4DNQA

Crystal structure of dad2 s96a mutant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
TLLDALNVRVVGSGERVLVLAHGFGTDQSAWNRILPFFLRDYRVVLYDLVCAGSVNPDFFDFRRYTTLDPYVDDLLHILDALGIDCCAYVGHAVSAMIGILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLAVGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARDHSVPASVATYLKNHLGGKNTVHWLNIEGHLPHLSAPTLLAQELRRALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DAD2
publication title DAD2 Is an alpha/beta Hydrolase likely to Be Involved in the Perception of the Plant Branching Hormone, Strigolactone
pubmed doi rcsb
source organism Petunia hybrida
molecule tags Hydrolase
total genus 80
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dnqA00
2C0QA 2JGMA 1U4NA 2V9ZA 2WFMA 1VZ2A 3VJKA 3STTA 5CURA 4GWLA 2WHPB 4X94A 4JYMA 4KE6A 1QTIA 3N2ZB 1MAAA 1SCIA 1OILA 5HF8A 1USWA 2H1IA 2B20A 3CCBA 4AO7A 2WHPA 1QFMA 5DTIA 1XKLA 2XMQA 3ZLUA 4INZA 5D3KA 1SFRA 4KAAA 4W63A 2J4CA 5A62A 3WKAA 3F97A 4QWWA 3DDUA 4BTLA 1AQLA 3YASA 1CRLA 1GQRA 4HRXA 4BE9A 4BVLA 1QIFA 2PKYX 3S8YA 4CIBA 1K63A 5E4YA 5HK9A 4W1SA 1IMJA 5T4BA 5ALGA 3HXKA 5K3EA 2QUAA 1TCAA 5IKXA 1XRMA 1Q83A 3WWCA 1QFSA 4UPDA 2ECFA 5CT4A 2D0DA 5ALHA 2VA9A 2XUJA 1ZGCA 1C7JA 1HL7A 5CT5A 3WL5A 5AOBA 3H18A 3H2KA 4WCVA 4E14A 1CUEA 3AIMA 2HFJA 5CT9A 5AK4A 4DTCA 2Y6UA 4JH0A 2Y1KA 2WG1A 5FUMA 4G8DA 1N5RA 2XUGA 5ALKA 4HZGA 5HCUA 1CQZA 3I28A 5JATA 2WTMA 2HL6A 1R1DA 4PSUA 2Z3WA 2AJCA 3GBSA 2BUBA 4GI1A 1A8SA 4OB7A 5JADA 1EDDA 4UHHA 4DYHA 3HC7A 3WJ1A 3C6XA 3E4DA 2ZSHA 1HPLA 2UZ0A 1ISPA 5HK8A 2JGIA 4HVTA 4OSEA 1HBJA 5CBKA 3QPDA 4Y2PA 1UOQA 4MEBA 4CCWA 1J2EA 3VISA 1QJ4A 5EIEA 5ALTA 1HDEA 3ESCA 5ALSA 3RK4A 3ZV7A 3C6YA 1RP1A 1U2EA 4U2GA 4IH4A 5JZSA 2NW6A 3BF8A 2XDWA 1T4MA 1GPKA 2XI4A 2DSNA 4EY6A 3O95A 4H35A 5LP1A 5FKJA 2YXPX 5BOVA 1NU6A 2GYWA 3D2CA 2AJLI 1IZ8A 1Q0RA 1K6EA 3KWFA 2Y2VA 1NX9A 5A7HA 3KXPA 1CFJA 5C8ZA 4H0CA 3R3UA 4Y7DA 3TJMA 5ALXA 3I6MA 5AM2A 5T4HA 1M33A 5HF9A 3OURA 1TCBA 5K3AA 4Q3KA 5LZ5A 2XQFA 3D7RA 5AICA 3LP5A 2HA7A 3BE8A 2G4LA 5KREA 4HS9A 2EEPA 1LPAB 2ZYHA 1EK2A 5CW2A 1EB9A 3QBJA 4FKBA 1QONA 3JYHA 1E5TA 4FFWA 1MX1A 1QIHA 5ALUA 4QZVA 4OU5A 3X3HA 5LZ2A 1C4XA 3OM8A 4U2EA 1EH5A 1VE7A 1ZGBA 1CEXA 1CUAA 3FYTA 3WKBA 1P0PA 4Q34A 1CLEA 3HLKA 4K2AA 1U65A 4FDMA 1PFQA 3N0TA 2BGRA 2VAXA 3VKFA 3STYA 4UBOA 1YB7A 3H04A 2BAGA 1E66A 3DKRA 3ICWA 1FFDA 5AKKA 5AK6A 3LIIA 4H7EA 4S0XA 4KJXA 1X2BA 1N8SA 5C7YA 3IUQA 4ARBA 2EDCA 1XZGA 3G8YA 3G9ZA 4X00A 2K2QB 5ALPA 4UHBA 1ZD3A 1XZHA 1A7UA 1Q84A 1B6GA 3QITA 3L1JA 4LXHA 4AO8A 1ZI9A 4QDTA 3NWOA 4DMCA 3M82A 5K3CA 2VQ6A 3WKCA 4B9AA 5K3DA 4N8EA 3HACA 5AI4A 5ALMA 4B84A 5AIBA 4UHDA 3CXUA 1XRLA 1AUOA 5KWJA 3DJYA 4DMHA 3I2GA 3HSSA 3C8HA 2OAEA 1QIGA 4I4CA 3WK7A 1WM1A 1C7IA 4C4ZA 2QVBA 1JU3A 4JYPA 4RE5A 1DWPA 4OU4A 5SYMA 3S2ZA 1H2WA 2WUGA 5AKLA 4C89A 4X90A 5HQ3A 5ALNA 4DLNA 2DHDA 3PUIA 4JEIA 1BROA 3OC0A 5IVIA 2JEZA 1BRTA 1THTA 3WMRA 3IUNA 5FXMA 5DNVA 2XMGA 2OGTA 1QIIA 2HM7A 3LCRA 1DX4A 1L7QA 4YASA 1A8UA 3UUFA 3C87A 3LIPA 1RWQA 2CKMA 4X3CA 3K2IA 2XUPA 3CN9A 4OB6A 2HHAA 3I6ZA 5H3HA 3BIWA 3PI6A 4MXDA 1EHYA 3IA2A 2WILA 3LLCA 2QUBA 1RYYA 1JJBA 1JMKC 4P9NA 1OXMA 3R3YA 1VOTA 3FYUC 5K5EA 3C6BA 1JJIA 2DCMA 2OLEA 4C4YA 2W22A 4BAUA 4J0DA 4GHWA 1JU4A 3RKSA 2PL5A 3F98A 3I6YA 4Y2RA 1LBSA 5CH5A 3T4UA 1P0MA 5AM5A 2XUDA 1GQSA 1LPSA 4RPCA 1ZD5A 4B82A 1CV2A 1EK1A 3FVRA 3GELA 3H2JA 5DJ5A 3WZMA 1VA5A 4G8CA 1ODTC 2X8BA 4CG2A 5A2GA 2C7BA 1CUFA 3ZLVA 3B5EA 2XMDA 3L1HA 2BKLA 1XZLA 2JGEA 2IIVA 4Y2SA 3UUEA 3R3ZA 4N8SA 4C88A 2GYUA 4IO0A 2QOEA 4PO3X 2CMFA 2VJDA 4G4JA 5AKGA 1WPRA 3GFFA 5EGNA 4GDMA 1HLGA 4WY8A 3KD2A 4HTAA 5AIAA 1TKRA 2QXUA 3DNMA 5EHZA 1O6GA 5HKBA 3NUZA 2RIPA 4IH9A 4J0KA 1FSSA 3ANSA 4ZRDA 5C81A 3WWPA 4LIPD 2R8BA 1A8QA 2C0PA 3BJMA 4C87A 5AK5A 4EZIA 3QYJA 4NVRA 2XUFA 1BS9A 1EB8A 3D4LA 4ROTA 2G5PA 3QVMA 4FLFA 5DLPA 1UT6A 3BXPA 2JBWA 3D3NA 1AKNA 2XQJA 3I2HA 3FOBA 1AX9A 1MO2A 1CUDA 1YCDA 3WL6A 3QPCA 3FLEA 3IUMA 2OQIA 1VKHA 1YS2X 3MGAA 5AKHA 1F6WA 3QMVA 2XQGA 1P0IA 5JARA 3G9TA 3D0KA 3DYIA 3R40A 1UKCA 2AXEA 2V98A 2HRQA 1XZBA 3FYUB 1QTRA 4PV7A 2DHEA 5EHNA 3HEAA 3FYUA 4L0CA 4WDRA 1N5MA 4BAGA 3AZPA 1WOMA 4J0CA 2Z8XA 3R3XA 1WPXA 1CUJA 2FX5A 1JJFA 2B9VA 4Y2XA 2OXEA 5D6OA 4X6XA 2HU7A 1DWOA 2QKYA 4PNZA 4WDQA 4NMWA 2XMBA 4GLBA 3C43A 3BF7A 3V1KA 3IUJA 3L1IA 1QIDA 4UBIA 4LXIA 4G5XA 4AB1A 5BV7A 1MNAA 4BCDA 5YASA 4IQ4A 1VXRA 3OTQA 5JIBA 2XUAA 4KYVA 1FFBA 1XQVA 5SYNA 1XRQA 4W1QA 4UBJA 1WHTA 1VZ3A 4E11A 2ZSIA 1LNSA 5ALRA 4AQDA 2DFPA 5LKAA 1GKKA 3DL7A 1UFOA 5CXUA 4YPVA 1JFRA 1R88A 4X6UA 4MWTA 1CUZA 3O4IA 1X70A 2QJWA 2WHRA 1ZI8A 4L3WA 1DWQA 2BCEA 5BWBA 5FDFA 2FUKA 4NS4A 4BCBA 3DD5A 3FCYA 4LKOA 1CVLA 4CCYA 4EA6A 4U2CA 2GBGA 5A7FA 3VJMA 3B3QA 1G66A 3ED1A 3FBWA 5ALOA 1MAHA 3V9AA 3T52A 3AIKA 3H1BA 4FMPA 2PPLA 3KDAA 3DLTA 3U0VA 1MJ5A 3R41A 2P8SA 1LZKA 1UK7A 3PUHA 4JNCA 3WA7A 4X95A 4DSAA 1LZLA 3D2BA 3BL8A 1TAHA 3W06A 5ALVA 4Q3LA 4F0JA 2WIFA 2PSDA 5EIHA 1QO7A 3WZLA 1XZMA 3ZI7A 4EY5A 2JGFA 1EX9A 3H0CA 1S8OA 4GECA 4QDXA 2D5LA 3WYDA 2RONA 4WJLA 4FOLA 4EBBA 3EIOA 2C5FA 2VAVA 3ZWQA 5D3ZA 1VE6A 2ORYA 3QH4A 