3OJCA

Crystal structure of a putative asp/glu racemase from yersinia pestis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MKILGLIGGMSWESTIPYYRMINQHVKAQLGGLHSAKIILYSVDFHEIEQLQAKGDWQTAAQLLSNAAISLKHAGAEVIVVCTNTMHKVADDIEAACGLPLLHIADATAVQIKQQGIDKIGLLGTRYTMEQGFYRGRLTEKHGIEVITPDDTDREAVNRIIYEELCLGIISETSRDAYRRVIKKLEAQGVQGIIFGCTEITLLVNAQDASVPVFDTTAIHASAAADYALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative Asp/Glu Racemase from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Isomerase
molecule keywords Putative aspartate/glutamate racemase
total genus 85
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ojcA01
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ojcA02
2DGDA 1JFLA 3S7ZA 2EQ5A 2OHVA 4B1FA 5ELLA 2W4IA 2VVTA 3OUTA 5HQTA 2OHGA 2JFYA 2OHOA 3UHPA 2JFVA 2JFZA 3HFRA 2JFUA 2DX7A 2ZSKA 2JFWA 2DWUA 2JFOA 1B73A 2JFXA 2GZMA 3ISTA 1ZUWA 3OJCA 1B74A 5HJ7A 2JFQA 1IU9A 5HRAA 5IJWA 3S81A 3UHOA 5ELMA 2JFPA 3ISVA 2JFNA 5EVCA 3UHFA 5HRCA
chains in the Genus database with same CATH superfamily
1JWBB 2QN8A 3GJ6A 3LBAA 5CVCA 3FDZB 4F85A 5IVPA 1QORA 3PD1A 1QFZA 4BJ5A 5AW6A 4XDZA 3CGWA 4PYJA 3AMVA 2BUBA 1S1MA 2MSWA 4MUNA 3WLNA 4AZTA 2MR5A 4WY5A 1JHMA 1OASA 1XF1A 5AW1A 2V96A 3FETA 3OEHA 1XNQB 2JARA 3OE4A 3C14C 2FE4A 2RB5A 1HY3A 2G5CA 3TZKA 5EJ4A 2IV3A 3AF6A 3W34A 3WMGA 3RHTA 3JYPA 5AWFC 1NU8A 1UMCA 4O2AA 4YGXB 4BC0A 4OHCA 1NVFA 4M9ZA 1PLKA 3FZGA 3DMDA 5AUQA 3U6BA 5DN9A 3H1PA 4YQZA 2OFFA 1CUDA 3UW3A 3ZW9A 3HDYA 3Q1KA 4ZI5A 2C2MA 4JEMA 5GINE 3IQXA 4ARAA 2BTOA 1NU6A 1JVNA 1TQ6A 4KFTA 2R65A 4DJDC 4HDRA 1R7RA 2JRCA 1IWOA 2H57A 1U6IA 1KDPA 2NNLD 1IC6A 2QM3A 3GF4A 2OHGA 4P9NA 1XG5A 4HATA 5IN4A 5LA6B 1I32A 5CH3A 3THYA 3HR8A 1JFFB 4FMDF 4IXDA 1QR6A 2ISSD 4ZVVA 3U81A 3T1HB 1VGRA 1Y4ZA 4D74A 3AR2A 3HO8A 4LYGA 3ZE8A 1UK7A 4F8EA 1OLSA 1HDGO 5IM4F 3LHSA 4EFNA 1IN7A 4MP3A 2IYEA 5CX1B 1VBFA 4MWZA 1JNYA 4R05A 1V6SA 2W6OA 1N2JA 1AUVA 1POWA 1KJNA 2ARKA 2HZ7A 4BUJA 4DJAA 5ITVA 1R0RE 5L8VA 1ECCA 2COEA 1UINA 1SC4A 4ETMA 2DBYA 3ENZA 5EJ8A 2C4HA 1KYTA 2AFHB 1H6DA 2Y9MB 3VR4H 3ZJ5A 3FNRA 4HMQA 4N12A 5JCOC 2HN9A 3CSSA 4F4CA 4DVGA 3M6IA 2CDRA 2HRDA 4D9IA 4PGGA 1OXSC 4C7MA 3ACCA 2ZTVA 1MQ9A 1Z75A 2WSIA 2WU1A 4KQWA 1C7EA 1QYVA 4OM8A 4WDQA 1BC5A 1P91A 1NNLA 3ADPA 3IESA 2R96A 1G2OA 3DF9A 1Y3BE 3SDSA 5JPIA 2AC2A 1X42A 3R7NA 4LOHA 3K6SB 1VCHA 4P33A 4YAOA 3ND6A 1UC8A 3VVMA 5JV5A 3S81A 3T5PA 5LBTA 3ROXA 1D0VA 8AT1A 5FADA 2ZG6A 3H97A 4HTFB 4R2XA 1VG0B 4NV0A 3HMQA 2HJVA 1VI6A 1LZKA 1R6UA 2Z8ZA 3EMKA 1KZ1A 3QEOA 4N6NA 3TZHA 4BYMA 4E32A 4HDNA 3NOXA 5K3CA 1U8EA 4EJ2A 3HLTA 4KGVA 4DANA 2IY9A 3KYDB 1BMDA 1PEYA 3WSTA 2B1RA 4QU5A 4FFBA 5F78A 5CBPB 1EUQA 3WWYA 2J9FB 4WZ6A 3EXG1 3TLMA 4B6EA 2OGWA 4H0NA 5BOSB 4DAOA 2GN1A 4L75A 2WSYB 3E9RA 1TYBE 2CBZA 4RD0A 4TXJA 5G0WA 5TRTA 3BA1A 3T5MA 3VMMA 2C3OA 5ICFA 4BLUA 4X45A 3AZPA 2IBTA 4Q6WA 5F5NA 4B31A 1MJHA 4JJ7A 3TRJA 4GQAA 3DKVA 4DSOA 1SXJE 5B3JA 2GRJA 1J1IA 3I2IA 5MN5A 3WZ2A 2PJRA 3I04A 2QTNA 2C4KA 4D8UA 4XVQA 2PWBA 5B36A 1EVIA 5ALXA 2QVCA 2AEJA 2VZEA 3O91A 4MV5A 1L5SA 1USKA 2HU8A 4NAUA 4LC0A 3NU1A 3VPBA 5EUBA 1I7LA 1XZQA 2JCGA 3TOZA 4BNUA 1G17A 3AVUA 2I9KA 3D3QA 4G0OA 5HKAA 1N9GA 1PL7A 3PVCA 3V3TA 1JDBC 2YXDA 4LSMA 5JR3A 1UF9A 1JNXX 1QF7A 3BBLA 2AZTA 3PIRA 2NVUB 2CFOA 2PZMA 1NURA 4OH7A 5JNUA 1YK0A 2ZP1A 3O4RA 1A97A 2W90A 2XVMA 3CLKA 3O90A 3KXIA 3VKFA 1MRSA 2CNLA 4XWGA 1D7AA 5FWAA 2C9CA 1U8CB 3UMBA 3R24A 3ZE9A 2CMKA 1V16B 1FNDA 4ZQCB 5HZMA 1XEFA 3CPEA 5I9IA 2GN4A 3GXBA 4KMOA 2EJTA 3OH8A 2NYRA 5KKAA 1ZU5A 2I66A 4MUHA 1RIIA 1Z0AA 3BPSA 1TFUA 4M1ZA 1BCSA 1GPBA 4W5HA 5MGBA 4HRAA 5EKSA 1L5KA 4YO7A 1YR6A 3C8HA 1DX4A 3JQRA 2OKGA 2PZLA 4NAHA 4YA6A 3PXCX 5EFZA 2J4CA 3ZQKA 4B9EA 2WIJA 5AVSA 1P4GA 5CUQA 2W6JA 2IPOA 2Q8NA 3HJNA 3ROFA 3VR3D 1U5CA 3IE1A 2WSMA 1TM3E 4BCCA 4GLJA 2BZ0A 2YBEA 4MGIR 3SSMA 1QGUA 2GZ3A 3UWMA 3WGZA 1E3SA 3LRTA 1Y33E 3MMSA 2W6NA 3H8SA 3HYRA 5G53C 1CZOA 4ZOBA 4X20A 4WXMA 3TL3A 3TNJA 4GE3A 3EFOA 2AUMA 4ALJA 4CIYA 4IR7A 4QYMA 3UMJA 3FRHA 3HNPA 1KRHA 1ZZEA 2WZQA 3GCDA 3KHKA 1KAEA 3AUJB 1IHYA 2BTQB 2I6XA 4JUCA 4OQFA 5DO9A 1SC3A 1KSFX 5J43A 3P96A 1AQIA 3OZEA 2CXUA 1ESEA 4C43A 2D0OB 2VH5R 3DFIA 3ANSA 4GUDA 3UG7A 2GASA 3RASA 2PX5A 2ATIA 3DTTA 3QVJA 3V8NA 2YS6A 3VR6A 1NQXA 4QDOA 1J8VA 1DQYA 2IYQA 1V39A 4FMBB 2VYQA 3AV0B 4HZGA 1PX0A 4RQBA 1OXVA 3WGTA 3TPCA 5FA6A 1E1QD 2IL1A 3RH0A 1IQ0A 4UDNA 3ZWCA 4OYRA 2OG2A 3T1YB 3CWQA 1JPUA 2Y1DA 3C3BA 4HAXA 2Z3WA 3RWMB 3WB1A 3AM4A 4CIAA 5JSHA 1RYDA 2AYYA 4PPFA 2FP4A 2WIFA 3C98A 1U9IC 3EAFA 3E05A 4Q9HA 1HK7A 1J24A 3JV7A 5D8DA 2OK8A 2CVOA 3E27A 1M1ZA 1G38A 2XXAA 3LC7O 2BMJA 1LDMA 1LPMA 3UC9A 3R5FA 4F4HA 4DV1B 1GN8A 5B6JA 4B3IA 4I9FA 1RBQA 1OB5A 4NZMA 4X8MA 4DEYA 4RYLA 1NDQA 3KEQA 5JE8A 5ALRA 1AF4A 4HWRA 3VR6D 1KDTA 1Y8CA 2AOUA 2I55A 1SKYE 4J0IA 5DASA 3SNHA 4AG6A 1XEAA 1GLVA 1QWSA 4GMGA 3TOCA 3X2FA 3W04A 5FAKA 3PVSA 1QB8A 3CJTA 1J20A 2HSWA 3D3WB 3OFNA 2C3PA 2VHJA 2FW9A 3F4LA 2O59A 1EPUA 2DUMA 1IUOA 2XUQA 5AYVA 3CVYA 3QEAZ 1VXRA 1MR3F 3UAGA 3WVNA 2ZB4A 2ICAA 2WAXA 4AWAA 4Y0NA 1JLRA 4KQGA 1FQOA 3VI3B 4D2IA 