4YUZA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 5-[(4-methylbenzyl)oxy]quinazoline-2,4-diamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
285
structure length
273
Chain Sequence
GWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
total genus 93
structure length 273
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuzA02
4M7RA 4HSGA 2GAFA 3PX2A 2BH2A 1N7JA 2HMYB 3G2PA 1NW7A 1FPQA 3MAGA 3MTIA 2ERCA 5BW5A 4EK9A 5KS2A 5ICEA 1B42A 5HIKA 3M6UA 5T67A 3DOUA 2ADMA 1G8SA 1VL5A 2IDKA 4FSXA 4OBXA 5EQJB 5K03A 3FYDA 1IXKA 1I9GA 4V0QA 3CC8A 1F3LA 3PX3A 3TPZA 4XUDA 5LQCA 2GLUA 2ZWVA 4HTFA 2A14A 4CKBA 2P3LA 4C03A 1JR4A 3P97A 1QAQA 5E8JA 1QAOA 1G38A 3EMDA 2BZGA 1DUSA 2EFJA 5K8VA 3B89A 3FTEA 2XVAA 3HVHA 5KYGA 3ERCA 3LKDA 1R8YA 4MTLA 3DH0A 4DF3A 1VPTA 2PX4A 5LSAA 1YUBA 5EOVA 3AY0A 3ELWA 3QOWA 3SR4A 1R74A 3RODA 2Q41A 4KIGA 5DXAA 3Q87B 1RI2A 4YV0A 4AZWA 1KR5A 2Y1WA 1KXZA 5K0EA 1JG1A 3CBGA 4V0RA 4IV0A 2IBTA 1RJFA 5EIFA 2IH2A 2JH8A 3EVGA 1G55A 2WA1A 4ER0A 2AOWA 1EIZA 5GIOE 4GQBA 2PXAA 4HG2A 5DM1A 2OPBA 2PT9A 1XCJA 2Z6AA 3PTAA 3C0KA 3GCZA 5CVUA 2OB1A 2YQZA 1O9GA 5CVDA 1N7IA 1P1BA 1FP1D 3OFKA 4DCMA 4FZVA 3L8DA 2VDVE 1FBNA 5B1SA 2NNWB 2P35A 4BY9E 4AZTA 3CJRA 3MGGA 3E23A 1RJGA 3B3FA 4UOEA 3KQOA 2IPXA 5IKMA 1U2ZA 3HEMA 5EMLA 2OB2A 1SUSA 3FYCA 4C04A 2P7IA 3LCUA 4M38A 1SQFA 5E9WA 5EG5A 1Y8CA 4GOMD 3BT7A 5C1IA 3I58A 5DT2A 3BWYA 2ZIGA 3V97A 4E32A 5GM2A 4GOOD 1KPHA 5DM4A 5DX8A 4EKIA 4QPPA 3P2EA 1AV6A 5EMMA 2BM9A 1RI4A 3OU2A 2HV9A 2OY0A 3P8ZA 4FT4A 3R6TA 8MHTA 1WY7A 3ER8A 2UYOA 4R05A 5HOQA 1QANA 3DTNA 2VDUE 2AVDA 1KYWA 3DMFA 3HVIA 3B7PA 1XTPA 1NT2A 2BR5A 3DUWA 4DM3A 1M6YA 2ONYA 3LGAA 5DTRA 4PNEA 2B2CA 5K0JA 3GRZA 4QTUB 5FQOA 3UJBA 3TQSA 1IY9A 2HNKA 3EEYA 3RIEA 3PVCA 1L1EA 2ZZKA 4FT2A 4KW7A 4OBWA 2O07A 9MHTA 3M6XA 2PGXA 3R24A 3UWPA 4BLUA 3OFJA 4MHTA 4RWZA 3SGLA 2NP7A 3EVDA 2AOTA 3UJ6A 1Q0TA 5D1NA 3E8SA 3KPWA 5DM2A 1JQDA 4E70A 1N2XA 3EVEA 5FQNA 4BLVA 3AWIA 3BKWA 2JJQA 4AX8A 4KDCA 5LR6A 1EAMA 3GRUA 2OBFA 5CUQA 5EMKA 3LBYA 5DSTA 5E9QA 3BWBA 3WSTA 2YUIA 2CMGA 1ZG3A 3TM5A 2GS9A 2ZBRA 3NVMB 3FTFA 3KQWA 4DQ0A 5CVEA 3A4TA 2IDJA 3A7DA 4X61A 3OZRA 3VC2A 2ZFUA 3ER9A 2Z6QA 3A27A 2B3TA 1WXWA 3LSTA 5DTQA 1NBIA 4OQEA 3LDGA 4IKPA 4E2ZA 4PYNA 1V39A 3EEOA 5FTWA 1G6Q1 3FPEA 5F2KA 4QQKA 1EQAA 3G8BA 3T7TA 4RTSA 3KQQA 2ZW9A 1JQEA 5K0GA 3QOXA 3LDFA 3NWEA 3VSEA 3NW9A 1R8XA 1NW3A 3T0IA 1XDSA 2IIPA 5FCDA 2PXXA 2CKDA 4GEKA 4PGHA 3UJ8A 5LQRA 4Y30A 3LL7A 3PT9A 1PRYA 3BWCA 2VP3A 5EKXA 4PYLA 3GIWA 3JWGA 4H0NA 3DMGA 4HGYA 2QRVB 2PWPA 5E1DA 1X19A 3KR1A 3DXYA 5DTMA 4M37A 1JTFA 2PX2A 2G1PA 3FPHA 1L3CA 2YXEA 3FZGA 3EGIA 5T6BA 1JSZA 1RJDA 3UJ9A 4OX9Y 3FPJA 4AZVA 1JG2A 4F86A 4YV1A 3ELYA 3GNLA 5ERGB 5GP1A 3GDHA 5CVVA 2JHAA 2I7CA 1TW3A 4FSDA 5FULA 4C4AA 2ZCJA 4CXMA 2JG3A 4XUEA 5DPMA 5JR3A 2JH9A 1JQ3A 3BGVA 4RTQA 2BM8A 1SQGA 1EG2A 1YB2A 3IV6A 3KQSA 5EEGA 3HCFA 3UJCA 3OU6A 3VYWA 5DX0A 2H00A 3KQTA 3I5UA 1WZNA 4BP1A 3BZBA 3KR9A 4C05A 1G60A 3B3GA 5LQJA 3TKYA 3AJDA 1NKVA 3NJRA 5BP7A 1I1NA 5K05A 2NXNA 3EGVA 4IV8A 3M6VA 2JHCA 4R6WA 3EGEA 5CCXA 4PYOA 3O4FA 2ZSUA 3PB3A 2V7EA 1SKMA 1JTEA 4RTNA 3GJYA 3LHDA 2YR0A 2FCAA 2YX1A 3KPJA 5HIIA 3KQPA 4PYJA 4HTFB 2G72A 3HCAA 4RX1A 2HTEA 2B9EA 3P9IA 2ZTHA 1ZKDA 10MHA 1BC5A 2AOUB 3G5TA 3SM3A 3VC1A 2OO3A 3M4XA 1IM8A 3SXJA 2C7OA 1EJ0A 1O9HA 3E05A 3K0BA 4FGZA 3P2IA 4PYIA 5KVAA 3OCJA 2UYCA 5FWAA 1D2GA 2EJUA 4LWOA 3ELDA 2R6ZA 2ZULA 3UJAA 3HNRA 1NW6A 2AS0A 3TMAA 1D2CA 2B78A 1SUIA 4E31A 2FYTA 3UJ7A 3UBTA 5ICGA 2K4MA 3R3HA 3G2QA 5BW4A 3FPGA 4HC4A 4AUKA 1VLMA 5K0LA 1KIAA 3H2BA 3OZTA 5E8RA 4K6MA 3G89A 1JG4A 3HA3A 5HZMA 2O0LA 2CMHA 5ICFA 3TFWA 2ZZNA 5G02A 3MCZA 4R8SA 2FK7A 1WS6A 1L9KA 3PLAE 5FADA 5GINE 5FA5A 3FRIA 3KQVA 5K01A 1UIRA 4DZRA 2HR1A 2O05A 3BWMA 3LCVB 3DLIA 4RTLA 1BHJA 1ZGJA 4P58A 2OYRA 4X60A 2ZZMA 3K6RA 2IFTA 2P3QA 3UA3A 4P7GA 5CM2Z 4BP3A 3NMUF 3LKZA 1DCTA 2EX4A 5M5BA 2FHPA 3D2LA 3REOA 2VDWA 4E33A 3KKZA 3HCEA 4HGZA 1WG8A 3FUVA 4LECA 4C06A 5DXJA 4GBED 2BR3A 3C6KA 5DSXA 5P8WA 5HFJA 3LPMA 4YUZA 3G8AA 5F2OA 1XXLA 3MTEA 2BR4A 2F8LA 3I53A 5DLYA 3FTCA 2V74B 4RTKA 4ER3A 4P7FA 1VP9A 2E5WA 1BOOA 1JG3A 3KU1A 4YUXA 3SX0A 3LECA 2GA9A 1NW8A 3ID6C 1ORIA 5HIJA 3UZUA 3ORHA 4BLWA 5FHRA 4X1OA 2PV0A 3KR0A 2P3OA 5FWDA 4LWPA 3DP7A 3HCDA 1MJFA 1P39A 4X41A 2ZBPA 4HRAA 5H02A 3P2KA 4PYKA 4RVFA 3T7RA 4C08A 5GIPE 1AQIA 3FTDA 2GPYA 3I9FA 4ER6A 5DX1A 2C7RA 2P40A 2I62A 2QY6A 3CJQA 3LX6A 2ZVJA 4XCXA 5DM0A 2C7PA 2Y1XA 4X63A 5EHGA 1HMYA 1T43A 2I6GA 2N47A 5C0OE 3UA4A 4EMSA 1M6EX 2CWWA 3O7WA 2CL5A 2DULA 2ZWAA 4ZTBA 3M70A 5KQSA 2O57A 3KPUA 4ATNA 3G2MA 4CTJA 3EMBA 4RTOA 1EJ6A 4FR0A 2Z6UA 3GU3A 3FUUA 2P41A 3P71T 4DA4A 3TM4A 1QZZA 5HEKA 2NXCA 1TPYA 4AZSA 2LD4A 3BUSA 1H1DA 4PINA 5EVJA 1P91A 4YUYA 2ORED 1X1DA 2PX8A 3C3YA 3OPNA 3KR2A 3PFGA 3MQ2A 3S68A 3FRHA 2ZBQA 5E1MA 4DKJA 3BGDA 4ISCA 3IHTA 5CD1A 3GXOA 3CKKA 7MHTA 3HA7A 2PT6A 4EQZA 4PYQA 4RTPA 3M33A 1M0EA 4GOND 3EPPA 1NBHA 1INLA 1SG9A 3IEIA 2PBFA 5EGSA 1KP9A 2YXDA 3CJTA 3G5LA 4RV9A 3MERA 4GOLD 2EG5A 2FK8A 2AOXA 