4YUZA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 5-[(4-methylbenzyl)oxy]quinazoline-2,4-diamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
285
structure length
273
Chain Sequence
GWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
total genus 93
structure length 273
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuzA02
3TPZA 3PX2A 2WA2A 3GXOA 2UZ4A 2E5WA 4R8SA 5D1HA 1D2HA 4CKCA 2UYHA 3H2BA 5GWXA 3B7PA 2UYOA 3FPFA 3HA7A 4YUYA 4HGYA 4GF5A 1WG8A 4PIPA 5E1DA 4QQNA 4E2ZA 4RTOA 3VSEA 3ANXA 2P7IA 3DXYA 2A14A 3CBGA 5CUQA 2R6ZA 3KR0A 5JR3A 3MCZA 4FR0A 4FZVA 3VYWA 1NV9A 3GDHA 5CIYA 5FWAA 3MERA 3LCUA 4ER6A 4HGZA 1WS6A 1P39A 2VDVE 5CD1A 3BT7A 2VDWA 1VLMA 3T0IA 2GPYA 3KQOA 5EMKA 4C4AA 3GNLA 1EG2A 3G2QA 2BR5A 1ORHA 4ER7A 3LHDA 3NW9A 5FA5A 1JQEA 3HCEA 2YUIA 3I5UA 5FHRA 5CVDA 4QTUB 4LWPA 4PYIA 3C3PA 3LECA 2NXCA 3LPMA 1QAOA 1I9GA 3ID6C 1FP2A 3M6XA 4E2YA 4CKBA 3LDUA 3BUSA 5LQJA 3NWEA 1Y8CA 3HP7A 4OBWA 3A4TA 3LSTA 3M4XA 4OQEA 3IHTA 3ELYA 1KR5A 4PCLA 1N7JA 4U7PB 3R6TA 1SKMA 2VZ9A 4R6WA 2QRVA 5DTRA 4CXMA 3EVDA 4DM3A 1BHJA 4KWCA 4PWYA 1G8SA 4KIGA 4RV9A 2PXAA 5U4XA 5LSAA 3M70A 4ATNA 4MHTA 1XVAA 4R05A 4BP1A 5E2BA 4M38A 5CCXA 3KPJA 3PB3A 2ZZNA 1ZHFA 3UA4A 2JHPA 4FSXA 4RTPA 3C6KA 5E1BA 4DQ0A 5FQOA 3UJDA 4RTJA 3PTAA 3TKAA 2BH2A 5E8RA 3SX0A 5F2NA 2KW5A 3UJBA 4B17A 3G2PA 1D2CA 2YX1A 3JWJA 2IH2A 2ZIFA 2I9KA 5B1SA 5K05A 2GLUA 2IGTA 2ORED 2ZWVA 4KRGA 1QZZA 3R24A 5ERGB 1SQFA 4YV1A 5KYGA 5ICFA 8MHTA 1F38A 4RTLA 2I6GA 3HA5A 2K4MA 1JQ3A 2AOTB 3LX6A 3THRA 1ZKDA 2CL5A 2DULA 3KQSA 1EJ0A 2YQZA 3I64A 5CM2Z 3M33A 4QVKA 4FGZA 5KQRA 1VQ1A 4ER5A 1AQIA 4POOA 5EHGA 4C03A 3FPHA 2FYTA 3KQQA 4YUXA 1WXWA 2N47A 3EEYA 3EGIA 3MTEA 3A7EA 3O4FA 5E9QA 2EFJA 4JXJA 3FTCA 3M6VA 4DCGA 2Z6UA 1NBIA 3P97A 1U2ZA 2ESRA 3P9NA 4IWNA 4M36A 4PYLA 4QPPA 5IH3A 3KR2A 2PX8A 4PYOA 3PS9A 5EGSA 4DCMA 1RJFA 5HIKA 1X1BA 3MCTA 3CJRA 3UJ7A 2Y1WA 4GOOD 1UWVA 5T6BA 3EMDA 4HRAA 4RSRA 2AVNA 5EEHA 2ZULA 3Q87B 2BZGA 3CJTA 3FPJA 2CWWA 2IP2A 4ISCA 5JUWA 1WXXA 3DLCA 3K6RA 5DM4A 3P8ZA 3NMUF 5HOQA 2OO3A 1AQJA 4AZVA 3HEMA 5K0FA 3UBTA 4GC9A 1NT2A 2JHAA 3G2MA 2ZZMA 4XUEA 4BLWA 4HC4A 3HCAA 3NWBA 5DTMA 5EKUA 1R00A 3BKXA 5FWDA 1M6EX 5GIPE 1VL5A 2CKDA 2AR0A 1XDUA 3OFJA 3GRZA 2NXEA 1QANA 3CGGA 5DRYA 4RTNA 9MHTA 1YFLA 3KHKA 3BKWA 3T7SA 2Z6AA 2ZIGA 3TMAA 4CKEA 1KPHA 1KPGA 1XXLA 2G1PA 3E8SA 2AOTA 3KR1A 2IPXA 1HNNA 1BC5A 3FYCA 4OA8A 3G8BA 2JJQA 3LBFA 3B3FA 3I53A 2LD4A 4GUAA 3OFKA 5KQSA 3LBYA 3UJ9A 3MGGA 1KXZA 2B3TA 2JHCA 2ZWAA 2PVCA 2H11A 3DMGA 2IH4A 5K0EA 2VDUE 5E1MA 1QAQA 1EJ6A 4Y30A 2AOXA 2ZVJA 2FCAA 3KR9A 4BP3A 1KIAA 3IV6A 2PY6A 3GCZA 2G70A 2G8NA 1Z3CA 3SM3A 1QYRA 2BR3A 3FRHA 5K0BA 4HSGA 5K0GA 5CVJA 3BWYA 1SQGA 1YZ3A 2P3OA 2PXXA 3BWBA 2YVLA 4HTFB 5EIFA 5DWQA 1JR4A 2PX2A 4E2WA 1YB2A 3UJ8A 3EPPA 2CMGA 3HA3A 3OU6A 3M6WA 4R6XA 4MIKA 4RVFA 3REOA 2AN3A 3GRRA 1N2XA 2WK1A 3EGEA 3FPEA 4C08A 3S68A 2UYCA 2BM9A 2ZTHA 1RI4A 3UFBA 3UJAA 5E1OA 3IEIA 3ELWA 3EEOA 2VP3A 3PT9A 1V39A 2HWKA 3K0BA 2OZVA 3EVGA 4FT4A 3A27A 5E2AA 5T67A 5GINE 4ZTBA 3THSA 1JG2A 4FSDA 3QOWA 3V97A 3OU7A 2JH8A 5P8WA 3I58A 2AZTA 2ONYA 3LL7A 3V8VA 3FZGA 4RX1A 4M7RA 3HVIA 5HFJA 5EEGA 4GOMD 3BZBA 2PSSA 1QAMA 2GS9A 2PKWA 3QOXA 3WSTA 5BP7A 4HH4A 4E30A 3SSMA 3LDFA 1NV8A 4QDJA 4E33A 4X41A 4K6MA 1RI5A 5C9ZA 5DX8A 5DT2A 2IIPA 4PYJA 3UJCA 1G38A 2FRXA 4E31A 3SVZA 5DM1A 1SUIA 3OE5A 2XYQA 4PYNA 3SMQA 2HR1A 4P7JA 1N7IA 4WXHA 4RTKA 4E70A 5LQCA 1RJEA 3P9CA 1YF3A 2XYRA 2O06A 2V7EA 2OY0A 2OXTA 1SUSA 3CC8A 3CKKA 1X1AA 4MWZA 2B25A 3NVKI 1R8YA 2FPOA 3DLIA 4YUWA 2QE6A 1FJXA 2IH5A 2PX5A 4QQKA 4RVHA 1M0EA 4C06A 3UJ6A 4C04A 3DOUA 4GC5A 4X1OA 4AUKA 2GAFA 4DMGA 2OKCA 2NP7A 3RW9A 2Q41A 3EGVA 5K8VA 5CCBA 5FTWA 5BW5A 2PT6A 3FUVA 1B42A 4UOEA 3B3GA 3AY0A 1OR8A 2PT9A 5LQNA 1O9HA 2VS1A 3I9FA 1NW8A 1EAMA 1RI1A 3OZSA 1JG1A 3PLAE 4EKGA 2YXDA 1ZGJA 5DM2A 2IBSA 4IKPA 3Q7EA 5DPMA 3VC1A 2P3QA 5HZMA 4E32A 1JSZA 3F4KA 5EIWA 3ORHA 4AZSA 3IYLW 5FA8A 5FCDA 1ORIA 4QVGA 5GM1A 5HIMA 5LQRA 1R8XA 1WZNA 3M6UA 4EQZA 5GIOE 3BGVA 1KHHA 4OX9Y 1KPIA 1INLA 2PBFA 4IV8A 2FK7A 1AV6A 5CVUA 3ERCA 3HTXA 1Q0SA 1FP1D 4EK9A 2ERCA 1PRYA 4XUDA 3G88A 5EHIA 2GB4A 4DF3A 5LQAA 2JH9A 4RVGA 4XCXA 3CVOA 7MHTA 1BKYA 2P8JA 3ELDA 3HCCA 5EZQA 1DUSA 3AXTA 1O54A 2YTZA 3DH0A 4YUZA 3VC2A 2AOVA 4KDRA 3EVAA 4PNEA 4FS8A 5H02A 3TFWA 3BWCA 2OB2A 4PINA 1MJFA 2C7PA 3EVZA 5K09A 1X1CA 5K0CA 1EQAA 3AXSA 3G8AA 1P91A 3AWIA 3R3HA 5EPEA 2HMYB 2IBTA 2EG5A 4MQ4A 5KVAA 3EVCA 3TLJA 3ER8A 1FBNA 1VE3A 5EC8A 2AS0A 1R18A 3GRVA 1TW2A 4C05A 5K0LA 1UFKA 2OB1A 1TW3A 4AZTA 1WY7A 2P7HA 4ER0A 2ZFUA 5FUBA 1Q0TA 3CJQA 3GGDA 1O9GA 2ZLBA 2EJUA 2P1DA 3FYDA 2PWYA 2NXJA 2BM8A 2QM3A 3B3JA 3FTDA 3G2OA 3OE4A 3KQYA 1KYWA 4GOLD 4M37A 4P7FA 4CTJA 4RTMA 3FRIA 1XDSA 4GQBA 3NDIA 4EVIA 1YFJA 3KQMA 3SSOA 3SSNA 4X63A 2EJTA 3P9KA 3G5LA 3G89A 2IFTA 3DTNA 2G71A 3TQSA 2I62A 1VP3A 2C7OA 3HVJA 3C3YA 5DLYA 2ADMA 5D1NA 1NKVA 1NW7A 2I7CA 1X1DA 3PFHA 2HNKA 3EVFA 3LGAA 1RJGA 1XCLA 1T43A 4U7TB 2NXNA 3A7DA 2QY6A 2P3LA 2OBFA 5K03A 2PXCA 2ZSUA 1IM8A 5EG5A 4GOND 