4DA0A 3P7MA 3V97A 3A1WA 3KS9A 3Q6NA 2AW5A 3PGA1 4OD0A 4XZ3A 1P7WA 3R7AA 5HKOA 1KVSA 1QFYA 5K45A 2DH6A 2OQIA 3MK31 1I01A 1E61A 3OKPA 2GBPA 4KE7A 4Q02A 2AA3A 5K09A 3ZVRA 3FYCA 5G0SA 4CE6A 2VK4A 4P7JA 4CHTA 4EVRA 3E18A 4YCCA 3R6GA 4P3KA 3THXA 2OZLA 2R44A 3OF3A 4OKSA 1EP2B 5DXJA 3SEQA 1EUZA 2Q7DA 3FPBA 2C8LA 3I45A 3FZNA 5JZ9A 3MAJA 5BR1A 3N74A 2Q6OA 4ZRNA 1UOEA 3ZE1B 3IP6A 1MA0A 4IIJF 4YP0A 3UWDA 2G9RA 3GROA 1L2TA 4O4IF 3IDZA 1T9HA 2ZUVA 1EQ2A 1R10A 4DSZA 4ZRMA 4TMWA 4IIFA 2QE7A 3AB3A 2PANA 1BO6A 2FUNB 4EG0A 1L4KA 1P4AA 1Z7WA 1P2BA 1BS2A 4U0KA 4UVGA 4B34A 4O2AB 4IX1A 5KNLA 3K70B 1Q15A 5BSGA 3FLEA 5EGSA 4R69A 5F51A 3FPGA 1JIJA 3EZ7A 1EWTA 1UQUA 2OV3A 3GJ0A 4JSTA 2JBAA 1JG7A 3HKEA 3CLSD 3BB1A 1DOHA 1Y82A 3QF4B 3UUFA 3ZHXA 5FUXA 4NCAA 4OXNA 1UJ2A 1XTIA 1MO2A 3T3PB 1S3IA 1JA9A 4NG5A 2AEMA 4JL6A 2VT6A 1UDXA 2CWWA 2REXB 1SN7A 2W2PA 3HJCA 3TR6A 1OWNA 3TAXA 3WBJA 4D9HA 4YV7A 2RIRA 3U7QA 2WA1A 4MJXA 1IN6A 4BB5A 5FWNA 1G8PA 1LQ2A 1YUNA 2LDBA 3DHYA 3KAPA 4YMGA 5T5QA 1XRSB 4DJFC 5IU6A 4QGAA 3JTMA 2QAGA 1UPFA 2BGTA 3D6VA 3CH5A 5FKJA 2E5LB 3RS2A 2ET6A 1KQPA 3AXTA 1PCXA 1EKXA 2DUWA 1W5FA 2DTXA 1N8TA 2FPPA 3FPHA 1ZSNA 3CUTA 3K32A 4JX9A 4DMMA 1AHHA 5J40A 4BBAA 7ADHA 3LXMA 1FLDA 1CQPA 3R5JA 4D3ZA 4KIUA 2CL5A 5EWJB 2FG7C 2CNWD 3KEFA 2L82A 2HJ9A 1U8XX 4W1PA 1KYVA 4RXMA 1ZI6A 3USES 2PUCA 1I2MA 1SC1A 1C8VB 3G68A 2DCUA 2RBEA 3OZTA 1Y5NA 4UHHA 2R84A 4ATNA 4CLOB 5FEMA 2DVMA 4BS9A 3BWMA 3KB8A 1JW9B 1FA9A 3K30A 2JAHA 3OTHA 3L6UA 1IL0A 5CR9A 4FEAA 2ETXA 2BHNA 4G6ZA 3Q15C 4HDOB 5AKZA 2ZJAA 4J2TA 4XI9A 3WQBA 4EVIA 4CKEA 821PA 4BGUA 4BNMA 5ALHA 2IZ0A 5H1YA 2HQRA 4DM3A 3H0EA 3B9BA 2QUAA 4XIGS 1P72A 4NEHB 1KAOA 4PFJA 1MAUA 2BFFB 4HDKB 2JASA 4LVUA 2QKYA 1VGQA 1RQGA 5CVJA 4YMIA 4A2WA 1F6DA 3V7WA 2C99A 3TTXA 4B4DA 3TFOA 2E4YA 1THZA 3A3KA 2C8VA 3G0DA 1BX3A 5FBZA 2PO5A 2VQ6A 3NVAA 1G7TA 4ZI3A 1KQFA 2HHAA 2VH2A 4UVEA 4ZK6A 3ZDCA 4NFYA 2W2QA 1DKOA 3IBGA 1JXOA 3ZD8A 4HTAA 1DBIA 2RGDA 4GZ5A 3U3OA 4E5VA 4EYKA 5ICMA 1RWXA 3KQSA 3FW1A 5JJBA 2OBYA 1QKKA 1JE1A 3CKYA 2HA7A 1OKKD 2WT9A 1YBVA 3KR9A 4EHAA 2ORYA 4WPGA 4JP5A 4JODA 5HDQA 3VPFA 2QPOA 1AXEA 3KPYA 2GAJA 3CH7A 3DLBA 4PIMA 1Q1QA 3FOEC 3HZHA 4EI9A 4X8HA 2XB9A 3VSAA 2CCKA 1RXSA 3PGVA 1ZRSA 5DM4A 1WB9A 4AICA 4LX8A 4DNFA 8ABPA 4JEHA 1NWCA 1U8YA 1FDVA 4CMBA 1ODFA 3ZUPA 3T9BA 1TVMA 3JWJA 4QL3A 5TGTA 1FQJA 3HO1A 2XTAA 4HNGA 4LRQA 3H6GA 2QTHA 4MEJA 4DV3B 4LKOA 5COBA 3QPCA 2J45A 5AJVB 2C9BA 1UMDB 2XQFA 4BAZA 4ZDKA 1F0NA 1CEEA 3PJEA 3RI3A 3E2PA 5LM3A 2FFQA 5CT4A 2W42A 3T54A 4JL8A 3ZCUA 4CF5A 3M5CA 2HJWA 4ENSA 1YB5A 4KMMA 4XRRA 4BNGA 4FTWA 4DMRA 4LJSA 1O0SA 2CSUA 1ZAYA 2NXNA 1TKCA 2EW2A 3EAQA 2P40A 3EBLA 3TZLA 3PA8A 1HOXA 1ORDA 2BRUC 3FD8A 3H4MA 4GOKA 5IF9A 3OTQA 4MDHA 3THXB 4RV5A 4IKEA 2Q7XA 4S1OA 3AOEC 5MFPA 2P30A 4HNTA 1T1JA 2ANBA 1TTPB 2X3YA 3C43A 1R6AA 4PNPA 4F2DA 4BAGA 2A3NA 1P45A 1Y6JA 1K06A 1OTYA 2VDMB 2AF4C 3L82B 1V8BA 4RF2A 1URPA 3NBMA 5C37A 2ZDHA 3D4PA 2QGNA 5HJ2A 5TSDA 3V1UA 3CU5A 4MDEA 2DJ5A 1FSSA 2IHUA 3NKFA 3OQNA 5FOXA 3PIDA 4E12A 4N41A 1DTSA 2HNKA 4YH1A 4UTRA 1LA2A 2JBHA 4LCJA 3UMRA 3F67A 1X7WA 3GC6A 2BP7A 2Q1TA 1RBYA 2EC5A 3HRIA 3AEZA 3EXG2 2D5CA 2VDRB 3DLIA 5DIFA 2VP4A 3JQQA 1RBZA 3IELA 2VEOA 3BHIA 1SNYA 1KJQA 2RHBA 3BD6A 2XRYA 4M8IA 4QECA 5EEGA 1J5EB 1RRCA 4UBJA 3UK2A 1ESMA 4LY0A 3ZN2A 1U9YA 4N54A 4ZTZB 4FMDB 3MS7A 2LIPA 4PWZA 4LA4A 4YGYA 4ZOCA 5K4AA 1AQNA 3RSQA 3ANYB 4GQIA 4BO7A 1UXKA 5K3OA 1FYWA 3HH8A 4RJJA 3KALA 3MTEA 2QLNA 4WT7A 1XPUA 1EXWA 4Q39A 2UUCB 1P74A 2X9LA 4AMZA 4Z5XA 5TF4A 5K8JB 4LPSA 2J87A 5G02A 2GHIA 3RABA 4B6GA 2F8TA 3GLFE 5ULLA 1G3UA 3LDGA 3W8FA 7MHTA 1DV1A 2AX3A 2NVUA 3OQVA 2QZSA 4Q7EA 1XBTA 1G98A 2H08A 3IMKA 3Q7RA 2ZAMA 4NEQA 2WB2A 1GZ5A 2ZI6A 4GEKA 4E1VA 2VI5A 4D96A 1PS9A 4AJ4A 4OHPA 5IABA 1IHXA 4EY4A 3C8UA 1U9ZA 3H5WA 3W9SA 1F6BA 3FCUB 1FU4A 1P29A 3IBYA 3OETA 3UKDA 2J32A 1DU4A 3VI4B 5IXSA 2YJGA 1I4OA 3T3DA 1B4DA 1Z3CA 1NMSA 1V37A 4I4TF 4N6OA 4DMHA 1WXWA 2OL4A 4MVJD 4ZMBA 3HVKA 4Q7KA 1Q7RA 1ZD9A 3HHEA 3FY4A 1VSUA 2X7JA 3QKRB 5CVDA 1V8ZA 3FX2A 4NH0A 5JHHB 1EMDA 2DR0A 3ENVA 3LXXA 2FLWA 1PV4A 4W1QA 5LP6C 3EFOB 1HWYA 3FXAA 5DDIP 1J4AA 5SZKB 3VC1A 4BFWA 3FMFA 1R1DA 3DT8A 1OFIA 1KY3A 1WY7A 1EAYA 1HOTA 3P0JA 3NR2A 2P4HX 3MAAC 2GCOB 1L3CA 2XUIA 1BVUA 4I1RA 3SXJA 1K66A 3L7JA 1J0DA 1U9IA 1M2FA 4KVGA 3WIEA 1FYDA 1NR1A 5DCWA 1J39A 2XTNA 2EW1A 4HEA1 4KSBA 4G9BA 3N0XA 3LYHA 1YI1A 1MEEA 2QIOA 2DQZA 1T5HX 2HCRA 4DR6B 4FN5A 4FFLA 5L9AA 3I58A 1SKMA 2WUFA 3TRKA 3AVXA 1U7ZA 2XF8A 1V8PA 1N0WA 3LC0A 4NOKA 1JV2B 1QBKC 2XE6A 3AL0C 2PZEA 3GRZA 4OEHA 5SY4A 4RORA 3FH0A 1S8AA 2IXBA 3U7GA 1IZ0A 2DUJA 4HAOA 4LZAA 4PS0A 3T9EA 3V42A 4ZTUB 5B12A 1JMVA 4QM7A 1C1HA 4TVBA 4S12A 1H3FA 1XXHE 2O3JA 3E9DA 3THOA 4QTYA 3OZDA 3CNBA 3P0HA 4G8CA 2JCBA 2G8NA 2ONYA 3VHXB 1U04A 5AVUA 4MTLA 1E4VA 4NTZA 4X95A 3WWOA 2YVKA 5BMVA 1N2CB 2JIMA 1P6QA 2RJNA 5E7JA 5FPYA 3WYBA 3H42B 2NO7A 2IELA 3JWPA 2CZQA 2XMPA 3BG5A 4PBTA 1NMEA 1XZBA 3P52A 4OB7A 1ZNQO 4AL4A 1N34B 2JGMA 5KTTA 3TKYA 1P1FA 4GM1A 2YJ4A 1C7RA 1C8KA 2XD9A 1D9ZA 2BKXA 2JKZA 3IHKA 2MYUA 4OB6A 5HQJA 3KOYA 2GSWA 