3AYXB

Membrane-bound respiratory [nife] hydrogenase from hydrogenovibrio marinus in an h2-reduced condition
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
273
structure length
273
Chain Sequence
PRTPVIWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAASGHAAEAILDEIKEKYKGNYILAVEGNPPLNQDGMSCIIGGRPFSEQLKRMADDAKAIISWGSCASWGCVQAAKPNPTQATPVHKFLGGGYDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDEGARKGYCLYKVGCKGPTTYNACSTVRWNGGTSFPIQSGHGCIGCSEDGFWDKGSFYSRDTEMNAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound hydrogenase large subunit
publication title Structural basis for a [4Fe-3S] cluster in the oxygen-tolerant membrane-bound [NiFe]-hydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 84
structure length 273
sequence length 273
chains with identical sequence D
ec nomenclature ec 1.12.5.1: Hydrogen:quinone oxidoreductase.
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
B PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3ayxB01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3ayxB02
3UQYS 4UCWA 1FRVA 1UBRS 1WUKS 3AYZB 4OMFG 5A4MS 3ZEAA 5JSKA 3ZE7A 4KO3S 1UBMS 4KO1S 3RGWS 3USES 1WUIS 5D51S 1YRQA 3ZE9A 1H2AS 1UBOS 3USCS 3AYXB 1CC1S 4IUCS 4TTTS 4UQPA 2FRVA 1UBUS 4KL8S 4UE3S 5A4IS 4UD2A 5JSUA 1FRFS 5JSYA 4U9IS 1UBHS 3CUSA 4KO2S 1H2RS 3MYRA 1UBLS 5JRDS 4KO4S 5JT1A 4UD6A 4GD3Q 4UE6A 1UBJS 3H3XA 1WUJS 4IUDS 1WUHS 1UBTS 1YQ9A 4UEQA 4CI0B 5ADUS 2WPNA 4UE2A 4KN9S 4UEWA 3ZE8A 3CURA 3ZE6A 4UCQA 4UPVA 1WULS 5A4FS 4UQLA 1YQWA 5JSHA 4C3OB 1E3DA 4UPEA 4UCXA 4IUBS 4U9HS 4URHA 1UBKS
chains in the Genus database with same CATH superfamily
4M8LA 1VG8A 1Z08A 4GZMA 5K0CA 4GFDA 4ZT4A 3GDGA 3OHPA 3UOGA 2Q0HA 3VC2A 1W30A 5IT0A 3M6FA 4TVOA 3R20A 2ZYVX 3KQSA 4HGOA 3E53A 3WGHA 1BD3A 1NFRA 3L0CA 3MT7A 4JLVA 1TKAA 4FE7A 4YAIA 1B15A 3S4YA 4HI0E 2OCBA 1W5FA 5TS3A 1SWWA 1SUAA 2WJPA 2J6CA 3RASA 1I6KA 5LKAA 2A1TS 4R8KA 2WHQA 3OEED 3H8JA 1WBDA 2DWUA 4WBNF 1KZ4A 3U1TA 2FWIA 4H3VA 1DIOB 4RLQA 1P74A 2HF8A 2V3VA 3H1PA 2MSCB 2VRNA 4Q21A 4A73A 2ZROA 3QXGA 5FLEX 4UARA 1PSZA 4D26A 5L8VA 3OEEA 4G4SP 3T7KA 1Y9ZA 1IYZA 1NQXA 2GM9A 2I7CA 3M1YA 4XQEA 1D4ZA 4XJVA 4ZHQB 3P9NA 2GAIA 1VPVA 1CR4A 1ONSA 3GR6A 1Y7PA 3HXKA 3RYCA 4GI2A 4HLDA 1YB2A 4CQMB 4DQVA 3HJNA 2IRWA 2V97A 2VHQA 3FKJA 3DLPX 2F9LA 3I30X 4A91A 5A3QA 2QX6A 1X7XA 3PNOA 4QDUA 1USKA 2WT9A 4WLNA 5E3IA 2WILA 3VKHA 1ZA2A 1S3IA 4L5YA 3I8SA 4UTZA 4R9UC 4R2KA 1ORTA 4PICA 4RHYA 1AN9A 1WUYA 4BQNA 4UUPA 1MGOA 4GPAA 1YVPA 4F4CA 2O0LA 2CJWB 1JHQA 3FOCA 5AOCA 2O14A 4FYVA 3R5JA 3F8SA 3CEMA 3KLMX 1UFRA 3FJYA 3K8ZA 4LEIA 3S1AB 4CZ2A 4KPFC 1JLRA 2CD9A 3EA0A 1YS6A 2R86A 2CUZA 2V74B 4RZXA 1DJPA 5FFMA 1V8FA 1KI8A 1QG6A 1UBFA 4K9RA 2TRSB 1BCRB 4KH0A 5REQA 4EUEA 1L4EA 4HFJA 3QQPA 3GGOA 4G25A 5T6BA 3IP8A 3ZHOA 4LJ4A 4DDUA 4UD6A 4FE4A 4KUGA 2F8MA 2AI3A 4KFUA 4BE7B 1A4RA 1P4JA 1U3WA 5TR9A 3VR2A 4BGEA 1EK5A 2YHAA 3KZ1E 1XNQB 3IAM1 1J0DA 3FKSA 2OBBA 3GOHA 3FDIA 2Q1YA 4U2DA 3TL6A 5JZBA 4G86A 4M0EA 2EWVA 3ACDA 3AEUA 1JAIA 2HA6A 3V1NA 2ET6A 5AK0A 2GLXA 2C3MA 2O1EA 3MSCA 3JWGA 4KLAA 4KQ2A 3WP1B 5FUWA 1FVHA 2D4AA 3DL2A 1T24A 2XYRA 1C8LA 3K9CA 5MGNA 2CNWD 5BN4B 1XTIA 1J7JA 1FP4A 4ZT7A 4AU1A 5LIPA 1ECJA 2HHLA 1Y3IA 3BFJA 1OGIA 2NZYA 3JR3A 4B6FA 1LSJA 2LKCA 2B8JA 1UZLA 2JCSA 4OAPA 4IWNA 1WZCA 2AK3A 3CG4A 3FDZA 3L1HA 4I14A 4N5LA 4EL5A 4MYTA 2YWCA 1H69A 4Z7NB 4O5OA 2XDQA 3BILA 4J6EA 4I55B 3JWPA 1L5ZA 1A9RA 4HDKA 3OWOA 1HX7A 4B4UA 3N58A 3A1NA 1Y3AA 3E4CA 2I62A 2H1VA 3RVLA 4RPCA 4LE1A 4OXIA 3DUWA 4MQUA 2X4IA 4IOMA 4EA6A 3GXOA 2ZRGA 4MV7A 1OFVA 5TGTA 3FUVA 3DQPA 3QZUA 3LDHA 1CU1A 1QV7A 1SIOA 3Q9UA 3CW8X 3HA7A 3D59A 1J2TA 3IUPA 2DJIA 2R48A 4OMFG 4D02A 4E3WA 4MYCA 1Y48E 3TZCA 5TEWA 3F8TA 4I9HA 5HKAA 1OI3A 4AQYB 1LA2A 1NJ2A 1WCIA 3DVLA 2IOYA 4KLRA 5E95A 3PGJA 1XQ1A 3MGGA 4UDXX 2B3DA 5KCMA 3SJCA 1ABFA 3FNFA 4R1PA 2WA2A 2WZQA 5EHNA 3RHZA 3RC7A 3MWYW 4HGNA 2JCBA 2HCTA 1E77A 5EQJB 1F3OA 2Z2YA 2AWOA 4RTSA 3T38A 1USVA 3I58A 4C6SA 1SBCA 2HUPA 1OWPA 4ENVA 1CUFA 1OX5A 1BIFA 2V5UA 2XADA 3Q7PA 3TW4A 3URKA 2ZANA 1LXCA 1GTMA 4IFEA 1LBEA 1PFQA 2YICA 4MVJM 2R0QC 3GJTA 4MRRA 5FV7A 1KETA 2FE4A 3RJMA 4BLPA 2BHRA 4AY5A 3E22A 2A14A 5JAHA 1SXPA 1MEOA 4TTSA 1HYGA 4YAOA 3N6VA 2IH4A 4YRZA 1X3SA 4R40A 1MC5A 1W88B 2ZSHA 5LJIA 1TC1A 1C41A 4HLUA 1E2KA 3ZS8A 4Q9AA 2FSPA 5C7IO 1U65A 4I50A 2J33A 3BXPA 3HR7A 3T3EA 4B0PA 3CXRA 4NMXB 3WGIA 3K94A 4Z54A 4V39A 1EK6A 4XIIA 3AZQA 1UKVY 4NHEA 4G81A 4EHFA 1O57A 3Q7QA 4HAYA 1SR8A 4PZZA 4R3UC 1WW3A 4YFVA 2YZMA 1J2EA 4NQRA 1DPFA 3B1ZA 1OWMA 2QTZA 4Z0HO 1K88A 5ESRA 1ESCA 3BMNB 2ZYWX 5KYNA 3WJAA 1JSZA 4O8ZA 5FUMA 5HXAA 5HP4A 3SJ7A 5E3HA 2IHZA 1UBLS 5KSYA 2G7MC 2DLCX 2VSXA 4CUZA 4KXYA 4BNGA 3TSOA 3KKNA 1EJ6A 5E1BA 2W6IA 2QQFA 5GADl 3D7LA 5I47A 3GLHA 1Z35A 1IVNA 5T3UA 2EJBA 3LC7O 5TT1A 3RV3A 1H1LA 1DTSA 2ZIWB 3EDQA 3DEZA 3IOMA 2KPOA 5CX4A 3AP3A 1AMNA 3VM6A 4JQOA 4Z4IA 2CUTA 4G4GA 1GUYA 4R69A 4C88A 1MTZA 2BMFA 4CJXA 1IH8A 4OB7A 1VPEA 5LZ9A 1PZGA 3AF6A 3Q7SA 2HAEA 2O50A 4RD1A 4CI0B 1U9ZA 5AFSA 4G5SA 2RIPA 3P2KA 4PW0A 3U81A 4V0NA 4FIZA 2QRUA 1UPTA 4LXIA 1S0UA 1YFJA 4RX1A 3JQBA 