4DNQA

Crystal structure of dad2 s96a mutant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
TLLDALNVRVVGSGERVLVLAHGFGTDQSAWNRILPFFLRDYRVVLYDLVCAGSVNPDFFDFRRYTTLDPYVDDLLHILDALGIDCCAYVGHAVSAMIGILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLAVGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARDHSVPASVATYLKNHLGGKNTVHWLNIEGHLPHLSAPTLLAQELRRALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DAD2
publication title DAD2 Is an alpha/beta Hydrolase likely to Be Involved in the Perception of the Plant Branching Hormone, Strigolactone
pubmed doi rcsb
source organism Petunia hybrida
molecule tags Hydrolase
total genus 80
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dnqA00
1H2YA 2Q0XA 5JZSA 1UFOA 4UHDA 1I6WA 1BROA 2QT9A 1XRMA 3H04A 2Z3ZA 2XUDA 4UBNA 3HEAA 1QIKA 1ZGBA 2WUFA 3GROA 5ALPA 3VVMA 4BP8A 2ZSIA 1WHTA 4QDZA 3M81A 4M0EA 1KEZA 4FMPA 4GEGA 1F6WA 5C8XA 1ORWA 3FLEA 3IURA 3IVMA 5AOCA 3GELA 1Z68A 4J0HA 4UHCA 1YB7A 2FUKA 4HRYA 4H7JA 4B0OA 2BKLA 4H7IA 1GKLA 3D3NA 4CCYB 1LPBB 2RONA 1WOMA 4INZA 4J0GA 4FHZA 3WKBA 2EEPA 3FCYA 3AUKA 2Y2UA 1EDEA 3AIKA 3WYNA 1R3DA 4J03A 2HA0A 2DHCA 4X3CA 1MJ5A 2Z5GA 1CIJA 3HYSA 5JIBA 4K6HA 1UK7A 3PFCA 4QA9A 4CFSA 5DNUA 5AI0A 1QIIA 5D6OA 4FBLA 4OU5A 5ALOA 3X3HA 4WFIA 5HKBA 3OTQA 2PSDA 2H7YA 1CUEA 1QJ4A 2W6CX 2O7RA 4Q3LA 1TCBA 2Z8XA 3BF7A 3M3DA 1TK3A 4Y2YA 5AM5A 2GBCA 1CUCA 5AM3A 3QPAA 4D9JA 1XRQA 3LP5A 1A88A 3BE8A 1UK9A 5AKGA 4JUIA 1OILA 4EY5A 2XQGA 2G5TA 4N8SA 2BUCA 1FFCA 1YSCA 3E3AA 3AZPA 1EINA 3R3XA 2AJCA 5YASA 4KJXA 5KWJA 3R0VA 1QO7A 2CB9A 1ZD4A 1HDEA 2VSQA 1CQWA 1CUGA 2BUBA 3IIIA 4QDXA 3PE6A 5HF6A 1C4XA 4MYDA 2HU5A 4EHBA 2WUEA 2PUHA 3FNBA 1VXOA 4FLEA 3W9BA 4X97A 2AJ8A 2Y6VA 3C6BA 1BEEA 4CG3A 2QZPA 1EDBA 4H18A 4BDTA 1H23A 2HA7A 1T4MA 3H2JA 2JF0A 1N5MA 3BXPA 1AC5A 3QH4A 1AQLA 5K3FB 1W1IA 1JT2A 4Y9SA 4P9NA 1LBSA 3FAKA 3LIPA 4EY4A 1GPKA 4CIBA 4OB6A 4PW0A 2HA2A 4C89A 3ESAA 3LLCA 2XQFA 1VZ2A 2VF2A 1CFJA 2WLSA 4KRXA 4OUKX 5AIAA 4EY7A 2BGRA 4QNNA 3FWHA 1UKAA 3R3UA 2B9VA 1MN6A 4XWGA 3GFFA 1EK1A 1YASA 2QTBA 1U2EA 4IHAA 2J4FA 4K2AA 4BZZA 3FVRA 5T4BA 5AK3A 3IULA 3RK4A 3SWWA 1SCIA 1EH5A 4RE6A 4BC1A 1U65A 5DTJA 3ZPXA 5EGNA 3BWXA 1GQSA 2NW6A 5HZGA 5DWDA 1N5RA 2XMGA 1R9MA 4UPDA 4FNGA 3AZOA 5DYTA 1UWCA 5JATA 5C8VA 4UBJA 5D3KA 5HF9A 1LPAB 4RNCA 1Q0ZA 2WIGA 1GQRA 2XE4A 5LKAA 1Y37A 4W1RA 4DSAA 2QMQA 2DFPA 4B6GA 3VXKA 1CUAA 3WL5A 1ODCA 4XVCA 4PO3X 2X5XA 3WZLA 3ZI7A 3WLAA 3D2BA 4YASA 2AJDA 5DJ5A 5HQ3B 3PICA 2ZVDA 3QZUA 2V9ZA 5FLKA 2XUIA 2CBGA 2ZYIA 4UBMA 5ALVA 4WJLA 4WY5A 2XQIA 3MGAA 4G9GA 4GDMA 1EXWA 3WK7A 1ZGCA 4YK7A 5CT9A 2DSNA 1EB8A 1XZAA 1EVEA 2H7XA 2WG2A 3MUOA 4V2IA 3W05A 3STTA 5T4FA 4ARAA 2BAGA 4UBIA 4X91A 2XI4A 1A7UA 5HK9A 1W75A 1ZD5A 1UKCA 1MX1A 2Y6UA 7YASA 4A23A 5JZBA 4Q34A 4GBGA 5ALWA 1WCYA 3A6ZA 4NMWA 1ZI6A 3DKKA 4U2EA 3KOOA 5K3FA 3WK5A 1ZD2P 1PV1A 1GKKA 1MNAA 1USWA 4DSZA 5IKXA 5AKXA 4AO7A 1CQZA 5A7GA 2C5FA 3I2FA 4BDSA 3DCNA 5ALYA 4BTLA 5ALDA 4B84A 3WKCA 2HFJA 5KWIA 2PL5A 2HL6A 4PSDA 4BVKA 2WJ3A 3G0BA 5BV7A 3IA2A 2VJAA 1XZDA 4EY6A 2XUPA 5I8PA 4X94A 3FVTA 1F8UA 4KAFA 1BS9A 3HXKA 1XZMA 2JGKA 5AKHA 4HVTA 5ALMA 4Y2VA 5LZ7A 5H3HA 3DEAA 4KRYA 1CUDA 2PVSA 1SC9A 2OCGA 4XX1A 5AI5A 2I78A 1MTZA 3EQ8A 4CG2A 1E89A 1QIGA 4DMHA 2I03A 2QUAA 4ETWA 1IZ8A 1BN6A 3JYHA 2PBLA 4B80A 4EY8A 4B82A 4AZ0A 1X2BA 1EB9A 3QM1A 2JEZA 2DCMA 2PKYX 4W1SA 5T4HA 2ROQA 2XLBA 2AJBA 3DS8A 3A2NA 3G0GA 5JAPA 3E1GA 5AKJA 1VE6A 3DL4A 4W1QA 5DTIA 1SCQA 5HQ3A 1L7RA 1YAHA 4BBZA 2CKMA 5AHXA 3WWEA 5K5EA 2WIFA 1N8SA 3D2AA 1BRTA 2V97A 3DDUA 3WMRA 3IDAA 2CEKA 4FKBA 2WHQA 1YB6A 2CZQA 5FOQA 5AH0A 5ALGA 2BGNA 1CV2A 4L3WA 2W22A 2WHPB 3IBTA 2OCKA 1NU6A 1WB6A 4Q82A 1GPLA 4DIUA 6YASA 3FLAA 1CUUA 1E5TA 5JYCA 1O6FA 2XMQA 2ZJ6A 1VZ3A 1R1DA 5JANA 4Y2QA 1TQHA 2RGUA 2B20A 4QWMA 4BE9A 1LPNA 3H2HA 1TCCA 2PPLA 3DJYA 4S0XA 3DKRA 4B85A 5FXMA 1IMJA 2G63A 1QIMA 4KR0A 3HLKA 1HBJA 5ALZA 1Q83A 1IUPA 5AOBA 2XUQA 3STUA 1CUJA 1CUZA 3CCCA 1EDDA 4BE4A 2XMSA 4B0PA 1XZCA 2QUBA 4IQ4A 4B83A 4UBLA 4GXNA 2GZRA 2XQJA 2PSHA 4QLOA 4OYLA 4MQLA 2ORYA 4W63A 4C4ZA 3PDCA 3F67A 4IH4A 4FBMA 2I3ZA 1IUOA 4BRZA 1XZGA 5D7BA 4QEKA 5ALFA 1XZBA 3BF8A 2JGJA 2OXEA 3GUUA 4WDQA 3WKAA 2WM2A 4N5HX 4X92A 2IITA 4ZV7A 1LLFA 4BP9A 5E4TA 3ILSA 3D5EA 2C58A 3BIXA 4X7BA 2WIDA 1CUWA 1FFAA 2RHTA 3WQHA 2O2GA 4H7HA 2AJLI 2O7VA 3C87A 1CEXA 4JEIA 5IVDA 1Q0RA 1GT6A 1RWQA 3STVA 4WFJA 4X71A 1H22A 3RLIA 1KU0A 5AKEA 5AK4A 1QONA 3G02A 3G0DA 2C4HA 5CH5A 5JZ9A 1YA8A 3R40A 4C87A 3WIOA 2P8SA 4KACA 5AM0A 5EIHA 1XRRA 4AB1A 2J3QA 1DT3A 1QGED 3WWCA 1T2NA 5SYNA 1H2ZA 1AZWA 1DTEA 1QIHA 1GXSA 5DNWA 4BAZA 1THTA 2WU3A 5IVKA 3C5VA 2C5GA 4BCDA 2C7BA 2GYWA 2XUAA 4HXGA 2GYVA 4UFPA 2XQKA 4PNZA 1WB5A 2GBFA 4FFVA 1E8NA 2XUGA 4OB8A 1JJFA 2WJ6A 3TJMA 3H1BA 5BWBA 2JGMA 1DT5A 2FX5A 1XRLA 2VEOA 3ZLUA 4CCWA 3V1KA 5BWCA 3R3ZA 1XZLA 5F4ZA 3G0CA 4B9EA 2E3JA 3V1NA 2PU5A 1QE3A 1FFBA 4LKOA 4C88A 2H7CA 4U2BA 3WK9A 3G9XA 3WKDA 1JJIA 3CXUA 4NS4A 4M0FA 2R8BA 2HA5A 5EHNA 1VKHA 2EDCA 4AXBA 1J06A 4BVLA 1LNSA 4E15A 2VJDA 4P92A 3KDAA 3CCBA 2VT6A 2V96A 5LKRA 4BYMA 3G7NA 1CPYA 4P08A 