3QMWA

Redj with peg molecule bound in the active site
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
251
structure length
246
Chain Sequence
SAWFPRPVAAAEPPDPAAAPLRLVCFPYAGGTVSAFRGWQERLGDEVAVVPVQLPGRGLRLRERPYDTMEPLAEAVADALEEHRLTHDYALFGHSMGALLAYEVACVLRRRGAPRPRHLFVSGSRAPHLYGDRADHTLSDTALREVIRDLGGLDTLGAAYFDRRLPVLRADLRACERYDWHPRPPLDCPTTAFSAAADPIATPEMVEAWRPYTTGSFLRRHLPGNHFFLNGGPSRDRLLAHLGTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the RedJ Protein, a Thioesterase from the Prodiginine Biosynthetic Pathway in Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
molecule keywords Thioesterase
total genus 80
structure length 246
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.-:
pdb deposition date 2011-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qmwA00
3DOIA 1SCQA 3TGLA 1Q0ZA 2PPLA 5AK3A 4PQEA 1BS9A 1PV1A 4DNPA 3D2BA 4BVJA 4FLEA 2WU3A 2Y1KA 1EI9A 3A2LA 4X7BA 1MX1A 1XZBA 1UOOA 2VA9A 1CUIA 1MN6A 1CUSA 3G0CA 4PSDA 4EY5A 1CLEA 1XZCA 2WIJA 4DMCA 1THGA 1CUFA 5BWBA 2PU7A 1WHSA 5SYNA 1VZ2A 2JBWA 5ALWA 4AQDA 3M82A 3IIIA 2PVSA 5CXXA 3DOHA 4E15A 3SC2A 5HK8A 2QRUA 2GBFA 1TAHA 3PF9A 1F6WA 1KU0A 2J4FA 3AUKA 4OU4A 1FSSA 3DL4A 2YASA 3H2HA 5HF8A 3CN7A 3DDUA 2BCEA 4KAAA 3QYJA 4HRYA 3WWCA 5A2GA 2ZYSA 2ONCA 4K6KA 1MX5A 5DYYA 1VOTA 3G9TA 4CCYA 1SOMA 3OC0A 5E4TA 4BYMA 5AKKA 4IO0A 3D59A 5ALDA 3H19A 5AK4A 2QTBA 1K63A 4EB0A 1XZFA 2HIHA 4UHCA 2I78A 1LPAB 1ZIYA 4Y7DA 3V1NA 4D9JA 2VT6A 5ALUA 3DL7A 2C0PA 5K3AA 1W6RA 1EA5A 1QIMA 1GPLA 2C5FA 1TCCA 3OPMA 5EHNA 4MJ3A 2NW6A 2VF2A 1CUBA 1AZWA 4GDMA 1UOQA 1TIBA 1ODTC 4B0OA 1Y7IA 1TRHA 4QEKA 4BDTA 2PSFA 2ZSIA 4CFSA 2HA7A 1QIIA 2AJ8A 3QMMA 4BCBA 1MAHA 3WZMA 2BUCA 2IX9A 2JF0A 3CCCA 5I8PA 1SFRA 3W2TA 2B20A 4UHBA 1YS1X 4L3WA 2J3QA 4GHWA 4IQ4A 3KOOA 2O7RA 4H77A 4X93A 3FNBA 4H0CA 3WK9A 2RAUA 1UZAA 1XQVA 4W63A 4K6GA 5ALYA 4RE5A 3F67A 5CRIA 3WYDA 2PL5A 5E2IA 3I6ZA 4LXHA 1LGYA 3F8SA 1XZJA 3C8DA 4QLOA 1CFJA 4Y2QA 5AKGA 3H04A 1BN7A 2V97A 1VXRA 2XUIA 4NMWA 3VXKA 1IVYA 4QWWA 4XX1A 1FFEA 5AKYA 5LIPA 2WUGA 1QIEA 2JEZA 1CV2A 1A8UA 4J0HA 1B6GA 3KD2A 3E4DA 2QUAA 2FJPA 2VT7A 3V48A 4X6XA 2ZJ7A 1MPXA 1F0NA 5JADA 1XZDA 4JH0A 1B41A 1YCDA 4UHHA 4J0GA 3P2MA 2XUDA 4BATA 5CH3A 1WB4A 3WJ2A 4WFIA 3LLCA 5A7FA 4F0JA 2BJHA 2XUKA 3AIKA 1N1MA 3IVMA 3E0XA 2XQFA 5HKAA 2BFNA 4FLFA 2BGRA 1N8SA 1U65A 1MT3A 2WKWA 1Q0RA 4L9AA 2XUGA 4Y2RA 4OPMA 5K3EA 3STVA 4X92A 5AI6A 3HACA 3PI6A 4KAFA 5HCUA 5ALXA 1R9MA 5JYCA 4UPDA 4IH4A 4UBIA 3DKRA 4KYVA 5HZGA 2CEKA 1TQHA 3NWOA 1XRQA 4O08A 1EH5A 4BE9A 2HFJA 4X3CA 4FNGA 4GLBA 4P92A 1Y7HA 4ROTA 5JD5A 2I3DA 2I3ZA 4G1FA 1TCAA 3ANTA 5HF5A 5K3FB 3O95A 4BAGA 3D2AA 5D3ZA 4FFVA 3M3DA 2ACKA 4UHFA 3D7RA 3JYHA 2Z8XA 4LIPD 5CT8A 2Y6UA 1JKMA 5JZBA 4ZGBA 5AKJA 5HQ3B 4MEAA 2HHAA 3D3NA 1XLWA 4PSUA 3A2NA 4KR0A 3R3WA 2XUPA 4YPVA 2OAEA 1OCEA 1XZGA 1WB5A 1EX9A 4OCZA 1E3QA 5AP9A 1T4MA 3C6YA 3FWHA 4FOLA 2EEPA 3VKFA 1XRMA 2DQZA 4P9NA 1N5RA 3W04A 4UUQA 5HK9A 4AO7A 4A5SA 1LLFA 2DSNA 3IBTA 2FUKA 4K2AA 3G9UA 3ED1A 2AXEA 3FYUC 2EDAA 5CTAA 5E4JA 5E4YA 4B80A 4BRSA 4QDZA 1BCSA 1UT6A 4G9EA 2WJ3A 4AO6A 3BWXA 4NS4A 5AKIA 2Z3WA 1YS2X 3W9UA 1IUNA 1JMYA 3I6MA 4FTWA 2CUTA 3WI7A 3QZUA 4L72A 4YX9A 4QDTA 4H7FA 3K6KA 2EDCA 2HA4A 3VJKA 3OM8A 4FDMA 2GYUA 3QMVA 1CEXA 2WU4A 3R3ZA 2DCMA 3S2ZA 5A62A 3C6XA 1BU8A 3B12A 3EQ8A 4HRXA 1W76A 3STUA 2XB6A 4IH1A 4RGYA 4Y2JA 3TEJA 4Q05A 1FJ2A 1QTRA 4JYPA 1AQLA 2WHPB 4B0PA 4I3FA 3I6YA 1VA5A 4G8DA 2WIKA 3WLAA 2VJDA 2X76A 5CURA 3PE6A 1PJAA 3DQZA 4IHAA 1AURA 1FFCA 5FP0A 5CT5A 2OG1A 2ECFA 1T2NA 3M83A 2X5XA 3I1YA 5FDFA 1ZI8A 5C8VA 3ZWQA 1ACLA 3STTA 4ZWNA 4WFKA 2XQJA 4Y2TA 5ALZA 4HAIA 1H22A 3MVEA 3WWEA 3R40A 3WL7A 4V2IA 1HKHA 3QITA 2XUFA 2IITA 3X3HA 2Z3ZA 3R3UA 4OYYA 4N8DA 3V9AA 3UUFA 3SK0A 4EY7A 1DX6A 3CXUA 1SCIA 1GPNA 1R9NA 1JI3A 2PUHA 3WK7A 1LPMA 5FPPA 3W06A 1BN6A 3EF3A 2CB9A 5CT9A 4Y2UA 1YB6A 1K5PA 5K5EA 2QKYA 5ALLA 3DD5A 3NOXA 5T4EA 4B9EA 2C4HA 3L1JA 1WHTA 5ALTA 5ALPA 4GWLA 1QO7A 1ZJ4A 1WPRA 4GI1A 3RK4A 5ALIA 4ARAA 4MWSA 1EDEA 5DNWA 2GYVA 3EBLA 4BTVA 4B83A 3FLAA 5ALEA 3AZOA 5LZ4A 4MXDA 4QWMA 5FUMA 1CUHA 5EHZA 3T52A 4ZXFA 2RHWA 4QLAA 1R1DA 5C81A 1E8MA 5FRDA 5AKEA 4W1QA 4OU5A 1H2ZA 1LNSA 5AIAA 4CIBA 5AI4A 4KRXA 3WA7A 2PUJA 4EY4A 1C7IA 3DYVA 1ZGCA 5CH5A 1YA8A 5ALHA 1XQYA 5DYWA 4ZV9A 3TRDA 1IZ8A 3HZOA 2HA3A 3HLKA 1OXMA 1VJ5A 2UZ0A 2C5GA 4GBGA 5AKLA 5EHQA 1XZKA 1LZLA 2WHQA 3G02A 1LPOA 5A6VA 4WDQA 2XE4A 1Y37A 2G5TA 4G4JA 4M0EA 4MWTA 1M33A 3WWPA 2QXUA 1DU4A 5AM2A 3ZLVA 5HF9A 1IMJA 5I7UA 4QE3A 2O2GA 5I9IA 1DQZA 1AC5A 3WK5A 3G0IA 4WY8A 3C70A 4DIUA 1AX9A 2FJ0A 1KEZA 3G9XA 1LBTA 2OCLA 1CUWA 3VISA 2K2QB 3O9MA 4J0JA 3A6ZA 1DINA 3F97A 2PSEA 3LIPA 4EZIA 1HDEA 2WIFA 3E3AA 2XMSA 4QDXA 2RHTA 5DTJA 3MUNA 4FKBA 2PX6A 1CUVA 1QIJA 1CQWA 4DSZA 1CQZA 1QJ4A 5KWJA 5FV4A 3VDXA 3ILSA 3WKBA 2OCKA 3G0GA 3LP5A 3G8YA 2QUBA 4Q3KA 2WJ6A 4OB7A 2WILA 3EQ9A 4ITVA 5YASA 4AZ0A 2E3JA 3HABA 5AKXA 4LKOA 4Q3OA 3STWA 3ZI7A 2QT9A 5DLPA 4BVLA 4BZZA 4Q1VA 3OOSA 1UKBA 1EVQA 1QONA 2B4KA 1CRLA 4H18A 1EXWA 1RWQA 2GYWA 3GFFA 4XVCA 3RLIA 2DR0A 4J0DA 5DWDA 3H2KA 3N2ZB 2XI4A 4UFOA 1HQDA 1QOZA 