4F3RA 2X3UA 3R7BA 1RMQA 1R5BA 1IXZA 3AP1A 1PFGA 2VJCA 3LYLA 3GH1A 2C2GA 4KWHA 4KR6A 1Z4QA 4EUEA 3COSA 3AIMA 3UT5B 4YO8A 4PICA 2XAAA 2AHRA 2F3PA 1Z2AA 4GMKA 2RHGB 1M66A 3ZCQA 4EJMA 1GPJA 2K4MA 5B1HA 2YXPX 2AOXA 3NIBA 4HDRB 1ADBA 1HQDA 5ISMA 1XP5A 2C59A 2H63A 4K6OA 4B83A 2AG5A 1IFXA 3U7QB 4QDJA 1C9JA 5IC5A 3VYTB 4XB2A 5ED0A 2CUZA 2Y1WA 1B0UA 2J08A 4PRZA 4GL2A 4YN3A 4BO5A 4BUCA 1YQTA 5ALVA 3KQPA 1CUWA 5E9QA 1D2CA 2PX4A 4LZWA 3OE1A 1Z88A 3ESDA 2VWGA 4HGQA 1R9MA 4NESA 1YU9A 4F04A 4PVDA 2ZB8A 2CV1A 3QNMA 1X9GA 4CMIA 3MCTA 2I2DA 3PQ5A 1W1UA 3CLSC 2IPLA 3D8SA 3X2SA 2XCOA 3KVOA 3ABOB 1QYXA 2BEUA 4YPFA 3WNDA 1EXVA 4RPIA 5KQSA 4HNAB 3NATA 1NTRA 4QICA 3T7DA 4DEVA 1T26A 2ODPA 3CRQA 3QOXA 2AG1A 5CDYA 5J9FA 4AJJA 1QR2A 3BGDA 2J5BA 1BU5A 4Y2UA 5B4TA 1KP3A 3GCGA 1RI4A 3EXFB 4HDKA 1K6MA 4AVYA 4AECA 2OAP1 4MKHA 2P2YA 1GJRA 3H4VA 5KNCD 1BA2A 2CXRA 4FYJA 3O2SB 4H7FA 5FOUA 3SQOA 3D31A 2QD1A 4P86A 1FIUA 4GSYA 1VPTA 2Z6AA 3USZA 2Q07A 1MHPA 4JLJA 4NFSA 3TEJA 3I9JA 4UJ3A 1XJQA 5HTKA 3EVAA 3A31A 3THWA 2YFHA 1K5DA 4YRDA 2GEKA 4QGHA 4C5AA 4O0MA 3RSLA 1UZAA 3NM5A 2FFHA 3NHSA 3SR4A 1W6UA 3JQFC 4ALLA 3FOCA 2ZQ5A 4ZD6A 4NECA 2I7DA 1JF8A 5DMXA 1PS8A 2O8FA 2JA1A 3GB9A 1V8DA 1ZCZA 3P26A 4OQZA 1PYOA 1Q95A 4U2DA 1PR1A 3OWOA 1AKTA 4HZUB 2WJJA 1YZYA 4UDYX 4DMGA 1A5AB 3N05A 5C1PA 4BPBA 4M1YA 4K6HA 4V0LA 4C20A 4GC9A 4IILA 4MR9A 4MW9A 4GX0A 3PJRA 3IDOA 4WBNB 2QMQA 3KKLA 2VC2B 5AESA 4PPNA 1ADGA 1QQAA 1NLFA 1COZA 1V3TA 2TSYB 3AETA 5L3RA 2D1FA 3MJCA 4E5YA 1I2CA 3NTLA 2GBFA 5K7SA 2AH5A 3ANLA 3LOUA 3ZHCA 3BMOB 4Z4FA 2ZJ8A 4S05A 3S2EA 3F6SA 1Q92A 3BJEA 5CIWA 2HV9A 1I2BA 3DHNA 4XIFA 3ZHTA 2IS4A 3WL5A 3HUDA 2QZ9A 1RYZA 3L0SA 5DKFA 3BULA 2JFNA 5K6TA 3H8WA 3I52A 2HRCA 1GD1O 3M83A 1FW8A 5KYUB 1E0KA 5DLDA 2DHCA 3L8HA 4M8SA 3IBSA 5MGNA 2M98A 4PZYA 1WF6A 2GHRA 2R7NA 3JALA 2BCGY 2J30A 3FCAA 4YUWA 1K92A 1WXQA 2X15A 1X70A 3IAAA 4D4JA 5JS7A 1ID1A 3S0JA 1FX0B 1WEKA 1CX9B 3UOWA 1T9CA 3CLUC 3DNFA 5EHGA 4CLEA 1G5RA 3SYLA 4E2ZA 4WVFA 4CCYA 1LGYA 1P5ZB 4NI5A 5AOBA 5IG2A 3SXUB 2QM7A 4C30A 2ZUDA 4K7JA 4Z49A 1M7HA 4HRYA 2Q27A 5EFOA 3COYA 4O4HA 5COQA 4QUJA 4HLUC 3HUFA 3DOEA 2GXSA 2Z5GA 1YAJA 1NXXA 2V65A 3A4YA 5EZYF 2FQQA 4H77A 3ITDA 4P2GA 4MI6A 1THMA 1LV7A 4IBOA 4ZGBA 3R0IA 4G89A 1QGUB 2RK3A 4E5UA 1NA5A 3T99A 1E89A 4QEDA 4XCVA 3VJMA 3FUWA 3KJFA 4DRXA 2QP9X 5ECWA 4C08A 3OQIA 5JBNA 1AV6A 1DL5A 4N7JA 3QBTA 4DCUA 4EUNA 1GA1A 1D1SA 1KO4A 2O8VA 3PNKA 1D0SA 3ND8A 5C5CA 3ZCVA 4ZEXA 4C4SA 4JU9A 4HEHA 4D3DA 8ATCA 5CDHA 2X7XA 4B2LA 1IJEA 1L1RA 3FWKA 1J49A 3LXRA 1A9QA 1AGPA 1UWKA 3L2OB 1DCTA 2PMWB 1VE5A 2L42A 4ZVNA 5I48A 2QLTA 1CP2A 4V02A 4BE9A 1ENPA 4MR9B 3QVXA 5B30A 1GTMA 4FHGA 4OI4A 3R41A 3LUAA 4PHHA 3P4XA 3WKEA 4EPWA 2JK0A 2HCBA 4B76A 3C85A 2C4VA 2P8JA 2PYIA 4PW0A 1WX1A 5F5XA 2FW6A 3GRYA 3PT9A 2PMEA 4A10A 4ZIRA 2QQFA 2A2ZA 2PUJA 4CMGA 1W36B 1EFPA 4QIHA 4RJTA 4RIFA 5LOVF 4ZGWA 5JJ5A 2VP5A 5M29A 1X7ZA 3DBRB 4QAJA 3I5XA 5JW6A 4Y0VA 4NCIA 2ZJFA 4IH1A 5F7OA 3BQMB 3P5SA 2JLSA 2XYGA 3QXXA 4JVNA 4G41A 3UWOA 3T0GA 4LFAB 4B6FA 2B69A 4R2MA 3UHFA 2W48A 4HGRA 5HE9A 3GPDG 3W5DA 4E21A 4EFMA 2OHVA 3SDZA 1ZH2A 2YNMA 4DG9A 2ZYSA 5F4ZA 3PD7A 2H2HA 4UMVA 3IEPA 5KQLA 2Y1OA 3DE4X 3HP1A 1Y1RA 3PRHA 4M6WB 4I55B 1SBYA 1LV8A 1R27A 4RSGA 3AU8A 3QQPA 4P83A 1ESNA 2Y2UA 3SZRA 1LLDA 5FWDA 2I9PA 5JCOA 1XSEA 4N49A 3ORFA 4OUKX 3JPYA 1L5HA 3VHLB 1CQZA 1YZ3A 4YDHB 2OYRA 4R31A 4KOAA 3I30X 3LOQA 1QP8A 1EEXB 1X39A 3ESRA 2WLSA 3QJYA 1NNI1 2J3QA 1MU0A 2TMDA 1ZOLA 2ZE6A 4ZO7A 5FBWB 4GI2A 1PFYA 3PX3A 4LS3A 4WOPA 4ND1A 1HKHA 3WRYC 3G1UA 1F2UA 4FYPA 1GPNA 2PV0A 4IZIA 3DW3X 5TVKA 4EQ6A 3CN9A 4RU1A 2XR1A 3BFXA 4CRWB 5MHTA 4OFXA 5KREA 4ZAVA 1FNSA 1B15A 4FOTA 3TIIA 5K0BA 2HBRA 3O8OB 1VKOA 1W88B 4O1HA 3B6MA 3EUFA 4HOYA 5A4FS 3R0QA 4F60A 2G4LA 3EZ9A 2HR1A 2VK8A 4G0YA 3P32A 2FN4A 2H65A 1VE3A 1E1RD 2WNHA 8LDHA 2BKLA 4DDWA 5C35A 1FK8A 4GOND 4WOKA 5LZ9A 3FNEA 1MFPA 2WWHA 3CPSA 3DAHA 2EF1A 2HU2A 4BL5A 4BVLA 4BLSA 1WWKA 3X1KA 1EVZA 3B1WA 1L4FA 3TL2A 4KN8A 2XUFA 4G0XA 5JATA 1IB6A 1NQWA 2PQMA 1Q57A 1Q6YA 2OFPA 3G0OA 3IPRA 3PVZA 1ZG3A 3AZQA 1KEKA 4B75A 4OJMX 4BNHA 5I4CA 4XLLA 2POQX 3K1TA 1YL6A 3LUFA 1DBVO 1GPWB 1U0LA 3GEBA 4P8RA 4GKJB 4V0QA 4YAEA 3OBBA 1PR4A 1V71A 2GO1A 3NUZA 4B6OA 1IUKA 3MRVA 2Q1YA 4YMLA 3GG9A 2NU7A 2GM4A 4AT1A 1IQUA 2ZM5A 1NPYA 3I23A 2DFKB 4IUYA 1KERA 1JFFA 1C3LA 2AJCA 2A67A 3N2ZB 2OG1A 3UICA 3LW7A 4DPKA 4Q3BA 3GGSA 1ILWA 4E70A 1W5AA 3CF2A 5JSYA 1E6KA 1GA6A 4HKTA 4NHEA 3CE6A 1J90A 3QOWA 3KB2A 3RYFA 1G20B 3RAJA 1Z5NA 4Q4AB 3OT1B 4KIJA 4YRCA 4EHIA 1EVKA 2E1RA 2ODEA 4P3NA 2XCTB 3RTDA 3PWZA 3M2PA 4FHZA 2F59A 1SWVA 2NU8B 3UXMA 1LZLA 3EFHA 1X80A 3F4BA 3RIXA 3SZUA 4WA8A 4Z1OA 2DG2A 3FG9A 4NMXB 2DKNA 1UM8A 2H54A 4FXOA 5KTKA 4C01A 5FFFA 3W5UA 2FPKA 5LXTB 2VAXA 2OQRA 2FHPA 4F2PA 5DEIA 1Y1LA 4HNRA 3TLCA 3TVDA 1PZNA 3QKSA 2YUIA 4B6JA 3CUSA 5ADUS 3A28A 1G8JA 3AR5A 2GCOA 2Q4RA 3WY9A 1LNQA 1WDWB 2ID8A 3G7SA 4I1UA 5DHRA 2AJDA 5EIFA 1GPLA 1UBEA 3N5CA 4JA0A 5DNEA 5F73A 4GOMD 1PN3A 3D1VA 1M0TA 1B6RA 2HCTA 2F43B 3C4JA 3KLNA 3Q6MA 3GAFA 1XAGA 2GJ8A 2HNBA 4RUKA 4RXUA 4YQEA 1G1MA 3T1NA 4X3PA 