5DRYA 2C7QA 1YF3A 4POOA 3THRA 4GC5A 1VBFA 5K09A 2IGTA 4O29A 4PIMA 3NDIA 4GF5A 3NTVA 2UYQA 1NW5A 3G2OA 4YV2A 3OE4A 3UJDA 1TW2A 5EKUA 4DMGA 3HVKA 4CKEA 3JWIA 4PYMA 4ER5A 3BKXA 5EMJA 3B5IA 2AZTA 2YXLA 2IP2A 3KHKA 3SSOA 1L3BA 1SVUA 1PJZA 3DLCA 2PY6A 4JXJA 3A7EA 5E2BA 2I9KA 2UYHA 1X1CA 4NECA 3ANXA 2IH4A 3T7SA 2NYUA 3E7PA 3PFHA 2GH1A 4XUCA 3LDUA 3HCCA 4DCGA 4YMHA 5BXYA 5K0CA 1YFJA 1XVAA 4OA5A 1XDZA 1VQ1A 1BKYA 1Q0SA 3FPFA 3NDJA 4U7TB 4QDJA 3HTXA 4E2WA 5GWXA 2FPOA 4RYLA 4B17A 1YZ3A 2AOUA 2G70A 4HH4A 3R0QA 3JWHA 3KPYA 4PWYA 4LG1A 1HNNA 4MQ4A 4P7KA 4KWCA 1R18A 4R8RA 5EPEA 4RTRA 1RI1A 1X1AA 1ZGAA 4FS8A 4P7JA 4QPNA 5EC8A 5K0NA 2JHPA 2XYVA 1NE2A 4QVGA 4E30A 2NXJA 3AXTA 3DMHA 5GOZA 3JWJA 3EVBA 4RTMA 2OKCA 3SSNA 3FUTA 1XJ5A 2B25A 5CIYA 4RVGA 4YUWA 4RSRA 5E9JA 3HA5A 1QYRA 3R9XB 3M6WA 5EEHA 2ESRA 2PLWA 5HILA 3SMQA 2P8JA 5E2AA 5D1HA 3B3JA 2G8NA 2QM3A 1ZQ9A 5DWQA 1DL5A 2YTZA 1OR8A 2OZVA 5EZSA 5F2NA 3DR5A 1UFKA 3CCFA 1QAMA 5K0FA 3MHTA 1P1CA 4GUAA 4QQNA 5LQNA 4MIKA 4F84A 1UWVA 1VIDA 2FRXA 1R00A 3C6MA 3DXXA 2PKWA 5T64A 3DULA 4EKGA 2HWKA 2ONZA 3HP7A 2QYOA 4ER7A 1AF7A 2KW5A 3O31A 4PCLA 3KQMA 2AN3A 5ICCA 5E1BA 3OU7A 3TLJA 3IYLW 2XVMA 2QE6A 4KRGA 2IBSA 4U7PB 5K0BA 1RJEA 2P7HA 4KDRA 3G88A 2PX5A 2EJTA 3BGIA 3EVFA 5E1OA 4G56A 5EHIA 5LQAA 2WA2A 2WK1A 2DPMA 3NVKI 3CGGA 3KQYA 2AN4A 2YVLA 1I4WA 3A26A 4MWZA 4RVHA 5FHQA 3HM2A 1AQJA 1XDUA 4R6XA 1VE3A 3GRRA 1YZHA 1VP3A 4KVZA 4L7VA 3X0DA 3ELUA 4PONA 3G7UA 1KPIA 1NV9A 2XYQA 3TKAA 3EVZA 4YMGA 5KQRA 1JSXA 2XYRA 3TRKA 3V8VA 4QVKA 5IH3A 2P1DA 1X1BA 4IWNA 2VS1A 1D2HA 2AN5A 3GRVA 3TR6A 2PJDA 2ZLBA 3A25A 3UFBA 4Y2HA 2AR0A 3LCCA 5FUBA 3I64A 3KPVA 1XCLA 2ZIFA 5MHTA 2IH5A 3GGDA 4GC9A 4KIFA 5EIWA 4EVIA 2NP6A 3SSMA 4CKCA 4RTJA 3HVJA 5FA8A 3P9NA 1O54A 3DXZA 3QV2A 5JUWA 3GRYA 2UZ4A 2PWYA 4M36A 5C9ZA 3GO4A 1MHTA 3P9KA 4PCAA 3AXSA 3ME5A 3THSA 4E2XA 3FUWA 2AOTB 3LBFA 3OZSA 3Q7EA 2AOVA 1FJXA 2H1RA 2AVNA 5LQUA 1WXXA 3PS9A 4QDKA 4PGGA 4WVLA 3NWBA 5LQKA 4F85A 2XBMA 3EVCA 1NV8A 1RI3A 4RVDA 2ZIEA 4QTTB 4A6EA 2R3SA 2PSSA 3RW9A 2PXCA 2QRVA 1ZHFA 2O06A 3GWZA 4Z2YA 4WXHA 3TOSA 1ORHA 3CVOA 4A6DA 1F38A 3P9CA 4OA8A 3U81A 1YFLA 3FUXA 4FP9A 5GM1A 2OXTA 3HCBA 5CCBA 1R6AA 4CTKA 1L3IA 2GB4A 3OE5A 3C3PA 4C07A 3MB5A 4E2YA 1KYZA 4PIPA 5CVJA 2G71A 3EVAA 5DRTA 1KHHA 4OQDA 3BXOA 1FP2A 3F4KA 5EZQA 4YUVA 3MCTA 2VZ9A 3SVZA 2NXEA 1RI5A 4CWAA 1KPGA 5HIMA 5U4XA 2H11A 1Z3CA 2PVCA 1G8AA
chains in the Genus database with same CATH superfamily
2IU3A 2REQB 4Q01A 1H2XA 4HLUC 2FPGB 2HLPA 1PZNA 1F2UA 4LJYA 4RELA 2Y0DA 1ZM2A 1JNXX 5T67A 1NXXA 2C95A 3WRWA 1EUDA 1G8SA 4ON9A 2D7DA 1BWSA 3LH5A 3QE2A 3GH1A 2VNJA 3M6LA 5H3CA 4H1TA 1C1HA 4MH0R 1TM2A 2D6FA 2F3UA 4L15A 2DPXA 4ME6A 5DNEA 4BQIA 3AIKA 4AP5A 5ALPA 1DQNA 2H9AA 2FQ1A 2FN8A 1YMUA 3P97A 4NAHA 2VG8A 1TZKA 1I7PA 4NFLA 4YMVA 4KXQA 1N6NA 2C54A 3KWLA 4U0JA 1JQLB 3O4VA 4RENA 4R1PA 8GPBA 3EG9A 1EXNA 2WWVD 1WDTA 2WV9A 3GEHA 5HWSA 3DTVB 1WRBA 4X1YA 4DF3A 4L16A 1JILA 2V3WA 4NYJR 4R3UC 1SCKA 3OE7D 5MN6A 1FLVA 3TTTA 1V2GA 4LDJA 4OTZA 2Q41A 5FPKA 3GFGA 4AF8A 2BM0A 3Q41A 5C7YA 4ZVTA 5J43A 1I3CA 1V4NA 1WP4A 1WDWB 2QTAA 3DVAB 4P53A 2J0UA 2SICE 3DDWA 1E2GA 3CBGA 4V0RA 4F56A 5BRJA 3AP1A 4GGPA 2D3WA 4OY3A 1VMEA 2HLDA 3I9KA 4HDQB 3H6HA 1EH5A 2O8BA 1YB5A 4CU5A 4UTRA 2X9NA 1Z4PX 2MMGA 4W5QA 4XDGA 3A9VA 4UUQA 2G5GX 5TQ0A 1G8PA 4R1LA 3KJGA 1O4WA 3GN1A 4G84A 4MHSA 3TBKA 4FZVA 5JJIA 2RK6A 3N7AA 3T4UA 1OUMA 1JEDA 4WKNA 4GL4A 2QZSA 4HNSA 1I01A 4DCPA 1Y8RA 4TYYA 3AYXB 1YZKA 4TMWA 3COJA 4YX9A 4MGZR 2QVGA 3D8HA 3HQ4O 1UQUA 4FE7A 2DUNA 4PSUA 4KDEA 1Z0SA 1LV8A 2XOEA 5FV4A 4PLPA 1E3LA 4M7OA 1LVGA 1DEHA 1AXRA 4EWLA 2R96A 1UK9A 2WFAA 3GI1A 2CHUA 3HFJA 3HI6A 2XGSA 1ZC3A 3HSKA 1A04A 4Z1MA 3NRCA 3HKBA 3T15A 1N1EA 1O97D 1AV6A 5BWBA 2ZWIA 4HXGA 1JEJA 1RAAA 1ESMA 1S9DA 3BXPA 3FDIA 4IZOA 3SHTA 1N3LA 2FNAA 2HMVA 4B40A 5HPYB 2YOGA 16PKA 1M2WA 1T4BA 2GN4A 2VDUE 4EKDA 2HQOA 3ZOKA 1UPCA 2R5NA 3HB0A 3W6UA 1VCMA 1IN5A 1AKRA 1MOQA 2QU7A 1UMDA 3A4MA 3HBMA 1VFPA 4JLVA 4NFSA 1AXGA 1PZFA 1UUFA 2PRJA 4PFQA 1B8VA 1SG6A 4QTUB 4KKXB 4LOHA 5AI6A 2X7XA 2HQSA 4QU9A 1YA6A 4LDQA 4AU1A 1WW3A 4HNHA 2NZ8A 3M6FA 4OBWA 3IBYA 5FAKA 5C46F 5E7QA 3UWPA 1JH9A 1ZJ4A 2C8VA 4EJ2A 4MA5A 1BVRA 2V4UA 4G4GA 4TRNA 3G82C 1G2QA 2BLLA 4MJLA 2Z5LA 3F8TA 5FRDA 1DQZA 3G1WA 3MJCA 4U0KA 1YTUA 3C3EA 3MT7A 4P82A 1KI6A 2GN1A 3A06A 1KZ4A 4MEBA 2DUJA 4OI2A 3SXUB 3WSTA 5LR6A 1XHEA 4L73A 5CNIA 3OHSX 3PQ8A 1R8SA 1DVRA 3VISA 4DARA 3A4TA 3ZGYA 3O38A 5EJ4A 2HSGA 2QRLA 2VHUA 3B1YA 4L9RA 3G3EA 1JLRA 3NIGB 4JC4A 3UG7A 3MFDA 3T4EA 1WOYA 4HV4A 5ELMA 2RGUA 2A0FA 3IDOA 4KNWA 1Q17A 4PYNA 2R8ZA 4KJZA 1WB6A 2JLWA 3MJFA 1PR5A 2PH7A 2CCKA 2R751 3G8BA 2PA0A 4BMDA 2F9MA 3BL6A 4KK4A 3QKWA 3A6KA 2C9DA 3H1TA 1K5HA 4OQXA 3WWCA 1NXWA 4M7PA 3IR7A 4NEQA 5DGCA 2IP4A 3AU8A 2WABA 1E8NA 3AHCA 4Z4QA 2CJWA 1BSVA 2PZJA 1DJPA 1B8NA 1DHTA 4NARA 2R62A 1FVXA 1M8FA 4AP9A 3PT9A 1I1HA 3VR4A 4GPZA 2DHRA 3T35A 3JWGA 1GL3A 2O1WA 2POCA 4TQ9A 3GVIA 1M6VB 1KEZA 2DT5A 4CKYA 1XEWY 4JLMA 5IH7A 4NMXB 2VHYA 2P2LA 3UJ9A 3OOYA 4UVHA 2DLNA 