2QVBA

Crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
296
Chain Sequence
FGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase 3
publication title X-ray crystal structure of Mycobacterium tuberculosis haloalkane dehalogenase Rv2579.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 113
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qvbA00
4CIAA 3PF9A 5AOCA 2BGNA 3IA2A 3W2TA 2GYVA 2Q0XA 4B9EA 2YASA 3WWDA 4BDTA 3SWWA 2OAGA 1GPLA 2AJDA 5LZ7A 2BAGA 2JGFA 4G9EA 2C0QA 1SFRA 2RHTA 3KXPA 5FV4A 1MTZA 1IVYA 3OG9A 5AI6A 3QPAA 3G7NA 4Y2JA 5AM4A 3LCRA 1XLWA 1YB7A 3DNMA 3FLAA 2Y6UA 5CXUA 5AM5A 2XMQA 3IIIA 2HM7A 3AIKA 5K3FA 5IVKA 1R50A 4EHBA 1QTIA 3QMMA 2I3DA 1P0QA 2ZJ7A 2R11A 3FYUB 3HEAA 3NWOA 2HU5A 1CEXA 4H7DA 4WJLA 2D0DA 5CW2A 1MX5A 2VAXA 2PSDA 1JU3A 2PU7A 3O4IA 2GYWA 5JADA 4MYDA 3AIMA 3R3ZA 1EB8A 5AHXA 2WQZA 1CRLA 5AM0A 5AJHA 3WK7A 2BUCA 1ODCA 3I2HA 4DNOA 5ALDA 4AZ3A 5JAPA 1THTA 5E4TA 3EQ8A 4BRZA 4BTVA 2Z5GA 1JFRA 4CCWA 2J3DA 5C7YA 1GKLA 2QKYA 3A2LA 3NUZA 4OU4A 5T4HA 3G0CA 4ZREA 5DJ5A 5ALEA 3S2ZA 4HXGA 3TEJA 3W05A 3V9AA 5DYTA 5CH3A 3WA6A 1A7UA 3DOIA 4MXDA 2RHWA 1XZFA 2RIPA 1UKAA 3BJRA 1LNSA 1NU6A 4OSEA 2PBLA 1R9NA 2X5XA 3N0TA 5EIAA 2B9VA 3WMRA 2H7YA 5ALSA 1K4YA 4MQMA 5LZ8A 4B9AA 5LZ4A 1CIJA 5EI5A 5LP1A 3H2KA 4G5XA 5ALYA 2WIDA 4QDTA 4FDMA 4H7JA 2O2GA 1FFCA 1G66A 1EH5A 1H2ZA 3DL4A 1Q0ZA 1P0MA 2G5PA 1ZGCA 1O6FA 4L9AA 5AK4A 4P93A 2AJ8A 1ACLA 3BIXA 4G8BA 2JF0A 5ALGA 1H2WA 5DNVA 3G0DA 3G8YA 3EBLA 4K6KA 2BCEA 2WM2A 5HK9A 3D59A 3I6YA 4QDOA 1DQYA 3EF3A 3WWOA 4IH9A 2CMFA 1QE3A 3HRHA 4UBNA 4WFJA 4OPMA 4A23A 5AK5A 4H7FA 3M81A 1GZ7A 3OURA 3W04A 2PVSA 3LLCA 3PDCA 2BUBA 4HXFB 1L7QA 1Q84A 4Y2YA 1XKTA 4BVLA 4QLOA 1DU4A 4MEBA 2JGMA 1XRPA 3E3AA 5CBKA 2ECFA 2RONA 4GHWA 2WG0A 1QOZA 3I2GA 3MVEA 4CG2A 4NVRA 3F98A 2XMRA 1DWPA 4OUKX 5DNWA 2HA4A 2ZJFA 