1BN7A 4W1RA 4AN0A 3MUOA 1VXOA 1ZJ4A 4EUSA 4X85A 1R4ZA 5AM4A 1W76A 3W9BA 1EDEA 4CI9A 3VJLA 1ODSA 4KR0A 3PICA 5ALZA 5CT6A 2EDAA 1YA4A 3DS8A 1TIBA 2H7YA 2XQKA 3O4JA 4BZWA 2XMCA 3IURA 3SC2A 5HKAA 1XQXA 2YASA 3VXKA 3HRHA 3AINA 1XQWA 2PX6A 4Y2YA 2YYSA 4BC0A 3JWEA 1B41A 4Q3OA 5JAOA 1YAJA 2QM0A 4OCZA 1IUOA 4H7FA 1YAHA 1XROA 3RARA 4C01A 2XMZA 1QE3A 2HRRA 5HF5A 1LPPA 5FRDA 2ES4A 2WKWA 2Z3ZA 2QMQA 4DNFA 2RHTA 3A6ZA 4YK7A 2VJBA 3G0IA 5E2IA 4E46A 3D2AA 4X92A 2GBCA 3MVEA 2JGJA 1CUVA 2VTVA 5AHXA 1CQWA 5IVKA 3H2GA 2XT0A 2IX9A 5JZBA 3EQ9A 4QNNA 4C4XA 4AXBA 2HDWA 5CTAA 2RAUA 2OQVA 1UZAA 4ZWNA 1ORVA 1W52X 5K3BA 1XZFA 3KOOA 3STXA 7YASA 5LYYA 3HZOA 1BE0A 3C45A 3IULA 3UMJA 1XKTA 4QDZA 3U1TA 3M81A 5AM0A 2PSEA 3A2LA 5JAPA 4XVCA 4MQLA 4HXFB 5AK3A 2WJ4A 1EXWA 2ROQA 2ONCA 4RGYA 1EVQA 2XUIA 5A7GA 3GROA 4BE4A 1XZKA 1GPLA 5HQ3B 4LYEA 3V1NA 4QDUA 3ICVA 2RHWA 4B0PA 4DSZA 4EB0A 4N5HX 3O4GA 4H7JA 5AI0A 2OGSA 3AUKA 4TPKA 5KWIA 4KE8A 4HRYA 4BDSA 1TQHA 1KU0A 2HA6A 3K9BA 1ACJA 4YX9A 1P0QA 5AI6A 4BZZA 4CFSA 2WQZA 1H23A 3G02A 2CB9A 5JD4A 3ESDA 2CUTA 2OCLA 4UFOA 4ETWA 2XUKA 3ANTA 4QA9A 4A16A 5A71A 1ACLA 1QIMA 3W04A 3NOXA 3PE6A 4Q1VA 1ORWA 4BP9A 2WFLB 4TGLA 3I1YA 2VEOA 1LLFA 4QDOA 2WIDA 4FHZA 4N5IX 2PVSA 2I3ZA 2H9YA 1XLUA 1XFDA 2WFLA 5AM1A 2ZVDA 5BWCA 2IITA 1BCRA 3V1LA 1R3DA 5JASA 2C5GA 3O4HA 1TCCA 1G4HA 2ZYIA 5ALDA 2XQIA 5AP9A 3DL4A 1EINA 4AZ0A 1A88A 2O7VA 2YH2A 5JZ9A 2BGNA 1J1IA 2WIGA 3G0CA 1ZD4A 4RNCA 4Y2JA 4FNMA 2XE4A 2PUHA 4ZREA 4Y2QA 1IVYA 4UFPA 4Y2TA 4Y2VA 2VJAA 3SK0A 1XRPA 4F60A 3P2MA 4MYSA 2O2GA 1U8EA 1DT5A 1UOPA 1D07A 3G0GA 3QMMA 2QZPA 2QT9A 3V1MA 4H7DA 4FFVA 5AOAA 1CUBA 3BJRA 1E3QA 4MJ3A 1R9MA 2Y2UA 1WB6A 4X91A 2DQYA 1GT6A 1KEZA 4MEAA 5AO9A 5I9IA 4FBMA 4B85A 3ZPXA 1F0PA 3I2FA 4U2FA 5JALA 1BEEA 2VATA 1XRRA 3PFCA 2WG2A 4P92A 5K3FB 4G4IA 2BUCA 2HA4A 2XLBA 4DMKA 1LGYA 4K6HA 1MTZA 1YA8A 1PV1A 3BIXA 4L9AA 4LYDA 1UXOA 5K3FA 1XLWA 1XZCA 3A70A 2WUFA 3RM3A 1DU4A 3WYNA 5EFZA 2G5TA 2XB6A 1F0NA 3G7NA 4X97A 3A2MA 4GXNA 3AFIA 4G9GA 1YB6A 3DOHA 1DT3A 3FSGA 3JW8A 4CG3A 4QE3A 4XIIA 4PSDA 4WFKA 2VF2A 4A23A 1SCKA 2GZRA 1SC9A 4BB0A 4ZGBA 1CUGA 4B81A 4B9EA 1GXSA 3H19A 1MNQA 3WK9A 1QIJA 3OOSA 4GEGA 3EQ8A 3GUUA 4AO6A 5LKRA 5E4TA 1XLVA 3AZQA 3KWJA 4GBGA 4BDTA 4H77A 4KACA 3TEJA 5ALFA 1CUSA 4E15A 2E3JA 2ZJ7A 2G63A 4ZXFA 1BU8A 2FJ0A 2WJ6A 4OPMA 3FSGD 1QO9A 1WCYA 3V48A 4QLOA 3PF8A 1UK6A 3F8SA 4UFNA 4A5SA 2JIDA 4EY4A 3WWDA 4WFIA 4C6HA 3WA6A 1TRHA 1EVEA 2OCIA 1CUIA 2J3QA 2B61A 5ALJA 1JKMA 2DQZA 2AJBA 4M0FA 2QJRA 4P93A 3WK5A 1WHSA 4H18A 3STVA 5DTJA 1YASA 4UHFA 3C70A 1DQYA 1ZIXA 1LPBB 2Y6VA 3WK8A 2OGZA 1LPOA 1MPXA 4FLMA 1BCSA 4QWMA 3FVTA 3Q8WA 5ALQA 1QOZA 4B7ZA 2HA3A 3WK6A 4F5ZA 5LLSA 2JGKA 4BRSA 4DM7A 2WM2A 2GBFA 5C8VA 4J7AA 4PSCA 5AKYA 1SOMA 2WFZA 4DIUA 1K5PA 1WB4A 3BDVA 5I8PA 5ALLA 2OPHA 1VLQA 1ODCA 1HKHA 2HA0A 4CCYB 1IUNA 1Y7HA 1CR6A 2QTBA 2ZYSA 2RI6A 3ILSA 4PQEA 1CUXA 3WL7A 4L72A 4FLEA 5ALEA 4G1FA 3C8DA 4EY8A 1QGED 4I19A 2BFNA 3H2IA 2R11A 5LZ8A 1E89A 3KSRA 5AKXA 3AIOA 5KBYA 3R0VA 1T2NA 5AOCA 4FNGA 3TGLA 4P08A 4FBLA 4PF1A 5A6VA 2GYVA 1CUWA 2Z5GA 4RE6A 4BBZA 3O0DA 3WK4A 1EA5A 5HZGA 1K8QA 3F9CA 3FWHA 4H7IA 4IHAA 4UBKA 2X5XA 2QXTA 3DKKA 5EIAA 2HA2A 1GPNA 4BAZA 4OYLA 1BEZA 1H2XA 4Q82A 3G9UA 4Q05A 4G8BA 4X71A 5AJHA 1G42A 4KAFA 4LXGA 5JD6A 1ETHA 1JT2A 4UHCA 4J3JA 1H2ZA 4UUQA 4UBNA 5ALWA 4BTVA 4H7KA 1E8DA 2LIPA 2FJPA 5F4ZA 1UKAA 3H2HA 4K6KA 1Y7IA 4MQMA 4Z49A 4OD0A 3AZOA 4BVKA 2H7CA 5ISMA 1AC5A 4OYYA 2O2IA 1CPYA 1DTEA 3AJAA 1XZJA 3E0XA 1QIEA 3E3AA 4I3FA 1HQDA 1IUPA 1VJ5A 4DNQA 4CIAA 1PJAA 3EF3A 4O08A 2WSLA 3QZUA 2JEYA 3DEAA 4HXEB 4Y9SA 2HIHA 2PBLA 3VDXA 1Z68A 4ZV9A 3HYSA 4UBMA 3W9UA 1FFEA 1MU0A 1ZI6A 2WIKA 4D9JA 4N8DA 4G9EA 1YR2A 4F21A 4K5QA 3C6ZA 4V2IA 1MN6A 3K6KA 4J0HA 5D7BA 2HADA 4DMFA 1ZIYA 3IBTA 3WJ2A 2I3DA 3O9MA 4H7HA 3IIIA 4TVKA 4AX4A 1XZAA 4EY7A 1NU8A 4BRZA 2VSQA 4B83A 3WLAA 2PSFA 4G4GA 3PFBA 5HF6A 3SX4A 1KU6A 1LPNA 5ALIA 5LIPA 1R50A 5IH7A 2JGLA 2PU5A 4KRYA 1W75A 4KE7A 2Z8ZA 3G0DA 3H1AA 3STUA 1LBTA 4M0EA 3HI4A 2ZJ6A 4JUIA 3WQHA 2WJ3A 3FCXA 5FP0A 2PM8A 2CJPA 5DNUA 1E8MA 3HABA 2OCKA 2XUQA 2HU5A 3VVMA 4WFJA 4X93A 4B0OA 2O2HA 1F8UA 4BP8A 4KAJA 5DWDA 4AZ3A 2B4KA 2XMRA 3ESAA 4QLAA 1Y37A 3QM1A 3WIOA 1ZOIA 1QIKA 1GZ7A 1UK8A 5AKIA 3PDCA 1XZDA 4XX1A 1X2EA 3R3WA 2HA5A 3C5VA 4BATA 4K6GA 3M3DA 2WLSA 4HXGA 2WUDA 5LZ9A 4U2BA 3W2TA 3VVLA 2WIJA 3EBLA 1EDBA 5CT8A 3CN7A 3EQ7A 2OG1A 4BVJA 3Q0TA 1FFCA 2BJHA 5FOQA 3DOIA 3IB3A 1UWCA 2X76A 3BDIA 5CH8A 4CG1A 3WL8A 4AMYA 1MX9A 3WKEA 1Q0ZA 4X7BA 5EHQA 1MX5A 2O7RA 4PW0A 4J03A 2XMSA 4UHEA 2CBGA 3W05A 2WG0A 4QEKA 1O6FA 2W6CX 5CXXA 2H7XA 3DQZA 2I78A 3QMWA 2C4HA 1K4YA 3AILA 2PSHA 2RGUA 2OAGA 4XJVA 3BWXA 3I1IA 3FNBA 1JI3A 4B6GA 4GW3A 2PUJA 1R9NA 3B12A 2WU4A 2ZYRA 4IH1A 4ITVA 4AMZA 4XWGA 4X6YA 1CUHA 3WWEA 4W9RA 5CMLA 1FFAA 1CUYA 2V96A 2HFKA 3CCCA 5JD5A 4WY5A 1AZWA 1FJ2A 2OCGA 1AMNA 3WI7A 1JMYA 3OG9A 4DNOA 5DNWA 5JYCA 4FTWA 1XRNA 5AH0A 1W6RA 2WUEA 5HFAA 2GZSA 5DYWA 2CZQA 2DR0A 5LZ7A 3M83A 5JAUA 1UOOA 4U2DA 2ACKA 2AJ8A 2J3DA 4Y2UA 5LZ4A 5I7UA 1TK3A 3F67A 4LHEA 5AKEA 3OPMA 1ZJ5A 2VJCA 1YS1X 