3AYXB

Membrane-bound respiratory [nife] hydrogenase from hydrogenovibrio marinus in an h2-reduced condition
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
273
structure length
273
Chain Sequence
PRTPVIWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAASGHAAEAILDEIKEKYKGNYILAVEGNPPLNQDGMSCIIGGRPFSEQLKRMADDAKAIISWGSCASWGCVQAAKPNPTQATPVHKFLGGGYDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDEGARKGYCLYKVGCKGPTTYNACSTVRWNGGTSFPIQSGHGCIGCSEDGFWDKGSFYSRDTEMNAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Membrane-bound hydrogenase large subunit
publication title Structural basis for a [4Fe-3S] cluster in the oxygen-tolerant membrane-bound [NiFe]-hydrogenase
pubmed doi rcsb
total genus 84
structure length 273
sequence length 273
chains with identical sequence D
ec nomenclature ec 1.12.5.1: Hydrogen:quinone oxidoreductase.
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
B PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3ayxB01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3ayxB02
4IUDS 1H2AS 3ZE6A 5JSHA 1UBKS 1YQWA 1YRQA 5JRDS 4C3OB 4KO1S 4UEQA 1WUHS 1WUKS 5JSYA 4KO3S 4UE2A 5A4MS 4KN9S 4IUCS 4TTTS 4UE3S 1UBUS 1FRVA 1UBHS 1WULS 3H3XA 4UE6A 4UD6A 1E3DA 1WUJS 4UCWA 3AYXB 2FRVA 4CI0B 3ZE8A 4U9IS 3CURA 4GD3Q 4UCQA 1WUIS 4UD2A 3CUSA 5JSKA 3ZE9A 3AYZB 1YQ9A 1UBRS 4UPVA 3MYRA 5A4FS 4U9HS 1UBLS 1UBOS 3USES 4IUBS 1CC1S 3ZEAA 1UBMS 4URHA 1UBJS 3USCS 3UQYS 4UCXA 5A4IS 1UBTS 5JSUA 1H2RS 4KL8S 3RGWS 4UPEA 5ADUS 4UQLA 5D51S 5JT1A 4UQPA 3ZE7A 4KO2S 1FRFS 4OMFG 2WPNA 4UEWA 4KO4S
chains in the Genus database with same CATH superfamily
1AHIA 3F4LA 4G0ZA 1FFDA 1XTIA 1R6UA 1TQ6A 2D5AA 1V9CA 4N18A 4PONA 3W9UA 1VGQA 2OQRA 3I28A 4CMKA 3O8CA 4HL6A 3TEJA 5B37A 5WRFA 3DV2A 2QUHA 4S2UA 5JR3A 5L45A 2JB9A 5G02A 1F7UA 5DOVA 2P75A 3LA6A 3Q9UA 1R0XA 3IJRA 1TT5B 3INNA 1NE2A 1RWVA 3L7MA 4KIGA 3QLEA 3L4BC 3RFXA 4ZYXA 1UKBA 3GP8A 3KPVA 1NPTO 1G66A 2AJTA 3D8HA 4ZQBA 2IP1A 3GT4A 4YLGA 3TLAA 4EF4A 2QXTA 1BEZA 4TTQA 4DVGA 4C6HA 3E8SA 3HKEB 1YZFA 4HWRA 1F0PA 4LSZA 3QXSA 3FW1A 1SEVA 2G71A 3KAJA 1EHYA 1QR6A 3H5VA 4R2IA 2A9QA 3W2TA 3UXHA 1NXWA 4G4GA 1ETUA 3ODPA 5U4QA 3SOPA 3AV3A 4A0RA 1P1HA 2V4MA 3VZCA 3TLYA 3FNEA 5CDHA 2YXEA 1PGNA 4KFTA 2F59A 4MVXA 1DX6A 5AUQA 4D3XA 2CYCA 1DT5A 1W0CA 2WTBA 1DX9A 2IYUA 3F67A 5FOVA 3V1NA 4V3BA 4ZVTA 4NDAA 1OLSA 2VFAA 3LMKA 3DE4X 3QKTA 3WMFA 4ENTA 3QLUA 4I1RA 1O9BA 5F2KA 4H3HB 2J3QA 4G6ZA 3P9ZA 5BWLA 4LGCA 4L8LA 2BMEA 3OT1A 2Y2UA 2GYWA 2BR4A 2GK6A 1DSSG 1V8BA 4OKSA 3RYTC 3IAS6 4URVR 2HHHB 1FXSA 4EB6B 2V7VA 1AZLA 3CLSD 3GH1A 4JJZA 2V1UA 4RTPA 1OLUA 1BX1A 4TN1A 4B44A 4DA4A 1LC0A 1O89A 4MW5A 1LFDB 1RLOA 3QPWA 3RUFA 5CB4B 1IYZA 2CUZA 1SXIA 3LHIA 2ZBRA 3AYZB 4X1KA 3DR3A 3FMGA 1E77A 1A98A 1E79D 2G80A 3TYXA 2BFFA 1FFSA 3K4HA 4DSAA 4KR2A 3O9MA 1WXWA 2PO5A 3PKZA 1B8OA 4LQLA 3WWOA 3JRNA 2PRIA 4N47A 2IIQA 1QIDA 3UEOA 2XTAA 4LSMA 1QYRA 2GXQA 2OV1A 3ZIDA 4UVHA 3TTXA 1KY3A 4RAOA 3ZWNA 1Y4DE 2PG3A 3ZD8A 1K7CA 3W2EA 2XVXA 5JFOA 2HMUA 4J1SA 3EZFA 1NBME 2OXEA 4I2VA 1O6FA 3WLEA 2QMQA 3M4YA 1SK8A 3LX8A 2V0NA 1UFOA 3HLKA 1GNPA 1N3IA 1ZWKA 4G5HA 1SU4A 2CLHB 1BDBA 3I9NA 3PNBA 4UMFA 4X6XA 1ODLA 1IOWA 3WWDA 4EHKA 3CZ9A 5JD4A 2I91A 4E4TA 1M34E 2VJMA 4ZTBA 1XQ6A 1F2UA 3K1ZA 5KS2A 3VVCA 3PVZA 1YVRA 2WKPA 1V4NA 2O2SA 4RVFA 6YASA 1JEDA 1QO9A 2CFRA 4E11A 1LBSA 2BI7A 2P1DA 3QOXA 2F6RA 3Q6IA 5ANRB 4N76A 4LMRA 1IBCA 4RYLA 1UBCA 5IRCD 4RF4A 1G7SA 1OZ0A 4GSKA 2Y77A 3VU8A 5AW2A 2WW8A 3LWBA 4U0JA 2QUJA 3IQEA 4LXTA 2RHLA 4UEWA 3JQAD 1HURA 1NVXQ 2IOHA 2ICAA 1SO8A 2Q4RA 3BVPA 3FMOB 4K9QA 3UC9A 1F17A 1JHAA 2XE7A 3OCUA 1Y8RA 4BFXA 4NOMA 5F7XA 1NI5A 3L0BA 5G0SA 4CUKA 2CC2A 1DADA 1XZLA 3HB5X 5EL0A 4YLYA 4MHOA 3VOAA 3VPBA 3ZIAA 4YCDA 4X94A 4Q47A 1IN1A 3PVSA 4MCIA 3OCCA 3FJOA 2VQEB 3DXFA 3IAFA 2CYBA 4QUDA 4COKA 4DRZA 3ZJVA 4ND3A 3S1LA 1M67A 4BGDA 3H0KA 5D3QA 4D25A 4DR2B 5K6RA 2QM3A 4CMHA 4ZN6A 4MV3A 4F3KA 3EH1A 3ERCA 3AH8A 5EMNA 4G0VA 5LZ8A 3PJFA 1JSCA 3MWGA 2PAAA 3G2NA 1GZUA 1KYWA 4OSPA 4DDHA 1G38A 1GP2A 2I22A 3CLTD 1OFUA 4FLMA 3WXMA 3Q7SA 5HRCA 1R5JA 1PU2A 2EQ5A 2P7HA 3M5CA 4LJ6A 1M66A 3GW8A 5HCNA 1ZR2A 1DJQA 3VR4D 1T3GA 1XWWA 1T5DX 2NZUG 1LZKA 5U4XA 3AQ4A 2VSNA 3V1TC 3B8EA 4ZT6A 2FSHA 2VYVD 1NP7A 1U1GA 3PLRA 4B8ZA 1XHEA 3BC1A 4WI1A 1A9XA 1O6GA 4RK1A 3WYBA 3P9NA 2DRIA 1EGAA 1WOMA 3FBGA 4JCCA 3HKCB 3FYUA 4LGMA 4TLCA 4TMKA 5J4HA 1RCFA 3JQFA 4CQJA 1RZRD 1C7ZA 3A27A 3IH5A 2I6QA 4J7XA 4TQ9A 1KP2A 2GX6A 2H17A 4DBLE 2UXDB 3LRXA 4DQXA 4EX7A 5LYJB 4BWYA 2DXIA 1X7GA 4CKYA 4YMTA 3LBAA 4UXIA 1CFZA 3DL2A 4LC0A 4O2BF 2I7TA 4NBSA 3U4HA 5C5EA 5L4NA 4LRWA 3ITKA 3BK1A 4Z1OA 4UZEA 4YRQA 2BJWA 4RHUA 4E2XA 5H16A 3ZV7A 4FDAA 3WRXA 4PSDA 2J08A 2PMBA 1LJUA 5DNAA 1DIOB 1Y1PA 2APJA 4ZEWA 1LJLA 2HPAA 3QOWA 4RIGA 5FAXA 3EBLA 5HIJA 3PGLA 3ZV4A 5CH5A 5SY9A 2CLCX 4XGRA 1KO8A 3R3HA 5A05A 1V3QE 5TB5A 4UHCA 2QUKA 3NTXA 4EVRA 2Z9BA 1RAAA 1MC4A 1VG8A 1LSSA 1F8XA 3EG9A 3R4VA 1KSGA 3DYVA 3A4YA 3AF6A 2HD4A 4C6RA 1G20A 3H16A 1CY7A 4ER6A 2GLXA 4OJNA 2OXFA 2C5BA 3QE2A 3QYFA 1SIBE 2J3MA 2Q9AA 4L8YA 4B75A 4BVGA 3KG2A 1W4BA 1JLKA 1PRYA 1UPCA 1UXJA 