4FNMA 3A2MA 4BB0A 1K6EA 5HQ3A 1SC9A 3MGAA 4UFPA 3GZJA 3FOBA 2QJRA 4WJLA 1XLUA 2WFLA 1MNQA 1VZ3A 2ZYIA 4YK7A 2H9YA 1GKLA 4F21A 1DT5A 4FWBA 1BCRA 3BJRA 5D6OA 4GW3A 4LYEA 4BAZA 4AMZA 4C01A 4QDOA 4UHDA 5LZ8A 5DYTA 6YASA 1I6WA 1E5TA 1J1IA 1S8OA 3RKSA 1YASA 4C87A 1XROA 1DTEA 1W1IA 1EB8A 1GPKA 3K9BA 5FOQA 5CBKA 1WB6A 1ZI9A 2HFKA 1UOPA 5AK6A 3U0VA 2QM0A 1DX4A 4NZZA 3ICVA 2WFZA 4BP8A 4Q3LA 2RIPA 4P93A 1MO2A 4Y2XA 1XZEA 3H0CA 4Q34A 4IH9A 2DHEA 1NX9A 1CR6A 4ZREA 3HSSA 4AB1A 5KWIA 1OILA 2PKYX 5ESRA 1VA4A 4PSCA 5FKJA 2ZYRA 1L7RA 3ESCA 3O4HA 3GA7A 1G5FA 2AJCA 4ZI5A 4B9AA 1CUYA 5BV7A 5LYYA 1ACJA 2G5PA 1TKRA 1ZD2P 4MQLA 1QGED 2WHPA 1JU4A 2QS9A 4M0FA 5LZ7A 5AKHA 4BRZA 2QOEA 4HZGA 3KWFA 5ALSA 1RP1A 4J0KA 4FBMA 4ZRDA 1EHYA 3V1LA 3VJMA 3PUIA 2OGTA 4DNQA 4FLMA 4QA9A 5AM1A 1XRNA 4U2FA 5C8ZA 4JYMA 4KE9A 2XDWA 4DLNA 1ETHA 5FXMA 4U2DA 1NU8A 2WJ4A 1CUCA 2G63A 5ALOA 5EGNA 5LZ5A 4KJXA 5A71A 3O9VA 5ALFA 3DNMA 1XQXA 4GEGA 3WQHA 5JAHA 1WCYA 1LBSA 5ALMA 3H2JA 4KAJA 1P0MA 3ZV7A 1CUEA 2Z8ZA 3EQ7A 3WKEA 5C7YA 2Y2VA 3I2GA 5D7BA 4G8BA 3WWDA 2WIGA 3UUEA 3ICWA 4X71A 1L7QA 1XLVA 5IVIA 2ZJFA 1JU3A 5T4HA 1BRTA 4XIIA 1VKHA 4JUIA 4X6UA 3C45A 2XQKA 4TVKA 5ALJA 1MNAA 2DHCA 1EK2A 4E14A 1QLWA 1C7JA 3BF8A 5J3JA 1U8EA 2Q0XA 3I2IA 2CKMA 3QM1A 2CJPA 3F96A 4GXNA 1J06A 1J07A 2XLCA 1Q83A 1YAJA 3WWOA 3FAKA 4AN1A 5JALA 2ACEA 3QPDA 1DT3A 1XKTA 2ORYA 1H23A 3PICA 3IDAA 1XZHA 1YB7A 2BUAA 2AJLI 3QMWA 1JJFA 5AM0A 5ALQA 3I28A 5AJHA 1CUUA 2QR5A 3JW8A 2GBCA 3WA6A 3LCRA 1Z68A 1BEZA 5CT4A 3MUOA 4U2GA 2PBLA 3B3QA 3WKAA 2OPHA 3AZQA 1YA4A 1JFRA 5LP1A 3KWJA 3WL6A 5AOCA 3AFIA 5ALNA 4W1SA 1H2WA 2HA2A 2ZSHA 5KREA 3LS2A 4U2BA 1ZIXA 2OQVA 1TCBA 4G4GA 4EA6A 4U2EA 2YH2A 3I1IA 4HXFB 4UBNA 3C5WP 5DTIA 2DHDA 1JJIA 4FFWA 5DNVA 4XJVA 1WPXA 4OB8A 4A23A 5JARA 5FLKA 2ZVDA 4AZ3A 3GBSA 1BE0A 1XRRA 1L7AA 1R4ZA 5EFZA 1HBJA 1WM1A 1DWOA 1EINA 4J0IA 4HTAA 4H7JA 4X94A 3IA2A 3HI4A 2XQIA 4G5XA 3FVRA 1GQRA 2PM8A 1R50A 3JWEA 2WIDA 5IVHA 5CXUA 4MYDA 2OAGA 4OYLA 3VVLA 3ZLUA 3WL8A 3R3VA 3C6ZA 2C0QA 4Y2PA 2WHRA 4I19A 4C4YA 4UBKA 1A7UA 2H7YA 3RM3A 3FCYA 1W52X 1Q84A 1XKLA 4FMPA 4PNZA 4TGLA 1UWCA 4P08A 1QE3A 1XZMA 3DEAA 4KE8A 1BROA 1ZICA 3PDCA 2O2IA 3SX4A 2XUJA 3DCNA 4DNFA 2FX5A 1EDBA 1X70A 4OUKX 1E66A 4B85A 3A70A 3DJYA 1EB9A 3WKDA 2BUBA 1CUXA 1C4XA 3B5EA 3C8HA 3H2GA 4KRYA 5D3KA 4X95A 2OCIA 3AIMA 3KXPA 1VXOA 2VSQA 1WOMA 5BOVA 2R11A 4E11A 1MJ5A 1QO9A 4BBZA 1CUGA 5K3BA 5T4FA 1QZ3A 4Y2YA 1P0QA 3H18A 4WY5A 2D5LA 4Y2SA 4I4CA 4X97A 2VJCA 2QMQA 4HVTA 1HLGA 2WLSA 3BL8A 5K3FA 1XZLA 4RPCA 2OGZA 1IUPA 2XMQA 2V98A 1XZIA 2VAVA 2XUOA 5H3HA 1G42A 3BE8A 1DWPA 3FBWA 5JAUA 3IB3A 5IVKA 5K3DA 2ZYHA 4DMKA 1MTZA 2XMDA 2VEOA 1X2BA 4B6GA 3LIIA 4GECA 1HPLA 4UHEA 4PV7A 4G8CA 4B7ZA 1FFBA 2Y2UA 2GBIA 3BIXA 1MAAA 2HADA 2WQZA 5JIBA 3FYUB 1XRPA 5AICA 3FVTA 1E8DA 4HXEB 4B82A 3HRHA 3R3YA 2XUAA 3OG9A 5HFNA 5AM3A 5FPQA 3N0TA 1TK3A 4ARBA 2AJBA 4CG1A 2XMCA 2XUQA 3H1AA 4LYDA 2WUFA 4W9RA 1LPNA 4KE7A 4CG3A 2QXTA 4DTCA 4J7AA 4B81A 1CIJA 4DMFA 5AI9A 2RI6A 2HU5A 4L0CA 5AM4A 5JASA 3AZPA 3BIWA 3WMRA 4BDSA 1XRLA 2XMBA 4RE6A 1GQSA 4G9GA 2VATA 4CCWA 3BF7A 4K6HA 5IKXA 5AI0A 3I2KA 1HL7A 3S8YA 2VQ6A 3WKCA 3L1IA 3HEAA 5LZ9A 2WG0A 3CN9A 1EK1A 4AXBA 2QVBA 1UFOA 5A7HA 2HA5A 5KBYA 3ANSA 2DFPA 2QZPA 4C89A 3BDVA 5JD6A 4C4ZA 2PSDA 4QZVA 4X91A 2ZJ6A 4LXIA 3K2IA 4XWGA 4CI9A 3BDIA 3D0KA 5T4BA 1ZGBA 2HDWA 2JGEA 2B9VA 1EDDA 3F98A 1U4NA 4BCDA 5JATA 2PSJA 1CUJA 3AINA 3D2CA 4W1RA 1ZOIA 2DQYA 4N5HX 3HXKA 5EIHA 2OGSA 4J3JA 4CG2A 2XMRA 3H1BA 5AOBA 4H7HA 2JGJA 3TJMA 4Z49A 5JD4A 4WFJA 4N8SA 4AX4A 4Y2VA 5K3CA 4JNCA 3BXPA 5HF6A 2J4CA 1QIGA 1N5MA 5DNUA 2WFMA 3OTQA 1UKAA 4H7KA 1E8NA 3H17A 1JT2A 2V9ZA 1KU6A 3FYTA 2CBGA 1QIDA 4B84A 4Y9SA 1QIHA 5ALKA 3W05A 1UKCA 3HYSA 4J0CA 4F5ZA 3F9CA 4J03A 1K8QA 3STYA 1W4LA 5AHXA 1ODSA 1DQYA 1G66A 2WG1A 5A7GA 1RYYA 5IVDA 2HA0A 2JGMA 3IURA 4N5IX 3IUQA 2P8SA 3DKKA 3BJMA 1GZ7A 4KACA 1CPYA 1XFDA 1GT6A 5JZSA 1ISPA 4UFNA 2OQIA 1IZ7A 4UBLA 3WK4A 4YASA 2ROQA 4PW0A 3WYNA 3PF8A 3EIOA 4PO3X 4KEAA 4MQMA 3WIOA 4DNOA 3V1KA 1A8QA 3SWWA 3IULA 1UK9A 3C43A 4S0XA 2GZSA 3IUNA 4UBOA 3WZLA 5AKZA 3FSGA 1ZD3A 3HC7A 1D07A 2ES4A 2WTNA 2XLBA 2GZRA 3O4IA 1E89A 1QFSA 2H7CA 5JAPA 4N8EA 2WTMA 1UXOA 1CUAA 1U2EA 7YASA 1QIKA 4M0MA 2HRRA 3L1HA 1MX9A 4BCCA 4WCVA 4QNNA 5BWCA 4OSEA 3KDAA 2WM2A 5CW2A 4BVKA 1G4HA 3PFCA 3M81A 3VJLA 1IUOA 1DWQA 3C87A 4H7DA 4C6HA 3DYIA 2R8BA 2HU8A 2Z5GA 5DJ5A 3G7NA 2GBGA 4JEIA 1P0IA 4DSAA 2HA6A 5JANA 3DLTA 3ESBA 2YXPX 1MU0A 3V1MA 5JAOA 1VE7A 4H7IA 2OCGA 4BP9A 3GUUA 5ALGA 5ALVA 2Y6VA 1FFDA 4X6YA 2IIVA 2WUDA 2CMFA 4BC1A 2PU5A 3T4UA 1QIFA 1YAHA 3E1GA 3U1TA 1UK6A 5AIBA 4H35A 3ZPXA 1ORVA 3WL5A 1THTA 2HM7A 4C88A 1GGVA 4K5QA 3D4LA 2HRQA 4AN0A 2RONA 2JGIA 4MEBA 3QPCA 4EY8A 1CVLA 5F4ZA 1EVEA 3FYUA 3O4GA 3FLBA 4X00A 1CUZA 2JIDA 2HU7A 2XMGA 2C7BA 3DS8A 2WUEA 2O2HA 4EBBA 5EI5A 4BZWA 5LKAA 2XMZA 1AMNA 1ODCA 1F8UA 5EIEA 1H2YA 1SCKA 4BAUA 1XQWA 2W6CX 3YASA 1QTIA 4EHBA 1UK8A 2WFLB 1W75A 2VTVA 1X2EA 1ZJ5A 3G0DA 2XQGA 3KSRA 1ORWA 3R41A 2YYSA 1P0PA 2O7VA 5HKBA 1A8SA 3IUJA 3VVMA 5HFAA 2VAXA 2G4LA 1LPSA 2H7XA 3CCBA 1ZD5A 3GELA 5IH7A 