3IDAA 1XZEA 4J0GA 4EHBA 5ESRA 2XUOA 5JANA 1AURA 2CEKA 3QPAA 4BYMA 4KEAA 3FLAA 3WKDA 3NGMA 2BUAA 3SWWA 4W1PA 3TRDA 3ESBA 5AM3A 2Q0XA 4MWSA 5E4JA 1ZD2P 1N1MA 1AGYA 5CRIA 5AI8A 1QLWA 5FV4A 2I03A 2PU7A 5FPPA 1E8NA 3D59A 5AKZA 5AI9A 1J06A 1YSCA 4BC1A 3R3VA 3F96A 1GGVA 5HFNA 4DNPA 2WHQA 1SCQA 3I2JA 5EHXA 3WWOA 2WU3A 3PF9A 3LS2A 1EI9A 2J4FA 1BN6A 5ALYA 1W1IA 3C5WP 1WB5A 1XQYA 1LPMA 1H22A 2XLCA 4ZV7A 1H2YA 3I2KA 4NZZA 1QZ3A 4M0MA 2QR5A 4OB8A 3G0BA 2QS9A 2ZJFA 3I2IA 3WIBA 2V97A 2AJDA 2PSJA 1THGA 3A2NA 4ZI5A 3DYVA 2QRUA 3GZJA 1CIJA 4ARAA 4KRXA 3DCNA 3H17A 2JF0A 2VT7A 1DINA 2GBIA 1OCEA 3FLBA 4OUKX 5FPQA 4FWBA 5J3JA 5AI5A 3MUNA 3E1GA 1CUUA 3HJUA 1L7RA 2XUHA 1W4LA 1IZ7A 1L7AA 1I6WA 4B80A 1J07A 5DYYA 1GKLA 5FLKA 4MYDA 1DX6A 3D5EA 4J0JA 4KE9A 5CH3A 1XZIA 2ACEA 4BCCA 1G5FA 4AN1A 5IVDA 1CUCA 1ZICA 4HAIA 1MT3A 3STWA 5DYTA 3IVMA 6YASA 2HU8A 1VA4A 5T4EA 3GA7A 3RLIA 2DHCA 5IVHA 5T4FA 2VT6A 5EI5A 4UBLA 1UKBA 3FAKA 4DGQA 3G9XA 3ZLTA 2WTNA 3O9VA 5JAHA 2C58A 5C8XA 5AKJA 1DQZA 1UK9A 4J0IA
chains in the Genus database with same CATH superfamily
1FS4A 1KJQA 1N6HA 4RD4A 1T13A 3L0DA 3GA0A 4FBGA 4KLZA 4D3YA 1ZQ9A 2HYIC 3RUEA 4KWIA 5CURA 4GWLA 1UC5B 3NTVA 3SSAA 4AY6A 4HEA6 2JAXA 1M67A 4M88A 1Y7TA 2YVKA 3WQQA 3CKMA 2WIBA 2EZUA 1BXRB 1N2OA 2XNDA 5ECDA 5HHTA 4DV7B 1OXKB 1ABFA 3N2ZB 1MAAA 2A86A 1ISSA 2GHQA 2GSDA 2GPAA 4KMSA 5IMSA 3PIRA 2PBRA 1IHUA 4LISA 5HF8A 4QJ4A 1CQPA 5ENDA 2O1SA 2V55B 1WCXA 4QIHA 4ZYYA 1YD7A 2B20A 2H54A 3ZV4A 4AO7A 2SICE 4M9RA 3K6SB 3ENKA 2BGTA 2GJSA 2I76A 3RT1A 1BXRA 4U7WA 4KQ1A 1XKLA 2R8RA 1P7PA 4TRNA 5JJKA 2ERCA 1PFWA 1SFRA 2IPMA 1VCIA 3H5OA 3IMKA 2BMVA 3E7XA 5D3KA 1PT8A 1TXGA 1W9HA 3GG2A 5SV2A 1JYSA 1G5IA 2DPYA 5KQMA 4OXRA 3I8XA 5A62A 5MFPA 2BGJA 3F97A 1SULA 4FK8A 4I4NA 1DXOA 4QWWA 3JXEA 4ZYLA 1U8XX 2QW1A 2A1IA 1FF9A 2AQ8A 3A1WA 3K6SA 2ZR0A 4B74A 1DDIA 1E1KA 4AC9A 1AQLA 3BE6A 121PA 1J1ZA 1UC8A 1P2TA 1YCHA 3YASA 4A1OA 2AJTA 5A5EA 1A98A 1FLAA 4JC4A 1ZW1A 5J2TF 3S55A 1QAQA 3L40A 5JNLA 4URYR 5KKAA 3S8YA 4ZT3A 3A6EA 4NNJA 3WVNA 1DOAA 5BXQC 4MNTA 3CEHA 4L9RA 2BHNA 4ABYA 5KJ1A 2GCNA 1K63A 1MJFA 1U9YA 1I33A 5E4YA 2DWCA 2FA9A 2OHJA 2FPOA 4K9RA 5T4BA 1UJMA 1FZQA 4RKWA 2D2FA 1H5UA 2JKZA 3S7TA 2I91A 3FB1A 3W2EA 1UWLA 3I42A 3OETA 1MH1A 2GNAA 2YMMA 3TQCA 2ID4A 4HDQB 4KPGA 5BYJA 1TCAA 4JLUA 2RI1A 5IKXA 2VPQA 3QWHA 1RYFA 2PR2A 1MO4A 1FFXB 2C7VA 3F5FA 3S7ZA 2NYAA 2FMUA 3BH6A 1KFJB 4LQ4A 4ER7A 2VA9A 1ZK4A 4OHKA 2H16A 1HNZB 1K8RA 2VRWA 4PC1A 4WCVA 2XX3A 3L6CA 1PZFA 3ZHYA 4AJIA 4C4TA 2HFJA 4XDYA 4OF4A 3WLKX 3LPLA 5ICFA 5KYVA 4B3FX 2Y6UA 4G3XA 4G1VA 1DO0A 1V3TA 1FFXA 2Y1KA 3E9RA 3FNQA 4G8DA 3U3XA 3I5MA 4O4HB 3K0AB 1N5RA 3KXKA 4OTZA 2P2NA 4RF2A 1E2HA 1YGYA 2FSSA 2XUGA 5ALKA 1LNQA 2QB5A 1YVRA 3MMPA 4QBIA 2NVUB 4UNIA 2FQWA 3DZHA 4BGIA 3DFUA 3B8HA 3UBMA 3X1YA 4DCCA 1H4TA 1R5BA 2AFVA 2GZ1A 2V7PA 3AVWA 1GZ4A 1XYVA 3L4BA 4BECA 4IHJA 1VJ1A 3K0AA 4UJ3A 3EX7C 3PLNA 4DYHA 2HF2A 2QPLA 3HC7A 3HVJA 4CQLB 3GMSA 1WJGA 2GXAA 2NVUA 1CDDA 3ORFA 4MWCA 5FWDA 3E4DA 2ZSKA 3O8DA 3ZBPA 1WXDA 1NV9A 2YFQA 2ZSHA 1NVEA 1H93A 1XVVA 2V3WA 3C97A 2JGIA 2QXYA 3KKNA 5E6SB 5ARDA 5HK8A 4IJQA 5DZSA 3ZY6A 3LW7A 2EW2A 1D9XA 2IBTA 2I2XB 1Y4DE 3WADA 1NUUA 5FR1A 4J2TA 1JG1A 2HQ1A 3AI3A 3OE5A 4CQLA 1T4CA 4YXWD 5KC9A 4OSEA 1L5NA 2Z8YA 2QTVA 3GVHA 3N8DA 1HC7A 2R47A 1JAHA 4CMCA 1RAFA 3N28A 4LS3A 1SXJC 5E6SA 4BN0A 1QHGA 1L7XA 1HY3A 1U7UA 2C2BA 2IYXA 3NC4A 3RD5A 4B5KA 3FNFA 2PUFA 2AMFA 3T5TA 3MIIA 1VGRA 4YDRA 5CA1B 5LOVB 1DSSG 4UTNA 3RK4A 3EEBA 3RYCB 1RP1A 2IS6A 1QE0A 1BJKA 4D56A 1XU7A 5FWAA 1V1JA 1SPXA 2IHJA 3MQ4A 1CY2A 1QF6A 5JZSA 4MVCA 2RHMA 1YZ3A 1YQWA 3FOCA 5BUSA 3EF0A 1ITZA 1XQ1A 1E1RA 2DSNA 3DWEX 1U3VA 1NKSA 4HLCA 5CA1A 5KNBD 3PNSA 5LOVA 1E4OA 2QQ5A 2V7WA 2IXGA 3MYYA 4DXAA 5ARBA 1BGVA 2AXNA 5LP1A 4D6PA 3RYCA 2DJIA 2ZAOA 1M8FA 2QL7A 1WW3A 4I1SA 4I5EA 1GTMA 1Z13A 5B1SA 3D7MA 3LNTA 4MVJI 3NBAA 5BPHA 1R6BX 5MN6A 3E3LA 3RC3A 5BOVA 3FCOA 2G5GX 3GJ6A 1MO3A 3GRPA 4HH0A 1KAMA 4K88A 4TQAA 4EZEA 1I3NA 2AJLI 2NSYA 3BPSA 4CMGA 3AR6A 5FOTA 4BWFB 1BGXT 1J0DA 1K6EA 3KWFA 3SBDA 1GCUA 3DAHA 4NNOA 3AB7A 2C3MA 1BZYA 2R8YA 4W4TA 3X1ZA 2I5PO 1EU1A 1L1RA 2V6FA 3KXPA 3OTWA 4N9QA 1QVVA 4MJ7A 4H0CA 3KQUA 4WFQA 2YHUA 1NYTA 1KRXA 1OXTA 1U0TA 1K6MA 2C59A 1M33A 2BMDA 4RPHA 1TCBA 2DHQA 2E7ZA 3PXBA 5K3AA 1P2FA 3UXHA 3ITKA 3D7RA 4DLTA 4JBNA 5AICA 4HVLA 1YZNA 4GX0A 2J87A 5JVDA 2VZ9A 4MWGA 3QXGA 2X7HA 2REOA 1G8SA 2G4LA 2EZ8A 3L6DA 1XA3A 3WGKA 2IU3A 4DT1B 4EYSA 4HS9A 5K8TA 1H0KA 2OFPA 4DLUA 2WTXA 4MQ5A 2NQ2C 4II3A 5HWSA 4PO1A 1LPAB 1F48A 1EK2A 2GBLC 2ZYHA 3KAKA 4IIVA 4UPVA 4V0ME 3GG9A 1SIUA 2WHYA 3NANA 4PGAA 1E6KA 3U19A 1GITA 1QYDA 4QAJA 1XQ9A 3ZCUA 1NTOA 5JXJA 3IUPA 3JYHA 2RAVA 4G8JA 4R2JA 2XD4A 2RHCA 4MUAA 4OKIA 2HMSA 5AHOA 4YREA 1QV9A 1FQWA 1Q22A 2J59A 4M87A 4OU5A 5K1ZA 3LW8A 4XM1A 1U80A 1VGQA 2JFNA 2Z56A 3OM8A 2X0IA 4CUKA 3SC6A 3CRMA 3HYRA 1UDXA 1ZM9A 5JQWA 4HCJA 2DFNA 1M2VB 3R1IA 1EH5A 4DBLC 1W8DA 1WTAA 4R31A 2VUTA 2Z04A 1MQSA 2O7NA 2QVXX 4KK4A 2QPTA 5EJIA 3VR2D 1YR3A 6LDHA 3EPKA 5G3YA 4CGZA 3X43A 5FO1A 5FUYA 3U37A 4Q9NA 5I4BA 4R51A 1G8FA 3B3AA 5FUQA 