1DQZA 2RI6A 3T52A 2WFMA 3QPCA 1E3QA 4ZI5A 5FUMA 2JGEA 1F0NA 1A8UA 5EFZA 1DWQA 1IUNA 4X6UA 2Z8ZA 4X00A 1VE7A 2DHDA 3RKSA 3TRDA 4TPKA 3ZLTA 3F8SA 3DD5A 1AGYA 1W52X 4G4GA 4C01A 4N5IX 1W4LA 3B12A 3UMJA 3C43A 3F98A 2GZSA 1GZ7A 3U0VA 5FPQA 3M83A 4UHBA 5JADA 5IH7A 3P2MA 3B5EA 2PSFA 4CCYA 1MNQA 4G4IA 2HHAA 2Z3WA 1NU8A 1R50A 4ZWNA 1QFSA 5AI8A 5EIAA 1JMYA 5AK5A 2ES4A 1XFDA 4Y2XA 3G0IA 1B41A 2QS9A 2OQVA 1QLWA 2PSJA 5ALTA 4BB0A 1AURA 4ZREA 3WA6A 1D07A 1K63A 2XMBA 2QR5A 4OB7A 4X90A 4Q3KA 2XUJA 4I19A 4HXFB 2PM8A 3G9ZA 3O4HA 4Y2JA 5JAOA 4BVJA 3WL6A 3D2CA 4H35A 2X8BA 3WK6A 5LZ9A 3V1MA 5AK6A 3HACA 3N0TA 5LZ5A 3KD2A 4OSEA 2HRRA 5AM1A 4DMKA 2XMRA 5AI6A 3FBWA 1CUFA 1XZFA 4MYSA 1SOMA 4U2FA 1UZAA 3FSGA 4E46A 3HABA 3IB3A 3OPMA 3I2GA 2BCEA 1X2EA 1JFRA 5ALIA 5AICA 3D59A 1QO9A 3C45A 3E4DA 2HU8A 1LBTA 4FTWA 2IIVA 2WG1A 3O9VA 3FYUB 5LYYA 3R3YA 5LIPA 1CUSA 3U1TA 3EBLA 3IUNA 2WIKA 5A62A 1YCDA 3HRHA 4QDUA 4YX9A 4AZ3A 3C5WP 1P0MA 2XUHA 3H2GA 1W76A 4Q1VA 1J1IA 2JIDA 1RP1A 5D3ZA 4OYYA 3A2LA 4K6KA 3GZJA 2YXPX 3SC2A 3PUIA 3BIWA 4AO8A 4H7DA 3QMWA 1ETHA 5DNVA 4EBBA 2H9YA 2OAGA 3TGLA 3JWEA 4H7KA 1JI3A 2QRUA 1P0IA 3DL7A 1CUVA 4TGLA 2H1IA 4WDRA 5ALHA 2ACEA 1CUHA 4LIPD 2RHWA 4J0DA 3K6KA 1G5FA 1EVQA 4OPMA 2GYUA 5A6VA 3WZMA 4BCBA 2XUKA 4DGQA 4QLAA 1SCKA 4DM7A 4FFWA 3HSSA 3FYUC 4NVRA 4A5SA 2JBWA 5E4YA 1A8SA 3LS2A 3V48A 5C7YA 3RARA 1BU8A 5ALNA 3ED1A 1YR2A 1K4YA 2VJCA 3LCRA 3R3VA 4W1PA 2D5LA 5CW2A 3UUEA 1ZICA 1A8QA 3C8DA 4JH0A 1HL7A 3O4GA 3H0CA 2IX9A 3WWDA 1DWPA 5HK8A 3ANSA 4KEAA 3G9TA 3WIBA 4HRXA 1JJBA 1VOTA 4MEBA 4RE5A 2YH2A 3ZV7A 1UK6A 3AFIA 4Y2UA 1E8DA 3ICVA 4AN0A 1YS1X 2QJRA 4ROTA 2WIJA 3I1YA 4H77A 1BE0A 4N8DA 3MVEA 1XRNA 2HA4A 1UT6A 1R4ZA 5C81A 3QMMA 4Q05A 2LIPA 5ALUA 1QIFA 5LZ4A 4BZWA 4U2CA 5FP0A 1WM1A 5CURA 3HZOA 3C8HA 1ZJ4A 3Q8WA 2PSEA 2VT7A 5E4JA 4MXDA 3FYUA 3QITA 3PFBA 3E0XA 1VA4A 3C70A 1CUBA 5JD4A 3DYVA 3I6MA 3D0KA 4DNQA 1PFQA 4J3JA 1MO2A 2ONCA 3STXA 1Q84A 2HA3A 2HDWA 4ITVA 1LZKA 3F97A 1X70A 3A70A 1XZEA 4EUSA 2J3DA 2VTVA 5JASA 1LZLA 1WHSA 5ISMA 3NWOA 2Y1KA 5AP9A 4FLMA 3I2JA 3BJMA 4ARBA 5DLPA 4DLNA 1AX9A 2WHRA 2HRQA 5ALSA 3EF3A 1DQYA 3R3WA 2JGIA 2QOEA 3O4JA 1QIJA 2UZ0A 2XB6A 3D7RA 1MX9A 4G4JA 4L72A 1ODTC 1ZD3A 5AKZA 3I2KA 4ZRDA 3PI6A 1CVLA 3IUMA 1XKTA 1MX5A 4XJVA 1GPNA 3M82A 4KAJA 3I6ZA 3WJ1A 1XLWA 5CT8A 5KBYA 2X76A 4UFOA 4PV7A 5ALLA 1ZI9A 3VKFA 2JGFA 1LPSA 3CN7A 3STWA 4Y2SA 4AQDA 2HM7A 4AN1A 3QVMA 3ZLVA 4KE7A 3MUNA 3FSGD 4G8CA 4MEAA 4FNMA 3UUFA 4W9RA 5IVHA 1BCRA 4EA6A 3D4LA 3BL8A 3AIOA 1O6GA 3H19A 3ESBA 1VA5A 1Y7IA 2OG1A 3ANTA 3B3QA 4MWSA 1TAHA 3W2TA 4X95A 5T4EA 1TRHA 4L9AA 5CH8A 5EHZA 1JU4A 1SFRA 4FLFA 1MPXA 5K3BA 5LLSA 2WJ4A 2WUDA 3C6ZA 4F5ZA 1BCSA 4EB0A 3I28A 1EI9A 1XKLA 3G9UA 4LHEA 1XROA 4UFNA 2JGLA 4O08A 3WK4A 5K3EA 1VJ5A 1BEZA 4OCZA 5FKJA 4LXHA 4CIAA 1AKNA 1R9NA 1UOPA 1U8EA 5CXXA 4WFKA 1ZOIA 3BDVA 3TEJA 1EK2A 2VQ6A 4EZIA 4UHEA 1ZIXA 3SK0A 5CT5A 1CR6A 2O2IA 1H2XA 2WTMA 3VJLA 2CJPA 3STYA 2WHPA 4IO0A 5ALEA 1TIBA 1OXMA 4FOLA 1QOZA 4DNFA 3AIMA 4HAIA 1MAAA 4DNPA 4WY8A 5EHXA 4A16A 4DNOA 4H7FA 1VXRA 4UHFA 1LPPA 4U2DA 1G42A 1HKHA 1XZIA 3WI7A 2QM0A 5EI5A 3A2MA 2AXEA 4HS9A 5K3CA 1IVYA 3NOXA 5HF5A 1WPXA 1F0PA 3HJUA 4G5XA 5ALQA 5LZ8A 1UXOA 4RGYA 4J0JA 2CMFA 4QDTA 4QZVA 3H17A 2QXUA 5ESRA 4Y2TA 3DOIA 4KE6A 2ACKA 4F21A 5J3JA 4IH1A 4Y2PA 1THGA 2ZJFA 4G8BA 2XMZA 4B81A 1G4HA 1NX9A 2VJBA 4UBKA 4BAUA 2B61A 3OM8A 4X93A 2WG0A 1ZI8A 1XQXA 3YASA 4K6GA 4K5QA 1XLVA 2ZYHA 1XQWA 3RM3A 1UKBA 5LP1A 2OGSA 2XT0A 5AKIA 2WQZA 5AKYA 4PSUA 4Q3OA 3I2HA 1VLQA 4N8EA 1E8MA 3L1JA 4DYHA 1AMNA 4Y7DA 5FV4A 1R88A 2VATA 3BDIA 1FFDA 2EDAA 2DR0A 3ESCA 3K9BA 2BUAA 2DHEA 1LPMA 4HTAA 3WK8A 3O4IA 4MJ3A 3WKEA 1MU0A 4Y2RA 2DQYA 3L1IA 1OCEA 3FOBA 5HF8A 5AOAA 5CT6A 2G5PA 4JYPA 2C0QA 4BATA 3OG9A 2YYSA 5K3DA 1JU3A 4QDOA 3KWFA 3QYJA 2C0PA 4E11A 5AO9A 4OD0A 1HPLA 2OPHA 1HQDA 5IVIA 5ALJA 3QPDA 3Q0TA 4ZXFA 2FJPA 3S8YA 1FSSA 3O0DA 2HIHA 1XLUA 3QBJA 4B7ZA 3AINA 4B9AA 4BCCA 4QE3A 1YA4A 5LZ2A 4ZGBA 3N2ZB 1DINA 5EHQA 1XZJA 1DX6A 1B6GA 3DNMA 3EIOA 4I3FA 5ALXA 1L7QA 1LGYA 3C6XA 3W06A 2I3DA 3C6YA 2Y2VA 3O9MA 2OAEA 3WL8A 2RIPA 4GLBA 1AUOA 5JALA 5CH3A 1ODSA 3V9AA 4KE9A 4J0IA 1M33A 1EX9A 3IUJA 5FPPA 5KREA 1TKRA 4C4YA 1BN7A 5A71A 1C7IA 3JW8A 3I2IA 5AM4A 3VJKA 3IUQA 1ORVA 2XUOA 3H2KA 4KAAA 3KSRA 3QMVA 2YASA 1QTRA 4Z49A 1J07A 1L7AA 4LYEA 4J0KA 4BAGA 3S2ZA 1KU6A 4LXGA 4P93A 5AKKA 3HI4A 3DOHA 1EA5A 2PUJA 1ACLA 4QWWA 4OU4A 4G9EA 2XMDA 2WSLA 4E14A 1UK8A 2OCIA 1QIDA 4DMCA 4CG1A 5JAUA 5AJHA 4IH9A 3KXPA 3WJ2A 1QTIA 4X6XA 2XMCA 1EHYA 2BJHA 4GHWA 5AI9A 3O95A 1K8QA 1LPOA 3NGMA 3CN9A 4FDMA 5HFAA 2OGTA 3WL7A 1DWOA 1DX4A 3HC7A 5C8ZA 4HZGA 3EQ9A 2JEYA 5I7UA 1JMKC 2G4LA 3ICWA 4C4XA 1JKMA 1IZ7A 4DMFA 2ZYSA 5AKLA 4JNCA 2QKYA 2R11A 2VA9A 4H0CA 1ACJA 3KWJA 2J4CA 3H2IA 2QVBA 2B4KA 1HLGA 4FWBA 1ZJ5A 4PSCA 2HA6A 5CBKA 1FFEA 3W9UA 4F60A 3DLTA 4X6YA 4AO6A 5I9IA 1QFMA 4C6HA 3AJAA 3I1IA 2XLCA 1XQVA 1CUIA 3AILA 3GBSA 5K3AA 2ECFA 3ESDA 4UBOA 1PJAA 3G8YA 1UOQA 1W6RA 3WWPA 3T4UA 1K6EA 3PF8A 4MWTA 1WB4A 2XDWA 4X85A 3DYIA 5AIBA 4F0JA 3PUHA 5JAHA 5EIEA 1K5PA 5CTAA 1XQYA 3FLBA 3VISA 