4DNQA

Crystal structure of dad2 s96a mutant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
TLLDALNVRVVGSGERVLVLAHGFGTDQSAWNRILPFFLRDYRVVLYDLVCAGSVNPDFFDFRRYTTLDPYVDDLLHILDALGIDCCAYVGHAVSAMIGILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLAVGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARDHSVPASVATYLKNHLGGKNTVHWLNIEGHLPHLSAPTLLAQELRRALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DAD2
publication title DAD2 Is an alpha/beta Hydrolase likely to Be Involved in the Perception of the Plant Branching Hormone, Strigolactone
pubmed doi rcsb
source organism Petunia hybrida
total genus 80
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dnqA00
3JWEA 4Y2VA 2CUTA 4Y2JA 5CMLA 3WL6A 1FFEA 3A2MA 2FX5A 4BZZA 1EVEA 4KEAA 5FP0A 3UUEA 5EFZA 3MUNA 1YCDA 4Q3OA 5JAPA 4BP9A 2WJ4A 4K6KA 4G8BA 2DSNA 1BN7A 2VJAA 2PVSA 2B9VA 4DYHA 3R40A 3B3QA 1AKNA 1PV1A 2Z5GA 4FNGA 1ACLA 2PU7A 2HM7A 1TCBA 1JI3A 1Y7HA 4Q82A 3L1JA 4QWWA 2ZYRA 1L7QA 3OURA 3QMVA 4Y2SA 1JKMA 1AGYA 5K3CA 1XZEA 4IH4A 3C5WP 2VJCA 4L0CA 5CBKA 5FPPA 2QZPA 4KE8A 3FLEA 2XI4A 2VT6A 5AK4A 1XQVA 5K3AA 2V97A 4BZWA 2WIDA 3STYA 4FKBA 5AM3A 1P0QA 3G0CA 2VAXA 1THTA 1ZI6A 5AJHA 3VJKA 3QH4A 2V9ZA 4BVKA 1ZOIA 2GZRA 3DD5A 3FYUB 1LPMA 1CUDA 1BRTA 2XUFA 3AIKA 3WKCA 1T4MA 1HBJA 3R41A 2O2GA 1RWQA 3G9TA 2JGEA 4WFJA 3QPAA 1EXWA 2Z8XA 4M0MA 1L7AA 3DLTA 5IVKA 4HTAA 1N5RA 2HFJA 1Z68A 1XQXA 2C5GA 2WHPB 1J07A 4GHWA 1XZGA 3WKBA 3BJRA 3F96A 3HACA 1E8MA 2QM0A 4OYLA 2OCGA 4UFOA 3EBLA 4B85A 2PBLA 1VE7A 1Y7IA 3SWWA 3MGAA 5C8ZA 3V9AA 1E8DA 4DGQA 4HXFB 5DTIA 4G9GA 5SYMA 2Z8ZA 1YB7A 3QMWA 2Y2UA 1W6RA 4P92A 3WKEA 2AJLI 1XZAA 5AKXA 2WTMA 4OD0A 2WG2A 1J1IA 4H35A 1Q0RA 5ALGA 5D7BA 2QR5A 4K6HA 2PM8A 2XUPA 5BWCA 4RE5A 3N2ZB 1DINA 4EY8A 1VKHA 2VA9A 1ETHA 2CKMA 5JAHA 4JNCA 5FLKA 1IUNA 2WTNA 2ACEA 5LYYA 2WIFA 4L3WA 5JD4A 1QGED 2WG1A 3SX4A 3AUKA 2YASA 1G66A 5K3BA 1UK9A 3BF8A 1U65A 3LS2A 3VVMA 1B41A 4RPCA 4CIAA 2QXUA 1TKRA 1TAHA 1MAAA 4C89A 5EI5A 2OGTA 4UFNA 4QDOA 3GA7A 4NS4A 5EHXA 4BCDA 2WU3A 1PJAA 1CV2A 1XLUA 3TGLA 4QDZA 1ZIYA 2CBGA 2ZSHA 2YYSA 2Y2VA 2OPHA 2HHAA 4HXEB 1QE3A 3I1IA 5AKZA 3FYUC 5EIHA 1ZICA 4J0HA 4B0PA 3B12A 4JYMA 1R3DA 4C01A 4OB6A 1MTZA 5A7FA 4A5SA 4DNPA 4DIUA 2EEPA 2Y6UA 4W1SA 5A7HA 4BRZA 4BTVA 1QIMA 5LZ4A 2WIKA 3QVMA 1TCCA 3R3XA 3BIWA 1N5MA 2G5PA 2IIVA 4RNCA 2WKWA 3IIIA 4Y2QA 5ALZA 3C45A 2PL5A 1ZI9A 4E14A 3FSGD 2XUOA 4FLEA 5ALDA 1CUZA 5CXXA 1JJFA 5DWDA 3LP5A 1H2ZA 4G8DA 4HS9A 3KOOA 4PNZA 3WYDA 3QMMA 3STWA 3WJ1A 4DNQA 4BCBA 3IBTA 4WY5A 1LLFA 3G0GA 3WIBA 4AB1A 4ARBA 2B4KA 3H2JA 1NX9A 1LGYA 1M33A 2V96A 5AM5A 3WMRA 5LZ2A 3DKKA 1GQRA 2XMRA 2HU7A 1I6WA 4BATA 3FSGA 4X85A 4KAJA 3STXA 3TEJA 2PPLA 1UXOA 4HRYA 4AMZA 3RK4A 3QITA 3H2KA 1H22A 1WB5A 2XUAA 3ICVA 4H7HA 2GBGA 1XKTA 3JW8A 5ALTA 1GPKA 3VDXA 3GUUA 5ALYA 5C81A 2V98A 2HA6A 2OXEA 1FSSA 1HQDA 5JALA 4Y2RA 3ESAA 4MXDA 4F60A 4KE9A 1VLQA 4AZ0A 2QUBA 5IH7A 2Q0XA 5EGNA 2OCLA 3R3WA 4DNOA 1LPOA 2XUHA 4QLOA 3V1NA 5JASA 4GDMA 1EDBA 5K5EA 3A2LA 3D5EA 5A6VA 2QUAA 2VSQA 3FBWA 4MYSA 3GROA 5AH0A 1WCYA 1DWOA 5DYWA 3G9ZA 4G4GA 3G0BA 3FAKA 4Y9SA 1UOOA 4H7JA 3EF3A 4H7EA 3C6XA 4P9NA 2PSJA 3T4UA 4X92A 4LKOA 5HF5A 4Q3KA 3WJ2A 4UBIA 1AX9A 1LBSA 4X71A 3HJUA 4BCCA 2ROQA 2WG0A 1DQZA 1ZJ4A 2XQIA 5K3FB 2OQVA 1MU0A 2VATA 1JJBA 3ZLTA 4TPKA 3H04A 3I6MA 3AILA 3O4IA 2O7VA 4J7AA 3RARA 1KU0A 5AICA 2WJ6A 4F5ZA 2D5LA 5JZ9A 5CT5A 2QT9A 2JGFA 1XRPA 5AI6A 3WK9A 1LZLA 2LIPA 1H2WA 2I3ZA 5AP9A 3HABA 5HF8A 3I2HA 2P8SA 5BWBA 2ZYIA 4OUKX 3U1TA 4J3JA 5AKIA 2XQKA 4G4IA 4QDTA 2C0PA 1OCEA 1SCIA 5FXMA 1FJ2A 5D6OA 2OLEA 3ZLUA 1ZJ5A 3ESDA 4Q3LA 1HLGA 4BRSA 4PQEA 1A7UA 4UPDA 1ODSA 4AZ3A 3H0CA 1DX6A 1WB6A 2BUAA 2RHWA 2HA7A 2DQZA 3H1AA 5H3HA 3ILSA 3DKRA 4ZWNA 3BF7A 3UMJA 4LXGA 3DDUA 4XX1A 3PFCA 4RE6A 4QZVA 2XE4A 1CUBA 1PFQA 2DHDA 3H19A 2C7BA 1SC9A 4OB7A 4BYMA 3IUMA 3LLCA 2XMQA 1R1DA 3MVEA 4BAUA 1YS2X 4MEBA 3V1MA 3GELA 2OCKA 3Q8WA 4CCYA 3TRDA 3FYUA 1XRRA 4NMWA 4H0CA 5I7UA 5HQ3A 1Q0ZA 5AM2A 4EA6A 1QO7A 4WDQA 3WWDA 4YASA 1UKAA 1F0NA 3DNMA 3W9UA 2HA3A 4UFPA 3A70A 1HKHA 5DTJA 1IZ7A 3AIMA 5LIPA 4DMFA 4P93A 2R8BA 5LLSA 4HVTA 3WK4A 5DJ5A 4BVJA 4EUSA 3RM3A 4AMYA 1Q83A 3GZJA 4LYDA 2H7CA 4KR0A 4B81A 3K9BA 4PSDA 3RLIA 1U8EA 2QOEA 3WK7A 4FOLA 4B7ZA 5SYNA 1C4XA 5AIAA 4UBOA 5CRIA 4Y2UA 5ALPA 1L7RA 3DYVA 1BEZA 2OGSA 2CMFA 1YS1X 2HA2A 5T4FA 1ZGCA 2VTVA 2PKYX 1QFSA 2I78A 5ALMA 4H7KA 2WFLB 2RHTA 1QJ4A 1XZDA 1DWQA 3F97A 4UBJA 2XMDA 2O7RA 4E15A 1N8SA 4J0CA 1CUJA 3Q0TA 3K2IA 5DNVA 1JU4A 2CZQA 1U2EA 3N0TA 5C8VA 3W9BA 3DJYA 4DMCA 1GZ7A 2HU5A 3IVMA 1FFAA 3KD2A 3WWEA 5LZ8A 3M3DA 3WK6A 2VJDA 5AM4A 3I6ZA 3WA6A 2PU5A 3E4DA 4X6YA 3PE6A 3BXPA 4UHDA 1LNSA 1BE0A 3DCNA 1XZHA 4J0IA 1QONA 3W2TA 2E3JA 4IH9A 3BL8A 3IURA 1QTIA 3FCXA 2WLSA 4GLBA 1XZIA 4I19A 4DMHA 1NU6A 1SCKA 3V1LA 3KXPA 1VZ3A 1MN6A 3RKSA 4O08A 4UBNA 2RI6A 4OB8A 1YAHA 3H2HA 1QOZA 1EK2A 4JYPA 1Q84A 2WUFA 3O9MA 4BAGA 1W52X 2W22A 4GECA 3F98A 2VT7A 2D0DA 1MX5A 1MT3A 2ZJFA 1XZKA 3KWFA 2CB9A 1AC5A 1GKLA 3S8YA 3GFFA 4OU4A 4EHBA 4KAAA 4CIBA 1CUFA 5JYCA 2BKLA 5HF6A 4NZZA 4DNFA 1XZCA 4Y2TA 2JGKA 1EA5A 