3EASA 5GP1A 1EJ2A 1ZD4A 3B9RA 7GPBA 1I94B 2V0NA 4KMOA 2OFPA 2XR1A 1ZLYA 4D8VA 4GXNA 2PN1A 3ZE8A 5JR3A 4KGZA 4RGVA 5LQSA 4D1YA 1T8PA 3I73A 1YB2A 3DT9A 2IZOA 5IT5A 3MJHA 3OU6A 1UOOA 4D3YA 2AFHE 3AFOA 4OCZA 1C9DB 4FMCF 2J6IA 1DAKA 1TX4B 4EG0A 1J8YF 2BSAA 2ORIA 4J03A 2GF9A 2AUMA 2X15A 1TIPA 2HB6A 2ZUBA 3FFAA 3K0SA 4FZRA 4RHCA 1Q20A 1VBNA 1GKLA 4HHEA 5B1EA 5CCXA 2C9OA 5CLHA 1C9KA 1T4CA 3O4FA 3KSBC 4HLCA 1XZPA 5CFMA 3HR4A 2FG6C 4I5FA 3SEZA 3ZS8A 3OCWA 1B2RA 4OI1A 1FMLA 3A3PA 3IQDB 10MHA 2JIOA 3L8CA 3SM3A 1Y1RA 2HSZA 4UPVA 2OQRA 5E6RB 3E9QA 4JQZA 3VDXA 1L4GA 5AI5A 1FFAA 3H9GA 2GBLA 3OCJA 4KQGA 4GG1A 5FWAA 4Q9DA 4WBNF 3PBKA 1XVLA 2Q3HA 3UMVA 2Z08A 3HRIA 3HNRA 4CLOB 5I3ZA 5AJXA 1HDRA 4FDLA 2AF3C 1JLLB 2HLHA 5GOTA 3WAGA 1GUDA 3R41A 3UHJA 3V5NA 2K4MA 1B1CA 3Q98A 2OSVA 2YIVX 4AROA 2B0CA 1UEIA 5FOWA 2H5JA 3L77A 1U2TA 3DQZA 2PKCA 3UMFA 5MFZA 2QTVA 4IIEA 4BMVA 2R8EA 5HZMA 3RIGA 2O0LA 1MP0A 1W73A 2FDRA 3QKIA 4MAFA 1J33A 4C78A 2RBEA 1OA1A 2YJTD 5FADA 4NZNA 4MAMA 4Y6GB 1BCRA 4YQYA 5JT1A 4QBHA 2DTEA 5JYEA 3IELA 3CBQA 4AIIA 6ADHA 2XGJA 4XYBA 1UBUS 4JQOA 1AV7A 2JAQA 1QUEA 1WY5A 2ZIVB 4XGKA 4TRJA 4X60A 3MFQA 3ROZA 4UUOA 2I66A 3RYHA 4UD2A 3V55A 3WLQA 4B0PA 1IY8A 4F2HA 5L3SA 1F60A 1G6KA 2AFIB 4UTVA 3H11B 1WU8A 5IWCA 5M5BA 1GJRA 2RKWA 3OIVA 3TPFA 3WKBA 1BGXT 3A6GA 3KK0A 1N2JA 1Y9JA 5C8YF 1IXYA 1ZGZA 1W6UA 3FIUA 4S24A 5DSXA 3H8WA 5CR9A 3PUYA 5EHXA 5BWOA 2VBIA 1XXLA 2BR4A 2FR0A 3GGJA 3UK0A 3DOOA 5C2JB 2VA9A 4WK4B 1ZIPA 2LWIA 3TX2A 4E7PA 4CDRA 2WF7A 1W88A 3Q3HA 1E1RD 1QHIA 1QRDA 4YGXB 1I3NA 3KR0A 2RKBA 2ZE7A 1DJNA 1V3TA 4IUDS 4CV2A 3KXLA 1V9CA 4WZAE 4BDTA 1PJBA 3WIEA 3U16A 2FB9A 2OBXA 2MINA 1R9GA 3IAS6 4I5IA 4PYKA 4RVFA 4UEKA 5FTNA 4ZO9A 4BUCA 4C08A 3LQYA 4LJ6A 2C3PA 3M89A 4JBGA 2OO7A 2FSUA 3RFVA 4UM9D 1UPAA 2QBYB 1TKRA 3ZOZA 2FXIA 4BO4A 2O0HA 1GDHA 1KY5A 3KXIA 3G0BA 2DPGA 3PC4A 1NYRA 4AKTA 4LYHA 1R9JA 4I4TB 2IBMA 2M32A 4LRSB 2J4CA 1RWBA 4PEVA 3TSZA 4FNGA 1ZW6A 2HMWA 3PT5A 4F0JA 3QX3A 1B43A 1YVUA 4MX8A 1BMDA 2NXCA 4PFJA 2ZIUB 3ZGXA 1M1ZA 1NDHA 4A4DA 4PINA 5CFPA 5GVRA 4YUYA 1J56A 3B9QA 5BV2P 1N2GA 1WHTB 1JHYA 2AQKA 4EF6A 3G2IA 4UU7A 4IBOA 3WOHA 2W6ID 1A4UA 3HA7A 5B3LA 5IT0A 2PFSA 3QMPA 2GPWA 4IDCA 4XA8A 1NBHA 4K40A 4LJRA 5EAIA 3I8OA 1RQ2A 2D4AA 3KLNA 3A0UA 5JNVA 3WV5A 4P3YA 1YF3A 1K66A 2G04A 3JVDA 5TEVA 4AN0A 1B0PA 3IEPA 3Q12A 4Z4CA 2UUAB 3NUGA 1SUBA 3AF4A 1P81A 1X15A 3OAAA 1SZPA 2DH6A 2IYVA 2CXSA 2W6QA 3EUEA 5EVCA 2QD4A 3MPUA 1GTG1 1NIPA 4MRPA 4CG0A 2BGNA 2JIQA 3JWIA 2LRHA 1TGVA 2C3YA 3Q7TA 2AZTA 3KHUA 4D81A 1D4FA 3DVAA 1IMJA 1CR1A 3DLCA 2J41A 4F2DA 2XB4A 1G21B 5TMBA 4B3JA 5LD2B 4FE4A 2J30A 2ZUVA 3CMCO 4JITA 2VDLB 2EJCA 1ZHHA 3I2FA 2R1UA 3I1FA 4JJGA 1BKYA 3CUUA 2ON6A 3WP0A 3HTXA 1GPLA 3TMYA 3GBSA 4EB8A 2B8NA 3QEOA 1US8B 2PMKA 5FA6A 5K45A 3FFXA 5A4DA 2Y6UA 2X3FA 1GD1O 1NU8A 1K3UB 3OOJA 1QWOA 2B4AA 4FS8A 4WOJA 3O4IA 1BEUB 5EC8A 1P5ZB 2Z5GA 4BLOA 4D6YA 1TM5E 1YGPA 2ZBUA 4MVJE 3DQQA 4X7RA 4NCAA 5EERA 4QJIA 1DV2A 3IAS1 4OMCA 4P08A 4N54A 5DCWA 4RY2A 4IXWA 4PNHA 3DBOB 3VDQA 4RVGA 4R2XA 5A9SA 4W8HA 4RSRA 1NX9A 4KLRA 3U3ZA 2ZJZA 5JLJA 4OQNA 4PLYA 3WQQA 5HJ5A 5K0TA 3TECE 3LMKA 1XWIA 1Y4SA 3GLGE 2YFHA 3L1IA 4CT0A 3THWB 1VRVA 3JRNA 3UFXB 3MTQA 4C4PA 1CUVA 3I5MA 4QD3A 5K0FA 1B0ZA 2C97A 3V8PA 2IOFA 2P9ZA 4B82A 3UPUA 1R8QA 3QUBA 2PZBA 1HE4A 5IAKA 2HJHA 4DWOA 2IIVA 3QEAZ 4JJKA 2IA5A 2HWKA 4AJKA 1Z5ZA 2VL7A 1WBDA 1P0FA 3ZNNA 4FDAA 3PGVA 1NHWA 4O4LB 4P7BA 4JD5A 4H27A 5E1BA 3TLJA 3UH0A 3VU3A 1X9HA 2J7KA 3BTVA 5JPIA 1RJEA 5GTDA 1E58A 3N2IA 1DXOA 3SYRA 2PO5A 3A6JA 3HCWA 2ERXA 3ZU5A 5AKJA 1R3UA 4Q66C 3FBTA 2FI1A 2W2MA 1MBZA 1QP8A 1U2SA 4B2IA 2DBQA 3OLWA 2Q1YA 3EUFA 3GRRA 4DB2A 3NOXA 1YB7A 5EWLB 1BAPA 4GU5A 3RRYA 3STVA 5TVGA 1XX6A 1Z6PA 1ACMA 3G7UA 4KTVE 1YJXA 2WIFA 4LCEA 4TYQA 1NOKA 3SXUA 3ZIAA 5LKAA 1HDXA 2XQKA 3BYZA 4QO8A 5G1NA 4DIOA 1OXSC 2XYRA 3WLIA 2C94A 1MX1A 4LBZA 3TSYA 1X1BA 1E0KA 2IS1A 1OZAA 1RP7A 4YLGA 2VYQA 4LZNA 2AN5A 3NAZA 3C4JA 4X93A 2OBLA 1JMVA 4K9DA 1CQZA 4IFEA 4KN6A 4LQLA 4TV9B 5AK3A 2QQ5A 2GAAA 3PUZA 4HWOA 1DRUA 1YRHA 1OW3B 1OT3A 2Y05A 3GPDG 4RF2A 3I09A 2VF2A 4D4JA 4KLZA 4Q82A 4M9CA 4WCVA 1E4OA 4DYDA 5P21A 5HJ7A 2Z2YA 2UZ4A 2ENWA 3AVQA 4F1JA 3OEHA 3QUAA 2Y2VA 4GEGA 4C2TA 3CWCA 1FTNA 4ZJUA 1MGOA 3AL3A 1UBLS 4RMJA 2YRWA 4IRXA 2YC2C 2UU9B 4FXPA 2AVNA 3F7OA 4DJEC 2FPKA 2EF0A 2I4NA 2X2FA 3EIWA 3PJGA 2ZRPA 5CK4A 4ZRDA 5EA2A 1IBKB 1KY3A 3S2YA 2ASVA 3WGLA 3ZV4A 1FDSA 3CEJA 2BBSA 2NWQA 1P31A 5AICA 3ND7A 2H48A 1VIAA 3JQRA 2YS7A 4J1SA 1ZOOA 1J8VA 1T2UA 2CLDX 2ZPTX 3AY6A 1M6VA 3ZHUA 4DHEA 3VJRA 2A0UA 1Y5MA 1WXFA 4X7MA 4YS6A 4D4GA 4ZJZA 3V2HA 1DG9A 4O5OA 3ZBUA 3SFZA 1PS0A 1SKAA 1L5FA 2WWGA 3NWOA 4EQ6A 3A70A 1ZBQA 3HDQA 3TI9A 3RS5A 4PSVA 2FPIB 3QFHA 4NMLA 4MV0A 2G5CA 1R7RA 4FD2A 2K6GA 1I8TA 3D6VA 4X7BA 1E2JA 1K06A 1G5RA 1UFQA 4LZJA 4H1WA 1X7HA 5CB8A 1YHYA 1Q83A 3AWDA 3DF9A 4QELA 4WA7A 3RS9A 4BE9A 4YTEA 1NPYA 1XZGA 1XNGA 1YS9A 3G1TA 1E3TA 3BSWA 1C3VA 3OOHA 1FSFA 5G41A 4MUGA 1DEXA 2BV3A 1AHNA 3AJEA 2HMYB 2H0RA 3W9BA 2W2LA 4AUEA 5C32A 5IJ0A 