2WFLB 3I6YA 1CLEA 3F96A 3BJRA 1FJ2A 4BRSA 1CRLA 1CUYA 3H1AA 5JARA 1H2WA 4KYVA 3H18A 2WILA 5HFNA 2BFNA 4H7EA 4HXEB 5JD5A 2HADA 3F9CA 4XIIA 2WFZA 1GGVA 4UHHA 3K2IA 1DU4A 4ZV9A 4UUQA 2QXTA 2HFKA 4L0CA 2GBIA 2V98A 2CUTA 4JYMA 1MT3A 2XUFA 5DYYA 2ZSHA 5ALKA 2FJ0A 3FYTA 5CXUA 4M0MA 2WU4A 2RAUA 4AMZA 2OCLA 5AM2A 4PF1A 4LYDA 5DYWA 1P0PA 2OLEA 4BC0A 1XRPA 3AZQA 1ISPA 4G8DA 5CRIA 1QIEA 4DTCA 2OGZA 4NZZA 3VVLA 2VAVA 1G66A 5HKAA 3FCXA 1YAJA 3NUZA 3WYDA 4AX4A 5JD6A 2QJWA 3WA7A 2O2HA 3ZWQA 1YS2X 3PF9A 4YPVA 1XZHA 5SYMA 1P0QA 5A7HA 3VJMA 1TCAA 4BTVA 2K2QB 3EQ7A 4J0CA 4AMYA 5A7FA 5HCUA 3OC0A 3OOSA 1E66A 5CMLA 1QZ3A 5FDFA 3OURA 4PQEA 4U2GA 5CT4A 3DQZA 3LIIA 1WPRA 4G1FA 1S8OA 2PX6A 2ZYRA 1ZIYA 2VAXA 3V1LA 1Y7HA 4KE8A 4TVKA 4J7AA 2OQIA 3GA7A 4GECA 5ALRA 3W04A 1MAHA 1U4NA 2DQZA 3WWOA 5A2GA 4MQMA 4GI1A 1CUXA 5AI4A 1C7JA 1XZKA 3SX4A 4GWLA 1J2EA 2WUGA 2WTNA 4GW3A 5FRDA 3R41A 5BOVA 4RPCA 2ZJ7A 3VDXA 3L1HA 2WFLA 2HU7A 2D0DA 4WCVA 5E2IA 2WKWA 1UOOA 4I4CA 4CI9A 2GBGA 1RYYA 2PU7A 4LXIA 1N1MA
chains in the Genus database with same CATH superfamily
2A88A 4MGZR 2XXBA 3COVA 4KPUB 4OQZA 5JNVA 2Q0XA 1NUSA 2NG1A 2H17A 4JLMA 5JZSA 2PYIA 1T25A 3FBGA 4YJHB 1VKZA 2CVPA 4OLHA 1UFOA 2OYCA 2BPOA 3KU4A 3WNZA 3QF7A 1XL1A 3PDWA 4TMTA 5MN5A 2QT9A 2IYUA 3RU3A 3VR0A 4JA2A 3MBKA 2J3IA 3H04A 2Z3ZA 3LKZA 4MWBA 1YOBA 3O90A 4UNQA 3KKOA 4UOQA 1ZGBA 1OBVA 4OJYA 2Q2QA 4YMUA 1D1QA 3GROA 4LSMA 1XV5A 3QX9A 5AR1A 5EMLA 1I4OA 2BIFA 1WHTA 2AG5A 2DJ5A 3CPHA 1EFUA 1U0SY 4NG5A 5BSKA 3M81A 2JLVA 5T64A 1ZMOA 1ZM3A 2GB4A 3M1IA 1SEVA 2A9PA 4M0EA 4O4LF 5BO5A 3S4YA 4ROSA 3CT6A 4L6AA 3E5HA 4PGMA 4BV8A 2BE9A 1MH9A 2X4LA 2XKAA 3WLPA 2R6ZA 3EGEA 3GXBA 3LPMA 3N8IA 3ZWNA 1CZLA 3NT2A 5EFOA 4CTNA 2L69A 2IYVA 3IURA 4L6CA 5MFPA 4B09A 1XN4A 5C46F 1RXWA 4X64B 1Z2CA 3EG9A 1YU6A 4JENA 3TLGB 3CNLA 4XM0A 3H1PA 4UHCA 2FUKA 3ANXA 4LHXA 1H66A 2OENG 3PXUA 5FI1B 2RONA 1WOMA 2IU6A 3AP3A 3V46A 4FHZA 4BN0A 3JATB 2X4DA 3EGXA 2X8JB 4IDEA 4HLQB 4MLDA 3GZ4A 3E22A 2GGSA 1TM3E 5AVSA 3PPWA 3QF4B 2NSYA 2MYNA 2WHEA 3FHCB 1Z13A 1FBTA 1R3DA 2EBWA 3D8TA 3EUEA 3LC1O 1S9HA 2OQ2A 5EYPB 1ORTA 1R8XA 4MWOA 4ZT7A 4BMXA 3L8MA 5A3JA 3U7EB 3PWTA 4X3CA 2BM8A 4BTEA 3DEYX 2Z5GA 2RGAA 1CIJA 1E3WA 2KE5A 4NQRA 1WXHA 2JKYA 3GLHA 3H75A 3HYSA 3MAJA 5JIBA 1N78A 4K6HA 4QOGA 4XCQA 5HMMA 4RH0A 1WY7A 4LRYA 3JZFA 5DWVA 2PUDA 3IKJA 4I3GA 4QA9A 1I94B 1B15A 2C5EA 3O7WA 5DNUA 3NHYA 4FHDA 4FYPA 4V0RA 5D6OA 2V7TA 4E2WA 1UXKA 3OHSX 2JFOA 4REQB 2MMCA 4XOUA 2C3OA 1G3MA 1P7YA 1OSNA 1V9CA 2QG6A 1G2QA 2ZR9A 4NYMR 4GR9A 4RETA 1HDXA 3LUDA 3OTQA 5LBUA 4DCNA 2YXLA 5FUYA 1FNBA 1H6AA 2W6CX 4B6SA 2CXHA 4W5OA 3KSZO 3WNDA 5ERGB 4LE2A 4BV2A 5HJ7A 4QYWA 4OBEA 4R51A 5D6NA 2Q7XA 1TK3A 2J0SA 1UBKS 1PRYA 1G64A 2LV8A 3CNBA 2GF9A 5AOVA 1YRQA 3EVTA 4R2IA 5KNLA 1VCMA 3OIDA 5DP1A 5J43A 2WU1A 3CB2A 3D43A 3GA0A 5TRTA 1N2BA 3QPAA 4MRNA 4ZVQA 3BRSA 5SZKB 2DFNA 4HUTA 1HEYA 3E05A 4MW2A 1V39A 2W11A 2FEWB 2GXQA 4IJQA 2DULA 1PLLA 4ZEWA 1A88A 3BE8A 4IMJB 2D5CA 5KAMA 2N46A 3EYAA 1E4VA 1NASA 4BVFA 1YS7A 4EY5A 5FEMA 5BN4A 3QEAZ 2H1FA 2I2XB 3RTAA 5KNBA 2IIPA 2NZ2A 3PDJA 4ZCLA 3ER8A 3UWSA 4YUZA 3GDFA 1FFCA 4OHRA 1E18A 1YSCA 1M1UA 1CDEA 2OHJA 3VR1A 3K35A 1VIYA 4V1CA 1LBQA 1PDVA 2FKNA 2YXBA 1N2XA 3GHYA 3D3EA 3E58A 3R3XA 4LJ9A 4KJXA 5G40A 1LX7A 2Z6VA 4XWWA 4AAYA 1FDUA 1T6YA 4E08A 4JLPA 1ZD4A 2C82A 5LU9A 1XOIA 5TMEA 4MSUA 4ENVA 4DMLA 5EIBC 5K51A 1UWVA 1BA2A 1Z08A 4CKYA 3HGTA 4YJ3B 2PKQO 3KSAC 4YR9A 4J3FA 1CQWA 5REQA 1NLFA 3KBBA 4TTRA 1RXYA 3KZXA 3IIIA 4I50A 4NP6A 3VU1A 3L41A 4FFNA 4JLUA 3RRZA 2E18A 3QLUC 2ZAIA 4QDXA 3GWZA 3NX4A 5HS4A 1KGSA 1VE1A 3BXFA 5LP6F 4IHQA 4EJSB 3EVDA 5BNTA 2B1QA 1TUBA 4RIIA 5J5CA 4CF3A 2GN0A 1X13A 5DM2A 3TAUA 4EHBA 3AETB 4MGIR 2YY7A 4XPZA 4BMOB 1F3LA 3L0IB 3O84A 4X7PA 4LTMA 3PUWA 5D1HA 5J2TA 1EJBA 3RIGA 3FNBA 2G6TA 2G1UA 5IDQA 4RD4A 3VI3B 3THWB 3VO8A 2PX4A 4DABA 3BUSA 1NIJA 1N2EA 3ZGNA 1AB6A 3VVCA 3D3KA 5H80A 1BD4A 1BEEA 1XD8A 3T99A 2NZYA 1ND5A 1SC4A 1C3VA 1EDBA 2PGOA 3MJDA 2AYYA 3N0XA 5JDIC 2TMGA 3T1HB 1H1LA 4UE2A 4CMJA 2HA7A 3K5WA 5JO0A 1C1DA 2EKDA 3H2JA 5CA0B 2OCDA 2G88A 2WDPA 3BXPA 2E1RA 2FMIA 1P7PA 1RBQA 2AUMA 1ZY2A 1GN9A 1AQLA 2UZ1A 2V3VA 3FXAA 3M33A 3MGKA 1VB3A 1WV1A 5K3FB 4XFJA 4K9RA 3WJ7A 3KKMA 1SVKA 4JN6B 4F4FA 1YS4A 1FU4A 2PX5A 1F51E 3FAKA 3GLUA 4B33A 5IKEA 3AR3A 1K08A 1T24A 2J9XB 2C2KA 3FHTA 1T1RA 3ETEA 3SI7A 1GVNB 2RGWA 2Y1DA 3RIXA 1KMHB 2ZRKA 1ECFA 2VJPA 2W6ZA 3AONB 4RY9A 5DBFA 2O6LA 2QAGA 4HDRA 4X20B 5HDQA 3S27A 1KJQA 2QTTA 3DMGA 5JC8A 1NOKA 1SC6A 3OX1A 3BA6A 3LZ6A 1K5HA 2VDUE 5LOVA 1WBDA 3WAKA 3PQ7A 3KQHA 5DWQA 3V4LA 1I3MA 2BCGY 1GTMA 2GRJA 4OUKX 5DGHA 1G6OA 1QLJA 1U3FA 4OH1A 3X1YA 4F4UA 2ZSUA 3IGFA 3JQ6A 2W2NA 1V0JA 1WULS 1GDDA 3N87A 4J7CA 4CM3A 4EA8A 4MUHA 3R8XA 3HYRA 1MN6A 4NJEA 1XE3A 4C4PA 3VR4D 2H59A 1XIVA 1ORIA 1XTZA 2EGUA 3DVQX 1VL0A 3OU6A 5JNTA 3ZS8A 4K9NA 4ZC8A 5K7SA 5KQMA 3ZWKA 4D57A 3TECE 1BOOA 1HE3A 1MC4A 1ZRHA 3H5NA 1XMJA 3H5WA 1RWXA 3JTMA 4IQ0A 2N1BA 2VQDA 4HK4A 3JQRA 1PW7A 3E4CA 4Z86A 4DA7A 1VLJA 3VV2A 4XFKA 3PC2A 2ST1A 3E48A 1HE8B 4E1VA 1OR8A 3AUFA 1DAKA 1WVMA 1YONA 2HN9A 