4ZV7A 2QJWA 3QPAA 2WSLA 1R3DA 3QBJA 4BTLA 5JZ9A 3AILA 5AI8A 2VJAA 3H2IA 4UBJA 1O6GA 3PUHA 3UMJA 2JEYA 2I03A 3GROA 1USWA 5EIAA 1AKNA 4DM7A 2JGKA 3ESAA 3HJUA 3D5EA 1YR2A 5CH8A 3FLEA 2BGNA 1F0PA 2V96A 4TPKA 2HL6A 4EUSA 2XUHA 5CT6A 5AM5A 1LZKA 4DMHA 2XT0A 2AJDA 3C6BA 2VJBA 3AJAA 5AK5A 3NGMA 3O0DA 4FHZA 1AGYA 4KE6A 1YSCA 3I2JA 4OD0A 5LZ2A 1QFMA 3G9ZA 4PF1A 4EY6A 4U2CA 1JJBA 5SYMA 5ALRA 1A88A 3FSGD 5LLSA 2RGUA 4LXGA 4X90A 4OB6A 2J3DA 2CZQA 4Q82A 4E46A 1GKKA 1R88A 4CCYB 3Q0TA 5ISMA 1PFQA 1BEEA 1UK7A 3FCXA 4HS9A 4FBLA 4F60A 3Q8WA 1GXSA 3NUZA 1O6FA 4C4XA 2OLEA 3ZLTA 3G0BA 2H1IA 2OXEA 3I2FA 2LIPA 3R0VA 5EHXA 1VE6A 2BKLA 3W9BA 4DYHA 1XZAA 3STXA 5AH0A 3I2HA 3WK8A 1LPBB 3WJ1A 4BC0A 1FFAA 4A16A 3R3XA 2PSHA 4LHEA 4QDUA 4AO8A 2D0DA 5AI5A 1LPPA 4ETWA 3RARA 3QH4A 3PFBA 4X85A 3ESDA 5C8XA 1CUDA 5LKRA 4WDRA 2BAGA 2JGFA 2W22A 4BE4A 3OURA 2C58A 4NVRA 1ZD4A 3IUMA 4INZA 1K4YA 4UBMA 1J2EA 2WG2A 4RNCA 3O4JA 1NU6A 4HXGA 5AO9A 2JGLA 3QVMA 4AMYA 2B61A 1JMKC 1ZI6A 4G4IA 3WIBA 5AOAA 4CIAA 3C5VA 3WK6A 1H2XA 1AUOA 1VLQA 2X8BA 4H7EA 4DGQA 4MYSA 5CMLA 4W1PA 3AIOA
chains in the Genus database with same CATH superfamily
1YT5A 3T34A 1Y3AA 3JVVA 3TTYA 1RM3A 4V38A 3EXEA 1UIRA 2W6QA 3A9RA 2NU7A 3SZMA 1BS9A 1OWNA 3MHTA 1N2XA 1E7YA 4IGAA 4QYXA 2PEYA 4B7CA 4ESOA 2W8ZA 1RT9A 4R84A 4YTEA 3ZD8A 2AMLA 2CXTA 4D3ZA 1GNTA 4FLEA 1QUFA 1RYBA 2C2WA 2E4ZA 2WU3A 4L51A 3MTQA 4URZR 1KBZA 2CNOA 3A2LA 1Z4JA 3I9JA 5COQA 5JC8A 1MJGM 3BMCA 3T3PB 1N1DA 2QMYA 3N59A 4AF6A 4AG6A 4HG2A 1W93A 3EZXA 2QL6A 1DC4A 4KWEA 1IZZA 1NLYA 4KG7A 1ACMA 4MDYA 5EVCA 4L8YA 1Z5OA 3CE9A 2WIJA 1XZCA 3MRVA 1L7PA 1O58A 1TA0A 1UIMA 2ZREA 3LHIA 4PC7A 3HUEA 1PJZA 3ROMA 1ATIA 4IIJA 2PV0A 4MP8A 4TKVB 2V58A 4ZI7B 1WHSA 3VR0A 4GWGA 4NF2A 5K0FA 2PWZA 1W44A 1UZMA 1MHTA 4LYJA 2R6JA 4UDNA 1B15A 5LYJF 1OF1A 3NEJA 1ZEJA 4LWZA 3TGPA 1DAPA 1O94A 4TSFD 3VUEA 4TMXA 4BLQA 4DCSA 1DIRA 2H8KA 3IAAA 3ZU2A 3WGLA 5MDHA 1R16A 3BWCA 3VR4D 5ICGA 5KCMA 3WV5A 2JDIA 1ISGA 2Q3DA 2QNIA 2GETA 4OQPA 3T5MA 4E08A 1FC0A 5JISA 5KU7A 4IWXA 4LTNA 3AUKA 5AXAA 2JIMA 3DL4A 1FLVA 4BUZA 3TQRA 1ZOLA 3NHRA 4WKCA 5KINB 2YASA 3PD0A 5C51B 1JDUA 2QVYX 1OFHA 2CFSA 4MQFA 4PAOA 1H8HA 3R7WB 1POWA 1X9HA 3R6LA 4RMJA 3T3NA 3GJ7A 2I1LA 5MGBA 2BCEA 3QXGA 3CZQA 2DH6A 4OQDA 2EJUA 3TMAA 4HRYA 3NIFB 3OZDA 4WBXC 3MM4A 3AETB 4TMFA 1WCV1 4K6KA 5BNWA 3FPSA 2FPGA 3HDTA 4J7UA 1R8YA 1VOTA 4TYPA 1DAOA 1Q1BA 4CKCA 1SOMA 2C2KA 4QODA 5FCDA 5HMLA 1ID1A 2AQIA 1O95D 5BYAA 1IUKA 1CF9A 1XQ6A 3V00A 4UZEA 4ZEOA 2XB4A 1JIKA 3EGDA 4F84A 3QKRA 1BD4A 1L2TA 1GRVA 1N7GA 1VPTA 1RXYA 1VSVA 4O4LF 3UH0A 1NFFA 5L4SA 4L5AA 1CEQA 1WUYA 2IEBA 2IJGX 2ZRFA 1OFVA 2WB4A 3DE0X 1AUPA 3QFCA 4MA4A 4MLDA 5C1IA 3CUTA 5JJ5A 2J3LA 1DAGA 2IH2A 3ZWMA 3SHQA 4ALJA 2G09A 4E4YA 1GDHA 4QUIA 5JD3A 3ZDCA 4R0MA 2HRDA 1XZFA 1WOYA 4FHDA 4ZAGA 1XNHA 3FHLA 3S44A 2DULA 3I6QA 4Z4HA 2Q8NA 2WTAA 3AQ4A 4C5AA 4O2BB 3TW4A 5HGXA 4QHYA 2EGUA 5AJVB 4EO7A 1SOVA 3DDZX 4PBTA 1KQOA 3PP8A 5FBZA 2R9VA 1XXLA 3REFA 1P1KA 2V6FA 4AMGA 3W8NA 4MMXB 5AW3A 4CIYA 1GDDA 1XVLA 3TSAA 1JQBA 2HHLA 2QSYA 1NJ5A 3OZEA 5LA6F 1QIMA 3AFGA 4MVXA 1NF2A 4WZAE 1D2EA 4OJMX 3JASB 2O57A 2F8SA 4YJ3A 1NXOA 2RKBA 3HWWA 3R0JA 1DQPA 1TD1A 1E1CA 3GGSA 3H4IA 5CB0A 3EBPA 1UOQA 2PG3A 4AZSA 2C07A 5CYOA 1PVDA 3PEYA 3LBFA 1GZ4A 2DLDA 2JVIA 3IUBA 2D5CA 2QT1A 3P9QA 4WOBA 1Y7IA 2PIAA 4EPVA 5MGNA 1C0PA 4HEQA 4QEKA 5JECA 1E69A 2ZSIA 4X84A 3H9BA 1R4AA 3PC8C 2I9KA 1J5PA 2VP0A 4BCBA 3E81A 3PL1A 2XYPA 3HN6A 1Y1PA 1QO0D 3OSUA 4IIXA 4MS1A 4TTVA 3LY8A 5B53A 2GBLC 5HP4A 2UUBB 3HB7A 3LC0A 4C0QC 3CSDA 4EUEA 2IX9A 4HRVA 4B2IA 4ZJYA 2RCNA 2G76A 2WAAA 3A0RB 3I1FA 2QRNA 1FXWF 2ONYA 3G2MA 3AMVA 3AR9A 2B20A 2OV1A 4CT4B 3OZFA 3CZ9A 2FRXA 4L3WA 1NBME 2P5YA 4JKIA 2ZWOA 3I9LA 1O8BA 2E5WA 1YQXA 2ZI6A 4CKYA 2IXAA 4XOIA 4ZZ0A 2PZ8A 4GHWA 4IQ4A 1AKYA 3ESYA 4EZEA 5CU7A 2IYXA 1JQKA 2O7RA 2OB2A 3KOOA 2HAEA 4M46A 3V34A 5IK2D 3FNBA 4EUHA 1ZWKA 2NSJA 1V8DA 1MEJA 2DKFA 4BGIA 1L0BA 3TMKA 4H0CA 1IY9A 5AVSA 5EWLB 4DCPA 3WAGA 3NTQA 3DFKA 2H4FA 3PZBA 2F8LA 3SVTA 3VZPA 4RA6B 3MBIA 2B4TO 2PXHA 2X2FA 1EVIA 3DLCA 5ALYA 5KHAA 1S9DA 2QU8A 2C59A 2ZTMA 5CRIA 4XCXA 5H82A 4ZZ2A 2X86A 1C1YA 3KJZA 3N0XA 1QYWA 1JEEA 1V7QA 1V2GA 2ATXA 1PBNA 5REQA 2BZSA 3SS8A 3WGMA 2UZAA 1P18A 4MQ6A 4PQGA 3C8DA 1RQ2A 3G49A 3A14A 2SECE 5AKGA 3U9LA 3BZUA 3SG0A 1KEVA 1QHYA 3HVKA 3C7KA 4YCMA 5HRUA 2GRUA 2K2WA 4LJSA 5GVRA 1X7DA 1VXRA 2O5VA 2V97A 2MSNA 1EUDB 1N75A 1SVOA 2ZYGA 3EWAA 1F8XA 4OAQA 3TRHA 3VXKA 4YRKA 1Y6GA 2IH4A 2JNWA 2C5EA 4PM4A 3KUCA 4M0LA 4QWWA 5CA1F 5FPKA 4LJRA 2O8BB 2IEGA 1FFEA 2PUCA 4RL4A 3V8VA 4CEHA 5AKYA 2ZVQX 4B3JA 1RKQA 4G56A 1U5BA 3OOJA 3KOXA 4EG1A 4MMYB 2FE1A 4JLPA 4M0CA 4QBIA 3D43A 2O3TA 4NR0A 2XB8A 3AR8A 2CUNA 5AW6A 1U0BB 4JP5A 1D2AA 2CLDX 3U44B 2H2IA 4EZBA 3RCBA 2AQHA 4LDQA 5AXCA 1VMAA 2BRUC 2VT7A 3FX2A 4KQMA 4RS4A 1ZO8A 1ZBQA 1L4NA 2EKBA 3EW9A 3T5TA 3KTDA 3HCRA 1EVZA 1MPXA 3W7VA 1F0NA 1RKVA 3BK2A 3D4BA 3CG0A 5E6UA 2FW7A 3AIIA 3QNWA 4EF6A 5HUQA 4GP9A 3H9GA 2ECKA 4TZ6A 1R6TA 3CUUA 2ZR7A 3LUDA 2CXPA 2VP2A 2ZZKA 4KFRA 4RPHA 4ZYVA 2VTEA 1KFBB 3T0FA 3MSXA 1SVSA 4AF7A 2YFQA 