2QVBA

Crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
296
Chain Sequence
b'FGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSAAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase 3
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
publication title X-ray crystal structure of Mycobacterium tuberculosis haloalkane dehalogenase Rv2579.
pubmed doi rcsb
total genus 113
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qvbA00
2JEZA 3G02A 3UUEA 3KOOA 5JD5A 1GKKA 1WB5A 4CFSA 5KWJA 5CT9A 3LCRA 2WIKA 4XX1A 5AM1A 2VF2A 3D2AA 4X93A 2H7YA 3V1KA 5CURA 1MNAA 4B0OA 4FLEA 3RKSA 4RGYA 7YASA 2P8SA 4DGQA 2VATA 3SC2A 3HI4A 5ALGA 1EX9A 3O95A 1B6GA 1N5MA 1UWCA 5AOBA 1UT6A 2ZYSA 4BCDA 5I8PA 4BVJA 4EY5A 5LP1A 1T4MA 4G9EA 2GBFA 1CUHA 5I9IA 2Y2UA 5CRIA 2Y6UA 4Y2UA 2HU8A 3IUNA 3F9CA 3K6KA 3FLEA 4BE4A 2QXTA 2EDAA 1QIFA 1R3DA 3FYUA 4AN0A 3WKBA 4FOLA 3IUMA 2JF0A 4QDZA 4J0IA 3FSGD 4AO7A 5T4FA 2UZ0A 3I2GA 5BWBA 5JATA 1J1IA 1RYYA 3B12A 4J0GA 5JZSA 2YYSA 4B0PA 5ALNA 4NS4A 1XZCA 2QMQA 5DYWA 1ZI9A 3LP5A 5IKXA 4ZXFA 4ZV9A 2WQZA 5DNWA 3I2FA 1SOMA 5IVIA 3ZV7A 2IX9A 3OG9A 2WHRA 4ZV7A 4KE8A 1C7JA 4LKOA 1ZI8A 2OQVA 3V1MA 3FNBA 4EY8A 3SK0A 3EBLA 4HTAA 3STVA 4DTCA 3CCBA 1N8SA 2CKMA 2HDWA 3GFFA 1IVYA 4GI1A 1H23A 2XB6A 4FNMA 5AOAA 1VLQA 5LIPA 4C88A 1QIKA 5E4YA 3HJUA 2GYVA 1QONA 3OTQA 1R9NA 4RPCA 4E11A 3I1IA 1WHTA 1XRPA 4QLAA 2WKWA 1J07A 1YA4A 4H0CA 3SX4A 4W63A 3VVLA 3A2MA 2EDCA 3AJAA 4DYHA 5FLKA 3WKDA 1YB7A 4ZGBA 1EDDA 1ZIXA 1BEZA 3T4UA 1WB4A 4DNQA 4J03A 3C8HA 4G4JA 5EIEA 1CR6A 1AKNA 1IUNA 2XQGA 2BAGA 4CI9A 1MAHA 4X6XA 5LKRA 4F60A 3QM1A 2PM8A 2VT6A 2DSNA 4BVKA 1VJ5A 1J2EA 4IO0A 1PJAA 3L1JA 4PF1A 4TPKA 4UBNA 2Z8ZA 3QMVA 4IH1A 2VJBA 1ZD3A 3K9BA 3D2CA 2WG1A 3H1AA 3HABA 4EY6A 4PO3X 2HL6A 4WFJA 1Q0RA 2WFZA 3BXPA 3FSGA 5ALXA 3S2ZA 5AK3A 3WKEA 4XIIA 1TIBA 2QVBA 3O4JA 2OGTA 4A16A 1DX4A 4J0DA 2PSJA 4HRXA 1LBTA 6YASA 3KDAA 2OG1A 1QO9A 1CQZA 5H3HA 3MVEA 3VDXA 3F97A 4FFWA 4C4YA 2PSEA 2WJ6A 2J4CA 5AM5A 2XT0A 3I1YA 2BCEA 1EB8A 3C70A 4BDSA 4UBIA 1LPOA 3KWFA 3GBSA 1XZLA 1BCRA 1QLWA 5JALA 2H7XA 4CG2A 2PUHA 4W1PA 3N2ZB 1OCEA 1E8MA 1QO7A 2XMRA 3WL7A 4KACA 4DNPA 1XZIA 2XUJA 4HS9A 1N1MA 3LIPA 1E5TA 3DL7A 4PSDA 3IDAA 3JYHA 4B7ZA 1BU8A 4H7IA 5C8ZA 1OILA 2WJ4A 5AM4A 3WA7A 1ZD4A 4YX9A 2JEYA 5EHZA 2PSFA 2W22A 3DL4A 2OLEA 3ZLTA 3N0TA 3K2IA 3D0KA 3WYDA 4OYLA 4E15A 4MYSA 1TCCA 5FP0A 3DYIA 4C6HA 2OQIA 1QOZA 4FNGA 4JYPA 1YSCA 1IZ8A 1E66A 3T52A 4X91A 5HZGA 1JJIA 1MPXA 3MUNA 1Z68A 2XI4A 4B82A 1EINA 4Q05A 4LYEA 3LIIA 3L1HA 4AN1A 2Z8XA 1F0PA 4L0CA 4BC1A 3E3AA 4RE5A 2XUFA 3AIMA 1QFMA 3FCXA 3AFIA 4EHBA 4LXHA 5K3FA 4QZVA 4Y2XA 3TEJA 3H2JA 3VJMA 2HADA 1ZJ5A 2FUKA 1MTZA 3F8SA 5AM2A 3A2NA 1XZMA 4X00A 4F5ZA 4Q82A 2HFJA 2IITA 3FOBA 1UK6A 2H7CA 3I28A 3GA7A 3I2IA 4UFOA 5ALPA 3UUFA 2HRQA 3BIWA 2BKLA 5ALEA 4X92A 4KYVA 2BGRA 1G4HA 1ORVA 3G9TA 4G8CA 2XLCA 2C4HA 1AGYA 1Y37A 5AKLA 3EF3A 1WHSA 5C8XA 3WWPA 3C87A 1CFJA 5A71A 4C89A 5CT6A 4EBBA 1H2ZA 1LGYA 1ETHA 4WY8A 1TCBA 1LZLA 3CN7A 2ECFA 3V1NA 3C5WP 5T4BA 5E2IA 5E4JA 1G66A 2JGMA 3HZOA 3V48A 4F21A 5AI0A 2HA2A 5A7FA 5FXMA 4BRSA 2DHEA 2WTNA 5A2GA 4HXGA 5AK4A 1Q83A 2WHPB 4KRYA 4B6GA 3HSSA 4MJ3A 4NVRA 2XQIA 1GKLA 4H7HA 3Q8WA 2HHAA 3ICWA 3PICA 1RWQA 1UOOA 3H2IA 2GZSA 3WIBA 1HKHA 4GBGA 4FDMA 5IVDA 1MNQA 1UK7A 2VJDA 4KJXA 5JAHA 5ALVA 3H2GA 4GW3A 4BCCA 2QM0A 2WFMA 2HFKA 2PUJA 3STXA 1LPAB 2B20A 4QLOA 2XUKA 4BBZA 3BE8A 2XUAA 2PSDA 1LPNA 4JEIA 4GDMA 4DNFA 1YCDA 5F4ZA 4QDOA 4W1QA 2VTVA 5A6VA 1LLFA 5JASA 4K6KA 1HL7A 1SFRA 5ALYA 4WFIA 1QIIA 3D5EA 4IHAA 4X97A 3GZJA 4H35A 4W1RA 5AHXA 3C6XA 1BROA 4BZZA 1MU0A 4GECA 4GHWA 3G0IA 5SYNA 2ACKA 1H22A 1DU4A 4X90A 2B61A 5IVHA 4FKBA 3JWEA 3HC7A 5DYYA 1ODSA 1XLWA 1NX9A 4G5XA 1C4XA 2PBLA 4UHEA 1BN6A 4U2CA 4AMYA 1KU6A 2WG2A 3DJYA 1HBJA 2PPLA 4J3JA 1JU4A 4S0XA 3WZMA 1DTEA 1CUXA 4I3FA 1HDEA 3D7RA 1VA5A 3DOIA 2OCLA 1MX9A 3DNMA 4BYMA 5ALTA 3R3UA 4B9EA 3R41A 4D9JA 3WJ1A 3AZQA 3O9VA 3G9UA 4Y2YA 5DJ5A 2VSQA 2K2QB 1EI9A 1D07A 1QIDA 1AUOA 2WJ3A 1YASA 5DTIA 1XZEA 1TAHA 2CEKA 3M81A 2XMDA 3S8YA 2WU3A 1HLGA 1CUWA 1W6RA 1U4NA 2WIGA 3DDUA 4OD0A 2I3DA 1VE7A 3BF8A 1YB6A 5EIAA 2GYWA 3YASA 1BCSA 1P0QA 5CT4A 5T4EA 4B81A 3H0CA 2PU7A 4EA6A 3R3WA 3R3YA 3ANTA 2QT9A 3C5VA 4OB7A 1XLUA 3DQZA 4MEBA 1FFEA 1A8QA 1LBSA 2DHDA 5ALOA 2V9ZA 1FFAA 3W04A 4X7BA 1UZAA 4CIAA 1AX9A 1WOMA 4CCYB 4M0FA 4PNZA 3FYUB 3PUHA 2G4LA 3FAKA 3H04A 4K5QA 1HPLA 4J7AA 1DQYA 3MUOA 3H2KA 5FPPA 5JAOA 5J3JA 5K3AA 4OB8A 3STWA 2XMZA 3I6MA 5CXUA 1P0PA 1EB9A 1E8NA 1DX6A 3OOSA 4WY5A 1JKMA 1TCAA 3QZUA 4AQDA 5K3CA 1JI3A 4QDXA 1LZKA 3DKRA 5EHXA 5AKEA 1ODCA 5LZ7A 1VA4A 4M0EA 1DWPA 3ESCA 1OXMA 4GEGA 2WILA 3HLKA 3O9MA 2HIHA 5K3EA 4ZI5A 4NZZA 2PVSA 4DMHA 5AP9A 1XRNA 2R8BA 3UMJA 1UK9A 1QGED 5ALFA 1EH5A 1E8DA 2PKYX 1G42A 1L7AA 5CTAA 4FMPA 4U2FA 1XZAA 3KD2A 4X6YA 5YASA 3C6YA 4XJVA 1ZGCA 4H7DA 4CCYA 1CUUA 2JGFA 2QS9A 1UKBA 4H7EA 2QJWA 3ESAA 3B3QA 5K3DA 5AI5A 4IH9A 2BFNA 1DQZA 1QJ4A 2ES4A 2ORYA 5ALMA 1QIHA 1XFDA 1CUJA 2C0PA 5JZBA 3F96A 3F98A 4A5SA 1XQXA 1UOPA 4YPVA 3WQHA 5FDFA 3R3VA 2ZSIA 