4YUZA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 5-[(4-methylbenzyl)oxy]quinazoline-2,4-diamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
285
structure length
273
Chain Sequence
GWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
total genus 93
structure length 273
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuzA02
1NBIA 4E2XA 2HR1A 2NP6A 3KPUA 4GF5A 3P2EA 3CKKA 1NW3A 5BW5A 1SKMA 3HVKA 5FADA 5ICCA 2C7RA 5DPMA 2R3SA 3A25A 3DMFA 3JWJA 3MAGA 4U7TB 3G7UA 1WXWA 3THRA 4E2ZA 1QYRA 4EK9A 4MIKA 2ZBPA 2IDKA 3MQ2A 4IV0A 5ICFA 2HV9A 3KQTA 3RIEA 3GIWA 1G6Q1 3EVBA 2JH9A 4E31A 3OFJA 3REOA 4ER6A 2XVMA 5H02A 5K0CA 2HTEA 2YX1A 3UBTA 2PWYA 2PT6A 3THSA 2N47A 4KDCA 3M6UA 4X41A 2WA2A 5K05A 5EPEA 3SX0A 4V0QA 4RTNA 3I58A 4HH4A 1R74A 4PYNA 3GWZA 1KYWA 1YB2A 5C0OE 4M7RA 5FWDA 2AOVA 4F84A 3NTVA 2Z6AA 4RTPA 3DULA 3Q87B 3FPEA 1IM8A 3OFKA 1N7IA 5DRTA 3T7TA 3O7WA 3HCFA 2AVDA 4OA5A 1RI1A 5DLYA 4AZVA 2NXEA 2ZWAA 2G72A 2P8JA 3P9IA 4NECA 2B25A 3KR2A 3CJRA 5GOZA 5BXYA 4KW7A 2FK8A 3NWBA 4KVZA 5EOVA 3HVIA 4OX9Y 1B42A 1RJFA 3PX3A 5CUQA 1QANA 4PYOA 4RV9A 1XCJA 1WG8A 2EJUA 1BHJA 2QRVA 3LCUA 2B78A 1ZHFA 3HNRA 4H0NA 5FULA 3B89A 2GLUA 5C1IA 4OA8A 3EVAA 3GRUA 4HG2A 1I1NA 4QQNA 5FTWA 1V39A 2ZULA 2PX4A 3A26A 1YUBA 2ZZKA 4E33A 4DA4A 3QOWA 4XUCA 2R6ZA 4Y30A 3GDHA 3R3HA 2CMHA 5DSTA 1D2GA 1ZQ9A 3TLJA 2PKWA 2PT9A 3R24A 4RTQA 4RX1A 3T7RA 4M37A 2B3TA 5KQSA 2BM8A 2HWKA 5GM1A 3FUUA 3OE4A 5BW4A 2OZVA 3C3PA 5F2OA 2G71A 3B5IA 3FUWA 3RODA 5D1HA 3SXJA 3HP7A 3LPMA 2DULA 2AOUA 4QTTB 5DX1A 3KQQA 3UJ6A 3UJBA 1WY7A 3DXZA 3DMGA 5ERGB 2PY6A 3PLAE 1O9GA 3OPNA 4M38A 3SSNA 5F2KA 3UA3A 3BWYA 1VP3A 4HSGA 4XUDA 3V97A 3EEYA 4RYLA 5FA5A 3UJ7A 1EQAA 5CD1A 4FT4A 3EEOA 4R05A 2GA9A 4PNEA 3AXTA 4C07A 2P3OA 5HZMA 3E8SA 5E9JA 3SGLA 5DX8A 3GNLA 3M4XA 3DUWA 3SMQA 9MHTA 1MJFA 2EFJA 2P41A 3EVEA 5EMJA 1SG9A 2BR3A 4IKPA 5K0JA 2YUIA 5EMKA 4BLVA 2ERCA 4R8SA 4E30A 3A4TA 1RI4A 2IFTA 3AWIA 4AZTA 5EKXA 1O54A 1RJEA 2WA1A 3JWIA 2Q41A 3HCAA 4QVKA 3TKYA 1VBFA 1JSXA 2ZZNA 4C05A 1JQ3A 2O07A 2EX4A 1XDSA 3ORHA 4FSXA 3C6MA 1P1CA 1Q0SA 1QZZA 3EVZA 2OBFA 3GRVA 4YUWA 2XYVA 3OZSA 3AJDA 1G60A 2ZW9A 3BKWA 3GRRA 3P2IA 1L3BA 4PINA 3EVDA 1ZG3A 4GC5A 4B17A 3UFBA 3NVMB 1RJDA 3I53A 3B3FA 3GU3A 5LQNA 1I4WA 2XYRA 1QAQA 1YZ3A 2JJQA 1VPTA 4CKBA 2CKDA 1NV9A 2AOTA 4MWZA 4RSRA 2FHPA 1NE2A 3MTIA 3UA4A 3M6XA 4C4AA 1T43A 5EEGA 1JG3A 4K6MA 3LX6A 4M36A 1RI3A 4LWOA 1ZGJA 1XDZA 3R9XB 3IYLW 3OU7A 1R8XA 2JHCA 3GCZA 2ZBQA 4DCGA 4CWAA 5GIOE 3VSEA 3DR5A 3MGGA 3LBYA 2OXTA 2NXCA 3K6RA 1YF3A 1RJGA 3AY0A 1VE3A 3M70A 5KS2A 1F3LA 3DLCA 3EMDA 3VC2A 1YFJA 1X1BA 5LQAA 1DL5A 1TPYA 1JG2A 2DPMA 3KQVA 1BKYA 1X19A 1KIAA 2BZGA 5F2NA 4XUEA 3TRKA 3BGDA 2BR5A 4ZTBA 3PFHA 3VC1A 3G2PA 4FR0A 4X1OA 3EGIA 5FUBA 3OZRA 5EMMA 3S68A 3BKXA 1JR4A 1JQDA 5EC8A 4KDRA 4AZWA 1NW8A 3P9CA 4ATNA 4KWCA 3B7PA 3LCCA 3NDIA 1XDUA 4QDKA 5E1OA 3G2MA 5EZQA 3TM4A 4CTKA 2OYRA 3G88A 5GP1A 3FTFA 3BGIA 1G55A 4KIFA 5EGSA 2PX2A 2VDWA 5K0FA 3EMBA 3LGAA 4DCMA 2AS0A 3HCDA 2O57A 3PT9A 4C03A 2VP3A 5CIYA 2CMGA 2Z6UA 2P3QA 4WVLA 3X0DA 1R18A 1TW2A 4BP1A 2H1RA 2LD4A 5CCBA 1EJ0A 2CWWA 1F38A 3TPZA 3EVCA 1OR8A 5EEHA 1NW6A 2G8NA 3FPGA 3LSTA 3G2QA 4FSDA 3HM2A 3MCTA 2GS9A 3EGEA 5EKUA 4RTMA 4OQDA 3NJRA 4AX8A 4DF3A 4QQKA 3Q7EA 4JXJA 5GM2A 4E32A 3TR6A 5KVAA 1JTFA 2UYQA 4PYKA 5K01A 1AV6A 1PJZA 3ELYA 1VQ1A 3KQMA 3LECA 2PJDA 4LG1A 4C04A 1R8YA 3EVFA 3G89A 1P91A 5DXAA 2ESRA 4PONA 2ZWVA 3A27A 4RWZA 1JG4A 5T67A 2GAFA 1PRYA 5FQNA 3UJ8A 2FK7A 5EQJB 4WXHA 5KYGA 5DXJA 1FP2A 2BH2A 2ZIFA 3RW9A 2KW5A 5MHTA 2ONZA 4X63A 4ER3A 2C7PA 2C7OA 3G2OA 5LQCA 3GGDA 4PGGA 2OY0A 4G56A 3OZTA 2QM3A 1VL5A 4GEKA 1P39A 2JH8A 3ELWA 2OPBA 5ICEA 1BC5A 5E8JA 1VLMA 3EVGA 3P2KA 5T64A 1UFKA 2FYTA 1Q0TA 2NP7A 3TKAA 3UJCA 3JWGA 2IIPA 4PCAA 2ORED 2ZVJA 3DP7A 1UIRA 4UOEA 4BLUA 4PYIA 4GUAA 3E23A 4PCLA 3DLIA 2IPXA 4GQBA 4V0RA 3PFGA 3MHTA 4GBED 5EG5A 3SM3A 4GOMD 5CM2Z 2AVNA 3BT7A 4ISCA 1KPIA 3NW9A 2P7HA 1X1CA 3QV2A 2O05A 4GOND 4ER7A 2UZ4A 5EIWA 3ELDA 5EZSA 2ZFUA 3CVOA 4DM3A 4QPPA 3M33A 1SUSA 4L7VA 2CL5A 4RTJA 3FUXA 1JQEA 2H11A 3NWEA 3H2BA 5HIIA 2YXDA 2GH1A 1M0EA 3NVKI 2YQZA 2B9EA 2K4MA 3LDGA 1QAOA 2YXEA 3OU2A 2JG3A 3FZGA 4YUZA 2JHPA 2PV0A 3IHTA 1ORHA 5K03A 3FRHA 3FYDA 3NDJA 2I9KA 3G5TA 2PWPA 5EVJA 3FPFA 3HA7A 2E5WA 1G8SA 2AN3A 1NT2A 2ADMA 3GRZA 4RTOA 3DTNA 2OB1A 1H1DA 1EAMA 1KHHA 3ANXA 2UYOA 1RI5A 5HOQA 5FHRA 5E2AA 1WZNA 3JWHA 4EKIA 1QAMA 2OKCA 3FUVA 4U7PB 4HTFA 2I6GA 2FPOA 5IKMA 3PB3A 5JUWA 3IV6A 2QYOA 5DTQA 2IBTA 2P3LA 3BUSA 4RTLA 5C9ZA 4YV1A 1X1AA 3KPJA 5GIPE 2IH2A 1KYZA 1TW3A 3DXYA 4RTRA 2PBFA 3G5LA 1IXKA 1XCLA 5LQRA 5CVJA 1KPHA 1VIDA 2HMYB 5EHGA 3EPPA 4FS8A 4GOOD 1JG1A 3PVCA 3SSMA 3R6TA 3U81A 4F85A 2BM9A 1KR5A 4YMGA 4DKJA 5EIFA 4PYMA 5FQOA 5BP7A 3IEIA 1M6YA 2BR4A 3SVZA 1FP1D 4RTSA 1VP9A 3OCJA 1BOOA 4YMHA 3TMAA 2PVCA 3HCEA 4X61A 8MHTA 1XTPA 5G02A 2GPYA 1HNNA 1I9GA 3KPVA 5CVUA 3GXOA 5DTRA 3B3JA 4EQZA 1SQFA 4HC4A 5DM4A 4E70A 2Y1WA 2ZIGA 3KR0A 5DRYA 2XYQA 4R6WA 3CCFA 5LQJA 3ER8A 5FHQA 3C0KA 4PYQA 1FPQA 4YV0A 3CBGA 