3MUOA 1Z2NX 3MT9A 2P0YA 5BN3B 1FRZA 3MA0A 2JPDA 5BW5A 2MSNA 1FLAA 1A7JA 1U2PA 4UU1A 2PWZA 3EVTA 3LPCA 4ZI7F 3RJMA 5DEOA 4FS3A 2M9MA 3OFVA 4MVWA 2VDRB 5CB4A 2ZRGA 5AWFC 5ALOA 1JN0A 1LCIA 2QV7A 4UMEA 4OHUA 1ZQ1A 3GR6A 1P9RA 1PT8A 4KLAA 3DOJA 5FTMA 3WFJA 2IHBA 4B4WA 3U7EB 3ET5A 4NY1A 1QAQA 3KKEA 3JZAA 5IT9A 2F1KA 5K8VA 1PR9A 3CRQA 4HPXB 1ZK0A 5AKGA 1FS4A 4YVFA 4XTCS 3S0JA 3LKDA 1O8BA 1Q2XA 4QFCA 4J0JA 1JG7A 4KAJA 3HB7A 4I9NA 1YUBA 4EY4A 4YCCA 4IDBA 3SXPA 3ELWA 5A5GA 4CLOA 3HJCA 1P3JA 2UXBB 4OPMA 4PZPA 1JLLA 2DUWA 2FN4A 1XLTC 4UBKA 1PL6A 1H2EA 1DX9A 2RAVA 2Y0PA 3RJZA 3REQA 5I7UA 2Y1WA 3NP9A 5LDDC 4D02A 1VKHA 1PQYA 5ITSA 3N0RA 1LKZA 4XFKA 1A5AB 4IX1A 1Z18A 3CU5A 3RAFC 1XNHA 3VZQA 1AF4A 1PR0A 2NTNA 4OYRA 3RRNA 5CXUA 3T3PB 5CFNA 3NATA 4YCLA 1PGOA 3C0KA 5CDSA 1HH4A 2YQZA 5CPFA 4BJ1A 5BNZA 3IUMA 1C4XA 1HF3A 2CUNA 4XPIB 1CR2A 2OORA 4J7AA 2RHMA 3V48A 4D2IA 2XNJA 1E2UA 5JAQA 3T34A 2CVQA 2AFIA 2C2YA 2FRDA 3WA6A 3BJIC 5IKMA 5JSQA 2OVBA 3NBQA 4M22A 1E3EA 3WLNA 2O2CA 3L0IB 1UWLA 4JLPA 4JP3A 1IK6A 2D00A 3Q7RA 5E7MA 1Y9EA 4HAWA 4FMCB 5IK2D 5CFZA 1I3LA 2R6JA 1U2GC 1FUKA 4WUTA 3ZDQA 4E7OA 1QQAA 3HACA 4WZAA 3UN1A 3B3QA 2IHUA 3ETHA 1Z6ZA 4EAAA 4GYWA 3ZCXA 1M2HA 4EW1A 3L8FA 4QQ8A 5ANRB 1OGIA 3FWZA 4JP2A 4M6WA 5DO9A 1LD3A 4ZCIA 1GPDG 2VRWA 3V7WA 2JLXA 3K6SA 1DNPA 1Z5GA 4XDHA 5AXDA 3STUA 4IDAA 2PUFA 2VF8A 3EIEA 1KYWA 1J2YA 1VHDA 5AJZA 5I8ZA 3UMCA 4O2BA 5I4KA 1BJRE 2VJQA 1NOIA 4RO0A 5JSZB 5DWDA 1XI2A 4H6PA 4PLZA 4RD3A 3G9ZA 4RCVA 2QBYA 1IY9A 1OFIA 2PUEA 1VXOA 3T3DA 4LF8B 1JSLA 2IYYA 2D8MA 4WA8A 4ND2A 3M6XA 2IE8A 2WD7A 3NLLA 3QI2A 4W9NC 4L9SA 4WBNB 1KVQA 2AX4A 4ZKDA 4QIHA 3F46A 3IQIX 4JR0A 3FUCA 2AWOA 3U37A 1YZFA 3D2BA 2FVYA 4L95C 1V8BA 4BCBA 3QWFA 2GX6A 3ZFNA 2I2XB 3PQ4A 3L04A 5K3DA 4X44A 4DYVA 1H4SA 3GLVA 3PDCA 3FVQA 4W82A 2WYIA 4I4NA 1Z6XA 4FYPA 1VE9A 1WHTA 4ZO6A 1L5MA 4QHSA 2Y9PB 4ZT5A 2IGBA 2E5LB 1LFAA 3COPA 9ABPA 5LM3A 4BNXA 3A27A 3QIVA 4R71A 1P2VA 1U4OA 3D8TA 2Q9BA 2YIJA 2G1KA 4TTJA 4OQEA 1KGSA 2Y92A 4JBXA 1Q5PA 1VYHA 2HSEA 5CU7A 1G8HA 1W36C 6CHYA 2C1XA 1C9YA 3EY9A 4ZKEA 4DIBA 3LKVA 4R3NA 5JAIA 5JC1A 2O2EA 2XCOA 4IIYA 4QQKA 5EKTA 5HCIA 2Y4NA 5BQ3A 2CFIA 1TL7C 1DKPA 2Z9BA 2IYSA 1WEHA 5B2ZA 3I8XA 5TQ2A 2OQ2A 1L7BA 1ADCA 1A72A 1BWPA 3L02A 2JIMA 2JBAA 5AKEA 4HFNA 4AMZA 3PSAA 2IXTA 4LFCB 2C20A 2ZSEA 2YWHA 2PX0A 4UJ3A 3CCCA 2Q1UA 2ZRAA 5G1OA 1UK7A 3LZCA 4PZAA 3QI7A 5C53B 3DQPA 1PNQA 2OBYA 5EE5B 5HQTA 4YDSA 1T8UA 2G1AA 1EUCA 3CF4A 4HYQA 4M1TA 4UAGA 3F4BA 4IJUA 1L3CA 3BHMA 1M2OB 1JSZA 3WGGA 3WRXC 3FLBA 4EY8A 1I6MA 4BNVA 2B3DA 2VBCA 1L9XA 2PXHA 3W2IA 1GWNA 4EZBA 1RBQA 5I7VA 3AINA 3DWEX 2EFHB 4OEHA 1CZKA 3JXEA 3GRFA 1YD7A 2VHXA 4YRQA 4GQIA 4EZEA 3AUJB 4G09A 1AQUA 2AKAB 3LOPA 1P1RA 3NTOA 3SZ3A 2A4KA 2C42A 2WVHA 5TPWA 1LDEA 3HCFA 2FWPA 3ED1A 4YT2A 3RFUA 4R51A 2YBDA 2A35A 2WHYA 2JK0A 3EWNA 3KQTA 3AB7A 4QUAA 1Q0PA 2BELA 1L5KA 3PNYA 3EE6A 4QOIA 4YP1A 2ZT5A 4DSZA 3OVMA 1NW9B 1WDLA 4M8SA 3KT6A 4FYWA 3NFYA 1QO0A 2O23A 2FFQA 2IKQA 5JS2A 3UBMA 2QX9A 4MI1A 3UK7A 3ZI4A 1TJ4A 4NK5A 4RKWA 1X80B 1ZJ5A 2ZSUA 3H05A 3TB6A 4EGSA 3DZ8A 2P1RA 3NIBA 5LU9A 1ZMBA 1Y4AE 1QIIA 4NATA 4HTFB 4FYMA 3S40A 1KOLA 1ZKDA 3I52A 1DMSA 2QVLA 3OIUA 2QA5A 3AK4A 3ANNA 1QDEA 1G5QA 1EJ0A 3WFIA 2J3IA 1UEXC 4PYIA 4S05A 3E1KA 4Q37A 4W7IA 4LVOA 1P0IA 2NO6A 3N2KA 3NGLA 4E13A 1W29A 2FGKA 3RDPA 3DE0X 2JL1A 1N0UA 4LHWA 3CLKA 4ZCMA 4DMHA 3R8XA 4BS9A 4KWIA 2LKDA 2B78A 3ZE9A 3LT0A 5JNWA 1WB5A 4Q3DA 2VIIA 3OPYI 4MOWA 5FWYB 5CDHA 1A88A 1YZVA 1ZH6A 2NUPA 1ZGCA 5EWLA 3PPYA 3FPGA 1IBLB 2I76A 4IJMA 1FDWA 5JMPA 4G0NA 2GZRA 4EMUA 3H97A 5BN1A 2VZEA 4QVIA 4BFXA 1RXVA 2YYZA 5ICFA 2D5AA 2O2ZA 2EFYA 3HO6A 4PR0A 3RGGA 4PG6A 4X54A 2YQ4A 1YFZA 3H83A 1QWSA 4UBMA 4D42A 1BHJA 1I6LA 1GGVA 3TZCA 3THXB 2CNBA 3A58B 4DQXA 1FJGB 3K6RA 3NMUF 4DREA 3UAXA 3AVOA 2PBLA 2O14A 4BO9A 1D8AA 1KZ9A 3TCXB 4E33A 2VDWA 4AG5A 3NOVA 1ANKA 4BO2A 1WG8A 3FUVA 5A6VA 1IULA 3F98A 3GRAA 3O1LA 3BEDA 1P7WA 2OO5A 3DL0A 4GMKA 5DXJA 5P8WA 2V03A 5FWXB 3ZWXA 3IERA 5IBPA 2DKNA 2ZYGA 1RJ9B 4ALKA 1XLVA 5TC4A 5ALFA 3GAZA 3LL4A 4YJGA 3AERA 4A03A 4YPVA 1QIEA 4DLWA 3LDAA 1ORIA 1E9CA 1PL0A 3RYFB 2F8MA 3IPYA 3V1TC 2AD5A 3R4VA 1Q3HA 3MXOA 4FZ3A 5H3LA 3MQ4A 4ILKA 5HKBA 1H9AA 5D3KA 4HS9A 1JBEA 2PEZA 4B76A 1Y34E 3PA8A 2GPYA 3EXEB 3K31A 1YFKA 3KU4A 4ND3A 1KDTA 3AEKB 3L8GA 2YVQA 3FCSB 2C7RA 1PYGA 4CV0A 3LQQA 3QKTA 2ZETA 2FPIA 1A82A 3D8UA 4D74A 3C3BA 3U62A 5DM0A 5CH8A 5A4KA 2HU2A 1ZN9A 2R25B 2N47A 1TF7A 1BIFA 3U13A 3ZDAA 4KN5A 4N47A 3TGLA 1W48A 2ROQA 3BAZA 4E22A 2RH9B 4KPEC 3NHKA 3NM4A 3SOZA 2B1GA 3SJBA 1XEFA 3Q3IA 4X3CA 4RTOA 3FTNA 1C1YA 2O6LA 4B35A 4PYRA 2R1VB 3NONA 1BO6A 3PXXA 4R83A 3VPDA 2B8JA 5BUZA 2QUKA 3BUSA 2Y27A 4OHPA 1P91A 3E3NA 5JBNA 2CXRA 3VPSA 3W7AA 2QLLA 2CVPA 5TJHA 2JAUA 2H2HA 2PQMA 3R9IA 4Y6QA 3H5TA 4DKJA 1X9IA 621PA 2R8RA 3L7JA 3O94A 3W1WA 1WSAA 4RTPA 3M33A 4GOND 1T2NA 3WJAA 3QKUA 2VPXA 2E21A 2VRCD 2FVXA 2FFRA 2YJ3A 1FUYB 1N25A 3JQBC 4LSWA 1KP9A 3G5LA 3MMSA 4PAQA 2MHCA 4PX3A 5EXDA 5HS6A 3VYRB 3TOCA 4QJ4A 3PE3A 4BPBA 5A6SB 5FD8A 4KI7A 