4BAGA 4PW0A 5ALQA 5ALLA 3WL8A 3FBWA 2XUPA 1X2BA 4WDQA 2XQJA 4GXNA 3BL8A 4L72A 2QKYA 4MQMA 3NWOA 4X85A 4ITVA 1JJBA 2WHQA 3GELA 1YA8A 5ALHA 4Y2JA 2WIJA 2V96A 5FKJA 4YASA 5BWCA 1QIJA 5ALUA 3GROA 1SCKA 2RGUA 4CIBA 5ESRA 4HXEB 4FLFA 2RONA 2HM7A 1GT6A 1VXRA 1XZBA 3FYUC 3F67A 3AIKA 3E1GA 2OCIA 5HF9A 3IBTA 4FBLA 2X5XA 2AJLI 2OAGA 2XLBA 5FOQA 1F8UA 4QWWA 4K6GA 5EHNA 3KSRA 2ZJFA 1U2EA 3OC0A 4TVKA 4L3WA 2ONCA 4EY7A 2GYUA 2GBGA 4ARBA 1R88A 3ED1A 1K4YA 3BWXA 4H7JA 3PFBA 2BGNA 2FJPA 1GPNA 2CZQA 3WL5A 3QYJA 4EY4A 1TRHA 5IVKA 2XQKA 3H17A 3QMWA 5LZ4A 4MWTA 4FFVA 1M33A 3WK5A 4FTWA 1QIEA 1JT2A 4BTLA 1K5PA 5AI4A 4UHCA 4J0CA 1MT3A 1YAJA 1LPBB 2V97A 4J0JA 3PF9A 5KREA 1VZ2A 3FCYA 4BVLA 1PFQA 1GXSA 4N5HX 3L1IA 3O4IA 2WU4A 2G5PA 1R9MA 2ROQA 3QBJA 3QH4A 4G4GA 3W9BA 4DNOA 3DLTA 1CUSA 4KAJA 5DNUA 2BUBA 2ZYRA 2C0QA 5JD6A 2ZJ7A 2DR0A 3WKCA 3R0VA 2DFPA 4FWBA 2WSLA 5D6OA 4LXGA 4Y2QA 2X8BA 4N8SA 2DCMA 1XRRA 3H18A 4E46A 4QNNA 4UBKA 3I6YA 2HU5A 4AX4A 1BRTA 4MQLA 5LZ2A 3BIXA 4JH0A 4CG1A 5AKKA 4UFPA 5A7HA 3U0VA 1XLVA 1CQWA 3G8YA 1AQLA 1CVLA 5ALKA 1DWQA 1G5FA 4RE6A 5AM3A 4AXBA 5AKYA 3BDVA 4X3CA 3D2BA 5I7UA 1CUDA 1UFOA 5LKAA 1USWA 2WFLA 1LPMA 1K8QA 1A88A 1K6EA 3STUA 3QVMA 2D5LA 4JNCA 5CBKA 4Q3KA 1MAAA 3TRDA 4B85A 5LZ5A 4L9AA 5JARA 2C5FA 3CN9A 4UBOA 3WI7A 1C7IA 3FWHA 3WA6A 4MWSA 2C7BA 4QE3A 2Z3ZA 2XMQA 4MYDA 3I2KA 4Y2TA 1BN7A 4B83A 4EB0A 2WUGA 1CV2A 1MJ5A 2D0DA 3R3XA 5CW2A 5FUMA 2AJBA 2BUCA 5HCUA 4HVTA 5JYCA 3AILA 1ZJ4A 4B9AA 3FLAA 2O7VA 1ZIYA 4ZWNA 1W4LA 3P2MA 3OPMA 4X94A 2O7RA 2WUEA 2VEOA 5AK5A 4CCWA 1ZICA 4Y2PA 5FRDA 3ANSA 3WKAA 3ESDA 5JAUA 1H2YA 1R1DA 4HAIA 5KWIA 4UBJA 3W2TA 2YXPX 3ZWQA 5K3FB 2VA9A 2HU7A 1GZ7A 2HA3A 1UKAA 3C6ZA 4BE9A 1IUPA 4Y2SA 2I03A 3WK4A 3STYA 2PL5A 3EQ9A 1CPYA 3QITA 4LIPD 1Y7IA 1MX1A 1WB6A 3AINA 4QWMA 2CB9A 4AO6A 2WUDA 4GLBA 5JIBA 3RM3A 4OUKX 1THTA 5DWDA 5JANA 1ODTC 1X2EA 1DINA 3WJ2A 2I78A 1W75A 3AIOA 3PFCA 4EZIA 1ORWA 2QRUA 3I2JA 1ZD2P 1WM1A 5BOVA 1XQYA 4PSUA 1KU0A 4KE7A 4BP9A 2ZSHA 3WK9A 1UKCA 3O4HA 2JGJA 2XUIA 1E3QA 4H7KA 5FV4A 1RP1A 4Q34A 4KR0A 4BRZA 3SWWA 4MEAA 4BZWA 1XZGA 2HRRA 3IULA 3QMMA 1XKTA 1VXOA 2WIDA 2AJ8A 5AKIA 4DMCA 3BJRA 2AJDA 1CUIA 5AKJA 1ZD5A 2G63A 4IQ4A 4BB0A 5EGNA 1VKHA 3DYVA 4H77A 2AJCA 4BDTA 3ESBA 4O08A 4LXIA 1CRLA 1YS1X 4PQEA 4OU5A 4G9GA 5AM0A 1TKRA 2W6CX 2H1IA 1L7RA 3EIOA 1WPRA 3FVTA 4AZ0A 4C01A 3BJMA 1XQVA 4A23A 1MN6A 1P0IA 1A8SA 2QJRA 4K2AA 2OGZA 1IMJA 1J06A 5HKAA 4XWGA 2JGIA 1L7QA 2RAUA 2OGSA 3W05A 4Z49A 4IH4A 3G9ZA 1ISPA 5D3ZA 4ROTA 2XUHA 4V2IA 2PSHA 1XZKA 1CUAA 5CT8A 3AUKA 2G5TA 2WIFA 3KWJA 3ZLVA 1JJFA 4XVCA 3B5EA 5IH7A 1FJ2A 2ZYIA 1W1IA 1TK3A 3D59A 1BE0A 3FYTA 1GQSA 4OCZA 1YS2X 1A7UA 1KEZA 4H7FA 3RARA 5DYTA 1WCYA 3EQ7A 2OAEA 1IUOA 3H1BA 3STTA 3G0DA 1WPXA 1QE3A 2WM2A 5FPQA 5D3KA 5AKZA 3M82A 3WMRA 3CXUA 2QTBA 3R3ZA 4BTVA 4QDUA 5AI8A 1GGVA 3A2LA 4U2BA 4QA9A 2C58A 4YK7A 2GBIA 2J3DA 2XUGA 1FFCA 3O4GA 2Q0XA 3WK8A 3E4DA 2GZRA 2C5GA 3W9UA 1ACLA 3G0CA 2E3JA 4FBMA 1E89A 3V1LA 2V98A 5ALDA 4PV7A 4U2GA 3WWCA 3H2HA 4KRXA 1AZWA 4W9RA 1SC9A 4G8DA 1MX5A 5D7BA 1XZJA 2VJAA 5LZ8A 2HA0A 3VXKA 2QUBA 2YASA 3PUIA 4LYDA 2Z3WA 4U2EA 5AIBA 1GQRA 1T2NA 1QIGA 1U8EA 3VJKA 3R40A 2QR5A 4HZGA 5ALWA 4Y9SA 3WWDA 3D3NA 5AIAA 2QXUA 1P0MA 2VAVA 2XMCA 4DMFA 5ALIA 5BV7A 5HF5A 1GPLA 5CH5A 4N5IX 5HFAA 5AICA 4X71A 1CUZA 2XDWA 2JGKA 2R11A 5LZ9A 3AZOA 1LPPA 1XZFA 3ZI7A 5ALJA 1QFSA 4WCVA 4DSZA 1Y7HA 2ZVDA 5HKBA 4QDTA 1UK8A 5AO9A 4UHFA 2QUAA 1CLEA 4Y2VA 1XRMA 1Q0ZA 4JYMA 1VE6A 2Y2VA 2CUTA 2XMSA 3WWOA 3C6BA 3IB3A 3WIOA 4X6UA 1DT5A 1I6WA 1QIMA 2WTMA 5A7GA 1GPKA 2XE4A 1UOQA 3OM8A 2X76A 3ICVA 4NMWA 4ETWA 1Q84A 1H2XA 1FFDA 4F0JA 2ZYHA 1DWOA 3C43A 1VZ3A 3MGAA 2WUFA 4BP8A 3WWEA 1CUFA 2XUDA 4KE9A 2JGLA 2OXEA 1NU8A 3H19A 4MXDA 1X70A 5EI5A 1JU3A 3M83A 2JGEA 3DEAA 2Y6VA 4OSEA 5DTJA 1YAHA 2CBGA 1S8OA 2Z5GA 2ACEA 4KAFA 2XMGA 1CUVA 4H18A 5LLSA 5EHQA 4C4ZA 1EDBA 1JFRA 1FFBA 4GWLA 5K3BA 2PX6A 4UUQA 5CH8A 5EIHA 5JAPA 1W52X 2HA5A 1BEEA 3NOXA 5AJHA 3ZPXA 2FJ0A 2VQ6A 4G1FA 4B80A 3HEAA 3VISA 3CCCA 3G9XA 4BAZA 4ARAA 2JBWA 1F6WA 3HYSA 3WK6A 4INZA 1XROA 5CXXA 1XRLA 2HA4A 1XZHA 5T4HA 3PE6A 4DSAA 5KBYA 1CUGA 5DLPA 2CMFA 1QZ3A 1EDEA 4PSCA 2PU5A 4WDRA 4UHDA 4OPMA 5AI9A 4KEAA 3WZLA 2I3ZA 4JUIA 5AKGA 4OYYA 3PDCA 5LYYA 3EQ8A 1EVEA 2FX5A 3FVRA 3VVMA 4DIUA 2DQYA 3QPAA 4B84A 3BF7A 2RHTA 3QPDA 5AK6A 4C87A 4UHHA 1EK1A 1R50A 4HXFB 2HA7A 1PV1A 2WHPA 5JADA 4G4IA 5AKHA 3G0GA 5ISMA 4X95A 4AZ3A 4Y7DA 3ILSA 1VOTA 1CEXA 3NGMA 4I4CA 4CG3A 3ZLUA 1XZDA 3HXKA 3HRHA 5HF6A 1XKLA 2CJPA 2Y1KA 4G8BA 4UHBA 4WJLA 3DD5A 1XQWA 3C45A 1QTIA 2YH2A 5C81A 3BDIA 2WFLB 3IUJA 3A70A 5HQ3A 4UBLA 2WG0A 1LPSA 4ZRDA 3DOHA 1W76A 2VT7A 4OB6A 1JMYA 1CUEA 2OCKA 2XUOA 4Q1VA 4AO8A 1F0NA 5E4TA 2ZJ6A 3IURA 4J0HA 4Y2RA 2VJCA 1SCQA 5CH3A 3VJLA 2XMBA 4K6HA 3TGLA 1CUBA 2OCGA 5JZ9A 5CMLA 5AH0A 1FSSA 1JMKC 5HK9A 3W06A 2LIPA 4U2DA 3WK7A 4EUSA 2OPHA 5HK8A 3NUZA 1YR2A 2GBCA 5ALSA 3FLBA 3DS8A 1EXWA 3O0DA 5A62A 3KXPA 1HQDA 4J0KA 4ZREA 5DNVA 3WLAA 4I19A 4BC0A 1EVQA 4P9NA 1A8UA 4FLMA 4UFNA 4N8DA 1O6FA 3LLCA 2O2IA 4KE6A 4KAAA 1NU6A 4HRYA 