1CVLA 1LPSA 4E46A 3DQZA 2JEZA 5KBYA 1QIJA 4KE6A 1F6WA 3STVA 3QPDA 2EDAA 3CCCA 4FFVA 4KYVA 5ALEA 1W76A 3O4JA 2ZJ7A 3IDAA 4W63A 1R4ZA 3WK5A 1VOTA 2HDWA 4IHAA 5AI4A 1UWCA 4FTWA 4DTCA 2YH2A 5EHZA 4ZRDA 3C5VA 3D7RA 3PUIA 4X93A 3D2AA 5AI8A 5AKEA 1TCAA 3OG9A 1YA8A 1VJ5A 1ORWA 5BV7A 3AJAA 1XKLA 1XQYA 2WFZA 2XMGA 4X90A 4N8EA 2DHEA 3VXKA 3MUOA 5ALJA 3CXUA 3YASA 2HA0A 3HLKA 5AM0A 1WM1A 1CUIA 3C6YA 1YSCA 1XZLA 1WHSA 1JJIA 4B9AA 3OOSA 3O0DA 5EIEA 3G8YA 4J0JA 3C6BA 7YASA 1T2NA 3S2ZA 4BAZA 5BOVA 3D2CA 3VVLA 3FYTA 4K2AA 3I2GA 4QLAA 4LIPD 4C4YA 3G0IA 4WFKA 5K3EA 4UBMA 5CXUA 3F8SA 4QWMA 1A8UA 4BBZA 1ACJA 5JZBA 4UHEA 3A6ZA 5YASA 1XRLA 2BAGA 4Y7DA 3I1YA 5DLPA 2IX9A 5FPQA 3PF9A 1ZIXA 1B6GA 2XDWA 4B9EA 5A71A 4EB0A 1MNQA 1IUOA 5K3FA 3WI7A 4G5XA 4J0KA 4C4ZA 5ALLA 5I9IA 2HRQA 3HXKA 1EHYA 4AX4A 5AI9A 4OSEA 4A23A 4BP8A 2XQJA 3DYIA 4W1RA 5CH8A 4ARAA 3G7NA 2BGNA 4UUQA 5AOCA 1XQWA 5HK9A 4MEAA 1S8OA 3FWHA 1ISPA 2BGRA 4IQ4A 3EQ7A 2XMSA 1ZGBA 4X7BA 3IUQA 1A8SA 2XB6A 1O6GA 4ZGBA 1O6FA 5JAUA 3C8HA 4PO3X 2BUCA 1H2YA 2C5FA 3F9CA 3CCBA 2IITA 4EBBA 3DOIA 3R3YA 4X95A 4P08A 4AQDA 3IUNA 1SCQA 5AK6A 4AO8A 5JATA 5AOAA 4H18A 1MAHA 1EI9A 3SK0A 2B20A 1P0IA 2XUGA 3C6ZA 3M82A 3WWPA 1UFOA 4X3CA 5ALVA 2AJ8A 2GYVA 4WFIA 3HYSA 4MWTA 1GPLA 3PUHA 3G9UA 2WU4A 1LZKA 3ESBA 4TVKA 5AKHA 4DSZA 4BB0A 5LZ7A 1QIFA 1CUAA 1RYYA 4C6HA 1P0PA 1W75A 4IH1A 1AZWA 2J4CA 4CG2A 5CT9A 3O4HA 4UHBA 4BC1A 5FOQA 3FLAA 2X5XA 3HEAA 4ETWA 4HRXA 4FBLA 1YA4A 5AKYA 3BIXA 1BS9A 2PSHA 2WHQA 1H2XA 1TQHA 3AZOA 3D2BA 1OILA 1W4LA 4C87A 2UZ0A 4BDTA 1RP1A 4QA9A 4C88A 4WJLA 4ITVA 1HDEA 4A16A 4ZXFA 1VXRA 3FOBA 5AK3A 5DYTA 3BJMA 1UKCA 3BDIA 5FDFA 2WUEA 3EQ9A 3L1HA 1J06A 1FFDA 2ZYHA 4KE7A 3KDAA 4FLFA 4F21A 2RIPA 4BVLA 3HRHA 3IULA 5A7GA 3TJMA 1XLWA 3LIIA 2J3QA 1CUWA 4H7DA 3ANTA 1AMNA 3ESCA 3O95A 1K8QA 4X6UA 5AI5A 2Y6VA 2QJWA 2PX6A 2PSDA 4PV7A 5KREA 5HK8A 4RGYA 2G63A 2JF0A 3FNBA 1AQLA 2B61A 2CJPA 4UHHA 4B83A 2QRUA 5JIBA 5FUMA 3D59A 2H7YA 4QE3A 5HKBA 1YR2A 4J03A 1D07A 1ZD3A 5JANA 4I3FA 3NOXA 3FVTA 3DOHA 3G02A 2WIGA 5ALQA 3DEAA 3QPCA 5CT6A 2NW6A 5E4YA 4CG3A 5CH3A 4MYDA 4FLMA 3VJMA 3STTA 4INZA 4TGLA 1FFCA 3HC7A 3PDCA 2H7XA 3T52A 1BN6A 1DTEA 3G0DA 1UK6A 2OG1A 2JGJA 4UBLA 2WHPA 1EH5A 3FCYA 1CQZA 4FWBA 1ZD5A 4N5HX 1X2BA 3ANSA 5LP1A 5AK5A 2ZVDA 3VISA 1JFRA 5DNWA 2AJBA 2QJRA 1CUSA 3ZV7A 1CUVA 3C43A 3H1BA 4EZIA 2JIDA 4Z49A 4BE9A 4MQMA 1UOQA 3EQ8A 2FJ0A 3ZI7A 1CRLA 4K6GA 5F4ZA 1NU8A 1DT5A 2WILA 2VJBA 2OCIA 1LPPA 2GBFA 1QTRA 1XZFA 1ZI8A 3W04A 4ZI5A 1QZ3A 1USWA 2G5TA 3WL8A 3WZMA 4LYEA 2H9YA 1BROA 4GXNA 1GPNA 2J3DA 3I2JA 3WKAA 4EY4A 1EDEA 3H18A 4B80A 5AO9A 5CT8A 4U2DA 4OPMA 1G42A 3C87A 2XUDA 1WHTA 3DL4A 2XMZA 2ZYSA 5LZ9A 2Y1KA 4YK7A 2HU8A 2JGLA 4XJVA 1IMJA 4E11A 3H2IA 3VKFA 4FHZA 3L1IA 4X00A 1GKKA 2DCMA 1X70A 5ALKA 2CEKA 3B5EA 5AKJA 5ALIA 5ALWA 1ODTC 1IZ8A 1H23A 5ALUA 4J0GA 5HFAA 2Z3ZA 4H77A 5LZ5A 1MO2A 4B82A 2XUQA 3R0VA 1LPNA 3OTQA 4ZV7A 4JH0A 3QYJA 1VZ2A 1XZMA 2QVBA 1HPLA 3D0KA 2XLCA 3NGMA 4DM7A 4J0DA 5JZSA 2VQ6A 4CFSA 4CCWA 3E0XA 2QTBA 2QMQA 4UHFA 3FLBA 2WUDA 5JADA 1MX9A 1YB6A 4M0FA 2O2IA 1OXMA 1UKBA 5IVHA 4AXBA 1N1MA 2AJCA 4CCYB 5ISMA 4L9AA 3X3HA 5HQ3B 4DSAA 3DS8A 4Y2YA 4D9JA 4W9RA 2BFNA 1E3QA 2OQIA 4YPVA 4M0EA 3I2KA 4X6XA 1A88A 1R9NA 2JGMA 3WZLA 5ALHA 3A2NA 3IB3A 1G4HA 2WUGA 1QO9A 4AN1A 5HFNA 4KJXA 4BE4A 2C0QA 1WPRA 5A62A 2HIHA 4AO7A 2HFKA 2WFMA 4QDXA 4S0XA 4XVCA 1JT2A 2QS9A 1ZD4A 1QIIA 3OPMA 5AHXA 2DFPA 4U2EA 1P0MA 2FUKA 3EIOA 3I28A 1EB9A 4XIIA 2XMCA 1GQSA 3C70A 3O4GA 5CT4A 4XWGA 1ORVA 1VA4A 1SOMA 3WL5A 1A8QA 1XLVA 1ODCA 2I03A 2ACKA 4U2BA 4GBGA 2VAVA 4FBMA 1CLEA 2YXPX 4KRXA 1CQWA 4EY7A 1VXOA 1TIBA 5CURA 5KWIA 1VA5A 3DL7A 2XUJA 4FFWA 3QZUA 2HA5A 1R88A 4G9EA 4ROTA 1UOPA 3E3AA 2VEOA 4F0JA 5A2GA 5CW2A 3R3VA 2QKYA 2HRRA 5ALOA 2RAUA 3CN7A 1QIGA 2XT0A 3ICWA 1J2EA 3D4LA 5IKXA 5AKLA 4EY6A 3HZOA 4DMKA 3KWJA 4Q34A 4ZREA 1GGVA 2ZJ6A 2JBWA 4X91A 4NVRA 6YASA 5E2IA 4GWLA 2BCEA 3WQHA 2WSLA 2FJPA 4N8DA 1MNAA 2HA4A 3CN9A 4N5IX 4Q05A 1BEEA 3ED1A 4GI1A 4W1QA 2PUJA 4B0OA 1C7IA 1CIJA 5JAOA 4CG1A 4OCZA 2OAGA 3BE8A 2ECFA 3IA2A 1AUOA 3AFIA 1HL7A 2EDCA 5JD6A 2WJ3A 2XUIA 3V1KA 3ZPXA 1UT6A 1MX1A 4QEKA 4MJ3A 2XLBA 5EHQA 2X76A 1JMYA 2XQGA 4H7FA 2JEYA 5T4HA 3UUFA 1BCSA 2C58A 3AZQA 4HAIA 1KU6A 5C8XA 3AZPA 1Y37A 3WYNA 1IUPA 5LKAA 1AURA 1E89A 4K5QA 1KEZA 2PSFA 4KAFA 5EHNA 5K3DA 3I2IA 2XQFA 1LBTA 3ZWQA 4IO0A 4FNMA 4QDUA 3AIOA 3G9XA 1BU8A 3FVRA 2RONA 3NWOA 1XZJA 1U4NA 4U2CA 2H1IA 2J4FA 3WIOA 1CUEA 4FMPA 2GYWA 4DLNA 3STUA 1IVYA 3U0VA 4GW3A 4BTLA 3WA7A 3OM8A 5EIAA 5HF9A 1UZAA 4WY8A 4UHCA 1CR6A 1XRNA 5AKGA 4Y2XA 1TRHA 4I4CA 4H7IA 1LPBB 2JGIA 4MQLA 5HZGA 4KACA 1K5PA 1W1IA 1GT6A 2DHCA 1XRQA 3OC0A 3R3UA 2GBCA 5IVIA 5FRDA 1K4YA 1R50A 5ALXA 3HI4A 4YX9A 5HCUA 3E1GA 1E5TA 4JEIA 4KRYA 3WKDA 5ALRA 1TK3A 5D3ZA 4QNNA 4U2GA 1VE6A 1BCRA 3P2MA 5LKRA 1CEXA 5E4JA 5HKAA 1EDDA 1XRMA 5E4TA 4GEGA 5DNUA 2G4LA 1XROA 5CH5A 1CFJA 3WL7A 1K6EA 4BC0A 3C8DA 1QIHA 1CUGA 1QIKA 2WQZA 1UK8A 1C7JA 1YAJA 3QM1A 4C4XA 4LHEA 4EY5A 1K63A 4HXGA 2I3DA 4WDRA 5KWJA 1CUXA 4LXIA 1UK7A 5ALFA 2OGZA 5C7YA 1DT3A 2VF2A 3KSRA 3H17A 3AINA 