4YUZA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 5-[(4-methylbenzyl)oxy]quinazoline-2,4-diamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
285
structure length
273
Chain Sequence
GWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
molecule keywords Spermidine synthase, putative
total genus 93
structure length 273
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuzA02
4QDJA 3P9KA 3EGEA 3R0QA 3U81A 3UJAA 3RW9A 2F8LA 3AJDA 5DX0A 1SKMA 3THRA 3FTDA 5GOZA 4QTTB 3HEMA 3MHTA 2BH2A 1KYWA 1ZGJA 2ERCA 3GRVA 1JSZA 4RSRA 2AZTA 1VE3A 5T67A 2UYQA 5C9ZA 2YXDA 1KHHA 2HMYB 4R6XA 3SSOA 3EGVA 4F86A 1EAMA 5DM1A 3KU1A 5K05A 3LX6A 1AQJA 2PWYA 2Z6UA 2ZBQA 1FBNA 2ZVJA 1G8AA 3DULA 4EKIA 5EIFA 3E23A 3FUTA 3P2KA 1U2ZA 3I9FA 3P9IA 5ICGA 1V39A 1KXZA 3EVCA 1R74A 1D2HA 2O05A 1MHTA 5K0NA 3BUSA 2BR4A 2QM3A 5E1BA 1QAMA 2JJQA 4E33A 3E05A 1NW8A 4HH4A 1SUIA 2O57A 4YV0A 2CKDA 3LPMA 5FADA 1OR8A 3TMAA 2IP2A 2AN5A 8MHTA 1Q0SA 1L1EA 1P39A 3M6XA 3IYLW 3GWZA 4GF5A 1RI5A 1XXLA 4Y30A 4QTUB 1KP9A 1BHJA 3O7WA 2E5WA 4C07A 3FPJA 3JWHA 4OBXA 1WY7A 2GB4A 4DA4A 2ZW9A 2YQZA 2IBSA 5CVVA 5DXJA 5DTQA 1G60A 1NT2A 3KQVA 2GLUA 4GEKA 2FK8A 1ZHFA 3G2QA 2YXLA 4RVFA 2CWWA 3EVEA 5E1MA 3LCUA 5FWDA 3G2OA 3MCZA 2YTZA 1JTFA 3KPJA 5FHQA 5GIPE 4X63A 3CGGA 5CD1A 4KWCA 2B9EA 3IHTA 3UJBA 5IKMA 5K0JA 3M4XA 9MHTA 4XCXA 2P7IA 3A7DA 1G6Q1 1SG9A 7MHTA 2OXTA 2HNKA 3SR4A 1MJFA 3PFHA 5LQKA 3CJRA 3DUWA 2IPXA 3G89A 1X1AA 3EVGA 2ONZA 3VC2A 3CJTA 1Q0TA 4E2ZA 2KW5A 1X1BA 3UBTA 5EHIA 3M33A 3BWYA 4E31A 5FA8A 4IKPA 5GWXA 3Q87B 2WA2A 4KIFA 3NWBA 1D2GA 1QAQA 4EMSA 1YFJA 1VP9A 4LECA 3CVOA 2OKCA 4C04A 2EJUA 5FCDA 3PTAA 3BGDA 2XBMA 3GO4A 2H1RA 3TM5A 4BP3A 1TPYA 1JG2A 2AOVA 3A4TA 3P9NA 3NWEA 4RWZA 5K0GA 1ZGAA 1YFLA 3UJ7A 4RVDA 1R8XA 2Y1XA 1JQDA 2ZZNA 1UWVA 3CKKA 3BWMA 4DMGA 3HM2A 4YUWA 1SUSA 3LECA 2IIPA 3MTIA 4PIPA 5HEKA 2ZLBA 1XCLA 3SXJA 1QZZA 4F84A 2NYUA 1HNNA 3T7TA 4DKJA 2ZIEA 3FPFA 3P2IA 3PB3A 5DTMA 3SSNA 5EIWA 4HGZA 4GQBA 2BZGA 5F2OA 5LQRA 1R18A 3B89A 3PFGA 5DRTA 5HIMA 2OYRA 4DQ0A 4DZRA 3M6VA 1JR4A 4FT4A 2OB1A 1G8SA 4X61A 4RVHA 3UJ6A 1I1NA 2ZBPA 3UWPA 3HCCA 3NW9A 2BM9A 2Q41A 3LL7A 2JHCA 3OFJA 2ADMA 4PYOA 3EVDA 5EPEA 2PBFA 2P35A 5LQUA 1TW3A 2IFTA 4MHTA 3T7SA 1B42A 1ORIA 4OA8A 3HTXA 3BGVA 3DTNA 3LGAA 4P7JA 1VIDA 3KQSA 5CM2Z 1QAOA 2V74B 3DMFA 4MIKA 2OO3A 3QV2A 4HTFA 4RTRA 2AVNA 2ZIGA 1L3BA 4K6MA 5DM2A 3FTFA 2YR0A 3FRHA 2UYOA 3P71T 4PYKA 3EMBA 1XTPA 3G8BA 1N7IA 1TW2A 2P3QA 2XVAA 2CL5A 1NW7A 3PT9A 2R3SA 3DH0A 5JR3A 2G1PA 5BW5A 3KR0A 4KRGA 1IXKA 4G56A 5BP7A 3ERCA 2G8NA 3ER9A 4OA5A 3HA5A 2UZ4A 2ZCJA 3R3HA 3V8VA 5H02A 3RODA 2PWPA 2PXXA 3I5UA 3LCCA 5T64A 4UOEA 4RTQA 3VC1A 2OBFA 2DULA 5DM0A 2PLWA 2HWKA 3HA3A 2P3LA 3QOXA 3C3PA 3L8DA 2VDVE 4QVGA 5DWQA 1QYRA 4MTLA 1X1CA 3M6UA 3R24A 3TPZA 4E2WA 2ZFUA 3FTCA 3JWIA 5DRYA 1R8YA 5E1OA 2R6ZA 3GDHA 3AXTA 5K8VA 3Q7EA 4F85A 3IV6A 3KPUA 5K0BA 2PJDA 4M7RA 5HIIA 2H00A 3GU3A 2NXNA 3LBFA 4KDRA 4RYLA 3UA3A 4DCMA 1QANA 2VS1A 5EKXA 5EQJB 4EK9A 4E30A 4FGZA 4QVKA 4EKGA 3HCAA 4O29A 3GIWA 3T7RA 5DX1A 2ZWAA 2NXJA 3A26A 4GBED 2G72A 5EEHA 4X1OA 4BLWA 3NMUF 1WZNA 3THSA 3GJYA 4FS8A 2AOWA 1YUBA 1X19A 3FZGA 3G88A 4RVGA 1UIRA 3KR9A 5E8JA 2AOXA 5EMKA 4CTKA 5FHRA 1DUSA 1YZHA 4M38A 2VDUE 4L7VA 1PJZA 4C05A 4ER0A 2P40A 5ICCA 2UYCA 4PINA 3CC8A 3K0BA 4OQDA 2VP3A 3REOA 2C7QA 2Y1WA 1UFKA 1VLMA 3O31A 2V7EA 4POOA 1D2CA 2EG5A 5CUQA 1T43A 5P8WA 5EMLA 3SGLA 5CIYA 1O54A 3ANXA 3DP7A 1JQEA 4X60A 5C1IA 3FYDA 3JWJA 4P7KA 3R6TA 3MTEA 2AOUB 1RI1A 3B3JA 3NDJA 3QOWA 4KDCA 5E9JA 1KPIA 4QPNA 3M6WA 2AN3A 2YUIA 1XDSA 1Y8CA 5EZSA 2AOTB 5FA5A 1I4WA 5M5BA 5DPMA 3TLJA 1DCTA 5GP1A 2G70A 2Z6QA 4GOLD 5C0OE 4RTJA 3C0KA 2BR5A 1KYZA 4GOND 1AV6A 5FQNA 3UJ9A 5EGSA 2C7RA 3KQMA 4QDKA 1XDUA 5BW4A 2PX2A 1I9GA 1Z3CA 4YUVA 1NV9A 2I9KA 1JG1A 4M37A 2GA9A 3TKAA 3DMGA 1PRYA 2IDJA 3A25A 1RI2A 2DPMA 2PXCA 3BXOA 3FPGA 5EG5A 4YMHA 1P91A 2ZZMA 4CXMA 3MQ2A 5DT2A 2PT6A 3V97A 4GOOD 1NW5A 4XUCA 4ZTBA 1WXXA 3FPEA 3LKDA 1VL5A 3OU2A 2P7HA 3PS9A 4AZSA 4RTMA 5LR6A 2PVCA 3SX0A 2ZWVA 1BKYA 3UJDA 5FQOA 5JUWA 4YV1A 4E70A 2UYHA 2B25A 3DMHA 3KQYA 4FZVA 5EEGA 5KVAA 3O4FA 3BWBA 2N47A 3KQPA 3UJ8A 4PGHA 1IY9A 5K01A 4CKBA 3FTEA 1FP1D 1BC5A 2FHPA 2JHPA 1XDZA 5LSAA 4ISCA 3KPYA 1G38A 3GRZA 2FK7A 3VSEA 5DTRA 4GOMD 3HCBA 2K4MA 2HTEA 3EVZA 3CCFA 1RJDA 3LHDA 1KPHA 4CKEA 2JHAA 3EEYA 4U7TB 3EGIA 4C4AA 2PXAA 3MGGA 5T6BA 3IEIA 3KR1A 5E9QA 4PONA 4A6DA 2YVLA 3DOUA 2EX4A 5EHGA 4RTSA 4YUZA 2YXEA 1XJ5A 4GC9A 3KQTA 2PKWA 2B3TA 3KQQA 3I64A 1YZ3A 1L3IA 2GS9A 1IM8A 3ER8A 3EVFA 3OCJA 4IWNA 4WXHA 3TOSA 2BR3A 5U4XA 5LQJA 3DLCA 3ELYA 5CCXA 1L3CA 2JH9A 4KIGA 3FPHA 2FRXA 4PYQA 4EVIA 4V0QA 3SVZA 3AXSA 5DX8A 2IH2A 3BWCA 2ZTHA 4QQKA 3CBGA 1EJ6A 2WA1A 3E8SA 3MCTA 1P1CA 4QQNA 5E2BA 5EKUA 5MHTA 3FYCA 3B7PA 2ZIFA 3KHKA 2OPBA 2XVMA 3C6MA 3ME5A 3GGDA 2QE6A 2PY6A 3HCFA 1O9GA 2PX5A 5KYGA 3BKWA 5KQRA 2AR0A 2XYRA 5FWAA 3MERA 5CVJA 5K0LA 3HVIA 3KR2A 4PNEA 5K0EA 2IBTA 4AZWA 3C3YA 1NBIA 2PSSA 3ELDA 3LCVB 3SM3A 3OZRA 1JTEA 3E7PA 2JG3A 2P1DA 3UZUA 3TRKA 2FYTA 2H11A 4MWZA 3X0DA 