2QN1A 2ZYUX 1E4EB 1Q12A 4KKVA 3TD9A 3TI7A 2XB8A 1EQ2A 2IWHA 1T8SA 3VO9A 1RHKA 5FL3A 4WZ6A 1NXQA 4HWGA 1HYBA 2WC1A 3BXOA 5FBLB 3SSOA 2DFVA 2P2LA 3F6BX 4IWNA 4BECA 3K5IA 1KE1A 3N0XA 1L8QA 4K9KA 3RDPA 1D04A 7AT1A 5ED4A 4MA4A 1A9ZA 3B82A 5DLYA 1SG6A 1KDVA 2IIPA 4GU5A 2A4KA 1DJNA 1TIBA 2BFAA 2OP1A 3DH0A 4HP8A 5AJTA 3ABZA 3CY6A 3IHWA 2FFHA 1XVIA 3OQ1A 4IY1A 1KOJA 3X1WA 4BO8A 2HWUA 1L7MA 2FPXA 4M1YA 1KAGA 1T4DA 1SBQA 1XTVA 2O3RA 4KYUA 1LLQA 4FFWA 4MR7A 4PAGA 1AG9A 3AESB 1RAFA 1MD9A 4U2KA 5DGCA 5JG7A 4BVEA 5CITA 3TDMA 4CEJA 4OHVA 2OK7A 3W05A 3N87A 3FVRA 4XR4A 1ZHFA 4J1TC 5HZHA 4WFJA 1NBMD 3HI4A 3D7SA 4GEKA 1XJCA 4GX2A 1YQTA 3H7AA 4A4DA 2AW3A 5J4YA 1NQXA 1SBIA 2JVKA 4FFVA 4A6PA 2ZKLA 5I01A 1YQXA 3U6KA 4RA9A 1VLLA 1DO8A 4FHZA 1KZYC 1MOQA 1SXJE 1K27A 2HTEA 3IBYA 4HZUB 2G5TA 3SC4A 3VOTA 4E2WA 1PBNA 1E2PA 3LYUA 4LKRA 3WMGA 3HXOA 4HQ0A 3O75A 5J2UF 1QWSA 3BMQB 1KSFX 2Z2XA 3F3YA 2WWTA 3P2YA 2WBLC 3JYQA 3QJYA 2AFRA 3V9AA 4EW6A 1H8ED 2O8EA 4LKOA 4D97A 4B3GA 2UYGA 1ENZA 1LQUA 1Q44A 4ZVVA 4WK6A 2ONCA 1PQPA 3OFNA 1GUDA 3WGHA 3CRVA 1ZUNA 3AVTA 3RJTA 3LKVA 1ORDA 3P2EA 4B6RA 2V6GA 4QGHA 4RV4A 4S05A 2XE6A 1R0KA 2PKQP 3PNPA 1U2DA 4HX2A 4R8KA 5JU6A 1KFEB 1OWMA 4YP0A 1WMBA 1U4NA 4YJ2A 2CZGA 4HX9A 2QAGC 4RMIA 4G5FA 1AQUA 2W6ID 3R5JA 2AG6A 1R6VA 3SJZA 1KETA 3C6MA 2ODQA 2TS1A 4E3WA 3W5IA 2DETA 3I1IA 3SX0A 2A57A 1WUJS 4YJKA 3KKNA 2IW1A 4UEOA 2XZLA 3CVUA 2ZZMA 1R9NA 1BU8A 3GJ0A 1W44A 2VSOA 4KV9A 4LNUA 3PG5A 2JAUA 1OX6A 2YWFA 5L8VA 3AUUA 3FDFA 4CKEB 1E94E 2OB2A 4MS3A 3EWIA 4PO8A 3TOSA 1X2BA 2QN6A 3VU1A 1NHWA 5KNLA 4XJSA 2AVDA 4DEXA 2QAJA 3HYNA 5DP2A 5AM3A 1P5JA 2JAQA 4KVAA 4K6HA 2BFMA 1MXFA 3PD0A 1L5OA 3ADKA 5K8JB 4E5VA 5IHPA 1M6EX 1V8FA 4RZQA 3DDHA 5AW6A 2V54A 2RAFA 1NC1A 1HOXA 1MVLA 4WECA 2QG9A 4D56A 3THSA 5KNBD 1CD5A 3HXQA 4TWAA 5T3YA 2VO1A 3EUEA 3IQFA 4WDRA 1CEXA 3ZGLA 3FD8A 4D5GA 4CF6A 3M4ZA 5L3QA 4EPYA 3AI7A 2JJ2A 2OKCA 3IR6A 3KSAC 4CW7A 3L9WA 3PIDA 4DM7A 1E2FA 1G7TA 1U5BB 5JATA 3EMVA 2XKAA 3ZTWA 4ZZ3A 1GCIA 4PWYA 4DCGA 1EFCA 1KI9A 3ZK8A 3L93A 3D5QA 5DJ5A 2JLXA 1PFQA 4HDSB 4QBHA 4YJFA 2AHRA 4KE7A 3QM1A 4GZ6A 4B85A 5TS3A 5B58C 1YI1A 1TKBA 1X94A 2A35A 4B7CA 5TIIA 3FAZA 3W90A 1X0VA 1MQSA 4KAFA 3R3UA 2HCRA 3PGXA 4PLTA 5E7IA 1YAHA 4B81A 1T2VA 1X38A 4HDQB 3SQNA 5EMMA 3LT4A 4X62B 1Z0SA 2E6KA 2N3ZA 2JCYA 1E9VA 5A3RA 2SICE 5EIEA 2PSDA 4TWJA 1JPVA 5E7MA 1E62A 2IOFK 3D64A 5BSVA 4BRUA 3DWEX 1P77A 5F4BA 4CMGA 1LW7A 3JVIA 2WZQA 3DLCA 2ZYVX 3HCPA 10MHA 2VCHA 5IBQA 2AFHE 4HPWA 4KQJA 1J2RA 1YS4A 3H4IA 3GR6A 3IAAA 2E85A 1DJOA 2JJ8A 4QOHA 2EFDB 2BC9A 3BIFA 4U7TB 5DGIA 2DECA 3FMPB 4Z9BA 3SDZA 1YU9A 5LZ9A 1EK1A 3NBAA 4WUVA 1CR2A 5JD5A 2BGJA 1SOUA 2J4CA 4G1BA 5DNEA 2P2CA 3NJ4A 5K0ZA 4D2IA 2GRJA 1PQYA 4BVLA 2HA5A 4G01B 3GUYA 4ZQFA 4DKXA 4RWZA 1Z5NA 2IEDA 1AKVA 2R1TA 3FGOA 1Z0IA 2O0JA 5ALYA 1TXGA 5FTJA 4NMMA 2ZBDA 1Z5VA 2CHQA 1MPTA 2XRFA 3MCAA 4C4ZA 3UK0A 3M5WA 2QPOA 4C7VA 4QASA 2TYSB 1KORA 4L02A 4KXFB 1ZJ4A 3NVAA 1F0KA 4NEGA 4R84A 1GT91 1QP8A 1VRVA 2B5WA 3AY0A 3ED1A 3ENZA 4J4TA 4OOFA 4PRLA 4RSRA 2WJAA 2HCTA 4X60A 1E0JA 1Y9JA 2PX3A 3JQ8A 1U5AA 2E89A 3H2ZA 4TSFA 3C7AA 2ODBA 3L6OO 1LI5A 2YYZA 1ZCBA 2CGEA 3CVXA 4Y6OA 4Q01A 1ZX1A 2FN9A 2IH4A 2O1WA 4OJTA 3TPFA 1KYYA 3PNLA 4QSMA 1SXJD 5HFAA 2Q49A 1RAGA 4K86A 5LSAA 1R0BA 3OWXA 3BGDA 4G1VA 3CMMA 4ZA2A 3VR6A 2B83A 1D4ZA 4IS2A 1IWOA 3FYHA 4HATA 2XAAA 1OA1A 4B09A 1YF3A 1OJ7A 1QDEA 2YL2A 2ZZNA 2EC5A 1SIWA 5E38A 4DTIA 1O54A 1SRRA 3H1BA 1O6BA 1QHHB 3PBKA 4DRXB 3LKZA 1BOFA 4DLXA 1GTZA 1W0KD 1IRIA 3IP9A 1PI3A 4LYEA 1GHTA 5JVDB 3JVVA 3CINA 2WY2D 3KQMA 1W93A 1N6NA 2WZDA 3QVGB 2D2EA 4NU8X 4J3FA 1M74A 1DKNA 3WNCA 3VKVA 4PN3A 1DBRA 1MTOA 4IDDA 1R4NB 4X9XA 5IZCC 4YCNA 3B9RA 2G5PA 3HL0A 2C9DA 3WGGA 2I3ZA 2XWPA 1RKBA 1HT0A 4HN4B 2RGGA 1RKUA 1W4RA 2H48A 5CYOA 3BILA 1AB6A 1DZ3A 4PG6A 4GYYA 4LJ4A 4RY9A 3KPJA 2C4KA 3FI0A 3OEYA 3U62A 4BEBA 2QZ9A 1C8BA 2A5FA 4HEA1 1KZ4A 1Z08A 4ER7A 1WHSB 1TUGA 2F8LA 3ASVA 3KLNA 4EYSA 5C7IO 5KQMA 5IT5A 1DDGA 2Z5FA 4EG7A 3CKYA 5JECA 4IG9A 4EJSB 4GOJA 1RLMA 1AF4A 1FZQA 2Q07A 3L7NA 2C78A 4B3CA 4W4TA 5DI3A 3L0ZA 5C31A 4DMCA 2VAMA 2QP3A 3GLHB 2FPRA 1C7QA 3GRZA 3AEUB 4QA9A 3U0BA 3A2MA 4W5NA 5LWQA 5KTKA 3GLIB 2CFOA 2GHQA 2G6TA 2ODWA 3Q40A 2H11A 2XUAA 3STHA 4RPLA 2JFGA 1S8FA 2AUTA 1HLFA 5CAEB 3U2QA 3ZWDA 2GCEA 2QG6A 2Z3ZA 2FMFA 1TM1E 3QELA 4RF3A 5H1YA 1S8AA 4MCJA 3RIGA 3V1LA 1V96A 2A5JA 2Z1MA 5KREA 1T9ZA 1R10A 1T2DA 3JD0A 1GCOA 1SULA 3MRXA 3U81A 3TCKA 4BFZA 2CFSA 4ZK2A 1C3JA 3WMRA 3DVLA 5AVOA 1PLLA 3FPKA 2E1PA 4K2AA 3CKMA 1NTRA 4O2RA 4BIMA 1G9SA 2H5LA 4DY6A 5AVUA 5K0CA 1REQB 4U6NA 4F56A 3IE1A 4GBED 2UZAA 4GM1A 4PYNA 5H5JA 1VPDA 4W8HA 3UM9A 1FVHA 1VE6A 3OCZA 4CI9A 3B5EA 4RK6A 1YBAA 5GONA 4WAUA 4B3RB 4TTVA 4OHUA 2IYZA 2CCKA 3SI7A 4GKBA 4MUXA 1NI4A 3LIPA 4GZMA 4LE1A 3RU3A 2Z58A 3UXMA 3B1YA 1NC3A 5JAOA 1VXRA 2OR3A 1NWHA 3FDZA 3IE0A 4QWWA 3P19A 1G42A 3OF5A 2BHLA 4L5YA 4BO1A 1BYIA 1V6SA 2Y6UA 4C30A 3EMDA 3LOQA 1DI0A 4EUHA 2WTNA 4GPEA 3S28A 3HB7A 4R1OA 3REQA 1IONA 2G8NA 2B8EA 4OKNA 2EYQA 5FULA 1RYDA 1IVSA 4M38A 4BJ3A 1PV1A 4AROA 1A69A 1RYFA 3VPAA 2H2IA 1VG0B 3JZFA 2ATVA 2BI8A 3C8UA 4WZAE 3OPYA 