3H2IA 1ZJ5A 2CKMA 2LIPA 3HACA 5AM2A 3WJ2A 5AI9A 5ISMA 5K3EA 4G4IA 3OOSA 1YASA 3DKKA 1FJ2A 5HQ3A 2WJ6A 4H0CA 1XZGA 4ARBA 5AKLA 3HZOA 5HKAA 3OM8A 4MWSA 4Q82A 3FCYA 2ZSHA 3ZWQA 2HRQA 2HADA 1Q83A 3TRDA 3MUOA 1EX9A 4KRYA 2DSNA 2HA6A 5JIBA 1CUAA 3ZLTA 2OPHA 2HFKA 3JYHA 2XQIA 4OU5A 2WUDA 4XJVA 4OB8A 2OQVA 4AX4A 3SK0A 4NS4A 4PW0A 4MWTA 5A7HA 1XRMA 3DD5A 4KYVA 4MYSA 4H18A 4QA9A 1XRNA 3PUIA 1XZAA 5JATA 5ALPA 1CUUA 1QIEA 1RYYA 1QFSA 1CUYA 4C87A 1IZ7A 3IUQA 4X93A 4UBIA 4E15A 2XE4A 5K3AA 2XI4A 1XZCA 5A6VA 5JALA 1O6GA 2CUTA 4RPCA 4BRSA 1VA4A 4BYMA 3ZLVA 3Q8WA 1VA5A 1ORWA 1YCDA 3IB3A 3FSGD 4CI9A 2BUAA 2PL5A 2GYUA 2WHPA 5KREA 1E5TA 1Q0RA 5FPPA 4LXGA 2OAEA 2H7XA 1UZAA 1EINA 4OD0A 2JGIA 3HYSA 3H1AA 3ESCA 2BFNA 4AMZA 3GZJA 4DNPA 3S8YA 1J2EA 2HFJA 1UWCA 2ORYA 1UK8A 4G9GA 3PFBA 4QWWA 2H9YA 1R4ZA 3WYNA 4AQDA 4WY8A 4EY7A 4FKBA 1W75A 3DEAA 3WI7A 4J7AA 4X92A 4DNQA 1THGA 5LYYA 1A8SA 1ZGBA 3WKCA 4ZRDA 1R3DA 3WZMA 1U2EA 5DYYA 1EVEA 3NOXA 3I28A 3RK4A 3GA7A 1XRQA 3BF7A 3F96A 3C6YA 4W1SA 2PUJA 3BE8A 5HFNA 4IQ4A 4XWGA 5ALTA 1BCRA 1ZOIA 4HAIA 3WYDA 4O08A 1BEEA 4B6GA 5EGNA 5DTJA 1A88A 3CN9A 1TK3A 2WTNA 3F8SA 2WFLB 1SCKA 2FX5A 4QE3A 1BCSA 3QPCA 2V96A 3K9BA 4HRXA 4E14A 4RGYA 3R41A 4JEIA 5IVDA 5IVHA 2QT9A 2OCGA 4BCDA 4JUIA 1ZI6A 3VVMA 4Y2VA 5DYWA 4KE6A 1ZICA 2JEYA 2WG1A 4J0DA 2AXEA 1WB4A 4W1QA 3M83A 1XZMA 2XMZA 3WA7A 1CUXA 4QZVA 4IH4A 4EY6A 2D5LA 3G0GA 3C5WP 1W4LA 4PO3X 1R1DA 5LZ9A 4H7EA 3IURA 1UK9A 5A2GA 5EIHA 2QXUA 1DX4A 3C43A 1LLFA 5FDFA 1WHTA 2C58A 1DWQA 1LZLA 1XZLA 5HCUA 5AKKA 2VSQA 4X71A 4CFSA 3AINA 2XLCA 2OLEA 1AKNA 5ALZA 2XDWA 1YAHA 3D7RA 1N8SA 4X6UA 4X90A 1GQRA 1K63A 3D0KA 5CT5A 5JAOA 5AM3A 1LPNA 4GDMA 2DHCA 3SX4A 2QUBA 5ALVA 3QH4A 1N1MA 1RWQA 5AP9A 1CR6A 1TCBA 2XB6A 4Q3LA 3WQHA 3V1MA 4Y9SA 4AO8A 4WDRA 3STXA 4HVTA 3ZLUA 3DS8A 5K3BA 4B83A 4MEAA 5ALHA 5AI5A 3QVMA 3ICWA 