1ZG3A 4X41A 4AX8A 1M0EA 1RJEA 5E1DA 1HMYA 5BXYA 2HR1A 4YMGA 2ZULA 2WK1A 1VPTA 5B1SA 3KQWA 5D1HA 3NVMB 5EVJA 2ORED 1ZQ9A 4JXJA 5F2NA 3P97A 2B78A 1RJGA 1WG8A 3HVJA 3LDFA 4R6WA 1AQIA 1JSXA 3DR5A 3G2PA 4C06A 5HILA 1JG3A 4PYNA 3R9XB 3RIEA 5K09A 2LD4A 3P2EA 4GC5A 2GAFA 4H0NA 4QPPA 3UA4A 2GPYA 4AZVA 3AWIA 4DF3A 1N2XA 3OZSA 4BP1A 4PYIA 5E9WA 2P3OA 3GRUA 3H2BA 3MAGA 1SQGA 1P1BA 4BY9E 5GM1A 3PX3A 4XUEA 3NDIA 5DSXA 4P7GA 4HG2A 3LKZA 3EMDA 2OZVA 4FT2A 5KS2A 3B5IA 2CMGA 4Y2HA 5DXAA 3G2MA 4KVZA 4PGGA 5CVEA 3TQSA 2P41A 4A6EA 3KPVA 3OE4A 4RTOA 2NXEA 5LQNA 3OZTA 1EQAA 5KQSA 2AVDA 3DLIA 1F3LA 2ESRA 3PX2A 4CWAA 2O06A 3F4KA 4PCLA 1YF3A 1R6AA 4HSGA 2FPOA 1L9KA 4R8RA 1ORHA 2IDKA 3SMQA 3DXXA 4C08A 3LDGA 1FPQA 1NE2A 5HZMA 1XVAA 5EC8A 1VP3A 1EIZA 3EVBA 5GM2A 4E2YA 4PYJA 3P8ZA 1WXWA 3B3FA 2I62A 3B3GA 2BM8A 1RJFA 1ZKDA 5K0FA 2AN4A 2XYVA 2AOUA 4E32A 5E8RA 1BOOA 3HCDA 3C6KA 1XCJA 4RV9A 1RI4A 2QRVB 3G8AA 2FCAA 1FJXA 2ONYA 2PT9A 4C03A 5GINE 4R05A 5F2KA 1NBHA 2EFJA 4V0RA 1RI3A 5GIOE 2IH5A 3KKZA 1KPGA 3NTVA 3OE5A 3NJRA 4FR0A 3ELUA 1R00A 1JG4A 3BKXA 3TM4A 2NP6A 1M6YA 3UJCA 1WS6A 3A7EA 4YUYA 4PWYA 4BLVA 4ER3A 3PLAE 5EMJA 1SQFA 2ZBRA 2XYQA 5LQCA 1KR5A 3UFBA 1NV8A 3DXYA 3FUXA 4RTNA 3HA7A 4EQZA 4B17A 5K0CA 3FRIA 3G7UA 2IH4A 5EZQA 2YX1A 3EVAA 3HNRA 4RTKA 4OQEA 5D1NA 4U7PB 3WSTA 4ER6A 1O9HA 4FSXA 1EJ0A 3ELWA 3FUUA 2O0LA 2AS0A 4HGYA 3OPNA 2NNWB 5E2AA 1NKVA 3LBYA 4HC4A 1M6EX 5FULA 3TR6A 4RTPA 4LWPA 2ZZKA 1SVUA 4PYLA 3EPPA 2PX4A 1JQ3A 2HV9A 5FUBA 4FSDA 3GRYA 3NVKI 3D2LA 3A27A 1F38A 2QRVA 4LG1A 3G5LA 3MB5A 4ATNA 2PV0A 2NP7A 4P58A 4DM3A 4P7FA 5EMMA 5HIJA 4YV2A 3VYWA 1KIAA 4NECA 4R8SA 5ICEA 3EEOA 2C7PA 3FUVA 1YB2A 5K03A 2EJTA 4FP9A 2VZ9A 2I7CA 1X1DA 3GRRA 3OU7A 2PX8A 1H1DA 2NXCA 2B2CA 2G71A 2QYOA 2AOTA 4IV8A 2VDWA 4E2XA 4MQ4A 5DSTA 4RTLA 3SSMA 5HIKA 1FP2A 3OFKA 2I6GA 5EOVA 3S68A 4CTJA 2C7OA 4ER7A 5LQAA 3HVKA 5CVDA 5CCBA 5G02A 2Z6AA 5ERGB 3BZBA 4PYMA 2JH8A 3K6RA 3KPWA 2CMHA 2IGTA 4HTFB 1DL5A 4PCAA 3DXZA 3P9CA 4AZTA 1NW3A 4RX1A 1INLA 5DM4A 3G5TA 3GXOA 3GNLA 3M70A 3TKYA 5HOQA 5FTWA 4Z2YA 3LSTA 4OX9Y 4BLUA 2GH1A 3FUWA 1VQ1A 4IV0A 4AUKA 4YUXA 3HP7A 3ID6C 3I53A 4XUDA 3T0IA 3JWGA 3HVHA 4PIMA 4OBWA 3PVCA 3HCEA 4CKCA 1AF7A 1VBFA 1NW6A 2PGXA 4HRAA 3AY0A 4KW7A 4LWOA 4WVLA 5DLYA 4ER5A 2P8JA 2QY6A 3CJQA 3KQOA 1G55A 3ORHA 3OU6A 5IH3A 3TFWA 2O07A 1EG2A 3I58A 5HFJA 2OB2A 5ICFA 10MHA 2ZSUA 5CVUA 3LDUA 4DCGA 3GCZA 3BGIA 3BT7A 1N7JA 2OY0A 4GUAA 4M36A 2A14A
chains in the Genus database with same CATH superfamily
1VCMA 2E37A 3RW9A 3E9QA 1GSAA 4MWSA 1HDIA 3IQZA 2CLOB 4EBFA 2G17A 5KNCH 3K0EA 1E3DA 1VJRA 2H2GA 4BTVA 4TTPA 4MW6A 1CUHA 2AZTA 1BCRB 1LVGA 1M8FA 3FE2A 3LRTA 5TQ2A 4E51A 6YASA 1EFHA 4FGSA 5FBRB 1FC0A 1P7VA 4B79A 1U98A 5L3QA 2PMEA 3OQPA 1F9EA 4XGQA 1MORA 3S7ZA 2FWPA 4BU1A 1ZAKA 2ZQZA 3D8NA 3QENA 5I4IA 2Q0XA 3A3YA 5ICGA 1E3MA 3IH5A 3QU5A 4M1WA 4G4GA 2X4IA 3BE8A 3BUSA 1Z15A 2JJQA 3ITEA 5KNBD 2H07A 1U3TA 1AHHA 2QTBA 3BJEA 1AKMA 3JD1A 1Z17A 1G1MA 2ATVA 4WCVA 2XUGA 1XZKA 4MUMA 3TIIA 4C7MA 1BX1A 2VDWB 3TLXA 1H65A 1NYTA 4JLDA 4YRIA 2EL7A 5IS2A 5A9SB 1KP9A 3ETLA 2BKLA 4X5OA 3SYLA 3PDHA 4S3MA 1JKMA 3M34A 4ENVA 1IB6A 2BBOA 4IINA 4CMEC 3L41A 1NUHA 3OPYI 1BYIA 1JEQA 2GB4A 2Q7OE 3VH1A 2CSXA 5KTRA 5FUWA 3SQMA 2HCRA 3FZEA 4TXLA 1TX4B 2YWEA 4GLJA 4OM8A 4D99A 4EVSA 2YHUA 1A5AB 1TQ2A 1AKVA 1Z0AA 3G2QA 1P4HA 5KI6A 5L51A 1T3HA 5E1MA 1HUQA 4FYMA 1XPRA 1YQUA 3I01M 1N78A 3BH7A 3IDFA 1SG0A 2JLVA 2X8JA 2H5EA 4HFNA 3R77A 4MAFA 5HBRA 4BFSA 5L3SA 3F49S 2XSZA 3AIOA 4B3TB 4XCXA 3QLUA 1AMUA 1L7VC 1M34A 3WLSA 1NI4B 3CU5A 4QBFA 3SR4A 5DSZA 2J3LA 3G89A 5JROA 2H18A 1CVRA 3VC2A 3ER6A 4CCYB 2F8SA 2VJLA 1CRQA 3IKVA 3V4ZA 1KVUA 1VCIA 5I6DA 4UREA 3M33A 2CVFA 5KVSA 1RXEA 2XMPA 1LVHA 1N5RA 3L93A 1J42A 3Q5EA 3WA6A 2NU9B 5BWCA 3K32A 5JWHA 1YFJA 2G9RA 3X3HA 4AWXA 3I45A 4CODB 2WYWA 4H6VA 4AC9A 3PXCX 4ESEA 2ORYA 1ZXLA 1J5EB 3GO4A 2H1RA 2DKOA 2C2BA 1D3AA 3HB9A 5K0GA 2VRCA 2DT5A 3PQ8A 3DV2A 2CEKA 4CQMD 5AVRA 1HLDA 1G291 2ZBUA 3FB4A 4FLMA 4OJKA 1WMAA 3ESDA 4PQGA 2EFDB 2FR0A 1L4LA 3DCNA 4RK5A 3P45A 3THWA 1OXTA 4RULA 2JLRA 4QFDA 8GPBA 1FFHA 2XLCA 5E38A 3R7WB 4JA2A 2OFWA 5JNWA 4MVJI 4C7OB 4WXYB 4Z0HO 3SQDA 5HRAA 3R76A 5BVGB 2WTBA 4GBJA 4IXTA 5K3DA 1L5GB 4A0FA 4ESHA 3ZGXA 5BUCA 3P2IA 3AB8A 3NALA 4RKYA 5JARA 3OLCX 2OD7A 5LLTA 2XMBA 2BZGA 3D5QA 4JJKA 4YRMA 3N5CA 2BGLA 3S5UA 3VR2A 1UBCA 3FMFA 4LBWA 1H9BA 3O26A 5LFAA 2JLWA 1X1QA 3I09A 1I7LA 2C2OA 2WVJA 3F46A 3E9CA 3NW9A 2B4TO 3PRKE 2DAPA 3QVMA 1VJ0A 1DC3A 2ADMA 2O2GA 5E4YA 4C29A 3IX7A 2JJYA 1Y7LA 1DWUA 1CUZA 3CEJA 3TSZA 1PT7A 5BT9A 1Y1PA 3AL0C 3WMXA 1AJEA 1VJTA 2ZXEA 3OX2A 1W6RA 3FBGA 1ECJA 3OT1B 1HFWA 4DJAA 4EGAA 3HB4X 1YZYA 1SELA 4MVJE 3LG2A 4I66A 5CH5A 4YPFA 2Y1DA 3DBIA 1N32B 1TCUA 4L4SA 1XTIA 4EUHA 1OAAA 3HY3A 2ZRIA 3DH0A 1SBYA 1AS3A 2HA3A 4LS3A 4TS4A 3UAOA 5J4HA 1J0CA 1O6BA 1D2RA 3RFVA 3KT8A 1DMRA 3ZZ0A 2G8NA 4MCHA 1WHSA 4ZVSA 3SIPA 2ZCJA 1YQXA 1ZVQA 3DFFA 5CVCA 1J09A 3JD0A 4A8JA 1DX6A 2UUCB 4QOEA 1PD0A 2V6IA 4J1QA 2XRMA 1A2KC 2I55A 2NVUB 1X0XA 5DWQA 2R8EA 3LCJA 2HJVA 