221PA 3D4IA 2GCOB 4QVIA 1FTNA 2X0DA 1N6IA 3W8DA 4HH3C 4IIUA 1BQ4A 1QVWA 4KRGA 1P2VA 4OVKA 3B1KA 3LECA 1C1DB 3D4OA 2IDZA 4HNUA 3OICA 1BQEA 3UMJA 5LNK6 3Q1KA 5K8LA 3N7AA 3PJDA 2QTVA 2MWMA 4JJ7A 4JJFA 2I29A 1QQ5A 2XB4A 2C07A 4CWAA 3AR5A 2WA1A 2OGZA 1UJ4A 5FPTA 3A28A 1UJBA 4V0KA 4FFLA 1YK0A 3OESA 4OQQA 4Y0AA 4AMGA 5GQSA 5JI3E 1ETHA 2HQ1A 1WL8A 2WHQA 1GILA 2E6UX 1IAVA 4LRYA 4I9NA 3PL1A 5D3MA 1RRCA 2VYND 1PK7A 2EJCA 1KFBB 3JXEA 5ICEA 4IO1A 4QIHA 1T9KA 3WX0A 2XXBA 2PQMA 4YY3B 3R7WA 1G8MA 4MYRA 2DQKA 2P41A 2GZ2A 2VXBA 3NIWA 3H9QA 3N6VA 2CDCA 4QNMA 4BNVA 1W6UA 4C0AC 3EY4A 3X2SA 4CR8A 1XRMA 1VSBA 4NCIA 2P3LA 1OYWA 1S3FA 1SUSA 4HH1A 4HNVA 5K4HA 1YFLA 4Z3KA 2J0QA 3OZSA 3H2BA 5GGYA 2QTFA 1PYOA 3E6AA 1U0EA 3JVEA 3I9LA 2CKDA 4EVQA 3VR4A 4NJEA 1T24A 3UT5B 1N7IA 1P1RA 2V96A 4J7AA 1GKIA 3FNQA 4AJ1A 2WB4A 3V32A 3O95A 4CF4A 2UVDA 2LVBA 3SIXA 1VG1A 2VYVA 1WXDA 4IHAA 5HIKA 2JH8A 3CUWA 1K3TA 1SD1A 1EM8B 1YGPA 5KNCD 4L5AA 1J42A 1RZRA 2JD0A 2C1EA 3UNXA 5I9NA 4Q12A 3NKVA 5AUPB 8MHTA 5AVTA 1NF2A 3K2IA 3MLAA 3LQFA 2VR1A 4EELA 5J9FA 3OPXA 1DFGA 2WR8A 5DXAA 5EMHA 4FT2A 2ETXA 3I2IA 3WLPA 2ISSD 3FTCA 3KQPA 4HH0A 4C5AA 4G26A 3VVLA 4KGVA 1S3GA 1DC8A 3G82C 4MLDA 4QEZA 2YVQA 3OM9A 5LBTA 2EKDA 1N6KA 5FBZA 4FX2A 3KYBA 3O91A 1I4WA 2P5YA 4HMPA 4W5RA 3I9FA 3T0IA 1EP2B 4PPNA 3THXB 4YCJA 3JRWA 5SZIA 1VLZA 4QYIB 1UMBA 4TLBA 1DCMA 3D6VA 5EJFA 1C0KA 2VSXA 3NHUA 1A9QA 1ID8A 1EX9A 3BWCA 1GZ7A 1U2GC 3GDGA 1MH9A 3DAPA 4JY7A 3F8TA 3K0BA 1ISFA 2ESRA 3L49A 3QKRB 4X6UA 3DQQA 2C2YA 2GM5A 4DT1B 3T1HB 4K6KA 4RBNA 1I3LA 2B69A 2OFWA 3QFTA 2P4HX 3W2HA 4DRYA 3WGUA 4BP1A 2DQSA 2PYDA 3RBXA 1UJ5A 3MWFA 3UJPA 2LKDA 4L4ZA 4QE3A 4TKVB 1AC5A 4C2TA 3ND5A 1ZVQA 2QU8A 9ATCA 1RJFA 1M8FA 1S1CA 3Q15C 4CV3A 4J3JA 4BO0A 2EZ4A 3WY9A 3QKUA 4A2WA 4V2UA 3AC0A 5A5DA 4RH0A 4UD6A 5AOVA 4EG8A 2BM8A 3EE6A 2HBZA 2XZTA 5KYYB 2EERA 3WNZA 4JNCA 4MW9A 4M37A 4RHEA 3H5AA 4E4YA 4H60A 4B3SB 3P2JA 4NKRA 1FCJA 1L4YA 4U9IS 3V3TA 4ARZA 4F93B 2DUUA 1R8QA 3C3WA 5HUQA 3LQKA 1NR7A 3ZXYA 2DKFA 2IL1A 4RHXA 4XLTA 4O1IA 2YQ5A 1NBMA 4LG1A 2X0IA 2OYRA 3MTQA 1ECFA 1WD7A 4M6WB 1NJ6A 3KR2A 4RYDA 5GZ6A 2NU8A 4YROA 4YMSA 2OP0A 2PT9A 4WBNB 3RQIA 1P4SA 1I9GA 2ZYSA 2ZUWA 4E5PA 1M34A 4CKZA 3CZ4A 4P93A 3GBPA 1CR6A 1SC6A 4KN5A 5EI5A 1BVYF 2RG7A 4AZTA 1HQKA 3EISA 4KAXA 4M7PA 1KARA 4R2HA 4XVRA 4ZI2A 4JKOA 5ARCA 1HG0A 4H0FA 1JRLA 3T5CA 5AQEA 4PLHA 2GJ8A 1OI4A 1A9OA 3CNQS 1H8EA 4QLAA 2A4MA 3CX7A 5ALJA 2KYRA 4ZARA 5E2BA 1CHDA 1AQIA 1P9LA 5LOVF 4E4RA 3O9VA 1EEHA 2VRNA 3NTRA 3QF7A 3GPCA 1NF9A 1GT6A 1EMDA 4X1IB 1K8YB 1LCIA 3ENQA 2IQIA 2HSJA 1GNQA 3FB4A 3OETA 2IE8A 1Q3HA 1GTJ1 1DRWA 4QDKA 3I0NA 3CPHA 4YPOA 4B33A 5GADl 1G5HA 3T52A 4DR3B 2VXOA 3FH0A 1CHNA 3MTDA 2W6IA 1V1JA 3WKBA 5FR1A 4FHCA 4CMJA 1U99A 5IDVA 3BPSA 3CKKA 3DL7A 1BH6A 2G9ZA 1TK9A 4B1FA 2JHAA 5CBKA 1GQFA 1YZ3A 2QLTA 3P52A 1XDUA 2H7YA 2WV9A 3DTYA 5DPMA 1Z3CA 3TW8A 1TCUA 3IEVA 3IUBA 1S2LA 4OFXA 4W1PA 1ZXBA 2BGIA 4F2WA 3IVMA 1Y7LA 4DV4B 2WKRA 4P82A 5EXEA 4S1TA 3NYQA 4CCYB 1NVBA 2VZLA 4H3VA 5DHTA 3LX6A 1D0IA 5ARBA 1L7OA 2P9EA 4P5EA 1OD6A 1GUAA 3D4PA 4BVBA 3GO4A 4PYJA 4HDMB 1OWOA 4C76A 3LT0A 1P1CA 1IL0A 5C8YB 1Y33E 2FSUA 4BXOA 1VHDA 1RQPA 5B3JA 4DDMA 1JB1A 5AJVB 1YBMA 2E5FA 3GOHA 2ZSBA 5FUQA 3EIXA 3F71A 4ZWNA 1ZYUA 2UYCA 5KNBA 1CZNA 4F5DA 1XPRA 4B7XA 5AI5A 1IHOA 2JS7A 1SOWA 3RHTA 2WK1A 2DVMA 1A3CA 1QRDA 4DLTA 1JNYA 2PMKA 5IC6A 1U31A 1DAPA 1D9XA 1V1RA 3OSUA 3WGYA 2GT1A 2QJTA 2VJOA 3KOXA 3MOSA 3R3VA 1O7JA 2PMFA 2YX1A 4P5DA 2BKEA 5IAEA 3RSOA 2C3MA 2O57A 4CM9D 1Q2XA 1JE0A 3F7MA 3TLKA 2G06A 5JFGA 2AB0A 1X8JA 4MHSA 3R74A 1VHJA 2C58A 2V8OA 1XMJA 1G7RA 4LVCA 4MPJA 1PJBA 4M0KA 3GQBA 3JQPA 4FU0A 1H4VB 4MS1A 3RTAA 4HQFA 2R6AA 3W8EA 3HCOA 2YMLA 3OZVA 1RQGA 1C9JA 2QD1A 1FYDA 1N75A 5I7FA 3SQXA 2VK4A 4BLWA 3X44A 1ATZA 1SB9A 3ABSB 3K5HA 4EJSC 4W7HA 2PLNA 3TJMA 1QIFA 3JX9A 4CMAA 1BE0A 3M5PA 1LF5A 3C6YA 1TAHA 2H2HA 5KMGA 2WLTA 2X6TA 2WFAA 5CNMA 4MA5A 1J5PA 3EHEA 4Y98A 4EPVA 5KTOA 3EDCA 4EFKA 4XJXA 3HL4A 4YP7A 4DCUA 4ENSA 3ZCSA 5K8IA 1G59A 4MV6A 2C1XA 2YXPX 3FI9A 1X0XA 2ONKA 2YJ6A 4ZP1A 2GBLC 4PNEA 4IHJF 1ZOIA 3PRYA 5TEWA 3QNUA 2O8FA 2EF1A 4DEVA 1Z2EA 2IYSA 4CIYA 4L4SA 1ZLYA 4C9BA 3SDBA 2VI5A 3PUZA 4LPKA 4FYPA 4U3JB 3RVBA 4KDFA 1UZLA 2P90A 4JP5A 1BWPA 3FCAA 3JALA 4Z8YA 5REQB 2VAXA 5IJ0A 9MHTA 2GM9A 2MR6A 4OY3A 3BJZA 3L1UA 3RVSA 1MJGM 1W8IA 4HDAA 3VR3D 3CNOA 2DUJA 3GFPA 4OHZA 1YKSA 5I5GA 3USZA 1VSUA 1XZCA 3PFWO 2C42A 2AI3A 5CIYA 3NI2A 5IBRA 2P11A 2Y1CA 3GY0A 2Q41A 4XM2A 1RFLA 1T5TA 2BE9A 3LX5A 2CXSA 2IYNA 3OZIA 4YT8A 1M5TA 1E7WA 3UMGA 2FPOA 5BVHB 2O7QA 1QOZA 2B5OA 2FPGA 4P5PA 4E1BA 2XZOA 3I1JA 1QX3A 5DWDA 1VL6A 1EDEA 5AKGA 3UENA 4E03A 4Z7JA 1AA6A 1SXJA 2KWIA 1DX4A 1CWUA 1KI8A 2WIGA 3AERA 1W47A 1PS8A 2PXCA 4UM9D 2P2DA 2WUGA 3GWZA 3HFRA 1XMIA 4FQ5A 2JFFA 4G1UC 1HDCA 5DYTA 1KEVA 1JG4A 2DP4E 3GJQA 4V0OA 1TW2A 4Q18A 5JBIA 2PX8A 2PRYA 1W5BA 4W5HA 3AHIA 4X84A 5LB4A 3T0FA 3SHQA 3OZCA 1CP3A 4FYKA 4A0QA 4TS4A 1ONNA 2GR9A 5A5GA 3QX9A 1TPYA 1YT5A 4EMTA 3EGDB 4FR2A 1EUQA 1W0KA 4W7IA 2PWYA 3AJRA 2GF9A 5DTQA 1DINA 5KHAA 4KFRA 3ZHOA 3OPVA 5HF6A 1ZOPA 2DM6A 4A6XA 1QIHA 2JKVA 2A92A 2PBLA 1Z34A 