3OJCA

Crystal structure of a putative asp/glu racemase from yersinia pestis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MKILGLIGGMSWESTIPYYRMINQHVKAQLGGLHSAKIILYSVDFHEIEQLQAKGDWQTAAQLLSNAAISLKHAGAEVIVVCTNTMHKVADDIEAACGLPLLHIADATAVQIKQQGIDKIGLLGTRYTMEQGFYRGRLTEKHGIEVITPDDTDREAVNRIIYEELCLGIISETSRDAYRRVIKKLEAQGVQGIIFGCTEITLLVNAQDASVPVFDTTAIHASAAADYALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aspartate/glutamate racemase
publication title Crystal structure of a putative Asp/Glu Racemase from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Isomerase
total genus 85
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ojcA01
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ojcA02
2DX7A 2W4IA 1JFLA 3S7ZA 1IU9A 5EVCA 2OHVA 2ZSKA 2JFWA 5HQTA 2JFVA 5ELLA 2JFQA 3HFRA 2JFOA 3UHPA 3UHFA 2GZMA 1B73A 2JFNA 5ELMA 2JFXA 2VVTA 1B74A 2DWUA 2JFPA 2JFUA 2JFYA 3OJCA 5HRAA 3S81A 4B1FA 2EQ5A 5HJ7A 3OUTA 2DGDA 3ISVA 5HRCA 2OHOA 2JFZA 3ISTA 5IJWA 2OHGA 1ZUWA 3UHOA
chains in the Genus database with same CATH superfamily
1JE1A 2VOEA 4R2XA 1FYEA 2P6MA 3D3QA 3DUFA 2I2CA 3DBLA 3AR5A 2F6RA 2FPMA 3V55A 1CY8A 1T5IA 2XLCA 1G0NA 2FEPA 3OOJA 3T7CA 1GQOA 1QYWA 3BUSA 4W63A 1K8YB 4LOKA 2RGNA 1QCCA 4DYDA 1NQ5A 4YX9A 3ELWA 3LIIA 1ZD5A 2BEUA 5IS2A 3RVDA 4N5LA 4DCTA 2DJIA 5JSZB 4LXIA 2C8KA 4B0PA 1DRKA 3I01A 1T3HA 2IVZA 2VSXA 3OHSX 2B20A 4IJKA 1DKNA 1E2FA 4FYWA 2H2HA 1C7IA 2VSYA 5CVCA 5F78A 2A30A 3B70A 4PG4A 1LS6A 5HRUA 2HBQA 2ZJFA 4MW6A 4FUQA 3MJRA 2DOKA 3L92A 3T3EA 2X0NA 1PJBA 1NWCA 2I7VA 2VDPB 1KZ4A 3A4VA 3DV0A 2WJYA 5EJAA 5IN4A 1GUAA 3TSWA 4XWWA 1XFAA 3F98A 2GEJA 2PX0A 1Q2XA 1WZEA 2XUKA 3L1IA 4I1OA 4KFRA 2VDKB 4C2BA 1UKEA 2MR5A 2ZB2A 2JFPA 3DMTC 4EB8A 1XCJA 4U5XA 2J85A 1ODSA 3VNQA 4ALNA 1TM3E 1KF0A 4O4LF 1XE3A 1PEAA 2O5EA 2A35A 4PGAA 3WDLA 1R5JA 2HF8A 4UEWA 3WBKA 1A4RA 4N40A 1T26A 2C2ZA 4NH4A 4I3GA 5F2KA 1MHPA 2HUNA 2VTDA 3L1JA 5LLSA 4V0NA 2DQZA 4RHFA 2BMWA 2WVGA 3HVUA 2OXCA 5LMCA 4LRQA 1U4NA 4OGLA 2IDZA 1QYVA 4TWZA 4C4XA 2WSSD 3FHJA 3Q6IA 2UZ3A 3VNRA 4RL4A 2FCRA 1FL9A 5MDHA 2B4QA 2XF2A 4MUEA 2H2WA 4GSLA 4BTLA 1UMBB 1EDEA 2WT4A 3OICA 4CCSA 5CD1A 5A7FA 4KIUA 2O48X 4MITA 4QYIA 3C98A 2VCYA 4N47A 3VBCA 4CMJA 1ZM3A 1LRJA 4RH1A 1NRXA 2I4RA 1NJSA 2AMYA 2ZRNA 2OAP1 3U3OA 4RDIA 1T8TA 3PXCX 1E3EA 2J9GA 4JL6A 4MS1B 3WIEA 4GKJB 1M5UA 2YV1A 4MPJA 2J48A 2X8LA 1UBGA 2NO4A 5LZ7A 4PNZA 4QUBA 3OFNA 3TSAA 1SCQA 4M0KA 4FJ0A 1MT3A 1UM9A 4LCBA 4MQBA 4U2FA 5GOZA 2PLNA 3SR3A 3F6CA 5DX8A 1DGQA 1KAMA 4HEQA 2H92A 4LJLA 1CUBA 4MKZA 2ZRIA 1V9CA 1TTPB 1XD2A 5ALWA 5BOVA 5BW6B 3F3YA 1EFKA 1NP6A 2MT9A 2XA1A 3DFUA 3P27A 4FEEA 2PH5A 4NZYA 1U7OA 2CY0A 3NIWA 4YRJA 4BQEA 2BGWA 3F7OA 1ZA2A 2JIDA 1P7VA 1ADBA 1WMDA 4JASB 3STVA 1Z15A 2VUHB 4OQQA 1X1EA 4AZ0B 5C2JB 2VBIA 3TQRA 2Z56A 1DKOA 4DUGD 1Q50A 3QUQA 1T9GS 4L74A 3DEFA 1XEXA 3HLKA 1GL3A 4KLCA 4X97A 5ECGC 1XN1A 2VP6A 4W5OA 4P22A 3QEAZ 1H4SA 1PJZA 1XVTA 5DWQA 1WHSA 2NU8A 1GU0A 1X94A 1V2GA 2FXIA 1E0KA 1ZQ9A 3YASA 3FSEA 1Q0ZA 4DGSA 1B93A 2MDTA 4IOLA 1KA9H 3ZWPA 4DLTA 5FPSA 2PYDA 1SB8A 1PQUA 3RADC 3QUAA 1DFIA 4WXRA 4DFDA 4EUEA 2CZCA 2QOEA 1NW4A 2BMEA 1S8OA 3LLUA 3A36A 5JC8A 5E4TA 1D8AA 2P9ZA 3OMLA 5B55A 1RM3A 5K3SA 2CKDA 1EKXA 2ZRPA 5JMOA 4YUZA 3SSOA 1QFJA 1ACLA 1OC4A 1P29A 5IARA 1IH8A 4HDMA 3VHQA 4C6SA 4HUTA 3BXZA 1GNQA 3RT9A 3K09A 3GXBA 4I5EA 3NJRA 2DWUA 4R1LA 3T1YB 2XMGA 2NYAA 1KY5A 2BGGA 1SCAA 1MRNA 4ZODA 2BMVA 1RM5A 3GCXA 2Z4RA 4UCXA 4JAVC 3VI3B 1J25A 1RIFA 3G23A 3P9KA 4U9IS 3K94A 3HE3A 5AKIA 3V1LA 1X39A 3CONA 5HKOA 3TF5A 4ILEA 3LH5A 2I2FA 3FVQA 1E3DA 1ZP6A 4WN9B 2F4VB 3U9TA 4OXIA 3VPFA 1V3TA 2O54A 2AX4A 2IUTA 4K6GA 1QX4A 3AFMA 2H4FA 3GLIA 2GHQA 3UWKA 1J2YA 3TNDA 3D3WB 1PAUA 4BKUA 3U1BA 2VP0A 3I0ZA 2X7HA 4AP9A 1F38A 2C1XA 1I9GA 5LQMA 4ZV4A 3QNMA 4MVCA 2YWJA 4R2MA 1L7RA 4ALIA 4ZKEA 1XU9A 5CIWA 1JX6A 2JFUA 3JD1A 3KDSE 3S2IA 1N2SA 3N5CA 1VL0A 4IQFA 1G9XA 3X1MA 1MB4A 2RHBA 4MCAA 4B4KA 1GU1A 2AQKA 1CV2A 5FEMA 1OV6A 2VJMA 3H4MA 5BSHA 1XQWA 1ZVKA 1KVRA 2CJWA 2PUTA 3LSYA 3EGOA 1RPNA 1MEOA 3IAXA 3PNKA 3CNQS 1SCDA 5C8YA 3R8XA 3WYCA 1Z08A 3K0KA 5IAJA 5HF8A 3DGFC 1FUIA 4KV9A 3VX4A 4D57A 4P3PA 1FU4A 3I3SR 4B17A 1SXIA 4ZOLA 2B78A 5KCMA 1T5TA 4X63A 4DADA 2R1VB 5I47A 2DU8A 5AKGA 1XLWA 2IPAB 3GOQA 1R6XA 3DZIA 2CMFA 5FA8A 3QKWA 3REGA 4ZIRB 3CH7A 4JQZA 3FPAA 4C0WA 4DMMA 5KTOA 1RBMA 4C08A 2HJ9A 2JZNA 3OM0A 2HO4A 3IQHX 5LSAA 4KO8A 2OD7A 3CZQA 2BT4A 4TZ6A 2NVOA 1P2TA 4N5HX 3QOXA 5DI3A 5CFRA 1UDCA 2XVMA 2FF7A 2IYSA 2YUIA 3CF6R 3HP4A 3VJLA 3OM8A 3QIVA 4CEIA 1SELA 4X6LA 3GRUA 5TV2A 4NXNB 4DN6A 1DQNA 2I2AA 4KQCA 2UXBB 4K28A 4RVNA 3ZY3A 3A2LA 1WMAA 1KO1A 4B8ZA 2VTBA 3PQ3A 5LYJB 4RHEA 1XXHB 5A03A 3QE4A 2W9XA 4GS5A 4ZJUA 4JXJA 5IKPA 5T7BA 4LG1A 1HSOA 1LW7A 4J1NA 4R41A 1IEQA 3SYRA 3ETCA 4YI3A 2W11A 4QHSA 2IXGA 2NTVA 3ANLA 4RK7A 1BGWA 1O9HA 1D7OA 2FZVA 2XYRA 1PUJA 1ZRMA 2L42A 2IT1A 1ARZA 3JQPA 5DN9A 1RXUA 4O2AA 3RRMA 1Q44A 2ZWVA 5B4VA 1GG5A 1KGDA 1ZGBA 2VP2A 2ZSFA 1GGJA 3I9V6 1CEYA 1OVGA 5L8VA 3OLCX 1TQ4A 4QPZA 2P77A 4DIFA 4KC0A 1MBZA 1OU0A 2C20A 2ZJ6A 1MDBA 1NY6A 3AKDA 5DV9A 4AG3A 