5GVRA 1XAJA 5TVGA 2WR8A 3AR7A 4F3KA 1QUEA 1W581 4EUKA 2QHXA 1M2VA 3H0EA 1M8JA 1OWLA 3DC2A 2QVGA 4A0HA 4RZXA 4J7CA 4YMWA 3PIIA 1C14A 3IEKA 1EBFA 2FKAA 3N7UA 4DCPA 1O54A 3LUBA 4Q34A 4E3ZA 2BFPA 4QUKA 3MGBA 5LB2A 2QMZA 3A6GA 3QJYA 1P5FA 3WMEA 3TL6A 4EA7A 1AHHA 2WUWE 2A0WA 3K30A 2GB4A 3V7WA 2X8JB 4EF4A 4K2AA 3AGQA 1JTVA 3KC2A 4UUOA 2SBTA 4GD3Q 3C8UA 4HWKA 4R6XA 1TEHA 2EZTA 3NTOA 1KZHA 4B3IA 3TTSA 5GJCA 4UBOA 1MIOB 2BP7B 4BRWA 1X80B 5CLLA 1LX6A 3RUCA 4QOIA 3FM9A 4XE5A 3WGOA 5C5DA 2NPOA 1C8LA 3ZOKA 3I5UA 1ULBA 3ELBA 1LH0A 2A59A 3DKRA 2GRUA 4RKQA 3I6IA 4BQOA 4E21A 3BZBA 1E4VA 3OIGA 4F93B 2VDUE 2X8JA 3OEHD 1FFDA 1G5RA 5AKKA 4LZNA 3DV9A 3BHNA 1K4KA 5FPYA 3WBKA 4TMFA 3L0CA 2VPWA 3CUTA 1T5LA 2PUTA 2W6ID 3QLTA 4QOEA 4MJXA 1MIOA 2BP7A 3BREA 1X80A 2BZ1A 1KH2A 2Q6TA 2YXLA 4RLSA 4L78A 4IWXA 4JJ4A 2DECA 1SXJB 3CF6R 2W0SA 4XWTA 5IAKA 3TUIC 4ARBA 3I39X 3ZJVA 4ZOBA 4ZCMA 1D2EA 3FKJA 4PLYA 3M6VA 1VL8A 5T64A 5ADHA 2BJVA 3G9ZA 1EQ2A 3CF4A 4C4PA 5DN9A 1S9DA 5LYJF 1KDOA 1N6LA 1MP0A 1O08A 1VRVA 2GK7A 3KVNA 1P4AA 5LDGA 4YJFB 1SXJA 3VGPA 3ZHZA 1V8OA 4AO8A 2FLWA 2R68A 4XCXA 3RS8A 1OZHA 2FRDC 1NONA 1T29A 1A5TA 4GUAA 1ZNQO 3E9CA 4RHCA 4RQBA 3KJEA 1G9XA 2CE2X 2M32A 4HJXA 1QHIA 1V16B 2JATA 1N5KA 3VC1A 4AX8A 2PLWA 1ORRA 3LUFA 4RM2A 4B9AA 4RADA 2J5RA 1KEEB 3A9TA 5K3DA 4DBLE 5HW0A 1XMOB 1YUNA 4FMDF 4XJXA 1N0HA 4CTMA 2GFIA 4YJFA 3WGIA 4D8VA 1P18A 2C2HA 2C5LA 4IO1A 4BQEA 2ZWOA 5FUBA 3BMCB 1MQAA 2FMIA 1AUOA 3A06A 3A26A 1XMSA 3IXMA 2BTQA 1LRLA 1P9RA 2ZI6A 3GRAA 2O1XA 3IKJA 1L3IA 3L6UA 4WLEA 4P0QB 1COZA 1R6UA 4KJZA 1CZNA 1V16A 3C7DB 1QIGA 1AXRA 1YJ8A 2ZTHA 3LC1O 1WQ4A 3HDJA 1KEEA 3WK7A 2J31A 3NH9A 1N6IA 2XTMA 1GZVA 2QVBA 4GYWA 1YR9A 5EQJB 3BAZA 3B7WA 1U6KA 4C3OB 4OU4A 1XTJA 3BMCA 4DLVA 5SYMA 1EDOA 4KPEC 3FWPA 1ZOSA 2IEYA 3SJAA 1WXFA 1FUUA 3WR5A 1LBHA 2YC2C 5HQ3A 3IVRA 4FFDA 1K9VF 3FB4A 4DLNA 4OKNA 1M0SA 2DHDA 4OQFA 2UUAB 1C9MA 5G02A 1QYWA 1KHTA 3DDZX 1U2GC 5J1TB 1P3JA 2XWBF 1VPVA 2H4HA 4IJ6A 3IVAA 4JEIA 4ER6A 4Q39A 3OC0A 5IVIA 3LYLA 4O6VA 3BH7A 1BRTA 1THTA 2APJA 2NXNA 4FCVA 1AG9A 2J7PA 4H9GA 4L07A 2BGKA 3NHJA 3GRRA 5FXMA 3ZWOA 5HCIA 4R71A 5DNVA 2QRMA 1TO2E 2H5IA 2VBGA 3A9RA 1IJBA 2AUNA 1SKUA 4WD3A 5EIXA 1PG5A 1GSAA 3SY8A 2OGTA 1SBHA 2VYCA 2H9AA 3MC1A 5E38A 4KI0A 2DR2A 2WV7A 4JI5B 3GLFE 5KZMB 4D0RA 2RGRA 3OTGA 1RI2A 1DX4A 4NENB 1HM5A 1T9HA 1EWVA 2H1RA 3L7LA 1EK6A 4QXOA 4YASA 4BOYA 4ROSA 2FMKA 2JRLA 3HVIA 1U0FA 2WKSA 3QFFA 4HB4A 2XWQA 1WZUA 5F7ZA 5H02A 1ZRNA 1SNYA 3K70D 1NP3A 1GJRA 3E9ZA 5FI1B 2OBBA 4C5BA 1JBKA 2R5FA 2AZDA 3DO8A 3AUFA 1IN4A 5EXDA 3U3RA 1FDIA 1R15A 1WMFA 3TOCA 4U6NA 5ES4B 1A4XA 4AUMA 1WABA 5ICEA 2ZR8A 1IM8A 2VG8A 1XMPA 4NENA 2PV7A 3K92A 4HUJA 4IIXA 5CK4A 4EF6A 2UUOA 1HI9A 2ZS9A 4QPPA 1B6TA 2HHAA 5KAMA 3LUCA 2O8EB 1C1DA 2R84A 3K1JA 5H3HA 3GD5A 1GADO 4KIFA 3WG9A 3G6KA 2Q5LA 3KOXA 1ADGA 1KDPA 1Q0QA 1VL5A 1RQLA 1ORTA 1G7RA 2VFAA 3CNQS 3E4CA 3NFRA 5IWCA 3VU3A 1PWXA 1NURA 3TSYA 3BKWA 1UPFA 1BD3A 1E18A 3LKDA 2Y1FA 1V2GA 2WWIA 4PC6A 3BRWD 1ORHA 3R0ZA 4HRAA 4TWJA 4YJ2F 3PI6A 2O8EA 3AEYA 1Y5LA 4MXDA 1EHYA 2X0RA 4Z6KA 4OGGA 2CCJA 1UAYA 3K16A 3DT8A 2B1IA 1L4EA 4HSEA 3CKKA 4RAQA 2IW3A 2HDOA 3EVNA 1ZM4A 3NOVA 2ZZMA 2AQKA 2AUTA 3VKVA 4JL6A 4H3KB 1C1XB 1OF1A 3DEJA 3HXLA 3FNEA 1E3WB 3OJFA 4XSVA 3V1YA 4OQPA 2FSVC 4P9NA 4CCSA 2ZJ5A 4IINA 1FYVA 5KHOC 1D4FA 1OXMA 1R0CA 2P75A 3TGPA 1E6MA 4QHSA 1VOTA 4UXHA 1UC9A 1MB2A 2PZLA 3OCVA 4Y1EA 1I4TD 2GFQA 3S27A 3F90A 1FW8A 3ISTA 4K1XA 1KAEA 2W22A 2MINB 1YB1A 4KDFA 5CLQA 3ZUPA 4BAUA 2B3DA 3OCUA 3RS5A 4D2IA 1C1XA 4BO6A 3EOZA 3LZDA 2QW8A 1LQ2A 2L0XA 1E3WA 5KOYA 1JU4A 3RKSA 1O89A 3TDNA 3F98A 4Y2RA 5FNVB 1LBSA 3IMFA 2P8JA 1OWPA 2C04A 3AR2A 4OLAA 2ZJ4A 1P0MA 2AFHE 1PX2A 2ASEA 3R5SA 3P19A 4LSZA 4M76B 1U9CA 4EH1A 5K99A 1K08A 5DH9A 4ALMA 1A4UA 1GQSA 1LPSA 1ZOLA 1ZD5A 2MINA 1SO8A 2ZJ0A 2C2GA 2OHVA 2M6KA 3TR0A 1CV2A 3GNTA 3UGKA 4B82A 1R8XA 2YWRA 3UQYS 2R8ZA 5IC5A 2W2NA 3L02A 4M1ZA 5FNVA 2QN1A 4I4LA 9LDTA 1CWUA 2B5OA 2BKEA 1VA5A 2C2XA 2FRDA 1JSRA 3FPEA 4G1UC 4ZTBA 3OOWA 2W4QA 4RPKA 1ODTC 3IERA 1T34A 1KZ9A 2A8YA 2IOHA 2J46A 1S2OA 2QN8A 4U1RA 1EFDN 1NFRA 2DULA 2FW1A 1TECE 5A0VA 1UM9B 5CXQA 3MRSA 4A7PA 1G63A 2Y1DA 1SHZA 2C7BA 2PLFA 3L06A 4I9HA 4ZI7F 2F3TA 1UBKS 2QD1A 3B5EA 4H6XA 2OVFA 3L1HA 1XZLA 1Z5NA 3SM9A 1N3BA 3N75A 2W6OA 4OFZA 3TPCA 3I9KA 1KQOA 3JQGB 2QOEA 2CMFA 2VOJA 1M1XB 3CNOA 3HDGA 1A5SB 2G07A 3BUSA 4WXRA 3DB2A 5K05A 2ZJ3A 3I4CA 4ZYUA 2HSGA 3GFFA 3BS4A 1XD9A 5KQGA 3PS9A 4JU8A 5EGNA 1YDWA 1CX9B 4GDMA 3VDMA 5K0TA 4JHLA 3EFOB 4E88A 4WY8A 3KD2A 3M5PA 3TLKA 3SJUA 2F9LA 1DAIA 4OQQA 3M7IA 5A1TA 2FSPA 1SQSA 3UHAA 1QBKC 2E5WA 4A73A 3JQGA 2VNKA 2VHQA 2A9JA 4RK7A 3LU1A 5EP1A 2X22A 1ZCBA 3D9QX 4IV0A 1QF7A 1RXYA 4V2UA 5JEEA 3DA8A 3ZU3A 5IM5A 1TADA 3DNMA 3P2EA 1UXKA 4P7GA 5K0NA 3U13A 5EHZA 2RIPA 2LDBA 3ER9A 2JAHA 1VSVA 4J0KA 3EJWA 1U2GA 3EFOA 5JWHA 4ZMRA 4LSWA 4PZYA 5C81A 3BTVA 4DMMA 4LIPD 1VLZA 3K0HA 3PJEA 1X1QA 1N8NA 4XRRA 4B4WA 3GLIE 1VB5A 3DAFA 4KZKA 4NECA 4O8ZA 4RY8A 1RE0A 1RXSA 4HDRB 3W5AA 2HIGA 1Z0JA 2EHJA 3BJMA 3NP7A 3TN7A 3HU2A 3NP9A 4G0VA 3U3JA 4EZIA 2PRYA 3RPEA 