3KK0A 4XEUA 3KELA 3UG6A 1FY2A 4ID9A 2CLIB 2QQEA 4O2LA 1YQEA 3DV0A 5GJCA 1EM6A 2NVWA 2NVUB 1KO7A 1XZEA 1ZM2A 2Y71A 2XNSA 3GFVA 4RO0A 1FP2A 1EFKA 2WIFA 4EQ6A 4C7XA 1E2DA 1MNQA 2C29D 1BMFD 3WIOA 2XVMA 3COYA 1LBHA 5DK4A 4ZO8A 1BGXT 3D3QA 1CB0A 4PAMA 1E9EA 5CNKA 3GDHA 4CT5A 4NP6A 4CBVA 5JDIA 1ULBA 2WT4A 3IV9A 4U6SA 1ST2A 3ADOA 1E66A 1IDN1 2G09A 5AT1A 5IMBA 3H9GA 3A26A 2F9MA 3FPJA 2XSZD 2ZUUA 3K1YA 1OOEA 1X2EA 2C99A 1XZMA 4PSCA 2HF9A 4ENQA 1BX3A 3G1WA 4MARA 3C3DA 1KJJA 4MKGA 3OQ6A 1T0BA 4GOKA 4IKOA 1AGYA 3U39A 2AQIA 1N78A 4XGKA 3NHWA 3AP3A 3PD7A 2VDKB 4NZNA 1PHPA 3WKDA 3PDWA 4O4JB 4BWVA 1OXXK 4Q4JB 4KQ1A 5AOCA 6ADHA 1B1CA 1CQZA 4GX0A 3PPXA 4CL8A 3VQTA 3MC1A 3BZUA 2QIPA 2E4UA 2M9MA 1ZIOA 3FCSB 4AIRA 3RLIA 1N2JA 3PHJA 1DLJA 1X9IA 5KQLA 4QBFA 4M4SA 4JJKA 2IXTA 4PZYA 4QAJA 4AZ0A 3I4FA 1ZH4A 1Y8QA 2BI4A 1BG6A 2JGDB 1JZQA 3R0IA 1FYXA 4IDPA 4TMYA 4WBNF 4BWGA 1SVOA 2O8DB 3LBHA 3NBZC 1BO6A 1IN8A 1EVEA 5I9LA 1UPAA 4KQIA 1DAGA 1L5QA 3BH7A 2NUAB 3ZVLA 4LYAA 4Z4IA 3PDUA 2FPIB 1NSYA 1XWIA 3EGOA 3D1VA 3JQ9C 3HXMA 3RF6A 4FVTA 4IO0A 4WX2B 3DXYA 2HWKA 2R65A 2H1RA 3A3KA 3L7YA 1B43A 3CX4A 1GU0A 4K9RA 4PC3A 3ER9A 1KPGA 1YMUA 4WNAA 2LGJA 3F98A 4P33A 3D6MA 4KPUB 2PK3A 1D2HA 4V24A 3JAMA 3I1FA 3G8AA 5EEGA 4W5WA 4J4HA 4G0NA 4ND4A 3RRNA 1WCV1 2XE8A 3L7JA 4RVCA 1QS0B 5EYPA 3ZOKA 2EP5A 4U1RA 3O03A 4DAEA 1IBKB 4F6CA 2F3RA 2H8GA 2PUBA 5BSGA 4MJXA 2X0FA 4FC6A 1YGYA 1ZCFA 2AFHA 1J4AA 1Z0AA 2Q3JA 1Y63A 1JHMA 1QGYA 2PGLA 2WF5A 3DOEA 3EVTA 1L4GA 1JL3A 1WXXA 2BBOA 3BAZA 2ZYHA 2DMRA 3LUDA 4URUR 4X45A 4ZT7A 1D4FA 1Y80A 2I1LA 1E4OA 1JDSA 4B2IA 4CCAA 4EUSA 4YUXA 4J07A 4M9RA 3HB9A 1TM7E 4YIKA 1CSEE 1C2TA 1DELA 1L7EA 2DWPA 3MB5A 4JLOA 4Q3LA 3VR0A 4IH9A 4L9WA 4C03A 4MW7A 5FHRA 3PDIA 5KYVA 1C3OA 3UAZA 4XWKA 1T4BA 3LL7A 4ZXPA 3HEAA 3O6VA 4F72A 3ELUA 1W9MA 5F9HA 1GFZA 2P7IA 1VIDA 1WNTA 3H13A 2HA0A 3C6XA 1G8GA 4I46A 5HJEA 3ZBUA 1VKRA 3GVIA 3K8QA 2Z3WA 2UYOA 4UEJA 2X0EA 4H1VA 4JGBA 1NP6A 3T95A 5EPEA 4DJTA 5ALMA 1XEAA 4LX8A 1U28C 4KQEA 2VQFB 1KRXA 1YFJA 3HVRA 4RVNA 4IZ6A 2J5RA 2IXFA 3QU4A 4FXOA 1XROA 1GLVA 2DBRA 3SLGA 2ACWA 3JPWA 1S2NA 4WJKB 4HWOA 4UJ3A 5HFNA 4LHXA 1UBUS 2D13A 3JQCA 1VSVA 3BUSA 3WK9A 1SUBA 3I4CA 1MAVA 1TUIA 3ZZNA 3EIQA 1SQ0A 4I4IA 4JAVC 2ZUCA 1QHIA 3UMSA 1UDBA 1E2GA 1MDBA 2NPIA 4UBMA 3TFOA 3IEKA 4O33A 4ZT2A 5HE9A 1R3DA 2BVNA 1XR3A 4DCJA 1OHHD 2DU8A 5KSZA 1SZPA 2ZWIA 4FEGA 3LVQE 1R4MB 1KAQA 2KW5A 1DBIA 2A7QA 3CW9A 2I1WA 3OH8A 1DL5A 1TO6A 3MIZA 1QH9A 1V39A 3WB0A 3HXKA 1U98A 4KBYA 2WFZA 4YRJA 1RWBA 1A2OA 1FJHA 1YZNA 1N2GA 3G23A 4LOLA 3V97A 3C98A 3CUUA 4IQGA 1QQBA 4UEKA 3TDKA 2C5FA 2XKJE 4LXUA 1P2SA 4BO6A 4Z4EA 4RQAA 1RM0A 4JYCA 2E18A 1BS1A 3ID6C 1RQ2A 3VAAA 3WIVA 2IHNA 4FFPA 3QLVA 4PYOA 3E58A 2H4XA 3NB0A 4FEAA 1CC1S 3SXUA 4DABA 5K6TA 3W5CA 1Y1TA 4TZ6A 3OWOA 1GRVA 3DWFA 4ENPA 1DU4A 4P3PA 4XE5A 1E5QA 2VPZA 3MF4A 3HDVA 1T6NA 2PU7A 1A7UA 3TRKA 4LDAA 1ZISA 2FWPA 2BFCB 5FLKA 4F8EA 2MYNA 3HLYA 4MQ6A 5BMVF 3QYAA 5HKKD 3D3WA 1I10A 2VHWA 1K3UB 4LYDA 1UFVA 2YHSA 5B1HA 4D4IA 3AJ9A 1TZCA 3VO1A 2QVXX 4UVGA 3K53A 5CFMA 2QUBA 1Q0UA 3WK6A 5DEOA 3SN6A 2IBSA 1ESZA 3U3MA 1GG9A 3UJHA 5CA0B 2JHFA 2FDCA 1U8YA 4G2TA 1CQIB 3Q88A 1LH0A 2Z57A 5FBWB 1ZD1A 5MGBA 4NBTA 1U3DA 1XPJA 1D2NA 5BW6B 2D59A 1ZQ9A 3NATA 3CXUA 3H97A 3CZMA 4D8UA 4D0GA 1XRQA 4TLAA 2XUGA 4BNDA 5HK9A 5FTNA 3M6FA 1JG2A 4RESA 3E9YA 3AP2A 1I7LA 3O8DA 3Q8MA 1EXWA 4UATA 4KUHA 4ZO7A 4UHHA 5EJ6A 5M34A 1YI0A 5GIOE 1VB3A 4ND8A 5HQJA 2IY8A 1FTGA 4PSAA 3S2IA 4BEVA 3KP1A 5UKDA 4YRZA 1P81A 1QNFA 4R1LA 5KYXB 1TJ3A 3WS7A 3AEQB 1FXUA 2OM6A 3C4VA 3HN7A 5F5XA 3ZDQA 4PG7A 3NRCA 4WINA 3BGIA 2K5UA 2W37A 4RU1A 4BAUA 1XUOA 2Z8XA 4LX0A 4YJGA 1Q95A 4LQ4A 3FFWA 4N5IX 1MXHA 2HC9A 2BLNA 3G0DA 3HA5A 3MXTA 1G63A 4FMDB 2L69A 4P9NA 3ZTYA 1PN3A 1MJFA 3NXKA 3K0CC 4HFRA 5K3FA 3RYIA 3L43A 1JHPA 3IMEA 2VHZA 4BATA 1W6RA 4EJ6A 4TSRA 2QL9A 3SU8A 2X8BA 3SYNA 3FNFA 2B4KA 2XDAA 4R40A 4RZUA 3ISTA 2QQ5A 3C7TA 1X8KA 4U0KA 1IG3A 2CUKA 3CVJA 5SYAA 5I7VA 2PZJA 2CK3D 3G2QA 1VJ1A 4J0FA 1F7VA 3HCFA 4QBIA 4BPBA 4LHSA 1LK0A 2DFDA 2CNLA 2W90A 4L4RA 5GZ1A 4NATA 4WZAA 5ALSA 1ODKA 1TYDE 1U6KA 2IY7A 1Y3BE 1UEJA 3HI6A 1EFUA 1WXEA 1RQ7A 5BPFA 2FAXA 4KTTE 2C0QA 2JAOA 4I36A 3RHSA 1XMSA 1L6IA 2AWNA 4J76A 3ICVA 4BASA 2G1JA 4LN1A 3HYSA 3UBTA 3T12A 3RT7A 1FK8A 2VT3A 2WUEA 2PUWA 3IPYA 4PICA 4QQFA 2W6ZA 5BNTA 1G8HA 2W7TA 4NAVA 1XZGA 2CXQA 2DPMA 2ZP1A 3MS7A 4EHDA 3Q87B 3HK2A 3O8NA 3QFHA 4MGZR 3EGXA 4MSUA 4ZDWA 3K9NA 4DYDA 2Z43A 1UKZA 5A3JA 5JWRA 3TGLA 3FJYA 5GV8A 4BYGA 1CNMA 2QXUA 1SOAA 1KS9A 3P96A 5BSUA 1IZZA 1LUAA 1UPTA 2JGKA 1YIAA 2XYRA 4O4JF 4RD6A 5DN9A 5CG1A 3L6UA 2ZW9A 1EINA 2RKBA 3BE5A 3AHEA 3O9ZA 4DMGA 3ZHVA 3IDFA 5LQCA 3QJGA 2HB6A 3MUNA 1TMKA 3LBFA 4KNVA 5EE5B 3MYRA 5AR1A 1YNOA 1KL7A 3QBEA 4HZGA 5LB2A 4FWIB 3ASYA 3IP6A 4WGGA 4RPJA 4MGHA 3EZLA 4L72A 3ZDEA 3DSRA 3ILYA 2EJWA 5A7FA 2QRVB 3VPHA 4CIVA 4IFIA 5U1PA 2J67A 4HN2A 1DIAA 1ZNWA 2DE0X 3HBJA 2QY9A 4A16A 2IIBA 1I0IA 3DL0A 3PF9A 5EKTA 3CUYA 2NPFA 3W3ZB 3K72B 3HY4A 4GIBA 1VKZA 3INTA 2WICA 1R9JA 1QHSA 4KEAA 5KZMB 1CUEA 1FNNA 2PRKA 4DPKA 1G5TA 4PVDA 2JI4A 1GRCA 5DOZA 3RGWS 1C4KA 1DLIA 3LCVB 4Q03A 