2ODAA 1KS2A 3ZY6A 4MGKR 4YAUA 2IS4A 4R84A 3D9QX 4BBAA 3SS8A 3LWBA 2EZ9A 1RJWA 3BM5A 4J3JA 4RY9A 1U2EA 3M1YA 4AN1A 2IDMA 2QQGA 1QK3A 4NI5A 1E4EA 4F4CA 3N28A 1UJNA 3CURA 1K8ZB 4CKEA 5JBIA 4IUYA 5CT8A 1R15A 4ITUA 3EXIB 3MIZA 4E1AA 4YH1A 4KQ2A 3BCUA 4CVNA 2LCFA 2ZREA 1U98A 2J3DA 3TZKA 3RWMB 1M0SA 3IXQA 1EX7A 1G1MA 1QHEA 5DI3B 4MWOA 5FBZA 4DNXA 1HDEA 5B1HA 2EKDA 4YHBA 1I33A 1E2EA 1I80A 3F3YA 4B17A 5C7LO 4IDPA 3TQHA 4ZANA 1L0BA 2P8SA 2QR3A 2XTJA 5G2OA 3UMBA 1PW5A 1H3EA 1NI4B 4LG1A 4A8JA 4EPTA 4F98A 3EDOA 5EPEA 3LX4A 4CFYA 3BH6A 4QPNA 3AF0A 1AZSC 1YE5A 5DTJA 4ZD6A 5IMBA 1A5TA 4UTOA 3S6JA 4BFZA 2DOKA 1YIDA 3FRJA 2X7HA 3A4IA 3NR2A 4AO6A 1EP2B 1XTIA 2XIJA 3GZNA 4QGGA 3OP4A 4O5AA 1R64A 4TQAA 1V25A 3IAEA 5D5HA 4KE9A 2QR2A 4C4TA 1V5FA 2Y3IA 2IC5A 2XQGA 3ZK8A 5LYYA 1NXSA 1QTNA 2VUSA 3LK7A 3ONWA 2PZ8A 3IOBA 4HOYA 3VH1A 4GMHA 2R86A 4LC9A 4XSVA 3KVVA 3USZA 3CNOA 1P45A 1J0AA 2MT9A 4LDZA 1CUXA 3IVRA 4HLQB 4RZIA 4P54A 3ICOA 2VP2A 1HT3A 4UNIA 5SYNA 1C80A 1VIDA 4GLJA 5TRTA 4NS4A 5GMOA 4LUCA 5DK6A 4B3HA 1DIBA 3TS1A 3INNA 4C6TB 1Z7YA 2W83A 1TYDE 3ESRA 1FNDA 1MAWA 1MGPA 3Q7IA 4HX5A 4MP8A 1I13A 2P9BA 5JSZA 2EW8A 4N82A 1MH9A 3RIYA 1JIUA 3MPOA 4REQA 1SEPA 1YTLA 4OMDA 4RVSA 1U0OC 4FGWA 5CLGA 2JIZD 2GPSA 2HA2A 3OECA 4IJWA 4KQKA 3EZXA 4UZSA 1TKCA 2A6PA 2CEKA 3I8SA 3PV0A 4RHEA 3RO7A 1MFPA 3OY7A 5J2TF 4WBNA 4GVLA 1DCFA 1UPXA 4MVXA 4XIGS 1G7SA 1E1KA 2YVLA 4UAJA 3U17A 4DCUA 3SQWA 3EF0A 2YINC 1V0JA 3EQ2A 3R9WA 1G8YA 2G8LA 1K68A 4GSLA 1T10A 4PRLA 5D6NA 3OHPA 3DLAA 4JCCA 4L0CA 4DCJA 3CLVA 5BORA 1ESZA 3FNBA 5IBQA 4BKMA 1XA0A 3QPWA 5M34A 1E9DA 2CVZA 2E48A 2HK6A 2P1DA 5HA5A 4P5EA 3HFRA 3O8DA 1ILEA 2R48A 2EJVA 2QRHA 4OKIA 2ZLBA 2RGCA 2YUTA 3L0SA 3LUKA 4OUDB 4RFLA 1JHOA 4BNMA 5JXGA 1X70A 2EP8A 4EFKA 1T9GS 2IH5A 3DDZX 2XPCA 4WCDA 1P3DA 4CMKA 3A1EA 1YMVA 2HD4A 1EWRA 1DCKA 1L5SA 3ZW7A 2XNDD 3CLHA 2FSIA 2IHNA 3NBZC 3AXSA 3CE9A 3SLGA 3ME5A 4FXOA 3EISA 5C8YA 2I87A 5A7GA 3Q7EA 1N5JA 3ASYA 2H1RA 2V58A 3KXKA 4XVQA 1Y3FE 1T3TA 4Q0MA 5DHTA 1MB2A 1NVTA 4MULA 4F2PA 2HWWA 4RK1A 3RSSA 2QM8A 4OH1A 1M8JA 3R0VA 4KH0A 1AKUA 1DBIA 3KOYA 5I7AA 2IPLA 4KXMA 5G53C 3TRFA 1SBHA 2YV5A 2AUTA 1Z62A 3TXAA 2WWFA 3JARB 1C41A 3S81A 4C76A 1WEKA 3FAZA 3JPYA 2YHIB 3M3PA 3RRZA 2HXSA 1E2FA 2VO1A 3MS7A 5IMSA 3D3EA 1D07A 4H9GA 3CRRA 5L3RA 4DV7B 9GPBA 3LC7O 1QQ5A 4DW8A 4J7XA 1SJ9A 1EK1A 3BERA 4BJ5A 2B61A 3K0AA 1A3CA 3QWAA 3EC7A 5AR1A 3MJVA 4D6PA 3IHWA 2R8XA 1QF7A 1Z6QA 1JAXA 2CLSA 2CW5A 5CH5A 1VC2A 4KUEA 3MUNA 4FFPA 5LP1A 3NC0C 3GA0A 1LNZA 4L74A 3S70A 4J43A 4QG7A 5J4KA 4I50F 3OPXA 4Z99A 2LUOA 3FYUA 3PX2A 1TUEA 2P2CA 3AIOA 3ZWNA 2FMKA 2ERCA 2KYRA 4HWKA 3QBTA 4L8VA 3V00A 1SA0A 4EKYA 3VA7A 5K8IA 1SCUB 121PA 3MLBA 3RBVA 2ADMA 2X5JO 4A5OA 1MW9X 3AW8A 1I6KA 3CR7A 4FQ8A 4K8OA 2IQIA 3FDZB 4NJMB 4RPJA 3RSFA 1USKA 3DE7X 3LNCA 3WAJA 4IY1A 4OH7A 4HTFA 1XMXA 1QIKA 1CP3A 4G1CA 2CF6A 4NIMA 5D5PA 5KNLA 1S3FA 4AWXA 3W1VA 4RJJA 5B2FA 1YRLA 1TIKA 3GAAA 4IMIB 3V8NA 2JGAA 4S0ZA 3WNZA 2JGDB 2QZ4A 3M81A 3MJEA 4A2CA 2JA2A 3S1AA 2LGJA 4MP6A 3U0BA 4G01B 3BL5A 1ST2A 2IUTA 3J80A 2J32A 4QASA 3CB2A 3WGNA 1DAOA 1OQAA 3MN1A 2CE7A 1ZL0A 4R9SA 2ZTVA 1E66A 1LDNA 1MHPA 2P0AA 3KSZO 1EGHA 2C31A 2Q3DA 4JBIA 3T9DA 4DCTA 2FMXA 2H0QA 3EZ6A 3ZE2B 3LO5A 1NJ6A 4QYIB 1GU1A 2W48A 4TLCA 4X97A 5AJVB 2NU6A 3R75A 4L0MA 3IJRA 1QGZA 3K30A 7REQB 5CJPA 4X64B 1A8IA 5JJLA 3FB4A 2Z6AA 5HS4A 2I6SA 1K7EB 1B6RA 5JYCA 4EI7A 1WKVA 3WK8A 3EXHA 5C1DA 4LDPA 4MMXB 2HF2A 1YHZA 2VZ0A 4C4YA 1DFHA 4HGRA 1RQNA 4OXXA 2G40A 2KJQA 1NTOA 3OOSA 4H31A 5T4BA 4BZQA 3A1CA 1EIWA 1H0KA 3EIUA 2OCLA 3HWRA 1IHUA 3CT6A 1TYAE 5H82A 1MQAA 1SBTA 3EQ8A 1SUSA 5TV2A 2P7IA 1QCCA 1ZSNA 5EMNA 1P4HA 1SQFA 5EG5A 5FWXA 1Y8CA 2ZQZA 1QR2A 3N5CA 4IKEA 4UFPA 4OQZA 3VFDA 3RSLA 5JZVA 1PNRA 1RJ9A 2FE1A 4REMA 1XK6A 5TE9A 3T6KA 3USCS 3WHLA 3WYAA 1SCQA 2IXBA 1QRAA 4Q5IA 3ZWKA 1XJQA 3R3XA 1A2KC 3GJXC 1BCSB 3D5QA 1DRKA 4RABA 1LC3A 3V8BA 4ZOLF 4DDVA 1HG1A 2HL6A 3F49S 2PDAA 4MB0A 3SHWA 1G3RA 1QANA 2AVDA 3ZZUA 1KP2A 2CNKA 4LBVA 4M98A 5KOIA 1LNSA 2VT3A 4UE2A 3O74A 2H4YA 4XM0A 2B2CA 4JU9A 2QE7D 3ZCVA 1YASA 3CHYA 1JJVA 3KB2A 4V38A 4B32A 5EI5A 5K3SA 1Z88A 2ZZKA 3K1ZA 3TVTA 4AJ9A 3VH4A 1NE7A 1CUEA 1W4CA 1XDBA 5EWJA 3SQNA 3NZEA 4MUHA 3T9FA 3ZLVA 3CKYA 4CM8B 5IBCA 4R1UA 1H6AA 2R1VA 3GBVA 1V9SA 3TW8B 3HS3A 4FSHA 4JXKA 1V26A 1FW8A 1Z8DA 4JKYA 4A1FA 3GY0A 3VAAA 2HJ9A 3FTFA 4KMMA 1RLMA 4RM3A 4M8IA 1QLWA 1YUMA 3A6LA 1NBMA 3A7DA 3IPAA 4R8MA 1AMOA 4CHTA 4AS1A 2VOJA 2HZ7A 3E5MA 3TGWA 4J0QA 1K0UA 4BRZA 5ALKA 1HDCA 3HHEA 1ISIA 1B8OA 1JEEA 1EGAA 3IALA 1FLNA 3AHGA 1I6WA 1J20A 4G1EB 5CH3A 3VR6A 1DCMA 4R7GA 5CYFA 4A2WA 3B5JA 2CL0X 4X5OA 4A91A 5B7GA 3AUXA 1Z35A 2D2FA 1AS3A 2SHKA 1OWLA 1NLYA 2Z83A 2WG1A 4TKZA 1WKCA 4YBRA 1T6NA 4GP7A 3PUKA 4JT9A 3FOWA 1DS6A 4LHYA 1JJAA 3OZDA 4TKUB 3ZUGA 3Q5EA 4W5RA 4PGHA 4QLAA 2CXTA 1KI8A 1P18A 2HO4A 1CIVA 3TLAA 4GE3A 4IGEA 4MPPA 1PI3A 4URFA 4E14A 1T9GR 1ESDA 3AG5A 1XL0A 4H0NA 2QRVB 3HV2A 3K53A 4RMGA 1HYEA 1TK2A 3WL8A 4WFQA 2FXVA 4TLMB 5DI3A 2EYQA 4LZOA 4Y2TA 1P77A 5A7FA 2XUKA 2CFOA 