3QMWA

Redj with peg molecule bound in the active site
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
251
structure length
246
Chain Sequence
SAWFPRPVAAAEPPDPAAAPLRLVCFPYAGGTVSAFRGWQERLGDEVAVVPVQLPGRGLRLRERPYDTMEPLAEAVADALEEHRLTHDYALFGHSMGALLAYEVACVLRRRGAPRPRHLFVSGSRAPHLYGDRADHTLSDTALREVIRDLGGLDTLGAAYFDRRLPVLRADLRACERYDWHPRPPLDCPTTAFSAAADPIATPEMVEAWRPYTTGSFLRRHLPGNHFFLNGGPSRDRLLAHLGTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the RedJ Protein, a Thioesterase from the Prodiginine Biosynthetic Pathway in Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
molecule keywords Thioesterase
total genus 80
structure length 246
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.-:
pdb deposition date 2011-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qmwA00
2QZPA 5LZ2A 4H7JA 1OXMA 4HZGA 6YASA 1NU6A 2HA5A 4FKBA 3WQHA 4PSDA 2WIJA 2OQVA 4Y2SA 2PSHA 3E4DA 5LZ9A 1EK2A 5K3DA 1R9MA 3FAKA 5DNVA 2EDCA 5ALVA 4BE9A 1YASA 3E3AA 2XQKA 3OPMA 1QGED 3FSGA 4O08A 3C8HA 1W75A 2WM2A 1KEZA 3RK4A 1F0PA 3H1BA 3FLAA 2R8BA 3AZQA 4U2DA 4W63A 3PF9A 3D2CA 5FLKA 2OLEA 1K63A 2B4KA 3K6KA 3O4IA 1A8UA 1JJBA 4B81A 1CUGA 2YASA 2JGKA 3C5VA 2I78A 5ALEA 4UHFA 1WHTA 3CCBA 1RP1A 5I7UA 5JATA 1QJ4A 1YB7A 2RONA 3G9ZA 2JGEA 2QKYA 5AJHA 2IX9A 5D3ZA 5H3HA 1ZI9A 1UKAA 3WL7A 3F9CA 4X00A 5LP1A 1FFBA 2XB6A 1YCDA 2QRUA 4UHEA 2RHWA 1XQWA 1XZJA 1MN6A 1VZ2A 1CQWA 3WA6A 4MYSA 4W1RA 4ZV9A 1XZIA 5A6VA 5LZ4A 2QVBA 4N8SA 1WOMA 1QFSA 2WFLA 3IA2A 4KACA 3V1NA 3HI4A 3VVLA 1W6RA 4X6XA 5ALUA 1GKKA 2CBGA 3IUQA 3DLTA 3ESBA 3TJMA 4RE5A 4HAIA 5IVKA 1GPKA 1XRMA 3D2BA 1HLGA 5AI6A 3R0VA 1XRQA 2P8SA 4QDOA 2X76A 3WWCA 3A2MA 4UBIA 5CT8A 1ZD4A 4QLOA 1UZAA 3B12A 2W22A 5E2IA 1XKTA 3QPAA 3WK9A 1P0QA 1QO9A 2V98A 3ICVA 2WIGA 3KWJA 2E3JA 5CH5A 4LXIA 1BEZA 4MYDA 4X71A 2CUTA 1GKLA 4ZXFA 5BWBA 4QA9A 4BRZA 3JWEA 2Y6UA 3VISA 3G0DA 1SOMA 1K5PA 5DTIA 4CIAA 3VKFA 5ALNA 3WZMA 2X5XA 5KBYA 4RE6A 1EI9A 4J0CA 1EXWA 1QIIA 1CQZA 2NW6A 2R11A 4GI1A 2PSFA 1U8EA 4UUQA 1GPNA 1CR6A 2HFKA 4IH1A 3W05A 5SYMA 1JT2A 1AGYA 1VLQA 4DGQA 4KRYA 2XMRA 3TEJA 1QLWA 5LLSA 3G0CA 3R41A 4NMWA 2O2GA 1ODCA 1SCQA 3A2LA 3AILA 5FPPA 1VA5A 1VE7A 1ACLA 4CG1A 1LPBB 1XZFA 2ZYIA 3G7NA 2G5TA 2QS9A 4Y2QA 2B61A 1XQVA 1U4NA 3SX4A 5F4ZA 4B83A 5ALHA 1IUNA 3IB3A 3WKBA 5ALLA 4BRSA 3BIXA 3WWDA 1QIKA 2HRRA 5IKXA 2XMZA 3D5EA 4OSEA 2C0PA 2JF0A 4EB0A 1CPYA 4K6HA 5ISMA 2QT9A 5EHNA 1CUVA 4EBBA 3CN9A 4X3CA 1CIJA 1AKNA 4E14A 2QOEA 1XKLA 1XZEA 3F96A 4X85A 4QWWA 4Y2UA 5T4FA 4M0EA 4HXEB 3AJAA 1IUPA 3C6XA 3O4GA 3LCRA 4FLEA 2HU7A 3BF7A 3RLIA 1BCSA 2WFMA 5JIBA 3ZV7A 3WKDA 3AIOA 4LIPD 2PVSA 1GPLA 4BZZA 2OQIA 2WG1A 1XZDA 4H7HA 4Y2YA 3BDIA 4FOLA 1BN7A 5KWIA 1ZOIA 3UMJA 1HKHA 2XDWA 3HSSA 5ESRA 4JEIA 4AO6A 2VJCA 2C5FA 1XZMA 4QZVA 4KE9A 4NZZA 4KE6A 3PFBA 2ROQA 1MX1A 4KYVA 1YR2A 2GYWA 4XVCA 5C81A 2VT7A 4J03A 4INZA 3VJKA 3D59A 2C7BA 1ZD2P 2XT0A 5CXXA 1K4YA 4FDMA 4X7BA 2C4HA 3DYIA 2XLCA 1XRPA 1XZGA 2XQJA 1QTRA 1X2BA 5EIHA 1EDDA 3WJ2A 1QZ3A 4FBMA 5FUMA 4N5HX 5ALZA 4BATA 3W04A 1MX5A 2G5PA 1XZHA 3PFCA 1QIHA 3V48A 3FYUB 4OUKX 3FLEA 3ZLVA 1UK9A 2O2HA 2PX6A 5HKBA 4DNQA 2WU4A 4B84A 5JAPA 5K3EA 5AKYA 1TK3A 2J3DA 2JEZA 4OB8A 1T4MA 1DWQA 2J4FA 3I28A 2VF2A 4DTCA 4Q3LA 3DD5A 1UOQA 3DYVA 3V1KA 4HVTA 5ALTA 3HACA 3WWPA 4U2EA 3I2HA 1ODTC 2GYVA 4DYHA 5AKJA 4BVKA 2ZYHA 1XLVA 3G9TA 4OU4A 3R3XA 1HBJA 4QDXA 4ZREA 2DHDA 1SC9A 3QM1A 4WJLA 3KWFA 2VEOA 4D9JA 2QUAA 5FOQA 1R9NA 5HKAA 4B85A 5ALRA 1WPRA 1MU0A 2BGRA 4G4IA 1XLWA 5ALJA 1A8SA 2YYSA 1GQRA 3KSRA 4ETWA 4L3WA 1BU8A 2OCGA 4PV7A 4MEAA 4C6HA 3C87A 4OYYA 1QO7A 5HF9A 2DFPA 2HFJA 3Q0TA 1TRHA 5ALQA 1FFDA 1BROA 4X92A 2HU5A 2O2IA 2W6CX 4MEBA 2EEPA 4AXBA 1IZ8A 2VT6A 2XI4A 5JADA 1XRRA 2PSEA 2DQZA 2XUHA 4L9AA 4Y9SA 4G9GA 1ACJA 1GT6A 3OTQA 4WFJA 3PDCA 3IUNA 3W9UA 5IVIA 4EZIA 3QITA 1Z68A 1YS2X 5YASA 4AO8A 3WA7A 4B6GA 5AKGA 4U2GA 4F21A 5K3AA 3G0BA 2VTVA 1EINA 1E3QA 2Z5GA 5CH3A 2XMGA 5HK9A 1LPNA 3LIPA 2JGLA 1N5MA 5AI5A 5K5EA 4JNCA 5JZBA 1PFQA 2WQZA 5LZ5A 2HA0A 3C8DA 2HA3A 5EI5A 5ALMA 1EA5A 5K3CA 2OGZA 4BDTA 3SWWA 4WY5A 3VXKA 1EB8A 5LZ7A 3DCNA 3HC7A 4ZWNA 4M0MA 1LLFA 3GFFA 4DM7A 1WB5A 3WL8A 4J0GA 1XROA 1Y37A 1XZCA 3EIOA 4WFIA 5CT5A 1VXRA 3F8SA 4KRXA 5E4JA 5JASA 1CUCA 2Y1KA 3NUZA 2Z8ZA 1W4LA 4W9RA 3FYUA 4UBKA 4DMHA 1ZIXA 3FYUC 4A16A 3ZLTA 3C43A 1ETHA 2VA9A 1U2EA 2HDWA 3O4JA 1H2YA 3PI6A 1LBSA 3YASA 5LYYA 3L1HA 3R40A 2X8BA 4Q3KA 4G9EA 4UHHA 3E1GA 5JAUA 3OURA 1N8SA 4HTAA 4AZ0A 4U2BA 1XLUA 4PO3X 2VATA 1JJIA 5EGNA 1HL7A 1CUYA 2ZJ7A 3WLAA 3BL8A 4UPDA 3R3UA 2GBIA 2GZSA 4H7DA 4ARBA 4PF1A 1ZJ4A 1SCIA 1LZKA 3C6BA 4FNGA 1P0MA 3GUUA 7YASA 1UFOA 3WIBA 5A71A 2RI6A 4X90A 4B80A 1CUJA 1ORWA 4X6YA 1QIDA 3DKRA 4LXHA 2OPHA 4G4GA 4FBLA 1X70A 3G8YA 2XQGA 1UKBA 3CCCA 4DLNA 5FP0A 4BAUA 1J2EA 1H2XA 5J3JA 3H19A 4J3JA 2XUIA 4EY6A 4B0PA 5C8VA 3IULA 4HRXA 5FRDA 5C7YA 4AO7A 3EQ9A 3C6YA 3WK6A 1G5FA 4OU5A 2ACEA 3QBJA 1VJ5A 1QOZA 2Y2UA 4K5QA 2WTNA 4BE4A 2ZSIA 5FKJA 2EDAA 4A23A 2ZVDA 3WJ1A 4WDQA 2O7VA 1MO2A 5T4EA 3WL6A 5T4HA 1F6WA 3CXUA 2VJBA 4F60A 3DL7A 4BC0A 3RARA 3GBSA 5EIEA 5A7FA 1C7IA 1VXOA 3HJUA 4MWSA 1AURA 4KEAA 