3OJCA

Crystal structure of a putative asp/glu racemase from yersinia pestis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
b'MKILGLIGGMSWESTIPYYRMINQHVKAQLGGLHSAKIILYSVDFHEIEQLQAKGDWQTAAQLLSNAAISLKHAGAEVIVVCTNTMHKVADDIEAACGLPLLHIADATAVQIKQQGIDKIGLLGTRYTMEQGFYRGRLTEKHGIEVITPDDTDREAVNRIIYEELCLGIISETSRDAYRRVIKKLEAQGVQGIIFGCTEITLLVNAQDASVPVFDTTAIHASAAADYALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aspartate/glutamate racemase
molecule tags Isomerase
source organism Yersinia pestis
publication title Crystal structure of a putative Asp/Glu Racemase from Yersinia pestis
rcsb
total genus 85
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ojcA01
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ojcA02
2GZMA 2JFUA 2OHVA 1B74A 2ZSKA 2JFXA 5HJ7A 2OHOA 1ZUWA 2DGDA 2VVTA 5HRAA 2JFZA 2JFOA 1IU9A 3OJCA 1B73A 2JFNA 3S81A 3ISVA 5ELLA 2EQ5A 3UHFA 2JFQA 2JFVA 2OHGA 3OUTA 2DX7A 5EVCA 5IJWA 5ELMA 3S7ZA 2JFPA 1JFLA 3UHOA 2JFWA 5HRCA 3HFRA 3UHPA 5HQTA 2DWUA 2W4IA 3ISTA 2JFYA 4B1FA
chains in the Genus database with same CATH superfamily
1EZ1A 3KQSA 4AYXA 3FTCA 4HB0A 5MGBA 2Y67A 3KB1A 3ZWQA 4NONA 3ENNA 2Z9DA 1E2MA 3ICQB 2D5LA 5K03A 4AYWA 3U3MA 4OXXA 5CG1A 3Q7QA 4OGWA 2EGGA 2RAVA 3G2IA 3K8QA 5DNEA 3ZU2A 2P9EA 2JK0A 3TCNA 1PSDA 2V7GA 4MQEB 2ZSUA 3CRMA 4AJ4A 1EE9A 5B1YA 4JUAA 5DK6A 4PXYA 1KS2A 3WA6A 1GPH1 1P44A 1P5FA 4MV0A 1EXVA 1J1UA 3I01A 2QE7D 2WYVA 4YMGA 4YJFA 1OC4A 4I9GA 2IE8A 3LLMA 5LP6B 4GNKA 4CCAA 1H1LB 1UF9A 4OHFA 5KWEA 1ECFA 3EGWA 3RAEC 4D79A 4MZDA 3WLQA 2PWYA 3DFFA 4ERXA 4D3DA 3PC7A 3AYZB 3KZOA 4F9TA 3ETCA 4BCCA 1BXKA 1SUPA 2Z1NA 3BWDD 1CYEA 3WHIA 5A04A 5D87A 3HU2A 1TYBE 3ITKA 4LV8B 5EZYA 2VPXA 3D9QX 4JN6B 3PHLA 1IOWA 1NMSA 2WICA 4UUPA 4OX9Y 1Y5IA 2ZIUB 3RSCA 5HEKA 4W5JA 5CJPA 8AT1A 1FP6A 1YQXA 2AXQA 2VT2A 3A31A 1K1EA 1U0OC 2V7XA 3SZOA 3RQSA 5B2FA 2HCRA 2QJFA 2J32A 5HF5A 1HDEA 4IUDS 3ZW8A 1NMZA 1QE5A 2V7WA 4K6FA 3SS7X 4BVKA 5F9HA 3G6WA 2ZYDA 1UWVA 4OLAA 4Q4HB 2C1EA 4JJ4A 4DA6A 1L5VA 3K0KA 4FONA 2XUQA 3GRYA 3MCVA 2J3LA 4XWGA 1P6QA 4A6DA 3E3MA 3F98A 2JBHA 5I5EA 3VH3A 3H1AA 2R6R1 4RZQA 3TGWA 3SIWA 1JLRA 1M75A 3FWHA 3JSXA 3I9LA 4PG4A 1MO3A 5AKJA 2IXGA 3WLMA 2Z3ZA 1JQ5A 3CO5A 1Z16A 3AMVA 1C80A 2QUBA 1QH0A 4X62B 3PD1A 4G84A 4MVYA 1U0FA 1DRWA 3GMDA 4FOSA 2XDWA 4O59O 4C2BA 1JE0A 3F47A 1E8DA 4YI5A 4KDFA 1V96A 4F8EA 4XYLA 3R7FA 3GGDA 3U2QA 2VK4A 4NICA 3EF1A 4YRSA 3RG8A 4AKSA 2F67A 5DGHA 3W4KA 5I4KA 2XMDA 3SJZA 3VTZA 2HGZA 3WV5A 1OD6A 1R8YA 3OZRA 4JX9A 4Z3DA 3RVQA 1Y3FE 4BL5A 4DDTA 4XTCS 3TI7A 3QHAA 5DHTA 4AU1A 5CAEA 4PXAA 2O2ZA 1GZ3A 2VHQA 4R3UC 1ABFA 3PXEA 4C4TA 3AL0C 3OJXA 3A4NA 3M0EA 4C6SA 5IDQA 2HREA 1C4WA 2GDJA 1IB0A 2HL6A 1Q0UA 3OWXA 1SC9A 4JLBA 3T7CA 3GLUA 1KMCA 3X1ZA 3PDUA 4R1UA 1YD7A 4D96A 4G85A 3TRFA 3NGLA 4YUYA 2EW1A 1CDOA 4UTPA 4JY7A 1U8FO 1XSEA 4L74A 4HNUA 2VPWA 3WXBA 5DGDA 5DBEX 1NBAA 4URHA 3QUCA 1HE8B 3LD9A 1CUUA 4JUFA 5EFZA 5BMVF 1GDHA 5BSTA 3T7IA 5HMLA 1F6WA 1TAUA 2ZYHA 2YZNA 4B3HA 1A88A 4AKHA 4CKWB 1Y81A 5IDVA 4C08A 1VZ2A 2OQRA 2ZI5A 3LJKA 4WWHA 2VQ3A 2XNDD 4B6OA 4BQPA 4GBED 2B4AA 1S01A 3AF4A 3J7TA 3OETA 3KWMA 5EE3A 3VYTB 1N77A 2G9NA 5A02A 1XX6A 3AUYA 3FUCA 2OK8A 3LY8A 2O2EA 3SZUA 5FX2A 4IOMA 3Q88A 3C1AA 3RVJA 3UJ7A 1P0IA 1BJRE 3CYFA 4C0SA 3NAMA 3CF4A 5ED0A 3AU8A 1Y37A 4MQ6A 3KUUA 1XAHA 4PGGA 2XUZA 1L5GB 1RM4A 1ZXXA 5JLJA 4NDNE 4NFHA 4ER7A 2WYIA 4MX8A 1YB4A 4YQFA 5LFAA 1IDN1 2PZEA 2AZXA 4ZAVA 3CUEF 1XZCA 2W6IA 1X8XA 1E1DA 3JZMA 1HLFA 3MGCA 1AQIA 4DC1A 1OA0A 3KE8A 5LQDA 2VUHB 3BIFA 4RE5A 2A9RA 3EDOA 4OMUA 2R62A 4ML3A 3TAUA 3RSFA 3NTOA 1LDBA 3IJEB 3WG9A 1C0PA 1J97A 5FUYA 2ZAIA 4YCBA 1P2UA 3OBBA 4OGLA 4TLDA 5D3ZA 3VNQA 1EQAA 4HRXA 4DCGA 3SMVA 1PL8A 3GA5A 1UMCA 3P9XA 1V5GA 3WL5A 4Q66C 4B80A 1EZ4A 1B1CA 3I8SA 1NYRA 4EW6A 4L7VA 2ZU0C 5ARDA 4PO3X 1REQA 5LZ5A 2JK1A 4D41A 1LD3A 3DFMA 3V1KA 1ISRA 1VG9B 2JA2A 2ODBA 3JWHA 2JEOA 1AKMA 1IUNA 4OIFA 2WMOB 3DDOA 5IU6A 4Z8XA 3B5IA 4BNTA 1VPEA 2QQ5A 2WK1A 2YN2A 2ZUEA 2FYTA 1KFEB 4KPFC 1XVIA 5ALGA 3O8OB 5IASA 2WP0A 5CTAA 1Z37A 1GG8A 5AW0A 2FPUA 2Q2NA 2F3UA 3GR6A 3L2OB 4I4IA 4IP0A 3RVPA 2PKWA 3QITA 3ZD7A 1VQ1A 4FBGA 2WQ7A 4RM2A 3E35A 1N6NA 1E2EA 1E98A 3DL2A 4B1FA 3IAFA 3TB6A 1V4VA 1N2IA 5J59A 2E4VA 3QVMA 1XDDA 3I01M 3JR3A 4CIWA 1AO0A 4PE5B 4UU7A 3P9NA 5DB4A 2XE6A 1MPXA 2PY6A 1IZ0A 4KIFA 5KHAA 4OJNA 4FQ8A 4B6QA 1DHRA 3G5TA 5DYYA 4DMHA 3TLMA 1U65A 2IHKA 1AA9A 4CDNA 1PFGA 1SCBA 1UBJS 3B70A 3ACBA 1YMVA 1P0FA 3W5HA 5DCYA 1WEKA 3FWNA 3I0MA 4H7EA 5ENVA 4FVTA 4NS1A 2OKGA 4PG5A 5JS2A 5JH7F 1ORWA 1RXUA 4GMGA 2AK2A 4ZANA 1S9DA 3WXMA 4KLNA 3OUUA 1YBHA 4RHXA 4AKTA 5BRJA 1JAYA 3R9WA 2VDUE 1NT2A 1XYGA 1DC3A 2OG1A 1U3TA 3C87A 2GLXA 5LDHA 1WZUA 1TMKA 3NC1C 1NKVA 1EDDA 1U90A 5K51A 5BW4A 1AKVA 1RHKA 4OO3A 3FBWA 4U5XA 1RZRA 1FMJA 1XMXA 1EX9A 1QGYA 2ZBVA 1NNEA 3DEYX 3A4VA 3ETDA 3L1VA 3ONWA 1U3CA 4MRNA 3V1MA 3DT8A 4EX6A 1X7GA 3PJGA 1H5NA 1A97A 1F1BA 1FYFA 1Z34A 3U3KA 1ZX1A 1XTVA 4QYWA 4CUJA 2PCJA 1IEQA 2X42A 4XD2A 4UDOA 1U11A 2R79A 3L7BA 2XNCA 3L0DA 2HCBA 4L3OA 4M99A 5F1PA 2D8MA 1N2BA 2ZJ4A 4BU0A 5JBNA 4LJSA 5HW0A 4MQFA 2EKDA 