2ZVJA 1X42A 3IULA 2VPQA 3QLUA 4IHJB 3WB0A 5KU7A 1XVTA 3EZXA 5HIJA 4YT4A 3EGVA 2M32A 3HCWA 2G40A 2FGKA 1WZNA 3RWOA 1U65A 2CZCA 4Q7QA 3MTIA 5EGNA 3VPCA 3TLKA 1XTVA 1ZVVA 1JKIA 1QH0A 4R2JA 1K3UB 2GJKA 4BO9A 3RAJA 3TTXA 3UJHA 5CIQA 3D2LA 4V1CI 5EHGA 2XMGA 4NR0A 3RKRA 2QRJA 5DM60 4B32A 4TLEA 3QOYA 4UPDA 4CHGA 2ZU6A 4UTRA 1RWKA 3EVGA 1PYGA 4IFTA 4YAJA 1S89A 3B1JA 3AZOA 1UWCA 5JATA 2GWHA 3NWPA 4J9VA 4P80A 2ZAOA 5A9SB 2UVDA 3MWEB 1W29A 2ZE6A 5D3KA 3FDZA 1ESZA 1RYNA 2HYDA 1TKCA 4ZOLF 1L3BA 4PCVA 4HNHA 2HSDA 3CZ4A 2J3HA 2QENA 4NENA 4F1WA 5F77A 3FPFA 4AYWA 5JDIA 1D3AA 3LY5A 1GD1O 2XE4A 3NYQA 1YFJA 2IDZA 2QMQA 3WYCA 5LLTA 1LA2A 3QUAA 3VXKA 2NAFA 2X2FA 3LA6A 3RUPA 1RMYA 4KZKA 4DTIA 3BICA 2PUFA 1KIAA 2I8AA 1WUHS 3ZI7A 3N76A 4PIMA 3WLAA 2EJCA 4CKCA 3PFNA 1H2AS 4YASA 4KLZA 2AJDA 4QQKA 3PICA 1NVVR 4R9SA 1ZUD1 5I7EA 3TF5A 2OZPA 1MLDA 3OLCX 2PKRA 3JALA 1WSAA 3OQMA 4QPPA 4FEAA 2CBGA 4PO8A 3OFNA 3R6TA 5ALVA 1PHPA 1JFSA 4CQNA 1I2AA 1WKBA 1EPUA 1IOLA 2A8YA 3V8VA 1VBFA 1Y80A 1I5RA 1R0CA 3FPKA 4PLHA 3UGKA 3GJ0A 2NXNA 3DLHA 3MGAA 2PLAA 1M34B 3K9LA 3LO8A 1EFLA 3C5HA 1NW3A 4GP9A 2Z1DA 4OYRA 1P5HA 5G3ZA 3AXTA 4D3ZA 2XNDD 1EXWA 3FF4A 4LCEA 3WK7A 3T3NA 1U7HA 1XVUA 1UDXA 4XW2A 4ZOEA 3RRXA 4WBNF 3D3JA 1XWIA 4K1LA 4EPXA 4FR2A 3VRHA 4MR7A 3MSCA 4J7XA 5HR5A 5LXTB 3EXEB 1XZAA 3FAZA 4J9UE 4Q15A 4X71A 1PK8A 1N3IA 3F9IA 3E18A 3GGSA 1F4LA 3IBCA 1FQWA 4FJ1A 1RRKA 1PR9A 2JLSA 4FEGA 4KQKA 1BA3A 3STTA 3W05A 4ESOA 4URVR 5EUBA 4PC1A 1BYUA 2EIHA 5D86A 4TS9A 4MPTA 3DEHA 1GP2A 1IK4A 1G21B 2QIOA 2CLOB 4IIHA 1I2MA 1YH3A 1Z5ZA 5E6SA 2BTEA 1T1JA 3TI7A 1YULA 4KBFA 3B82A 4UBIA 1QX4A 2H4HA 4C2UA 2J31A 3EQ2A 2C9MA 3G1TA 4ZAXA 5HQTA 1Z5PA 3I37X 3M4NA 2WA1A 4WKPA 4ZVPA 5I7HA 1SVMA 1JIKA 5JQWA 3T7CA 1ZD5A 1T8UA 3CG0A 4XQ0A 4IKOA 3G68A 2Y6UA 1XD2B 2YJ6A 3K2EA 5FL7A 4MZDA 1A7KA 3JAWB 3OUTA 4F86A 3G6WA 5CFLA 5JZBA 5F2OA 5D3QA 3QEMB 4KH1A 1O97C 3QLVA 5IP5A 3HE3A 1DTWB 3AHCA 4PRZA 5FAXA 5CAEB 3TQCA 4B40A 5ALWA 721PA 3H16A 1RPTA 1FZQA 2VJYA 4QOEA 1Z74A 3EXFB 2A0KA 3A6ZA 3GRPA 4NMWA 3WGOA 1HM5A 4RYDA 5ES3A 1X1EA 5FTMA 3R7LA 1SELA 2UAGA 2EFDB 3DTVD 3EAGA 2F48A 2YJ4A 1Y6QA 2C5SA 2R79A 3DBVO 3DDOA 2FN8A 2YOHA 1UMDB 3GGJA 2WNIA 2F17A 3VR6A 1ZD2P 1Z6TA 1PV1A 2Z2YA 3WK5A 4LY0A 2AEJA 3BTOA 1GKKA 4BUCA 4ASUA 5C1BA 1YI8A 4DRZA 5LWQA 3Q15C 4DJAA 2Z6QA 2VP3A 3HU5A 5AKXA 5JWRA 2ZCUA 5FOWA 1CERA 2JEOA 4AO7A 3KYJB 5JXGA 1CQZA 1DHTA 1TVEA 2WIBA 2YRWA 3A3PA 3P0RA 3WBJA 3C97A 2XUZA 3CLRC 3P71T 3CLTD 3NT5A 2EV9A 2EHJA 1K8RA 5HWSA 4NXMB 3FETA 4YRMA 5TEWA 4E30A 2FWRA 1V6AA 1IXRC 1YL7A 4K7JA 4C4TA 2PRIA 2PS1A 4QOHA 3WKCA 1B14A 1DL5A 2B1RA 1KJ9A 3BAZA 2YFKA 2YX1A 2VZ9A 2FG7C 1VECA 2PL5A 3FTNA 4LWZA 3D6UA 3QX7A 4M7OA 1NI4A 2ZULA 4KRFA 2XTNA 3ENVA 3OF3A 2EZUA 4Q1AA 1Q92A 4FHGA 1PJRA 1VP9A 1GGEA 3Q7IA 2B21A 3CVWA 4WK0B 4CR6A 2ODPA 1UBTS 4F4CA 4BNHA 3PDIA 1K9VF 1DAOA 2GD2A 2VJAA 4O1MA 1O77A 2XUPA 4Z3DA 1GSHA 2GCPA 4X94A 1UPTA 1F2TA 3WLNA 2XF8A 3SKYA 4G5HA 1JSXA 2XVXA 1E0SA 1TJ4A 1IY2A 4DJDC 3RBZA 1M5RA 4M99A 2TMYA 2PGXA 5E6RB 4F2HA 9LDTA 1LV7A 1BS9A 5K6TA 1W34A 1T3TA 2C2YA 2QVGA 3DKPA 2HQ1A 2WYOA 4JMLA 2EWMA 2NO4A 3N0VA 1L5NA 2P2GA 3KTFA 2JFUA 4O5OA 4D56A 4FFPA 1QF7A 4Z4QA 3NIFB 4DEXA 5LZ7A 1VYUA 3DEAA 1NW6A 4YRCA 4D82A 3WGIA 4FYKA 4OAPA 5TR9A 4XX1A 5AI5A 3D6NB 1RBYA 2FSSA 2GA8A 4RPGA 2JCVA 4E13A 3BXGA 5JS1A 1U5BA 5B3AA 3H6HA 4FW9A 3HVJA 5DH9A 1SPBS 4BN4A 2OXCA 2Y9MB 4LPKA 2VA8A 1O94C 3L1VA 5TDHA 3FNIA 3G2MA 4IIBA 1MGPA 3HKBB 4PCLA 2XODA 1UM8A 1XK6A 2Q6TA 1OIWA 4LI3X 4MNTA 2MSCB 2C4TA 1IZ8A 3A4NA 5DHSA 3LXMA 2PBLA 2VPTA 3L46A 2WSSD 4O4LA 4Q1BA 5TMBA 4B80A 3BN3A 4CDNA 4DQVA 3NXKA 4YCBA 4JAVC 4J1NA 5KI6A 4GBJA 4EDFA 3Q11A 5JRDS 3KIPA 1QGOA 2QE7A 1Z4QA 2G28A 1WA5A 2X23A 2DCMA 5T4HA 1WQ3A 2H5JA 1PGPA 1H8ED 1SXIA 2XY4A 3WHPA 4HZUB 2PMFA 2GPAA 5E7QA 4D42A 3GLGB 5A05A 2I80A 3EDMA 2DHRA 2EG9A 1T10A 4OSOA 4PYIA 5C53B 3LLMA 2ECOA 3QKTA 1WVGA 2ZWMA 4RFVA 1E94E 1K97A 1VE6A 3TJRA 4B8ZA 4ENTA 4F6LA 2VJKA 4LHSA 5LB4A 5BV1A 4JYZA 3ZQUA 1JRLA 2VDPB 1FNDA 3K92A 5J9FA 4EHKA 5HQ3A 3ENNA 3H5AA 1AB5A 2OL4A 4URUR 3ULKA 1L5RA 2XCQA 2CXPA 3BGSA 3WWEA 2ZJ0A 2WIFA 1N8SA 4ADSG 5H7XA 3NHSA 1GPBA 1V1MA 4M76B 2HWWA 3OJOA 1DARA 1C0PA 1XK7A 2V97A 1LB1B 2WJWA 3ENWA 4CV2A 1P4JA 1BXGB 2RGEA 4US1R 1W1UA 3UEOA 5F3RA 4EGQA 3MT9A 2GF2A 4KPYA 3KPJA 3ADDA 3G8AA 1SUIA 3KCNA 1QDEA 4KYIB 1P18A 4UMDA 2R9VA 1QGUA 1XA3A 2VYQA 1JB1A 4OQEA 1V6SA 4FKBA 4W9NC 1Q74A 3VPAA 3QUBA 3GU3A 2OKGA 2IH5A 4JC8A 5F5LA 3WDKA 4E5YA 1RZ3A 1YB6A 2H51A 3GCWA 2VDWA 2CZQA 4M36A 4MITA 3UOGA 4RA9A 1U3DA 3GT4A 1ZOPA 2JIZD 3I9V6 1W2GA 1G8MA 3KUDA 4YECA 5LUBA 2WHPB 4LF7B 2J0QA 3CRVA 4G5SA 1XNGA 1QRTA 1ACMA 3KE8A 3JD3A 4IFEA 4EDHA 1H0SA 4TLBA 3AKEA 3MFYA 2IHBA 2ZBGA 3HA2A 4BPBA 3BCUA 2GKSA 4OHFA 3FFBA 3ZWAA 2FB9A 2VJNA 3LDFA 1RTTA 2PY6A 5JYCA 1E2PA 1O6FA 1D0IA 1T0HB 2O0HA 3AKDA 1SVUA 2C98A 1I36A 3LHSA 2ZJ6A 5LJLA 3O8DA 3R7AA 2AI2A 1Z6GA 2O1XA 2GN6A 1GPAA 4AIIA 2ZIGA 1MQSA 3LUGA 4PO1A 4AS2A 5IULC 2ZBQA 5JANA 1BWSA 3F8TA 1C8VB 4UQPA 4OH7A 4Z2YA 5JJIA 1TCVA 5E7IA 4MR9A 3GD7A 2WJGA 3UY4A 1JEJA 2B36A 1DRVA 3D4IA 1X94A 