1EX9A 1JMKC 3PF8A 1FFBA 1DQYA 1DX4A 1F8UA 1XFDA 1DU4A 3HSSA 3JYHA 2WFLA 4B84A 3BDVA 5FV4A 2QXTA 1DWPA 2PSEA 2ONCA 1E66A 2HADA 4B6GA 1EINA 3I2FA 4N8SA 3VJLA 1MPXA 3LCRA 1QFMA 4LXHA 2OAEA 1CUYA 5T4EA 1THGA 4MWSA 1E8NA 4HZGA 5T4BA 3K6KA 1QLWA 5FKJA 2XUKA 5ALNA 2C4HA 2XMBA 3WK8A 2O2HA 1CUHA 5DYYA 3ZLVA 4FDMA 3WLAA 1R9MA 2ZSIA 4L72A 4WCVA 4OYYA 3H2GA 1YASA 2DR0A 1CUUA 3I6YA 4G4JA 4X97A 4CI9A 5AM1A 2K2QB 1WPXA 3SC2A 5CTAA 1WB4A 2AJDA 2BJHA 5JD5A 2Z3WA 3PICA 3D3NA 3NUZA 3M81A 3W05A 5AIBA 3O9VA 2AXEA 5AOBA 4ZV9A 5I8PA 1GXSA 2DQYA 4G8CA 2ORYA 4X94A 4PF1A 1LPAB 2PUHA 1QIEA 3W06A 2GYUA 3LIPA 2WM2A 1QIDA 4JUIA 1F0PA 1EVQA 1ZD2P 3BWXA 4W1PA 5AI0A 5AKKA 3PI6A 3PFBA 4AO6A 5JARA 1G5FA 2X8BA 4UBKA 2GZSA 5D3KA 4PSUA 5J3JA 1X2EA 4Y2PA 4V2IA 1EB8A 3WWOA 4AN0A 2ES4A 4U2FA 5ESRA 4PSCA 3M83A 4OU5A 3QBJA 1XZBA 3WWCA 4BDSA 1CUCA 1EK1A 1WOMA 1CPYA 3F67A 4G1FA 3V48A 5ALSA 2R11A 1JU3A 1SFRA 2WIJA 4PW0A 2W6CX 1MJ5A 2RGUA 4Q1VA 2HL6A 2GBIA 3GBSA 3IUJA 2WHRA 3R3ZA 2BUBA 5IVDA
chains in the Genus database with same CATH superfamily
2HJRA 2PIAA 3M6FA 3KXDA 5BQOA 5CMLA 2QL9A 3TGPA 1E3MA 1SBCA 5TMBA 1T4DA 3ZHRA 1WLSA 3B5JA 1L7BA 4ND5A 1B0UA 3RIXA 1NMEA 2EG9A 3A2MA 3L5OA 1Q0SA 3AF0A 1G8FA 1RPNA 3GT3A 4UOZA 3F47A 5I45A 1Z2NX 4CEJB 2DT8A 3T7CA 2GCEA 1PNQA 4HFJA 4KEAA 4PYRA 5FP0A 2HO4A 4MV7A 3DWGA 5EFZA 1HE4A 2L17A 4RK6A 2B1RA 3OD5A 5ITVA 2EX1A 1YRHA 1WDMA 1VE5A 3HCNA 3DVAA 5ULLA 4L6CA 3ITEA 5F77A 2B5WA 4ESEA 3P20A 1NP7A 2ZTLA 3A3NA 3DEZA 4DEYA 4KPGA 3HLTA 2X0IA 3O31A 3N70A 1A2OA 5I47A 3BT7A 2WTBA 3IQIX 1ZM4A 4DYHA 2FHPA 4EZBA 3R40A 2ZXFA 3MRVA 1Z29A 4IGFA 4NZPA 3CNHA 2VF4X 1H2EA 5BQPA 1V4BA 2YJ5A 3SHVA 4AWBA 1XTQA 5LQCA 2ZS7A 2PG3A 3IT3A 3LPLA 1I3KA 2VZ0A 3CBGA 4CLHA 5JTTA 2JI7A 4L95C 4MIEA 4I8XA 2O2SA 4YRGA 3RSHA 1G4AE 1WV1A 1TCBA 1JI3A 1Y7HA 3NATA 1R16A 2FP3A 4IDAA 4R0VA 4YAKA 5FL7D 2JS7A 4Q82A 2WP8J 1EXMA 3U81A 1RLJA 4QWWA 1TVCA 4DDWA 4QXMA 2VJOA 2YHIB 3R7DA 3OURA 2GQ0A 1XNQB 3F49S 3HCFA 1TIPA 4NY1A 3OHSX 1JKMA 2FP4A 4PNPA 1DEKA 2YYZA 1PG2A 1QZXA 5K3CA 5CVCA 1D6MA 4R1SA 2IHNA 3GGDA 4Y6GB 3WOVA 5CBKA 3GJ7A 3RTBA 4AZTA 2P3LA 3BREA 4OI4A 5FPPA 4JP3A 2QG4A 3ED5A 2YMQA 4PX9A 4YRTA 3GLHB 3ONVA 3RIEA 3Q7IA 5JY1A 3TLKA 2ET6A 3OQNA 1JHAA 4KE8A 2BEJA 1SXIA 4NPHA 5EP3A 3U17A 2FWPA 3FLEA 1RHMA 1ATIA 3R0QA 3H5OA 4H59A 4NP6A 5D8DA 3QHAA 4RY0A 3NBUA 1XQVA 1DIOB 3VR1A 5CDSA 4CL2A 1TZCA 3O4RA 2PA3A 4GUAA 4HUTA 2OSBA 5CDYA 5D51S 3DLHA 3ABOB 4JLPA 4QOEA 1UH5A 1Z8NA 3AM4A 4I1VA 1TJ5A 3UW1A 5DXAA 3STYA 5THKA 2Z04A 2EKQA 3CEAA 4DLUA 4MW6A 4B17A 1F3OA 1T91A 1CNEA 1RI1A 1SHLA 3PQ4A 3OECA 2VAXA 1THTA 4M21A 1LS6A 2G36A 4ZAZA 3U5TA 1ZI6A 5EZQA 5B1HA 4O25A 2V9ZA 1ZOIA 3KDPA 4QNRA 1C9NA 2NUBA 1A8HA 1WXEA 1VE9A 1I0IA 2FG6C 3MWGA 2R4TA 5IKPA 3BRSA 5IEJA 3Q12A 3I58A 1JKFA 2JFWA 3SSNA 3UMGA 4DXAA 3R41A 5GGYA 3PYXA 2PUTA 1SRQA 2OO5A 4Z1MA 2QP4A 4WFJA 3QPAA 2BDTA 1J97A 1DBQA 1GUBA 1L7AA 1XYVA 3EA5A 3O84A 3PCTA 3ZE0B 4CNBA 5IVKA 2FUG1 2FH5B 5D01A 4E2ZA 3KEMA 1W5BA 5ELXA 4PCLA 1RJGA 1N5RA 3MQ2A 4JP5A 2AC2A 3S0JA 1XQXA 3RRZA 1BKSB 1JP7A 1F17A 2P5TB 5LJLA 4BIIA 4EYGA 2ODEA 5EPUA 3D81A 4UNRA 3M9WA 2M6LA 2CDNA 3QPUA 1QV7A 4GHWA 1A71A 1DB3A 3EWAA 2HGSA 3WKBA 1M34B 1XDUA 4YP1A 1Z0FA 2H85A 2LCQA 1BEUB 3GJQA 2HAEA 1PJCA 1EM8A 2RH8A 1L4GA 4M36A 3V8NA 1NC1A 2AR0A 4FDUA 3K9WA 3COSA 1YJXA 2G9NA 3WE7A 1U5CA 5JYEA 5KSYA 3DW1X 4HMOA 1T5SA 2F64A 4QU0A 3EBLA 4NOKA 4CMGA 4D25A 3G82C 3N05A 2PBLA 2QXYA 1SBYA 1VE7A 5KB3A 1HEIA 2YIVX 4M1WA 1BS2A 1L8XA 1V0JA 4QTTB 1U2DC 4EG7A 4HNVA 4MULA 3SWWA 3QVKA 4GDFA 5AJYA 4LWQA 5J47A 1CDOA 4DGQA 1PX0A 1F60A 4D9EA 1V95A 4Q1BA 3D3KA 3KKMA 4GIBA 4EMSA 1X8XA 5SYMA 4UD2A 2Z8ZA 3QMWA 3OCZA 4HN9A 1HDYA 5JSHA 4TQGA 2Y2UA 5E6RB 4RCVA 5KVQA 3NG1A 1DUVG 1KAGA 3CJRA 1RM0A 2PY6A 4P92A 3MWJA 4D9NA 4Z5XA 3UV6A 3PC7A 4OD0A 3U7JA 1QHHB 5IAAA 1FEZA 5K0BA 3ICPA 1EVKA 2ZIXB 4W7SA 5EESA 1QPZA 5IJZA 3JARB 2CHGA 5F2NA 2AOVA 4J7UA 1QRTA 1Q0RA 3CHYA 1KEUA 5BN5A 5JPDA 3U4AA 2HLHA 2WWFA 3IEUA 4RSHA 3V4LA 4CKBA 1DAGA 2IDJA 4MPRA 4K6HA 3LZDA 4Z9BA 1L4YA 4TLLB 3BHMA 5BT8A 4CKWB 4WNCA 4HLCA 1M9NA 2XUPA 3U1VA 5BWCA 3N2ZB 1FF9A 4WGFA 1I2MA 1FMTA 1D1QA 4ZCIA 1W36D 3UYLA 3OP1A 2NT4A 2CKMA 2PIDA 3WGLA 1Y6RA 2P9JA 4BMXA 4UTRA 1T8TA 1WHTB 5JAHA 3THWA 1HMYA 1H2AS 1VPVA 2C83A 2F2TA 3DD1A 3H9GA 3OICA 4NMXB 2CLCX 2ACEA 2BISA 2WIFA 2WTNA 4OIMA 4TSFA 5DWQA 5LYYA 5A9SB 1PU2A 1GAQA 1M1NA 4DM4A 4KBYA 1QGED 4QUDA 3SX4A 2VYND 1MR3F 3AUKA 1YIOA 5CLGA 1YB5A 3L40A 3RYHB 3RG2A 1DAEA 1CNMA 1XRSB 4BQPA 1U7WA 1WULS 1UK9A 2OE2A 1M6WA 3HKDA 4EG4A 2FSIA 3V34A 2H3EA 4A6XA 4BX0A 2ZXEA 3T7KA 3TXYA 4XPIA 1K9SA 3FWYA 4RPCA 1A77A 3COZA 1T1SA 2FK8A 5DI9A 2ZJ4A 3ILXA 4ALLA 3ICCA 3SCZA 5J4VA 5SZIA 3ZGXA 5JSZA 2H17A 2QXUA 3N0RA 2F67A 4WKGA 1MAAA 2QTRA 5EI5A 5BW4A 5FX2A 1Z0DA 1LU9A 1X14A 4MGKR 3HU3A 5DCUA 3KQHA 2PD4A 1AHNA 4IXWA 1AUVA 3GA7A 4V0QA 4ZD6A 1T3SA 4RK0A 4LWPA 4NS4A 4Y1GA 3E2PA 4F11A 2X1HA 1DJNA 1MC8A 2D2VA 1R8QA 2QN7A 3IQZA 5DTEA 4KKVA 2PGIA 4HN2A 4MROA 2XD4A 1MAWA 1D09A 1RRGA 4FNOA 4P3YA 3KQYA 3Q87B 5DNAA 1HNWB 3GD5A 4QDZA 1ZKDA 3ZDBA 2ZSHA 3E9MA 1JEDA 