4Z0TA 3C7TA 5AKZA 2XGJA 2ENUA 4AZVA 4QDZA 4ZEWA 4IGFA 1NHWA 3MS7A 4H7DA 3URKA 5JJ5A 4GUDA 5KYXA 3V5NA 3K35A 1AK2A 2YJ5A 1ZNZA 1R7RA 4JJKA 3NHMA 5J1SB 5TS2A 3F6CA 4F7DA 1BCSA 1RAHA 2GM4A 4F60A 3VA7A 2AC4A 1WVMA 1JTEA 1ZA2A 1Q84A 3I76A 4OUDA 3TZ6A 1Q7CA 3GLFB 1TE2A 4RZUA 2FZWA 1SK8A 2I2WA 3ELYA 3GLFE 3WRXC 2OTCA 1TB4A 3LBHA 1G5QA 1K5DA 4OP3A 2XB6A 2J0UA 5D85A 5K0LA 2W5UA 3VOSA 5A03A 2YQ4A 4YCNA 2QD4A 4CG1A 2YUIA 1OFUX 1E3SA 1Z2PX 4C7JA 4CM4A 3OOSA 4BFVA 3GXOA 3ZIUA 3P9RA 1LJLA 3GF4A 3FBTA 3RKRA 3W6NA 1VL0A 3ZGOA 1QQ6A 1Y1SA 4GMXA 4UW9A 1S1CA 1FK8A 4E6EA 4WZAB 1T8YA 4AJOA 2OD2A 1YRAA 3SHVA 2FUEA 1ZAKA 5C34B 1KBQA 3MBKA 3QSGA 5CT4A 1XU9A 3RRZA 4BLWA 4C01A 2CJFA 1AUQA 2AFRA 2J85A 4PIVA 4Y2QA 4B71A 1P1FA 3DV9A 4A27A 1SUEA 1BTOA 2OFOA 5H68A 5CB4F 3IFSA 3OKAA 5BN5A 2YCBA 5BORA 2CLHB 2C5GA 1T3SA 5JSFA 1WB4A 3NVMB 4KFUA 1D4FA 3FPKA 2IF0A 5KWJA 4UQLA 3D6VA 3DAHA 2EKQA 2NQ2C 1YA8A 2EARA 4JENA 2VYFA 2FW0A 4JL5A 1YB7A 1YR2A 4W4TA 3C7AA 3STUA 1I33A 4UUAA 5FP0A 1KWGA 3H7IA 3WMGA 4UHJA 1V8PA 2Y4OA 1JQEA 3T6KA 3M6UA 1WD5A 4LGYA 3ASZA 3TL3A 4MJ7A 1VC2A 1ZQ1A 1UZNA 2IA5A 2WZCA 3I09A 4EIWA 5JVDF 4D7AA 3A6LA 1KO8A 4MP3A 3QF4B 4FYMA 4LA4A 5JC8A 2D6FA 1DDGA 2QVCA 3KOMA 4KK3A 4ZREA 5K8LA 1GUFA 1FY2A 2CYBA 4G9EA 3FI9A 1GQFA 1MR3F 4NBLA 2IEDA 3Q3JB 4Q3CA 4UTVA 2IOFA 4E5VA 1V16A 2O1EA 3CWCA 5TDHA 4C0KA 4KIGA 4O0MA 4MS1A 3VPFA 4KQEA 2ZVQX 1IRXA 1H8EA 3AKCA 4YV7A 4QT0A 1KYQA 4CMIA 1KYIA 2WKRA 3BCHA 1D8AA 4I55A 4HQOA 2NLOA 3JR7A 1KY4A 3VKFA 4JI4B 1UXHA 3FUUA 2HR1A 2X23A 2Y9MB 3UQYS 4IZIA 3GI1A 2JAHA 2ENWA 5JZMA 3WNBA 2R96A 1ZITA 5JNTA 1RWQA 3LP8A 1RAFA 2D5BA 4QPJC 1SXGA 2PV0A 2H2DA 1UQTA 4ZQCB 1T5OA 5F7OA 4HRYA 3FFXA 1E4VA 4RPIA 3BMOA 3DTVD 2GTPA 4RS4A 4DLBA 2C4TA 2KQUA 2G70A 2QVBA 2OHJA 4ITRC 3GYGA 2AFIA 1XTUA 2Y0BA 3KFVA 3ORRA 3ZR4B 1RHMA 3ZVRA 2CDNA 1RR6A 2JB9A 5I4IA 2CSUA 3ENWA 4GLOA 2ZZMA 4KQ1A 2GYYA 5CR9A 3IEIA 1QQBA 1OBHA 3V1YA 1NV9A 1BO6A 5L8VA 3FOWA 4Q4CA 2HLPA 3OM8A 1OB5A 1MP0A 3C6YA 4BP1A 1DV2A 2CT8A 1YV9A 3CG0A 1D1PA 1Q95A 3K4HA 1ATIA 4UM8B 2ODAA 2VJQA 5T8KC 4LMBA 1HBJA 4ASUA 2QRJA 1EFPB 4I9NA 3HCAA 1NJSA 4JLOA 3ABRB 3L7CA 3EARA 4YJ2F 1N0UA 1L5YA 1S3SA 1KNXA 1CQIB 4CWAA 2ZB3A 3D81A 3TQCA 4ZOCA 1XDGA 3EIQA 3Q5DA 4QUDA 5EZQA 2PH7A 1RI2A 1HRKA 4DARA 3AEKA 1QVVA 3HDYA 1WP4A 1XUOA 1XAGA 2OCDA 1JI0A 1Q50A 1I4EB 1ZCBA 3G59A 4IIBA 4F1WA 5JSZB 1HFWA 3GVIA 1W35A 2B0JA 3P2IA 4UAUA 5CH3A 5B3JA 3ANNA 3DXYA 1CIVA 1Y8RB 2I2XB 3MILA 2H8KA 2Q8NA 1MDFA 3DBHA 1JKJB 4UCQA 5EZYB 3U9TA 2OYCA 4W8OA 2FOXA 3RAPR 3S7TA 5LL6P 1R50A 4BWFB 3GT4A 1CQZA 2PIAA 5AHXA 1UMCB 3OZEA 1KO4A 4R2IA 1B14A 1Y7IA 5C4GB 4JSTA 1LKZA 3UPTA 3SOPA 3HP1A 2CKDA 1NFFA 3O4JA 3WLOA 4RVFA 4TVSA 2DTEA 1OFGA 3UH0A 4IO0A 4QBGB 1SUSA 1HURA 1XJQA 3JQBA 3G7SA 2H4WA 2WWHA 2BFDA 3H8JA 4FFMA 4FJ0A 5DT2A 5JMPA 3ZQUA 3R3WA 3U3DA 3QQPA 4J0QA 3MCTA 3AUUA 4YJGA 1GYRA 3G8CA 3T52A 2FK7A 3Q85A 1KDOA 2IS1A 4MQEA 1NY5A 1JW9B 4XGNA 2RHDA 4R0VA 4BGUA 4ZGGA 4KVGA 2HIAA 4LRTB 1UWLA 3PYXA 4FEAA 1ZD2P 3QMMA 1UL1X 1XNRB 5B1SA 4JI5B 1Y9AA 1T43A 1NSYA 3RBXA 3W7VA 2XPCA 4ZT5A 4ZYZA 1E79A 3CZPA 1XC7A 1ULTA 1Y33E 2HN9A 1OT3A 1KP9A 3CVUA 2B3DA 1AUOA 3RHFA 1UEJA 4UEOA 1T4CA 4WCVA 2HV8A 3W8DA 1R0XA 1VBKA 4YMWA 2W2LA 1SHLA 3BXPA 4FWIB 1IQPA 1DO2A 1HDRA 4B6GA 3N0XA 4HMPA 5KCZA 1R8XA 2CCKA 1E5TA 1H93A 3NBZC 2L42A 5EQFA 1QG0A 3SF8A 3WWCA 4BWGA 5DW3A 2CHQA 3AOEA 3WQSB 4KPEC 3U4GA 4RY0A 4PLWA 4YJHA 3U4MA 1PVVA 2OBYA 3LPAA 3NH9A 3W4JA 4DMGA 5B2EA 1BJKA 1GFIA 4B4VA 2GCEA 1SJ9A 1N6PA 2HB6A 4XB2A 4X1YA 5BPHA 3O2NA 4IIXA 1U4SA 2WT9A 2FPGA 3Q3GE 1F38A 1YZLA 2ANCA 1YK1A 4QWWA 4RUKA 3H2IA 1HYGA 4OHUA 2SICE 5DRTA 3WBKA 1GL3A 4W8HA 4L9WA 3PT5A 4ZCPA 3T0FA 2AOTA 2Y8EA 2M32A 3TQFA 5LU8A 5LP6C 1U2QA 5CAEB 4LK2A 1Q22A 2W71A 1Z7WA 2XMCA 3FVWA 3QE0A 1NXQA 4M1WA 3RU2A 3MJDA 5CB4A 2O8CA 5JPDA 1QBGA 1HFKA 4IVRA 2BM1A 1AE1A 2WD8A 3G8BA 5EHZA 3W9UA 3M9WA 4GP9A 4D1YA 1VSQA 2JJQA 3P1JA 4F72A 4KREA 3WRXA 1DXOA 4RSGA 3U0BA 3WYFA 4KGXA 1XZNA 4WRRA 3VDQA 1ZJWA 5K6RA 4G9GA 2P2DA 2OZKA 1XNGA 3C0KA 1TD1A 4PLHA 4EYQA 2QG4A 1MX5A 4WLFA 1U2GC 1WRBA 4RVUA 4UBLA 4C7XA 1Q3TA 1FUEA 1H0KA 3OE5A 3N5CA 3TVDA 1W5EA 3D64A 1OI3A 2BAGA 2FJ0A 1TJYA 2JIMA 3H18A 3A06A 3P0JA 1XZEA 1YQQA 2IOHA 2ZRNA 3ORYA 4N54A 4NK5A 4L78A 3TK1A 3QUBA 2L17A 1UBRS 3GH3A 4GKKB 2P91A 3OCYA 2X2OA 3QLJA 2AEMA 3GJ7A 3P0HA 4Q48A 4CDGA 1OH7A 2QN8A 1CVRA 2V7QA 2PX6A 2PBZA 1FYVA 1PWZA 2R7KA 3DVSX 2EJWA 2OSBA 5DX1A 2B61A 3R9KA 1YRYE 2P40A 4BUZA 2BGMA 5JCZA 2RKWA 4TTQA 1R0CA 1WO8A 2WSIA 4CV2A 1XEWX 4YJ3B 2GPWA 3N75A 2HO5A 4IXNA 3N2NA 4WNAB 4LRSB 3QSYA 2ZE8A 4AN1A 2QP4A 1A7UA 4UDXX 2FVYA 2QRPA 5U4QA 1NHGA 4C0HA 2RHBA 3DE3X 3W2FA 3VR0A 5HVNA 3LIIA 4MQ5A 1G6KA 4AN0A 1MO6A 2FEAA 1N57A 3ITEA 3THXB 1Z8FA 1OZGA 4HAUA 2GN4A 2VN8A 1DARA 3VGPA 3CVYA 2J09A 3I5AA 4C43A 2REBA 1M1NB 2QMUA 5H82A 4UQOA 2JZOA 3OM9A 3V3TA 5BWMA 5JY6A 4KDEA 4YRRA 5EVCA 2C61A 3G85A 3F71A 3TVTA 4B46A 1CB0A 4IJ5A 3V8EA 1JKIA 3MRTA 5C32A 5U9CA 2XHZA 3F46A 3AY3A 4TTVA 4WFIA 5AVVA 2WIBA 4ZQEA 621PA 2IOFK 1TU4A 4UNNA 1RWOA 2AVDA 3K72B 3OOHA 3PXXA 3FKSD 2W8ZA 1CJMA 3GRVA 1AGPA 3QKIA 