3O8OA 3R0VA 1BKDR 2I87A 2EEZA 3I6MA 4OHKA 2FRDA 1K3UB 2XBMA 1G9TA 2AFIB 4MDFA 3PUXA 1DPGA 2OGUA 1PTJC 5EJ2A 5BO5A 4DIMA 4DFDA 3HJTA 2BJHA 2ZAGA 2UVPB 4KXUA 5SZIA 5TS3A 5KSYA 2NN3C 4K0RA 4L0QA 2DMRA 5JNTA 1N9KA 3AKYA 3MLAA 1U7XA 4Q9AA 5M2QA 4CN8A 1NKSA 4BTLA 1OFHA 2DFDA 2DFPA 2C92A 3QLUA 3RTBA 1Z56C 4ENQA 1U8ZA 4Y6LA 5D7NA 5JSFA 2C00A 5B58T 1I94B 3QEMA 2B30A 3OEED 1FP4A 4R3NA 2GERA 4R40A 3O94A 1UEJA 2GUGA 1U0TA 1VRVA 5CLQA 4U0JA 2RHDA 3VZCA 1AJEA 3ESYA 4DCSA 1DWUA 4KXYA 4Z8YA 1QP4A 5AHKA 3H5TA 1OXXK 3C7CB 5KJ6A 1CETA 2G1PA 4BLQA 3ABIA 3K20A 4G0UA 1KIAA 1RRVA 1Z0FA 4UCWA 2DY1A 1O03A 3H84A 1R9NA 5I9SA 2PS3A 5JLJA 1J07A 4DVJA 1KMIY 1T9DA 2VUHB 3AF2A 4GI7A 1FL9A 1E8MA 4DG8A 1KAGA 2HMSA 3DVLA 1N6HA 1V5IA 5FR1A 4OBEA 4GGMX 4FS8A 1ULHA 5JTUA 1RWPA 5F9MA 1RRFA 3CZ4A 3D8HA 1HYHA 4JI3B 5CLFA 1C3JA 1OLXA 3IPCA 4DW8A 3EGDB 5DCYA 2BVNA 4LTDA 1JHOA 3DBHB 4OSEA 4EPXA 5KDOA 3TQTA 3OIYA 3ANTA 2YVQA 2ZI9A 1K7YA 2ENWA 3H11A 3NVDA 2PLNA 1XDUA 3EH1A 3TZQA 3VJRA 3QFFA 1M33A 1WUJS 2OCAA 3L4JA 5CT8A 2ES4A 1L7QA 1C4XA 1QK5A 1QO9A 3IXMA 3NVMB 4QBTA 1U90A 5K2OA 2ZI7A 3W77A 2X8JB 2PXHA 1E96A 4H15A 3C1UA 4YDSA 1E1CB 4QC2A 1DAHA 3B8HA 4ZVQA 3WFJA 5D5PA 3WLOA 3Q7EA 4MGHA 3ZIUA 1XWFA 4CUJA 3JAMA 2JNWA 3DE6X 3I83A 2H4HA 3EWNA 2ZIAA 4UXHA 1NM5A 5EKDA 3ZCXA 2CUNA 5CYPA 5LQJA 4IX9A 3OI7A 4RKFA 2A9VA 1EM8B 1NPDA 4X92A 4Y67A 4ZO4A 1UKEA 2XNKA 2G0TA 2Q3CA 3T7TA 4HB3A 2GKOA 4NXNB 3JWHA 4JP1A 5AKGA 5K0FA 1AY0A 1RYYA 3T38A 1H2BA 2VXYA 1D2EA 4M89A 3TRFA 2ZAIA 3ZBUA 3LUHA 3L7CA 5GJWC 3C6MA 5H3LA 4CU5A 4Y6OA 4C6HA 1EINA 2JLWA 2WFMA 1NHGA 2GVNA 4IXNA 3GEEA 4JS0A 5D3ZA 4BWFB 4HAWA 3WLEA 2OSVA 5TQ0B 1XZDA 3TAHA 4Q1BA 1RLIA 5BWMA 2DOKA 3V4FA 3GLIE 3RVLA 3SN6A 3KOXA 1P4JA 2V7TA 1PEDA 1PIWA 5JI3E 3NM4A 1W0JA 5FI5A 2CNWA 2QRKA 1ZJJA 3EY9A 1QPZA 1S2MA 2HXYA 2UUBB 4ID3A 1L5YA 2HLNA 2WFLB 3R75A 3S4YA 2A1TR 4EY5A 4LF6B 1ZMRA 3PFWO 4G85A 5DXFA 2AX4A 1R4MB 1VDMA 2QUKA 2WMNB 1BTOA 1IPHA 1YS1X 2A59A 1MB2A 2HBQA 4PBSA 3AOEA 4NLLA 4ZVOA 2C07A 3I1IA 1H69A 1COWD 2WD8A 2WHPB 2ZAYA 1Q0PA 5E6RA 4NBWA 1U5AA 3BE8A 3HU5A 1BXZA 2ZANA 3NPMA 4P36A 1KE1A 3DJYA 3CRVA 3QRWA 6PFKA 4LXIA 3OZFA 4HRVA 4PE5B 3TMAA 1Z8FA 3MJFA 1YQWA 2LUOA 2GYVA 3A9TA 4IFBA 5B1SA 3LQYA 3ZHUA 4EGJA 1XZNA 4UEOA 5EP3A 4U6SA 1CNMA 3E9EA 3H1BA 4NMLA 1WMBA 4OQXA 3UF0A 4MWOA 5EA2A 4BNWA 2C2OA 1XFAA 2ID9A 4JVSB 3F6EX 1QH1B 4FQ7A 2GPNA 4PQFA 4UAVA 1I1QB 4Q3KA 5EWMA 4IRMA 1CHDA 1RHKA 4U7JA 3WK8A 1P1JA 3NDIA 3S40A 1ZJ5A 1NW9B 3JCZA 4JJ4A 2GHQA 2C2HA 1H2RS 1TRHA 2P9GA 5CCDA 1YIOA 3A70A 4MVJI 1CD5A 4WK4B 3HN2A 4LMRA 1YF3A 3H6HA 4O4JA 3H2JA 4PBRA 4UEWA 4C29A 4CVNA 2F8LA 2Z09A 4ER0A 1YRHA 1PDOA 3QOFA 3ZWPA 4G9EA 4EKDA 4OAOA 4TKLA 1CUZA 1T5IA 4TTTS 4RETA 2IT1A 2XXBA 4FNOA 4JITA 4WK2B 4BC1A 4EJSA 1W0KD 1XU4A 3VV2A 5H82A 1OXBB 4Q21A 3OP4A 1TZMA 5JH7A 5HQTA 4B48A 1KVTA 3HCDA 1XXHA 3DDWA 4TWAA 4Z0HO 1PQWA 1CQWA 1EUYA 3UENA 3HM2A 2J0QA 2FMFA 2WM2A 3CNEA 3D7NA 4LE1A 1QWOA 3UMCA 2JLAA 1UFQA 3BZWA 3VGJA 1UAGA 4EIWA 2XB8A 1V2GA 5EP4A 3C8DA 3RFCA 4J2HA 3N39C 4UEQA 4HH3C 1U1FA 1QVAA 2Z83A 3EIXA 5HS6A 2WJZB 3MGAA 4MP6A 4TSRA 4Y3UA 2IYTA 2PBZA 1SXPA 3C6XA 2WG0A 3V1TC 5L51A 1FJXA 1AN0A 1OZ0A 4O4JF 1FCJA 1TQDA 4AZVA 4YP7A 2GBLC 2AS0A 1RYFA 2D3WA 4ER7A 4JUFA 1TYEB 2HRQA 3LU1A 1SULA 4K3VA 2VRCD 3C74A 2VJNA 2NU9A 3GLTA 3HGMA 3VDQA 4CL8A 1O9GA 3ZDAA 1PE0A 4IWYA 1OR8A 3FBGA 4RE6A 1GTG1 4NBNA 2FZVA 1L5LA 3ONFA 5FO1A 1A4XA 3UJBA 3HBMA 3PHCA 3F2IA 4HLUA 5F2OA 4O4LB 3L1UA 1XQ9A 3M3HA 3VPHA 3SICE 4DKJA 1HMYA 2UZ4A 2BBTA 2R5NA 2Z1MA 3KLOA 3IURA 3VKHA 2A92A 4ZO6A 1ADYA 2VRWA 2JAQA 4BQOA 1WO8A 4DR7B 3KTFA 4GC5A 4EHHA 4TV9B 1CUYA 1IY8A 2R66A 2FSUA 4ZMSA 1AZLA 4NATA 5FAXA 4AF8A 1TIBA 2RHOA 2OFWA 3DXYA 1KHHA 3W1VA 2P6PA 2J0UB 2YHIB 3C7DB 4MCAA 3D7LA 1LJ8A 1WQ4A 4KWTA 4NV1A 1YOVB 2QIPA 4IDDA 3H5IA 1THGA 2OO7A 1EP3B 1Y5LA 1RPZA 1CJSA 1EFHA 1TK3A 2CFCA 5HFNA 3C4VA 3WJ2A 1PKEA 2ACWA 4AQDA 1SQGA 2PQ6A 3H8JA 3E3LA 4JT9A 4M83A 2XF2A 2PDAA 1T9GS 3CLVA 1PL6A 3GDWA 3Q0IA 1KQ3A 1TMOA 3EGVA 1L8LA 3CB4A 2PE5A 2YZMA 4HQFA 2FPLA 1W5BA 1EB9A 4FBLA 1ZS9A 3QVGA 4Y6RA 2JHCA 4F2HA 3G9ZA 4MAAA 3LKZA 2UYQA 4FOSA 2I0FA 5EPEA 3K0EA 2RKOA 4IOJA 1EX6A 5C53B 2FJPA 2IX9A 5LP6B 2L0XA 2RK6A 3D6TB 3M81A 4AX8A 4CT5A 1F8FA 3U4GA 3PC8C 1XP8A 2AT1A 1BQ3A 3DEIA 4OL9A 4R2KA 3EGEA 3GJTA 5DHUA 3CZPA 3HEBA 4NQRA 3W06A 3G9UA 1VJTA 3GT7A 3O8BA 5IJ9A 2QLMA 1B7GO 2CLDX 5KPJA 3KKOA 3IT2A 5D51S 1D5WA 3IMEA 1RMYA 1NRIA 3N76A 4K9OA 3SEFA 4AJOA 4Q4AA 4YYZA 2OM6A 5CPBA 5E7IA 1NLYA 5C3UA 1M6HA 3M89A 4R8SA 1SBZA 4HXYA 1QVZA 5BMOA 1Q20A 1QF6A 3M1IA 1O77A 1MV8A 1TEHA 3S7TA 1ILEA 1RLTA 5J1TB 3WAKA 1KDOA 2IF2A 2IOFA 3GMDA 4JR2A 1UWLA 4MEBA 3AJEA 4G9GA 4EA7A 1QH8A 4R8VA 1GNPA 3B6ZA 5IDYA 3SPXA 3TI9A 2Q3BA 2GLXA 4FX5A 1ZD1A 2ATXA 2XYQA 3AG6A 3FPAA 3JRNA 4HLQB 3ZI0A 3NWBA 5IC4A 3GIDA 2PKXA 3LCRA 2X5OA 3VKWA 4QUGA 1YB6A 4XSHA 1K2VN 3EDOA 3HCRA 2IITA 4AF6A 1XD8A 1RWVA 3BD9A 5K0ZA 1M2HA 4LRTB 3KCNA 1ZGCA 2O8CB 4ZV9A 1X1DA 5JZSA 4RESA 1T9ZA 3MJTA 4EG7A 3FCSB 4WDRA 3GPLA 4OHZA 1XLVA 4NS4A 3RAGA 5KIAA 5AK5A 4DIDA 3PEWA 3ZGYA 2YKGA 4DBLE 1ZUWA 2XYVA 5EQFA 