4PIMA 5B1SA 7MHTA 3KQYA 2ZSUA 1EIZA 2VDVE 4YUYA 5GWXA 2P35A 2PXXA 1D2HA 3V8VA 4C06A 2ZCJA 1ORIA 2QRVB 1P1BA 3KHKA 4YUXA 3FPHA 5T6BA 1DCTA 4FP9A 3TM5A 2PXCA 4R6XA 3HA3A 4CKEA 3M6VA 10MHA 5E1DA 1ZKDA 3CJQA 2FRXA 2QE6A 4Y2HA 5K0GA 1IY9A 4P7KA 2EJTA 3HCCA 3UWPA 2FCAA 3P71T 4RVFA 5CVVA 3AXSA 3LDUA 4OBXA 4P7FA 5E1BA 3FTCA 3HCBA 4QTUB 3I64A 1L9KA 1G8AA 1XVAA 1Y8CA 4IV8A 4P58A 1L3IA 4RVDA 2YTZA 3K0BA 2AOWA 2P1DA 3O4FA 2HNKA 2IP2A 2VS1A 2ZTHA 4CKCA 3ID6C 4XCXA 3TQSA 4IWNA 5K09A 4MHTA 3O31A 5HFJA 5HIJA 4YV2A 2AOUB 3B3GA 4DQ0A 4EMSA 3MCZA 5HIKA 1AQIA 5DSXA 5D1NA 4POOA 3UJDA 3LHDA 2Y1XA 2ZZMA 2YR0A 1X1DA 1FBNA 3DXXA 3FTDA 1AF7A 2YVLA 1INLA 1RI2A 4A6EA 1YFLA 3LKZA 5DM2A 2UYCA 2O06A 5K0NA 3DMHA 2P40A 1O9HA 3G8BA 2IH5A 2VZ9A 3M6WA 5FA8A 3MERA 1U2ZA 5DT2A 4A6DA 3BWCA 1L3CA 3FRIA 2IH4A 1KP9A 4PYJA 3P9NA 5LQKA 3T7SA 3GRYA 2XVAA 4GOLD 2NNWB 5GINE 1DUSA 4KRGA 2IGTA 1XJ5A 2I7CA 4E2YA 2JHAA 5E9WA 5K8VA 5K0BA 2AN4A 5DWQA 3ER9A 3MTEA 3E7PA 3NMUF 2OO3A 2YXLA 3P9KA 4HGZA 4O29A 4HRAA 4PWYA 5CVEA 5EMLA 5K0EA 1HMYA 1YZHA 2ZBRA 2NYUA 5HILA 4F86A 3FTEA 4YUVA 2EG5A 3PS9A 4FT2A 3QOXA 1R6AA 4P7GA 5E2BA 5FWAA 4E2WA 2V7EA 3LCVB 2IDJA 2ONYA 2VDUE 5EHIA 2OB2A 3LKDA 3KPYA 5DTMA 5HIMA 3BGVA 1N7JA 2I62A 3FUTA 1Z3CA 3P97A 4HTFB 3ELUA 1M6EX 4KIGA 4C08A 4PIPA 4DZRA 2Z6QA 3VYWA 1FJXA 3BWMA 3T0IA 3KQSA 1EJ6A 2GB4A 2PGXA 2H00A 3LL7A 4BP3A 3HA5A 3DOUA 4R8RA 3FPJA 1ZGAA 1KXZA 4RTKA 1WS6A 2C7QA 3GO4A 2PSSA 2AOTB 3MB5A 4LECA 2G70A 4BY9E 4LWPA 5U4XA 3TOSA 4QPNA 2QY6A 3TFWA 4BLWA 2P7IA 1EG2A 3R0QA 5LR6A 3UJ9A 4Z2YA 4P7JA 5HEKA 3HVHA 3SSOA 2PLWA 3KQOA 3D2LA 1JSZA 3KQPA 1R00A 2B2CA 3KR9A 2PX8A 3G8AA 5CVDA 5DX0A 4AZSA 3HVJA 4MQ4A 3EGVA 5E1MA 5FCDA 3KR1A 4CXMA 1N2XA 3BXOA 4GC9A 2ZIEA 3OE5A 3LBFA 3ME5A 2AR0A 1SUIA 3DH0A 5E8RA 3UJAA 3F4KA 3L8DA 1AQJA 4CTJA 2V74B 3I9FA 4RVGA 2PX5A 4HGYA 4EKGA 3I5UA 5DM0A 4PYLA 1NW5A 1MHTA 4X60A 5CCXA 2WK1A 4OQEA 3CGGA 1D2CA 4RVHA 3UZUA 1WXXA 4EVIA 1SQGA 3FYCA 3GJYA 3HEMA 3BZBA 1G38A 5K0LA 5JR3A 5LQUA 2AZTA 3PX2A 4ER0A 3A7EA 1JTEA 4MTLA 5DM1A 4FZVA 4OBWA 1NKVA 4FGZA 4PGHA 4ER5A 2A14A 4QDJA 2AOXA 5M5BA 3HTXA 3E05A 1XXLA 3A7DA 3KQWA 5E9QA 5IH3A 3PTAA 2UYHA 3LDFA 4DMGA 3CJTA 3KKZA 1L1EA 2NXNA 2PXAA 5KQRA 2O0LA 2ZLBA 3WSTA 3KU1A 2NXJA 3BWBA 3C6KA 1NW7A 3KPWA 3OU6A 5ICGA 1KPGA 5LSAA 3ERCA 1NV8A 1NBHA 3CC8A 1UWVA 2G1PA 4AUKA 3P8ZA 4QVGA 2IBSA 3SR4A 2AN5A 2XBMA 3C3YA 5P8WA 1SVUA 2F8LA
chains in the Genus database with same CATH superfamily
2H1WA 4KO4S 2R1ZA 5EE1A 3MWYW 4L0MA 5HMMA 3S1LA 2C1ZA 1KQFA 2BAGA 2FR1A 4O4IA 3SD7A 4J3JA 1I6LA 5CR9A 1N75A 5DGXA 3UTDA 4YJGA 4CFSA 2R3SA 2RI0A 4AICA 3L4JA 1OIWA 1PHRA 5IK2D 3QKWA 2HREA 1PR2A 1QRDA 2ZAGA 1J2JA 4HYTA 1KKMA 1DI0A 3KXPA 5SY4A 2FE4A 2AN1A 5ALIA 3BMNB 2I4NA 5SZJA 5A9SB 2HV9A 1XUOA 4NONA 3ZXXA 5NULA 1G7CA 1U0TA 4E3ZA 5F7ZA 4MUMA 2JH9A 3P27A 2RGYA 5G0SA 5DI3B 5DCYA 2I4TA 4G0NA 1FL9A 1KZ1A 5FA6A 5CDYA 1CYDA 4B6JA 3WBBA 3O3OB 1BE1A 1KEWA 2WYOA 3JY6A 4YAJA 3USCS 4CIYA 2WSYB 1J99A 1JP7A 2YW2A 1LK5A 3INRA 3PL5A 4V0QA 1NVMB 5LBIA 3LT0A 3HL0A 2I2CA 3WL3A 2AYYA 3B36A 2P75A 3AB8A 2AL7A 3PCXA 3QF4A 2I7XA 1PQUA 3C3JA 3FYUA 3KVVA 4AYWA 1UEJA 1GKKA 4FDLA 4MVJE 2YRWA 4M3NA 4F21A 1KYIA 2QRLA 2DY1A 2IY7A 1FOEB 1L7RA 1JR3E 2HRQA 3LL4A 4MA0A 1TUEA 3X44A 4B33A 4MVXA 4BTLA 2F43B 4DNOA 4ENQA 1M1NA 1G8PA 1R50A 2J7PD 2W6JA 2Z4TA 3LUDA 3QF7A 1DB3A 1GGJA 3JQAD 1CUIA 2PS3A 1ODSA 1S2IA 4C7MA 4D8UA 4QICA 2AG0A 1P1IA 1NUSA 2HQOA 4BKMA 1Z74A 2G0AA 2YZGA 1D4ZA 2E87A 1H9BA 3SC6A 1AA9A 4OBBA 2PL3A 2DYKA 5FI1B 2WYVA 1JPVA 2D3TA 1TT5B 2O3TA 4RD0A 5FTWA 4E33A 1T8YA 1YUBA 2M98A 2VCEA 4JQCA 2O54A 4LJ8A 2CVFA 3TQQA 3VVCA 2CLSA 2FSIA 2CMHA 1PJSA 1E3IA 1ZOIA 4EHLA 3ANSA 1KZ7B 4ZK2A 3HDGA 1Z22A 2F1JA 3GQVA 3L0SA 2G1UA 2XCOA 2POQX 2QDKA 2GRAA 4NEHB 3AVOA 1Y6QA 2FSVC 3E2IA 2XBUA 3B5IA 4BO7A 1JHVA 4B8ZA 5K4HA 3SDSA 3AUAA 1FFSA 5DX1A 4HR7A 6CHYA 4HTAA 1Y9ZA 2W90A 2K2WA 2AF3C 2N1MA 5ERGB 2GJAA 3HBJA 2ZU6A 5BVGA 1X3SA 3CF0A 4JBYA 4R1LA 4BO8A 3RU9A 2E6KA 2AXPA 1ISRA 1E4EA 1VBNA 1PFGA 2O8EB 2AC4A 1R6BX 1Z17A 3Q0TA 4FDUA 5KVVA 3IMCA 5TGDA 4J43A 4N7BA 3D0OA 3TE6A 4F1JA 3GCDA 5BOSB 4LXHA 1YR3A 1SG0A 3CVJA 2L0XA 1MEOA 3HWSA 3P2OA 3LVBA 4RD2A 5DYYA 1V3QE 9ABPA 3J7AC 3MUEA 3PNSA 5CH8A 4ZC1A 3ZD7A 2Y77A 5KYWA 4KCGA 4UE2A 4H18A 1IPHA 4J0HA 1FP4B 3DUWA 2P9CA 2H5EA 4RPCA 4YYZA 1GZ3A 5H83A 4CLEA 4GNRA 4WK2B 2W98A 2Z56A 3IAUA 5K0JA 2ZR0A 1MTZA 1AHHA 1IQPA 2FFHA 2IW1A 5GONA 3A4TA 1WF6A 5IC4A 3CLUD 4LTDA 4XXHA 4DCOA 2M1ZA 5IDWA 3C3DA 1F2TA 1V16B 4XWWA 4RMJA 3T1VA 3ZWQA 1J49A 2GWRA 4OGKA 4WDRA 5BV7A 1XTQA 3E9YA 2GPBA 3LUCA 1XMIA 5HRUA 1X87A 2MYNA 5DNUA 1UZMA 1YC5A 3BRWA 3MD9A 4A8PA 3N0VA 2FOXA 5FOUA 1HOXA 2NYAA 1E61A 2RDMA 2ZG6A 2Y2VA 2YJ6A 4D9GA 3JU3A 4G4SP 1KBQA 2J9ZB 3BJEA 1AN0A 3K94A 4PTLA 5CT4A 4B48A 1L3BA 2VQ6A 3AERA 2XOEA 1V71A 2G25A 4TLMB 3VVLA 3NVMB 2CW5A 1U4NA 2FPIB 1K5GA 3ZNQA 1N92A 2JJQA 1UPFA 3K3PA 3O90A 1RHJA 1QTIA 1QX3A 3PUIA 4O4JB 3U3DA 1EQUA 1NLMA 2ZXEA 2PEZA 2NYVA 1VE9A 3UC9A 4ERNA 3V8NA 3D7NA 2XMSA 4LF7B 4G6ZA 1XDZA 1KTVA 2PUHA 4CM5A 