1ND6A 3LNTA 3AJAA 3MCVA 4KPFC 3K2QA 5JAIA 1Q19A 1HKUA 6GPBA 2YQ4A 2W0SA 3L84A 4D3DA 1J07A 4RK1A 3K0AB 4DZZA 1Z6XA 3Q9LA 1BA3A 1DC7A 3C74A 1LC0A 3EY4A 3K1YA 3RGWS 4HDAA 2D7DA 1GNPA 3LGAA 3EHDA 2ZPAA 3IQFA 3ZNPA 2CDCA 4YJGB 1XMXA 4MJ3A 3T7JA 1OQAA 3UATA 3K6KA 1QQTA 5H3CA 1C8VB 1U02A 3C5VA 1EG7A 4W1QA 4DDUA 1SKMA 2NM0A 3D9QX 1EB8A 1F06A 1Y7TA 2BR4A 5J58A 3DUFB 3ROGA 3MQFA 4LV6A 4W7HA 2FWJA 3JRNA 4I0WB 5A62A 1QH1B 1JZTA 3GAAA 4W5JA 4DBVO 1QTQA 2VJBA 3WGMA 1ISGA 3PQFA 4F0JA 2KLBA 5A5FA 4TLBA 2JLQA 3V2UA 4F3YA 3PPXA 2RB5A 1FFHA 4BC1A 4LBWA 1W5SA 3BMCA 2HJGA 2V7XA 4M1KA 1SHKA 2YR0A 1G8JA 2YUTA 2XNHA 3LBAA 4ECEA 3M8KA 3D4NA 4TRJA 5GJWC 4BGUA 4XFDA 1JT9A 2J5RA 4TSFA 1A04A 1JQ5A 4YMHA 3W5SA 1EQAA 2Q1SA 4HH0A 4MUJA 1W4LA 4QQRA 3HDVA 2Z57A 1MO2A 2Q3EA 3DV0B 1QJCA 1XXLA 3JQGB 1QQ6A 1A8SA 1DXOA 4KO1S 2OOSA 4OHVA 3G79A 4GC5A 4UUQA 1AT1A 4EJ0A 5J40A 1MFZA 2ID4A 3BWBA 4RADA 5JCZA 1NP7A 2C83A 3WKEA 2W00A 5BR4A 1C4XA 3R6DA 3CINA 5I7AA 2WHRA 3PHHA 5K4GA 3STYA 1PR6A 5IASA 1HI9A 3K32A 3HU5A 1UK6A 1DWOA 1ZIXA 3QKTA 2OHGA 2K87A 1RTTA 2J6CA 2O3TA 4KWIA 4Z8XA 2AX3A 2MSKA 3J81A 2EQBA 2NO7A 1OZ0A 2XNJA 1ZMXA 3X2EA 1DKRA 2J07A 3ITNA 2YIMA 4J75A 3S2FA 2VRBA 3LVRE 4X1IA 3TTVA 2ESRA 4B32A 2JFVA 4BX2A 4JP3A 1D07A 4L16A 4R05A 1EDDA 2XECA 4B6RA 1NKSA 3G17A 4BU1A 1IJEA 3OAAA 4MRPA 1YUNA 3B6EA 1COWD 3U40A 3S8EA 1Y6GA 4RVSA 2A4MA 1G19A 4Y6RA 2ZU0C 4BGEA 2CDBA 1U0FA 1FOEB 1YB4A 4TUYA 3HJHA 1KOJA 4BO6A 4QOHA 1UDRA 2B3DA 1ZN8A 3AYXB 5HVNA 2BVNA 1P3JA 4MCIA 5DF1A 1M2HA 3QKUA 4UE6A 1T43A 4BO1A 1GGVA 4EKNB 7GPBA 2OM2A 1JP7A 5K0ZA 5KU7A 1CCWA 4C3VA 3M4XA 1UM9B 3JR3A 5LMZA 3H18A 1V5GA 2REBA 5JARA 1GDTA 1HSZA 5CX1A 4IZHA 1T5OA 4UATA 1HWYA 3QJGA 1XD2B 1JHVA 3SIRA 2CW5A 4JC8A 1WS6A 4L27A 3GFQA 4YLYA 1Q84A 3PENA 3DCIA 3IVCA 1QUFA 2QG6A 4QVIA 2AL7A 1NNSA 2VQDA 4QOGA 1YRWA 2BE7A 2ENUA 2AE2A 4ZZIA 3DM9B 1G8YA 4GP7A 3HO8A 4FSHA 3EQ8A 3H7AA 3FNIA 1EWVA 1US8B 2B8TA 1H0KA 1KZ7B 1R0SA 2CNKA 2PS1A 5G0VA 3U37A 4CV3A 4EGJA 2XKKA 5KO2A 3SHOA 3R0XA 5FUWA 3HA2A 2B98A 4LHEA 5T67A 3MMXA 3IP8A 4KLAA 5DGTA 3WYAA 1QOQB 1SUFA 2WV7A 4RK4A 3MWJA 1CQIB 3BS4A 5KI6A 3T5PA 4FDVA 4G56A 4LF4B 4F60A 2PAFA 3GDHA 2QRUA 1IVNA 3TMYA 2X23A 2GJ4A 3WQHA 4S1WA 3H1AA 3EUWA 2FPGB 2HSDA 4IH4A 1L1EA 3GZNA 3Q6NA 1YQUA 6PFKA 1XN4A 1Q11A 2W6JD 3NORA 5HKBA 4JN6B 1QYRA 4HDMB 2RHMA 2GM5A 1FK8A 3LWZA 4CTJA 2OHFA 1NBMD 2VQ6A 3N3BC 1S3SA 5BSGA 1JLMA 2PKRA 3OPXA 2CV1A 3PU6A 4N5IX 3DLHA 5FADA 1KMNA 4E70A 3ENVA 2DLCX 1IVSA 2Y27A 2OV6A 2YYYA 2PRZA 3UANA 4CF6A 4BRWA 3R7FA 2EZTA 4CUJA 2ID8A 3QLEA 1ZN9A 4JOSA 2IUEA 2CBGA 2QN7A 1P1CA 1MV5A 5I51A 1JG2A 1NONA 3KR0A 4XVRA 4ZYLA 4CKWA 1J8QA 1V71A 2RHJA 3BWXA 4I1RA 5D3ZA 5F9MA 2A7QA 4HLCA 1XF9A 4PG6A 2GPAA 3OY2A 3GLIB 3UMYA 3SMVA 4OH7A 1C7EA 3ZHYA 4AJLA 4I5GA 1VSQA 5I9MA 3WKDA 3SQLA 3EODA 1WTAA 4ALLA 1EVYA 2BHNA 3DZDA 1YCHA 1MJ5A 1D4AA 1VL6A 1XRQA 4ER7A 1KSHA 3PQ6A 1F2UB 3U6BA 4ZVQA 2VJMB 4TKLA 4YYEA 1PT5A 3IDQA 2FEKA 3AUUA 2CJWB 4DY6A 2LXNA 4YV7A 5KOYA 1T9BA 4DYHA 1WUTA 5JCJD 2ZRHA 1UPCA 2NW6A 1NN0A 2WVAA 4FQ8A 4FYYA 3UKJA 1H9CA 1VI5A 2VFAA 1OWMA 5HFAA 5BPFA 5LJIA 1XKQA 4G1VA 3H86A 2HWKA 5EZ6B 3T5CA 2HQ1A 3JY6A 2YMLA 5EOVA 4GDFA 2OCIA 3FPFA 4LFBB 2QMZA 2P6OA 2OV3A 3JPWA 3K16A 1E9EA 1RKXA 3ZV4A 4F56A 3BRSA 3QUSA 4Q21A 2FUEA 3FUTA 4NYIQ 1L8XA 1E1CA 4CRWB 5KTPA 1CUWA 3PUHA 3VR5A 5DM4A 3KXIA 5CXSA 3QUBA 4GPZA 5GONA 3TL2A 2WICA 3AHDA 2I3ZA 3PDHA 3W9BA 2WMOB 2C2HA 4AZ3B 3DF9A 2IRWA 4LXTA 5DI3B 1H2AS 4QJIA 2TYSB 4DVGA 5D6NA 3QWIA 1VBNA 4JBWA 5CB4B 4R6WA 5J1SB 5G1PA 1GTJ1 3D3NA 5IXYA 5EIXA 5GZ6A 1WUIS 3DCYA 4P4GA 1WCIB 3IIIA 2X0JA 2F55A 5LYYA 3UPDA 2OESA 3P97A 4R1SA 2BUCA 1EZ1A 1G1AA 3OOSA 3QLUA 5EZ5A 2C3PA 3RR2A 4ALMA 4NOJA 2A57A 2DFKB 2K7ZA 3KDAA 2VTBB 1IRIA 3B3QA 2IQ5A 3RYIB 3UN1A 3WRXC 4XOIA 3AEXA 1KVTA 4ALJA 1XB2A 3ZCUA 4O0MA 3OU7A 5IHPA 5FHRA 1AKWA 5AIAA 4RKRA 1JTEA 2KBFA 3OLWA 2PBZA 5CYOA 3V1NA 4C7BA 3QI2A 1LNSA 2HU2A 1P3Y1 1H2YA 4LYEA 3UMCA 5KPDA 1A4UA 1QBKC 2GJKA 4O2AB 1PR2A 3GUCA 3S55A 3VZQA 4NYJR 2QGNA 2DX7A 1KS9A 4MOWA 5IXSA 3ONNA 4CM9D 3EG9A 1L5YA 3OWHA 1UODA 5FPQA 1SR8A 2AFIE 4A10A 1GPWB 3TW8A 5BSKA 2DEUA 1R0XA 1E7SA 5BR7A 5ABPA 1W1UA 3EBLA 4HADA 1GGKA 1UDWA 2REOA 4NCIA 1J9GA 2V5UA 3K9CA 3VZDA 5ETJA 4BP9A 5KTKA 2ACWA 4O3FA 3RIXA 4GZ5A 2BJHA 1C5KA 2Z1MA 3AUXA 3L7DA 4PTLA 4E12A 2WD8A 1ZCBA 4ETNA 1QK5A 2ZBPA 4ZYYA 2IU0A 1TU3A 2EQ5A 3H2HA 1EE2A 4FE3A 3TEMA 1XRSB 3HN2A 3VPGA 4KR2A 2XE4A 1PJQA 3EXAA 2BFPA 2G83A 5KJ6A 1Q1GA 5A4IS 2R8YA 3DKKA 5EJ2A 3ZNNA 1MR3F 1OTYA 2C0CA 2O6LA 2XD9A 5FR2A 4H7FA 3NUQA 1BWSA 1ESDA 4PN3A 1ISJA 4Q3BA 2ECQA 4TS4A 2RGXA 3M34A 4KFTA 1EFPA 5I8ZA 3SF8A 1FXWA 4NBVA 3VHXA 1TUEA 2QAJA 2GCOB 3ASZA 5J2UA 4LF7B 5AK5A 1ZOIA 2I6GA 4AJOA 4XVCA 1EXNA 4NOLA 4DQVA 1WD5A 3VOSA 5JJIA 1P2SA 2WKSA 4HAVA 3F5FA 4IWNA 3TUZC 3UPTA 1UADA 1R5NA 2H0AA 3AWDA 1KIFA 8AT1A 3K20A 3CRVA 3T6KA 5CFOA 2B94A 2WJWA 3P9XA 2QN2A 3PNSA 5CHEA 1VIVA 3QLVA 2E21A 2D2FA 4MVXA 1CG6A 2YXNA 3HS3A 4WK0B 3FSGD 2E7ZA 3HBAA 3IA2A 4INZA 2ZRDA 4UTXA 1Z4OA 4E2YA 2B6HA 3BFVA 3CXRA 4I6GA 4MV7A 5IBQA 1GA4A 2YWBA 3PCRB 5CM2Z 1LB1B 4BTVA 