1U7OA 2ZTHA 5B57C 1B2RA 1P1IA 3ZN2A 1BVHA 4FOLA 2V97A 4WN3A 2NXWA 5BSKA 4MI6A 4CKCA 2FK8A 1ZMOA 3P2IA 1VDMA 1Q6ZA 5BQ3A 3TD2A 3KOOA 2BUBA 1U4SA 1Q11A 4ISCA 1PR4A 1IQRA 1SBNE 2AMJA 3ITDA 2C2HA 4ZVUA 5JDCA 1SHZA 1HE8B 3AHHA 1VJTA 4NTZA 4BCCA 3NPAA 3GNQA 4E14A 1B6SA 4MV1A 5AVSA 2YYYA 1CJTC 3DE0X 4Q37A 1GZ6A 1QC5B 3LW8A 4BNYA 3AFMA 3TLGA 4GXNA 3AHFA 5FI3A 3DPUA 4D6YA 4QRIA 1COWD 3EPJA 1YA6A 1P74A 3ETJA 3T5GA 1VL1A 3KQWA 3ZWXA 1YQWA 4A82A 4AXXA 4LRXA 3SX2A 1JFRA 2HR1A 2QNIA 1FQKA 3RK0A 1IHDA 5K0SA 2OY0A 5EPOA 4HO1X 1GZHB 1YZUA 2O4CA 1AUQA 4R31A 1TL7C 3G49A 1D07A 4ZYTA 3NP7A 3P4YA 4KB5A 2AUMA 4R3WA 5A9SA 3LPCA 2AKAB 2PWAA 4PGMA 4V02A 2XWQA 3QXHA 1RYBA 4UZFA 4KQ2A 3RSFA 5THXA 2M6RA 2R5NA 1EX6A 1N2XA 5JSYA 4B3XA 4FGLA 4PC1A 4PO1A 1B73A 4PINA 3DVRX 1T4CB 1Z73A 4QUJA 2JJ1D 4FKBA 1H93A 4NU6A 3WFZA 2HNBA 1PDWA 1YR1A 2H16A 3EDYA 4ZTUB 1H9BA 3QBDA 5F9MA 1RHRA 1K6EA 2QTGA 2V45A 2VPIA 3BXGA 4CM8B 4JA2A 3VR3A 4D41A 3KSDO 5CFLA 3MBIA 3PGA1 1XZQA 3H2GA 1E5XA 3NWPA 2QT0A 4WL0A 2HZBA 3RWBA 1R8YA 4TV9F 4CM5A 1JZSA 1HYHA 3H99A 4HB0A 4K6OA 4MUHA 3AOGA 3TIGA 2I3DA 4BU1A 1NLMA 3Q3JB 5AJWA 3WWPA 2AR9A 1WEKA 2ZBFA 4IJ6A 1I1OA 4ESOA 5IAAA 4RJKA 4C89A 2CXUA 2VNHA 4BB6A 3WLHA 1DQYA 5JASA 3PXAA 4MVJF 2BMFA 2FEPA 4WN9B 3S5JA 1AGRA 4NK4A 1YDHA 3UB4A 4UUAA 2D54A 1S7GA 3V1MA 1T5LA 2JFVA 2R85A 2QMYA 3G5AA 3QMPA 2H4JA 4KDRA 2YDYA 1XO1A 1AUPA 1SC1A 1X1EA 2DHDA 4B4KA 4KODA 3ES9A 3IV7A 4C0BA 2XB6A 2L0XA 4K6FA 4M83A 5LMZA 5MHTA 4TROA 1MX5A 3SS9X 3PD1A 1WEHA 2FWMX 2YR0A 3NNNA 4BKQA 4L3WA 5F2EA 4PIVA 2DUNA 1FU7A 1ZP6A 3PZBA 4KMRA 4IYJA 4UTOA 4LCEA 5ECDA 3MM4A 4YACA 1IQUA 1UJNA 3QWIA 1QZTA 4IDEA 4M87A 4WHMA 4DA7A 1BMFA 3AM5A 3WNDA 4KHPB 1ZI6A 1FNSA 2F1KA 4AZ3B 3G8DA 2Q99A 5AK3A 4HAXA 1BE8A 5E4TA 4CE6A 3I5XA 1OBHA 4ID3A 4X66B 5DSXA 4BTVA 1PZGA 5BOSA 5E9JA 1I4EB 1AO0A 3B6ZA 4UQLA 5J3JA 2OD7A 2COUA 1KF0A 2FUCA 1M8PA 1F6WA 1Q17A 2XSZA 5CW2A 4RLFA 3VUEA 1VYTA 1SBHA 4OP3A 3S1SA 1RM3A 2JGJA 5EUCA 3ZCXA 4YAKA 4YMUA 2RD2A 1TJPB 1AKWA 2OFPA 3MJCA 2EQBA 1RHUA 5DNCA 3GT7A 1A9RA 3RS3A 4EYQA 3ZY3A 4BLPA 5FPHA 4DXDA 4H7DA 2YOHA 4FYVA 3JAKB 1SD5A 1YRQA 2RHRA 5P21A 3N58A 2Q7OE 3V8BA 3AZQA 4FMDF 5CDYA 2WWFA 3K1TA 4PZUA 4WCDA 4RMJA 3TO5A 4PXSA 1TFUA 5F12A 5T8KA 2CHFA 4YQFA 5I47A 4I50B 4I14A 4YRMA 3JPYA 5TDHA 1BMQA 3NWJA 2Q5EA 3MTIA 3RT1A 4RF5A 1YDGA 1QCZA 4RTSA 1K6XA 4UOQA 4F8YA 3U7HB 3MIIA 3GLIE 2ILTA 3SKXA 5H02A 5ILGA 1A96A 4BO2A 2AZDA 2C4NA 3QF4B 4W8OA 3QKSA 3WK8A 5FLXA 2ZAMA 2ZUDA 1L7VC 3SSNA 4ZGBA 4KO8A 2PT6A 1MA3A 3K9QO 1E63A 2ZPTX 4C2UA 2RKWA 5IH3A 4OUKX 4LBVA 4MLZA 1JTEA 1XDWA 2HM7A 1RYEA 3ENVA 1NHGA 3NEJA 1GUBA 4XYEA 2ZR8A 4K81B 2O2EA 3H6GA 4AG5A 2IYWA 3L9XA 5I48A 2GK4A 3KKEA 2QTBA 1DXYA 3DEAA 3D9QX 1NUUA 4TZKA 4N6NA 3P97A 2B92A 4WXYB 4YUZA 1WTAA 3M4JA 5C32A 1E9DA 2R1VA 1VSQA 2V5UA 3AUSA 4JUCA 4UVDA 1XCMA 2PUEA 3SYLA 2VHTA 1X3LA 3V7UA 1QKIA 5BP7A 3JATA 3S55A 1ZI9A 4BZZA 2PPLA 1QB7A 4BQIA 1XDZA 1E0SA 2B20A 4K9DA 1V43A 1M5UA 2RHHA 3KKQA 1YB5A 1X6VA 2HNAA 2MYTA 3M83A 2NO9A 4U9HS 3VPFA 1QRTA 1AKMA 4BNWA 4O2BA 4MAMA 3ZGXA 1P1BA 1QHGA 4X8HA 4BNFA 3T99A 4C4SA 1B3BA 3NV9A 4HQOA 2FSPA 5DBHX 4AJNA 3WICA 1XD9A 3TSYA 3ABQB 3L77A 3V1YA 4KLZA 4OXRA 2EW1A 1K7SN 3L8HA 4XIIA 4WCFA 2V9ZA 3HPRA 5GOTA 1E3QA 2VUSA 1PK8A 2ZWVA 4UAJA 5EUMA 1GV0A 3UJNA 4HYEA 3D5EA 4WKGA 4AURA 4XM1A 3ORQA 5LQNA 1EZ1A 4OM7A 1EJ2A 4B31A 5IANA 3EQ2A 5BWCA 3ZDRA 1DCFA 5KEIA 3AU9A 3TBFA 3GG2A 4PXYA 3U4IA 1KDRA 4DPMA 3IE2A 3TPZA 1CPYA 1QGUB 2GBGA 1V16A 3M6VA 2W8BB 3QE3A 4MDFA 1ZH2A 3OEHA 2IGBA 1XF1A 1P19A 4UBNA 3E3NA 1K97A 1WA5A 2BCGY 1DUSA 4YMHA 2VL7A 4G24A 3RUHA 4EJ2A 1JILA 2VG8A 1GAEO 3SP1A 1OHHA 3DLPX 1C1HA 3LK6A 3THYA 1PV4A 1PEKE 4ISBA 4DUGD 2E21A 4RELA 3B1JA 4MUJA 2XRMA 2EOAA 5DGTA 4CFYA 4UNRA 2IEGA 1XRPA 1W48A 3TE6A 1XAGA 4PNHA 3RYHB 2X3FA 4HVCA 4H3KB 3ZBPA 3ACCA 4KREA 1FMLA 2IPAB 2VHXA 2WYVA 3TL3A 2ALJA 4DM3A 3QI7A 3T3GA 3TRFA 3HWRA 4KI7A 1M0SA 4DQ0A 5EHZA 4TT3A 3LLUA 4MV9A 4B73A 4DQVA 5KYWB 2FZCA 3FFAA 4JENA 4FNGA 4N3AA 1I2ZA 1EZ4A 3OHMA 4QPZA 1RJDA 1ZJ6A 3DMTA 4DFDA 4F92B 4P2GA 3U31A 2NNWB 2QD3A 3R23A 4C43A 4JCOA 4DMUB 4EY3A 4F06A 3MT9A 3LPDA 4FD3A 1TT5A 4ALMA 2UVPA 5CT9A 1BA2A 3KUCA 5HKKA 2Z2YA 1YCHA 2VPWA 4EUEA 1EXNA 3D54D 1YC2A 5KTMA 1KMHB 5J2UA 4Z53A 5B58T 5C1PA 2BGRA 1VE7A 2H06A 3F7NA 3LDAA 1N1GA 2QRKA 2YWJA 2K7ZA 5H3CA 2ARKA 3CG4A 4MZXA 5LZ7A 1ODIA 4UMEA 1QYIA 2K4MA 4URFA 3SC6A 3ON5A 4FGZA 1HDOA 1VI6A 2JG3A 4PCLA 1DAFA 1FP4A 5INTA 1J8DA 1OB2A 1I5OA 2ZBVA 2ADFA 4XB1A 4WFQA 2BP7A 5BR1A 2Z08A 3WTCA 3E0QA 4U5QA 1G2QA 5K4AA 3LBIA 1FFYA 1NA5A 1BIFA 4K9LA 4CI0B 1OFTA 5KWVA 3DPIA 1QK4A 2WLSA 1CERA 3UXEA 4B4VA 4BGIA 1F0NA 5I8WA 2OC4A 4KFSA 4MUAA 6ABPA 4FOTA 2P9BA 4D4GA 2DHCA 5JC8A 2HA7A 4LYGA 3IXLA 2QJWA 1WXGA 2BGMA 3NOOA 4LFCB 4AECA 4MWOA 4O4IB 5F7ZA 3ZYZA 2HQRA 2ZRMA 2G1PA 2FPUA 4P3NA 3KOZA 4J0HA 3VPCA 3ZQJA 3OMWA 1VC2A 2L42A 4MGIR 3IAXA 4R3NA 3SR3A 2LIVA 5JYDA 5B6JA 1A0OA 2DBZA 4Z7OB 2I33A 2WMYA 1JG7A 1QO0D 2CBGA 4INOA 4YHHB 1OXBB 2UUOA 2REQB 1VJDA 2CK3A 2ZYRA 1JEOA 4TMFA 4ZO9A 3W6ZA 4IXWA 5JNUA 5DM4A 2JHGA 4CG2A 1EPUA 1TKAA 4OQNA 4NARA 3NVKI 4DMRA 1ZWLA 4RC9A 4ZOAA 4MV0A 