4OKNA 4AY2A 1Z0KA 2JGDB 5FHRA 4O4LB 1ARZA 3PENA 1YL7A 4I1OA 4AZ3A 1T2NA 1V8BA 1WOYA 2BFAA 1PS0A 4ES6A 3S27A 2IJGX 3ESCA 5GTDA 4FJ2A 4G56A 3P0RA 1XZKA 1J33A 1SELA 4QYIB 5E6SA 3EMKA 4XOUA 5IJ9A 5B1DA 1E2JA 3EWAA 1J0XO 1ZRHA 4M0DA 4G0UA 2WU8A 1A72A 1PJ4A 1VHWA 2Q3BA 2H2IA 2QSJA 3AJ8A 3BTOA 4IMRA 3D8RA 3QJYA 1FC0A 1Z12A 1I14A 3F67A 2UUAB 3Q85A 1UPBA 2BGMA 2Z9DA 1AD2A 5ITVA 4DLUA 2YV1A 4OA8A 2QN8A 3CLRC 3NI2A 5IVPA 1DCFA 5ADHA 1P9LA 1SBIA 4FZVA 3ZGVA 3W3AA 3TMAA 3G8AA 3LBFA 4O2AA 4IIDA 1JAZA 1EHYA 1G6KA 3OM8A 1BD4A 3VC1A 3HJHA 2FOXA 1FJXA 4NXNB 1GCOA 3MF4A 2W83A 3ROFA 2OSVA 4PHCA 3H04A 3V7UA 5LOVA 5BVHA 4HLUC 1SU4A 3D6HA 5C5CA 3OT5A 3ZNOA 4WIAA 2BKAA 2YHBA 5JZ9A 1WP9A 3IDFA 4HB3A 3LCUA 3OCWA 3SQDA 1WZIA 4KQKA 1AS2A 1P1BA 1C3OA 1A2QA 4J76A 2YZ7A 1K5GA 3ANTA 2E21A 1AK1A 1DAIA 4LXYA 4MWSA 3W2TA 3P9PA 4DRXB 2ECOA 5DM1A 1JG4A 4UW9A 1CNEA 1G20A 5CHYA 5E2IA 2CDCA 1JU9A 3RU3A 5KSZA 5BXYA 3CWQA 1QIDA 2RB4A 4IJ5A 4CUJA 2QIPA 4BJ1A 3AL0C 3L43A 1TT7A 1M72A 3DZHA 3OOSA 1G8HA 4HGQA 3GLHE 1PDWA 3PR2B 4OEHA 1G21A 1MDFA 2Z09A 3D6FA 3GEIA 4YPVA 2GS9A 4O4JA 2GFHA 4YLYA 2HXYA 2O2JA 4C7OA 5COBA 1R8YA 4WSOA 4QSMA 4KR9A 2VBIA 3DZ8A 3FOBA 5BY2A 4P33A 1JT2A 1KZ6A 2BZGA 4UHJA 3VZCA 5B1HA 3T6KA 2DBVO 4DY4A 4HN4B 1IZ0A 4QAJA 4UU1A 4IVQA 4GLFA 2H7YA 5EIAA 1ACJA 1U0EA 2GJSA 4YECA 4BB9A 3DGFC 4MB0A 4KLZA 4E09A 4UHFA 4CKBB 4KN8A 3EGWA 4BNXA 1ABEA 1QF9A 1TYCA 3DO6A 1Z8HA 1EDOA 1SC9A 3GQBA 1K7CA 2CLOB 3N2KB 1TYDE 1VL6A 1P7CA 2Z0MA 3JQBC 4I5DA 3QY0A 4JT4A 3HO1A 2BE9A 2C8JA 4I3HA 4CTNA 1E2FA 1ODLA 3WB2A 4DR4B 2NXCA 2ZBUA 1A5AB 3AEZA 1ENPA 3H9UA 4NDZA 4ZVUA 4CQLA 1UZUA 3CNNA 4ZWNA 3SJZA 3JAWA 1G59A 4IIUA 1E1KA 1BFUA 2C84A 2DMRA 2ZYTX 2QX8A 4JOBA 4RMIA 5DM60 1LSSA 5HE8A 1E2GA 1CW2B 3O47A 4BAUA 2PH3A 3G1TA 3GRFA 4NG5A 4Q03A 3HCWA 4LTNA 1FJHA 1GEGA 4CMGA 1QE0A 2ZRJA 3G59A 5JH7F 1W87A 5COAA 1AA9A 1V39A 3FD8A 1V35A 3WRXA 4BZQA 4B44A 1Q7GA 3VKVA 2I67A 4NENA 4C7KA 4TVBA 4LIPD 2WWHA 5CJPA 3B38A 2IYZA 5FFFA 3V6MA 4ITRC 4BN5A 1WAMA 2D1SA 3SICE 4HYEA 4OYHA 4OQQA 3LLUA 4RJIA 1F4PA 4F56A 3WLSA 4IXWA 2FSSA 5DEIA 2R97A 1D6JA 4OP1A 3RC2A 1PQ4A 4LF5B 3WXMA 3WGLA 1TCAA 1U0GA 3CJQA 3LBAA 2PUTA 4Q18A 4H4EA 4D4LA 3EW7A 2WWIA 2JHAA 1IWPB 1EFDN 1P91A 2GFIA 3BE4A 4J0QA 5EERA 1O94D 3FMIA 2QZJA 4TL8A 2ZI6A 3GEBA 2HIHA 2IZOA 5LYJB 1JV2B 1QGUA 2HBQA 4ML3A 1ZU5A 5SICE 4MDHA 1MEEA 5AI4A 5A7FA 4MJLA 5K0GA 4F06A 4O02B 2BGTA 3CW2A 1IZYA 3BGVA 4PZPA 1XWFA 3F6YA 1KC3A 3KSMA 2OXTA 1H2BA 1Q1BA 5DASA 2C61A 1LK0A 1KYYA 1E96A 1XZAA 1OA0A 3BJIC 3GVHA 4DANA 2DCMA 4HKTA 2UU9B 1SUSA 3ZIAA 2F1IA 1XNGA 3PCXA 4UDYX 3K6SB 3KKLA 1WKVA 3B1KA 1RLMA 5JFGA 1G3UA 4HVAA 1G20E 1FFDA 1F0PA 2CNLA 2CL5A 3KR2A 3LH5A 4WT7A 1A7JA 5AI0A 4FGZA 3MGKA 4U7PB 3QOFA 2OZLA 2FI1A 4N39A 5EPEA 2FMUA 4MR7A 2WQ6A 4MWCA 2IHTA 2DPHA 3RVSA 3WGJA 1PF7E 1PGOA 2L2QA 2V54A 1AM4D 4UUOA 1JXAA 5TQ0B 4KRFA 2LUOA 2E4AA 3RYIB 4BB5A 4KJXA 5C8XA 3RU2A 1QVAA 1KOFA 5KYWB 1SBQA 2PKQP 3MAGA 4FNOA 4MUMA 5ENDA 3PXDA 2J31A 4X54A 2A7XA 2VO1A 3WWCA 2DFDA 4G07A 1WA5A 2R8XA 5LYYA 4YPOA 3KXKA 4J91A 1JKXA 4OIFA 5FO0A 4F3RA 2DQYA 3UMGA 3T7CA 1V3QE 3KEQA 2M6LA 3F9RA 3ENNA 3VDXA 4XASA 3VDNB 1IRXA 4YS6A 1L3IA 1N2BA 1E6MA 2DCUA 3L6UA 4MRNA 3CLUC 2P4HX 2OTCA 3RS9A 3SXPA 3T7RA 2IDJA 4DMGA 4O33A 1CG6A 1PLKA 3I2YX 3G79A 1DV2A 2EIXA 5E1DA 4H7JA 4MR8B 2ZTVA 5CGQB 1AUXA 3L9WA 1D7AA 4QA9A 3L1VA 3N8GA 3OQNA 2ZT7A 4CHGA 3MRXA 4M87A 5DHFA 2G4VA 2WIJA 4HX9A 2PUBA 1YOVA 3QF4B 2JL1A 3BEOA 3IHKA 4AK9A 6ABPA 2AKAB 2QVYX 4N6NA 3W5BA 1V45E 3DBRB 4Y98A 1U8CB 3IL2A 1Z38A 2VHVA 1BXRB 2DPMA 2SECE 4WZBA 3FROA 4Y30A 1PT6A 2G8LA 1PCXA 2CLDX 3WRXC 4Y2GA 2XH8A 3B6IA 2YFKA 1E6UA 7REQB 4P4LA 4CTJA 2Y0BA 3QPCA 1G3MA 3AUKA 1WDMA 1XXHA 2JAXA 3ELDA 1J07A 1ZA1A 1JQJC 2GB4A 3ONNA 5I9NA 1SVIA 2QJTA 3F46A 3TM4A 1U0OC 5G40A 4OKIA 2Q7DA 1QTNA 3ESYA 3UN1A 1J09A 3SGLA 3U3OA 1XZJA 1Z5NA 3JTEA 4PX2A 1EFPB 5T5QA 3T1QA 1KY2A 2ADOA 4P83A 3NTQA 3TD9A 2O8CA 4EYOA 3WIOA 3SYNA 3V5NA 1CPYA 2XNDD 4M76B 4C0XA 2JCXA 3KB1A 4BP9A 4YVFA 1USIA 2R6R1 4L0DA 4K9MA 1P39A 3HI4A 4ZPXA 4YP1A 3BWVA 5F5NA 5HFAA 5EKUA 2Q0XA 3ETLA 3L46A 5BW4A 2H1SA 4PX9A 1L8QA 4UUBA 3I2KA 1P2DA 5ARDA 4E31A 5LP6A 1G41A 1FBNA 1WUKS 3VHQA 1RWKA 3F98A 2H2HA 4PYNA 1JJBA 2R6FA 4KQEA 2O5RA 1UXHA 5DX8A 3AUXA 1U2GC 1IZ8A 4EFKA 4C2TA 2HK6A 1S89A 1E66A 1LUAA 4M1MA 1IDN1 3B7WA 4NR0A 4Q34A 4UBMA 1Z6QA 3ESXA 2H4ZA 1JIQA 3HPRA 2ZULA 4GVXA 3CKKA 4U9UA 3UMRA 4C4YA 1K5DA 3BWEA 3G9TA 2VJDA 4M3NA 3AX6A 3D31A 3DE3X 5DLEA 3ZI0A 4KAAA 3REGA 3SZLA 1A96A 5DGCA 5C32A 5K99A 4F91B 2ORWA 2ZTSA 1GFWA 1T2AA 1UCFA 3EJ6A 4PAGA 1XVIA 4NE7A 5FR2A 2NZ8A 2EZTA 3CPEA 3PWTA 4A0HA 5LQNA 3JQPA 1TO1E 3V8BA 3ZWDA 5D3MB 3UW3A 4YQEA 2Q9UA 1J1IA 4JWTA 3OZFA 5FPPA 5EWJB 3GYBA 4M83A 2J5KA 3K9GA 3PS9A 4JT9A 4MR9A 1P44A 4E2WA 2LE0A 4GECA 3MTIA 4DL9A 3GVIA 1DEAA 1Q0SA 1J1UA 1BX0A 4RA9B 1VMDA 3TVDA 2CV2A 1PJZA 2FPPB 1P17A 3BH6A 4DA0A 4EAAA 4CGYA 3MXTA 3EVTA 3QSGA 5IYZA 2X86A 1TQ8A 3HPQA 1IXYA 2F43B 2DSNA 4OU4A 4PYRA 1QU2A 2CN1A 3ZVMA 2CMGA 2VAXA 2OV6A 3SK0A 1FRQA 4GL2A 3JATA 2W8BB 2BEJA 4JJIA 3T94A 2B92A 2OFWA 4FW9A 3R76A 4TV9A 4AP9A 5JAZA 1UPXA 1JDPA 1VI2A 1AO3A 3OZBA 