1NXOA 3U3JA 4DV4B 4ZGWA 2J4DA 2HY7A 2AI3A 1EFRA 4DL9A 5KTYA 1GO2A 1YDWA 3C4JA 3RARA 4BCDA 3GJ3A 2LIVA 1DL5A 4CIDA 5E6RB 3OIFA 1ZH8A 4M98A 4XQGA 3DMTA 1K27A 3GEBA 4CMHA 1EFVB 4M1YA 1GSOA 3D2LA 2JGMA 2DXIA 4NE2A 1G9TA 3EXFB 3RSGA 4F84A 2QBYB 3PGVA 3UOGA 5HUJA 4K9RA 4CUZA 4DDTA 3S2YA 3RS9A 4W1SA 3TAUA 1U2QA 2HM7A 3S6JA 3TOZA 4JEUA 4GLFA 4EI2A 1EX9A 3JYQA 4RLFA 4ETMA 4IFEA 2X2FA 3IV7A 1MQ9A 3L6BA 1YJCA 4R0MA 4IDCA 1OFTA 1DWPA 3V4FA 3R9WA 4PHCA 5L45A 3HJCA 4YRQA 4DLVA 4F6RA 1BXRA 1PFUA 2Y1GA 1XI2A 4MVJH 2VAVA 5B1SA 2H1OA 3QOYA 4ZAXA 4HFJA 3TQSA 2YY6A 4B2IA 1PRYA 1TAQA 3Q8XB 4C7OB 2ZT8A 2JASA 5K6AC 4XFKA 4BNKA 1WZCA 4GOJA 3F73A 1XQ6A 1LQTA 4UVIA 3UB3A 2WJZB 3VDNB 1GNRA 4IGEA 1ES9A 3I73A 4JLMA 1K7EB 1NSYA 1OWNA 2BM9A 4L8GA 5JCXA 4OUDA 2ST1A 4EGAA 4RULA 5IHXA 3WQQA 4HS4A 3MB5A 3OT4A 5GZ1A 3KS9A 4JYZA 3FZNA 1N36B 3G88A 3IUBA 3M33A 3RS3A 3BKXA 3HXTA 3TVTA 5B3LA 2WVJA 1PTKA 2WZDA 4RGVA 3U13A 2BSAA 1O5TA 3DOEA 1U94A 1G3MA 3KQMA 1BDIA 4NOMA 1S8FA 1F48A 3RJMA 1JLLA 1MFPA 1RQGA 3EGVA 4Z49A 1AZWA 4XD7D 2EBUA 2QRMA 1G21A 4CKZA 3EEFA 5EN4A 1B2RA 4RABA 4QGGA 3T35A 3IT1A 2XCUA 3KPWA 1W5AA 1LPSA 5JLAA 4DHWA 3OC0A 1OR8A 2WUWE 5HS4A 3KQKA 1MAWA 5TQ2B 1DC4A 1I1QB 1V11A 4IBOA 1KWGA 1BMQA 2R5FA 5CB0A 5EHQA 4KP7A 4CM8A 1L3BA 2A1TR 1E7YA 5K0EA 4IXMA 1GGEA 3AR4A 4OI4A 1Q7TA 1EUYA 3LK7A 1A4IA 3Q9NA 5LP6A 2PHZA 3IAM6 2G9UA 1NQUA 4EF6A 5A9SA 4C2UA 2GJSA 4QNNA 3PQ5A 3FKSD 5JSUA 1Z7WA 2DBQA 3DHYA 3NTXA 3D1LA 3L7JA 3OQIA 4GOLD 5AKEA 3WA6A 2GF2A 1P60A 2JW5A 3GZNB 3PXDA 4EF4A 1UFKA 2RHOA 3FOCA 2AJDA 4ZDWA 4BJ5A 1ADGA 4N0PA 4MKXA 2O8VA 4MUGA 5ESDA 3M7IA 1YBVA 3FDFA 3Q12A 2BFFA 2FPOA 2Q0QA 3CRRA 3JR7A 5DMXA 5FPYA 3ZWWA 3SAJA 3N58A 3OF3A 1Z68A 1DIAA 2D5AA 4HRAA 5GQSA 4FMCF 1O1YA 3GCWA 5CMLA 3AM3A 5GGYA 2X9QA 1A96A 1DADA 1YB2A 3HRHA 4OFBA 4Z1OA 1NX9A 1YB5A 4KIGA 3TD6A 2PKCA 3N07A 2GWHA 2F59A 4YCNA 3SSMA 4YLEA 3CO5A 1Z2PX 3HN6A 4W9RA 3PEWA 4HEHA 1Z18A 3U5ZB 1ZEJA 4WK4B 1AKVA 1SVMA 3E15A 4EG8A 1SKUA 1Z88A 3QX9A 2Y6VA 4WH0A 4B3JA 3IR6A 4J0GA 2Z4SA 1FSGA 3OJOA 2EX1A 1PYGA 2D06A 3BE8A 1GU7A 4KTTE 1CDEA 3GWZA 3MWLA 2XWJI 2JJ2A 1AQLA 3OA2A 1P1BA 4L57A 4Y9SA 5EJ7A 1PIWA 3LPLA 4P3OA 3CSUA 5A06A 4U7JA 4DG9A 2X3UA 4YRCA 1UPXA 1XQXA 3ZCTA 2OOKA 3ME5A 1UPBA 3EDQA 221PA 3QFTA 5AXCA 4CMBA 5F76A 3LA8A 1XXHE 3QTLA 4WY5A 1D5WA 4DILA 3X1XA 5KYYA 4IZ6A 4UTOA 1YJXA 3EFHA 4S2EA 3EUAA 4WCVA 1OGJA 5LP1A 1FDIA 3F78A 3ZQ6A 4E5KA 4YCCA 2ACKA 5FOQA 1VPLA 3BWMA 4TQUS 3C16C 1O6ZA 5IM5A 2FFRA 1SXQA 1A2KC 4G4JA 1HLGA 1AGRA 1PR0A 1XOIA 2HSGA 3CS3A 1B6TA 4XRRA 1E2NA 3LQQA 4M0LA 5CA0A 4TM8A 3VJKA 1FS6A 1O95C 3SXUB 1U0NA 3V4ZA 4FP9A 2JLZA 4B83A 4F3KA 3CKMA 2COKA 2G0AA 2OVBA 2Y0DA 1E8DA 5JH7F 1PU2A 1R4AA 4HUQA 1Z0IA 5GONB 1K75A 3RT1A 1GAWA 2PGIA 5EXPA 3TZCA 3FNBA 2VI5A 3AUTA 1KQNA 4OSEA 3EQ9A 2JZCA 4LRXA 1MDFA 3QI7A 1QZXA 2AXPA 3K9QO 1QE3A 1G5IA 5AW7A 1P2FA 1KE2A 3VV3A 1FLAA 3MAJA 1COZA 3O4HA 1EVQA 3ONVA 1ZMBA 1F2VA 2G17A 4I19A 2HTEA 3CZ5A 3TOXA 4U8HA 1LRLA 5C4IA 2FN9A 3P0FA 4A0FA 1MAUA 2EFCB 2R6AA 1KERA 3MT7A 5KJ1A 1KBQA 3AHHA 2AUNA 4D79A 3L0SA 1NRWA 2UYCA 1QYXA 1EBUA 4Z9YA 3B9RA 4QX6A 3PD1A 2H4YA 3T1VA 3ZCPA 3VSEA 2LW7A 2Z4TA 3IUYA 4FD3A 3JWIA 3F4KA 3JYLA 3PQ8A 2CMGA 3T1QA 4B80A 5IMSA 4PRKA 2WWYA 4R5HA 4J29A 1B00A 4YRPA 2O4CA 4GYKA 1E7QA 4CCAA 4ND5A 5EMLA 3PC8C 4KAJA 4IVRA 3DLAA 1Z35A 1P5RA 3KOXA 4XSGA 5T4HA 5C7YA 2X3YA 3GZJA 5IDWA 1SO8A 3TW8B 4B3SB 2VT6A 4DWOA 2AZMA 2DG2A 4MK4A 3P5BA 5MHTA 1UDBA 1ZM7A 2FMUA 3ZU5A 2Z95A 1LDBA 1Y1QA 2NQ2C 4LYFA 2Q0SA 1G8MA 3ORHA 1P75A 4B45A 3F5SA 1R1DA 1WPGA 2XIJA 3AF6A 4X8LA 2C5AA 2EWVA 2O57A 4AS2A 2A9VA 4ASUD 2P6PA 3E7PA 4P5PA 4QA9A 3BJEA 1RBYA 5LA6F 3SKVA 3ZC3A 5JTTA 1Y81A 2HAEA 1ZBDA 4U63A 5KIAA 1G4AE 5BY2A 5CVVA 1T0PA 4EDHA 2Q1YA 2HA3A 3DP9A 4EI8A 3B9QA 4DA6A 4KH1A 2OK8A 2X3FA 3BF8A 2RAPA 3GFBA 4IQ8A 6NULA 5IKEA 4YCLA 1JKMA 3AJDA 3AL3A 3HCDA 2RC6A 3IIJA 1EFPB 2BFEA 3SF8B 1X9HA 4TT3A 1RZ3A 5J2UB 2DBYA 4WW0A 3V8MA 4KGDA 2PX2A 2I6FA 4EYEA 2JD0A 4KO4S 5HW0A 2XQVA 1ICIA 5AVRA 3GLFB 1ESCA 3A9WA 4LAFA 5BMOA 2EFGA 3PGA1 2LRHA 4NULA 1IMJA 1DAKA 4M22A 1OE0A 3NOVA 4GYWA 5C8VA 1DRJA 1HFWA 2FMHA 3JD4A 1IN7A 4ZQIA 1DMRA 3B13B 1N25A 4HWGA 3IXQA 3P2JA 3ZLTA 1RWWA 5CAEB 4DSOA 3IERA 3L0ZA 1DJQA 2BFOA 2VDWB 3JQAA 1K3FA 1A27A 3WGGA 3SKYA 3ICWA 5INTA 1VMKA 1FTQA 2FPLA 4KQ6A 4NNOA 4RELA 4UUAA 1WL8A 5FL7A 1I6WA 3EWNA 4QL3A 1SC1A 4AVYA 4D8YA 2J59A 4DCNA 3HO1A 1TLTA 1WMSA 5F2OA 3QMWA 4MCJA 1N6RA 5U4XA 4CM4B 3JQ7B 3INTA 5ALDA 5JJCA 5IK2A 5MN5A 2XZDA 4QYXA 2ABWA 4RMJA 4BJ1A 2X2OA 3EJWA 1YJBA 5LN1A 3FKJA 4RU1A 3WV4A 3MSXA 1X14A 2D3WA 3S2SA 3SBXA 1OX6A 2PX3A 2GN9A 3D7KA 4H2DA 2BFWA 3ANNA 2HK7A 2CFRA 3EH2A 3LWNA 2VPXA 3PNPA 4B40A 2V3VA 4FN4A 5FNVA 4BMPB 3QX8A 4EEZA 2JHPA 3A1SA 3G3EA 4Q66C 2OGZA 4C0HA 1PTJA 4RJ2A 4ZVTA 3RJTA 1QLWA 2NN3C 4DANA 3NUZA 1UKYA 4UBLA 3OZEA 1JAZA 2Z1DA 1IPEA 1MTOA 4HLNA 2XZTA 3MNFA 4IYJA 4DMCA 1A9OA 5B6PA 3LM8A 5EZYF 2AFRA 4EA6A 1AO3A 2HK9A 4WNAA 3IOCA 2QVYX 2NZ8A 5TQ0A 3NKVA 1GZ6A 4TKVB 1L5NA 3D0RA 2NPIA 2YN2A 3B12A 3UMFA 4B46A 4JVNA 4ENQA 5KOJA 1YS2X 2HN9A 3G1WA 3OY7A 4P08A 1OT5A 1KC3A 