3PI6A 1IZ7A 4C4XA 2BJHA 5ALZA 4OU4A 3RLIA 2XUQA 1THGA 2B4KA 4AMZA 3TJMA 4P93A 1H2WA 5HFNA 4RNCA 1CIJA 2HA6A 1MO2A 1B41A 3HACA 2QOEA 4AB1A 5C8VA 3Q0TA 3IA2A 3RK4A 2DHCA 3WL6A 3IUQA 1ZGBA 3IVMA 3D4LA 5K5EA 1EK2A 3WYNA 2NW6A 1EHYA 4DLNA 1CUCA 3VKFA 5AKXA 2EEPA 5CT5A 1AMNA 1SCIA 4E14A 2B9VA 1UXOA 4Q3OA 2O2GA 2RI6A 4BCBA 1AURA 4LHEA 2VAXA 1LNSA 2XQFA 1QTRA 3GUUA 4TGLA 2BUAA 5ALRA 4DMKA 5AOCA 3I6ZA 3V9AA 1EA5A 4P92A 1CUYA 2H9YA 5HF8A 4M0MA 2J4FA 2WLSA 1ACJA 4W1SA 2RIPA 3JW8A 1R4ZA 4QEKA 3G7NA 1XRQA 4P08A 3G0BA 3X3HA 1DT3A 1N5RA 3LS2A 3QPCA 2JIDA 2RHWA 5HQ3B 3U1TA 4N8EA 1ZOIA 4Q3LA 3OURA 4DM7A 3C8DA 3M3DA 5JD4A 2IIVA 5EFZA 3I2HA 1U65A 5SYMA 2AXEA 3A6ZA 4UPDA 2QZPA 1BS9A 4UBMA 3AZPA 3PF8A 3DCNA 3DKKA 3E0XA 4WFKA 4BAUA 3IIIA 2DQZA 1K63A 1TQHA 4FHZA 1ZI6A 2J3QA 5AI6A 4BATA 1O6GA 2O2HA 1AC5A 5C7YA
chains in the Genus database with same CATH superfamily
2IE0A 3AVQA 3CZMA 4W82A 3UUEA 1X39A 3VO8A 1AB5A 1MJHA 4HH0A 1AK1A 1AHHA 3AHIA 2D2XA 4MB2A 5JYBA 2OXRA 2XRFA 2OAQ1 4JQCA 3LCRA 2JFFA 1G0NA 4JT9A 4KIJA 2YCBA 4U7JA 4CF7A 4OV6B 4NXMB 1YD7A 2HUPA 2I1LA 5EVJA 3KBOA 2XAUA 1T3LA 3OZFA 2VEDA 4LSZA 4WWHA 5ITSA 1ODKA 4YRPA 5EKXA 5FNVF 2C3MA 1RRPA 3E5NA 1PFVA 4ISBA 4RLSA 1C1YA 2XE8A 5CURA 4YMSA 4B17A 1SIBE 1MNAA 3GHHA 4NZNA 5JR3A 5EE1A 3RKSA 3TSWA 3MRTA 1E5QA 1KA9H 2MMGA 3GAAA 3GLRA 3OZVA 2C7VA 4BNIA 3BMNB 5CA1B 7YASA 4D3ZA 1C5KA 2P8SA 5IXSA 2PA3A 2VATA 3DM9B 3HFRA 3HR8A 2ZJ4A 3KR1A 4JT4A 1EX9A 5LBTA 4X84A 3O1JC 2ZXEA 4XH9B 1B6GA 2OPBA 1BMQA 1NBMA 2VT3A 4MR7A 2M1ZA 1XCOA 2BFBB 2ZSAA 3GFRA 3RWBA 4BVJA 3IP5A 1KFEB 2VZLA 3JZIA 1I4TD 3RREA 1T2UA 3VNUA 1KI3A 1PSDA 1NSYA 3TMAA 1J33A 1FJXA 1IN8A 5B7GA 4PAWA 2B0JA 5CRIA 3SKXA 1NZJA 2PG3A 2SKEA 2XZOA 2VG8A 2HU8A 2GPTA 3U62A 3U6BA 2CHEA 2W4IA 3W6NA 4WOBA 2V59A 2D0IA 3FI0A 4QOJA 2H1FA 3A8TA 4BE4A 3W5JA 4H1VA 1HA3A 3FWZA 5CU7A 2EZ4A 3FYHA 5IWCA 4EYKA 2PNJA 1ZMBA 3ONFA 4M0PA 3SNHA 2FTKE 4PYRA 2AG6A 1UXJA 2GA9A 4JR1A 4F72A 2ZGVA 3LRTA 3PGXA 2VPIA 4G5HA 4S35A 2C94A 4AN0A 4LCJA 2GPWA 2X0IA 1D2NA 3DBRB 1CG6A 3H5IA 4R6XA 3TAXA 1SUDA 1KI6B 2JRCA 2UZ0A 1GADO 3I37X 3ZQ4A 3HCDA 3ZQJA 2Y1EA 5K0CA 5JSKA 1C7EA 2LKDA 1H6AA 4HNHA 1G2OA 2I6GA 3Q11A 4J0GA 4KFUA 4YIKA 1L0BA 3AK4A 4JZKA 4FUTA 3UENA 2IYZA 2G88A 4GSLA 2DOKA 5ALNA 4NS4A 3DMPA 3ZHCA 5IG2A 1KP2A 2FSFA 2QMQA 1R0CA 5JNWA 1ZI9A 2IVFA 1ZITA 3U56A 1H6CA 1IWBB 4CKZA 1X3SA 2VDWB 1SD2A 2HZBA 5TVKA 5IKXA 4LFAB 4YRJA 3AUAA 2V7QD 3G6KA 5EN4A 4HNRA 1WETA 4I6GA 4NEQA 4JLUA 1OA0A 1N8TA 3MMZA 3FNEA 3WLFA 4D6YA 4MWZA 5DASA 5MN5A 2D6FA 2YDXA 1TTTA 3S68A 4I55A 1YCGA 1Z0IA 2YYAA 3FCAA 4QRIA 1T4GA 1PVDA 1VHLA 2GN2A 2H51A 2WSBA 2AN5A 4W6ZA 3RQSA 3ZBQA 2OQVA 1GFSA 6CHYA 4RVCA 1GNRA 1K27A 1N7IA 3EBLA 3LPNA 4DUGD 4GZMA 5TRTA 5MGNA 4RKQA 1N8SA 1AG9A 3GFFA 4R01A 1IVYA 2H4WA 2XKAA 1H23A 2ZJAA 4D57A 5FBHA 3OZIA 1NKTA 3DDNA 4AMBA 1N36B 1GVHA 5FWNA 2XB6A 3V3TA 5AOAA 5EIWA 2QVCA 5LIPA 4R0VA 5BVGB 2AA3A 1Q92A 3HCBA 5BQOA 3T1TA 1U2GA 1EQUA 1QVVA 4UDNA 5KTRA 3TM4A 1DKQA 4LJLA 5EQJB 3RHTA 4O5OA 3EC7A 2GYVA 2OFWA 2UAGA 1IQ0A 1NN3A 1TI7A 1R9NA 1K75A 2UVQA 3TMYA 2B35A 3NRJA 1P7YA 1FW8A 2X41A 3WBFA 4XB6B 3I1IA 1WHTA 2WKWA 1J07A 4PE5B 5FI1B 2BFFB 4BN0A 2HH9A 1YA4A 3JWJA 3HB4X 4W63A 3UMGA 2P9YA 2PSSA 1VJRA 5M3BA 3ZHQA 1J2RA 1ONSA 2RH4A 1PT7A 1KL7A 3RVOA 1IQRA 3NBXX 1XDUA 2WPNA 2O1XA 4OBEA 3WKDA 5AJYA 1UZMA 2W4MA 2IVZA 4RZHA 4YMUA 4U7WA 4B7XA 4ZTZB 3T4UA 1JT9A 3RJ9A 4Z99A 1RRGA 3LC7O 3HE3A 4J03A 2EHDA 1C8KA 2HSDA 3C8HA 2J7PA 3HB9A 4G4JA 2PN1A 2QAJA 4JEMA 1UBFA 1IUNA 2ZJOA 4DSAA 4QPDA 4U9UA 2VAWA 5EIOA 1YI1A 1YU6A 4J1QA 4DIFA 1QORA 2G0TA 1E2GA 3FVQA 5EUMA 2JLUA 5KTMA 3WLLA 4QSMA 4EHLA 5BR8B 4U0KA 2DC1A 2DSNA 2O2CA 1XAHA 1KSGA 1IXYA 2IYNA 4RY2A 3LHKA 1KDZA 1WDLA 4F4HA 2OFOA 1Y4UA 3CKKA 3HP4A 2LCQA 4IO0A 5C4GB 1PJAA 4RTNA 4Q9HA 3HY4A 4IZHA 3PE3A 2JHPA 2MWMA 3HLTA 3D81A 1HV8A 5T5QA 2W8BA 3PD0A 1KGSA 2E18A 1B8NA 4U7DA 4FCTA 1KJJA 5KUTA 1KAGA 3TQIA 1NM5A 3ZU6A 1AKWA 2NSJA 4NMXB 5H02A 4IH1A 1ZD3A 4CPDA 2JD0A 1P9LA 1FRQA 4II2A 1FIUA 4KX5A 3DEJA 4EG6A 2CL6X 3H1AA 9ABPA 4RYLA 5KKAA 4HDMA 5U4QA 5AMXA 1SB9A 3ELBA 5JUWA 4PO3X 4WFJA 1LTQA 4XRGA 3ZDZB 3DDSA 2WFZA 4QTYA 1YVDA 3ENKA 1L5FA 4PRYA 4BV9A 1P44A 3CBGA 1JEYB 5K99A 5FH9A 3VQTA 2GLXA 4J29A 4RO0A 2D1RA 1J0DA 1WSWA 4MK4A 5KDLA 3S2ZA 4BNYA 5AK3A 4C6TA 4YBRA 3F6CA 5WRFA 3WKEA 1LFAA 1JRLA 2DVMA 2QRHA 1TIBA 2QVBA 3CJQA 4BLWA 3UT5A 3PLAE 1T3ZA 3ASZA 2XTMA 3EA0A 4P1ZA 3O4JA 3WG9A 4QULA 3L7DA 3IDFA 1MABA 3VUFA 1DX4A 1A4IA 3IFSA 2IS1A 3N2GB 3EEQA 2P9GA 2MSLA 4HRXA 3RC7A 2MSEB 2AFHB 1TVEA 4LTNA 2LKCA 1TYZA 3KDAA 3EODA 4WK2B 4M9SA 1E3DA 2GK3A 2QDKA 1YZKA 2OG1A 4URZR 1F9EA 1K9SA 5H3HA 1E0AA 2GEJA 3BGSA 3I8OA 2Z2XA 3ILVA 1FRZA 3KZOA 3WBKA 1NVFA 3RGGA 2JD1A 3IPYA 3K1JA 2VNAA 2WJ6A 3WQBA 1PNOA 2BM9A 4IMRA 3KM0A 1P62B 4TZTA 3DCYA 1JVBA 4L78A 4YRGA 1EB8A 3S44A 4EUKA 2JGDA 3QHPA 4PQGA 3I01M 4R9SA 5BR4A 4IIEA 4L5CA 2ZSUA 4EL0A 1G5QA 5KYTA 1I6KA 5JQGB 2J46A 3KWFA 4X66B 4G84A 4LF9B 3DAHA 3E2MA 2IUFA 5EJEA 5JALA 1YULA 2IYLD 2O5VA 1U31A 1X7WB 3LTEA 1JJVA 2H7XA 4IYJA 2OP0A 2VHZA 