1RI3A 1FPQA 3ELUA 4O29A 4E2XA 2F8LA 5DM0A 1JQDA 1JTFA 2PWPA 5FULA 1PJZA 1H1DA 3LCCA 5E9WA 3A25A 5E9JA 3X0DA 1VIDA 3KPVA 4YUVA 3GWZA 3KPYA 1L3CA 1TPYA 3MTIA 3UZUA 1ZGAA 3KQWA 2YR0A 1XTPA 2FK8A 4KW7A 5GM2A 4V0QA 3MB5A 1RI2A 5ICGA 3HNRA 2XVMA 3T7TA 2B78A 4LECA 2XYVA 3C6MA 1DL5A 4PONA 2OPBA 3EMBA 4KIFA 4Y2HA 2P40A 5F2OA 5EQJB 3TKYA 3GO4A 5ICCA 3L8DA 2OYRA 2PLWA 2AVDA 3TM4A 2FHPA 1YZHA 3PVCA 1NBHA 3BGIA 1XCJA 3LKDA 1JTEA 2IDJA 3TOSA 1VPTA 4YMGA 2DPMA 1JG3A 4OQDA 3KPWA 3P9IA 4ER3A 4GBED 3HM2A 5GP1A 4P58A 2ZBQA 3NVMB 5EKXA 1AF7A 2QYOA 2YXEA 4YV0A 4G56A 1XDZA 2H1RA 3DR5A 4X61A 4X60A 5F2KA 2O07A 4YV2A 2PGXA 3MQ2A 2ZBRA 5EMJA 3HCDA 4F86A 4PGHA 1NE2A 3KU1A 2ZIEA 4R8RA 5GOZA 1F3LA 2AOUB 1L3BA 5IKMA 3P2IA 3HCFA 5LR6A 1IY9A 2AN4A 3OCJA 5E8JA 4HTFA 4CWAA 3FTFA 5CVVA 3TR6A 4RTRA 1KYZA 3RODA 1UIRA 1G6Q1 3KPUA 3RIEA 5K0NA 3A26A 10MHA 2NYUA 4QTTB 3E05A 4PYKA 4C07A 5BW4A 3JWHA 4OBXA 1NW6A 1JG4A 4RVDA 4XUCA 1I4WA 3FPGA 4IV0A 3R9XB 2ZZKA 4P7KA 3BWMA 4EMSA 3GRYA 4MTLA 5ICEA 1RJDA 5M5BA 2XVAA 2PV0A 3DMHA 5K01A 4F85A 4RYLA 5G02A 3DP7A 1JSXA 3B5IA 5C1IA 5LQUA 1L1EA 3R0QA 4KDCA 2H00A 4PCAA 1VP9A 1ZG3A 3CCFA 5BXYA 1NW3A 2O57A 3FUUA 3ME5A 2ONZA 2GA9A 4RTSA 5T64A 4KVZA 4PYQA 1D2GA 4FT2A 2HTEA 3E7PA 1G60A 3GRUA 3P71T 1ZQ9A 5DSTA 3G7UA 3KQTA 2C7RA 3OZRA 3SXJA 1BOOA 2IDKA 4WVLA 5DX1A 2EX4A 1MHTA 4RTQA 2NNWB 5DRTA 3HVHA 2NP6A 4RWZA 4LG1A 3P2EA 2BR4A 4BY9E 3EVEA 2UYQA 3DXXA 4PGGA 2P35A 4CTKA 5FADA 4P7GA 4V0RA 4LWOA 3DXZA 3TRKA 5DXAA 4DKJA 3PX3A 3KQVA 2AOUA 1P1CA 4NECA 3KQPA 5EVJA 5C0OE 3C0KA 5EZSA 3JWGA 3FUXA 5CVEA 5DSXA 5DXJA 1HMYA 5EMMA 1XJ5A 5K0JA 4QDKA 3DULA 4H0NA 4A6EA 3HVKA 2O05A 3GJYA 2Y1XA 5LQKA 1I1NA 2AOWA 3O31A 2ZCJA 3NJRA 2GH1A 3SR4A 3O7WA 4OA5A 3HCBA 5HEKA 1P1BA 3NDJA 2PJDA 3PFGA 2B9EA 1NW5A 1SVUA 3GU3A 4QPNA 2ZBPA 3TM5A 3MHTA 3FTEA 3GIWA 4YMHA 2YXLA 2O0LA 4AX8A 3OPNA 5HIIA 2CMHA 1EIZA 1G8AA 1X19A 4Z2YA 3ER9A 2B2CA 3FUWA 1DCTA 3LDGA 4PYMA 3DMFA 3SGLA 2R3SA 3D2LA 3OZTA 5KS2A 2WA1A 5DTQA 4A6DA 5FQNA 3FUTA 3P2KA 1YUBA 4L7VA 4EKIA 2JG3A 3MAGA 3UA3A 3DUWA 1L3IA 1VBFA 3LCVB 3G5TA 3T7RA 5HIJA 4BLUA 2XBMA 4AZWA 3QV2A 2HV9A 5HILA 4GEKA 5EMLA 3U81A 2P41A 1M6YA 3BXOA 3E23A 5FHQA 5MHTA 2QRVB 4BLVA 1R74A 2ZW9A 3LKZA 3OU2A 2C7QA 3BGDA 1SG9A 4DA4A 3NTVA 4DZRA 1G55A 1KP9A 3B89A 2Z6QA 4FP9A 1R6AA 3JWIA 5EOVA 2G72A 1IXKA 3AJDA 1L9KA 2V74B 4PIMA 4HG2A 4F84A 2PX4A 3UWPA 3EVBA 3KKZA 5DX0A 2AN5A
chains in the Genus database with same CATH superfamily
3HXQA 4WBNB 3PNBA 4EVRA 1OPXA 2PUTA 3V1TC 4CKCA 1VJ5A 1F06A 3F71A 1WA5A 1UK8A 2O8DA 1B3BA 1YBFA 1IOLA 4PR0A 3U37A 4A7PA 4BZZA 4QGSA 1DC7A 4INPA 2RGNA 4KKXB 4ZQFA 3A1FA 3ANXA 2P7IA 2WW8A 2YY6A 1A9XB 3ET5A 3IUQA 1R1DA 2K6GA 1EVIA 3KR0A 4FZVA 4NABA 3QYFA 2IXBA 3KLBA 4QPCA 4Y1FA 2PPLA 5DNUA 2GHQA 2BFWA 2I1WA 5IULC 2VDVE 5BSWA 3G68A 4C0JA 1VLMA 3NHUA 3KQOA 3IX7A 4FC7A 2IF0A 2QTWB 4OHCA 1RXSA 3ZFPA 4G65A 4Q18A 1P2GA 4G1VA 4HQOA 2YBDA 2B83A 3JV7A 5HTKA 4DLAA 5JJCA 5KTKA 5FV7A 1QUEA 1J5PA 4LJ5A 3T9DA 2ZROA 4CFZA 3V4ZA 5IMSA 1SCKA 2I6QA 2BFCA 1EG7A 3KO8A 4F04A 3TYXA 1IK4A 4CKBA 3R9WA 2W90A 2PSDA 3NWEA 4I5IA 1TIBA 2P6PA 4MEBA 4ND2A 3OEHA 2NWQA 4KODA 1NMEA 5JMPA 4CMJA 4DANA 3N3BC 3V80A 1KR5A 1EIWA 1U8AA 1Q3TA 2B2NA 2VCEA 3M81A 1C9JA 1ZUNB 4I6GA 4MI9A 2E55A 3WBBA 5ITWA 3EDYA 1BHJA 2HCBA 2P2ZA 2QGZA 2NU9B 3HC7A 3OAAD 1TFUA 4ZOAA 2OBMA 3NTXA 1FVXA 2WF7A 4CLXA 4I4TB 3SNHA 2C1ZA 5E3HA 3HFGA 3AP1A 1GKKA 3A4YA 1KC1A 2BP7B 4TSRA 4YJDA 1PR1A 4MMXB 1UZMA 2R66A 3ECAA 2AXEA 3CVYA 4EA8A 4QJ4A 3AIKA 3MBIA 3UJBA 3KKNA 1VC2A 2YX1A 5CFZA 1US8A 2O2ZA 2QDXA 6LDHA 4LJ8A 1TUIA 3ZE7A 4D4JA 1XWIA 1T9DA 1VZ2A 1AU9A 2PV7A 2GZDA 1SVIA 3IODA 3R24A 1E2MA 1T1RA 3FYUA 4RK0A 1A76A 4RUKA 2G1KA 2CLMB 5ICFA 3FPCA 1E4OA 3SR3A 1OU4A 1AM4D 5HYVA 3HDJA 5CM2Z 4S1NA 3AESB 1BU8A 3ZJYA 4HAZA 4IKOA 1HFKA 1AXGA 3A6LA 3BXGA 1TM7E 2XCOA 5EHGA 1Y4SA 1PL0A 3EGXB 4NDNE 4YUXA 2V7TA 1JSCA 4YRKA 4OI0A 4RZUA 2QTAA 4MWOA 3WR5A 1N9ZA 1P0CA 2DGDA 2VNHA 4G5QA 1Z0AA 2IHTA 2WDZA 4QUIA 4R1LA 4ROSA 1ULHA 1NBIA 4CQLA 3LXMA 4WJZA 4EKYA 4IH9A 4NRDA 2OPHA 4QOGA 3OUUA 2PK3A 5A62A 3K9NA 3TOCA 1X1BA 1USWA 1UWVA 2P9FA 2PUCA 1YC2A 3P9ZA 4KUHA 2F2TA 3UFXB 2BIFA 3ADDA 4GM4A 4IJMA 4C7OA 1G21E 1P1IA 3PUYA 1MJ5A 4YRFA 2OBNA 2CXOA 4JC4A 2P6MA 2R1TA 1U04A 4EX7A 3DLCA 2GK4A 3MJRA 1F9AA 2GF2A 3I01M 3OX4A 3W9YA 4AZVA 5JQGA 1JHAA 1A71A 3BHNA 1GCGA 1CTQA 1RJWA 1CJKC 3IAM1 3ENQA 4GC9A 2BUCA 2VXOA 4TKMA 1T3ZA 2J6CA 2PMEA 1QIJA 2QRZA 4CE6A 1ONBA 4PLCA 4PV7A 1MX9A 2VP4A 3ZZUA 1R00A 4IIEA 4XH9B 2DLCX 2CKDA 3JXEA 1HE1C 1KZ6A 1MDFA 4J4BA 1DEHA 3DQZA 4RK4A 3S81A 2B61A 3F8TA 3WL4A 1E3SA 1A8SA 3MGCA 1YFLA 1BMTA 1GZ7A 5D3QA 3QJYA 4JI5B 3ICCA 2QJFA 1XA3A 4NMMA 5JDIA 1YONA 4GLJA 4HI0E 3L9WA 2HPZA 3CUKA 4O1HA 2OV3A 3HY4A 3OP4A 4L95C 2A4KA 3IHLA 3K3PA 1W4RA 1C7FA 1O6FA 2JIZA 4FWTA 2OWDA 5CURA 1KXZA 4X1YB 1XYYA 4LQLA 3SI7A 1CUXA 2ZETA 3FB4A 4REOA 3VNBA 3VZRA 4JC5A 3W2EA 2KHZA 7ABPA 3CG0A 3AYZB 3GGGA 4H59A 4CTOA 4AKIA 3QXCA 4FFBB 4FI3F 1DGQA 4X20B 4YQYA 4W99A 2BR3A 1X8JA 4BMZA 2FMKA 4RETA 1DFGA 4UJ5A 1GZ4A 