3IYLW 4XSHA 1QSGA 3E8MA 3OFNA 4HDRB 4NS1A 3SLRA 1V6AA 2FU5C 2O2GA 1J2YA 4X97A 5K6AA 5KS2A 1C8BA 1C3OA 4H60A 1V5WA 2BTEA 4Z0TA 4ARUA 1A9XB 1QLWA 3H4VA 5DHSA 1FC0A 2N42A 4H6XA 5IDYA 1KH1A 1GFWA 1H65A 2N46A 1PDVA 1LW6E 3U4CA 5HM6A 2UU9B 1OX6A 2XKAA 1C1XB 3JZAA 3OEHD 3A1FA 1JEJA 1CY1A 2J3HA 3NFYA 1DQRA 4WK6A 1JR4A 4LZWA 4JBHA 1GFIA 3UFXA 5DNYB 5IAKA 3WTCA 2FDCA 1HEYA 9LDBA 1Z6GA 3WSVA 1W88A 5F73A 4BV8A 3RAEC 2FMTA 5E1OA 3MB8A 3PD7A 4QEDA 2WJ6A 3BJIC 3JQFA 1QOQB 1YMVA 3R5TA 4OM8A 4B3BA 1FLDA 5CB8A 3OUZA 4BWGA 2O50A 4P3XA 4C4SA 5FBHA 1MLDA 4MGHA 4KVFA 1RFGE 4Y2TA 4ECAA 1E5LA 1REQA 4DA6A 5A5FA 3NWJA 1U80A 2H63A 3A9CA 2B20A 1XSEA 2PS9A 3LRTA 3S6JA 4FGLA 1R16A 1WOMA 2BP7B 1TE2A 2ECPA 1VKRA 2PKQO 3SQOA 2X0KA 4EUKA 1ONBA 2VRCD 1BVUA 1F1JA 1T8TA 3BHMA 4WVLA 4X92A 3WADA 1A2KC 3R7BA 4DYVA 4CEJA 1QVAA 3EVCA 1G21B 1N2JA 3DT8A 4P4GA 3U0VA 4FSDA 4Q18A 1BE8A 1Z0AA 3CRQA 3H8WA 3M49A 3QU5A 4LYJA 4QFCA 3G2JA 1GSAA 5HCUA 1GRRA 1A8PA 1RYZA 2AUMA 2VFAA 3LUBA 4FE7A 4LY3A 3WLNA 5K01A 2IYOA 4Y6RA 5A9SA 3BMNA 1KFBB 1V3VA 2CWDA 4QYXA 1RCUA 4LDNA 4LJLA 4QBGB 4YAWA 3QX7A 3NS7A 5EIHA 1JG4A 4OB6A 5T6MA 1U4OA 3S8MA 5JI3E 3P9XA 3SHQA 1AS0A 2V6MA 4AMGA 3RIYA 1Q1ZA 2KW5A 1GPWB 3T06B 4PGGA 4OUKX 4YCSA 2Y1DA 2GBPA 3R3ZA 4ZAXA 5IBRA 2A9PA 4JX9A 4EB3A 2YXPX 4Z49A 2Q99A 4RELA 2FE1A 2JH8A 1IJEA 3D4PA 3L84A 3CVUA 1X1SA 4UHBA 5JWRA 1Q7BA 1A7JA 3BRQA 1PZEA 4ALLA 2Y27A 4HAWA 4M0EA 2EFCB 4BLOA 1OA0A 3OTOB 5K9ZA 2NN3C 2QN1A 1JT9A 3W2TA 3GT7A 2BHRA 4AJ1A 2XDAA 3I0NA 3CIOA 2F43A 3AKDA 4G0OA 3SM3A 4RMNA 3ETEA 1XNHA 1PR0A 4KK3A 4MVCA 4Y1FA 2ZETA 4DLZA 3F67A 4RH0A 1HH4A 3FVWA 5B55A 5EZSA 1ZU5A 3GT4A 5C46F 3BE6A 2R6CA 5LJIA 4IDAA 3H5OA 2FG6C 4WOJA 3SN6A 2AZXA 4L8YA 1NDHA 2D2EA 3BQMB 3HKBB 3IT0A 3O7MA 4V03A 5DISB 3DNFA 3ZW9A 3EDRA 3H2BA 3NWEA 2YXDA 2GH1A 5TS3A 4DLKA 4J91A 5LZ5A 3HBAA 3VTFA 4TRJA 1CY4A 1K63A 4UMVA 1ZUHA 4ZPXA 5H82A 3BD7A 4QTXA 4DWJA 1A3CA 4EF6A 2W4QA 1SCJA 1E32A 4BE4A 3OPXA 1FIUA 3H84A 3Q3VA 5BURA 1JJIA 2M2IA 5HZKA 4FINA 4AJHA 3CRRA 4H35A 4LHEA 5CLJA 4L5BA 3CMMA 1U2GC 4ZT3A 1FXSA 4HQ0A 3MMZA 5H5JA 2XT9A 5JD6A 3E9CA 4IJWA 1L7VC 5E0KB 1TO2E 5JJLA 3V1UA 1P0CA 3EJ6A 4D1YA 3ZDZB 1X13A 1BDJA 2C29D 2FDXA 3RHTA 1D1QA 4C29A 5BUQA 4AO6A 4P22A 4B44A 3DWEX 4R2IA 1BX3A 3E27A 1O2DA 1R3DA 4KO3S 4L1KA 4GZMA 5BOSA 1VIDA 3FOWA 3RF7A 5DK4A 1PNVA 4HF7A 4BX0A 1TDJA 1FS6A 3WLRA 1IY1A 2QNBA 1C2TA 3UHFA 3GFOA 2VVTA 1FP4A 2DH5A 1KTIA 1KJNA 4F85A 5H70A 2PUBA 3FFBA 3GEDA 3H3FA 2HV8A 3PR2B 3RFVA 4EEZA 2WTEA 3LQYA 4L57A 5AHWA 3SVZA 2BCJQ 4ZHQB 3NP9A 5EJGA 3WI7A 2ADOA 3AR3A 4D0GA 5AW0A 1PDWA 3T5CA 1JS1X 1V16A 2GPYA 1CQXA 1P44A 2RC5A 3B5EA 4DL9A 2FSFA 4L5JA 3CF4A 4BFUA 1ZEJA 1BN7A 1QP4A 2JLQA 5LB2A 5C53B 1TCAA 5T41A 2BN4A 4UZFA 3O1JC 5IJAA 4D80A 4OHVA 5FHQA 3DZJA 2A0YA 4G8JA 1TGYA 1JLLB 1IK6A 1IE3A 1ZRHA 3AUFA 4H7KA 4IRUB 3WK6A 1V7PC 3M0EA 3E58A 1VSUA 3NEJA 2P35A 3EIEA 1YVRA 5TJHA 1HQKA 2VA8A 3RKRA 2CZQA 3EAFA 3UG6A 3OKPA 6GPBA 5DIZA 2GM3A 3WGNA 4BKPA 4ARAA 4MI6A 5B58C 3DDSA 3FOFC 4TS3A 4O4JA 4DRZA 2EFYA 5F5NA 2EHDA 3LDUA 1KY3A 5CJJA 4IDEA 1ZCJA 3PFNA 4QTUB 1A2BA 1ISPA 1U94A 2QX7A 1CS0A 5D7NA 3DEKA 3R4CA 4LV5B 5JD3A 2EGUA 4D25A 3KJIA 5FTMA 2HN9A 3E5RA 3TXXA 1NF8A 2C5EA 4CMIB 4MHTA 1RHUA 3O8RA 1JBKA 1LSUA 3VR0A 1UKEA 3ROMA 3A3YA 1TUBB 2QYSA 3COWA 2H1CA 4OP3A 1TVMA 3DXXA 2XNJA 4IKEA 1WZIA 5H3LA 2EWVA 3I3SR 4PLGA 3QX3A 1H9CA 1EX6A 1F6BA 4HAUA 4DC0A 1CEXA 1HDIA 3EZ7A 1AHNA 1J9GA 2IT1A 3BWDD 4H15A 1SRRA 4XGIA 2VZ9A 3WGTA 1C1XA 2IHBA 2IH5A 1U3CA 2D2VA 4HGPA 1PUIA 1IVNA 2F9FA 1USIA 3BTUA 4S1OA 1AGRA 2HWYA 5G1NA 2QAGB 3T3EA 1CFJA 2AT1A 2C9YA 1CKEA 2PAAA 3BDAA 3VQTA 3QWBA 3BQ9A 2TMKA 4WOKA 1UT5A 4GHWA 1WHSB 4KFUA 4FD3A 2C4MA 4KRGA 3ISTA 4CMEA 4UFOA 1JJVA 4BTEA 5E9WA 3G8CA 5JRDS 1OILA 4TTRA 5LYJB 1VJ0A 2P9FA 3CIFA 1Y5LA 2GASA 4RMGA 3C8DA 4EJSC 1Q2XA 3KU4A 2P91A 4XEUA 4XKJA 3VZRA 1B00A 3HMKA 5BV2P 4HRAA 1L4HA 3H2HA 4YRAA 1GM5A 1BROA 3OUUA 4F9FA 1XLTA 1HMYA 1SKQA 4F86A 5F5LA 3O93A 3AFIA 3I1YA 1PUJA 1G21A 1N5IA 2O6HA 4FT2A 2AD5A 1R1DA 1YTLA 3ZLUA 4CQMD 1XHFA 3B85A 1LC3A 2UZAA 4L95C 3V1KA 4LXTA 1PZXA 1P5ZB 1LCIA 1A82A 2CLKB 1ZWLA 2J46A 4KIGA 1M6EX 3DYVA 3QEOA 1D4AA 1A0OA 1P75A 2YASA 3C1OA 4UMFA 1YZFA 3DOUA 4N7JA 3A6KA 3KKLA 2IBMA 2C07A 1FUYB 5HDBB 1CUGA 1ADFA 1DEXA 3EQ2A 2A9RA 1YJ8A 3E9RA 1G1MA 4XX0B 5A0TA 3IL2A 4WK4B 3LGSA 1JJ7A 1LSOA 1PL6A 1T2FA 5EPUA 3VC3A 3WAKA 2R96A 1R00A 4INOA 1ODFA 5LPNA 2AQKA 4Q15A 5CPFA 4AZSA 1RFLA 2FZVA 3B5JA 3RU2A 3ZS9A 3ZWAA 1BDMA 1T24A 2OVBA 5CLIA 3KS9A 3LBFA 3ME5A 5FPTA 1CY8A 2W2MA 4NNOA 1G5TA 2PGJA 2WHQA 3PQDA 3VOSA 4QYTA 3ZBPA 1E2UA 2V7UA 4ETWA 3RU7A 3AM1A 4P4SB 3A3PA 4TTVA 4S1TA 3CWCA 4Q9IA 3W7AA 1ZK2A 1ZSYA 3LS2A 1R4AA 2JLSA 4K3UA 3L1VA 1GLVA 3HKBA 5CBPB 1U7PA 1GLNA 1USUA 1WXIA 3QLVC 5K0LA 3DE5X 5FWXB 2I4LA 3PX2A 4M7OA 1EWYA 1SIBE 3WGYA 1S1CA 2G6TA 4PC6A 3S0JA 3KE9A 5FEUA 3A7DA 1D1PA 3KQWA 2R7KA 4TYYA 4HFNA 3MSXA 4DWVA 4BNJA 2VDWB 4RSMA 1SBIA 4TMVA 5FIUA 2Q7XA 2X58A 3EUEA 1J8VA 4GGPA 3UB4A 1QS0B 3CC8A 2EX1A 3E7WA 3UICA 4RQUA 4NMLA 3ZFTA 2EWWA 