2Y77A 3VAAA 5KYUA 4OKSA 5H8WA 5L53A 3LKBA 1CQPA 3N2ZB 4KV7A 1CY7A 3K9NA 1QO7A 2OENG 4B3DA 2PS1A 1CY2A 3KELA 1RM4A 3TG8A 2NPIA 1FNCA 1V8DA 4KACA 3WGLA 1OYWA 4PHFA 2SNIE 4ENUA 3LIPA 1HE1C 1B43A 4IWYA 3SJAA 2YUIA 3SG0A 5H0IA 4DKJA 4EB3A 4CE6A 5EJAA 2IHJA 3AUJB 1KDTA 1V5GA 2J07A 3NO4A 4H7IA 2A94A 5C8ZA 5I7HA 2QG9A 2XA1A 2NYAA 3LTNC 2CD9A 3U3KA 4IGFA 4NDNE 4RVNA 5FOUA 3ZU5A 2HJHA 4H3VA 2P2LA 1RXUA 4AAYA 5T3UA 1WCIB 2Y1DA 4N5DA 4Q4JB 4YAKA 2QRKA 3T5DA 4NCXA 4M0DA 4XGKA 3GLKA 2CFOA 4GOMD 4AJNA 3IVGA 5EHZA 5ELXA 3JQ9A 2R1VA 1JHVA 2M6RA 3DL4A 1M3SA 2J7PD 3ZLTA 1FFGA 3N0TA 3K2IA 3MWKA 3JQ7A 2AZ4A 1PG0A 3CNQS 2WHXA 4ENPA 1WXGA 1VPTA 5EWMA 2YV5A 4K3VA 4BQRA 3FTEA 1O87A 4H9GA 4JOBA 5BVHB 5KYVA 3KHUA 1SM4A 3UJBA 4K9RA 4AG5A 4H6WA 4N5LA 4OGLA 3HFGA 3B1WA 2NP7A 1G6OA 1CBUA 1XEXB 2PZKA 2FPUA 3E7XA 3I32A 3KSDO 2FPIA 1DXYA 2JASA 3C97A 3NUQA 4MYTA 4V0SA 2VYVA 4M1SA 3NHMA 1OYVA 1O2DA 3DMTA 3G1TA 4J0FA 2CT8A 5LIRA 4TX1A 1NJGA 4CEHA 4MUJA 1RJDA 2CVOA 4NFLA 4LMPA 4DIDA 2XOKD 3FTCA 1WA5A 4BO3A 3OCUA 5HJ2A 2QGZA 2C92A 3DZJA 2NXEA 1HDRA 3HCAA 3PSHA 1XL1A 2CYAA 5DSXA 2CV2A 2D5BA 2PUWA 5AW8A 5A9TA 4JL5A 2QMYA 3N7AA 4KXVA 3R7BA 3IVCA 3NHBA 1XF1A 3CG0A 4QBTA 4LYEA 2X86A 3Q5DA 1MOQA 4B76A 1S4MA 3QTBA 2Y66A 1E63A 4BRWA 3DTVB 2Z8XA 2SICE 3A9WA 1EFHA 1REQB 2JIQA 1UT8A 4CIYA 3O93A 5IKPA 3LDAA 1IBCA 4GPEA 3VI4B 3H11A 1CY8A 4B46A 5ES4B 4RE5A 3BB1A 2P2ZA 4IKOA 2XUFA 4PFJA 1YB4A 3AIMA 4LWQA 3RBAA 1B0ZA 3Q3HA 2AD5A 2B25A 1IN4A 1UJ2A 5FBZA 5K3FA 2DQKA 1RXCA 3RSZA 2GBLC 2VK2A 2H31A 4Y2XA 3TEJA 4TTVA 4A7PA 1P91A 2P9BA 1O4VA 1KIAA 2B4QA 2PKCA 3SEZA 3WXMA 1LK7A 2I6UA 1Z26A 2HADA 4EGQA 1QVAA 2I34A 1G6KA 3GWZA 5A4MS 4LUCA 4TV8B 4TYMA 4R9NA 1JW9B 3F8SA 3NC4A 3PYMA 1I7QB 1SC6A 1RWMA 4O4JF 1IXRC 2VBIA 1A82A 3A2NA 4C5BA 3OIUA 4IIUA 2JZOA 1KZYC 1YK1A 1D1PA 2VBGA 5JQGA 1J6UA 2EKZA 3FOBA 2YHIA 3OZBA 4WH0A 2QRVB 2ZRIA 4NHOA 2R8YA 3NUGA 4IIVA 3ZKWB 5J47A 2Q2NA 5HE9A 3ZCSA 4EF4A 5ALPA 3UUFA 4J3NA 2HRQA 1ODFA 1B00A 2FCRA 3BIWA 5HFJA 4B3FX 1EA7A 1SBHA 2EFDB 3G3EA 1RBQA 4ALMA 3EZ7A 2IS6A 3WGTA 1Y5IA 5BUSA 4DADA 3EEBA 4X92A 1Y6QA 4NL4H 3VZQA 2C2ZA 4KYVA 1B0UA 1RYEA 2G25A 3ZJTA 5KNCA 2XCIA 3OE1A 2O0KA 2UUPA 4LI3X 1Q22A 5DFAA 1JGTA 2JFNA 3ZCRA 4OQFA 4ZFNA 3AG5A 3OUUA 3TNFA 5AKLA 4IG4A 1UFQA 3UIEA 1AQJA 1MMFB 3OEHD 1AVTA 1Y33E 3M34A 1X13A 2AX3A 3WOVA 1KK1A 3WWPA 2CXRA 2WWVD 4CIDA 3O8LA 1RI1A 1SHLA 2VBFA 1OZ0A 3NDIA 2CMHA 4HEHA 2OE2A 3ER6A 1G8PA 4TWJA 1BVRA 5FA5A 3J7AC 5CT6A 2I6QA 3EZNA 3UBTA 4CIXA 2ZIXA 3O3CA 3VPSA 3FMFA 3F7MA 2R6FA 3CN7A 5K4GA 2ECFA 1FA9A 1VPEA 2BBTA 2E4VA 1Z08A 2V7GA 1BMFA 2YZMA 3EXHB 3NASA 4ACBA 5CG2A 5HZMA 4NU8X 3S1LA 4RD1A 1NXVA 1Q1GA 1T8UA 1VCNA 1ORRA 2IPLA 2DP4E 4HX9A 1NBWB 4H1UA 5GZ6A 1DUVG 3RB8A 5KTYA 1ZBDA 1XK7A 3U4QA 2NU7B 1RKUA 5DNCA 1PU2A 3MW8A 3QLJA 1RVDA 4FYHA 1EX7A 1J4AA 2X8AA 2WT8A 5EHGA 3HO6A 1RMYA 2JHCA 4L22A 2R4TA 3LQRA 4ENTA 4YREA 2PYIA 4MRSA 2WHPB 1RM5A 2CN1A 2PQ2A 4TKUA 5KAMA 3K8YA 3HSSA 4MJ3A 3ROGA 3RROA 3SKYA 3R6LA 2XQIA 5DHSA 1AGNA 1GKLA 4UOZA 1NBIA 1VBKA 2W2LD 3FTFA 3JPYA 4PLTA 4XQ0A 4WY2A 4BEJA 2SCUA 1JFTA 2IHNA 4NEGA 2RGAA 4C7OA 4RMHA 3PICA 2EEZA 2RC5A 3CLSD 4L27A 1RWQA 4UZEA 1OH5A 5EZ6B 5FA6A 2W90A 3UMCA 5CB4F 1GEGA 2CHUA 4OOEA 3INGA 1PGQA 2AN9A 3K16A 4R1QA 1A9SA 4YT8A 2QTLA 1I8TA 2A2ZA 1MX3A 2OM2A 4RTOA 4RXUA 3MTGA 5JH7B 3GGPA 5J2UA 1I2AA 1ZA1A 3A3NA 3B53X 2C3YA 3H3JA 1FXSA 3KVOA 3PUVA 4JT2A 4RQUA 5HMMA 3WADA 1VJTA 3H8VA 5HA5A 4EA8A 2I1VB 1UK7A 3BD6A 1XDSA 2HIGA 5JAHA 1HRKA 1NOJA 4N3CA 1XN1A 5COBA 1K0FA 1CJTC 1MUUA 3JYLA 1Q1EA 4RVFA 4ZJUA 1Y1LA 5KC8A 2QM0A 4HKTA 2FZWA 4PTYA 3U31A 3KUXA 3NG1A 4AG6A 1KPHA 4ZTUB 1RPNA 1TM4E 2AZTA 2YWDA 4IVQA 4ZQFA 4L5BA 2PUJA 5IKOA 1FEZA 4MWGA 4QC2A 1FX1A 1W7AA 1P17A 2PNFA 1XTBA 4DRXB 1QV9A 3EWAA 1G5HA 2R48A 4N7MA 4D26A 3TLGB 4GI3A 1R9JA 3ZWYA 1VSTA 3I92A 5G53C 4QLOA 4U7FA 4TTQA 5JWOA 1VFPA 3KPJA 2IYFA 5EWJA 2E4WA 5D5PA 5F7JA 1Z0AA 4GDMA 1W4ZA 2Z5VA 2NZ2A 3THRA 1QHFA 2YWXA 3FJOA 3OLWA 3VDMA 4PZEA 2Q0QA 1EGMB 3AJ9A 4BWVA 1AN9A 4E94A 1QAQA 4US2R 5F4ZA 2ZU0C 1I01A 4GYJA 1ZM4A 4UAJA 1BH6A 4MV7A 1UM9B 1ANKA 3GT3A 1USGA 2ACVA 3EAGA 4ZYYA 2ISSD 3QKRA 1IBLB 4LZJA 2CKDA 2GAAA 5F4BA 5C5EA 4ZAYA 3SAJA 2AF3C 4U5XA 1LLFA 4HPWA 2QUHA 3QBEA 4AURA 1GJRA 4PLHA 3RVNA 1W48A 2H1LA 1SFRA 2XDQB 1TJ4A 4R6WA 3H6GA 5ULLA 4CL3A 2FR1A 3U4MA 2QTAA 3GZJA 3U9TA 4YQZA 1MC5A 1PW7A 2WOOA 3UMFA 4H6PA 4HGYA 2VL7A 1C3EA 4L4UA 5E7QA 3SBXA 1IB0A 2R79A 4BZZA 1V7ZA 1ZN2A 1MU0A 2DKNA 5IXYA 4GHWA 1K1EA 3X1ZA 1YZYA 4L6CA 3G0IA 1TYCA 2HBRA 5L9AA 5E9QA 5LR6A 3RE1A 1EXDA 4GLOA 3OC6A 4DZTA 1H22A 1ZRNA 2VIIA 4RV9A 4X90A 2HK9A 4NBWA 2B1JA 4X54A 3EPJA 1C7FA 3IUYA 1P0CA 2OD9A 3W1WA 1E6EA 1Y82A 4JGIA 4LN1A 4WE3A 4RWZA 2I67A 4R5HA 3NKVA 4TKVB 1XLWA 1E2HA 1T4BA 3JQ8B 1G8MA 4P7GA 5DGXA 3HKBB 3I4FA 1L4FA 4UHEA 1E2UA 4PLGA 3T12A 2H4HA 1ORIA 3IKLA 4CQLB 4X0EA 4U2CA 1MVNA 2FUG1 4EW3A 1J49A 3I52A 1SMKA 3M9WA 1TKBA 2DFVA 1KU6A 2HSJA 4BP3A 4C2AA 4BFWA 5C9ZA 3U6KA 3A6PC 3FTNA 2VRCA 4MW4A 2NV0A 3QOYA 2O20A 2A5YB 2B36A 5FUBA 4DWOA 1LSUA 2XCLA 1IEWA 4C0LA 4TMTA 2Q41A 