3O91A 4A1OA 4FOSA 3ESQA 3QOYA 5IVKA 1QHXA 1NIJA 2F3SA 3R4CA 5JW6A 4XR4A 3NTUA 5EXDA 4ZAFA 1EVJA 1BVUA 2RDMA 4ZRNA 1GGKA 5H4HA 2JAHA 5K51A 3RYTC 4HH3C 4KDFA 4TZ0A 2MTBA 3CX4A 4WNAA 3MFDA 3CZMA 3L0DA 4AF7A 1HO3A 1TB4A 4MVCA 2FTKE 1ZNYA 4EW6A 1XQXA 2B4RO 3M83A 3ORQA 3O3NB 3TW4A 1YZUA 1ZOIA 3T94A 3QBJA 4RD2A 3GROA 4MUNA 1ADJA 3QUAA 1EWQA 1E62A 2X3YA 2X3UA 5FD8A 5B12A 1DJMA 1M8FA 4MTCA 5TGTA 2HD4A 4LPKA 2Q3CA 4B32A 3HJRA 3K5IA 3DCYA 1OXXK 4P4GA 3SHFA 5CH3A 1HE4A 1JV2B 3LLSA 4LTMA 4BNKA 1YQEA 4MUHA 4EHBA 3EY9A 4XIJA 4S1WA 2X58A 3RD5A 3UHPA 1QBKC 4D5GA 5AKJA 4TWBA 2FMUA 5B7QA 3IKLA 3GMIA 1KOJA 2C29D 2XHZA 3SVZA 3QQPA 3D02A 3FX2A 1WABA 1FLVA 1E3JA 3H4TA 4MX8A 4DLVA 3C6ZA 3UG7A 2R8OA 1DXYA 4Q7MB 1W0KA 3OIFA 4HQFA 3OMWA 3QLEA 3ODGA 3MUOA 1YDMA 3R7WB 5C7YA 4WPGA 5EWLB 5MN5A 3ZV5A 2W8BB 3F9CA 3L7NA 3JAKB 2PYDA 5CT4A 2Y99A 1PFWA 4L4YA 4WSOA 1TVKB 4N0DA 3ISJA 3U4IA 3KOUA 3LRXA 3HSKA 3BB3A 1KI2A 3SD7A 2NP7A 1G3UA 2Q41A 1KI6B 3ICPA 1X7WA 1Q11A 3ZV3A 4EO9A 4XVUA 1IDN1 1DKQA 3AC0A 1KNXA 3P9YA 1SY7A 4N54A 3N76A 4QBFA 5FTWA 1B1AA 2FVYA 3MC1A 4EW3A 4JU8A 2E2WA 4YJ2B 1CJUC 3FF4A 3JQAB 3PC6A 3WV4A 4FGUA 3U49A 2CXSA 2O14A 5IG2A 1M5UA 4BO8A 3BFKA 2IOHA 1I7QB 3WNCA 3ZCQA 3KZCA 2F8SA 1AK9A 3C3XA 3R5FA 3HZOA 4JY7A 3P2JA 5F1YA 1CJBA 1FLAA 2HREA 2I4TA 2VP6A 3VR3A 1JGTA 4CR7A 4KV9A 5DPMA 4I9GA 1JR3D 2WDPA 1HE2A 5JS8A 3HVUA 2G04A 5EIWA 2EC5A 1PZNA 2C78A 2F3RA 4NV3A 4BO9A 5IJ9A 4WY5A 4AU1A 5IUJC 1KHHA 2F1JA 4GBMA 3FJ1A 3VR2A 2HK7A 1Z6QA 4IV8A 3VV3A 4PRZA 4TSFA 3FFWA 3HTXA 3MWGA 2LPMA 2MINB 2IS4A 3B8HA 5KOJB 3K72B 1T0JB 1VCIA 3EIUA 5EHIA 3ZCTA 3ACDA 4P82A 5B4VA 3L0YA 3AF5A 4FYIA 1IZ8A 1JDSA 2DM6A 4YNBA 1EK5A 1H65A 1NBEA 1P3Y1 2C4UA 1IHUA 3FETA 1F0NA 2YTZA 4IH1A 4IDOA 4NV0A 4RABA 2AOVA 4E5YA 1RAAA 1X7GA 3E15A 1DCMA 3LUJA 3NRCA 4A2CA 5KJEA 4C2AA 1R4NB 1IQUA 1R9JA 2RHDA 1Q1GA 4RS3A 3I2HA 2FLKA 4TQGA 4KAJA 1KKUA 3HKDA 1SVLA 1YS7A 3PXEA 3B8EA 5KZMB 1T4MA 3Q9UA 1R18A 1H6BA 2CB9A 1C8KA 2I4OA 4H7IA 4UUBA 4XDHA 3SOPA 2RHCA 1JNYA 1T2AA 3F3SA 5FUQA 2JDID 2FP4A 5JNTA 2QAGB 4E21A 1ABEA 3FVVA 2DKNA 2DWCA 5AM0A 1J24A 3ANYB 5IHPA 5E6UA 5JWOA 3C7DB 5FL3A 1MB4A 1VSUA 3GIDA 2GM4A 1JJVA 3ZBQA 3BQ9A 2HIAA 1UEJA 5LLSA 1YFJA 1TUEA 3LC0A 1TF2A 3D5TA 5EJFA 2HNBA 2Q5LA 2DR0A 2KPOA 4OHYA 1GCOA 2HEIA 3JASB 4CLHA 3L40A 3IRVA 3MJVA 3WIEA 1YJCA 4ZVVA 4R41A 3B5JA 4FGJA 3TLBA 3RSHA 4UFOA 3ZFTA 1AZTA 2ZB2A 4HDOB 2QX9A 4MUKA 3IVGA 4E1AA 1OUMA 3FNFA 2IRWA 1XCLA 1ZIPA 3E7WA 1HBJA 2FKAA 4M1KA 4RA9A 4BUZA 2J9FB 5JQWA 2QXYA 1NX9A 2B3DA 4S12A 1Y6JA 1RM5A 1TTQB 3KL2A 1JTFA 4U00A 3UC9A 2WIAA 4DYDA 3NHWA 1DAPA 2VPZA 4G1CA 3EF3A 3MIIA 2D62A 4TRNA 4W5RA 4GZLA 3N3AC 4I08A 2VA9A 4QHTA 4WFIA 3CF2A 3DQQA 1Z34A 1DL5A 3RJ5A 1QH1A 2AKEA 1NN5A 1O95C 5BMOA 3RIMA 2G1AA 1M67A 1TAHA 1TKCA 2W6MA 4CR8A 4EF6A 3QKTA 2BM1A 1BDIA 3TRFA 4K03A 1Z2PX 2IHVA 5KNBD 1VPTA 3HKCA 1JG3A 4CEJB 1CBUA 2N0SA 3CZ4A 3NC0C 1GNQA 4FYYA 1H2RS 2J33A 2X5KO 4PZ0A 3VQTA 1Z2AA 3B1ZA 3IELA 2IYUA 2ZTSA 4BQNA 5CDSA 4CVNA 3KWMA 4HGNA 3RC1A 1QLJA 2GWRA 5FIUA 3OWHA 4DEYA 4F4DA 4OXNA 1UBNA 3AEZA 1QDEA 3AP2A 3K53A 3KZVA 3P2IA 2VQDA 4I55F 3DE2X 4N0EA 4MS4B 4Z3KA 4E07A 1F8YA 4IHAA 3I6ZA 3OCJA 4PHCA 2HWXA 3C6QA 2XRFA 3RIHA 3LU1A 1L4KA 1Q20A 3GI1A 1KO4A 1HYBA 1NY6A 1XVUA 4MKXA 4PQGA 1YGYA 4JLAA 3TE6A 5J4HA 3GUCA 3KAKA 4OUKX 4YO7A 2WE7A 3BM5A 3C97A 4PYKA 4URFA 1NA5A 3BRQA 2NZWA 1AO0A 1TVMA 1QVWA 3AUAA 3LPDA 1FDVA 1E9EA 2XOKA 3LOUA 1E2FA 3LPAA 4B6SA 4E5DA 3RUHA 2IDZA 3ASZA 4HFMA 3MTQA 3QX8A 3I09A 3E9QA 2XVAA 2VTEA 1JEOA 1MORA 4F9TA 5G02A 1DX9A 1LQTA 5IJWA 5KTRA 3DOIA 2CCGA 1DKUA 2IYOA 3O3CA 2AN9A 3MS4A 3BHIA 1IL0A 1VP9A 2AQKA 2EF0A 4IFIA 4L5JA 2PNFA 3GW8A 2PN1A 1DIBA 3AILA 4KHZA 4ITVA 1D2GA 2L17A 5I7OA 1EBUA 1LI5A 3KJEA 3QLTA 4D9MA 2MYUA 2FWIA 3BICA 3EODA 1NBOA 3MYRA 4GMXA 3WG9A 4BFYA 4ASUA 1PZGA 2IDKA 3EAFA 5K20A 3SM9A 5GJBA 1FMFA 5AW2A 2ALJA 1IZ0A 1CF4A 3P2EA 1M7BA 1OLXB 1YVUA 3QXJA 3ZY4A 5JO0A 3TL3A 4XSGA 1Z2CA 5FPQA 1RMQA 5LZ5A 3VGJA 1PT8A 1NGSA 5FADA 1UPXA 1XAGA 2VJDA 4ZO6A 5FA6A 4EI7A 1FDUA 5I51A 3KQVA 2AOUA 1MCZA 3CVWA 2I2AA 3Q6MA 2PD6A 4OTZA 5BWMA 3RRYA 2VYNA 4TTQA 3B6IA 3RQSA 1KMQA 4EHIA 1QIHA 1U7XA 2DQYA 1AKUA 1WUKS 4IGEA 1P6XA 4MITA 1RAIA 1J1UA 4R8MA 4PTYA 4RGYA 4LF8B 2W6OA 5LA6A 2BMAA 3CF6R 4O1MA 1AUPA 2BJVA 1QX3A 3DHNA 1AKYA 2XTZA 3KALA 1PS9A 4FFSA 3HCWA 4QU5A 3SBDA 3PWSA 3RTBA 3TLAA 1AKMA 4QFMA 4AMGA 3PRKE 3CXUA 1H1TA 3O92A 4A03A 1WDLA 1V37A 3EISA 4TKLA 2A1UA 4N0MA 2J6HA 3DZCA 1ESEA 1J2JA 3ETJA 2ZI4A 3SWWA 2B6NA 3B3QA 4MQ6A 1CFJA 3NHJA 3WL5A 3QBEA 2VJCA 4A6DA 1JEYA 4QYTA 1PLJA 3IEKA 4JX9A 5FNVB 3UF0A 1EP2B 2LNDA 1I30A 2OYSA 3PUWA 1RABA 5CYFA 1LX7A 2XBMA 3IKJA 3KEQA 3KELA 3NH9A 4GEKA 4KH1A 3WL8A 2CLHB 3ZVKA 5TEVA 2QVLA 3HADA 3EC7A 2AFIE 5F33A 4JYBA 1LZKA 3WLJA 1LNSA 3M6FA 5JVDB 5AVOA 1R6UA 1IHOA 1NYLA 3ABQB 1YR9A 5CVTA 3B89A 1XJ0A 3GH3A 2Y9PB 1NUUA 4R1NA 4BVAA 5JDCC 1RMTA 3V6LA 2QUAA 4TRRA 4YDRA 4TZTA 1ZY2A 3GLSA 3V7NA 3QX3A 3LRPA 2DY1A 4OL9A 3SHWA 2VDNB 4UVIA 2V1XA 2D1YA 3RJ9A 4ZA2A 2AFVA 3E03A 4WHMA 3EXEA 3EIWA 