16PKA 2R8RA 4I46A 4OB7A 1YS7A 3X1MA 2FEAA 3LWNA 4JP2A 2RG7A 4GF5A 1CWUA 4KXVA 3PVSA 3OZFA 3EWSA 2J33A 4ZZ2A 3W7VA 1G20E 3I9MA 4DA7A 4Z54A 2X5NA 1SQ6A 1NP7A 3KQHA 1SQ0A 3A25A 4UUNA 1V8PA 5IDXA 2A35A 3H8VA 4YASA 1WMFA 1F0YA 4FIZA 3CPJB 2C5FA 4IV0A 2F67A 4M54A 4Y2VA 5IAEA 4GSLA 2H18A 3RIEA 3L4EA 1YSCA 2ZRPA 5C8VA 2WJIA 3VKVA 4EEKA 2XVMA 1Z15A 4YPOA 2RONA 3S2IA 2PWYA 3O4GA 1ZITA 2Y1EA 3UPUA 3O0DA 2X9QA 3FDJA 2BHSA 3SX0A 2ZRNA 4GUDA 1UANA 3N8IA 1Y1TA 4YONB 5KHOC 2C31A 2HU7A 4YT8A 2Z9BA 3RV3A 3F4LA 4L6IA 1EX7A 4E6PA 3RVKA 2ZTSA 4KAXA 1TAQA 2EZ4A 3AEYA 3E0XA 3FNRA 3QBVA 3HLYA 2PD6A 1TL7C 2QQEA 5B1HA 4ZKEA 3T7IA 1RJ9B 1EWQA 3JQBA 3U61B 4NECA 3KR2A 1NY5A 4DHEA 4KW7A 4P5EA 1JLLA 5KMGB 2FK8A 3EUFA 3NWBA 2VKQA 3EMKA 3GLKA 5AP9A 4M6WA 4PYOA 3TBFA 3R9WA 3NM4A 3ONEA 5DWDA 1M6HA 1ZHFA 4FCWA 4E6EA 2HHHB 4BPBA 4OA8A 1Y4UA 4RV4A 5EIAA 5H80A 1YJXA 2P6MA 5BYKA 1DTWB 4X62B 4QQNA 1R5BA 3A26A 1EP9A 3QHPA 1V8BA 3BMXA 4OP1A 2BLLA 2ZT6A 4C0XA 3A4YA 4TWJA 3OCCA 2P67A 2OPHA 2LGJA 1QVVA 3GAAA 1PG5A 2B1RA 2PA3A 2RH4A 4OL9A 2XGMA 4PAMA 3WIVA 2O2JA 1P3JA 1XCMA 2ZYAA 3MRTA 2WMYA 4U6NA 5FUWA 1OAOA 5L6LB 5JFTA 2D1YA 2VLIA 2WBLC 4GM0A 3DE1X 3KQQA 4I4NA 2AFIB 4EL5A 1G8YA 3JASB 1D9ZA 2XCSB 2CHGA 2FN3A 3DMGA 3NR2A 3R75A 4UU7A 1TUBA 2UVQA 1T9GS 3OPNA 2GKGA 4IIDA 3KUCA 1PR9A 4NYJQ 4UUAA 4KPFC 1KAQA 1JHQA 4KSCA 3ZH2A 1BD3A 1OXKB 3EEYA 3I0ZA 4TQUS 4JVSB 4ZMBA 1IRIA 4OQMA 3L7JA 2VUIB 5CLHA 1OT5A 3KV3O 4TYQA 3TPCA 3EEOA 2RGRA 3RUIA 4WCVA 4FHCA 4ZDJA 3T9AA 4KR0A 1EVIA 2QAGA 3KKKA 1RS0A 3FB4A 5E9JA 3M8KA 4ZVRA 1FE8A 1H4VB 4HWKA 2VBIA 4HS4A 4IDHA 1E63A 5DN6A 4PEVA 1C4XA 1RAHA 4LWQA 4Q3LA 1UK7A 4QPDA 2R5FA 5IUJC 3ASVA 3LV8A 4E5YA 1UC5B 1LDEA 5LYJA 4N6NA 2YUIA 4DIBA 1BMQA 1M9NA 5F23A 1Q11A 4RZSA 5HOEA 4GP9A 3DB2A 3RGWS 3L6BA 1H0SA 4QELA 2VLBA 4NU0A 4RZHA 4DWWA 3MUFA 3B1ZA 1WNFA 4M1WA 4QVKA 2D5BA 1OB5A 4NICA 2O07A 5IJ0A 4RY2A 1YL6A 4OATA 3SZRA 1O89A 3HO8A 4LHXA 4W99A 5UKDA 1J5EB 3F46A 2J32A 2YJNA 3ILYA 1UBHS 3UAWA 5CB4F 2QLBA 3ETNA 2ARKA 2EJBA 1GU0A 1OWMA 3OTHA 4XGRA 1OZ0A 3EIWA 1JQKA 2VDJA 3CW9A 4CM9D 5FXMA 1HYHA 1Y5NA 1OBOA 4HQNA 2ID7A 4PLTA 2Y0BA 3ZIUA 5IYZB 3GU3A 2WAMA 5B4TA 3N53A 4X65B 5D7BA 4DMHA 1VMKA 3Q2KA 1LXCA 4BEBA 2IE0A 2GUGA 2ATXA 3E0QA 4XX0A 3DO8A 2OD7A 3E84A 4I5EA 4MS1A 1YOVA 1L8AA 1PAUA 1PIWA 3KKOA 5JPDA 2BMEA 1LB1B 4BVBA 2DHDA 1ZGCA 3BXXA 3C6ZA 3G1TA 2VSXA 1A7KA 3DAGA 5D3ZA 1ZGJA 2JJ1D 5IU6A 2AK3A 2JFWA 4ZU3A 2IHKA 4RZIA 4TRNA 1W73A 2G1KA 5DW3A 2OXTA 3B6MA 2OR3A 1Q17A 1Y8RB 2JAPA 2UVDA 2HJWA 4O3FA 3ZU3A 1LWOA 4ENUA 2PHZA 4XPZA 5LQAA 3P0IA 1A98A 4P4SA 3JALB 2P4UA 5AUNB 1BVYF 3FGNA 2INGX 1YVDA 2I80A 3M3PA 1NBAA 5CBPA 2I6XA 3KV1A 1OJLA 2PSDA 1NMSA 1SVLA 3LLMA 4K6CA 4MAAA 5FWXA 1QGUA 1GKYA 1GZHB 3GIDA 1E1QA 4O2AB 1SFRA 2XWPA 4DLWA 2A3RA 3LNCA 1NW8A 1NG9A 3EWIA 4ATNA 1VL8A 4EG3A 2GCOB 2F1RA 1G9SA 4GKAA 4Q03A 5B1IA 2DQSA 1JB9A 3I6IA 1RQXA 3W5JA 5GP1A 3FTFA 2HSWA 5CPBA 4DREA 1YDWA 3IMKA 1U02A 2C2WA 2N0SA 2VDWA 3CKYA 1R4MB 1LZKA 4OKIA 5I5EA 5HWSA 3EEIA 1QS0A 2FNAA 2VHCA 1IJBA 1I6MA 1QCDA 2VP3A 2VN8A 3E2PA 3PR3A 2FUNB 2JDID 1PS8A 2R6AA 1HL7A 2WV9A 3WAGA 4BP1A 1BG6A 4KR3A 1KZHA 3FTQA 1V1JA 4EA7A 4D45A 1AS3A 3COVA 4BLQA 2B4AA 4F8JA 2BC9A 1B26A 3BL8A 4O0MA 3KTDA 4TLEA 2PDAA 2QRUA 3K6SB 4M1EA 3Q0EA 3NH6A 3Q7EA 1GRCA 4G0MA 4C78A 4CR8A 1NIJA 5BN5B 3WAJA 1IBSA 1B16A 1QV6A 2X76A 1UEIA 2FMIA 2OTCA 3KQMA 4L5YA 4AN0A 1E2QA 4LOAA 2B0CA 4XWKA 2NV2B 2AV6A 1YR9A 2ZWVA 5AUOB 5K45A 3SS9X 2V3VA 2JRCA 1Z5OA 2A5DA 5DXJA 1H8ED 3P4XA 1EWTA 1I7NA 1Q3KA 3CNQS 3GPDG 3QPUA 4JWTA 3CTPA 3AR8A 4Y2GA 1MUUA 3WHPA 3FVRA 2P9JA 4CN9A 5D5PA 2Z2IA 3KUXA 4BN4A 4TLCA 2FHSA 3AHHA 1VLMA 3MUOA 1AO0A 4BGVA 1ZK0A 5IM4F 2ZROA 1Q0TA 3K6JA 1ZH0A 5FR1A 1NSFA 1UJ2A 2G4CA 1J5PA 5ECGC 1LFAA 1J0BA 1EJ2A 3WQRA 2UUOA 3OPYI 1UIRA 1RJ9A 4ALMA 1L7OA 4S05A 3GZJA 1POWA 4HFJA 4Q7QA 4W7SA 3IP9A 4MI9A 5KMGA 1OH8A 5BV8A 1XJWA 4MO9A 5DJ5A 3BM5A 2MSEB 3UT5B 1L1FA 1X1CA 4PTYA 1GHTA 4YCLA 5JCJD 5ESWA 1WKCA 2RGNC 3U9TA 3FPKA 4EHAA 1GADO 1PWYE 2I54A 3MYYA 1T9GR 2P79A 3GPCA 4X6XA 5HR5A 4RXTA 3FUXA 3H8SA 2CLCX 4B2YA 1DTWA 3GLGE 1KZ4A 1GPKA 1ZBQA 1H2HA 4BWVA 5LNK1 4F2PA 4MVJG 3LDGA 4IS3A 4BZXA 4YP5A 4CDGA 3FZGA 1G8KA 4KFSA 1ULBA 4E5VA 3HZZA 1GTRA 4QPCA 1D09A 3PNVA 1PWHA 1E60A 4F38A 1WV1A 1SD2A 4X1IB 4ENVA 4BO4A 1G4UR 1XO1A 3LXMA 4W5HA 2NNLD 3KKNA 5AVYA 5LIRA 2PWPA 2B83A 4ARZB 4X91A 1LD3A 1O95D 1BE0A 1K4KA 1QYIA 1ULHA 3BULA 3O2JA 4QG7A 3NHAA 2AFIA 4RGYA 3WB2A 8ADHA 2FV8A 1DRJA 5IZ4A 4MQBA 3T41A 4ZOCA 4DMRA 3IAFA 3EPLA 1DKPA 2BGUA 3JWHA 4NBTA 3KEGA 2QNRA 1FNCA 3KOYA 5DLQC 3VR6A 4HNHA 4RMIA 4J07A 3OOYA 3GEHA 1NUQA 1LZLA 4FCCA 1UJ5A 2QI9C 1NMEA 1CHNA 2CZGA 3D8NA 4JIMA 2R00C 1KYZA 4MIOA 1XHEA 5A3VA 1JVBA 2QUAA 3H0EA 2XB8A 4JLOA 1JIJA 1RTTA 1CV2A 4INPA 3HJHA 1EDEA 2V6FA 3TQCA 1A9QA 3BXGA 5CT5A 5CDFA 4O6VA 3AKZA 1FFYA 1D6MA 2Q2QA 2VEOA 4KVAA 1BGVA 1US8B 4KR9A 1ADYA 2RAUA 1VP9A 3GZ4A 4FIDA 5CW1A 1PT9A 2LBPA 2BMJA 1UEXC 1MNQA 1Z28A 3V4VB 4BV9A 4XFKA 2E4WA 2PZFA 1LDMA 2JGFA 4D5EA 3SYLA 2IOFA 3U1VA 2RHDA 4PVCA 5DFAA 4GRIA 