3WRYA 4A82A 3P9IA 4MVJH 4B3RB 2C2BA 1CZNA 3ROTA 5I51A 1KOGA 3D7KA 3E7XA 2GZ1A 3ET5A 4G86A 3TSOA 5BQ3A 1CKEA 4DLAA 3A1UA 4ZQHA 1BE0A 2GTHA 2F9LA 5AM5A 5THQA 4KQJA 1E4EA 5DLPA 3RTAA 1J8DA 3V2HA 4X6LA 4UPEA 2DH5A 1W36C 2RONA 3RRFA 4L02A 3QWFA 2V7PA 3DPIA 1YULA 3IDAA 1XEWX 2HDHA 4R9SA 1KBZA 3BMNA 3SYMA 4B40A 1ZM2A 2IBMA 4PFQA 2BH9A 5LNK1 2BHSA 5EIHA 1JZSA 3ZGVA 2WMDA 3FMIA 3A2MA 3R0ZA 4XYEA 4I2NA 4R9UC 1QH0A 4CIWA 1MBZA 1LXCA 2PQ0A 2X41A 3AWIA 1QG6A 1A8UA 3D7MA 3D4IA 1XUOA 3TRDA 1I1NA 4RGVA 1XQ6A 3CISA 1N5IA 2G17A 1M2VB 5SZHB 4OUDA 3NBXX 5A5VA 3U60B 3L4BA 4HJXA 5DSZA 1GPYA 1G8SA 3LKVA 1JAZA 4RCVA 1U9CA 5EJ7A 2X58A 2MMCA 5IVKA 2QHXA 4B3JA 2C7RA 2O8DA 3CH6A 2J9ZB 2ERXA 1KS9A 2JF0A 2NADA 2Z5FA 3EIOA 3DULA 1MB9A 2P2GA 3GT0A 4IDBA 4Q0MA 4XYMA 3DCIA 3PDWA 3IB3A 4H3VA 3T1QA 3I37X 3PRYA 3QYFA 4NVRA 3H8VA 3UA4A 1SVKA 2X0NA 4UMEA 4DIKA 1QLHA 4ZCMA 1PZXA 1QCCA 1QQTA 2WNSA 4N03A 4NONA 5IYZB 3AM1A 4HNQA 4I81A 1HRKA 4I6GA 2XNDD 2CHEA 3FZEA 4KEAA 3O4HA 2QVZX 5F1KA 2V6JA 1W1WA 2QD4A 4ROTA 1Z6QA 1RWNA 4X63A 2GESA 3P2JA 3MB8A 1QCDA 2XMSA 2GTIA 3QFSA 4WI1A 4YS6A 1VFPA 3LKBA 1RC8A 2W8ZA 5A05A 5JANA 3S2YA 4H7KA 5L4LA 5KQPA 1NOKA 2NVOA 4D1YA 5LOVB 1KIFA 2FJ0A 4M1WA 2J5QA 5AM3A 4GPIB 4CFSA 2QTCA 4PXAA 1RLMA 3PV0A 4UOZA 1II8A 2AFRA 3V1LA 1KRWA 4Z0PA 3VO8A 1EQUA 2H7YA 2ZSKA 2P2NA 1WCV1 4OI1A 3ZDQA 3H9CA 5C8YF 3W5VA 4LZNA 4R6WA 521PA 4GXTA 2JD0A 2P9EA 3U1TA 2XPCA 1VHJA 4ZO9A 3KOWA 5BWLA 5ER9A 4UZFA 3DL7A 3NDPA 4M60A 3ETLA 1JEQA 1RI3A 3B1VA 3EB9A 4XPIA 3CR8A 3L41A 2LKCA 4HWGA 4AROA 5ENVA 5ESDA 2DPLA 1QK4A 1ND6A 2JAOA 1WCYA 3EZFA 4LC9A 2EGUA 3NHZA 4LXQA 4YJ3A 4PGFA 3C6ZA 4JYMA 1G20E 1XMIA 3CC8A 3QV1A 4P81A 3CHYA 3SJ7A 3WDKA 4BB9A 1YIAA 4IIBA 4C0BA 4F1WA 5ESRA 1RM4A 4IHQA 1VM6A 1YRLA 2PXXA 3MLEA 1JLHA 3TF5A 1KSJA 3PT5A 1NVVR 2R8EA 4ZU6X 3A3YA 3MTAA 4CZ2A 3O3CA 3KUKA 1A5TA 1DBSA 4H16A 2NGRA 4JQOA 4PX2A 2ZYDA 4F5WA 2QS9A 4XYGA 4LJYA 1QG4A 4C2AA 3UOAB 3SS7X 3LE8A 4G07A 1SOWA 2C5BA 3H87A 3V8RA 2D4AA 1FEZA 2GAFA 5FWXA 1ZZGA 5JWHA 1WXEA 1SXJD 1VYUA 1PWZA 4XJVA 5F76A 4LJRA 2EJBA 1ZCBA 4I8XA 1EBBA 2ZDGA 4Z7JA 3K70D 3DZJA 2GPAA 5KYUA 2CL0X 1VBKA 4JXKA 2JATA 2HU7A 3C1AA 4HD8A 2P0EA 4TWJA 4ALIA 5AQ1A 3DTVB 1A9OA 1Y8QA 3R7LA 5AI5A 5B3LA 2H8GA 4LF4B 4QU8A 1N6KA 4AZ0B 2X8AA 1U0OC 3OMXA 4WLVA 3EX7C 1SUCA 1YQXA 4LYYA 1IJFA 1AO3A 3BJRA 3QXHA 3JQGA 4DR2B 4JMPA 5KPDA 1KI2A 1X1CA 2E18A 4BQFA 2P79A 1I3MA 2I8AA 3TE6A 1T8SA 1N2SA 3NGLA 5FNZA 3KJZA 3RV3A 1WW2A 4C03A 2D1YA 2GYWA 2QAGB 1QAMA 4GWKA 4G2TA 4FWIB 5KX5F 1RVDA 4RJLA 1LK0A 1Z47A 5CDFE 4JOCA 3A1EA 3ORQA 2BBOA 4AY2A 1U28A 4TMVA 2GA9A 4IJMA 3W5AA 2RAUA 3PEYA 3FYUB 8GPBA 3MUOA 2AEEA 4FEEA 1SD2A 1ZWKA 4E22A 1QHHB 3DTNA 1FNMA 2GXUA 3D1JA 3RKRA 1Y3AA 1UFKA 3JQAB 4AYWA 5IJWA 1HA3A 4DC0A 1PS0A 4OG2A 5T67A 4KTTE 3OM1A 2BUAA 3AVPA 1XEWY 5AOCA 3A8TA 4JB0A 3O4GA 3U16A 2VPWA 1GARA 2WSSD 3AR8A 4M1QA 1E77A 2OILA 1VSVA 2E85A 3ITNA 3RIHA 1TPZA 2NSJA 5JY6A 1G2QA 1BE6A 2OVFA 4RCZA 1W4CA 3LPMA 3AR4A 3FFBA 1VB5A 1Z7EA 5GGYA 3EVTA 2NUTA 3RT1A 4JJKA 3TW8A 3COZA 3KYBA 2PX3A 3Q7TA 4ZVTA 2VUSA 4EHJA 1YCDA 1KH2A 4PHGA 4Q1EA 2XNJA 2O2EA 3VO9A 1LBEA 4L5BA 1CZHA 2GR9A 2IIVA 1EX7A 4YRBA 2A1IA 4RPHA 1EM8A 5A9SA 1GEEA 2LTAA 2BW0A 2J3IA 2VHQA 4WZAE 1R50A 5BW4A 4ZI7B 1OD6A 1L0BA 3NAQA 2PSFA 2FMXA 3VDNB 3FKJA 2ZBQA 3TXAA 2HMVA 1YR2A 3BOSA 3UGQA 4Y1FA 2VTDA 1YFZA 2ORED 4LWPA 3EG5A 3STVA 3HKDB 4Z8XA 3JD2A 2XVXA 3T7EA 5JUWA 1JILA 2BGIA 2G82A 3X1JA 1GVHA 2O8BA 2CWDA 3DLCA 3M1LA 4JJFA 4PSKA 4PX3A 3C7AA 3FNGA 1DTWA 1JG3A 2VHUA 4X44A 1GAJA 2A0KA 2NLOA 1OREA 2POCA 2XX3A 3JQ9A 5CTJA 2QLLA 3EZ6A 4BOYA 2XV1A 3HVIA 3BEOA 4LOIA 5E6RB 4DLKA 4ZYWA 1ANKA 5ECDA 4ZVKA 3O4FA 2JHGA 4UW9A 3IUYA 4FSHA 5ITZB 3IT1A 4CKXA 3L49A 4P84A 2XEDA 2W6QA 1PBTA 3OA2A 5G3YA 4CEJB 2DBQA 1PQYA 2VUTA 3FUTA 3K53A 1UK6A 1Z8DA 1Q17A 1UJNA 2WJWA 5ERGB 5HBGA 1UPCA 3K1JA 3VBCA 3JD1A 4MRVA 2F62A 3SS9X 4FJ1A 4PO1A 5AM2A 3M4YA 2ZRKA 4KKXB 4INAA 1GAEO 3NV7A 4WXEA 5DNAA 4AZ0A 4F11A 2VWQA 3QKRA 1P7PA 3MTGA 1YZQA 2REQA 5JI2E 3T6KA 1B43A 2AN9A 1VI5A 2HYDA 5BYAA 4YY3B 3W2TA 2BGJA 3GJYA 2Z95A 4KXQA 2H16A 2XY4A 1WLYA 3FB4A 4H4DA 5K0LA 4D3XA 4YCBA 4CLDA 1A5ZA 3L8FA 3BICA 1M1YA 3U1VA 1LNSA 1CUSA 5CNIA 4KPGA 2P9BA 4URYR 3VTAA 4YAJA 1TUBB 1GYRA 3LD9A 4BCDA 4B17A 3KUUA 2ZSIA 3CEAA 1WEHA 1Z6AA 1H9BA 3GUCA 1EX9A 4E5KA 3LF2A 3L6BA 4D44A 4MSUA 3AI7A 2RH9B 1IM2A 1ZRHA 3QPWA 4LG1A 4JT2A 3MUNA 1HE3A 1HBJA 4MITA 4D9JA 4GIBA 2GETA 1I7NA 1G19A 2ERCA 2GK6A 4R1NA 3L7OA 4PG7A 3IKVA 4RZXA 4A03A 2EP5A 5L40A 3IXLA 2WSBA 4NHOA 3EMBA 4QUEA 3R74A 1Y3DE 4G8BA 3KKPA 4QGFA 4TZ0A 1YDGA 2CNBA 1Q84A 1BMQA 1MUUA 3ITKA 4GZ3A 1VJRA 2XTJA 3CRRA 2ZIFA 4IEFB 1AUPA 4MR8A 5JD3A 3L18A 3TBHA 2Q4EA 4KBFA 1UZNA 2W2OA 2WWRA 1YA8A 3TCKA 1XAIA 1QIEA 3M4XA 2ZRMA 1KF0A 1KP2A 4XH9B 3U3MA 3K9BA 4HT3B 3GGCA 4IKOA 5B2ZA 1BXGB 1XQXA 1KMNA 3MWEA 2QORA 3ZYZA 2GJKA 2PKQO 1T4GA 3B6KA 5KU7A 4US1R 4IF4A 4QO7A 4UM7A 3RC8A 3EA0A 3O73A 1HE1C 1ICEA 2QGFA 1XZEA 4Q93A 3TTTA 3CX3A 3VU3A 4KV7A 3JAKB 3NMUF 1KH3A 5CRIA 1WPXA 1L7XA 1EFTA 1W8DA 2N46A 3QBEA 2A0FA 4G0QA 1YQUA 2PXAA 4PQRA 4TOIA 5FBRB 5FPTA 