4I3FA 1WMAA 2RCYA 3D7RA 4U7TB 1MCZA 1L9KA 4R81A 3NANA 4DM3A 1XMJA 3AUUA 4G5GA 1L6RA 1MX9A 4ACAA 1OFHA 1KEKA 1ETUA 5ALTA 3VDRA 3RODA 4TUYB 2REXB 2R4UA 5FNVA 4B9EA 4LRSB 1C3OA 4K6OA 2OCDA 2ZE8A 4WOPA 2FDXA 1RQ2A 3CC8A 4Q1AA 1T43A 2Z43A 3EIEA 3TLEA 5B30A 4DW8A 2F43A 3MLEA 4Y2YA 4R71A 3N2NA 2ONYA 1A9RA 3RYFB 4C2UA 1AXEA 1ZP6A 4N5NA 1Z0UA 1GZ6A 5TQJA 4DDHA 3FTQA 3ZZ1A 5L3VA 3MMXA 3WDMA 4EPWA 4CXMA 2CFRA 5COAA 2OHXA 4NEHB 1VI6A 1BX1A 4D4KA 5KSZA 1TAHA 4JLKA 3IUEA 1LWOA 5IU6A 4P38A 1R5BA 3WBBA 4DKXA 2JVJA 4KK4A 3DDUA 1BH2A 1J22A 3IR7A 4OD0A 4DG5A 6PFKA 2W2LA 2CV1A 2X14A 1YB6A 2Q1YA 3NDRA 2GYWA 4AX8A 3YASA 3HJTA 3W7AA 4ZAGA 5DX1A 4XEUA 1BCSA 4L8YA 1N6IA 3WDSA 1FDWA 1M0SA 1A2BA 1GUBA 3PFGA 3RHSA 1LB1B 2QVYX 1ZBQA 3KL4A 1PFKA 1I0IA 3W4IA 1R6VA 1EWQA 3D3KA 3H5LA 3GPDG 4G25A 4MLPA 2Q7DA 2EJVA 2EVWX 2JHFA 3OBBA 4X8MA 5BY2A 5MN6A 4UTZA 2CUKA 3R3YA 5CB8A 1ZXLA 4RJKA 2AMJA 4KDCA 3DXYA 1YWGO 2Y93A 4OB7A 4EYEA 3HJHA 2IGBA 2BCJQ 3SQDA 1JX6A 1XRSB 1JIVA 5IW8A 2K2WA 2K7ZA 3CVJA 3HXQA 3DQZA 4K6FA 3HY3A 1E3JA 1FFEA 1WDWB 2JFGA 4MEBA 5C37A 2VNIA 1U5BA 1LBSA 1OTYA 3M3HA 4JVMA 3GH1A 5FUVA 3VHQA 2H2AA 3IO5A 3PKZA 4MW6A 1QQ5A 1M1YB 2NX2A 2HV9A 2X0NA 1CU1A 2W6ID 1JKJB 3R0JA 4PPNA 1YB5A 1MAVA 2C98A 2ETXA 4O8CA 1V25A 1P18A 4PNZA 4Q1FA 2RI1A 2Q29A 1IY2A 2G4LA 3DVRX 4LDAA 4WASA 1N33B 5A4AA 4IS3A 1EM8A 3C8ZA 4HQRA 5DLQC 2N3ZA 2VDUE 3IE2A 3K35A 2ZM5A 1HPLA 2UVPB 1GQ2A 1Y1TA 1MR3F 3H9BA 5F5NA 4D3SA 1WR8A 1EFRD 3M6IA 4FP9A 5ICFA 3TCNA 2ZRCA 5JAOA 1P2TA 1TB4A 4UVDA 1IOZA 4Q9KA 2RGXA 5C1IA 2BT4A 2XCUA 3PVZA 3AI2A 5F78A 1X7XB 3PUXA 1P0PA 4FW8A 2JB9A 1VMDA 2VDMB 5CVUA 5BT8A 1Z75A 2FRVA 3WGJA 1P33A 1P3Y1 2PS0A 1RRKA 1C8LA 3D6HA 3OOSA 2FWBA 4GZ6A 2UUOA 3AR6A 1RM0A 3ETCA 4WY5A 3LL7A 1YACA 2WD7A 4CU5A 3GLFE 2BY4A 3QZUA 3K1TA 3KZNA 3V4LA 1SCDA 1Q2UA 1O97D 2B98A 3T6KA 4QDXA 3K70C 5TR9A 1DLIA 4HDQB 5ED4A 2P9JA 4B4KA 2PRYA 1XVLA 5C32A 3DKRA 4E88A 4NJMB 1F7VA 2I91A 3LCUA 1Y3HA 1CHNA 3OICA 1DAEA 4HB3A 1VA4A 3O92A 4M0EA 3GEBA 3HWWA 2ZWIA 4LYFA 2IL1A 2H1SA 4S24A 3JAWA 1M2WA 4GEGA 2IE8A 1ZC3A 3C1OA 2JLQA 4QUJA 5KVAA 3FHTA 2OORA 3NYIA 4EARA 2QIOA 1KY5A 3IPLA 2JH8A 3P5BA 3TTTA 3V1TC 4EG5A 3AX6A 1OLXB 5FWAA 3LO5A 3H2SA 1HXHA 1C1HA 1SURA 4IFIA 1LBIA 5EIBC 1V35A 3H99A 4N3GA 5TGDA 4DC9A 4FYPA 4DMHA 4EJSA 4X60A 3GP8A 4EJSC 3PL5A 4MVXA 1XRNA 3UMJA 3A05A 2G06A 1T1IA 1QGED 2C7OA 2H8GA 1WSDA 2E6UX 1BXKA 3P2JA 1HSZA 4HUJA 2PKYX 1V71A 4EGJA 1G42A 1L7AA 3G89A 4YJHB 1N77A 4TYYA 3F5MA 5DGTA 2OWDA 4PC7A 1Q3TA 1PD0A 2BR5A 2IUTA 1B76A 1YVRA 2G7MC 2XJ9A 3CMMA 3DV0A 3G85A 4WHMA 2W2MA 4BHTA 1M54A 4RTLA 1D09A 3SR4A 4R1TA 1R4AA 3KD2A 3V6LA 1BMFD 1QXSA 1SO8A 4CIVA 1U6IA 2RHCA 4LQ4A 2YHAA 4XX0A 4AJ2A 4CKXA 3TLMA 4OBXA 3ZHUA 2XR1A 3RRXA 1SXJD 2E4AA 2JCVA 1TO1E 3NI2A 4BUZA 4CCYA 3WSWA 3LY7A 5FR2A 2FR8C 5BYJA 1VGQA 4IOKA 4YO8A 4H7EA 1L3IA 2XHEA 4ETNA 4G0MA 1CCWA 3H87A 2B9EA 3KQYA 2QJWA 4GYKA 3SNKA 4ENVA 5I6DA 2R68A 3I6QA 3EXHA 5L6MB 2REQA 5TMEA 5KOIA 3SX2A 1U94A 5B4TA 4JXXA 3UV7A 1O57A 3CWQA 1MOSA 3VC3A 3INRA 1G291 3LOUA 4IIYA 4QGGA 4EDFA 1AQIA 5JH7F 4ZCQA 1N7HA 4FD2A 3ESRA 1OHHA 3O4FA 3VC2A 4K0RA 2QLFA 4HNUA 2B0CA 3O3OB 1EBBA 3F98A 4A5SA 2W42A 3ANNA 1VCHA 4OJYA 4KKXB 4MV9A 1QTNA 1FP4B 2AXQA 5JS1A 4YCSA 3N53A 1JKJA 3PC2A 2XB4A 3NFYA 4ISCA 4JA0A 5FDFA 1JN0A 3R3VA 4EMUA 5J4KA 1KH2A 1Q0HA 1H8HA 2FQQA 2BM1A 2TYSB 2ZSIA 4J3FA 3WJAA 4OAQA 3DUWA 4LJ4A 3T0GA 3FBWA 1Y1PA 3CJRA 3GGDA 4UXJA 1K7YA 1LLCA 1TMYA 3DOEA 4ZVOA 4KITB 2NXJA 2LRHA 1VKZA 3PQ5A 2DB3A 1M8GA 4JEHA 4Y9RA 2J85A 2JBAB 4Z4QA 3HV2A 3KHTA 1P31A 2FN8A 3L6DA 1ORDA 3FAZA 1JJBA 2IPXA 1DAPA 1VRVA 2WDPA 1YA8A 3UYKA 4A8JC 2G8NA 3DHEA 3DHVA 3MHPA 5K8LA 4EG3A 3UG7A 4Z4GA 3SYTA 1JLHA 5IABA 3LAWA 2NVOA 2H65A 3PQ4A 1EM6A 3DBOB 3L46A 4LDRA 2FW7A 1DFGA 3NWPA 4JKYA 1JEQA 2P2CA 3CNOA 4ZCMA 5ALUA 2GETA 4CIBA 5ESRA 1N2CA 1FOEB 2QLJA 3RRFA 3KETA 1GT6A 3WNDA 1N7JA 1Y6FA 4NJMA 2NZVG 2UYOA 3FYUC 4RU1A 2XSZD 2JI4A 1WUHS 2XSZA 3E1GA 4D8TA 1YRWA 1ZVMA 3QU2A 3K0AB 5JAQA 3R5FA 3HZHA 2N1MA 3VOAA 3IBTA 2ZR7A 1XTSA 2OCYC 5TGZA 1K4KA 5IKEA 2RFLA 3OQJA 3GQBA 4UHKA 2LUOA 3BAZA 3JCZA 2C4TA 1T1EA 2IUUA 3VR6H 4OGWA 4FBLA 4ZAFA 3EPKA 3RFVA 1V4BA 2PJDA 2Z4SA 2AJLI 2OAGA 2F00A 4KQXA 4L0DA 1ZVKA 3L82B 1WLSA 1IJFA 3F8WA 2DCUA 2EWVA 1FTNA 4TL7A 2QX7A 4Q9IA 3RVPA 3WE7A 5ALZA 4Q5IA 2ZJFA 5BW4A 5F76A 4TS9A 4TVKA 4L3WA 3CT6A 5CGZA 1I4LD 4IDPA 3T1VA 1C8BA 1NBOA 4CF3A 2QJFA 4ARBA 4LOHA 3ED1A 1K4YA 2CFCA 2QMUA 5IJ0B 4BO8A 1T2EA 1Y8AA 3NHPA 3E27A 3QOFA 5IZCC 2R6CA 4KFSA 2RB4A 4D41A 1AGXA 3IIEA 3FXAA 3OIFA 2NUBA 1NM5C 3FZYA 1G21E 2AKYA 2IP4A 4Y18A 1E5LA 1G6Q1 2PV7A 1EX1A 1GPNA 5C8YA 4YJFB 2D13A 1N9KA 3SHOA 3PNLA 4V0OA 3LU1A 1JF8A 3R9KA 2F8SA 1GZDA 1S3GA 1J2YA 3MMSA 4CMHA 1KYXA 4MVJE 2VK4A 3BGVA 4QJIA 4RSMA 5IFLA 1NQWA 1ESZA 3TLKA 4PZAA 1HORA 1RIFA 1TRHA 2PFKA 1SUPA 3D8TA 4O2AB 2J3KA 1E94E 3QELB 5PNTA 2GASA 2N9UA 3E35A 3H17A 3HCPA 1KYTA 3IS3A 3QMWA 2D2FA 2G82A 2QSJA 1YE3A 3NC1C 3WLHA 6GPBA 3JVEA 4FFVA 3QGMA 2FEPA 2TMYA 1YZTA 5G0VA 5BSMA 1W0KD 3F4KA 1G19A 2GM4A 2IEYA 4LZWA 4YR9A 1K5PA 1U2QA 2G0NA 