5CVUA 1I7DA 4R8LA 4TX1A 3ILXA 4AG3A 1KEZA 4HC4A 5A62A 4B3SB 1VL6A 2Z5FA 4NV1A 4LPSA 2BFWA 4XTRA 3RDPA 4YV0A 4L51A 1F60A 1GGVA 1Z5WA 3V8VA 2IEIA 4YAUA 4RD6A 1ZGZA 3T1OA 4LGYA 4YUXA 1H42A 1CB0A 2FPWA 4AWBA 5IYZA 4K9DA 2WSLA 5EKDA 1YMUA 2GN9A 1XP5A 3S8YA 2PWBA 1TU4A 4FMCF 4C3ZA 1AGPA 1KYVA 2Q6IA 3UWPA 5J5CA 2GAAA 1PJCA 5AICA 2O7QA 3AXSA 4RNCA 4JVOA 3U9SA 2ZUBA 3VNAA 1NVGA 4M8IA 3CW2A 2BDUA 3O74A 5TMBA 4EG4A 4JEHA 5F4BA 1GN8A 2Q2OA 3II6X 1QK5A 2WOOA 1V45E 2OEPA 3DZ8A 4DG8A 2FAXA 2ZTHA 4CMCA 3O4FA 3HXLA 2BFDB 5I45A 2OCBA 1A9ZA 1SOMA 4NQRA 5J4KA 1B6TA 3F5SA 3LP5A 4RLSA 5JAIA 4KO2S 1GPNA 1Y8RA 2VT7A 5H59A 3VSAA 1KWGA 3QLVA 5H0IA 5F64A 3HYNA 5KAMA 1L7QA 3BD9A 1M2EA 5AMXA 4E1VA 2GSDA 2A9KA 3JALA 1IB0A 4HRVA 3UENA 3ZDRA 5C18A 1IYZA 2C9BA 2X41A 2I65A 3IEPA 3WLIA 3I34X 4YRPA 5BSWA 3GCXA 1QIGA 1N34B 1I9CA 3HEAA 1GTMA 1NQWA 1SUDA 3AUJB 1T5BA 4FUQA 4IG4A 5BW6B 1K86A 1KY2A 5JPIA 1W581 2PWZA 4TV9F 5DYGA 1XJQA 4BS9A 1J56A 3H5WA 2BDEA 3HJAA 4LTNA 5HBGA 4U02A 2PNJA 5B37A 2EKDA 3ZE2B 4UAVA 4UU0A 1V1MB 4BNUA 1R4MA 2NU7A 4OHBA 1Q44A 3P9KA 5AR1A 1N7HA 3DBHB 4RO0A 5CCDA 3WHIA 4DOMA 1T6YA 3BBPA 4B7CA 3EDOA 3NDBB 1G41A 1THGA 1VYVA 4E4TA 4WLOA 1QE0A 3JYNA 1M1XB 5ABPA 3GVHA 4ZEMA 3UPDA 3ZVLA 3GLVA 3Q7RA 2EZ9A 4I55F 5I9TA 1W52X 3K6SA 1YNSA 4MRVA 3FNHA 3COSA 2JARA 2RHJA 5B36A 1SEVA 2E2WA 5KDLA 1QYCA 3TTWA 5I7RA 1HDCA 5EAIA 4XYLA 1ZJ6A 2PH3A 3F7MA 2II6A 3A8TA 3USZA 2C9DA 2BT4A 2E89A 3HA5A 3DDWA 4NZPA 3WRXC 3GDGA 2W5UA 4X71A 3KXKA 5JSUA 4MQEB 2PKEA 4PG7A 5H16A 3A6LA 4BZWA 4PPQA 2X2EA 2YWBA 4Z2YA 3RBAA 3GLSA 1DTEA 4U0JA 2R2GA 4AK9A 4OLBA 3OMXA 3ZLVA 3K05A 4HZIA 5JJIA 5ADUS 1L5RA 2C99A 2RGWA 4MJXA 4F72A 3F98A 2WF6A 3OPYA 2B2CA 4F4CA 2EP5A 2GHIA 2JAWA 2QMEA 3GUZA 3WB0A 1XZKA 5BN3A 1NHGA 4F9TA 1KO8A 2JCSA 3ZJUA 4BNXA 1AKNA 3PGJA 4LJ5A 3OP1A 1RYYA 3FBGA 3ACDA 1C0KA 3TTUA 2ZR7A 4RVGA 3UT5A 5KOYA 1X7WB 1CHDA 1XVLA 2PLNA 3E2MA 3V1MA 3EPJA 3OURA 4HNQA 2DWUA 1NMYA 2FWRA 4EMTA 4BDTA 2GXUA 2X15A 1GNVA 3FYCA 3NYWA 5DTEA 2X9GA 1RTKA 5KYUB 2DU8A 3E1GA 3GC6A 3Q7SA 2W2VA 1U3UA 2H54A 2UYGA 4K9RA 4P6VF 4CIWA 3ZXUB 1NKVA 5AK4A 1KSGA 4YA6A 3FJYA 3L0YA 2I2BA 3HB9A 4KREA 2ASVA 2EFGA 2WB4A 5E9QA 3H05A 3WKAA 2QUIA 3QEMB 5ALSA 1XEAA 1CUZA 4TXHA 4X1IA 2W6QA 1Q7EA 2WFLB 2O0LA 1NJGA 1KA9H 2GZ2A 1OCEA 5DHFA 3R7AA 3WSTA 3HLTA 4ARZA 2R1UA 1OFUX 3CNBA 4HRYA 1C7IA 1NBHA 2VJLA 4I9NA 1Z6TA 1UFOA 1OKKA 1ZVQA 1QIHA 2QT0A 3A2NA 4TL6A 4B75A 1LLQA 1LI5A 1W4CA 3PV0A 1RHRA 3HM9A 2ZDGA 3WNZA 5ICCA 4E12A 2FZ4A 5KC8A 2HK9A 4Q05A 3LT5A 3NALA 3Q85A 4S0ZA 4IG9A 2Q6OA 3R8CA 3OWOA 5DNCA 3THWA 1E66A 1L7XA 4HDQB 4W82A 2V6BA 5AFSA 3V4LA 2IS4A 3WDKA 3OJWA 3LE8A 4UBIA 4RQBA 1MKYA 1H05A 1QFMA 2EFEB 1FFEA 3H2KA 4LAFA 3ECAA 1UMBB 2VHWA 1TT7A 2YOGA 5LA6B 1IUKA 1WXDA 2O3RA 2G9QA 2TECE 2FPLA 5BV0A 1I2DA 3QG5A 1J0EA 1FQJA 3IPYA 2WHEA 1RWPA 5J4LA 5BPHA 2ACKA 3MT8A 4OP2A 2WM8A 3T7JA 3HDTA 4D9CA 3HB4X 1LV7A 2DUWA 3HJBA 2ZJ6A 4PHTA 1Y3HA 3AG6A 3DULA 3KRTA 2C1EA 2OCPA 3OTQA 5C8DA 1E64A 1XXHE 1WQ4A 1CJVC 2Z2YA 3MJEA 4HD8A 4IM7A 3T7TA 4CM4B 2VSQA 2OFPA 2NO7A 1JFVA 2PEYA 2ZWAA 4FNMA 2G72A 3UMFA 3PKJA 3WC4A 2V97A 3CJRA 2FRDC 1YK0A 3ORFA 4KODA 3OJFA 4MW1A 1QYVA 1A88A 1GAEO 4FI3C 4URWR 1T5DX 3EISA 4H1VA 3RSOA 3TOXA 3I30X 3RVQA 5AM5A 3VR3A 3V33A 4IOJA 4NU5A 4BFLA 2R4UA 1CR1A 2R97A 4KLAA 1GGNA 1I1NA 4M53A 4WCFC 3M83A 3RVOA 4CKYA 4F91B 2ZULA 2PX4A 2OAP1 4NV3A 1WEHA 2R6ZA 3E15A 4XLLA 2ANCA 4Y30A 4BEVA 1SOUA 4K40A 4FU0A 1PVVA 5JWOA 3VDQA 1GL6A 2G0TA 4AO8A 2C5LA 4F98A 4ZU6X 3A05A 3NV7A 3QVKA 4FOOA 5L4NA 4J2HA 1CZHA 3K20A 5GV8A 1SXJD 4QOHA 2F1OA 1BX0A 4N0MA 3LPMA 1S7CA 2GPJA 4KH1A 3OIWA 3ZD8A 3BEDA 2DLDA 4M38A 5AVWA 4KQGA 5CGZA 2AJLI 3DLTA 5JS1A 2BW0A 3QPCA 4B71A 2IZOA 4RSGA 3UJ7A 2IDMA 2C83A 2NO6A 3LHKA 4FT4A 1JRLA 2C3OA 4AROA 5BNZA 5IBCA 1K2WA 2HSDA 1UBCA 1ZEMA 3BX1A 2P3OA 1PLKA 2IYQA 2R6R1 3DXFA 4DAOA 1I4OA 4K8OA 2NUPA 4MNTA 3WK4A 2WSIA 4MUNA 3ZWYA 1NOIA 3MQFA 3EEBA 2QIPA 3G2LA 3PUXA 2HA6A 1SIUA 2ZRDA 1J7JA 5IC5A 4QC2A 5EMKA 4IUYA 3QXSA 1V1MA 4OGFA 4NJMB 5AW8A 1RI4A 1Y3DE 3NM5A 3DBHA 1W29A 4OAOA 3RT1A 3WKDA 4RFLA 3NTRA 3OT4A 4R8VA 5ADHA 2B5VA 2QTWB 4NYIQ 2PYIA 1RD4A 5C51B 1GGFA 3JWPA 3IAAA 4PW0A 3CX4A 4GNKA 2JVKA 3ESAA 1VPEA 3ZHXA 2REQB 4YCJA 3DJYA 1GTSA 1IG0A 2Y92A 4BKOA 2C03A 5IKXA 2RH8A 4LRYA 3SIXA 3D3EA 4YUWA 4M87A 1NR5A 4PZCA 3AJDA 1U2TA 3C5EA 1PT6A 1ZN2A 1B15A 5KOHA 4KH0A 1CPYA 5KKAA 4ZOLF 4AMBA 4ON9A 3B1VA 4PGAA 4UBJA 3W9BA 2XB9A 2HDHA 3G5MA 4MP3A 1YZ3A 2O5VA 2PRSA 3MJTA 1N78A 3LCRA 3TZKA 2CKDA 4AB1A 1GZ6A 4MQEA 5JYEA 2YIMA 1TIBA 1RXEA 3LUAA 1T43A 3KKQA 3CN9A 3SJAA 1LS6A 5JQGF 1E7RA 2WPNA 2Y76A 4L8GA 2HBYA 4M36A 3SSNA 3UOAB 5AJTA 1WMDA 2Q50A 3SQXA 2RGNA 2X40A 1ECJA 2V7QA 4PGFA 4PS0A 4U63A 3VNVA 1LX6A 4BJ3A 2WM3A 2VSOA 2OCKA 3LUJA 4OGLA 4GL2A 2OZPA 4EHHA 3I1FA 1Z9BA 1UAYA 2DTDA 3NIGB 3MYRA 1UF9A 1W2GA 1X7WA 1T4DA 1N2IA 5F2NA 5FPYA 1MRNA 3B6KA 3C3EA 1HETA 3AJ8A 2VT6A 3AM4A 1D0VA 1ECFA 2CYAA 4H59A 5KYUA 4F3TA 2HM7A 4UHEA 1BD4A 3GXBA 1J8QA 1JQDA 3BKXA 1YB1A 4ZJZA 4ZOBA 1GSIA 4A82A 2H4JA 1U1CA 4P3PA 4TV8F 