4WBXC 1E6UA 2PE5A 5IXYA 2H4WA 4HUQA 4B6FA 3ND8A 2IKSA 1E3IA 2YWCA 2HU7A 1V8DA 4YNBA 1F9AA 3RAGA 1W73A 1B0UA 2OUIA 5E3IA 1PF7E 4LHZA 1HX7A 2B36A 3PCRB 3TIFA 1FDUA 1GGHA 4CYMA 5EZSA 1PG5A 2YZ2A 1F8FA 3B9QA 4G3XA 4B9AA 1J00A 4WGFA 4ZDKA 5EWMA 3TN7A 1U1FA 5AHKA 2GSWA 2WYOA 5NULA 2A1IA 2XMQA 3B7WA 3SKVA 1BC5A 4OREX 4DZZA 4XCXA 1GA6A 1X7DA 3OP1A 4EYGA 4R6WA 1GTVA 3ILSA 3GZJA 2ANCA 1B6GA 5DHFA 5ECYA 3ZHUA 3ROEA 4DVJA 1MIOB 4RHYA 1UAYA 4NCJA 3WADA 3VNQA 3A2KA 3AM3A 3IOYA 1HDZA 4I4TF 4KMMA 4IEEA 2JLWA 1NYQA 2DR0A 3HM9A 3WQRA 5J4KA 3FUTA 3II6X 4QDOA 2QL7A 2MCFA 2XNDA 2UZ4A 4LVNA 3IR7A 1XZHA 1LS1A 2VRWA 1LRKA 5CTAA 1PJQA 3QX7A 4KHZA 4M9CA 4RY0A 4QTYA 1X1RA 1UH5A 3RUEA 4B7AA 2IBMA 1S1MA 3A7DA 5F33A 3KPYA 2G36A 3NYWA 5G3ZA 1K98A 3UC5A 4ZOCA 1BZYA 2NZ8A 4B6JA 1KO4A 4LFBB 2P1ZA 3RV3A 2FMTA 5KWIA 5T6BA 1EWYA 2EBHX 4M8IA 3VISA 1CUDA 3LXUX 1SPXA 2IP2A 1MAAA 2QR3A 2YVLA 4FGJA 5BN4B 2C2XA 3ZGYA 4DN6A 3RRXA 4ZEMA 1U80A 2VWGA 5IASA 4Y2JA 1ZAKA 5FORA 3W4IA 2I3BA 3RHZA 3AY6A 1GPUA 4ZCSA 3DLIA 4YFYA 2OZKA 1SHKA 3DMFA 3J7TA 3EEBA 3BTOA 5HILA 2PSEA 3SEAA 3W5UA 3W5JA 1V37A 1T2AA 1VP3A 2R6JA 1JEEA 3SIRA 3ZVNA 1CNFA 3A6DA 3WQHA 4R2MA 4A2QA 4Q1FA 4IJVA 1M76A 5ELLA 1YJBA 3HUTA 1I0LA 4CUJA 5GV7A 2C8VA 5K09A 2O48X 2DULA 1ODSA 1Q0RA 2PGJA 4ZKEA 1LU9A 1LW6E 2E4WA 1XCOA 4HI0E 4H0NA 5E0OA 2QMOA 1KBZA 2OHHA 3OMLA 4IX1A 4AY4A 1YL5A 5BXYA 1V25A 1MJ5A 5K6AC 1LNZA 1GG2A 1BCSA 1W4LA 3L7AA 1GRQA 2AI2A 4I4NA 3DB1A 4PQEA 4FHEA 1VE9A 4Q4CA 4U2GA 1WABA 3A9RA 3AM4A 5A6SB 2D0IA 2QQGA 3G13A 3TL6A 2YVUA 2FUNB 4Q9LA 5JSKA 5I9IA 3A2LA 3EYWA 1QZXA 3GDWA 3HKCA 2QW1A 1COWA 3HZRA 4I8XA 4CCWA 5HMLA 2SKDA 2ECPA 4HUTA 2CWDA 4WIAA 5EFOA 2O3TA 1P9RA 3EZ6A 4MYHA 4ML3A 1QGZA 5CVJA 1HG1A 3DL4A 3GNLA 1TNDA 4BX2A 5JOQA 4XWWA 1QF6A 3H11B 2D5IA 5T4EA 2JGLA 3GZ4A 4OQ4A 1HLPA 4J16C 1X1AA 5LA6F 3RTGA 1ZOOA 2GWRA 2XVAA 3EIUA 3ZCRA 4B47A 4WJLA 3PF8A 2WJYA 1ILEA 1EFPB 4MIYA 1R6TA 3VC1A 1TEVA 4P84A 5HGJA 4TVOA 2JIDA 5TT1A 5CVDA 1U8EA 1XJWA 4WA7A 4DV5B 4XA8A 1OA0A 2ZTSA 2BHRA 2B34A 1E5LA 3ZE0B 2IYAA 3C1AA 5AXCA 3RV4A 3VHRA 2D1QA 4QO7A 5FO0A 2JJ1A 3K6KA 3PKJA 4OPMA 4C2AA 5K05A 3I04M 3UKJA 1A71A 2JCXA 5JE8A 4PWZA 1SUDA 1IULA 2PA0A 3MQFA 2X42A 3EF1A 4ND1A 1KJQA 3ESQA 4R16A 4Y7DA 1G41A 5CVEA 4ZANA 4U2DA 3WL6A 2AOUB 5JQGB 4QFMA 5D85A 3H6HA 3IDOA 3OCYA 1C2YA 1I2AA 3VFDA 3VPXA 4ZZIA 1U0NA 5CFRA 5CEEA 2I2AA 2VUIB 5AVKA 4KWCA 4F91B 1MG0A 3I5UA 4RKYA 1E4EA 3ZQ4A 1ZC3A 4WK2B 4BNLA 2FPWA 1HUQA 3KETA 4Z7NB 2X2OA 4GC9A 2FEKA 1RPNA 2EZ8A 3VR1A 4DSZA 1LSJA 3NRJA 4G8BA 3LBYA 1C7JA 3IV6A 3PPIA 3LDFA 1Z15A 2GPYA 1L5LA 5E8RA 3RUCA 3KAKA 3HXPA 1LK7A 5I9TA 3U1TA 5B1DA 3UN1A 3GLGB 2D3WA 3LF1A 3VBCA 4K1LA 5I7HA 3EMBA 3EZ9A 2RGUA 1FNCA 3TTUA 4L8FA 3RK4A 1Q77A 5KX5F 4JP2A 4TQGA 1PLJA 3H05A 3Q72A 2WU1A 5LMNB 5TMBA 2J3JA 1L5NA 1M1YB 3KDSE 4QUEA 4EOGA 3FCYA 4J9UE 5TF0A 5EY5B 1I1HA 2R62A 3UBMA 3PEYA 2WWWA 3C43A 5IXJA 2JIMA 4OJKA 4F9GA 2XADA 4GPTA 3G8BA 4TRRA 1QG6A 4IIHA 5HUJA 4L8GA 3BWMA 4QJ4A 1H2YA 3J7AC 4NS1A 3TINA 4HZUA 2C98A 3TTYA 1HQYE 2BE7A 1S3SA 2PV7A 2NSLA 1R0ZA 3BMQA 3JAWB 1NM5A 2XCUA 4S0XA 3U4MA 4MW6A 3R75A 2AWOA 4GQBA 1L4KA 5GOZA 2R7LA 2E82A 3AJAA 1KJNA 2IOQA 1J5EB 3I83A 2BEWB 4BVHA 1AXGA 1P4JA 5LM3A 2YXDA 3PHBE 2PLAA 4H35A 1Y5LA 2JFZA 2Y92A 3PFHA 4FP9A 1PBTA 3K0HA 2VLBA 2JPDA 1NUPA 1RRMA 1YE5A 2PGXA 3HVKA 3W9SA 1W4ZA 1BOOA 2C97A 1CYDA 2BZ1A 2FEAA 3SEQA 3OLZA 1VTKA 3UFXA 1V41E 3UGTA 1PW5A 1I4OA 4GI2A 4A92A 2XHZA 2WJHA 2QYOA 2VHYA 2X8LA 3OPQA 4YO8A 3ZGZA 1DQZA 2PYZA 4OSOA 1TT7A 2ZI9A 4RTOA 3FOBA 3U4GA 4B82A 1X1QA 4M1TA 4EG0A 4ZYYA 2OQ2A 3JR3A 3OFVA 5FWDA 4RENA 4P7GA 1IOLA 1IQPA 4IZOA 1NJ8A 4NDNE 4QEDA 2BGWA 4GSLA 2CVOA 4EG1A 5KIAA 1NDUA 1QQAA 4OI0A 2GA9A 5KNDD 4CKEA 4J75A 4CMIA 1M6VB 4IUBS 2AG0A 1WS6A 1U1IA 4Q3OA 2YWEA 4RMHA 4YAIA 4KU4A 4TL9A 5JBNA 4R9UC 2BFOA 5G0WA 3RVNA 2B1QA 2WD7B 2PEZA 1X3SA 3GVCA 2J4FA 1ZN8A 4NBVA 2ZUVA 5AI8A 5B7PA 1U63A 3GDOA 5CD9A 2V7UA 4O08A 3PNYA 4YT4A 1AB5A 3DMNA 3K92A 3P5SA 1NW7A 3EEFA 4JJ4A 2IEAA 5HF8A 4RA6B 4LXYA 3GVHA 1TLFA 2GZAA 3GRVA 4LF5B 1U9JA 3V4OA 5CX1A 1ZLXA 2VPYA 3LT5A 3TSOA 4AJJA 4B5LA 5IKPA 3INYA 2XJ9A 2VBFA 3AFHA 2EJUA 3E5NA 2WHPA 2W11A 1RWPA 1U5BA 1WAMA 3ZY6A 3UCXA 3INGA 2N1MA 1I6LA 3MGBA 2V6FA 4L7QA 1Y5RA 1SVIA 1Z63A 5EWJA 3GJ5A 1QFMA 2GESA 2GZ3A 5DXFA 1GPAA 4KZPA 4BAGA 2ZYWX 3E9CA 4FONA 1WRBA 1H6AA 3JQGB 4R1UA 5JRZA 2OCKA 4INAA 1UBSB 3IKVA 1KIFA 2ZBPA 1NFRA 3KVYA 3L7IA 3T3PB 3VZBA 2XQFA 2HMSA 5DIZA 5H59A 4DJEC 1AK1A 1VM6A 4ZVRA 4G5OA 4I1YA 2ZUEA 3EMKA 4M49A 4ZI7B 3L0CA 4QJBA 5JRDS 3OTIA 1W0JD 4G1CA 4XR9A 4DQUA 3VNVA 4OP2A 5AK6A 2A5DA 1Y82A 1R2QA 3CG0A 2C5EA 3JWEA 3V7FA 4R71A 3PHCA 3OZTA 1V3VA 3ST7A 1Q0LA 1WNFA 3ZI7A 3IOEA 4ECEA 1TO2E 2F3PA 2RGEA 3BK7A 3SWWA 3RVKA 2IQ5A 1ZU4A 3ESBA 3OCXA 4PNPA 3NTLA 5EZYF 3IYLW 4N8DA 1EU1A 4OOEA 4DLZA 2AXEA 1KZ1A 1QJ4A 3C45A 2OQIA 1FRVA 2H63A 1U3WA 1D9ZA 1FE8A 2ZE6A 1GGEA 4L74A 1TMGE 1SD2A 4N82A 4JZKA 1YQQA 1CY8A 2F7SA 4MPRA 1NNUA 5FO1A 1GA4A 1DAOA 2FN3A 1TEXA 3QLJA 1XRJA 2LCFA 2Y0EA 4EW3A 3NKLA 4ZHQB 3ZWMA 3D5TA 2GF2A 3L0DA 3RD5A 4BUCA 3DP9A 4RS4A 1VA4A 3KYIB 1P7CA 1LX6A 2YN2A 5A2GA 4XFJA 3WDMA 1QGED 