3WYNA 3KDAA 5AH0A 1VZ3A 5HF6A 5HF5A 2HL6A 4H7FA 4Y2VA 3HLKA 3HRHA 2IITA 2QJWA 5HFNA 1CUUA 1JJFA 5DYWA 1I6WA 4GEGA 3WKAA 1ZD3A 4PW0A 4UFNA 5FPQA 3M3DA 1ZGCA 4G8BA 2WTMA 4MQLA 1DWPA 1VOTA 1DWOA 2BFNA 1MT3A 2XMDA 2XE4A 5SYNA 1AMNA 1XZKA 4OCZA 2VQ6A 4YPVA 3WZLA 2DR0A 4JH0A 1BEEA 1C7JA 3T52A 2CKMA 5ALXA 1Q0RA 1THTA 2WHPB 1TKRA 3AFIA 4I19A 1CLEA 3QMMA 4H7KA 1QIEA 3GA7A 2CJPA 3I1IA 3VJLA 2QXUA 1H2ZA 3IDAA 4LXGA 1R4ZA 1EB9A 2WUGA 3WK4A 5AM3A 4MJ3A 1DX6A 1TCAA 1RWQA 1VA4A 2JBWA 2K2QB 5HK8A 3IIIA 4UHCA 2XUPA 1YA8A 3SK0A 1L7RA 1G4HA 3QVMA 4NS4A 4QLAA 4MQMA 4X93A 2WHPA 5EHQA 1DT3A 3NWOA 4HRYA 5DYTA 3M83A 1E8DA 4P08A 3K9BA 4H7EA 1XRNA 5AKHA 3H2IA 1RYYA 1ZD5A 4A5SA 4Q34A 2YH2A 4FLFA 1IZ7A 2QUBA 5AKKA 5AK4A 1ZICA 4B9AA 4E11A 1LGYA 2C5GA 2Y2VA 2XLBA 2WIKA 4C87A 1TAHA 2PM8A 5JZSA 4JYPA 1VE6A 1R3DA 2H7XA 4EY7A 4PSUA 3QMVA 2VAVA 2YXPX 3P2MA 2WLSA 3G0IA 3GZJA 4DSZA 5ALPA 5DJ5A 5ALDA 4IH4A 1DT5A 2ONCA 3JW8A 2Z8XA 3I2GA 4DMKA 1NU8A 1QIMA 2Z3WA 3WKCA 2ES4A 5HQ3A 5IVDA 2XUFA 4C01A 1CV2A 1ZGBA 5FXMA 2OCIA 1CUDA 3DJYA 4MXDA 3O95A 3BDVA 4K2AA 3OG9A 4H77A 1GXSA 4HXGA 5AI4A 1UT6A 2ORYA 5EHZA 1CUIA 3V1LA 1CUAA 1J1IA 5LZ8A 2XMQA 4Q82A 1AZWA 1MAHA 1H23A 3D4LA 3HXKA 1W1IA 2DCMA 4ITVA 2QR5A 2QXTA 4DMFA 3MUOA 5DNWA 4L72A 2FJ0A 2OAGA 5CT4A 4Q05A 1JKMA 2RAUA 2GYUA 2OCLA 4H0CA 3R3WA 1OCEA 1CUBA 5AM2A 5CBKA 3PF8A 5AI0A 1E66A 2ZJ6A 2J3QA 2Y6VA 1THGA 3KOOA 1D07A 3AIMA 1EHYA 1PJAA 3M81A 2PL5A 3HEAA 1UOOA 3D2AA 4UFOA 2UZ0A 4OYLA 3D3NA 2BCEA 4N8EA 2BJHA 2PSDA 5D6OA 2XQFA 5E4TA 4AMYA 4FWBA 4FNMA 5DLPA 2WJ4A 1UOPA 5ALKA 4AQDA 5ALFA 4EHBA 2I03A 5DYYA 5C8XA 1DTEA 2RHTA 2IIVA 4J0KA 5BV7A 4QNNA 3T4UA 2WG0A 4L0CA 4W1QA 5AHXA 5JAOA 3DNMA 3O0DA 1JU3A 4MWTA 5DTJA 3NOXA 3C5WP 1A88A 5IH7A 4GDMA 4XWGA 4Q3OA 5FDFA 1CVLA 4X97A 1QIFA 1CUEA 2PPLA 1BE0A 1F0NA 2WKWA 4G8CA 4RPCA 3AZOA 4QDZA 3K2IA 4BVLA 2H9YA 5AM1A 5AI8A 3QMWA 1Y7HA 2RGUA 3G9UA 4CI9A 3GELA 2ECFA 4XJVA 2DSNA 1CEXA 1DX4A 4B82A 4F0JA 4G5XA 3N0TA 4IQ4A 3IUJA 3WYDA 3PUIA 4TVKA 4CIBA 5ALWA 5ALYA 5EIAA 2HRQA 4YK7A 2JEYA 1QFMA 4N5IX 3DDUA 2WUEA 4Y7DA 2AJBA 2HA2A 3IUMA 4F5ZA 1EDBA 4FFVA 2H7YA 1N1MA 3ESDA 2JGIA 4Y2JA 4X95A 5KWJA 3BE8A 4GBGA 4B0OA 4ROTA 3O9MA 3ZI7A 4AX4A 1NX9A 4KE8A 2I3DA 2QMQA 2WUDA 1H22A 2JIDA 3I6YA 1O6GA 4P93A 3VDXA 1CUFA 1CUZA 5JARA 2ZYSA 1MTZA 1CUHA 3W2TA 2XMSA 1AC5A 2XUQA 3U0VA 3WK7A 1A7UA 5K3FB 2WHRA 1PV1A 4DSAA 4HXFB 2PU5A 5AOBA 4QDUA 1DQZA 1IUOA 5AM5A 4AMZA 5ALSA 3RKSA 4G8DA 3FOBA 3QPCA 1YAHA 2C0QA 3UUEA 4Q1VA 3V1MA 1O6FA 3H2HA 3C70A 2D0DA 3I1YA 1JMYA 2HM7A 4LHEA 5HCUA 1B41A 2LIPA 5AKLA 3STTA 3DOIA 1BRTA 1H2WA 3PE6A 4UBJA 5JD5A 4HS9A 1VKHA 3IVMA 4UHBA 3H2GA 1Y7IA 1QE3A 4BP9A 2J4CA 5K3BA 4OB7A 5KREA 1EDEA 1Q83A 5LKRA 2HADA 1BS9A 3D0KA 3LP5A 4XIIA 5AKXA 3MGAA 1HPLA 1YB6A 2WIFA 4C4ZA 3A70A 3H17A 5JD6A 1UXOA 1XZBA 4EY4A 3FWHA 5T4BA 4UFPA 3D7RA 2HA7A 3C6ZA 4GECA 3WMRA 2HA4A 4J0JA 5JAHA 4BTVA 1MJ5A 5AKZA 1BN6A 1JU4A 1UWCA 2PUHA 4DNPA 1LPPA 3H04A 2WSLA 1W76A 4JUIA 4PSCA 4G4JA 2B20A 4ARAA 1XRLA 3ICWA 4CG2A 4J0DA 4KR0A 4Y2RA 5I8PA 3PUHA 3IBTA 5DWDA 4WDRA 3DKKA 3VVMA 1R50A 3V9AA 3AUKA 1J07A 5AK5A 2FX5A 1K8QA 2H1IA 1ZJ5A 4M0FA 1LBTA 2AJCA 3AZPA 4K6KA 3STVA 3H18A 3STYA 1AQLA 3FCXA 4TGLA 1DQYA 2RIPA 4I3FA 4PNZA 1E89A 4IHAA 1S8OA 1ZI8A 2XUJA 5CT6A 1Q0ZA 5AP9A 5E4YA 3TGLA 5AK3A 4WY8A 4J7AA 2WJ3A 3HYSA 4OD0A 5AKEA 3ZLUA 3I2FA 2O7RA 4Z49A 3ANSA 3DL4A 4J0IA 2BUCA 1A8QA 2OXEA 2AXEA 5CH8A 3FBWA 2XUDA 5AIBA 4H7IA 3N2ZB 1WPXA 3E0XA 2JGMA 3WWOA 4P92A 2XUOA 5LKAA 1FSSA 1TCCA 3I2KA 1LPSA 5BOVA 2WJ6A 1LNSA 5CW2A 3A6ZA 3KD2A 3BJRA 4CG3A 5A62A 4EUSA 3ANTA 3STWA 1HDEA 2HU8A 5ALOA 5AICA 2G63A 1KU0A 1WCYA 1TCBA 5LIPA 5D7BA 3F98A 1L7AA 2XUKA 1ODSA 1EVQA 5HF8A 4FLMA 5JZ9A 4C89A 2OCKA 3Q8WA 4X6UA 3MUNA 2VSQA 2BGNA 4TPKA 5AK6A 2WUFA 4EY8A 3R3VA 1WM1A 4ZGBA 2GZRA 1DINA 4G1FA 4YASA 4GLBA 1B6GA 2XQIA 2Q0XA 4U2FA 2FUKA 3LIIA 4W1SA 1XQXA 1WB6A 1QIJA 3NGMA 4BZWA 3ILSA 4U2CA 4BVJA 4IH9A 3FVRA 2CEKA 1XFDA 4X94A 1QTIA 5IVHA 4QDTA 1MNAA 1ORVA 3FNBA 3R3YA 3WK5A 3UUFA 4AN0A 4UHDA 4EA6A 2WU3A 4E15A 3DQZA 3EQ8A 3OC0A 4BAZA 2FJPA 5CURA 3L1JA 4LYEA 4CCYA 3QPDA 4Y2TA 3DEAA 4CCWA 2GBGA 1XZAA 5D3KA 1TQHA 5AO9A 4GHWA 4DIUA 1UKCA 3G9XA 1HQDA 2ZJFA 2V97A 2PU7A 5A7GA 4WCVA 4H18A 4ZI5A 3W06A 2D5LA 4QEKA 4GXNA 3S2ZA 2B9VA 1Q84A 2BAGA 2CMFA 1LZLA 2QTBA 3STUA 2PUJA 4FMPA 4RNCA 4LKOA 3QYJA 1G66A 1K6EA 2DQYA 2C58A 4I4CA 2BUAA 2XUGA 1N5RA 2Z3ZA 4KE7A 2JGFA 3WWEA 4AZ3A 5EFZA 2DHEA 2HA6A 1M33A 3I6MA 4QE3A 2AJ8A 4S0XA 3O4HA 1XZLA 1J06A 3W9BA 5K3FA 3RM3A 3S8YA 4B9EA 1AUOA 1CUSA 2XMCA 3FCYA 1USWA 3KXPA 2WHQA 1GQSA 3M82A 4QWMA 1FJ2A 1E5TA 5JALA 1L7QA 2OGTA 4IO0A 4UBLA 2WFZA 1BCRA 5CT9A 3AIKA 1IVYA 1EK1A 1R88A 3I2JA 4C4YA 4P9NA 2XUAA 1CRLA 1P0PA 3O9VA 5C8ZA 3I2IA 5HQ3B 2WIDA 4WFKA 4KAJA 3BXPA 5AM0A 2PBLA 1IMJA 1MNQA 4ZRDA 3H2JA 4KJXA 5JANA 3WK8A 3GROA 2V96A 4DNOA 3R3ZA 2AJDA 1KU6A 1F8UA 4ZV7A 2QJRA 4RGYA 1GGVA 4Y2PA 3QH4A 5A2GA 3EQ7A 3A2NA 4BCCA 4BCDA 3BJMA 5JYCA 2GBCA 4C88A 2BUBA 1ZIYA 4X91A 1UK6A 5HFAA 5AKIA 2PKYX 1YS1X 2QM0A 3G0GA 5AOCA 4DNFA 1AX9A 4LYDA 4BTLA 4AB1A 1JMKC 3FLBA 4E46A 1JI3A 3CN7A 4XX1A 1MAAA 