3RIGA 4QDKA 1KNXA 1AJEA 5K99A 5L6MB 4IOKA 2YCLA 4H4DA 3G88A 2IY8A 4DDWA 1UOEA 3QEMA 4FZ5A 1JR2A 1IBMB 1GO2A 1JDBC 1OU4A 2WFLA 3KP1A 4AY2A 3D7KA 4XIIA 2ZI9A 4RWEA 1JDPA 4DE5A 5AVZA 1T0UA 5ES4B 1HV8A 2GYYA 4KTTE 4RL6A 4F6LA 1DBSA 2BUBA 1E94E 1UMCB 4OG2A 4HUTA 1ADBA 4JL5A 5SZIA 1Q22A 1JKIA 1GAJA 5CH5A 4AFNA 1YI0A 3JQGB 2Q9AA 4Z3OA 4P3NA 1XFDA 4DIOA 4GX0A 5FUYA 1IQRA 5EIBD 2J31A 4ALIA 4FDTA 3WRVA 3KZNA 4L72A 1U5BB 4WLEA 2YVKA 5IUNC 2GD1O 3ELYA 3V80A 2GILA 3GFSA 1E9SA 1KJ8A 1QOZA 4JL8A 4MVJM 1CCWA 2BKVA 4JI3B 2HPHA 4HSEA 2XCTB 4YMTA 1UMBA 4ZAVA 5FQNA 3DZHA 5E6SB 2GAOA 5LA6A 3F9CA 4GKVA 2W2OA 3SR3A 2FPPB 5AI5A 1VCNA 4HDAA 3EWNA 1SBHA 4M86A 3ELWA 4KGDA 1G6KA 5EXTA 1HA3A 1HLGA 1LI7A 2A8YA 3C8MA 3IDZA 4FQ7A 4ARIA 3WL8A 1QF6A 4CLHA 1QIIA 1OPRA 2WJWA 5JAHA 4BNNA 1O87A 4FX5A 3W5SA 2GFHA 4LSWA 2AEMA 3TYXA 4CM4A 1CDOA 4GUAA 4PYIA 3SHOA 2VZ8A 1E79D 3EBOA 3P19A 1I5OA 3PNYA 4R1SA 3MBKA 4GBED 5EG5A 2D74A 4CR6A 5IRCD 3BT7A 1SEPA 3FNFA 2HCFA 2P7HA 4HV4A 4CF3A 1GZ5A 1SBTA 1AKQA 4ZO7A 5J40A 1AA6A 4Y2RA 3KT3A 5U9CA 4W5TA 1OYOA 4MLZA 3PNBA 4OEHA 1O94D 3HKEA 1MOQA 2HA0A 3ROEA 3A2KA 1G7TA 2PL1A 1AZWA 1YR1A 1Z2NX 5JC8A 1L7NA 2UUCB 1PG2A 2QTTA 1X7HA 3OU2A 4J2OA 1Z4PX 5G0TA 2BEWB 3CA8A 5BNFA 1JA1A 1OX4B 4FFVA 4DQLA 3GEEA 2X7HA 5EQFA 4YJDA 5IC6A 3ESZA 2A5YB 1W4RA 4AX4A 3NDJA 4B6RA 2PANA 5ALHA 1M1YB 4CYMA 3ZQ6A 4RBNA 1USKA 3B1JA 2FI1A 1T9HA 3EPRA 1JEEA 1OX5A 1VKNA 1SZDA 1YKSA 2Y4OA 3UH0A 3AR9A 3CE6A 1FVHA 2PO5A 3C7DB 1KH2A 3ANXA 3HYLA 4PZ0A 2P27A 1K66A 1YL7A 4EW2A 4TTQA 4DR4B 1Y8AA 1L4BA 1U3FA 1ZCBA 2PUCA 5JMOA 3Q8LA 1Z75A 3I5AA 4BNIA 4FDAA 4FYJA 1TCBA 2DFTA 2OBXA 5DCLA 4M21A 3KVNA 1A4XA 5LQRA 3BIXA 2J6IA 5J59A 4WE3A 2M6KA 1ZOPA 2GTPA 2PMCA 3AG5A 4TWIA 4FLMA 4WOCA 3SIWA 2BD0A 3FFXA 4YLGA 1QHGA 2CVOA 3WHLA 4O5AA 3AF1A 5BO5A 5IM5A 3CZ9A 2O2DA 3JYQA 1L7EA 3BC1A 4I5IA 4UNIA 5COBA 4N41A 2JAUA 1OJ7A 2ID9A 1U0SY 4NJMA 3I2FA 1W93A 3AP3A 4Y2YA 4X61A 5AHXA 2FW9A 2A92A 3MOGA 4W8GA 4AJIA 4LYEA 4P4TA 5IBPA 3N05A 5IK2A 1NDQA 5IMBA 1GPDG 4Z4CA 3QUSA 1SQFA 1ZAKA 2WAOA 4RETA 3ER8A 4L6AA 3HR7A 2REQA 1ZL0A 1YZKA 1E18A 1XNJA 1YAHA 2PD4A 4GMGA 4QEZA 3WRXA 4E14A 2ONJA 1K6MA 2FJ0A 4RJLA 4YRKA 4LBWA 3HB1A 2WP8J 2UZIR 1W48A 4JJ8A 4YHBA 2XVZA 3MRXA 3KWLA 1P1BA 1BFUA 1YRYE 2W37A 1QYWA 1GGMA 4DTCA 1JZTA 3V5NA 5KNCA 4JUAA 2ZBEA 5M34A 2VP6A 4MGEA 3T7CA 4NCIA 3ADKA 4ZP1A 3TEJA 4BOYA 5CD9A 4ILEA 2EJTA 4ZAFA 5M29A 1O5TA 1OI3A 3GUCA 2ZIVB 2FA9A 4MYCA 4WGGA 4V38A 3LOQA 1OFHA 3LY7A 3H04A 4JVMA 1XVAA 1LF0A 4UTVA 4V3BA 3GDFA 5ADWA 2OGWA 4YP6A 1KOJA 2CJYA 4LDZA 3U3MA 3JQAA 2C0PA 1T6XA 3TQSA 4JBNA 4K0RA 4OIFA 1IHDA 3PIRA 3IB3A 4ZYTA 5D1NA 2FWBA 3IUQA 5I5GA 3OD5A 1Z45A 2FEXA 2WVJA 2PQ6A 3ZX4A 2FW8A 3TTXA 1DMSA 1A8IA 1PWEA 1KNQA 1RCFA 1J42A 3MQ4A 4R41A 1YTUA 3W6UA 1S3FA 4BVKA 2AC2A 5DT2A 5CK5A 1VJRA 1E2MA 2RH9B 5K0TA 5DHTA 1EFRA 1WDMA 1RACA 5LQKA 4AF7A 4HJRA 4F6RB 4TSFD 2QP3A 4NBRA 3GARA 4JK3A 1F9AA 4M8LA 3RSFA 3UAYA 1EB8A 1NYTA 4LFAB 4QM6A 2NNWB 4GG1A 3F5QA 2V45A 2WWGA 1R6TA 5CYOA 1R66A 2BRUA 5DKFA 5CFLA 4WN9B 2AN4A 3BBLA 2R48A 2CT8A 4TL8A 3JQ7B 1B1CA 1NJ5A 1IM5A 2N75A 1Q77A 4I4TA 3D5EA 3LUHA 3O8OB 1E3SA 3RRZA 1K8RA 3KB6A 4G0ZA 1YHYA 3AR6A 4FHEA 1ZESA 4UUOA 4BTVA 3JQGA 1R0LA 3FWPA 1AU9A 1USVA 2NSDA 4GDFA 1YZQA 4QYMA 4GKKB 1AZSC 5H81A 3TE7A 4PQEA 3TVTA 1R0WA 3B51X 3MINB 2PR7A 1U5BA 3L40A 4A2QA 4V1CI 2XUKA 1E0SA 3GFFA 3VI3B 3GCWA 2QW8A 1Z3CA 4Z0HO 3WYCA 5KYYA 1XYVA 1P72A 3AVTA 1U11A 3O3CA 3DUFB 1YV9A 3NC4A 4OKSA 1KI9A 1O3YA 1QFSA 2H00A 3ILHA 3EC2A 4G1BA 3LSYA 3PGLA 4FOLA 4WSOA 3BA1A 4LGVA 4R8RA 3FPJA 3IQZA 5E6SA 4FE4A 1Y9JA 4BY9E 3SBOA 2PSSA 2Q0HA 3IQGX 3K0AB 2FPPA 4UE3S 5IAAA 2QG6A 5LP6B 1O08A 1SK9A 4GI2A 4R2KA 3AUUA 1VTKA 4RIHA 5IVIA 3TXAA 3TTSA 5BWOA 1N2CB 2WHXA 2WP0A 3GLTA 3KLPX 4J0IA 4CMBA 1JEDA 3K5PA 2ZJ2A 1G6HA 3FHOA 1EFKA 3D2LA 5K5EA 1CBUA 3OJEA 3IELA 3NT2A 2D3WA 3RHFA 1EAYA 1FUKA 1I3OA 4OXXA 5E2IA 1FX0B 4LJKA 3GZNB 2E1PA 3KR1A 3BXOA 1ZPDA 5DEOA 2QN6A 1V8ZA 3VAAA 1GGKA 3BL5A 3AJRA 3O3NB 3VI4B 4RKWA 4WCFA 5K3EA 4QZVA 2FZEA 2ZRLA 3V4SA 2IIBA 1VSQA 1J9EA 1U3DA 3DYIA 2PUEA 3PWSA 1CIPA 4Q39A 4U2GA 5AESA 4RVHA 3HDQA 1RYBA 2EHJA 5EXEA 2YICA 3KSUA 1ATIA 5JE8A 2E9SA 4ARBA 2GM4A 1QQ7A 3PT5A 3ZI0A 1Z33A 3PD0A 1IATA 4EYSA 4JFRA 1OTXA 4FFNA 1C1YA 4M9SA 2A4KA 2COUA 2EBFX 3QQPA 4MRAA 4BU0A 2VDOB 1T4CB 4B6FA 2BEWA 4BKRA 5ITVA 1DGQA 3EWAA 1R8QA 1OX4A 2ZP1A 2JHGA 4LF6B 2EV9A 5FT9A 3ZHSA 5CXSA 4DV0B 2GETA 3AZPA 2PJRA 1GZ4A 2NXNA 1M1YA 3WO0A 3ANNA 4YROA 4F5DA 1NN3A 3BJMA 4HRXA 1FA9A 2JEYA 5GZ3A 2IYTA 2ZKIA 4Q9HA 1BCSA 4D4HA 5JROA 4QQFA 1UWVA 4ZVPA 1BRMA 3UV6A 2DT8A 3EXHB 3OEHA 4RHTA 3U13A 4KU4A 4QXQA 3VH4A 2V3CC 3KPUA 4MWCA 5IUKC 3THYB 1UC8A 4DJFC 2R47A 1V7CA 2O20A 2XIQA 5FADA 2IITA 4IDNA 5KSPA 2ZB7A 3BRCA 3JWJA 2ACVA 1ZM3A 1RLMA 3NKLA 5AW4A 1T35A 2BFOA 3QPWA 1ID1A 5DU2A 5BSTA 5MHTA 5CDHA 1ZD8A 3D4IA 4WN3A 5CA0F 1LUAA 2IUSA 5INTA 1XFAA 1NA5A 3FPAA 2QWXA 5ICFA 3S3TA 4JUCA 3F73A 3G9ZA 3W5HA 2O2XA 3OFJA 4M89A 4XW2A 4G1CA 1KOLA 4EFMA 3GP3A 2EBUA 1K06A 3ETLA 4N5NA 4NBNA 4TT3D 4QUBA 2VRCA 