3LUAA 5IEBA 1YRHA 3C8ZA 1BFKA 1KC3A 1S2GA 2AQIA 3DMRA 3L79A 4AQ7A 1VI5A 1TCCA 3G9QA 5DNAA 1Q14A 3AUSA 4R7GA 4POOA 4HQFA 1OYYA 1E96A 1QIMA 1A5TA 1SG0A 2FOXA 3QHPA 3CLSC 5ALZA 1KVRA 4MP6A 1P2DA 3SJAA 1IUPA 4Z53A 3IAAA 2ZXEA 1CUJA 1CUZA 3T5MA 5JSZB 2NZ8A 2YR0A 5C7OO 1G3RA 2GX6A 4Y6OA 5K8LA 4BE4A 3Q8XB 5A4KA 3LYLA 3MGGA 3PTLA 4CUJA 3WLQA 4B0PA 1OJLA 1XZCA 1OX6A 1JA9A 2FG6C 3KVVA 3U62A 3A37A 1FP4A 4KSBA 1GL6A 5DV9A 2PVPA 2SCUA 2F8TA 4UBLA 1X8JA 3JWHA 3EPLA 2GZRA 2XQJA 3VTZA 2VP9A 3ERCA 5LP6A 1IULA 2C57A 2O57A 1XU7A 1YJCA 1YIAA 2H57A 3CBQA 2P2ZA 3QI7A 3EIUA 3PDCA 1T2FA 4OYHA 5H0IA 3J7AC 2QQEA 3IVGA 5DX1A 1IHYA 2C83A 2H0AA 1V1JA 3BJEA 3DKVA 4J91A 4JFAA 3FRJA 3DVLA 5TJHA 2E4AA 3PUZA 3A9TA 4DLUA 1Z6AA 1J56A 1KQNA 5GM1A 2B1JA 2H63A 4W9NA 1ORHA 3P32A 4WZAA 4JOBA 3RYIA 1W0KD 3WWYA 4C03A 3T0GA 4AJJA 4O63O 2ZT8A 1BGWA 2QM7A 4X5OA 4FBMA 5TPWA 4AJ4A 5BR4A 2HYIC 1IUOA 3UHAA 3Q8KA 2I7XA 1HFWA 1PJ8A 3KEMA 4XR9A 3HXOA 5CLGA 1MVOA 2P2SA 4I46A 3DT9A 4BRZA 3I3SR 2HLDD 4M2LA 4UMFA 3LCUA 4Q9HA 1JG3A 3KC2A 2FXIA 2NV0A 1I0LA 3WQBA 2ECQA 5BW4A 1UP4A 2AFHE 3HJBA 4LPSA 4Y9UA 3VO1A 3CVXA 2OXEA 4LXUA 2I7TA 3OICA 1GRCA 3TK1A 2JZNA 4E33A 4ZARA 2GEKA 4PLWA 2JRCA 3OKFA 3WYBA 2Y1XA 4XYMA 4XPIA 1ZU4A 3TTWA 4B6FA 4ECAA 4TV8F 1T3GA 2GJ9A 4JL6A 4LBZA 2O0JA 4DG5A 4Q24A 2X2PA 5KQLA 3QUQA 5KIAA 1HE5A 1XVVA 3GAZA 5E4TA 4CF5A 2VSYA 1OF1A 1TAQA 3A32A 3EMDA 3BIXA 3W8NA 4PY2A 1JHZA 2OBLA 1L7MA 2O2GA 1NBWB 5B4TA 4RTMA 4WNAB 1OKKD 5GGYA 1LLQA 2FSHA 3QPUA 4DA6A 1D4AA 1EFRA 4GVLA 2ZUTA 2F59A 3P0EA 2D1TA 4FN5A 1DJPA 4JGBA 2IHUA 4CQLA 3GT7A 4LE0A 1RWQA 3DR3A 4GSKA 3P52A 4F4IA 4WKCA 1ILEA 4M22A 5LU8A 4OQFA 4OBXA 4MUJA 3MWYW 1Y5RA 3JVIA 1KU0A 2AL7A 4DXAA 4AK9A 1QONA 3G02A 3NCHA 2C2WA 4Y3UA 1EFAA 3MD9A 1HNWB 4Z9FA 3F46A 1N6OA 1YA8A 2D06A 5BT9A 2HEGA 1T2CA 2BKVA 2NGRA 3WIOA 4D0LB 3DDCA 1NZFA 4KGZA 3NONA 1DMRA 2NUAA 4D81A 3LMKA 4KV9A 4F9FA 3FDXA 3LTEA 3GEPA 2VT2A 3L05A 4J0QA 3WDLA 1Z7GA 5IJ0B 1T5HX 2J3QA 2QN9A 3FCCA 5HBGA 4GMXA 3S0JA 3RO7A 2WM3A 2YJNA 3A36A 4XIYA 2JATA 1H8HA 1T2NA 3GDWA 2EZ4A 4RVGA 1T29A 3A9VA 3ISJA 3KV1A 3LP6A 1N9ZA 4R9NA 5DSXA 4OSPA 1HRKA 5DNWA 1DV1A 3PNYA 2QLTA 3GUCA 2UUOA 5JE8A 3EAFA 3I9FA 1YDFA 3M2PA 4GXTA 2XOXA 3F2VA 4MA4A 4YRNA 2C7BA 2GYWA 5CM2Z 3F7TA 4CTMA 4B4VA 2GYVA 3FWZA 2C5AA 1T9DA 1Z4PX 2QT1A 3R1IA 4ZOLA 3GAMA 5JI2E 3HHEA 1JQAA 1HA3A 1QNLA 2GBFA 3PNVA 1U7ZA 4CJXA 4EO7A 5AW4A 3WYFA 3FJOA 1AUXA 1WPGA 4FFBB 1I4WA 2WPNA 2X9GA 4OB8A 4ILEA 1T8TA 4J90A 4XSVA 5TV2A 1M3SA 1FL9A 3FIUA 1NV9A 1WAMA 3EASA 4KO1S 4AQYB 4I1PA 2Z57A 4YB8A 3C1AA 3TJMA 4YS6A 5ADUS 3T3HA 5BR1A 3IKTA 2OFXA 3GVIA 4M6WB 5BWBA 3B60A 1KP2A 2R2GA 2X14A 1R8JA 3RVPA 1ZU5A 2FX5A 3ZX5A 1VRCA 1XRLA 2ZJZA 2JARA 4R2MA 1OW3B 1VIDA 3L1UA 3BXOA 1GT91 4KR6A 4A2CA 1HXHA 1SB9A 3A14A 3GVCA 4J1TA 2A1UB 4UAVA 1KXJA 1QHFA 3A06A 4XYEA 1ZINA 4RH1A 1PKXA 1E77A 4EI8A 1Q0SA 3V32A 1UQRA 1K98A 5LQNA 4RVDA 4NV3A 1XZLA 5IF3A 1JYSA 2ID9A 3IPLA 2PDAA 3VZCA 3ZU3A 3QY0A 5HJEA 5BVHB 1XVAA 4NJMA 3Q12A 2OV6A 2PX3A 1BKDR 1SKQA 3COZA 4B9EA 5EMNA 4F3YA 3JRWA 2ZRCA 3P9ZA 2QAJA 4C6TA 3KUKA 5HTOA 1ZFNA 3V1NA 2GTPA 3PXBA 2GK4A 2BGMA 3FZEA 3NIBA 1CJVC 2X2OA 1O89A 3SY8A 3WJAA 5JISA 3EFHA 2W6MA 3VNQA 2BFOA 2NU9A 4C88A 1ESCA 3AKCA 4S1WA 2H7CA 1CW2B 3UT5B 1MO5A 4NTZA 3CUUA 1VBKA 3IESA 1JJIA 2XR1A 3LHFA 1LBHA 1WXXA 4NS4A 1SOUA 2FEXA 2R8BA 4M9CA 1TA4A 4TS3A 1YDMA 1LF0A 4NOLA 1K92A 3RSGA 3GJQA 4E0BA 3D5QA 2FR8A 4EF5A 5K0JA 2P67A 3EOAI 4E15A 5CFPA 4LEIA 1GHTA 1QX3A 4LNUB 4P92A 4P4SB 3ZBQA 3KDAA 4BO8A 2VT6A 4P86A 3ZY4A 2WW8A 4QHTA 5LKRA 3U3KA 1R15A 3G7NA 1CPYA 3FPLA 4RORA 1OX4A 2PO5A 1RRFA 2OBBA 4IBOA 4AZ3B 1RLIA 1C3OA 3R6WA 5EESA 5GZ3A 4MGHA 2W37A 5E1BA 2WFMA 1RE1A 3HCDA 3ECSA 1E3QA 4EVIA 4UE6A 1YL6A 2GEUA 1NBIA 2BFBB 4QYTA 5KWJA 4N6GA 2KBEA 5KTRA 1A8UA 1GZ4A 1DCFA 2BHSA 1IUNA 5EFZA 3SC2B 5B2ZA 4RY0A 1C7FA 4CM8B 1YB4A 3A1NA 4FQ5A 1YOVB 2NX2A 4C7OA 4HDAA 4X00A 5A4MS 2EATA 3UGTA 2BGIA 2GPTA 3N86A 4WECA 3VR3A 3WGNA 1PJ3A 4AW9A 3C16C 1NJFA 3G2JA 3BK2A 1NT4A 2OBMA 2OKCA 2W6JA 4PAOA 4TVBA 1HE2A 4HG2A 1OQAA 3ZLTA 1DXOA 4L5JA 1JR3A 3SZUA 2Z08A 4XLTA 3L7YA 3A04A 4E32A 3TO5A 1D2AA 1K6XA 3VKVA 3VPBA 3KAPA 2D7CA 4TKMA 4EJMA 3BOSA 4GOLD 2F3TA 3QNMA 4J29A 2QN7A 5FUWA 2NTYC 3N8HA 1XELA 1U2DC 3KVOA 2GN9A 2C1EA 1YU9A 1IN5A 3D6JA 2QTCA 4KVGA 2GZSA 2M1ZA 2WR8A 1KDZA 2ORED 1O4VA 4BB6A 1MIOA 2Q5JA 3EMKA 1YI0A 3PD1A 1OPRA 1XHFA 2CDNA 1GLNA 1NJ6A 2D4HA 3THYB 4L75A 2IYNA 5IH7A 4EZEA 4KWEA 2O20A 2HQBA 3ON5A 4TN5A 4RJKA 1W5AA 2XV1A 1M1YE 1CJCA 1SMKA 4CCYA 1MNQA 5COAA 5GZ6A 3TCKA 3PD7A 2Z3WA 3AVYA 3V8MA 1RWWA 3L0BA 3ORQA 3QW2A 4LBYA 3IQGX 4ZWNA 1A7JA 3SE7A 4YAIA 1DKNA 3E82A 3FVVA 3QWHA 3K7EA 4BGIA 2QN6A 1XJCA 4WLEA 1Z5UA 3ZCVA 1GEGA 4LDQA 3IQXA 2IBTA 4Y1RB 2ES4A 1RVDA 1XFDA 2H2DA 3F6CA 3E9QA 2HX1A 1C9YA 2CVHA 3N7UA 4Y2XA 5DXJA 3H2SA 4ZRMA 3G0IA 4R6WA 1Z4KA 4PLCA 5JYBA 1B41A 4DGSA 2QS9A 2D2IA 2AR0A 1Y4DE 1FMCA 1JZTA 1X7YB 2Y1LA 3IRVA 4PR3A 1V3QE 2Q0SA 4DR6B 2PSJA 2VS1A 3K20A 4NBSA 5ALTA 5CB0A 5DK6A 2XWSA 4WA7A 3OQVA 5KYYA 3GJTA 2MWMA 3S44A 2ZRGA 1D07A 1K63A 1WABA 2QLFA 2V7VA 2ZVPX 1UXIA 3F1KA 