4MVWA 4P3NA 4CVNA 1A0OA 1NBWB 7REQB 1RCUA 1Y89A 2Q5EA 4ZKEA 4R2KA 4A7PA 3L8CA 3VSAA 1XMIA 1XZAA 4RHTA 3GYBA 5E4YA 4HB2A 1T91A 3HADA 2VUSA 1PSZA 1VB3A 3FR7A 3KM0A 4A0RA 2BBWA 3HN7A 4UU0A 4D98A 4ZWNA 1U3GA 3M1IA 1NZDA 2AN5A 1J25A 1MB0A 1Z36A 1Z2OX 2SCUA 1SIOA 2OECA 3JWEA 2D5CA 3OU2A 4HNSA 2DULA 1ORVA 4RIIA 5K1ZA 2JGAA 5GONB 1I2BA 2BR5A 4YB8A 4FINA 1QVZA 3PF8A 1IWPB 1NN0A 3P9ZA 1D7AA 1ZYUA 4LOJA 4MIEA 1RBZA 3KJXA 3PGVA 4ZP1A 4ZQIA 3T12A 3SWWA 1U7HA 3DE1X 1WG8A 3KSUA 3PQ8A 3SC2A 4RY2A 1V7CA 1PT6A 4BVHA 1NVTA 2Z5FA 2QORA 3BGWA 4TMWA 1VPLA 1LI4A 3HR4A 2F17A 4M1EA 2AFHB 2G17A 3AEZA 3IIEA 4TLLB 1VMEA 3TLJA 1ID8A 3L4JA 1SXJE 2AGVA 3QYJA 2J0EA 2NNLD 4BP8A 1GZ5A 5KNCD 2OXCA 1UPBA 4IJMA 3K2BA 1QIEA 4BMPB 4HDSB 3G1UA 3NM5A 3B38A 2DHQA 1NURA 2I4TA 4NCNA 1W5BA 3HCCA 1SZCA 3I39X 4HUTA 2TS1A 1TEVA 2CE7A 3BXXA 2NQTA 4FYYA 4RABA 1U1FA 5FOVA 3H2JA 2R44A 1KEEB 1GUBA 1FFWA 2PXXA 3NWOA 4B0OA 4B73A 1U9CA 1XTBA 3BULA 1ZOOA 3NHSA 3OF5A 2OLKA 2VNHA 4FGSA 1NC3A 1RHRA 3AW9A 4B5LA 4BEBA 1YASA 1W7AA 2XJ9A 4EG3A 1AY0A 3IDZA 1SVIA 4KDCA 4FE3A 1PZMA 1CUHA 1Z3IX 1QTRA 1PNVA 1YVRA 3EEFA 5EQJB 4PX5A 2QXUA 1XF1A 5BSMA 1DG9A 5DTIA 1RYFA 4AECA 4DNPA 1EM8B 4BKRA 3AXSA 2A0FA 1OKKD 2CXXA 4GLJA 1E6EA 2ZULA 3JPYA 3SC4A 5C53B 3SFZA 3WLAA 4TS3A 2XZLA 3ZS9A 4WXYB 4U2KA 5FPQA 3EZ9A 1BE1A 2NSLA 2FWPA 4N12A 3VNAA 2JGKA 2PD6A 4MV5A 4EFKA 1RQNA 1E5XA 2XWQA 1I10A 1QQTA 3VZCA 3JVDA 2NX2A 4QG7A 1OKKA 1EP2B 1ZR2A 3PC6A 3EFEA 1AF4A 2Q2QA 2BM8A 5KZMB 1SKYE 2VTBB 5FLYA 4MWTA 1PJ4A 4IO1A 1N5IA 2GXQA 2N42A 1HV8A 2W2PA 1M2NA 4GWKA 5H7XA 3OG9A 4NL4H 1K5GA 4UM9B 4I4TA 3RABA 2AW3A 3PXDA 2IQIA 3I12A 5IEBA 1VSTA 2C2KA 5TB5A 3W8NA 2ZJYA 3O47A 1H2XA 3VPHA 2C99A 1QKIA 5JS1A 2YMQA 1W581 4EELA 2YWFA 1J70A 1JJBA 1PDVA 2ANBA 1JILA 1WXEA 2D0PB 2DQKA 2E7ZA 2O07A 3DWEX 4QJBA 5BR8B 1JWLA 4BMOB 1B6GA 1LGYA 2GK7A 3TXXA 3U09A 1SBQA 1DCKA 4MVJI 1N75A 4IINA 2VPYA 1DNPA 5EWMB 1A7AA 3DV0B 3QXJA 1FUYB 4YRCA 3H8WA 1Z18A 2ZITA 821PA 5CHYA 3RYFB 3FTQA 4I14A 3RT9A 2JVIA 3OTWA 2XCQA 2VVTA 1EHCA 1RSZA 4UTZA 3M4NA 1AUVA 2J48A 4AUKA 3INRA 4YMVA 1NAHA 5BV2P 5KOHA 4KNWA 3EZXA 4IRUB 1UKYA 4B40A 1FTSA 2FVXA 2PGDA 3QXCA 4OLBA 1OIVA 1DJPA 1VIMA 1M0WA 3O8NA 2HK8A 4OQYA 5CDYA 1O95D 2M6KA 4LC9A 5ITVA 4U2BA 1Q1BA 4PG7A 4WY5A 1T0PA 3BMNB 5DIZA 1YAJA 2CN1A 2X19A 4BPBA 1G63A 1KP2A 2P6UA 2O2YA 1IXRC 2C54A 3TRKA 4GFDA 2VAVA 4D9IA 3KLBA 1F4LA 3OCCA 1PQPA 1JT9A 1ZLXA 4W9RA 4B35A 2ZBPA 2JLAA 4LXIA 1PBNA 3PFBA 3TD2A 4YR9A 3ZU6A 4I81A 4J0GA 1CDEA 4K86A 1T2UA 1YZHA 1KZ6A 1XVTA 4PEVA 4EUHA 3VKWA 3DMRA 4EPWA 4UFNA 2ZI3A 5AW6A 2BCGY 1O0BA 3GLKA 1ZVQA 1Z39A 4X6YA 4IHJA 3I3OA 5C18A 1TTPB 2VF7A 4WLUA 1ISFA 1BN7A 2Z9BA 4G5GA 5CP8A 3GLTA 4JT2A 1CZKA 1F0YA 3ICWA 3ONDA 5CEEA 1XKTA 1V3VA 1E92A 1N8SA 3QBTA 4TQ9A 5CXSA 1KAMA 1Y9JA 4ZN6A 1JEDA 3JXEA 4H4EA 1TKBA 2G71A 1ZZEA 4QBTA 1O9HA 4EZIA 3UAXA 3V4LA 4YAIA 2JGFA 4PFJA 2HXSA 2XNKA 3HBFA 4ZO8A 4ZYVA 2QIOA 1QV9A 4WLOA 1XEFA 2FSUA 3OOWA 5CA1A 2R5NA 4NAUA 1XZLA 4BHTA 4J0FA 2AFIB 4ZRNA 1AGXA 1RJ9B 1G2IA 2FU5C 2ZM6B 1E89A 4FC7A 5I3ZA 3NTLA 4JVLA 1VE9A 3H11B 1WBJB 2RGDA 4BRUA 2FQXA 4NE7A 5TEWA 4A5OA 5IAOA 1AGNA 1SHZA 3Q9NA 4HB4A 3F2IA 4IAOA 4L02A 3HRKA 3KR1A 4ICIA 3BAFA 4Q03A 5EMJA 3T1QA 3A3PA 1PCXA 1FBTA 3F1KA 2HF8A 4M38A 4YEDA 3K96A 2VT7A 4GXRA 5BP7A 2HMWA 3CLSC 4UZEA 1NFRA 4R5HA 4UVIA 4LC1A 4Y1GA 5AKKA 2H6EA 3AV0B 3PQEA 3A25A 3C98A 1DBVO 1XRRA 1KF0A 3CLRD 3QJYA 3SIXA 1MW9X 2AX4A 3OCVA 5LNK6 5KC9A 1TVKA 1QRSA 1SBCA 4Y9TA 5CLFA 3O8DA 5E7QA 4W7SA 3JAWB 1OI4A 2MTBA 1WBDA 5CT9A 3ZHZA 2YZ2A 4C7BA 1VBFA 1I30A 1WPQA 2HZBA 1F7VA 1KBOA 2JFVA 4Z2YA 1LQTA 4WUVA 5ENZA 1ZUIA 1OLSA 2ZB8A 3LQ4A 2Y1FA 3WGGA 5C8VA 3R3JA 3EBPA 2PUDA 4BC0A 1DAPA 3ET4A 2YV3A 3BL5A 4HD8A 3TLAA 5KYYB 4HTFB 4MB2A 1NLFA 1V5IA 3NV9A 4IPTA 4TLAA 3L93A 3RUAA 1ETUA 3DLTA 3WK5A 4RXMA 3CY6A 1BH6A 3DB2A 3M2TA 1V1JA 1GT6A 1B43A 3PVSA 4XUCA 2E2WA 2PRKA 5M7EA 1G55A 2L69A 1SKAA 3IV6A 1L8XA 2K2QB 3IIKA 1RWWA 3BTVA 4BV9A 1U2PA 3SFTA 1OXBB 2AOXA 4RQBA 4TKMA 4TMZA 4DJFC 4EGQA 3OQNA 3K16A 3UJDA 2QMHA 2H7VA 4KH1A 1K8XB 3MWDA 4UKDA 3PE3A 4LTNA 2QN6A 1FX1A 3EXG2 2JKZA 2O3RA 4L0QA 3IP6A 1V2HE 5C7LO 2V5VA 1QFJA 1JIIA 3H99A 4IUBS 5F2NA 4CEIB 2DFTA 2NXWA 4CUKA 1IPFA 4DY6A 3K05A 4CKYA 5IRCD 3I6MA 2PQ6A 4RMGA 2UKDA 4DDMA 4CF3A 5FJIA 2E4UA 2PNJA 2GS9A 1T1IA 2FDCA 3HXTA 5BMVA 2FSHA 2ONKA 3CZQA 5EPEA 3U7EB 2A30A 3AK4A 4RKEA 3UKJA 3E7WA 4R2XA 2QLNA 5KSOA 4U2DA 2DLNA 3PJEA 1Z0FA 1R6AA 3VUEA 5IKOA 2UYOA 1FXWF 3O95A 4EK9A 2DR0A 3DFUA 3S5UA 3BSSA 3EVGA 1T8PA 1K8YB 1P3JA 5DHSA 1STOA 5IS2A 4CI0B 2D0OB 4CL2A 3RAJA 2ODNA 2BI4A 2DJ5A 1V4NA 2CYCA 3H6GA 2IUYA 3UAYA 4EYSA 1UMBB 3B13B 3DKVA 1YUNA 1ONBA 3LX6A 5K8CA 1N2GA 2ONCA 5K4GA 2NO5A 1UKBA 2JATA 4IIYA 1Q1GA 3DTVB 1ONNA 1TM2A 2FCRA 4PFSA 2O4UX 4U9UA 4PAWA 1XQ6A 1QG2A 1XCMA 1W9HA 1HQCA 3NTUA 4P1ZA 1Y9ZA 1FU4A 3HVUA 1GPNA 1XCOA 3KUKA 1RIIA 3BGSA 1GRVA 4R4JA 2YXPX 3I58A 4I4TF 4KODA 4WFQA 3RRFA 3VU9B 4D9GA 2JLWA 3JTMA 4AY2A 3TIIA 4D56A 3DF9A 1F6BA 3I3SR 1E3MA 5HS6A 2OPBA 5ILQA 5FEUA 5LOVB 3GJ5A 2C1ZA 1Z56C 1G4HA 3TQRA 1O96A 3LPMA 4HDOB 3HI6A 3HL0A 3I04A 5IJWA 