1W2HA 4YCCA 2UYCA 2XJ4A 3HNOA 1NQXA 3HL0A 1NW9B 4LXTA 4NVRA 1VYTA 1XT6A 3PJFA 3D4LA 4FFMA 4MARA 2J9RA 3NM4A 2F3UA 1QGZA 4V39A 5KSPA 3CZ5A 2V5VA 5DLPA 3ZWCA 5C8DA 5KO2A 2BD0A 3IELA 1UT6A 3JZDA 5JSFA 4OMFG 1RXUA 4HDRA 5E3IA 3HCRA 4JUAA 3TJRA 1KJ9A 2JBWA 2GXQA 4LOKA 3TL2A 4F1WA 5TSDA 2QRZA 3D3NA 3ASUA 2QTWB 2NUAA 1R12A 1RW4A 1AKNA 2R44A 2XQJA 2D1TA 3CZAA 4GSKA 4IX9A 3IE1A 5JMPA 3I2HA 3FOBA 1AX9A 3AG6A 3A28A 5FT9A 4C1BA 3GLHB 3HK2A 4Z4CA 3QPCA 3FLEA 4CKZA 3RF6A 1Z4MA 1KQFA 4IM7A 4C04A 1Z0AA 4G5YA 1I2AA 4KLAA 3LCCA 5BV8A 2FQ1A 1OIVA 3VPDA 3TO5A 3T54A 2FWRA 2FCAA 3OZRA 4QXRA 4ZT4A 2XQGA 1Z47A 3GCGA 3UV3A 5EMHA 1EUCB 2R85A 1G6KA 1Y3DE 5JARA 1OZGA 1R0LA 1V71A 1I4EB 2DBVO 3QVXA 2Q5IA 3ZC3A 4EW1A 1QRRA 2CF6A 4AT1A 4F5DA 1D7AA 3UHPA 3MT7A 5BSTA 3G9TA 1LKZA 1P5ZB 1U9ZA 2GCEA 3D0KA 1OA1A 1YDHA 1OW3B 2H6EA 2ADFA 3CX6A 1TK9A 3GLUA 1U2SA 1QX4A 3MQ2A 3LQ4A 3P9RA 1S2IA 4ZQIA 5FCDA 4D8YA 4PPFA 4ZJZA 2HRQA 1H42A 3C4JA 4DJ5X 1VKZA 4V1CI 2IPNA 1EUCA 2FFQA 4HTFB 4DCTA 4CTNA 3P97A 4ZJPA 4TMVA 1XPJA 4ZICA 1P19A 1QTRA 1EWKA 1T25A 4PV7A 3N2LA 4KXQA 3VGJA 1UDBA 3T9BA 3R09A 3AM3A 1TKAA 1T0BA 2KS6A 5I01A 1VKRA 2GRAA 4ETMA 3INYA 2UV8A 4P34A 4F8EA 4LOHA 4X66B 2FSVA 2PJRA 2YN4A 2Z98A 1FCJA 3QYAA 1BJRE 3QI2A 4M1EA 1EFUA 4WDRA 2RAPA 3LLVA 4P7JA 1U99A 5LMCA 5HZKA 3KTDA 4GNRA 2H8GA 4LOAA 1NUAA 2Z8XA 4G89A 5ELXA 2NZJA 3PXDA 3NHLA 1GZ6A 2QY9A 2G36A 1JJAA 5BN3B 1DIHA 3T6KA 2HIMA 1AKMA 1HQYE 1S2NA 4OJTA 3H7IA 5JROA 4YJHB 3GXOA 1IK4A 2ISCA 3LGXA 1VKJA 1UXIA 1F14A 1XBTA 4ZOEA 2YZNA 3T95A 3I2YX 1BKDR 2VZ0A 3D1LA 3H9UA 1UBSB 4OP3A 3R3JA 1E2FA 1X1CA 2Y68A 1AV6A 2CFSA 2F55A 5FA8A 2XMBA 1SVMA 3LCVB 5BN3A 1FBNA 4FX2A 4F4HA 3NHKA 3A2KA 1AK2A 4KO1S 5D6NA 3BF7A 4Z4GA 1PT6A 9MHTA 5ILQA 3K94A 2ZXUA 4YJHA 1H4VB 4MWBA 2CCGA 4AB1A 3RVMA 1MNAA 2GN6A 2IDMA 4JIGA 4FGJA 2C2YA 4BCDA 5YASA 2FB9A 2AEFA 4LY9A 2JIPA 5AT1A 1J9GA 2R751 3N0XA 3Q5GA 2CVHA 5JIBA 3HO6A 2ZZNA 1ZXLA 4KYVA 3QXCA 1Z56C 1XQVA 1GPUA 1G2OA 2GR9A 2X7JA 5THXA 2H2DA 4DS3A 4DWWA 3PUZA 4WKCA 2CJFA 2QRGA 3WYEA 3D3EA 4UBJA 2AC4A 2YNMD 4S1TA 3B6KA 5B6JA 3K8YA 4PZZA 3BVPA 4C4AA 4RFLA 3OQNA 1NF9A 4ZGGA 1P7WA 4HS4A 4L8YA 3U49A 1GKKA 2H92A 4GKBA 9ABPA 3W2IA 1I9GA 4YPVA 1MORA 1JFRA 1R88A 2FETA 3D7SA 1DCKA 4DC9A 2QUIA 1GQOA 4QQKA 3DEFA 1UODA 3GIWA 1L3BA 1D6JA 3IPYA 4JA2A 1EZ4A 2G9NA 5K0EA 3QSYA 4NEGA 1GNVA 1CUZA 4EJSC 4YP6A 5IJXA 2ZYDA 1GGNA 1X70A 3OF3A 5JAQA 3S40A 5CEFA 1P4RA 2VAWA 4F5WA 1EYZA 1Z45A 1DOZA 3WNCA 2OM6A 1ZGHA 1I7PA 5BWBA 4U63A 3A32A 3ECAA 3LY8A 2W2KA 3AM4A 4NJEB 1VMAA 3H3XA 2GO7A 3R7BA 2VWPA 4UZFA 2I1LA 4U0JA 4V3BA 5JCJD 2ZE7A 1VLVA 1JKXA 4R8MA 5LQNA 3D4NA 3S2YA 1GZSA 2X8WA 4DA7A 4ZVQA 3L84A 4TRRA 3NBFA 1UEXC 2VRCA 2Y93A 2TS1A 3G8DA 2Q3LA 3H1PA 5TQVA 1WAMA 4D9CA 4CM6A 1GCAA 3ZIDA 4N49A 3P9YA 4NJEA 1L4NA 1FMLA 3B9QA 4J75A 3VI3B 2Q07A 1YIAA 3ABIA 4Q19A 4V24A 3B3QA 5BY2A 1RWWA 3BXHA 3FBWA 3DVAB 5LMZA 3DW3X 1W1WA 4OHMA 3KUXA 2J5BA 5A9RA 3WHIA 2IPOA 1EEXB 4XYMA 1N8KA 4JL5A 4Z1OA 3WAJA 4ALIA 3N6RA 2J5KA 3UO8B 5LFAA 1X1TA 1N25A 4LTNA 5BUCA 4OX9Y 2PPLA 1NR5A 3H2ZA 5HUQA 2PYDA 4G1MB 4U5XA 1V5WA 1K88A 4DM3A 2P4SA 1MOPA 2QTMA 4H6PA 2M6LA 5CD1A 1VI6A 1XEWX 1Z82A 3H3FA 5EIBC 4TM8A 3HYCA 3U0VA 3ZHQA 3R41A 3OO0A 3ROKA 1IEWA 1UK7A 1I1NA 4Z7NB 4PRYA 1P39A 2BHLA 4X95A 3TLGB 3WA7A 4DABA 1G0OA 3A4TA 3F5DA 2AA3A 1MHPA 2W2VA 4ZA2A 4MWDA 3LFHA 4EAQA 4OYHA 4WXMA 4IGFA 3L5KA 2ZG6A 3R23A 1M8PA 2PSDA 2WIFA 3A3YA 1UCFA 3EA5A 4IZOA 3P32A 4D4HA 1RWMA 1Y42X 5EIHA 1VCOA 2EW8A 2WNSA 4X8MA 3CLKA 3WZLA 1XZMA 1AS0A 4FILA 3ZI7A 4EABA 3TLGA 2C9MA 2HMVA 3FIUA 1HT0A 3BD6A 5KIAA 2DAPA 4EQZA 3H0CA 2EAUA 4QDXA 3L3BA 1HORA 2ZRNA 3DXFA 3UHOA 2E0IA 2HXYA 2H31A 1L4FA 4Z3OA 3V2HA 5C80A 3TM5A 4WJLA 4J7UA 2AMLA 3EIOA 3ZWAA 2XYHA 1PSZA 5I4IA 5CUQA 3LL7A 5KEIA 3O2QB 2HIAA 1EHCA 2VDMB 4Q4DA 1SCBA 2ORYA 2WFAA 3OWOA 5IULC 3QGMA 1RMQA 1ZMTA 2WWTA 3AF2A 3VO8A 1UM8A 1PJ4A 1QZZA 1XE3A 5A4KA 4OP2A 2OA0A 2QVLA 1RYMA 2Q1TA 1Z8HA 1QR2A 2AN3A 5H83A 3Q7EA 2A9VA 5I4CA 3DLHA 2XYQA 4Q48A 3M70A 1WKBA 4FFOA 1GTL1 1JG7A 5AM4A 4TVOA 3AETB 1A7AA 5TJ9A 1T3LA 1SHJA 4M9QA 4QHYA 3X2SA 3VX4A 4ZZIA 5KJFA 3O8RA 1W76A 3A6PC 4K87A 1SOWA 2E55A 1ANKA 4BP1A 2WSYB 3BXGA 1SK9A 3DDHA 3B2EA 4YHHB 4QVIA 4F91B 4F04A 3IXLA 1I7SB 2QM8A 1KXZA 2ZROA 4MP8A 4DRXB 1XR3A 5IAAA 2PJZA 2CZGA 3GPIA 3IOMA 3WBJA 4H4CA 5FORA 1EJ6A 3O4JA 4LDZA 4UOZA 4PYKA 3RHTA 1VBMA 2W98A 2NYRA 13PKA 2PL3A 4HNQA 3S5UA 4C20A 4M1KA 1QFZA 1Z29A 1S2GA 1SY7A 4EELA 2P9YA 2D1SA 1URPA 1VG0B 3SXUB 2YASA 4DRXA 1GTRA 1EVJA 3PA8A 2V4UA 3VXKA 4Q47A 4AY3A 2XOKA 4DIKA 3K05A 3ZY2A 3AINA 4A10A 5HZMA 4GWKA 1LI5A 3BILA 1IEVA 3DOUA 3ZTTA 5LP6F 1WP4A 2VHCA 2JBHA 5HKLA 4EJSB 4O4HF 3ZE2B 1J42A 4Z7JA 4DEVA 5BV2P 3DEKA 2Y0EA 4JOQA 2F9MA 3F1KA 1V96A 1SUPA 1GRQA 2K87A 1XJCA 4IDFA 5AW5A 2OYCA 1BA2A 4OM7A 3VYSB 4EG7A 4MLCA 3SXUA 3R5HA 4BC0A 3JWEA 1P2SA 4Q12A 1SC4A 5GINE 1B41A 4R1TA 5JQGA 2IIPA 2IL1A 1DDGA 4ZRNA 2QM0A 4DPKA 4HWGA 2IW1A 4NR0A 3PVZA 4EJSA 3UKOA 1RMYA 5LDDC 4CEHB 3TTVA 3EAGA 4ASUD 1EVZA 3K5PA 1A82A 4RWZA 1FQOA 1FYXA 3OE7A 4IV5A 4QASA 1I6MA 5D87A 3O2JA 1O94D 3CFYA 5I48A 3SBOA 