4TZTA 1ZVVA 2BV3A 3R5JA 5FWYB 3R7SA 1XLTA 5BNWA 3HJTA 3OA0A 3HCNA 5LOVA 1AGYA 1C7FA 3HUTA 3LT5A 3GLHB 1DB3A 1E4VA 1JAHA 2G09A 4FOPA 4Y7CA 2IKSA 2QN9A 3RIGA 4IJQA 5JI3E 1SC4A 2P9EA 4F12A 3DMYA 4ISCA 1JEYA 1VL5A 3EFBA 4OFZA 4XUEA 3HU1A 1ZKDA 1R5BA 4G67A 2XBMA 2Q1UA 2KE5A 4R8MA 4GHWA 1Y37A 3IPRA 4KIFA 1ZK0A 1RNLA 2HGZA 2QXTA 1V96A 4Q9NA 1BN6A 1XMVA 2DSTA 3EXHC 5CXXA 5GVRA 3SZUA 3DDNA 5F9FA 1Z0UA 1KAHA 1V11B 3A10A 4ICIA 2QTCA 1QS0B 4OBEA 3C7AA 2BCJQ 4RNDB 4E09A 5FLXA 2OFFA 2DB3A 1PG5A 2OAQ1 1AOXA 5HOQA 4DM3A 5LZ4A 4KQWA 1J7KA 2O19A 4UULA 4I9UA 3AF4A 2DVMA 2QTGA 3ZCRA 1TD1A 2HMAA 3EYWA 1HT2E 5LP6B 5F98A 2P41A 1ENOA 1NNUA 3AL0C 3O92A 2AEFA 5ARDA 4OMDA 1ONPA 4KHZA 2HPVA 4HYTA 1U8XX 1FFGA 2Y4OA 3OQIB 2G04A 3FFTA 1DAIA 2VUTA 4FT4A 4QO8A 3U39A 4EGFA 1KO5A 4AFNA 4TMZA 4QLOA 3PQ2A 3VSAA 5TGDA 1IPFA 1RRMA 1ZWKA 1P6XA 4EHDA 1PHPA 2WUGA 2ZR0A 1NUTA 1RRPA 1POXA 1QZ3A 5K4AA 3GK3A 3VZCA 1XRPA 5BVHB 3R3ZA 5M34A 4P5DA 1QH8A 2BDUA 4OQXA 1SXJD 4R16A 4HZUB 2ODBA 1Q3TA 4JUAA 4L2IB 1UT5A 2ZRFA 4MVYA 4MIEA 2PGLA 2ZITA 3K35A 5HIIA 1O0BA 5FTKA 2BHRA 1ZA1A 3PPVA 2AN5A 1E9DA 1Z5PA 2Y3IA 1G20B 2PBFA 4JHLA 6CHYA 1GPUA 1XHLA 1H3FA 1YGPA 2HT6A 4C87A 1G55A 1FYVA 4D0GA 3P5SA 4V1CB 2QAGC 1A0OA 3NM5A 4HGZA 5T8KC 5HKLA 1DAFA 1WJGA 5JXWA 3EA5A 3CF2A 4MRSA 3GI1A 1F20A 2DUJA 1FRVA 3AM5A 3MIZA 4R4JA 5ESRA 4ZFNA 1Y4UA 1RKVA 1FVOA 4D43A 3TS1A 3LO5A 1SUWA 3O8CA 3C5HA 3VPBA 4QU0A 1U9ZA 2QP4A 4NBUA 3DQZA 3BXHA 3HJBA 3MS4A 4C0SA 2B92A 4PQRA 1NV8A 1OKKA 4LI3X 2CE2X 4Y67A 3ZQ4A 1YL7A 3DXZA 3H83A 4YFYA 5K8IA 3Q10A 3MJDA 3NIGB 4OLJA 2K2WA 1IQUA 4PCLA 1E9CA 3TMAA 1R2QA 4YCAA 4EVRA 1GUBA 3KJGA 4PU0A 4RHYA 3ENNA 2CNLA 4K05A 1Q1ZA 2FHPA 3MWDB 2FP3A 5CFLA 1X86B 3WY9A 1KQFA 2E4UA 3FGNA 1BOFA 1KI4A 1BVRA 3WNQA 3OCWA 4WZBB 3T94A 1YQDA 2FG7C 1U1IA 3KRTA 1UWVA 1MD9A 4Y2VA 2D0PB 3ZX4A 1D0IA 1UBLS 4FBLA 3LT1A 3LPAA 1S1CA 2EHJA 4KQ9A 3SS7X 3T3DA 1LVHA 4LCEA 2BSXA 3ZYCA 2DJ5A 1TXGA 3AF1A 4G5RA 2ZSUA 2J09A 3K3PA 4F45A 4RENA 3CB4A 5D87A 3S40A 3KC2A 5F7OA 3DVQX 4JUFA 4KSYA 3WRXA 1II8B 3OF5A 3BRWA 4C30A 2X6RA 1ECGA 1YCGA 3TPFA 4WNYA 1SOAA 1DRUA 3CURA 1SPXA 5T6BA 3AR3A 2WLTA 1FE8A 4RZ2A 5CPFA 5FQOA 3MTQA 4GPBA 2E9SA 1Y3CE 3N87A 1MRSA 4KE8A 2XRYA 4RF2A 1OFHA 2CLSA 2RONA 3HXOA 4K2HA 2QQ5A 5ISMA 2YOFA 2DUNA 3WDMA 4AJHA 2VUUA 4F4UA 2ZWIA 1P4RA 3NBFA 3IEUA 1WW2A 2NPOA 2Y0PA 1KIAA 3Q9UA 4LV5B 5B7PA 1WF3A 4CETA 1T91A 2RBGA 1A97A 4F91B 1CNMA 3O8NA 2G3YA 2EQAA 3ETEA 1XDDA 1E6WA 2HDOA 3HY3A 4NTZA 5F9HA 2EVWX 3G9TA 3QKSB 4URUR 1EHCA 3HV0A 5AHRA 5ICMA 1AS0A 1OBOA 3AR7A 5LFAA 2DWCA 4B7AA 4YGXB 5BVGA 4BVKA 2HCBA 4NYIR 1OYYA 2R8BA 1LH0A 2LUOA 3B1ZA 3KVVA 3NIDB 5JQGA 2UXCB 3GJ4A 1RI3A 1ZXBA 3X43A 4M87A 2J3LA 3ZBUA 1TAUA 1TX4B 4C4OA 4HGOA 3ST7A 4GXQA 4BAGA 2BONA 3B36A 5H5JA 1JU3A 1N1MA 2C88A 2HBRA 3DJFA 2VH1A 5SY9A 3RKSA 1N5IA 3AGPA 3H5RA 1XDBA 3P0HA 4KMSA 1O03A 1P1FA 5EERA 5LZ8A 3I53A 1Z6ZA 2I5PO 3LFHA 1H2XA 3DAPA 1AKQA 2ECOA 1KPIA 1TK2A 3NH6A 1VE5A 3NTRA 4G0ZA 4GNRA 4TQ9A 4IQ4A 4YJ3B 2IK8A 1CKEA 1EPUA 3A11A 3EQ6A 5JRZA 2GBCA 4V0RA 3LPNA 3UMGA 1PWYE 1W94A 1JWAB 4QRIA 5FCDA 4BP8A 3EVTA 1NF8A 2H31A 4WCDA 5GPBA 1KEKA 3COYA 1PT8A 2VCEA 4J07A 4GO1A 5CRIA 1UP6A 4MCHA 3I2YX 1HOXA 1LDGA 1NOIA 4UOZA 2HQOA 5IJ0A 3TTTA 2JL1A 4XA8A 4OLBA 3LY5A 2IU3A 2ZAMA 3PWZA 4QEZA 4DNXA 1FX0B 1KHHA 2IDMA 2IEZA 1MIOB 2GPTA 4JXKA 3V2HA 5KVCA 4XI9A 1SVLA 4NEGA 2IYZA 1ELOA 3GUYA 1GPJA 1HT0A 4RANA 2HXSA 4YAFA 1JLSA 4DR2B 1PG2A 3P2OA 5F73A 5JPCA 3OEHD 4EY5A 1ZAKA 3ZKWB 5C8XA 1KAEA 1E0AA 3AB7A 3ODPA 3LRTA 4ECAA 1QIMA 4PFQA 4U6NA 1WF6A 4DQ0A 1S2IA 1CZNA 4UU8A 2I2WA 1DXYA 2XMRA 1REQB 5L4LA 3AY0A 1ZJJA 3P45A 4JGGA 2LCFA 1IK4A 3TLAA 3U4QA 3ADOA 3EB9A 1YRHA 1L7PA 2C0PA 2FNAA 3OKAA 1K66A 4TQGA 1BWPA 2J5BA 5THXA 1L5FA 4AWXA 5CYGA 1WB4A 2BMDA 1DINA 1Z39A 4FNGA 2G72A 1OFIA 2DRIA 4JB8A 1LI7A 4KODA 3G0OA 5D7BA 2C7GA 4E4YA 4YMVA 2P0AA 1OPRA 5A5VA 2A5JA 4YMWA 4Q18A 2OZVA 3HP1A 1Z4PX 1BW9B 3B6IA 3IJRA 3KJQA 4MV5A 3TZ6A 5L7TA 4JQOA 3G2IA 1Q74A 1ONOA 1RWNA 3ELUA 2I6SA 2X13A 4CLRA 2XMDA 2VYNA 4KO2S 1PR1A 1R0KA 3QG1A 2BMFA 1FQJA 1G66A 1RAHA 2C9DA 3RVOA 1EIZA 3ZCSA 4F8JA 1OJLA 1V45E 3L0YA 2GGSA 2LBPA 2OVFA 3KR1A 3DHWC 1BSVA 3FTNA 5ALUA 1OGIA 4EFNA 5BV7A 3RVJA 5EE9A 1N57A 1IG3A 4H0CA 5EKDA 2PR2A 4WKNA 2A0KA 4HQOA 4LDAA 2VPPA 1YKSA 5JSHA 3GU3A 3SZLA 1ECFA 3OBIA 4Z4CA 3JQQA 2D8MA 3AFNA 3OZGA 2GYUA 4RPCA 1GZ5A 1CJKC 4G23A 4XCVA 4JENA 5KYYB 5EPOA 4RTLA 1UJNA 4KXFB 3V7FA 1TVKA 5EWLA 2HA0A 1HPLA 3ECSA 3EE6A 3ESZA 4N6GA 2UYOA 1F7UA 3SQWA 1XCMA 3HSKA 2V6BA 3GIWA 5LOVB 1YD7A 2AKAB 3LHKA 1SOVA 4MTLA 4RY8A 4LVOA 3NEJA 1EDOA 5DDIP 3U62A 4NZZA 4C2AA 4BQFA 3PPWA 4KNYA 3I4FA 5ED4A 3EZFA 3W8RA 1O87A 3OZWA 3FZGA 4QUKA 3MIIA 1RHKA 1UWCA 3UJCA 1MC5A 3FLMA 1UEXC 2POCA 3O5AA 1QP4A 5IM4F 1ZGCA 3FTPA 1R0ZA 1W1IA 1E3TA 3OFKA 1P33A 3TLGA 3IHTA 3RVQA 3ZZ1A 5AVJA 1HO3A 4EF5A 2XTJA 1QWSA 4QODA 5BN3A 3IEMA 3O94A 1LPAB 1ZMOA 5CFNA 3CPSA 2XVYA 3ORYA 1AS3A 1H2RS 4MV8A 3U7HB 4KR3A 3WLAA 2LDBA 2Q3LA 1ZDMA 3HCAA 5BR8B 1GG8A 1V48A 3A4TA 3RWBA 4EYOA 3U31A 1EH5A 2AFHA 2KHZA 4B47A 3C48A 1JR3D 3HDJA 3M4NA 3SX2A 2CGEA 4Z9BA 3BK7A 