4XQ9A 3NEYA 4D46A 4POAA 4AJJA 2IDKA 3NDRA 2GUWA 1U7XA 4CTNA 2B4KA 3QXGA 4O4LF 4XGQA 5JAOA 4RCZA 2YY7A 1CQPA 5KYTA 1I2DA 3LX5A 1R88A 2NP7A 3TM4A 3ZDFA 4NOLA 2H11A 2OFPA 1UT6A 2EBHX 2W0SA 4OGFA 3KVOA 3ZHXA 3EGEA 2GZRA 2GTIA 3CTMA 4X3OA 4CXMA 1QKJA 2LRHA 2X22A 2YV4A 2X13A 2E82A 4G67A 1PRYA 3NIBA 4S1VA 3FTEA 3DZDA 2X2FA 4AJ9A 2YH2A 2G0NA 1JG7A 1X7ZB 3R6WA 4K28A 4TMKA 3WWOA 4LC0A 1BWPA 3RI3A 1QHGA 3OPYB 4DRZA 5K2OA 4PYNA 3TLKA 1ILEA 2PEZA 4FDMA 1OX4A 1XU4A 1VJTA 3KV1A 3DHWC 2HLDD 2Y1LA 1K88A 4RNCA 1ZW1A 3FFWA 2B9EA 2HCJB 4DRXB 1RYDA 3TZHA 3SYTA 5FPPA 1SZPA 4ZVTA 5KX5F 5ALJA 3EQ8A 1WUJS 3VV2A 4E4TA 1I3MA 3TSWA 3UOAB 1O03A 1YNOA 1VZ3A 2HFJA 5EJMA 3AESB 2GAAA 2NZUG 4F4FA 1N5OX 1SXHA 1Z33A 5AI8A 4ZYXA 2JFZA 2P4SA 4WBNA 2B2NA 2DPHA 1UJ5A 2FZCA 2C3PA 3KKQA 3D8SA 4H6PA 4R1PA 4Q18A 1U2EA 4H18A 4JL8A 1O4VA 2XXJA 2VF5X 4P4LA 2WEKA 4MVXA 5F77A 2AOUB 2JRCA 1KQFA 3MINA 4JHXA 3SM9A 4II7A 1GNTA 2VIIA 1VHWA 1YI8A 2IX3A 3WRVA 4QM7A 3N2EA 2IL1A 1XWWA 2WFZA 3KSAC 3SQXA 1JR6A 3NS7A 4LHEA 1TW2A 4E1BA 3Q9LA 2RGGA 3KKMA 5K99A 3LY7A 1A4RA 4KXNA 4KSBA 1VGRA 3QY9A 2RGWA 3HR7A 1CE8A 4PX9A 2XF8A 1M6VA 3NHBA 3P26A 3U44B 1JXAA 4PLYA 3DPSA 1EUDA 2IYYA 1PNRA 1QE3A 1T9ZA 3JYQA 1P4SA 1E3LA 4LY9A 1UK7A 1Y5MA 2VWHA 1CHDA 2YN0A 3RS2A 3L92A 4BUJA 5KOHB 5KWVA 3C5WP 4I46A 4L2IA 4ARZA 1BQ4A 1K66A 2H17A 5B2ZA 1TRKA 4W9NA 1Q0ZA 2YRFA 4DPMA 1GOTA 4KQFA 3OI7A 1N6HA 2W6CX 5GTDA 5DCLA 1WU7A 1SWWA 5ESWA 1XAJA 2QLBA 2X2EA 4YUXA 4ENRA 1XWIA 5LP6F 1R18A 3DCJA 3OQIB 1ZOSA 4RPJA 4XLZA 9GPBA 1VSBA 1NE7A 3PQ3A 5KPDA 3QTLA 2ZIVB 3QBJA 2GK6A 1Z5NA 1S8OA 3OTOB 5ITSA 3WYDA 4FHCA 4BV3A 3COVA 4FMBB 4IIDA 3TAHA 2IZOA 1K63A 2J5KA 2ATCA 2PWZA 2HWYA 4TRNA 4QXMA 1Z0DA 4OI4A 3O90A 3SSAA 2X8JB 3L0ZA 1G3RA 1O0CA 3ZDDA 1M1YE 4JJGA 2DY0A 5DJ5A 5L7TA 3AVUA 2Q7XA 3MMSA 1PLKA 4TTSA 2HYIC 1VYVA 3ZWOA 3L8ZA 4RYDA 1CF9A 5K4AA 2WIFA 3PIDA 1D4ZA 2I7XA 3GMIA 1Y82A 3NASA 4PAGA 5D1HA 2EC5A 2CLCX 2PUTA 2DF8A 1MN6A 3OE4A 4KQWA 3PDIA 1CZNA 1ZD9A 4FSXA 4M53A 4NESA 1N7HA 2FEPA 1HXHA 3BTOA 4MS4A 1OX6A 1P7YA 1ZL0A 1JMKC 1PO7A 2CFSA 2K7ZA 1L4FA 4LQLA 1PV2A 2NV2B 3M9XA 2WUDA 1H2RS 1N6LA 2O0LA 4J2HA 4U6SA 2P27A 2O7QA 1NJ2A 2WYOA 1H2AS 4LZNA 3K70C 1VJ1A 4ZT3A 3FGOA 2R6JA 4DREA 4FYKA 4YRAA 5ECDA 4PRLA 5JEDA 3WYCA 3QX7A 4UTOA 2OZLA 1AHNA 1U4NA 1UBMS 4QBKA 2PQMA 4HQFA 3RFCA 1JECA 2FFHA 1M5TA 4NE9A 4DQXA 2WSLA 4PC3A 1NXWA 5ALDA 4R31A 4UOZA 1W5SA 1D2RA 1NQTA 1MV5A 5FBVB 1YHZA 3PHCA 2O1WA 5CXXA 4CF7A 1L7EA 1ZJ4A 5BVGA 3TDKA 4PS1A 4WESA 4XIJA 2NUPB 3H2YA 4GRAA 4ED9A 2PANA 1Y4DE 3LUGA 4DLWA 1YZUA 2G1UA 4KLZA 4Y6LA 5PGMA 2XE4A 1TFRA 1NR7A 2XJ4A 3HCEA 4KP7A 5I01A 2W42A 3I9MA 3S2FA 1N3IA 3S2EA 1VL8A 2WFAA 2DWQA 3WK8A 4QBIA 5EJ8A 4CG2A 2AKAB 1SRRA 2UZ1B 3BE5A 2G4CA 3M70A 5BMOA 1EDEA 5F5NA 2V0GA 3FWZA 4KXQA 4NPHA 3DCYA 2DETA 2P68A 1IAVA 3E1SA 5FPTA 5ALOA 2WQ6A 5C37A 2VTVA 3JD0A 4DSOA 3MB8A 3PQ6A 4ER5A 2GEVA 4FDVA 4GXTA 4CMGA 2JGRA 3KXDA 4MV6A 2CLMB 3LGSA 3OE7D 5EIWA 4X65B 1RHJA 3HKCA 1FRFS 1WZCA 3QENA 3LWZA 1JYEA 2F1JA 5C46F 2RARA 2PU5A 2WZDA 2YV5A 2XGOA 2BHLA 3ZE8A 1RHUA 4XYGA 5LQNA 3HG7A 4CIDA 4DA0A 3HDHA 2F62A 3T3OA 3OC6A 1G6Q1 5T4BA 1ZM3A 3RWBA 3WB0A 4ENPA 4FCVA 2JLSA 1N0WA 4HXFB 4E08A 3GQBA 3PEEA 4F06A 3DE4X 4TWBA 3E9MA 3M83A 3HYRA 4IXTA 3QK7A 4A10A 3UAOA 2Q3HA 2ZBGA 4QQKA 3JWIA 4WXMA 3TLBA 4Q3NA 4D6PA 4XX0A 4YX9A 3T7JA 2Y1EA 4BRZA 2W00A 1BMQA 2IKSA 3SYNA 4AZ0A 2Y05A 1MGOA 1VIVA 4MV1A 3ESQA 4RKWA 2LGJA 2YC4C 4LZOA 2R7MA 1NUTA 4P34A 4FGJA 4IBOA 3IEKA 3L0BA 3A9CA 4G0OA 4P3KA 5FADA 4IICA 4D9MA 3ZZUA 1EK0A 3NONA 4EFDA 5IP5A 1F9AA 3C2QA 4TWIA 3DV2A 4V38A 5CBPA 4O4HB 5IDWA 3THWA 3U4IA 3KUXA 2H7XA 1L5LA 2D7DA 2MOKA 2IYQA 3SE0A 4HVCA 1Y6ZA 1ZH8A 3BWMA 5K0FA 1PJTA 2H7CA 3IAS6 3MTBA 4FEYA 4NR0A 4WKCA 4EABA 5KTSA 2XB2A 4PHFA 1ZQ9A 3SFVA 3OQOA 1QJ4A 3OX4A 1VSVA 2C88A 2PNFA 1LI5A 3RK1A 2AR9A 4IMJB 1C8VB 1NW5A 3OFNA 2VWGA 4ZJZA 1Z6PA 2GCOB 1P2TA 4Z2AA 5L3QA 4YV1A 4E7OA 2GETA 1FDOA 1NN5A 2PJDA 3PHGA 3T4XA 3KQVA 5ARCA 4JNCA 1SUDA 2F1IA 3PBKA 4ZCSA 2ZE5A 1HWYA 3WB2A 3GVCA 1GNLA 2XODA 2FPXA 3PC8A 2AEEA 2FSPA 4DCVA 1XPJA 3QWAA 1Q1AA 1UOPA 5IT4A 2NTEA 2CNWA 4XIYA 2Y4NA 4Y1FA 3WP1B 3O6VA 2BZSA 4J3NA 2ZRJA 3AHEA 3O75A 4CQNA 4XVHA 1A5BB 1CJCA 3LK6A 3OZAA 4EHNA 1GYQA 3K92A 2FEOA 4UCXA 1NU8A 3IURA 4J0DA 4DDKA 2QMYA 4OHCA 1UOQA 1MEJA 4C30A 1UDBA 2H51A 1W4RA 1NRIA 4YAJA 2X1LA 1W8DA 1TA0A 1SVMA 2ISSD 5H8WA 2QRMA 4OB7A 3CPSA 1T3LA 1UBEA 2A3NA 1Z4OA 3D6UA 3FNGA 1XEXB 2Q1SA 2VRNA 1FIUA 3PICA 2X5JO 2KB0A 2GFQA 4TMXA 4EATA 4NTZA 1Y8ZA 1L3IA 3FG9A 2NUBA 1LLCA 1KR5A 3SKXA 1XTSA 5JXGA 1AQUA 4OP1A 1NV8A 1K6IA 1RWKA 1VJRA 1DBIA 1IPHA 2OO3A 2P90A 2QGZA 1VFNA 3CVVA 2X15A 2C8LA 3C6KA 4IDDA 3MT8A 3BJZA 4MR7A 3UK7A 4BMVA 3C4JA 1U7WA 2F2TA 1QTNA 2CJXA 1X15A 3IPYA 5LZ8A 1RWMA 3ZTTA 3C6QA 5JRZA 4C9BA 1VI5A 2OOKA 1LZLA 5E6SB 4ZVMA 5ALEA 4BVJA 4Z54A 3GFPA 5BWLA 4MGEA 5BUSA 4WOKA 1W29A 4GR5A 3GUVA 1JQAA 4O33A 2C3UA 1DWOA 1FS5A 3CCCA 3R7BA 2AH5A 5JVDB 4JC4A 1EVKA 4WLVA 1BEZA 3TQTA 3W5SA 5M29A 1CG6A 2BKAA 2JNWA 1I1QB 4BNMA 5EMNA 4DCPA 3VI3B 1P81A 1P2DA 2CVZA 2GEDA 4CKZA 2JH9A 3RS3A 3CZ9A 5G3ZA 3KOWA 1DBPA 