1ZJJA 2CJYA 3QJ5A 1L1RA 2YYSA 4KFRA 3I01M 3VR6H 5ICSA 2ZGVA 2BKUA 3T3HA 4RTOA 5G4KB 1ZNWA 4JX8A 4CM4B 5LL6P 1UMDB 1EP3B 1RHKA 3KQOA 5FUWA 5LYJB 1SC4A 4FR5A 1BU5A 2OPBA 1PGNA 1D5WA 3HCBA 1Y1QA 2A3RA 4ZAWA 2W4QA 3A1UA 4OOEA 1JDBB 4B44A 3DJFA 5EIHA 2IPNA 1QB8A 1ID1A 3KTAB 3LY7A 4KDCA 4CQLA 2H54A 2O2XA 1DV2A 1N2CB 3K0CA 3GCXA 4GYJA 4MUYA 4OXQA 4JYMA 5IN5A 1R3DA 3UMCA 4YAUA 4OB6A 4NNPA 4HPJB 1QE5A 3AHGA 3AR8A 3HJAA 4M86A 4CI0B 5A7FA 1KI6A 4RGVA 2EBFX 1FRZA 1ZM9A 1GILA 3OZUA 4LJ8A 2EIHA 1V26A 3LDFA 3VOBA 4A5SA 2QVGA 1IOLA 3D8BA 4GKAA 4UVIA 3FYHA 2P0AA 2Q28A 4PN7A 2HBYA 1CE8B 3CIOA 5ARDA 4O63O 2OQ2A 4WK0B 4P0QB 4YJ3F 1N92A 1Z4NA 4WIAA 3R8CA 2OXFA 3OQ1A 3Q9UA 5IWCA 1RYNA 3LKZA 4NABA 5LZ4A 5KAMA 2BF4A 3D5TA 1Q12A 2IYXA 3PJDA 2FR1A 3R3XA 1DJPA 1GPH1 3BIWA 2NU6B 4TL6A 2ZWVA 2JK0A 3ZWAA 1LB1B 3TSZA 1NHWA 4E03A 2GEBA 1J2RA 4I1SA 5C0OE 4GF5A 1GPMA 3A4VA 4YO7A 2ZJZA 4AM8A 1B93A 4RNCA 2WKWA 1OKKD 2YC4C 2VK2A 4E4YA 1O9HA 4IDDA 1NNEA 2PH5A 3JVUA 2E4YA 1ID8A 1MHTA 3FSGD 3V2HA 4OM7A 1II9A 2GXQA 4XD7A 4LXUA 2E2WA 4MQ4A 1CUZA 3HKBA 1WDLA 1JJFA 1IBMB 1AZTA 2JJMA 3OJXA 4G8DA 5TE9A 3R6LA 1SEPA 4Y1EA 1VJGA 4HS9A 4M9UA 5CLQA 4ZJUA 4PNZA 5JU6A 4CMHA 1E7WA 1IBCA 2Q41A 3WYDA 1L5VA 4L8FA 5H8WA 5KVCA 1U9IC 2IFTA 3GEPA 4DNQA 1TJ4A 1BMTA 5IDXA 3E9DA 4XUEA 3H5TA 1UBOS 2F8SA 2Q49A 2EQ5A 3ZGVA 5JE8A 3EZ7A 4RK5A 4E5PA 1E1CB 3G0GA 3OEHA 4AB1A 2Y0EA 5EP4A 3RYIB 4RTNA 1I5RA 2B4KA 5ITWA 5TGDA 4NPAA 1SXJC 2J5XA 3DBHA 3O8NA 1LGYA 3R9KA 3GJZA 3HRIA 3LZCA 1B26A 4JX9A 3DMDA 3WMRA 1PYDA 3DKKA 1GQRA 5F7OA 4D9IA 1JHUA 4UU8A 3TSCA 2QQFA 2HX1A 4FYVA 2P6NA 4BLPA 1T4GA 3CR3C 3LT0A 3S4YA 4NU8X 3WGOA 1VCHA 4PGMA 1OT3A 3C3CA 4RDIA 2GOYA 1K97A 1WSBA 4YFYA 1OXUA 4ENTA 4HJRA 2CXTA 2GWHA 1ICEA 3O03A 3RK4A 5JCOA 3JD3A 4PSKA 2P4UA 1P2FA 2OMEA 1MC5A 3K2EA 2ZVQX 3HUTA 4H15A 5FWAA 5AYVA 3VR5D 4MGHA 1SPBS 4WN3A 4TTVA 4ATNA 4EX7A 3FCEA 1J25A 5KIAA 3ICVA 3IGFA 2GBGA 4OREX 3FH0A 1QOQB 4NLLA 4P4UA 2PH1A 4PLHA 3U09A 1X94A 3F0TA 3WNBA 3GUUA 1VPWA 2AZTA 2C9MA 4E7PA 5C81A 4S05A 4N7MA 1RTTA 3M6WA 3O75A 4JC8A 3VSAA 5DK4A 4EW6A 4MW5A 2OXEA 4ADSG 3DP9A 3KNZA 2BVNA 2VJPA 4GPEA 5C52B 3EW7A 1XAHA 3NC0C 3SXPA 3NV7A 4KPYA 1A2KC 1N3YA 2SECE 2WYVA 4G85A 2J9XB 3LCJA 5DKFA 5L3QB 3VRHA 4I9HA 1R5JA 3OBBA 1A5BB 4F60A 2D7DA 2HXGA 3IVCA 1VLQA 1JEYA 2OZEA 5IXJA 2QV0A 8LDHA 2Q4RA 2BTQA 3K9QO 4R9VA 5IH7A 3KO8A 1CDZA 1KDRA 2Q0XA 2BBSA 2P77A 3F7TA 1KERA 1QGAA 2FFQA 4G9BA 2GKGA 4LY0A 5AVQA 5EYPA 2A2ZA 3HKCA 3KBBA 1LPOA 4DNOA 4CLRA 3ZHVA 4OLHA 3RS2A 2CYCA 2PRYA 3DXZA 4KUEA 4GP9A 3DLAA 4D4LA 1AVTA 2PZBA 5CB4F 4I66A 5EE5B 5DU2A 1ZISA 4EH1A 1AQUA 4MYTA 2Q7DA 4KR6A 4EGJA 4RXUA 4KODA 4FD2A 5I7FA 3EC2A 1LQUA 1Z82A 4BO3A 3AHCA 4X61A 4G07A 3FBWA 3MQ4A 2TSYB 5KJEA 4YUXA 5ECWA 5AVUA 1PDOA 1ZITA 1Z22A 4DIDA 4BOYA 4QDKA 4GOKA 4OUDA 3VC7A 5A4IS 4GKVA 1DWOA 2ZUDA 3K4HA 4OATA 2FOXA 1ZJWA 2FN9A 3G9ZA 4YP6A 1SC1A 3L8ZA 2GNOA 4GX2A 2EZ8A 4OKIA 3HL4A 4UDNA 3HB7A 3C3YA 3PDIB 1UOOA 1HLPA 1VP9A 1KL7A 1DTWB 4M8IA 4BQOA 4H7JA 4TXNA 3TE7A 5GVSA 1U0HC 4KQMA 2Z09A 2LKDA 3DVLA 2P5UA 3FIJA 4QUEA 4R83A 2WQ6A 4TN5A 3MJVA 1ZLXA 3WRYA 2P9CA 3ZS9A 1KBOA 4LKOA 5HF5A 4Q3KA 3VUFA 3ZNQA 1HSOA 4EJ0A 1AQJA 2QUHA 3OPYB 3EWIA 1YNOA 3AVPA 4AZSA 1MRSA 3IKVA 1A9SA 3QRWA 4Z7JA 1JDVA 2IHBA 4C0AC 2WG0A 1PJ2A 4E5VA 5K0TA 2FPKA 4QYTA 5K3FB 1VYVA 3HLYA 4GBJA 2HB6A 4YQZA 3AM1A 1CS0A 4HN4B 3U4QB 2W2LA 4TKMA 1MU0A 3V00A 4V24A 1NI5A 2PUCA 3L0CA 2VDKB 1XT6A 1SZJG 1SCJA 3QVXA 3BK2A 4G24A 3ZLTA 4BFCA 2ZK7A 2AQKA 4OFBA 3NEAA 4JEMA 2PXHA 3I42A 1JHYA 5ICCA 2I1LA 2YMMA 2ZDGA 1V8DA 1QVWA 1VGRA 4X1IA 1K8YB 1V8PA 5ENZA 4IFTA 3UM9A 4J7AA 4X41A 4F71A 4CXMA 1HM5A 2A14A 1KU0A 2BFOA 1V5EA 5BSGA 1EX7A 2D5LA 1GYRA 3GK3A 3T7SA 4D9BA 4ESOA 4RZXA 1P7CA 1P7VA 3N86A 1EJBA 5CT5A 3DE5X 1N5KA 2WJWA 3MIIA 4JLKA 2IHZA 4BLOA 5F23A 4WD3A 2V0NA 3NO4A 2H3HA 3WK9A 3KJEA 3W5VA 1FSPA 2A6PA 3GGCA 3D7MA 4O2BB 3FPLA 5JISA 1VL2A 3CGWA 3DDWA 2WP0A 4TT3D 3W7VA 1X1RA 1ESZA 2B2XA 5PGMA 2VDNB 5JS6A 4F93B 1B6RA 1P5ZB 3D4BA 4CKEA 4GAEA 1QU3A 2JD2A 2P0YA 3HDGA 1K0FA 5E3HA 1NBMD 5A3JA 5AKIA 3L0YA 4M1TA 1JH9A 3ESXA 4HDRA 3TNFA 4HH1A 3M3HA 5D6OA 3AVUA 4LY6A 3I0NA 3NAMA 1JR3D 1CF2O 5IDQA 5FO1A 3V32A 4J90A 5LVAA 1EP1B 1BWSA 1GAXA 3ZHZA 2W2TA 4C3ZA 4IMIB 4WERA 2NV2B 1BMDA 4PCAA 4WQMA 4MV4A 3S8MA 4F2PA 5C1OA 4BRSA 4XLZA 3QNUA 1KZGB 3WYGA 1CF9A 3UJ6A 1BDMA 1ODSA 1UBUS 1HZJA 2HNAA 2WA1A 4IIUA 2OFPA 4KXYA 4O4HF 3I0MA 3LQ2A 4PNHA 1WB6A 2UUCB 2BUAA 2DPLA 4QFMA 2E4UA 4XSVA 2WI8A 1X1EA 2DQZA 3H1AA 5LU9A 3SC3A 2XBMA 1SUBA 2K2WA 3L0OA 1PL8A 1E1DA 4X7MA 1UJBA 4BMOB 4K9RA 3PFCA 3CX4A 4LK2A 3BFXA 3G2KA 3E22A 5GAJA 4ER6A 1QDUA 1VHDA 1IPFA 2XE4A 4YRDA 4CEIB 4WEOA 1TJYA 1E1KA 5HS6A 2OCYC 5E38A 1WWKA 4GKBA 4NBVA 1U0LA 2DUJA 4LCJA 4RNDB 1T13A 1SC9A 4OSPA 1Q16A 2Z5LA 3M6LA 3NW9A 2FF7A 1GQFA 2YWRA 4O4LB 4BKOA 3THYA 1KKUA 2PGAA 1GIAA 4L3VA 1KO7A 4FGKA 4KDRA 4RPIA 3TNJA 4BYMA 2C78A 1G20E 4EQ6B 1OAAA 1A1VA 2XMQA 2QLFA 1TPYA 1AIPA 3HGTA 1YS2X 5A3SA 5C80A 2PUFA 3RVSA 3Q8WA 4IJMA 2VJMB 4KWEA 3HM9A 3RS9A 3L0BA 2Y1OA 4FFDA 3SN6A 2GLUA 4C07A 5LM3A 4NDNE 1XRRA 1TVKA 4D0GA 3FRJA 