 2VJLA 5L7TA 4OQMA 4D0NA 4UTOA 1QRAA 2PT9A 4JSYA 1JQBA 1T8TA 2J5KA 3UY4A 3LWNA 3NIWA 1RRCA 1SFRA 3E0XA 4RKQA 3V8RA 3TLGB 3PC8C 5DHAA 5GM1A 5H81A 1DJPA 3N07A 4G3XA 3GRYA 1IEXA 1G7SA 3AB3A 3IUMA 5IHXA 4KODA 4L51A 2RH5A 5EZ6B 4KAAA 3FR8A 5CH8A 1IK6A 3RD5A 1DX4A 2IXAA 3TLAA 4KR6A 2ECOA 3IQGX 4GXQA 1LCIA 3K2IA 1CF4A 5KBYA 4DNOA 5KHOC 2GN9A 9LDBA 5BPFA 5E95A 5E3HA 3HB5X 5ADVA 4FILA 5EIBC 2BGIA 3LX6A 3AG5A 5ICSA 3OO0A 4H35A 1JZSA 1H2YA 3IEPA 5FPYA 2V9ZA 4BZPA 3HGMA 1Y1SA 4NR0A 1XNHA 5D87A 3AEQB 1FNDA 2QPAA 1D2CA 2QN8A 4YXFA 2HCRA 3UMGA 4JL8A 5A0FA 1S0UA 1NR1A 2PK3A 2EDCA 4I1RA 4EEKA 2D4HA 1A9RA 1J7JA 2D5BA 2DRIA 2JAOA 3D7LA 2GD6A 3UAYA 1L9KA 3E9MA 3I9KA 3DB1A 2JLWA 5DHPA 1VGQA 4EYGA 3IMEA 1OB5A 5LQCA 1T6NA 3BA1A 3EVTA 4LWPA 1UJ4A 1N7HA 4MDHA 3BA6A 4FW9A 2ZRAA 1FDSA 4QUIA 3OUTA 3RYFB 5TMPA 1X1RA 3QYAA 1Z5GA 1AO0A 3LBHA 1HDXA 5A7GA 3S70A 3U3JA 2Q9UA 1FJXA 3UATA 2WUEA 2GBFA 5LM3A 4LPKA 1NP7A 3QFRA 3T3MB 3UHPA 4AZ3B 4BNJA 1KI3A 4NRDA 1DG9A 3J7TA 4QDOA 5EIXA 2WJVA 3GQVA 3ETCA 2VHEA 1RXSA 1ULUA 1UFRA 2R4QA 3CVOA 3KLBA 3QFSA 4IUCS 1M8GA 2WD8A 2IHVA 3A2MA 4KXQA 4U0JA 4RCVA 1TUIA 1U8XX 5KX5F 3EX7C 2P3SA 2C4NA 3GRVA 1J4AA 1S6YA 5FLYA 2GD0A 3T1QA 5BSWA 1YZGA 2KPOA 3GJSA 1IHPA 1QGED 4TXMA 3Q87B 2O5RA 1TIPA 4YONB 4Z3OA 2NV2B 4OYLA 4KVAA 1EVIA 1U3DA 1FYDA 1PTKA 2AFHB 2KM1A 5GP1A 1XRLA 1IM2A 5HNKA 1F0YA 3LD9A 3V4RA 4HUQA 5JAQA 5I7FA 4PZAA 1G8SA 4AG3A 3T5CA 2RK6A 3M4JA 4EG6A 3VHLB 1PEAA 3N8KA 4BCBA 3HDGA 3K8YA 4KXFB 4OJMX 3FTCA 1H65A 4G5YA 1K66A 4KFUA 4HAZA 4MJ7A 4GMFA 2A88A 4RLQA 4FC7A 3IDQA 3RS8A 1XZMA 2Y66A 1OW3B 1X8KA 2UXCB 4XEHA 2CUZA 1XKLA 2BVNA 2GPAA 4C4ZA 4JQOA 4TS1A 4KQHA 3ZBTA 2ZPAA 1A77A 3RSCA 3AVXA 4LDAA 5B7PA 5EINA 4DUZB 1HDRA 3K1YA 4XGQA 4TS9A 2O2EA 4MQ5A 4YCCA 1RQ7A 4GYYA 3WAGA 1M8KA 1C8BA 3ESZA 3R0IA 2F48A 2JLSA 1LWOA 4V0QA 2FDCA 2HJRA 2GEDA 2PSHA 3DTVA 2AUNA 1LY1A 4IV8A 1XRMA 4GOND 4QXOA 4W6QA 5SV2A 1V35A 1W9MA 2CZCA 4BPBA 3E0QA 1KQFA 3RAFC 1SBZA 1PAUA 4PCLA 3UJBA 5MFZA 3NTLA 4GXRA 3ZDFA 3PFWO 1ZK1A 3U4IA 4YQYA 1E6EA 3BL6A 3NASA 4WCDA 3X2FA 4RCYA 2GFIA 4JDPA 2ZPUA 2JGDB 3H1BA 2OFXA 3TW6A 2P6RA 3CLSC 4IZOA 1EWTA 3PRKE 1E58A 2D62A 1L5OA 1T8RA 3NALA 2J7PA 5D00A 2H51A 2XEXA 3QEKA 5CM8B 2X9VA 4CRWB 5JASA 4J49A 4Q16A 1EVJA 2BRUC 3LBIA 4O2BA 1GEEA 2FOXA 1Z18A 2ZI3A 3LSYA 4MV1A 5DB4A 5CM9C 5DRTA 4HF7A 1YDEA 4Q9DA 3RFUA 4G0PA 1N57A 3ESYA 1B4DA 2OV2A 3DZGA 5EXSA 2MSLA 3AIMA 3R74A 1JYEA 4IO0A 3MJTA 4G2NA 3CQ9A 1YB2A 3ON5A 2PL5A 1M6WA 3VR5A 3CLKA 3K9NA 1SY7A 1TVMA 4F1JA 4UNQA 4MZXA 2QRLA 4AIRA 1Y3CE 2C31A 5BNZA 1GUAA 2FFHA 4PO9A 1M75A 3NIFB 4R3UC 3IIJA 2ZKIA 3EJWA 3K0FA 2CC2A 5KYKA 1JEYA 3DHEA 4XWGA 4PE5B 5CTJA 5ALNA 4YGYA 6YASA 5BMVF 3DAYA 3RJMA 4UVHA 4Q48A 4I3GA 2B4QA 5EP4A 3NYRA 4GX0A 4IAOA 3WOHA 4AD8A 5KYYA 3TDNA 2VBFA 3EVCA 4AP5A 3HXQA 1GU1A 2NP6A 1LU9A 3E9NA 1NATA 2Y0BA 2JGJA 5HMLA 4RTJA 3OPYA 2GCOB 4FFBB 4B2IA 2GXQA 1ISIA 3GZ4A 1FTSA 3GLUA 4H77A 3AB7A 2HTEA 1DOAA 1DCTA 3PNKA 4N12A 1W76A 1WIWA 4EHLA 3UMVA 2IS2A 4RK5A 2JFNA 4IV0A 3M6VA 1EBFA 2COUA 1XQXA 1QIEA 1H0RA 2JLBA 1JDZA 3KVRA 5DBFA 3GJRA 4GKKB 4CMJA 1XDWA 2GVNA 4URFA 2FE4A 