4FFSA 4J6FA 5AI8A 5CG1A 1SCNE 2IXBA 3T1YB 3CUEF 1TXGA 1YJCA 3HMKA 4R1MA 1QTQA 3TGLA 2FW1A 1TAUA 4DVGA 1QTRA 4QRHA 3R75A 1XCBA 4LQ4A 2VXYA 2IYXA 5G4LA 1GP2A 3WQRA 2CT8A 3FXAA 3NIGB 2P78A 3TZKA 5HIMA 3DV0B 3TLEA 1WB4A 1C9MA 5JLAA 2EFDB 4YXFA 5FBKA 1ZGZA 4II2A 3UJ7A 1SKYE 1XXHE 4GPTA 4FFRA 4DNQA 4QOEA 2EQ5A 1C4OA 1M2VA 5TF4A 3V8VA 4BN4A 4B45A 2G5TA 1JR3D 1L7OA 1W2WB 2CF5A 2PSHA 1M2WA 3I1JA 4DMRA 3DFKA 3HJFA 1RAAA 2GXUA 4QXRA 2YINC 4P86A 5FTNA 4P22A 3TK1A 3WHPA 4BS9A 2H7CA 3LX4A 5ALEA 1Y7LA 3KLNA 4S0XA 1D2EA 1PL0A 1RP7A 1YXMA 4V38A 2OXEA 1C8KA 4PYMA 4PIVA 1JLHA 3IQDB 3JZFA 3D7RA 3GJ6A 2CJYA 1RLIA 3RIYA 1X1EA 1L7PA 1DWQA 2VUUA 4PZCA 5LP6C 5IAAA 1D2NA 1YZNA 3GJXC 1Y5NA 2NX2A 2E18A 1NVXQ 4JS0A 1FNBA 3C6ZA 3WSTA 4KR0A 5KVAA 2HRQA 3PI7A 3VYWA 1VIVA 1Q12A 5KAMA 1NNSA 4JGBA 3OSUA 4WPGA 1LBSA 4Y1RB 4RZUA 4JQSA 1V95A 4F93B 2FPMA 3E9EA 3OX3A 5A06A 3O1HB 2NYAA 3O74A 2V45A 5IVHA 4NHOA 4RSHA 1EFRD 2BHSA 4IG9A 3ZDFA 5DNEA 3R24A 3NATA 2BV3A 3H2BA 4ALMA 2CBGA 1ZC4A 3S28A 3H65A 1VRWA 1E4VA 3OCJA 3O83A 4EEKA 2EX1A 4Q47A 4ZK2A 1R5BA 1Y4ZA 1D0IA 1O3YA 1W5AA 1H6CA 1KAQA 1OZ0A 2BHTA 2O2EA 2VF5X 4YCCA 1H0SA 2ZYHA 2QEQA 3BB4A 1ND6A 2OB1A 1VMKA 1BS1A 1NN0A 2WIKA 4OBXA 4DSZA 5B3JC 1FXWA 3E3AA 5KNDH 4H35A 1G9XA 2JA1A 2PJUA 3EEIA 4PPFA 4YYEA 4AO8A 1RMQA 4D4GA 1TIKA 1GUAA 2BKEA 3ETDA 4WLOA 3U7EB 4ER6A 1L5HA 1CV2A 4D44A 1BFKA 3TVTA 4WBXC 2RH8A 2VPIA 3CWCA 3EH1A 4LSZA 1TO2E 3EYWA 1PJCA 5HDQA 3R0IA 5EMKA 4EYQA 3ID6C 3W5AA 1XA3A 4WZAA 3GLGB 3QMPA 3ST7A 1Y4UA 3ZWBA 4DDTA 5JARA 1KXZA 2SNIE 5K3SA 4J7XA 1J8FA 1Z4OA 4BLVA 1P2TA 3USZA 3QEBZ 1A8PA 3QEKA 1QPZA 2J9XB 4FEYA 3ZOKA 2P9QA 4ALKA 1RCFA 4M1OA 4UTRA 2JFZA 2Q9BA 3BZWA 1D8TA 1LQ2A 1PL7A 2GF9A 4G85A 3RTBA 3I9LA 4UJ3A 1CZLA 3E6AA 1Y80A 3H4VA 2YXDA 1EFVA 4QGFA 3A6PC 3CFYA 4JP3A 4FGWA 3THWB 2QY9A 2X8BA 4YFYA 2WP8J 4J0IA 2X2PA 1EE1A 4MUJA 5E4TA 2NSHA 3OM9A 5SYAA 2ZB3A 2B3TA 2I2XB 3U37A 1F0NA 3LI2A 2FR0A 4O6VA 4N0EA 1I7DA 1MZPA 1EX1A 1B4DA 1EFHA 2H65A 2WJ3A 1LD3A 5HZGA 2ERYA 4WKOA 3ZQUA 4AXXA 2XCTB 4N48A 1QYVA 4HAIA 3DLTA 4J1SA 5A3RA 3M4XA 3U5TA 4IIVA 1EWVA 2UYOA 2YY6A 2WSMA 3Q7IA 5EHQA 1PGNA 4EJSA 1JB9A 2IXEA 5TC4A 1G7RA 1Z4QA 3L7YA 4LY9A 2XUAA 5EQDA 3W7VA 1JR3E 2LPMA 4BFCA 4GYKA 1CVRA 3DQZA 3WWYA 3ZV5A 4V0LA 2OK8A 4JCOA 2PZAA 5HNKA 2ASEA 3VSDA 1NPTO 2C7BA 2X3FA 3V8NA 4G1FA 2EZUA 4H18A 4N3AA 1EH5A 3OD1A 4P4SB 1R4NA 4BQQA 4C7MA 4XVUA 1OI7A 1NJ6A 2ZJ8A 1U90A 3H9JA 5FBHA 1ISRA 3LZCA 2NU8A 3R7SA 1RQXA 3UMBA 4D25A 5JSHA 3PQDA 2FWPA 5UKDA 3A1WA 4R8RA 5PGMA 1LW7A 3CLHA 1NQOA 2BL4A 3PGKA 2J4DA 3B3QA 3OZTA 4FE3A 3ZDBA 4XTRA 2FQXA 4NPCA 2HCFA 4TKZA 4XR4A 5EZSA 1YWGO 2K87A 5D6NA 3AXTA 1VHJA 4WKBA 1MV5A 1PWZA 4NAHA 2O2ZA 1VXRA 4QUHA 3FJ1A 1SD5A 1FRVA 3GFFA 1YR6A 5DNAA 3RSOA 4Z4GA 1XU9A 3L7LA 2P4UA 1A2BA 4G5OA 1P0MA 2WFLA 3K20A 3U0VA 4PVCA 3CUYA 4URUR 2DR0A 5DGIA 3UKJA 3JYHA 3KPYA 3UK7A 2FP3A 3ZR4B 4BN0A 2BGGA 1E2IA 2Q5EA 5A02A 3ZDEA 4KO8A 2VQEB 2ZBPA 4KRXA 2D5BA 1QHIA 2X23A 1M2JA 3CMCO 4FWIB 3D6MA 3PNMA 3QVGB 5KKCA 2ZWMA 3H18A 4KVFA 2XOKA 4N40A 4LJ8A 4AZVA 4PBSA 4HMOA 1GUFA 1MB0A 1Z16A 3IGFA 3OZ7A 3VTFA 1P45A 3AY3A 2ZITA 3STVA 3QIVA 2BGIA 4XGNA 4DVJA 2F1RA 4ZI3A 5LQCA 5FL7D 2J9GA 3DKKA 3F6BX 1NVTA 3FOWA 4URXR 2IE0A 3R7NA 4DWJA 3VSBA 3DWIA 4NULA 4I5FA 3VH3A 1OIWA 3V7YA 1WL8A 5HIIA 3U48A 3L41A 4WOKA 4PG7A 5BSKA 1D5WA 1EWYA 3DAHA 4PCLA 1RTTA 3AEQA 3ZK7A 1MXHA 2VYFA 1FW8A 4S35A 1CDZA 1I5OA 5ED0A 1WCWA 3ZWYA 3GIDA 4X62B 1O9GA 4LDPA 3FCOA 3FFWA 5JSUA 4RYDA 3A6JA 4ZVNA 1LV7A 4JI5B 1Y98A 3IUQA 4N65A 1LPPA 3FSJX 3MBIA 1M6WA 3N86A 2C54A 3D4PA 1TAQA 4KWEA 2V0NA 2C9OA 3FRHA 4WNAB 2D0PB 4B85A 3PGXA 1U7ZA 2I8AA 5AVUA 5C37A 2BR5A 1ZH6A 4EVIA 4LHEA 4MKXA 3L8ZA 3PJFA 1J24A 2O2IA 3FYUA 4H0NA 5I5GA 3VU9B 3MJFA 5HUJA 2W6MA 3HUFA 2EWWA 3P4YA 4X3OA 1YQDA 2HF2A 4RE6A 5EJGA 5KTOA 4KGZA 2E5LB 3DH0A 2GYUA 4EJSC 1DOAA 1JL3A 1L4KA 4H7IA 4OIMA 4Y6OA 3NUZA 1V5EA 3DMNA 1GQFA 3WQHA 2WM8A 3WLQA 1V1RA 3RC3A 4BLOA 1QRTA 4ZAXA 5M5BA 4JCCA 2CXSA 2H7XA 3PC6A 4DLWA 3F3SA 3H19A 5K0ZA 1PFWA 4WHMA 4H0CA 2X77A 1LWOA 1TM7E 4ENUA 2PMKA 3BIOA 4DJEC 1Z2AA 3C1UA 2PBFA 3CPSA 4I1SA 2EP5A 4R8VA 4HGRA 4XDZA 5AI9A 1DAOA 1TYEB 3CRZA 4BB6A 5CAEA 4KN9S 1GZ5A 1DARA 3AXSA 2IEDA 5JSZA 1N5LA 2WLTA 5AW0A 1M1NA 1T13A 1JB1A 1KDRA 3AB3A 2FW0A 4HDSB 1TUBA 4OLFA 4RLHA 5BQFA 1XE3A 4WMLA 5ICFA 3AM4A 4P2GA 4HFNA 3HVHA 5DBFA 2QP3A 3DC7A 1AMOA 2O7RA 5IDVA 4YR7A 1A3CA 1CYDA 2X13A 4UCXA 4IUBS 2GEJA 2C4WA 1A69A 2OM6A 1YS4A 1HE3A 4EPYA 1XI2A 1YJ5A 3UAZA 1QFYA 4DSTA 4H27A 2FFHA 2I4OA 4FUQA 1FOEB 1KIMA 2VPWA 1TZBA 2KM1A 3PX2A 3PEYA 1Q0HA 3QPBA 2EGUA 1T4GA 1SHLA 1TM2A 4LWZA 4OOFA 2KB0A 3P2YA 1D04A 1F2TA 2QYHA 3UTCA 1TM5E 3L0PA 4N6GA 3Q3JB 5DHTA 1R0CA 1FSPA 3U19A 4BO3A 2FQQA 3GFVA 2XY4A 2Z1NA 2VP6A 3I01A 3MSXA 4J3JA 2I3BA 3UMMA 1E92A 1W47A 1UBGA 2OVBA 3LCRA 3KETA 4WADA 1XTRA 4PPYA 5GY7A 2OAGA 1J2UA 5EL0A 5BWLA 2Z4SA 1FS6A 2ZIFA 4QG7A 3TM5A 1EIWA 4QTZA 1WDWB 5KVVA 3CX6A 2A78A 3R6GA 1W73A 4UNPA 2WYUA 4IVPA 4HAUA 5B36A 5DNUA 3OCCA 4NS1A 4ZARA 3EZ7A 2ZGVA 5IT5A 2OFFA 1ZISA 4YP7A 4EO7A 1ZM4A 4XA8A 2QPLA 2FLVA 3E0XA 2CUNA 1X1TA 3TTYA 4D8UA 4WGGA 1FS5A 4N41A 5EJ2A 1CRZA 