5CTAA 1MO2A 2QS9A 4UHCA 5D3KA 1DTEA 2GBFA 4B0PA 1ZD4A 2GBCA 1RP1A 4GBGA 2HA5A 4EB0A 4KJXA 5ALUA 4DM7A 4XX1A 3E1GA 2IIVA 2WFMA 5AKJA 4BE4A 1XQWA 4YX9A 2VT7A 2PSHA 4DMHA 3ZPXA 5ALXA 5AICA 5FUMA 4LYDA 2WKWA 5FP0A 3BIWA 1XROA 2QUAA 4LYEA 3VVLA 2WUFA 4G8CA 1XQVA 1DT5A 4EY5A 5AOAA 3WZLA 1BE0A 1LZKA 1GXSA 4Q3OA 3KOOA 5FXMA 2CZQA 4DIUA 2OGSA 4UBOA 1Y7IA 1YSCA 2HA3A 5C8VA 2XQJA 4Y7DA 3IUJA 2H7CA 4L72A 4E11A 4GLBA 1SOMA 1KU6A 3FWHA 1CQZA 1XRRA 2XUAA 4J0CA 3B3QA 3AJAA 4CCYA 1ETHA 2ZSIA 5T4BA 1MN6A 4UBMA 3BL8A 3NGMA 4W63A 4Y2SA 5D3ZA 4DMFA 4KE8A 4K5QA 1HPLA 5CT9A 2XT0A 3I6MA 3N2ZB 3CN7A 3WL8A 1SCQA 2B61A 4OYLA 1QIIA 2QMQA 3R3UA 4M0FA 5K5EA 4KEAA 3PICA 4HZGA 2OCLA 1XZEA 2XMCA 3D2BA 3PF8A 3KWFA 5EIEA 1XZBA 3ANTA 4FBMA 2HA0A 1FSSA 1LPPA 4YPVA 2V97A 1G42A 5C8XA 1WCYA 3E4DA 1MU0A 3I2KA 3W9BA 3G9XA 2VT6A 2W22A 1L7RA 1JMYA 4Y2QA 5BWCA 3AIOA 3TJMA 5ALJA 1UKBA 4HS9A 5K3DA 3LP5A 3KWJA 4EBBA 1QFMA 3P2MA 4E46A 4WFKA 4X85A 4F5ZA 5I9IA 1CUEA 2WU3A 2OCIA 1EDDA 5HKBA 2X76A 1QONA 4UBKA 5LIPA 3T52A 4U2DA 3WK5A 2QJWA 4PSUA 2WSLA 2ZJ6A 3QBJA 5AI8A 3O9VA 4D9JA 1E8MA 2PSFA 3F9CA 2JGEA 1T2NA 4B84A 3A2NA 3H2HA 1J1IA 4UFNA 1WM1A 3ZI7A 2OGZA 3OTQA 1KU0A 3AZQA 3ESDA 1JJBA 2WIJA 5AO9A 7YASA 1C7IA 3FBWA 3WK8A 4BDSA 4FOLA 5E2IA 4F60A 1AQLA 4X7BA 1AMNA 1VXRA 1W52X 1AGYA 4UFOA 4JYPA 5CRIA 2HL6A 5ALRA 1FFEA 5EFZA 2VEOA 4GECA 3VJMA 2G63A 4J0KA 1QIMA 1HQDA 4KAAA 2FJ0A 5ALKA 1MNAA 1XQXA 2JBWA 3ED1A 2HU8A 5J3JA 4EUSA 3VISA 1DINA 1QTRA 4Y2XA 4FFWA 1H22A 4KR0A 2JGJA 2CBGA 4AN1A 3FLBA 2C7BA 3E0XA 3C70A 3B12A 1ZJ4A 5AKHA 2VA9A 3HC7A 4PF1A 4I19A 3C6BA 5F4ZA 4X6YA 5CURA 1FFDA 5IH7A 2CEKA 3VDXA 2CB9A 2HRRA 4ETWA 4B7ZA 4B85A 2J4FA 1CPYA 3GELA 2VATA 3MGAA 2IITA 1EB9A 3DOHA 3W9UA 3FVTA 4BVJA 1MPXA 5JANA 2QM0A 3O4JA 1ISPA 1GT6A 4FFVA 5HF8A 2HA7A 4BC1A 1HL7A 5IKXA 4DMCA 1YA4A 1ZIYA 2OGTA 2G5TA 