4V02A 2YIDA 1SBQA 1QOPB 3OAAA 3QG5A 4MGIR 5AI4A 3ECCA 1AQNA 4J0CA 2X4IA 3GQBB 3EDQA 3HJCA 2Z5FA 4QU0A 3B3JA 5EXPA 3HK2A 5ECDA 4JI3B 4EFKA 2BONA 3EFOA 4XDZA 3W77A 1MO5A 4R16A 2A3NA 3EVAA 2GS9A 2VZEA 3BERA 3FCYA 4JK3A 2XYPA 3ZUGA 2J0EA 4N6NA 1U90A 3LUHA 2NU8A 1PFQA 2GXUA 2PA0A 3Q7TA 4BFCA 2ESRA 3K8ZA 3LG2A 3NPMA 1OLXA 2YV1A 3ZE6A 3D7SA 1E5XA 1NWHA 2X0RA 3O4IA 4N5HX 5E7JA 2BYTA 4I08A 4W5TA 1NBHA 3A4NA 4MH0R 2WZBA 5C1OA 1A9ZA 1CUSA 1QS0A 2H0QA 4DZRA 4P4SA 1TU0A 1N3BA 4AJPA 5DNUA 3D6NB 3OCXA 5G0WA 1PGPA 2C0QA 4YROA 1V6CA 5JD6A 5M2QA 3WLKX 4A10A 4JODA 4HMOA 3VZSA 1U28A 4DE5A 4BNLA 4JLOA 3S2UA 3R0VA 3KPYA 2DFPA 2VCYA 3JD1A 2DQSA 3UW1A 3V97A 8ABPA 3CLTC 5JT1A 1JXOA 2FWNA 2WSLA 3VKVA 2AKEA 4LXGA 4XQCA 3B1JA 4UCXA 1U9JA 2X8BA 3LLVA 5CB4B 2ISQA 1PR1A 2WZCA 1EFVB 1JYEA 1M34E 3CTMA 2GRAA 3E5HA 3QPBA 4NBLA 2Q2OA 4WAUA 4XX0B 3S1SA 3B1KA 1DIAA 4E5KA 1Q7GA 2OUIA 1P1KA 2ZJ2A 4OIMA 3MJHA 5EIXA 1WBBA 2I4MA 2WWYA 1PK9A 3VX4A 4MIYA 1HETA 1H66A 1JYSA 4M37A 3ZIDA 3HNRA 3B8HA 3ZXXA 1KZHA 1CB7A 4ED9A 4CDMA 3N2GA 1A5AB 4HGNA 3BWMA 2IHBA 4YHBA 4CMAA 2BGIA 3KG2A 1CQWA 4BWFB 3G8YA 3KTFA 4S1OA 2GMWA 1CVLA 1LDNA 1NT4A 3OU7A 4OHVA 1DWQA 5FYQA 4AC9A 1PFYA 3KJNA 3N8NA 3D3QA 3PEFA 1I3OA 4DY4A 4RELA 2OBXA 3IQDB 1K6XA 3UAVA 1LC3A 1KC1A 2EWWA 3DYBA 4FMDB 4RVHA 1QPBA 1Z6YA 2BEWA 3FPKA 4EKDA 2QD3A 3AFOA 1EAMA 2Z95A 3D2BA 2P9FA 1TTQB 3RVMA 2PMDA 4EKIA 3TZCA 1QVRA 4MKFA 4BXOB 3WIDA 5SZIA 1DO0A 3IHWA 3F7NA 5JV5A 3GZ4A 1YKFA 2ECQA 2YW2A 3M6AA 2BV3A 2VJPA 3EF0A 5C5DA 2PUBA 2V6MA 3GJ7A 1CR4A 1A88A 1RHUA 3ADKA 1JNYA 1K6EA 1PP4A 2WAAA 2ZU6A 3FMPB 2XY4A 4WI1A 3CTPA 3CUVA 3STUA 1AZTA 1ORHA 1N9ZA 1RR6A 1EBFA 2NO0A 3IIKA 3PFKA 3QVMA 1N57A 4QBGB 1G3MA 4Q3KA 1EFVA 3IAAA 3RUFA 2NP6A 2CCKA 3QX9A 4YR7A 1EUCA 2FPPB 2CD7A 1C9JA 2CXNA 3PL1A 3V4SA 3VPXA 5CDYA 2B30A 1TMOA 5K8IA 1FMFA 4FW9A 3K72B 5TQ0A 2EF0A 4DANA 3D6UA 3LT4A 4JI0B 1WXIA 5JARA 2GF0A 3IUSA 5CAEB 1EM8B 1H69A 2PGXA 3NONA 2CB0A 4PHHA 4RK0A 2O48X 3SQNA 3THOA 4ZO7A 4AF7A 4M86A 3D0QA 1JG2A 4GNKA 4RF5A 2PXAA 3R6DA 1ZEMA 3E3OA 4UBOA 2OCXA 3T3HA 1V3TA 5FTKA 3EWIA 5JNLA 3EC2A 3TLBA 1OWMA 1U80A 2XMPA 4FYYA 3A4VA 4TLMB 1SVUA 4I8XA 2C4UA 2Q9AA 1POWA 4UTOA 6ADHA 3ZDDA 4I2VA 2HK7A 4DN6A 4UPVA 3AQ4A 4Q03A 4W7IA 1ZJZA 5CNIA 1E79A 1FTQA 1M1NB 2IYAA 3BS4A 2CLOB 2I7DA 3K1ZA 2JI9A 1OB2A 2AOUB 4PZZA 1PCXA 4PAQA 2HNAA 4B83A 1U1CA 4GLFA 1YFZA 3L5KA 4QBHA 2X5OA 4YAEA 3TYXA 3HMQA 3S27A 1X38A 2Q07A 3E05A 4ZQCB 1E2BA 1OIXA 4OHZA 4ZN6A 1LDGA 2JBHA 1U9IC 2ZJ0A 2UYCA 3IEKA 1JR2A 5FUMA 2AJBA 5HCUA 3D7NA 5JJIA 4HVTA 1SXIA 2X1LA 3B85A 3IUBA 1DGQA 4LG1A 5ILQA 4ZWNA 1DKRA 3S1AA 3ZTTA 1TC2A 3LNCA 4D9EA 2ZLBA 3RSFA 4X94A 1UDRA 3II6X 4URHA 1D6MA 1PJZA 2ZXUA 1YOVA 4BRUA 3ITKA 1SHZA 1DCTA 2BP7A 2GPNA 4RA6A 4L3VA 1E69A 2JLRA 4Y1FA 3ROKA 3G9QA 4LBYA 3R7FA 4BX2A 1FQOA 2HTEA 3ZBUA 4Z51A 2IYEA 4Y2PA 2CFIA 2PRSA 1Z6TA 2QRJA 1GLGA 3IBFA 3L7NA 1IIBA 1Y1KE 1GTZA 2AFIB 1G5TA 3BCUA 3PXXA 1XTRA 2EKBA 2O8BA 2F9FA 4D9FA 1YZLA 2B1RA 2ZE7A 4QHYA 1XWIA 1ZNZA 4IFTA 4ZOLA 4HBGA 2VT2A 4HAIA 4M1MA 1Z39A 1NQ5A 3Q2IA 3ZD7A 4WBXC 3W2TA 2ZDQA 2DXIA 2R6AA 4A0FA 3PUWA 4YDQA 1B8VA 3GVCA 1P7PA 1N0IA 3E84A 2BHNA 3DE5X 3PQEA 4G0QA 1T9ZA 1CYDA 3RUIA 1Y8QA 2I4LA 3LT5A 1YRYE 3M6LA 5K3FB 1QP0A 2DLCX 3ETLA 3GAFA 3P2EA 1KNQA 2VSFA 2P4QA 1TZKA 3GN1A 4BN4A 2AQIA 2HU7A 3CLUD 4UNPA 3GNQA 1NLMA 3Q3CA 1ULAA 5CG1A 1LK0A 2ZI7A 2HD4A 2OHGA 1JWBB 2HA3A 3FGPA 3I34X 3K92A 5BSRA 2X0FA 2BEUA 3HGQA 4HSEA 3WSTA 1T5TA 4O4HA 1A9PA 4G37A 3MJSA 4BS9A 1Z34A 1BHQ1 3EZ9A 1UM9A 2YZGA 2H5EA 2I03A 3F1LA 3A36A 1SZJG 2HO4A 4X8OA 4Y2SA 4YQYA 3WK4A 4B73A 3STYA 5DX8A 3OTHA 4BQFA 1ILEA 1QCYA 3EQ9A 4BNFA 4NJEB 3TZEA 1MEJA 4UHJA 3FFBA 4KQGA 1WUJS 4RA6B 2DETA 3HRIA 3IELA 3D7LA 3KQSA 3W5BA 1WY5A 2H4XA 1Q0LA 1Z0ZA 1B3RA 2LZ0A 3C8UA 3AINA 3DPSA 2CB9A 2VZ8A 3HU1A 2DX7A 4Y9UA 5DU2A 4L5AA 4AO6A 5JIBA 4EJ2A 3E7PA 3A26A 4L75A 3B6MA 1EPUA 1F17A 4NV0A 4OUKX 2QRMA 1Z15A 4TQUS 4DUYB 4RZXA 3EE6A 4DEVA 2QSYA 2AXNA 1HE3A 4DV1B 3GH3A 1XX6A 4LE2A 2AXPA 3WJ2A 4CNBA 3IERA 3OQBA 1ATIA 5CB0A 3FYCA 3WGQA 2YC4C 4OJKA 2I5PO 4UEKA 2IXBA 3TR0A 3FRHA 4YAJA 3ZUPA 3D6AA 3W2EA 3G2NA 4L4YA 1C2YA 2GT1A 4EZIA 1ORWA 1S3IA 2P2SA 2QQFA 3PQ8A 4NAVA 1O03A 2H5JA 5K3OA 1WM1A 2ONKA 4IQ0A 5BOVA 1XQYA 4EAQA 4M3NA 4YJHA 3FFTA 4C6SA 5THKA 1MP0A 4LGVA 2GJ8A 3ZIAD 3VVCA 3O4HA 5JY1A 2C83A 2JGJA 2WIAA 1E2MA 2ZRGA 4W5HA 3HFJA 3TSOA 3HVUA 2A3RA 2ILTA 4QYWA 3U7HB 5I51A 2YWBA 3HUEA 1RP1A 4NK4A 3W3ZB 2VC2B 4FFOA 5K05A 3WLIA 2BKXA 2RE8A 1HFKA 1MORA 1UBJS 5DBGA 2VHTA 4KR0A 5ENDA 4WOCA 1JFSA 3DE3X 4BLSA 1NHGA 5GJWC 1DKNA 3DE6X 3UT5B 2VHYA 1KYWA 3F6YA 2E5WA 4OUDA 5FB3A 4BZWA 3OE4A 3GJ6A 4INOA 4Q15A 5DNEA 1D4ZA 1T9KA 2AYXA 5KHOC 3RBZA 1PKXA 1T9CA 1ZFNA 4AKTA 1R27A 3IULA 3QMMA 3PG5A 4KIFA 3HQ4O 3GXBA 1VXOA 2VS1A 4RADA 2AJ8A 3MMNA 4WVFA 4DMCA 4YUYA 3P0JA 4OSPA 5C0OE 1V9LA 4FXOA 2H59A 2XKJE 3L9WA 3C3MA 4FGLA 5A6SB 1U8CB 4E5DA 4DCCA 1M67A 4BB0A 3QI2A 1VBFA 2PXHA 1KH3A 1U0HC 3NBUA 5EGSA 2E82A 1PT6A 4H77A 3SF8A 5SZHB 5LJIA 1IPEA 2PIAA 1KJ8A 1C9NA 2H2DA 2W5UA 3UK6A 4EOGA 3VU9A 2PHZA 