1R1DA 5CMLA 4UBOA 4BC1A 3WL5A 3PICA 2G4LA 2GBFA 1U65A 1X2EA 4CCYB 2OG1A 4BP8A 1XQYA 2WG2A 1YSCA 5AIAA 2I3ZA 2HHAA 3ZWQA 1T2NA 2H7CA 1LPAB 3H2KA 2XMBA 4GWLA 3JYHA 3FYTA 5EHXA 2CZQA 3X3HA 3EF3A 1WB4A 1JFRA 4DMCA 3G02A 3TRDA 1C4XA 2ZYRA 3U1TA 4J0HA 3ESCA 2OAEA 3IURA 5JD4A 4C4XA 1EX9A 4W1PA 2BKLA 2VJAA 3H0CA 4PQEA 5AI9A 4OPMA 3LS2A 3OM8A 2VAXA 3BF8A 3SC2A 3ZPXA 3ESAA 1P0IA 5AM4A 5CTAA 3HABA 4B7ZA 3FSGD 3WIOA 2OGSA 1OILA 3B3QA 1E8NA 1ISPA 1GZ7A 1W52X 3VJMA 4Y2XA 5AOAA 4BDSA 5A7HA 1CUWA 1E8MA 1WHSA 4N8DA 1EVEA 4UBNA 1CFJA 1FFEA 2DHCA 1ZI6A 2V9ZA 4FFWA 4KAAA 4KAFA 1SFRA 3WKEA 4UBMA 5ALIA 3F67A 3I6ZA 4FHZA 3AINA 4AN1A 1YAJA 3BIWA 4GW3A 3BWXA 1MX9A 2PSJA 1G42A 5DNUA 2VJDA 3C45A 5FV4A 4CFSA 4BBZA 3FVTA 3L1IA 3H1AA 4EY5A 3MVEA 3LLCA 2WILA 5HZGA 2JGJA 1TIBA 3ED1A 4BCBA 1EH5A 3EBLA 3B5EA 4H35A 3OOSA 3STXA 4YX9A 5ALGA 3DOHA 2ACKA 4BYMA 2AJLI 2WFLB 4BB0A 2CB9A 5CRIA 4V2IA 3QZUA 1MPXA 1LPOA 1FFAA 4OB6A 4JYMA 1QONA 1DU4A 3DS8A 5CXUA 1QIGA 2ZSHA 1LPMA 1YA4A 4BAGA 3HZOA 5BWCA 1CUXA 4K6GA 3WI7A 4FTWA 2HIHA 4NVRA 5I9IA 1FFCA 1UK8A 3F97A 1SCKA 1UK7A
chains in the Genus database with same CATH superfamily
1ZR2A 2QORA 5DX8A 5CP8A 3EZFA 5L53A 1I2DA 5LZ2A 4H7JA 4HZGA 1XEWX 1FYXA 1RXIA 5EZSA 3F5MA 1NMYA 3TIIA 3SC2B 5JCZA 2EWMA 3EA0A 2ASVA 3WYAA 4OHWA 3RUPA 2AG1A 3W5CA 2H4XA 4S1TA 2AR7A 4BV2A 2DEUA 3DA8A 3OZIA 4C1NA 1YASA 4R3UC 3GFTA 1VIDA 1JMVA 4QDJA 5FBRB 3T5GA 1SBIA 1YONA 5JC8A 5A9RA 1CY7A 2W2PA 4IJ6A 2JARA 1XD9A 4QIHA 3AF2A 5JZVA 5BMVB 2WM2A 3DEYX 1E64A 1LDMA 1PVVA 3LO8A 3PC3A 4M0UA 4WKNA 3Q4GA 3P2JA 2DHQA 4K03A 1R66A 1Z6PA 3EHDA 3JYOA 5FL7A 3RTAA 4A9AA 5HVNA 4P8RA 4W63A 3WRXC 5B3AA 4DLXA 1XF9A 2FP3A 3D2CA 1N2CE 1NXPA 1Z07A 4HP8A 1EZZA 1PWXA 4RZIA 3VZPA 1AU9A 4BNKA 2WDPA 4CL8A 4ITUA 3K6KA 4ZMBA 2J0EA 3O4IA 4HFRA 5AJTA 5FO0A 4KN5A 2QZZA 5DBOA 1WB9A 4L7QA 1TM3E 4CT0A 2NV2B 2ODNA 2CNLA 2P3SA 4H17A 3UGQA 2YASA 4EHKA 5IZCC 2YV2A 3GJ7A 4UW9A 3IIJA 3PRYA 3G1WA 4JP3A 3U16A 2OA0A 5GIPE 1YZ3A 2I1LA 4JQYA 4ALMA 1LI5A 4HDSA 3S1LA 5BRJA 4A8PA 4TYNA 4NJEA 1MVNA 1II8B 1QM5A 1M2VB 4B3XA 3TCKA 3UKJA 1YUNA 2DR2A 3DPIA 4GG1A 2D2XA 2BGKA 4JS0A 4EPRA 1UANA 3SZUA 3RYCA 3ZEIA 3AP1A 2JGEA 1T24A 1OLXB 1VG8A 2DFTA 1U2PA 5GJBA 4MVWA 2AF3C 1NBMD 1OYOA 3IVAA 3DXXA 3VH1A 2NPIA 2ZSFA 1NOIA 3GLVA 3OUUA 1TXGA 2A0FA 3R9XB 1HDRA 4CXMA 2P6OA 3W2IA 5EL0A 1R8JA 2VYCA 3UAYA 1A97A 3CVWA 5LP1A 3WTBA 3EXHC 2NTJA 4NAVA 4I46A 4URXR 1WZ2A 2COUA 4CF7A 1HLPA 2E9SA 4B74A 1YC2A 1M6VB 1YCDA 2QY9A 2QRUA 1TQ6A 1GZ4A 2XB6A 2C95A 2X3UA 4RVFA 3EGVA 4UHEA 3VMFA 3FTDA 4ESVA 1YB2A 2JIZA 1XMIA 1E9FA 2HJ9A 3BHNA 4D9MA 1Q0UA 1DQNA 1JJVA 2XYHA 4MYSA 3WA6A 4QTTB 3H5VA 4BXOB 2HUPA 1C2YA 2PR2A 4ZC1A 2P79A 4YV1A 3NC0C 2FPUA 3OQBA 1UC9A 1KJYA 4GKVA 4YONB 1KS2A 4W1QA 1WMAA 1G18A 1QFSA 5FB3A 5TARA 4DBZA 1UMBB 2JIBA 3D8BA 3K70B 1DKUA 2N42A 4GQIA 4NSNA 1KNXA 1DAIA 5HIJA 3V1NA 1QHEA 4YRRA 1PVOA 2ZI9A 3VVLA 2RMKA 3NI2A 5BSFA 3T9FA 2XTJA 1E96A 1P9WA 1ZNZA 3SZ3A 2P91A 1A04A 2XNKA 3KPJA 4J1TA 1RAFA 3O2JA 2XF2A 4JOSA 3ESBA 4FT2A 5CVDA 3PYXA 4ASUD 1QKKA 2KM1A 3DZDA 4ZAGA 1MABB 4B3JA 5IVKA 5MN4A 4RHCA 4I8DA 3BB3A 1XRMA 1OKKA 2QTGA 3D2BA 3RGWS 4I08A 1X13A 3UB2A 3A8TA 3Q0IA 4LXQA 2P9HA 3PUWA 4DCSA 5FNVA 2O52A 1E94E 2O4CA 3GT4A 1Q1NA 1XRQA 4IQFA 1V9LA 2ACWA 1QWOA 3RCBA 2R6ZA 3GAZA 4K86A 4QDOA 1DCKA 2P65A 2QL6A 4E2XA 4IUDS 3ZVMA 3FWYA 1UPXA 2WSSD 2HCJB 4ZTBA 3AEUB 4CTKA 4XD7D 2PNJA 2DLDA 1MQ8B 3RS2A 4F8JA 1IHOA 2ONKA 4HLDA 4LW8A 4UBIA 1A69A 3ABIA 5CT8A 4ZOLB 1Y8QB 3IDFA 3R23A 2IXAA 5CR9A 1I3NA 1TQ4A 2D4HA 2QM8A 2J0UA 2W22A 2P5UA 2QTWB 4KOAA 4LMAA 5TNXA 4PO8A 4YAJA 1XKTA 1JQ5A 5I7HA 1UBGA 2DUJA 1P0QA 1Q1QA 2A9OA 2FVYA 1KORA 2V98A 3QXSA 3DMFA 4KVZA 4S1WA 3SMQA 5M7EA 5IBRA 4ME6A 1IJBA 2J59A 2JLZA 5FORA 2C2XA 1VG0B 1IPEA 1UWLA 4K9NA 4LXIA 1ECBA 4MIOA 3SEAA 4QJ3A 2CUTA 1R5JA 3WYBA 4I3GA 4Q7EA 3BFXA 5C1IA 3EG5A 4G86A 1VLJA 1Y3AA 3ZE6A 1DFGA 1E4EB 1XELA 2K4MA 2QRNA 4BRZA 2L69A 5IUKC 3T5TA 4RHFA 5B2ZA 1ISHA 1HDCA 1XC7A 2CLOB 3HCFA 5FL3A 3EIEA 4TX1A 2G25A 3JVDA 3NHJA 4ZYTA 1BDBA 1FNBA 1Q19A 4NBWA 1K5PA 3FRHA 4F46A 2C31A 1LV7A 2ONJA 1L5FA 1UBRS 5ALNA 4BBPA 2X3YA 4G41A 2I4OA 4HX5A 5CIYA 3KR1A 1U4OA 4C3OB 4J7UA 1EI9A 2PMKA 3OBBA 4WLFA 2R1TA 4FXPA 1EXWA 2OKGA 3GBVA 5G0WA 3UATA 3M9XA 5C2JB 1OT5A 4JUFA 3F73A 2CNKA 4IXWA 1CQZA 3A6HA 1HKUA 3SIRA 3ZHYA 1HMPA 1CB7A 2PSFA 1BX1A 5IJXA 1G5HA 4DIKA 2EV9A 3QEKA 4W5HA 4PAGA 2A88A 1E2NA 1U4SA 5FUYA 1CR6A 3HJRA 1FUEA 1G5RA 4IXMA 1HFKA 3AI7A 3I3OA 4TWIA 3SHFA 3W05A 4B3CA 5SYMA 2IYAA 4DREA 3MQ4A 1VLQA 4RTQA 3H11A 3PR2B 1JTFA 2ZT6A 3PZBA 3OTWA 3TLGA 3IAFA 1OGJA 3WL3A 4ZJUA 2V45A 3U6BA 1VMIA 3BWDD 3TEJA 3NU1A 4YT4A 5GADl 1OROA 1HYBA 1CY2A 3IHKA 3EXHB 4BMCA 4EI9A 2XA1A 1KMNA 1EZ1A 1SIBE 2ZYTX 3DOJA 1SWVA 3GBPA 4I50A 4YT5A 2WWHA 2ZS9A 3M49A 3SG0A 1FCJA 3RQSA 1NMSA 3EPJA 1GNRA 4WJKB 2EGHA 3R0QA 5B5SA 2CLHB 3O8OA 4NG4A 4NYJQ 3AOEC 1VE7A 1SKMA 3RD5A 4DR5B 1J21A 1OIWA 4ZK2A 1XXHA 1WS6A 4CG1A 3UT0A 3PBKA 4GOOD 4N65A 4BMYA 4WLVA 4LJ4A 3BICA 3Q98A 1Q7CA 2YRWA 4Q4JB 4YALA 4D0LB 2F55A 1MAWA 2F6RA 3D7LA 5C8DA 3G7NA 4MQBA 5DWVA 2GI4A 2XHZA 3K20A 3CZPA 