2PUHA 4W9RA 5K3FB 1SCIA 3FAKA 5KBYA 1TKRA 1CUIA 4FLFA 4HXEB 4BAUA 2WUGA 1R9MA 3DKRA 4I4CA 2V98A 1A8UA 5KWIA 1WPXA 2ROQA 4RE6A 5A7FA 4BZZA 5FOQA 3G9UA 5D6OA 4BATA 5AKZA 2JEZA 2WTMA 2XQKA 4A16A 1EK2A 2HU7A 1F0PA 4FTWA 5HF5A 1IUNA 2OQIA 2R8BA 4J0JA 2K2QB 1L7AA 3ESAA 4TGLA 3WIOA 2EEPA 2EDAA 5JAHA 1X70A 4K6HA 2GZRA 4K2AA 1HBJA 2DHEA 5A71A 1OCEA 4OYYA 5JZSA 2WU4A 3X3HA 4ZWNA 1XFDA 1QIDA 1QO9A 4GXNA 3H1BA 4Y2UA 4C4YA 1YAJA 2AJLI 3H17A 5HF9A 2QOEA 3BWXA 4DMKA 4H7KA 4W1PA 5DNUA 3RM3A 5BV7A 2UZ0A 3L1IA 1HLGA 1YS2X 1LPAB 5AKGA 2XUIA 3ICVA 3UUFA 3QMVA 4S0XA 1CUGA 3GUUA 2RGUA 4LXHA 2DQYA 5HF6A 5YASA 4RNCA 3FYUA 1QJ4A 5CH5A 2WFZA 3HLKA 3R3YA 2Z8ZA 1CUSA 1EXWA 4C88A 2XUOA 3AFIA 5AK6A 3JWEA 3WKDA 1H23A 2PU5A 1KEZA 3FVRA 4LKOA 1BROA 1K6EA 1AZWA 1F0NA 4N8DA 3OPMA 4G4GA 2QVBA 1NX9A 3BJMA 5AOBA 4BE9A 3HI4A 4TVKA 1UK6A 3EQ9A 4DSAA 4LXIA 5EHQA 3U1TA 1CQWA 4P92A 1R88A 2WG2A 1UOQA 4MQLA 1ZD2P 2G4LA 5T4FA 1E66A 3VKFA 1Z68A 4OB6A 3C87A 3D2CA 2VJCA 3U0VA 5JD5A 1MAAA 4GEGA 1CUDA 1UK7A 2BGRA 4G1FA 1VJ5A 1GQSA 4ZXFA 4KE7A 5AKXA 5K3CA 1Y7HA 2JGLA 5LZ5A 5HQ3B 2DQZA 3AUKA 1I6WA 3AZOA 5ALNA 3H0CA 4KAFA 4BAGA 4QDXA 2C5GA 1LGYA 4LIPD 5EHZA 3H18A 4Q05A 3WL6A 2QR5A 1D07A 3WJ1A 5KWJA 4OCZA 5JASA 3C5VA 4BB0A 3I1YA 2O7RA 3IULA 3L1JA 1IZ8A 3WIBA 3EQ7A 3K6KA 1XQYA 4FLMA 5SYNA 1QIGA 1CUWA 2CJPA 3KSRA 2VJDA 4FHZA 2QZPA 1CV2A 1YR2A 2WIFA 1XZJA 4BC0A 2ZYHA 3KDAA 3ESBA 4U2FA 5AIAA 1W6RA 5ALOA 4ARAA 5LLSA 1IMJA 2XUGA 4X6XA 1AURA 1YS1X 1VXOA 3T4UA 1FFBA 2XMSA 4X00A 2ACKA 4ZV9A 1M33A 3BXPA 4K6GA 5A7GA 2QXTA 4EY4A 5FLKA 3FNBA 1VZ3A 3DLTA 3DL7A 2YYSA 4KACA 1U65A 4AXBA 2YXPX 2XQFA 3G9TA 4P9NA 4FBLA 2GZSA 2XUQA 3STYA 1XLVA 3BF8A 2RAUA 3R40A 2C0PA 4ZV7A 3BDVA 4M0EA 4N5IX 4UBLA 2Z3ZA 1E8NA 3LIIA 4UBJA 4N8EA 5E4JA 3JW8A 1Y37A 5C8ZA 5DWDA 3QMWA 2DCMA 2VAVA 3WWEA 4F0JA 1WOMA 2WILA 5AKYA 4JH0A 1ODSA 