1GU1A 2IEDA 2R6JA 3HCCA 3KL4A 3M6VA 3B1XA 4UQOA 1JW9B 2HRCA 2XUJA 4Q3KA 3FD8A 1C29B 3KPWA 5E9WA 1NYRA 4BKRA 3PEEA 1HT2E 1P6UA 3PDUA 1E2GA 4L8WB 5FOSA 4BVJA 2PCJA 1X1RA 1PVOA 3A6JA 3JQ8B 3AO0B 1LBIA 1E6LA 1JGTA 1COWD 2OFWA 2F3QA 3F0TA 4BFXA 5IASA 5EHIA 2H52A 4EGSA 1C5KA 1KI1A 1SIOA 2W43A 1DADA 2ZPAA 3DOCA 4AIRA 2F67A 4C05A 3E2PA 4D9KA 1WETA 4A15A 3KOMA 1A9ZA 5GZ1A 1PDOA 1FW6A 5A6SB 5KSOA 1GA1A 5CVUA 3RUHA 3KHSA 4E4RA 4GWKA 1ZZGA 2BKAA 3RT1A 3TQIA 5I45A 2A5DA 3HJFA 1YZHA 2J6IA 5LZ5A 4EF6A 1S3FA 2HGSA 3KD2A 1P91A 2W2VA 3QVTA 2W83A 3G2NA 3L4BC 5T6MA 5CLJA 3OMXA 2XMRA 1FZTA 4CQMB 4B43A 1XZFA 1CUFA 3JWJA 5G1NA 3RS5A 4U2FA 4TL8A 2HY7A 1HFKA 2P9YA 1R7RA 3HABA 4E46A 3QLTA 1L4EA 3ZZMA 3OPMA 3KVRA 4G6ZA 5GADl 3OCXA 4E07A 1I3LA 2Y71A 5AVOA 3VHQA 3WRYC 5HMLA 2GEBA 2C1XA 4KMMA 4F3NA 1Q7CA 2VYNA 2VL7A 1OH6A 3I2GA 2EZTA 3TM5A 4RA6B 4I9HA 2HW8A 1M8JA 1N7JA 1X2EA 3AOEC 1M1NB 2AMYA 3LPNA 3NBKA 3O83A 4MQ4A 4HPWA 5ALIA 4URZR 2ZRBA 3D59A 1BU5A 1KOFA 1N8TA 4F72A 4FTWA 4AF6A 2YV2A 4RK4A 1VM6A 3GB9A 5IT9A 3TIFA 4DIKA 1SWVA 3ZHRA 3H9JA 1YBMA 1VG1A 3BERA 5FUVA 3UA4A 1V4NA 4AROA 4Y8VA 1B3RA 2HIAA 3UK0A 3GGPA 4F6RA 3AQIA 1PIWA 2GAAA 2HJHA 1EUZA 4TWAA 2YMMA 3KKNA 4KWIA 4GDFA 1QR2A 1PGNA 3NIWA 4N3BA 4NXNB 2CFRA 3EBLA 5SZIA 3O21A 2FZCA 1JQKA 4WLNA 4I1UA 4YVFA 2QWXA 1YR3A 4D9BA 5A62A 1W30A 1RYFA 4D97A 1K7YA 2OCBA 5G4KB 3USES 1ZUIA 3W78A 2AOWA 2NZJA 1YCDA 2C04A 3HRHA 4QDUA 2I91A 4E03A 1T5TA 1FDTA 5EKDA 2G9NA 1P0MA 2XUHA 1HOTA 4BNJA 2IEZA 4UOZA 1R5OA 3FOFC 1H3EA 1U31A 1W76A 2RAFA 4R1UA 1J1IA 2E49A 4NE9A 4CUZA 2YWJA 4LMAA 4ZEVA 5B3LA 1P9WA 3KQNA 4F4HA 5KEIA 1R4NB 1JXQA 1DCMA 5I5GA 2H00A 4DC1A 3FPGA 2R7MA 4RHFA 3I64A 3CZQA 2ZE7A 3PRYA 1MJHA 4RCYA 9ABPA 3NWBA 1EJ0A 5JZOA 4AO8A 1TTHA 1DFHA 1RPAA 3T0FA 1ETHA 5AW7A 1UR5A 2Q8NA 1E1DA 2WHYA 1H0KA 4NBVA 4JGGA 5H83A 3JPWA 3RW9A 1JAHA 1OX5A 4EVRA 2CHVA 3QVGB 5CJJA 1GYRA 2BJWA 2MSEB 5LUAA 2JLRA 1B8VA 3WP1B 3JWEA 2VP6A 4OFWA 2ZTSA 3CX6A 2BHTA 1FNMA 2YHSA 1VJDA 3GWGA 4HO1X 2YW9A 4B3BA 4DBLE 1IBKB 3DF7A 1MEEA 1FP6A 4HAXA 4EPRA 3AFHA 1RADA 1G5HA 3LRTA 2P91A 2ACEA 5E95A 1AUVA 2XNCA 4B46A 2HWXA 4WIAA 1XZQA 4E3WA 2P9HA 3O73A 4IDNA 3K6KA 3HCFA 2JI9A 1U5AA 1IXKA 2ZRJA 1JFVA 1GCOA 5BQ5A 2I29A 1EVQA 4XE5A 5AJYA 2GYUA 3U5ZB 1MPTA 1ZJJA 4TTSA 3TB6A 4JI0B 4KQ9A 2FP3A 4C76A 2P78A 4Q21A 1LI7A 1T2UA 2W2KA 4FFLA 5ENZA 3T7IA 3WRYA 4KMRA 1RHJA 3C3EA 3EDRA 4G23A 2YHBA 3U4QB 3L8YA 1A50B 3AOEA 4MV3A 1JWAB 3E35A 4A5SA 1PQUA 4JK3A 2BLLA 2KS6A 1E1RA 5E4YA 4PVDA 2W2QA 4EB8A 4CTOA 3A1TA 3F9RA 2WV7A 4HCJA 5DM0A 3V48A 1ZN9A 4CM7A 4CM4B 1CJMA 2RGBA 3H13A 1X7WA 2IY8A 1XZNA 3CVJA 1GPJA 3QJGA 1YR2A 1F20A 1CS0A 1PUXA 1U3CA 4IEEA 3CH7A 1SRRA 2BDUA 4K0RA 4YONB 3ZHOA 4OOFA 3LCRA 4I9FA 1VTKA 3C6QA 1SKBA 1JAIA 1EGMB 2XOKD 1EM6A 2BR4A 2LPMA 5E9JA 4PNEA 5FADA 2D5LA 4XGIA 1OU0A 4LOAA 1COZA 3QPWA 3RK0A 1I1QB 4TV8A 2A5LA 2OB2A 1VKJA 2CUNA 3V8PA 1KSJA 1EVYA 1HL7A 1OBCA 3UFXB 1M1YA 2YW2A 3BCHA 3O4GA 3TKLA 3HBMA 4ZCSA 1G5IA 3RIHA 2F3RA 3ZHZA 1Z0IA 1EBUA 3G3EA 3NKFA 3ICQB 4NPAA 2ZIFA 1X3SA 1J8DA 3GAFA 4IR7A 2XTJA 3T7KA 3H5RA 5AVQA 2PAAA 1YZYA 1TEHA 3BRWA 2NYRA 3CHYA 4EH1A 2HQRA 1XEFA 2HK7A 4KEAA 5CDGA 1GSAA 1ZIPA 3VC7A 3SVTA 4HRXA 3QE3A 1JJBA 3L8GA 5FWAA 4UOEA 4PYMA 1G2PA 7REQB 5FPKA 4RE5A 4BY9E 2Q3FA 5CLQA 2HB6A 1CZNA 2HDHA 1PWXA 2V5VA 1G55A 2VK1A 2Y4OA 3OEYA 3QPBA 3FUXA 4MUYA 4EK9A 3O1HB 4HL6A 1UJCA 3TG8A 1GGHA 2PKQP 5IANA 4OQXA 2VZ8A 2FR1A 4U4AA 2J5XA 1T6ZA 3WAJA 3FUUA 4ROTA 3MQ4A 4QUGA 4MVJF 1H69A 1Y1LA 5D87A 1BWPA 1BE0A 3RPEA 1ZNQO 3KOWA 5K3SA 1PL8A 1XRNA 2NYUA 1VPLA 4D8WA 5K6RA 2F43B 4W5JA 3VU9B 1UT6A 1YJ5A 4ETIA 1Z8DA 3GUVA 5DM4A 3CSDA 1R4ZA 5C81A 4Q05A 2AXNA 4UTOA 4QTTB 1XDDA 5D8DA 2LIPA 5FLEX 4IJ5A 3O03A 2DUJA 1DE0A 2JBAA 4RJIA 3H87A 4Y6QA 4ZVLA 2HSJA 2VF8A 5EWJA 3TCNA 1EHIA 1R2QA 3G7SA 1VLVA 2AB0A 2JFYA 4D3SA 3K9FC 2VJMA 1MH1A 1H05A 3P2IA 1GUFA 4FILA 4JZKA 5BNWA 1VDZA 1L5HB 3R4CA 2VHVA 4U2CA 1GYPA 1KP3A 1NW5A 1UANA 1R0RE 1YB5A 3QNUA 1FNCA 1QCZA 3K8OE 2WWVD 1BTOA 1PI3A 1SVOA 2OVFA 2OE2A 1N3BA 3ZNOA 5E4JA 5FCDA 2GJ8A 1KKUA 3NB0A 3NVAA 4GYWA 2WSBA 2RBGA 2QSUA 2CFIA 1V8DA 3EGXB 5IYZF 2N75A 3E22B 1CT9A 2IOHA 1KDPA 1U3TA 1CUBA 2Y0DA 4HAYA 4KNVA 4QL3A 4RZ3A 1QGYA 3LL7A 4ZVNA 3ZXYA 1KWGA 2WVJA 3GRFA 3L6DA 4KQIA 3SZGA 3A0RB 1ABBA 1D0SA 4I6JA 3QSGA 4BFZA 2VN8A 1DIOB 1FP2A 3GLVA 4MIEA 1JVSA 3AR8A 1MO2A 3L82B 4J3JA 1E3WB 3I72A 4PC3A 3STXA 4RM3A 1YL5A 4XYBA 5NULA 3SJ7A 5ICGA 3A9WA 4A7PA 3HCBA 1SD5A 3JQAA 2JA2A 5BP7A 1J8VA 4ZO7A 5B3KA 2ZJAA 1UBSB 3TZHA 1FQJA 2O5VA 3H2BA 4CM5A 3JAKA 5BYJA 1OH5A 1T26A 3QXXA 4XEHA 3GP3A 4EUSA 3DNFA 3IPRA 1WHSA 2P9GA 2VVTA 1RVV1 4FYXA 2R6GA 2AZ4A 2HMAA 4L4UA 1UMBA 1P2TA 2OAQ1 4MW1A 1BX0A 4FLMA 3OQPA 4G84A 3PD0A 3PHHA 3KQUA 5CVVA 3DFMA 1YDGA 1QQTA 1X8KA 1DUIA 4ENQA 4RTLA 4NKRA 4CDMA 4DLNA 1VHWA 1USVA 4LA4A 3C48A 4PLPA 2JGDA 7GPBA 5ALSA 3FNFA 1DQYA 1Q91A 3V8BA 5ICEA 1PDWA 2R62A 3U7QB 1NPTO 1HDCA 1Q0PA 3CSUA 2P4EA 3DBLA 1SBHA 1J1UA 4PX3A 4JNKA 3O4JA 3CPSA 5JSYA 4GPIB 4ZQCB 5A5GA 1PR2A 4PQRA 1NF3A 5F98A 2JCGA 2E87A 1E5VA 3KJNA 4XX0A 4UNSA 1NQVA 1V1RA 2ZB8A 3DV0B 1D8TA 