1CE8A 1G8KA 4HR7A 1V7CA 3IJEB 1YR8A 3ONVA 4XFDA 3J81k 2FP3A 2IZ1A 2P2LA 4M9XA 1N7JA 1V8FA 4U02A 1EYZA 1EZ4A 4N76A 3OFJA 4U00A 5E9WA 2BSAA 4ZYYA 3WYGA 2DPGA 4EUFA 3OECA 4N40A 4XUEA 3RU3A 1ADCA 1H9AA 1REQB 4LHEA 3RKSA 2G1UA 3PYLA 2DFTA 4PEVA 2EP8A 1M10A 1WXDA 3EMVA 4FC7A 1HG0A 2JLQA 2PKRA 3M6UA 4GEGA 2Y1LA 4LHXA 4RA9A 1IMJA 3IKTA 1GM5A 3I6YA 3OCJA 4A8HA 2VRNA 3DGFC 3K0CA 5CH5A 4YV0A 2XWBF 1EU1A 3EG9A 3EBPA 4G23A 2H51A 4PLWA 4REOA 4TSKA 4YLGA 5EERA 3A4MA 3PXEA 5K03A 1VYHA 2OHHA 3T5GA 2P41A 5KS2A 1B1AA 1O58A 2IXDA 4JYCA 2XB6A 3CN7A 5GONF 3PXGA 3T35A 3L93A 4FW8A 4D8XA 4GM0A 2GNPA 2H2DA 1VFNA 4ZOAA 1N2EA 1AX9A 2DGDA 4E2XA 4XQ9A 4FYIA 2Y1GA 1SO8A 4K87A 4XB6B 3HE3A 4R8KA 2ECFA 1OX6A 1W44A 3K1ZA 1R5NA 5BNZA 3V8QA 3A6HA 3UN1A 3L02A 1VQ1A 3ER6A 2ZJ3A 1Y98A 3GU3A 3PC2A 4UUAA 5EAIA 4YUYA 3GDGA 2C98A 4KRFA 1UBUS 2E2WA 3E3AA 4O33A 3L40A 1SIOA 3WYNA 2BGKA 1E2MA 1MORA 2A1UB 2FDXA 3H19A 3TBKA 5BSWA 1F0YA 1FLNA 3A9UA 1H93A 1ZD8A 1HL7A 2R8OA 3WISA 4BMVA 2V5VA 1V2HE 3DLTA 4FYVA 1V4NA 3HWWA 4HDMB 4LRSB 5AW5A 5KBYA 4F38A 3COJA 4M0CA 1IBSA 2HRRA 5B1DA 4J3FA 4G1VA 3OZSA 4GBED 4NU0A 2QU7A 4MQEB 4UNQA 1C1DA 1XTVA 1JQBA 2HWKA 3DBLA 4PIVA 3IPLA 5I01A 4Z51A 5BNIA 2AR0A 3LGSA 1P5HA 4F91B 2B4AA 4IXTA 1J23A 1UBRS 4J0JA 5FUVA 2HB6A 1CR0A 1KOJA 3SGLA 4ETIA 3I1FA 1QRDA 4F1JA 2ZI5A 5EKUA 3QW4B 3UGKA 3WS7A 3C3CA 2PGAA 2Y0BA 1P0IA 1L1FA 3ILYA 5H3HA 3V2IA 3DT6A 1MJGM 4JSRA 2HIGA 3HPRA 3I39X 5EI5A 4C89A 3FVRA 4IIHA 5CLLA 3FTDA 3E7PA 3H3XA 5EKTA 1E1KA 3OX2A 4IFEA 1RAIA 3WBFA 5CW2A 4H1VA 1Z15A 4C4OA 3S5JA 5HUQA 2EX0A 3S29A 2YN2A 2ZYAA 1SUFA 1HLGA 2ZRPA 1DBRA 3GYBA 3GFSA 1REQA 4MYDA 1UBMS 5ALKA 3O8RA 1QH8B 5EEHA 1TUBA 4Q3OA 3Q9NA 4UXIA 3HDHA 3R40A 3OJXA 4TS9A 4A8TA 4ZVPA 1UP4A 2QLBA 1JEDA 4OHFA 1QS0B 5DP1A 3TYXA 3TW6A 1J0EA 1X19A 2Y05A 4N5MA 7MDHA 4J49A 3LGXA 2G80A 4CMEA 2J3KA 1UFVA 5FJIA 2XZTA 5ITZA 1V3QE 2O3SA 2BOVA 2IHNA 4GDFA 4CL2A 3B89A 4MB2A 4G24A 5CT6A 4P0TA 1JPVA 4WACA 5DPMA 3G82C 3ASVA 3SVZA 5DGTA 3R1IA 3LPAA 4C4AA 1RQ7A 1N57A 1ZMBA 3KEGA 1K7SN 4XPZA 2JC3A 1Y9JA 5EGNA 1OV4A 3QPUA 4WEOA 4PG8A 2VP2A 4R54A 4P4GA 2E21A 4TL6A 2QYOA 1GXSA 2ASEA 3OFVA 2X2PA 3TIVA 1DCMA 1KY5A 1VBNA 3OM0A 4L3OA 1L5HB 3HQ4O 2FWIA 3K96A 1J70A 1ZNYA 3N2YA 2JVKA 5A9SB 3FCOA 3B3AA 2FWRA 1EFVA 1DXHA 1U7HA 2YV2A 4TYNA 3OFND 2HLHA 2Y3IA 1DC3A 3UTDA 5I8WA 5K4HA 2J67A 5G3ZA 5BXYA 3A6FA 4QDUA 1SFRA 3HKDA 4XWWA 4QXQA 1MP0A 3DL4A 1JFLA 3BH6A 2V74B 4QFMA 4JGGA 2JI6A 2ZWOA 4IQFA 3RK1A 4B8WA 1KPHA 1RE1A 2J4DA 3D0RA 5FH9A 2XIQA 3E8SA 4NL4H 2A4KA 2VAPA 1WSAA 2CDBA 2CEKA 4GXRA 4G65A 5SY9A 3WXMA 2QA5A 4N48A 5B1IA 2FMIA 2HAEA 2BD0A 4BNXA 1IXRC 3D2BA 5TMDA 1YB7A 5JYCA 2BRUA 3KAJA 4A26A 3HI6A 1FU8A 4BDSA 5JAOA 2JIRA 4RJKA 4TUYA 4ESVA 1DRKA 5K5EA 5FI0B 1CV2A 4ZDJA 4JUBA 3GP8A 2QQ0A 2QRHA 3A32A 1NBME 2FV8A 2HV8A 2WP8J 3RVJA 2N47A 3KOMA 4S0ZA 4AB1A 4MKGA 5ES4B 1E0SA 3R4CA 4UTXA 2FSIA 3D3WA 1N8NA 1SUEA 3O8DA 4MKXA 3UQYS 1JR3A 1KTVA 3B48A 3BMCA 4COKA 4OJQA 2ISCA 4HXEB 1K27A 3MWLA 3PHBE 3PDIB 2RGNC 1G0NA 3KQQA 1F2TB 4Y7DA 1LLFA 3QU4A 4GS5A 2RD2A 4PLVA 4CV2A 3BQ9A 4XDGA 4XDHA 4HGNA 4AUMA 1C41A 1PSWA 3G9XA 4GWGA 2JEOA 2B3TA 5EP1A 5IANA 1UBGA 4XUDA 1KGDA 4A8PA 1U7DA 4N7BA 5IK2A 4JKIA 1JDNA 3X3HA 4NJEB 5DLQC 5K05A 3WQQA 2Z5VA 5TB5A 2VDNB 3RS5A 1F2VA 3WHLA 5EXEA 4JJEA 5CVEA 4Q37A 1VLMA 3SKVA 1K4YA 1X2EA 5AVOA 3GHYA 1WDKA 1U02A 1ZX1A 2P1ZA 1X7XB 1V45E 2HMTA 5BMVF 3BSWA 4ND5A 3T8YA 4N65A 3DWEX 1FJ2A 4N01A 5HG0A 3SBOA 2WU3A 2P5YA 1SHZA 1CJVC 2HCFA 3FYSA 1RJWA 5D1HA 4D6XA 4DHWA 2VDQB 1R6XA 1JAIA 1KY4A 3PFGA 4JYPA 2BEWA 1NSYA 4M0FA 3ADKA 2D7DA 5FXMA 5KJFA 1GLNA 1CY4A 1NLZA 2VJDA 2Q4BA 1KJ9A 4FYMA 1JLLA 1XQYA 1VPEA 4BX2A 4F84A 1YS9A 2OY0A 1N2IA 4PLYA 4TRMA 3F9IA 2QN1A 4IMJB 1QYCA 2FN9A 4BVGA 4GUAA 3WGLA 3WMFA 1Z0KA 1IEXA 4LYFA 3KLPX 1NUUA 4AMVA 5NLLA 1SB9A 1GL3A 4I9HA 2NNWB 2BZ1A 3EBOA 3KTAB 1Y6ZA 1QIMA 2WWGA 3UK0A 2BFOA 2Q5FA 1ZA1A 2J3EA 1NKTA 2ZT7A 3GCZA 3NFRA 4FCCA 5ALTA 3S1SA 4AMBA 3LL4A 1IN8A 1MB4A 2BEUB 3GAZA 3EEIA 1J9GA 3MJDA 3QKWA 4OJKA 4EJ0A 1PFWA 3OUUA 1SBNE 4KQFA 4QYWA 5KSWB 1GT6A 4MIEA 3DDSA 4L0DA 3A4TA 1WDMA 3NHUA 4GVLA 4LF7B 1NG1A 4C7OA 4CYMA 3U09A 1FP6A 4MI1A 3JATB 4CQJA 2NUPB 2VSOA 3LFHA 4LHVA 1M54A 5L3VA 1NIPA 3HZZA 4BVEA 3KYJB 1TVEA 3IMFA 4M55A 1ZO8A 4JYZA 3F5MA 4TPKA 4E15A 1X0XA 3S28A 2UZ1B 1F5NA 3H86A 3WGJA 3OQ6A 1MNAA 3PJDA 5IBQA 4TYYA 3F7NA 3Q85A 1ZIOA 3DC7A 3B1ZA 4Y9RA 4A2PA 2AOWA 1FUUA 2V4UA 2X5KO 2HGZA 4GYKA 2ZBGA 1R8XA 3C6BA 1GZ4A 4YCLA 4TLCA 1W36D 4JLAA 2W6PA 3GA0A 4O0LA 4QYXA 5H16A 2I6GA 2A86A 4EEXA 1BDHA 2TRSB 1EHCA 4ETNA 4CKBA 2O8FB 2C0CA 2ATEA 5T3YA 4HVCA 4QOEA 4LZLA 3SEAA 1T3HA 4YPOA 5FNVF 3TGLA 1KAQA 3UPDA 4B3CA 5K8LA 4CXMA 1I1HA 2HA6A 1TIKA 1XQ1A 3MLBA 3WIUA 3VU9A 4C07A 4EO7A 5F21A 1WP4A 3EXAA 1PU2A 3HJBA 1XL1A 4PSAA 4QLAA 4RFVA 3VJLA 5JPCA 3F6PA 8OHMA 1R0SA 2DQKA 2JGRA 2QUJA 3SE0A 4YXFA 4UM8B 3R5SA 5LYYA 4MB0A 4BJ6A 4KN5A 3OQOA 3Q4GA 5IF3A 1MIOB 4Q4HA 1EWQA 5C7LO 3HM9A 2UYCA 1Q0ZA 4AF7A 4M9CA 5T4HA 3OEYA 5LWQA 1NW4A 2JGFA 4WY2A 1D6JA 3WK5A 3IDFA 1ZNZA 4MJ3A 1Z4IA 2FQWA 1A69A 2G67A 3H9UA 1M34A 4MIOA 3I4LA 5AUOB 