4N49A 4UM8B 5EJ9A 4RAQA 2Z58A 2CXOA 1TGYA 3OJEA 4JYCA 4EFKA 5L7TA 4MVCA 1VPDA 5GGXA 5J63A 4DILA 3GVCA 3FWYA 4DZZA 1E3IA 3MINB 4RELA 5B12A 2ERYA 3ZVLA 1SB9A 3LLCA 3RGWS 1YHZA 1H2AS 4IR7A 5H02A 3RVOA 2ZRBA 1XMSA 4KXNA 3AIKA 4LDRA 3HN7A 3DVRX 3FCOA 8ABPA 4JI6B 4Q9DA 4J6EA 6PFKA 1RACA 1KOFA 3KYBA 2ZTVA 1JSCA 3RJTA 1F5NA 3LDAA 1DXHA 1PWYE 4FLFA 4IBOA 4RQBA 1QHEA 2BGRA 1JTEA 1X86B 2FPPA 2QR2A 4GVXA 4JLWA 1BG6A 4NV3A 4FGJA 1E2HA 4L9AA 4TYYA 2XUGA 1NAHA 5JCJA 4ESEA 4XW2A 2ODWA 4RNDB 2BGTA 3SHOA 1W36D 4DMGA 4X92A 5AI6A 2MU1A 3HACA 3ZN2A 5FOUA 3UJ7A 1ZK3A 5FPHA 1N7IA 2F43A 5FLEX 1R9MA 1CZRA 4UUMA 5BWOA 2AOVA 3HCCA 4F45A 1LLCA 4UBIA 1L5MA 1ZNZA 2I67A 3GDOA 3N2YA 3A9VA 3OCCA 4KYVA 1GTRA 1B23P 1FQKA 2UV8A 2CEKA 3I76A 2ILVA 4NMMA 3NC4A 3T94A 3EYWA 3ED5A 3OCWA 2CNNA 2YMMA 1XRQA 4P4NA 1AD2A 4O08A 2D5AA 1WVIA 2A4KA 4JL5A 2BM8A 4ITRC 4LDNA 3TLXA 4NG5A 1LNQA 3QX8A 4O3FA 5FPSA 3KHUA 2HFJA 4IKPA 2OO3A 1X0VA 4O2AB 1CJKC 2I3DA 1CWUA 2I3ZA 3O3MB 4J90A 5NULA 2BFAA 4A0HA 3ANTA 1ZR4A 3IEUA 5CK5A 3HHPA 3EFEA 3LQQA 4OJTA 1H3NA 2XV1A 1DJPA 4Z53A 3DEYX 1PLJA 5D3ZA 2J85A 6GPBA 1OBFO 3D7RA 5FOSA 1IFXA 3RWMB 4LPKA 3OZBA 3OY7A 3R20A 3NORA 3NT5A 4P3XA 4ZQBA 3KR1A 1G2IA 3FPGA 3OJ0A 4H6WA 1P73A 2Q5FA 1DC6A 4TYQA 3H6HA 2WUVA 1TU3A 3HLTA 3RVNA 3G2NA 2VNAA 5IHPA 5EYPB 1DC7A 4JI0B 3ZJ4A 3RBZA 4XGKA 3D3NA 1F4PA 4M54A 5FA6A 2RH4A 2CHGA 2OD7A 5BV1A 1P9LA 3EA0A 3R3WA 1L5VA 2XUPA 5DMXA 3SI7A 3GFTA 3J7AC 1PZGA 4AY3A 1OCEA 1XZGA 2G0AA 4RK0A 3OECA 4OCZA 4P35A 3OLYA 3UG7A 3ASVA 3O4FA 4D26A 3LKVA 4NU6A 1ST2A 3WRVA 4QYTA 2F1RA 1Q16A 3V8MA 2H3EA 2DQZA 3TKYA 3VKFA 2GGSA 1RJDA 1JFLA 1KWKA 4LZOA 3BC1A 3W04A 2QK4A 3TSCA 4V03A 3H86A 3U62A 1D2HA 1A4IA 2B8EA 3ZEIA 3IMKA 4ILKA 4LHVA 4QELA 4D0GA 4BQEA 4YCSA 2YWGA 1FYWA 2YN0A 5IC6A 1UPAA 4AO7A 3RSGA 3OP1A 1KZ7B 3R1IA 3MJRA 3CKLA 3SGLA 2DSNA 4FEEA 3MT9A 4UDYX 4OQNA 3CLTD 4K2AA 2FY8A 5TX7A 2NV6A 5A04A 2W0MA 2FDRA 2QN8A 4S2UA 2EDAA 3QPUA 2V7WA 4C6TB 5JSHA 1JSXA 3L6UA 1W7AA 1C0IA 4REQB 3OZSA 2IQIA 3K7EA 2IYNA 4W7IA 3PQ5A 1TVKA 2GD2A 3OLVA 1UT6A 4G9EA 5LP6F 5CIQA 1OH5A 3EXEB 3V4OA 3X43A 4EY4A 3ORQA 2HMWA 3EOAI 5IWCA 4OQ4A 2F1JA 2VLBA 3BSSA 5CIWA 1YB2A 3CONA 5I4CA 2ZIZA 4BKUA 4NS4A 3G0HA 4OKNA 1JZSA 3V4LA 3WY9A 3LWBA 1YIAA 1RYEA 2FRVA 2YW2A 2Z3WA 1U7OA 3W9UA 1GT91 1NXPA 3DMPA 1S0UA 2BTOA 3CUVA 3H2ZA 2EFJA 3F74A 1B16A 2OGUA 1W29A 1PS8A 3CNLA 3MAAC 3UPTA 2P2YA 1NXTA 2XA1A 4QVKA 1WDLA 4TV9F 1D3AA 1Y9DA 2C94A 2N47A 2PQ6A 4XFJA 5IDYA 4BO6A 1UM9A 3F90A 4YX9A 3WSTA 5FD8A 1WY7A 1ZVKA 2GCOB 1Y1RA 2VRNA 2YVLA 3PQDA 3RSHA 4P7JA 5CLJA 1KEKA 3U60B 4DY6A 2ID4A 3DZCA 1DBQA 3BL5A 1M67A 4NARA 1OVGA 3R7SA 1YRHA 3R0IA 1FCJA 4XM2A 5EZYB 2EKDA 2HO4A 2ICAA 2Y71A 1L5QA 2NUPB 2R1UA 4YI5A 2J0SA 5THXA 4GPBA 3VR5H 2DCMA 3PUJA 3O2SB 3D8SA 4MCIA 3EQ8A 3D81A 3K31A 3OX3A 3AEZA 3S7ZA 4A6XA 4JYZA 3MMZA 4CLHA 4PPFA 4JGIA 5L3QA 3SFTA 1OYWA 3O8QB 1FUYB 3TLYA 4AS1A 2GEDA 3QBTA 4IH1A 4RGYA 3L77A 4Y2JA 5FTKA 3RPEA 1ISMA 1FJ2A 4QM6A 5A9TA 3CRZA 2R751 4B0PA 4B40A 1E2FA 1VL8A 1VA5A 1ZXLA 4EGQA 5K8CA 1L5RA 4L85A 1MDFA 4L1KA 1E18A 3MD0A 4G8DA 1YJQA 2NACA 2VJDA 3DAFA 4WA7A 5CURA 1NULA 3UUWA 4DS3A 5I7SA 4JA0A 3PE6A 4LYAA 3ES9A 5A1JA 5H4GA 4NHOA 3DQZA 3PXEA 4EB6B 3NOQA 1FFCA 3P97A 5FP0A 4ZVQA 4V1CA 3SXUB 2CNWA 1N9GB 2OG1A 5JMPA 4JN6B 5FDFA 3N8DA 1EJ0A 1DCKA 1A4RA 1QYIA 3DAPA 3HG7A 1KH1A 4GG1A 2X6QA 3ZJTA 3W5IA 4QBTA 2AZTA 3GNTA 2NOAA 3E4CA 5EKSA 5J2UF 1IBLB 2IOFA 4IZ6A 4JQCA 3O3NB 1XALA 2HMTA 2XQJA 1M0WA 4N5MA 4QOEA 5ALZA 7MHTA 3OZXA 2XZPA 1AK2A 2C57A 3CB2A 1H22A 2WKRA 3WWEA 1NJ6A 3NDBB 2W2VA 2WWXA 3I30X 1KJ9A 4ND7A 5CPFA 1H1LA 4B4UA 1FP7A 4BKOA 3PBKA 2A5JA 1R0LA 4X54A 4O2AA 3DJFA 1TJ5A 2ZUSA 3QITA 1P0FA 2XUFA 5JAMA 4YAGA 3H6KA 4MV5A 2WAXA 3BSWA 1NBOA 5SZKB 1I4EB 3PDJA 1CIVA 2Z3ZA 4ENUA 4BVGA 1QH0A 4M49A 3C98A 2ZUDA 1PJ8A 1P17A 4OYYA 4RA9A 3UN1A 4ZDIA 3OO0A 4HEHA 1P2DA 4TMYA 4JODA 3SK0A 1DKLA 3A11A 3HL4A 1FNCA 4TQUS 4EY7A 1IEWA 1OFIA 5FB3A 1NG1A 1SQ6A 1JI3A 1VHDA 3IPXA 4TXNA 5DFAA 1L9KA 1C9MA 4K9MA 1BS1A 5KJEA 3TQTA 5A4KA 2AK3A 1LPMA 4UULA 1O0BA 3PHHA 5EFOA 4GU5A 1OYOA 3DM9B 2ECQA 4MWZA 3UWOA 1G38A 3A1VA 2NVBA 4II7A 5B7QA 1YB6A 4F5YA 1K5PA 3M6LA 3U4IA 2Z8YM 2OXRA 1VB5A 5K5EA 1LRJA 3K4PA 1YZUA 2XNDD 2WSBA 4EECA 3UUGA 2OCYC 4BN0A 3GPLA 2HF2A 3AV0B 5ITVA 3WE7A 5ALPA 4U63A 2F48A 3VAAA 4CFZA 1TLTA 1JS1X 3GVIA 4JASB 4Q7MB 4HLQB 2FPSA 1XGKA 2CXHA 2FEAA 1YH3A 4QGGA 5IAOA 2YTZA 2QTHA 2D6FA 3NM5A 2DOKA 3IP5A 4NJEB 4G97A 4M98A 3RK4A 3MA0A 4ARAA 3O93A 2VPWA 3I04M 4HH0A 1I3MA 4W6QA 4LRQA 1EDEA 5EMNA 1DO0A 2GVDC 1C2YA 4WBNB 2QLMA 3MUFA 1J0XO 1ZKDA 4DWWA 3NOOA 3P9XA 2RC6A 4JWKA 5H1YA 2GZ1A 5ALEA 4YJDA 1JBEA 5CVUA 2GD1O 3AZOA 5LZ4A 2BH2A 2CD9A 3BBLA 2I2XB 2B83A 3QLTA 4WK4B 4GUDA 3ZG6A 1RQNA 3OMXA 2YRXA 2O4UX 4PGHA 4HGNA 1UQTA 4FSHA 4HNUA 5A6SB 3ICEA 1PK7A 2DE0X 3KQSA 3N39C 1TAUA 3KQTA 2PH3A 5FBLB 4RXTA 3RIXA 4CNBA 3H0KA 5DHAA 1FSGA 1AA9A 1B0UA 4JI2B 3X1WA 2XXAB 1YL6A 3FDJA 4XDGA 1Q5PA 5EMMA 2EATA 1E3DA 2X0DA 2VRCD 3H2SA 3VZSA 1KFCB 4GZ6A 1QP0A 2HQBA 1BRMA 3B9PA 1NT2A 4CHGA 4B3RB 5AKEA 3O83A 3A3NA 3K0EA 1H2ZA 2A92A 2FZEA 4HEJA 1AT1A 2Y1XA 