2R4TA 4IUCS 2I4IA 3O2NA 1BVHA 1DJMA 1E1CA 2GJ4A 3W6UA 3SDBA 3U7IA 1XB2A 4TRNA 5EQTA 3E8SA 1L4NA 5CCDA 3ZDXB 4AMGA 4EDHA 4R2WA 1K8ZB 4PNHA 5D00A 1X8JA 1C1XA 5GMOA 2FW8A 4ZTUB 1K97A 3FETA 3PXEA 1U4OA 3FYUC 4HB0A 4QLOA 5F98A 4WLEA 4DJ5X 4EGFA 5CB4A 3FX2A 4V24A 5D7BA 4R83A 4WD3A 1ZD2P 5J2UB 3NKFA 1WB9A 3F47A 1TADA 3BXXA 2Z56A 2CLCX 3MJTA 5EQFA 2HBZA 5EE1A 1WVIA 2IW3A 2VAVA 3WGTA 4AW9A 2YW2A 1YE5A 5KIAA 2D3TA 3KT3A 1AJEA 3QBJA 5TE9A 3H84A 3RK4A 1K9VF 2HWXA 5IS2A 2CMDA 1N2CB 5JVDA 3VTZA 1F14A 4UPDA 3S2SA 1QGZA 3D8BA 4JBLA 3T4PA 1F9AA 1A0OA 2QTFA 1KRHA 2I7XA 2WE8A 1JFRA 4Y8VA 4UZEA 4NZ9A 3LG2A 1XN1A 3G2QA 4YDQA 3GG2A 4I55F 5AUNB 1EESA 2O8BB 3JD0A 3BXEA 2AFIB 4UJ5A 3V42A 3F7MA 5K0EA 4EW1A 5KQMA 4GXRA 2YXNA 4V0OA 4A8JB 3LV8A 4N54A 3TJRA 1KAEA 1V37A 3IPAA 3BGDA 1Y33E 5HE9A 3AFOA 1NAHA 3GLSA 5EXEA 4HY3A 3ORYA 2OZPA 4QULA 2DQ4A 2QTCA 1HI9A 3CURA 1XQ6A 3TR0A 2IZ7A 3JWJA 1HEYA 3ZY4A 1PR1A 3L77A 1WCYA 3D7NA 4Y1GA 1RHQA 2UKDA 1YIOA 3L4KA 5B3KA 3UCXA 1UMCB 3N0WA 1SOMA 5KHOC 1OLOA 2Z8ZA 4INPA 3AHJA 1R0KA 3F3KA 2BTEA 4Q9IA 1IN8A 5F1OA 1V7ZA 4XI9A 1QVRA 4MEAA 2PKRA 3OWHA 3AJRA 4ERXA 1F1JA 1LQTA 3HDJA 4E46A 4D82A 3CPJB 4DNFA 4E5UA 4F8EA 1SOAA 2QQEA 2X1HA 1UM9A 1BOFA 3GP5A 3ICVA 3MRTA 5GVSA 2A1UB 2A94A 1MIHA 2HMUA 3CG0A 3PDIA 4QWMA 4DMUB 5D3ZA 3HN6A 1HF3A 2O8FB 1E0SA 3HKBB 3H3FA 4MP8A 3FOEC 4X5OA 5EXXA 1TA4A 3GT3A 5C8YA 5FWAA 1I7PA 4RQTA 4EG1A 1GT91 2FAXA 3R41A 3B2NA 5JDCA 4KQGA 1Y7TA 2H6EA 3C7KA 4I19A 4KMOA 5IBCA 5K0FA 2FUKA 1NY5A 3V3TA 4WJZA 5CB8A 4E4YA 2ON6A 1X1SA 5CYOA 4ZCIA 3F7TA 5JY1A 2MSEB 1KYVA 4DIOA 1K86A 4XQGA 1E6CA 2HSWA 1EFLA 1FFBA 1G18A 2CJPA 3HA5A 2IV2X 4A2CA 4ZKDA 1PEKE 3DTVD 3NVMB 3CUTA 2QJFA 1DWUA 3I9KA 2X41A 3DDWA 3WB1A 4M2LA 4F4FA 3C5EA 1ST2A 4TKUB 4DM7A 4I5EA 4IOJA 2AQKA 2HMTA 2X5JO 2IWHA 1Z4LA 2C0PA 1AZLA 1TZJA 2IDZA 3FRJA 3GK3A 3R5TA 4O1MA 2J87A 5DYNA 5GONF 3UT5B 3MMPA 3P27A 2C4TA 3D81A 4PWYA 1VM6A 4YC7A 2P6UA 5DOVA 1FP2A 4G84A 1A50B 2CB9A 2PZJA 3R7AA 4M1WA 2EYQA 4R2IA 4EMUA 1ICIA 1OF1A 1CR1A 1LF5A 1II0A 2A9VA 4TWZA 3BL5A 3PQ3A 4DARA 1I13A 1GPLA 2FDXA 4J49A 2PWPA 3OVMA 3OP1A 3Q8WA 3R6LA 4L2IB 2BWJA 3L07A 3ZWKA 4QYXA 4EECA 1IATA 4AJLA 2FOIA 4RVFA 4P1ZA 1MO3A 3JRXA 2FMTA 1GPKA 4ZU6X 2YOHA 3ZNNA 2IY7A 1O03A 5CYPA 4FBMA 2CDRA 1JYFA 2XUDA 4KI0A 1DEHA 2QZPA 2G63A 4BOYA 1ESZA 5ICSA 4ZIRA 2BBOA 4X44A 4PQRA 5JRDS 4AFNA 1OLSA 3W77A 1JEDA 1YU6A 5TXGA 3ESDA 4BFUA 1Y1LA 5IEJA 1B14A 2ZAIA 4BC0A 1R8QA 5IM4A 3HWX1 1FJ2A 1IOWA 4TVSA 4FI3F 2A5FA 4Q9HA 1JG1A 3WR5A 4IQ8A 3IT0A 5ADWA 1TRHA 2FW9A 2EKQA 2WTAA 3MCTA 1FQJA 1H8EA 2P9ZA 2IUSA 2C3PA 1I7QB 2EJWA 2HJRA 3H1FA 1DTEA 2RKBA 4M99A 3UMJA 1JQ5A 5K0TA 4UVDA 4YREA 1UKAA 4HQRA 4MW0A 4ZVOA 3HWSA 2P4SA 5IWAB 4Y7DA 2NWQA 3ABOB 1IJKA 2IODA 1GL6A 3T1NA 4DV5B 3C1OA 5EMJA 1YCHA 4OU5A 3V4FA 2I6FA 3L0DA 2NV6A 4OK5A 4X1YA 2GZAA 3IE0A 3K0EA 1Q1GA 1L8AA 2DPYA 2GZ2A 3TE7A 1K3FA 4EZBA 3FRIA 4IHAA 5JECA 4UCQA 2BKXA 4O3FA 3VOSA 1VJ1A 3O1IC 3HBFA 5LDDC 4XX1A 3DEHA 1LLUA 5C8ZA 1E6LA 3UJNA 4LVUA 3GJ3A 5DGHA 2JJ1A 1MB2A 1E1NA 1PT5A 3Q8XB 4EWLA 3HXQA 1E2BA 3FFAA 3OLCX 3P97A 3NBFA 3U26A 5F5LA 2NNLD 1W29A 3JD3A 1PT7A 1CR0A 3RVDA 3CLTC 4KVGA 3AM5A 3RROA 1UT5A 2QTMA 3EQ6A 5JDCC 4ROTA 4D9FA 5KKNB 4BC1A 4HDRB 3LUGA 1E3SA 2OAEA 4NI5A 2BFBA 4LC0A 3VO8A 3L92A 3BJRA 2JCGA 3IIIA 1VSBA 4M6WA 4E1AA 4EHNA 4DR2B 4M46A 2O06A 1YUMA 3KBBA 1K3TA 4ZOEA 4FLFA 8ATCA 4D81A 3DL4A 4OPMA 1VGQA 3WBBA 3WICA 3TTVA 2FG7C 3DR5A 4TKVA 1QIGA 4MVXA 5AW9A 3HN7A 2BTQB 2PKEA 1YTUA 3NAGA 3RRFA 2PGDA 2B78A 4GI1A 4P5PA 4NDNE 3DOJA 3C1TA 1EJBA 4KXXA 4YP9A 1STOA 3G2IA 4MQEB 3W3AH 5A1JA 5JPCA 4B73A 3K0AB 4JKIA 3QSYA 4RIGA 4JC4A 2IZ5A 4UUAA 1S5PA 4UUQA 1QR6A 1U7PA 3B8EA 4IFTA 1U8ZA 3FCXA 4H7HA 2WMNB 5BP7A 2HD4A 2Q5HA 3OE1A 3MGCA 4PZ9A 1WPRA 3NIWA 5HQ3B 4CM7A 3EVDA 4IFBA 4TQ9A 1CF4A 4UULA 5CNIA 1HLGA 1KBQA 4MUFA 3GFSA 2GKGA 2AOWA 3EQ7A 1GDTA 3IIKA 1FFGA 3DSRA 3WDMA 4C14A 4EW2A 1KE1A 2JAHA 2QROA 3C6MA 4N3CA 3GLKA 5FADA 3G0IA 2RGWA 4MW9A 4B8ZA 1DWPA 3OTGA 2C4MA 2JIMA 1CZHA 4RVGA 3VPHA 2XEXA 1WCV1 2YDXA 2ZSUA 3WJ1A 3TECE 1QYRA 2RFLA 3NAMA 1ZKDA 4HZGA 5IH7A 1JWLA 2PLNA 2GF2A 1M6VB 1A82A 4D6XA 5LIRA 5IEBA 4RMNA 3ENWA 4J75A 4ZAVA 1R37A 1YJBA 3KQMA 2VAWA 2CSXA 3H7AA 4HC4A 5HZHA 1XO1A 3M1LA 4BMPB 4NKRA 2JLYA 2NVOA 4K81B 2PXHA 3JU3A 2WJVA 1XHFA 4PYOA 4DRYA 5U9CA 5KUTA 2BTOA 3TW0A 5AQEA 1JFFA 1KMNA 1UBJS 1YKFA 4NF2A 5EUBA 1B6SA 2LCQA 2PMEA 3QPAA 3DD1A 3V34A 2RHBA 4X94A 2XXAA 3GBPA 4ETNA 3LBNA 1ZN9A 2GCIA 2J6BA 1UJ2A 1LPOA 3SHOA 2DTXA 2P91A 1PFUA 3EH2A 3LSYA 4MJXA 4ZOAA 2OA0A 5A4JA 3VVCA 3FTEA 2OV1A 1GUBA 5FULA 3GDFA 1ZOSA 4PC3A 1QX3A 3AVPA 4DJFC 5GIPE 4D3XA 2GBFA 4UBKA 1V7PC 3M9LA 4YJDA 3HCPA 4HMPA 4HH4A 3ADDA 2EGGA 2IS1A 3KL2A 4KBGA 2ZDGA 3HFRA 3VNVA 4X90A 3ORHA 5LYJF 1FPQA 4LMRA 2Z43A 1PZNA 3UIEA 1T9BA 2AN3A 4EG4A 3B78A 5HIKA 3THXA 1ECCA 1Q84A 2JKVA 2PBRA 1OOEA 4GQIA 5LZ2A 3DL7A 1K4KA 4JXJA 4DSUA 1NKTA 2AZTA 3NC1C 5TEVA 1H3NA 1AY0A 3PFGA 4G5QA 3ZCQA 4RKEA 4DGQA 1CQJA 1NBHA 4JZKA 3SS9X 4BQFA 1CR6A 2ZRMA 1B6GA 3KT6A 4G41A 4HAWA 5HM6A 3UQYS 4EYGA 3L06A 1QP7A 4RSMA 4LRSB 5FYDA 3AOGA 3LL4A 4DCJA 6LDHA 1U3TA 1AGRA 5D1NA 1DQRA 1JHYA 1GUZA 