2V0GA 3N6XA 1WG8A 3S2GA 5FRDA 5IH3A 3BE5A 2ES4A 3VPCA 1UT8A 4LVCA 1IVNA 5KNCD 2XAAA 4DNFA 3S29A 4CEHA 4UU0A 2RHTA 1B2RA 1FNDA 2MOKA 3A6ZA 4YK7A 3WDMA 4PQRA 2QMUA 2XYPA 4HVAA 4D81A 2FZ4A 3SZLA 1NF2A 1TCUA 3EOBI 5BOSB 1DQSA 1Q19A 2EGGA 3GLVA 4MULA 4MW4A 2HLDA 1P44A 3FDJA 4BX2A 4TKLA 4RVUA 3HGMA 1U0JA 4X63A 4ZVLA 1RJGA 2VSNA 1ZCZA 3GT4A 4RPJA 4YMUA 1OH5A 3P45A 4RHFA 1E6CA 2PANA 2YOHA 3KO8A 5AFSA 5CA1F 5LOVF 4E5PA 4GDFA 2VTVA 5AHXA 3GCDA 2ZBFA 3ZQUA 1TW2A 5BOSA 4LTMA 4TLMB 2IX9A 1GVNB 4BP3A 5JZBA 2HTFA 4EFNA 5AW0A 5ICMA 3MWGA 3RSOA 1QORA 4L5IA 4D25A 2IZ0A 2G82A 5BN4B 1OY1A 4HWTA 3L46A 4B7XA 1VJGA 4ZPJA 1PEKE 5E7QA 3MW8A 1ORVA 1W52X 1ADBA 4XVRA 5K3BA 5CLJA 2QD5A 4TV8B 4HH3C 1I3KA 1G4AE 3E70C 3GRCA 4GZMA 1ZJZA 3VOAA 1M54A 3CH7A 2QLLA 3KXIA 5EZ5A 2GWHA 3QW2A 5DTRA 3BWBA 4MI3A 2PMCA 1GA4A 5BN4A 2XSZD 1XKTA 2NWQA 5D5HA 4K7JA 221PA 1LBEA 3U1TA 2BSAA 4U7PB 1Z2PX 1OC4A 6PFKA 4FZ5A 4I4TF 1HSOA 2EBWA 4TV8A 3TL3A 2OHXA 4RK6A 4DLWA 3DPSA 5GQSA 4YV1A 5GVSA 1UL1X 3BSFA 4C22A 1T9DA 4G4SP 4JN6B 3ZV3A 1QB7A 2HF7A 2D3TA 3JSAA 3MSCA 4B7AA 1W36C 3TG8A 3T35A 3RRFA 4EMTA 1IY8A 3SQWA 4X7MA 2R65A 1EVQA 4EY3A 2XUIA 1ZXBA 3CSSA 4GI2A 4NCXA 1NW3A 2OL4A 1IYZA 5C0OE 3R76A 1WMAA 2OESA 4RD1A 2FK8A 4JI6B 4P31A 2BJWA 1ONOA 3PFWO 3JZFA 2Q2WA 2IUUA 4BX9A 1YB2A 4ZMSA 3RHFA 1M0EA 3QV1A 1TA9A 2VPYA 3NHSA 1GAQA 4LYEA 3ORYA 5BVGB 4GGPA 3DGFC 1M5UA 2UXDB 3NHPA 5IW8A 5K2MA 3WLSA 3OQJA 3WGUA 3EG9B 5IJAA 4CM3A 4DSZA 4JI4B 3BB4A 1EJBA 2MHCA 2PN1A 1F1BA 3T1OA 3TFQA 1PR2A 1SHUX 5TPWB 3LTEA 5I8ZA 4BB6A 1VDMA 3U7EB 1IDOA 2ZT6A 4V02A 4LDQA 1FU7A 1LDBA 1YVDA 2B8JA 2J6IA 3NFYA 4MX8A 4TPKA 4R0NA 4FGLA 4MGEA 3WLOA 1JYEA 5BVGA 2YIJA 3OJOA 4GM4A 1HLFA 2OSBA 4JGBA 1DC6A 2GN1A 1KU0A 2HA6A 2W83A 3EG9A 2F62A 3JAWB 4R1QA 3PTAA 2YOFA 1ACJA 4C03A 5IC4A 2C4TA 4YX9A 1QRSA 5AI6A 5TPWA 4BZZA 1CJCA 5THKA 1JSXA 2XE7A 4MHSA 3I37X 2PH5A 2WQZA 4CFSA 5CVVA 4XGNA 4YRNA 4ACAA 1H23A 4A0QA 5IEBA 4KXLA 2ZYUX 4G97A 4IDAA 1RRGA 4B8YA 4JA0A 4FEGA 3SE0A 1PW5A 4CTJA 1I8TA 2JGRA 2W9XA 4GMKA 1YVEI 1ISGA 4MRVA 2WMOB 4XTCS 3LG2A 3JAWA 2NUBA 2Y66A 4ETWA 3FRIA 3LDGA 1PZEA 2NU7B 2RFLA 4JD5A 4KH0A 4F2WA 3RRBA 3PJGA 1R8QA 2EKDA 1EXMA 4WIAA 1KJIA 2GAFA 5DYIA 4YR7A 4Z4EA 1ACLA 3THXB 4Y2GA 3LGSA 4TSKA 2N0SA 1TMKA 1V6SA 4RKRA 4YRZA 1VE9A 1A9OA 1LVUA 1PGNA 4TXMA 2J32A 2PA0A 2GXSA 3QWIA 4PRKA 1JXMA 4AP5A 3AUXA 4BB9A 5FH9A 4AL4A 3EUEA 3D4OA 4C05A 3DLPX 5LBIA 2GERA 4UD6A 2JLCA 2OC4A 4ONEA 4BP9A 3NS7A 1P1KA 4NCAA 2LBPA 2BFWA 2NU7A 3GAFA 1QLJA 2F4NA 2FN3A 1ODIA 1RM4A 2P4UA 2ZB4A 3IHLA 3OLZA 3ZWYA 5BP7A 3THXA 3UXMA 4RD6A 3G9QA 4C7MA 5AXBA 3H75A 4YYZA 3KDPA 2QTGA 4JP8A 3AFHA 1WNTA 4YP1A 5JYDA 3Q11A 5JDIA 4L8FA 4PLCA 2PZJA 2I3ZA 1AZSC 3USZA 1KYTA 3CRVA 4G86A 5IJ9A 1EUZA 2O57A 2I55A 1JXOA 4FSXA 3UT5B 4C7OB 1HH4A 1QDLB 1GSOA 1CHNA 3GRYA 1NXTA 3EA0A 3IQZA 2MSKA 3LA8A 3QKWA 2LCQA 2NU9B 5AM1A 3RSHA 1Q7TA 1XPUA 3TR5A 2ZJ8A 3VPXA 2CNLA 3JQQA 1R3DA 1Q0SA 1SU8A 4MYTA 5CFZA 1NYQA 3Q72A 1YFLA 1MFPA 4EPXA 4FNAA 4NFYA 3NAQA 4XIFA 1WUKS 4JBLA 3PKIA 3JYQA 1RCTE 2YS7A 4GMXA 4RSMA 1G4HA 4W82A 3UT5A 4DW8A 4C7OA 1Y1SA 4IZ6A 5ALDA 1Z25A 2IC5A 2XQIA 2FTKE 2HZBA 1K97A 3H65A 5E7MA 4C08A 4E2FA 3INTA 1A88A 4E1AA 1YK0A 3I53A 3TIXB 4L4UA 1OBVA 4FHGA 1J1IA 4LPKA 1ST2A 4RJLA 2D0PB 3OTOB 3LOUA 4TXHA 4UM9D 2W7TA 1DPGA 5GONF 2VWQA 4PVCA 2W6QA 1ZD9A 2JFHA 3IEXA 4FHDA 1UPXA 3U40A 3I3OA 1B8VA 4HAUA 4Y2TA 1H8HA 4Y2VA 3BWYA 3EBPA 3W7VA 4BUZA 2X5NA 1BG6A 4PZCA 3UWMA 2DU8A 1WEKA 3REGA 3TXXA 1MDFA 4DUGD 2DMRA 1XRPA 3HYNA 3QOYA 5CB4B 4UOQA 1W36B 1GDTA 2FYTA 3UJ8A 3KQYA 1GUBA 3P2MA 4F60A 2Y1OA 4MYSA 2O2GA 1Y3CE 2DE0X 1BIFA 3OF5A 4TLEA 5FBKA 2D13A 5JBQA 1JIQA 4QTTB 1F8FA 3W5DA 1YHNA 2HMTA 5BNFA 1D07A 1VIVA 2OV2A 3P0EA 4ZQHA 4YN3A 2XA1A 2R1VA 3ZJ4A 5A5GA 5HRUA 4JXZA 3ZWKA 3QMMA 2EZ4A 1YS6A 3V1MA 3AUTA 2RSLA 2VC2B 4UUPA 3JQAB 4QPCA 5CB4A 1VL1A 2B99A 5E1DA 3UTDA 4P3NA 1L1EA 3KFLA 3T3GA 3EVGA 3LRXA 2LKCA 3C98A 2FFJA 4MJ3A 4KPYA 1XZPA 4JEHA 1R9MA 3JASB 1QRUA 2Y2UA 3MRXA 1E5LA 4HWPA 1ZM2A 1L3CA 1N33B 4P3YA 2OFXA 2XB2A 5FWXB 3E9QA 3F5SA 2Z4RA 3JQAA 4FZJA 4KGZA 1GT6A 4LA4A 1KEZA 4NABA 5J4HA 5HEKA 5FBZA 2IGBA 4A8PA 1ZVKA 1DBIA 1CEEA 3WAKA 4B85A 1EFKA 2KHZA 1F0PA 3JASA 4EG0A 1J7JA 2PWPA 5SZHB 4F3CA 2QBYB 1BEEA 3WIEA 2PO7A 2PS1A 2CLMB 1RS0A 1DEOA 3EIUA 2BW0A 4QRHA 1PJ2A 2R8EA 1IZ9A 1XRRA 2G83A 3FWZA 4HI0E 5H68A 5TGZA 4YRDA 1YMQA 3UXYA 5JBIA 2EWMA 2PGIA 4FJ2A 1SG0A 4QARA 4G4IA 2FEPA 4QBHA 3WLEA 4DZTA 2NSLA 4FYHA 1CR0A 5GGYA 4OK5A 2XLBA 5KOIA 1UMCB 1I5RA 4ZQBA 1ZCJA 4ANFA 1EZZA 4K6HA 3ZI4A 5IU6A 2NG1A 3N2EA 4UDNA 3UK0A 2QBYA 4HB3A 1M1YE 1PV1A 4TL6A 1GOTA 4FEEA 5LLDA 5B53A 4ZOLB 1EVLA 2KMLA 3GRVA 4L9AA 3VAAA 5GIPE 1WQ1R 4LYDA 1G20E 4X44A 3GPBA 3SC4A 4XGQA 3VOTA 5J5CA 3Q8MA 3VNVA 1UXOA 4S1WA 2ZI9A 2CFOA 2A9OA 1Z9BA 3PL1A 3CRZA 4H6VA 5M29A 5GAJA 1UMCA 2POQX 2WP8J 3IIEA 3T7IA 3QVGB 3M4YA 4IRXA 5EFZA 3H4IA 3I92A 2G5TA 1A1SA 3RKUA 3WX0A 4JYAB 3UAXA 3QPWA 1ZMXA 2O6LA 4KQ9A 3D31A 4QUEA 4ZOLA 4MV0A 4NCJA 5D1NA 3DL0A 5KX5B 5DV9A 3OX3A 3A2MA 1YE8A 1GAEO 3AFIA 3LHSA 4G9GA 1E6EA 4BU1A 1ZPDA 4WK0B 5EMLA 2FLKA 1W73A 1P91A 