3W2HA 7ABPA 2QS9A 3LGXA 2BHLA 4ZHQB 4PGAA 2RE8A 5J9FA 2R96A 1SJ9A 1YD7A 1XQVA 1U4NA 3LYAA 3A9UA 1AN0A 3DHWC 1EG7A 5J63A 4L8YA 3IT2A 3F78A 2Q5JA 2BZSA 1H85A 2AFIA 2V7EA 3SLRA 2P2DA 1XCJA 2A58A 2RGRA 2UVPA 3GWGA 4RMNA 2PLAA 3IB3A 3LHKA 4ZI3A 3W6ZA 1P0FA 4BRSA 2XITA 4U7HA 1DCTA 2AJTA 4BO8A 2NQTA 3BIXA 5B7GA 1HE1C 3WWDA 1MB2A 1YT5A 1QUFA 1QIKA 5E9JA 4YBZA 1EIZA 2FW1A 1TF5A 3UJ8A 1UQUA 3K35A 3E03A 3NBFA 4RHTA 5E38A 2F3QA 3EWNA 3F5DA 3TCXB 4DYVA 1IHXA 5IKXA 2ZB8A 1CRQA 2DWQA 3AR6A 4UAVA 1FTQA 4Q7KA 4MPJA 2BHNA 3ZXXA 1BKSB 1KO5A 1R3UA 4AJ2A 4EB0A 3U4MA 5IDYA 2X1VA 4ZA2A 1TT5A 3OOEA 3MQFA 4KITB 1DC6A 1PT7A 1XTKA 2HNAA 2BCJQ 4Y6LA 2JLYA 2CKDA 4EBBA 2J3IA 3CN9A 2VF7A 1AKNA 4N82A 3KKEA 4PN3A 2I67A 4QOHA 4OQEA 1XQ9A 2PH3A 2R66A 3AYZB 3FZGA 3WQSB 4TYPA 5I8WA 3I1FA 1XZEA 2D06A 2JCYA 3F96A 4K40A 4X85A 2AR0A 3G79A 4YP7A 4B40A 1D8TA 3TVDA 1KGDA 5JSKA 4QWWA 2SCUA 3DW3X 3RHFA 2AW3A 3TZQA 1HUQA 1V5IA 5JSZB 2UZ4A 1XPRA 1FY2A 3W6UA 1DJQA 3KZOA 4NE7A 4JOBA 3V1TC 4GM0A 4B75A 4PX2A 4Q24A 5D84A 1CFZA 4YWHA 3OTIA 4L1KA 1XWWA 2F67A 2FX2A 2OY0A 3AJAA 4ENSA 2R4UA 5KS2A 3CX8A 4JI3B 1L5ZA 2YRXA 3HJBA 1AXGA 4C4RA 4W5OA 3SIPA 1QH0A 3AUTA 3H75A 3TKAA 1QNLA 3MJFA 3PFNA 4H0NA 4R2IA 5FPHA 4K26A 4GPTA 2JL1A 3AFMA 1KI4A 4Z1MD 4OUDB 2GYYA 1JB1A 1A9QA 4D42A 1NVTA 2J7PD 2V59A 3KSBC 3JQEA 2JASA 3MJVA 1GVNB 1U98A 3QPBA 1AQUA 1QRAA 2WFMA 4JB8A 4JL8A 3GARA 2FFBA 3REGA 5F64A 1AKRA 3TUJC 3PPXA 4NC9A 3ULKA 1P4JA 5JIBA 1OLSB 1CRPA 3VSEA 2Q9AA 3N0RA 4BN0A 4Z51A 2QVXX 2H59A 4WSOA 3I30X 3AIOA 4HWPA 4NFYA 2IFTA 2Y1GA 4DANA 5C8YB 3NNNA 3DKVA 4FEEA 4P5DA 3T0IA 2VYVD 4I4TA 1XZDA 4H7HA 4BKUA 4FOLA 4K9LA 3UN1A 2MSKA 5AHRA 1ZOIA 5KWIA 3L41A 4Q93A 3GA0A 4AKGA 1EUCB 2OB2A 5ESRA 4Q0MA 5F12A 5L45A 1OGIA 2I5PO 1L5SA 4B47A 4JEIA 1A2BA 4QFDA 4NYIQ 1TA4A 3E8XA 4Q6WA 4AO6A 4EF6A 1T0IA 2VNIA 3CWCA 3UJNA 2W6PA 1T9BA 5F5LA 4I5IA 3G2JA 4NARA 3V4PB 2YHAA 3KK0A 1X9HA 3OIUA 2KBEA 2QD2A 2H08A 4NZZA 2R25B 3PFBA 3FF4A 1EM8B 4MS4B 1G3IA 1AMOA 3QEMA 3RHSA 4DY4A 4HQ6A 4KYVA 1P72A 3H8SA 4YO8A 1YR2A 5TQ2A 2O3SA 3BL5A 3F1LA 4IKPA 1VBNA 5TMBA 1CY6A 4KXMA 5DSXA 4INZA 1B4DA 1X74A 3CUSA 4YROA 4WHMA 4QELA 1PX2A 1CULC 2XDQB 3B36A 3D59A 4BV8A 1F06A 2ZJ8A 1IXKA 3QUTA 4WAUA 2ZIZA 3DDNA 5CXXA 4EFMA 3OPQA 4FDMA 4BNIA 3LQ1A 4A0QA 5SZHB 1YIAA 3DYIA 3K8ZA 3RS7A 1XRPA 1LLDA 3QUQA 4JYAB 1V6CA 2NO6A 3BDAA 1XZGA 2Z6UA 3MTIA 3UGTA 4JU9A 4WNIA 4DG5A 1QTRA 1GFIA 1PK8A 2CZCA 3NIDB 1VI6A 3R4VA 2JAPA 3RUHA 3NATA 1W30A 4QXQA 3U3RA 5LD2C 3WNVA 1AUPA 3KVOA 5ILOA 2EZUA 2YNMC 1NAHA 1RI4A 3DBHB 3O1HB 4YS6A 5U9CA 3MBOA 5I9BA 3QKWA 1X7HA 1CC1S 2R8PA 5ALZA 3KQUA 4BATA 1OU0A 4YRFA 2IHNA 1MX5A 3MTJA 2CL7X 5G0VA 3FYUB 5DIFA 3QBTA 1SKBA 2XB2A 4O2BF 2J85A 1T9AA 2XRZA 4JJ4A 5FPSA 3CR7A 1UK9A 1JDJA 1HFEL 3CWZA 3ZLVA 1GCGA 4F5DA 2O2HA 3JWPA 3VKWA 3A4MA 3HZHA 1ZO8A 3O26A 2ZRQA 1QP4A 5FWXB 2Y1XA 1Q6ZA 1AA6A 3K9CA 3TYXA 2WU4A 3FMVA 4WRRA 5JAPA 5EKSA 3ONNA 2C61A 3DE3X 2OV2A 4FE3A 3FCUB 3ZH9B 5L3ZA 5CM8B 4RANA 5K3EA 1QHNA 2JEZA 3QW4B 3A3PA 1NNUA 4OB8A 2PT6A 1T4MA 3A25A 3E23A 3VHLB 2YJ4A 3SQLA 3RF6A 4H6VA 3IS3A 1U9CA 2OHIA 3K53A 3KKPA 2PIAA 3Q6NA 4WZZA 2FDXA 3M9LA 2VF2A 3OE1A 1YB5A 2FPSA 2W6OA 5GV8A 5B53A 2LD4A 1KRWA 4J9UE 3WVNA 4JBNA 2ICAA 2WNHA 3H2YA 1UC5B 1IJFA 1Y1LA 3CH5A 3QKIA 4X1KA 3P5BA 4F4JA 3AVUA 1ZSYA 4UNIA 4RAQA 4IGAA 3OX3A 4QXRA 3SJBA 2ODAA 3C6MA 2YMLA 5DISB 2VLIA 3DMDA 3N74A 3HVIA 1Z0SA 2ZWAA 1SB8A 3LVRE 3OUTA 1Z0FA 2AEMA 2H1VA 2XOKA 1QBGA 2IWHA 2FG5A 4U2EA 3I2HA 1NBWB 2GYVA 3BD9A 4DE5A 2FPLA 4ZU1X 5LP6F 3K70D 2OV8A 2Q8QA 2YICA 1P9NA 3I42A 3WIUA 2ZYHA 1KDTA 8AT1A 2CK3A 1XLVA 2DWUA 1SHLA 2JLBA 3VYRB 4GKBA 1TECE 1UFRA 4OL0A 4QYIA 1FMCA 1KO4A 4B4DA 1HBJA 3BAFA 4BB9A 1F6DA 1PR9A 4ZYUA 4JB0A 1SC9A 4MNTA 4D81A 1H3FA 1A7AA 2D0PB 3M33A 3QFFA 3MJCA 3EEOA 3DWFA 4E1BA 3D3WA 2A4MA 2QMUA 4D9JA 5LMZA 3H11B 2YVLA 4MLPA 1ZH0A 2RB4A 1LBIA 5FOQA 2PRZA 4JAVC 3KKNA 1KI8A 2A0WA 3DM5A 4B85A 4PCLA 4EGJA 1KGSA 2QUHA 5ALRA 4HDSB 1WPRA 2IQ5A 5C1PA 3CMCO 1JT9A 3GI1A 3KZMA 4OHUA 4GPD1 3TQCA 1HYGA 4A27A 2RHCA 5KYXB 5BPHA 2M6LA 9MHTA 3I8XA 1L9KA 1Z7EA 1F3OA 2RDMA 4MVJD 3LCVB 1BU8A 2UXDB 2WICA 2YV1A 1X7GA 5BWNA 5C4IA 4PV7A 3Q10A 2C2HA 3DZKA 2XNDA 2WKSA 4XSGA 4ZQEA 4S05A 1R8YA 1S2IA 3OPYI 1JG7A 4OYYA 2YVKA 3RFCA 3CJQA 1MC4A 2HFJA 4GRDA 3VDQA 2CF5A 3HNRA 3H6KA 2PVPA 3RS5A 3Q0TA 4JJIA 1E58A 2EKQA 4UCXA 4IIYA 3UWDA 4BLWA 3X2EA 1BFUA 6REQA 5L3VA 3VR5A 3QKRA 4JX9A 1LSUA 4EHAA 2X5OA 2YV3A 2W6CX 1QK4A 2CVFA 1NF2A 4L0MA 3K30A 4R81A 5BSVA 1VPVA 3RYIB 2CBZA 3EDYA 1H1LA 2X1LA 3A10A 5FFMA 3R5TA 1TRKA 1IZ8A 5BVHB 3L06A 4XW2A 1KYIA 4PHHA 2RGAA 1XMVA 1RXYA 4OLHA 3GIDA 4QUKA 1LW6E 4ZZ1A 5KSYA 1SQFA 3O1IC 1QH1B 1TA9A 5JADA 3HCDA 3VDMA 1U8FO 2PBZA 3PSHA 4KGDA 1O0SA 4NTZA 1XNQB 3UAZA 4JJ8A 4RIHA 3QGMA 1DOZA 1MC5A 3N7UA 1AXEA 4RD0A 2OSBA 4LRWA 1IVNA 1XP8A 5IVIA 3L46A 5ETJA 2RHMA 4HATA 4C0XA 2JI9A 3ZGOA 1Z68A 1R4MA 3TW4A 1PGJA 1J8MF 2Y0PA 4AO8A 1AG9A 1LSJA 3ZWDA 4NCHA 4GKAA 1GG9A 4X7RA 4AN4A 3U4HA 5K3AA 2YXBA 1HNZB 1Z8FA 3G0BA 4E70A 3H5TA 3B6ZA 3Q5DA 4DLYA 3GEIA 2WZDA 1IJEA 3SKYA 2IOHA 2JIQA 3LLUA 3OJCA 3ORRA 4I55A 2XMGA 5DXJA 