4XQGA 1MX9A 5K8UA 4WEQA 2QSJA 5AJTA 4QD3A 4F96A 1GRVA 1ENOA 1P6XA 1PP4A 2M6KA 2BEUB 2O3UA 2HDOA 3PQ4A 1AK1A 3PI6A 4UTPA 1G63A 4BQSA 3WIUA 2ZTHA 3NTRA 3IUMA 3ZG6A 4DDVA 3GNTA 1Z7YA 2IE0A 2B5OA 2F00A 1LY1A 4D5EA 4ZJZA 1AV7A 3I23A 4EI9A 4JL5A 1MX5A 4YY3B 1WXDA 3NPMA 3OU7A 4BNFA 3K71B 1Q0UA 3C15C 1WKCA 4XJVA 5JXJA 4QSMA 3B89A 1NP7A 3TQOA 4AT1A 4DC9A 1K8YB 5JJCA 3AI1A 3HXQA 3NR2A 1QDUA 1XPUA 3VNVA 2WT4A 2IBSA 3I6ZA 3F3YA 1L5LA 4P2BA 4Q6BA 5CT8A 2BFWA 2ZJOA 5REQB 5KBYA 1UKZA 3WIDA 4F5YA 4YBZA 2HSGA 3BTVA 4I50B 3EE6A 4L4ZA 3ODGA 3VKFA 3ZQ4A 2JGFA 5KOYA 1KOLA 1MA3A 3CPEA 3CMMA 3IT0A 2OLJA 3EEFA 3M2TA 3UT0A 3DFUA 1PBTA 4KE7A 3CLTC 1NJ1A 4TYNA 2YOFA 3ROPA 1TUBB 3G8CA 1AKWA 4W9RA 2WJYA 1XCMA 1BCRA 1GL3A 2I2CA 1NF2A 4D26A 1Y9AA 4QU9A 1XTUA 1BXRA 1QB7A 3OT4A 3D4LA 4MR8A 4XSHA 1J90A 3BL8A 3RVDA 5KC9A 3HO1A 4U7PB 3CUWA 2OD9A 5BXYA 2Q2OA 1YRBA 2BFDB 1LRJA 1K8XB 3I01A 4NIMA 4FFRA 2Q5FA 5H81A 1L8AA 1Y7IA 2AZTA 4QOJA 2ZBPA 2HF8A 2REQA 4IWNA 3SQMA 4QIHA 1VSBA 4DIFA 4ZYWA 5FX2A 1LJLA 3GLQA 1BVUA 1KDVA 1N8KA 2PRKA 3P4XA 4ESEA 3D4NA 4CXMA 2HQOA 3I0ZA 4BX8A 1MT0A 1XBTA 5HPYB 5T4EA 2NXWA 1GGNA 1TRHA 4QOSA 4ZI3A 4NOKA 1C1DB 1E32A 3W34A 5L3SA 1JN0A 4CNQA 2RSLA 4RULA 1T5IA 4KOAA 1G5RA 5C18A 1AN9A 2FMKA 4NEQA 4OL0A 5IW8A 1KZ4A 2WJ4A 2WUDA 5KSYA 4B3DA 1PQPA 2YRFA 1BCSA 4F5ZA 1NXXA 4JC5A 3LK7A 2XMPA 1NE2A 4UVIA 1L5KA 3WK4A 4NHEA 3TGPA 4QGGA 5B53A 2WJVA 3BD9A 2W7TA 3IUBA 1ODIA 1R8YA 1OLUA 1GG2A 1HURA 4NNPA 1K88A 2PEYA 2QIPA 3I5MA 1AKNA 5IVPA 4ENRA 4BB9A 3W5HA 1PYOA 3SS7X 2JA1A 4GPTA 2OR3A 4MQEA 5LOVB 4D4MA 4R98A 3PUVA 3EIHA 3LLUA 1Z16A 1Q20A 1S8AA 4GR4A 4RPLA 3BS4A 3TEJA 3PG5A 5LNK6 3OWHA 4BO6A 1YXMA 2EBHX 4UHEA 1T1EA 3SK0A 4IFBA 1KA9H 4KNYA 2JHPA 5CT5A 5M2QA 1ZEMA 4FOSA 1USIA 4TKUA 2O2IA 5ADWA 4MVJE 1H2XA 1LXCA 3QNWA 3KCQA 1CE8A 5BSHA 1NUPA 2CW5A 1ZUNB 4EQZA 1G19A 3Q5GA 4YT2A 4JLJA 5FH9A 2MTBA 5EINA 3FNRA 1YMVA 1QP4A 1OXMA 1QOZA 4DDUA 1RMTA 1FSPA 1UT8A 4OM8A 4PYLA 2HF7A 2IZ5A 1AHIA 4H3SA 3SDZA 3OJLA 1TLTA 1F2VA 1MAAA 1TF2A 3BSYA 3NNDA 1IWOA 1NUUA 1AVTA 1E2QA 3EHDA 4WN9A 4DNPA 5EHXA 3MCUA 1LEHA 1F6BA 3BCSA 2BV3A 4JKIA 4BVEA 1PK9A 3N3BC 4H7FA 1EE9A 1QO0A 3DTNA 3MW8A 2NVBA 3VFDA 3D6AA 4WESA 4XR4A 1V2GA 4KNWA 2QM0A 3TG2A 2YFHA 5IJXA 4WEOA 2AMJA 2AXEA 3C4VA 3VR5H 3QVOA 5K3CA 4CV0A 4D74A 3MWKA 1QRSA 1NN1A 1IVYA 2H85A 3U44A 3SQOA 5ES4B 3U7FB 1KEUA 2GSDA 1N6HA 4BUZA 2Q29A 4PN3A 3K94A 4MUAA 2RE8A 2XRMA 3FFXA 4BLWA 2DPGA 3CZPA 1E1NA 5KQGA 3EUWA 1OFGA 1UXOA 2PZFA 2DP4E 2LBPA 3NHZA 3ZWOA 3W6UA 5BMVB 2NOAA 4QELA 4QICA 4QDTA 1EDZA 3IP7A 4B3IA 2Q5LA 1SKUA 3KLMX 3O7MA 3HCPA 4KMOA 3C6MA 1CG6A 4HYEA 5JHGB 4YP1A 3F6BX 2VUUA 3TQFA 1B4DA 5E1MA 2FUEA 1BDHA 4Y2PA 4ESHA 2XBMA 5COQA 1NXQA 4G8BA 5DFAA 1OBOA 3W6PA 1B8PA 3NBUA 3R3HA 3PLAE 4NAUA 4KXVA 3B9BA 1Z4IA 2B61A 3S40A 1ECCA 3DWEX 5KYNA 2OV8A 2BT4A 4PONA 1ZI8A 3YASA 1W4CA 4K6GA 2X0NA 4M1SA 1U04A 1WW2A 1W4AA 1XLVA 2GETA 2ZYHA 3RRBA 3O8CA 4E2FA 2GARA 2MINA 4TVSA 1FBNA 2GZ1A 3LKBA 1II8B 3Q72A 4DYDA 1XQWA 4IJUA 3OO1A 1J00A 1SXJD 4RACA 2FK8A 3SZRA 3FTQA 1ISIA 5CFZA 2ONJA 5AKIA 1PZNA 1WXEA 2XYRA 2O14A 4M8IA 4FZVA 3HKDB 3TW8A 3UKJA 5DT9A 4PSUA 3JZIA 4ZAYA 1VFPA 3WHIA 2ZJ1A 3CKKA 4IP0A 5FBQB 1S0UA 3I2HA 2AIRA 3SIPA 1XI2A 3PI7A 4N8EA 2PSSA 2R3SA 3GLRA 4A36A 2OM6A 4U5XA 5KWSA 3E7DA 2QI9F 4IICA 1NVTA 1SQ0A 2JIBA 3M6WA 3R5JA 1GUYA 3I9LA 5EXSA 1PWHA 4DYHA 5EZ5A 4NBWA 2E55A 2GERA 1AMNA 1UDWA 3QYAA 3L7BA 5A5FA 1KFJB 4QOIA 2VATA 3QENA 5AVYA 5TIIA 2BCJQ 1FFDA 3BDIA 4FKMA 4ZDIA 3ESCA 3ETHA 2LVBA 4IWXA 2DHEA 3VYRB 5KYTA 1YRWA 1R6UA 2I4RA 2FAXA 1WXWA 4HTAA 2JRLA 2Z8YA 4X9XA 4D41A 5C32A 5K0BA 4KW7A 5L45A 3O4IA 4HWGA 4LZJA 4B48A 1OWOA 2BMAA 3I9NA 3ITNA 2WFAA 4GOMD 4R5MA 3D6HA 1RZRD 3P8ZA 1JH8A 1N5KA 3PJEA 4NQZA 2A59A 4LN1A 3WB2A 1H93A 4Q48A 2HK9A 4ID3A 3VU8A 3BHMA 3JQFA 2E4VA 3OZSA 3CQ9A 1ESEA 3I8XA 3DEJA 1KJJA 4Q4LA 4U8GA 3CNNA 3ZE9A 2VPPA 1YO6A 2OUKA 3PEVA 4Y98A 3C14C 4JR1A 4MTLA 5HF8A 1U2RA 2DLNA 3SJCA 3TFOA 3O8NA 1GG9A 1OWPA 3IV9A 2O7SA 2FCRA 2HH9A 5FWXB 1KJ8A 2EL9A 2JIZA 2I8CA 3K5HA 2IE8A 3A4YA 2C0QA 2JW5A 4ZJUA 4WD3A 1MJFA 4F4DA 5C7IO 5TMPA 2YYSA 2OCPA 4COKA 2WU0A 2HMWA 5JJBA 1LLCA 3DAOA 4JBWA 3QYJA 5DASA 2CCJA 4KKXB 4KX5A 4L5YA 4MS3A 5LR6A 2BSQA 2C0PA 3EVNA 1ZZEA 3B85A 1N36B 4OD0A 3ABZA 1OXSC 1V6CA 1HPLA 2ECPA 3EFOB 3N5KA 3LVQE 1R6TA 1J0DA 2WE8A 2ZFUA 3IE2A 3NHJA 4WNCA 3SFZA 4A6EA 1SOAA 2QYSA 1HYGA 4UD6A 2R97A 5P8WA 3IUYA 3R5FA 1UKVY 1HQDA 2IEGA 3F5FA 1E3JA 3TNJA 1SQ5A 2O8EB 2M1XA 4QTYA 4LZWA 1TVKB 2R1TA 5EQFA 1J0EA 2JIPA 3Q4GA 2EJTA 3V4VB 5A5VA 3OT1A 4KC0A 4I5EA 3QBJA 3SXPA 2BHNA 3JYPA 3AVPA 3W6ZA 3K4PA 1YB2A 1DIAA 3OZ7A 3BXEA 1N2OA 1J0CA 3DXYA 4GMDA 4FGKA 1EVZA 1BJTA 2OT3B 1NF8A 4U6QA 2VO1A 5EC8A 1YA4A 4TM7A 1QE0A 4ZGBA 1TEVA 1M7BA 3N2ZB 4CLXA 3RIYA 5EHQA 2ZVQX 3FCOA 4PYJA 3TTVA 1DX6A 3EIOA 1IE3A 1QRDA 4R1LA 3M1LA 2YMLA 5ALXA 4ENPA 4NE2A 2QN1A 4D4IA 2ZIVB 3C6YA 3VTFA 3A3YA 3D1JA 2AF4C 3ONNA 4PGHA 1R18A 2CY0A 5BWOA 1U5BB 3QUTA 4W5WA 1XR3A 2JCBA 3ZDXB 2XKKA 1I8TA 4BLQA 5C5IA 3GRCA 5HTKA 3LT5A 2TS1A 4CTKA 5JH7F 2JCSA 6Q21A 4KE9A 2YMQA 1P2UA 4J0IA 4CG0A 3Q7SA 5EE5B 4H4DA 