2NXNA 3DFUA 3EY9A 5AHRA 2ZEJA 3GARA 1ZUD1 3IOMA 2CLDX 1Q0ZA 4HKTA 5L6LB 5KNDA 4CQMB 3S8YA 1GM5A 1PNTA 4O29A 2G9ZA 1OROA 3PXEA 1A4IA 1AA6A 4QYIA 4MYCA 4KNYA 4DZRA 2I2BA 1S8AA 4YR7A 1IFXA 1XDSA 1CSEE 5KMGB 3R0IA 3DNMA 1G98A 3W8EA 1XMJA 5BN3A 5I9TA 3UH1A 1HE5A 1Z5UA 1E1RD 4RULA 4UFPA 3A70A 2EP5A 4P4SB 4A2WA 3LY5A 4AX8A 1MLDA 3QA9A 2QBYB 1IZ7A 3IJRA 4LOJA 5LIPA 5CFNA 2KMLA 2XE6A 1XE3A 3IMKA 4DMFA 5D00A 2C97A 4LQDA 4QJBA 1PF7E 3Q0EA 1CDDA 1RW4A 3SJCA 1ADYA 4J4TA 1ZHOA 1O5OA 1UZLA 2FRVA 5DJ5A 2XDQA 4GL4A 4A1FA 5JVDB 1KWKA 1IY9A 4K9KA 2XGGA 3CH5A 4LYDA 1D0IA 1DZIA 1HV8A 4ONEA 5F64A 1KJJA 2C94A 3WYEA 4PX3A 4NEHB 3JATA 2GX6A 1NKVA 2H7CA 5KNCD 3TBKA 2BFCB 4DC1A 3GJRA 3K9BA 2TRSB 4JJIA 1V8ZA 2JIPA 3FOFC 4CHGA 2CVZA 3MTQA 4YJ3A 5SYNA 1SOVA 4HCJA 1V7QA 4JSYA 2NVBA 2FWBA 4YJDA 2WJHA 3T3IA 3NFRA 3DMNA 3EOAI 2B1IA 4R1UA 2ZBRA 1BQ4A 5CRIA 5ALPA 4MZDA 5HW0A 1L7RA 4CR6A 3KB6A 3A04A 1URPA 3QW2A 4FQ5A 1E79D 4I50B 3ICQB 1SG9A 1PR5A 2YV4A 2HJ9A 4YHHB 4L9SA 4LVOA 2OYCA 3FSRA 2TMGA 3UBMA 1PK9A 1YFZA 1YS1X 1ZXLA 2Y1WA 4RCYA 4B3RB 3KETA 2AMJA 4JA0A 4IOJA 3Q8KA 3CT6A 3TQTA 2PKYX 2ZSFA 1QFSA 4RS4A 1ZH8A 2XITA 1MW8X 4GMXA 4Q6BA 3PI7A 1S9DA 2IVZA 1JQBA 3B1JA 2JIOA 5FLXA 2CMKA 1XZDA 3DT8A 1J0EA 1DWQA 2A0UA 2X2EA 1WVIA 4HO1X 4KO2S 4OYRA 4TTIA 3BGIA 4UEKA 1BXGA 1NE2A 4M98A 4HUQB 3AVQA 4ZYUA 1N8SA 2EP7A 2YXEA 4P5PA 3RYTC 3CNEA 2WHXA 4JJFA 4MV9A 1OOEA 4BEBA 3TG2A 3K2IA 3H9CA 4LMRA 3WLNA 4E08A 2IY9A 1FLAA 4UM7A 2E37A 4YH1A 2QZ4A 2QLMA 3V4PB 3WNDA 1GA4A 1GZVA 2XXAB 4G1BA 1JU4A 4JP1A 4D6YA 4D96A 1RTKA 1JIVA 2F1OA 4C06A 2BF7A 3C6MA 3IDQA 3IJPA 2CLHB 1E0DA 2IYPA 3PQDA 4FFOA 2DBRA 5EXDA 3TNYA 1SQGA 2HU5A 4D8VA 1E3LA 3PVZA 3IVMA 1FFXA 3WAGA 4JAVC 4ENVA 4YRSA 5INTA 4AWAA 1EFLA 1U5BA 3CH6A 2VDVE 3G3EA 3HU2A 4C4AA 2Q9CA 1KVSA 1CKEA 1SELA 2PU5A 4OJTA 2Z1MA 1ZLYA 4TVOA 4X6YA 5HUHA 1O0BA 1ZGAA 3BXPA 2VYVA 4AIRA 5A5VA 3KAKA 1FP4B 2YHSA 2CC2A 4DLWA 2PX2A 4H16A 1YJCA 3ENZA 1SUDA 1SUAA 3R5FA 1FTGA 2P2GA 2E3JA 4P32A 5CFPA 1FLDA 1ZVJA 4F8YA 2ABWA 1XVLA 3DDHA 5CB0A 4IH9A 1PSZA 1OPXA 2ZPAA 2BGUA 2RK6A 3ZG6A 2FN8A 5K8JB 2QVXX 3GLIB 1VIAA 1DKMA 3BQ9A 4DR2B 3L7DA 5E8RA 3WC4A 5C7LO 1D5CA 3UUWA 3O3NB 4E4TA 4GLBA 3WLMA 1XZIA 4X9XA 4I19A 1JHDA 2O20A 3LK7A 2W4MA 4GE3A 4IQGA 3JQ7A 1D4ZA 1SCKA 5ADVA 2PKQP 1VZ3A 1MN6A 3E9EA 4HDSB 1MBZA 4ND3A 5FNZA 3VH3A 3TTXA 2HZBA 2H1CA 3SHQA 2BL4A 2PGOA 3KKZA 4YFVA 1USIA 1VHWA 2H9IA 2RI6A 5MDHA 3RAFC 2VRCA 1R0XA 3QX9A 1NVDA 1ULHA 1OA0A 2F9LA 3MW8A 3QPVA 4PAGA 5JDIC 3OZRA 3DHNA 2NMVA 1Q84A 4F45A 3WAJA 1WX1A 2C5SA 2V8OA 1NR1A 3GA0A 1PL6A 3B1KA 1JLHA 3N5KA 3RR2A 4C7OB 4ARVA 2RI1A 3PNVA 4ODIA 3SFZA 3D8UA 1PK8A 2AX4A 4HEQA 4C0SA 5K8TA 3WLLA 1ISJA 3GDFA 2DKFA 3EVCA 1WQ3A 4B2IA 3AR9A 2ATEA 2JCGA 5LMUB 1DLIA 5CBPB 1M6VA 4INJA 2X0EA 2Q5HA 5CB4A 3DPUA 1X7ZA 3IP9A 3QUQA 4D41A 5AVZA 1XZKA 3K09C 5FUXA 5GINE 2E4XA 5TEWA 1SNYA 3ND6A 4NBUA 1Y89A 4JI8B 2VZLA 4MEJA 3AU9A 4HT3B 3PFGA 4D0NA 2O3UA 1S6YA 3P8ZA 2PXAA 2O8CA 1ZGJA 4UMFA 3C4JA 1Q7EA 1GKLA 3EVDA 3FJ1A 4YCNA 3ZVNA 2GZ1A 3RRYA 1TQ2A 1RLUA 1WD7A 4WRRA 4YT2A 3CISA 3KQUA 4KAAA 3E9NA 3ZDXB 1CZLA 1L4KA 3IAS6 2J6BA 3CPEA 3S1AA 1KJWA 4IOLA 5JYCA 3UEOA 1W1UA 3IUEA 4L02A 5JS7A 4AURA 5JS2A 1WUKS 4E5SA 3FPAA 2X4GA 1SZCA 3HBFA 4CWAA 4E2XA 2JASA 1KJ9A 4DNFA 1YTUA 4Y2TA 2AUNA 4FUQA 4X3PA 3MYRA 3GFPA 3MXTA 1DFIA 2HZ7A 2QN9A 2X8JB 5TMEA 2PJUA 3D0QA 3KFLA 4Y9RA 3ZC3A 4E46A 1E2QA 4ED9A 3DQZA 2JEZA 4P7BA 1I4LD 1L4HA 1TM7E 2QM8A 1RJWA 2Q8QA 5KBYA 2OSVA 2BN4A 3F7NA 4R1NA 4XQ9A 5L40A 2BE7A 2PMWB 4KE6A 4X1KA 3QLTA 4G2TA 1NW7A 4XUGB 1F6WA 1M54A 4RL6A 1GSOA 2OCXA 3A4LA 3E15A 3PFIA 3STVA 2XGMA 4C20A 4DF3A 1QFZA 5D1NA 1GO2A 1RMYA 4GSLA 1PFWA 2ZSKA 3MJCA 1OLSB 2JCVA 2FPIA 3FYCA 1E7RA 2Z5VA 1KDZA 3LM8A 2VYQA 5ALEA 4UNIA 2PS0A 4FFNA 5BSEA 1WSWA 4W9NC 3RJ5A 1MD9A 1U0BB 1R4ZA 4ZAFA 4M83A 2GDJA 3AF1A 4ID3A 4LE2A 2YN0A 1PT8A 1J22A 2HO5A 4GU5A 3E3MA 1EFVB 3PD1A 4R9NA 2YH2A 3VYRB 4Q6WA 5FPHA 3C5VA 3PUIA 4TXLA 4X93A 4YCDA 3EUAA 4CEHB 2VPIA 3FHTA 3M4ZA 1POXA 4RH1A 5F9HA 3K70C 5AKEA 2PK3A 1TCAA 1XZ8A 3HDHA 3AF6A 2JFHA 3RV4A 3QTTA 5BSKA 4D8TA 5IT9A 4XD2A 4KPEC 2XMGA 2WFZA 1MDFA 3AK4A 2IXAA 5IKMA 1DGQA 2M9MA 2RD2A 3NIBA 4QBHA 1H69A 2PV7A 2ODNA 4JT4A 3ZLBA 5HR5A 1R0SA 5FIUA 4Y30A 2I6GA 1YDEA 2J9RA 2J0QA 1XI2A 3ENKA 4Z53A 3O94A 5LA6F 2UKDA 3YASA 5ER6A 1QGZA 1IJFA 1Z7BA 2ZPUA 2IU3A 3HLKA 1I9GA 2ILVA 2PYZA 2QAGB 4NTZA 1NVWQ 1N6IA 2ZSDA 4O4HA 3ESZA 4PG6A 3L18A 3KYCB 5IDVA 4ENUA 5BW8A 3E27A 1Z0IA 3PE3A 1L4MA 2GRUA 2ECKA 1F7UA 5FO0A 1IDOA 1Y8QB 2PO5A 2VNHA 3A25A 4LNAA 4PHGA 5E3IA 2NVUB 3RFTA 2QUJA 4E5KA 1TFUA 4DR1B 3FUTA 4ENPA 5JMPA 1GN8A 4C6RA 1DKLA 3SZ3A 1R6UA 4XR9A 2V65A 1XKQA 2I76A 4G8JA 4CBVA 4ZYYA 5ADWA 1NDQA 2IZ6A 3M5CA 1MB9A 4WLOA 5GQSA 3TOCA 1S96A 2F00A 3A2KA 5BOVA 5C18A 2IUSA 5IT0A 4KREA 3TLZA 1Z36A 4WESA 2IW1A 3FPCA 1PFYA 4NMLA 1LRJA 4K2AA 4BV2A 4FT2A 4A7PA 1W88A 5AJWA 1BDHA 4LIPD 2Q45A 2VNAA 4TLCA 1KDVA 1Z37A 4C4YA 3KP1A 4DDVA 1YU9A 2X9NA 2QR2A 4RMJA 3GJ0A 3HBMA 1XV5A 4ZZ0A 2HGZA 1HQYE 3NIWA 5TB5A 1Z18A 4UBMA 4UM5A 3SKYA 1NFRA 4KK4A 2X0KA 3AOEC 3AKZA 1RWVA 2XZLA 3GAFA 4PRLA 