1N6RA 1S6YA 3R3SA 3MJSA 1OXMA 1MW9X 2YXNA 4MLCA 1H0KA 1GITA 3CU5A 4N82A 2PGDA 2ZU0C 1K7SN 4OOFA 5SICE 2EW8A 3VR4D 4CQMB 4HQLA 4PLCA 2OLEA 3R20A 3RRMA 1Z5PA 1BXGB 2CL0X 2IYXA 2R6HA 4HAOA 1TKCA 2F9LA 2DWOA 1N7IA 5HIAA 4UFPA 5EGNA 1NI3A 3RGGA 5GMOA 2G9UA 3ABZA 3P9IA 2SCUB 3Q11A 3IGFA 1DCFA 1QIDA 3IILA 2QORA 1VE7A 1F0KA 2OMEA 2VYND 3K1TA 3L77A 2GAJA 1QCZA 3D81A 5E38A 3I2YX 1Z13A 1ZNXA 3KHTA 3VZDA 1U0JA 3G9QA 3HXKA 2NQTA 4XJVA 4OHFA 3K9HA 4LHYA 4BNWA 5JFOA 3COZA 5LNK6 4QYIB 2IUTA 2A9OA 1WCIA 1HGXA 1Y1QA 2CUZA 2FRVA 2YY7A 3LC7O 4L27A 1U8YA 2OBLA 3L7OA 4Y2PA 3T38A 1QK4A 1LI4A 1UKAA 4LHWA 3VOBA 2IX3A 2XVYA 1I3CA 3GDHA 3KJQA 3G6KA 3IBFA 3ND5A 2F1KA 4Q3KA 1W76A 1PTJA 3B78A 3MN1A 4M37A 9GPBA 1VG0B 4X3PA 5G41A 2AR9A 3IAXA 3R3VA 3TUIC 4CUZA 2F3RA 2IC5A 3C3PA 4EM6A 2QW0X 3RRBA 3DD5A 3UXMA 2HZBA 1XKQA 5DHUA 4B80A 1F14A 5TPWB 1K2VN 1ZUWA 4AMUA 2OGSA 4QTTB 3QP9A 2YY6A 2EC5A 2QJFA 3ENZA 3UJ6A 3OQIB 2CL6X 4MW4A 2C95A 2VOJA 2QLLA 4V0SA 1EWKA 4HH3C 2I87A 3PLAE 3ED5A 5AI9A 3ZVRA 3NRJA 3PC3A 3H1GA 2HLNA 1S01A 1N8KA 4BMNA 4EW6A 5CURA 2HBQA 3HVUA 1CJTC 3N2LA 3QU2A 3NLLA 2ZSBA 3CRMA 4LJ6A 1JWAB 2HAEA 2IXFA 2OL4A 3AO0B 1Q91A 4UM8B 2Q28A 3X1YA 1H6DA 2CVQA 1R6XA 1TYEB 4RD4A 4Z9XA 5F3WB 4Z1OA 1Y4DE 4F6RA 1T9KA 2JI4A 3QBEA 4Z1MD 2PS0A 3FR7A 2I9PA 4I36A 1J0DA 3IOMA 3TR5A 1ESDA 2EFJA 5A4JA 3ESYA 3EQ9A 4F4DA 5B5SA 4OGGA 1UOPA 1IUOA 1U0LA 3H42B 3V42A 2I1WA 4WN9A 3V8QA 1PJ2A 2VH5R 1NBMD 4X1KA 3VC7A 4DKXA 4QU9A 3JQ7A 2ZBFA 2E5FA 2MSWA 2AMVA 2ZB3A 1IC6A 2Z8ZA 4H1HA 3O8OA 5C1DA 3U4QB 1L8XA 1ETHA 3UXYA 3CKMA 1D6NA 5GGXA 2X8JA 4FWBA 3SYTA 2YKGA 3M3DA 3C87A 1E2IA 2J45A 3U4MA 1UFQA 2P11A 3Q3GE 4ZGWA 1H23A 3MINA 2WKRA 5AJWA 3OICA 3TLEA 1CE8B 1NUAA 4DZZA 2C2BA 4KO1S 4V0OA 3ZWCA 1DCKA 5GQSA 3QPDA 3NO4A 2ZUEA 1U2DC 1LC0A 1MB2A 3GY0A 3LPDA 2XYRA 1Z3IX 2H7YA 1VLLA 2VH2A 5E95A 1IK4A 2DF8A 1JEQB 3H18A 3NDRA 1VPTA 5EI5A 2LXNA 3K0AA 2PRYA 4B4UA 2CXTA 2ZT8A 5LP6A 2FFAA 3TNJA 2DT5A 4KNYA 4D0SA 3ZE8A 4DIFA 1N2CA 3H9GA 4EGSA 1HNWB 3HI4A 4EFLA 4YACA 5LIPA 2EX0A 1MQ8B 3H9BA 5G53C 2DVMA 3ZWWA 1BWRA 5CDSA 1JALA 3KQKA 4JZYA 4ZVNA 4GD3Q 3GCZA 4RCZA 3TK1A 1U0HC 1VCMA 5JD5A 1NFRA 3D4OA 3GZNA 2Q4RA 3LBYA 4HUQB 4IJVA 1EXDA 1AKMA 1XLWA 3LT1A 4XWTA 1VE3A 1FP6A 2PKCA 4NMWA 3O47A 3AR5A 3QU9A 3FR8A 4YIHA 2AR7A 4JP1A 5C1BA 1BWSA 4RLHA 2MSNA 3SDBA 1TUGA 2SNIE 1C0PA 2VOEA 1XQYA 3H16A 1K88A 1M67A 1EFLA 1G9XA 1UZLA 3ETGA 1J21A 2QLJA 1F0PA 4MW2A 4GBGA 5AT1A 4RVNA 2QQ0A 3G85A 1R4ZA 4YRCA 4E7OA 2DTEA 1M2WA 3CEAA 1JHRA 3DDHA 1Z4IA 3H5VA 3R7FA 1Q7GA 4ZZ0A 1QH1B 1JL3A 2DP4E 2XD9A 2H06A 2XNKA 3JQ9A 1T4CA 4R2WA 2CMDA 3B7PA 2H4FA 4TUYF 3H5AA 3T0FA 3WMWA 2O8VA 2G04A 4DLRA 3TW8A 4A2CA 5I3CA 3IEKA 3FVQA 1E1NA 3NTLA 1TB4A 5CIWA 3ROPA 3BXFA 3A9WA 3T34A 1FTWA 1APBA 1F7VA 2B98A 4DEYA 1JPJA 1WMEA 3V46A 5IVPA 3QVWA 1I2CA 2QTFA 2DHEA 2VCHA 3EXHA 2JLWA 1C8KA 2LD4A 2JAOA 3A1CA 5AKIA 3ROXA 3T5MA 1GNQA 2BFEB 1OR8A 1CYEA 3THYA 2QUHA 3LSTA 4MRMB 3G2QA 3OTWA 1JX6A 2NO9A 3MCTA 1CUHA 2ABWA 5JDCC 4FHZA 4IH4A 5AM3A 3STTA 4QQKA 2DFDA 5KJCA 1GTVA 4CTNA 3PFFA 1LPNA 3B7WA 3DKRA 1GDHA 1ZSVA 1RABA 5J5VA 5LD2C 3G89A 3PC6A 3UMCA 2ZUTA 4PG8A 4LYHA 4D9BA 2QMHA 1LQTA 4BV2A 5KKCA 2VSYA 1L5LA 5KYGA 1W36C 1AQUA 3UJ3X 2G3YA 4BMZA 5LLTA 4AI6A 1BSVA 4WLUA 1UJCA 3QE2A 4PANA 5KYNA 1WD5A 3QLEA 2NTJA 3QU7A 1BJTA 1NASA 4KBGA 4UUMA 4LFCB 3TLBA 4RA6B 4ETMA 3CVXA 3TMYA 2JLBA 4XIJA 4TS4A 3S1AB 4X7RA 4RD3A 4I6GA 4CQMA 1GAQA 2NTVA 1EESA 1Z26A 6NULA 1BXGA 2REBA 3ZI4A 3AEZA 4QRHA 1YRBA 5ALDA 4U7GA 4CLRB 3TSYA 4B32A 5AVXA 4QSHA 3L1KA 2NTEA 4KSBA 1PL0A 3CF4G 4I1SA 4LRQA 2GZ3A 4ZU1X 4G85A 2SCUA 4GQBA 4WFKA 4KQ2A 5KDDA 3AVPA 3NB0A 1N5DA 4GOMD 5CM2Z 4Z9FA 1U0BB 1CF4A 5CFRA 3GN2A 3IO5A 1ZD1A 3LLVA 3WV4A 2AYXA 1TQ8A 3GELA 3UY4A 2B2NA 3CVOA 2FMXA 4M1KA 1J06A 4CG0A 1HDRA 5CXQA 1SBZA 1W0JD 2HNAA 4JBXA 4QYIA 4TYPA 4JI2B 4NPAA 3E7DA 4BGUA 2VPTA 2C5SA 5HIIA 1S9DA 1EG7A 1U99A 1CJUC 3RJMA 3OMLA 1YZUA 2NVOA 1WXGA 1CQPA 3L4BA 3U39A 1Z88A 3FYDA 4MW0A 2I9KA 1PKEA 4DCTA 3TO5A 4P53A 1VG8A 4BGDA 2EZ8A 2HHAA 2C8KA 1FZQA 1Z0UA 4K05A 2ADMA 3ULKA 4IGIA 5HS4A 4AN1A 5BQ3A 1H2FA 2QT9A 3S99A 1MXHA 3VV2A 1YIOA 2OORC 4TN1A 1U9JA 5G3YA 5E2AA 3JWEA 4XZ3A 3Q15C 2H17A 3ZW8A 4EKIA 2PE5A 1YBMA 5JUWA 3VSBA 1GL9B 3U5ZB 2Y0PA 3U4DA 1EIWA 2QYOA 4QJ3A 3WSWA 1RLOA 1SO8A 2P3LA 4FOPA 1BS9A 5CLQA 2WJ4A 2GAIA 3E9MA 1L4KA 3DXYA 3P2MA 3C3CA 4IAOA 3DE6X 4JYMA 1IVYA 1KPHA 3IT3A 5EHGA 3EG5A 3V8BA 3CLRC 5KNDD 4PICA 4FN4A 1E6WA 1HSOA 1GZDA 4YECA 4JXKA 1WHTB 3RS3A 3GOHA 1GPYA 1X8LA 3WV5A 2BE7A 1NQXA 1FSZA 3GCGA 3ICVA 1QRAA 2BHLA 4TVOA 2Q2NA 3QVMA 3GRPA 4HDNB 1WUIS 4DLUA 2BI4A 4IHAA 1Z35A 3F7TA 2HA3A 1DQSA 4RA9B 1X70A 1ORVA 3M6MD 3NU1A 4ZGGA 5JSHA 1CUWA 2VZ0A 1DO2A 1S8NA 2H4HA 3OEWA 4L4SA 3L4KA 2R6JA 2WIJA 1P31A 2UUPA 3WL7A 2OAGA 1M75A 1U0RA 2C58A 5EFZA 5F1YA 1D5WA 3O4RA 4YMSA 4MV8A 1KIMA 5TQ0B 4C0SA 3T3NA 2RGAA 4XUGB 1KJ9A 2B94A 1CU1A 2GJ8A 1YD7A 3O8LA 5A5DA 4Q66C 4U39A 5A4AA 1UOOA 5FAKA 3B1KA 1ZOLA 3RJ9A 3P52A 1M5TA 3QWFA 1J8DA 2R62A 1MCZA 4F4IA 3NP7A 1UZNA 2ZCUA 2WQ6A 3FPHA 3G8DA 4C1BA 