1PNVA 1Z3IX 4LXIA 2VP5A 5GWXA 2OOKA 1FU7A 1MPTA 2RHMA 2ZBFA 3FOWA 1Y3CE 2QSZA 3EYAA 3TGWA 2BFDB 4OU5A 3TI7A 4CV1A 3KSUA 4U02A 5DW3A 1VI5A 3K1AA 4G9GA 1AKTA 4YXWD 3IILA 1JG1A 3TPFA 2DWCA 3LYLA 4I8IA 3GVPA 1YQDA 3WGKA 4D9HA 1SHUX 1ZA2A 3KKKA 3ZEAA 3FDXA 1IZYA 3EPRA 3LXRA 4I4TF 5MDHA 3GJTA 3X44A 2G0AA 3ISVA 2C61A 1JSZA 2OV4A 3G2LA 2WKSA 1I4OA 3URMA 1NAIA 2C03A 4KMMA 1XQVA 4A23A 3G2OA 4C0XA 5LU8A 3DKPA 2FW1A 3NAMA 2C2XA 1F5NA 1THZA 1A8SA 4UJ3A 4EENA 5L40A 1UADA 5A05A 1SHTX 2Z9BA 4KQHA 3O2SB 2OGZA 3SIRA 3RTCA 2JJ8A 5AJTA 4D43A 4YRSA 4XWGA 4XJXA 1JIXA 2BLNA 1N32B 1L7QA 2A0XA 1RI5A 3QJYA 4FQ5A 4OH1A 1RBZA 4ND2A 5D3ZA 4KDFA 3V8PA 3GFTA 4EHFA 1X77A 1KHHA 1Z5OA 4R3NA 3WLMA 4HV4A 3CEPB 3U7JA 1YRAA 5LMNB 2XYHA 4AY6A 1VYHA 1P77A 3QVXA 4BBAA 2G5TA 1YF3A 1MZPA 4IVPA 4BFZA 1I32A 1XO1A 2D5CA 4UAUA 5DISB 5GJCA 2AUNA 1WZCA 1OXTA 1TT7A 3SYMA 3CX8A 3LMKA 4ZJPA 4RZUA 3UV3A 4XVCA 4CM3A 4E5PA 2VOJA 4L8GA 4DPLA 1E0DA 1P5RA 3BZUA 4FBGA 2J3LA 4GGOA 1FJ2A 3CLRD 4EPXA 1Q0TA 3B6ZA 5IK2A 2EOAA 3CNNA 2J3MA 1QKIA 3IVXA 3RF6A 3QENA 3CW2A 3L01A 2P11A 1PZXA 4PIVA 3N2YA 4MKGA 1H1LB 3KJGA 1PEYA 1KEZA 1Z0SA 3TIVA 5HDBB 1ZG3A 3P0FA 4XGRA 5IJ0A 4I1PA 1KI9A 2FGJA 3TOZA 1XE3A 3QVSA 4I2NA 2BEKA 2JFHA 2XDAA 1O6BA 2OAEA 4X1IA 3WYEA 4KQFA 5D87A 1IUOA 4TV8F 5DRTA 421PA 3NT4A 3A25A 3OZRA 4I50A 5FWXA 2WM2A 4UNRA 4KLZA 4MWCA 1J8MF 3NTRA 5IAKA 1KAMA 2CZCA 2L18A 2MR5A 1D2CA 3CXUA 1NJSA 3DONA 3KJFA 3NNNA 3OQHA 1UR5A 4B09A 3D54D 2XB2A 1LW6E 4HADA 3W2HA 1E60A 1XFAA 4QDUA 2B7BA 3FGOA 4MO9A 5AI8A 5IJ9B 5IYZB 5IASA 1OE0A 1TF2A 3NAZA 3GRUA 2ZIZA 3A2LA 4OLBA 2XWPA 3KDPA 4XAQA 4NMHA 3DNFA 2R0QC 1DG3A 4H0FA 2B37A 5EXSA 5IH3A 5HE8A 1RTKA 1AKVA 3GVXA 4IJQA 4QNMA 4ZZIA 1FLDA 1HH4A 3KZ1E 3I5XA 1Q57A 2F4NA 2RBEA 4HDAA 3LF2A 4XGQA 5FTJA 5GGXA 3HJNA 3QVVA 5BMVA 4RDIA 1JXAA 1RAGA 1ZS9A 2GBIA 3DMRA 5E1BA 4R2KA 2XUGA 4G36A 2Q0XA 1VIVA 3L0PA 3WK8A 3WGVA 3E4DA 2DM6A 3GUZA 5D2CA 2GZRA 1HZJA 4KNWA 3R7SA 3VPBA 3RVDA 5JANA 1NP3A 2E3JA 3LLMA 3A4TA 1PJ3A 4U0JA 2BGLA 4XUGB 5JVDA 1E4EA 1SUWA 4RMIA 1XG5A 1JSLA 4RHYA 5HCNA 5IP5A 4JN6B 1P2SA 1LDBA 2Y76A 3PWTA 3PYXA 2XIJA 3KYCB 3D8UA 1NOKA 2RGBA 3EPPA 4XTCS 1NZDA 3GGSA 1TAGA 1S2GA 4K9PA 4JHXA 4GC9A 3FCCA 4CTNA 1Y3BE 4C7MA 3AW9A 4A8JB 4ZRNA 1MA0A 2EKDA 3KYIB 3WWCA 1H2BA 2Y67A 1RQGA 2Q62A 3QRWA 3L6OO 1B74A 3H2HA 1OBOA 3VNSA 3MJTA 3VV2A 2HMWA 3ETDA 4KRXA 3DLCA 4XFKA 3TECE 3CZAA 1JWLA 1OPXA 3LM8A 1NLUA 4B6SA 1M8JA 3HADA 2AEFA 2FMTA 3G8BA 5D7BA 1EBUA 5C80A 4HDSB 1KZ1A 2C9YA 1RWOA 5DYGA 4H1TA 2V4MA 2VJAA 1E2JA 3K5IA 3M7IA 3HKDB 3AF0A 1U99A 2JAOA 4ZT4A 1PD1A 2NPFA 3BN3A 1ZX1A 2Z3WA 4IY1A 4V0KA 3MZ0A 4WKNA 4YDRA 1Y1QA 3R75A 4C0KA 5AIBA 1SXPA 3GX1A 4GUAA 1JHDA 1U8EA 4NAUA 5DHAA 3V2HA 4UNQA 4Y0NA 1TIKA 1ZVQA 2E21A 3GNTA 3R40A 4KGVA 4HZGA 1NMEA 1MDFA 1ZNQO 5E95A 1FXUA 5CDFE 4QAJA 2FZ4A 1FNMA 2QXUA 1AKUA 1P0MA 2CF6A 3K5HA 4FE4A 1RXEA 1T3GA 4WOJA 3ABSB 4YI3A 4IJMA 1T2FA 1VYTA 1FPMA 4PCLA 2QX9A 2JHGA 4B43A 4DMFA 4EGAA 4F12A 5HF5A 3E1SA 3ER9A 1GZHB 1R15A 2C9MA 3BTUA 4MARA 1LVUA 3CEHA 4JSTA 5HJ5A 3OQNA 3CF2A 3RO7A 3U7RA 1YJAA 4IHJA 3DTTA 1RWXA 4Q4CA 1PQPA 4N5IX 5AICA 1IOLA 2FMXA 4EWLA 3SE7A 2UVPA 3AJ8A 4MWDA 2JGKA 2R11A 1RPJA 1KNXA 2ZJ8A 1EE1A 1Z5ZA 3V7FA 4C04A 2ZYGA 4E22A 2OBBA 4JDUA 5A03A 1L9XA 2J9XB 1H5QA 1QSGA 3R4CA 5EE3A 3VOSA 4INJA 4Z0PA 4QTZA 1JEDA 5BMOA 1UAYA 1AMUA 1DOAA 1DP4A 4FYXA 1OF1A 4DSZA 1BVHA 4E2WA 2DWUA 3HVIA 2P27A 2BGKA 4O1IA 1JEQB 3H1PA 4PC1A 1VE3A 3RNLA 3HBNA 3N7UA 5TQ0B 1V96A 2MDTA 3EH1A 3RD5A 4U9HS 4Y2VA 2G1PA 3THSA 4FVTA 3I1FA 5KZMB 2PO5A 1FK8A 1PWXA 2QLNA 3WB1A 4F6RA 1AUQA 1FJGB 4TMYA 1VYVA 3OJCA 1IQPA 1G63A 2W00A 5DT9A 2A84A 4RLFA 2Q1SA 1IONA 2V7VA 3L2OB 1VE6A 1YL6A 1JTFA 3WZ2A 4LXUA 2H4ZA 2XMSA 1BXGB 4CGZA 1RLJA 3HM9A 4QT0A 4JYAB 3VVBA 1DJPA 5DNYB 3H2YA 4JY7A 4LFBB 3AV0B 2A4KA 2VJMB 3BB3A 2WZQA 2J6IA 3SE0A 4GC5A 1E1CB 4H4CA 2VJQA 1BJTA 2QW8A 1GPKA 2YWCA 3VR4A 1UOQA 1V7PC 5K3SA 3OM8A 3R5XA 2C88A 2X76A 4NENB 5KVQA 1NXTA 1YONA 3FA2A 4TTRA 2NU6A 3HPRA 3RKRA 4NMWA 1CVIA 3MD9A 4A0QA 4BNMA 2I7CA 3KKLA 1H2XA 1LX7A 4NV3A 3I39X 3RYIB 4YCDA 4UTRA 2QU7A 4KWTA 1NJ2A 4UMEA 4JA2A 3EWSA 3KB8A 3A0RB 4MVJM 3GP3A 3DMGA 1Q0QA 2XHZA 2ZYHA 1NVVQ 4WMLA 3B9BA 1MW9X 2VN8A 2ZBUA 1VZ3A 3MSXA 5TT0A 1AQ6A 3VPAA 1TF7A 2CLMB 2PAAA 4Z4CA 4Z4FA 3EOZA 4L4RA 3CGGA 3ABOB 4KOAA 3WWEA 5HZHA 2Z5LA 1YOVB 3CF6R 5HVNA 2H2WA 1YDWA 1RSZA 3PX3A 1CUFA 1GA6A 3BWBA 1EUDB 4BMCA 1QYDA 2YJGA 4KR7A 1KP9A 3X1MA 1ZGJA 3B20A 3KSZO 5H82A 4ME6A 4BEBA 4F46A 1K3FA 1NATA 2IIPA 4U5QA 1X8JA 2R60A 3W5HA 4UM9D 2HUNA 5KQLA 4HGQA 3M6FA 2YV4A 4Z7JA 5KWEA 1UJCA 4UEWA 5DTJA 5F7XA 2CBGA 1YDEA 4YMGA 2Z5GA 4Q7MB 2PUEA 5IJ9A 1ZU4A 1G5IA 3EC1A 3CMCO 1G7TA 4KAFA 2BFCB 4YACA 5J4LA 4H18A 4N65A 4N03A 3WDKA 4DSTA 4PWZA 3NHLA 4NU5A 3M5PA 4ZQGA 4LJRA 1UANA 2IYPA 5A4KA 5FT9A 3OCJA 5CX1A 3ZC3A 4QKQA 3QV1A 1U9ZA 2JIRA 3F78A 4WK0B 1UIRA 2G76A 2JLWA 1QZTA 1S9DA 1R0BA 3SZGA 3MT8A 4C7XA 4K86A 4XLZA 4EA9A 5CH8A 2V3CC 4LRQA 3W8RA 2PJRA 2G28A 3QK7A 4J2HA 3ZW9A 4QDJA 1TZJA 5CIWA 2P40A 3DM5A 3ZK8A 2WSIA 3K0EA 2YWFA 2ZS7A 4MP3A 1JILA 