2F43B 4PCUA 1U7UA 2XDAA 3BRWA 3DO8A 2Y76A 4KTVE 2Q0HA 3SJAA 2ZRHA 3K16A 4DDHA 1ACJA 2C82A 3VDNB 5JZBA 1R7RA 3QLVA 4TS3A 2IUTA 1EP2B 2PZAA 3A6ZA 2C4MA 3CEHA 5TGZA 4DIEA 1VJRA 5J4LA 1QFYA 3G89A 1EGHA 1VLMA 3I1YA 3OT5A 5DLDA 5DLPA 2IX9A 3QVTA 3PD7A 4MR7A 3TMAA 1KS2A 3SJBA 1PRYA 1B6GA 4UXJA 2LIVA 3LY9A 4D26A 2GHTA 5LB4A 5DX8A 2ZIUB 4JVNA 1BFDA 5A71A 4KOAA 3COJA 1UDAA 3GHHA 1W4ZA 4WXYB 4PHTA 1C30B 4AJPA 3JQPA 1PJRA 3S81A 3RIMA 5CM8B 2MJLA 1MNQA 1K86A 1X7XB 2CLSA 2FQXA 3OJFA 2WMOB 3ROKA 3CO0S 4DQ0A 3G5UA 4AJEA 1YE8A 3DL2A 3LBYA 2BEWA 2AN1A 5KYWB 4HB2A 1ENYA 1ZMXA 3WI7A 4G5XA 3MPOA 1S1MA 5IRCD 4WKNA 4C4ZA 4IR7A 4NI5A 3ADDA 4RHTA 3SE7A 5I9IA 2UXDB 3HSKA 1SBHA 1N2ZA 2FSVA 3UXYA 3HXKA 3DEIA 1JVBA 2R8ZA 3BMNB 3GJ5A 1ZW6A 5BPFA 2D0OB 1O89A 4OSEA 4TV8F 5TJ9A 4FCWA 3C3WA 5BSFA 4ZQEA 3R74A 4N5NA 2ISCA 4J6EA 2OCPA 4UCFA 2CL5A 1QHFA 3ECAA 1F38A 3F5MA 4RF2A 4F56A 5EIFA 4OXXA 4EAAA 4HGRA 1MH1A 1M1YA 2VXOA 2Y71A 3N2LA 4Y9UA 3IEMA 4DR4B 3HE3A 2I33A 5ICFA 1FIUA 2JRLA 1GUAA 1CR1A 3L1KA 5ABPA 1XDBA 1I6KA 5DBEX 4MVJP 5HDQA 3BH0A 5EINA 3D6FA 5DNDA 1RE1A 3ZH9B 4JMLA 1K8XB 5E0KB 3RS8A 3O2JA 2IE8A 4FDLA 1HORA 5J2UB 2BGKA 1SCDA 5CYOA 4HMPA 3Q2KA 3B3JA 5BOSB 4B7XA 2YDYA 5CGZA 1TA4A 3JQBC 3KOUA 4M2LA 2O8BA 4X7BA 2AG8A 2BTEA 2HJVA 2JCYA 3CUEF 1I2CA 4LJSA 2VP5A 3TD9A 2RAPA 2PL3A 1O6GA 2AR9A 1ZBQA 4IZOA 3FGOA 1DWUA 3DCIA 4HX2A 1UCFA 4KWCA 4RIHA 4TL7A 3TTYA 3JQ6A 1NYRA 1ZYUA 5JYBA 5E6SB 1H9AA 3A9RA 1N2IA 2IEAA 3EMKA 1BOFA 2RHRA 3CCBA 4TZ6A 3AB8A 1GSHA 2ZRQA 3DBLB 3CTPA 4IXDA 4WK6A 4LWOA 3DOIA 1XDDA 3QXJA 2FZKA 1N2GA 4JK3A 4X95A 5TPZA 3L6UA 4BV9A 1FOEB 3JVVA 3O8QA 3AJDA 4TZTA 4JR1A 3U9TA 1J39A 2BFDA 3MOSA 4HDMA 4E2WA 5JATA 2IHVA 4H18A 1TU3A 3EEIA 4FPXA 1MAHA 4G4SO 2MR6A 3AX6A 2QYOA 4IYJA 1JQLB 3FPFA 3M82A 4KBGA 2CJWB 4U0JA 3UFBA 1D2RA 1VM6A 2VNJA 4LCEA 3IDZA 5JJIA 2MMGA 3G23A 3OPXA 2AZDA 3BB3A 4MPPA 1C9KA 3OX2A 2GYVA 3CRW1 3DE1X 1O9BA 1SBTA 1FLNA 1MRZA 2YHBA 2R5WA 1IZ0A 3FJOA 4TKVB 2C3UA 5DF1A 2JHGA 5DOVA 1MP0A 2BGTA 2FPXA 1YBMA 4YHBA 5K51A 3OLVA 3VAZA 4UKDA 1W2WB 1KXJA 1LZKA 2IHUA 2WKSA 2WU4A 1FTNA 4MWZA 1W85A 3PEFA 1V1RB 4Z0PA 4NARA 4KRFA 4KCGA 4K1LA 3ZI0A 2X40A 4WFQA 3LRPA 2O06A 1LRKA 4AF6A 3X1ZA 5BW6B 2BHLA 1F2TB 1U9ZA 2IYQA 3Q3EA 3BUSA 3R9XA 5KNBD 3MRXA 2Q1YA 2Q5IA 2X3FA 2QRGA 3L4JA 1NW4A 2X15A 1R8YA 3RCBA 1U3GA 1QIFA 5JR3A 3L79A 2N42A 1CUAA 3BE4A 3FPJA 4QPCA 5JD3A 1G8GA 2AVDA 4I36A 2YRFA 1RYYA 1N2EA 4OGLA 4OKSA 1KI9A 3W8FA 1W75A 3CUUA 3HVIA 1UKVY 5C31A 4NHOA 2FZWA 4QPNA 1Y34E 4RK1A 2V74B 5LBUA 2HBRA 2E5LB 1AKUA 5L53A 1O58A 1XA4A 2J4CA 1RYMA 4J29A 2MSLA 4P4TA 4RZIA 4ALJA 4IJQA 4MVJI 5CT9A 3O4HA 3U56A 5TS3A 4DY4A 1HE2A 1JI0A 2QSUA 4NMMA 1LH0A 1TYBE 4B3JA 5FOQA 1D8TA 4FSDA 2DWUA 4ZHSA 1RZRD 4FCVA 4C22A 2L69A 4ETWA 1AGNA 4HRXA 5IC6A 4YYEA 2KI5A 4PZAA 1NMSA 4QXOA 3DNFA 2IXTA 3GCZA 3Q3JB 4IGEA 1G8HA 3UK6A 2V6FA 1BS9A 3A31A 1DHTA 4PAQA 1C29B 1LJUA 1LBQA 2FEAA 1LW6E 5EEGA 3JSAA 3WDMA 1QP8A 3GRFA 5BQ5A 4C2AA 4B4VA 1R4AA 3MGGA 1Y1PA 1TQHA 2AMFA 4OXIA 4IWNA 1PJ4A 3G0OA 1S3SA 5DI3A 421PA 1LQTA 1BO6A 2JFPA 2QY9A 2QD5A 4PTLA 1BKYA 4JI2B 3I73A 1BHQ1 1TJNA 4GXTA 2EYUA 4TYMA 1IXRC 1ZUWA 3QF7A 8AT1A 4ER5A 1ULZA 1CY0A 3A6DA 3BXEA 3A6FA 1XNRB 3IPXA 2UZ0A 4WI1A 3T7JA 4BDTA 3FUUA 3BOSA 1CIVA 4NFLA 1RP1A 2PVPA 2W4IA 4QA9A 1BH2A 1E2MA 5CNJA 3LQYA 4XOUA 2YXDA 1PG0A 3FFTA 5EY5B 4CDMA 3MWEA 4HEA6 1CHNA 1U7ZA 3KPUA 1QAOA 1QQ6A 4WJLA 4PLCA 3RC2A 4PS0A 2G0NA 4FDAA 3SBEA 2PJDA 2X2OA 3RRFA 4J75A 3L9WA 4OLBA 2ZI5A 2ZIVB 5F9MA 2FN7A 2IPAB 1HQKA 2WJVA 5K0EA 1ZIOA 1Y63A 3S8EA 1T26A 1FL9A 4JCOA 3A1TA 4L4UA 4TRMA 2RHDA 4JELA 1KVQA 2HQSA 1QH9A 1KVRA 3LD9A 1K6XA 1DG9A 4UE3S 1KJNA 5FDFA 3BFPA 3CBQA 1IWPB 2JKVA 5AQ1A 4BU1A 3LHDA 2H2DA 3EPRA 1DC4A 1J06A 5FOTA 5DHQA 4FYHA 4C0XA 4PQYA 3LPNA 1Y98A 3ELBA 4KE7A 2BZ1A 1BGXT 3NIFB 3KDAA 4ZI7F 4QYWA 2Q1WA 1PQPA 1FPQA 1Q3KA 3DOOA 2JFYA 3AY0A 1S2IA 1EJ6A 3RJMA 1DLJA 4LSMA 2BHNA 4IIJB 4WPGA 2EKBA 4M1QA 2J3QA 5IAGA 1ZVKA 5SYAA 3UCXA 1DO2A 4RIFA 1RM3A 3IHWA 2RI0A 2JRCA 3FPHA 4ZVLA 2IWRA 3R7WB 3SOZA 4AWXA 1BE8A 1LFDB 2CHUA 3RF7A 3M70A 5ES3A 2FW1A 3ESCA 3IP5A 4KPUB 4X6UA 5IUKC 3LFTA 3L7NA 4O02B 2QJWA 2PX6A 3Q72A 4PV7A 3RTCA 3RVDA 3QFTA 3W90A 5IJWA 5JSUA 3CLHA 3OE7D 3E58A 4S35A 4RGYA 1OAOA 2IPXA 2Z1NA 4XASA 5DYNA 1OIVA 2D59A 3RE1A 5C9ZA 5KWSA 1KIFA 2FPGA 2I7XA 3GGPA 1NNLA 3GYBA 3H5RA 1OVMA 1SVNA 2QMUA 3ISVA 4FN4A 4CL0A 3Q6MA 1RBMA 5LA6A 2CW5A 1QHNA 4KN6A 4KQXA 2ZRFA 3ND9A 3R5KA 3FNBA 3G2OA 1AQLA 3LI2A 4FEEA 4HYEA 5EE9A 1J00A 4BO9A 2B61A 4BQFA 2HCTA 2QRVA 1WCWA 2FXVA 4QJ4A 3PIIA 4UHHA 4BHTA 1ISSA 2H7YA 1OBFO 4QE3A 1KQNA 1Z2PX 4DQXA 2QL5A 1VHTA 3VNRA 3OMLA 3QA3E 4KR2A 1ZD3A 1UEIA 4DCCA 3NH6A 4JJKA 1ISIA 3ZIAD 4MUEA 4QBFA 1Z4KA 3DOHA 2WWVD 1YJ5A 1YI0A 2OHHA 2OV8A 4EA8A 2H31A 4Y1RA 1DJMA 2BI7A 1ODFA 1DX9A 3DEAA 1EVIA 3NBAA 2O1EA 1H6CA 1D4AA 4BNIA 3IT1A 1C9JA 1T0UA 2C8JA 3ETEA 3GUCA 4GWKA 4JKOA 4RSGA 5CH3A 3P4UA 1E2EA 4MA4A 3V55A 4EA7A 1SC6A 4I6EA 5C1DA 4NU5A 4OSOA 2E4VA 1ZNXA 2JAQA 3L3BA 1M8GA 1XNGA 5H1YA 3V1YA 4NONA 4ZO7A 4EHDA 3ZV6A 4JWKA 4F91B 1T36A 5C7IO 1IE3A 2KPOA 1XVVA 5JROA 