1KFEB 1PJ4A 2FW6A 3GX1A 2VYFA 5GONF 3TZHA 1JHAA 1DFIA 5BR8B 5G53C 4IG9A 3FPKA 4HXFB 4OYRA 3OZDA 1CZNA 2B2NA 2OAQ1 3DVQX 4NZMA 3CONA 5HHTA 3K1AA 4JKYA 4O25A 4OHRA 3K0BA 2IF0A 4NH0A 3PXCX 3IDSA 5B3JA 3WICA 4ASUA 2XVMA 2HM7A 2P7IA 1XZJA 3I9FA 3QK7A 3A70A 2HSEA 2H0AA 1UJ5A 4IIUA 2FEKA 5DXAA 3WZLA 1UXHA 4CG3A 1E89A 4I1OA 4FMBB 3ZDDA 2B4RO 4QOHA 2OCBA 3BWYA 2ZS7A 3HJNA 3S44A 3PPVA 3WGQA 4F8YA 1QCDA 3RSOA 7REQB 2LCFA 2CDAA 5HG0A 1CY2A 2IEBA 3NBUA 1CYEA 3DBVO 1FQJA 3FUTA 3OQIB 3LT4A 5KTKA 2AG0A 2FPXA 3KT8A 5GMOA 4G5HA 4QQ8A 5E8RA 4ZC8A 1KI6A 1GG9A 1U1DA 5CLGA 2NUPA 2WD7B 1OF1A 4C0JA 1F38A 2IY8A 5HILA 4I4TA 4NYMR 4WBSA 3KSDO 4UBLA 3SJUA 1OI4A 4FDTA 1MO4A 4Z7OB 5JNTA 2ET6A 2HKIA 3KV3O 3NHYA 5AJYA 1I4DD 3DXFA 3PA8A 4EO7A 1O1YA 4ZIRB 1J49A 4EG7A 1I3NA 2OAP1 4B1FA 1TECE 4ABYA 4DQ0A 1BHQ1 4J1SA 4WNIA 3JWHA 4MRVA 4P4SB 3ZGZA 4E30A 1KA9H 3AW8A 1H2EA 2OCYC 1RJDA 2HSDA 2PAFA 3PC7A 3ELYA 5TRTA 2HDWA 1HRKA 5KVSA 3HXMA 2R1TB 5DRYA 3RRYA 2X14A 5A9RA 3KQNA 2JS7A 2Q07A 2OEPA 1F51E 3CUKA 1LBEA 4K0RA 3AY3A 2X0FA 1B42A 1PW7A 3IHLA 3DEZA 4WZ6A 5DMHA 4BO1A 1OB2A 3LXMA 4UUMA 4NE7A 3S8EA 3EBOA 1JQLB 1I2AA 2CL5A 2WKQA 3NRBA 4LQCA 1R1DA 4AFNA 3BFVA 1MPTA 4DCPA 4G97A 3TXAA 3EXHA 3I04M 1VI6A 4QYWA 4DIEA 1AB6A 2ROQA 2ZJOA 4P54A 1TE2A 1TM1E 5B3AA 3P27A 3FSJX 3OAAA 4A91A 1BWRA 1GZ6A 3B7WA 4QICA 4JR1A 5DNCA 3QLVC 3QOXA 1HGXA 4GLFA 3MMNA 5KHLB 3D4OA 3U40A 2WIFA 4OHMA 2Z5FA 3A26A 1SXGA 1UBNA 3L6DA 4HFRA 2ES4A 2QM8A 3ENZA 2QD4A 4RESA 5TPWA 1TYCA 2FXVA 3E5MA 4CKZA 5IDQA 3SS8A 2DXIA 2IDZA 4AVYA 1Z6PA 1YR1A 2QD3A 2XRFA 3T5DA 1QIGA 1BXGA 3O95A 5KMGA 1FDOA 1W1WA 4X1KA 1ZD3A 1QGDA 1H8EA 4BAZA 3R3UA 3KB2A 2C1ZA 1YCDA 2LDXA 3MM4A 3C2QA 5CYPA 4CIDA 1BIFA 4HNAB 2YZ2A 3I2HA 3T9BA 1UDBA 2G1AA 4LECA 1N5IA 3HYSA 4DC0A 5KJ6A 3ZD8A 1O6ZA 5BRAA 5EJFA 4UXIA 1GZSA 3QFHA 3K09C 3G68A 4E21A 4UQLA 1JYFA 1B6TA 1R0XA 2HA2A 1JSXA 3M1LA 4G1MB 2ZG6A 3V00A 4F4IA 2PHZA 1BDHA 1FFBA 1SA0A 1WA5A 4FZVA 2W6NA 1WTCA 1ZI6A 2JHFA 4L9SA 5DNVA 3AL0C 1CVLA 2ZUCA 4UDYX 4ENQA 5E7QA 2LKCA 4BU1A 1CDOA 3HFSA 4M4SA 4W5NA 4F3RA 3GFBA 4QGFA 5FBZA 4ER5A 1WLYA 2J3KA 3H2BA 4L22A 1N2CE 3ST7A 1D8TA 2AHRA 3N8HA 3O73A 4RJJA 4RF5A 4ZXFA 2V0CA 3TW8A 1U90A 4QG3A 1QUFA 2OBNA 1H93A 4TQUS 1MV8A 1MDBA 3RRFA 1P81A 1OI3A 4NCAA 2YIDA 3DYIA 4WBNF 1HTBA 2WWIA 4LMPA 1PQUA 4KQ6A 3T94A 1GG8A 2RKWA 3IEVA 1M8PA 2DKOA 3W2IA 5IT4A 4N76A 2RBGA 4YGXB 5FTMA 4YWJA 1NQTA 2BP7A 4P0TA 3QM1A 4L85A 4F85A 4LBYA 2V7BA 3ZW8A 1YE3A 1KO1A 2O4CA 2Y1KA 3GT4A 4YRLA 1T3HA 3UJCA 3ZC3A 4AB1A 2AX4A 1KI7A 4OQ4A 3M6IA 3RK0A 1GQQA 1HEUA 5LLDA 4GRDA 2BJWA 1I36A 4IFIA 1Z83A 1CUYA 1SCQA 4U63A 3T0GA 3W5IA 4UBKA 5A9SA 2R5FA 2FSUA 2Q49A 2ZUVA 5DULA 1NBEA 3M6LA 1L5KA 1BMTA 4NC9A 5K51A 3EIWA 1MX9A 2PJDA 2CFRA 3RVDA 2ZYDA 1KEZA 1CFJA 1HV8A 3ABRB 1IOVA 1RXIA 3Q8WA 4X8MA 4P33A 2E9SA 5FJJA 4EPYA 1XAJA 2V7TA 2R7NA 3HVUA 2GNAA 4HWOA 5KDLA 3IUQA 4XLZA 4W5JA 4FMCF 5J2TF 5I5GA 1XEXB 2Q9CA 2VSNA 3CCBA 2H59A 3O26A 1LQ2A 4NFSA 5EMMA 1CS4C 3ZDZB 2G6TA 3FPLA 1CBUA 3KLNA 2EGHA 3GI1A 3KQYA 3L8YA 4RSGA 4AP9A 1G6OA 4B3BA 5MN6A 4DLSA 2C5SA 4BMVA 5DNDA 4YO8A 4Y8VA 4HDCA 1I1OA 3HBMA 