1E66A 3H9QA 4NU0A 1BQ3A 3KR0A 1UM8A 1HTTA 3R3HA 4HPXB 4R2JA 3QVJA 5LA6B 3ZWNA 3QMWA 2NZ2A 4FFNA 5TJ9A 5K8UA 3C5EA 1Z6XA 3DAGA 4MULA 3U4AA 2W93A 2QPAA 1XDWA 3OZWA 2P9ZA 2FTKE 2HQSA 5DZSA 2E3JA 4Q16A 1KPHA 2GXSA 2XWSA 3IBYA 3JWPA 3PGXA 1Y5NA 2WG2A 3IR7A 3EEQA 1NF2A 2X8WA 4KE9A 1COWD 1E6MA 2TMKA 1W87A 2PDAA 2Z2JA 1SXJA 3OPVA 2M6SA 1CDZA 2DQSA 3H3XA 4FXPA 4WJZA 3V6MA 1E4EA 1UDCA 3HJBA 1JHQA 2R68A 4ZALA 1AOXA 4EKYA 2PYDA 1I4LD 5HHTA 2UUBB 1KI1A 6GPBA 1EGVB 4D9NA 5JDIA 4ZVKA 2D1QA 4UXHA 4M6WB 4NZ9A 3IP1A 3T7RA 2J46A 1HNNA 1SOWA 1NC1A 1P1BA 1NYTA 2FLWA 2J9XB 1CY8A 2V8OA 2I4NA 3HZRA 4PGHA 4RF3A 4ZJYA 2PMDA 3OY7A 5L4LA 4GW3A 5J3JA 2ZIFA 221PA 4DR4B 4ES6A 3QEJA 3EQ9A 3R7AA 3RF6A 1MPTA 3D2BA 1U28C 1VBMA 1XHFA 4EJSB 3EWAA 4DR1B 3HUEA 3EOAI 2CHVA 3OT1B 2EX1A 3VTKA 2QTHA 4IVPA 1XALA 2FPPB 3RH0A 1X42A 4HYQA 3WLPA 2B78A 3WSTA 4ME6A 3OZ7A 3ACCA 4L85A 3TI9A 3Q9SA 1X2BA 1XMQB 4QKQA 3RHSA 3F97A 4ALNA 1ELOA 3A28A 4GG1A 1S02A 4O4LA 4U7FA 3RS5A 3KB2A 5SYNA 3ZWYA 4AP5A 4K6GA 1MRZA 3EQZA 1BGVA 4YTEA 3CLVA 2C7GA 2CUZA 1ZIPA 4WPGA 3BJIC 3FOBA 1HLGA 1EK2A 2A5DA 4KXXA 3HCNA 4MV8A 4C5AA 4DUPA 4E03A 1JTVA 2KWIA 2QMOA 3PVZA 4HUQA 3ASUA 4LJAA 2H1CA 2P11A 5JZ9A 1A2QA 1UMDA 2NO7A 2FW1A 3FN4A 5JE8A 4CKEB 1L7AA 1DINA 3Q4GA 5DDIP 1HKUA 1OHHA 3LQKA 4KC0A 3UOWA 5FA6A 3HB5X 3DLHA 2VCHA 3DZBA 2RKBA 3LTEA 1II9A 2II6A 4MRVA 4ARBA 5F35A 3KT6A 4UVEA 4WV3A 4A0SA 3K6SB 2O3QA 1WCV1 3IILA 4GYYA 3OO0A 4DV1B 4M7PA 1LSOA 3I1IA 3HN2A 4J1NA 3ZQ6A 1GG9A 1MZPA 2MU1A 3T0IA 2PYZA 4I50F 4QVIA 4ZXPA 1YL5A 4WASA 4FZ5A 1G21E 1KFBB 5AW7A 3HEAA 3AFOA 3E48A 4KPYA 1K4YA 5A9SA 1FLDA 4X92A 3DXFA 1OYYA 2J30A 1UBSB 1Z0AA 5HKBA 1B93A 5CDFA 5EJ2A 2FPIA 1XZFA 3R7DA 1K06A 3GBVA 1S2OA 1WIWA 1T8TA 3ML1A 2XCSB 3NIGB 2FRDC 1IAQA 5HBRA 5IX8A 1P0CA 3LKDA 3EY4A 1O6CA 4CM6A 2WU4A 4B3FX 3QE3A 1AKTA 5FI0B 1CUJA 1MLDA 4UNRA 3GJQA 3CW9A 2XGSA 4LWZA 5I8ZA 4TS4A 4DT1A 1BVHA 2F3TA 1QGUA 3BD7A 5BOSB 1P5RA 1R9MA 3QLVA 4XOIA 5EKUA 1R0RE 4FNMA 4LSMA 4O4JA 4REQA 2E0IA 4BN5A 4F6LA 1M1ZA 3IHLA 1XTJA 3ZE6A 5JQGF 4B8YA 2QD3A 3WSWA 4W5HA 4A6XA 1VJ5A 3CSUA 3S2ZA 3TOSA 2HNBA 3W5AA 3RRXA 1A72A 1B76A 1N3YA 1AKUA 1NG1A 3EZ7A 3WYEA 5CMLA 4BZPA 1WD7A 2I2CA 3IVCA 3AY0A 3G9QA 3RYFA 5IULC 1JVSA 3BWEA 4M1MA 5LR6A 3PWZA 1O08A 1OGYA 1QJCA 3LLVA 3RUIA 3RYHB 1MT0A 5B3JC 3QPCA 2Y9PB 2BI8A 4BNYA 3HJRA 3PQ7A 3QEAZ 1R8SA 3B78A 1EDOA 4JR2A 4D02A 1L5RA 3V80A 4MWGA 1RNLA 1P61B 1QRRA 4C6TB 5AW5A 4LI0A 4YV0A 3K4QA 4Q00A 3CU5A 4UUBA 5D3MA 3RGGA 4ZZ1A 1T9GR 2PV7A 4MVJH 3CN9A 4BYMA 1QYWA 5SYMA 2VJMB 3RJ5A 1EYZA 5AD1A 3T1HB 1Z7YA 1BVRA 3I37X 4DJDC 4F3RA 2R8PA 4QYIA 4ZXFA 2Q5FA 4QOIA 1ZUNB 2P1DA 2QKYA 1VPWA 1GZVA 3X1YA 5DMHA 5BSKA 2VXOA 3PWTA 3PDHA 4OOFA 3R3YA 1KMHA 4RGVA 3UHJA 4CQMB 2DB3A 3HE3A 4IIGA 1W5FA 4RJIA 4M1QA 2EEPA 4KYUA 5EI5A 2BGNA 4JJ8A 1YZVA 4NBRA 3RTGA 2O6HA 1TYCA 2ERYA 2OLEA 1C0EA 1GRRA 2PSJA 4YP1A 1TECE 4RTOA 3R23A 4CM8A 3GARA 4DQ0A 2G8LA 3ESRA 4YP6A 4K7JA 4JBXA 5G3YA 1AZWA 1JSCA 3I4LA 5K09A 2B4YA 2RIRA 4GC9A 3B7GA 2G6BA 4ZPXA 4W7IA 5IKEA 3HM9A 3DS8A 3A58B 1ISHA 1W59A 4EM6A 4JA2A 3WGIA 3DVAA 2OR3A 4KFTA 2P5YA 3A4IA 1YFZA 2WJIA 1R1DA 3G0DA 3WLJA 5KJCA 3EXHB 2M98A 3R0JA 1EH5A 2W9XA 4PF1A 3QG1A 3GPIA 4RGBA 4RQUA 2J4FA 4YRIA 3LTNC 2B1RA 1V6AA 1DB3A 3C1TA 3ND9A 1W93A 4IV0A 4ENUA 1JDTA 2GI4A 3HYNA 2DLCX 5KVCA 3IVMA 5H5JA 2ZJAA 2OV8A 4E70A 4P98A 2EJUA 1QF7A 3RSSA 1LRJA 5BPFA 2VKQA 3V7FA 1Z9BA 1PDOA 3PD7A 4I1IA 3TTYA 3S2SA 4E2FA 1YTLA 1CVIA 1UM9A 3ZY2A 4R5MA 3AI7A 1L7BA 3MQ4A 4C4RA 5LA6F 1ES9A 1R74A 3NHJA 3R41A 4POOA 3NETA 1FVXA 5KNBD 4OJKA 2FMTA 3WTBA 5AJUA 3QIAA 2PFKA 2QW1A 2XMRA 2GSWA 3A4TA 3ESZA 2GVDC 4D9HA 2QR3A 3KVYA 2L2QA 3SYKA 5TC4A 3GELA 3EASA 4LMPA 2ORIA 3H1TA 1H42A 3PXGA 3HY3A 1ZMRA 1EFAA 2KBFA 3NG1A 4ZC8A 1TDJA 3CF6R 1KAQA 2JFHA 4AO7A 1QIDA 3HDQA 3TQOA 4AJLA 3OAAA 2B92A 2WE7A 2GNPA 3KU4A 3NCTA 2CVPA 4H3SA 3RM3A 3COSA 5JJCA 4HN4B 4CIXA 4D99A 3UUWA 2P3OA 5LXTB 1YQEA 4D0GA 3LUAA 4H1VA 1ZCZA 2V3WA 3JD2A 1Y8QB 5G2OA 1QCDA 3UMVA 5FHQA 4WQMA 5F4BA 1V5EA 1QRAA 1HL3A 2CZQA 2OV4A 3PX3A 3L7YA 2D4HA 5D01A 1XELA 2IYUA 3O84A 4N8SA 1EFRD 2HUPA 2R48A 2I67A 1PHRA 2XYGA 2ZBQA 3DEKA 1Q7EA 3N7AA 4R8LA 2JH8A 4IZOA 4XQEA 4A2WA 5B7GA 4KCGA 1WY5A 2GKGA 2RCYA 4R2HA 2OXRA 3LO5A 1JBEA 1HYHA 3MF4A 4WGGA 2C4VA 2R97A 4KE8A 4X7RA 1ITZA 5TPZD 4O08A 1TPZA 4D3SA 2FUKA 1S8NA 2PVCA 3U62A 1X80A 5FWXB 1FVHA 2CXOA 2ZB4A 1D5WA 1S7CA 3HB1A 3LHSA 3QNWA 2XH8A 3K20A 2YOHA 1FUIA 1MEOA 1TF5A 1Z4MA 1CW2B 3AG5A 3EPPA 3OF2A 4KXFB 4OMDA 4YQYA 3PNPA 4A2PA 5ECYA 2B7CA 1P0QA 1M1NA 2GZAA 3EAGA 3P0EA 4BS9A 2WWXA 2CZGA 2A86A 2JI8A 1UINA 2P75A 1H1TA 4J0HA 4LE2A 1SVSA 4AROA 5A6SB 5I51A 4IRXA 4JQSA 5SZKB 4CBVA 2RHOA 1XYYA 2YZ7A 2OQ2A 4GL2A 1F06A 1CLUA 1SXJD 4MO2A 1WB5A 1EVLA 1GRCA 5CFOA 3FVRA 4I9HA 4S2UA 4BB0A 2FN3A 1Z83A 1QYIA 3QTBA 2I6SA 2QZ9A 4ZCTA 4I1YA 4BY9E 1KRXA 2VC2B 1JHOA 4BIIA 4G8CA 3RFXA 1EJ2A 1BHJA 1M2HA 3RK4A 2X58A 4HLQB 4YBRA 3OM0A 2L82A 2NTVA 3B7WA 1DOZA 1JPUA 1CYDA 1XN4A 3GRAA 4GMKA 4P7FA 3I2IA 4BXOB 4UE3S 3DV0A 3UGJA 1C7IA 3UCFA 1RVV1 3WVNA 5KJ6A 2G04A 3BOSA 3ILXA 2RB5A 3AUXA 2X5OA 4JC5A 4X3PA 2W37A 