3JQ6A 4OEHA 5TR9A 1RLOA 3KOZA 5A5VA 1LNSA 5A6SA 4Q39A 2CC2A 5IFLA 4QQKA 2WVGA 4KJZA 3IKVA 2PZAA 3HWX1 1GYPA 3IQZA 1GTMA 2H07A 3VJRA 2ATEA 2J3EA 1Z0JA 1I1NA 1JU9A 2PUJA 2OBXA 1C7IA 5FTWA 1KC3A 1RTTA 2QR3A 1OTXA 1W49A 4KVGA 1DAIA 1Q91A 5C18A 5C8YA 2CGEA 1R0WA 1I1HA 2CF5A 4FGLA 1FNNA 5J4VA 2BGGA 1L3CA 2HMAA 2PXAA 1X3LA 4QUDA 5DYWA 4A0RA 4OI0A 2JBAB 4YQFA 3TRDA 1P2BA 4E4RA 3G3EA 1RABA 3M4ZA 1NV8A 3HZOA 2OXCA 3JQ8A 1OIVA 2DEUA 3NQ41 1JX6A 2OD9A 2B99A 2QNRA 4L4XA 3U7IA 2LKCA 5AKLA 2VCHA 5EHQA 4AJHA 2P4HX 3IBSA 1BCRB 3AW8A 1FEZA 1LPOA 2W6IA 3SYLA 1ZS9A 1E77A 5A6VA 4JLUA 2YMPA 5FBQB 5GM2A 3QXCA 2G8LA 4RTMA 2PKEA 4G4JA 5FWXB 2QY9A 3PHBE 1I9CA 2O3RA 1DB3A 3P4UA 1POXA 2HUNA 5CTJA 2VH1A 4PVDA 4YP9A 1XVVA 1YB1A 4G5GA 1DIGA 2G36A 3HRIA 2ZTSA 1NJ8A 4LVCA 1JDVA 5DT9A 2JJ2D 4MWTA 3T7CA 3WIUA 3EXFB 2VEDA 3JARB 3LPMA 4IUDS 4N01A 3ZIAA 2Z9DA 1EUQA 3D3WA 4OHYA 1O2DA 1Z7EA 3BTSA 3LC1O 5KB3A 3CIFA 1G1AA 4K3UA 1HZZC 4NK4A 4QATA 2EZ8A 3RRYA 5KVVA 1BQEA 8AT1A 5HE9A 1SXJC 2VCEA 5I7UA 3UIEA 4OBEA 1WZCA 2GVZC 2V0GA 3Q87B 2H1SA 1NYTA 4BQFA 3WNQA 2QTZA 3L7LA 1SXJE 4X7MA 1EZ1A 1WW8A 2ORED 1YWGO 3T1YB 1G21E 1WSWA 2F17A 4L5JA 1NSYA 2NU9B 3WYFA 4DIUA 5DGTA 3ZJYA 5KC9A 1Y1QA 3QU4A 4WZBE 3M5CA 2NZUG 4HCJA 2WSIA 4I1OA 1TF2A 2FVXA 4PIVA 1KDYA 1BWSA 4J7XA 4PU0A 2BFCB 1ZUIA 2K2QB 3IP9A 5EE9A 2YZ7A 3O9MA 1RVV1 4WXRA 3UHFA 4DT1A 1KK2A 4J0JA 4Q01A 5BQOA 4RIEA 4D82A 1DINA 2QLBA 4N7JA 1I7SB 2D62A 2HX1A 1QHXA 2WIFA 2J0UB 3ZS8A 2CVQA 3PQ6A 3G9QA 4P86A 2RHTA 2JLXA 2D8AA 2YZ2A 2BIFA 2EBHX 3PUWA 3I8OA 1A97A 4FKBA 3BAFA 5DTJA 5PGMA 5B3JC 1MTOA 2CDBA 5JDIA 3WNCA 5CEEA 1Z6TA 3NO4A 2WZQA 1SO8A 2QA5A 5JAZA 4A5OA 1E9VA 1GR0A 2CLFB 1QJ4A 4ML3A 3TLGA 4AP9A 3E9NA 4Z5XA 3WIEA 5KWJA 4AI6A 1NVDA 4BFTA 1IXRC 1PT6A 3ILSA 5DHRA 4CEHB 2PFSA 1CYEA 3RVBA 5F23A 5BN3B 3ACBA 3IIJA 4WACA 2VZ0A 2PGLA 1PVOA 2HCFA 1XTJA 4CU5A 1ZGZA 4D4GA 1G8MA 2BEJA 2D1QA 2QUBA 2AMYA 3ORFA 4QL3A 2WILA 3QKTA 3RVLA 3EQ9A 4DREA 2ZB7A 5AVXA 2E3JA 5AKXA 1R6DA 1XZ8A 2ZE7A 4LKOA 1EIZA 1OPRA 1SKMA 4XDYA 3ZUGA 4C6SA 3TS1A 1X8XA 2IRWA 3NGXA 4ZOBA 3TZQA 1C30B 1Y6QA 2GM4A 4UM5A 4B6OA 4EEXA 2MSLA 1PGQA 1KETA 2QTAA 2W71A 3CPEA 1B8OA 4PGFA 2VFAA 3PEEA 1KE2A 4ZFNA 3DZIA 1R0SA 3QUSA 1N5OX 2VYQA 3TINA 3RRFA 4QJ3A 2FF5A 1FRNA 5B36A 4KPEC 4KO4S 3TR5A 3ZW9A 1R6UA 2LP4Y 2PUTA 1IY0A 3JZIA 1DCFA 4NEGA 1FDTA 1R5JA 1RQPA 1YQQA 3UAWA 2CV2A 5A4DA 4UEWA 3N53A 5EE0A 4B31A 3G79A 3GRAA 3HDJA 4H0NA 5DB4A 5FBVB 1YKSA 3GFFA 4FJ2A 1U6KA 3NHBA 1HTBA 4DUGA 1ZAKA 3L0BA 4DZRA 3H2KA 1AHHA 1ZESA 2XZOA 2A7QA 2PD3A 4QUGA 4G0OA 5A4FS 1HQDA 5LXTB 1SA0A 2NZYA 3CURA 4FNMA 1XVAA 4B45A 3HH8A 4W5HA 2NO5A 3ZOZA 4E09A 2DETA 4WVFA 2FMUA 5CVEA 5JQGA 1Z4MA 3U3KA 4BB0A 1N6HA 3O4VA 2PRYA 2QVZX 2IYWA 1YOBA 5HQ3A 1SC9A 4MIKA 2EP5A 2VBFA 3COWA 3MGAA 5CVDA 4CHTA 2UVDA 4DSNA 3B89A 3GZJA 5TQJA 4A91A 2QJRA 3A1UA 4QKQA 2AZXA 4OJNA 4EOGA 2PRJA 1V11A 1II8A 4YK7A 2H9YA 1FDWA 3FNGA 2VQDA 1O95C 4HT3B 4UVEA 2M6KA 3PA8A 4KQ9A 1T0IA 3FFAA 2CJXA 3LK6A 4PE5B 3JQ8B 5GZ3A 1U1IA 2NV2B 3IMEA 4UU7A 2F1IA 4I4TF 1INLA 8LDHA 5GONB 5I7OA 3UTCA 1DO2A 4HNGA 4C0SA 3FOEC 1XMJA 1YZVA 5KOJB 1QFZA 2MYTA 4NE9A 1KY5A 1BCRA 3M70A 5AOVA 3V3KA 3BH7A 4XYBA 3GT7A 3RFVA 2J46A 4YLGA 3ZNNA 4XB2A 5JNWA 4FGWA 1NBHA 5ECDA 3AI7A 4MS4B 4BAZA 3VRHA 5LD2B 4YMWA 1CKEA 4AMZA 4C01A 4KQJA 2ERCA 4LJ4A 4D79A 1N6LA 1A2OA 2ZWIA 1KMQA 2WE7A 2VZ9A 1SBYA 3UJHA 2W42A 2D4AA 2ONKA 2F2TA 5E8JA 6YASA 1RKUA 4TYWA 1I6WA 4KPUA 3MRSA 3PQ4A 4G67A 4KXWA 2QN2A 1M2OB 1T26A 4PTYA 4L4UA 2EQBA 2QRHA 4BUJA 1PHPA 2YY5A 4RSMA 4Z0HO 4R9NA 4Q12A 5EP4A 4R1OA 1G5HA 1W73A 1UXHA 2Z57A 4IIJF 1DKRA 1Y4AE 2O2DA 1GPKA 3HYTA 2R0QC 2EQ5A 2O5EA 5L3RA 3BD8A 2C78A 3ODGA 1LA2A 1WB6A 2I4MA 4US1R 4Z4GA 4IKOA 5AK6A 4I5IA 1TFRA 2QM0A 2COKA 2JCGA 5CBPA 3PC7A 2V1XA 3JCZA 3L84A 4MW0A 1JYSA 3QKUA 2B8NA 3H0CA 4PFQA 3N8IA 1HDOA 1U6IA 3A6HA 4YO7A 1QR6A 2FFQA 3EK2A 3PFFA 3SIPA 4RTKA 4WNAA 1CR6A 2B1RA 3H1FA 4RCZA 5M2QA 3L4BC 4F86A 1O03A 3DBLB 3EQZA 5DU2A 3IC5A 1OILA 3DWGA 5C4GB 3GCDA 4URVR 4FYHA 4DR4B 4MNTA 3LRXA 1AHPA 4PSCA 3T4PA 3KCNA 1TUBA 3LRPA 3F3YA 1YCHA 3PGKA 3ESCA 3O4HA 4BV8A 2BFPA 4EA9A 4H1TA 4LG1A 1FPMA 4JP3A 1J9EA 3MWEB 3TZHA 2Z2YA 5AW0A 1IB0A 4RGBA 1O8CA 1ACJA 1ZRHA 3EVTA 3PTAA 2KB0A 2H1OA 4HQKA 4GUAA 1FNMA 1PSZA 1TKRA 1ZD2P 3DBLA 4LXXA 1WA5A 4ROSA 4V0LA 2GILA 2AOXA 3D8NA 3DHVA 2R84A 4URUR 3RT1A 3QIVA 3MNFA 1UBLS 2ZIVB 2I1VB 3UPDA 1WDTA 4ZAXA 1X7GA 5I8ZA 1ENOA 1U0TA 2ENUA 5FUWA 3ZY6A 1TEZA 1XVUA 3K6SB 2ZJAA 3GLUA 5ABPA 2J31A 2P6MA 1PHRA 1QYXA 4IQ0A 3I3SR 2AW3A 2DTXA 2RGYA 2JIRA 1OYVA 2PZFA 2X4GA 4TQAA 5CFNA 4D81A 5AKHA 1VSQA 4OQYA 2POQX 4DQDA 1B3BA 5IYZA 1RDFA 5I5GA 2PJUA 1RAIA 4HZGA 1JV2B 2IHBA 3FTPA 4BQPA 3RAEC 1FX0B 1N8TA 1QDLB 5K8VA 1L5WA 2YVUA 3CRRA 3DLBA 3GA0A 2I6FA 3H16A 5AJYA 3R5HA 2QU7A 1D8AA 5FO0A 2OFOA 3ZWWA 4M9XA 4R2MA 4UU1A 2YIDA 3HUDA 3X3HA 3KUXA 4URWR 3H5NA 1RP1A 1UBEA 2GJ4A 3HXTA 4J0KA 3VI3B 1XPUA 3L8MA 3DPSA 1CVIA 1E61A 3BD6A 4U9HS 1TPYA 4FW8A 3KQYA 1F6DA 5K20A 4DQUA 4BV3A 1KJWA 4Q3NA 2E87A 1HUQA 1Q0SA 1H5QA 1HE1C 1WQ4A 1KXZA 2AFVA 4OMCA 3R5SA 1H6AA 2H1HA 2OGTA 2ZRLA 1MFPA 3KB1A 4M1SA 