1KDPA 1U65A 2B1JA 3EWNA 3UYLA 4BN0A 3W2TA 1UUFA 3W1WA 5KU7A 3M7IA 1VDMA 4YO8A 2QMEA 5GWXA 3SNKA 2UYOA 1Y9ZA 5HMLA 5CA0B 4O2AB 1C3OB 2RHLA 4PE5B 3UCFA 4HDCA 2CNDA 4YMSA 1MD9A 1RQ2A 3G2IA 3DXYA 3PGA1 5DEOA 4FM9A 5HHTA 4BNDB 1XCBA 5BSEA 1OSNA 3V3KA 5AYVA 4ER6A 1L2TA 1Q95A 3IP1A 3V3TA 4LJ7A 5C32A 1UL1X 4KRFA 4KFRA 4KGDA 3CLSD 1XZBA 3OJWA 4GP6A 1ULAA 2IYSA 4X3OA 2NSLA 1NU6A 4Z9FA 4C4AA 4EZBA 3S7TA 1RXIA 1O95A 4HQLA 1YR3A 3OIGA 4Y98A 2ZU6A 4A91A 1E2GA 1VL0A 1Z6TA 2G0AA 2XQVA 3ZU5A 4YMTA 4ZIRB 1FP2A 3V1YA 4NX2A 4G4SP 4GX2A 1ECGA 1YZQA 4PC7A 3C5VA 1ZFNA 3PPWA 2GJSA 2ZJ3A 5DMHA 3RR2A 1I10A 3W9BA 2NUAB 1E9DA 1LA2A 1OFTA 3PXAA 1SUBA 4HNSA 1KDYA 1T13A 1GTJ1 3ZWXA 1BH2A 4YRIA 4RHFA 4KQ2A 4BASA 5KOYA 2IYAA 5E2BA 2Y1OA 2AC7A 2BW0A 3CRVA 1NL3A 3ESYA 4QJ5A 4YROA 2Q7OE 3SX2A 4D3SA 1F7VA 5H82A 2CVHA 3ESXA 4PZYA 3H17A 5THKA 5D2CA 4ZCRA 1Z6ZA 3IMCA 3TSWA 4EB8A 3PTAA 4O3MA 4UMVA 3UBMA 1R37A 4K26A 1JPJA 3LHIA 4ZOCA 2IEZA 5B1SA 3MW8A 3FDFA 4HUQB 4M89A 4A10A 5I9SA 2D7DA 4XI9A 2PVPA 2HPVA 1SBTA 3LMKA 2AXNA 1EINA 4JQYA 5LZ7A 1UK9A 5F98A 3HA5A 2V4ZA 1H94A 2K4MA 3LVQE 2DSNA 4HWKA 4J76A 4DEXA 2YRFA 3K1AA 1P80A 3ZQ4A 3W5DA 1B6GA 4K5QA 1EJ0A 2WHEA 3I64A 4ZP1A 4V1CA 5BWBA 2X0EA 1Y8ZA 4PVCA 1PZXA 3TD2A 2VWQA 4FGZA 1V35A 1JSRA 2BONA 1GKIA 2XZLA 3F2VA 4JBYA 5CXUA 4O3FA 5ILOA 3HBMA 3O7MA 3ZGXA 3KZNA 3PEVA 2O2IA 4HAUA 3P1JA 1TK2A 1H9AA 2W43A 4MRMA 2V7GA 3FWZA 4Y9SA 1BHSA 1RBQA 5TF4A 2Z6UA 3EUAA 1NQOA 3DZKA 4G1MB 5FFFA 2FWBA 2P79A 3KTAB 4D99A 2I78A 3I92A 3NBUA 1RJFA 5DK4A 4AP9A 1RYMA 2G5PA 4GOOD 4C0WA 2P9EA 1YO6A 4YYZA 4NE7A 4WOKA 4UQPA 1RXUA 3Q87B 4I7EA 2BE7A 4GMDA 1YJQA 2HF2A 2BZGA 1MX1A 4MRNA 6ADHA 3NDBB 2JRLA 2IYYA 2OV6A 2CE7A 2GO7A 3G8YA 2VDMB 1ECBA 3U4AA 1HI9A 1UBKS 4XB1A 1NKSA 2P78A 2QN7A 2QN2A 1AS0A 4Z0HO 2WV7A 4CT5A 4EY5A 2QMYA 1P4RA 4ZZ1A 3A6ZA 4DSNA 3K70D 3KQUA 4MQUA 2Z1DA 2D13A 3IQIX 1L5OA 2JHAA 5B7NA 1YVEI 2N9UA 4WBXC 5BOVA 2XCTB 3H19A 3HCAA 4L50A 1KIFA 2VF2A 5THQA 4JI3B 4FB5A 2WPDA 2XKAA 4WJKB 1DC5A 1T8TA 5BRAA 4B6PA 1D5WA 4IGKA 2FPPA 1U81A 3CH4B 4P3PA 5ENVA 3I2FA 3WLTA 3OVMA 2VWGA 1C50A 2OK7A 4KB5A 1ZIYA 5EZ5A 2VJMA 2XVXA 1FW8A 4WQMA 4RK5A 2JGAA 1XXLA 3HGTA 4XX0A 5EHNA 1QH8B 2E9SA 3KLMX 2FSHA 3DDWA 3D0OA 1HZJA 5GGYA 2WUGA 1RXCA 1OYVA 4PN7A 2A3NA 1SEVA 2TSYB 3AFMA 4O02B 2Q6VA 2SKDA 4TV8B 1U5BA 5EHQA 4CKWA 1Y8QA 1CQJB 1P6UA 2CUZA 2EKDA 3A4MA 3UH0A 2YFHA 4MW2A 5AK4A 4C6RA 4EWLA 1U0TA 2GCGA 3O2QB 1O8CA 1OOEA 2WSMA 3AO0B 4JLDA 4MYUA 1PJ4A 1PZFA 4CLOA 1NN1A 2QMOA 3OOYA 5DP1A 1QP4A 1UXIA 1LNZA 4TTAA 2I3GA 1AK2A 3B6MA 4HZUB 3PDWA 1DV2A 2YZ2A 3EWIA 1ATIA 3HA3A 3OU6A 3KDAA 3PL5A 4PZ9A 4H77A 1GPAA 3IPRA 3VR0A 2ZUWA 4IEFB 5DWDA 1PWHA 1ZMBA 5CPFA 1T1EA 2NZYA 1N2XA 3GRCA 1C7JA 2JIRA 1Z88A 3TJMA 2AR7A 1I2AA 3MTJA 1RRVA 5COQA 4ABTA 5K8CA 3ZBUA 1NJFA 4U9IS 3NOVA 3OPYB 5I7AA 3R75A 2B1GA 5F23A 5M34A 1CZKA 3B51X 4UMFA 1WHSB 1XTUA 2JJ1D 3NHSA 1UKCA 3FFXA 4QRDA 3MWDB 1XR3A 4Q7KA 3THSA 1BX1A 1DO0A 1GILA 3SSAA 4CMKA 4ZCMA 2FEWB 1U1EA 3WYBA 4RDXA 3S8MA 1WSBA 4LZNA 3RRMA 2YXPX 2VQFB 1MV5A 1NY5A 1WUYA 3PWTA 1LI4A 1V6SA 4JITA 4UVDA 2OA0A 3V2GA 3IHKA 3VNRA 3BSYA 4OL0A 2QTBA 2VDOB 1NV8A 4X1IA 3V7UA 4DCUA 3IB6A 4G0MA 4W7IA 3EOBI 3N8NA 4LF6B 3HUEA 4H3VA 2O2DA 3WLNA 4ZCIA 4E31A 1LBTA 1QORA 1SUIA 3DE4X 4NZOA 1CJCA 4BMNA 1NSFA 3PC4A 3UKJA 3W8NA 4RTKA 3K30A 4K6CA 4F7DA 1IQPA 1L1FA 4INJA 4MVJP 4LGYA 5JAHA 1QE0A 4WKPA 3T9CA 2IZZA 3PI7A 1X1AA 3CEPB 1T3HA 2FZ5A 1QVZA 2HQBA 4WVFA 5I01A 4HNAA 4IW3B 3IPXA 4EGFA 4DDKA 2G9RA 2IOQA 3LQFA 4RY2A 2GAFA 1K63A 4FHZA 4WA7A 3N0RA 1EJ2A 3JZAA 3NAZA 2Q7DA 5BQPA 1YRWA 2EFCB 5C8VA 4LUCA 2PT6A 4MJLA 1TK3A 5K6TA 5L6MB 5FFMA 3VXKA 2W6QA 4MUIA 5DHAA 5IAJA 4L4UA 4D44A 3WAGA 1NQXA 1JL3A 2XXBA 2NU6A 4BVHA 3U19A 2CBXA 1C30B 4JYCA 2FWJA 1NLYA 5AHXA 1XZQA 2F8MA 3QTLA 5AW8A 1ZIXA 1QQ5A 3BFPA 1RD4A 4PXYA 3FTPA 3F2IA 2ZSBA 3RU2A 3HWWA 2BGWA 1TKAA 2QXUA 1LLUA 3S2IA 3VC1A 1IDOA 2RJNA 5KSOA 1YS9A 2V7QD 3OCWA 4M6WB 2Q6IA 4YMLA 3U40A 3GFVA 3ORHA 4H31A 4UM8B 2Z9DA 5A4KA 2VOEA 3BSFA 4KMRA 4B82A 2IZ0A 1O03A 2K2QB 4N7BA 3KT3A 2FK7A 2Q0XA 3EGCA 2BFAA 1MQAA 1TD9A 1W46A 4DKXA 5FEUA 5LD2B 4GKKB 2SICE 4GZMA 3BQMB 4KPUA 4GYWA 1ULTA 4AP5A 4LFAB 5CP8A 2OK8A 3COSA 3UQYS 3OX2A 2Z4RA 2EBWA 5KOHB 1XRMA 4FGKA 1RYEA 4XIGS 5K1ZA 4E5PA 2VPYA 2PGAA 5IAEA 4JI8B 4AJ9A 4YWJA 4GXRA 5BVHB 3RRXA 4HF7A 3VOAA 2WP0A 1EFKA 2VYQA 3RNOA 1Z6YA 2P9TA 4AJ2A 4IQGA 4JD5A 2G06A 4B83A 4HLCA 3UEOA 4YT4A 2EG5A 3HWRA 3AUYA 2OAEA 4Q9NA 4RFSB 3R5XA 3BREA 3VTAA 1JTVA 3ZDFA 1ND5A 2WT9A 1N2ZA 1AHPA 3Q15C 3PJDA 4A0HA 2PR7A 4HQ0A 1OJLA 2BZSA 5JJKA 1MNQA 2XUGA 3JRXA 4K1LA 3TNYA 1XF9A 4AKGA 2OB1A 2OLJA 1WZUA 3B2QA 4LI3X 4R54A 4ER0A 3S70A 4BCDA 4YRMA 4B47A 2UYGA 2ZFUA 3BORA 4FD2A 4DBVO 2IX9A 1V8OA 3HU5A 3UV7A 3P32A 3ZE9A 3ORFA 1UT5A 4K6KA 4FBGA 3B20A 1BVRA 3CNHA 3GDWA 4IIBA 4P7FA 3RIXA 3IAFA 4JEHA 1XDSA 3C7KA 2YWCA 1DIAA 1WPRA 3CO5A 4Q16A 3BPSA 4FGWA 1P77A 2R7AA 3AF0A 1Z5VA 3CWZA 3JAWA 2QX4A 4EPTA 3DTNA 5AW3A 1DX6A 4DIEA 4X65B 1Z13A 1H3FA 4F3YA 1I7SB 4KXMA 1Y89A 1FLDA 2W71A 4UVGA 1KSFX 2I7CA 3V8NA 