2PU7A 4G63A 3AZQA 3ECSA 2QBYA 1X2EA 1MC8A 2WJJA 1M72A 5PNTA 3OG9A 3CPEA 4J0HA 1WCV1 5DMXA 3ANTA 3V4PB 1W35A 2C9ZA 1NBMA 1QC5B 2B0JA 1RT9A 4B9EA 1DBRA 5THKA 2PBZA 4DT1A 2Z83A 1UANA 1UJ2A 3TEMA 1SXJE 1WKCA 2VPYA 4QYMA 4XYLA 1CEEA 4IVPA 4WJKB 3D7KA 4PO1A 5GIOE 1SB8A 5DT9A 4I8DA 1BTOA 3HFGA 2JCXA 3QWBA 1G9TA 1PT8A 4TM7A 5EC8A 2GFQA 4CM7A 1R8SA 1RRKA 3OM9A 3RSSA 3SS9X 4BRWA 4ES6A 4G36A 4E7OA 2OCLA 1NF3A 2O1EA 2VOJA 2E2WA 4OFBA 4W7HA 3ZBPA 1I6MA 2PCLA 4F38A 4CETA 4DANA 1EXMA 2W2LA 4R1OA 2Z57A 4RHEA 5IAEA 4G26A 5K3CA 1R8QA 2X8JB 1SB9A 1Z17A 3GVHA 3NKFA 1U2SA 4FFDA 4UQOA 4FGUA 2WYUA 3DBLB 4XQ0A 4DWOA 4F4CA 1DMRA 4QFBA 1Y6GA 2WAOA 4WEQA 4AZ0B 1PKXA 4DS3A 2IU6A 1IUKA 1QYVA 2QLNA 4XVRA 4X71A 3KU1A 4Y2HA 4PN7A 5JI2E 1I9CA 1NXXA 4HDAA 4Q3CA 2F17A 3F5DA 2QV7A 4NL4H 2BGTA 2G0AA 1TJPB 1KEKA 1E9BA 3H1EA 4Y18A 5KTNA 1U2DA 2NUTB 2ATIA 3WGLA 1Z07A 3ED5A 4FIZA 3SOPA 4XPIA 2RGEA 2Y1GA 5JDCC 4CT5A 1CRZA 4LHVA 2GGSA 4PONA 2CXUA 2YQ4A 4RL4A 2GSDA 4XGRA 3H2KA 1WZEA 3RIGA 4B6EA 4BO5A 3GQBA 4KR7A 4WH0A 4MVJD 3QXHA 1JX6A 3HJBA 3NHKA 1I2MA 3HRIA 1LUAA 2AG1A 2Y6UA 2C7VA 2YY7A 2YWEA 4YIHA 2ECPA 3DT9A 5HIAA 3PEUA 2OZLB 2A9PA 3TZQA 4YUWA 4GUDA 3EIXA 5KNLA 4C4SA 4LJ6A 1JPJA 1MT3A 4LMBA 3FPAA 4LRYA 3TJZA 1OBHA 1Q95A 1ZUIA 2LKDA 1FQWA 3RTCA 3ZWPA 4D4GA 2Z3ZA 1UOEA 3DZJA 5AJWA 1XAHA 4Z0TA 2I6SA 5EZQA 5FT9A 5T4EA 2AJTA 3QKWA 2ESRA 5IUNC 1JAXA 2Q5QA 3SZUA 1NW7A 5HQ3A 5F52A 3MJRA 2CHEA 1PRYA 1BGVA 2IITA 3H0CA 3ZN2A 2FWBA 1N3BA 2UUCB 1P7WA 2YW9A 5IBCA 3K73O 3U44A 1POWA 1PFGA 2I62A 3B7GA 2F4VB 3OC6A 1XVLA 1TFRA 2ACWA 4AO8A 1V7QA 1XZNA 1AKWA 2CZQA 3TOCA 1MZVA 3P0FA 4XJSA 5ALFA 5CIQA 1E5LA 2GPJA 3I73A 5ALVA 1X39A 1XKQA 3UENA 1ITZA 4NICA 3OVMA 3ZBUA 1NQ5A 3HK2A 1RTTA 2FU5C 4FFOA 4B85A 1X2BA 3K6KA 3HYTA 2H54A 2NU6A 3NBAA 3EGOA 2PS3A 2YHAA 4P1ZA 3QWAA 1XZQA 1HE5A 1N6OA 1FP4A 4Q1BA 5DM70 4XR4A 3V1LA 4IHJB 1WW2A 4C3UA 3IPXA 2JIZA 3MJDA 4W6ZA 2DFLA 1OIVA 3PSAA 2H5IA 5DK6A 1M34B 3CF4G 4YK7A 4KREA 1TIBA 2EC5A 1O9GA 4HNRA 3R40A 5LZ5A 1NVVQ 1ZJ6A 2KBEA 2YMPA 5DSZA 2JL1A 3WE7A 1N9GB 1VLQA 2N1BA 2Q50A 4TWRA 1E0DA 2R87A 3AM3A 1WMEA 3KT3A 1N7IA 1XRPA 4IH9A 1G60A 4N5LA 1AHIA 3FWHA 4X7MA 3PFBA 3AKEA 4O4JF 2X5JO 3VHQA 4CCAA 4NZOA 1E1NA 2G4LA 1E9FA 4PQFA 4H4EA 3JWIA 2VP6A 2ZIVB 4ME6A 4PAMA 1RWXA 2FN4A 4TRNA 4I1VA 3LX4A 2IPNA 4RD4A 1MTOA 2VVTA 3OZFA 4WVFA 6LDHA 5LNK6 1JECA 4HATA 1JBQA 4YMVA 2PUGA 3KEFA 4H9GA 5JAPA 4ZO6A 2OC9A 3DHYA 2ZULA 5BR1A 3EXEB 4EA8A 1E63A 1B8OA 5DTMA 1HE1C 3CZCA 2BEWB 3EIQA 4L8VA 4JLBA 4PLHA 3P9KA 1GUFA 1ESEA 2IUTA 4WN9B 4Z0HO 2LP4Y 4P3YA 1TMKA 4BMXA 5BWCA 4P53A 1YZUA 4DZZA 2IPAB 3IB3A 4UARA 2DQYA 2G9VA 1QNFA 5HKOA 2OYRA 5B53A 2JJ2D 1Y3AA 3N87A 1NPDA 2PO7A 1TUBA 3PS9A 4HDKA 3H97A 1Y3HA 1L1EA 1FRVA 1ZGHA 2EKBA 2O14A 1N2EA 4MQFB 1CZUA 1ORWA 2W6JD 2VYVD 4LXGA 4X3PA 3E22A 2WWGA 2P6UA 1AF4A 3N8IA 2EQBA 3OU2A 1JFRA 4LOHA 2ZAGA 3SD7A 4TROA 5FOQA 2GM9A 3V1KA 1V5EA 5DSTA 4NK5A 1R4ZA 1KIMA 1NN1A 1W93A 1JDNA 2C8JA 2ZSIA 1PGQA 3KSMA 4NU0A 2VF5X 3HVRA 3AO0B 4WK0B 3GFFA 2PEYA 2PT7A 1GKLA 3C43A 1ZRSA 2ODQA 4GRIA 4JLKA 4QVGA 2Y05A 1XD2A 3Q7PA 5F51A 3JARA 2QDKA 2RKOA 3UOWA 3RUAA 