3JS5A 1CF4A 3BCSA 4QA9A 5AM1A 3KBOA 3I61A 1NI5A 2JCXA 3DHEA 1F1BA 1K66A 1IE3A 3EW7A 1GPJA 2NLOA 4KE9A 1TIPA 4OGKA 2B4QA 4RV5A 4M8LA 4XFDA 2B0JA 2NUBA 3D8TA 4COKA 1RHQA 3OF2A 4GI3A 1ETHA 3GPDG 1XPRA 2O06A 3A1FA 3U4GA 1GTZA 2ZW9A 1QP4A 2WJ4A 2GN6A 3RYFA 4H31A 2ZRIA 2G63A 1WDMA 1XA3A 3W6OA 4CYMA 1P2FA 2B25A 3OD1A 4NHEA 4Z1MD 4TYNA 5F9HA 5JQGB 5U9CA 3BHNA 3HJNA 4UCFA 2YV3A 1NIJA 1GP2A 1NXSA 1EVLA 4CQLA 4M0PA 2GJ8A 4I46A 5ALFA 3WDLA 2GERA 1P5HA 3DNMA 1NQVA 3FUTA 3NAMA 4GEGA 1KA9H 2VYVA 1WCYA 3BGIA 3UGKA 2Q4RA 1W5BA 5KMGB 4UD2A 3AW9A 3WP1B 1HDXA 1SC4A 5KZMB 2C88A 3I58A 2AR9A 5LBIA 3LTNC 3UOGA 1I51A 2PYZA 5IF3A 4TX1A 2P9TA 1N25A 4FOOA 1WE2A 4GP6A 5D7BA 3WWDA 3ADDA 1SD5A 4CWAA 3FPLA 4I55F 3RYHA 4BQNA 2VHCA 1QOPB 5JUWA 3LUGA 2O1XA 3QVVA 3K8QA 1LJUA 3PR1A 1XQ9A 2JAWA 3CPHA 3PUZA 1EHIA 1V4VA 1AB6A 5DTRA 2R6AA 1PZXA 5IM4F 1S9HA 2QPTA 5IVIA 1VKZA 3OU2A 4IUCS 4E4TA 1JU3A 3IL2A 3AERA 2GD6A 1RS0A 4YAJA 1NMZA 1ZUWA 4XIIA 4D5EA 2G67A 2IYTA 1YU6A 4JUIA 3TH5A 4RV9A 4XSHA 4A9AA 1YACA 2FP4B 2WKQA 4B4WA 4WUTA 1EDOA 3IA7A 4TVKA 5EINA 3AU8A 1DAFA 1SCAA 1XYGA 4OQFA 1GTG1 1NOKA 1EK2A 3ORRA 1F48A 1I0ZA 3EULA 3LT0A 4JDUA 1C7JA 1F2TB 3ZH9B 2D3WA 3IQFA 3GI1A 1BW9A 3ONWA 5LMUB 3UJ6A 1CR4A 1I80A 3GBVA 3L7YA 2ZGVA 2ID7A 1R66A 2F3QA 3VR6A 2CKMA 3OFND 3ZDEA 1J06A 3L6OO 2EX1A 3H13A 2R62A 2XLCA 3IJRA 3QE0A 3PVCA 1W35A 1MLDA 1YAJA 3WJ7A 3WWOA 2IOHA 1G0NA 5JALA 2V7VA 2XCLA 2G7ZA 4OHBA 5U4QA 1KDVA 3X0DA 4XQ9A 1BMDA 1H66A 3WR5A 2G04A 2BJWA 1H23A 2OP0A 3G2JA 1UBMS 4JL8A 4ZODA 5BNFA 1KOJA 1J2YA 3PEWA 2FUEA 2IYAA 3EVBA 4OBWA 2I66A 1EZZA 1NUTA 4JJ4A 2F4VB 5IDWA 1K88A 3IDAA 3EMDA 2IV3A 1YB7A 3PSHA 1JALA 3W5VA 1PUXA 1RQ7A 2AJLI 2HYIC 4XIFA 2QI9C 1UQUA 3B7WA 3QMWA 4KQGA 2WMNB 1EFCA 2WF6A 5ALQA 5CXSA 4KRGA 4AJLA 1YQEA 1V8PA 4DLAA 3I28A 1OLXA 3BWEA 1N8NA 3ESQA 1CUUA 3MGBA 4MHSA 4R1TA 3WYAA 2QR5A 4B6PA 5BP7A 1RYZA 4G1CA 1L1FA 2VHUA 5IT9A 5KNBD 3WA6A 2R5WA 3TQIA 3HJFA 2Z2XA 4IZHA 1R0XA 1B2RA 2DYKA 1ZOPA 3LCRA 3ONNA 3PGXA 3KCQA 1S3SA 5JSFA 2REXB 5CYPA 3K53A 3AUJB 3H7AA 1NNLA 2ZYUX 5E1OA 4YPFA 4XYLA 1KQNA 2PBLA 2VSXA 3B3QA 4Y1GA 2Z08A 1PQYA 1XELA 3JWGA 4RJKA 4R8LA 1E2IA 3C5HA 2JLCA 1OB2A 5LQMA 5EJMA 4Q0MA 1BS2A 1U0OC 2ZI3A 3CX4A 3RUPA 3GCZA 2JH8A 3OFSA 1ZH4A 1XHEA 3HJRA 1L3IA 5LP1A 3KWJA 1NP7A 4DG9A 2ZR9A 4MR9B 4OG2A 5EJ5A 4AD8A 4AKHA 5ALNA 4DC0A 4W1SA 1H2WA 2HA2A 3THYA 4DUYB 4U2BA 2QQFA 3Q5GA 1KI7A 3QQPA 4LV8B 1OT5A 2C7GA 4BNLA 4CQMB 3EXFA 2EFYA 4YAKA 4GS5A 3M1LA 3QHAA 4BS9A 3V7UA 1FYDA 4E5SA 1LC0A 1WMEA 3VDQA 3LCJA 3VC7A 5CA0A 4BECA 2FPIB 3LNTA 2E5FA 1TCBA 3AR5A 4G4GA 4I7EA 2VZEA 3FNQA 3GQBA 2GYYA 4PS0A 2JJ1D 4ASUD 1V3TA 4QDKA 1LI7A 1OAOC 1YIDA 2D5IA 4GSLA 3ZZMA 1A5SB 3I1IA 3G5MA 4IWYA 4TXLA 4LWOA 5IMSA 2RIRA 3DC7A 2V3CC 1P2GA 2PTGA 5JXHA 2J9RA 3KKNA 3BCRA 2DHDA 5DNVA 3ID6C 3NFYA 2J09A 1ZUD1 5BYJA 3F6BX 4KTVE 2FW8A 4PZDA 4JJGA 1VI5A 4RD6A 4B3SB 3VOSA 3AR6A 1OLUA 3KFXA 4OB8A 4A23A 5JARA 2LR0A 3ESXA 4EBFA 2FFJA 5LFAA 1QU2A 3DAOA 3BFPA 3EWNA 1XZPA 4NECA 2Q7OE 3DMGA 4CMIA 1D4AA 1CHNA 4C6RA 4BMPB 5TNXA 5DOVA 2F1OA 3L79A 3OJCA 2RBEA 2P35A 2UZIR 2VDRB 4RY9A 5BSUA 1YUMA 3W3AD 3JYPA 2I2DA 2TECE 3R8XA 5EIBD 3U7JA 5KYKA 2O8DA 1WM1A 1WMDA 1SU6A 1VKOA 4ENVA 1Y63A 3DB2A 4QRHA 3DFZA 1ODJA 3E03A 2F7SA 3P0FA 4CEJA 3C39A 1UWKA 3WGYA 2OQ2A 2PQ0A 3A26A 3LX5A 4N03A 4MRMB 1QF9A 1BH2A 2ORIA 3DSRA 1YTUA 2CD7A 4ZCIA 3PPIA 1C29B 2BHRA 4ZT6A 1JWLA 1GPWB 4A10A 1L5YA 1DC3A 3F7NA 3OE4A 3UAGA 2G72A 3ME5A 2XQIA 4KV9A 1DJOA 4WNYA 1BFDA 1S01A 1GV1A 2V55B 1E3WB 3P2OA 3E7WA 4L3OA 1DOHA 1P3DA 1TXGA 1DRJA 1HI9A 1OC2A 3GUCA 4FFOA 4MV0A 4PBSA 1RYHA 1ZJJA 1NXWA 3CLRC 1NMEA 2V45A 2WIDA 4QUBA 3OZWA 3RSZA 4A0QA 5CXUA 1VE3A 2O19A 2OAGA 5EQDA 4IOLA 5COBA 5H16A 5G1OA 3VVLA 1NVFA 1SRRA 4M76B 1VCNA 1RU3A 5LQKA 1ZK2A 3OJLA 5HXAA 1KIFA 2HJVA 4D9BA 2C84A 2J7PD 2REQA 1ZD1A 3IVGA 1X1AA 4YCLA 2EEZA 4F9GA 2GAFA 4RAOA 1U7WA 3EE6A 4D8XA 1XDGA 1A5ZA 2H3HA 4MUBA 1BQ4A 4UBKA 4RGVA 4D0SA 3MF4A 4EG5A 5H4HA 5K8JB 3JZAA 1Z47A 1UZLA 3V3TA 4R2LA 3E9YA 2WWWA 4RK4A 4LX8A 3ESRA 4HLNA 1F2UA 3AVYA 3H9CA 3NVKI 1R18A 4MQ4A 4MQUA 1YR8A 5K9ZA 1W52X 5EE5B 1UEXC 3W6NA 4ZHSA 5I47A 3FCUB 3AUAA 3AWIA 4PNZA 4BO4A 3M9LA 3O3CA 1XZMA 1O1YA 2WUWE 1HO3A 3DEAA 3PFKA 1BROA 2IS4A 2VC2B 3CC8A 2ZQ5A 4G5SA 1MV8A 3HKCB 2ZAGA 4RVCA 3QF7A 3WO0A 1NZDA 2I87A 2ODBA 4D1YA 1CSEE 4EUNA 1QQTA 1RI3A 2DQSA 3JATB 4JC8A 4MAFA 5JH7F 2FX5A 1EE9A 3E22B 3PGA1 4LK3A 2PIDA 2P77A 1MB2A 3W78A 4DSUA 2EFHB 1YFLA 1M1YB 1HRDA 2Q3BA 1GRRA 2J59A 3CS3A 3DJYA 1AOXA 1H5NA 1FSZA 1EB9A 3OE5A 2ZPAA 3HBMA 3LUPA 3FOCA 3HU3A 3R2JA 3HVUA 4HZIA 1NW6A 2H5JA 2ZSBA 1S3GA 1NW4A 3PTZA 2M9MA 1IQPA 1U0FA 2YJ5A 5ILGA 4B8WA 3LX8A 3ZDXB 2BF4A 1ZAYA 3RBAA 3ZQ6A 1O77A 3C8HA 1ZYUA 3T0GA 4X95A 3BMXA 5CDSA 4JROA 2GN2A 3CNQS 3PE4A 9GPBA 1C0LA 3ET5A 4EHJA 1WNFA 3AIMA 4OSPA 3VR2D 5ED4A 1ZJ6A 3O8OB 1XA0A 3LU1A 4QU8A 2F4NA 2VNHA 1KAEA 1UP4A 3F6PA 3QI2A 2FKAA 4W5WA 3S8EA 3WLPA 2R11A 4PWZA 4YYEA 3HCDA 4X5OA 1JE0A 1MJ5A 2D1YA 5BR1A 2GAJA 1OAKA 3T5BA 3P5BA 4KR7A 3FPCA 3AB7A 3KJXA 1I10A 3MB5A 4AF8A 4XB6B 2BMFA 4HDOB 1PD1A 3Q10A 4EVRA 3TR6A 3NX4A 3Q41A 2D5LA 