1QO7A 3IAS6 1I3OA 3WDLA 1Q0RA 3K1YA 3UY4A 5B2FA 3FTCA 3HEBA 5IEBA 4DM4A 4G25A 5CW2A 4RMIA 1V48A 1N5IA 3AERB 1QJCA 1GARA 4AG5A 4A92A 1GL6A 1QQAA 4E12A 1NVWQ 4F2PA 2A5FA 3ZE7A 2WZCA 2P6RA 5FO1A 3AV0B 2OENG 3GU3A 2XKAA 3LBFA 4GWGA 4HRYA 4K6GA 2W2KB 4MOWA 2XCLA 4U6QA 4UD2A 1VB3A 5AM0A 4B3XA 2A1TR 4L1KA 4P1ZA 1ZAYA 4JB3A 1OQAA 4A1FA 1YBAA 2HJ9A 1TLTA 4YGXB 2O1EA 4AJ2A 4PM4A 3EIWA 1EM6A 3NHPA 2H9IA 4MWGA 2EVWX 1BQ4A 2AN1A 5KHAA 3NMUF 4MW1A 5T57A 2ZROA 5THXA 1LS1A 2QLBA 3OT5A 4DDUA 2XZPA 5EMKA 1X8XA 1E1CA 1W19A 4N8DA 1VPEA 1GRCA 2E85A 1DJOA 1SXIA 5T4HA 1XZMA 1HE3A 1GFZA 3R5FA 4IJ5A 1DAGA 4ZCRA 4BZZA 5ELMA 4RLSA 3FCXA 1KSGA 2UZAA 1TK9A 3ZDYB 4IG4A 4HAZA 1SD1A 1N7GA 2YYSA 1QMPA 4IDOA 3OF5A 3TTWA 1VXRA 1AK1A 4GVXA 3ZNPA 4DEVA 1YS6A 3C74A 4II3A 5E9JA 1FSZA 4BRWA 1KPIA 4YALA 4HNTA 4FGJA 5PNTA 4QM7A 2DB3A 1Q0PA 1GOTA 3I0MA 4C43A 4MYRA 4MS4A 3R9IA 4KIUA 3P9QA 5TGZA 1XNHA 4CTOA 1UMBA 1CF9A 2YZGA 3N2EA 1OXBB 1P9LA 2LVBA 4GOND 3R3UA 1RZRD 1Z5WA 4MVCA 3RTAA 3BXZA 2JGRA 1AA9A 4MB0A 4MR7B 3ED1A 4BJ6A 4JH0A 4C7KA 2NTYC 2MJLA 2QIOA 3F5FA 3I9V1 3I04M 4WIAA 3BXOA 2W6ID 3M9XA 4LJ7A 4BATA 4KXMA 2FGKA 4LNAA 4IMIB 2PT6A 2N75A 3NIBA 4KTTE 5I9MA 1DKRA 3TDMA 1YC2A 4J43A 3ZHZA 3OG9A 1R6DA 4DUGA 3BH6A 2QDKA 1Y5NA 3CPEA 3LT0A 3OOJA 1PTJA 1J1ZA 1HXHA 4QECA 2Z6VA 1CIPA 2G67A 3IUMA 4RFLA 3QW2A 5KSPA 3OCCA 2OO7A 1XYYA 2P6UA 4WOCA 1RQNA 5L6LB 3FDZB 2NQ2C 3PNPA 3T1QA 3ZKWB 2ZQ5A 3HBAA 4C7VA 4DPKA 7YASA 5CHYA 3NEAA 1Z5PA 3DHNA 3JQGB 1R0LA 1G8PA 1CZLA 1U2PA 4HBGA 13PKA 1KMHB 4CMEA 5HZGA 1AN9A 3DFZA 1O94C 3V3TA 1HE4A 2R96A 3WHPA 3BRQA 4OGGA 3JATB 1YUMA 4B40A 3ENWA 2WYIA 4P5PA 1W581 2A0UA 4B6FA 1DS6A 1OTXA 2VPWA 3EUWA 4JP3A 1DAPA 1F17A 2Q4BA 2WTNA 4F9FA 1KOGA 4CM9D 2GCGA 4IQ4A 4Q4LA 4I1OA 4Y9DA 4ECEA 1T91A 1YK1A 5EKTA 1AC5A 1CUSA 1XRSB 1P9WA 2GUWA 2H29A 4AI6A 4TLAA 4B82A 4AIRA 1HDYA 4H7EA 4HDOB 5LB2A 1NL3A 5D3QA 3UWOA 3GJSA 4MV9A 1BJRE 1LBEA 2EWVA 1T8PA 4KU4A 4O4HF 5I4KA 2XB6A 4ZDWA 4RZ2A 2V54A 3SFTA 2Z58A 4L28A 4O0LA 4M7OA 3PGMA 4WECA 3L02A 3TLGA 4V0QA 2CXRA 5FI5A 2TMYA 5CDGA 1SWVA 4J6EA 1YR2A 3U4GA 1JKFA 3TTUA 1UXIA 5IZ4A 3NUGA 2VPZA 5E2BA 5LDHA 1DIBA 1WKVA 3OEHA 3GCXA 3AESA 3L4BA 1HF3A 3HO8A 1EVJA 2VXBA 4MGYR 3SJCA 2JLUA 6PFKA 3OC0A 3EFOB 4N0MA 9ABPA 3FLAA 5EKSA 5HM6A 1AO0A 3OOHA 5HIAA 4P4NA 4GLOA 2PUAA 1L5VA 3TXYA 5GTDA 1EUQA 2IELA 4I50B 4WNCA 1FTSA 5JALA 2VOEA 1RJEA 3IIKA 4QDXA 1MC1A 4YMGA 5AKHA 4ZYWA 1E6MA 5LWQA 1YONA 4OVKA 5D1HA 3UG7A 1HNXB 5IC5A 5DLDA 1E6EA 4G1CA 4JLUA 4PHCA 3WC4A 1N8TA 3LDFA 3M83A 1IY0A 4XIYA 3GLFA 2NZWA 4R1PA 4R6WA 4NBNA 4WLOA 5ALHA 4DNOA 1VMEA 4GE3A 5DVZA 1WB4A 1UKAA 2JJMA 1II8B 1YQDA 2A1UA 2CF6A 5J2UF 5CYPA 1AY0A 1MN6A 2R1UA 3ZS9A 4HAIA 2GAFA 4MVJH 4MYDA 1CZUA 1PWEA 1XN4A 2HIMA 4IZOA 4KUHA 4FK8A 4EJ0A 3C4QA 3PKZA 1XRMA 4H2DA 2JFOA 5E9WA 2NUTA 3EBOA 2PEZA 1GPNA 4P0PB 4EARA 4B6JA 1ZCFA 1GZ3A 2HHCA 2QD5A 3PNYA 4D9KA 1HE8B 3ZW7A 4E6EA 4YUAA 4EO9A 5GM1A 5DLPA 5AM4A 2VF7A 3D6AA 3TSOA 2J6HA 4UASA 3UT6A 3ROFA 1S2IA 1VM6A 4DLXA 4ZGWA 4UVHA 1VE1A 3IKJA 1JTVA 4D79A 2NV0A 1ZOOA 2YH2A 4HRVA 2P6PA 3EZNA 4WN9A 3E1KA 1NBMD 2HHJA 3PSHA 4DDWA 1MAUA 4DLYA 3CVVA 3IQEA 4UUNA 4AKHA 1RTKA 3GG9A 4QGSA 2DFTA 4UE2A 4OI4A 2WDZA 2BCGY 4LCJA 1JJVA 1TVEA 4FNOA 5BNZA 2ZUBA 1FCJA 2GXAA 3QPVA 2OCBA 1YHZA 4YRNA 4FFRA 3WP1B 4TXHA 2QORA 1CJMA 1A69A 1CUBA 1KI2A 2GD0A 2WMOB 4ADSG 2DBZA 4KWTA 4KSCA 3DS8A 5EAIA 4CL8A 1N3LA 1UT5A 3UAYA 4BNLA 1ZL0A 3F4BA 5EZ5A 2GVDC 4Y3UA 2BYTA 4JXZA 2VAXA 1EGMB 2W2NA 1NPYA 2OCGA 4MV3A 4O8CA 5F64A 1THMA 3BCUA 4NESA 1YL6A 4XYEA 3H2JA 2R7MA 3KTDA 4MVJG 5HA5A 4WCDA 1H3NA 4M9RA 5DBOA 3SD7A 3ZVLA 4TRRA 3CR7A 3A9RA 3F3MA 5JISA 3DW3X 1NVAA 1PI3A 1G5TA 3FNIA 4YUYA 5EMJA 5LZ8A 4G1BA 3GDGA 3ZE0B 4U00A 2ZJ5A 4F4UA 1X38A 3H1EA 5LQCA 3VDMA 3HZZA 2CFOA 4OYRA 3WK5A 2BGGA 1C3OB 4GE0A 4BQNA 2D8MA 4UKDA 5LBIA 4AF7A 2I6TA 2GNOA 3G7UA 3DAFA 1YU9A 4EA7A 1EUDB 1O95D 4GKVA 3GEDA 3PICA 1TU4A 2O0LA 1ZVJA 3G68A 1NKVA 1NUSA 1W4RA 4B4WA 1R50A 2O1WA 3SN6A 4LFAB 2NZXA 4I6JA 4E14A 4GU5A 4B2YA 2HV9A 2LKDA 1QRAA 2OGZA 5CMLA 2HK8A 3PU6A 2GCEA 2BM0A 2HDHA 1DTWB 3NEPX 4QNMA 1ETUA 3TUIC 2YYYA 3NFYA 4GPAA 4ZEVA 3FNRA 1K6EA 2C96A 2C1ZA 4MQMA 4Q7MB 1SZJG 2IYNA 3H0KA 2C5GA 3FX2A 1D6SA 3CW9A 3GPCA 2ZSHA 3T4UA 4YBRA 2GETA 3KOYA 3WWCA 2IPAB 4FQ5A 5C34B 3LT5A 1X1DA 4X71A 4CI0B 3AM4A 2H4HA 1OI3A 2B2CA 2ZJ6A 3ORRA 1NU8A 1XA0A 3P4UA 4R2WA 4MQ4A 5HIKA 2DWQA 6NULA 4ZCSA 4MJLA 1I3CA 3FPAA 1U5BB 3M81A 2YV2A 3LZDA 3L43A 4LDNA 1E6KA 4YLEA 2Y9MB 1K5DA 3HZOA 2VP6A 5I7VA 3PCXA 3QLUC 1QZTA 3R7WA 3ELBA 4ALLA 4QA9A 3PJEA 1ENYA 1ATZA 3UAWA 4EPTA 5FD8A 4YQYA 2WHRA 1V8OA 1W5BA 3ZDQA 3EGXA 1X3LA 1IJFA 3Q9UA 2ODNA 4RX1A 4B32A 2WYUA 3HNPA 2QLFA 5BMOA 1Y1TA 3H5IA 1L7OA 1V1RA 2GJ8A 4AJ9A 2QTVA 2IQIA 1ID8A 3RM3A 1V1RB 3GNQA 3NBUA 4BLUA 3T94A 3FUWA 4DL9A 5FBVB 3WQBA 4YUXA 2FG7C 4QUBA 1I32A 1DC5A 4U9UA 2G3YA 2C61A 3HVHA 3IV7A 3NH6A 4ZV9A 1G8KA 1WJGA 4B6EA 4FMPA 3LIIA 4CKCA 2WPDA 1AF7A 2CXUA 4NJOA 4Y2JA 2VSNA 4K9DA 2HNAA 1Z35A 3F8TA 4XVHA 3HUTA 2Y1CA 3E15A 5AW3A 2NNLD 4IAOA 5LDDC 2Q3FA 2OB2A 3L0DA 