5L51A 2BCJQ 1KFBB 2CXHA 4U3JA 4YT8A 1GL3A 1UK6A 1FY2A 2CE2X 3SX0A 1YZLA 2XTMA 2LP4Y 3KJGA 4PWYA 1HK7A 4UBLA 1E3JA 1QYWA 4JI0B 3FCYA 1CQZA 4FWBA 1ZD5A 3PWKA 2YVKA 4RIGA 1R9JA 1YWGO 4PYKA 2VHQA 3ASUA 3ANSA 2ZSEA 4WH0A 1CY7A 3RC1A 2HIGA 3ND7A 4DCMA 2OZLB 3VISA 1RXIA 3E5MA 4ZO4A 5DNWA 4UVHA 3M1IA 3TOXA 2RARA 1CUSA 3FPEA 3ZJ5A 5ERXA 3UT0A 4L9WA 1GNRA 3C43A 3I92A 4AFNA 5EHIA 4KHZA 3T38A 2W2PA 1KY5A 1O54A 4MKIA 5M3BA 3OLYA 4LMPA 2C7OA 4G1UC 1VLVA 4BE9A 1CYDA 1UXKA 3VPXA 1UOQA 3K0CC 4MRPA 1P0CA 4K6GA 5F4ZA 2C2OA 3GFSA 1NU8A 1O8BA 3DSRA 5B3JC 2ZRPA 4UVDA 2VUIB 1W96A 1OFIA 1SQ0A 2QA5A 2XE8A 4PZCA 4TN1A 3FCOA 2GBFA 4YN3A 5DTQA 2PKEA 3W7AA 3WMEA 4F4IA 1XZFA 3MJHA 1ZI8A 1HE8B 4MLPA 3N5CA 1QZ3A 3NTRA 4GPD1 1MIHA 5BXYA 1O87A 2G5TA 3B78A 5E7MA 1N5OX 2SICE 1RXEA 1JMVA 1VBFA 4TV8A 2GERA 2OEPA 1BROA 1OJ7A 5K0CA 4OHCA 3CLUD 1F8XA 3M6AA 1QC5B 1P9LA 2XAUA 4YRCA 3RUEA 4DG8A 4XFKA 4US2R 4WAUA 4QHYA 1NPTO 4WN9A 4YBRA 3H18A 1J09A 3DA8A 3R9IA 2XZTA 5EAIA 5U9CA 5LBIA 2LXNA 4MUFA 5CT8A 3M49A 4YRLA 4YJHB 1KBQA 3PNBA 1M73E 3CV3A 6GPBA 4PPNA 3SXUA 3T8YA 2FQYA 3FFBA 5G0WA 3X0DA 3CEMA 1P5JA 3K0BA 4CM5A 3DL4A 1MB4A 4EVRA 5EKDA 3TB6A 6ABPA 4LBVA 3JYNA 5LZ9A 5ELMA 2GWRA 4LWZA 5KU7A 4FEYA 2OB1A 4R05A 4NAHA 5DYGA 4Q1CA 2F4NA 1F4LA 1RWBA 3DHVA 3EXEA 4WOCA 4G67A 3T1NA 2WIBA 3FN4A 1OXBB 1F2UB 4JMPA 4MRAA 4BVFA 5K6AC 5KJCA 4Y7CA 2JGLA 2RCNA 4XJVA 1RNLA 1EUYA 3OAAD 1FU4A 2VP3A 3RTGA 2UYOA 5BVGA 3ZCQA 5CK4A 1KJYA 1PLJA 3L1IA 3WIEA 4QATA 2G70A 1GKKA 1A8IA 2DCMA 4FQ7A 4QU9A 3R5HA 4UUMA 5FEMA 1N8TA 4YREA 5ALIA 3SIPA 4I9FA 5HIAA 3H9UA 4LNUA 3AY7A 2P9BA 3B9PA 4DHWA 1J56A 1V5IA 2VKTA 4P1ZA 1N5IA 4WE3A 2W71A 1QCDA 5ALUA 3WIUA 4B1FA 5KTRA 4EDHA 1VTKA 1RKVA 2UYYA 3SGLA 3SC2B 5JSKA 4Q19A 3HQ4O 3GT4A 2QWXA 2ZATA 2FLVA 4EB6A 1ESCA 2F1HA 5KJFA 3C3DA 3R0XA 4AN4A 4P3NA 3VHXA 1H66A 3DEJA 1ULTA 3GDHA 3EG9B 3VSDA 4AZ3B 2VTBA 1JSZA 3IOEA 5JPCA 1YB4A 4ZALA 5L9AA 3KKEA 1H1LB 3CNNA 3FPKA 7REQA 4B87A 5GVRA 2PTHA 2QHXA 4D81A 1TU4A 5JLJA 2IH2A 1P45A 1XEWX 1AZSC 1SXGA 2QVBA 4UUBA 1L5HB 1Y3HA 5ITZB 4F2DA 3NYIA 1XYGA 3PLRA 2GRJA 2W93A 1MEEA 2VHZA 2NUPA 4CLEA 1FU8A 3Q88A 3ONEA 4NK5A 3RKRA 1C1DA 1D2GA 2NYAA 3DZHA 4C5AA 5JECA 1U7PA 4J0DA 2G6TA 1F3LA 3IP8A 5THXA 1NI4B 3EWSA 4CCWA 2FN4A 3P9SA 5JJKA 4RAOA 2QTBA 3OZIA 3AHEA 4EG0A 2Q4TA 4W5TA 4UHFA 4PC1A 2VF8A 2RAFA 1WNFA 2C42A 3G85A 4QRDA 1L5MA 4P4NA 3ZTWA 3D8RA 3HPRA 1G6KA 4JJ8A 3Q1LA 1IATA 4IDCA 2VT2A 3TQHA 1PQYA 5IUNC 4DV7B 3A6LA 4FKMA 4X84A 4QELA 4CCYB 1BX1A 4PZLA 4KAXA 1R0RE 1TF2A 1WO8A 1U2RA 3DM5A 3PYLA 4HFRA 1HT2E 3FMPB 3X3HA 4AJ4A 5IDYA 3GRKA 3S99A 5HQ3B 3UG7A 2IL1A 1ONSA 4L2IB 1NBME 4N48A 4H3HB 2H16A 4DEXA 3B6EA 4MX8A 1X1DA 4UAUA 3ZE8A 3QE9Y 3DS8A 2P2DA 1YT5A 1JR3E 1OYOA 3L8FA 3Q5EA 3RRMA 4TTAA 1QH8A 4WZAA 3W5IA 4C4TA 3JV7A 1GNTA 3EDOA 2IX3A 2O1SA 2V7XA 4LUCA 1YKFA 3F6EX 4IKPA 5G0UA 5L6MB 4M0EA 4X6XA 4D4JA 1A04A 1A88A 1UJ6A 1R9NA 2JGMA 3WZLA 2BFBB 5L7TA 3SLKA 3NCHA 2CNWA 2WM8A 4A9AA 3A2NA 3IB3A 1JIUA 3VPAA 3LUHA 4B4UA 4EKDA 1P2TA 1ZK1A 3LA6A 2RKBA 1YDFA 1WA5A 4KVGA 1G4HA 4BE4A 1ADJA 1QO9A 2W6JA 2VUUA 1E9VA 4YMTA 1S4QA 2ZT8A 1YDHA 1A76A 3WZ2A 1BX3A 4AS1A 3F6RA 3BC1A 2BI4A 3EVTA 5ENDA 2QW0X 2ZAOA 1NBHA 4EVSA 5I3ZA 5TMPA 1ZD4A 1H94A 1RXWA 2I91A 1BYIA 3OPMA 1P33A 3B9RA 4JZYA 1MEJA 4N1AA 4U2EA 4V39A 4NBTA 3K8YA 4K87A 4W82A 3SIRA 5C8YF 3U19A 2PUAA 3O74A 1FNCA 2AF4C 1RLIA 3AF3A 3GUVA 3I28A 4XDGA 4MA5A 4YIKA 3FE2A 5DHSA 1EB9A 1PUXA 4BNWA 1NLFA 1DBSA 1QCCA 3H1TA 3W3AA 2WV9A 4I6JA 1UPCA 3F46A 4YMVA 1EFRD 1M2OA 1OI3A 3ZWBA 2XMCA 4UEOA 5FBWB 3EXFA 1GQSA 1CJBA 3C70A 4OHUA 1ZONA 4L74A 4O2LA 5CK5A 4N4AA 3ZBTA 3AGQA 4M99A 2JIZA 5CT4A 3ZNOA 3ZW7A 5BVHA 1OASA 1ORVA 1Z8FA 4Z9YA 4B75A 5KEIA 1G38A 3EAQA 1LNZA 1VLHA 5DVZA 2Q0QA 5IF9A 4FGJA 4IP0A 4R2JA 2GN9A 3DFMA 3DZ8A 2ACKA 4M1MA 4LYHA 1V7PC 2VAVA 4GBGA 2MSCB 1RKQA 3OOWA 5HMLA 5A6SB 3RQSA 3VUEA 1CQWA 2DT5A 3K72B 1TIBA 3RIYA 4LHZA 4Q3AA 4ZI7A 1TAQA 2LUOA 1F2VA 1I7SB 1ODIA 4EHAA 1IVNA 4PZYA 2VCYA 5AK0A 2VJYA 2PKWA 2V7BA 2FTKE 1L5OA 3BX1A 2XUJA 1CD5A 1ARZA 2BTOA 2GZ3A 1VYTA 4DLTA 2XTNA 2P3OA 4B7UA 2I4IA 5DMXA 4DWVA 4K3UA 4JGBA 1PR9A 4I5EA 1P1HA 2M2IA 1KHHA 2VEOA 3E7FA 3D1JA 4IUBS 1ZMTA 2R7MA 1SA0A 3A0RB 5J5CA 3UWPA 1IU9A 1XXHB 1ONNA 2HYDA 2OAQ1 1W2HA 3DAOA 4JBHA 1C4OA 5FOSA 5A2GA 3CZ9A 3A28A 3ENQA 1E0JA 2H2WA 2HUPA 4C7BA 4PICA 1Y3BE 2HRRA 4XYMA 5HE9A 3WGKA 2RAUA 2HWUA 3VPFA 3F6BX 1NJSA 1PJ8A 1T43A 3P9YA 4EKIA 2XT0A 2FP4B 2GJ9A 2WYOA 3ICWA 2ZQZA 3OCCA 1A5ZA 4JJ7A 2Q6IA 4ZQGA 1C80A 2PJZA 3EH2A 4C4PA 5CDFE 3MBKA 4CMIB 1L7NA 2VPWA 3BJEA 3E35A 5AKLA 3ZCSA 8ABPA 1J8QA 3NBZC 3K1JA 1IEQA 3PHCA 4DMKA 4J76A 1DHRA 2EGUA 4PAOA 2FEXA 1KQOA 2WOOA 5CVVA 1RI4A 4EI8A 5HOEA 1C2TA 4N3CA 5HGJA 5CDGA 1ZDMA 2IBSA 2NO5A 2NO4A 1NQUA 4P7FA 4E12A 1WVMA 4AMBA 2X86A 3TLYA 4XRRA 2ATVA 4WKBA 2QE7A 4HAUA 4RANA 2REQA 3SZMA 1MNAA 5T8KC 1FDIA 2ZDQA 3QEKA 1SQ6A 2VHWA 4JI6B 5CDTA 4BJ1A 3PRJA 1W87A 4PGFA 4YDSA 5AXBA 4TS4A 1EZ1A 3N2GA 3CIFA 4KUHA 4OA5A 4YXFA 1NN5A 2ALJA 3OZ7A 5TT1A 3S5JA 2QJTA 1DUIA 4QOIA 3E1SA 5F35A 3S2IA 5LD2C 1XO1A 1ZJ6A 4JYBA 4TTQA 4D4HA 1K7CA 3A4TA 4E3ZA 