4EP1A 5LP6A 3P9QA 1EDDA 2AGVA 3LGAA 2ZUSA 4WV3A 1MB9A 1OX4A 2P62A 1ZIOA 2P9GA 1BXRB 1KQNA 1C9KA 4KXXA 4BKRA 2A2ZA 1R8QA 2XZPA 1UQTA 2ZSUA 2LVBA 1BFKA 1MO3A 2Z8XA 3IQEA 3JD2A 1R6VA 1WQ4A 1X87A 3RG8A 1Q0UA 3IP8A 1QYWA 3ZX4A 5KSZA 1M2VA 2HJGA 2PWPA 5JHGB 3KK0A 1R0KA 5KO2A 4GP9A 4DG9A 1JMYA 2QI9F 3NQ41 4UATA 2A57A 3K0AA 1N6HA 3NYIA 1IUOA 3KKOA 2ZEJA 4OREX 4P53A 4FMBB 5KHLB 4TPKA 4E11A 1T2VA 1EQ2A 1Y5IA 4LYEA 4TVKA 3RRZA 5IFKA 2ADFA 1VCMA 1VKRA 2NO7A 4GSYA 1TTHA 3GELA 4LK2A 2BSAA 5ALOA 1QZ3A 3ZDXB 4B3SB 2HUNA 1LRKA 3ZFOA 1YQDA 1JJAA 3PEYA 1EFPB 1JLHA 2GM5A 3RVNA 1NASA 4LVNA 5JAZA 2LWIA 2I7XA 4WECA 5SV2A 4YV0A 3EG9A 4EEKA 4JT4A 1O1YA 1P19A 4TS9A 3N7TA 4F86A 2DWPA 1QIMA 3VNVA 4DJAA 1BXKA 4G86A 1F3LA 5HK8A 3JQBC 2Z8YA 4NICA 4D9JA 3P0EA 4ROTA 4YRRA 2AN4A 4YRJA 4XWOA 4IZIA 1QV9A 1T8SA 3VMMA 2BEJA 3KUCA 2GVDC 4B9EA 1K08A 1AKQA 2XMPA 3DPUA 4EI8A 4PQEA 4NEQA 1OT3A 2O6LA 4JEMA 3T1HB 4H0FA 3IS3A 4N47A 2WJYA 1IZYA 4EZEA 3CUEF 1I4WA 4JP1A 1FB5A 4OQFA 2ZRDA 3KZ1E 2LW7A 4TYMA 1YBVA 3TTWA 2CSXA 3GRYA 1LLQA 1E5XA 2A5LA 1ZMTA 1FTNA 2VF5X 2NO6A 2LZ0A 3AGPA 1K27A 3F5MA 2GETA 1TA0A 5LQUA 2QTMA 1J8QA 2ZUDA 1OAOA 2VUSA 3ZJUA 3T1TA 1NXVA 5BXYA 1J0XO 1A5ZA 3FUUA 3V42A 2HMAA 2VTBB 4OHMA 3ZHVA 1P4AA 3O6VA 4YP9A 1GGNA 3C3JA 5IANA 1FQJA 4BGIA 3NONA 4B43A 1QU2A 3WYAA 4JI7B 3OEED 3ZDDA 3JQGA 3ZKWA 1OC4A 1BMQA 3VPCA 4HRXA 3KKLA 5LC1A 1JAYA 4A26A 3AZQA 5IKEA 1ISSA 1UAYA 1AIPA 4M55A 4RWZA 1T3SA 2BI7A 2R7KA 4Q3OA 1ZI9A 1KI7A 3B3AA 4EDHA 3DW1X 2B36A 2HF7A 3R5HA 1C81A 5T57A 3CLTC 4K9QA 2ZSFA 3WYFA 4TKVA 2WJWA 1LTQA 5H9VA 5A4AA 1M2FA 2H7XA 4F6CA 2ZBDA 1KERA 1L6RA 1P7PA 1WE2A 2A67A 2E4VA 2WF5A 2C3UA 2WPNA 3BHJA 3E7FA 3H9CA 3QUQA 5CVEA 2EATA 5LBTA 3SEZA 1EDOA 3GJXC 4IRXA 2P9CA 4O5AA 4QDKA 1SAYA 2VF8A 1N1MA 1NSYA 1HDXA 2DTEA 5AJYA 4KQIA 4EUNA 2A9FA 1YB1A 3PK0A 1R9NA 1KYQA 4B85A 3LUGA 5EJGA 4H6WA 4OA5A 1L7MA 3ZHOA 5KWSA 1A8QA 4UAJA 2V8OA 2NSJA 3AEUB 3PFGA 3MJHA 4QPNA 1KYTA 4UCFA 3OKCA 3EN0A 1IY1A 3N2ZB 4MW1A 3LT1A 2G9UA 3C5WP 4BJ5A 2WTUA 1H8EA 1TO2E 2VP0A 3IMGA 5HIIA 1U11A 2XQJA 1NRIA 2X8LA 2AYZA 3EMVA 1DCTA 3EDQA 2UUAB 2XMGA 4HMOA 2PRSA 1V96A 1YUBA 3DFIA 4HDKA 4PX3A 1GUFA 3VZCA 4M1WA 2R751 5FPYA 4TOIA 1JHMA 2OCBA 2B4AA 1NW9B 3EW9A 4Z1MA 3ZV6A 2ZUEA 1FSPA 2DY0A 4GPIB 5IM4A 3ES9A 4NMHA 5JROA 1NVGA 1C0KA 2OO7A 3BXOA 4W1SA 1XXHE 2OTCA 2QL5A 4LW8A 1EBFA 2HLPA 3DJFA 1G5HA 4J3FA 3RFFA 1HT0A 4E15A 5ISMA 1OH7A 2CBGA 3IO3A 3MYYA 3BGDA 3DTYA 5JZSA 1GQ2A 1XLVA 4G41A 1OIVA 3TQHA 5T8KC 2N1MA 3JWIA 2HBYA 1BQ3A 3O4JA 2CJWB 4K0KB 2V74B 4DCSA 4GDFA 2ZE7A 3UAZA 3VZSA 4PM4A 2RHTA 2EQ5A 1Z5PA 4C3OB 2DSTA 4NG5A 4KZPA 1KBQA 3PX2A 4YJ3A 3ITKA 1V0JA 4U2EA 4WEQA 3FVQA 4BB6A 1RKUA 1TXGA 3FSEA 1WXGA 5ER9A 5BVGA 1Y8AA 3GRFA 3UAXA 4RZ3A 1LV8A 1W36B 1LK5A 2GD2A 2EKPA 3ABIA 3V4FA 4M1ZA 3VSEA 4XWYA 4JI1B 4X5OA 2NT3A 1QC5B 4QSHA 3UO8B 1QWSA 4MQFA 3TINA 1KKLA 2IK8A 1X7HA 3C8DA 2RHMA 3D0KA 1CUFA 4OH7A 4H17A 2OFPA 2SCUA 3V2HA 3LY9A 2MOKA 3Q41A 1DQNA 3U7QB 3W34A 2GNPA 3GEPA 3VYSB 1NQAO 3WLFA 1WVGA 1NSTA 3WRYC 2XZOA 2AMLA 1ENYA 3LECA 2NXCA 2ODEA 4EO7A 1I4DD 4F2DA 3NHFA 4E2YA 2LCQA 2CNWD 3LDUA 4JYAB 2QUBA 1C3LA 2AYYA 1E1KA 2PYZA 3HLTA 4OBWA 3UAOA 3A4TA 3M4XA 4S0XA 1GAXA 3A6DA 3BMNB 2O1EA 5MN4A 2VZ9A 4FKBA 4HOYA 3AVYA 2AFIB 3OJFA 5EKDA 4DAEA 1YS4A 5KQGA 1MAAA 3LOQA 2WKRA 1Y1KE 4GOJA 5AI5A 3ZHTA 2G5GX 4ATNA 1JP7A 1E9AA 3IIEA 3KV3O 1YQQA 1KZ9A 1R0RE 4QBKA 3MMSA 2JFOA 3EXHC 3JYLA 5C8XA 1MF7A 2BFFB 1RQ7A 4CN8A 3D43A 3OC6A 5JJBA 1DWQA 2JK1A 1AXRA 2LR0A 3RC7A 2ZUBA 5F2NA 2PUGA 1WAMA 4B17A 3IQWA 2V59A 2V7BA 1EP1B 3LNCA 3SYTA 1BFDA 2JEOA 4A16A 4BFUA 1PSZA 5CJ2A 3SEQA 4AY2A 1CLEA 4TRMA 4Q4JB 2PGOA 2QMQA 1W2GA 1DRWA 2JJ2D 3WHIA 1A9RA 1QXSA 4FFRA 1TPZA 2VK1A 4QU8A 2JH3A 1RWKA 5ALFA 4HFRA 3KX2A 1GLVA 3KQSA 3DHEA 3FSGD 3LK6A 1AA6A 1M1UA 4K46A 3IURA 3RNLA 2OCAA 1SVNA 4TV9A 3J80A 4BV2A 4MQEA 1OQAA 3ILYA 1L5HB 2YDYA 2UXDB 1GU0A 1OZ0A 1X94A 5HCIA 1L5VA 2RK6A 2WHPB 1GFZA 3PNVA 3R8FA 1V8FA 2ATVA 3BRWA 4FIZA 4EDFA 4M9QA 1W94A 4UASA 5AM3A 3EBLA 4C0XA 3HWSA 5LZ2A 2QIPA 4U2FA 1P2FA 3RUCA 1H5NA 3ZD7A 3L1VA 2HYIC 3CJTA 4IIFA 4PSDA 4BB0A 4DGSA 1VZ3A 4DJTA 1BX3A 1Z4LA 3I32A 4M1SA 1J90A 5CH5A 4AXXA 1NQVA 5F76A 4BVBA 3IPLA 2QLMA 5B5SA 2JGDA 2QYSA 4HNQA 4RL4A 3E5RA 3OLWA 3TBKA 3L1KA 4ZYWA 1PK8A 3RB8A 2JLCA 4BLPA 4XUEA 3ZWVA 5FBHA 3A6GA 3ABOB 1K3TA 3OMXA 5CEEA 1IUNA 1NTOA 2IIBA 2AEJA 1ZH4A 2ODPA 3GLFB 3HDVA 4KQ9A 4IDPA 4PR3A 3GV0A 4H18A 4J90A 1A8UA 3ZDYB 4I2VA 1FOEB 1G8PA 5JJ5A 1S02A 1KPHA 4MVJD 1R9GA 3A05A 2O8BA 4OA8A 2B1IA 4S1OA 1THGA 4MGHA 9GPBA 3I53A 4I6EA 4JCOA 3H1EA 4EUKA 3DZFA 3PVSA 2QG6A 2KLBA 2JHCA 4XPZA 3WLRA 2WJGA 4NOJA 3DMGA 1FFXA 4Y2XA 3LO8A 4H9JA 4LXQA 1A4IA 5E1MA 2WWXA 1XDDA 4Z7NB 1K9VF 5JYEA 4YRNA 3C85A 1ZC4A 1UBOS 3WB2A 2RJ3A 4I0WB 1PZHA 2FEPA 2V6MA 4A0FA 3PQFA 4BP3A 5AVXA 2C92A 1TZBA 3SJZA 4BN5A 5K0BA 3HN6A 4HSGA 3REQA 1GTRA 3EPKA 1AKNA 4PSUA 1N8NA 4OAPA 1BW9B 5DWQA 1C7RA 2ODTX 1CDDA 4MKZA 3AKDA 4JDUA 5T8KA 5CIQA 4R6XA 1KVRA 3MB8A 1OYYA 4LZLA 4OFXA 1NNSA 2FNAA 2O3QA 3KTOA 4X7PA 4HNVA 2GHIA 1Z5GA 