5KYKA 4TRNA 4RQTA 1XTVA 1YACA 2YJNA 1YDFA 2GAJA 4N18A 2B5VA 2D5LA 1FZTA 1AT1A 2MTBA 4QDJA 4X24A 5DJ5A 5K05A 4CDMA 3PNKA 3NWOA 2JFGA 1DELA 1KEPA 1QPBA 5GOZA 4XYLA 1CUGA 1O4VA 4L85A 1C9DB 1QK4A 2GXQA 2JVIA 4HEHA 2FW0A 1A4RA 4DUZB 1DKOA 3BMNA 1PFUA 4O8ZA 2C98A 2O59A 2EYUA 3CCBA 3R0IA 3W5DA 2XMGA 1PG5A 1DRJA 1PV1A 4ZI7F 3ZJ5A 3KVVA 5JMOA 4ALIA 5FBQB 3NUQA 2ATXA 2OD2A 3Q1KA 4P4SA 1KXZA 2VXYA 1C9NA 1MENA 5AUOB 3PEVA 2PEYA 2FWRA 4IEIA 3NETA 1KE2A 2XMSA 3V8MA 4UBIA 4CG3A 4E33A 4QBHA 2IPOA 2VN8A 2YMMA 3BMCA 2DMRA 4L15A 4BUJA 2GYUA 2XRYA 1IM5A 4Q3EA 4YJ2A 8MHTA 2DLDA 4N7BA 3GP5A 1K5GA 1NMYA 4PLGA 4QQFA 4AJNA 1ODJA 2PTHA 3R3YA 1BXGA 1BHJA 2G80A 3FIUA 4S1OA 2O8NA 1MIHA 3ETGA 4C07A 4DILA 4DMUB 1YRHA 1ZI8A 2YIDA 4BWFB 1Z2EA 4J9UE 3CZ4A 1TYZA 2J3IA 1YI0A 2X15A 4O2BF 5IF9A 1NULA 2ZG6A 4R1UA 5CVVA 5A1TA 5B57C 4FQ7A 3K9LA 3OA2A 3UENA 3W77A 2RB5A 1T3ZA 5DTQA 5ECDA 2JD2A 3I2IA 3RH0A 2Z1MA 4CIYA 3OJWA 2WKSA 3CLRD 3SCZA 1ST2A 4AKIA 4IOMA 5AXCA 4U7JA 4CM5A 1BHO1 1NRWA 1OYVA 2C04A 4LXYA 1AKTA 2PO5A 3ESCA 3HB0A 2V7WA 2QX4A 5LDGA 2ARKA 1NNEA 5LZ7A 1GGKA 3DHEA 1N7HA 2K87A 3N9IA 3ZZ1A 4DSNA 4YPVA 1M2WA 1FDRA 4ALMA 3TUZC 2EFEB 5AKGA 1M1NA 4C0HA 4Y6QA 1T2VA 2QSZA 5KTPA 1X1BA 1DC8A 3P1JA 5AVUA 2VT3A 4YRRA 1QIDA 1VOTA 5LA6A 4IKPA 1MOZA 2XB4A 4RAQA 2RJOA 4Y2RA 1D2GA 3IMKA 4OSPA 4ON9A 1K6IA 1CX9B 3Q3GE 4M9XA 4F2HA 4GDMA 5HYVA 3G0IA 4EO7A 2ZBEA 4YRJA 1XHFA 1GQOA 3RFCA 4MUAA 4OJNA 1E4OA 2R7LA 4DIMA 4PHGA 3BMXA 3FH0A 3CUYA 3HM2A 2CHVA 2TSYB 4RD6A 5BQPA 5JQWA 3GGOA 5I7EA 2ZLBA 2X3FA 2UV8A 4W5RA 3CZAA 2OAGA 5AKKA 1IEQA 1KJ8A 2ZIEA 5AJWA 4BNUA 4CU2A 1ZM9A 2C2WA 2EFYA 3DL7A 1URPA 3Q15C 4WZAE 4EA6A 4HN4B 3IUBA 1C4XA 2PE5A 3U0VA 3H5TA 1T9CA 1X70A 1BXKA 1NJFA 3O73A 1H9CA 4FPXA 3QPUA 4RLFA 1RRVA 4RVHA 1W5TA 3PENA 3OF2A 2JNWA 2E4ZA 3AZPA 1CQIB 5CYOA 3PEFA 4DBLE 1K8YB 2UVPB 3EOBI 1LJLA 4NMLA 4TRMA 4WXMA 4QBKA 2Z3WA 2EWMA 1JDBB 1H2EA 4MO9A 4M1MA 4CLDA 1LTQA 1GGEA 2JIZA 1PFQA 2GASA 2JRCA 2OCPA 3IQXA 4IQ0A 5DWDA 2C99A 1NFRA 5EQDA 1Y6FA 4HNAA 2IEBA 3BSSA 3P71T 4I8IA 3V4OA 3DR3A 3VR1A 1PL0A 3G8BA 1JVBA 4HF7A 2VAVA 4JSTA 4E2FA 2AXQA 1Q2UA 4KPGA 3RS9A 3S1AB 3W7BA 4EZBA 2IK8A 2RH5A 1GQFA 4JR2A 4P93A 1J20A 2W6OA 2VDQB 2PZJA 4XPIA 3E5NA 5HF8A 2EC5A 4KR6A 4MQEB 1J23A 3ZGVA 4OQZA 3S7TA 1J2UA 2F90A 5G3YA 1FYDA 1RPAA 4GYWA 4UOEA 1IQPA 1UFQA 3I2GA 5E6SA 2XZDA 1W2WB 2HQSA 5KHOC 3CNBA 4R16A 5LWHA 3QA9A 1QQ5A 3F6BX 5CEJA 1S96A 4RF3A 4WNYA 1EK6A 2C3YA 2QX6A 3CY6A 1GFWA 5JQGB 1NATA 5F21A 5B7NA 2LWIA 1VG9B 4BMXA 3R24A 4MULA 3PSAA 3OZFA 1CV2A 3DTTA 5CP8A 4K6CA 4KH1A 5AK5A 5AM5A 1W7AA 3AJEA 1OKKD 2NOAA 2CNWD 4I55F 2J9RA 4ZIRB 5I9LA 2MYNA 4YRPA 3CA8A 2C97A 1W1UA 3CF0A 4WPGA 1BWPA 1U9ZA 1YJAA 1FNNA 2GYYA 1ICEA 4LXIA 5L4SA 1ZCZA 2EXXA 2DQZA 2C4KA 4O5OA 4EKGA 1EQUA 4O29A 3EISA 2Q6VA 1KQNA 3T7RA 1JHZA 5B6JA 4MUHA 2ONKA 2PPVA 3B9PA 2RAUA 4RC9A 4X3CA 3WIDA 1XCMA 1EVLA 4B4UA 4A1OA 1HO3A 2D1RA 1UFVA 2PPLA 4UE3S 1V37A 5ECYA 3E82A 1DP4A 3B51X 4GAEA 4QBTA 4WVFA 5ALQA 4EB8A 2HRRA 4O4LB 2QRUA 1L2TA 2QY9A 3I5MA 3ICWA 3WG9A 3P0IA 3JALA 3K0AB 1WNFA 4F72A 1M83A 1WF6A 1DDOA 3R1IA 4GLLA 3WGJA 3UMMA 2QK4A 2QENA 3KDPA 4RKWA 4TVSA 2C9YA 3RROA 4LISA 3R0ZA 3ONWA 5CK4A 3ZV4A 5LMCA 3DP7A 1E7QA 5BYKA 1KAGA 2M9MA 2QKYA 4K6KA 2WAAA 4X1IB 1V9LA 2C7GA 2X40A 1B6TA 1PQYA 3O92A 2WVAA 3AI1A 4F9GA 8ABPA 4YAIA 5JD5A 1FTGA 1R9MA 2ZCVA 3V4PB 4DLZA 1Q1AA 2RHLA 2YUIA 2PZGA 4JZKA 4G6ZA 4ND1A 4NJEA 1BRTA 2QYSA 5G0SA 2J5QA 2JGIA 2C9CA 1NVMB 1Z8FA 3IT0A 3JTEA 1E5TA 4TPKA 5GP1A 4DA6A 5HNKA 3FI0A 1EZ4A 1THZA 1IQRA 4Q01A 2MSNA 4JLAA 1FY2A 4OMUA 1JZTA 1AV6A 3JVEA 4CM4B 2BHNA 3E7FA 4DWVA 1UFOA 1M54A 3EQ2A 1AE1A 1TCVA 3RD5A 1BN7A 1XRQA 1JG1A 4EAAA 4ZA2A 5AHRA 2IDJA 2DPMA 4BMYA 1KEEA 2HADA 3ZCXA 4D4KA 2DUWA 3HUMA 1N75A 3V1UA 2RONA 3HN2A 3EZ9A 3NDBB 3VBEA 4HTAA 1U7ZA 2WKQA 2WQ7A 3GQBA 3HU2A 4S1VA 1Z28A 2J9ZB 3BULA 1CQWA 4YV1A 4E03A 4ZAVA 3DMHA 3FDFA 5BN5A 3EEQA 5A7FA 2AWOA 3E3LA 3ZLUA 2FUKA 1LQUA 4PHTA 1FP1D 4DIBA 1GQSA 1NR7A 3O83A 1GYPA 3EXEA 4CMJA 4EY4A 2QN1A 3GRZA 1IVNA 3J80A 3K7EA 4S0XA 1SU4A 1W87A 5CPFA 1SAYA 3U80A 4QJ3A 4G3XA 1H5QA 4DMKA 4EFNA 1T0BA 1G6HA 1TVMA 2F3SA 2PMDA 1RJDA 1W48A 3H97A 1T36B 1E3LA 2ZVQX 4NARA 2VF8A 3T4PA 2PZAA 1N57A 5CGQB 4CUZA 1HFEL 4FI3C 4XWAA 1UJBA 3UT5B 3V9AA 4BYGA 1IY2A 2Q5CA 4HR7A 3TXAA 2M6KA 1AKWA 2H1VA 2J3HA 3N59A 4HX5A 4Q3LA 1YZ3A 2GS9A 3KJGA 3JPWA 3OEWA 4JN6B 1TGVA 2VTBA 4JCOA 3V46A 3P9YA 4DBZA 1MUUA 4KIJA 3TEMA 1FSPA 2CJWB 1W4BA 1P5FA 1P61B 5EMNA 5AKYA 4BDSA 5FWYB 1EFUA 1MG5A 4D8XA 1BMFD 4W7HA 3UJHA 5I3ZA 5DHRA 1K6JA 3AUJB 3RABA 1FLDA 4QQNA 3AESB 5C8DA 3EEBA 2IZ7A 3WSWA 4XGKA 4YMHA 3M5CA 4LRWA 5LA6F 2XWQA 2C8LA 3A9CA 3I72A 3N28A 3FF4A 4KQFA 1K3UB 1XZCA 2WJAA 3FYTA 3SK0A 2BM1A 1P7YA 4I4TA 5FWXA 1M0TA 4X66B 2IEYA 2Y71A 3LF1A 4HLUA 3SJBA 5BUQA 3GLHB 1COZA 1YKSA 1GO2A 3TSAA 5HDQA 4B3IA 1EWKA 1RFGE 4WACA 4LF7B 4OXXA 2N1BA 3PGXA 5HTKA 4RETA 3T7EA 4AX8A 3GPDG 3GPIA 3B8EA 1RYNA 2H17A 4U2BA 2XB2A 3M2PA 1VPTA 1HNZB 3FR7A 5CA0F 1LBHA 3K70D 3D2BA 5F2NA 1ISJA 4LQDA 1FEZA 3GUZA 1JAIA 3KZOA 3FCEA 3LVRE 