1C7IA 3FLMA 3TUZC 4CG1A 2ODQA 2V7PA 4MUBA 5IHPA 2OAGA 1EWKA 1RWNA 3MINA 2ECFA 1LS1A 2DBYA 3GMDA 3AFIA 2REBA 3GFBA 4LMBA 4C04A 4WA7A 2H1FA 3AM3A 5JD6A 1MOZA 1IY8A 2P3QA 2C8LA 1UT6A 4MVWA 3DBOB 1JDPA 3FW1A 4RZ2A 4G0VA 4DL9A 2VHYA 1KBZA 2XLBA 4MJ3A 3SZRA 1PWYE 2B34A 2G7MC 2O9JA 2YYAA 3H83A 3MC1A 3OEED 2DBQA 4IAOA 4MLZA 4XM0A 3TSAA 3PFHA 3I23A 3OMWA 2AC4A 2FDRA 3O8OA 4H7FA 3ER6A 5T4HA 3IQXA 1BCSA 1NATA 3EVGA 4E1BA 4CKCA 1Z3CA 1RKBA 3AZQA 1KU6A 4G1CA 1Y37A 3U80A 4YCSA 4QARA 3W4IA 2ZUWA 4AKTA 4I4LA 1AURA 5LKAA 3K15A 2JA2A 5HZMA 3LV8A 1KO1A 3ZQKA 3EMDA 3N2KB 1KEZA 1YS9A 2BJWA 4S1OA 5E7IA 4D7AA 4JFAA 1WS6A 3GEHA 1W5TA 2GAJA 2PBRA 3N8DA 3QVUA 3LWDA 1VGQA 4HFNA 4FB5A 3DT6A 3HG7A 1PBNA 3I01A 5TRTA 3E9ZA 4IO0A 5EQTA 4LW8A 1X87A 3CJQA 3KRTA 2GK7A 3RHTA 3TVTA 2QTLA 3EBPA 3HCDA 1JBEA 5IK2D 5EMMA 2ZCJA 3ZD9A 1OH5A 2BWJA 2B82A 2IBMA 3UWSA 1XZJA 2J09A 4B6EA 3SOPA 2R1ZA 1KP3A 2EXXA 1N2SA 3WIOA 1CUEA 2KE5A 3A1WA 4MW1A 3V2UA 4X8LA 3IHTA 1YF3A 4DIBA 1MC4A 2B3DA 3VR6D 4MQFA 4DLNA 3STUA 4NESA 3JZDA 4J0EA 4A0HA 1J8FA 3HS3A 2JKZA 4BTLA 1L3IA 1BXZA 4LX8A 3C5EA 4MS3B 5DTRA 3CONA 3TSOA 1Z38A 3VPBA 5TMDA 4ZAYA 4CIDA 5IUJC 3TWOA 1SEVA 2BGWA 3ZZUA 4DLRA 1W9HA 4UQLA 4TLEA 3LY8A 1MZPA 2M1XA 2FFBA 3NMUF 1CR6A 4CQMD 2Q6LA 3TKYA 1D6SA 3KXIA 2CNOA 1SBQA 4X64B 1Z7WA 3TINA 2QL7A 3PLNA 1YRAA 3NYRA 4MVCA 4Y2XA 3ETGA 2VRNA 4LJLA 2YV3A 4MRVA 1AGRA 3DTVB 4PG4A 1LPBB 2JGIA 2MU1A 2AG1A 2Q8PA 3DOCA 4N9QA 5JBIA 4KACA 3U4MA 3WQSB 1W1IA 2RAVA 3PPIA 4EP1A 4DV3B 1Z5VA 2X2FA 3HPQA 5BV8A 1Z4MA 4I81A 3R3UA 5FNVB 2BM0A 1TUBA 2VPXA 5AR1A 4AKSA 4NCXA 1AKEA 2O59A 1CJVC 1I1NA 5ALXA 1ZVMA 1P4RA 2E9SA 3HI4A 2WT8A 3R2JA 1REQA 1JH8A 3CLTC 2B4YA 2R6HA 4D99A 3E1GA 1E5TA 1LDGA 2V55B 3MCWA 4XUDA 1QS0B 2WVHA 1IQ0A 1ZMBA 4OH7A 2J9FA 2CVOA 5ALRA 2FUG6 3WLKX 5DYIA 3P9NA 3MXOA 1IN4A 1ZUNA 2ZJ0A 2I65A 2EX4A 3E2IA 3ZV4A 2YXNA 3HJTA 3JTEA 3SEFA 4A82A 1BCRA 1KHTA 4EJ6A 5M29A 2YOGA 2VEDA 3NZEA 5JSZB 3FRIA 1J42A 5CEEA 5LKRA 1CEXA 1MVLA 4RJKA 1ELOA 3AJEA 5HKAA 4JOBA 5F2KA 5DNUA 2IYTA 4IS3A 4KGXA 1BAPA 2ENWA 1W59A 2O0HA 3W3ZB 2IUFA 1CFJA 3NNSA 3HKEA 1YA6A 1V11B 4DG9A 4RHYA 4E5YA 1IBRA 4BX3A 5IX8A 2WJYA 5EKXA 3VU9A 3AOGA 3IHLA 1Q74A 4BC0A 2B1QA 4BWGA 3K96A 3IOYA 1KJ8A 6REQA 1A9ZA 1WXGA 3ZJUA 2BCGY 4ZOLF 1G1AA 3D0OA 5EMJA 4DDKA 5CA0F 2DSTA 4V02A 5DXJA 5F2OA 1SK8A 2KQUA 4S12A 2QR3A 4JVMA 1J90A 3QELA 1XDGA 1OY1A 1YAJA 1PGJA 1Z4PX 4LOIA 3E81A 3HYCA 5KTMA 4BMZA 4P35A 4ND4A 2H00A 3K0AB 5JWHA 4MGZR 4RTJA 2ZANA 1P9NA 3I53A 1U2GA 4G23A 1YR9A 3N9IA 2I8AA 1CQJA 1Z5GA 1R8SA 4JCCA 4LN1A 4XIFA 4GR4A 2G1JA 1XJWA 2P2ZA 3PKZA 3FZEA 3H7AA 3IVXA 4RPLA 3JR3A 5K8LA 4ON9A 1IG0A 2XCOA 3TIGA 4BX9A 3BKWA 3I9KA 1SVSA 4DRXA 1HNXB 1ZSNA 3AVTA 1J0CA 1VJCA 1DC6A 3G13A 4IIDA 5KOJA 1JBKA 2C1XA 4KPFC 4WHMA 1YI8A 1XAJA 1DX4A 2C3MA 3CUWA 3NHLA 3QOWA 4CIVA 3B2EA 3UAGA 4K86A 3LKBA 1DU4A 1GL9B 1G3UA 1NLZA 3HSSA 3JYHA 2OXTA 1U7OA 2ORWA 3P4YA 2DR3A 5EJFA 3UV3A 3VI3B 3WFZA 4B84A 3DLBA 1ZMOA 4RJJA 3JYQA 5IKOA 2PGXA 1Q1BA 5FV4A 121PA 2QXTA 3GQBA 5ILGA 1N6OA 4DARA 3KM0A 5CIYA 2E49A 2AS0A 2PSEA 4ERNA 1G55A 2X0NA 3HXTA 5DT2A 1F51E 3H5AA 3KXKA 3RSFA 4B6GA 1KYIA 3B1ZA 3OZDA 5EJ7A 2X8WA 1XTBA 3PEVA 2IDKA 3ZDEA 4FR2A 3CG4A 4IDPA 2OAEA 4U00A 1K5GA 1TGVA 3NQ41 1P7ZA 2Q4OA 4L85A 2V6MA 1YH3A 1K66A 3QBEA 5T4EA 1PR0A 2BMFA 4MWSA 5FBLB 1RI3A 1I24A 2Q50A 3PL1A 2FK7A 1KZHA 3NJ4A 3WLJA 5EJ5A 2J45A 5THQA 5C8YA 2OMKA 3K6KA 4ZDKA 4P83A 3DLIA 1A9PA 2KBFA 1DC3A 4AF8A 5FKJA 1PW5A 2WVGA 4PPGA 1X92A 3FMOB 3HKBB 4QOGA 3HB4X 4UAJA 3WV4A 4E22A 3W5JA 3EXHA 3O2NA 3PGLA 2A0YA 4DLPA 1B43A 4E5MA 2XMBA 3DDSA 4GZLA 1UBNA 1FX1A 4OP1A 1Y1RA 4G56A 3AVXA 1GDDA 2EJWA 4DXHA 2FMIA 2QZSA 2JG3A 4B3SB 1ULBA 3F5FA 2WTEA 1EUCB 1NRWA 3OC6A 3K6RA 3NALA 2YQZA 3PC8C 3CT4A 4L72A 4WCVA 3OLXA 4AMGA 3G2NA 3OQJA 3R44A 3OCWA 4OYYA 2I87A 3KQPA 3LAWA 3A3KA 1BXKA 1I33A 1C3VA 3MQFA 1UM9B 4JHXA 1SUSA 2HT6A 4F96A 4ML3A 1CUUA 3I6YA 3ZTTA 3EVAA 1Z4QA 2CZGA 4EIWA 5G0VA 5AD1A 3FNQA 4EX6A 2B35A 1WXDA 2IP1A 1CZHA 1R0ZA 5BMOA 1W581 2HHLA 1YULA 2K2QB 3BXHA 4AY5A 3CVVA 1O0SA 1WPXA 1O95A 2NLOA 4MWDA 5HIJA 5IN4A 3I5YA 3T35A 3W2EA 4JJAA 1ZZEA 2CVHA 13PKA 1WB4A 3AERA 3OSUA 4X8HA 5DCYA 4FM9A 3H3XA 1J20A 2BJHA 2VP6A 5GM1A 2EW8A 4ZI3A 2FRDA 4BPBA 3D3NA 1ISHA 3M81A 3VGJA 4D0LB 2ARKA 1F4VA 4XM1A 2EGHA 2PRJA 3MM4A 2ATIA 1AG9A 4TQAA 1YS4A 3W05A 2WINI 7AT1A 3U3XA 5H4HA 1XHFA 3JQAB 4UREA 1M72A 3H0EA 4IDFA 1HDGO 1D0SA 1Y9EA 2O2EA 4IEEA 3O9VA 5FBZA 4ZV9A 4M8KA 2Q3BA 2VPPA 2J3JA 2Q0SA 4KIFA 1UDWA 5L3RA 4E7OA 4G8CA 3NVDA 4HDOB 4X94A 4B2PA 2WOJA 2PUHA 1IEVA 4IDQA 5E9QA 2C29D 2W0MA 1QIEA 3W06A 1SHJA 5B6IA 5IAOA 3FSEA 3ZD7A 2WM2A 2QRLA 2QN8A 3OJ0A 3RSQA 1BJRE 1FU7A 1KQFA 1XPRA 2VK4A 5EGSA 1YCHA 4INPA 4R7TA 4OI0A 1GLGA 3TOVA 2FVXA 3VAYA 3BWXA 4RJIA 1MUUA 3LSYA 1NVVR 1Q6YA 1SK9A 3T7RA 1Z12A 2QTFA 2P6PA 2Z08A 5TJHA 1DARA 2WFAA 1DCKA 3EFHA 4WUVA 4AO6A 1VPTA 2P9TA 4XJTA 5L3ZA 5HYVA 2A0KA 2ENUA 4K26A 4RL4A 2XECA 4R8MA 2R62A 3ETNA 1NW5A 2HMUA 3SSMA 1MQSA 3UMRA 4PCVA 2W6IA 4QXPA 4RHUA 1N4AA 2GZSA 2ZWMA 4GVPA 3TXXA 1XDZA 3HKCB 2AKEA 1IHXA 4U7TB 4EG3A 4ZK2A 4P86A 1E4YA