3T5MA 1E99A 3DDWA 4ZAZA 5BXYA 2JDIA 2QMOA 1WVIA 3COPA 2YJ6A 5A1TA 2GSWA 2GYWA 4ZMRA 4PYRA 5SYNA 4B6PA 4DIUA 5GIPE 1BMTA 2OHJA 4XTRA 5AW9A 1KJWA 4JJGA 5E9JA 1W44A 1LDNA 4DG5A 2ANCA 3IHWA 5AW1A 4BNDA 5LVAA 5K0NA 3KBBA 1KZYC 4LQCA 3E3NA 3U49A 4DZTA 1FBTA 4C0QC 1GAJA 4REOA 1X7ZA 1XTIA 3P7MA 4CU2A 2C3OA 1IOZA 4GBGA 4IO0A 1SVIA 2ZB4A 3G8DA 3WB1A 3UT0A 1G8HA 4FX5A 4N3CA 1K68A 1VLZA 4H6VA 4HL6A 4L9AA 5HBRA 5HZHA 3I61A 3P9CA 2ZFUA 2JFXA 3W9SA 4MQLA 1CUSA 3U1TA 3TH5A 5JW6A 1QIGA 4M46A 2YNMC 1ML4A 2HLDA 3WL6A 5ED0A 1IBLB 3HCFA 1MJGA 4ZAYA 1T34A 3I6ZA 4HH3C 3VDMA 1TJ3A 2H2FA 3RCBA 1XRLA 3K5WA 2DPMA 3DYIA 4LX8A 4QTTB 1DCKA 1NFFA 4W5HA 5KDOA 4IDEA 5LWHA 3K9WA 3T61A 1TF5A 2HJSA 3BREA 3DFIA 4JSYA 4KQKA 3QVGB 1FUKA 4EHFA 2W4IA 4Z2YA 3AZQA 1ISMA 4L8YA 3FRHA 5K99A 4LHYA 3KSRA 3PQDA 4BFTA 4N41A 4JT2A 5CR9A 3B5IA 3HM2A 3TSYA 5C5CA 2YW9A 3IAAA 2X4DA 3VKFA 2WEKA 3K70B 1B73A 4N3GA 3RUHA 4RW0A 2I4TA 2ZB7A 1EEHA 3DOFA 1GDHA 2QT1A 2WDZA 1GPKA 3L8MA 3KKKA 5L9AA 3U7FB 2I4LA 2AHOA 1XT6A 3MT9A 4YT2A 5DWVA 1S3FA 1XD9A 5LLTA 2PMDA 4AUKA 5DT2A 1F0KA 3PXGA 1RT9A 4D9HA 5L53A 4B9AA 4CM5A 4KPEC 1QGOA 1ST2A 2Q6VA 1HTWA 4PC3A 4IIEA 3PL1A 4TN1A 4BBJA 4OJMX 5JNTA 3COSA 4JVSB 3NBXX 5AUNB 3E3AA 1SG6A 2IF0A 5TF0A 2WA1A 5D5QA 1RYEA 5JWOA 3LLCA 1LW6E 4M60A 5CYPA 2WIKA 3L1KA 1WOMA 1E4YA 4N03A 1T4CB 3HGQA 4UU7A 3WP1B 4BVLA 2QUBA 4RIIA 1FZTA 3GT0A 1ISHA 4YT4A 2BCEA 1UJ5A 3IBCA 3HDGA 3GIDA 3K1AA 4BO9A 5J5AA 3MRTA 2FRXA 4YK7A 2GD6A 3URMA 5BMVF 1WPXA 5ADVA 1JMKC 3AMVA 3PFCA 5KCZA 5BSEA 1M8GA 4R3WA 2IYOA 4ZQCB 1E8NA 1KS2A 1Z5ZA 4FM9A 1WCWA 2P6UA 2XKBA 3PC8A 1U3DA 2YBDA 5EP4A 1DDGA 1RMYA 4Y6OA 5IEJA 4MVJM 2WIJA 1CUZA 4TVKA 2PJRA 3GLFE 1BN7A 3EZLA 3FPEA 1BQ4A 5C7OO 2UUBB 5DM1A 2R25B 4OHXA 3N0XA 5KX5F 4QPJC 4PX3A 1NOJA 1WIWA 2FJUA 2ICAA 2JAQA 1ZIPA 5DLPA 5I9BA 5CFPA 4PONA 4NIMA 2ZBUA 4HSGA 2OV8A 2CT8A 3ETGA 3C7KA 3K0FA 4NHOA 1A1VA 1FDRA 2ZI5A 1MA0A 1ZJ6A 2YN4A 3H2ZA 4NBLA 4MSUA 5KNBH 1UEJA 5BP7A 4E3WA 3FRJA 3USCS 1CZOA 1QMPA 2K2QB 3B9PA 4WWHA 5FPPA 3SC3A 3SOPA 4DXDA 4QJBA 5IEBA 3CJRA 3LPCA 1IFXA 2VPWA 3QW2A 2EJTA 2RK3A 4AW9A 4KQFA 2A8YA 3RNOA 4BX3A 1KBZA 1OSNA 1LK5A 3HL0A 4GG1A 4EYQA 1WXWA 4M89A 2VJLA 4IZOA 5KYGA 1YE3A 2LP4Y 2CFTA 1KEEA 1NDQA 4ZQBA 4QYTA 1MP0A 1D9XA 5I48A 1ILWA 3Q3HA 1TQ2A 1U1CA 1UAGA 3NHSA 1Z2CA 3R6LA 1PV1A 2IC5A 4X3OA 5CTJA 4CR6A 1G8PA 2JARA 4YLGA 4MW0A 1E2GA 1EUDA 1I7NA 4PW0A 4WIAA 1JECA 4I5FA 4EY6A 1GTVA 3SS9X 3EVBA 2QVLA 2W5UA 1UBSB 3QVXA 4MQEB 4DA7A 5CYFA 4I2NA 2MWMA 3COZA 2NGRA 5IJ0B 4KE7A 3H8SA 3I5MA 4O4LB 5JJLA 3VX3A 3VDRA 4LJKA 2AGVA 2GEDA 1E1DA 3RRFA 1TUBA 5TEWA 2FG5A 2ORED 3PC7A 2PT9A 1U9YA 1LKZA 3SE7A 3WK4A 2I54A 3OQHA 4AZVA 2V96A 3P0EA 4Y2YA 1YASA 1VI2A 3M81A 1DQYA 3VFDA 4BATA 1ACJA 3V9AA 3ZDXB 3PQEA 3HQ4O 3EYAA 1XU7A 2VUSA 4Q9AA 4YP9A 1IOLA 1SRRA 2ZROA 4BYGA 3LBIA 3SEZA 3TVYA 4DLNA 2JATA 4BLRA 4RETA 4CKXA 3J7AC 1YULA 1DNPA 3NEAA 4LSWA 3UAGA 1Q83A 1P2GA 5GVSA 4MA0A 3TECE 3WX0A 3LHFA 1RCFA 1N2XA 3UCEA 5A4AA 1CY1A 3UM9A 5HZGA 1HL3A 3GLHE 3FPSA 3HCPA 4BB9A 1QZUA 1C7ZA 3H5AA 1N7GA 2I7XA 1J33A 2ZS8A 5B2ZA 3P1JA 2IEAA 3RTDA 4E30A 1AMUA 4HWPA 4RF4A 4W4TA 2YFHA 2O6HA 4V24A 2XZOA 3BJIC 4CLRB 4GMFA 5TMBA 1UBFA 2DY1A 1VKJA 2HU8A 3HKEB 4CGYA 3R7DA 4RTRA 2ZCJA 4Z3OA 4EJFA 3W5CA 4X1YB 2OQVA 4DNFA 1FVFA 4BJHB 3EGDB 3GUUA 1L4FA 5DWDA 4X6XA 5KNBA 3ZWAA 5HJ7A 2ZBGA 2F62A 4KXWA 1M7BA 2QYOA 2O8FA 1EFUA 3TBFA 2FDCA 2JPDA 4TXMA 3VR4H 4OBWA 3WYEA 5ALGA 4FB4A 1L4UA 1UQRA 2V98A 3HMQA 4I4TB 5DSXA 4D9IA 5D51S 4WXPA 2HWYA 4NABA 2BI7A 1M1NB 1P39A 1G8AA 1CR2A 1WMFA 3MFQA 3AV3A 4FGKA 2V54A 3PEYA 1WUJS 2JAOA 4MX8A 4BMYA 2O3UA 3NKFA 2YJGA 3WZMA 1TM1E 5EUQB 3UJNA 3GRKA 1JXQA 2WIBA 5GP1A 1FXSA 3KSMA 4BMNA 2A94A 1EP1B 3ETDA 2YV5A 3IVGA 1CS0B 4L5IA 3E4DA 2GASA 2VP3A 4GI7A 4MUAA 4GWLA 1G20E 1R74A 4OKSA 1IULA 3E27A 5ULLA 1Q0TA 1EVJA 2VAWA 5F5XA 2Y05A 4DDMA 2CLFB 3IP3A 5EIHA 1V8OA 1UJBA 3GJ7A 5TPZA 1Z0KA 2ILVA 1JKFA 1NHWA 2AC7A 1LJLA 2ONCA 2VHYA 3AH8A 5IW8A 5EMMA 4JEIA 2C7QA 2OMKA 2ZR9A 1SMKA 2DTEA 3PX3A 3LDUA 4S1PA 1MZPA 4MGYR 1UZAA 5EPEA 3C3JA 1CRZA 3K4PA 2NSHA 3PEEA 2APJA 4QFDA 2EBWA 2LVBA 3A05A 3HSYA 4C5BA 4NFYA 5HE8A 2X1VA 5YASA 2J9XB 1W25A 4BDSA 2OXIA 1W0JA 1R4NB 1L1FA 3UH1A 5DGHA 5EIFA 4MVWA 1TUIA 3D3EA 2IIBA 1OHHA 2X8AA 4Z6KA 1Q5PA 3DLTA 1Y82A 3VU0A 4LXQA 5AVTA 5KVSA 3N7UA 1XZHA 1E2IA 3VBEA 3MS2A 1PE0A 4GZ3A 4BVBA 5AUPB 1XCGB 2TMYA 2NU7A 4MS3A 4GX0A 4CEHA 3JATA 4LYHA 4M99A 5KHOC 4KPUA 4NJMB 2R8EA 2J41A 3MJEA 2AT1A 4WESA 1BHO1 2HA4A 4WZBE 1KZGB 5EUBA 5T8KA 1CR0A 1ESZA 5I9NA 1TEXA 2OCPA 1XWFA 3EA0A 5DCLA 2QX8A 4QATA 1BVYF 4ZO6A 5E9WA 3W4IA 4B33A 5FWAA 2UZ4A 2HEGA 1BDHA 4ARIA 4MDEA 1OPXA 3AUYA 1YRLA 2PX8A 1MORA 1KKUA 4A15A 2O8DB 2WPDA 2QTTA 3U4GA 2DTXA 2R6FA 4LC0A 4DHEA 2GN8A 3DL4A 1T4GA 3PS9A 3DLBA 4OMFG 2Z3WA 3I1FA 4BLUA 2QWXA 1X77A 4MI3A 5CXUA 4LE0A 2C7BA 5G3ZA 4FEAA 4II2A 1R3DA 1YAJA 1OUMA 4EDFA 1GUZA 4UHEA 5FIUA 4C88A 4HNQA 1KI6A 4YDSA 4YASA 5E2BA 3TZBA 3WAJA 2PZFA 3LA6A 4IMRA 1GL9B 4KMMA 1YBHA 1Y80A 2J6BA 3SLGA 5B2FA 3NQ41 5ELMA 3LSTA 4KPGA 4PYLA 2I7DA 5D5HA 1TEHA 4B4UA 4HDNB 1MZVA 3K2BA 3OFND 3K30A 