5A9TA 3RADC 2Y2UA 4N3GA 1CJTC 4Q4JB 4XYBA 2PUGA 1RVDA 1A1VA 5AIAA 2D6FA 1AQIA 2HA7A 2QI9F 4HT3B 3AK4A 3G2PA 2YHBA 1U7PA 3MUFA 1JG3A 2XTZA 5I8ZA 3FOEC 4G36A 4XPIB 1QZUA 2RKOA 4QXQA 4JKOA 4U2CA 5DLEA 3O8QA 3UA4A 3I3SR 2X23A 2YDYA 3OZSA 1YRAA 5TPWB 4PX2A 3RUAA 5D5QA 1DIRA 3NNNA 3Q3CA 1VG1A 4KG7A 1PT5A 1GWNA 3MAGA 2ODEA 5BQOA 4BBPA 3CNQS 1SQGA 2HT1A 1V4NA 2YDXA 4DR7B 2IOFA 2ZI9A 2PZEA 3KYBA 3THXB 4ZC1A 4TQGA 2NUAB 3U09A 1G2OA 3HSYA 1UKCA 5JSHA 3DTVD 4KXWA 2XUQA 2EU8A 3KSZO 4HAUA 3UANA 4KRXA 1ZD5A 4S1TA 5LQNA 2CT8A 5IZCA 1N77A 2PZBA 1NDHA 2XNKA 3QXJA 4ML3A 4PCLA 2BLNA 2ZYGA 4TZTA 5EP1A 5C3MA 1TQDA 1OBCA 2KX7A 4NTZA 1KYQA 3KL2A 2R68A 3K9HA 3WHLA 1C3VA 4RYDA 1RU3A 1SD5A 5HZMA 2IYQA 5FL7D 1SCBA 3ICEA 3G9TA 3ZWAA 4Z7OB 4ETIA 3TYXA 3VQTA 4F21A 5EERA 2GJ4A 2X58A 3CE9A 1GKUB 1U3GA 1UC4B 4L6AA 2X8JB 2VAMA 4MEAA 4ZARA 4LOJA 1U8EA 2HA6A 1WDKA 3GD5A 1THTA 2CV0A 2ONCA 3QKTA 2EZ4A 1X8JA 4DR1B 1E2PA 4Z99A 2IH5A 4JVOA 2CVOA 3RASA 4AJIA 5DF1A 3CLUC 2C07A 2WFZA 4NYJR 1OBHA 5F5NA 2XDQA 3ZK9A 1Z56C 1VBNA 2QMEA 5HUHA 1JEAA 1PEKE 1FTQA 2OV1A 2VPQA 2C54A 2DC1A 2O3UA 2QG6A 2XD9A 1ZSNA 2LCQA 2XYQA 2RIRA 4OTZA 3IPAA 5EJ8A 4YLYA 1XZNA 3IP5A 4TWRA 3HA7A 1ZBDA 4EQZA 5CB6A 3TRIA 4UHHA 4YC7A 3A1SA 3KT6A 4M0PA 4KLZA 2VA9A 3QE4A 5U9CA 4O2AB 1YA4A 1M9NA 2IS2A 3PF8A 4JSYA 3ELWA 4NRDA 3E53A 4K46A 1PKEA 2OYSA 1IXZA 1KYYA 4DC9A 1LDGA 1ORDA 3OE7A 2EIXA 2AZMA 2VTBB 5A0FA 3S4YA 1ZBQA 2BUAA 4UBLA 4X7MA 5JFOA 3ADCA 2BSXA 1KBOA 2J41A 5TS3A 5BSWA 5EFOA 1IH8A 2QZ9A 4WA8A 3D1LA 1W36C 3AETB 3BTOA 4IYRA 2W2TA 4PGAA 4RZQA 2PV0A 5KNCA 4IOKA 2WF7A 2BMJA 3TD6A 1RR6A 2Q1TA 5L7TA 4YV2A 3RYCB 2R47A 3C43A 1JDTA 4HWPA 1NW4A 4G67A 2QRPA 1YB2A 5K03A 3DG9A 5NULA 4LRXA 2YINC 3VI4B 2O8FB 4OP3A 4HXGA 5F35A 1C9KA 4JEHA 1QGOA 4QYSA 2Q3CA 1FP2A 2P6MA 5AKJA 4YHHB 3E9RA 3OOWA 2VG8A 4HWRA 3HU5A 4OIFA 4Y2SA 1FIUA 2SKCA 3ISJA 2IA5A 5FBKA 3BZBA 1XZDA 2JH8A 1XRRA 1L4KA 4X20A 4FFOA 3BIOA 3LT1A 3OT1A 4KQCA 5GJWC 2BI4A 4L9WA 2OHIA 2BKXA 1MW8X 3U39A 3GXOA 1OWNA 1RAHA 2FG5A 3DPUA 1OXXK 3OC6A 5E95A 5IJ9A 3EDQA 4XR4A 4UTNA 2GZ3A 1I14A 4BJ3A 4EGQA 5K3FA 1FOEB 3T5TA 4IEEA 2UZ0A 4J16A 3R09A 1U0RA 3W4KA 1E1CB 3G3EA 2BGNA 1YS9A 2O3QA 3R0JA 2PZKA 5KYUA 2DBVO 4YWJA 3CF4G 4XI9A 3K53A 3R6DA 3R0VA 3RJ5A 1GDHA 1WV0A 2QZ4A 4UBMA 4UPDA 3V32A 1P81A 2ICAA 1VIMA 4ES6A 2IZ1A 4NFLA 2BMFA 4WLNA 3V2HA 2FPUA 1WHTA 1QHHA 3G59A 1M1NB 4LC9A 1KFKB 3JD2A 5CVUA 1I1OA 2MSEB 3AM3A 3ZD9A 2FP4B 3LUJA 3TMKA 4CR7A 1E3IA 2A14A 2X76A 2H8KA 2ZT7A 3QX9A 1JYEA 4JOQA 3NP7A 1YJXA 4HVCA 2C4UA 2ATCA 3RTGA 3TW0A 2MOKA 2FE1A 2XZOA 1XU7A 1T3SA 1I5EA 1A7JA 2HWUA 3JQFC 3KUDA 1O8BA 3LPCA 4G1EB 3E18A 4OOEA 4F5YA 3LGXA 4CIDA 3THYA 3LS2A 2RGDA 2FUEA 1JIQA 1Y4SA 1ZNYA 3EYWA 1H6DA 3GZNA 4RVUA 4OI0A 3DE6X 3KU1A 2Q7DA 1AQJA 4FYPA 1KO1A 1J7JA 1PR1A 3FUTA 4N9QA 4TV9A 1MAVA 3SZOA 1V39A 2GRUA 1YR3A 3ACDA 3C3AA 3KKOA 5ALSA 3CLUD 1G1AA 4DGQA 3ZDBA 1VRCA 1D1TA 4AY2A 2ZRQA 5IARA 4GX0A 3T3EA 2BR4A 3O2SB 2HK6A 3CW8X 4XQ9A 1X15A 3UPUA 2Y66A 4GZLA 3GUVA 1U5BA 4H0FA 2JIQA 2OSBA 5FADA 1OR8A 4L74A 5K3BA 1O8CA 1Z06A 1ZI6A 2ILTA 1Q0SA 5IANA 1GUDA 2CXNA 1XEXA 1N1GA 2UDPA 4GF5A 5SZJA 3TLAA 1RHUA 1PZNA 2XKBA 2ZCUA 3ABOB 4PR3A 2HWYA 4RFVA 1CS4C 4UTOA 5UKDA 4BPBA 3BM5A 1C1YA 2H4WA 3E35A 1CQJA 3I83A 4CEIA 4KRFA 2AQHA 5DHAA 1IOWA 4GX2A 5AW2A 5A5VA 1U7DA 1ZUHA 1Z4LA 1QM5A 3NEJA 5ALTA 3SYTA 5K99A 3WKDA 3Q0EA 1N36B 3OQBA 3Q10A 2WE7A 3H5AA 1IN5A 2CWWA 2HLNA 3NNSA 3MCZA 1D8TA 1E7SA 1XK6A 1IOLA 2W90A 4BN0A 4GPEA 5DGHA 4CV1A 5E0OA 1YL5A 3UW1A 5K3AA 2OYCA 4IHKA 1HDCA 1UC8A 5D00A 1V11B 5F51A 3V1TC 5GONA 1SG9A 4ER3A 4NEQA 3FVTA 5LD2B 1NXWA 1NVBA 3CFYA 3SLKA 3II6X 5FPPA 2C95A 5J1TB 4PY2A 1M8JA 4D9GA 1R15A 4P5DA 4INPA 2W2MA 5ESDA 1LLCA 1C50A 2WA2A 1BQ3A 2FWBA 1UMCA 3HJAA 2GTIA 3GGPA 4CL2A 3O9MA 4BO8A 5JCPA 1TZJA 1OC2A 2QM7A 3E2IA 3R3XA 2EJUA 3DFUA 4PANA 4PNHA 3ZQJA 4JQSA 4N3BA 2WPDD 1XF1A 2C83A 1Q17A 1NSFA 4JLVA 3I92A 4GOKA 2JL1A 1EBFA 2NX2A 4UM9D 1YFLA 3VX3A 4XB6B 5CFPA 1HE1C 1UBOS 2WJWA 2XBLA 1NXSA 1U8CB 1R8XA 5FL3A 2Y1XA 3P0HA 3A6GA 1XXHB 2NU9A 1L5RA 3OZXA 5FFFA 4C0QC 2OECA 4DIOA 1RLOA 4V1CI 1GG2A 3UGTA 4Y6GB 2NYUA 5BMVF 1HNNA 1OV6A 2PFKA 2Q49A 2YOHA 3D8BA 3HDGA 3PXBA 3S29A 3T7TA 3F3SA 2BLLA 3I32A 3O91A 4J8PA 4NMWA 3NM5A 1W0JA 1VBKA 3I9OA 3UHFA 5CB4B 4F5ZA 2VI5A 1GSIA 4BJ1A 1R5NA 1RQ2A 3P2MA 4JUAA 2ZJ1A 4F45A 4DQUA 4E08A 1SVNA 1G8SA 5IT5A 3PFIA 3H1PA 2DHCA 4LMPA 4OOFA 4UNPA 4L75A 3TM4A 1JHVA 4C0AC 4LDPA 1B6SA 4G86A 3EVDA 2FRDA 3EFHA 4RPKA 4GYKA 3WBJA 4F98A 3GZTB 3TNYA 3KQNA 3DAOA 1L4NA 5CM2Z 1VIDA 1Z9BA 1E9AA 3G9UA 2REXB 2ZSIA 1EK0A 5FUQA 5ALWA 4CLRB 3IT1A 1TVCA 1TYCA 1Z2OX 4OHBA 3SF0A 3R3SA 1C4KA 2DFNA 2C59A 2CHUA 2PYDA 2YBEA 1C5KA 1P0FA 4WWHA 4C4OA 1GU0A 2CJYA 2FFJA 3IE1A 1W25A 1Z74A 2FPPB 1ZYUA 5EJGA 3V2UA 1DOZA 1E3QA 5ITZB 3DZJA 4U0JA 4X9XA 5EFZA 3LRPA 5KU1A 2QOEA 2O8VA 5EE9A 1R6UA 3EE6A 3MWKA 4PPFA 4GI3A 1P6XA 2PN1A 4M0LA 3UAZA 3QOXA 3UH1A 3L8DA 4BDTA 1GUFA 4YMIA 1M75A 4PZYA 2VDVE 4WLFA 1LD3A 5EUBA 3JX9A 1CFZA 4DS3A 3NT4A 3C8MA 5MF6A 3PUYA 1YTLA 4K9KA 4NL4H 3PHGA 3QYFA 