1EX1A 1MJGM 2I33A 2JHFA 3GW8A 3SQMA 2CLMB 1NPTO 1BX1A 3II6X 3ZU6A 1FYXA 2ZTMA 2RH5A 4FSDA 4WNYA 4BX0A 1Y6RA 2JKZA 1HTTA 4XUEA 2CBGA 3MJDA 4G5HA 1DV1A 2TMYA 5EKDA 1ZM9A 3IKVA 3ZDRA 5ILOA 3EGXB 4HLUA 5B1DA 4HX9A 4AECA 1BU8A 3E4DA 3ZZ1A 3WB9A 3WGKA 5AVSA 2CXPA 4NNPA 1IZYA 4H18A 4QSMA 1X77A 1IY0A 5JJBA 5EJ7A 2P5YA 4NG5A 3SIXA 4Q9AA 4QYXA 3VNAA 2ZTLA 4DMKA 5LOVB 1MOZA 4MWSA 2OG2A 2WFMA 1XMQB 2XCIA 2XZPA 5GV8A 1AZLA 3UYKA 4CQLB 1WD5A 4PYOA 3VDMA 2GD1O 2NUBA 4DDTA 5CIWA 3OPVA 2VT7A 5CM8B 3CX6A 3SYMA 1GGFA 3ECAA 4ZI7A 4B5KA 3DFZA 3BPSA 1BN6A 1G8FA 1QQBA 1J06A 2GERA 4DOMA 3EAQA 2ZTHA 3QELB 2ZS9A 4OP2A 1J8DA 3RIMA 3VC1A 3UICA 3W6OA 4KQCA 1N9ZA 2NV6A 1ZK2A 1YIAA 3W90A 1EVEA 3EWIA 1W47A 4KXUA 1ZN7A 1P1KA 2VWQA 3OD1A 1RACA 3OPYB 1NRXA 2NQ8A 4IFIA 4JB0A 2R6ZA 2ZULA 3E7WA 1Z7EA 2K87A 1GFSA 3M1IA 4EP1A 4HF7A 1D2CA 4L4YA 3TJRA 3UBTA 1KSHA 2VJAA 2SNIE 3SC6A 4A23A 2YVAA 4D4LA 3EGDB 3MWFA 2I4LA 4UVIA 2PTGA 1RE0A 2EOAA 3JQAD 3QVXA 3V4ZA 2R0QC 1JWLA 1ZHOA 3FPCA 5I8PA 3WE7A 5ER9A 2LPMA 1Z2OX 3IIMA 3OZIA 4LZLA 4MQLA 3T41A 2J9FA 3MBIA 2G7ZA 1BJTA 2ZZNA 3DT6A 1NTRA 5TT1A 1QVZA 3GOQA 3L7DA 1QOPB 4R3WA 1A95A 1MXFA 4R8SA 3SX2A 3FRIA 1TCCA 1MCZA 4QXOA 1MC8A 1XMJA 1S1MA 1AURA 3AF3A 3OBBA 2P3QA 4DY4A 1E9VA 1NY6A 1UR5A 5F4ZA 1GQQA 5EMHA 2YNMA 2X0FA 3KSAC 4ZOAA 3VTAA 2WJVA 1NU6A 1YOVA 4R1MA 3QOYA 5IHPA 2AMVA 3D1JA 2EU8A 1GYPA 3OETA 4G0ZA 1I3OA 2F8LA 3MTEA 2O7NA 4J07A 5DLYA 1JFTA 2WQ6A 3P27A 3RSOA 4KPYA 4CMIB 1GV0A 4QBGB 1DAGA 1U9YA 1ENOA 2I78A 1K2WA 3FPAA 3LECA 1NW8A 3SJZA 3QYPA 5DFAA 3T3MB 1W85A 4RHFA 5A71A 3Q7SA 4LPSA 5FO1A 3L4SO 4LWPA 3L0OA 5A3JA 1Q91A 3JARA 1U8EA 4AP6A 2DETA 3M3HA 3LP6A 1T8TA 1CLEA 3T7RA 1H2BA 1IAQA 4N0PA 4V0LA 1AQIA 1UAGA 3I0MA 1I4DD 1YRWA 2IYFA 3FI0A 4RK7A 1PHRA 2WZBA 4ZAVA 4ER6A 3K1JA 1BROA 2CYAA 1LEHA 3SJUA 4OREX 3OJFA 1WXHA 1YS7A 3AV3A 4LRQA 4LYGA 3WGYA 2YW2A 1DDGA 3AR4A 4P1ZA 3DMRA 1BTOA 4TOIA 2C7PA 1IZ8A 3Q0TA 1SUCA 1KP3A 4H3VA 1KC1A 2XODA 4Z9BA 2B92A 1BEEA 2HFKA 1O94D 3F6CA 2P9GA 3PD1A 3QU4A 4PCVA 5C80A 3S5UA 1WNFA 3KPUA 3KYJB 4UQLA 2WU3A 4ITVA 4FR0A 1CP2A 4OLBA 3K2BA 2C5AA 3JQQA 1EM8B 4AZSA 4D99A 2IT1A 5JCOC 1LWOA 2MYPA 1NURA 3VV2A 1SEVA 2ECQA 4QGAA 1QIDA 5JJCA 1DP4A 3MQ2A 4MJ7A 1QC5B 2Q2WA 4M8LA 4DJAA 3VR4H 3U26A 2XX3A 4CV3A 3FDZA 5CFQA 4PYQA 2P2GA 2QX6A 3HN6A 2TYSB 1H3FA 1XZNA 3G6KA 4N4AA 2EZUA 3T5AA 4F60A 3IPCA 4X8HA 3KM0A 3T61A 3TKLA 4GC5A 1T8WA 5K09A 2IGTA 4JOQA 2JGDA 3ODGA 2C0CA 5ADHA 1J0XO 1LPPA 1RWMA 2PK3A 3I32A 4EL0A 3PFWO 1BQ3A 1JLSA 1V96A 1T1RA 1U2DA 4YGYA 1TW2A 2ZJ8A 1NUTA 4KXYA 2X4LA 1OLSB 1TA9A 3RHFA 3BKXA 5EMJA 4TRRA 3DAOA 3YASA 1QGOA 1T3GA 3EEFA 1MUUA 3ZXSA 2DHEA 2QTMA 1E3JA 1J2TA 1JPNA 1N1MA 4JJZA 2X6QA 3F74A 3HC7A 3FNHA 4WY2A 3PR2B 1FDRA 3E84A 1ZM4A 1BFKA 2C2WA 3EAFA 3GLSA 4G26A 1CUIA 4QYIA 1JA1A 4YB8A 3UXMA 4CLDA 4YRIA 3THYB 3NDJA 4PG8A 3SIPA 7REQA 4I1PA 2OCIA 5EJ5A 5GWXA 1PFQA 2QGFA 4J0EA 3QWIA 1GGEA 1OHHD 1XCMA 2WQZA 3EW7A 3BH0A 4BKUA 4HDAA 4Y2GA 1ZP6A 4Q7EA 1GYQA 1X1AA 2OCBA 1XB2A 1TYZA 3RFFA 3WNBA 4E21A 1K98A 1C4KA 5EJFA 3CZ9A 2YMPA 3DMHA 3MBKA 1N2CB 3OCVA 1XJ5A 2B25A 3L1KA 4RANA 4RK6A 3WMGA 4EJSA 1PDVA 1VHLA 1XD2B 4HEJA 4DGSA 4RS3A 2ONCA 1CUUA 5AM1A 2YXPX 1X3SA 4PO3X 2Q0SA 3L0PA 1D09A 4XM1A 5EEHA 5D1HA 2VPIA 3CW8X 1MRNA 2EQBA 1V45E 3N2GB 2QPLA 4LJ4A 4ND7A 1KZHA 3RE1A 1I0IA 2UUBB 1BCSA 3OMWA 1JMYA 1ZMRA 4OVKA 3OZ7A 4PZ9A 4DJJA 1CKEA 4M0MA 4H0CA 3CZQA 4DFDA 3T8YA 5C31A 4S2EA 4EKEA 3K73O 4Y2PA 1QGED 2ZJBA 3ILHA 4ASUA 7AT1A 2NPIA 1ID8A 4FLEA 4FE3A 3NH9A 4LZPA 3NDPA 2ADFA 1AF7A 4HCJA 4JAVC 4NCIA 4PSCA 5TNXA 4C7KA 1TXGA 1NN3A 1N6IA 4U7WA 3QQPA 4ROTA 2JGLA 4K9SA 4V3BA 4X6YA 3ECCA 3JQPA 5B7PA 1KSFX 3KTFA 1NQ5A 2DU8A 3QNUA 4I55B 4JJ4A 4BX2A 1SG0A 1FX1A 3GEPA 3GH3A 2BT4A 2DPMA 1KYYA 4P31A 4H4EA 4OIFA 4X8OA 1I4WA 1II8B 4RL4A 2AH5A 2D2VA 2X8LA 3BWVA 3HZRA 3SLKA 3UTCA 2VUUA 4QEDA 5ENZA 4N9WA 4CM8A 2VK1A 5CX1A 1TK9A 4JUDX 4X8LA 1QPGA 3LPNA 3PXBA 4D0RA 1NVAA 3TW8A 3MRVA 1QRSA 2ZI7A 1ULZA 4O02B 4QXPA 2PSHA 1TJ3A 2PYZA 4RYDA 4YMGA 1ADBA 3H4MA 3VPCA 1JG6A 3OQMA 3RGWS 4QVKA 2PT5A 3UOWA 1KMQA 1SC3A 2CVOA 3V80A 3LLMA 1F8UA 1R4AA 3NHWA 4M76B 5F12A 2O48X 2OCXA 5T5QA 1CIPA 2PJDA 3TR6A 4NE9A 2O0KA 4TT3D 3MFYA 4B6RA 4D3XA 3I64A 4JZKA 2C5SA 2JZCA 3ZC3A 2H2DA 2PMWB 5MN5A 3PUVA 1EDBA 5F78A 2RGXA 4F6CA 3P9NA 3F47A 1N2SA 1E6KA 4HNVA 2XT6A 3OHMA 3ZWCA 3QNWA 2ZB2A 4XSHA 4F9GA 3MMZA 4QRIA 4E2XA 1X7GA 2XUGA 3G2JA 4GIBA 1YZLA 1TT5B 1SHUX 2EEPA 3L8YA 4LZZA 2XMBA 1U3GA 2J9YB 1R88A 4QDKA 2CXXA 5C35A 5K0ZA 4QLOA 3CNLA 1D5CA 4CIVA 4EM6A 4FGLA 1IPHA 1UKCA 3IOCA 4HMOA 3K96A 5LWQA 2R5FA 5JSUA 2QRVA 1AC5A 2Q0XA 3C4QA 1DUVG 4XLLA 4EHKA 1W75A 1E60A 2RHLA 4MVJP 3KVYA 4B8WA 3VR2D 4U2GA 1C4OA 2Q2OA 4B75A 4L9AA 2EGGA 4ZHQF 1DLJA 2FOLA 2HU8A 3OQ6A 2YV1A 1LLFA 2GB4A 4NU0A 4AM8A 3S8EA 1L7QA 2NM0A 4O1IA 3FPLA 5C3MA 3AVWA 2SKDA 3AKYA 4PIPA 1KMHB 5K0SA 3LCMA 2B34A 3IDQA 4D4IA 2PKRA 2ZRIA 5F7OA 2ACVA 2O3SA 3DYBA 4I1YA 4IXMA 4UKDA 3E58A 2EWVA 2EKLA 1Q6ZA 2JVKA 2NXEA 5IYZF 4LF7B 4BASA 2UVQA 5IAOA 3RASA 3BRCA 1FDOA 1Z5NA 2AJBA 2PUTA 3PGLA 