3EUEA 1NJ8A 3BAZA 2FR1A 4Q1CA 4TKMA 3D3KA 2NVUA 3W6PA 4EPVA 4Z2AA 1DXYA 4LOHA 1B00A 4PGGA 5KX5A 3DMYA 3DP7A 1CVRA 3O94A 4QDKA 4F3RA 3LPLA 3R4CA 5K5EA 3PJGA 2XVXA 1J9GA 1VBMA 2GX6A 5JZBA 2JBHA 2NADA 4IHQA 4LMPA 1YRLA 2ZGVA 4XWTA 4BV9A 1KJ9A 2O3JA 2RGCA 2XBUA 3HCNA 4DARA 2CV1A 1H93A 1SU7A 2HBZA 5EWLB 3SSOA 2JKVA 1EA5A 2VOJA 3EXG2 2OGZA 5KYKA 3LZCA 5JYDA 1SVMA 1RAIA 4IJWA 4RDCA 3BE6A 1MORA 4WY5A 1EB8A 4M9RA 3R7WB 1C50A 3LWNA 4PZLA 2F43A 3DCNA 3HC7A 4FFBA 3TDMA 1CYEA 2I34A 4WCDA 4KLAA 4ENUA 3KKKA 1LLFA 2WD8A 5D5PA 3G5AA 3TDKA 4CYMA 3ZZUA 3U13A 2IF0A 2OAP1 3ASZA 3CURA 4OI1A 2BTQB 3L79A 2R8XA 5BOSB 5BSEA 2C4WA 1S2OA 2ONZA 2V1XA 3QXGA 3COWA 4UMDA 1YJCA 5IAEA 3ZXYA 4F92B 5EUMA 3ER9A 1XZQA 4DDMA 1RMTA 3BSSA 1XZCA 3EIOA 3DT9A 5IMBA 2V58A 4WFIA 3DO8A 2XKBA 1P7PA 2YRFA 1R0LA 2EJCA 2B34A 4HDKB 2C7RA 3LZ6A 4F1JA 4ZEVA 3H0EA 5AW2A 2Z8ZA 4OQZA 4P7JA 3GVHA 1UBUS 4IY1A 2W2LA 4U39A 5G1PA 5KJCA 4X9XA 1WTAA 4KN9S 2O9JA 4M1OA 1FLNA 5LCXA 2GXQA 1OASA 2OORC 1U0NA 2DOKA 4HQFA 4M7WA 4X54A 1KE1A 2B6HA 3ZBPA 2IZ7A 5CDSA 3CLHA 1K2WA 3AK4A 2ERXA 5FQNA 2HXGA 3MXOA 2QX7A 4BX9A 5REQB 1AK2A 3TTWA 4AKTA 1G5QA 1G2IA 4X1OA 4WZAE 4EQ6B 1D0VA 1JBQA 1R9GA 1U2EA 2QD4A 3N53A 5ICEA 2LP4Y 2FG7C 4AS3A 2QHXA 3O4JA 2ZLBA 2QM7A 5F51A 5FBLB 1Y8RB 3ZUPA 1GITA 1LBSA 4OMDA 3OEEA 4JROA 1JFFB 3YASA 2YIDA 3EC1A 1VRCA 3KE8A 2LBPA 3KS9A 3RS0A 4C7VA 2HIGA 3CW9A 5EN4A 1IIBA 2E2WA 4TLDA 2V1UA 2FEXA 2QVCA 2YZGA 5EQFA 5EXXA 4PAWA 1JTVA 2AOUB 4WCFB 1U6KA 2Y4OA 4G1EB 3LWDA 2DQSA 4IMRA 3UA4A 3RVPA 3UTCA 2SHKA 3HRKA 2IGTA 2FUG6 4GQBA 3L1KA 2Y1WA 2ZSDA 4ZVRA 3TRIA 4F9FA 4JJKA 4PYJA 4ZK6A 5BSKA 4P32A 5J2UF 2JFHA 3MMSA 5P21A 5FD8A 2X0EA 5AVWA 1EAYA 4GOMD 1H9BA 1PR0A 3HA2A 4PO3X 4PX3A 4CHGA 2WWVD 2BWJA 1OIVA 3O5AA 3RS4A 1YZKA 1CUYA 1O9GA 2V3WA 2XRYA 2OZLB 3MGCA 3R5FA 2PIDA 4I3HA 1PW5A 4GLOA 1C1DA 5CVVA 5JXJA 3DEKA 1E1LA 1A9TA 2O07A 3A4YA 4OA8A 2GBIA 4EA7A 3TX2A 1NP7A 4UTZA 3GGCA 5KIAA 3TZKA 4G0VA 4F2DA 3NR2A 2VUUA 4H7DA 4QGFA 4PF1A 4ARBA 1STOA 3BCUA 2V0NA 3RVLA 4R1PA 3R7FA 3QE4A 3DWIA 3QEOA 4FNGA 3ZGYA 4K46A 2C4MA 4HWTA 1NXQA 4EB6B 3DF9A 7YASA 4MVJG 1QP7A 5EQDA 5NLLA 1FJHA 3V2GA 3B7PA 5KOJB 3MS2A 4XSHA 3WIBA 2A86A 1JLMA 1KFJB 5JH7A 2ZULA 2IKSA 4KDEA 4NQZA 3K72B 2WYOA 4PSVA 1TEVA 4X90A 1XEWY 4DL9A 5BSWA 2HCBA 1B43A 4KB5A 1VHDA 1WUKS 4TTRA 4UUPA 1M2WA 2R79A 3PPVA 4CMJA 1NV8A 1QZZA 2YFQA 4G4GA 4KWEA 3IXQA 3KOMA 3ZLJA 2ZJ1A 3AETB 4E21A 2UZ3A 3O4RA 5HXAA 5IT4A 4G0XA 5I7RA 4NV0A 4Q9JA 3GJTA 3DHVA 2XYVA 4GWGA 2A7QA 4MGEA 4Y1EA 3EDCA 3CCCA 1J00A 4ZPJA 2R0QC 3UMFA 4YCJA 1S8AA 4E5DA 1LWNA 1J2EA 3F2VA 5B2FA 1YRBA 2CHGA 2B1JA 1FDVA 3DKPA 1NSYA 2DPXA 2EP7A 3KKQA 3AC0A 4FIDA 1CERA 4J3JA 5DM60 4DBLE 5IKEA 3SIWA 1AKEA 2E4XA 1MX3A 3JZIA 4B0PA 5C8VA 1M1ZA 1V7CA 4K88A 4KXNA 3LUAA 3B89A 1QQ6A 1Y1RA 2EJBA 1FLVA 1OA1A 2IY8A 2PH1A 3Q6IA 4HRXA 1XUOA 3N2NA 3B3FA 3FSRA 3FPFA 5AVYA 2A59A 3NZEA 2Q9BA 1WULS 3ZWCA 2QT0A 3L8DA 2NOAA 4HX2A 3WRXA 2BTQA 1E0KA 1FPMA 4FE7A 1QYVA 1IPHA 1HL3A 1ZCAA 3R6GA 1DKLA 1JEAA 4R3WA 1TEHA 4UMEA 1L8AA 4NFHA 1GZDA 4QYSA 1SRRA 3HV0A 2CHQA 2ZSIA 3S44A 3FOZA 1W19A 2O0LA 1T36B 4I1SA 3BM5A 4TLEA 4BMPB 2L17A 7MHTA 3R9IA 1TADA 2BLLA 4IIFA 2R1ZA 4PRYA 1L8QA 2X22A 3NCHA 3SSMA 3S8MA 4BOYA 4B7AA 2O7VA 4MGIR 1ZUNA 1MO2A 1OI7A 3IT0A 4QGGA 3T7EA 1CS0A 1REQB 1NULA 3RT9A 1WLYA 3S7ZA 4FOPA 5T4HA 2BFDB 5KJ1A 2IUYA 2XOKD 1SBNE 2RH4A 3LT5A 4PIVA 1U81A 1A2KC 4KDRA 1PV4A 2IHTA 3HKCB 1I3KA 4AMBA 4LVNA 4BNMA 4FILA 4AUNA 3ERCA 4HNRA 3EXG1 1L5MA 2VP5A 3P19A 3RARA 3FPCA 1PJ8A 3QY0A 3D43A 4KYTA 4BC0A 5JQWA 1GTSA 2JD2A 5KEIA 4TN5A 4ZCSA 3VR4A 5HBRA 2ZJ5A 4NIMA 3RIMA 4QU8A 4C21A 2C3MA 5CAEA 1FSPA 4JC4A 4K9DA 2Q3BA 1TI7A 2O2EA 1PFVA 1EZ4A 3EQZA 2CGEA 4HCJA 1J22A 4QXMA 5T67A 1U2DA 3PFKA 4KEAA 1FXWA 3WYNA 1CQIB 2QRMA 2DE0X 3J7TA 4C78A 3LT1A 5EVJA 1PEAA 1GPMA 3STHA 1M2FA 3LLSA 4MPRA 2I7XA 2Z4TA 3URMA 4CM8B 4KNYA 2IITA 2QJWA 4QXOA 1EXNA 3FETA 2FMUA 2I55A 1O4VA 2RG1A 3IDZA 3UJAA 4ENVA 4FVTA 3FRIA 2ZUDA 1SUEA 3R7AA 4OLBA 3E58A 3LC2O 3QKUA 2REOA 3MRSA 3B82A 3KLMX 3PFHA 3T9DA 3WKAA 4BVBA 1KEPA 2B2NA 3MGBA 2GKGA 1YTUA 3QUAA 1QHHB 4Q4AA 4O1IA 2QWXA 4YV2A 1KYYA 2NQ8A 4KSYA 3SF8A 1R0YA 3JQBA 3LDFA 4MQLA 1QFZA 2WAAA 1DWPA 3OZBA 4KO3S 2QRQA 4LCEA 4MIKA 1VOTA 4REMA 5F7JA 1K8YB 2VJKA 4GR5A 1OOEA 2R97A 1RXWA 1PNQA 4JC0A 3TKYA 4E07A 2ILVA 2VZ9A 5I9TA 1AMNA 2GCGA 3RNOA 4OCZA 2VQ6A 3PXXA 4KN8A 4CMIB 3KSUA 4XVUA 3C3PA 3D8RA 4MCIA 5BW5A 1PZXA 3FIUA 1VL0A 4GLLA 1NLMA 1C7JA 4LA4A 2CKMA 3DTYA 2QNBA 1ICIA 2OOKA 4KH1A 5JCJA 3LO5A 1P1RA 5F3DA 3WDMA 2R8ZA 4EFDA 1WZEA 3DXYA 1E2EA 1ZUIA 1U0JA 3IBGA 1RPZA 1GAEO 1Z25A 1DL5A 1TKRA 1AHIA 2CK3D 3AFIA 3MJRA 2XGOA 4NPHA 1T91A 1FYFA 1M10A 4PZEA 3VU9A 3HUTA 2HK7A 4RYLA 2IH2A 5B58T 3VGJA 1SUPA 4Z86A 5DCLA 5CHYA 1HNXB 1XA0A 2ZYAA 5DHSA 1PZMA 2GZ2A 2HQ1A 4JLPA 5L7TA 1NMXA 3VOTA 3IUBA 4YJ2A 3VR5H 2R8OA 1HRDA 3AONB 5EJIA 4CBVA 1JQDA 4DC9A 4DZTA 1DI0A 2BELA 4FYPA 3A6GA 3QYFA 1P31A 1V95A 3VR2A 3EUAA 1E3WA 5CTJA 4E5SA 4IF4A 4OHVA 4XX0B 4XCVA 1SA0A 3FM9A 2AH5A 3ED5A 1XCBA 1LBEA 3GVIA 4RK5A 3LOPA 3NX4A 2G09A 1T29A 1TCAA 4QQ8A 3UA3A 4UUNA 2FFJA 2GPAA 4KI0A 