3FCCA 1E2QA 1E2UA 4L9SA 3EGXB 1RS0A 1M76A 3L0OA 4UNPA 2PRIA 1UBGA 3I45A 1RZ3A 4W8GA 4WT7A 3WGTA 5K0TA 2AG5A 1IM5A 1HOTA 3RREA 2YQZA 1QFSA 1L5KA 1C4OA 5IUKC 2HCFA 3WWEA 1E9BA 4KQMA 1XVLA 4MCJA 2X6QA 3N5KA 3V4PB 1UKVY 2VXCA 2QTVB 1YS2X 2YHAA 4NFLA 2QLJA 3PCXA 4D45A 3ZY5A 4CMEC 5TNXA 1NMXA 4H7KA 1P2SA 5JI2E 2JGNA 4M7WA 2X8BA 4HTAA 4GVPA 4IDCA 4O1MA 5FBQB 2VHUA 4Q37A 5THQA 4F9GA 2A1IA 3MWYW 3KJFA 3QUAA 1SN7A 4GD3Q 3EOBI 3KAPA 3E9CA 1FP4A 1PT8A 3OE1A 2OM2A 1MABA 2WKQA 4ZCIA 2VYND 1E63A 2W2NA 1C3XA 2ZTUA 3D02A 2RAUA 2CHGA 3HDVA 3PQ2A 4P80A 3PA6A 3CLKA 1T1SA 2YWCA 3RVBA 3WQBA 1GIAA 1GLGA 1ZXLA 1WCXA 5A7HA 4YJHB 4KR6A 4E5SA 1Z8NA 4JK3A 2QA5A 4QBHA 3ZX5A 3FMOB 1RZVA 2ZJZA 4LXHA 6ADHA 3WKAA 2FWBA 2ONYA 4CV0A 1YCGA 4IGIA 4KZKA 1RI5A 3C7CB 1DKQA 1C4KA 3CLHA 5DT9A 2QN1A 2YN4A 2V0CA 5JQGB 2XITA 3OIYA 1UT5A 2DWPA 4W5NA 2J7KA 4N40A 5E1MA 2XWJI 1SQ0A 4E4YA 2F8LA 3ELBA 2H29A 4IIFA 3GLGE 2YVQA 3GEGA 1SUBA 2ILTA 4WA8A 4EJ0A 3MHTA 1RBMA 2EBFX 1XP5A 2Y92A 3GRFA 4C04A 1I14A 1K7XB 4CNBA 4BTEA 3O38A 2QJRA 1YA4A 3WNQA 1L7NA 3L4BA 4KQCA 2GJKA 3AXTA 1B0ZA 3RO7A 2HRCA 3AR6A 3JQDA 3GUZA 4Z4GA 1QIJA 2M2IA 4GZMA 1UDAA 3U6KA 2QHXA 3IQXA 3T8YA 5L53A 2QRVB 1TF2A 3QP9A 3VHRA 1HLDA 4BB9A 2P9CA 1E6UA 2AC7A 4FR0A 5AOAA 4I19A 2IVZA 2P9QA 1PT7A 4IEEA 4D74A 2JS7A 1OAKA 1Y8AA 2AA3A 2GM5A 2O8EB 1H69A 2WAXA 4MCAA 3DAYA 3LOPA 5JASA 4HL6A 2ODEA 2P9HA 3D2LA 3M5PA 4NRDA 4LUCA 2XMPA 2D0DA 4NFYA 3UBTA 3CM0A 4ND7A 2DHDA 4RTKA 4KLAA 4MR9B 3UXHA 5ERYA 2DG2A 5LIPA 2YJNA 2AYYA 3ASYA 5F64A 1ZY2A 5IT0A 4Z1MA 3UJAA 4RV9A 3SSNA 5I3CA 1Z0KA 3U49A 3HFJA 1QRTA 4M8IA 3UFXB 3ZQ4A 3D3EA 3JZIA 1V43A 3PGJA 5ICSA 2Y1DA 3DOOA 1USIA 5C4MA 3Q3VA 5JNSA 1B4DA 3TBHA 1SUWA 3PU6A 3H1GA 2Q50A 4ZOLB 2V65A 4OEHA 3G2NA 1THGA 1F0PA 1YS6A 4Q1DA 4ER0A 1BD3A 3AM3A 3Q8LA 4W5WA 2QAGC 4OGKA 2GUGA 1HDCA 4QGGA 3V4VB 3DEAA 1RAEA 4CLXA 5B12A 2HBYA 3MRVA 4B8WA 1K98A 1WXIA 1PFYA 2A1UB 1IN4A 3BWVA 4R1NA 1DRJA 2Y0EA 5F1OA 2YFHA 2IV2X 1DPFA 4OQMA 3CJRA 1MMFB 2C83A 1PV1A 1OLXB 1J21A 4L22A 1ESNA 1YC5A 2YOGA 3MGGA 4UBMA 2JFWA 2ZQYA 3AJAA 2BEVA 1GA1A 2V7TA 1D2MA 1NDQA 1TEXA 2YYYA 3L7NA 4FFOA 4HN2A 3IUEA 4MWBA 3D3WA 1QLWA 2GASA 3QX8A 2HDNB 4U63A 2NU9B 3U4HA 3UB2A 4A82A 2XMQA 3TW4A 3MVEA 5KNLA 1LJ8A 3A6KA 3ZGNA 1N2SA 4K8RB 5F78A 5JUWA 4WKBA 1JL3A 1XCGB 4GGPA 1OBOA 1TJ3A 3CNBA 2HZ7A 4C29A 1GV0A 1D2AA 4S3MA 1Z12A 5IKXA 4HXGA 4EY5A 1K7FB 3RUPA 2WKPA 1P1HA 2VJLA 2OXEA 1WSAA 3D1LA 9MHTA 3H5WA 5FDFA 5BUCA 1I6KA 3IA2A 1G6OA 1TT7A 4TLEA 2C29D 1D1TA 4LYFA 3VH1A 2WJPA 2RH8A 2RHHA 3BMOB 4GZ6A 5C5DA 3S29A 4LNUA 1GZ7A 3X2FA 4FLEA 4N49A 3WL7A 4Z4CA 2PYIA 3G17A 2V59A 5EQTA 1IMOA 2Z57A 2QVYX 3KYJB 5BN1A 1QOPB 5KNDA 4DCCA 4RD2A 1KL7A 2FPLA 1N2CE 3L8YA 4ZCRA 4HS4A 2JJ8A 2WNSA 3EFOA 2G9RA 3MMPA 1YRHA 3PEFA 2Q45A 3KK0A 4M1SA 3L0CA 3OVMA 3UATA 4U7PB 3T3EA 1PX2A 3EN0A 3AR4A 3LVRE 3NXSA 1OT5A 3GJ0A 2PMWB 4PX3A 4WESB 3CNNA 5JNVA 1XQ1A 3RANA 4NHEA 3H9JA 4FW9A 3PX7A 3T9AA 3L6OO 4NP6A 5J58A 5KAMA 1UBKS 1BS9A 2VBIA 4P7JA 1CD5A 1HM5A 3W34A 3ZXSA 4HV4A 5KX5B 2ZYAA 2G4LA 3LBYA 3VDXA 1ZI6A 3DMHA 3FNHA 1N33B 2ZCUA 1GFZA 1R4ZA 2ZDGA 3BFKA 2ZJ2A 4MPPA 3AILA 1OZHA 2ACEA 4AKIA 1ENYA 1GY8A 1FRNA 5EIOA 4A9AA 2BTEA 2E5LB 3AVTA 3UG7A 4LI3X 1C81A 1I0LA 4YUAA 5J5VA 1X6VA 1EVEA 2QQ0A 4M7RA 1N7IA 4RH0A 2JIZA 1E6LA 1XKXA 4K81B 3IXQA 1QGOA 5TMDA 2R6HA 1KOJA 2ZPUA 1N1GA 3RGWS 2V6MA 4V1CB 4G5OA 4UDYX 1DHTA 1L1QA 4IDAA 5WRFA 3RFUA 5IXJA 5A4DA 3EPJA 4NOJA 2AZDA 3GLQA 1QNFA 4MW2A 3VPSA 1CNFA 2DZDA 1YDGA 1XD9A 2E4ZA 2DWOA 2XCIA 4OU4A 4DLTA 1JPJA 5FWAA 2JFUA 4EJMA 2IYOA 1CU1A 2J8ZA 4XVCA 1A8HA 1PZFA 2IYAA 3HJTA 4HWGA 4G81A 5CCEA 3KAKA 4PPNA 2H65A 4FT2A 3A9UA 3AY6A 2RJNA 2AWOA 1TZBA 3MOSA 3O3OB 4P82A 5AVTA 1ND6A 1OI2A 4BVLA 4EHLA 4ZDKA 3ISJA 1OYVA 2C0CA 5G0TA 5IKPA 2O3UA 1VOTA 4JAVC 4OOEA 4WUTA 5BNIA 1USKA 2B1IA 1C3OA 2HA0A 1BN6A 3AHDA 2B1JA 3CIFA 1E32A 1O2DA 3BS4A 1LLDA 5AK3A 3VHLB 3WBBA 4YO7A 4F8YA 3SE7A 3K9GA 4UZFA 3ZKWB 1BD4A 2YTZA 3AR5A 1J9GA 2PD3A 4DXDA 3KQOA 5B1EA 4Y6GB 2XRZA 2E4WA 1GARA 4YWHA 2P0EA 3QX3A 1WZ2A 2GT1A 3U1VA 5EEGA 3QNUA 3GLFA 3U4QB 2PLAA 3ENZA 2FWJA 3RBZA 3STHA 4C03A 2PKQP 5L4NA 2DFLA 1OXMA 1QYVA 2QP3A 5CDSA 4B3IA 3EGDB 2WAYA 2X1VA 1T9KA 1XNQB 3WO1A 1FW8A 3MLBA 4H6VA 1CRWG 3O7WA 2FNAA 1NOKA 1G3UA 1UFKA 3H2ZA 5C1DA 4HYTA 2YS6A 2Q4DA 3H16A 4L4SA 5CDUA 3AWDA 4BEJA 5BRAA 2VATA 4FFRA 1R9NA 4EH1A 1GRNA 3DZCA 1JT2A 4QFDA 1QGZA 1IBLB 4WKPA 2WJJA 2XTMA 3HSYA 3DHYA 4B76A 1BXGA 5A7GA 5BWBA 1SK9A 2K87A 6AT1A 2NO4A 4YECA 4AZWA 4UBJA 3QVKA 4NMWA 3FI0A 2P2CA 3G6KA 3WDMA 4XM1A 2IEGA 3GNQA 4BO8A 4ZYUA 1X9HA 1KJ9A 1KYYA 2QLTA 4KXYA 5AW8A 1CQIA 2PJRA 4LJ7A 3WDLA 2GO7A 3ZCQA 4WBNB 1WTCA 5JFGA 1ECJA 4IIVA 4LAFA 1AQJA 4IGKA 1JJVA 1J7JA 3RIEA 3KU1A 2O8NA 3D0RA 1ZD8A 3GRKA 4NZPA 2HSGA 4HAYA 5TPZA 1DT3A 1V4BA 4H59A 3GEMA 1S2GA 1VKNA 3BMQA 4UUQA 1IJFA 1Q0HA 3WYBA 3OZVA 4X45A 1TQ2A 4KQHA 3G2PA 5CFNA 3ME5A 2Q9AA 4XCXA 6REQB 3GRUA 1QG6A 1VRWA 4IFBA 1LW7A 3F4BA 1ZM4A 1BMDA 1Q77A 3KYDA 1JXOA 4KYTA 5GZ6A 4TKVA 5KTOA 1MW8X 1YVEI 2BGJA 2Y6UA 3IQWA 1LDNA 2ACWA 4PANA 1XD2A 1M2FA 1T6XA 1NKSA 1OYOA 1XGKA 4CL3A 3CLTD 