1ZZEA 3LRTA 3PNVA 1MU0A 4RELA 1PZMA 2GILA 1Z4KA 3T3OA 4LZWA 1KTVA 5AJWA 3R9WA 4M9SA 2Q9CA 2R1VB 1FFCA 2GLUA 3MWDB 5DN6A 1HA3A 2BFCA 5LC1A 1UZAA 3W2GA 3AR3A 3D4OA 4MI3A 1ZN7A 4MLCA 2Z6UA 1AKQA 1NW8A 3QVSA 2PPLA 2OHJA 3IOCA 3VNRA 2C2ZA 3C3EA 5EKSA 2X5XA 4B2PA 4MXDA 1LKZA 3A28A 3EXFA 2GEVA 2VJPA 3A0RB 1H3FA 4P93A 4DAEA 5BQ3A 5JTTA 2JAPA 5LJLA 2ZM6B 2A3NA 5JG7A 2BONA 2FMHA 1WVGA 1N3BA 2PGAA 1L1FA 1CB7A 4IHQA 2V7XA 3NKLA 5B3AA 3KOWA 2ATVA 3RUEA 5FT9A 3OESA 2KYRA 3L40A 4L6AA 3S40A 4Q39A 4FBGA 3H9BA 4UNQA 1VG0B 1CUHA 1E9SA 1EBFA 3L7CA 3I2FA 1OV6A 4LDRA 4QECA 5BPFA 2AG0A 1H6AA 4Z4FA 3AL3A 1RYBA 3QKTA 3UHPA 4BKOA 1Y8CA 1TM4E 2P68A 1X9GA 3I9V6 4A5OA 3GFQA 3IODA 4W8HA 2BGWA 4F0JA 3L5OA 2C5FA 3L82B 4GP9A 4PSKA 3RSGA 4ZJYA 4DA8A 4P2BA 2IBSA 3OM1A 3FDXA 3IEXA 4BWYA 2FN7A 4KXFB 4W7HA 3LQRA 4XIJA 4LOJA 1QFXA 2ZR0A 4RWEA 1LQUA 4DSAA 3RVBA 2P5TB 4U1RA 1T6NA 2AC4A 4IX9A 3ZJUA 4BU1A 3D2CA 4RHUA 1X7WB 1K98A 1MRZA 2GHTA 1N6PA 4RD0A 4F7WA 3C45A 5T4HA 1Z6GA 3OHMA 2E0IA 3O8OA 1EP3B 2Z30A 1LRJA 2GGSA 2UYGA 3FKQA 3FWPA 3P1JA 2PYDA 9LDBA 2GN0A 4R71A 3DWFA 3OETA 1P4AA 1OXXK 1P4RA 2QLMA 1YRHA 2VHXA 3C5VA 4R5MA 2VTBB 4BU0A 5C1OA 3RSSA 2RE8A 1EUQA 3I2GA 4FVTA 3PEEA 3P2EA 1OUMA 1CUBA 1ZXBA 1I2BA 4NCXA 4JOQA 5IZ4A 2W42A 3KEGA 2VN8A 3GCDA 4KZKA 5BMVB 1PJBA 2IBMA 3A58B 3J7TA 3EEQA 1Q17A 3GPIA 4KACA 1AZTA 3FF1A 1C2YA 3ZQJA 4DIFA 2VJYA 2WD9A 4BASA 4B7XA 2GN1A 1F3LA 4GKJB 3M5CA 4U7WA 4CBVA 3AP2A 1OXVA 3DBOB 2VJQA 3OH8A 4EQZA 4LNHA 2ONZA 3HBJA 1K9SA 4C7BA 1NP6A 3AR8A 4N5NA 5JYDA 1M34B 1ZJ5A 3DG9A 4U5XA 4WXEA 3NALA 5L3QB 4N7RA 2DQKA 4HBZA 2XT9A 2FF5A 4KFCA 5DM0A 4I46A 1YR1A 1V43A 1W35A 1J0AA 3PZBA 4YMSA 1E2QA 1JHRA 2BC9A 2FEKA 1OFGA 5IUKC 4IDBA 2H54A 5EJ8A 3T5AA 1GWNA 1T9CA 1RRCA 1I5EA 2XWJI 2YHIB 1L2TA 4GBMA 5H59A 2FPUA 1W1WA 2VTKA 2Y1EA 4NZYA 2DLNA 4HGYA 4YASA 1ZVJA 1NQWA 3A27A 4JV5B 4G67A 3VZDA 2JH3A 3F5SA 4W82A 4ZOLA 4ZVQA 3INGA 2XMZA 1WSAA 3RM3A 3A9UA 5G0SA 2JLSA 2O3QA 2QRZA 5A05A 4Q48A 1GGNA 1XTTA 1C9NA 3EG9A 2FPGB 2HDOA 2I8CA 3AEXA 4OF4A 3CVWA 2ZJFA 2ZR9A 1LDGA 2W22A 3ZC3A 1PO7A 5EUQB 3CZ4A 4EKDA 4EK9A 4OQZA 2ZRAA 5DM70 2ZLBA 2ZUUA 3BWXA 5KDLA 1JTFA 3SR4A 4KKXB 1HLDA 1CJCA 1NN1A 2JI7A 2Q3DA 1ISFA 2NNWB 4J3NA 3F96A 1T3ZA 3KRTA 4XSHA 3RB8A 3X43A 3QWHA 3JVDA 4OHFA 5HVNA 4HLQB 4AZWA 3FCCA 1CJMA 2VKTA 4KL8S 2OHXA 4TYNA 1GSHA 4N7MA 1DTWA 2CCGA 4RQUA 121PA 3PJDA 3LHSA 1Q91A 4OQXA 1QCYA 5ED4A 3KOYA 4XRRA 3IKJA 3FPHA 3GCGA 4FLEA 1QHEA 4TROA 5FJIA 3ZIUA 4OYRA 2ADFA 5KYYA 3FB4A 4U02A 4MMXB 1V6CA 3E48A 3V97A 2P2LA 2K2WA 4XM0A 4NRDA 2NOAA 4DQKA 3H9CA 1N9ZA 1N2JA 5ADVA 1F20A 1M83A 3DLAA 1KQNA 3FTFA 4CG3A 4NTZA 1F0YA 3W05A 4RW0A 2QMZA 2JIOA 3OQ1A 2GOYA 1Y3CE 1WZEA 4LDQA 2GKSA 4X1KB 1QMPA 4M7PA 5FO1A 5LA6B 5BN3B 4TYQA 1HYBA 1K7SN 1XN4A 2L42A 1FRNA 3K09A 3C7DB 3V1LA 4IZIA 1U6IA 4G5FA 1ZDMA 2OLJA 1EXWA 4JOSA 2FZ4A 3DBLA 5HJ2A 4B33A 4D56A 2CHUA 4JQYA 1WLSA 2ZJAA 1GRVA 3IVMA 1F7UA 1M75A 2WD7B 3SP1A 5K5EA 3PXXA 3SIPA 4EEZA 2QJWA 3RAJA 3BXZA 1P7VA 3HP4A 4LZOA 4MICA 2WLSA 4PRLA 5FBQB 1FDIA 4JLAA 4TLAA 5MFZA 2IVFA 5KOHB 1PR3A 3KOOA 4CKCA 3UJ6A 4L72A 1ZIOA 4IZ6A 1W9MA 4E14A 5FWXB 1NG1A 1LCIA 4D9HA 2HSGA 4AMUA 4IJMA 2I7DA 3X1YA 2RHMA 1ISIA 3VOBA 1XNRB 3W9UA 1G6Q1 2MYNA 2P1ZA 3ZWMA 5IKPA 3K2BA 1FXSA 1I1QB 2WYOA 3EF3A 1U0NA 2QU8A 4II7A 1G5TA 3PQCA 2P6OA 3FA2A 3NHYA 4PAMA 2NXJA 3RUHA 2VDWA 4XQ9A 5B58T 3WRVA 1RM3A 4JFAA 4BYMA 4IEIA 1HR0B 4W5WA 3U4QA 3HBNA 1OX4B 4B7CA 4Z5XA 5ES4B 1VHTA 2BEUB 3GI1A 3OFJA 4GKAA 3RODA 3IS3A 2ZT8A 2QD2A 4JBNA 4JUIA 4WN9B 3M89A 1NQ5A 1OVGA 5T8KA 3D8TA 1I24A 3L18A 2WRZA 3DDSA 3AY0A 3GNTA 5HBRA 5F2NA 3WLAA 2O19A 4ZVVA 1Z63A 5IABA 1PR6A 1NDQA 2NV2B 1VECA 3LQ2A 3Q3HA 3F2VA 4ZTZB 6PFKA 2BHNA 3KKZA 4ARCA 2VBGA 1BS2A 1IOZA 3DXXA 1DAEA 3K35A 4AULA 1VYHA 4P3XA 4Q3LA 3T3NA 1UWCA 2CSUA 1E2UA 2R44A 5FA8A 3TLBA 3AIMA 5I4KA 1EE2A 4TV8A 1ZW1A 5CDGA 1GUDA 1V11B 3N2YA 4K9KA 3I5MA 2HHJA 1L5LA 3ZGYA 1W8DA 2POQX 3KCNA 1E9RA 4PSVA 4FOLA 3B48A 3LECA 1GRCA 2AXQA 2I65A 3VPAA 5F3WB 2ACWA 1W1IA 2JBAA 3WWDA 4HS9A 4PYLA 4PHGA 1EYZA 1Q14A 3RIGA 4F1KA 2FEOA 2QRKA 3LZDA 3T8YA 2LZ0A 4C87A 3PF8A 5BSRA 1Q0UA 4ITUA 4YCMA 5IDXA 1ZUD1 2J3QA 1DKRA 1YCDA 2NVUA 1TL7C 4BVJA 2UZ1A 2OY0A 3AW9A 4YV2A 5A3JA 3HDQA 4AO7A 1NXVA 3FWKA 5FIUA 2HWWA 5TQ2B 3UVEA 4B46A 5JQGB 1U11A 2J0VA 3G0BA 5TMEA 2F3SA 2VBCA 2ZUVA 4Q1BA 3V2GA 3V8QA 1GJRA 2AXEA 3I4FA 1ZGCA 1JXMA 3D0OA 1PR4A 1QS0B 2V9ZA 4QKQA 1X77A 4GF5A 7ABPA 1BQEA 1QHYA 2XGMA 3ZBUA 2O8EA 3K09C 3O75A 4BUJA 3LC0A 2CK3D 1NULA 1RDFA 1R27A 3H8VA 4G97A 4ZCPA 4IV0A 5LBUA 4YIHA 1OIVA 2EX4A 2J85A 5LU9A 2O7QA 3PC8A 1JH9A 2QGNA 1U0BB 3KBOA 5FOVA 3ZKWA 4OHYA 1XTJA 2SCUB 1RRVA 3P0FA 3UPDA 3V1MA 4RULA 3FPCA 4FN4A 4BIMA 4Q93A 2IOHA 1XVLA 2AYXA 3RKUA 5DE3A 1SCUA 4MVJD 4LI3X 2TMDA 5CDYA 1S01A 3WFJA 2R87A 3U31A 1E64A 3A37A 4FB5A 1GQ2A 2PVSA 2REOA 3PXBA 5G0TA 1ND5A 1DMRA 1I32A 1O95D 3IHLA 3ZQ6A 2Z83A 4QEZA 1G8SA 1R12A 1E3EA 1L5MA 4TKMA 3FTCA 5IFLA 1Y42X 3RUCA 3I05A 2Z8YM 2B30A 1ZSYA 1DO8A 3Q5GA 1ILWA 1T8SA 5HBGA 1RZRD 3DF7A 3X1WA 2J7PD 2G8NA 4F38A 5JMPA 4UDNA 1T3GA 4NAVA 3QP9A 3TLCA 2ZWAA 3RG2A 3DCJA 2ZB2A 1BCSB 1V2HE 1P5FA 3OPYB 1ZINA 