4UVHA 3OD5A 5AR1A 5JW6A 3LKDA 1A1VA 3ZJUA 5DULA 4BNZA 3EAGA 2EWVA 1T4CA 3NHZA 3QVGB 2IXBA 4HUJA 4IVNA 4OI0A 1YA8A 1IHUA 3WWZA 4FINA 4PYLA 2VUSA 1I33A 1NVXQ 2HV8A 1NZFA 2BYTA 1XQ1A 1G4HA 1N9KA 5H68A 3GNTA 8MHTA 2D59A 3PGXA 3LPMA 4NS4A 5JTTA 1W0CA 1T4DA 4MQMA 2WHPA 2ZFUA 4IM7A 4KGZA 3RKUA 4C29A 1ZXXA 2RGXA 1W88A 2BSQA 2GAOA 2VZLA 1T5IA 3F4BA 2G82A 5DYTA 3QY9A 4ARUA 4R8VA 3BT7A 3TF5A 1ZUNB 4MW6A 4UCFA 1UPFA 1E8DA 2AOXA 5DBFA 2Z9CA 1S7CA 1KTVA 3KXDA 4U7WA 1V1RB 3K9LA 2M6KA 3TOVA 3UWSA 5IZCA 4FCCA 5AKHA 3H2IA 2ODQA 5FADA 1RYYA 2YXEA 3SNKA 2CXRA 1ZD5A 3L7LA 2FSVA 2XD4A 4HPJB 1Y6GA 1PWEA 1Y9EA 4FKMA 1F0YA 4EI8A 1HA3A 3CSSA 1WDLA 2WQ7A 3OT5A 2PH5A 5E95A 2QUBA 2X0NA 4FN5A 5H5JA 4RTNA 2PS3A 5AK4A 4B9AA 2EQBA 4G9BA 3UJDA 4G23A 3HUFA 2RBEA 1V0JA 5JISA 3KQLA 2XLBA 5JNRA 2RGBA 2FMIA 1ZL0A 1W2GA 3FCCA 1L5HA 4C87A 4EQZA 5CXQA 5JZSA 2QL9A 3E1KA 4D3YA 1NY5A 1IZ0A 1VE6A 2H7XA 3OE7D 4HC4A 2OYCA 1CQIA 2H4HA 4PLZA 1K9VF 1JZQA 1SEPA 3GGOA 4RKYA 2O5RA 1KOJA 5DHAA 1U2GA 2WC1A 3G0IA 3GZJA 3RREA 3EGIA 1F51E 2X0FA 1KP3A 3PHJA 5J1TB 3H0KA 3WV4A 3OA0A 2K7FA 5JQGF 3U9SA 1GQ2A 1DT5A 1CW2B 1TVKA 2DB3A 4RHXA 3JW8A 5WRFA 4I1VA 3ENVA 3U19A 3KDSE 3QBEA 1EX7A 4XCQA 1K5GA 4OQFA 1YU9A 2Z8XA 4XRRA 5CDUA 4EJMA 3SF0A 4BWFB 3I2GA 1GNVA 1C0EA 4DMKA 5TPWA 4KPFC 1PT6A 1RZRA 3ONDA 2Y67A 2W11A 3C8MA 3LSYA 2C1XA 1ZIDA 2O0JA 3G2OA 4RJIA 3WKCA 4BVFA 3N2IA 1QHGA 2H2WA 5B12A 5FUQA 2AS0A 1X1BA 3OJOA 5CX1A 1ESNA 5H8WA 5IVDA 1YZQA 3N07A 2L0XA 2GN4A 4LY6A 5TVKA 1ZGBA 5FXMA 3MERA 1VTKA 3IPLA 3NB0A 4M8IA 4WMLA 2UKDA 2LE0A 1SHTX 1JG6A 3E15A 3H5OA 4CT5A 2GJSA 2PWPA 4YLYA 3KKMA 5TF4A 1KMCA 5HCIA 1HLDA 5K03A 4CTJA 3SP1A 2PGXA 1GXSA 3CZCA 4DG9A 2ZAOA 4Q3DA 4N49A 4LOLA 1IDN1 1RXCA 4AP9A 2V8OA 3PK0A 1MC1A 1SULA 3ENZA 5B1HA 2ZBUA 3JATB 3UAVA 1K06A 2EOAA 1CUIA 1JLRA 4PS0A 5HOQA 5JR3A 4C4OA 2JFYA 4F3TA 1N2CA 3OZCA 5AHKA 3UCFA 1KXZA 3HJTA 5ITZB 2EKDA 2HNBA 1KSJA 2GOYA 3CLUC 4EHIA 1AQNA 3K1JA 3DLBA 4Q82A 2FPGB 1G21B 1MAHA 4UDXX 5JJCA 1RYFA 2V03A 5HILA 4ETIA 2J5KA 4OQXA 3BZUA 2FSSA 3JYNA 2XVYA 3TO5A 3HDTA 4XFDA 4TVSA 2DCMA 4Y9TA 2J9ZB 2H2GA 1EGHA 2FN3A 1RMQA 1LTQA 3DE6X 2WJGA 1U11A 2AFRA 3U40A 2OFPA 1UDRA 2NP6A 3SYMA 1K4MA 3OTHA 5LXTA 3MUOA 3A6EA 5EXDA 5A4AA 4A15A 3IQXA 3H9QA 4FYJA 3AOEA 2XTAA 3KZ1E 2FJ0A 3HCCA 3U7JA 4HI0E 2OAGA 4UU0A 3OZEA 3MAAC 3OC6A 1ORIA 4KVFA 4OHMA 4RIFA 4EKDA 1R12A 2A57A 4RVNA 1ABFA 4H0CA 1UBJS 2NU7B 2BHTA 1Z8NA 2IZ5A 2G3YA 5IPFA 3P9XA 5CLHA 4BEBA 5AM2A 2EG5A 4UEWA 2BFDA 3SU8A 4P98A 1SXPA 4PSKA 5AI0A 5A05A 4Y18A 2ZJ6A 4WVLA 1CZOA 1YL5A 3KHUA 3D5QA 2DFVA 3INRA 4I9UA 2XE7A 2VDNB 1QGYA 1Y7PA 4RK7A 4B79A 1U3GA 1JQKA 1TJYA 4NYMR 4V3BA 5EY5B 5AVZA 1V6SA 1U90A 4U7GA 1EP2B 2EBUA 2YUIA 2VDRB 2YHBA 3EVGA 1BNCA 3OLWA 4KXWA 1EHIA 2J0VA 3RWBA 3S70A 3UW1A 2XW6A 1NTOA 3K0FB 1VPWA 1KPIA 4IQ8A 2EFYA 4YJGB 3AUYA 2UZ0A 1LVUA 1LQUA 3QJGA 4CM7A 1M2VA 2BEWB 4H2DA 5LQJA 5FX2A 1U3FA 3K1TA 1UJBA 1YV9A 3B9PA 1D2NA 3QNUA 4BHTA 1S2MA 2PS0A 3U7GA 1NAIA 1RI5A 2TMKA 3KJZA 3MINB 4N9QA 1E62A 2QGZA 3S40A 4HGOA 1QQ7A 5ALKA 3DHNA 2D1YA 3OCJA 2EW2A 4EPXA 1ULHA 2BF7A 3HDQA 5ENZA 1LWOA 4R6XA 4YEDA 3WXBA 3ZHRA 5DYYA 3CH7A 3UHFA 3CX4A 5CLFA 2FWJA 3EZXA 4RDXA 3PG5A 1DTEA 1U3UA 3FI0A 4CM1A 3R9XA 1T1SA 1EFCA 4OQYA 1P1CA 2WY2D 3KOXA 1VYUA 4J0KA 4CM9D 4AURA 4GAEA 5J40A 2H1LA 4OJKA 3UV7A 3COPA 1VDZA 4QNNA 5FIUA 1XDUA 3IL2A 1FPQA 1KH2A 2VR1A 2VF8A 2KJQA 5AHXA 1ODKA 4KAXA 4MKGA 4QQNA 1NPDA 3G6KA 1YI0A 4BZWA 2O2SA 4B17A 2A30A 5DVZA 2ZYDA 1A88A 3ENNA 3PNKA 5H81A 5HJ7A 4ZVVA 2JCVA 4PG4A 3H1TA 1X1RA 1F9EA 4WESB 4XWGA 4AJHA 3AR8A 2Y9MB 4BJ6A 3AQIA 1ULZA 4B7XA 2Q46A 4MTCA 4IR7A 4Q3OA 2FZKA 5JAZA 1D03A 1NPYA 3FTCA 3SHVA 1WVMA 1AB5A 5SICE 5KNBD 4LAFA 1H5QA 3S29A 3QHPA 5KVCA 2NVWA 2ZIGA 1HDYA 4EG8A 3MWYW 2RI1A 3KYCA 5I01A 1WX1A 1P6XA 3G2PA 4PQGA 4NR0A 3FGPA 1I1NA 3PGKA 5DV9A 5TEWA 2ETXA 1N7HA 4IP0A 4JB2A 5F3RA 4W6ZA 2CHEA 2PMFA 3AF3A 3BMXA 1VDMA 4M86A 4DPMA 2AUMA 2GNAA 2WPDA 1D9ZA 4JR0A 4DZZA 1N2XA 1GFSA 1PTJA 3GELA 4ZU6X 2PKCA 2YHUA 1XVIA 2GFIA 2JK0A 2GPNA 3MMZA 2N9UA 4BNWA 5IVPA 3GZNA 2JG3A 1L4HA 3IEMA 1BDJA 1X7YA 3TL2A 1IU9A 4FCVA 4MVJI 2DSNA 1Z5WA 3WHLA 4DRXA 2NU6B 5HZHA 1W35A 3DMPA 4DT1A 1E3SA 2VHXA 4F0JA 1DAFA 4G5XA 4G89A 5BN5B 1UWVA 1N2JA 3OX2A 2WYHA 3IE0A 3JRWA 3HR4A 4HN9A 1BC5A 1WUYA 3EYAA 4CFZA 4DR6B 2IU6A 4IQ4A 3IUJA 4FCWA 4S12A 3LUHA 4PNEA 3NTLA 1GRRA 5ICCA 1Z35A 1ZM7A 2Q27A 4OHBA 3V8BA 2ZBEA 2Y9PB 4B6JA 4EX7A 1BVHA 3VFDA 2YQ4A 4LFAB 4HLUC 1AA9A 4TZTA 2HRQA 2G1AA 5EIAA 1JI0A 3EVEA 3RFUA 1S2NA 3U37A 3WRYA 5KOHA 3VC7A 1XTZA 1EWRA 5D85A 4F71A 3DDUA 5FBVB 5AHOA 1VP9A 3PQFA 4GZ5A 1ZCBA 2AJBA 3HBLA 3U7RA 4NCIA 1GPUA 1XTRA 1G64A 2H3HA 3BK1A 3EVCA 3NJ4A 4FFVA 5EIBD 3M1AA 5EPUA 5DX1A 3QWHA 3WMFA 3C8ZA 2PT9A 2O3UA 2BKAA 3K05A 2JJ2D 1NRXA 3O74A 4U1RA 4X95A 1IXSB 3ROMA 3WICA 5LBTA 2POQX 1AQJA 2QW8A 3CW2A 4MV4A 2OV1A 2H5LA 1VJ1A 2X86A 3ISVA 2QDKA 4GBGA 5HTKA 4D8WA 4LZAA 2FN9A 2WVJA 1NQXA 1P2VA 1YZGA 4PBRA 5FPYA 4B0OA 2WRZA 1D2HA 1KEEB 3F7NA 4G0YA 4QPNA 5HS6A 3DQPA 5CU7A 2QMQA 5JO0A 1EESA 2GAFA 3WQBA 3VKGA 1N8NA 2IPOA 1BA2A 3NEPX 1DTWA 1LJUA 4OQDA 3IB6A 4KMMA 