5EMLA 4DUGA 2ZJ7A 2DJIA 3OBBA 1N4DA 4WADA 2C59A 2BONA 1UJCA 4F04A 1V5FA 5IWCA 4Z9XA 3RWOA 3ZE9A 2XGSA 2P68A 2QRUA 3UFBA 4IKPA 3W77A 2MSCB 4IQ8A 2XYVA 2E87A 2G04A 2PYIA 3HSSA 2VK2A 3ONDA 4WK0B 2CVFA 3T35A 3W6UA 1JECA 2FNAA 1ADCA 2YC4C 1NR1A 2ZITA 2WU3A 5TQ2B 1DKUA 3G8YA 4LZNA 4OI1A 5DX1A 2AC4A 2OO5A 1I24A 2ORYA 3CU5A 3O84A 4OU5A 2Q0QA 4X20B 1QHHA 1NOKA 4DRXA 3ZLUA 2XYPA 2YWRA 2J5KA 2PPVA 1UBJS 5IUKC 5MFZA 1JFTA 4HTFB 1FNBA 4MHTA 4PCVA 1AJEA 3BE4A 2FUG1 6REQB 1W1UA 3C70A 5COQA 2FSVA 5EJEA 1XDGA 1KAHA 2RGBA 4BNGA 2AA3A 1Y9EA 1Z33A 3G0GA 1EUYA 3NBQA 2GTHA 2PGOA 4D9NA 3MGGA 1JEAA 3M82A 4MVJE 1KJIA 1MORA 3BD8A 2PUGA 4QATA 4GPIB 5KKAA 5JNLA 2NUBA 4TYWA 5HBRA 3DVQX 1NKVA 1RI4A 5JQGF 3FUWA 5ER9A 1CUGA 3O3NB 1J0DA 4UHBA 2Q0HA 5EERA 1P7YA 1FUYB 1UIMA 3WRVA 1DBVO 3A9SA 3QNMA 5BN3B 2R7NA 1XZNA 3GXBA 7ADHA 5CA1F 3H2KA 3WLSA 4JB2A 2G76A 3D8NA 2VPPA 4R3UC 1IXKA 4XW2A 3LUHA 2Q6TA 5AMXA 5DNVA 3TLMA 2WPNA 2GZMA 1S4MA 2ZRIA 4LECA 4CL0A 4QPJC 3AGPA 3SDSA 4ZMSA 1XTTA 4INJA 4UUOA 4ZFNA 1HRDA 3HDHA 3IPRA 3WMEA 2X15A 2I0FA 3GV0A 1ZXXA 3QXJA 2JK1A 2ZRNA 3RAJA 2J59A 3S27A 5TGDA 1K8XB 3GI1A 4NV0A 3UJCA 1NUTA 3GLIA 2FRDC 3BS4A 1L5RA 2AKYA 2G9VA 3E53A 1V7QA 1GSAA 3PKIA 4G36A 4DADA 1BMTA 3HJFA 2GSDA 4Z6KA 5CAEA 4IIJB 2Q2OA 4Q1BA 4RMGA 2YDXA 2XJ4A 3TOXA 1ZICA 3A7EA 4FCWA 1KQNA 3VAYA 1NQWA 2QQ0A 4HXYA 3GP3A 1AKRA 1JDBC 3T7IA 2Y1KA 1RCUA 1NMSA 1QO0A 3V4PB 5FTKA 4AKGA 2X19A 1R9MA 1REQA 4FBMA 1FS5A 1PHRA 3SR0A 4E13A 1N0WA 5ICSA 2WJPA 2Q0SA 3PQEA 5J2TB 3WXBA 1ONOA 2IV7A 5C8VA 2QLLA 1VPLA 1JNXX 4Q9DA 4EGSA 1BFKA 1H0RA 2B6HA 2QRMA 2WM9B 3CPEA 3IODA 3P5BA 5DMXA 4ZVPA 2UUCB 2EYUA 3FLEA 2WAXA 2R7MA 2W48A 3BXXA 4LJ5A 3TX6A 3KOMA 5FFNA 3WLAA 3ZV5A 2JHPA 1Q20A 2F8SA 3Q2IA 5IKOA 4DQDA 3OZDA 4MMXB 3RNLA 1EVYA 5L4SA 4LF6B 1BXGB 2VUHB 1M1XB 4S2EA 1IIRA 3NJRA 3TMKA 1SKQA 3C6QA 3PJRA 2I8AA 1ZDMA 3PCTA 5CVTA 5J4VA 1SHLA 5I3ZA 3WL7A 3RS2A 4HFNA 4BE9A 4BRSA 4ETWA 2OO7A 2G83A 3JCZA 1OFHA 4K9PA 1F51E 1QYDA 1UBRS 4L50A 4AKEA 4DL9A 4EH1A 5FUWA 3U9LA 4ARCA 2FK7A 2V6MA 4L9SA 4D92A 1XRNA 2YIDA 3ML1A 2YIMA 5B3LA 2KX7A 2FQQA 2RHWA 3AL3A 3RRFA 2WWXA 1M5RA 4DG9A 2IZ1A 5C4MA 4OP1A 3BD6A 1K9VF 4P3KA 2IHKA 1QYCA 3A1VA 3S1AA 4IZHA 4MQEB 1T34A 2FMXA 5JIBA 3M6AA 2OV2A 2VJNA 5SZKB 1QAMA 1UPFA 4FS3A 3SEZA 2QW8A 1P0IA 3RBVA 1RXIA 4LE0A 1QDUA 3ET5A 4B7ZA 2O6LA 3RVDA 4M0FA 1VJGA 3FOZA 2AZMA 2J48A 1HNZB 4IHJA 3CVWA 2Q62A 1MT3A 1RRVA 3UJ3X 4I4LA 1KY4A 4FW9A 3ZC3A 4KLNA 2G4LA 4EKGA 3E1GA 4F1JA 1UXOA 3TTTA 1EUDB 4YK7A 4EFNA 1ECPA 1AUOA 4JWKA 3KDPA 2YY7A 3LHKA 3A4MA 3ET4A 4GVLA 3ZBTA 3A1SA 1NVKA 4OQFA 3VHXB 2A0YA 3QPCA 4WACA 2OBMA 4KAJA 3VTKA 2Q4TA 1R8XA 1G3UA 1NTOA 3D6NB 1N8KA 5EJ7A 3UT5A 2W71A 4AMYA 1IPEA 1SNYA 3IP8A 3EVEA 4KUGA 4YRCA 1PYDA 1OTXA 3MJFA 2V8BA 2DLCX 4B7UA 3BMNB 2IZOA 1T5OA 2Y9PB 4MR9A 4YVFA 3T7TA 2CCGA 4L6IA 2XT0A 2YBEA 1JQJC 4RDXA 1UODA 4I2NA 4CDNA 4LJKA 2HO5A 3RFVA 1ML3A 5KWJA 1NT4A 4LPSA 4KN6A 4F9TA 3FLAA 1KC1A 3BA1A 3PNVA 2Y0DA 3NCHA 4JJAA 2EIXA 4UCFA 4XEHA 4MVJD 1L5ZA 3HKDB 3KT6A 5DTIA 4YP1A 5AVVA 2WSBA 3K30A 2IZZA 1W35A 4GR4A 4OL0A 3W5DA 3C3PA 2G7MC 3TRIA 2ZJZA 4FZVA 2R8EA 4RJIA 5J1TB 1Z7EA 4H16A 1R88A 4ALLA 4G4SP 3RS4A 4U7JA 3NTOA 2GBIA 2VJYA 4MQBA 5D6NA 1CF9A 4GXTA 4UHKA 3UPTA 4WBSA 2PJRA 1SKYB 1KI7A 1QP7A 3CFYA 5LC1A 2Q29A 1DHTA 5DU2A 1UJ2A 2IZ6A 3MYYA 4QYIA 1OPRA 1S9DA 3CNHA 1J9GA 1IM8A 5ADHA 3K5PA 3DXXA 4WOKA 5HOEA 4IOMA 4HLQB 2W6OA 4URXR 3SF8B 4QGGA 1WPGA 3QKRA 4DT1A 5DH9A 2WF6A 1X42A 4C04A 5JPCA 2ZQZA 4OYRA 3LTNC 3O1HB 4MP6A 1RKXA 1P2FA 2NG1A 2WT9A 4TKVA 1U2ZA 1JDNA 2C2BA 3RARA 3V48A 4UCWA 5G0UA 1K3FA 4JYPA 1GGMA 1W87A 2QGFA 4FN5A 1Z2CA 4JB0A 4GI5A 3ZE2B 4DIFA 2E5WA 5BR7A 4A6DA 1VLVA 1QYWA 2ZYDA 3H3JA 3HDYA 3ZWBA 2ID9A 2FZKA 3F97A 1OGIA 4IG4A 4YCSA 3NH6A 4IVNA 1BTOA 2IY9A 1R00A 4MH0R 5KYYA 2CLLB 1V11B 3HE3A 3I4LA 3Q4GA 4MUGA 4R6XA 1QZ3A 5IJZA 1JTFA 3OLWA 3FPFA 1HDXA 4UXJA 3ZU3A 4MB6A 2GF0A 3U4QB 4OHOA 1P33A 2P9QA 1VDZA 1OQAA 3LNTA 1PR6A 3MG9A 4BMZA 5CFNA 4CQMD 1Z8NA 2A1UB 4RHTA 2YYSA 3CEHA 1G17A 3V8RA 1WSAA 5BXQC 3U44A 4M6WA 3DZFA 4DC9A 2HMAA 2NTNA 2VS1A 4RTNA 1AZTA 1OAAA 2QTMA 5D01A 3FHCB 4EUFA 1RQLA 4GLLA 2RDMA 3L8YA 3USCS 3SPXA 4ZCIA 3N2KB 1QRAA 4HEA6 4WBNA 3G2LA 2ZT8A 4H7IA 3WWZA 1MHPA 2R751 3CKLA 3LCMA 3UJ7A 1A88A 4YJ3B 3KL2A 1ODTC 4R1MA 1MFPA 5I45A 5JSUA 4FI3F 3WYCA 2RHCA 2NAFA 3ZY2A 1TE2A 4EGJA 3EJWA 5C7LO 1N0IA 3G2KA 2HJGA 1JU9A 4LRSB 2JARA 5JCZA 2QPTA 3AK4A 3PCXA 2W5UA 4JYMA 1HTWA 3NHYA 1NMXA 1R0RE 4RDIA 3O4JA 4HNAB 4XQCA 4D9MA 2HREA 1JJBA 4IDBA 1GRRA 5DBEX 3ILXA 1TI7A 3AI3A 3NC1C 5KOYA 1T91A 4FM9A 2IYVA 3VYSB 2V9CA 5EP1A 1Q1ZA 2E37A 2UZ1B 5JS2A 1DCKA 1TF2A 2FW0A 5CU7A 2HQBA 5BRAA 1JFVA 4JT8A 2H1OA 3R5HA 4ZU6X 2IXEA 3Q12A 4FMCB 4QUBA 3KYDA 2PX5A 2UAGA 2ZIXB 3PPWA 2OBBA 3L0PA 4BX0A 5LD2B 1GFIA 3RS5A 2JGIA 2VCEA 3P26A 3R6TA 3UATA 3E7FA 2ZIFA 2A33A 3IEUA 4ZAYA 1ENPA 2HK9A 4Y2VA 2H1IA 3A6FA 4NYIR 5C46F 2PSJA 3B1VA 2A1TS 3WKAA 3GJYA 4C4OA 4MGEA 1YU6A 3GA5A 1N2CB 3UHAA 3TZLA 4ZOQI 3H8WA 1Z07A 2YWGA 3FDXA 5E9WA 1RKVA 5C8YA 4BBAA 4CM4A 4QWMA 4DV1B 4JI8B 3TX2A 4ZVKA 1XAIA 4IP0A 3ZHZA 4G8CA 3L7KA 2FWAA 2NSYA 4Q7MB 3P9XA 1FRZA 4IUCS 2EFCB 