4R6WA 2AEEA 5I7VA 2ZJZA 4WXMA 3MGBA 4EARA 1JQBA 4I5IA 1S96A 1RZRA 1DHRA 4ZT6A 2HK7A 3NBZC 4IRXA 3PRKE 3MWJA 4WE3A 2PL1A 3IQEA 3K9QO 4X8MA 3D3QA 5KNDA 4D0NA 3H2JA 3ZJYA 5TV2A 5KQRA 2IHUA 1XZNA 5T8KC 4CCAA 1TJYA 3IOBA 1T0JB 3H86A 5K2OA 3PITA 3AMVA 2BY4A 5CIYA 2O07A 3K5WA 3P9XA 3GLIB 3EEBA 1H94A 2PM8A 3IJPA 5EXDA 5G4KB 3UB3A 2VF7A 1RI5A 3F7NA 2G9NA 2Q3LA 2ZT5A 5LD2C 1YQTA 1PV1A 3IR6A 5M2QA 1RR6A 1T2VA 3H5RA 2AOUA 2BMAA 5DULA 3ZCTA 1F2VA 5C4GB 3KKEA 1Y6GA 2VOEA 1R7RA 1SJ9A 1BJKA 1FFXB 3ZE7A 1V25A 2EP7A 4QBGB 4X97A 4BFWA 3GELA 4D97A 5JR3A 1P62B 1F06A 4GDFA 1GYPA 2Q3EA 1EZ1A 4X1IA 1C4XA 1WUIS 4UHKA 3T1VA 5BYAA 3L0BA 3ZQKA 5KNLA 2UZ0A 3M6AA 2AG6A 1QHHB 3QUQA 1ONOA 1QYCA 1MX1A 4WDRA 3RVKA 2ZJBA 1VP9A 4XX0A 4GBGA 1V96A 5FAXA 2RGEA 1XDGA 1H2YA 1DXYA 1XTPA 2CNNA 5E6RB 3CC8A 3R8XA 5I4BA 3G6WA 4HL6A 1BDJA 4P8RA 1AIPA 3ICOA 1ELOA 2I55A 2B20A 4ZQFA 3AFMA 2I34A 5HKLA 2WZCA 5I7HA 4Z4QA 3NYRA 2ZK7A 1I0LA 1B1CA 1XZIA 1Z0IA 2GNAA 3VU0A 2RHHA 4BBJA 4O08A 2MSNA 1OB2A 1H2ZA 3QHAA 3ASVA 4NH4A 3UFXB 1E4OA 4LPKA 4YRFA 3IQXA 4M7RA 1HNZB 3UM9A 4G0OA 4CTMA 2EC5A 3BHIA 3HN2A 3WIUA 3QX9A 1EA5A 3D54D 2BR4A 1FU4A 2CDBA 3DGEC 3N8IA 3PJEA 4PN3A 4C05A 1E1QD 5AMXA 1SKBA 3GA5A 2IHVA 3PC8C 3QVXA 2IY8A 2QN1A 5C8VA 1UOPA 3RBZA 1NASA 2IYLD 1OH7A 1JLKA 3EDRA 3UWMA 5DBGA 1GA4A 4V0SA 4ESVA 4TYPA 3K2IA 5TPWB 5EWMA 1AK9A 2V0CA 3IC5A 2XZTA 1OBCA 4BLRA 3ZV4A 4FS3A 4EPVA 5DKFA 2PRSA 2NIPA 3PSAA 4GVLA 1PVOA 1ZBQA 1EG7A 2V7QD 4ZHQA 1EXMA 3GV0A 2FX5A 1I4EB 3NT2A 4WFQA 3C6BA 1KTIA 2PS1A 4Z1OA 4H1TA 1R15A 3PUWA 1EKXA 3LUFA 1E0JA 3SSAA 2DR2A 1YNSA 2IIBA 3THOA 2PUVA 1M2HA 3FHCB 1V4NA 1G55A 4I99A 1CZKA 2PAAA 3TAHA 3ZDZB 4A9AA 1XZFA 3HCNA 5L7WA 4F84A 1BO6A 1MMFB 2ZCVA 5JPDA 2QM8A 4Y2JA 4DJJA 1N5OX 4NBWA 3G2HA 3UPUA 3K1ZA 1RYZA 1X8KA 1KK3A 1ECBA 1NUQA 2GCGA 3OEHD 4N3BA 5BQXA 5F64A 3Q9LA 7YASA 3M1AA 3ZV3A 3Q3VA 4MP3A 1E32A 1PW7A 1JQAA 4IGFA 4RD3A 2MCFA 3KL4A 1IN1A 3MTBA 3VZRA 4OQMA 1BSVA 1R74A 4LE0A 3C4VA 1R18A 2HPVA 3DZJA 5A3VA 4LRWA 5SZJA 2GJ9A 4TRRA 1Q3HA 5LU8A 4HJXA 3AM3A 3Q3EA 2NU6B 5FI1B 1T5OA 1BQ3A 2JD0A 3AEUB 3T5GA 3KZVA 2VCEA 3IIEA 1DADA 4D0RA 3SJAA 2ZRNA 4WCDA 3PWKA 3V00A 3ONWA 1HQYE 4DV4B 4UHEA 3N74A 3P32A 3K1AA 4NZPA 1FP4B 1XU7A 3RFCA 5WRFA 1UKCA 3A1EA 3FMOB 4JJKA 3L8HA 1S4QA 1T9GS 1XZQA 2X5OA 5IBPA 2ZRIA 3YASA 1RFLA 4Y6GB 4MQFA 3RC9A 5BN4A 3J7AC 3HABA 4IV5A 3S7TA 5EHXA 2VC2B 4Q4CA 1ZONA 5C52B 3O94A 4IDEA 1ZH0A 3OIDA 3BIFA 1U9CA 3V2UA 4MHOA 5J2UF 3IUYA 3DNMA 2H7VA 2XDQB 4JUFA 2BGLA 4RPGA 4F5EA 1RWXA 1W0KD 1FDWA 1JHMA 4HF7A 3OZWA 4LYHA 3LDGA 1W76A 3KHUA 5C80A 2ILTA 2JFQA 3NP9A 2QW0X 4V0ME 3OMLA 1W85A 4M9XA 3MAAC 3B6EA 2OCKA 4YJ3A 4M1SA 4CKWA 4LZJA 5IF9A 1C7QA 2GR9A 5L40A 4UVEA 1Q19A 3T3HA 5KPDA 4XOIA 1N6KA 5TQJA 3ZZMA 3VR5D 3PNSA 5LQSA 1WCIB 1M2NA 1E1DA 5K45A 1G7CA 2GAJA 3SAJA 2OP0A 3ZE2B 3DFMA 4L9RA 4E11A 2HJ9A 2YV2A 3E03A 5LMUB 4NOKA 4FDMA 5EP2A 3O4JA 3WLIA 1H9CA 4FCWA 2Z98A 2ZRDA 3AWDA 5F4BA 3TOXA 3VR5A 2JZCA 2D5AA 2Z95A 4Y2VA 4ID9A 4L85A 1MJNA 3HVUA 4V3BA 5A0VA 3WLOA 3SNHA 4PRYA 3Q3IA 1J8QA 1PUIA 2FWAA 2OVFA 3IB6A 1P0IA 3E9ZA 3WBFA 4E5KA 3E22B 4ZVPA 3K6RA 1ESEA 1H5QA 4J7UA 4QU0A 1KMQA 4HEQA 5HPYB 3I76A 4CG0A 3NJ4A 1AMUA 1J5XA 3C85A 2PQ2A 2QVXX 1IG0A 4K88A 1NM5A 2HEIA 3RWMB 3SEAA 2IF0A 4BVBA 3C3CA 3TOSA 1KI9A 2VDVE 1B8PA 2PIDA 2X0RA 1BU5A 3E7DA 5JO9A 1T9KA 1TTPB 3GT7A 4I50B 4MUYA 2RCYA 4WOBA 2ZQYA 3HKEA 3WYCA 4JGGA 4KUHA 2DT5A 4MRVA 4WEOA 4DLRA 2PUGA 2XECA 3W1VA 1H4TA 3I4LA 2XBMA 1K8QA 1KBZA 3AIKA 1IBKB 4N0QA 1D1SA 3DR3A 2JDID 4UEWA 1RLUA 4O5AA 3WSWA 4XVHA 2YJ6A 1I6LA 2VP0A 4HADA 3MVEA 3H2YA 4YMGA 2VYND 3H5TA 1U3CA 4BNVA 5B7QA 1K5PA 3DULA 4QDTA 1XRLA 2GBCA 4QDKA 3UAOA 5HJEA 3OP4A 3U6BA 1EPUA 2J0QA 4NATA 1UJNA 2BEKA 2RBGA 2V7TA 4FK8A 4FS8A 4R1UA 5EZYA 2ZVJA 4QO8A 4CETA 1W7AA 1QVZA 4UOZA 3H1EA 1QRSA 3ASUA 3B9PA 3D5EA 1KEKA 2DHDA 3BMNA 4MW7A 5DI3B 4PGGA 3S1LA 4DQUA 4K87A 3RH0A 4BCCA 3GLHB 1SMKA 3O92A 5MGBA 2HA0A 4NONA 3GGDA 1H1LB 1RQNA 1MO5A 2P0EA 1ORIA 4BMSA 3JZIA 5JI2E 1DQZA 3NGLA 2IYAA 3DKPA 3F9CA 5GV8A 4EG3A 5IJWA 3SBXA 3GGJA 1I9CA 2Q1XA 4I66A 4EB6A 4K9SA 3DNPA 5LFAA 3MTEA 4GI5A 2Z04A 1GZDA 2QYSA 3G8YA 3L04A 4EJFA 4P32A 1QNFA 4U7HA 1HQKA 2D13A 4G0YA 5T64A 1NNLA 4Q9KA 4TM7A 1QO9A 1U2EA 2J3KA 2I9KA 1F1BA 3HDHA 3OQVA 3U7QB 4CQJA 3NBAA 4M0KA 1NQAO 4RU1A 4TL7A 3LCCA 4EG6A 3SDSA 2QT1A 1MPXA 3CINA 4AZ3B 1RRMA 1Q0LA 4NXMB 2O2CA 2JLQA 4M7WA 1CT9A 3C43A 2R47A 2PN1A 1M0WA 4ID3A 1SXJD 1DXHA 4O4LA 2G83A 4FYJA 1K6JA 4PINA 1L4HA 1OU4A 4RMGA 3VVBA 5JMTA 1RE1A 2BCGY 2Y1DA 3FVWA 3QA3E 5E6SB 2DBRA 3H9QA 5IJ9B 5EVJA 1YRQA 3K71B 2AT1A 3H9EO 1DUVG 3HKDA 2JIPA 4FKZA 3V32A 1Z83A 4D4IA 4MDFA 2ORYA 2FJUA 4G9EA 4XLZA 1C9YA 4PO3X 1Q7TA 1DELA 4MARA 2DWCA 3C3AA 3PUJA 3ER6A 2WWVD 4RAOA 3QOYA 2WHEA 4UAJA 4YJKA 4EI2A 5JXJA 3AIIA 5KX5B 3TBFA 5HRAA 1T9HA 4O2AB 2PFSA 2IHKA 2GK6A 3EQ2A 3LS2A 2QRPA 2M98A 1DC5A 2MSKA 4LVCA 3ZE0B 3PEWA 2A5LA 8AT1A 1HKHA 2QV0A 2WVHA 2J59A 3OIVA 3QG5A 3LCJA 4JODA 2J3MA 4PANA 5E8RA 2HCRA 3AI2A 2CDNA 3LHDA 1J1ZA 3PP8A 3W34A 4A03A 5GINE 4ZZ3A 1NM5C 3AB8A 2G1UA 4PZ0A 4C30A 4ZRNA 4H6VA 3V4RA 2DLDA 1PIWA 4MRSA 4LHYA 1XAHA 3FZGA 4RF3A 3BIXA 3EPKA 