4WZBB 2Z08A 3VO8A 1HOXA 1S2GA 3VDXA 4S2UA 4EFNA 3ZW7A 4UC0A 5JARA 3KQWA 5H7XA 5LUAA 1H2AS 4NICA 3H8JA 1G9SA 1P5FA 2O8FB 5EUBA 3EGDB 1JLLB 1OX6A 2A0XA 3RVNA 4BEJA 5KNDD 3ZE2B 1NMZA 2XUQA 4IOMA 1ND6A 1CVIA 1YU6A 1AS2A 2GNPA 1U8XX 2WF5A 4S24A 3V4OA 5FI5A 1OXKB 3AWIA 2YY6A 3RABA 1JP7A 1NQVA 2WVAA 2XOEA 1MOSA 4HRAA 3O1JC 2RHJA 4IRXA 2GKSA 3LG2A 4AS1A 2BEUA 3ZCUA 3BMQA 4Y30A 1WUTA 2A14A 3ZR4B 4A2CA 5FWDA 1C0LA 2GEVA 5B1DA 1IUOA 1BXGB 1SZJG 2FEAA 4D25A 4YA6A 3GRZA 3PGJA 4LDAA 3UENA 1E3LA 3I34X 4IG9A 1NWHA 1TW3A 2HIAA 2WWWA 4FZ5A 1OXUA 3IQFA 3JY6A 4QQKA 2DLCX 3FOBA 2PUVA 3AOGA 3R77A 3RHTA 2CXOA 1PJRA 1RKVA 2JFOA 2ZU0C 3NTOA 4PXSA 5EYPB 2HGZA 1U7HA 2KS6A 2QA5A 3I0ZA 3QPCA 3U4IA 4O4LB 4PXAA 4XM2A 5C1BA 3HSKA 3UUEA 4MQEA 1NQ5A 4BVHA 3H2HA 4NBSA 3C70A 2D0DA 3F6SA 4BMOB 1U0EA 3GRPA 5IDXA 1ENOA 1JMYA 1K89A 4RELA 5HCUA 4EKNB 4KRFA 1J2TA 3PL1A 3A3YA 1NJGA 4IKOA 1XXLA 4UZSA 3VHQA 1E32A 4H4CA 2OCPA 5BRAA 2GCPA 3IBSA 3I76A 3LX5A 4IUCS 4TUYF 4YMIA 4JXZA 2J0QA 3D0QA 4KCGA 3CYFA 1QRRA 2OHOA 3I5YA 4ZAXA 2NX2A 5PNTA 3U44A 1E2PA 5A4JA 4UBJA 2F64A 5JD5A 3BHMA 5B64A 3IVMA 2IXDA 3D2LA 4IIHA 2OFXA 3QV2A 1TZ2A 2XGSA 3PKJA 1IXRC 2MT9A 4J2OA 1Y7IA 2FFRA 4QBIA 4M0CA 4XRGA 5F1PA 1QE3A 2V7QA 2G36A 1NBHA 1M2NA 2J4CA 4H1UA 3INNA 3EG9B 4CLDA 3IAHA 4KQXA 4BQEA 5SV2A 3MWGA 3PWKA 3GDFA 4B3BA 1Q83A 1Y9AA 5LKRA 1TZMA 3D3JA 1FUKA 1SUFA 2DTEA 3NWPA 1VHLA 3OP4A 3LP5A 1UP4A 4WNAA 3T1OA 4C04A 2WWRA 1HPLA 1KZGB 2JB9A 3A9WA 3Q7EA 4J1QA 3RI3A 3BXGA 5EXSA 5A3RA 5EQJB 2YV4A 2XE6A 3H9UA 2PHZA 1TTTA 1RFLA 1JAZA 3B3GA 5F98A 1XZBA 1PGQA 2YY5A 1Z75A 2OCXA 3I9V6 1ULTA 3DE7X 3LBFA 4IIUA 5T4BA 4ABTA 2V7UA 3FUVA 1S3GA 3EIXA 3LQYA 4TTQA 2ZBPA 4V0OA 4F11A 3EVDA 2H0RA 1XJQA 4NZMA 3WMRA 1EHCA 1A9XB 4FJ2A 4J0JA 5HG0A 3EC2A 1MZVA 2IP1A 3HGTA 3SJZA 1P7CA 2WTBA 2F1JA 1I3OA 5EHGA 2JVJA 3T3GA 2XYQA 1KQFA 3L6DA 3ZLBA 4WL0A 3ZWYA 5EP1A 4ZOCA 4C3UA 1Y42X 2EX1A 1LDGA 3E1SA 4AQYB 2OD9A 1L5GB 3R3HA 5J5AA 5AUNB 1DIRA 2YUTA 3T5CA 1YQUA 3LY9A 4NDAA 4UEJA 2OCAA 4CIDA 1CG6A 2P0EA 1T1IA 1DADA 3OPNA 1GPJA 4JUIA 5AVTA 1H4VB 1U02A 4IL5A 4OXKA 2R00C 4C7JA 4G4JA 2B20A 1XRLA 1Q3KA 4MSUA 5FOWA 4L15A 3JV7A 1E2GA 3W90A 3UGJA 2HMAA 2QD5A 1SXJE 4J0DA 4KR0A 2G6TA 4ZPXA 1JQLB 3OQNA 1F6BA 4HF7A 4YJ3A 1IRIA 4YO7A 1Q1AA 3G3EA 3AF5A 4WBNA 2MINA 4WDRA 1UQRA 1S1CA 3SKVA 1P4AA 5T5QA 1R50A 4BQOA 1KI2A 5GZ6A 3V9AA 1BWQA 2G71A 2W58A 1J07A 1NN0A 2NUAA 2WLTA 4MJLA 3OKAA 1ULSA 2O0MA 4RKFA 4KPGA 4AY5A 1LCIA 2HMUA 2WYWA 2O7NA 4K6KA 1FVHA 4JQOA 1BZYA 3AEQA 2GHIA 4HAZA 3TBFA 4BP3A 4LX0A 3H18A 1RKUA 1N5IA 4F1KA 3STYA 1OH8A 2ZUVA 4Z5XA 3T94A 4F2PA 1L5HB 1NC1A 3UBMA 4NEGA 2HWUA 3KETA 4IDNA 2IJGX 2WVHA 3QP9A 4LJSA 1E89A 4PNZA 5G0TA 1H8EA 4OX9Y 1JL3A 3QX7A 1FQKA 2GEFA 1QH9A 3W77A 1JIIA 2GARA 5CGQB 1NQWA 1YS4A 4JGGA 4AG6A 3KBBA 2QUKA 5GM2A 4EJSA 5GINE 3W7BA 4TTPA 2BDEA 2O2YA 5E4YA 2W8ZA 4FWTA 1OFIA 2WJ3A 4BNVA 1SPXA 3VZCA 4JFAA 1GFZA 3ICQB 3CEPB 3ZDYB 3DXFA 1YQDA 5TPWB 1CZNA 3I2FA 3ZLUA 4Z4QA 4A0GA 1P7VA 1KXJA 4Z49A 3BCHA 2NPFA 4CPDA 1YK1A 4TT3D 5DW0A 2XA2A 2OXEA 3WGTA 1RZVA 3X2FA 2EKBA 4NCBA 3FBWA 1F2TA 2NACA 3INGA 4HL6A 1FIUA 3SZGA 1L5QA 1D6MA 2M9MA 2UDPA 1WPXA 3H6HA 3A1WA 2P9YA 2GK4A 1WCXA 4DLRA 3HDJA 1RS0A 2JGMA 3WWOA 2VHYA 1JG3A 1KERA 3DFIA 3W7VA 4HN4B 1GSAA 3FMIA 2YYAA 3RC9A 4D3DA 2O54A 4I2NA 1U9YA 2XWJI 4MUIA 3LBYA 3QNMA 1ISGA 3FY4A 4FM9A 1EAMA 1PEKE 1FF9A 5E1OA 4AJ4A 1ZVMA 3DGFC 5AXCA 2ZBFA 2DR3A 1NG1A 3G82C 1SQ0A 2SKDA 1NKVA 4FQ7A 3LQRA 2WJ6A 1Z37A 3MCZA 4BGUA 2HF7A 3JQPA 3H9CA 4ZJZA 3Q8LA 4KW7A 2Z4SA 3WMWA 1M2KA 1REQA 4FI3F 5CW2A 2VBCA 4E30A 2XRMA 3BRWA 4CM5A 1DEOA 2WK1A 4LGCA 4CG3A 4EUSA 2JDIA 1YDFA 3S2EA 2G9UA 3STWA 2A9QA 3X1WA 4DXHA 1Y0BA 2AXNA 3IPYA 1YIOA 4ZKEA 1OYVA 4LVCA 3CY6A 1JXMA 4JUBA 4PIMA 4EHFA 5CFRA 2AD1A 2AB0A 3BKWA 1X7XB 5AICA 2F3UA 5L9AA 3NTUA 3NDPA 1WCYA 3L1VA 3PDJA 4RF3A 4IIGA 3UGKA 4GI3A 5DX0A 4LYFA 3C3WA 3JWGA 2R60A 2HW8A 1DARA 1H2HA 4FB5A 1GA4A 3HB7A 4ZIRB 1H8HD 3VRHA 4M1TA 4N5NA 4L5AA 4NPAA 1ZM3A 4DVJA 4CN9A 2NAPA 1QGAA 1WQ3A 3Q7TA 1GTG1 3WDSA 1C0IA 1T3SA 4FD2A 3IHLA 1E2HA 1ZW6A 3LBNA 3CWQA 1JDNA 2J30A 2JKZA 2O6HA 4E5KA 1P3JA 3MUNA 2WIBA 1JHMA 4MR8A 3IVXA 2XIQA 3CF4A 1XJ5A 5C8YF 3S2YA 3QWAA 5AK6A 1ADCA 2WUFA 3DZCA 1NVAA 1SU4A 4N41A 3U1VA 2XCIA 4A2WA 5EIOA 5JV5A 5EMLA 1RQRA 2R9VA 1N5OX 1ZX1A 5EJ7A 4G1FA 4LFCB 5L3SA 4I50F 4X66B 1PAUA 3G2NA 1NG9A 3E3LA 4XTRA 3MBKA 3BIOA 3D6NB 5EE3A 3LXRA 3ZWOA 1BE8A 1CR4A 1NI4A 3FB1A 1Z6YA 2XQIA 3A28A 3BXXA 3CLUD 1X6VA 4E2FA 3OZFA 4TT8A 1BE6A 5BP7A 3IJPA 2FUKA 3EIUA 3BN3A 1FFHA 1NJ6A 2H18A 3NT4A 4L50A 2CDRA 1WB6A 2Z58A 4Q37A 2HTEA 2JJ2A 2Z56A 2G08A 3HB5X 3PUJA 4ZVTA 5HIMA 1YRHA 2IA5A 5FTNA 5JSUA 5KZMB 3IUEA 4MS1A 2QIPA 4Y1RB 2LR0A 2HU2A 2Q5OA 1DBPA 1EUCA 3OBIA 3PQDA 1T3LA 2V7PA 3OVMA 1GGMA 2XYGA 1ES9A 4Y1FA 3WP0A 3X1ZA 2XCRB 1FA9A 4IH9A 3HJAA 2E1PA 2QRZA 3B1WA 4O2AF 3SXUB 4D26A 5A9TA 3U17A 1KDZA 3ZK7A 2CEKA 1XFDA 4X94A 5JBNA 3PFFA 3MJ4A 1ST2A 4DAEA 2A9VA 2EQ5A 4HAXA 4JOQA 3DZGA 2GF9A 4CEHA 4RJ2A 3MBIA 2ISSD 3JYPA 2EKLA 4OY3A 2JHCA 4TS9A 2FN8A 2O20A 5JRDS 1N7JA 3UUFA 3NC1C 2BD0A 4V1CI 4DS3A 4EJSB 2L19A 3QXHA 1EFKA 