5AK0A 2PJUA 3LWDA 4Z9FA 5AKHA 5KVVA 4JV5B 1NW7A 2R1ZA 4HXEB 5LOVA 5FJIA 1EK0A 4II2A 4E1BA 4BUJA 4Y9TA 3WYEA 3L41A 1BH6A 3HUUA 2WQ7A 4X3OA 1HA3A 1I3KA 1V5GA 2RH4A 3ZU4A 1UZMA 2GCOA 4LJLA 3HBJA 3SG0A 3MOGA 4A36A 1PZEA 1W94A 3AEQB 3H1PA 4G2NA 1DUIA 4NPAA 2FMTA 1Y4UA 1KORA 1BDIA 1SXJE 3T9CA 3L9WA 4KI0A 5GGXA 1BH2A 3CQ9A 1USIA 1AIPA 3QELA 3IP5A 4ZXFA 3AR9A 1G38A 1N5RA 1S2IA 2ZQYA 4PO1A 5H5JA 3NO4A 1H4QA 3B89A 4WSOA 4WKBA 5JWRA 1W0KA 2H0AA 3FNGA 4OM7A 4C20A 4W5OA 3ZDDA 4NZPA 4EO4A 3KZXA 2W9XA 3CX4A 1S8OA 1FMCA 3IQFA 2XD4A 4MTLA 4B5LA 4G0PA 1DG3A 2AL7A 5BR8B 1XTKA 3L92A 4D3ZA 2PSJA 3WGOA 2OFFA 1LWNA 1UXIA 3UGKA 4E4TA 5CA0F 1GKYA 4GI7A 5GJVC 3WBJA 1Z6YA 2B21A 1A7AA 2XZDA 2KWIA 5DXAA 3HLKA 3GLFB 5ARCA 3WXBA 1ISGA 2O2HA 2N0SA 5I7WA 5E4TA 1U5CA 3PUHA 1MT3A 5U1PA 1EB9A 4U4AA 5I9SA 2QUIA 3LTEA 1R16A 1V7PC 3E5NA 1H8EA 1JE0A 2HXGA 4II7A 3ZHSA 4I0WB 3MWEA 4Z9YA 5B7NA 5LZ9A 3OX1A 1QO9A 5AOBA 2F7SA 2X0RA 1XCJA 2H51A 4LGYA 1OBHA 3PHJA 4HXFB 1GYRA 2OB1A 4L7QA 4ZCPA 1DXYA 4H6VA 1K8QA 3GEMA 2CFSA 3GJQA 3OFKA 4UARA 3LYHA 3W1EA 4MUEA 3DE1X 2J48A 3K32A 1KXJA 4WJLA 4J6EA 1C8KA 1GQRA 3UWDA 4QUGA 1RLIA 3PCTA 4DRXB 2NSYA 1ZA1A 4F4HA 3P9YA 3R5KA 3JZIA 4NCKA 4CGZA 1D3AA 4OQFA 2XW6A 1P9WA 3AZPA 4Z0PA 5J3JA 4CMIA 2OFXA 3TNLA 3NRBA 4I2NA 1E3SA 4Y0NA 3OKFA 2Z8XA 4EB3A 4CUZA 2BHNA 2I1QA 1CUYA 2XUZA 3CSDA 3L1JA 4FHDA 3S5JA 4GDFA 3QENA 3IPRA 3HN2A 1CG6A 2EXXA 2ZAIA 3RTEA 4GZ3A 1K7YA 5HOQA 5KJFA 3CGWA 1PSDA 2AMJA 4FNOA 3DMFA 2OV4A 4DLPA 4BNLA 2HYDA 1V5IA 4WY8A 4XR4A 3W8RA 4DSTA 5FQOA 1YGYA 1PYOA 3AH8A 3HB4X 4KFUA 2QXTA 3WRVA 4AJHA 4E31A 1SZDA 1IFXA 1Z13A 2QVXX 3K15A 4OFXA 4HQFA 3EA5A 2PGXA 1MORA 2H29A 2IYRA 5CT5A 1M1YB 3SCZA 4C0LA 5TF0A 3UJ6A 4D9IA 1U4SA 5D1NA 2ZUUA 4EUEA 5J2TA 4L8LA 3ANYB 2NADA 1Y3BE 3ETGA 2VSQA 3CLTC 2QUBA 3EVEA 2HHLA 3PFIA 3N0XA 4BQQA 1X7YB 5G40A 4X1KB 5A5EA 3GLGA 3ZDEA 4I6GA 4CI9A 2JJQA 1U9IC 5K8CA 1VBKA 5A4JA 3CWZA 3C8DA 1GZSA 5CUQA 2VYVD 1YVDA 2I3AA 1Y7PA 1LBIA 1UBJS 1L1RA 3FGZA 1C0EA 3AC0A 2GYVA 1OSNA 1QC5A 3CVJA 3CW2A 4UMDA 3RVBA 1E8MA 5CVEA 4ZAGA 2V54A 2HKIA 4GWLA 4BPRA 4E6EA 5KYUB 2VQDA 4LE1A 4GHWA 4QODA 1E8DA 4KQHA 3TRDA 1N2OA 3GGSA 5L6MB 1K6MA 2D5BA 3DDOA 3FVVA 4Z7JA 5IWAB 1NIJA 1GFZA 3EEOA 5EPOA 5JNTA 3ZWYA 1OILA 4HAXA 4RTSA 4P6VF 3NEPX 1NY5A 1UJ6A 3LBIA 3LDFA 3Q40A 3WK4A 2EGUA 2IOFK 4KACA 3CEMA 4HQNA 4QAQA 3T0IA 4DUZB 5AMXA 4PRKA 1Q77A 3LP8A 2XE8A 3Q8KA 2O8CA 1OLSA 3L8HA 2CV0A 3WHKA 2LDXA 3CZCA 3QTLA 1XVTA 1I5RA 4IIXA 1PRYA 1VMAA 3E9ZA 5G0SA 3IUPA 1C9NA 1XN4A 1DOHA 1JXOA 4KR7A 4LAFA 4Q03A 1Y8AA 2V6JA 4QPJC 4DQLA 4GQAA 4RPLA 4LYDA 3THYA 1JEQB 2C98A 4E46A 1ODSA 3F3SA 2FJ0A 3EGIA 1XEWX 4RD1A 1E1QD 1P0CA 2NN3C 3AVYA 3F0TA 3IHKA 3KLPX 4NSNA 1NF3A 2AD1A 4IZ6A 2XRZA 3EEQA 4BTLA 1HDOA 1SBCA 1QHNA 2JG3A 2WM3A 4N49A 5ABPA 1I0LA 3IV6A 3PWKA 5DGHA 2HI0A 1H0SA 5EEGA 2JLUA 1HE5A 4G36A 1N2CA 2PT7A 2P79A 4R98A 4BMXA 4EKNB 2Q28A 3AEUB 4BP1A 1PJRA 1XD2A 4B7ZA 3GG9A 3FDFA 1DBPA 3K9LA 4TVBA 2IEGA 3N2GA 5JO0A 1A8PA 2C5HA 4I50A 4OHXA 4M1YA 2QMZA 3OE7A 5G0UA 3T1VA 4C5AA 3T06B 4DXDA 1D1QA 4ZZ0A 2P69A 2NTYC 2CNWA 3C3XA 5TQVA 3SMVA 2XE4A 4FYHA 2MSLA 1M5TA 2OZKA 2YVKA 1THZA 2B9EA 2PH1A 3QWHA 4CUKA 1XKXA 2QG4A 2VRBA 2NAPA 3F6RA 3K9HA 2Q6LA 5D6OA 2QTNA 4MW2A 3FSJX 2KPOA 3UYLA 1DAEA 1SQ5A 1TC1A 2W6CX 1YNSA 3KZCA 3SS7X 4B3IA 4RV5A 2A9KA 1KYQA 4KHPB 4I55A 2LIPA 1PBTA 4ETNA 1O95D 5I8WA 1II8A 1LX6A 5EJ8A 1SMKA 4QECA 5DYNA 5C3UA 4KTTE 2V59A 3D5TA 4TTSA 2FW1A 3QE4A 5JVDB 1SIWA 1PKEA 1OBVA 1RT9A 5J23A 4HC4A 3HCOA 3O26A 2ET6A 2HUNA 3X1MA 4HDSB 4YMLA 2PYIA 3PICA 5LP6F 2DFKB 1M6HA 4KQMA 2BHRA 5G02A 3MCZA 4PAMA 4EYEA 4AULA 5HRUA 3CNBA 3RVDA 3IEKA 1G6HA 2GEVA 2ZR0A 4MRNA 3IAM6 1QF9A 2IUUA 2CMFA 2NSHA 3VZCA 5TLSA 3QGMA 3R1IA 3VU9B 5DM60 4ERXA 2BGGA 4RF4A 1V5WA 3PD7A 4DBZA 5EE3A 1LDBA 1QIJA 1JXAA 1V1MA 2HMAA 5LZ4A 4RM2A 2XB2A 3KKZA 4F2WA 4MCJA 2ZRCA 4GBED 2XITA 1VLZA 3FF4A 3PKZA 1O6CA 1OA0A 1P2GA 2C03A 2FKAA 2WG2A 1Y7IA 4HN9A 5HFJA 5BW6B 2OZPA 3TUJC 3UPTA 2W2OA 1TT5A 3FTCA 5ES4B 3V7YA 3V2GA 1YS1X 3P2YA 3R44A 1GXSB 1U9ZA 4JFAA 4ZDKA 3IV7A 2CD9A 2WLTA 3FWKA 3OC0A 2VN8A 3KCQA 3SS9X 1EDZA 2FQYA 5JMOA 1XTZA 4J3FA 1L5NA 1EEHA 4ZOLA 3HCDA 3DO5A 1MJFA 3KAQA 3TSCA 2ZBPA 4YP9A 2VBGA 3RIHA 1GPAA 1O94C 2BBOA 2CDBA 2IZ6A 5FWNA 1MEOA 1EP3B 2JGEA 3NT2A 5G4KA 1YV9A 1O96A 2ST1A 5MDHA 3GG2A 5LMNB 1S5PA 5DX1A 2XYHA 3STTA 1MB0A 2R00C 4O8ZA 1I51A 1SU7A 1ZISA 4PGMA 3RHTA 3T4PA 4ZYYA 1KMHA 4XCXA 1M5UA 1TQ2A 4IM7A 4R7TA 4X63A 4JI3B 2OTCA 3AM5A 4JCOA 1EVJA 1AGYA 3EK2A 4DNFA 2ZYDA 5GONB 5KYXB 1XA4A 3NJ8A 4LXHA 4H77A 3UW1A 3GUVA 5F2EA 4RHUA 2ZRLA 2PR7A 3U3XA 1HQDA 1Q15A 3KJZA 4FFNA 5IHXA 2Z6UA 4DANA 4ZYXA 4G0WA 4Y1RB 2C4KA 5CBPA 2Z5FA 1WZUA 3N87A 4DLUA 4R9UC 3GYBA 4MGYR 4Z49A 2E4VA 1QS0B 1FFGA 4XSGA 4C6HA 1GG2A 3DCYA 5J58A 4DQKA 1KJ9A 2PT6A 1WMAA 1NR5A 4KQFA 4C5BA 2KLHA 4GR4A 2H1FA 1PVOA 1PFUA 2QRNA 4CHGA 3H42B 4RV9A 4M9UA 5KOHA 4LC0A 1XC7A 2EG5A 3IP7A 4OP3A 4MVJH 4X20A 5KYTA 2AOXA 3Q7QA 5HKKD 1GNVA 2OYSA 1VBFA 2XTZA 3WGUA 5TF4A 1A7UA 4D9BA 2UZ1B 4AQYB 2HPAA 3OQJA 4PN7A 2W93A 