3GBSA 2AJBA 4G8DA 4UHFA 3D2AA 4EY8A 3FOBA 4DSZA 3CXUA 1F8UA 4JYMA 2DR0A 3PUHA 3DJYA 4CG1A 5JYCA 4IO0A 3C6ZA 1CVLA 2QTBA 2W6CX 4BP8A 4Y2PA 5H3HA 4I3FA 3PE6A 1PJAA 4H7IA 1K5PA 3WWCA 4B81A 3Q0TA 4PV7A 1P0PA 4BCCA 4GI1A 1EDBA 1LBTA 1LPMA 4KE9A 3DQZA 3L1HA 2HA2A 3UUEA 3QPDA 4H7HA 5HFAA 1HKHA 4B80A 4M0MA 1B41A 2XUPA 1CUJA 3WL7A 1QIJA 5AIBA 4DYHA 5CXXA 3C8DA 1VZ2A 2PSEA 4X91A 4IH1A 1GGVA 3VXKA 4BZWA 3I6ZA 2GBGA 3IUMA 5ALWA 3IBTA 2VTVA 1BEZA 1WB5A 5EHXA 1XZDA 1FFAA 4ITVA 3W06A 5FRDA 3WK4A 1E89A 4KAJA 2J4CA 1AC5A 3ZV7A 3A6ZA 1N5RA 3I2FA 1E8DA 2I03A 1BU8A 4Q34A 5BWBA 2O7VA 1VKHA 4N5HX 2NW6A 1XZHA 2AJCA 2GBIA 4BBZA 1JJFA 1CLEA 2V9ZA 4BCBA 1VLQA 3QITA 4H77A 1UT6A 4NZZA 1JMKC 3H04A 3F97A 1MX1A 2Z3WA 4FWBA 5C81A 5JARA 1EK1A 1TCAA 4V2IA 1XKLA 4PSCA 6YASA 4X3CA 1CUHA 4UFPA 1MAHA 4J3JA 4LHEA 4Z49A 3I2IA 4FNMA 1XRLA 5JZ9A 4EA6A 4HTAA 2Y1KA 4UUQA 1QGED 3IDAA 1PV1A 4B0OA 4UHBA 3M82A 3I1IA 1GPKA 4C01A 3DYVA 4NMWA 3V1LA 2DFPA 2BKLA 1BN7A 4KRXA 5D7BA 2WFLA 5HK8A 1BRTA 2XUKA 5FPQA 3QZUA 5AM1A 3H2JA 3EIOA 1UOPA 1N5MA 1U4NA 2OCKA 1GPNA 4QEKA 1CUZA 2WIKA 1CUFA 3MUNA 4JNCA 2XLBA 5CT6A 1UOOA 3VJKA 1JU4A 1VE6A 5AH0A 4PQEA 2I78A 2ACEA 2WLSA 3GROA 1UKCA 3O95A 4MJ3A 2PKYX 5ALIA 3R0VA 5AKEA 3GFFA 1VE7A 1ZI8A 5AK3A 2WHRA 5IVIA 4AB1A 1DQZA 3LS2A 4HRYA 4FLEA 5JAUA 3B5EA 4BP9A 2PSJA 4BVKA 4P08A 4AMYA 1C4XA 1QIFA 4X95A 4WCVA 2IX9A 2Z8XA 1E3QA 4OB7A 1MT3A 2H1IA 2ES4A 1ZD5A 4QDUA 5ALLA 4Q1VA 4B82A 3FLEA 1P0IA 4C4ZA 3V1KA 2ZYSA 2WIGA 2XMGA 2O2IA 2RI6A 5LKRA 2PX6A 1JI3A 2VJAA 1XZKA 1S8OA 3H2GA 1ZD3A 1JT2A 1PFQA 3PFCA 3O0DA 4FMPA 4N8SA 4CCYB 2EDCA 2Y2VA 2WJ4A 1TIBA 5HZGA 3DDUA 1TRHA 2I3ZA 4AN0A 1F6WA 3QYJA 3RKSA 5ALQA 3R3XA 3SC2A 3F67A 3WK9A 1U8EA 4UHHA 2FJPA 4YASA 3VJLA 4WY5A 4C89A 2VF2A 1JJIA 1AX9A 1W1IA 1ODTC 1G4HA 3RLIA 1B6GA 5ALFA 5AKIA 1TQHA 3G02A 4BAZA 3C8HA 3WKAA 3ANSA 2VQ6A 