5EPOA 1THMA 4BMXA 4E15A 2HJVA 3F4KA 3VU8A 1E1YA 2V4UA 1LU9A 3DQZA 3OC0A 4PLHA 2VP2A 5D86A 4BAZA 3DBVO 3FJYA 5AK0A 2HWKA 5ITSA 2ZBDA 4KR3A 2RH5A 4HR7A 4JWKA 1NDHA 3ADKA 2GA8A 5CDFA 1USVA 4GOJA 4YB8A 4CIWA 2DERA 1PSDA 3DEAA 4KQWA 3UQYS 5BMOA 2F8TA 3GGPA 5KTYA 1NX6A 2XZPA 3OE4A 3T0GA 2ID9A 1U5BB 3D3QA 2IYRA 4G2NA 2B4AA 1R4NB 3OU2A 4NYMQ 3CR8A 5JSHA 1E2FA 1H05A 5AVRA 1EGVB 1GV1A 1PQWA 2PJDA 3CX7A 4KTVE 4GOND 3IKMB 4YCBA 2PU7A 5BW6B 5EUQB 4QHYA 3FHLA 4BO1A 4KWHA 5CCEA 1P29A 3TSAA 1FNSA 1TYBE 3FFXA 3D6HA 5KYWB 4GWKA 4B76A 5KNCD 2CMGA 3N5CA 4Q9AA 1P2BA 2VJOA 4QEKA 1G1AA 3HRIA 5GIOE 1KO8A 4CEJA 2IY9A 1I4LD 2EF0A 2BAGA 1Q0QA 2GWRA 1QDEA 4HNGA 4YMSA 3MA0A 1KAEA 1NZDA 3TQFA 2WTUA 2PUJA 4UZEA 1K5DA 4FMPA 4RPHA 2XMPA 1P5HA 1ESCA 4LKOA 1G20B 2V9PA 2Q2NA 4P82A 2IE8A 4GP9A 5BSUA 3RRYA 2HK9A 1D5WA 1K4KA 2JLRA 2O2XA 1XNGA 4CETA 3EMVA 3GPLA 5LP6B 1FK8A 3B6JA 3DBRA 3RV3A 5LQNA 1JIQA 1ZY2A 3H3XA 3QWFA 5F5XA 2NVUB 3E61A 2JGFA 1T9HA 1XSEA 1SB9A 4O4HA 4DWOA 4EBFA 2V6MA 4C4TA 1JHVA 1UDWA 5A9SA 5EFZA 1VFPA 2G88A 3T1HB 3AVTA 3O2NA 1A9OA 2OO5A 4QE3A 4TYQA 5CHEA 5LVAA 3CLKA 1T5HX 4QOFA 4JELA 4W5QA 4HBZA 3AY7A 1YI8A 4Z1OA 1SIWA 2C5AA 2IHBA 5HRUA 3W9BA 4D9EA 3ZU6A 3ILVA 4DLPA 3TM4A 3EJ6A 1HTTA 1U1DA 3FCYA 1JHYA 3UJ9A 1XCPA 2C4NA 1M2HA 3C4JA 2P9TA 4YDRA 3RSZA 3E05A 1VCMA 2Q3LA 2NZWA 3NBAA 2CFOA 1ELOA 1XAHA 4G0QA 3RSGA 3SE0A 3Q7IA 5B6JA 4QUBA 3W34A 2PXXA 3VPGA 1ZC3A 1KEEA 3AV3A 3G5TA 3EH2A 2EC5A 3L0BA 1BCRA 1GAQA 3I9NA 1KY4A 4EH1A 2PD6A 4KP7A 3L7AA 2IYNA 4BXOA 3BH7A 4S1VA 5JJIA 1U6JA 5IBQA 5EZYA 1CRLA 1JNXX 2ZVQX 4PICA 4RY2A 3AL0C 1P0PA 3BGVA 1VFNA 5HIKA 1TE2A 4KK3A 4XQCA 2B1QA 4QPJC 1TK9A 3F47A 2ZTUA 3OJWA 5JXGA 3RC8A 1F3LA 1I13A 5HQTA 5G3ZA 1QAMA 4KAJA 4X1IA 1DUSA 2JVIA 3TMYA 2CD9A 4XDHA 3OY7A 4R4JA 3UKDA 2ACVA 3ACBA 4IJMA 3ZV4A 2UU9B 4DLTA 2VDWA 1P33A 2OLJA 3LNCA 4M0PA 4WQMA 3SC4A 3SSAA 3UWOA 3ZHZA 1PHRA 4PGMA 5HRAA 4QASA 3PXEA 1EQ2A 3CTPA 3H2JA 4UNQA 1COZA 2WJVA 2FQWA 2GN6A 1BTOA 2H5EA 3WK8A 3IOEA 2CLDX 4P3YA 3OFVA 3HGMA 5KKCA 1MABA 1KU6A 3WGJA 3WLOA 4I1RA 2YMQA 1QZTA 4N54A 3WTCA 2A92A 2IS4A 2K87A 2JGRA 4W6QA 5HJ2A 3HS3A 2ONYA 4QYMA 4MUBA 4TKVB 1EFPA 4Y2PA 3BKXA 3R6WA 3LAWA 4C0HA 4M76B 4QUEA 3ZNOA 4C4SA 3G0HA 4TV9F 4N48A 1J5EB 5JS6A 1QFXA 2VRBA 1U80A 3FMGA 3IOBA 1KSFX 2AYXA 2I2BA 4Y6GB 4KPEC 3TXAA 4L9RA 2BR5A 5KSZA 4OX9B 2E18A 3HUUA 1C8VB 3IXMA 5KB3A 1ZMTA 3B8EA 1GG2A 2FPPB 3O8NA 1UK6A 4FFRA 4MUXA 4OA5A 1IBCA 5AKIA 5HFAA 4A36A 3UCXA 1KK1A 4LHYA 3AM5A 3BGOS 4EJ0A 3KYJB 1FE8A 3PUVA 1YS1X 2QM0A 4Z0PA 4OFXA 5K4GA 5E0OA 2MSLA 5KTPA 2CVHA 5JNTA 1N2OA 2JFZA 2OM6A 3ESXA 4V0ME 2I2DA 3FLBA 4LDJA 1P19A 2RAFA 1PV2A 4XUDA 3FOCA 2C7VA 5KOJA 2AKEA 1G3RA 3SQWA 3O8BA 4YRBA 5IJZA 3CN7A 5TVGA 1NJ5A 3WLMA 2XDYA 3KZCA 3GRAA 3OIVA 3FRJA 2HK6A 4UBOA 1ZR4A 1KYXA 2P77A 3EDMA 4I81A 3WL5A 1X1SA 2R6GA 3BFVA 2C2OA 3ZXUB 3PICA 1ZGGA 3SX0A 4IEIA 2PN1A 1BMFD 4M9XA 2JRLA 2XCOA 4PYQA 1R6AA 4YAWA 3QWIA 2BFEB 1U65A 2O8NA 3BVPA 4AICA 4KBGA 4JIMA 1RHJA 2BEVB 3EULA 3DONA 3QTTA 2QMZA 4PFQA 3GEBA 1AD2A 1XB2A 3RRNA 2IP4A 2O19A 1C0PA 1ORDA 1AGRA 2FPMA 2OC9A 1OBOA 1SHZA 2D1TA 1U1IA 2OG1A 4BP8A 2FCAA 5CNKA 4V03A 3TGPA 2VDKB 3CZRA 4JT4A 4XOUA 2PS1A 5HDBB 5MGBA 3BJEA 2A0UA 2IYVA 1N1DA 2H7CA 3AVQA 4PONA 4Y2GA 3H2KA 1K75A 1T2VA 1OBVA 3ZQKA 2FI1A 1MD9A 3IEKA 1UL1X 4GWLA 4IDEA 4IS3A 4MB6A 3JVIA 3RQIA 4A7PA 3RAEC 1I8TA 5A1TA 3DTTA 3JYHA 3CLVA 1XMQB 3AFOA 1ZNXA 2R5NA 1NN5A 3DV9A 5KKAA 5JNWA 1E99A 3PEWA 1U2ZA 3BTUA 3K8QA 4YUWA 3WBFA 3IKTA 5TQJA 2ATVA 2B4YA 3C1AA 3EF3A 1WB4A 5KTMA 1T0BA 4QTZA 4IXTA 2O3RA 3KJQA 4PZUA 2OV4A 4MGKR 3OEYA 4NP6A 3H9GA 3TRDA 4EJ2A 3ABOB 5K8TA 3U0BA 4MI6A 1IL0A 3KV3O 3KUXA 4P54A 4LDZA 1P1BA 3RANA 4WLEA 5B58C 4NJEB 1QHFA 5DM2A 4B4UA 1TQ8A 3IAM6 1L4LA 3O75A 3PL5A 3CCFA 4GQAA 4NBTA 1Z15A 3DE2X 2VJAA 3GK3A 3USCS 3PLNA 3H0CA 4PQEA 3TRKA 1QHIA 4HWKA 1G41A 3RYIA 3HB0A 3OT1B 4GZ6A 1KMMA 1T9GR 1Y4AE 3OM8A 1Q0TA 2YNMD 1DC4A 2CCGA 3IO5A 3L43A 4KKVA 1N3YA 2B1IA 1RXSA 3NORA 5EIXA 2HRDA 3EJWA 2F1IA 4Q9DA 3LKBA 4WOKA 1OVMA 3ZPXA 4L9WA 4B44A 3MWDB 3DH0A 5JSQA 1SKUA 1X3LA 3EEYA 3GJXC 3ZY3A 3ELYA 4L9SA 4Q7LA 1WLSA 3IT1A 3TTUA 2P2LA 3T7KA 1CTQA 1E3IA 1KOGA 2IYWA 3DOOA 3BIJA 2DF8A 3F6CA 3JQ7B 5L4LA 1Y6QA 1BO6A 1JLSA 1P1KA 2OGSA 3CUUA 3E8SA 3B3QA 4TV8F 4UEQA 1JH8A 4WK4B 1EFRD 3ZX5A 3G0OA 1ISPA 3EOAI 1U2QA 1XDWA 4KUEA 3V32A 2A1UB 3CINA 1OXVA 2W71A 1AO0A 2VF4X 4DUGA 3T3MB 3IJRA 1CUWA 1E7WA 5TGTA 3H65A 4RLFA 1J20A 2XDAA 4QG3A 3K1ZA 3DCJA 3RRBA 4RK4A 1EVEA 3L5OA 1F4PA 1CFJA 1OF1A 1HOTA 2WAYA 3N59A 4HZUA 5KMGB 3IEXA 3UHPA 3PNPA 1Y82A 4O2BA 2FRDA 4REOA 1ANKA 2ZIAA 4X8HA 3IV7A 4Q4JA 2QU7A 5AESA 3NPAA 4KAFA 4LOIA 3F7MA 2GJKA 2PGIA 4OH7A 4XLLA 4QX6A 3REQB 2Y1FA 1Q6YA 4HGZA 4WK2B 5F35A 3X1MA 2OP1A 3RIEA 5HZMA 2DKNA 2VFAA 3INTA 3NDJA 3P9SA 3I6ZA 3F67A 1GPYA 4LPSA 4MVXA 4UBMA 5ALIA 3KQQA 4PZZA 4R2XA 1D1TA 2QW1A 2WJHA 5T6BA 2FEWB 3DT6A 1IC6A 1PUXA 2ZSKA 3NW9A 4MVYA 2R7LA 4FX5A 1TLLA 1UJ4A 3AINA 3HA5A 3WWYA 2HLNA 1EYZA 4ZT6A 1IY1A 2NPOA 3ROPA 4GW3A 3SI7A 3JQ9A 4C0WA 5LWHA 1Z13A 3BWXA 4WEQA 1W25A 2PZ8A 3A1VA 2J3HA 4PLVA 1X1AA 5HCNA 5CDYA 1UBFA 1JHRA