1DQPA 1EGQA 1L4LA 1PN3A 2AMLA 2EZ9A 3FB4A 3KVRA 4RZQA 1EFHA 4TS3A 1BX0A 1FQKA 2B8NA 4FNOA 4P82A 2FW1A 4EG0A 4OQPA 2P62A 3K96A 4PSKA 3EFOB 2A3RA 1OXUA 1IZ7A 3ZHBA 3UFBA 1VDZA 1DAEA 5HJ2A 4N7MA 1ILEA 4UVDA 1SKYB 4WEOA 1IATA 5JRDS 1N6KA 4EZEA 5CA1F 1YDEA 1WR8A 1AU9A 2KX7A 4J43A 3ZU4A 5BRJA 3TXAA 5C46F 2WNHA 2O8NA 5EE0A 3WMXA 1SD5A 2ID7A 3WB0A 3OMXA 1B6GA 1K5GA 4NU6A 3ZXXA 1LX7A 4L4XA 4D9GA 5HRAA 3K1AB 1X2BA 4EKIA 4KRFA 1R16A 1SBHA 1VL2A 2MSDB 1NVBA 4RVOA 1GQYA 3SWWA 3ZQKA 1HDIA 3E22A 4L02A 2C5LA 3L2OB 2DPLA 4HGQA 1ZUWA 1TKBA 2WYOA 4EHNA 3G9XA 2IYNA 3NCTA 4AJKA 4IEEA 4D1YA 3G8BA 1JKIA 3AIKA 4PPYA 2W90A 2XCTB 1AGNA 1MABB 1R6AA 2BL4A 4MDHA 4P4UA 5EG5A 4CIVA 5BN1A 1JFVA 1VZ2A 3AOEA 3F9CA 2ZJ0A 1U8FO 4RCYA 1DG3A 1Z25A 1VKOA 2QRVB 3WGVA 3KUKA 3L0CA 5F3DA 2W2QA 1UOPA 2E82A 4MWSA 2VR1A 2UYGA 2HBYA 4GRAA 4PQEA 4RVCA 5KDLA 2Q6LA 1IIBA 2GQ0A 4GL2A 3NAMA 3K0FB 3UA3A 3OEEA 2G76A 3GZ4A 2ZT5A 3K53A 4HN9A 5FJIA 3TI9A 3PICA 2OYSA 4FDAA 4IMIB 1IZZA 1E2UA 3AM1A 3ICPA 4N5MA 3VYVA 4K6CA 2NTEA 2XKAA 4N7JA 3SIWA 1KYZA 3CH4B 2XAUA 5EKSA 4CBVA 1QRRA 4HB0A 4RFSA 4EB3A 3IELA 3NBQA 4MRRA 4M8SA 1KEEB 1PQWA 3FWNA 2LR0A 1UWLA 3JYPA 3W5DA 1G5HA 2R2AA 4TGLA 3N8KA 4YWHA 1KZ6A 5KWVA 5LQSA 3TW6A 1L8QA 1PV4A 1MO4A 4CEJA 3W2GA 1K3TA 4LQ4A 5DASA 4TLDA 2HJHA 5DPMA 4CKEB 3EMKA 1SHLA 1VE9A 1UIMA 1PFGA 2D2EA 2AWNA 2P5YA 1CB7A 3O4IA 4JCCA 4RJIA 3TK1A 4Z4GA 4KR9A 4F8YA 3DAFA 4X0EA 2FW8A 2JFFA 2R47A 3BGIA 1FFXA 1TUBB 4JZKA 3HXPA 4XQCA 5E38A 2FPRA 2E85A 1HFJA 1K7XB 1T0HB 4J03A 3BWEA 4A6EA 1HKHA 2K5UA 3FBWA 2BP7A 3ZV3A 4LX0A 3C7CB 4OHYA 3V1KA 3WHKA 1AKEA 2GA9A 3K6SA 1T6NA 2A0FA 2PGOA 4A0HA 1PSWA 2X58A 1S2MA 1XZAA 3ILSA 4IW3B 2QAIA 3QQPA 3UWDA 1HXHA 1M54A 5DBEX 2ZI7A 4F4DA 1JBEA 2GRUA 3KEOA 1M0WA 1BWQA 2HV9A 1I3MA 3DKVA 4HD8A 1W46A 1HDZA 5ALOA 1YU9A 4KEAA 3CVUA 1XZPA 1KMHA 5HILA 3PVCA 2I76A 1OX5A 3JCZA 3ZDCA 1V1JA 2L18A 3CVJA 3ITDA 3VYRB 2A0WA 5ALFA 1JYFA 1GP2A 4KK4A 1NJ6A 1V25A 3DL2A 1ZH0A 4RTJA 4L75A 2GZSA 4XEHA 3GA0A 4TRNA 3H2KA 3T15A 4FJ1A 3QELA 1HX7A 1K8QA 2VC2B 1LVUA 3LW8A 3PNLA 4C6RA 3QKRA 1ZK3A 3AI2A 4M83A 3KT3A 2PZEA 4BVHA 3UF0A 4QXMA 4UTVA 4XYLA 2R6GA 5KJEA 4U3JA 5M5BA 3AEYA 1ZCZA 1Q21A 5JYBA 1SIBE 4QJ5A 1DIGA 1L7XA 2QP3A 2X5KO 4U6QA 3WICA 2AMFA 3LRPA 2XXBA 1U0EA 2HGSA 3NHMA 3ZDZB 3KOWA 3ZI0A 5C1OA 4ZCLA 3DE3X 4ZCIA 5BYBA 1BZYA 2R8XA 1Z3CA 2VTVA 3ACBA 3LYUA 3MHTA 3A3KA 4I4LA 2ON6A 4HLDA 2OLEA 2EJUA 3BE6A 1U65A 2BI8A 2VH5R 5ALPA 4PNEA 1JSXA 1FS5A 1QC5A 2XMCA 2M1ZA 1L4NA 2Q5CA 4AJ9A 2BW0A 1JG4A 4QXPA 2I22A 4BNMA 4D02A 4EUKA 1LSJA 5KTRA 3NAZA 3PEVA 1RADA 2XTMA 1MJHA 3PUKA 5NLLA 1FLVA 1K5PA 2WU0A 3IAEA 4NK5A 5FWXA 2D1SA 3ZWCA 3IE1A 2Q28A 3BHJA 2WWTA 2PKEA 3R77A 1DOHA 4XCXA 1TW3A 4BLOA 4GFDA 1CULC 1YZFA 2NYUA 3KEGA 1Z7EA 1SQ6A 2G1UA 1FMLA 3IAUA 2VRWA 5AR1A 5TVGA 1V8PA 3ENQA 1DJNA 4RBNA 1ZXLA 2VBCA 3K1ZA 1BXKA 1ANKA 2F43B 4LGMA 1GGMA 4LIPD 4R0VA 2PA0A 1YVDA 1JMYA 1QNLA 3TYXA 2Z9BA 7YASA 3PR3A 2WDPA 2ZBFA 2W42A 1J0DA 5E9AA 5JNVA 3AU8A 3AZOA 3ZHOA 3U4IA 3DHEA 1K86A 4YQEA 2ZR8A 4RORA 2JH8A 2B37A 3MGKA 1VJRA 1Y3BE 4ND6A 4CMIA 3CXUA 2I4MA 3JAWB 5AOBA 3DM5A 2ZPUA 4B82A 2OHIA 4DIKA 3TNYA 4EFMA 1P45A 3FWHA 2JRCA 3HJAA 5C5EA 4QYWA 1RXWA 5AVQA 4TSFD 5GGXA 1TC2A 1Y6RA 2FW9A 5K0GA 4BVEA 3Q5GA 4FZRA 4WOBA 4J0KA 1TJPB 1UZMA 2NU7B 4CM3A 2QD4A 4WUTA 3JATB 4GZ6A 3GGPA 4IIJB 3NT4A 1IBKB 2V03A 1RI4A 3A4MA 1L4YA 2PSFA 4D81A 5K0SA 3BWDD 4XIIA 2ZIWB 3RNLA 5LQRA 4GVXA 1DTSA 4MV9A 3ZLVA 3TLCA 3UPUA 5JTUA 3L7MA 2EGGA 3KYCA 3PIIA 3X2SA 2P30A 2YNMA 4RLQA 4BZZA 1RYMA 3WE7A 2JAHA 5FV7A 4DQXA 4IM7A 3A8TA 3I2IA 1QVRA 1M0TA 5B3KA 3V9PA 3K0SA 5H68A 2OXRA 5KWSA 1GRNA 3ZX5A 2ZIFA 3FPBA 1CUJA 2F3RA 3GXOA 5U1PA 1N9ZA 3KEMA 1AS2A 1N0HA 1HC7A 5FOSA 5HIMA 1CJTC 3KEQA 4IJWA 2QB5A 3OAAD 3GLUA 1JEQB 5BR1A 2GBGA 3T3GA 4F96A 1HORA 1Q95A 1E1MA 1ZISA 2CBZA 2QZ9A 4FS8A 3KO8A 3AHFA 3QOWA 4X94A 2I2DA 3H42B 4FXPA 1I6KA 1Q20A 4POAA 3UWMA 3VR3A 3ZIDA 4KITB 2O05A 4HWKA 1ZVQA 5JNLA 2OBYA 4FYKA 1TO6A 4F06A 3TIGA 4EKGA 4PIMA 3RB8A 1M2FA 3HCCA 4JWKA 4RHTA 1SD2A 3GFTA 1HG1A 3TIXB 3ND6A 2Q27A 2ZUDA 4I36A 2XUJA 3WJAA 5P21A 4EAQA 2IXAA 3KQQA 4QQ8A 4NMHA 4F2HA 3PLAE 3BHNA 4JJ6A 4FOLA 5C5IA 2B8JA 3HLYA 2PO7A 4MEJA 1EA5A 3GD5A 3ROFA 4JU8A 2XA2A 3OZXA 1S7CA 1XPRA 1KYQA 1ISRA 1TD9A 1X80A 4RD0A 5DGCA 1MF7A 4J0EA 2O59A 5T3YA 4QDXA 3ZHSA 4FDLA 3GZTB 2CFIA 3QVLA 4ZOBA 2J32A 1RR6A 2F90A 3NTVA 3QG5A 3C39A 5FLEX 2GEFA 3Q41A 2MSWA 3H8WA 3UWPA 4BQSA 2CXPA 4AMVA 1K2VN 1NIPA 5AVKA 5LA6A 4BP3A 3TB4A 2PUWA 1Z33A 2G36A 2IELA 1MB0A 2Q7XA 3AP2A 2J0UB 2AUTA 3A14A 3GWGA 4HFMA 5H1YA 4FMDF 3R7AA 1I14A 1N0VC 4PRZA 3E22B 3A3PA 3CR7A 1C0EA 3AHIA 3SHWA 3WFIA 4UCWA 1IBRA 4IGIA 1ZL2A 3DMFA 3IJEB 3AEQB 4RD4A 1HF3A 3H65A 2G77B 1D0VA 5A7GA 4NU0A 2BZGA 4Q82A 1DO2A 1B0ZA 5CEFA 1ND5A 1ECPA 3DD1A 2OCGA 4CMGA 3O84A 3UGJA 4B6QA 3H99A 3VV2A 2Q3MA 3ZIAA 3A1NA 1NVTA 1V9LA 1W36D 3FVWA 2FPUA 3MUNA 1T25A 2RK4A 3JYOA 3M6MD 4GI2A 3UO8B 4AT1A 5K09A 3OJXA 5E8JA 1MU0A 4WLOA 2AN9A 3P0IA 3W6NA 3FWYA 5ADUS 3DWEX 1WKBA 4DAOA 4RY9A 5EMHA 3AERA 3WWCA 1EVIA 3X1JA 1KDYA 2XTNA 4JOQA 3K15A 2CB9A 1NQWA 3QEOA 4PLFA 