1RBMA 4FD2A 3AKDA 3HZHA 4DLXA 3WVNA 4B32A 3AERB 4LSMA 4Q15A 4UBMA 3AM5A 3IQDB 2R4TA 2WU4A 1I5OA 2QVBA 4ZODA 4LMRA 3SQXA 3FH0A 3A4VA 1J8QA 3N7UA 3P52A 4KYIB 5FPSA 2FMFA 5LBIA 4YJ2A 3HJCA 3JQ9C 5M5BA 2X9LA 1NRJB 2WWTA 1U7XA 4FDMA 3HR7A 2UZ1B 5ENZA 3FXAA 1AZSC 3CGWA 4HDNB 4RULA 1B8VA 4Y1GA 1PG2A 3QU7A 2B3TA 5F33A 1UPBA 2XCIA 2Q3DA 3KRTA 2Q6VA 5KVVA 3CY6A 1Y7TA 1B43A 5D3MA 2IOHA 4FCCA 3ZDEA 3FYDA 3CG0A 3E35A 3EZLA 3ONWA 1PZNA 4U7PB 5K0LA 4G4JA 1Z6TA 2BEVB 1YHNA 1ZAYA 4MP8A 4QU5A 4S05A 4AS1A 1A8SA 2QAGB 2RHOA 1DVRA 4HNGA 5H0IA 1KYIA 5IN4A 4Q24A 2YJ5A 3I1YA 2XV1A 2P75A 1UWLA 3NB0A 3HV2A 3INRA 2HMSA 1QOZA 2BGLA 2W2KB 3F5FA 4UU1A 2O7VA 2GO1A 5HUHA 1AGXA 3FOFC 3RBXA 5AK4A 1NLZA 2AIRA 3DV9A 1NW8A 4OHVA 4Q34A 4M36A 2VQSA 2P1RA 2ZQYA 1ODFA 2RGRA 5F5LA 4CODB 5BSFA 4O02B 1KC3A 1C3VA 5AD1A 2HGZA 5G4LA 1AT1A 1JHMA 1PF7E 1QYCA 5JMTA 3P9NA 1SXIA 3LLUA 4MVJH 3QFTA 2GI4A 3MPUA 3RDPA 4JJFA 3CF6R 1NWHA 2R79A 3H5RA 3D6TB 1VOTA 3K8ZA 1I30A 4IHKA 4PHFA 5ULLA 1NJGA 2Y1WA 3HO6A 4XD7D 4D96A 2VJMB 3QF4B 5JXGA 2IGTA 1KSHA 1OX6A 2O20A 2PGDA 2QRJA 3VC3A 1YCHA 1G59A 3NBZC 2JAHA 2GCNA 3C6ZA 3OJ0A 4B31A 1X86B 5EHNA 4EHAA 4ENVA 5EMJA 3Q8MA 3GDOA 1HKUA 3CZRA 3RYIA 2XUDA 5CLQA 4BAUA 3A31A 1CZKA 2H3HA 1UC8A 1ZHHA 5KYUA 2WKPA 5I7EA 1T5SA 3RYTC 3LI2A 2FSPA 3MN1A 5EXPA 4CM1A 3OO1A 4CJXA 4F9FA 2V7EA 4G1UC 4OHKA 3L8MA 4AECA 4ZHQB 1ZK4A 3CFYA 2IDKA 3TRFA 1DC7A 3WLTA 2H1HA 1Q7BA 2X40A 4UDXX 5FPTA 4D9NA 1PG0A 2GAFA 4M1SA 3OZ7A 1RXUA 1FU4A 1C4WA 4O2RA 5ILGA 3KQUA 1QHNA 4GDMA 4XCVA 5AI5A 2FRVA 3O4RA 4PQYA 2QYSA 4N39A 2PGLA 3IIMA 2R6HA 2WAXA 4EENA 2TS1A 3JVUA 4JX8A 4PYKA 5K3AA 4IY1A 1L7DA 2HO5A 3RC2A 3VR2A 4CNBA 2GN1A 3JYOA 4Q3NA 2E85A 4A8HA 4BKUA 3CSUA 5BYKA 4I7EA 1YB4A 1V8BA 3DE7X 5JSYA 4ZAZA 2EG5A 3TLMA 2AFVA 3WGTA 2QTGA 2K2WA 1NFRA 4WSOA 5IVIA 2NSDA 1ECFA 1XZIA 4TMZA 1MG0A 1DC5A 1PZHA 1TC1A 1X1DA 3GJ7A 2B92A 3LCMA 1U6JA 3ZLTA 2D59A 4RFSB 4RMNA 2A7QA 3KDPA 2ZSBA 3LWDA 4INAA 2FCAA 4JLAA 1W52X 4XAQA 3RIHA 3RS7A 3EIFA 3O7MA 3REOA 1WZNA 4M6WA 3ZUPA 2E6KA 2DWUA 1HX7A 5F76A 3JR7A 4EWLA 1NVVR 1BX3A 2Q5JA 3VC7A 4XX1A 1NY6A 4KUEA 1NHWA 3SF8B 4BCCA 3V48A 1J8DA 3CJTA 3S5UA 5F7OA 1L5SA 3E9QA 5I01A 3WMEA 3DBHB 1Z56C 4CQMB 4COOA 5E4TA 2X7HA 1SVOA 4X66B 3KXLA 2X7XA 5AVQA 3LKVA 4DMHA 1YNOA 5ARBA 4BMSA 1CF2O 1UAYA 1OT5A 3V1NA 1N5KA 1CNEA 2P9BA 1P0QA 1PHPA 1MRZA 1W0KA 2WA1A 3TNJA 1G21E 1UFVA 2E4XA 1U7TA 1TYEB 2G07A 2GZHA 3C3PA 3F6EX 3H2IA 4YBRA 2WI8A 2GHIA 4HWKA 3U26A 3ZK8A 3ZU6A 4WKBA 2GN0A 1T4BA 4MAFA 3ILHA 4LYJA 2YWCA 5G3ZA 4TX1A 2AKYA 1BDJA 5CJPA 4DCVA 1R50A 4I9NA 5AKLA 1YIDA 4DCJA 3A58B 1CLUA 3X1YA 5CAEA 1JDPA 4K6MA 3B1ZA 3HXOA 2Y92A 4JC5A 1ADCA 2V5VA 3EG9B 5EJIA 2BR5A 2VAWA 3LCCA 2QDXA 1U9YA 5CTAA 1KC1A 3UTDA 4FB5A 5J43A 3DKIA 1J22A 4AROA 2HIHA 1Q1GA 4EFDA 7MDHA 3WGYA 1NNLA 1H5NA 4XB1A 5KC9A 4K81B 2X8BA 5DV9A 4D8XA 3VSBA 1PFVA 4YP0A 4UOQA 1D9XA 1EB8A 3BQ9A 3FROA 4P80A 3I9V1 2IU0A 1JH9A 2BR3A 4LRUA 3KK0A 4UNPA 3F73A 4GNKA 1FB5A 3PQFA 2P2SA 2A67A 3IPRA 1TCVA 1JE0A 1GQFA 3KQWA 2XQFA 2YXDA 4G4GA 4HNSA 3CS3A 5I9SA 3BTVA 2Y1FA 1LZKA 1SUBA 1BFKA 1F9AA 3MBKA 2ZT5A 4R16A 1K06A 4ZT5A 