4LUCA 4BWGA 4E3ZA 2QAGC 4H4DA 3K0SA 3W5AA 1B16A 3U56A 2CNKA 2F2TA 1OILA 4ZC8A 1BXGB 1YDHA 4ZMBA 1FTWA 2FXVA 3N0XA 3MN1A 1GM5A 2OP0A 1BDMA 1GFIA 4JVMA 3BL8A 1CR2A 1QH0A 3OWXA 4Y2UA 4RFSB 1I3KA 1NOIA 2FZKA 9LDTA 3QOFA 2HH9A 2AMVA 1EAYA 1L8OA 2IHYA 5G0UA 1PK8A 4X6XA 1Z2NX 4QSHA 4AU1A 4MGIR 2BSQA 1A71A 4N40A 4BX0A 2AOWA 2YRXA 3FHLA 4J1NA 2AFHA 5H81A 2E4YA 4P3NA 4RVGA 2Q0QA 2IU0A 3ND9A 3IIJA 1CY0A 1P9NA 3F96A 1TT7A 4HDKA 1V5EA 4C05A 4D8WA 2XDQB 3NM4A 3CRNA 4K5QA 4W1RA 4HPWA 4N1AA 3REOA 3BSYA 1P18A 4TQ9A 2MSLA 3K8ZA 4POOA 4MZDA 2O2DA 2P77A 3E3NA 4PXSA 4B3HA 3ZEAA 4C6HA 3EUAA 2FPXA 2CVQA 1JKIA 1MO3A 1XAJA 2XE7A 3CEMA 1X13A 3QXSA 4ITVA 1RI1A 1QCDA 3BB1A 3DZBA 3EXFA 1PJSA 3KXLA 5TQ0B 2W6CX 4C2TA 2HDNB 1BQEA 2WWXA 3HKBA 3L0YA 1TE2A 1NTRA 2WSLA 3DBVO 1DTEA 1FP4B 1KMQA 3OMLA 4DLAA 1I4WA 3DE7X 2DUMA 2ZREA 2X9VA 4KZPA 4LZJA 5C0OE 2JLSA 1OTHA 4QDTA 5IXYA 1PV2A 2IVZA 2Y76A 3CGWA 3RVMA 4RTJA 4TWIA 4C0BA 3QMMA 3RVNA 2NQ8A 2PGNA 4KLCA 5HRUA 3C70A 1T3GA 5TV2A 2PZLA 2CDAA 1T5TA 3GWGA 3H8VA 5LNK1 5LQDA 4M37A 4UAUA 4EELA 4LOHA 3WKCA 1EU1A 5E7JA 1QF7A 5DT2A 1L5NA 3GHHA 5IPFA 4PNPA 4KLNA 2RHGB 1XZGA 2I99A 4WZAB 1Q7BA 2QB5A 1WXXA 3AHCA 4R83A 4AZSA 2RAVA 4G2TA 5C2JB 3EBPA 5E4JA 2YW9A 3LW8A 4NK4A 1ABBA 2XCOA 5FLYA 3LOPA 2PLFA 1SK8A 1DO8A 5M29A 3B2EA 3L7NA 1PJRA 4QIHA 5FYDA 1IBCA 1UMDB 1ZDMA 2RI0A 1P2DA 4HB0A 3K4HA 5IJZA 2W9XA 3UMSA 5JBNA 4AAYA 3I8SA 1L6RA 4TT3D 3U26A 3B82A 4EP1A 4IDBA 3WLKX 5CT9A 1Z45A 4OFXA 3T5CA 1KBZA 2GRJA 4Q19A 4B71A 1Y9DA 4C6TB 1T6ZA 4J76A 3GP8A 1NC1A 1YA8A 1Z07A 2DKFA 3KR1A 4Q24A 4RDHA 3X1JA 4A6DA 4BTLA 4DEYA 3RS7A 3WLIA 2YVLA 1WLSA 2I2FA 2NSHA 1TMGE 3BJIC 1WB5A 3FM9A 5JD3A 2E5FA 5BURA 1A95A 3M5PA 4JEUA 3IFSA 4RIFA 5ILGA 1AX9A 2DLCX 3C8UA 3M2TA 5EZYF 4OHOA 1FDTA 2BV3A 2JS7A 2Y8EA 5U4XA 4WK4B 3R3JA 1SXJA 1HT1E 3Q8XB 1DQYA 1KI8A 1HETA 4J4HA 4KIGA 4PYQA 1C0IA 1PJ8A 3IAUA 4BVAA 2Q7XA 1WSWA 2ZB3A 1EMDA 1S89A 3Q9LA 2CE7A 1RRPA 2QL7A 3IT2A 1RQPA 1KNQA 1HYEA 1T34A 3QNWA 1P1HA 5LMUB 3KETA 1J99A 2QV7A 1Q15A 3IVAA 1ZU5A 1UZLA 3C87A 3DUFB 1K88A 3KHKA 5AH0A 4G0UA 4M0MA 4FBLA 3V4SA 1KOFA 3FRJA 1QP4A 2AF4C 3RVPA 2RGRA 2OO5C 3FZYA 3O8DA 3OQJA 1ECCA 4A27A 1H2ZA 3KR2A 1DTSA 2IS6A 3EHDA 2VUSA 1FFGA 3AR4A 1EGHA 4XGRA 3O8CA 3NTLA 3PDJA 2IPNA 4I9NA 1KERA 4K87A 4ZK6A 1EZ1A 1E9BA 2Q3JA 5H1YA 2CUKA 4EQ6A 1HMYA 5F7OA 1E2UA 1A0OA 2II6A 3ABQB 4E1BA 1SXGA 3IAFA 8OHMA 4OBEA 3L79A 3KQWA 4M55A 1XJWA 2PCJA 2C1XA 4JBHA 2X3YA 4V2IA 5CNJA 1I5RA 3I9KA 3ENNA 4J3NA 4LWQA 1DBIA 2B78A 3D0OA 3PC3A 2VLIA 3QBJA 1NX6A 1WSAA 4PAGA 3SKXA 3AFIA 3DR5A 2M6SA 1L4EA 3DVQX 1RWXA 1LQ2A 2AL7A 3K31A 5AJXA 1E7YA 1Q0ZA 1VC2A 3HKEB 1BEUB 2EL9A 5FFMA 4PW0A 1POXA 3LP5A 5A71A 5TEVA 4H1TA 1VLVA 3W5IA 4JSRA 1QCZA 4ND5A 4BY9E 4XUEA 5K3FB 2VQFB 4Y2GA 4HG2A 3SDBA 5IJ9B 2CMGA 4Q21A 4TSFA 4EPYA 1VDMA 4KGXA 1E0KA 2ZI4A 3IVGA 3H05A 4GH5A 4I1VA 3UKJA 4L5YA 5CAEA 2WYVA 5AK6A 2ZANA 3DKIA 1A98A 3SNHA 3AC0A 5JY1A 3F4KA 4CKWA 3CT6A 4Z8XA 5CFRA 2FCRA 4R8RA 4TL7A 1ZNZA 1WMEA 1PEAA 3BEOA 1BEEA 2FLWA 3BAZA 3DXXA 3F5SA 3PNBA 5GJVC 5AVSA 4DVJA 1VP3A 2Y27A 1KY5A 4YMLA 3UTCA 1UEJA 1XCGB 5K8UA 1ZH4A 1OHHA 4YJDA 3WB1A 1JFLA 1QRTA 4RSGA 3T41A 5G4LA 3GEHA 2IJGX 2COEA 3HCDA 1RMQA 3MOIA 4ZXFA 5L3RA 2A9QA 3NEYA 5HJ5A 2WOJA 1ZJ5A 2AFIE 3ACBA 1HPLA 2G09A 4DE5A 5LXTB 3DMYA 1HDRA 2JCGA 2ODWA 1XMIA 1SVWA 1ODKA 2BJVA 1GVNB 1DIHA 2ZVPX 2FDXA 5JADA 2C9OA 2GLXA 4B81A 5EYPB 4BO0A 1JU4A 5CGZA 3BKXA 1OXVA 1Z88A 3UJCA 5ITWA 3JAWA 1OU0A 2IYUA 3RVQA 4LHEA 1Y1KE 5BV8A 3G9QA 4GPTA 3OY2A 2Y77A 1KR5A 4C9BA 3AVTA 4OUKX 4AX4A 3DNMA 3DXYA 4HP8A 4FE3A 3UMGA 3BMQB 1A7KA 4TLDA 1NBME 5CB4F 1ZHOA 4GMDA 1LVUA 4P22A 1E2JA 3ZFPA 1HC7A 3HL4A 3KFXA 4ZT3A 4XDHA 5DM70 1QG6A 2B30A 4U7PB 3WSTA 1BGWA 1N9KA 3TW8B 4L8VA 2QP3A 5EIHA 2OWEA 4H3VA 1XZQA 1FU8A 1KJYA 3PPYA 4BUZA 4F11A 3A4LA 4NMMA 1ZM7A 3GQBB 1RQLA 4ND2A 3ZHCA 1DSSG 3FVWA 1S2DA 2C2HA 3PD1A 1AUQA 1SURA 4ASUA 4OSEA 4RF4A 3GRYA 1C1XA 1R10A 4QUGA 4BFCA 3PEYA 1OYWA 1E60A 1KYVA 2ZU0C 3INNA 3TVYA 1PR2A 3OLQA 2FFAA 1ACLA 4KB5A 3WL8A 1QOPB 1SA0B 1Z39A 1YR1A 4IHAA 4UVDA 1V9SA 3R5XA 4MQLA 1Z5ZA 4OHUA 4YIKA 4B4DA 3RC8A 1SKYB 1SGWA 4YFYA 1EK1A 4GMKA 4C3UA 3RO7A 5T41A 1ISRA 1M67A 3FUVA 3NTUA 4FEAA 4PSAA 1PGNA 4C3OB 4FP9A 2VZ9A 2PUTA 4IJQA 3VFDA 1OC4A 5F98A 3OM1A 1VI5A 4DT1A 2AOTA 3NIGB 3TTXA 4HUTA 2DH6A 3MW8A 3NYIA 3OFKA 3OH8A 3O95A 4EVRA 5A0TA 3IHLA 3AB7A 4CVNA 4QEZA 2EV9A 3KYDA 4R1QA 5G02A 3UGKA 5K0EA 3FDZA 1C14A 4YO7A 2POCA 2Q1UA 5EQFA 1NX9A 2J46A 3IMGA 3RV3A 3VVCA 4YYZA 2AG1A 2OHXA 1H0KA 1YZKA 1I8TA 4MKRA 4OGKA 4DV5B 5BV2P 5KO2A 1V25A 1QRRA 5THQA 2PV7A 2ZRAA 3CB2A 5FTWA 3TNJA 3RYFB 1K7XB 4HUJA 5I4BA 1ZPDA 2VBCA 3C6YA 4TQUS 4YRCA 2A4MA 1VYVA 5FT9A 1SR8A 2PSFA 4IPTA 5TQ2B 4GIBA 2CDRA 3PHBE 4M1TA 3IP6A 4NDAA 3AM5A 4PIMA 2GOYA 4MAAA 1X3SA 4YIHA 5B58T 3NANA 2DF8A 2WMNB 1PWHA 2P8JA 2O4CA 4TS3A 1HFKA 3TOXA 2PNFA 10MHA 4V0LA 1CP2A 2MSKA 2Q2VA 3I1JA 5DCWA 3VH2A 2WSSD 3HJCA 1ADBA 3D0QA 1Y7TA 4HPJB 2RH4A 2BVNA 3AJDA 3EXFB 1QPGA 1X2EA 3QHAA 5G1OA 4TX1A 2ZRBA 4LJRA 4UQLA 1JS1X 4GM1A 5SZIA 1UDAA 4KPFC 