3VVLA 3D3KA 3FI0A 4CCAA 2ZUFA 1TUGA 2VQ3A 1Y81A 5BN5A 3UY4A 2WFLB 1MC4A 1LLCA 3FBTA 3H3XA 1V2HE 3PT9A 2IYWA 4FT4A 4HGRA 4KGZA 5DI3A 1KETA 3ZDZB 4EEXA 2Q5QA 1FDIA 2H0QA 2RI6A 2VDJA 3COYA 1SCUA 5HGJA 1JXAA 1X1EA 3VPSA 3W7VA 5BOSB 1NAIA 3A4NA 3TLMA 4BS9A 5FOWA 4F06A 1TC2A 3WKCA 5CA1A 3WDKA 3WI7A 2PSSA 2ETVA 2GS9A 5K0TA 3MWKA 4RDIA 5HKLA 3WIVA 4ARZB 1S7GA 1YIOA 3P0FA 1VBMA 1NJSA 1F2TB 5DT2A 4CLEA 1R5BA 2H2HA 1LH0A 1G2OA 1NVMB 1N9KA 1L7BA 2W58A 2VVTA 4D9KA 3JU3A 4DLKA 4LC0A 3OE5A 3RVKA 2XYQA 1XDWA 3WZ2A 1G5PA 2YZKA 5K5EA 4ZXFA 4JL8A 4PAOA 2FZGA 4L28A 3U3MA 3LYAA 5J4KA 1YF3A 2DT8A 4Y2QA 3NGMA 4Q3NA 4WBSA 5AT1A 3STXA 3FW1A 4OK6A 4GOXA 1PVVA 5C1BA 2UXBB 3F6BX 2GD0A 4NV1A 1O77A 2I6UA 3LBHA 4YRTA 4C06A 3SKVA 2I66A 3ZGNA 3ZK8A 4DMGA 1GEEA 4NE9A 4JBWA 4G8DA 4RESA 1AMNA 2VUIB 5J2TF 3LPCA 3OTOB 3I1FA 2X2PA 4M8IA 2POQX 4MYRA 1PYOA 1WU7A 1FJHA 2IYTA 4X6UA 5ALUA 3EXHA 4DR2B 2BGMA 4Z4CA 4YRLA 5JBIA 3I4FA 4JJ4A 3RS0A 4PX5A 4F2HA 1NW8A 1EAMA 2YYYA 1F5NA 2JGRA 2WJJA 3DTVD 3IP3A 1THTA 2GA8A 3TEMA 2AJCA 4MCIA 1UFQA 1XRSB 2BMFA 4HDMB 1IE3A 2RFLA 2Q07A 1DXQA 1X1SA 3HJCA 3ENKA 3HH8A 3B6JA 1YL5A 1ZGGA 4WA8A 1M0TA 1QO0D 1YE5A 2OBBA 2WYVA 4K05A 3RDPA 3AG5A 3LO5A 4B4UA 5HZMA 5LKRA 1A9YA 3OA0A 3K6SA 3NALA 1VCNA 4P34A 5FUVA 3OCCA 5IARA 3BGVA 2R0QC 4YAFA 2B69A 2XOEA 1OPRA 2BGRA 3S1AA 5ELLA 1E2LA 4EW1A 1U7HA 2XNDA 4LZZA 3BMQB 2IHYA 4NG4A 4X7BA 5GQSA 4O33A 3SQOA 3U6BA 5AO9A 4BNFA 4XUDA 2PVSA 2IQ5A 4IIJF 1KFBB 3D7LA 4EL5A 3CG4A 3H8SA 2BKUA 4DJEC 4QJ3A 5BXQC 3ELDA 2KBFA 3B9BA 3RIYA 3WGTA 4COOA 3JQ9C 3DF7A 3FXAA 3GR6A 4DN6A 5EJ2A 1LI7A 2NOAA 5EWJB 3TFWA 4X00A 4MV8A 5K09A 3LVRE 3F73A 1FNSA 3DOHA 1W9HA 4NDZA 3VBCA 5JASA 1NJ6A 1SZDA 4ALKA 3EVCA 4NAVA 4CKCB 2PXHA 1D4FA 3X1ZA 4F60A 2O8DB 2XMRA 2DECA 3IILA 4B3GA 4AWXA 3A1SA 4K9SA 2JCXA 2V5AA 3N2LA 4OXQA 3VU8A 1E18A 1K5HA 1WUHS 4HYEA 2QUHA 3EQ7A 3QF7A 5D3KA 3X1DA 4RS4A 4D8VA 3AZPA 3K2EA 3JVVA 1FRNA 3B3JA 4N82A 1PQWA 1HR0B 1TCUA 3FRIA 3N2YA 2ZSJA 3PFBA 4TTRA 4UAUA 3PNPA 4C5AA 4V2UA 2HT1A 4O4HF 2IU6A 3IIKA 2X8WA 1FFYA 2QRJA 1WV1A 4HNHA 5LMZA 4KX5A 5CH8A 3RK4A 1H93A 1V4VA 2A5JA 2H7YA 2YUTA 5F2EA 3SJCA 4ICIA 5BSTA 3QVJA 5D1NA 1V11B 1J56A 3RTAA 5C7LO 1Q2UA 2UU9B 3LUDA 3HKEA 4CM3A 1B0UA 2R8XA 3PNQA 1HEIA 1W52X 3L04A 4XWAA 1RE0A 1MXHA 2P3LA 2ORIA 3IRUA 1LLFA 4C5BA 1D2NA 3OQOA 1N78A 4Q0MA 1NJ8A 3DMRA 3VDRA 3LUHA 2ZJBA 1G41A 1VGRA 3JALA 2F8LA 1V25A 3G0BA 3N28A 1PO7A 4L4XA 4QYIA 1VI6A 4MB6A 1Z18A 5KHAA 2VC2B 1AMUA 5LBUA 1GR0A 4OK5A 2H1CA 2REBA 5A1TA 2YV3A 4RL6A 2IPOA 3WXMA 3BSWA 3DDCA 3VJRA 1P5HA 3QUBA 3AUKA 1Q14A 3MA0A 1MZPA 1O96A 2JW5A 3MINA 3OZGA 2XYVA 3CZ5A 3JYHA 2C20A 1F48A 1YKSA 3I39X 4CM8A 2DP4E 4QUHA 4BO3A 3CX3A 5EQJB 3FYUB 4CCYA 2O3SA 5JIBA 1EFAA 1VE9A 4RMHA 1QS0A 1CYDA 2GCEA 1YZHA 2A9PA 2QPOA 3ONFA 4EB6A 3FGZA 1JTEA 2YICA 3NG1A 4D8TA 5I7SA 4V1CI 1SOUA 3Q7PA 2DKOA 1FUUA 4JN6B 5DKFA 2MSNA 1KA9H 1NF2A 4F5DA 5AFSA 3TGPA 5AVYA 3VI3B 1N2IA 4J0HA 4D1YA 3EGDA 3TWOA 4KNYA 3S2EA 3W06A 4CQLB 2XUPA 3U26A 4BFSA 2P9QA 1QG6A 3ZK7A 1TYAE 3VNSA 2H9AA 2QU8A 5DHRA 5E95A 2RAUA 4JLJA 4HTFA 4HHEA 1SR8A 4ZAVA 1SELA 1KMIY 1RHJA 1NPYA 3ED5A 4B87A 2AI3A 3TDMA 4FEAA 3ZGOA 3NUGA 1DO8A 2JBAA 4C7OB 10MHA 3AP3A 1I3MA 3G8CA 4I4IA 3UOAB 3WVNA 1Y0BA 2R6GA 1L8XA 2R1TB 1AN0A 1E2PA 2D8AA 3ANTA 2JRCA 1G5QA 2HW8A 3O4VA 3EX7C 2B8TA 3HR8A 4FQ8A 3PR3A 2GEDA 2VZLA 5JQGB 3DCJA 1LV7A 2R6CA 3BWMA 4DTCA 3CNNA 4L1KA 5ICEA 2P5SA 3GLKA 3PR2B 1ONPA 2PV0A 3OZCA 1YK1A 1U3CA 2JASA 3EEFA 3EFOB 4N5DA 3B5IA 2H0RA 1OLOA 1QYCA 3ZTWA 3PGKA 5KEIA 1K5PA 2C0PA 2JGNA 2XX3A 3B6KA 3CCFA 3P27A 1SXJD 4G97A 4IG4A 4WW0A 1O9BA 3CZQA 3FCOA 4H7DA 4INZA 4NPCA 1WMFA 3CY6A 1VGQA 1DOAA 4CEHB 1MUUA 5DHPA 3OCYA 2QTVA 3SIXA 4XWKA 3UMJA 1N3YA 4QE3A 3VAZA 1LC0A 3AETA 3QWAA 2HTEA 3SXUA 1Q7EA 2EXXA 1DARA 1D5CA 1T9KA 4ZPXA 4CFYA 3T7IA 4D8XA 4E51A 5DW3A 1Z74A 2KQUA 1MHTA 1G20A 4O6VA 4DCCA 1JJBA 1YJAA 1Z6AA 3HRIA 2IUYA 3RC9A 2HIGA 3MUFA 1E8MA 4J2TA 4RNCA 4RD1A 1IBRA 4GGMX 4P7GA 4XW2A 4B7CA 3X1KA 1J4AA 4TMXA 3TRKA 3O8NA 1XTZA 4LDPA 4ARIA 4MLZA 4DRYA 1RKXA 4Q34A 4CUKA 2PGDA 3FUXA 3DYVA 1EM8A 3MWYW 1Z37A 4FW9A 5I9IA 1G16A 1LVGA 2PT7A 3D2CA 3HVKA 3OG9A 3HN7A 2FI1A 2Q0HA 5C37A 3L5KA 3WMWA 3IPCA 1EUDA 5JS7A 1D2AA 4WCDA 3JQ9A 1WXEA 2ANBA 2BFOA 3GU3A 3PUKA 5CB4F 2V9ZA 1K8RA 2ZBPA 4EYGA 1RPZA 2P2NA 4LIPD 1K5GA 3RAFC 2YXLA 1HL7A 2VOJA 3MWEA 2BTQB 3G0IA 1BAPA 1U0OC 4DQDA 2CYBA 5JNWA 4JVSB 5DGXA 2C7VA 3F90A 1LSJA 3IAXA 3GOQA 4HR7A 5AMXA 4BNWA 1FVFA 2R3SA 3FCSB 3K0CC 5MDHA 3E58A 4ZEWA 3JZDA 3FUTA 1M8JA 2O4CA 4O59O 1R0XA 1HQKA 2XWJI 2FJUA 4KV7A 4EKIA 3MAGA 4FIDA 2AHRA 5G2OA 1E92A 1VLZA 3HB4X 2Z9CA 4X1KB 4IIJB 3NAGA 2FOXA 3FN4A 3N5CA 5E6RA 1IZ7A 1XEWY 3ZHXA 3NC1C 4B5LA 3IDFA 2CFRA 1XWWA 3PPVA 2ZE6A 4NPAA 4NZMA 4UEWA 2CMFA 4XWTA 1E7SA 4RF4A 2VHYA 1EXVA 1I5RA 2RHGB 4D4HA 2H1LA 1LZLA 1SKYE 5K3SA 1BN7A 3DMYA 2EZ9A 2PSEA 3X1XA 4Q4CA 1Z5UA 3G8DA 4IVPA 4YRAA 1CETA 4G5XA 1JHXA 2V6FA 3AU8A 4Z99A 3KKZA 5FWXA 2JJMA 2QD5A 3V34A 1UJCA 5K3OA 4B3TB 2HSZA 3KEOA 2QX8A 1HZZC 1RHMA 2ONKA 1I0LA 4EENA 4AKHA 4HGYA 