2ISSD 2PLAA 3ND5A 5DNYB 1YAHA 2E4XA 2F1IA 521PA 1ZRNA 1WB6A 1Z06A 2PKXA 3RSQA 5KWEA 1VE6A 2CNOA 3WL4A 2YFKA 4R3UC 1XVVA 2B30A 2R8RA 4M9XA 5JNWA 3WMEA 5BYJA 4KN8A 2CDRA 2BWJA 4UHFA 3WJ1A 5A3SA 3GDWA 3OKFA 4BE7B 1YR9A 4KPYA 2YWXA 2AOWA 2CWDA 1JAXA 3FNFA 3HUDA 3LBYA 2DCUA 3I83A 3B1VA 3NNDA 4KSCA 1JQDA 4QRDA 3IULA 1H65A 3ABOB 3JWEA 3GFVA 2DLNA 3EZNA 4LBZA 4UM9B 3DMNA 1N9GB 1PS8A 3DNPA 3BKWA 1PNRA 1Q17A 4JQYA 3A3OA 4M55A 4ETIA 1WUYA 1RHRA 1GNTA 3V80A 1CVLA 3OX4A 1ZONA 2H1LA 4FHDA 2BP7B 5EIAA 1VPDA 4D0SA 4B6FA 1JSZA 1CDOA 4ZYTA 3VR5D 2C5BA 3RJZA 4EB0A 3S5UA 1XPOA 3OTQA 1J0AA 1JDZA 4YALA 1R12A 2FMKA 1MEJA 4P98A 2GPSA 1RWBA 4PS0A 4Q37A 1PL6A 3M6FA 1JEOA 3C8ZA 5EZYA 2ZBQA 4TSRA 2PMCA 3FMFA 1YKFA 3EZXA 3B1XA 3IRVA 2ANBA 1AKUA 4FEGA 4INAA 3GBSA 3IQWA 1I5RA 1SC6A 1P2VA 1Z45A 3F97A 4K3VA 3W06A 4AIIA 4RM2A 3CT4A 3HNPA 3QHQA 3BMNA 1O4WA 2PKWA 3WDKA 2CDNA 4ZPXA 3SLRA 4OGKA 2D4AA 2Y93A 4UQOA 1FFEA 2ATEA 3JASA 4HEA6 4Q12A 1H85A 3LWDA 5JV5A 2WNSA 1NXSA 3ORQA 4HAUA 1CYEA 3QVKA 1K8RA 2ODWA 1A2OA 1WPRA 3C8MA 3O8QB 3E7WA 3QKRB 4PO1A 2OCAA 3L7LA 3C8UA 4X20A 1QHNA 3OIUA 5EUCA 2Q2WA 4XFJA 3X1DA 2QTWB 4EUSA 5LQNA 1Y3FE 3L7BA 3HYSA 2NTNA 2XMZA 4QKQA 1RTKA 2R5NA 3F6PA 4X5OA 4JUDX 1J5EB 4WZAB 4S35A 2QJRA 3HG7A 4RF5A 3R5TA 2EZ8A 2QX7A 4LJYA 1RP1A 1Z75A 4NPCA 2JGNA 2H3EA 2BFDA 4B3DA 5TC4A 1SGWA 4A36A 4IIGA 1PKEA 1U0JA 4RPHA 2P8SA 3U4QB 1TZCA 3ASYA 3ZE7A 7MHTA 2AIRA 3A9TA 1R8SA 1PDOA 3CLUC 1QC5B 2JK1A 1GNVA 4RZUA 2VHQA 3G7NA 4OLHA 1WXQA 2Q45A 4UD6A 3A4YA 3C97A 3O4GA 3TRHA 3CMMA 3RLFA 10MHA 1YDMA 5E3JA 4A8JC 4KI0A 1E9SA 3HZOA 2B4YA 3LPDA 4KAFA 4P9NA 2UZAA 3DULA 4MWGA 3DT9A 4FMCB 3DLIA 3K9HA 2D0OB 2FYTA 1TPZA 4H6WA 4W8OA 4AN0A 3VPXA 1JLRA 1GL7A 1ZH4A 1JJIA 4MYDA 3WGQA 3CUSA 4ZHQF 3FOFC 1N0UA 1RRFA 2BSQA 4ITVA 4UBNA 1KJZA 4MWTA 1R6DA 1ZGJA 4HCJA 2AR9A 2ZAIA 1J56A 1PX2A 2QLNA 2AUMA 2ATXA 4YRRA 3AIMA 3DXYA 2UU9B 3GPCA 4YRDA 4LRSB 3FYSA 5AVUA 2IYWA 2Q5QA 1JHMA 4AKIA 1DKQA 3KTDA 1Q14A 3I4CA 4UBOA 1SUAA 3WWPA 5IUNC 3P20A 3CNHA 2XUIA 3M9LA 1MA3A 3RH0A 2VO1A 4A9AA 3H19A 3QE9Y 5B36A 3QV1A 3GVPA 4N82A 4NZOA 3SSAA 4ZI3A 1Q12A 4P92A 2CVQA 2KYRA 2C7OA 3RQIA 4N01A 4MUHA 1EFRD 3WI7A 3NALA 3BL6A 4V2UA 1L5RA 3NMUF 3VNUA 1B23P 4M8LA 3N28A 1T9ZA 2JA1A 1RXEA 4WACA 5DX1A 3PT9A 2Z2IA 5CW1A 4DV2B 1AA9A 4DLWA 1QPZA 2WMNB 3DE4X 1SBYA 3FKQA 1SB9A 4FE4A 1QDLB 4UTZA 3RWOA 1Y6FA 3R7LA 1MAAA 1EE9A 1P18A 1U5BA 4B7UA 3HDHA 4K9NA 3O83A 1M5TA 1QHGA 1SKYE 3OQ6A 4CPDA 5JH7B 1IUOA 4BNHA 3QSGA 1NR5A 2ZYWX 4TL9A 1PEKE 3JQFC 3TQHA 1FP2A 1KOGA 1OAKA 2VDRB 2GVDC 3CLSD 2EDCA 3WFJA 3ZE2B 3B3JA 1N6PA 1PLJA 1YQ9A 1ORRA 3HZRA 1DMSA 2SCUB 1CUEA 1IE3A 1K7SN 1ORDA 4DDWA 2XOXA 3FJYA 5C4GB 1P7PA 3CN7A 3LQRA 2EF1A 3IUQA 4PYOA 2E4WA 2ZDHA 3U48A 2P35A 4DABA 4R1OA 4IR7A 4Q7EA 3DDZX 3LUBA 2R60A 4AUEA 2QP9X 1EWRA 1YI8A 1VG1A 3IR7A 1IWOA 3BQNB 5CU7A 4O4HF 1VE3A 3HDYA 1JU4A 3QMVA 4I46A 3S70A 3T9BA 3ZNQA 5JXIA 5BSUA 2WP8J 2BUBA 3ZXUB 4JP8A 3A9UA 4R01A 1C30A 3TRDA 1O57A 3HVKA 3HYTA 1C0PA 4Z99A 4BO7A 1KK3A 1NU6A 1YDGA 3PD7A 4Y1EA 3THWA 4OOFA 4O8ZA 1XTRA 4PAMA 3EXIB 3BBLA 2RHRA 1XCOA 3D02A 1G8SA 1HTTA 2QTRA 4P36A 3T3HA 3RBAA 4DTCA 1OH6A 4UOQA 1WD7A 3HXKA 1MG5A 2IOYA 4EHHA 1NXTA 1TVCA 4M1MA 2Z1NA 4CU5A 4DLPA 2H1CA 5LYJF 5IYZB 4D6XA 3F90A 4OAPA 1HDRA 1PS9A 1IN8A 3ZUGA 1EP3B 4XGNA 1CP2A 1YH3A 3RAPR 5F12A 4PHTA 3MINB 1YA6A 3TLEA 1YQWA 4S05A 4G09A 3CQ9A 4M9QA 3DW3X 4QQKA 3HZZA 3DE2X 4JDPA 4JR1A 3RU2A 2GESA 4O2BF 2JC3A 1BCSB 3RABA 3QXXA 3RU9A 3EGWA 2X0EA 2QL6A 3DVRX 4ENRA 1WDMA 1CUGA 4ZGBA 3I1JA 5LA6B 5EP1A 3RRNA 621PA 5KU1A 2ZYVX 1N75A 1OTXA 2AYXA 2Z3ZA 4QSHA 3HYNA 4DOMA 2A0XA 1A1SA 2EP5A 2AW3A 5JISA 3LX8A 4I5DA 4IOMA 4RPGA 2EEZA 3KT8A 4Y2UA 4GYYA 2GXSA 3HJRA 3E9DA 1UL1X 3NIFB 5DISB 1VGQA 2OR3A 4FFOA 1BHQ1 4S2UA 1U7UA 4YO8A 5FX2A 1VGVA 4Y7DA 3GNTA 1PGPA 2A6PA 2P2DA 1TOAA 2HSWA 2M9MA 1ZJ4A 3OE1A 4JJIA 4QYMA 4DVJA 4FILA 3QF4A 2PH1A 3LG2A 2YFQA 1JHDA 2PM8A 4EECA 3D8NA 4D4KA 2OFWA 3F3MA 3PX7A 3ZTWA 3C6KA 1XTVA 3ILXA 2BFCB 3BGDA 5EJ9A 4NMWA 3KLMX 2CEAA 3RKRA 3DTVA 4NL4H 3A7DA 2GAIA 4F4JA 2NUPA 2EKPA 3CEHA 3CWQA 4IJMA 3R9KA 4P7GA 2YJ4A 3CGGA 4JY7A 5ERGB 4QREA 3WLHA 5AHOA 4ZT2A 1CRPA 1SXJC 4RTNA 4BEJA 1SKBA 5JXGA 1SHJA 4BPRA 5KDDA 2VPIA 4UE2A 2QMHA 2IHUA 4UNNA 4KXVA 1RJ9A 2FWIA 5JAOA 4OQNA 2I71A 2XKJE 4Y6QA 1RWKA 4RDCA 2JJ2D 1KR2A 4PAGA 3PFNA 2J9YB 4WBNF 3H8JA 5CVEA 3B5JA 2Q5EA 2LCQA 5L4SA 4E2XA 1A7UA 1V4BA 4RGYA 4DNQA 2JCXA 2SICE 4I08A 4EL5A 1OIWA 2FPKA 4UEKA 3WISA 3L43A 5EIBD 1LBIA 3SC2A 4AKEA 2ZJ2A 4FX2A 3IBSA 4BNDB 2JFBA 4NMMA 1CY2A 4FS3A 4FI3C 1E2QA 2B5VA 2UZ0A 3QBVA 5IVKA 4FFRA 3V8BA 3IQXA 4UFOA 5IFLA 1YR3A 3NASA 4JLNA 5EMNA 5B53A 2IHNA 1FP6A 2V0NA 3FUVA 2EYQA 3NS7A 2XXJA 3IP9A 3LQYA 3LFUA 2J0QA 4UDOA 1USKA 3GLGE 4YRBA 1PWHA 1QVWA 1B3BA 1T36A 2AK2A 3PRKE 4D45A 4RPLA 1QDUA 5EJ4A 1C7RA 4MYUA 1EXDA 2HH9A 2FK7A 5COQA 2GNPA 4LF8B 3R9XB 5EZYB 5L95A 1DE0A 3ESBA 3NXSA 2ZWOA 1U2TA 3AB8A 3RUAA 1BX3A 3O8LA 4J1TC 4F4HA 1N2CA 4OXXA 3IQIX 3HYRA 3K05A 4BB6A 4A6DA 4GPD1 1C41A 4UDNA 3E1GA 2HU7A 1VRWA 4MJXA 3E9EA 4X60A 1SUCA 5KAPA 4DRYA 3GNSA 1C7JA 2HF7A 3TI7A 3OIWA 1RHQA 