3RVDA 1KI6A 2CNKA 2YWHA 4FFDA 4BFWA 3DQPA 2IYWA 1GNPA 3U3RA 1TU3A 1J1IA 1O5IA 2QN2A 1N5JA 1KZGB 1SQSA 4UTXA 2AMJA 1FJ2A 3CNQS 3PHIA 1TCVA 2KBEA 4IQGA 2VJKA 4DUZB 3KLPX 1KO7A 4MLPA 5J43A 5TLSA 1HEIA 2XXBA 2HWKA 3FNFA 4D3YA 5ALMA 1FC0A 4URVR 5JXWA 1E2KA 2X40A 2GR9A 3DYBA 1EHIA 1ANKA 1U2ZA 4TSKA 2QRVA 4ZK6A 4ZAZA 1PYGA 2CLSA 2Z30A 2Y93A 1DQPA 3WKEA 4YJDA 1TZCA 2MT9A 3KOXA 4Q21A 5IMSA 1YIAA 2BLLA 1EG2A 4OA8A 1U9IC 4BFZA 1ZUWA 1T2VA 3MWLA 3G5AA 3ADOA 1C1HA 1QHEA 2NXNA 3URMA 2CCGA 3A26A 1ZICA 1J06A 1JDBB 3GEEA 4P31A 1NX9A 4CM5A 4E2XA 4EVSA 4LYJA 1ZI9A 4MW4A 1KI8A 1V11A 3IJRA 3I0NA 4LYAA 3EUWA 3QEMA 5AI6A 3ET5A 2GA8A 3SIRA 1KJNA 3R5XA 4GYWA 4L4XA 2J5RA 1SM4A 1RJGA 2D2FA 4YRPA 3T34A 3VNUA 3BF8A 3VZPA 3O1IC 5FNVA 4E11A 121PA 2WV9A 3T5PA 4LWQA 3OOJA 4X61A 5CNJA 1D9XA 2X3YA 2PUWA 4PBTA 4RQAA 3SHTA 4EPTA 2UUCB 1FJGB 1B6SA 4XA8A 5BT8A 1EGMB 5DIFA 4HZUA 3FKSA 3OZIA 3H0EA 4M22A 1PHPA 3GJSA 3ZOZA 2C92A 4ILEA 4ALJA 4V03A 1CK4A 1HC7A 3CXUA 1CY1A 4K05A 4N8EA 3RHZA 4D6XA 2WVJA 4PR0A 3ZLTA 2O59A 3KXLA 5K6TA 4FSHA 4UVGA 3UXMA 2R6AA 1FU8A 4ZAWA 3KJGA 4WFJA 1NBHA 2A0KA 2INGX 3AR3A 3GJ3A 4X54A 1PF7E 3ENVA 3MUFA 5ER9A 3W90A 4H77A 5B36A 2ZJ0A 2BH2A 4ZO6A 4B5KA 4C14A 3WK7A 4RZ2A 1E1YA 5BOVA 3VPDA 2KW5A 1KA9H 2PXAA 4JMPA 2ZE6A 2QVGA 3H04A 4PYLA 1P4GA 4XFDA 3WSVA 1MNQA 4QX6A 4F5DA 1UC9A 2CHUA 1PJCA 2PPLA 2Z08A 3QKUA 3VVBA 1U0BB 1J2YA 4D97A 4DLYA 1BEUB 2IF2A 4C87A 4G89A 1JZTA 1GN8A 4L73A 5SZIA 4L1KA 1X1SA 2XIJA 4G1MB 4XYEA 5J9FA 2NU8A 2H16A 2X0RA 1EBUA 3RWMB 5B7PA 2VBCA 2BZGA 3LF2A 4BNXA 3PPYA 5CRIA 2X0IA 2IS4A 1ECBA 1BSVA 1NVGA 1GGVA 4LSGA 2RAPA 2O8FA 2ZIXA 3I32A 1GNVA 3KP1A 1XIVA 3AR2A 3JZDA 5C5IA 4AKGA 1AXEA 3P2OA 1CNMA 2W6NA 2YZMA 3QFSA 1E2IA 2ZR9A 1A69A 5LIRA 4TMFA 1TKRA 3C8DA 2HA6A 4HWKA 1SC3A 1EFVA 1NMQA 1JG4A 3NOOA 2FI1A 3S55A 5EKTA 4PZ9A 4GECA 5AVZA 4KR0A 3KR2A 1FTGA 4KV9A 5CURA 1C8BA 2BMWA 3EZFA 1LFAA 3BQMB 1N6RA 1NLZA 4JP8A 4MROA 2E9SA 2WNIA 5D2CA 4JU9A 5EWLB 3TQIA 4F2PA 4D8WA 4RTLA 5MFZA 3CUUA 4ZQHA 5F9FA 4UMDA 4BE7B 4PV7A 4BNHA 4NENA 1I3NA 4OJTA 2BGKA 3SKVA 4HNAB 3W2HA 4US0R 3H1FA 5HZGA 1YS1X 3B52X 5KYGA 2ZSIA 1CF2O 4JEHA 3IBGA 4KPGA 5DEOA 3V7UA 5JTTA 1ZOPA 4QXOA 3H11A 2XOEA 4JB2A 4O4HF 1ZIYA 1FX0A 1SU8A 1V37A 1ZMOA 4YLEA 4R8RA 4TV8F 3T4PA 3ORSA 3M4JA 3KYCB 1LK7A 4HOYA 1TJNA 2AXNA 4FGUA 5L6LB 1WTAA 1DC8A 1QFZA 3GCZA 5DV9A 1CRLA 2J3HA 2YIVX 3UIEA 4YPVA 4XQGA 2RGNA 5AUQA 2PZKA 1I2CA 4A2QA 3W7AA 5A4MS 2FFJA 2DBRA 4LXYA 3G82C 1RYBA 3GGGA 4ND5A 1RWBA 1F14A 2PMFA 5LXTA 1PDWA 1E4OA 2QU7A 3C3KA 3FR8A 3C1UA 3P97A 5ANRB 3W5CA 3RRBA 5DYIA 1FYWA 5EIFA 4BO6A 1X13A 2PLFA 3IVAA 3QM1A 1G8JA 1XRQA 1ZH4A 4LZWA 4LY3A 5HM8A 1AK1A 3DF7A 2CXPA 3S40A 5JFTA 5JC1A 1DBSA 3T94A 3RR2A 4AJHA 4ALKA 4C78A 2ZUFA 1RD4A 2MINA 3EVDA 5FWYA 4QWMA 5EVJA 1N4AA 2JJ1D 3ZY4A 1IJEA 5BSUA 9ATCA 3GNTA 2RHMA 3FPJA 2Z5VA 2FG6C 3E9RA 1C29B 1GKIA 2J6BA 4D5EA 2RGYA 1U2GA 2W83A 3VUFA 3BX1A 3DSRA 1RXIA 1Y48E 2HXGA 2JJ1A 3GJ4A 4IIJA 4DWOA 2I91A 4H4DA 5ENDA 1HOXA 2GERA 2ODQA 3GMTA 3IQFA 3UMYA 2Z6UA 1SO8A 3INTA 4RWZA 4KWEA 5SZHB 3VTAA 1ZM7A 1GTJ1 3DDSA 1GL9B 1ODFA 4P54A 1X70A 1KJYA 1WB6A 4II3A 1P18A 2QTLA 5EPOA 2HWUA 3FPFA 1U8XX 3KV3O 3NJ4A 3PZRA 4ID3A 1TQ6A 4L6IA 3UJ3X 5JAUA 2I7CA 1I1OA 3JCZA 1E99A 4F3NA 3IOYA 3AI2A 3BD9A 5H02A 5UKDA 3HUTA 3H5RA 3ULKA 4IG9A 1ZGGA 4Q3EA 2A59A 3VZSA 2HU2A 3GY0A 4WK4B 2Q3DA 1A2KC 1T2DA 1KC3A 1NUUA 4N0PA 4PYRA 2BGGA 1UBFA 1Y8CA 3MC1A 3PE6A 1E8MA 4JA0A 2OLJA 4D4GA 1OPRA 3CONA 4O3FA 4XUEA 2XVZA 4AT1A 5K0EA 4C2UA 1EK1A 1NQUA 1DKPA 3FF4A 3MPUA 3ZK8A 5BSWA 3PP8A 3RLFA 1SH7A 2DMRA 4OLHA 3U7QA 1ZVVA 1JFFA 3NBYC 4JT8A 3FPGA 2H0QA 4O4IF 4Y2PA 1W94A 4YMUA 5BSFA 3GP8A 3W3ZB 1QP7A 2OZEA 4BP9A 4DMKA 4ZEVA 5JQWA 4RACA 1L1EA 2ZAYA 4M0FA 1ZN9A 3L0SA 3M82A 4V3CA 2OORC 4J1QA 2G7ZA 4Z7JA 3OOEA 4V2IA 5KCMA 3V2IA 2VJMA 3IBTA 4MB0A 2C77A 5TR9A 4TYQA 4EHKA 4CT5A 4RHYA 1MTOA 4BVAA 5HQTA 4O29A 1WXHA 2O5RA 1DBQA 3EXIB 1L1FA 3CE6A 3IP5A 3PGMA 5FD8A 5HRUA 3KKLA 2X9LA 3AJ8A 4HDMA 3OA2A 3ZS8A 1CIJA 3SEZA 2PUCA 2V1UA 4N5LA 5BYAA 3N2GB 1JPNA 1A9YA 5GADl 5E1OA 1DT5A 2I6UA 3QELA 2XCLA 4UM9D 1GG2A 2N3ZA 5L45A 4UEQA 3HACA 3QLVC 4B17A 3A1FA 4HGZA 2F8SA 1QC5B 1OBCA 4N9QA 4CTOA 4QODA 2V4ZA 2C5SA 2CNBA 1BU8A 2EDCA 3F4KA 3S7ZA 3K70D 1F3OA 4MQ4A 2B35A 3KOUA 3H97A 5CK4A 5CPFA 4XWOA 5K7SA 3ACDA 1XA3A 4N5IX 1ICEA 2VDJA 4JYBA 1R6UA 3GFSA 4EHDA 2FWRA 4RK1A 5BUQA 1DE0A 4GLLA 3J7AC 5AI0A 1HDIA 1SVKA 2PUHA 3C24A 3GZNB 3WLTA 3ZZMA 1ODKA 4BKPA 1NDHA 1V1RA 2YCLA 4JBNA 1CP3A 4DIKA 1DL5A 1UT8A 4EQZA 3EPKA 3O5AA 3IEVA 4AS2A 1BDIA 4D9BA 5HOEA 2GXAA 1T2AA 1GHTA 1N1DA 4OHYA 3DE5X 1P74A 1QHHA 1E1CA 1YB6A 3L41A 2FJUA 1M1YB 2NUTB 3G2JA 5AJWA 3VGJA 3F8TA 3W2TA 3LKVA 5E4TA 2VAWA 1EBFA 3JYNA 5FFMA 1ZHFA 1IN1A 4YV2A 5A7FA 1NBMD 3D4NA 4FOPA 3A0UA 2VNJA 4RU1A 2VOEA 1W88B 1B16A 1TADA 3FJ1A 4V0NA 4ER6A 3LLCA 1KEVA 2VZEA 1C2TA 4UJ5A 3SDSA 4DXHA 1XZ8A 5CFMA 1U2TA 2J5XA 3HY6A 4PM4A 1N5RA 1CXZA 5ESDA 5KTRA 4PICA 2A33A 3U37A 1KNQA 2NADA 3CVJA 3H86A 5TQ2B 3SXJA 3R3UA 3T1OA 4DMUB 1UPAA 3AWIA 3B2EA 1J90A 2D3TA 2O2GA 4GU5A 1AS2A 4IUYA 5FBZA 4JSYA 1U2DC 5JCPA 5DM70 3IT3A 