4BKMA 3GLTA 4FKMA 3LV8A 3QVMA 4GF5A 1Q21A 4I1SA 4Y1EA 3LT0A 1V8BA 4ZEXA 4EKNB 2EBUA 3CCCA 5AJZA 4ZK2A 3PHHA 1UFRA 1QH0A 2YN4A 3KYBA 1FSFA 1WS6A 1DIOB 4RPGA 3Q1KA 3JCZA 4U5QA 4D42A 4F1JA 1WF3A 3FM9A 4L0MA 1ZSVA 5FWYB 2HJWA 4NJMA 1W30A 5SY9A 1OFVA 5JECA 5AKGA 3MTGA 3NAMA 4LWPA 4BNNA 2HO5A 1K2VN 2UUCB 1NBWB 3N74A 4MR7B 4S2EA 4EPWA 4YDSA 4CQMD 4AFNA 4LV8B 3HUUA 5IJ9B 4HUJA 3N2KA 1CY8A 3CE9A 4RF2A 2BUAA 4AZ0A 3K8YA 4W5HA 3UGJA 2FWNA 2V9PA 3ELYA 4EUEA 2R8BA 3QWIA 3JRWA 4R6WA 5JD3A 1WXIA 2ZPTX 3F78A 3TH5A 5DHUA 3ZGZA 3CRQA 1OY1A 5A4JA 5LSAA 3INYA 1X2EA 5JH7F 3WQSB 1DQRA 3TNLA 1JG7A 3BVPA 5CCXA 2NPIA 3NVAA 3TCKA 1IXSB 1KVQA 2G1UA 3C6KA 4WZAA 1XZGA 4UE3S 3RS7A 3R6WA 5IWCA 2YC2C 3VYWA 1REQA 4L6IA 4C30A 2ILVA 2IXDA 5CNKA 4D4LA 1KJ8A 1Y9EA 5IZCA 1RFGE 3G0HA 1D07A 4HPXB 1TEZA 5DISB 4DWOA 4UDNA 4RGBA 2F90A 3LX6A 3RV4A 3NHPA 4NYIQ 4LOIA 3GEDA 1W6RA 4C89A 5LQMA 1H4TA 4ND5A 2XE8A 3OY2A 2VHJA 3VNUA 2CXTA 3FTQA 3QX7A 1L7QA 5AW7A 1Z83A 5JBQA 4R5HA 1TYEB 1Z0JA 2ZIZA 4POOA 1P74A 1IYZA 3RANA 2R8EA 3T7JA 3LZ6A 4TL8A 1PX0A 3OURA 1ZWLA 1UBGA 4G8BA 1GPYA 2W6ID 4ENSA 3TSOA 5KYKA 1HDRA 4XLTA 3G7SA 2RIRA 2IYXA 5L4SA 3NBXX 4PYLA 2XECA 3C8ZA 3OCZA 3ADOA 2GPJA 3D6MA 1B8OA 3K5HA 4MAMA 3CJRA 2BFBB 5B4TA 2Q46A 1JZQA 5J5CA 3EMDA 2ORWA 1CS0A 2RGRA 1ECFA 4FZJA 4I3GA 4Y2RA 1VSVA 1KP2A 3S5JA 4OAQA 1BMFA 1LTHR 4BIMA 4N5MA 3NMUF 4UJ3A 5DM4A 4RA9B 3GHHA 2G40A 3ZIDA 4C2BA 1UT8A 2YQ4A 2XYPA 3BJEA 4PYRA 5FH9A 3PIIA 1SQ6A 3GQVA 4DUGA 5H8WA 5AUOB 5JPCA 4AZ0B 2KM1A 1V3UA 1SU7A 1T26A 4KBGA 4LHXA 3VDNB 3M49A 3IEMA 4AXBA 4GLFA 4JBXA 3ZW9A 4BE9A 4EM6A 3BKWA 3QUTA 4EZIA 3A9WA 4WIAA 4EY8A 2QLJA 2R1UA 3ZHCA 4JVOA 5JI3E 3NIDB 2EIXA 3L7DA 3I2IA 4QLOA 5JE8A 2H7VA 5PGMA 1BC5A 1MKYA 4G5SA 3CV3A 1NUSA 1TKBA 1CUUA 3KWLA 4RELA 5HX7A 1UKEA 1S2LA 3HKCB 3WNZA 5UKDA 3QEOA 2NU7A 5CTJA 3W5UA 5AW1A 5K0EA 4OQQA 2LUOA 4YTEA 4S1PA 4YQZA 2AWOA 1K7CA 4XIFA 4J2OA 3D2AA 3EF1A 5G41A 4E5UA 4CEIA 3UN1A 1AKWA 2JVJA 2GLTA 2QV0A 1LJ8A 4L3VA 4WDQA 3HCPA 4LAFA 1LWNA 3ZKAA 4CJXA 2H1FA 3BWBA 2IODA 2R7NA 3H42B 3KB1A 4M7OA 5DGTA 1DAFA 1PCXA 1XTSA 4RKYA 1QQAA 2C00A 2FR0A 3HB5X 4G0VA 1UIMA 2G7MC 2VYFA 3FVRA 3HXOA 3NEPX 3B85A 2CXXA 4URYR 5JC1A 3R7SA 3U3RA 2W2KB 4H15A 4WRRA 4ZZ0A 1IOWA 2RB5A 1EZ1A 2ZTHA 3NWJA 4M9SA 1NLMA 1V3VA 2VP3A 1L7EA 5KVQA 1V39A 1WRBA 1U7TA 4BLOA 4XSHA 3F46A 1HZZA 2EJCA 3GZ4A 5EE3A 5GINE 1PT6A 4B3FX 1JG2A 1NJGA 4DG8A 3ANSA 1EDZA 3LX4A 3V8MA 1C0LA 3QIVA 2H4XA 3V8VA 6REQA 4ON9A 1RLMA 2Y0CA 3AVPA 5EMNA 1DC4A 4DA7A 1MEEA 4DMMA 1QAMA 2FZWA 3RWBA 2X8AA 3PI6A 5ESWA 1VBKA 1WR8A 2B20A 3HJBA 1BCRA 1MPTA 3KVOA 1RI5A 3Q2OA 2O0KA 4F4UA 2CDAA 3DB2A 4KX3A 2CLKB 5FT9A 2ZSAA 1TOAA 3CRZA 4LYFA 3LD9A 3WLPA 3SKYA 1A96A 3NGXA 4UULA 1U2SA 1XZMA 4LC1A 4WXHA 4BTLA 4DS3A 2LTAA 1W5BA 1Q22A 1U99A 3O84A 4HVTA 5HF5A 4BUCA 3QFFA 1D03A 1AGYA 3IPAA 3RSLA 1YZVA 4KCGA 3G9TA 4MV3A 3OIUA 4PVDA 5AJWA 1K0FA 2YV1A 1WUTA 2YC4C 3H5IA 2Q8QA 2CK3A 2PFKA 4CI9A 4GR5A 2PQ6A 1UBEA 3I6BA 4J0KA 1PTJC 3L0CA 1N0HA 4FLEA 1NI4A 4AUKA 3DB1A 3QPDA 2I65A 1W87A 1OU0A 1K06A 3MS2A 4A73A 3ICQB 4ZVOA 4PSKA 4P0TA 2V7XA 3TW8B 4K3UA 3FWHA 2Z8ZA 3K6KA 3Q40A 1HOXA 5JG7A 3GDOA 4X3CA 3ZY3A 3AY0A 4OHUA 1UKZA 1MQ8B 4G2TA 4U6NA 3PDIA 1OILA 3A9TA 5CBPB 5TT1A 3FNIA 2HA3A 3F47A 3IALA 4QO7A 3LG2A 1L4NA 2A1UB 1VIMA 1Y1SA 2VTKA 4Q3EA 2Q45A 2WV9A 4RQAA 3WJ2A 1W8DA 1AZSC 4L75A 1GA4A 3ZW8A 1BEZA 1B6RA 1JEYB 3UCEA 4DRZA 2J5KA 4WK6A 3UVEA 3I61A 2OBYA 2X8JA 2R6DA 5FOVA 5GM1A 4PX2A 1WPGA 4UHDA 5TQ0B 4PWZA 4IDGA 1CDZA 3SIPA 1D4OA 1KPIA 1ZI8A 1PDOA 1AQ6A 2R68A 2VHZA 4R9SA 4MGZR 5IK2A 1Z56C 5JH7B 3UB4A 2ATXA 2J3DA 3GBSA 2VG8A 4KRYA 4E2FA 3MJTA 1HE3A 3W77A 2DHRA 4BNMA 3H97A 2JH9A 1WBJB 1G8KA 1GJRA 4ZCLA 4ZMBA 1TDJA 2PLAA 2E37A 2UZAA 4WY8A 4UDYX 5DYWA 5ED0A 4PNEA 1H4VB 1P60A 1XOIA 1TA4A 4Y6QA 5H02A 4X85A 4C01A 4JGBA 2VA8A 1U02A 2CGEA 1A9PA 2DQSA 1PR0A 5EPEA 5E7QA 3VPDA 1P44A 3EXEB 2B5WA 4G3XA 3U5ZB 2OGWA 1T9BA 2GEUA 3PHJA 4IJ5A 2JI9A 4RD4A 3O9ZA 4WKOA 5EIOA 4D9CA 2EW8A 2OR3A 1DEXA 2ZP1A 4RHCA 5DCUA 3SYRA 4AYWA 5CB8A 2NYAA 1P9WA 3BXFA 2YYAA 3I8XA 7AT1A 4OFZA 3NM5A 2EZ8A 4GECA 1LVUA 3QMVA 2OD2A 4OGLA 4WE3A 2W98A 2J0UA 1IZ9A 1G8GA 1N9GA 1Q15A 1U3FA 3EZ2A 3FGNA 2PWYA 5LU9A 3GFFA 3RK1A 3PU6A 1ISIA 4FW8A 4IDQA 4LZOA 5FO0A 2ACVA 2OCXA 1P8JA 2ZTLA 1BX0A 2G88A 2R5FA 5KYWA 4R1OA 1LRJA 2O0MA 1I9CA 3QWHA 3P9KA 3A2KA 2WY2D 1SC4A 5IN4A 5LZ8A 2Q9AA 2WP8J 3OSUA 1YB4A 2Z1MA 4ZI7A 4GI7A 4UTNA 2I54A 4EJSA 1T34A 1H2FA 4V0NA 3AEXA 2WB4A 2WSSD 4H60A 4RH1A 3IUNA 4BCCA 2F7SA 1JS1X 4MMZB 4N03A 1WMBA 1J33A 2EL9A 1M0SA 2O2GA 3ITDA 1FPQA 4WLFA 3VAAA 4EFDA 5LKAA 2E4WA 1GGMA 4GS5A 5DM0A 2MMCA 4N7JA 3THXA 1DBIA 2A78A 1YDEA 2J5XA 2Y2VA 4LZWA 2RGYA 5E3JA 5E9JA 2ONCA 4BZWA 4XRGA 1TT5A 3CTMA 4YVFA 1KDVA 5DEIA 3KQWA 4XDGA 3WNQA 1O94D 1RRKA 1SVMA 1XCGB 4CU5A 3FNQA 2WQ6A 3FWNA 1YBHA 3DNPA 4MP8A 3HBLA 4G0OA 3GO4A 1SQ5A 3L8DA 3ROFA 2Y6VA 4LCBA 5A4MS 5JTUA 3A1WA 1WCWA 3FFTA 1GPKA 2YMPA 1T9HA 4H1VA 3SZUA 4KVAA 1XCJA 3L49A 5HE9A 4AS2A 4UTZA 4V1CB 4QUKA 3H1FA 1ST2A 3QK7A 3SHOA 4BB5A 4F5EA 2R25B 2B98A 