1UXJA 2OXRA 1ISIA 1E6UA 4JLWA 5H3LA 3RLIA 2GA8A 4D57A 2JZNA 2D1TA 3EGVA 1L4UA 4W7SA 1V7QA 5ETJA 3HPQA 1RAAA 1R6BX 1GAQA 3Q6IA 3OFNA 3SNKA 3OIGA 3VPFA 1YOBA 2V98A 2W11A 2V03A 3E2MA 3G0CA 1JHMA 4BNXA 1NLYA 1T2AA 1HR0B 2X0EA 2XUJA 3DL2A 1R74A 4F4DA 2GKSA 3R3ZA 2XX3A 1FK8A 1XIVA 4KHZA 2Y1FA 1O6FA 5FNVA 4J90A 5A3SA 3VNRA 1R9NA 1Z7WA 4A03A 5ESXA 1JJIA 3SPXA 4YV0A 2VDOB 3LQ1A 1EFVA 3D7NA 4KHPB 2GSDA 2PBLA 2OG2A 5JHHB 3CRMA 4D7AA 3CNNA 3TECE 2DQKA 4Y30A 4LYYA 2BKAA 1V7CA 4MGHA 4KSYA 2RBGA 4FEEA 2HMVA 2FFQA 2HDWA 5CLLA 4OBXA 1B3BA 5C4IA 1DAFA 9LDBA 2POQX 3ZHXA 4OHYA 1O96A 3JZDA 2WIGA 1STOA 1ENPA 3QELA 1HWYA 1NJ2A 1U8XX 2CKMA 4XFKA 3W7AA 1P1KA 1JIVA 1H2HA 3JZMA 4D02A 4MWCA 4MHOA 1CHDA 3ES9A 5EJEA 4KK3A 4TSRA 2G40A 4ZJYA 3AF2A 1H94A 4KWCA 3USES 3IUSA 4RDIA 9MHTA 3M4XA 5JJCA 1S2GA 3CLSC 1G6Q1 1MEOA 1RLUA 3KE8A 4QD3A 2IL1A 4DKXA 5A4MS 5J2UB 1WCIA 1X1AA 2IHBA 2V7QA 4OG2A 1SO8A 5D5HA 4TYNA 2YASA 4FDUA 1OA1A 5EPUA 4G0OA 2QTLA 5GWXA 3EWSA 5TQJA 1HE5A 1T5LA 3NH9A 3A2KA 3AEUB 1QAQA 1QE5A 3KYCB 4EMSA 5EWLA 2YYAA 3M6FA 1SVIA 1GZHB 2O7RA 2H2WA 2RK6A 4WEOA 5AW9A 2R4UA 2RCYA 3DT8A 4GBGA 3DDCA 1QTIA 1TPYA 2LRHA 3X1KA 2AOVA 4NBLA 4BE7B 3V7YA 3CXUA 4GQAA 2RSLA 2VUHB 2PU7A 4HV4A 1QS0A 1KP3A 2B37A 2P11A 4M83A 4MS1B 4QJIA 3BWMA 5H9WA 4QUKA 4TS1A 4M7PA 3IAAA 1E5LA 3TSWA 1L5MA 1ZIOA 2Y1OA 2V65A 4RD2A 3KBBA 4K81B 3SE7A 4IQFA 1Y80A 3NWJA 1P2FA 3QFSA 3V9PA 1G3UA 2PLAA 4ANFA 2GF9A 3D4OA 3KOUA 3T52A 1VLLA 1W85B 3WR5A 1RAGA 4LVUA 4C2BA 1X6VA 3K8QA 4EJ6A 5BSEA 2P4EA 3UAGA 4RPGA 1XP8A 2A9JA 3BWXA 5D86A 1FDSA 1SBCA 4CDGA 4G24A 5DRTA 1EHYA 3TQOA 1QOZA 1TQ8A 4QHTA 4DA9A 1JR4A 1DJQA 3ESAA 3D6JA 4G2NA 2ADOA 2J9XB 4TN5A 2HYDA 1L7QA 3UWPA 3FFXA 1IM2A 4YMTA 3OTOB 4JV5B 3ROKA 2Q9UA 1NZDA 3GEPA 2XIJA 4TKVB 2DTDA 1W5FA 5C53B 4OGWA 1DDIA 2W2XA 3C5WP 3OBIA 5I9SA 2OXIA 3T7SA 4YCLA 5IDWA 1RQRA 3EF3A 3O4IA 4DG5A 3ZXSA 2WSBA 2YMPA 3DMFA 4KUEA 5KVVA 1GCAA 3D3QA 1JQAA 2QTGA 5ES3A 8AT1A 3V00A 3ZWWA 1RZ3A 1DQRA 3K96A 721PA 5I47A 4K2HA 2DJ5A 5SYMA 4BNHA 4YR9A 2FUG6 4R0VA 2XWJI 5JR3A 4HD8A 4Q1BA 5AKLA 1A96A 3WNZA 4UULA 3TNFA 5JJIA 1PNOA 2O8FA 3CS3A 3ER9A 4PCVA 4B35A 2OFOA 2JGDA 3FNEA 3R7SA 3JR3A 4MRVA 1V6CA 3R3HA 4IR7A 4XCQA 1JAZA 1E6LA 1FQWA 4BKQA 2OR3A 3AR5A 3VVBA 1O87A 2EDAA 4Z4HA 2DULA 3T5AA 1VZ2A 4W9NA 1CDZA 1LLDA 3B3AA 3H17A 1SPBS 4S35A 1DQSA 1VGRA 2Q2QA 2GPNA 4J0EA 4G09A 3H19A 4E2WA 1OBFO 1ZN2A 1K3FA 3B5EA 3JWIA 4ZVQA 4EPXA 1FRZA 1VKOA 1Z6AA 2HCTA 1EGAA 1B1AA 3ZJ4A 1RC0A 1OLOA 3SI7A 2AJCA 2Y93A 4F85A 4RLHA 1RXWA 2TYSB 1K08A 3L7YA 2PGJA 2A0WA 2H00A 4KAAA 2IHUA 2FU5C 2G1UA 2H85A 2PS1A 1A9SA 2X6QA 5HFNA 1DI0A 1T5OA 4K9RA 4F6LA 2R97A 4KXUA 3JZIA 5SZKB 1CQZA 3DO6A 3N8DA 4JY7A 3VNQA 4OKNA 2IHTA 3BJMA 3SZUA 1OU4A 1WDLA 4LYDA 3THSA 4F97A 4BLTA 3K0HA 3NUZA 1ZUD1 4ND4A 3KQUA 1OB2A 2B2NA 1MKYA 4HAOA 4KN9S 4AS2A 1BMFA 2ZRDA 4OJQA 5IKEA 1E3WB 1E99A 1BE0A 3DHYA 1Z0FA 3H3XA 3VVMA 2NUPB 1TYDE 4A8HA 2V45A 4QOGA 5ISMA 4Q48A 3QVSA 1DLJA 2HRQA 3SHVA 3T5BA 2O5EA 1L5OA 3M3HA 4KXLA 3H4MA 4QU5A 5GPBA 3D7KA 3DTVB 2JCSA 2I4TA 1HLGA 3FAZA 3R6TA 4I1RA 4P7KA 5CXSA 2ZM6B 1GT91 1SBIA 1RYMA 2OTCA 2WF5A 4RLQA 3PA6A 3VJMA 2P9JA 1IVSA 1SCUA 3QG5A 4TWAA 2R8PA 4KI7A 3PL1A 5M5BA 3KZCA 2WJPA 3DZGA 5DGIA 2IU6A 4GOLD 9ATCA 2BR5A 4UHBA 4NSNA 5EGSA 2UVQA 3ZHQA 2PD6A 1CYEA 4FOTA 1U1GA 2GFQA 3SLRA 3BPSA 1V1JA 3TL3A 4P0TA 5EP4A 1C0LA 1UMKA 5KYUB 1KMMA 1KYIA 4D56A 3C6QA 4K1XA 3PUWA 4QARA 3MQ2A 4M49A 1ECLA 4ZHSA 2P9CA 3UMRA 3ZVKA 3QEBZ 4HLUC 2Q62A 1VMAA 4KQJA 3Q7RA 4ZKEA 4EB0A 4OP1A 4UDXX 2JF0A 1F5SA 3NONA 1VJCA 4XRRA 3DOIA 1TZBA 2CVHA 3FFAA 2X9GA 2YWBA 4HNHA 4UUBA 5FQOA 4JIGA 7MDHA 4RSHA 5BMVB 5HG0A 3DONA 2WMDA 4E5UA 3AGQA 3KQPA 6ADHA 2Y4NA 2IDZA 4S12A 3HI6A 4TMXA 4KOEC 5A4AA 3FTEA 3CLKA 2O0MA 3HK2A 1B8PA 5DNAA 4XJSA 4EHBA 4IUCS 1CUWA 2E2WA 2YC4C 5F9MA 1E77A 5DTRA 4GOMD 2C00A 3AR8A 1CNEA 4HGPA 3TRDA 1NBEA 3NNDA 4NNOA 1IJKA 3L92A 1H2FA 3X1YA 2HTEA 2OK7A 3MD0A 3NPAA 5HDBB 2N42A 5KTNA 5L8VA 2PAFA 1KPHA 2DZDA 2QR2A 4GSKA 4WK2B 3TPFA 1FYWA 5IK2D 4YJ3B 2FZCA 2OAP1 3WAGA 2HCFA 4RHCA 1GUAA 3KLMX 3ZDEA 5BWNA 1M2NA 3VPXA 4W5OA 4BRSA 4H1UA 1JFVA 5LJLA 1O96B 4YDQA 2ETVA 4BLPA 4CKYA 4OATA 1L3IA 4FFBA 4QRIA 4YQZA 4KO2S 4LZNA 4K28A 1R4AA 1DE0A 2GVZC 4NBUA 3RSSA 2DPHA 4PQYA 3EIXA 2XKKA 2CGEA 2A67A 4HPXB 2Z83A 2FRXA 3M9WA 4PU0A 3LX4A 2I3DA 2VPIA 4RADA 3G8CA 3LXXA 4BVKA 5BSFA 1X39A 1F8XA 1E1RA 2RI1A 3K92A 3SVZA 1DRKA 1ECPA 3AXSA 3R74A 1F2TB 3A6FA 3KQHA 1LGYA 1ZOPA 3KYIB 1J8VA 5CJJA 1EJ6A 1RZUA 1P1CA 5MHTA 3VR6D 4CV3A 1MQAA 4FFSA 2WR8A 4BYMA 1UUFA 3ADOA 4KTVE 2C8KA 2YCLA 1Z0IA 3EQ6A 3OZDA 1O0SA 2DECA 3HFGA 4LRQA 3KVOA 5K0LA 1BVHA 1U31A 3NDRA 3WK4A 4PNEA 1WCWA 1YRBA 4AZWA 4FZRA 4PNZA 1Y1SA 2H0RA 2Y05A 4YCDA 2H7VA 1C2YA 1O6CA 1L5LA 2IYVA 2P1DA 3DEHA 3SX2A 4NU6A 4AW9A 5JD4A 3AYZB 2QD1A 1KI9A 1SZCA 2BMDA 2CMFA 1TM7E 5T3UA 3WWPA 1F2UA 3DO8A 3JQ7A 4XQEA 4RD3A 1S2NA 2IW3A 2B4KA 1ZX1A 2QG9A 3ZIAD 3D3KA 7ABPA 5AJTA 3SR3A 3OTIA 3T9BA 5IBRA 4L6CA 4CN9A 2YV4A 1A9XA 4B87A 2QX8A 3HVJA 3KT0A 4EW3A 4LAFA 4XQ0A 2YC2C 3RKSA 2P4QA 2YQ4A 2JI7A 