5H7XA 1EUZA 4P4GA 1E62A 1XTIA 5BR4A 2HI0A 2OYCA 1ZIOA 1HEIA 3QVKA 3BIWA 3U3KA 4DC1A 3DVSX 2CXQA 3LWZA 4H1VA 2QRUA 2VDUE 4O59O 3CZMA 3FIJA 4TKUB 4RGVA 2W6IA 1D2AA 4Y2RA 3UICA 3OZVA 5B1HA 4BP8A 5LLSA 5H3LA 1FA9A 2XYRA 3MCUA 3UN1A 4BDSA 4O4IF 1ODSA 1J9EA 3D7RA 1ENOA 4LDNA 2VZ0A 1K1EA 4N47A 1JI0A 3D3WA 4DPKA 4BFXA 1NBHA 4HRAA 3CPSA 3INGA 2QL6A 3KQPA 5IYZB 3L6OO 1PR4A 1SRQA 2XE4A 1DO8A 3U3OA 1U6KA 1G4HA 1QLWA 3DP9A 1OQAA 1YRLA 1NQVA 1RBYA 4WNAB 3RWOA 1LK0A 2B3DA 1NXSA 4G5OA 5IAKA 4Y6RA 2YDXA 4NFHA 3TR0A 4C4AA 3RYCA 1R88A 5DYIA 3GVIA 1Z63A 5A9TA 4DNPA 2PTGA 5CA0F 3BG5A 2JHPA 2NYUA 2HMTA 2REXB 1Z26A 2HA3A 2YJNA 1KVUA 1KR2A 5AUQA 2WTXA 3I5XA 4NU8X 2XMRA 4F5ZA 4CKWA 4CLOB 4DREA 4ZEVA 4LSGA 3QQ5A 3WYGA 2JFPA 4C4OA 4LZZA 4H3VA 3HQ4O 2ZSKA 3L7LA 5H3HA 4OOEA 4JU9A 1AVTA 1RRFA 3PQ8A 4IFEA 4OSPA 4P4TA 4B4DA 4Q1FA 5BOSB 3G2HA 3BL5A 2RCYA 4P5EA 5CYOA 4NPAA 3I1JA 1IG3A 3F7NA 2WUWE 1SKYB 4BKQA 4D81A 1O5TA 5G0VA 5AI8A 1PEDA 1VSQA 6PFKA 3DE3X 1QPBA 5I4CA 1CQIA 2QXTA 5E2AA 4LXHA 3L1IA 3O8OB 4B3IA 4S1WA 2WB4A 4DMFA 3KJNA 1ZA2A 1XC7A 3UGTA 2PD6A 3TE6A 3J80A 1M0TA 2QF7A 3P9RA 4EY4A 1R4NA 4XIFA 1P7PA 1FC0A 1VXOA 3FI0A 1D1QA 5AKZA 1Q2XA 4C7VA 2Z9BA 3QVJA 5BQXA 4EHKA 3AVWA 4EEZA 4GPD1 2IYYA 4ACAA 2BV3A 1E79D 4E46A 1PJ8A 2MR5A 4IRMA 5EVJA 1OI2A 4EW2A 2PLFA 2QD2A 4HHEA 1LVHA 1FSZA 4TWBA 3W8EA 1HLGA 2VHYA 4ZZ0A 4TMVA 5I7WA 4RE6A 1PR6A 4KOAA 2QRQA 5F64A 1OY1A 4BMCA 3OD1A 2C4KA 1T4DA 3KCNA 4W7SA 3QI2A 1MOQA 5JMPA 4CFSA 2PUAA 3W6UA 1QG2A 4HEQA 4CT4B 4DV7B 1XD8A 4LK2A 3WSVA 1X7DA 2XCOA 1NQAO 1MAVA 1QVZA 2X76A 4UMVA 3SBXA 1S5PA 2PJUA 2L2QA 5ARDA 2ZETA 1IXRC 3SAJA 1NVDA 3M4NA 2BF4A 1V1JA 2O2SA 4MRMA 5T3UA 4MHTA 2XYGA 4OU4A 4D9EA 4RSHA 4Z9BA 4G0OA 4KDFA 1TYAE 1JEQA 3FSEA 2OP0A 3UGKA 1Z74A 4ZA2A 5LR6A 4MEBA 2VZ8A 1YRAA 2ZM6B 3BJZA 3LKBA 3F3MA 1BHSA 1NJ6A 1D6MA 1O03A 5TMDA 4CM4B 2W93A 2ZAIA 1GGKA 4HVLA 2WVGA 3QMVA 4F9GA 2P9EA 4OLHA 1O96B 4FGKA 3BCRA 3OIVA 3HDYA 2AK3A 3SYNA 4FBLA 3AR9A 4H2DA 1M6EX 3SYMA 1MPXA 4BVHA 1GUBA 2VQEB 2HK6A 3GZTB 3GLTA 4RPHA 2XUIA 3U39A 2FW9A 3K4QA 3IJEB 1R8XA 4QUEA 1SCUB 2BHSA 2QRMA 2BGGA 3HDQA 3TRKA 3T61A 2OMKA 4EB8A 2IOQA 1RZRD 3N6VA 3DFIA 2Y6VA 4YRAA 2XMGA 2YH2A 5TQVA 1TAGA 3LK6A 4EVRA 4EMUA 5IG2A 5JY1A 3EOAI 1F14A 2ZI4A 1R2QA 1D07A 1YULA 2AA3A 1K3TA 2G67A 2HLNA 2YWBA 3GJ5A 4ITVA 5EPUA 3VI3B 3TNLA 5TQ0A 4BLVA 3H87A 2QVZX 1QOQB 3OIWA 4IIFA 4GPTA 4E15A 5K3OA 1JZQA 4F11A 1KRWA 4YP1A 4RF4A 2IODA 3RKRA 1DV2A 1KRHA 1V11A 3BGWA 1PTJC 3B9BA 1FNBA 1RWWA 1FVHA 3RRBA 2HEGA 2P9CA 4KDRA 1S3IA 4FM9A 1SEVA 2QMYA 3SJZA 3FNQA 5AIBA 4FR5A 3HP1A 4OIMA 5IVDA 1QH9A 5DTRA 2V45A 3IS3A 2O3SA 3FGOA 1FS4A 1VMEA 1GNPA 2ECFA 2YYZA 1E6LA 2FYTA 4J29A 4QJIA 4RQTA 4BAGA 1UXKA 3LW7A 5JNRA 2P27A 1EDEA 3QVLA 3G85A 1NBME 4MP6A 4QPJC 4XE5A 3II6X 3HU3A 3FPBA 1SN7A 4BO2A 2QRNA 3U5ZB 2OV1A 2GXAA 3H0KA 2EKZA 4HG2A 3CNBA 1VTKA 3OETA 5BORA 1VHQA 5LQMA 3BF8A 4I9HA 1U1FA 3RG8A 3EA0A 3LUCA 2XZDA 4P82A 5LB2A 1GQ2A 2C5GA 3RSGA 4D8VA 3H8SA 2WUDA 1G8MA 4CTMA 1VCMA 5B7GA 1KK3A 3R7FA 1XP5A 4IIXA 5HF9A 2ODEA 2XZTA 4E4TA 1YQWA 3OHSX 4LNHA 3BMCA 1EGHA 3IO5A 3LZDA 4L4YA 1V1MB 3OZEA 