5L53A 4QDTA 1UEIA 3CE9A 5K0FA 5F2NA 7YASA 4FIDA 4OSEA 3AU8A 4UBIA 4TMVA 1NP3A 3LQRA 4I1OA 4CMCA 2MINB 4HVAA 5D8DA 2C03A 2GBPA 2HF8A 1KKUA 4QVKA 4QAQA 4X7PA 2GCGA 3ZDBA 3KZMA 3RC3A 1B15A 1KVQA 2HXGA 1NFQA 5B4UA 3BIWA 2NZJA 5IULC 1M2VB 3UT0A 2ZRPA 2B6NA 4FFDA 4CLRB 3AR8A 4FOSA 3FUCA 3GNSA 3UV3A 3G0OA 3UTDA 3DXZA 1U7UA 1KK3A 1K68A 3IVRA 3V34A 3VZRA 5L3RA 4OX9Y 3HBAA 3F3KA 4UNIA 2EG9A 4JS0A 2IUEA 2GA8A 2ZJ2A 4Z4FA 3EXAA 4MRMA 3N86A 5EGNA 3LQQA 3HB1A 3IA2A 2F00A 5BSHA 2UU9B 1SHUX 4CLOB 3TSWA 3SLRA 1W0JA 5IDQA 4LE2A 3R24A 1TUEA 1XVVA 4PC6A 4YJDA 3CUKA 1J21A 3R7BA 2PFSA 2QLJA 1E92A 3GUUA 3JQQA 2XTJA 1DJPA 1RE1A 2PD6A 3AILA 1OSNA 4F4DA 1X74A 3FCXA 1N1DA 3UF0A 1XLUA 3M4NA 4II3A 1ICIA 4P8RA 1WY7A 3U49A 3K6SA 3N8NA 5KQSA 2BOVA 2TRSB 2PQ0A 2QSYA 2JI6A 2XCIA 1XQWA 3JSAA 1EDBA 1VYVA 2SHKA 1KZGB 1N9GA 1MA0A 2VBGA 1E2NA 2FQ1A 3Q8WA 2XKKA 1G3IA 2REBA 5BMVA 3ANLA 3IL2A 1N0UA 5REQA 3IOMA 5EC8A 2ZSJA 1AHPA 4QYSA 4BO9A 2KS6A 1TTHA 5K2MA 4ZU1X 3EA0A 3ACDA 1AQYA 3UV6A 5HDBB 3KS9A 3KSUA 2YMQA 4JKYA 3SC3A 3ZZTA 5C7YA 5BNIA 2OXIA 5TS2A 1P1JA 5KB3A 5EMJA 1NVDA 2O2IA 3G2OA 1LV7A 2DYKA 3F6PA 4OFBA 3CN9A 1OT5A 1J56A 4D0LB 4CXMA 3KTFA 5BOVA 5BVHA 3STWA 4RKFA 2FR1A 3PXUA 3RC2A 2V74B 5C5CA 4BNKA 5DT2A 2Q6VA 2YWXA 1XD8A 5A4DA 1QO7A 2CF5A 2YFYA 4EW2A 1FLNA 5DHPA 4QHYA 5BWBA 1RWWA 2RGNA 5E3JA 2HK7A 3IILA 1YZHA 1K8RA 1DZIA 3BICA 4BLOA 5B1YA 1U8UA 4QODA 3MWJA 2A5LA 5TQVA 3IUPA 2Q28A 4QULA 5A4KA 4M8KA 4Y2TA 3ZU6A 4C2BA 3RM3A 2O07A 4LBYA 2BBWA 3EGDA 1G6Q1 1O95C 2P8SA 3ELDA 3L1KA 4HQ6A 4YRIA 1ZSVA 1YB1A 1F9EA 3K3PA 2PCLA 4AX8A 3MTGA 3KDAA 1KY2A 1R50A 3DF9A 5E9QA 2LNDA 4NZYA 2ZVPX 4ZRDA 1U2PA 4GZ5A 1CP2A 2CY0A 2NO4A 2OZEA 3F4KA 5EZ5A 3TEFA 2PO7A 3W1EA 4CRWB 1RJ9B 5A5EA 5GVRA 2GQ0A 1LPSA 3MCUA 2I3AA 2V6JA 2J45A 3OY7A 3PITA 2EHDA 5DK6A 5A1JA 2ZYTX 1YAJA 2Y0PA 1VSTA 4JI4B 4G37A 1T1IA 3LCCA 3KFXA 4RZIA 1HRKA 4H6VA 4AU1A 1WZNA 1RTTA 3OECA 1I1QB 2D1SA 5BV2P 1XLTC 1X1BA 5K3BA 4L7VA 4AP9A 1YRLA 1T9GS 5BN5B 4R2JA 3ZS9A 2MU1A 5FTWA 4WY2A 4CIWA 4EPWA 2O7SA 1TDJA 2Q3EA 3P4UA 4NH4A 3VMMA 2RCYA 1G9TA 5LP6B 4WMLA 1JGTA 1W2GA 3P45A 2QD4A 1LGYA 1Y3DE 4KCGA 1V9SA 4ZOLB 3O4HA 2FUKA 3AVUA 3QVLA 4H77A 1MZPA 5EIOA 1NBIA 2GASA 4EUKA 1H2ZA 3UMMA 4JV5B 3NHLA 1SU7A 1N9ZA 2NO7A 2FMHA 4IILA 4XYGA 1YB2A 1IEQA 5FYDA 3T94A 4YXWD 5KC8A 4D0RA 1X1TA 3C3XA 2G88A 3DB2A 3EWSA 4O4JA 5JISA 1XELA 2GI4A 3ZCUA 1E3MA 1W34A 1T6BY 3NBKA 2WVGA 5CM8B 5KKNB 4Q82A 1UF9A 3A9VA 3CGGA 4V39A 5LLTA 5IW8A 1ILWA 4ZAFA 3MK31 2CV1A 1MC1A 4G8DA 2CXOA 1F4PA 1Q0QA 1WPQA 4GWLA 1Y3IA 5AKKA 3RVJA 4AG6A 4HT3B 1SVLA 1XTQA 2VH1A 2FUEA 3QE4A 4GI3A 3SZGA 3TM4A 4YCBA 3LGSA 3LT1A 1T10A 3HBFA 4EDHA 5IABA 2QX9A 1II8A 4EBFA 1ZMBA 5LQJA 1PJSA 3N5KA 4TPKA 3VTAA 5F23A 2PUDA 3SF0A 1KQGA 2RBEA 3F7OA 4H1TA 3QVSA 2WB2A 1GPMA 1HDIA 3JS5A 4Y2RA 2PLFA 1P2TA 1YJ8A 2VBCA 3ASZA 4MUEA 1A7KA 1V5EA 2ACEA 4Z54A 3ESCA 3Q7TA 2HA4A 1I51A 3C1OA 3MJ4A 4KPUA 4LY6A 3TZKA 1OI7A 4ITRC 5E6UA 4TZ0A 1H2EA 2D2IA 2TMKA 1E1KA 1ZITA 5JJCA 1FDRA 3VHQA 6Q21A 4OMFG 4N7RA 4X8MA 2GJ4A 2ASVA 3B13B 1QS0A 4X3OA 5HF9A 3TVYA 2R66A 3PR1A 2ACKA 4NOLA 3TI9A 1SCJA 2OYSA 5JCJA 2F55A 3RFFA 1K4KA 2FJUA 4JBYA 2D00A 4FGKA 4ZVSA 4G0PA 5HRAA 4Q48A 2AW5A 3DA8A 4N5LA 5DNUA 2P6RA 2G5GX 4TL7A 4WD3A 1TTTA 1C80A 1X77A 3K96A 4P83A 3U3JA 3QKWA 3K70B 1KY5A 3NW9A 2C04A 3R41A 3QNWA 5A0FA 2Z5LA 4KQGA 2X0KA 4WOCA 1CTQA 3G3EA 3H18A 5L7YA 4LOAA 1V8PA 4RD1A 1A9PA 2IEIA 3RKRA 5DT9A 1UZMA 1XZ8A 2Y4NA 3IO5A 4HXFB 3WYAA 5AK5A 4F8JA 4YV1A 4AWBA 2J0SA 3HY3A 3WWEA 1HA3A 3Q41A 4OXNA 1G8PA 5DSZA 2X13A 3AVPA 4LVOA 3DMDA 5AJHA 4ITVA 5LIPA 1CZRA 1A82A 1F6BA 2AJCA 1Y7HA 2HGSA 2IIVA 2EVWX 5EPUA 2R97A 2XWSA 4UUMA 3SFTA 1MZVA 3UV7A 2QDXA 4WZBB 2VQ6A 1O94D 3L1JA 4YRNA 4I3FA 3AL2A 4BFWA 2XUKA 5GPBA 2P9TA 2CLFB 1E18A 1R0SA 2SCUB 3BYZA 2R2AA 4O8ZA 4INPA 2BR5A 5LQUA 4BMOB 3KPWA 4HFMA 1P1KA 3N2EA 1CFJA 2FETA 4XDYA 4WXMA 2WD8A 1FL9A 4UM5A 1ZD8A 1HDGO 5EIAA 4UPDA 3G7NA 3BMOB 5JCXA 4ZI7F 5K3AA 3P1JA 3WMWA 1MQ8B 4F6RA 1R4MA 3R6DA 4XPIB 4PX3A 5GM2A 1ZJWA 1U8XX 1GCGA 1MAHA 2C4UA 3LZDA 4KVFA 3OUTA 2P2SA 3C14C 5KQRA 1ZHOA 3GGGA 3KEMA 2WUWE 3LLSA 3WVNA 4G1MB 3TH5A 2PS0A 2VKTA 4WKCA 3O8OA 5CTJA 3ZJTA 3WLTA 4B3JA 4YREA 4UU7A 2VP5A 3WWYA 3ZEAA 4E5UA 3R8CA 4BBPA 3N53A 3SVLA 3KSBC 1IJKA 2Q1YA 2HWWA 2DBYA 3GRUA 1FUUA 5CBPB 1FJ2A 5AD1A 1SQ6A 3R7LA 5G0TA 3S70A 2O7VA 2GK3A 3SQOA 2XAUA 3DULA 5CJPA 4XFDA 4PTZA 2VYCA 1Z7WA 2J5BA 5DWQA 2VZ9A 4QXRA 4BOYA 4YMGA 3MWEB 2EP8A 3W3AH 2BZSA 4Q4AB 3GLUA 1GQQA 1V7PC 5AVJA 1YRWA 1JQBA 1ODFA 4QGBA 4L28A 1SVSA 1XQVA 2F17A 3JTEA 3M8KA 3LZ6A 5FOWA 3RRBA 2RAUA 1XNJA 3OLYA 5I9BA 5B36A 5GJBA 4JEMA 1ND5A 1UWLA 1ZSNA 5KJ1A 4TRMA 2XGGA 3JWGA 4QECA 5IX8A 4BFTA 1I4LD 1JKIA 1EZZA 3VH2A 3D59A 4FNOA 3ANTA 2WQZA 1FRFS 4YUAA 2OT3B 5ETJA 4JFRA 4D6PA 1OC4A 5F21A 1DWPA 1Z6XA 1V6AA 4AY5A 1XVUA 3WR5A 1RJWA 1M2HA 5ESRA 4DCPA 2VDNB 4PY2A 2QTTA 4DARA 1BEEA 3K4PA 4LK3A 5CXSA 1K92A 2IPLA 1AZSC 2V6BA 2VOJA 1EXMA 3T3HA 3QVXA 3K71B 1H4TA 3ZD9A 3MMSA 4X7MA 3S81A 4JI5B 4NY1A 5EIXA 2HIMA 3K32A 2B9EA 1KZ7B 1Z2OX 4NICA 2XQKA 4DCTA 2Z09A 4AT1A 1VYUA 2IHVA 4CQMA 2BF7A 3WLIA 3EQ9A 3PYMA 3AUTA 1OTHA 1VL0A