2AJ8A 3CZMA 1RWWA 2ZJ7A 4N65A 3R9XB 4JBNA 1N33B 5DT9A 4PRYA 4FHDA 1SCAA 5IMSA 4LF5B 2OBXA 3PE6A 4YA6A 2GPYA 2A92A 4MNTA 4OHCA 2DRIA 3BGWA 5EA2A 1H22A 2P3OA 3SBXA 4DARA 2HAEA 3K73O 1T1GA 1E62A 2PVSA 2JFYA 1H5NA 4E1AA 5IVKA 4CKZA 3PX3A 3UHPA 5BSRA 3FSGD 4XE5A 1QRSA 2C9DA 2VQDA 3ZDFA 2OZVA 3KJEA 3O75A 4HDSB 2WC1A 4LRUA 1Q92A 3L7BA 4RV5A 5DXAA 4EW6A 1KI6B 3PT5A 2NUAA 5E0KB 5KMGB 1YIDA 2VBIA 3AVVA 3PHLA 5T5QA 3ZXIA 3CTPA 1GKIA 2I8CA 2QGZA 1OBOA 2WBLC 2CLEB 2I34A 4PLFA 3I6YA 5AKIA 3TL2A 3SHQA 1XG5A 2RE8A 5CG1A 1FLNA 1T9GR 4F9TA 3PF9A 1A9YA 5HMLA 4Q3AA 5I9NA 3WLOA 1WXHA 2FPOA 2RH9B 1L6IA 4JI8B 4BNNA 2J4CA 3ZV5A 1NRXA 1I7SB 2FMUA 2JANA 1SCDA 1IY8A 1W0KA 1YDWA 4C08A 4GXTA 2ODAA 2XCQA 2YJGA 3I8OA 3DMPA 3VZRA 1E2GA 1P5JA 1P4GA 5GM2A 3ZJVA 4PYJA 2P65A 3WS7A 4ABTA 4FC6A 2EQ5A 1ZKDA 4GPD1 1OZHA 2FOIA 3C7DB 4ZAYA 2AOUA 5HUQA 5K0FA 1BVRA 4P81A 2H31A 2HSDA 1ONPA 2NM0A 2R65A 3A3KA 1ZM2A 4RA6A 4UOQA 4ZXPA 4JI6B 5YASA 4YY3B 1Q1NA 1GV0A 1LKZA 1NVTA 1LW7A 3GX1A 2ZUTA 1Z0JA 1ACJA 3KVNA 1L1QA 2H4YA 5EHQA 3T34A 1E6WA 2TMKA 1L8AA 4MI3A 3OIWA 4LRTB 2WWFA 4EG8A 4NOJA 1W4ZA 3D8RA 3ZE9A 4R3UC 5EJ6A 1P6QA 4JLOA 4QG7A 1E0SA 5CFMA 4B3BA 4L4YA 3QFFA 4DIUA 3ITNA 1YS7A 1D1QA 4BAUA 4QG3A 1OB5A 4QGGA 4JLKA 1REQB 5K6RA 2JI8A 4CTNA 3D81A 3UHAA 3BMQA 2WUGA 3LY9A 3BXGA 3ESXA 5FI0B 3GUHA 4OQEA 4F96A 2FG6C 1XQ6A 4FN5A 1D6NA 1KI7A 2GFIA 3PUJA 2X1VA 3HUDA 4LJ9A 2FXIA 4HGRA 2ZZKA 1PP4A 4NONA 4ERXA 5FDFA 2WF9A 3C6ZA 2JVKA 1Q0UA 3C8ZA 3W78A 2XT9A 3GAAA 1J0XO 1K6MA 2W7TA 1V5GA 1H1LA 2YIVX 1RYEA 1RCTE 2HOQA 2O8BA 1KC3A 2WU3A 3F6PA 1RKQA 2WAOA 1T1IA 3L1JA 2WJVA 3WI7A 1ISGA 4ZV7A 2G9NA 3GLFE 5IJAA 1AXGA 2D2IA 2QI9C 4R8SA 1QONA 3K9WA 3PGLA 3WISA 4ND8A 2AGVA 2I71A 3GRRA 3SC2A 4AURA 4UVIA 4YJFA 1ZCBA 4D3ZA 1ONSA 1DCKA 2GF0A 3MJSA 2WZQA 4HAVA 3Q3VA 1YV9A 4UNIA 4PC3A 4ZRMA 1JDJA 5BV7A 1ZJWA 3OQ6A 4RMNA 3GT4A 4IHJB 3GJ6A 3BGOS 5D2CA 5I45A 1NLZA 1ZOLA 1YVDA 1ZUWA 2REQB 1Q3HA 4K9MA 4XIJA 3RHTA 1J2TA 2WHXA 3VR4D 3ZI7A 4DDMA 2YJTD 1B4DA 3VOSA 3RSCA 4YV7A 4RHFA 3N76A 3T3IA 4H77A 5BVHB 2IEDA 2C84A 3P9CA 2B5OA 1A2QA 3O1HB 5EL0A 2C5SA 2VPPA 3B1KA 3EIEA 3QI7A 3RFTA 3M70A 1T5DX 4PVCA 1BFKA 1MR3F 2ODBA 3LSTA 3CM0A 1ZK2A 1N9GB 1H2YA 2J7PA 3VKHA 1ISHA 1Y8QB 2WVGA 2RGGA 4PZUA 1AGNA 1IHDA 4AP5A 1R0XA 4OBWA 1UBNA 3RGWS 3STXA 1VSVA 1E1QA 1LJUA 4QODA 3HKEA 5AK3A 4QYIB 5IMBA 2JATA 1KSFX 1LSUA 3K09C 1AQYA 1T15A 1HZJA 3CJQA 3ZFRA 2CBGA 1QVWA 1X14A 1ZESA 4BXOA 2NG1A 3FGOA 2JD0A 3PKIA 5FPQA 2F8TA 2H0AA 2XR1A 3RNLA 3WV4A 4ZZ0A 1YDMA 2OD9A 3HZRA 2R2GA 4RZXA 4QPCA 3UKDA 4EG0A 3KXPA 1UJ4A 3C3JA 1A5BB 3HGMA 3MRSA 4JB2A 3MG9A 4MJ3A 4PICA 5ARCA 3BRCA 1EVKA 4P36A 2FSSA 1BMQA 2WE8A 1FDOA 2Y0EA 1OLSA 2AMFA 1JSZA 3MJ4A 4WZBA 2B8JA 2VAPA 3K0KA 4G4JA 4CL0A 5JVDB 5CCDA 3SOZA 2YCBA 5C9ZA 3Q2OA 2R8BA 1EAMA 3HGTA 5DM1A 2JBAB 2PMBA 1Q57A 2ZBQA 1GPWB 1IMJA 3TZLA 3VUEA 2DXIA 5AHWA 3WB9A 3WOHA 1RJWA 3EY9A 1PZXA 3P9IA 1WQ3A 3KRTA 5JO9A 2ACKA 1FMLA 4MYTA 3T1YB 3CWZA 4TWJA 3WGLA 3WB2A 4K7JA 1BH2A 3HV2A 3COYA 5AW0A 4Q3CA 2XGGA 2J45A 4YP7A 3K20A 5A7HA 3T1TA 1K4KA 2X4LA 4CE6A 1Z4JA 3LL4A 4Q3DA 4QFBA 4EB6A 1V16B 3Q6NA 5AI4A 2MMCA 1TKCA 2O2SA 5HM8A 2NVWA 2AFRA 2E5WA 2GSWA 1RE0A 1Z4OA 2DGDA 2JFXA 3N7UA 1XZ8A 4HMPA 4MKFA 5CIWA 4YJ3F 1UOPA 4IOJA 2E82A 5LXTF 4M6WB 3AHHA 3HJRA 4F71A 1EXNA 4G9BA 2I6SA 4XYGA 5DYWA 4EHHA 1ZEMA 4OMCA 4MIOA 4J3FA 5MN6A 1K68A 2X22A 4DG9A 1P62B 2ZATA 2HBQA 4RSMA 1BO6A 1UF9A 1O5IA 2FRDC 1XZAA 2YNMA 3I52A 3PQ5A 4NPCA 3KXIA 1C0EA 3RYHA 3MT9A 5CDTA 5FHQA 1MDBA 1NJGA 1Z6YA 1RQGA 4DUPA 4WLVA 1PJLA 1WTCA 2YFHA 3GLHE 3RRFA 5JCOA 1NQAO 1MTOA 2LCIA 3PYMA 1CJBA 1IE3A 3A7DA 3FF1A 4QFCA 4AROA 3YASA 4DXDA 4L22A 2D4HA 1IU9A 2PGOA 3PFHA 5JJBA 2ZT6A 1VE9A 1EX7A 1E92A 4YAJA 3QY9A 1FSFA 1KIMA 1PYOA 4EYOA 1YGPA 3B6JA 1YIAA 2EKLA 4Q1EA 3PDIA 3TLKA 1RYDA 4IIYA 2GZMA 2NN3C 3IUEA 4RW0A 4A36A 2LXNA 3LNCA 4RM3A 5KTYA 4XQGA 1S9HA 2LP4Y 3CB4A 2EJCA 2R6HA 4YRFA 1NRJB 2I7XA 4YT8A 5KYNA 4JB8A 1JG2A 2I80A 4G1UC 5D3MA 1JE0A 2O5VA 1OF1A 3CEPB 4H4EA 4O4HA 3D6HA 2CVZA 1HDGO 4RVDA 1EG7A 1SH7A 3P9XA 2SBTA 2D2XA 2HREA 3AVPA 3BBLA 3JVDA 2Q3LA 4QJ4A 3AVYA 2C2ZA 1CUAA 5TLSA 1CUUA 4M0EA 3HJBA 2CLSA 3CYFA 4B44A 3TLBA 2NO9A 4KMRA 3ZE1B 1UEXC 1ZIXA 5DLQC 4HY3A 3ZFQA 3DC2A 3GOQA 3X2FA 4F1WA 4BGIA 2VHEA 1HK7A 1TVKA 3LBNA 4F9EA 4OBBA 3VHXA 1LV8A 4O3MA 3AEKB 3M6VA 5L9AA 3NBQA 4JJ8A 1NN3A 5CDUA 3UJ6A 2HA5A 4BB0A 1TD9A 3W5SA 4X45A 5AQ1A 2FQWA 3FMIA 2D2EA 1XELA 2VXCA 2AQ8A 2GX6A 5FPTA 3UMCA 2WIDA 3I1IA 1ITZA 2DUUA 2Y9PB 2DERA 4BB6A 1DLIA 4M98A 4K8RB 1W76A 4TROA 4X0EA 2ZM5A 3WIOA 3I9JA 3HTXA 1B7GO 2WSIA 1H2RS 2FEOA 5BN4B 2V74B 2WM8A 3GFGA 3AJAA 3T9AA 4IFEA 4Q16A 3GYBA 1BGXT 1KGSA 2J5KA 3GDOA 3GGGA 4HDNB 4G0QA 4NYIR 1IN1A 2P67A 3VPCA 3VOBA 5IAOA 3DM9B 2D4AA 2Z4SA 1NIPA 5I5GA 1C2TA 1LNSA 1OI4A 3Q1LA 2PRZA 1O5TA 3L82B 4UBOA 4FHZA 3REQB 3QPAA 1E3JA 4YH1A 1EFAA 3QVGA 1BSVA 2VFAA 4HN2A 4QYWA 4TKUB 5H3CA 1UL1X 3BB4A 3UM9A 4IJKA 1T25A 4JCCA 3WP0A 3A6JA 1PVDA 1FE8A 1Y8RB 3NTRA 1A9PA 3HB7A 3ZZUA 1IAVA 5A3JA 4G89A 1U9CA 3ICOA 1X8KA 2BAGA 4YREA 2AD1A 1R4ZA