4OXQA 3MA0A 3OFSA 2PWPA 4DADA 1NVGA 2C92A 1K5HA 2PSSA 2BFFA 3OOWA 2WPDD 3PFNA 4IWYA 1JR3A 2GEJA 5K4GA 4MYRA 3QW2A 4KR9A 1RE1A 3I28A 3ZQKA 5EY5B 5H4HA 1ZESA 3VKVA 4DLWA 2BGMA 4GOJA 3WWEA 3ZNOA 1A72A 4V02A 5IBPA 3Q2OA 1QRUA 3Q1KA 2DJ5A 3EASA 2NZYA 2F6RA 2PPVA 1MKYA 2JB9A 1IU9A 3JQPA 1UBLS 3OHPA 4LZNA 4X8LA 1IEVA 1A4XA 1ZC4A 3M4ZA 4TMTA 4UVDA 4QDZA 1H8HA 3HHEA 3FDFA 4HMPA 1L5HA 3S6JA 4MIKA 2DHCA 2QPTA 3A4NA 2HV8A 2V6BA 3QITA 4FFLA 4IWXA 4OXRA 1XEWY 5BVHA 2ZZNA 1PDWA 1BW9B 1ZUHA 4HNHA 1OZ0A 1A69A 1JMYA 2A9FA 2YVKA 4KIFA 5EIHA 1SVUA 4CV2A 4U5XA 4EITA 2XQVA 3HVHA 4RZXA 4URZR 1UEXC 3COZA 3EJ6A 1G3RA 5EPEA 2OXFA 5DWQA 1CR0A 3MYRA 3SGLA 4KQMA 5JT1A 2ZTVA 1W4CA 3N9IA 5JDIA 3TQIA 4ARZA 1KU6A 3PHJA 1SKQA 3WC4A 4WFJA 4RMHA 2IQIA 1I4WA 4J0CA 4JODA 4UHJA 4OXNA 2A5JA 2R2GA 3C5CA 3F49S 3K3PA 1EP1B 5F21A 2EF0A 4PC2A 3LFTA 1V0JA 3QUTA 4QRDA 1TB4A 2AG8A 4FVTA 3V1TC 1HYGA 1VE7A 1TC2A 1WXFA 3K20A 2PLAA 2Z9CA 3Q85A 4RGQA 5F3DA 4PQEA 4GGMX 5GONB 2LPMA 3EDRA 4K3VA 1FVOA 3UJ8A 3X2SA 3M1IA 4QULA 1FE8A 4KPUB 1MC4A 4YP7A 3OQMA 2IHNA 2O8DA 3A3OA 1V16B 2V6MA 3AP3A 5EZYA 3PWTA 4RNDB 1FP6A 2D5IA 3V55A 3QKRB 3SX2A 3E7WA 5AW4A 2HQOA 3ITEA 1OH7A 5HIJA 3WAKA 1HZJA 2GAIA 1A5BB 2GF0A 1EFCA 2R8EA 2CNWD 2VCHA 3FYCA 3P2KA 1F0PA 4LA4A 5DTIA 2OBYA 4F96A 3B7PA 3DDCA 2QTRA 1M73E 2J0EA 1L7XA 3AUYA 3DPSA 3KKZA 1I10A 2VRNA 3O2QB 3DEAA 4HLCA 4NDNE 1N0UA 4R7TA 4TLMB 4A5SA 2QROA 3A3PA 1LTKA 4V2IA 2ZB4A 5CU7A 4QM7A 3E8MA 1QP8A 4ARIA 3CPHA 3IIKA 3ESQA 3V1YA 3VR6A 4DA6A 2VP3A 4MROA 3SVTA 2OFFA 1IHUA 4WLNA 3AR8A 1PWEA 2OZPA 3KUUA 3TD9A 2YNMD 3M1AA 2X3FA 2ATXA 1NR5A 1GRVA 1BWQA 2HHAA 1GR1A 3GY0A 3W9SA 3KVOA 2XYPA 1RXEA 4MYTA 1YB7A 4ND5A 4Q7EA 2FV8A 3ZGNA 1VYTA 2WZDA 3NBYC 1HR0B 2XJ4A 2KJQA 3PTZA 5A4FS 1WV1A 1N1DA 2ZRGA 2IYSA 2O8BB 1IY0A 1PSWA 2MTBA 2JF0A 1EWKA 1B2LA 1GZ5A 2RH8A 2VWPA 2X13A 3GZNB 4HWPA 4PHTA 5KIAA 1MHPA 4GLLA 4YT5A 3EXIB 2BISA 2WE8A 3SLRA 1SKMA 4RM3A 2QTVA 2M2IA 1NRWA 1PT7A 2V96A 2FG5A 3GFTA 4GUAA 4F6RB 1ZWKA 2A9RA 2YRFA 4MS3A 3TPCA 3QPWA 3SJAA 4CW7A 4C30A 5C81A 1HSOA 1DPGA 2BTOA 4WEOA 1A9ZA 3BC1A 3OKFA 2A30A 1ZEJA 4L02A 3V8PA 3ZZNA 1OWOA 4A0FA 4QYIB 1AMUA 1DZ3A 1MZPA 1XU4A 2GN2A 3BD8A 5EL0A 2BELA 3CZAA 3RTBA 2YOGA 4PCUA 1IXSB 1T9HA 3T0FA 1AA9A 2ZYWX 1Z47A 2Z9DA 3W5HA 4NCHA 2O59A 5K3SA 1M54A 5FLXA 2XMQA 3QA3E 5AVSA 5CB0A 4XXHA 1P4RA 1IVNA 1CIVA 4PPYA 3W77A 5IK2D 2ZRJA 4C76A 2Z8XA 4RZ3A 3BIOA 2C9BA 1ZCFA 3S2EA 3CUUA 3KUKA 3PC3A 3NJ8A 1EVYA 4YUYA 5GGYA 1TPYA 2P2NA 3F8SA 4IDHA 4OKIA 2ZYVX 4Y2VA 2PNJA 3L43A 3ZCQA 2DH5A 2ZW9A 3QG5A 4DDUA 2FUCA 4HX5A 1YU6A 2PKWA 5BY2A 3COPA 2QXYA 2GBPA 3HSSA 4XX0A 2H52A 3RTAA 4FX5A 3KSUA 4QFDA 1P4SA 2NXNA 4X61A 4HS4A 2YV5A 4LE1A 4YJHA 4M9XA 2XBUA 5KTPA 4GP9A 4TXNA 1P2SA 4TQAA 3W9BA 1QBKC 1WPRA 4E7PA 4ATNA 1QK3A 2PA0A 3H5TA 4CU5A 3CSDA 3DO6A 4RGBA 2R1UA 2AYZA 1TTTA 2ZK7A 1HYEA 2GCEA 5KOJB 3CW2A 1Q7CA 2FEOA 1T6YA 1W2HA 3FYUC 5CPFA 3CR7A 3LS2A 4E11A 3C3YA 4NULA 4Y2PA 1HDIA 1C1DB 3VYVA 4DQDA 2VYND 1QO0A 1U8AA 1IZ8A 2SECE 4GYJA 3FOWA 1H9BA 3DKKA 1L5QA 5BR7A 2KBFA 1AV6A 2OV6A 1QYIA 5LZ7A 3UWPA 4K8RB 5EMLA 5JV5A 1WOMA 4CWAA 2X0NA 5IKMA 