4EJSA 5A5EA 5B7GA 4R3UC 1N3LA 3MOIA 1KRXA 2LNDA 3D0OA 3NM6B 4ZQGA 3VSAA 1AQYA 9ABPA 4I4CA 2XR1A 3EZFA 3GEDA 4IIUA 2ZCVA 3T3EA 1LDMA 2WLTA 1Z88A 2DLNA 2EX4A 4R9VA 2O7QA 2WLSA 2ZK7A 3BL8A 3OX4A 4Q4LA 2BTEA 1G3RA 3KYDA 4D9GA 2C96A 2ANBA 2X1MA 4ZT5A 4KR9A 4R8KA 4LSMA 1OMOA 4YXFA 5CNIA 1G42A 1W581 5JMWA 5HIAA 1Z6PA 4EL0A 3FBWA 4PLGA 2YMLA 1OLUB 1RZUA 1J09A 1C50A 1J90A 3CZ5A 3VAZA 4TM7A 3N9IA 5K3DA 5B1YA 5IVKA 2BFWA 5FOWA 4Q5IA 2PJRA 1NW5A 4JVOA 2VXCA 4RD4A 4P82A 1TVMA 2IPXA 3PDHA 2JLWA 3FNRA 2VEOA 1X2BA 2GOYA 5AT1A 4B6GA 1PNRA 3PPVA 3L1UA 4F9EA 1PGOA 2C4WA 4H9GA 3EB9A 2FUCA 4NU0A 3EZ6A 1ZCJA 3QFSA 2IBMA 4GKBA 4D6PA 1H2EA 1OVMA 3I83A 1AKQA 4B7ZA 4OTZA 2OWEA 2J3MA 3QPWA 4ZOAA 5CB8A 4Z4EA 1I4WA 1JR4A 1XRPA 1KAMA 1XNGA 5DTMA 4DJ5X 1H4QA 2NUAB 4ZVKA 5EIFA 4XWTA 3AR4A 4TLDA 1Z4NA 2FOLA 4BLOA 4U0JA 3ETEA 4CUZA 4YDQA 3R3YA 4P5PA 4A0GA 1H0SA 3PNKA 3C3MA 4Q1DA 4DR1B 1J22A 1Z6GA 2IPAB 4G0QA 2LV8A 1K2VN 1V11B 1Q0UA 5IJAA 5TXGA 4MAAA 2GH1A 3K0SA 3I32A 3N0TA 2KJQA 3F9IA 1KRWA 1KKMA 2ODPA 1XDWA 2AJBA 3HBLA 4CG1A 3PGMA 1Q19A 2XUQA 3LKBA 4FI3C 1E4OA 3H1AA 4YJHB 2CY0A 2WUFA 2YQ5A 3FB4A 3T35A 1LPNA 3DLAA 4TM8A 4G37A 1HQKA 3IKTA 4B8YA 5LUAA 3KSBC 2E82A 1RI2A 1N2GA 5DLDA 2V9CA 3A6PC 4Q4JA 2VDWA 4DTCA 1M0SA 1CIJA 1QYVA 1TC1A 1WXHA 2ODAA 3BMOB 5DBEX 3ZDDA 4MIEA 2PL1A 2RI6A 2RH9B 1JIQA 3EA4A 1X92A 3FFXA 3TXXA 1X7WB 3THRA 2CNDA 4YUVA 4OHPA 2BP7A 5ITZB 1QWOA 3BIWA 4XX0A 6NULA 1JVNA 4BDSA 3IOYA 1FYFA 5FLYA 2JLSA 5A3SA 1XD2A 1RPAA 1GQSA 1T1RA 4NLLA 2PKQO 3OEHA 2HQOA 4G09A 1MIOA 1MVNA 2N1MA 5I4KA 1NW9B 3LCCA 3PNMA 3GLTA 1LC3A 1F8YA 3AESB 5IKXA 4W5JA 5B58T 4FZ5A 4GPIB 3I2KA 3C7AA 3UY4A 2ZBDA 1HL7A 3BWMA 1T6ZA 4YRZA 3SF8A 3L1IA 4BHTA 1P3JA 4BVHA 5K0ZA 1YZKA 1DC5A 3K70C 1SOWA 3P94A 2PUFA 3PNVA 4OV6B 3FUVA 1N1GA 3HMKA 3WBJA 4RFLA 3IHLA 5DGXA 5GONA 3RK0A 5EKTA 5CK4A 2C2ZA 1KJNA 1UDBA 3ZZ0A 3TE6A 4MQEA 1VRVA 4ZAVA 4DCOA 5JJKA 2I7DA 2DJIA 2IUSA 4KCGA 3NWPA 3UXMA 2OQRA 4ZTUB 1EUCA 3HDGA 4C06A 2DFPA 3TJZA 3W5SA 1YR1A 1GPYA 1SURA 1II9A 2V4MA 1N0VC 3TUIC 2YY6A 3UWMA 1BAPA 4YHHB 4AFNA 3IVCA 3RJ9A 3T7DA 3NANA 4DEYA 1GZ6A 3OOYA 4QZVA 1JHDA 1J99A 1CY7A 1JG3A 2ZJ6A 3HI6A 4X45A 1Z83A 4P7FA 3VNUA 3AO0B 5AHKA 3VMMA 1G8PA 2DHQA 3TF5A 4BNYA 5DYNA 1CC1S 1L5FA 1XEWY 1WR8A 2DBVO 2YX1A 3A37A 4LTMA 5CCEA 3B3JA 1T5BA 4CN9A 2BHTA 2HSEA 5LL6P 4RZXA 3MUEA 1UMCA 3H4MA 2R68A 1RFLA 3TB6A 2H2GA 4HQRA 5JATA 4GR5A 2C9BA 1O5TA 1CUJA 2OM6A 3Q7PA 3HXLA 1XZNA 3IYLW 4W1RA 3WC4A 4N5HX 1OLXB 5EIHA 2X13A 4JJKA 4KLAA 2A0UA 4D4LA 3TNLA 1U3VA 2XMRA 2X7XA 2YC2C 3TBHA 3TM5A 3MCTA 4OXQA 5LYJA 2MT9A 4JJEA 4IDPA 1R4MA 5JD4A 1HYEA 1NX6A 3FHOA 3WB1A 1HTWA 4UTXA 3IT2A 3UKDA 4MV9A 4PX9A 2Q6OA 3KAPA 4AX4A 1C7QA 1HURA 2ZJZA 3IO3A 3PCTA 3SVLA 4FJ0A 4B47A 1E5DA 5HR5A 3JQBC 4IWNA 4JNCA 1RMTA 4OFWA 4XVQA 1SQ5A 3QWBA 3RUFA 4Q4DA 5B1EA 3BXPA 1FSFA 1DG1G 5L45A 4LY6A 1RSZA 2J4CA 3GAFA 3OH8A 3RD5A 1C7FA 1MHPA 3MGCA 3OEEA 1RLTA 1BC5A 2PUVA 2JW5A 4JXKA 2GBLA 3SC3A 4RJLA 5I4IA 1C4OA 2YXLA 3BCUA 1CHDA 2P11A 5G53C 4BTEA 2OOKA 3UT5A 3VO2A 4GOXA 3HEMA 2YINC 3CF4G 4QHTA 2GCEA 4O4JA 4LXTA 5HKKD 2Y1CA 3ROGA 2ZTHA 1QIHA 2RHJA 3OF3A 1WMSA 4D45A 1WXFA 1YS6A 4FYXA 4L5BA 1UKCA 2BE7A 2G06A 4P4TA 4X1YB 4F5ZA 3EPLA 3ZU6A 1MH1A 2KQUA 3BTVA 4O2BA 3OIVA 2YHSA 3NEPX 1F7UA 4BO9A 3EIXA 3SKVA 1JLRA 3JYQA 2B69A 1CY2A 1F4LA 2IXDA 5LQSA 3KQNA 4C7VA 2DQ4A 1GKUB 5LQJA 1DQYA 2NVUB 3C3XA 4OI1A 1RYYA 1DE0A 1K8ZB 1XDDA 3PCRB 4YECA 1Y5NA 2HA0A 5K3SA 3UH1A 3QX9A 1Q7TA 4CQNA 4YN3A 2YXDA 3IURA 2X19A 3HDYA 3L0IB 3R3JA 2VDOB 3CWZA 3TKAA 4LBWA 1WETA 2CV0A 3JQAA 3CEPB 1H9BA 3AY0A 2BI7A 2JFYA 3CVXA 1IOZA 1Z5WA 4FKZA 2REBA 3T1NA 1GZ7A 1BX3A 3LY7A 5JXJA 4R69A 2ETXA 3SHVA 4D44A 4KACA 3T38A 1XFDA 4V0ME 2NUTB 4Z86A 3GJ8A 2JL1A 4MKRA 5LMNB 2YZMA 4B35A 1Y3DE 1VE5A 1CDOA 2IU4A 1KIMA 1FOEB 4R7TA 3TLEA 3AG6A 3UAZA 4AJPA 4H3KB 1E58A 3EN0A 4G1UC 2NXJA 1DAHA 3LY5A 5FV7A 3NHFA 3IOMA 3ZGXA 4Q18A 1RQXA 1D4OA 3IBGA 2I4LA 2VIIA 4RHXA 1RC0A 4PIMA 3FW1A 1HMPA 3TG8A 3OP4A 3EIOA 4YRNA 2R60A 2O8CB 1PG0A 4PO3X 2IEAA 1MAUA 3NJ8A 3IJPA 4NBLA 2GFHA 3H1TA 4FYKA 3QFRA 3MQFA 3DTVA 1XR3A 2IUYA 3WIOA 1YZHA 4DNOA 3K96A 4QXQA 1J0CA 2YFKA 2G07A 4HK4A 5DXJA 4HLDA 3V1KA 1PR3A 4P4SA 1OXXK 4S0XA 2HGZA 1F2TA 3IUNA 4YRTA 4HSEA 3V7WA 1JQLB 1M54A 2ADOA 2O1WA 4IHKA 13PKA 3D6MA 1QF7A 1FK8A 1FP4A 1A69A 3HC7A 1ZD3A 3ETDA 4CLRB 2C2XA 2B4RO 4QJIA 1EFPB 1D07A 4UEJA 2ES4A 2WTNA 3QEAZ 1YR3A 2WAOA 1JA0A 1KNQA 4OXRA 4KIWA 4F3NA 4KITB 3M9XA 5BN5B 1HT3A 5K0BA 3I0NA 2VK1A 1J0DA 2CK3A 3AEQA 2PZGA 3LQYA 4NBTA 3EDOA 1J70A 3AEKA 2FLWA 3COSA 4B8ZA 2C4UA 2VJOA 5J5AA 4EI9A 3U4QB 4PN3A 1ZXXA 5J4YA 1GNQA 4E5YA 4HP8A 2UXBB 3C85A 4AU1A 4XEHA 2XNHA 3DVLA 2X5JO 1HE8B 2XPCA 3HVHA 2JBAA 3JAWA 1Y5IA 3SICE 5AR1A 4Q15A 1VTKA 4J94A 3T9CA 1C8VB 2KW5A 7YASA 3HK2A 1QIKA 1HNXB 2G7MC 4WECA 4NICA 4S0ZA 1A72A 2FPLA 4M0MA 3V2UA 1IZ9A 1XKXA 2AUNA 3KKQA 4ZPXA 5C7OO 1REQB 1UPBA 3G85A 3ROEA 4HN2A 4DDHA 1VLVA 4CEIA 1VRWA 2FN9A 3L1HA 1MX9A 4IXDA 4PPGA 4IXTA 1SG0A 5KNCD 1U2ZA 4RZSA 2ZRCA 3LPNA 4WCVA 3ZXUB 3QEOA 2VPQA 2OMEA 3IXMA 2ZXFA 3PHIA 2KLHA 4RGQA 4G41A 2RKOA 3SHFA 3TLKA 1RXSA 4K9NA 