4HADA 3RLFA 2JLUA 1PV4A 2V5UA 3GNSA 3QVGA 3WMFA 3AVYA 2X1MA 6Q21A 4RGVA 3JW8A 5F64A 1JE0A 3TLJA 3VH2A 2X9NA 1OTXA 1UZMA 1YJQA 4O4LB 3AVXA 1K9SA 4XIIA 1J5EB 5KX5A 4OHYA 4WFKA 4DG9A 1XXHE 2XF8A 5E8RA 5AW4A 1ZIPA 2GZRA 1NQAO 3UYLA 1MH9A 3BXFA 3OLVA 3B6MA 1BTOA 1WLYA 1GTG1 2HO4A 1XWIA 1NBOA 1DFHA 2OKCA 1ZCFA 5FPKA 1JBEA 1VG8A 4YUWA 5C37A 4O4LA 1DQPA 3F7NA 1BX3A 1L5SA 1G5PA 5EOVA 1YQXA 2O6HA 5EXXA 3I52A 5C4MA 2FQQA 4P4SB 3HUDA 3EGVA 1XUOA 1U7HA 3KQVA 3QIVA 4Z7QB 5KQLA 3FH0A 3WL3A 3G13A 1D04A 5BMOA 1J8MF 2GEFA 1M66A 5E1BA 1ZK3A 2GA9A 3EQ8A 2AEJA 4QEDA 5EPOA 3NIFB 5T6BA 4AO6A 4ZOQI 3EXEB 3V8QA 2CL7X 1GPMA 5JBNA 5I7RA 2O8NA 4BDTA 1H8ED 4NS1A 4D0GA 1S8NA 1YWGO 1EBUA 1JV2B 1NXVA 2PIDA 3GNQA 3HN7A 4P4SA 4XYGA 1FA9A 1C5KA 3PD7A 5EJ9A 1M5RA 2ZYVX 1BE1A 5KJ6A 2JNWA 1BYIA 2JANA 3GFSA 4RK0A 3KXDA 4GXQA 5CDSA 3U5TA 1Q0HA 2ZJ7A 2G63A 1PQWA 5GPBA 4ZXFA 1BU8A 3EA4A 4GAEA 1Y8QB 2WJ6A 1IG3A 1L5VA 2WD7B 3EXEA 4G81A 4OPMA 3K1AB 3TFWA 4DA6A 4POOA 3AF4A 1Y5RA 2VQFB 3WGTA 4CETA 1QHYA 3CPSA 4TXLA 5LSAA 4RZIA 4JITA 3ND7A 3TZCA 2PJUA 1I0LA 1QO9A 1DE0A 3NHUA 3PF8A 4AKTA 1J8DA 3HEBA 1UK6A 3D8UA 3HFSA 2JIDA 1QDUA 3V2IA 3DE7X 4GLJA 2CDAA 1TU3A 1Y8QA 2WD7A 3WA6A 2YXBA 1GP2A 3AU9A 4I1YA 3K1AA 2XNHA 4H60A 1F20A 2OCIA 2YWHA 3KQNA 4DLYA 1COWA 2Z6VA 5K8IA 3VQTA 3U7HB 3MTEA 3TKYA 1U4OA 4F9FA 3GEGA 4NP6A 4ZC8A 1THMA 3SKXA 1CY0A 5G0TA 5L7YA 1ZUNB 2FMTA 1XYGA 3I5AA 3KSBC 2FHSA 4WZBB 3L07A 4PE5B 3SR3A 5L3QB 3IJRA 4YP5A 1NRWA 5I7SA 1KZ1A 3T1VA 3C70A 1DQYA 1ZN9A 2PG3A 2W2PA 3C39A 1QFXA 3GDOA 1V7PC 3WK8A 4CFYA 4TKVA 1JLHA 1MPXA 2O19A 4NU6A 1M2GA 3C5HA 1PGPA 3BWCA 2ETVA 1YDFA 3ITEA 3KUCA 1ZUNA 3DZGA 1DB3A 3I12A 3L7NA 3ONDA 4N12A 2IWRA 4BEWA 1GTJ1 5EJ5A 4WZBA 3OOJA 1RJ9B 3VU0A 1ILWA 2EF1A 2XE6A 3ML1A 4AMBA 3RUIA 3ZS9A 3CX4A 4DLZA 1D2GA 5L3QA 2QP9X 4DEYA 2R96A 3WGVA 2DWUA 1NMXA 2H4FA 3UNXA 3D0RA 4NG4A 4F5ZA 2BLNA 1YIDA 4I50F 4MLPA 2Z2IA 2JA1A 2WV9A 1RKVA 3JRNA 3LY7A 4PAGA 5AVTA 5CR9A 5ITZB 4LE2A 3WTBA 1QHEA 1R7RA 3LVRE 4DVJA 4EJ0A 2ZOSA 3IP6A 1RJ9A 1XMVA 3NBXX 4O0LA 4D99A 4ZO7A 2NTJA 4OHWA 4OG2A 4RVGA 4WKGA 1SC3A 5AKYA 5L4LA 5P8WA 1RC1A 4PNEA 5SZIA 5AVYA 4BLTA 1MJNA 4D5GA 2WYWA 1E20A 1PLKA 4MW1A 1TZMA 2JS7A 2Q99A 3GZNA 1AQIA 3IRVA 4HJRA 2RBGA 4URHA 4O5AA 1GWNA 3LC0A 5JECA 2DUJA 2MTBA 2W6NA 2IGTA 4FC7A 3SQLA 2ODTX 4BJ6A 1BKYA 1WXQA 3EIEA 3IBGA 1AIPA 1IN5A 3KZNA 5E2BA 3UMCA 1Y7HA 3FTNA 3ZCPA 4YO7A 2P69A 3RWOA 1V4NA 2WICA 2GPSA 3EVDA 3WYGA 1H3FA 5B6PA 4F92B 1AJEA 3ASYA 4ECEA 1NLMA 2XNDD 2IS1A 5SY9A 1Y3AA 3UBTA 5BR1A 4DFDA 4RLFA 5ALEA 1RHRA 2H4YA 1DQNA 4UCWA 2ZWPA 3X44A 1ONSA 3WRVA 1S9HA 3WIDA 3H2IA 2R11A 1NQ5A 1KC1A 4LMAA 1E89A 3HKCB 3KSRA 2R6AA 3DAYA 3NDJA 1NWHA 1PR4A 2HWXA 3R0VA 3ZU5A 3P9ZA 4E30A 3CE6A 3PV0A 1SCDA 2NPFA 4TQGA 3GGJA 1GLGA 3GXBA 4XKJA 3K70C 4L7VA 5C3UA 1T2FA 3WLPA 4EKIA 1E0AA 1U28C 3ZE0B 3HMKA 1PJCA 3UAOA 5A6VA 2GYVA 5U4QA 5HUHA 4GR4A 1YJCA 2QTAA 4BMZA 3HKCA 4GXTA 3IEPA 4Q01A 1UAGA 1KL7A 2REXB 4N7MA 4S1NA 1LF0A 1P6XA 3AF3A 1AGXA 1HT3A 3CWCA 3EZ2A 4Q00A 1EA5A 2XCLA 2VBCA 3E5HA 1MVLA 2ZGVA 5KC8A 1K8QA 3F9CA 3LDAA 2OLJA 4Q4AB 4UMEA 3FWHA 5M34A 4IHAA 1J99A 1X7ZB 3DWFA 4MKHA 4GR9A 1IB6A 1CY4A 1HEIA 2R6JA 4AS3A 4QO8A 3KVOA 1Y9AA 5IASA 1UPCA 1FX0A 1BDIA 2CLEB 2AX4A 4OQXA 4CL0A 2I1QA 3N6VA 4TT8A 4YRIA 1VKOA 3ACBA 2QU8A 4DA9A 3IAM1 4EF5A 3KT3A 1LK7A 2BISA 2OUKA 4Q1AA 1BEZA 5JHGB 5F76A 1PL0A 2XHZA 4EJ6A 4Q05A 5CFMA 1UZNA 4Q4AA 1AMUA 1Z18A 2GEKA 2I8AA 4G8BA 1G6OA 1EFVA 2BBSA 3QW4B 4IW3B 3ASVA 4CKCB 2ZBUA 3U7RA 1KY2A 4G2NA 3SEFA 4N03A 5TGTA 1PUJA 3ZZNA 1Z0FA 3L1UA 3RSFA 3M6UA 2DFVA 2E2WA 1KYZA 4OXNA 1JT2A 1NJFA 3OIUA 4I4IA 3K15A 2PRIA 2OBLA 4RANA 3AEQB 5F2OA 5IDVA 3SM3A 1WCIB 4G67A 4JLJA 1KYWA 3HVHA 5AW9A 3G2QA 1YOVB 4MO2A 4M0CA 2EBUA 1QU3A 4CKCA 5FNZA 2X4DA 1NBIA 3OKFA 5CPFA 1XGKA 3UANA 2ZJYA 3O8QB 5E9AA 5KYXB 3OQ6A 1WW8A 1H0HA 4K6KA 4ZZ1A 3GRZA 1C9DB 4IFEA 1Y7IA 2RHDA 4MQMA 5DISB 1WCIA 1FTGA 1NASA 4OD0A 4CLOB 2QPAA 2GHRA 4D6XA 1CNFA 2GPWA 3KJGA 2RK4A 1YOVA 4QYWA 3ZX5A 4C0QC 4BFUA 5DGIA 1R6XA 4OYYA 3LBIA 5EJGA 5TNXA 4N5MA 1CPYA 1TZBA 4DXHA 2OMEA 3ORQA 4CM8A 2QIOA 2ZZKA 1B8NA 2HHJA 1EKXA 3VNBA 3ZBQA 3EGOA 3O8QA 5J4LA 3AF0A 2VHTA 5IAJA 5JNTA 2Q27A 5KYXA 1NYLA 3T3PB 1CLUA 3HVUA 2JVKA 1BQ3A 3GJ7A 1HMPA 3A04A 3B20A 3G2HA 1UZUA 2HC9A 3JD3A 4QQ8A 3NVAA 2WA2A 1VLHA 4CLOA 3PNLA 4I99A 2X0FA 3DPUA 4Z5XA 5KINB 3D6HA 3LY9A 3DAPA 1XTIA 3EVAA 4J4TA 3NHFA 2C9BA 4O08A 4CIAA 5DM0A 4V0NA 3ZGZA 2O2CA 2P68A 1VHQA 2WSLA 2Q2VA 4RXMA 4CU5A 1JIVA 1R0BA 3Q7PA 5KQRA 2CVQA 4HXEB 4Y9SA 4QQRA 5AUQA 1I1OA 4ITRC 1RFGE 2IV3A 2HDNB 2HCJB 4ZV9A 2RKWA 4LVUA 1QVAA 1SVIA 3HYSA 1HFJA 3ABQB 4UBMA 2VXBA 1OX6A 4D45A 3AP2A 3ZIAA 3PUJA 4A1FA 2OZPA 4F3NA 1PW7A 1A8PA 1R0SA 1R5NA 1ZI6A 2HPZA 4JS0A 5JJCA 2OPBA 3AU8A 1I7DA 4NOLA 1X39A 3ZY4A 4DLSA 3K4HA 3QVVA 4TUYF 5CCXA 2WB2A 4N8DA 3TNYA 2YWEA 4G9EA 4WY2A 3DVLA 2ZE6A 5HBGA 3W5UA 4B3HA 4DZRA 3COSA 3QFRA 4AICA 5FEMA 1N7HA 2AD1A 2OHOA 3TSWA 2ICAA 3CZRA 2FV8A 2PK3A 4MW0A 1C3OA 2VRNA 1O87A 3V7NA 4CQNA 2ODAA 4UULA 5F33A 1O1YA 3ENQA 5D7BA 4KKXB 1HE4A 2NM0A 3CV3A 1B3RA 3IBTA 1JHYA 1T6NA 1T4DA 3EQZA 3NVMB 