1EQUA 3CH6A 3CVXA 1AQLA 5I6DA 3QU9A 1J8YF 1DWOA 2WWXA 4EABA 1E1DA 3JQBC 4CIBA 1YJAA 4B4VA 2PUBA 5ECYA 1ESDA 1UKZA 2CXNA 4KWTA 5FULA 5CPBA 5HCNA 5IANA 1Z0UA 4QJBA 5LZ9A 1HPLA 3C5HA 1RMQA 2PLWA 1CVIA 1T2AA 5EGNA 3BYZA 2XCQA 2ACVA 3HMKA 3KOWA 1LBTA 2H18A 2RAFA 4GWLA 1M10A 3FDZB 4TV8B 2CLKB 1MJNA 1FBNA 1E3WA 1MGPA 1ILWA 3WHIA 1LJ8A 4Q5IA 4FNAA 1UQRA 4BIIA 2WU0A 4LXXA 3ZZMA 2DY0A 3QKUA 4C0BA 4H31A 2W8BA 1C4OA 2AVDA 5FV7A 5A3SA 1YI1A 5ARCA 4GS5A 3GLFB 1T5TA 4ND1A 1BD3A 5I8PA 1NUUA 2VRCD 3HYLA 3UXMA 3L41A 3U0VA 4IILA 1NIJA 5TQJA 1T1JA 2JHCA 2XIJA 4FKMA 3KKMA 5KQLA 1YDWA 5JTUA 4HV4A 3W6ZA 5AXBA 2AG6A 1WSDA 3C39A 3FUVA 2HQRA 1EI9A 3OKAA 1CR6A 2R8BA 5FLEX 4TRJA 3VZQA 4HAYA 4I6JA 1VZ2A 3D6FA 3FMPB 4QDXA 4OAOA 4RVOA 5T5QA 3UT5A 4EPXA 5ABPA 5E6UB 3UMMA 5SY9A 2CVZA 3AYXB 3PZRA 5UKDA 2GVDC 5JAUA 5JO9A 4YJFA 3AYZB 1E1RD 1FU8A 1CJTC 3AHEA 1LRKA 4HQ6A 5B1IA 1UKBA 3ZV5A 4H1HA 2FSVC 4KFSA 2QVCA 5A5FA 4WASA 5ALSA 2PUJA 3DA8A 2GNOA 3MSXA 4I2NA 3U62A 1J06A 4L8YA 4IIJA 5KCZA 3KFXA 1W25A 2WRZA 3O3OB 5FTNA 1HY3A 4D46A 2QVYX 3M5CA 1OWLA 2BI8A 5EHGA 5DF1A 5I8WA 1XMVA 2C0QA 2B99A 3EBLA 3TWOA 4QGGA 2BHLA 2ONCA 3PX7A 2DM6A 2EIHA 5HR5A 3MRXA 2GZDA 1H5QA 4JASB 5A3JA 5KOHB 2YHIB 3IT2A 1NZFA 1RLJA 1B2RA 4B8WA 3EZFA 3GPBA 5BWLA 2O8FA 3MUFA 2ZRMA 4V3CA 1DAPA 2O1WA 4LZWA 1REQB 1E8NA 1NJ5A 4BFYA 5B30A 2IKSA 4JR0A 4X6LA 2B8JA 5AW3A 4KR2A 1R5BA 3ENKA 1E1LA 3LVBA 4E5YA 4X8HA 4UW9A 1II8A 2FUKA 3AJAA 3P2YA 2QG9A 1C29B 2BOVA 2QP4A 3TUJC 3P1JA 2DUNA 3AJ9A 2YYSA 1U6IA 3CX3A 1KJYA 4G85A 4IBOA 4CIAA 3OFND 3W5BA 3U56A 1XXHA 1MG5A 1NVFA 2CVOA 4OHYA 4HGQA 3GLGA 2VPIA 1CT9A 1W44A 3OIUA 3WKBA 4MCJA 4DTCA 3HYNA 3IV7A 2CN1A 1A9XB 3DVAB 4ALKA 1SOMA 1XOIA 1XXLA 3BJIC 5KYWB 3JU3A 1JFSA 1UOPA 5F7ZA 5FTKA 1E9EA 3V4VB 2CLHB 1SBCA 4GNRA 3FOZA 3O91A 1W0CA 2YN2A 2GEFA 4TT8A 5FBVB 3M49A 5IDXA 1TKRA 1XCGB 4DRXB 4LDQA 5BW6B 5FLKA 3MT8A 1SU4A 4LN1A 5JCOC 3LPLA 2BEKA 4G9GA 3JRXA 5K6AA 2DMRA 1PNVA 2V5AA 4DNFA 4L6CA 4HO1X 1VLLA 2QMEA 4J0EA 3OOYA 4YXWA 1C1HA 3PPWA 4Y1RB 3TZCA 1DEHA 1G9SA 3DQPA 3MWDB 4IIVA 4GPAA 1HT0A 5FUXA 3WBFA 4RSMA 2IRWA 3U7RA 4D5EA 4AY4A 1SCIA 4QBKA 2JK0A 3GVPA 4AQYB 1S9HA 3WLPA 4ODIA 3L0SA 4DZRA 2H0RA 3UJ9A 2DKNA 1HDYA 4F46A 4TWJA 3IDZA 5T8KA 2J67A 3MWEA 4D8WA 3G1UA 4G37A 2WWRA 2Q1UA 3QLEA 1YS9A 4OBWA 1ZW1A 2CUNA 4AUEA 3SU8A 2OQVA 1U81A 2HGSA 2ZLBA 4ZOLA 4K6KA 5ITSA 1IPEA 2Q9BA 1W7AA 4DSOA 5FORA 1TQ2A 3NW9A 2HLDA 1N6NA 5LDDC 1PWYE 4A1FA 2P5UA 2IV2X 3VMFA 4Q01A 2F9LA 2V6IA 5CM2Z 4JB0A 2A0XA 3SSOA 1PJZA 1G2PA 4ETMA 1F60A 2AUTA 3HA7A 2ID8A 3GGDA 3SZOA 3BE6A 2QMOA 1QM5A 4MKXA 1P1KA 1XEAA 2ZTLA 3O90A 1T2DA 1Y1QA 2YJ3A 4PC3A 3PDUA 4N8DA 3IBFA 4QAJA 5H4GA 1RP1A 5ES3A 3L0ZA 4ER7A 5FAKA 3Q41A 1JHYA 2ASEA 3QLUC 1TZCA 3NV9A 3QPAA 4BBAA 1OBOA 4S2EA 5A1TA 2XB2A 1CP2A 2QRVA 4FEYA 3NHJA 4NOLA 1M2HA 4R5HA 5EKSA 3U9TA 5KZMB 3FFXA 3HO8A 3ABSB 4HN2A 1CY4A 1M6VB 3GEPA 1ZH6A 3GUYA 4WRRA 1NU8A 5FHQA 3WGIA 4MW0A 2EF1A 1TQ6A 2JG3A 3TIVA 4FXPA 2PS0A 4LKOA 5IKPA 3DZDA 2HIMA 3QU2A 2AUMA 1F5SA 2F9FA 2D2XA 3GPIA 2W2XA 4H1TA 3SBOA 1I4TD 5HFNA 4ZI7A 4UULA 1THMA 2GBGA 2FPKA 4BVBA 2YWRA 4O2AF 4HWGA 1XJWA 