3NBYC 4D46A 4UPEA 5KREA 3PQ2A 4H0NA 2ISSD 5D3MA 3T94A 5JCJD 4BNXA 2JD0A 3QTTA 4FYYA 3SHOA 4C4YA 5AQEA 4LZLA 3T1OA 3RIEA 3GPIA 3V4ZA 3VC1A 3M4JA 3VJKA 1ADGA 3IUQA 1J09A 4KFRA 5LXTF 3CIFA 3UWOA 4K6CA 3QMVA 4NARA 4A0QA 1Y8ZA 2JKZA 2VP0A 4IUDS 4F3TA 3B5JA 5J5VA 2Q46A 1CHDA 4LVNA 5DHUA 3ZD7A 3MNFA 4TUYA 1G98A 2XZDA 5FTJA 3BIOA 3S2UA 4DFDA 2YZ2A 5FF9A 2YIVX 2PWPA 3REGA 4LJ7A 1ZR2A 5IYZA 1Z2EA 4XA8A 4ISBA 4S12A 1G2IA 4C6RA 2VUHB 2C3UA 1R6XA 3PIRA 2I6UA 5JJ5A 3D7SA 4GOKA 1V8BA 4G0QA 1ACLA 4G5QA 2ZAYA 4RCVA 3I9KA 2XMDA 3L4SO 1Q21A 2H54A 3IP1A 4ACAA 1N34B 2OCIA 4RK5A 2XCSB 3OKCA 2IOQA 2VDRB 1QIDA 3AVQA 5JXHA 1LI4A 5ITWA 1EFPB 3H6GA 5JS7A 3NTVA 4O0LA 4B3XA 4IH9A 5KPJA 1P2SA 3AI7A 4KK4A 1QGUB 3UMRA 1U7XA 2ZREA 3FNQA 3H9EO 5FOVA 2RB4A 4GI2A 2G1JA 3QBDA 3URKA 4CMEC 1EUCB 4LJKA 1GDHA 4LV6A 4RA9B 4D8YA 2BJHA 4GHWA 3VDNB 4Z4IA 3O95A 2O8BA 2WF5A 2NQTA 3NJ8A 4EPYA 5KHOC 1EM8A 3E7PA 3ZCQA 2BSAA 3IYLW 4I4LA 4LISA 5C1PA 4KLNA 3P20A 2P5SA 1ATIA 3T35A 3ZUPA 4FDMA 5HFAA 1Y89A 3MAGA 2OGTA 3GJRA 3UB4A 4C0JA 1SBQA 4MS1A 2R7KA 1YBFA 5HIKA 3GJSA 2J3JA 5C8ZA 3NTQA 5IM4F 3U4MA 3FMOB 2SKEA 1C7RA 1SXQA 5I7FA 2FDCA 2E2WA 3BWYA 5I7UA 2A0UA 5EWLA 2QB5A 1Y1PA 3FPJA 4QXMA 4D0NA 1CEYA 2B0CA 2G4LA 3VZDA 1S5PA 4N7JA 3KZOA 3DM9B 4MPRA 2I9KA 1D03A 2O8FA 2QKYA 3PP8A 5IKMA 2VA9A 1M2VB 4HJRA 2VHQA 4JDUA 1DVRA 4LMRA 1OIXA 2J4CA 2XADA 4DUZB 2BGKA 2B4KA 2B8JA 2BELA 4EI7A 2HIMA 3TPCA 4M1KA 4MR9B 3GGOA 4FWBA 3AR6A 5CB8A 1YBVA 4PSCA 4LMPA 3W9UA 1P1RA 2QE6A 3HUFA 5CX1A 1Z7WA 2FMFA 3PQCA 3V5NA 3HN7A 4U1RA 2CLDX 1AIPA 1Z63A 3PQEA 4MRPA 4II3A 4JU9A 5SZJA 3BWVA 3RS4A 3D0OA 3G2PA 4KUEA 2GLTA 2J6BA 3DHEA 1G17A 1N0HA 1V11A 2HGZA 3I1IA 2G3YA 2D8MA 2YQZA 3K73O 4FGWA 1ZBDA 4BNIA 5I4CA 2OK8A 3BORA 4P3OA 1F17A 5J4VA 1M0SA 1EJ2A 3I34X 5K3AA 4B7CA 5IT5A 2VNKA 4C0AC 3ESDA 2C5BA 1ZGAA 2HSEA 3G8YA 4TN1A 2IHYA 2O05A 1V96A 3HSKA 4ZICA 3PS9A 5L6LB 3WWPA 4EKNB 4HQKA 2ECKA 2OD7A 2I7DA 3CJRA 4EA9A 1I6MA 4FIZA 4C0BA 3AM1A 1FY2A 3FPSA 1OXVA 4XQEA 5DIZA 2PJRA 1U8UA 4X85A 3WLRA 3LYUA 4MWZA 5EE3A 5JFTA 2HMSA 4JI2B 1RC1A 5LP6B 4HDNA 3IMCA 4RLHA 3JQQA 4Z7OB 3CINA 4UUOA 4ID9A 3ZHCA 3DUWA 1BFDA 3WWZA 4HQNA 4AYXA 5DOZA 1ZL0A 1GR1A 4HNAB 1K86A 3KTOA 4M4SA 2F64A 1E0DA 5CTAA 2G25A 3KU1A 3LBFA 3EMVA 2R8ZA 3UKDA 3VDRA 3GUHA 2PUTA 1RMQA 2J30A 3GJ6A 1DNPA 2AE1A 4RKEA 4WZAB 1ZGGA 4AY2A 3EULA 1YRLA 1YCFA 5KOJB 3LRXA 1OTXA 4M49A 4UXIA 1G8AA 4CMEA 4NCAA 3SHQA 4CEJA 1FU7A 4PZYA 3R44A 1I13A 2YWRA 4QPZA 1P4AA 3C0KA 1V25A 1CRZA 2BY4A 4BRSA 2XGSA 4IV8A 2V4MA 1KEPA 1K75A 2G6BA 2RH5A 3QU9A 3TZLA 5ADHA 2YQ5A 1FFYA 3AUXA 3JXEA 2Q4BA 1QKJA 3H18A 5EAIA 1YQEA 3W8FA 1V45E 3VGPA 5J4LA 1JDPA 4YRGA 3HUDA 3LY8A 4ZIRA 4XPIB 4YRFA 1E61A 3CVYA 2HI0A 1ENZA 3WLTA 2RHGB 3DE7X 3GJZA 1DQSA 4HXEB 2B6HA 5F5XA 3S55A 1ZWKA 3WFJA 3FX2A 3CRMA 4BYGA 1P60A 1YR1A 4BEWA 1GGVA 3GRUA 4L0QA 2XNHA 4PTYA 2RGDA 3DL2A 3X2SA 4BQFA 2AFIA 4FB5A 4JITA 3CNEA 4RTQA 1QK5A 2CK3A 4RX1A 1LVUA 3KQTA 4PTZA 4UUQA 5BN3A 4LJRA 3FR7A 5H68A 3PSHA 2ZLBA 1GTZA 3RUCA 1O96A 3ICPA 4Z0HO 3B1WA 3I04M 1CY8A 1VLMA 4JB3A 1SG6A 2CUTA 3LWDA 5FNVF 4BFSA 1BG6A 3M9LA 2CE7A 3GPCA 3PE3A 1YHYA 2QM3A 3EFEA 4JYMA 4NFLA 3LJKA 3NBZC 2YXEA 2ZSHA 3RJZA 3UUGA 2WICA 4RLSA 4ZTBA 3ORFA 4AY3A 1T0PA 5A1JA 3OZBA 1SIWA 1RAFA 1NZDA 4F3RA 5B7NA 3E2IA 1OMOA 3ZHYA 4DF3A 1Z35A 4WGGA 2BDTA 2IOYA 3FYTA 5C31A 1RIFA 1XQ1A 4M0MA 2X4GA 2QLLA 4LYDA 1BYIA 2O3QA 1RWBA 1JIXA 4HY3A 1P0PA 2OLEA 4UM9B 1E2DA 4BC0A 2GMWA 2ESRA 3AZQA 3NIGB 3D81A 4FSXA 1ZC4A 4Q4JA 3A31A 1QIEA 1RD4A 4RC9A 5JS2A 4DTCA 2R8OA 3HUTA 2OGZA 4JP8A 3ML1A 4NZZA 3VVLA 2X13A 3BGIA 1U2GC 1G66A 3RBVA 2BFCB 1IEQA 4KODA 1B0ZA 2C9CA 4N0QA 5HKAA 2OLKA 5GINE 2GZMA 2XDQA 3MHTA 4ARIA 1EKXA 4U7DA 4WVLA 4QPJC 4B74A 4B3SB 4CW7A 3LI2A 4V3CA 4EHIA 1NMQA 1PG0A 1H9CA 4BQIA 5U4XA 3W5IA 2DFKB 1C9MA 3EEYA 1QS0A 4NV1A 3MPUA 3VR5D 5JD6A 4PXAA 4BMVA 3D8BA 1E79A 3QSYA 2O2HA 1TO1E 3MYRA 3ZV5A 3MZ0A 3ZWQA 5ICSA 1ISFA 1KEEB 4ZOLB 1BMQA 2H1SA 3G2KA 3UW1A 2CXTA 5K4AA 3MBIA 3MHPA 3HRKA 1YQ9A 1E7YA 1SUBA 3VSCA 1SZJG 2AR7A 2ONZA 3ND5A 4FR5A 1P0QA 4GFDA 2H11A 3I53A 3TDKA 1M2OA 4N3GA 3OZVA 5LD2B 1TCAA 4ZZ0A 5LQKA 1KPHA 1W0CA 1V3VA 4K3UA 3T3OA 1V4VA 3CUTA 1AS0A 2VCHA 2DPLA 4RVNA 4A0GA 4CKBA 2K2QB 4QXOA 1N33B 4HJXA 5CDHA 3WLFA 3REOA 3NWJA 4RMGA 3P2EA 3DDHA 4G3XA 3MLBA 5T67A 4O02B 2P69A 4XM1A 1X80A 4XB2A 5CMLA 3AB7A 4D9HA 3M5DA 2RK6A 3VTAA 5CT4A 2QZSA 4QYIA 2AR9A 3LIIA 4OJQA 4TXMA 3D6MA 4EKGA 5A4FS 1WPRA 2Y67A 4G1FA 1TQ4A 4A9AA 3HJGA 1H85A 1K4MA 3GT3A 1H2EA 1NPYA 1W7AA 1NJSA 1Z5VA 1IH8A 3OOWA 5ARBA 4HFJA 4NJMB 3GRAA 4OX9B 3UA3A 3JCZA 2I4MA 4EEKA 4WBNB 2G0TA 3HM9A 1VPVA 4G4SO 1Y7HA 4KE8A 3ZHQA 1ZGJA 1NW4A 1LUAA 1TXGA 1KDTA 5DBIA 1VHTA 4C6TB 4DMGA 4EL0A 1KYWA 5HRAA 2R1VA 1XCGB 1LWNA 3IV7A 3LOPA 3RGGA 1U0LA 2DQZA 4BBAA 3DAFA 4MQMA 4GI1A 4OXIA 2ATCA 4WBXC 5IHPA 2R8PA 3A1UA 1COWA 1XJ5A 3RWBA 2R0QC 2GHQA 5G41A 4GWLA 3RTBA 4ZQEA 5B7PA 4UAGA 4NCBA 3S2YA 3MOGA 2ZBRA 1X7HA 3NAMA 4IRMA 3GHHA 1AKUA 4BGDA 3BFXA 2YYYA 4ENWA 2ALJA 4I2VA 3BHIA 3PC8C 4YO8A 4RPCA 4B7AA 1JKJA 4NH0A 3LA8A 2PH7A 1T3HA 2FEOA 3VM6A 1H0RA 5H9WA 1VJRA 2JHGA