4CKEA 1J39A 1Y5IA 3HBAA 1H8HD 2BE7A 2DUUA 3HO8A 3K2EA 1RRFA 3KDAA 1II9A 2PT9A 5JEEA 1C3OB 1UKEA 5JWRA 3QJGA 3LP5A 4M8NE 1RXVA 2O8FA 5GJBA 4PFSA 4I4TA 2H4JA 2R3SA 1VA5A 1L3BA 1GQRA 2EOAA 2CYCA 1E99A 3EIUA 3PB3A 1XD9A 1ANKA 1YQ9A 1I2AA 1ADCA 1G20B 3F4BA 1Q1NA 3GZTB 3EGEA 3NV9A 4GRIA 3WO1A 1YTLA 1IQUA 4BQPA 3CH4B 1CERA 2FFQA 3S2YA 3E7XA 1VGVA 3IAM6 2F3RA 4B48A 1LZLA 4N76A 2GCOA 3C97A 5HTKA 3X1DA 3MOIA 4AD8A 4AL4A 3BFPA 4O4JB 4C7OB 3KWLA 1CUVA 1TQ2A 3OJXA 3D8UA 1XTBA 1E6WA 1MQ8B 1YQWA 1TI7A 2KSQA 3TJMA 3O38A 2C5HA 1VCOA 1DC7A 2HNKA 4KOAA 1JLSA 1DBSA 2P90A 1M74A 1PZFA 2Z5FA 3HCBA 4D9BA 1PNRA 2H16A 2W2KB 1VSQA 1GVNB 1SURA 1E7QA 2R1TA 3RT9A 2V4UA 3ASYA 2O8DB 4WNCA 1LSUA 3CRRA 3GQBB 2Y8EA 4M9ZA 4CXMA 4BLSA 2ZUCA 2F7SA 2JEZA 2QA5A 2WM2A 3FLMA 3JVUA 3KHSA 1SXGA 1WP4A 1ITZA 3M2PA 4J0CA 3V9PA 2CYAA 1M76A 6AT1A 1K1EA 3GLQA 3E3NA 4CQLB 5HM8A 2VHYA 1VZ3A 1EGAA 4IIJB 2KI5A 4LJSA 1MHTA 1Z3CA 2YN0A 3JAWB 1GCUA 1KYQA 1R0RE 4V03A 5FOTA 3VBEA 4IF6A 5E4JA 3U13A 4GOJA 3GH1A 1Z5UA 2E82A 2WWXA 1HTBA 3OZCA 3HS3A 3FSEA 4MRMA 5EPUA 5KNCD 2FUNB 4F3NA 3HY6A 1XMQB 3E9YA 4EUNA 2QG4A 4DCPA 1RJDA 2P7HA 2N1BA 3ISVA 4PBTA 3ZWOA 1EVJA 1Z7GA 3JV7A 4KEAA 1YC2A 3CBQA 3QKSA 2B2NA 4WY2A 1N0VC 3DHYA 3I42A 2HU5A 3GJYA 1N5IA 3K16A 4NENB 1T1GA 3QHPA 4NABA 3B6KA 2NTNA 4C04A 3HB5X 5JY6A 2PLWA 4WDQA 5HW0A 1LPSA 1TM3E 3PQ6A 3UJAA 2R751 3FNHA 1SY7A 1THTA 3WMRA 1GTG1 2WU3A 3CF2A 2V0GA 1L5GB 4KC0A 2GEDA 2Y93A 4GR4A 4L8VA 2MDTA 1BX3A 4G8BA 1ZL2A 1VLHA 3EBOA 4UTNA 5LMNB 3SEQA 3SMVA 4DCTA 3PUYA 2YZ2A 1Z26A 1EXVA 1EWQA 3QLVA 4IYRA 2P7IA 3FCUB 3GJZA 1XQWA 4RY9A 2WKQA 1C2TA 2CJFA 1LJUA 2EP8A 5BUQA 1CNMA 1ECLA 3KTAA 1LNZA 3KJGA 4EBFA 5FL3A 3W5SA 4XCXA 1AB6A 1QGUB 3I09A 3Q5DA 4OQFA 5CLQA 1A77A 4JAVC 4GC5A 3NAZA 4LMPA 5DYWA 2WT4A 3NP7A 2IITA 1QV6A 2HSJA 1X80A 1BN7A 2GDZA 1F6BA 2JIZA 3WGYA 4HDNA 3SPXA 1N7HA 3VO9A 1RLOA 4DZTA 3BTSA 2CL0X 4ETWA 3JVIA 2R6JA 1NX9A 2QW1A 4W5RA 2GYYA 4UXJA 1J22A 2FYTA 3KV3O 1JQEA 4Q1CA 1E5TA 1KO4A 4IDOA 5EIWA 3T1TA 1UZNA 1K92A 1A7KA 1KMHB 3R5SA 4JP8A 1ZQ1A 3DMGA 4REQB 4ZO7A 3LQQA 3D9QX 2G06A 4YHHB 2XVZA 2OZLB 2LTAA 3AR6A 1FSZA 1CR2A 1PKXA 1P29A 3HVKA 4MR7B 4NU5A 3IE1A 3K6SA 3KUKA 3RGGA 1V8OA 2IXTA 4UATA 2C9MA 1ZMBA 4GE3A 2POCA 3KU4A 2BLNA 2G77B 2O20A 2OCGA 4PYQA 4ILEA 2VP4A 5L7YA 3VV2A 3EGIA 5AM3A 3U3RA 2XUPA 2A9OA 3PXAA 2CLEB 3TS1A 4EOGA 3THWA 3DCIA 3PPVA 5J43A 1RBYA 1M1UA 1QDUA 4R6XA 3H2ZA 5IG2A 2YMQA 1EFKA 4XYGA 2V59A 3KQVA 5CFQA 4KAJA 1T15A 5FWNA 2ID9A 1GAQA 5HK9A 1G7SA 2DU8A 4XCQA 4GXNA 1G3QA 1SQ6A 3KPJA 1YVRA 2QWXA 1DFHA 4PLPA 2JHGA 4UUNA 5TPZA 2VQFB 1RIIA 3ZGLA 4ZYZA 4LJAA 2AR0A 2C9DA 3T3PB 4ER7A 2VZ0A 2D62A 2VZ9A 3T7EA 3TD6A 4ZJZA 1UMBA 2YN2A 2ATCA 2J08A 4I2NA 1VLQA 1Z5GA 5EZ5A 2XVXA 2JJYA 2Y2VA 5EG5A 1CD5A 5FX2A 1Q2UA 3I5XA 1VSVA 1YDEA 2GEBA 4QYMA 2FZLA 2JD1A 5LB2A 1EUDA 2CE7A 1LTQA 3ON5A 1Z2OX 4GZ6A 1G2OA 1YOVB 4GR5A 4AY4A 4MR8A 3CVVA 4CMIA 4OSEA 2JGFA 3P71T 4I3FA 4D4KA 1GG5A 2QAIA 3WL3A 4QVIA 3U4GA 1TX4B 1QC5A 2OKCA 3QF4A 5EWLA 4EABA 1NQUA 3BD7A 4BY9E 4EITA 4CKZA 5A6SA 2ACEA 1H3EA 2HIGA 3FBTA 3CSUA 3CR3C 1XXHB 3LW7A 1BXRA 1KQPA 3D1JA 4UU7A 3CRVA 1HTTA 4FX2A 2QD3A 4TRMA 4F2WA 1ZX1A 2ARKA 1T9AA 3D6AA 4PGMA 3VPGA 1EB9A 4CIXA 2PX3A 4MLDA 7REQA 1L7AA 2E85A 2E4UA 4QTUB 1JIUA 5CFRA 1R1DA 5J4LA 3L8YA 3QUAA 2BZ0A 4JUBA 1PFKA 1NBEA 4KN6A 3RVOA 3W8DA 4MPTA 3KK0A 1GGJA 3B5IA 4TN5A 3U7JA 4PG5A 5CVUA 3TB6A 3QWBA 5D3QA 4EZEA 1CTQA 2ZAYA 5H0IA 4FZJA 3HDVA 3MINB 4F92B 1N33B 2Y67A 2NO0A 4LYAA 1EGMB 5H3HA 3TDMA 4HAZA 4B3GA 1LH0A 3NLLA 3VJLA 5LP6B 2IXGA 2HMWA 2X6TA 2PNJA 4H59A 5E6UB 2FLWA 2AA3A 3ZVLA 1HPLA 3DMFA 4ICIA 2NO6A 3A1TA 5C1PA 1CF9A 2GARA 2HNBA 4JLDA 2IUFA 3D0QA 5IKOA 1QO0D 2AMLA 1XF9A 2WOOA 1DQYA 3QX3A 4O8CA 1F6DA 1ZOPA 2XCQA 4RKYA 3NC0C 4Y67A 2AV6A 2RHOA 2XAAA 3ESRA 3FB1A 1Y4AE 1W6RA 1GAWA 1SULA 2FEXA 4NESA 5K3DA 4WKCA 1LDBA 3GPCA 1KJZA 4L9SA 3B5EA 5DW0A 1QO0A 2O1SA 4FNMA 4HWPA 1EFUA 3T7JA 5BRAA 4CG2A 1JAXA 1B0UA 4ZVMA 1ADBA 2C1XA 3FG9A 5HTOA 1L5FA 3HFGA 3KKPA 3OY7A 4JKYA 1EG2A 3IR7A 4MQBA 4FFMA 5TVGA 1G2IA 3KM0A 3C0KA 2VP3A 1I51A 1NZJA 2EQAA 1ZCBA 3M2TA 4KDCA 2XTZA 1RXCA 1BGVA 3ETJA 5I9MA 4S24A 3RS3A 3IV6A 4OSOA 2G9QA 3N2LA 5KNBD 2EIHA 2MR6A 1TAHA 3OE7A 5CVTA 3K05A 1PEDA 3J80A 4MR9B 1O4WA 1RPZA 4LCEA 3OCXA 3BA1A 4LHVA 2YWJA 2WSSD 4G0QA 1OTXA 2J0UB 2QRHA 1FFEA 2WV9A 2QIOA 3K4PA 3DC2A 1Z5OA 1FMTA 4I9UA 2BOVA 5JISA 1FSGA 2NP6A 1F8YA 4PLVA 5E7QA 1QYDA 4HWRA 1QMGA 3WLHA 1ISJA 5IYZB 5LUAA 3H4TA 2WSSA 3U6KA 4RA9A 1CQXA 2ZYGA 3C3JA 4E3ZA 3HU1A 1ZUNA 4F4JA 5BW8A 5CGZA 1PP4A 1TFRA 2FPPA 4M37A 2WKRA 3WLRA 3X1JA 1XQVA 4DLZA 3JATB 3VKWA 2C1EA 3Q6NA 2A9KA 2VVTA 4TV9B 1QRDA 4M9QA 3LM8A 1HO3A 2YXLA 3BH0A 5ALLA 3A1DA 3R6WA 3IO3A 4B09A 4G1VA 2IF2A 1AO0A 1D4OA 3FPEA 3RLIA 5ITZA 3U7FB 1UWLA 1U63A 5IX8A 4WLUA 2FNAA 1ETHA 4W7IA 2WUVA 2X0NA 3WLTA 4H9GA 4S1VA 3MJ4A 1XZBA 3OKAA 4GPIB 4HQKA 4LV8B 1XVAA 5EE5B 2UYHA 3M1IA 3WL6A 1I7SB 2DX7A 2GBIA 1YB7A 3OPQA 4YJHA 4U2EA 3LT1A 2P1RA 2HX1A 3EGOA 1HC7A 3VMMA 3VU3A 4ZEWA 1L7DA 1M2VB 2ECKA 1LDMA 4XM1A 4AN1A 2F9FA 2W2LD 1N2SA 5H5JA 5FQOA 3FZYA 4LWPA 2PZFA 2FSIA 1VCHA 3G13A 4C89A 5JHGB 1RXIA 2BFOA 