1H3EA 3T41A 1NPDA 3IRVA 5DX8A 1RM5A 4YJ2A 1OREA 5JCOC 3NVDA 4AUMA 3LT2A 4RZIA 3KYCA 2FMXA 4G8BA 2J4CA 3VJRA 3BMQB 3OQJA 1G17A 3IDSA 2PSDA 2DP4E 4J1TA 3VU3A 2MR6A 2HT6A 1CR6A 3HL4A 3QLTA 4TROA 3NPMA 2WF8A 3H5AA 5AOCA 5B6JA 5KNDD 3I2KA 1PFUA 4MGKR 3FOCA 5HTKA 5GVSA 5JARA 4LQCA 1OVMA 1R27A 4Y2YA 2RSLA 4AXBA 1UWCA 4CR6A 1S5PA 4P58A 5EYPA 1ZC3A 2P2SA 3KJIA 1OUMA 4AQ7A 3S2UA 5L3SB 4XGRA 2WJHA 1LJUA 2C9ZA 2QI9C 3GPCA 3GWGA 4KAXA 4KOAA 5FCDA 5HFJA 1BE6A 2FB9A 5T3YA 4JXZA 3UJBA 3EWNA 4ETNA 4GXQA 4UD6A 3AP2A 1RXYA 5FTKA 2Q5IA 2GSDA 2ZUCA 3I2JA 3RSZA 1VMIA 2A1TS 4DL9A 1KXZA 3ZUPA 2GYWA 3IAM6 3AI1A 4QUEA 4TUYA 4V0QA 1PVOA 3PXUA 5LVAA 4OHXA 1J0AA 1OYWA 1M7GA 5F52A 3OPNA 2ZR7A 1T9AA 1SB8A 2QTZA 2WC1A 1V8DA 2C5FA 3V1LA 1I94B 3DZGA 2ZVDA 4AVYA 1PUXA 2QDXA 3INGA 4B6EA 4Q39A 2VPZA 2IY7A 1SBHA 3OEHD 4OSOA 4FGKA 3VNBA 1PQ4A 3K2QA 2ZJ3A 3CRRA 2ZUVA 3L01A 4ZAFA 2NUAA 2JGDA 2ZB2A 2NU8B 4I50A 1G5PA 4OBWA 2FUG6 4JYAB 5IAJA 3UKDA 1QSGA 1WCYA 3LQ2A 4URZR 2AG0A 5M5BA 2CV2A 1SD5A 1Z15A 2G09A 1H66A 3H7AA 1SPXA 3MWJA 1KORA 4W7HA 1Z75A 5H3LA 4XJVA 5JAHA 2MSEB 4DR3B 4XWWA 1WXQA 3Q2IA 1L5FA 3ZD6A 4HDQB 4JMLA 4FNAA 1M6WA 5LNK1 3BJEA 1R6TA 4PN7A 1JG2A 3GP5A 1VM6A 1MXFA 1ML4A 2HTFA 4FLMA 4PSAA 4RHFA 1MIOB 4X1KA 3ZE7A 1PGNA 1KGDA 1JH9A 1K92A 5JZVA 2HOQA 3E84A 3RS4A 3OQMA 1NY6A 3JWGA 2XNJA 3KD3A 5KDLA 4Q1AA 3S70A 5BW8A 3CLSD 1NJ6A 2J5QA 2QGFA 3L3BA 5IYZF 1XMPA 5HPYB 4A0FA 3DHNA 4UARA 1LVUA 2GJ9A 1G8PA 1TAQA 3BDIA 3PNOA 4X1YB 4MLDA 5F73A 3LYAA 2AMFA 4MV7A 4DEXA 1F20A 4KO8A 1PIWA 3LO8A 2ZPAA 4WHMA 1OFIA 1XPOA 4MYRA 4EG6A 2P9GA 2RDMA 3COJA 1WW8A 2P5SA 3N28A 5L4SA 1PWXA 2BEWA 2Y1CA 3JQ8B 4KDRA 3CPHA 4AIRA 5C3MA 2C57A 1L5OA 2J67A 2WP8J 1VE7A 1G98A 1G7RA 1OSNA 2G77B 1FJHA 5IDXA 4NECA 4YGXB 4IH4A 4S24A 2ZI7A 1KMIY 3C14C 3IUQA 2JFOA 3PNSA 4G0XA 4GX2A 2GA9A 1WQ4A 4M76B 3VTFA 5ILGA 3LRTA 4O1HA 1V11B 1W48A 2C2BA 3IB6A 4LYYA 4X94A 5DHAA 1WE2A 4Y2SA 2W2XA 3OHPA 3ONEA 4NKRA 2RGRA 2XUGA 2A5JA 1B2LA 2FOIA 1DXQA 1NJ1A 1IHYA 2Z8XA 3LX4A 4YA6A 4ZHQA 1RI4A 3ELWA 1KTIA 4PHCA 1JFRA 4I8XA 4RJJA 2QS9A 3F6PA 3STVA 4RMIA 3W78A 4B3DA 3B1XA 4F92B 2IH5A 3O31A 2OVFA 1NMEA 2ACVA 3ZNPA 2VSFA 3KETA 3SYMA 2GLUA 1P2FA 4OMFG 3WL4A 5B3KA 3LFTA 4OM8A 3WNDA 3HJFA 1HX7A 1JS1X 1YO6A 3KFXA 2OA0A 4B9AA 4CFZA 1B42A 1T0JB 3PXCX 4RVOA 3H5NA 1SPBS 1QOZA 4A16A 2JJ2D 4BQOA 1WUTA 3LM8A 2DPGA 1T0IA 1JUDA 3A4MA 4G3XA 4P4UA 2OXIA 3RJ9A 4DCNA 5IWCA 3IEMA 2LCQA 4DZZA 1M2VA 1GAWA 1RLOA 3D7KA 1TEZA 1E3QA 1Z2EA 3NHPA 5JJIA 1P4AA 1VYUA 3TFQA 1T5DX 1LK5A 3ECCA 4HATA 5MDHA 2RI6A 4QPPA 1ZN7A 5K5EA 3O92A 3MWEA 3UENA 1ZEJA 2HJRA 3WQHA 1P1KA 1N8TA 3M6XA 1D6MA 3E3OA 4XDGA 4UUNA 3QUQA 4YHBA 4JU8A 3SK0A 3BXEA 4JASB 3QKWA 1Z0SA 4ND4A 6LDHA 1C0KA 2Q4BA 4A6PA 4Q1FA 3IXLA 4D4LA 2PKQO 1LLFA 3WC4A 5K3OA 4Q9DA 3U7JA 2OCAA 4GPD1 2BDTA 2JGIA 1SULA 2OCLA 3MMNA 3RRJA 3SX4A 1L9XA 1C7RA 4B74A 1N2OA 4YRZA 4GO1A 2QQGA 3TIVA 4W5OA 2PSHA 4N7BA 1QX3A 2DFVA 4CU2A 1E20A 4ILKA 4V1CI 2ARKA 1F48A 2DH6A 3EEYA 1O94D 3H2GA 1YKFA 4OL9A 3N86A 1KI9A 2JH3A 4C1NA 4LFBB 1JVBA 5CBPB 4BJ6A 5C8XA 2CJWB 1NUPA 1F2TB 3PSHA 2CBGA 1YI1A 2OP1A 3G2MA 4GI5A 4IEIA 4Q01A 4RETA 3TW8A 4D26A 3PC3A 2W43A 2CHFA 1PUJA 2QNIA 4HFJA 1YFLA 4QHYA 1JGTA 4GOND 3FCAA 4ECAA 2GJ4A 3UMRA 2A0UA 2CDAA 4H0CA 3R20A 4COKA 2RAFA 4LOAA 3HLYA 2FSIA 3K0HA 2CD7A 2QPTA 4OHOA 4RW0A 2FZLA 2Q41A 1W2WB 4TRRA 3HRHA 3GZJA 2LR0A 4XJTA 3THYA 2PMCA 2OXTA 1NKTA 6CHYA 1ZSVA 2IHNA 2NPIA 2ZVPX 4G97A 1MXHA 2FSGA 4QRIA 3BHNA 4DQLA 1AHPA 3DP9A 1PKXA 1CUEA 2C4MA 2AKEA 2PUVA 2ZW9A 4BNLA 2NZ8A 1DKLA 1Q6ZA 3W8RA 4EY4A 4YBZA 3WLRA 4EW1A 2LXNA 4GI1A 3W3AD 1UCFA 5FTNA 2JCYA 3DLPX 3IIIA 3LH5A 5KTTA 3NXKA 1U3VA 4W63A 3SLGA 1IVYA 2FRDA 1LBTA 1GKYA 1SFRA 2CCJA 2P9BA 3EEBA 3QHPA 4I8DA 1FLAA 2ORWA 2PLRA 1PZEA 4EBBA 5A5DA 2IYNA 2JAQA 3VSCA 2NN3C 2GNOA 2DKNA 3KLMX 1YOVA 5GVRA 5A71A 5F2KA 2BFAA 3BMXA 3VZDA 2WJ6A 1XZQA 3WZMA 1NDUA 2C1XA 2PVSA 2X2PA 4HF7A 1UZMA 3N05A 4JOSA 4XPIA 5EKXA 5TE9A 3CB4A 1LSJA 4DV7B 1UFQA 1U8YA 3WLLA 3RSLA 1DRUA 1EXDA 3L1UA 2WI8A 4JDPA 3CW8X 1Q91A 3NFYA 3Q6NA 1A98A 5J5AA 5REQB 3SHOA 1DO8A 1U9YA 1R0KA 3NUZA 5BV7A 4R9NA 3AIIA 2HDOA 2ZWOA 4ZOLF 3R7WA 1M2KA 5KHLB 2B0CA 1EP1B 1J00A 3OH8A 2Q3JA 1V26A 2R87A 3WWDA 4P32A 5F33A 4O63O 2H48A 4RC9A 1BVUA 4KAJA 4PG8A 1XDZA 1XYVA 4BV8A 3OJEA 4MO9A 2JLUA 3G8YA 2ZDHA 4LNHA 4PNZA 1F8YA 5EJ7A 1EE1A 1XVUA 4MGYR 5H80A 5HKKD 1J8VA 3DEJA 4X90A 1N7JA 2ZZKA 4R40A 5LN1A 1RQXA 1P5JA 2PE5A 2FFAA 3A37A 4GDFA 2XE7A 5FA8A 2X4IA 2ZRLA 4FR2A 4UPEA 2A4MA 4TUYF 5EIHA 2ZIZA 3CGGA 2GPSA 2YVAA 1QFYA 1EXNA 3C5VA 3D0KA 4KMMA 5MGNA 1RKBA 1KJQA 2HRZA 4Q02A 4G2NA 2VPPA 3FW1A 5AVRA 3TJZA 2QN7A 4RA6B 1F8FA 1S96A 4N8DA 1VLHA 2QUIA 4OM7A 1QH8A 1J4AA 4ZV9A 3NT2A 3NTRA 4N0QA 4OV6B 3SQWA 4PYIA 3B2QA 3RIMA 3KTDA 4G26A 2BRUC 3D7SA 1ZRMA 4OQFA 2WYUA 1XCJA 1NATA 1EINA 3I9NA 4G86A 4NG5A 4Y6OA 4GIBA 4UTRA 1ZDMA 2DUUA 3AX6A 2PBRA 3CBGA 3NTQA 3UT5A 5C8YB 4PHHA 3TBFA 5IYZB 2J9FA 1K2VN 3HM2A 1WNFA 3K9FC 4D4JA 1TMYA 1GAJA 2H92A 2JVKA 2AHOA 1BMFA 4Q7LA 1Q14A 4Q4AA 3TXAA 1KARA 3ILSA 1EHYA 3MPOA 3NM4A 3OCWA 1QIHA 3VKHA 4MUBA 4PIPA 2PZLA 5E95A 4N48A