2AG0A 3ND7A 3JVDA 4X20B 1GNQA 4L95C 1GPAA 2RCYA 3QLVC 4PGMA 4TTVA 4CKWA 1G6HA 4KSYA 4ZV4A 1XRLA 1XMQB 2LCFA 4V3CA 2P78A 2ZJ6A 3K6JA 3G2IA 3WRVA 3W3AA 1YUBA 1YCFA 4XEUA 3BCUA 2VHWA 2W71A 4DQUA 1KSGA 3ZCSA 1RKQA 3DFFA 2D2FA 3DYIA 1GNTA 2V3VA 5AI6A 5DWDA 2R9VA 2O7SA 1G3IA 3KOUA 1G5FA 4YV2A 3ELUA 1H3EA 3B13B 3LIIA 1YBAA 3MPOA 3SMQA 3MCUA 4Q9LA 3ZDFA 5F23A 5I9LA 2I65A 1OF1A 4GF5A 1HT1E 2D0DA 4ZKDA 1P2GA 1T1GA 4RL6A 4RANA 1A7KA 1XTQA 1MHTA 1HE5A 3QITA 4G5QA 1IMOA 3SBEA 5KTRA 2FSVC 3U48A 5C3MA 2CE2X 3LF1A 5E4TA 4MEAA 3EPJA 4G0WA 5IDVA 4EG8A 3OBIA 3TIXB 1OB2A 1TLFA 3ZI4A 4L4ZA 4W7HA 2CBGA 2HWYA 4BO3A 3RC3A 4KR9A 2JGDA 3RAEC 3R8FA 1BROA 4I4NA 4HN9A 3UCFA 5CDSA 4GPZA 4R9VA 4AUKA 3DDHA 1J5PA 1G7CA 1E2GA 4KAXA 2VJMB 1MEJA 3W3AD 2QW8A 1N78A 2H9AA 1E2NA 1SVUA 2ZJ5A 4KBGA 5FUMA 2GN2A 4FW9A 1ELOA 3DV0B 4DMUB 1O08A 5ELLA 1BG6A 2J1LA 4DMFA 5KAMA 4M0MA 4TTRA 5LOVA 3RSCA 4J4TA 3IEUA 3AM5A 1ECLA 3DONA 4RW0A 3BS4A 4P31A 3ECCA 3VNUA 1T5OA 2QDKA 2A0UA 4IH4A 4J07A 4LTMA 3JVIA 4D0RA 2ZIVB 1XYVA 4F1KA 2B78A 5HDBB 1WUTA 3KC2A 4KVAA 2GZRA 2WV9A 3CNLA 3MWJA 1JL3A 1NBAA 2IXEA 2R8XA 4EKNB 4WJLA 5J4LA 4DMKA 2RJ3A 3F6YA 4LDZA 2Q4OA 3OOSA 1L5VA 4NBTA 3OJ0A 3U7JA 3KQLA 3THYB 3QELB 3Q8XB 3AKDA 5AW4A 2ZTLA 1UFRA 2V7QD 4NC9A 2QG4A 2ZUBA 4XGQA 4RGBA 4D3FA 1Z4PX 4PVCA 5UKDA 2CBXA 2JK1A 3S5UA 2MHCA 5CAEA 2BJWA 1RZVA 3FI0A 3L1KA 4LJAA 1KDZA 3ZWKA 3R9WA 3TB6A 4KGDA 4L8WB 4N5NA 3ENKA 4JQCA 2VT2A 5JJLA 3IAEA 1O87A 2PH5A 3MJRA 4PZ9A 5HYVA 2TMKA 3LCMA 2WVGA 3B2EA 3H5AA 1NUPA 3O6VA 4Q01A 3FROA 1DG1G 2DFLA 4E51A 3PQ8A 3NHMA 1UPXA 3KZMA 2H4XA 1NUQA 2RKBA 3DB1A 1KO5A 3R5XA 2DLNA 4HPWA 4LYDA 2JKYA 5FIUA 4JLKA 1C50A 1T13A 3Q7IA 4C4YA 5LMZA 1QP0A 1X8XA 4JI8B 4KFCA 3DVQX 4P5EA 5LP1A 4B46A 1OU4A 5CIYA 3AF5A 3LLMA 5EXTA 4S2UA 4KVZA 2V0NA 1N5RA 3NJ8A 1A9TA 5IHXA 4I9NA 4OLFA 2OA0A 2YJ3A 4L85A 4L4XA 1JUDA 1P2SA 4JNCA 4DA6A 4E1BA 1G64A 1C0PA 3DR3A 4N3NA 4ZJYA 2VS1A 2OXCA 4B3SB 1P77A 1XVIA 3T7IA 1G21B 3ZG6A 1DAMA 1E7MA 2YRFA 4BO4A 1J9EA 3X1WA 3ZGZA 1GCUA 3FLBA 3HI4A 4L2IA 4J29A 1A72A 1P39A 3FJYA 2XVYA 1YMQA 4L8YA 4BJHB 2HCJB 1XCOA 1OZHA 3OKCA 4RHEA 5ALPA 3OJCA 4EQ6B 2HSGA 4NENA 4RTRA 3D2CA 1Z74A 4UDOA 3U7RA 5CX4A 1YS6A 2OCXA 2Z4TA 1LF0A 2R3SA 1KORA 2QPLA 3BK2A 1W2HA 4A8JA 1JHVA 2R6ZA 4HJRA 4AMYA 4JLUA 4X66B 2JGKA 1CY0A 3RR2A 2XUZA 5GJCA 4IRUB 4RK5A 1ZNWA 2FZEA 4JT8A 4MVXA 4P82A 2GRUA 3T7CA 2E37A 1E99A 1O9BA 4V03A 4RTLA 1E3QA 3VZRA 4ARSA 2VF2A 3QJGA 1DJMA 1TPYA 4D3SA 1B76A 2NX2A 3DMPA 1ZK3A 2W8BB 4KDCA 2JD1A 4XD7A 4Q4HB 1Y34E 5AVQA 4ZCQA 5HFJA 1F1JA 3RUAA 1JALA 2PGIA 4LBYA 2PSDA 5AHOA 2BH2A 4OA8A 3KQNA 2W2LD 1DQPA 3ZYCA 5KYVA 3W7AA 1QH1A 1RXYA 5A3VA 1T35A 4DNPA 1DUVG 4NBSA 4YRNA 2AN5A 2PR7A 3LC1O 3ED1A 5M5BA 1QC5A 2HMAA 1ZA2A 3TEMA 3Q3CA 2JD2A 1OWMA 1KQNA 3HXOA 4DT1B 1DEAA 5I8ZA 4W5NA 4XKJA 3OPYB 1KC1A 2QE6A 2DUUA 3T61A 2Q3EA 4K6FA 1YZKA 4JUDX 2PRSA 4U5XA 5E7QA 4DCGA 5HX7A 4N9WA 4XWOA 2A14A 1SA0B 1N6LA 4E7PA 1T0BA 1T9AA 5JNVA 4E5MA 1PNRA 2DXIA 4TV8A 2HZBA 5C4IA 1ZC3A 4J2OA 4I4CA 4ZTBA 1HEYA 2R8BA 3GFPA 3AC0A 2PUAA 1AQLA 1GZ7A 2VYVD 4F9GA 3K5PA 4DG5A 5LA6F 2GFQA 4YBZA 1OAAA 5EJIA 3RO7A 4PIPA 3UWPA 3AUXA 3H2SA 4DDHA 3ZVKA 4Y2SA 1RXEA 2Q99A 2X4LA 4D4KA 4M1TA 1P60A 4TWZA 5CFMA 4V1CB 1U98A 3AF4A 4H35A 1UKCA 5EE3A 3UFBA 1F3LA 2UDPA 4B4VA 3K0SA 4OLBA 3M6AA 3BFKA 1OA0A 3MFYA 1P7YA 3Q6IA 2ZT5A 4R2HA 2PTGA 2A9QA 2CFIA 3JYHA 4UVDA 4TTSA 2ZCUA 3WAGA 5A3QA 3RYIB 1CG6A 5EP2A 2X42A 3O0TA 4FDMA 5JC1A 3TTYA 2O23A 3LSYA 2GS9A 4JA2A 3QE0A 4NNJA 5E6SA 1YHZA 3OAAD 1NQOA 5TXGA 4ITVA 4PFSA 2HQOA 2ZXEA 3FPLA 2O7RA 3TD6A 1ICIA 4XSVA 2P6NA 4BNFA 5D3KA 1I6LA 3B12A 4QXPA 2QVLA 3O0DA 4AN1A 3JZMA 2X76A 1CQIA 2YMMA 1P0PA 1O94D 3KKZA 5HILA 1QU2A 4ASUD 1TAHA 1V1RA 4YDRA 4MK4A 3ZPXA 5T7BA 4MUKA 1ZONA 4MR7A 2ONJA 3HCCA 4JI5B 3QVTA 2H07A 2PX6A 3SHOA 5JS1A 4CQLA 5LFAA 2WD7A 2XSZD 1U99A 3V4PB 2YV4A 4HNHA 1T3ZA 3DOHA 4ZJUA 5DFAA 2DHEA 1U2GC 3PLRA 2ZOSA 4O29A 4RHFA 3AFIA 3RJTA 3DOIA 4C1BA 3CBQA 4D9BA 3MHPA 3KKEA 4ND2A 4Q4JB 5FT9A 2XTZA 3FMGA 1CJCA 2A58A 1ZSVA 3IQEA 2IXFA 1VPDA 4HRXA 1DMRA 1VJ0A 4K46A 4OIMA 4XLTA 1VRCA 3DBHA 4XWTA 5EIWA 5KKNB 5I4KA 1YB2A 5EXDA 4GLBA 4LN1A 3KL4A 4IG9A 2G83A 1I2ZA 4DV2B 2Z4SA 5AM1A 3RF6A 1VB3A 4H3KB 4KR7A 5BUSA 2ATVA 2P9YA 4R8MA 3NORA 5E1OA 4NWIA 3TINA 3TQHA 1E2BA 3R6LA 1EGMB 2DBZA 4YLEA 2FPMA 3TN7A 2XT6A 3BFVA 4HEJA 4HWKA 1WKCA 5G4KB 3VSDA 4KOEC 2ZKIA 4LPKA 3N2KB 2LRHA 3HVHA 2R4UA 1KJIA 4RADA 2XIJA 1XDBA 1MGPA 2H3HA 3RYCA 1U11A 4NZOA 3TQSA 4KXVA 4OHMA 3VYUB 4OXYA 4X3CA 2R00A 1RTTA 2QTZA 5AIBA 4B73A 2O1SA 4Q00A 1WXIA 4JOBA 1NONA 1FVHA 3LPDA 3KVVA 3DMTA 1Y9AA 4I4LA 4X1IA 3WBKA 1NR5A 3B1KA 3SSOA 1PW5A 1ZXBA 2G70A 4FR2A 3VKVA 1DDIA 1QV9A 3JQPA 4B4OA 1OAKA 2Q45A 1JI3A 1ZK0A 2B1GA 2FG5A 3RS3A 3U3JA 1MABB 1TYDE 3WNQA 3VOAA 1IVNA 1RWMA 3GJRA 2R11A 1VJCA 5HM8A 4JUIA 2HGSA 3IX7A 4I50B 3DEAA 5JTTA 3OIDA 2OLEA 1NFQA 4JHXA 1LVHA 4ZAGA 2Z04A 5M3BA 4FBMA 3OKAA 1ZGHA 1VSQA 4RPKA 2GPTA 2L69A 3Q2OA 4GGOA 5HMMA 2ST1A 3ZZ0A 4BLPA 4YAKA 3LBNA 3E22A 3S44A 1YQQA 1JFRA 1HRDA 4IFTA 4A27A 4Z3KA 1MTOA 1V4VA 1YASA 3B7GA 3D3JA 3GI1A 1H6CA 1Y8AA 