3CZPA 4B6QA 4X7RA 1TKBA 3D0RA 2IHNA 3N7AA 3N0RA 4MQMA 4GI3A 2ORIA 3HJAA 2JF0A 2GPNA 4HCJA 2O8NA 4K05A 4LF4B 1YVUA 2DY0A 3GW8A 3TNYA 1HT1E 2X9VA 3E1KA 4A1FA 3L4BA 3OE5A 5KS2A 2F1HA 3W2FA 5F9MA 3C3MA 2UXBB 4MWTA 4BV2A 3N87A 4FC7A 2YV3A 3IDZA 1Y9AA 4MYUA 3KE9A 1KEEA 4AJ4A 4O0LA 3I8OA 1JXOA 2WUFA 3K7EA 2GEKA 5DJ5A 4CQNA 5JAIA 1RQPA 1JAYA 3HUEA 2VAPA 2YWBA 4A0FA 1LRLA 5LA6F 3NMUF 3QH4A 2ZEJA 2WKWA 1LB1B 3IP9A 1MZVA 5JADA 1N2GA 1G5IA 3E8MA 3BK1A 3T0GA 1V4VA 5EKXA 3ISJA 4CL0A 2BBWA 3B82A 4P4TA 4DDHA 1XDBA 1TCCA 1WHTB 4KX3A 3SHVA 1SVSA 2YJ4A 1XRJA 5CMLA 2KW5A 2ZUFA 2E87A 1S2DA 4XPZA 1UEXC 4D5GA 4KPYA 3A6ZA 1TIPA 2YJGA 1H1TA 5B6PA 4EY4A 2VK8A 1KJ9A 2WAOA 2ZJ2A 4WN3A 2I1VB 3HADA 3V3KA 1ZVVA 2JLAA 1M6EX 4H60A 1QBGA 1T0BA 5IP5A 1CCWA 2HJHA 2IBTA 1YZFA 2ZIUB 4MQ5A 5DM2A 3W5VA 1XDZA 1R0BA 1IBMB 1HSOA 1WMEA 5JASA 4CTOA 3CZQA 4KWHA 4Q3CA 2CC2A 2MIIA 2Y0EA 3TAUA 4D43A 1FQOA 1WUTA 1NZFA 2FP4A 1GPYA 4KDRA 3BDAA 4LZPA 4WZAB 2JGNA 5ADUS 2PGIA 3BIJA 2Q3JA 2XE8A 3R5FA 4IHKA 1XC7A 4KHPB 2HLNA 2A5DA 2ZJ3A 4X61A 2OD2A 4HO1X 2VYVD 2G70A 3OQOA 2XCUA 2R79A 3LUBA 3PWSA 3A3NA 2X42A 3HZRA 1COWA 1D9ZA 5CW1A 1M5RA 1T2DA 3I34X 1AGYA 1REQB 4MAMA 2RGAA 1PAUA 2C4KA 2XHEA 1SZJG 4RVOA 1SU6A 1KIFA 1EFVB 3ANXA 1ZHFA 4NFHA 5BQ5A 2IIQA 2W2TA 2YXEA 2D5LA 3U9SA 1IZ9A 4C2AA 4C4TA 5INTA 5I9LA 2CLIB 2QUIA 1DS6A 5DH9A 1OWLA 4AZTA 2PGOA 1L5WA 2C1ZA 3FNGA 4Y2PA 4OLAA 2UV8A 1R50A 1GYQA 2ZBQA 3LO5A 4BJ6A 1NFQA 2H31A 3CZAA 2Q5LA 3T34A 2XUHA 5EJ5A 3GAFA 5JYCA 1J25A 3EMVA 1SQSA 1RW4A 2Y77A 3GA7A 4QPZA 3MG9A 3O3MB 1EXNA 1KS9A 1UOOA 4XEUA 3NG1A 1SQFA 4CMKA 2IZ1A 3LQFA 2PE5A 1U8FO 2I76A 2PMFA 4EJSB 3PT9A 4F9EA 2DF8A 2EF0A 3Q8LA 5BURA 2X7HA 4WK0B 4OQEA 4QOIA 4PM4A 1MORA 4QXQA 1QAMA 5D5HA 2XCRB 1L6RA 2BKUA 3L6RA 3L4BC 4W8OA 1M66A 4MQLA 2C2YA 2OUKA 2RCNA 2PMCA 3D3JA 4MV4A 5DT2A 1KPIA 4BTLA 2JFHA 3GHHA 3M6XA 5DXAA 5JXWA 4I4CA 3VKUA 5JQGF 4BV3A 4PPQA 3G23A 3VYTB 4DPLA 2NU8B 3OFND 3FR8A 3MAJA 2VXCA 4UZSA 1MN6A 2IXDA 4PZEA 4JQZA 4ZHSA 2ZTLA 1E63A 4P4SA 2OZVA 3LBHA 2DFKB 5FB3A 5T7BA 4F4HA 3VUEA 1GPAA 4AG3A 2CKMA 4RK5A 3MTQA 2V96A 3MMNA 2G72A 3W8RA 1TJ4A 2VPTA 4RTKA 1QHSA 1VKHA 3X1XA 1U8EA 3JQDA 5FTMA 3QVOA 5HOEA 3Q15C 1PUXA 2QE6A 1SOWA 2QTBA 4C0HA 4MDYA 3BTUA 2E9SA 1I0IA 4K7JA 1Y8RA 1PJRA 2JHPA 3LUPA 5H82A 1FVFA 2QN2A 1TGYA 4BFSA 5C18A 1GGMA 1KAGA 5KHLB 5C5DA 1JIVA 1PQYA 4YCLA 1ZK2A 1PWHA 5F3DA 4MITA 1L3CA 1SCBA 1ULHA 1RADA 1DBQA 2ZJ6A 3JWEA 3SFTA 3WSVA 3KOUA 4W9NA 1WQ4A 2YS7A 4ZCQA 3ZLTA 5K8JB 3NEAA 4WFIA 5KHAA 1IB6A 3FIJA 3OU2A 3S6JA 4BFYA 4CV3A 1F7VA 1VFNA 1O1YA 2IYUA 3G5UA 1K75A 3MM4A 2ZUDA 1N5KA 3MTGA 2G1KA 1FFWA 1VYVA 2RK3A 1KSGA 3W5JA 4COKA 3LLVA 4M60A 5DBIA 4JSTA 1N2OA 1M1XB 2YYAA 2PGLA 2Q4OA 5DV9A 1WMAA 3DAGA 4IXDA 1LFAA 3AEQB 2XMDA 4JYBA 1KJQA 2EW2A 2K5UA 1M1ZA 2WDPA 3G5LA 3ONVA 4X91A 3RADC 1Y8AA 1RMYA 1UF9A 1RZVA 1QJCA 1M7GA 2J3IA 3DONA 4Q02A 1D3AA 4R0VA 1KSHA 2PSDA 1CDEA 3NB0A 2QL7A 3QW4B 4PYKA 1IJEA 4HATA 2NG1A 4B6PA 2H4YA 4GE0A 4KWIA 1W36D 1BMFD 1VIDA 1PTKA 2MOKA 1K7XB 1T0HB 2O1WA 3K0FA 4BO0A 3FYUB 4B9AA 1VMAA 4YUAA 1GILA 1RCUA 2HM7A 3WQQA 3OZGA 4ZEVA 1A9OA 2BMDA 3KXIA 3LKDA 1IHUA 1E9FA 4WNAA 3G3EA 4HH0A 3VU9A 4GSKA 2VF2A 5C1IA 1CBUA 4YMIA 4D8WA 2PVPA 5JBIA 3D3KA 3ITKA 1LI7A 1DBVO 1ZUWA 4MUEA 3B89A 4JEUA 2V7WA 5AVJA 2XKJE 2RGBA 2QTVA 2UYQA 2ZUSA 3RRNA 4A15A 6NULA 5JCJA 2XYQA 3WNCA 4C29A 1MIOB 4WOJA 4E4TA 3CF6R 1M8JA 1KSJA 1XSEA 3KFXA 2QJOA 4N18A 2II6A 3KWMA 1CUXA 2WC1A 2I4MA 1ECGA 1QQ7A 1MV8A 4MW1A 2ZXUA 1VJGA 3HM9A 1QLJA 4HVCA 5KTKA 2PRIA 1G60A 4IIFA 2X1LA 3KYJB 3OQIA 3OTIA 3P0JA 4JBGA 4ND8A 4P54A 1JG3A 3IVAA 5CAEB 1Y82A 3DFZA 3KQUA 1IULA 3O1JC 1XK6A 2BBSA 5IKXA 3DAPA 3A4IA 1CUZA 4R9NA 1M1NB 2CE2X 5AM0A 2B94A 1G1MA 4DMMA 1TUBB 3AHCA 1ZL0A 2VI5A 3MS4A 4HWSA 2HT1A 5DCUA 3OOEA 1DO0A 1VPLA 1R0SA 3LC2O 3S2IA 2WJGA 4OGFA 1TF7A 5CT5A 1YBMA 1B6TA 2W6NA 3BFXA 1ZNWA 3RFXA 4D4JA 1AGXA 1IUOA 1RPAA 2X9QA 1Q50A 5J1TB 3CMMA 1AQIA 1KI6A 4RMHA 2Z5GA 1LVGA 1FYDA 2PYIA 2ZSAA 3AESA 4UM5A 2ZRHA 3FGPA 2PS9A 3QXCA 4OHKA 1UXKA 1VE7A 2EHDA 1XOIA 5J5AA 1XF1A 1J0EA 3MN1A 1KFJB 1XTSA 1QHFA 4AS3A 4W5TA 3DLHA 2HR1A 2AWNA 2OL4A 4I0WB 1PDOA 4MWDA 1F2TB 4F6RA 4YO8A 1TW2A 3LLSA 3HJBA 5AR1A 1A4XA 1XZGA 2AJ8A 4ENRA 1M2OA 3CGGA 3B3FA 3R3XA 3VUFA 1ADFA 4W9NC 3J81A 3IHTA 3BL8A 1HE1C 2KE5A 4EY6A 4KITB 1E2HA 3LX5A 3OQPA 3I04M 3QUBA 2O3JA 4HLCA 3SR0A 3PQ7A 1XRSB 3NHFA 1UODA 2WABA 1I33A 5BR7A 1T1EA 2O5EA 4EI9A 1IHOA 1N0WA 2P3OA 4PFQA 3UAXA 2B5OA 5IWCA 1YIAA 5AJVB 2B1IA 2QPAA 2YIVX 2I99A 1FNCA 4C0BA 5G1NA 3VRHA 2AJBA 4G2NA 4E2FA 4DDVA 4FFPA 1PJQA 3KSZO 5CDTA 1JBEA 1HT0A 1RZ3A 1BG6A 2IUTA 1TGVA 1E1CB 2PMWB 3L05A 5JSQA 5J40A 1WUHS 3BC1A 2G80A 1KMCA 3VAAA 3QGMA 1NI4B 1P0QA 2E4VA 3NPAA 1ZRMA 1P4HA 1XTKA 2CXPA 4G0NA 4LOHA 5DFAA 5FYQA 1C1XB 1TPZA 1AV6A 4BNWA 5AVYA 1E5VA 1X1RA 4RHCA 4YMUA 3RYHB 2B61A 4P35A 2VWGA 1SVUA 4I4NA 2JH8A 4X20B 4URFA 4ZQIA 4EPWA 4LYYA 5BORA 1I1HA 4FNGA 4UKDA 3R40A 4QQKA 2JVKA 1W36C 2Q27A 3CS3A 3ZU5A 5A0FA 4QDJA 5JAUA 1NPYA 1CS0A 2FPIA 4LZLA 4PZUA 1IWBB 1GNSA 4XB1A 5AM2A 3WDKA 3QK7A 4MW2A 3RRJA 1YH3A 3JQQA 4LYGA 3GRVA 4KQMA 4RZHA 3RV4A 4PSUA 2ZWIA 5ITWA 1Z7YA 2WM9