5JAMA 1EVZA 3MSCA 4IHJB 4EEXA 3UJPA 4YMHA 5HKKD 3ENZA 4HJRA 4JQZA 4BAZA 1Y3AA 3M4NA 1P8AA 2UZ1A 4CZ2A 3RV3A 4ZAXA 4INZA 1GNSA 1JP7A 1L8AA 4KR9A 2XVXA 1P7VA 1XZHA 3WMEA 4A8JA 3H97A 3I6IA 1G5RA 5DKFA 3GVHA 1CUGA 3GRZA 4G89A 1B23P 1U7XA 2DBYA 2CMFA 1YQWA 1QZ3A 2GFHA 1EDEA 2ZBGA 3O26A 3QA3E 5JCJA 4AM8A 5JCJD 4H3HB 2ECOA 3FSEA 1A8HA 1XTJA 2QTTA 3L7YA 2PU5A 4BNXA 4IRXA 5I4CA 2OECA 2OGWA 1P1JA 1R7RA 4LNHA 4OX9Y 1DHTA 2R5FA 3K94A 3REQA 5KJ1A 3ITDA 4KNYA 4CKCA 2I3ZA 4JUIA 5AKGA 3RG8A 4OYYA 3FGNA 5KYWA 1W5BA 2B69A 3PXAA 2WV9A 3EQ8A 4YUWA 3E1KA 1XNRB 3FVRA 3VVMA 2GESA 2JA2A 4D8XA 4YXWA 1WZUA 1JXMA 4FIDA 3HKDA 1NF9A 5KOYA 3TOSA 3OU6A 4M8SA 1D03A 3K9GA 3ADBA 1M0EA 4XI9A 3MB8A 4R1LA 4D4HA 4ADSG 4E1AA 1PT5A 2CSXA 4JI4B 1TYEB 1IHXA 3L6UA 4GKKB 3IP9A 2VDJA 1EK1A 4FDAA 1WVGA 2O8CA 4HXFB 4XCVA 5HQTA 1LBHA 3L8CA 4S1VA 3RRBA 3S2GA 2HA7A 3SF0A 5KWSA 2O2EA 3G0GA 4J8PA 4D79A 3ANXA 2Q3MA 2CVFA 3FNRA 4MQEA 3T7AA 1QF7A 1ECLA 3RYIA 2NU9A 1QBGA 1Y0BA 3ND6A 3USES 5ARCA 1Z8NA 3AFHA 4M9UA 4MKRA 2IBSA 1CEXA 3VR6A 4Z1OA 2AUMA 3BG5A 4L02A 1DC4A 1K98A 2JAUA 2X4DA 2ZI6A 4RA9A 4I4CA 3AWIA 1W2WB 2PMKA 3T5TA 3UGJA 2ZE6A 2R96A 3BFXA 4MQBA 5EP2A 1RRFA 1KH1A 3ZLUA 1LI4A 1XZDA 3TDKA 3HRHA 3D7KA 4L9SA 3NZEA 3QY0A 5DHUA 2HYIC 2OR3A 3LHFA 4Y1RB 1OI3A 4CMKA 2CJPA 3PLNA 2FSVA 1U3UA 1BD4A 3IP8A 4UHBA 3Q3IA 4MCAA 1JI0A 4DMRA 2L82A 3DD5A 3COJA 3C45A 5JHGB 3A6JA 3JSAA 1L4BA 4LBZA 4TV9B 3ZDBA 1GUAA 1H1LA 1LTHR 1YBFA 2VP0A 3EG9B 1GNQA 2B7CA 3AU9A 4K46A 4Q3BA 2YH2A 5C81A 3ILXA 2WFLB 3KVRA 1SU8A 4H3SA 2I3BA 3BTVA 3A70A 2RHRA 5DF1A 2XOXA 5ANRB 1AK9A 1NPYA 5F52A 3CVXA 4UBLA 2RH9B 4NYMQ 1G8YA 1X1RA 2DFNA 2P9ZA 3RIEA 4HGRA 2DLNA 1EESA 4V0MA 3TINA 1KS9A 5TS3A 4HNTA 5D8DA 5T57A 2JI8A 3DF7A 3VR4H 1RYBA 3G7UA 5HM6A 2CBZA 5HTOA 2ASEA 5EWJB 2AOTB 2UUBB 2IWHA 4OHBA 1WY7A 3VR4D 3LBNA 1C0IA 1E2PA 2AEEA 8MHTA 3RGWS 3TBKA 5CFRA 5CLQA 4C14A 2NSHA 5K6TA 4KQ9A 3O94A 3TUJC 1GPYA 3FIUA 3H5RA 2XUOA 1CZNA 3QLEA 1BE6A 4L3OA 4PC6A 3KKPA 4LRTB 4Q1VA 4DCTA 5C46F 1F0NA 3ER8A 1KJZA 2CXXA 1HDXA 2POQX 4UNNA 2PYZA 4TVOA 3VO1A 3DWEX 1Y98A 2ZJ6A 2YHIB 4Q4HB 5BORA 4U1RA 2VJCA 4CF5A 4V0ME 4YONB 1SCQA 4MUKA 1G1AA 1AK2A 1ADCA 5CH3A 4RAQA 4MRPA 2FYTA 1IN6A 2WA2A 3GLIA 1UBLS 1A27A 3SYNA 1KO8A 3OLVA 3V4OA 3NLLA 4S0ZA 2Q8QA 4XQ9A 1Z82A 1YBAA 3BSWA 4K6HA 1M1UA 1IM2A 1P6XA 1UKZA 4IDDA 3EB9A 2OBYA 4MUMA 4V3CA 1I2CA 4XD7A 5EMNA 1JTVA 4A4DA 5LWHA 4NCNA 1MOPA 3FR7A 4ZKDA 4CVNA 1CW2B 2G3YA 5E4FA 3GGGA 1PR4A 3ND5A 4BJHB 1F7UA 1C1DB 3ESZA 2C42A 3DL0A 2LIPA 5IWAB 5BNFA 4BOYA 4RESA 2Q6TA 2DF8A 2HJRA 3SLRA 3WK7A 4RFSB 5CAEA 2WF5A 2CWDA 2VYNA 4KODA 3NUZA 4WTOA 3GLHE 4GO1A 2FZVA 4HG2A 4MIEA 1C7QA 1H3FA 3FLBA 4DREA 3DS8A 3OT5A 2NAFA 5AW3A 1NJ5A 1TEHA 1PGNA 2NSDA 1PLLA 3RFXA 1B8OA 1HQDA 4MMXB 3AOEA 3U17A 3CWCA 5H80A 4BC0A 5IT4A 3IEVA 4JMLA 5L3SA 1JSCA 1SK9A 1X7ZA 2JC3A 4N8DA 3EVNA 4Q18A 4PC3A 3LGXA 4RHUA 1ZHOA 3AHHA 3BA6A 3BGDA 2NTYC 1KYZA 4J91A 4IRUB 4N18A 2ZVPX 4PO9A 4C4XA 2BJHA 2XT9A 1QB8A 3BK2A 2QQ0A 5A3JA 3ICEA 3KPWA 1E58A 2WJPA 1UPUA 2ZOSA 3TR6A 5A04A 4TWAA 4FX2A 4HZUB 3MCAA 3BXFA 2XUQA 3PTLA 5IM4A 3M5CA 3U7EB 1FMJA 5KVSA 16PKA 4C7BA 4DMGA 2Q5FA 3LPLA 1XQ9A 4IFEA 1FSGA 4YI5A 2BBOA 2J41A 1FDUA 3KRTA 1RE1A 2A7QA 1UKVY 1IOVA 3BC1A 3PYLA 3Q85A 4FGJA 4RH0A 4WQMA 2LDXA 2FFHA 4EVQA 1FDVA 3OQ1A 5SY6A 4X64B 1HEIA 2JI6A 4X1YB 3BMQB 5FNVB 2Y9PB 1X1AA 3C1AA 1ZL2A 5L3ZA 5C8VA 3P2OA 1UCFA 3GDGA 2XOKA 3ICPA 4QBFA 5D5QA 4B4WA 4BU0A 4ZPJA 4QXOA 1W35A 4BKPA 2N1BA 2IYYA 3SHTA 4CM6A 4LQLA 5M29A 4RLHA 3SN6A 4E09A 3NHUA 1G3IA 4I46A 4JI2B 4CWAA 3HDHA 1BQ3A 5J2TF 5KQMA 2QUJA 2VWGA 3AERB 4M9RA 1V37A 3LXUX 4ZT7A 1Z6GA 2B99A 4L50A 5EQTA 3KYCA 4EPTA 1EK2A 3BMOB 1EFRA 1CUCA 2C2KA 1GTJ1 2EARA 1ES9A 3I42A 4KMRA 4KDEA 4PX3A 1ISJA 3OQOA 5AVTA 1YZ3A 1YR8A 2YV3A 5B3AA 3UMMA 5K45A 1OGJA 1DXOA 4GR4A 3DFFA 3V8NA 4N9WA 5DHQA 3HXPA 1T91A 2J0UB 2WWIA 3CLRC 2HRBA 4YP5A 5GZ3A 4E6EA 4RK5A 3QLUC 1HT3A 1T9BA 3TQCA 3UT6A 3ME5A 3TBHA 3N2LA 3C3KA 2FPRA 3E81A 3QKSB 4P98A 4MIOA 4Q3OA 1KYYA 5TLSA 2YRWA 3QF4A 1RAIA 4ZO8A 1DC3A 1K92A 5JNSA 4LHEA 3U44B 1VG8A 2D1SA 4QLBA 2CL5A 3EZXA 1Q0UA 4L8LA 2TECE 4ND6A 4TGLA 1M2KA 1XA0A 5ALRA 1E3TA 1RI4A 3JZAA 5E7MA 4DMKA 3V9AA 2CNDA 3ET5A 1EA5A 1FJHA 4P92A 5F2EA 1TVKA 2JK1A 2VJMA 4XOUA 4B3HA 1NASA 4OA8A 3U7IA 1AQYA 1K86A 4A82A 3K09A 5CVTA 1CZRA 1ACJA 3ZZTA 4FI3F 3RHZA 1JYFA 2QAGB 5JWHA 2IS4A 4D97A 1F38A 3L6EA 4M49A 1RFLA 2OTCA 2RC6A 3IBCA 5H1YA 3IP6A 4GRAA 3FHCB 5B6PA 2Z2ZA 5C31A 3E9QA 4P08A 1X92A 3N8IA 2BELA 3T9AA 3G0BA 1KBZA 1ML3A 4RJTA 3IMCA 5IULC 4KN8A 1NTOA 3IPCA 2HCJB 2QM8A 2IBMA 3EG9A 1DT3A 5JBQA 4TZ0A 4PPGA 1L4GA 3A3YA 3R9XA 2VJOA 2JIDA 4YFYA 3M70A 2W6JA 4RHEA 1V8PA 1VJ0A 3EDCA 2WTEA 4AN4A 4P54A 2HPZA 4E31A 2KJQA 1YZQA 2J0UA 5EMHA 3EY9A 5KOJA 2OFXA 4RGBA 2IV7A 1KEEA 4WLOA 3U19A 1FXWF 3E0QA 2Z4RA 3KUUA 4Q3LA 1P5HA 3FRIA 2F8LA 4JX8A 4GPTA 3HFSA 4QPJC 1YGPA 2F55A 2IJGX 3TQHA 2PTHA 3ZCQA 2LXNA 2GCPA 1JIJA 2H4JA 3OCCA 4O1MA 2H29A 4LZPA 1VKJA 3I2HA 2BEUB 3JD3A 3E9DA 1E3IA 2SBTA 2PZMA 3EUWA 2ZB3A 3QEMB 2HF9A 4MAFA 3TTYA 3UMSA 3ZE8A 4B2PA