1KRXA 3KM0A 5K8IA 2DEUA 4MTCA 3O1JC 1AQJA 5I7VA 2YQ4A 3P0IA 3MHTA 1O9HA 2O1XA 3AVTA 1RWOA 1UK8A 3GVCA 3T4PA 4B7XA 3ZDRA 5HM6A 1QVVA 1S4QA 1P17A 3WADA 2XZOA 1K7XB 2FWMX 1BX0A 1XCLA 2YHAA 2F2TA 3HPQA 2CMHA 4FHCA 5CPFA 2OPHA 4OFZA 4JC4A 4BFVA 1NYLA 5IFKA 1E58A 4ZO8A 4HNUA 4WXRA 4WBNA 3IP8A 3ZS9A 4AZSA 3LHFA 3OU6A 3EY4A 2CZGA 2XODA 2QUZA 2Z2JA 4D9GA 1XTJA 4HS9A 4XAQA 3RT9A 4MV7A 1UKVY 2PG3A 4EW1A 1DO2A 1JDVA 4DM4A 3GUZA 4RVSA 3OUTA 3HBNA 3BEDA 4CNQA 1C1XA 3FYHA 3AZOA 3QZUA 3UJ7A 4KR2A 3K1AB 3D8UA 1S2IA 4PFKA 4EKYA 3JYOA 3LP8A 3P0FA 4RMNA 4LSGA 1M75A 1N0HA 4UBMA 2NG1A 4UFNA 5K3BA 1NVUQ 2BFMA 2Z4RA 3L6EA 3NBQA 1EA7A 3B1YA 3LP5A 5LUBA 2B5WA 5CB6A 2ADFA 3UJHA 3Q2KA 1SKYB 1O96B 3O1IC 4IDAA 1PO7A 5CP8A 1GDTA 2QMHA 3Q0TA 1N2CA 1WVGA 5LLTA 3S6JA 3H13A 1ZFNA 3KSRA 4HWTA 3QX9A 5TR9A 5L3QB 3NC1C 1TZCA 2Q5HA 3CURA 3QWBA 3EEQA 2GAAA 1QXSA 4KZPA 5U9CA 2HJGA 2WA2A 3KJXA 1D2MA 4MQEA 1N2CE 3HJFA 1L4LA 4JY7A 1VE9A 3CTPA 4DRYA 1OU0A 3PFHA 3P4YA 3RS8A 2Q8QA 1APBA 1O94A 4OHRA 2V45A 3UAOA 2EBUA 3TD2A 3R3VA 3ZV4A 3EDYA 3IUNA 3GFQA 4IJQA 2BHLA 4OM7A 4QOSA 3AHGA 2CXTA 1GPKA 4M3NA 4B09A 1C7JA 1E9SA 2O20A 3KIPA 4DYVA 3OU2A 1L7VC 2VSFA 4K6KA 1JKIA 1N8KA 4M49A 1KDVA 3TQRA 3LX4A 4DR1B 3F3MA 1K0FA 1G63A 3I01M 4R51A 5JPDA 5KOJA 3QLVA 4F45A 4QFBA 2JFZA 1A4UA 1XX6A 3KD3A 4URUR 1PJSA 4ZGGA 1Z6TA 3R7WB 2PT9A 4DGQA 4LY9A 2EWMA 3FHOA 1VXOA 5FQNA 3K9QO 4NCNA 1JSRA 4Q1VA 1N5MA 2EL7A 3UT6A 2L2QA 3FLMA 1DIOB 1GQQA 5ED4A 1LX7A 2AK3A 1U2SA 1MKYA 3BD7A 1IYZA 1WTAA 2Z57A 3OT1A 4MW5A 1V48A 3MWFA 4I08A 3IOEA 4KWCA 3D8BA 2W8BA 2V3WA 3CIFA 3P9RA 4LKRA 1AIPA 3RYHA 3ZZ1A 1M2EA 1X1EA 4QAQA 1QYDA 5KC8A 1XZPA 1E7SA 4JBIA 5DP2A 1NAHA 1NY5A 4KR0A 2PHZA 4G26A 2YICA 3H0CA 2JCVA 5ETJA 4B4KA 4DMCA 5C46F 3MOGA 1ODKA 3WLKX 3SJCA 4KNYA 3P2EA 5DRTA 4ZJPA 2B9VA 2EFYA 4XWYA 1BDBA 1V1JA 2HIAA 2PVPA 1KMHA 3ZJTA 1B14A 4KGZA 3P2OA 4OTZA 3INGA 1JKJA 3IB6A 3VR2D 5JLAA 3LBIA 4JVMA 2EAUA 3DZFA 1ZOSA 3B9PA 2OP1A 3LH5A 4OQYA 4OYHA 2A33A 1AB6A 2R1ZA 4EMBA 1D1PA 2YXBA 1FY2A 3D8NA 1KDRA 3M6WA 2O0LA 2RAVA 2CEAA 2FETA 3U4AA 3VOBA 4FPXA 1AQ6A 3VR3A 1RJEA 3RAPR 1BOOA 3TW4A 2BKVA 1IHOA 2BEKA 3MILA 1R6DA 3OZ7A 4KQHA 3PPVA 2F43A 1WPGA 1PYDA 1OLUA 3GT4A 1N0UA 3MJVA 5KJCA 5IJ0A 2HSJA 4FU0A 2IHTA 1XCMA 4FB4A 4MARA 5CXSA 1NULA 2DWUA 1IJBA 4DRXB 3TLXA 2P8SA 4M8KA 3SOZA 1NRXA 4LC1A 3I53A 3BBPA 1SVWA 5B2EA 3EAGA 4JBHA 4AS3A 3NRBA 4N8EA 5HWSA 3CXRA 2VBIA 4YUZA 4JXZA 2G5TA 2CMGA 2I4NA 1KXJA 3HGQA 3LL7A 1N2ZA 5JAIA 5FLEX 1J8MF 2FDRA 2BGGA 5IXYA 3HWRA 3JARA 2QV0A 4NULA 3UFXB 3CRNA 1ULZA 2B37A 1XMSA 1P44A 4MO9A 5H9WA 2UYHA 2VQEB 3RANA 2OCIA 5ECGC 4XD7D 4C0XA 1VLQA 4ZEWA 2PGDA 3Q1LA 4L5YA 4LZPA 2Q9CA 1I6MA 2DT8A 1O6GA 2XUOA 4J6FA 2XRMA 1MMFB 3EISA 4LBWA 3SIRA 5F3RA 3ELDA 1EFDN 5C5IA 5IAKA 3FFAA 1E3WB 1QG0A 4GRDA 4QKQA 1AHIA 2EG5A 1V5GA 1DUSA 3ETEA 4BN0A 2QX7A 3W5JA 2N1BA 1U0FA 2XZDA 2PZKA 3RFXA 3C39A 3CLUD 2IYRA 1QUEA 2M6KA 4CM5A 4ZALA 13PKA 2CJFA 4PNEA 3GJ8A 1FTGA 4YALA 3EYAA 1AKEA 1ZVMA 4KXXA 3OOHA 2Q6VA 4RK1A 3KRTA 4GM4A 4RPLA 3BIXA 4C6RA 2C1ZA 4ADSG 3VZBA 3DZ8A 3PXAA 3VU9B 2XRFA 3VYSB 1V6CA 4P98A 1AKRA 1MJ5A 4YIHA 2BKEA 4AG5A 3JQBA 2ZETA 1Y7PA 2H59A 4HFJA 3HUEA 3RVDA 2FWAA 5AW9A 2IV7A 4RM2A 4C0HA 4WOCA 2P6RA 3DMRA 1SUWA 4F7WA 4JI4B 4WK6A 1EVQA 1PJZA 2A0WA 1JE0A 1QK3A 2C8JA 1U2DA 3PUJA 2J8ZA 1FE8A 2QNRA 3LG2A 4IJWA 1Y9ZA 2FNAA 3EF0A 1VYTA 4RK7A 4ZQIA 3V2GA 2QXYA 3PQ6A 5A03A 2BGWA 1P0FA 1OWPA 5EMHA 5ESXA 3VR5H 5TMPA 5DOZA 1AZTA 2VZ0A 4FKZA 4BNDB 4OX9B 1E9CA 4V0SA 5DF1A 3ETGA 5H5JA 3ZY4A 3WA7A 3GJ4A 2Z5LA 3HGTA 3IHLA 1NBIA 4PO3X 4R1MA 1QB7A 1CQXA 3EXHA 3LVQE 3M1AA 1PLLA 3UKJA 1F8GA 1XV5A 2VJOA 4CV3A 2I6UA 3UMYA 3JATA 2Q5LA 2ZWAA 4JYBA 3TQFA 3AJ9A 4X7RA 2JJ1D 2XGOA 1SQSA 3UJPA 1TEVA 1T4DA 2J3JA 4LV8B 3U37A 4AU1A 1QRUA 2WHQA 1BSVA 1QVWA 3F8TA 3P19A 2EJVA 3DVSX 3L43A 4ZKEA 3ROKA 1S2NA 2ZTMA 1WOYA 4CKEB 5JRZA 2C31A 2P9TA 4UAUA 1Z4MA 3BH0A 2JEZA 3IJ5A 5TDHA 2QRLA 5LXTF 1FNBA 1MJGA 1RHJA 2DFNA 4Z99A 1WPQA 1CUEA 1MX3A 5CGQB 2FF5A 4QQNA 2NZUG 1AG9A 3PFNA 3V00A 4ARZA 3OX1A 2PSSA 3SR0A 4F4FA 2KWIA 2W2KB 2P2SA 4UFOA 2H18A 3VNRA 3Q8KA 4C5BA 1HTBA 1WW3A 1NI4A 4KPEC 1EUCB 3G5UA 5JNWA 3AY7A 4JLOA 3TX2A 4C0KA 4YAIA 3KJNA 1B0AA 2ENUA 4KPUA 4J0FA 2WKWA 3JASA 3CKMA 1XRNA 4KK4A 3UTCA 2R7KA 3V6LA 4MQMA 1CUXA 1E1MA 3Q11A 4PSUA 4ZEMA 1ZJWA 3EVDA 3S1LA 1GNLA 2EKQA 2IEBA 1SIWA 1Z28A 4M8NE 2HSZA 3L4KA 1RKVA 3WHPA 1TW3A 1VLVA 4DV6B 2C9OA 4YX9A 1NN5A 3TB4A 4JQSA 1LSOA 3HA5A 3JS5A 1YS4A 3E6AA 3BMCB 3JQ9C 2OHJA 3DWGA 3R5HA 3BF8A 4IYJA 1L9KA 4FR0A 4FP9A 2VJKA 3P20A 4EMSA 4RKEA 4HNVA 1ZCJA 1C7IA 4JEUA 3PUVA 3WGMA 2FFAA 2B5VA 3HFGA 3LQQA 3O8LA 4MPTA 1Z0IA 1EE1A 1M5TA 2H2WA 2R68A 3B36A 4MRSA 4MNTA 4XVHA 4ZU1X 4D9EA 1A5SB 1RXWA 1EHIA 5CYFA 4DS3A 1FRQA 2AEFA 2Q3FA 3GHHA 3NIFB 4IOKA 4MV1A 4BKOA 2JLUA 4ZARA 3KKKA 2FPGA 2I2BA 1M76A 2Z6VA 3K8YA 3VVBA 3DEKA 1E8DA 3IS3A 1UWCA 3KSMA 1NV8A 3M70A 3NBZC 4FMCF 1E4YA 3UT0A 4DLLA 5K0TA 1JT2A 4HZUA 2KBEA 1A9PA 1M0WA 4EO4A 2WWVD 1UPBA 5A0TA 2H3EA 1DXYA 2XLBA 4BBJA 1SBHA 4R98A 2QYTA 3LWDA 2WKQA 5E6SB 1EIWA 3IMGA 1UBJS 1J97A 1S2OA 5A4KA 3KQTA 4Z86A<