2FWAA 3IAM1 4L27A 3UJDA 2VF5X 3P1JA 1GPJA 4NPCA 5FH9A 2D7JA 4FHFA 1PJZA 3ESCA 4WPGA 4CN8A 5E2BA 4V3CA 2HDWA 2HRRA 2NO0A 5TMDA 3CV3A 3CINA 2G4CA 4EABA 1PWZA 2IYAA 2ZJ2A 4MIYA 5HCUA 4X00A 4D8XA 2VYCA 2WHPB 3AF6A 2ISQA 1IOZA 1D2RA 4ZHQB 1BGWA 4RNCA 3RRXA 3S2IA 5JQGF 1ODIA 1EVIA 4CKBB 5BR7A 1N36B 5JU6A 1CC1S 3B70A 4RTRA 4EG3A 4BMOB 4ZIRA 4TS3A 5D3ZA 1QX4A 2DF8A 2WNSA 2E18A 4LOJA 4E30A 1KI9A 1HE1C 1NHGA 4YQEA 2HEGA 3D3WB 4DCCA 4DRXA 4II3A 1U3WA 4KXLA 3BXGA 3HUTA 1W93A 5IYZB 1U7OA 2AZMA 1CDDA 4ZI2A 4KYVA 4QFDA 2KB0A 5PNTA 1Q74A 3M5DA 4N6NA 5KIAA 1ESNA 4MWEA 4YRKA 4JYPA 2Z58A 4Y2QA 4Z7NB 2JCGA 3DR5A 1JPVA 1SOUA 4P0QB 2XUDA 5F4BA 2DHDA 3LOQA 1WXIA 2R66A 3SC2A 1BVYF 5THQA 2VSFA 2YASA 2Y93A 4LSZA 2J46A 5EXEA 1IWBB 2Q7OE 3ST7A 3ZG6A 1ECPA 4ER7A 4W5JA 4RSMA 2FEMA 4BKRA 4UZEA 2JFPA 3ORRA 5HF8A 1DEKA 1BDBA 2FFBA 3D3QA 4QUEA 4BQOA 1YS2X 1SCIA 2I7XA 3GLRA 2WD8A 1J23A 4OU5A 4OLFA 3T1QA 4F71A 1UDCA 1SCBA 5AVRA 3SYTA 4XX0B 4OD0A 3D4BA 1AJEA 3U1TA 3DMDA 3RBAA 3RCBA 3O2JA 1KH2A 5ALDA 3T7CA 1VG9B 3F5MA 2WP8J 3OIFA 1CE8B 1X7YA 2R85A 4TL9A 1XJ0A 1UT5A 4M83A 4EX7A 4YRRA 3WZLA 3P4XA 4BMYA 2XEDA 2EW1A 3ELBA 1TLFA 1WE2A 3TKAA 1EP1B 1FNNA 2GA8A 2H08A 1LBQA 2IPMA 4HRXA 2YN2A 5DJ5A 2JI9A 3ZE1B 4A0FA 3MTJA 5JD6A 2XXAA 5KTSA 3LT2A 1LPBB 1TVCA 1VJDA 3BDAA 4N0EA 1U0JA 2FN7A 1ZNXA 1E1RA 2FWRA 3ISVA 4Q4HB 1CR0A 2AA3A 1CJVC 2G63A 4UHHA 1M5RA 3QVWA 3RC3A 1SXJC 3U5ZB 3GNTA 3KEOA 3HPQA 3NJ4A 1T3HA 2Q4OA 4RIFA 4NDAA 2ZUDA 2BKXA 1D6MA 1QBGA 3DXZA 2C7VA 3L18A 3MGCA 4AD8A 3ZH9B 4PG5A 4UCFA 2Q4RA 3C6XA 4RK0A 1ULAA 1FFHA 3AR6A 1NP7A 1FDVA 1V8PA 4QXMA 2FFAA 4EYSA 3WB0A 1ENYA 2I6XA 1A8QA 1JZSA 1KI4A 3LBFA 3NHYA 3KP1A 1X92A 2Y0EA 3IULA 3VXKA 2X42A 4DWWA 2OWEA 1WUKS 5L3QB 2E4XA 2JANA 1YL7A 1X42A 1CTQA 1RI3A 2YOFA 4J4BA 4RVDA 4CR7A 3CONA 2GJ8A 5FI3A 1UEJA 3WIUA 4C7OB 4RF3A 1H2HA 1CHNA 2CVHA 2GCEA 5BNFA 2VI5A 3VDNB 4CFZA 3A1DA 3KZ1E 5BN4B 2HHJA 3IVGA 4R54A 4DM4A 1MQSA 3U7HB 1ZOLA 1ISJA 1EP9A 1RYZA 4RD0A 2HRQA 1P72A 4DMLA 2JLQA 3LE8A 3THOA 6NULA 1C3JA 2HDOA 4RBNA 3I2IA 3MMXA 4IIHA 2W6IA 1E6EA 4KLNA 4LY3A 4XH9B 4ZQIA 4ZDWA 3LDHA 4HNQA 5B36A 1A1VA 2PH5A 1GLGA 4O4JF 2WTUA 4MVYA 5E6UB 4EDHA 4B3BA 1G19A 4ESHA 1ZR4A 2RGNC 1KO8A 521PA 4Q02A 3NHZA 1UQTA 1QGYA 5K6TA 3ZLJA 2CNLA 3E81A 2H11A 3LU1A 1N3IA 4H7PA 1SHKA 2G4LA 2PVCA 3EUAA 3H2KA 4MGHA 2I7DA 4B6QA 2ZSDA 5E95A 3ZJ5A 2GAFA 3DT8A 4LNUB 1KDPA 3Q5GA 2OOKA 1H42A 2XMZA 2YN0A 1CERA 4JSTA 3ROEA 4MRVA 4QUIA 5KC9A 1Y6GA 4MI3A 2FX2A 3PSHA 3M6UA 2BFPA 3DOUA 4FSXA 4C89A 1CY6A 3L6UA 1SRQA 1P2BA 1Y7HA 4JDPA 3T9BA 1VJ5A 3CC8A 2CXOA 5IN4A 1WF6A 3NB0A 1LX7A 1SXHA 2X6RA 1X1RA 2XSZD 2Q4BA 4BJHB 2P5SA 1GVHA 3Q3EA 4Q18A 1KVRA 3G9UA 1V47A 4U63A 1SBIA 4EHBA 3U7GA 1GAXA 3MMPA 3A4YA 3T5DA 3ZE7A 3VKVA 5EIEA 4UHKA 3DVSX 4RMNA 3HP1A 3GEGA 4NMHA 3LUHA 2IYTA 4BE4A 2O1XA 1ZCBA 1XO1A 5G4LA 2P0EA 2FDXA 4DSOA 1DRVA 5JJKA 2O7QA 4FLMA 2D59A 1I7DA 2GKOA 1SH7A 2PR2A 2QMOA 2RHOA 2BEWA 3GRPA 3N6VA 3I9MA 4M9SA 4IGAA 4W63A 1VJRA 3BZUA 4RS4A 5I7OA 4BCCA 4BIMA 2SBTA 2NNLD 3QRWA 4BV2A 2C2XA 2OAEA 4BP8A 3CTMA 4OUKX 1K4KA 4E5UA 2QRUA 1QYXA 2GSDA 4ID3A 1ZITA 2PT9A 4JENA 5EE1A 2C7BA 2QAGA 1MG0A 4OJMX 2O7RA 4UTZA 4UEOA 1X74A 1E32A 3WL3A 4DCMA 5EL0A 3ZFTA 1MX3A 1PQWA 2FSVA 4GBGA 5B1SA 1YZUA 1ZM7A 2EDCA 2NNWB 4MS4B 3FOCA 3EZ2A 3UHFA 1ZNWA 5FPSA 5K3FA 2IKSA 4QBKA 4TS9A 4D45A 3AJRA 4QQFA 1NM5C 3HN7A 1YZYA 1CXZA 4BNTA 3M5CA 3U4MA 3V7UA 5M3BA 5HP4A 1GNTA 2J87A 1QZXA 4Y9UA 2VBFA 2ZVPX 4R9NA 5DT2A 1IG0A 4UHJA 4AZ3A 5A0VA 2RG1A 3INYA 1A27A 4MQFB 1KO4A 4QUDA 2AHRA 3PF9A 4EPYA 5JHGB 5L53A 3SR0A 1O87A 2MCFA 1KPHA 2JJ2D 2J3EA 3N2ZB 5DX8A 1AN9A 3K5IA 1KYVA 1T2DA 1SBZA 2XUQA 4JS0A 3W7VA 4BVFA 3F9IA 1GDTA 2VHTA 1H1LA 5IT4A 1NVVR 3CXRA 8MHTA 5T8KC 3EBOA 1YK0A 5LL6P 1IXRC 2EJWA 4C3OB 4WNIA 3FFTA 3B48A 5SY6A 3CXUA 3PTLA 3PHLA 5JSKA 2XRMA 1B26A 4B84A 5K0JA 1X86B 3CB4A 1YZTA 1SHLA 4MITA 2DG2A 4UATA 3TQSA 1QJ4A 1OX4B 1P4RA 3ZQ4A 4POAA 2Q0HA 4MWBA 1JDVA 2RARA 5NULA 3PEUA 5GONA 3IBSA 4I8DA 4MKXA 4PPFA 2WJGA 4ZK6A 5KYXA 1VSTA 1KAHA 2HA6A 1BE1A 3JQFA 3PFCA 3GNQA 4RVUA 1AO0A 4LJ5A 3H2IA 4Y1RA 3BFXA 4I5EA 1Z0JA 4XQEA 2OXIA 1PLJA 4YP5A 4D9MA 1ZG3A 1QS0A 1IBRA 2GVZC 6GPBA 2QM7A 1D8TA 4F9FA 4XTRA 4GVPA 3T7JA 3SNHA 1Q6YA 3HSYA 2D2XA 4BV9A 2X6TA 1WXWA 1NMYA 3U7JA 5ECYA 3E3AA 2DCMA 2Y4OA 4B81A 3G0GA 3C14C 1XIVA 5D8DA 3AKCA 1SVIA 4K88A 4UEWA 1OAOC 3B78A 1VOTA 2QRJA 2ZYAA 3T1HB 3LY9A 4NS1A 5F3WB 4LGCA 1ETHA 5F2KA 3O47A 5DHPA 1TOAA 3U0VA 4BNZA 3TWOA 5JMTA 2PRSA 1LTKA 2GASA 2YIDA 1O58A 3L79A 3NWEA 2UZ1A 2ETVA 3PC6A 4A92A 4CW7A 3DKPA 5I9IA 4BVLA 1VJTA 1RLJA 5J5VA 3NRJA 2C04A 2NSJA 3CG0A 2I34A 3HJHA 1EX9A 4LRWA 1EBBA 3A36A 5LZ2A 4F1WA 3PQEA 1VG8A 4Q1BA 1HPLA 5EKXA 3V6MA 5B53A 4A9AA 2PWPA 1BA3A 1LPNA 4M37A 4I3GA 3CWQA 2HGZA 1R0ZA 3N0WA 4V0ME 1L1FA 3RFTA 1U1FA 2YJ6A 1ZL2A 4TVOA 3FZGA 1XTQA 1KK3A 2I2AA 4F86A 4D57A 4ZHQA 1FX0B 4KOEC 1XDDA 4TTTS 2H16A 1II9A 3GLUA 4W5WA 3P0IA 2WKSA 1H85A 4Q7MB 5DPMA 1J5XA 2JH9A 2NUTA 3W3ZB 4NQRA 1FU4A 2HWUA 3QEKA 5LWHA 1CY7A 3FWPA 4G5FA 2V4ZA 3D3WA 1UADA 1HL3A 4HQLA