1ZEMA 1OFIA 2PXCA 4I9FA 3WGJA 1KQOA 2AEMA 4QXAA 4X20A 4A6EA 3TIGA 4PFKA 4DHEA 5LP6A 2W6ZA 3NOOA 4EYEA 4NNJA 5EZ5A 4YX9A 1ZMBA 4OJNA 3D6VA 5C8XA 1NOIA 1KZ1A 2B8TA 2IDMA 3GNQA 4B6FA 2NMVA 3UHFA 4D0LB 4WN3A 1FRZA 4YPOA 4Z0PA 1S2GA 2IYWA 2JJ1A 3M4XA 2C07A 2V4MA 2X0IA 3DMTA 3EPLA 5FNVB 4ZCIA 4DGQA 2VHQA 4G0QA 3QIVA 2GILA 4RQAA 1UPAA 1SXHA 2H4HA 3LKZA 4ZC1A 1MC1A 2UVPB 3SICE 4YAGA 4FWTA 1P1RA 3AOGA 3PL1A 5IFLA 4UD2A 1CRPA 2V74B 2WQZA 1LDEA 2ZT7A 5KHAA 1ZD5A 3WIBA 5C1BA 4UZSA 4N3GA 1I4LD 3SSMA 2FPIB 3IPAA 3IJPA 1Z2EA 1Z06A 2FRDC 4URXR 2IJGX 3PYXA 4LYYA 2AQHA 4OMCA 5JVDF 2DTDA 3D4BA 3TVDA 4OB7A 1VSUA 3VNUA 1ZM2A 2AW5A 3UCEA 3F7OA 4BE7B 4QRHA 2B1RA 1TLTA 3WLRA 1KARA 4DUGD 1CIPA 3OIYA 2QZSA 1I1QB 3TCKA 5KQGA 2IOYA 3HPQA 1XNRB 3ZHCA 1ARZA 4KJXA 2J4FA 5IRCD 5IBQA 3M89A 3RRJA 1J8VA 1PJCA 4M53A 4OCZA 4Z4CA 2HWXA 1SURA 4AJ9A 5EWLA 2VNJA 1RIIA 3EH2A 3HP7A 2FAXA 3HUUA 4M1OA 3CGGA 2Q28A 1PSDA 3E15A 2EGUA 4BNIA 1IBMB 3AFGA 5MHTA 3I72A 4RH0A 3S2SA 4OP3A 4FZJA 3UUEA 5A7HA 2V7QD 1Q7RA 4AJKA 1G8HA 1GLVA 4ENWA 4PVDA 1FXUA 3GRFA 4FYXA 5CK5A 3WV5A 2BYTA 2BJHA 3CC8A 4H6PA 2AE1A 1R4AA 1H0HA 2PZ8A 1E5VA 3JALA 4WESA 5MFPA 3GRPA 1XPRA 4OHOA 4F3NA 1RMTA 1Z5PA 1QKJA 2IKQA 1AZWA 4G0ZA 4KWHA 4RW0A 3MQFA 3DL0A 1KJ9A 2P0EA 3L9WA 4B34A 2SKEA 3QMMA 1W9HA 4FT2A 4I50F 3L79A 1L6RA 4I81A 2G76A 3VAZA 1S89A 2PMKA 2Q9AA 1C9KA 2XUZA 3Q0EA 4RV4A 4UM8B 2O0MA 3W7BA 4RZQA 1ENPA 1VSBA 4ZJZA 4CEHA 1V8ZA 1ATZA 5ALKA 1KDPA 1Z4JA 4LHSA 4M1YA 2R8XA 3T7SA 4Z9FA 1JIJA 3TIFA 1L5MA 3VBEA 1KO7A 1XWFA 2D1RA 2XIQA 3BRWD 3L2OB 4J75A 3WTCA 5HM6A 2G0TA 3TFOA 4GECA 3OM8A 2HUNA 5EJEA 1WCXA 2FSHA 4PGFA 4IJKA 3SFVA 1AQ6A 2CKDA 3AI3A 5H82A 2IIBA 2QLTA 3AFIA 2QZ9A 2QG6A 3JPWA 4HTFB 5TVKA 4YRNA 4WNYA 5JWHA 2FUG6 4OVKA 1TCAA 1XCOA 4GSYA 5EE3A 4LV8B 2PYZA 2C59A 1XQ6A 2XW6A 4QYSA 3AEZA 4EG0A 2JFZA 4Z3KA 4GOXA 2A92A 2W11A 5DNUA 4YMLA 4DUGA 3G0DA 5AJXA 2Q8QA 3J81k 3ELDA 5HJEA 1MXFA 3L49A 2C5AA 1N2SA 3N2ZB 3NC0C 4QQRA 3GAAA 3PGMA 2NU9A 4FHEA 4G0NA 4NK4A 4R40A 4ZZ1A 3FWPA 4LZLA 3RWBA 2QN6A 4KO1S 4R6XA 1Z4MA 4J03A 4DIMA 2MR6A 2RSLA 4CKCB 1Y6FA 2PMBA 1ZGAA 1VG1A 4NPHA 3LY8A 5ELMA 4NTZA 4HLUA 2VTDA 4JI4B 1U0TA 2CNLA 2E89A 2BCJQ 3LDGA 4KKXB 4ZOBA 1ORDA 3I9NA 3JWJA 2HIGA 1CY7A 3AR2A 4QQKA 1BKSB 1UT5A 1LWNA 1LI5A 3EIUA 2QVXX 1C80A 1TGVA 1UZUA 2J6CA 3IESA 4G4SO 1F1JA 4CUZA 4P5PA 2F8SA 3ICEA 3HS3A 1DO2A 3G79A 4Y3UA 2EU8A 5KI6A 1OH6A 4UXJA 4FSDA 1QG4A 3PRHA 4H7PA 1R00A 1JPNA 3K6SB 4G81A 2HJSA 2PSJA 5EHZA 4OK5A 5HE8A 1O6GA 1WS6A 1P9LA 4LPSA 2NAFA 5LXTA 1CRLA 3PXXA 1NA5A 3JATA 3DDZX 2WVHA 3SZMA 4U3JA 3A1TA 3N76A 3N2KA 3FIUA 3QVGA 4ZOEA 4LE0A 2B6HA 5F1YA 3AX6A 2FZGA 2O57A 1QZUA 4RKYA 1GZ3A 2XUKA 3EVZA 4IYJA 4RTKA 3PSHA 1S8NA 1AQIA 4AMBA 2VJPA 1K08A 1MJGA 3F1KA 2OK8A 3ENVA 3MEQA 4PGMA 2Z04A 4QUKA 4YALA 2DBYA 4JWTA 2JIRA 2BR4A 3G9UA 4AKSA 4EVSA 4XIGS 5EFOA 3WMRA 1KJ8A 3VOBA 2UZ3A 1GSOA 2X8WA 5BWMA 1AURA 2YC2C 4WOBA 1OX5A 2OGZA 2XVZA 4Q3DA 1N4DA 1PP4A 3GGOA 4P86A 5B6IA 2DTEA 1JEDA 2G9ZA 3WJ1A 1A7UA 1B41A 3PEEA 1PDOA 1SUWA 2CD9A 2E4WA 3EIEA 3K2BA 2FZ4A 2I2BA 5JE8A 3KBBA 2KQUA 3GXBA 4C88A 4L2IB 1VCHA 1VKHA 1MT0A