3MC1A 2PXCA 4HI0E 4HX9A 1UK6A 8ATCA 5JS6A 1JEQA 2FPSA 2O2IA 3SXUB 4A1FA 4OI1A 2G28A 1UKZA 2NX2A 2ZB8A 5CVVA 2R65A 3A0RB 1YU9A 2HLDD 4E1AA 2HJHA 4NMXB 1I2ZA 3LVQE 3V7FA 2VO1A 4Z4HA 2J0UB 5C80A 1CEYA 1VZ2A 1JI3A 1UKYA 2HA2A 3ESDA 2AKEA 1XP8A 2IP2A 3BMQB 5CX1B 3CT4A 3VR4H 1QHHB 2HJSA 1QLHA 3I9OA 1N2EA 4HUQA 1RWXA 4POOA 1CETA 1KEKA 1ZISA 1YHNA 4G41A 1DWOA 2XAUA 3EY9A 4JKOA 2VHXA 4R7GA 1PJQA 4LGMA 2OECA 3KZ1E 4NJEB 4RU1A 3VYVA 3WWEA 4BJ5A 1AF7A 4N3NA 3GRCA 4LXYA 5BUZA 4K87A 2XQFA 4RS4A 2VBGA 2UYCA 3R3XA 3LXUX 3DMHA 3FRJA 2LE0A 3E82A 1GJRA 1VM6A 3MSCA 4Z9YA 4MUXA 1U2ZA 1ANKA 2B4KA 5BYJA 3BWCA 4Z2AA 3OOJA 1SHTX 4EZIA 1KP9A 3U1BA 4KC0A 2J7KA 1FQOA 3D6VA 4K2HA 4HGQA 1COWA 1YFKA 3CZ5A 4COKA 3C24A 2VQDA 521PA 4ALNA 2PZEA 3IIEA 3FOAA 3OT1B 1FZTA 3UHAA 3X1ZA 2KSQA 3VPHA 4LCJA 5EUMA 5DWQA 1Z7GA 3TOZA 1AO3A 2CXPA 2PZJA 1IZ9A 3BCHA 4HVAA 5KHAA 3GUHA 5HRCA 5TMPA 4KZKA 1G0OA 3M2PA 2YW9A 1G5PA 4Y6PA 3WGKA 1E98A 4ODIA 2EGGA 2JJ2D 2ONCA 3KJHA 4KN8A 5D51S 3U3KA 1NLFA 3U09A 5EMLA 4R68A 3UK2A 2G7MC 3HRHA 1PZMA 4MEAA 3K0CA 4NC9A 4UVEA 2BFEA 3IUJA 2XRYA 3AYZB 4OLFA 2VK1A 4B73A 1K1EA 1A5ZA 3ZVMA 4WGFA 4A15A 4UBKA 1YR6A 4AQYB 1T9BA 3WQSB 3KWJA 3FA2A 4V0MA 5M3BA 4LW8A 2RBEA 4Z7OB 2XDWA 3GP8A 2EFHB 1E5DA 4UNRA 1ISSA 1FYDA 2EDCA 2X6QA 3WE7A 5HDQA 4DSZA 4JBGA 4DZRA 3WJ2A 2O9JA 4PIPA 1JXQA 1WB4A 2AMJA 2EKLA 2GDZA 3G0OA 3T0IA 2POCA 1OFUA 2GPSA 2RARA 3LL7A 3UCEA 1FNMA 1ZUNB 1K3UB 3ISVA 3PUWA 4W6QA 4YMUA 4NU8X 3FHJA 1OYVA 3QVUA 4OYRA 5GOTA 3REGA 2QTMA 5SYMA 1D8TA 3S5JA 3PDJA 4RA6A 5FUQA 5JXGA 2P7IA 2OQIA 4R84A 1JDJA 1XDGA 3RS9A 3S1AA 1QVZA 4DSUA 1LPBB 3HVHA 5CK4A 1JG7A 3PWTA 4QHSA 1SY7A 2JCXA 4C7VA 1AKRA 1E2EA 1NC1A 2IU6A 3D4BA 4P2GA 1OZAA 4GSKA 3FDIA 4CM9A 4CQNA 5CVTA 3RFFA 2OZKA 1FVOA 1Y1SA 4IMRA 4HAXA 4NQZA 3L7MA 1QIJA 1P5HA 3OQPA 1G291 1KI6B 1GZSA 4IDGA 1PJLA 3S29A 3WJAA 3LI2A 5AD1A 4B7UA 2Q5EA 3R2JA 2XA1A 4FYMA 2Z8YM 3GAMA 1GQYA 2YV2A 2QM7A 1MENA 1P7YA 3CFYA 3MBOA 3UKJA 5JSQA 2YNMC 2FJPA 1WXXA 2FUCA 3EXFB 3HO1A 4AMYA 4KO8A 2AA3A 2PFSA 4DVGA 3P1JA 2DWQA 1PW5A 4M2LA 4OM7A 3EYAA 2GK7A 2J3QA 3LNTA 2RGEA 3BN3A 3SZ3A 4CM7A 4G1VA 1N3LA 2JAXA 1RZ3A 4JI1B 5CA1F 3O03A 3HTXA 1KI8A 3DPUA 3KUKA 1HEUA 1TRHA 4D92A 3K8OE 1JDTA 2DX7A 2PXAA 2QHXA 2X0IA 1K8YB 1RJWA 3M1AA 3WQQA 3BTSA 3KU1A 3JR7A 3W4KA 4Z3KA 1IVSA 3EG9B 5A4DA 1SXJC 4P2BA 3W90A 4BFWA 4C5AA 3DDCA 1NV8A 4IIGA 2C42A 3FPSA 1DXHA 5AOVA 3A6JA 2Z2ZA 4BNYA 4DY6A 1MC1A 2WNHA 2YHIB 4MDFA 1MA3A 1P6UA 2BBTA 1FJHA 1MU0A 3EODA 3IJ5A 2QTVB 4Q9AA 3ZS8A 4RJIA 3P45A 3Q1LA 3DJFA 1UPBA 4KYTA 1XF9A 1NPYA 3THRA 1K5DA 4MIKA 1IFXA 3HXPA 3MQ2A 1W94A 1UDCA 1N1EA 4PFKA 3F7NA 2RHMA 4WOBA 3OH8A 1S2MA 1E3EA 1Y1RA 2PT7A 3S2YA 4OQNA 3TGWA 4LSMA 1TO6A 1EVEA 1NJ1A 2A59A 2Q4DA 2VI5A 2DCUA 2VA9A 2WAXA 1WHTA 2EF1A 1VPWA 1TCCA 4Q24A 2PH5A 1C14A 2BONA 2QD4A 2FCRA 3L43A 3O8QB 3H17A 4A0HA 3RVLA 2WUWE 3FMFA 2A0WA 1UODA 4HDNA 3S2GA 3D8SA 2JHFA 3I4LA 3T94A 3KJNA 2Z6UA 1ODKA 3LO8A 1ZN9A 3NYQA 3PHHA 1I36A 2JIOA 3HN6A 3STVA 4TMTA 2GFIA 2WF8A 3ESCA 3NTVA 4EY8A 3PQCA 2DR3A 1U3TA 2VPYA 2W6CX 3TTYA 2E4XA 2BFFB 2CFOA 2PMEA 3BXHA 2HC9A 5TQ0A 4UCXA 4N0PA 3CNHA 3DV2A 1W5FA 2VWQA 3QUAA 5HRAA 4V0NA 1NP6A 1NTRA 1TOAA 4OX9Y 4MUIA 2JCVA 1IEVA 2PU7A 3LQKA 4NAUA 4Y8VA 5LC1A 4ZCTA 3B1XA 3AW9A 4DR2B 1BA3A 1D03A 4YXWA 5I6DA 4KWIA 3LZCA 3W5CA 3E35A 4U00A 2J5BA 4UAGA 3VR5H 1FUUA 3AUKA 3GRUA 3PCRB 1H2WA 3GLFE 3HB7A 1Z2CA 2E5LB 1UBOS 5CTJA 3SXUA 4L76A 1QG0A 5TR9A 4QG3A 1JKXA 4MV0A 5AOCA 1V5FA 4PCVA 1FSFA 3QBDA 621PA 3R24A 4RTQA 4HXYA 2XUPA 2J0UA 3NBMA 1HC7A 2HWKA 1BAPA 1SUEA 1W9HA 3FUUA 5G1PA 3W0LB 3VKUA 2XBLA 1XU4A 5F2OA 3BMQA 3VZPA 5MN6A 3AT1A 4YEDA 1ENOA 5CX1A 5DF1A 3TI7A 4OHRA 5CLFA 4Q93A 1RZUA 4GMFA 4F9EA 2P9BA 1Y37A 1YRHA 4H3HB 4D9MA 3ZYZA 5F9MA 1WB9A 2VQEB 2CL7X 1Z5UA 2JB9A 4A0GA 1NI4B 1O9GA 1PE0A 4GSYA 3IPXA 4NJEA 1NYRA 1UQRA 3B12A 3PUHA 3UA3A 1GPBA 5J4YA 2Q4TA 3CLSD 4PWZA 4YRIA 1PV2A 3FHCB 1XTJA 2SHKA 2VJKA 4HB3A 1ACMA 1VRVA 1IAQA 2F8MA 4RDHA 3SKYA 4DUZB 2QIOA 3EF1A 4PZ9A 1XG5A 3A58B 1Q84A 2CHFA 4U4AA 4A27A 1JU9A 1CRQA 2YRXA 2CLHB 1XL1A 1QZXA 4DCCA 3K16A 1RYHA 3C8UA 1O95A 3DHNA 1FYFA 3O75A 3E5MA 1PYGA 3V6LA 1HYGA 2COEA 2FW0A 2W6ID 3OT1A 1SG9A 2D59A 3H8JA 2C97A 4KNWA 4PNZA 1GVNB 1PBTA 1FU4A 2NU8B 3W5UA 3RYCB 3AVUA 4IIXA 4XWGA 1XMVA 2CK3D 5JDCA 2ZWOA 3LQQA 1LRKA 3HCAA 1HFJA 3MJDA 3W5AA 4AKIA 2ZE8A 4PXYA 2Z5LA 1PP4A 1JQ3A 3WWPA 2DBQA 2YQ5A 1N8NA 5F4ZA 4XEHA 1ZLYA 2IOYA 1G8MA 3TJZA 3QKIA 4DV1B 4R4JA 1Q0RA 3Q7TA 1ZYUA 4URZR 3BCSA 1T5TA 2QZ4A 4HHEA 3F8SA 2F3PA 5EIBC 5DB4A 4IHJF 4G0QA 1G60A 1SVKA 4QLOA 2Q7DA 4FGWA 4IO0A 4JENA 4E94A 4KR2A 4ZI3A 3DT9A 1ZG3A 2RB5A 1E7QA 2BFNA 1U8CB 4FEYA 1A8SA 4HBZA 3B3FA 4OFWA 2C92A 1RZVA 3QZUA 4M0UA 3S44A 3WA6A 1WJGA 1ZUNA 4OGWA 3B1YA 3AEUB 1TVFA 4D3SA 1ZGGA 3C15C 2EKBA 3FUCA 3H9JA 1U0GA 5SZHB 1W85B 3KZXA 1QG6A 3NBXX 2DR0A 1TKBA 4ZYVA 1CRPA 5BVHB 4IL5A 1LBEA 3SF0A 3TRIA 3S2EA 3LA6A 3KOMA 3EQ6A 1O4WA 4CWAA 3BH6A 2WJYA 3DR5A 2J59A 3MGGA 1Z2DA 3NXKA 3RYIB 3M4YA 1YF3A 5LMUB 4MUHA 1ZMBA 3PDWA 4BBJA 2X6RA 4RABA 4K9SA 3SVTA