4RVSA 1RAFA 3NVMB 4UHFA 5DNDA 5GP1A 3JD4A 1G2QA 1ZONA 1OLSA 4UCQA 5A0VA 2I4IA 3AKEA 1TM3E 2O07A 3DHYA 1XMOB 3P0IA 3D4OA 2WUVA 1LPBB 5GOZA 4CM4A 1EJBA 4ZJPA 3PXUA 3CURA 5K4GA 4LOJA 1QJCA 2XGGA 3ZLTA 4XQ9A 1SIWA 1K86A 2QJRA 3EZ6A 1V16B 2YJGA 5A7GA 2DPYA 1X15A 1T2DA 2LIPA 4ZMRA 3RODA 3O8BA 2B8EA 1Z28A 1SCQA 1QGOA 3GAZA 2CXHA 3OBIA 4YXWA 4DLXA 2MJLA 4AS1A 4MUJA 1Z0IA 1NUPA 1FU8A 4XUCA 1EYZA 2ZOSA 3NZEA 5B58C 3HFRA 2RGCA 4NP6A 1PTJA 4P4SA 3RAJA 3W1VA 2UDPA 1F2UA 2GZ3A 2WICA 1H3EA 2KS6A 3C14C 1FS6A 5K01A 1PEYA 1PEKE 5LB4A 1IN6A 1N5MA 1RLOA 2JIPA 4JASB 4XPIA 5C1IA 1KY5A 1MW9X 3S6JA 3PE4A 4FGLA 1A27A 4PBRA 3KIPA 1XGKA 5CVCA 2WJ3A 3UPDA 1FL9A 2FPPB 5KQPA 4JROA 3SZ3A 5FYDA 1B74A 3DE1X 4NZPA 2I3BA 2VJMB 3P9RA 1E9BA 3EIXA 1N2EA 2YRWA 1P7WA 1Q7CA 4Y2UA 3GJ0A 3ZYZA 2O3UA 1ZUD1 1T3TA 1AB6A 2QVZX 5ELMA 5A9RA 2N1BA 5B57C 1ZNXA 4GKJB 2AZMA 3JPWA 5ESRA 3W1EA 2EX4A 4D41A 4ENVA 3U39A 2JLZA 3CVJA 4AI6A 1J39A 4B3DA 3L8GA 2ASEA 3IL2A 2JD1A 3AR4A 1P0MA 1U5BB 1GNLA 4CKWB 1Y8QB 1GTMA 3NI2A 4JUCA 2R1ZA 3A1EA 2ADOA 4GSLA 4LWOA 4AJJA 4EY7A 4G6ZA 3KAQA 4I14A 2QZSA 4GMFA 1FQOA 2O8FA 3MRXA 1E3DA 4AB1A 5H83A 3CR3C 2ENUA 1C80A 1MABB 2OHHA 2OZPA 3C45A 4BAGA 2D7JA 2N75A 5J40A 4HVCA 3QZUA 3AZOA 3X44A 4AQYB 3O8QA 5DGIA 1YASA 3EXFB 1KEWA 2XA1A 2YWGA 3JVUA 3MPUA 1Q7BA 3NC4A 4W5JA 1JXMA 4JUAA 2KE5A 3VH3A 5JY6A 3T5DA 1Q1EA 1RDFA 2PJDA 1Y33E 1RT9A 1A8HA 4I4CA 1FFEA 2VRBA 5ECYA 3MT7A 3T3NA 1U98A 1JHRA 4G01B 1EE1A 3H2SA 4JKOA 4FQ7A 5FWYA 3OKAA 2WKPA 3PHLA 4YT2A 1TCVA 2B2CA 4QECA 3O3MB 3HO1A 3EK2A 5BURA 2IOFK 4MUAA 5DGDA 3D2LA 4G89A 4ZODA 4LCEA 5D5QA 1VIVA 4ALIA 1GP2A 1T8YA 4OXXA 3TBFA 4JU9A 4C6SA 4JR1A 2XDQB 4E3ZA 3ADCA 3IMKA 4J07A 4Q6BA 5AI8A 5AI9A 2O1SA 1SURA 2OXCA 5IEJA 4OX9B 2V0NA 4IHJF 2IF2A 2P5YA 4P3OA 5CDHA 4KN6A 4RIHA 1EFTA 3PA6A 5AVUA 3JATA 2P41A 4ZCTA 1OD6A 2X23A 2YV5A 2PR2A 4FNAA 4ZDKA 1M83A 1G8MA 3LKZA 4Q93A 2QR3A 1C8BA 4H7JA 5DF1A 3RKUA 4AQDA 4GYJA 4M3NA 1XNRB 2Z6QA 4NBNA 1X2BA 1FRQA 1Q44A 2FSIA 2QM7A 5EOVA 3ZDBA 1IXKA 2WFMA 4PIMA 2I4LA 2Z6VA 2XUAA 4FDTA 2HPHA 3MRTA 4P6VF 1NRJB 5TQ2A 3Q5GA 4CTMA 3JQ6A 1XPUA 4HNAB 5G53C 4QHSA 1YL6A 4JB8A 5AXBA 3IXLA 3STWA 1HG0A 2HT6A 3CNBA 3E7XA 3PQ5A 1Z4QA 1RWWA 4BAUA 2VZ0A 4D8YA 3B7PA 1M2EA 3HA7A 1R3DA 3LCMA 4V03A 5C5CA 2Q5FA 1ODCA 3BIWA 1X7XA 2WJHA 4YCBA 2AJDA 3PGXA 1H85A 3FFAA 3STHA 3MERA 1EX6A 5DNAA 5TGDA 1EHIA 5I3ZA 4UPEA 5AXDA 1F8XA 4UE6A 4TL7A 3E9DA 2NU6B 5CD1A 1IXYA 2UZ3A 3EQ2A 4H4DA 1GG5A 3RSCA 4CW7A 1CDEA 3G59A 4MV1A 3TZQA 1H4QA 3NW9A 1E2JA 3G79A 3I5UA 4WK0B 2V55B 4I9FA 5LUBA 3EOZA 1UPBA 3EWSA 3N2GA 4GLLA 4UAGA 4BKOA 4J7AA 1M0WA 2FETA 3ID6C 5TV2A 2EGUA 2Q99A 3IE1A 3QF4A 2C83A 1V9SA 3FCAA 3LSTA 2WWWA 1FDWA 4WD3A 2BMEA 1T1IA 2PQMA 3C1UA 1GOTA 1GZDA 3N58A 3ZCVA 1ZVQA 1HLPA 2LGJA 4TWIA 3TAHA 1ZCAA 4C7JA 3RC8A 3R7BA 4M22A 3T7KA 1YJXA 2DH6A 2X9NA 2BCGY 4M0UA 2GRAA 3GGSA 4BRWA 3OUTA 4W1QA 1U2GC 2D59A 2L18A 4YRQA 1HQYE 3B36A 4M38A 2EZTA 3WGOA 1KRXA 4H4EA 3D1LA 2Z83A 3INGA 3RH0A 1JAHA 4N39A 1UJ6A 4GMHA 2J8ZA 3Q3IA 3P19A 3GFQA 5ERYA 2IHNA 1E59A 4KGVA 1PGJA 3EZNA 3ZC3A 4BBZA 1JYEA 1D2CA 2G63A 4DC1A 4JZYA 1ZKMA 4KPFC 2IGTA 3F6YA 2YXNA 3ZXXA 3F3YA 2W2PA 5HP4A 2HF9A 5BN3A 2AXQA 1JVBA 3PITA 2Q2OA 2Z3ZA 3L82B 4CHTA 3RC2A 2WZDA 4HH0A 4GWKA 2XKJE 1U9YA 5K6AA 3DVRX 4JNCA 4QNRA 4QXQA 3AKZA 3BE5A 3BEOA 4J0CA 4P5EA 3SIWA 1EUQA 1BHQ1 2QTFA 3PUIA 1A9QA 1L4EA 4XAQA 5KYXA 1Y4UA 1JFTA 4UUQA 3KJIA 4NH0A 2FYTA 1NAHA 3PQ3A 1Q3HA 1M8GA 1ZAKA 4OI2A 1QKIA 5E9QA 1QMPA 5ES3A 5CT6A 3C4VA 3U4DA 3A32A 2ZR7A 3AONB 3KJNA 3KKPA 1U2ZA 4ZQGA 2BMDA 3OZUA 1JAIA 5IH3A 1J00A 1E77A 3FTNA 3LHSA 5SY4A 1ABFA 1WW8A 3BTVA 4QEDA 2PX8A 4GAEA 2V6JA 2WHYA 3GVHA 5EGSA 1A7KA 2OORA 5EJ5A 3TI9A 1N75A 2AZ4A 1B0ZA 1GNPA 5TQJA 1ZUNA 4G8JA 3DKKA 3GMTA 1WW2A 3V4LA 3W3AD 5B64A 7ADHA 5LDDC 2D06A 1FMLA 2CWWA 3A9VA 1BTOA 4J6FA 5FI5A 2NU9A 5JANA 4R2LA 4P3YA 3TRIA 1RC8A 1B41A 1KWKA 4NY1A 1UMBA 5BUZA 5K0FA 2AEFA 4XX1A 2C4KA 4C1NA 1JE1A 1JPVA 1M2VB 5IDWA 4C7KA 3GLHA 3T9EA 4WNCA 4EB0A 5KWVA 1KTIA 4KR6A 2SKCA 1VG8A 4A6PA 3CLUD 3K0AB 2NTVA 5G0SA 3RGWS 4AULA 4YRSA 3MMPA 4FDMA 4KO4S 1NONA 1LU9A 3Q2KA 5FTJA 3UJNA 4RTNA 1QRAA 2VPQA 1U31A 2PBRA 4MB2A 1EGHA 4UUOA 1DG3A 3EZGA 1AKEA 2IPXA 1R7RA 4PZDA 3T7CA 4E09A 1YVDA 2GYYA 1W4LA 2DHEA 2OGTA 2GJ8A 1XVLA 5CXQA 1G20E 4YMIA 3EEIA 1ULUA 4HLUA 4CV0A 1PLKA 4B3JA 3E9CA 5ALZA 1KAOA 3TR0A 4ERXA 5JD4A 2NZXA 5KX5F 1OB5A 3BB1A 3EGXA 3L4BA 2HU8A 1JDBC 4ZT2A 3SFVA 2G77B 2JKZA 2P9ZA 6PFKA 2BLLA 4MV6A 1J9ZA 3KJGA 3D5QA 3LC7O 4C7VA 3TFOA 1NC1A 1Y6QA 4EY6A 1XTIA 2Q4RA 2BMVA 4I19A 4GYYA 3Q8XB 4UHHA 2PXXA 3WO0A 4AY3A 2XCSB 3GFBA 1QZTA 2PX2A 1UOOA 2CNKA 2CDBA 4C0AC 2G67A 2AUTA 4EAQA 3M6WA 5BY2A 2Z2KA 2FAXA 2VHQA 2JNWA 5IT9A 1XN4A 3AOEC 1T36A 4C08A 4R3UC 4BNXA 2BM9A 1D6SA 3PC7A 5KQLA 4KI0A 4DIBA 3HG7A 3ONEA 2XCIA 3RUDA 3UGKA 1WDMA 2OZVA 3EVTA 3PSAA 4LE1A 3MMNA 2N42A 1RU3A 1YZGA 2MHCA 1J06A 1ZBQA 4H3KB 4PZPA 2FUG1 1ZISA 3IP7A 4KE6A 2VSYA 4YCLA 3K31A 3JQ8B 4CCSA 4DMLA 4ERNA 1T6ZA 2RH9B 3GJ8A 4D81A 1NP7A 1J7KA 4Y18A 3LTNC 5FWNA 1X74A 4AJ1A 3Q0TA