4Q15A 1FDRA 3KKLA 5B1IA 2C8VA 1BXKA 3ESQA 3IE0A 4I0WB 4NH4A 4R8LA 1CRZA 3B7GA 4TYNA 5DB4A 4MPPA 1I2MA 4JI0B 1E1RD 3O9MA 3H16A 2ISQA 5DIZA 1XZAA 2H1SA 3LA6A 1NU8A 4Y6QA 4BRZA 4URWR 1Y9JA 2JFVA 3IIJA 2J3JA 3VSBA 1G3IA 2Q8PA 5JWOA 4QOHA 1GVHA 4NE7A 4JROA 4TXNA 2B7CA 1A9YA 1TJ4A 3ZGYA 1XTSA 4A2WA 2E4VA 1K6JA 1HE3A 4G4GA 1M2JA 2O0KA 1T36B 2L42A 4DCVA 1HQKA 1RT9A 5M5BA 1NR7A 2WWFA 5JJIA 3PFBA 5HF6A 5FI3A 1C1HA 3SX4A 4PYNA 1YS4A 5LIPA 4NBWA 1R50A 3PXXA 2YQ5A 1Z6TA 3FVQA 3QENA 5IH7A 4OQDA 1F4LA 1Q11A 2IKQA 1T0HB 2H5EA 2PKWA 1QK4A 2YFHA 4PQGA 1ABEA 1BVRA 4X7RA 3T5PA 1ZOOA 5D00A 4KRYA 2Y1XA 1T36A 4AM8A 2X6RA 4G65A 3T41A 4E5VA 2Z8ZA 3G0DA 1X42A 4N1AA 5TE9A 3C3JA 5B3AA 1YDMA 3STUA 3PC2A 4FFPA 5LMNB 4JZYA 4JQCA 2ZIEA 3NBUA 2FZCA 3HI4A 3PEYA 1I0ZA 1LS6A 3DVQX 4JUIA 4OXYA 4E5YA 2V0NA 3P94A 5FP0A 1S1CA 2CJPA 2O3UA 4E5NA 1XCBA 3SR4A 5KHLB 4DG8A 2AR9A 2DT5A 4CUZA 5F2KA 1E8MA 2YWGA 2FG7C 5EE9A 2GETA 3KJNA 3AVUA 1O3YA 4PYMA 3IVCA 3RK1A 3R77A 3B2NA 1NW4A 2DLDA 1CF9A 1F8UA 2KE5A 2FPUA 3LPDA 3FJ1A 3WFJA 4NG5A 4AZ3A 4GIBA 4MO9A 2SKEA 5U4XA 5ITSA 1XMQB 3WZ2A 4OHOA 5HP4A 5DWVA 1A2BA 3VKGA 3M6MD 3NBZC 4AS2A 1ZOIA 1NXPA 1KR2A 2BY4A 2VZEA 1GZ7A 1OASA 2IH5A 3LWNA 3ID6C 3PDCA 3DO6A 3SSOA 3VC2A 2YWDA 1WBDA 2DH6A 3MPUA 2PLRA 4XASA 3TEFA 5JU6A 5FTWA 5BMVB 3I5XA 3P9KA 4V0LA 3KIPA 3EMBA 2HA5A 4MMYB 5CVJA 1Q1QA 3BL5A 4K6GA 4Q7KA 2WLSA 2DT8A 4HXGA 3CH6A 4UVGA 5GM1A 3A0RB 2OBMA 1QCZA 3IUSA 3R9KA 1U6IA 4G23A 1BA3A 2FH5B 4R2IA 2CGEA 3EBLA 2ZTLA 2RK6A 3G68A 3C48A 3CUWA 2QWXA 4BVJA 3ZJUA 1SU7A 5KYGA 5BMVA 2GHTA 1FFCA 4IJMA 2VI5A 1G8GA 3GJRA 4HZUB 1IXZA 3RG8A 2GCGA 2Z08A 3IEIA 4UVIA 3UV6A 4W7SA 3QU5A 1IHDA 1UWCA 1NDUA 3HB7A 5I9TA 2ZM6B 1TVEA 1G1MA 4ZQGA 4N0QA 3SBXA 5CJ2A 2PX3A 4E4RA 1NG9A 4YV2A 4AQYB 1NT4A 1XJ5A 3JQDA 1XJWA 2N9UA 4IOMA 3LDHA 5EXTA 4JT9A 3D2LA 1MX9A 3WKEA 3MS7A 3RSGA 2YYYA 4HZUA 4JP1A 4NEQA 1YU9A 1FJGB 1YI8A 1XCOA 1U81A 2HSWA 5K4GA 4QYIB 1KJYA 4KQIA 5HJ5A 4LNAA 1LK0A 1E2NA 3R5TA 4PZ0A 4URVR 3U7FB 3QHQA 1AE1A 4B09A 3GLGE 2PKRA 1U9JA 4FE4A 1MJGM 1GFSA 1UJ5A 2H7XA 2WNHA 3G88A 1KVRA 3GJSA 4ZDJA 2IH4A 2AI1A 4KXWA 3ZEIA 3AVVA 4LE1A 3SEAA 1KK1A 3BQMB 1K4YA 4JJGA 2RGUA 2ZUWA 1L5MA 2JCSA 4QYIA 2OAGA 5G4LA 4XJVA 3ADBA 1WXGA 2DCUA 2NO6A 3OTHA 2EKPA 3Q41A 5JG7A 3C3WA 3LJKA 3VR4A 3SZGA 4LWOA 5F2NA 2C7QA 3JTMA 1SXJD 1W0KA 4FFBB 4CIDA 3B12A 1J8VA 3PX2A 4TMXA 1QH8B 2B5WA 2QIPA 3K6RA 4FW9A 4GI7A 2DJ5A 3RFXA 5JSHA 4X6YA 4LJ8A 1ZUWA 2ZSFA 2FDXA 4FZRA 4XYBA 1UJ4A 1D03A 3WWEA 4RMIA 3GWZA 2BN4A 2R7MA 3OY2A 4IOJA 3DFFA 4WKBA 1E1CB 2I1WA 4Y6PA 5DBFA 4CM5A 5BQPA 3FD8A 3EJ6A 1YVUA 2OCGA 1MCZA 4TT3D 1Z0ZA 1OFGA 1QH8A 3FPCA 1R27A 4DNOA 2OOKA 4ERXA 1XRNA 4I8XA 1ZC4A 4TV8F 5TVKA 3RANA 4R68A 5C7OO 2O3RA 1RWPA 2VZLA 3ZYZA 1E1CA 1HE8B 1P5RA 3CU5A 3GGCA 2CXOA 4N3CA 5DYWA 2B8TA 5AD1A 2O2YA 1D09A 5T8KC 1R37A 2MJLA 2XCQA 2XGMA 3QLVC 1NLUA 4KN8A 1N6NA 4H15A 4WN3A 4AECA 1X13A 1O7JA 1RRPA 3EVTA 5JAUA 2Y4OA 3F5MA 4HYQA 4S12A 2F3RA 4U2DA 4YO8A 4BJHB 3PD1A 3H6KA 4UNPA 3HBFA 2H2IA 2J3DA 2HAEA 1HQCA 4GU5A 5E8JA 5K01A 2F7SA 5KQSA 4PCAA 3PQ4A 1RYZA 4WH0A 3HCDA 4LHEA 5AKEA 2R6R1 2C98A 1B93A 2X4GA 3T99A 3JPYA 3AHGA 2C8JA 4FXPA 1KAHA 3K1ZA 1DMRA 1YS1X 3BRCA 4QEZA 3SP1A 4EJFA 3VDQA 3UG7A 1DLJA 1DRJA 2H5JA 1EBBA 1AURA 5C9ZA 2CEKA 1OJ7A 4U8GA 1KPGA 3DR3A 1ZM7A 2F8LA 2D5BA 2J7PD 2NSHA 3CHYA 4ZO9A 4A2CA 3NWPA 3FLAA 2XKJE 4WNCA 1OU4A 3WKDA 2RGEA 3JQEA 2BUAA 4Y0AA 4NV1A 4R2LA 2AFRA 3PHHA 2H65A 2GS9A 3HGQA 2CJXA 2WSMA 1Z38A 2C1EA 3CJQA 2Q5EA 4B75A 3PGA1 4F9TA 2O2ZA 4ZIRB 5IBRA 4BKUA 4ZYTA 4HVCA 3MJDA 3F3KA 1SKQA 1T8UA 3L8ZA 1Z0KA 3OIFA 2HJVA 2PR7A 2ZSEA 4JENA 4K6FA 1ZD2P 4ALJA 2A9FA 3JVUA 4D4KA 3AEUB 1E58A 1P2GA 3L7DA 4ZCPA 4HV4A 4I5DA 3SKYA 3OPVA 1AGYA 2GK3A 1KRWA 5BNIA 2VAMA 2XR1A 4G5SA 4ZCTA 3RADC 1QO0A 1NWCA 4NBTA 2IFTA 4BB5A 3RJ5A 1AN9A 4B6QA 2XAUA 4YAEA 1LDYA 2H1HA 5FPPA 4L28A 4OVKA 1M73E 3D59A 2AMVA 3JSXA 4JBHA 1NRJB 4MV8A 4EUHA 3IGFA 1L5GB 1ECGA 5AKZA 1IL0A 3LUDA 3NQ41 3A36A 2AF3C 3AEUA 1SUEA 5G4KB 4BYGA 5L45A 3KR1A 4B73A 1WXXA 3TTTA 4A6PA 1R6TA 1T9KA 4OV6B 1SCJA 4NIMA 3V1TC 3K4PA 4C76A 4O2AB 2QNIA 2Z43A 4XDHA 3TNDA 3O1JC 2RGBA 4GUDA 2CYBA 4YUYA 3KUKA 3TVDA 2P1DA 3GMTA 2RGGA 1OHHA 5G4KA 4DA4A 1SCQA 4B3MB 4QG3A 2VH5R 3A05A 3I2JA 3M1AA 1O8CA 4P7KA 2QLNA 3NNSA 1TUGA 3HB0A 1IN7A 1AGRA 1Z37A 4FDVA 4XDZA 3UA3A 4KR3A 3G5MA 3O3MB 3PF9A 5MF6A 4MVJP 4KPUB 4K9OA 3NPAA 3LS2A 1QE5A 3X0DA 2BMAA 5AVZA 1K7YA 1LLUA 2IZOA 4JJAA 1UC4B 5KVCA 2A78A 5EL0A 3CNBA 2J4FA 2ZLBA 3CMMA 621PA 5GJWC 3ZI0A 5CFRA 1JVNA 3BC1A 3C5WP 1O97D 1N5IA 1UP4A 1OAKA 3SQMA 3DE4X 2JCGA 3ZHVA 3LTNC 1K27A 4KPUA 4YFYA 5ENZA 3CNHA 4K46A 2XLCA 4ZV7A 5EJ2A 5BSVA 3G5UA 3MCUA 3GB9A 2G40A 1IHPA 1UBUS 3H9CA 3I2KA 3KR0A 2HY7A 1RQNA 3SDSA 4G0NA 1T1SA 3RGGA 1G18A 1SKMA 4MS3B 3G0BA 1TC2A 1PK7A 2VQ3A 3WIVA 3I2IA 3UMGA 3GN2A 3JQFA 4LC1A 3OE1A 1SXJE 4WKNA 3WIBA 1H5NA 4G9BA 4EO9A 1YTLA 2ENUA 5CK5A 3IV9A 4U39A 5C8YB 1U2DC 1ZN8A 3A2NA 2QDKA 4I81A 5D5QA 1QMGA 1D6SA 2OENG 3CSUA 3OZGA 4RHTA 3W8EA 3F6PA 2VNAA 4BE7B 4M22A 3IQEA 1RXVA 4ZI5A 2X0NA 1NT2A 3BHJA 2XDAA 2QRUA 2ZI7A 4MS3A 5CFQA 1ARZA