5BWCA 4OLAA 2QZJA 1G7RA 4DLUA 2BC9A 2ZB2A 2G5CA 3B1FA 1JNYA 1IHUA 1B14A 1ZCAA 3JATA 4C30A 1ISIA 3V1TC 1G4HA 2CW5A 1J56A 4LUCA 2VP3A 3FTDA 5EAIA 1M2KA 3EHDA 3NH9A 1WIWA 1CK4A 4HNAA 4C6HA 1F0KA 3C48A 5F64A 2F3SA 4WGGA 1U0GA 3NP9A 1GSIA 1LFAA 2R8BA 2V7GA 3AONB 5D5PA 3RU7A 1M5RA 2JS7A 1RE1A 3TL3A 5B2FA 5DJ5A 2BR4A 2FSPA 3G7NA 4KN6A 4M4SA 2WJJA 2NPIA 3WNBA 2GBGA 3EUFA 3ON5A 5KYWB 2IYRA 1D04A 5I7WA 2EP7A 4QD3A 2NO7A 5IJ9A 4EPRA 1EAMA 5JANA 4DBZA 3OQOA 3FVWA 1E0SA 2GHTA 4D46A 4OL0A 3NVMB 3KSZO 4AXXA 3K9QO 5JO0A 3GGGA 1C3LA 4EARA 5LU8A 1ICEA 1E63A 1EFRA 3R7BA 1PS0A 1K5HA 2HSZA 1ISHA 3A6JA 1Z13A 3KEOA 4LYHA 1J39A 1UH5A 3ESBA 4LX0A 5K8LA 2YXPX 4RKFA 1Q44A 1DEAA 2GJSA 3BJEA 4XPIB 5K1ZA 4ALLA 1ESNA 2HDHA 4NATA 4RVNA 4RWZA 5JMOA 4ENQA 1X1TA 2FPGB 3V1MA 5KYWA 5JAOA 4JI5B 4WCFC 3DWIA 4E6EA 5GAJA 3LPCA 4MKZA 4NMXB 4OM8A 1X8KA 3WMFA 4J1SA 4EJSC 1E6WA 2OCGA 2QPAA 4IS2A 1D7OA 3SXPA 5ECGC 1T13A 4IFTA 2ZATA 1XDUA 3UK6A 3RTGA 4ENRA 4E3WA 5ALGA 5EP2A 3NHZA 1UXKA 1T1EA 1ZVQA 2Y6VA 3EEFA 3MELA 3N74A 2W6NA 4RD3A 3HDHA 1UF9A 5EQJB 1Q7BA 3H05A 2UYQA 4CG0A 4C07A 5IAGA 1YKFA 5JJLA 3TUJC 5KTSA 3UWDA 3UB4A 2PU5A 1UBKS 1D1SA 3T4UA 1UP7A 2P2NA 2FUG6 1Q21A 4IGKA 2VDJA 1J23A 1DXQA 1VPVA 1UK6A 2RBKA 1JLSA 4GWKA 4D6YA 3M6UA 4Q93A 5KEIA 3E35A 1L1QA 3I4CA 3ZPXA 1DXYA 4OLHA 1OX5A 2QW1A 4MJ7A 4DIOA 5B3LA 1ORVA 1SC3A 3WL5A 4ZEXA 3Q15C 1J24A 3ZGLA 2Q4OA 1RVDA 1BYIA 4R1QA 1AO3A 4XOUA 3FZNA 4RZIA 4YWJA 3F0TA 3LGXA 2UZ1B 5I9MA 5B5SA 1IN8A 4J0EA 2Z98A 4FMBB 4F6CA 2O20A 2AD5A 1SVNA 3NNDA 3PFGA 4JIGA 3ETLA 2D06A 2EFCB 2EFGA 4PAMA 4RLHA 4C3ZA 5IWAB 2JGIA 3NWJA 1O94D 1EM8A 4M86A 3EFHA 4MVJF 4LZPA 1N2OA 3TZ6A 2QSUA 5DEIA 1ZNWA 4DV4B 1UZUA 2Q2QA 2ZS8A 3D7NA 3DW1X 3JD1A 4NJMA 2G8NA 3HA3A 1P2SA 1DRKA 2B7BA 1CUZA 2EBUA 2JDID 3B1KA 1TB4A 5EWLA 3SY8A 4IMJB 4R5MA 2MINB 3L06A 2NYRA 4IFEA 4JUBA 4ZVNA 1MZPA 3WLOA 1GNSA 1ONSA 1T35A 2HU7A 2XMGA 2QTNA 4FONA 3RS0A 5G4KB 5AHWA 1IC6A 3CT6A 1VI6A 5K2MA 1D2RA 4F1KA 1BFUA 1LI4A 2O2HA 2IQ5A 1NC1A 3QXXA 3VNAA 4EBBA 3P9SA 5JLJA 1KI4A 2QBYB 2ZEJA 5D01A 1EM8B 2OHGA 3C24A 1AMNA 2CSUA 2WD7A 1O3YA 1ODCA 3ILXA 4PZCA 4DGSA 2BTQA 1FYVA 1I24A 2GA8A 3GRPA 2D7CA 3GZNB 3GVXA 1SNYA 4BWFB 1FNBA 5EIEA 4GICA 2H11A 2C5AA 1OXKB 1FJHA 2E21A 1GU0A 1OD6A 1C3JA 1DV1A 2DSTA 4RX1A 4F2DA 1QTIA 1RLIA 4UHKA 1IOVA 4EPTA 4RTRA 3Q6MA 5ERGB 4OA5A 1O95A 1U0SY 5DM0A 3RLFA 1ML4A 5GJBA 3WL4A 2VTVA 1X3SA 2VHJA 4P58A 4JLDA 4EDFA 2X8AA 5J40A 4AVYA 3KLPX 3HB0A 5ILOA 4FMCF 4L6IA 5E7QA 2FSGA 1EPUA 1DWUA 4EY3A 5L53A 1KI9A 4MW7A 1GWNA 2QMZA 3UJ3X 1P0PA 1U9IA 2OO7A 2PLNA 2X4IA 4R8SA 2FF7A 3ZV5A 3EUAA 4DXAA 4QULA 3S2EA 5BWLA 1A04A 2MR5A 3JQGA 3KZOA 3ADBA 2ZRJA 3DFMA 2PUBA 1SCUB 2H7XA 4RJJA 4P3YA 3GDHA 3KV1A 1GCUA 5IKEA 1EGVB 2REQB 3GJ6A 5KDDA 1ZD5A 2G83A 1PQUA 2A35A 2GN4A 2IZOA 3EVCA 2YN2A 1CW2B 3NR2A 1JDBC 1UDRA 4N4AA 4CMAA 4EW6A 1H9AA 2QJWA 1PNQA 3FXAA 2OAQ1 3MWDB 3SZ3A 1T4DA 3DXXA 1CNMA 1SUAA 4PLZA 1CYDA 2R7AA 4MSUA 3ZHBA 1ESCA 3H2IA 2NYUA 1AQIA 3I5AA 4BLSA 2XDQA 4HZUB 3ZWBA 2HQSA 2XGGA 3G7SA 1SCUA 2QP9X 1QKIA 2VUHB 1UM9B 3GROA 4OXNA 3VV2A 1M0EA 1USWA 2Q5IA 3D8HA 3ANLA 1FTNA 1U0LA 3GVHA 4Z3DA 4CM6A 1AKNA 2O1SA 3N7AA 5EMLA 4H1VA 3RBVA 3RT9A 3TEFA 4CVNA 3VPAA 2GEUA 2JGKA 2YUTA 4MARA 4YRDA 4ZHQF 4JR0A 5K05A 1VMEA 1CJSA 2C82A 5LDGA 4F46A 1YR2A 1NN0A 2B7LA 4PRYA 3FLEA 2ZM5A 1OH6A 2DWCA 1J1UA 3CHYA 3DAHA 2C4MA 2QN3A 4RZ2A 4A36A 3DT9A 3RTEA 5EWMB 1THMA 3G17A 3AKZA 3TD6A 4LNUA 4ARUA 4CV1A 3PJDA 3MMXA 2FV8A 2JD2A 5K4HA 5LSAA 1LZKA 4DMHA 4IINA 4KUEA 4LC1A 1J2RA 1GZDA 2Q6LA 4E7PA 1E3SA 1WLYA 2DPMA 3CU5A 4FD2A 4MVJD 3CT4A 5F4BA 4FHZA 2EF0A 2QTRA 5AESA 5ES4B 4IG4A 3IQGX 1WMBA 2REOA 3PXDA 1LVGA 3JYNA 4A73A 1JDZA 4IIEA 1WXXA 5KX5A 3FGPA 2AJTA 1DEKA 2Q5EA 4BP3A 4JI8B 4H2DA 4GAEA 3EUWA 5KQPA 1U7XA 3MTEA 3OQ6A 1Y1KE 2JC3A 4QUEA 1L4GA 1JJBA 3CRMA 5LNK6 4FD3A 1V2HE 1E2LA 1V7CA 1XC7A 3BWDD 4X41A 4FCCA 4UTOA 1HYBA 2C7RA 3A4YA 3EEYA 4OFXA 1BXKA 3FSGD 5LLSA 3SQNA 1MBZA 2RGUA 1YQTA 3IMCA 3OKCA 4P0TA 4AYTA 1GDTA 1N6KA 4X90A 4Z9AA 1PW7A 4Q66C 1J20A 3EGXB 4IJVA 3GEPA 2PL9A 4M1MA 3LD9A 3D4OA 1DIOB 4OQZA 5JBQA 1PFWA 5B57C 5L4LA 4BB9A 4HHEA 5IABA 3L4KA 1GKKA 1SXJA 3N0WA 1SQFA 4KGDA 4LE1A 2A78A 1L5GB 3Q0TA 3AVUA 3TX2A 3EC1A 2J6HA 1SUIA 1NVVQ 1HE4A 2PH5A 1QFYA 1L5NA 2FQ1A 2GF0A 4LMPA 1TZCA 2J30A 1L8AA 5J2UA 3EXHB 4JLJA 5EPOA 5LYJB 3G0BA 4TTQA 2PTHA 3UHPA 3I2FA 5FI5A 3AY3A 2LIPA 3GR6A 3JD4A 4Q7KA 1L7VC 4BLWA 4CM7A 3R0VA 2V6BA 5EHXA 1KKLA 1XEAA 4AM8A 3CNNA 1BKSB 3LOUA 2BKLA 3VQTA 2HWWA 4L78A 3VV3A 2W58A 4ZDKA 3TVTA 4YMUA 2ZJ5A 1N5JA 4PGAA 4AUEA 1VE9A 2JCVA 1V3UA 3EF0A 4OHUA 5TEVA 4BN4A 3I6BA 4F3CA 1XCGB 4QQ8A 1GGNA 4Y30A 3MWJA 2WE8A 3H9UA 3BQMB 3OTIA 1T8SA 1ZSYA 1SH7A 1V4BA 2N75A 1SZJG 1IAVA 3JQFC 4CKZA 2Q45A 1AN0A 2FPIA 2JGAA 4L5IA 4Y6GB 3ZD9A 1C3XA 1FFAA 1BX1A 3IP3A 2BJVA 4A16A 1U63A 3R3XA 4AO8A 3SSOA 4QDUA 2WYVA 4BU1A 1MABB 4TL6A 3KHSA 1G7CA 3IP1A 5FA5A 5L9AA 2X6TA 3RARA 5LQDA 3UT0A 3FTQA 1H42A 3QEMA 1OHHD 1UL1X 3JQPA 4OFZA 4X85A 4XUDA 4ZXPA 2JG3A 5HIIA 1V16A 1I14A 2YL2A 1NBEA 2EG5A 5LQNA 1ULTA 3KZVA 2I6TA 4N1AA 2I4TA 1ZMBA 1IDOA 3FJOA 5AJUA 2NADA 3HJBA