2V8OA 2XUPA 4OV6B 5FUVA 4HI0E 2XGOA 1VXOA 3U9SA 1DSSG 4IF6A 4X20B 1E0DA 1PQPA 3VH2A 3R0VA 1UBHS 2Y1OA 1IB6A 5JEEA 5CHYA 2AZXA 4K81B 2GZ2A 1JF8A 4FMPA 3FPCA 3HNOA 4MMYB 4OQ4A 1YIAA 4PLTA 5IM4A 1U63A 2FPXA 3MCWA 1QCYA 1E94E 4GNKA 1LLDA 4RE6A 1SOUA 5TDHA 4BV9A 4BYMA 5JZMA 2C61A 1B1CA 3N74A 1GRRA 4I1IA 3V1MA 2X42A 3GDGA 3ZS9A 1I1HA 1EESA 4NBNA 3BL5A 3NDJA 1CJCA 1XJWA 2CUZA 1JFRA 3A3YA 3KXLA 4QJ4A 1NQOA 3A25A 2G9VA 4AJEA 5BN5A 3ES9A 3F6SA 3OEWA 2D5IA 1OXKB 4PBTA 3TVDA 1WBDA 1P7YA 4ES6A 2FR8A 4JYPA 1SKAA 2CLKB 3LUGA 1DFGA 4KYIB 2J1LA 5AJTA 3Q8LA 1AUVA 1G9SA 4H31A 1IOVA 1BKSB 1N8SA 4PWZA 5IAKA 2J9ZB 3LS2A 4UAVA 1X6VA 5REQA 4C9BA 4DC0A 2ALJA 3ZWDA 2ZUEA 5BRNA 5IX8A 2D7CA 4J76A 2QTLA 2BISA 3NV9A 1WG8A 3DQPA 4FGZA 2E87A 4OQYA 5KSZA 1DTEA 5EGNA 3U5TA 1F8XA 2VZ9A 3H1GA 3PUWA 1KAOA 1KI2A 5AKLA 4TT3D 4EOGA 2OK7A 4HN4B 2P9BA 2IHJA 3BDVA 4RL6A 1Y6QA 1DO8A 4GMGA 4JUIA 1M1YB 1QXSA 1U2DA 1KGSA 2C95A 2FZKA 3K0EA 3OZRA 3AFIA 4ZC8A 1W59A 2C4TA 2P1DA 3KAQA 1RYYA 3B82A 3RVRA 2O8BB 2Y77A 4FFBA 3VRHA 2YJ5A 3EF3A 2LPMA 2ACVA 1GWNA 1IY9A 2QJOA 3BZUA 4A8TA 4HNHA 4EABA 2EKDA 3CZ9A 2V8BA 5TMEA 1QGED 4YRIA 1LLFA 5HTOA 2ZRJA 2D74A 3JQAD 1GJRA 2F1JA 5JC1A 2UXDB 2C7RA 5FL7D 3PK0A 3NWOA 3SICE 1ZZGA 3SGLA 4A5SA 3PWSA 1BD3A 1H6DA 4II7A 2AC4A 2JJYA 1NNLA 2KMLA 2RGUA 3AEKA 4HMOA 1ZIYA 4U7GA 5AI9A 3SN6A 4NENA 4BNZA 5EY5B 4EIWA 1N32B 1KNQA 1LLUA 1QGUB 1LPOA 1ZVJA 1ULTA 3JW8A 5HOEA 4M4SA 5IK2D 2RD2A 2GZ3A 4IGFA 4PLYA 2GXUA 1CDDA 2QJFA 5H3HA 3WLKX 4DJAA 5IU6A 2ZXUA 3KZVA 3PNBA 3LY7A 3F46A 4QYSA 3TG8A 3GPLA 4IFTA 4WXHA 1KQOA 1ZUIA 1V2HE 1A9QA 4C78A 4Q1VA 5IMBA 1S96A 4QXOA 3WAKA 2GO1A 2IQIA 3LYLA 3AR9A 5FBWB 1QFMA 2ATIA 1KDZA 4F86A 2PDAA 1PKXA 4L5BA 3U3XA 5LQAA 3WZLA 3DDSA 1NMXA 2VJPA 2PCJA 3E61A 1VP3A 4P7FA 5B57C 1K1EA 1RSZA 3DZGA 3LVQE 2RCYA 4WK2B 3ROTA 3GJTA 4XJSA 4BNFA 4G89A 2QLTA 3E03A 5HJ5A 3GLGA 1DIOB 1OGYA 2XYVA 3SYLA 4XPIB 4JLVA 4RXUA 2DUWA 3R7WA 3S81A 3AO0B 2CZQA 5CT8A 1VMEA 2FP4A 4FJ2A 5A4MS 1X8KA 3BFPA 3ZJUA 5FF9A 1KYXA 5EXSA 1AD2A 1UJ6A 4JB3A 1M73E 3ZZUA 2X5OA 2HDNB 4OJNA 4LFCB 3THWB 4OHMA 3FUCA 3ZEIA 1PD0A 2BN4A 4BNWA 2FE1A 3IGFA 5ILOA 4UREA 1BWRA 4DBLC 1IWBB 2X41A 2VF5X 2JF0A 1W5FA 5KX5A 1JDVA 1ODFA 3ROMA 3B1KA 5JR3A 1M83A 1FPMA 3I5AA 5I3CA 2R8ZA 3ZE8A 2I1QA 5CDUA 3FG9A 5JSQA 2J6IA 1TNDA 5JCPA 4CT0A 4XD7A 1PT6A 3AUKA 4UUBA 1HETA 3UT5B 3MCTA 5EESA 2FDRA 5FBRB 4IJ5A 2J5KA 1TIBA 4P53A 1U4OA 2G82A 4NESA 3NGXA 2OV1A 3HKCB 1EDBA 3EF0A 3CLVA 5FBLB 5DYYA 5IJ9A 2OECA 3OLXA 1JZQA 4DV7B 3SLKA 3M6XA 2OO7A 4PSCA 4IUCS 4ZXPA 5JMTA 3B52X 5E6SA 1QORA 2C98A 4E1VA 2FU5C 3NJ4A 1EK0A 4INPA 4WQMA 5CXQA 1WUHS 2GEVA 4TPKA 4K3UA 4NK4A 2O5RA 2FI1A 1U7PA 4HNTA 2QSYA 3OUZA 4UPDA 3PE6A 3MT8A 3GMTA 1Y42X 4OHBA 3BMXA 2VXOA 4JB2A 2ZSAA 3MLAA 4IRMA 3H9UA 4MIKA 5AJHA 5C5DA 5KQPA 3QX3A 4LUCA 4WECA 5CFMA 2ES4A 2H5JA 4TL7A 3M4ZA 5DHUA 2R7KA 4AF8A 1I24A 2C9ZA 4G1EB 2QUHA 3ZCQA 1CZRA 4J0QA 3WGNA 1M9NA 3DTVB 3JQ8A 1U8TA 4XLTA 3ANYB 4EFLA 1B15A 3KYBA 1G2IA 2D2XA 1V3QE 4LZPA 3WNBA 2E49A 1RVDA 1BHJA 1P5JA 1R8YA 4GKAA 4TXJA 2OWEA 2LWIA 2ZOSA 2PGAA 3HB1A 3REQB 3GJZA 3W2EA 4A3SA 4BDTA 3VU3A 4GC9A 4ONEA 4YJKA 3DDUA 5I5GA 4W5RA 1GCUA 1RABA 1PGQA 2G67A 4GM0A 4IDBA 4OFXA 3AHEA 3UOAB 4DUZB 4OGGA 2WHYA 1GPH1 3HCRA 2WE8A 3L93A 3NATA 2IUYA 2Y66A 5SZJA 2VQ3A 4XX0A 3DBOB 1GFSA 1OKKD 1XDWA 1LK7A 2CNNA 5K3AA 1YR1A 1FMJA 5EEHA 4HN2A 1RWPA 3UUGA 1ZS9A 3GARA 5JNRA 1W29A 5KC9A 4N0QA 2HHHB 1YNOA 4TV8F 3K70D 3TL3A 1P6UA 3MVEA 1TGVA 2EAUA 2A86A 3AEZA 2VA9A 4FDMA 4FQ5A 4K6MA 5L4NA 2BLNA 1BDBA 2PUJA 4PHFA 4WZAE 4U9HS 1GXSA 4RMIA 1DRVA 3WGKA 4POOA 4G9EA 2O0MA 1JQBA 1QHYA 2YXDA 5D3MB 2VXYA 3QPDA 3KSUA 1N6HA 3GAZA 4W1PA 2VPYA 3A6GA 1S6YA 4MDYA 5EWMA 5A02A 2GN6A 1SCUB 3W2HA 1Z4QA 2RHLA 5EMKA 4LF9B 1HQDA 1XMQB 1NRJB 3L7AA 4HYYA 3H6HA 2OUKA 4EY7A 1QJ4A 3WLJA 5K0BA 2YIJA 2C4WA 2EERA 5CCDA 2D7JA 2AEMA 2ZZKA 1UOEA 1Y4AE 5CGZA 2BKLA 2Q5LA 1YTLA 3MOSA 4GOKA 3JQBA 2IS6A 3GRVA 1XG5A 3SD7A 2CN1A 3SQDA 3BRWD 1H5QA 3ER6A 3Q72A 1X19A 3RC7A 1GSHA 3K4QA 1GQ2A 4BQRA 4C6TB 1Q1BA 5ICSA 5EA2A 1X3LA 4ARUA 1WMEA 5JHGB 3TGLA 4LXUA 4F04A 4WOCA 3ZDYB 1FQOA 3EGEA 3IQEA 3GX1A 2PEZA 4LXXA 4IFIA 2B9VA 4NMLA 5SICE 1K6JA 4CLEA 3AVPA 4BNTA 4RPIA 2ODQA 2PIDA 1GLNA 4RXTA 1DHTA 3H9QA 1Y8AA 3P2MA 4RHXA 3SIPA 2XXAB 3D1JA 3MCUA 3OOEA 4FUTA 2HJWA 1A9SA 2NTJA 2WRZA 4RX1A 2VNKA 2I3GA 3JVVA 3ZTTA 2EX4A 3I5YA 4BGIA 2I1WA 1YSCA 2O14A 2ZE8A 2M6SA 2AZ4A 2QTMA 1LC3A 1GSAA 4MLCA 1GA6A 3WKAA 1NQAO 5ITVA 2YZGA 3O9VA 1E92A 2XYHA 3GLTA 3A1WA 4HB2A 1QR2A 3CN9A 5FFFA 1RS0A 1Z28A 4B6GA 2PJZA 2Y1FA 4OM7A 1NVMB 2VIIA 4IX9A 1GZUA 3R5HA 1AXEA 3KDPA 3OTHA 4L4YA 1TYZA 4A8JA 3L4BC 3FWPA 2IOHA 1M6YA 5LDGA 5TB5A 2FN3A 2WSLA 2B2NA 3L4EA 1ZKMA 2VSQA 5EFOA 2NXWA 3M3HA 3LHDA 3E5MA 4QGSA 3IIEA 1A5SB 4ZZ2A 5LXTA 2WY2D 3SZ3A 4MEBA 3DE5X 4IS2A 1SQ5A 2Q99A 4ZEVA 3G1TA 4HV4A 3PP8A 4OMCA 5AKKA 3GELA 4IVNA 3UNXA 4KGZA 5JAMA 1OI3A 3VAYA 3W1EA 5BUZA 1PVOA 4JR0A 4JELA 3G6WA 1Z5NA 3NXKA 3W3AA 3OT1B 3A6FA 2F3QA 4OHRA 2K7FA 4FONA 2V5VA 7MDHA 4G1BA 3H13A 1UBOS 4OP1A 5CVDA 1XRRA 2ZVQX 3OCYA 5DLEA 5ECYA 3W6PA 1T4DA 3IBTA 5M3BA