2JGKA 4J0HA 1X2EA 2HIHA 2C5FA 2ONCA 4YK7A 2X8BA 4XVCA 4X97A 2QJRA 3D4LA 1VOTA 4CG3A 5A62A 3WKBA 4GWLA 1MNQA 1A8QA 4J03A 3HABA 1CFJA 1G5FA 4U2GA 3FYUC 2OG1A 3G0IA 3ILSA 4WDQA 1EVQA 1LBSA 2Y2UA 3FSGA 1WHSA 1LPSA 5BOVA 4U2BA 3WK6A 1QLWA 4H35A 3AILA 1AUOA 4L3WA 1EDEA 4U2CA 1EHYA 5ESRA 1C7JA 3DCNA 2WJ3A 1ACJA 1SC9A 3STTA 3HJUA 2XMBA 2E3JA 3STWA 4ZGBA 1ZIXA 3IVMA 1X2BA 5LZ2A 3H19A 3STVA 1GKKA 4INZA 2XUDA 3AZPA 3WL5A 4QDZA 1ORVA 1OILA 4QLAA 1EI9A 1QZ3A 5CH8A 4Y2TA 1IUPA 4PSDA 4ROTA 4QWMA 4X94A 1CUBA 1QIKA 2PM8A 1EA5A 1LPOA 2JIDA 2WHQA 1ZI9A 5AI0A 3O4HA 4UHEA 1XLUA 2WUEA 1OXMA 4C4XA 5FKJA 3D5EA 3TGLA 2Y6VA 4C6HA 2B4KA 2C4HA 4EZIA 1JKMA 3OC0A 1HDEA 3CCCA 1W76A 3RARA 4A5SA 2XUFA 5AI4A 3KD2A 3O9MA 5ALMA 3G0BA 3YASA 4DGQA 3V48A 1J06A 5DLPA 1USWA 2P8SA 4FNGA 2ZYRA 2QRUA 1J07A 3M3DA 2ZVDA 1TAHA 1TCCA 1DT3A 1XZIA 2XUJA 1QIHA 3HXKA 1QO7A 3QM1A 4DNFA 1K8QA 3PI6A 1DX6A 4PNZA 4U2EA 1UFOA 2O2HA 4CIBA 5CT4A 4G4JA 1LPBB 1WPRA 1H2YA 1T4MA 3A70A 2PPLA 3G9ZA 4DLNA 3WKEA 2FUKA 3WLAA 1CUVA 3DYIA 5JD6A 4XIIA 3D3NA 4Y2RA 1BN6A 1H2XA 4L0CA 3BDIA 5E4YA 4TPKA 1CUCA 5JZBA 5SYMA 4ZI5A 4F21A 3FCXA 5LKAA 4W1RA 4GW3A 3LIPA 3K2IA 1NU8A 3I2JA 1UXOA 2YH2A 3UMJA 1IUOA 3FYTA 3A2MA 3C45A 3HSSA 4AO6A 1MX9A 2BJHA 2XQGA 2DHDA 4AZ0A 3STUA 4BTLA 3CCBA 3R3VA 1YB6A 4Q3KA 4UPDA 3IUNA 4DTCA 2XUHA 3O4GA 4AO7A 1MJ5A 2B20A 2XMDA 2WHPB 4J0GA 5CMLA 2ZYIA 5EHNA 5JD4A 4QNNA 3C6XA 1DWOA 4IHAA 5I7UA 2J3QA 3WWPA 4WFIA 3V1NA 2VJBA 3R3WA 1WB6A 4RE5A 4J0IA 5T4EA 5CT8A 4UHDA 5I8PA 1YA8A 5DTIA 2OXEA 1BS9A 2HDWA 2HHAA
chains in the Genus database with same CATH superfamily
3QWHA 4DW8A 1M1YA 1QG6A 2C4MA 3QXGA 5AOCA 5K0FA 2BGNA 2RGNA 4P3NA 3HBJA 2Z4TA 3IA2A 3NJ4A 3T9FA 1YZVA 4EGAA 1RPJA 4CLOB 1XQ6A 4C5BA 5HRUA 2VBFA 4RFLA 4BDTA 4R0VA 2OAGA 5AUQA 3SWWA 1I94B 1W85B 3SG0A 4DV7B 2GAIA 4MUNA 2CYBA 5CNMA 3DC2A 2P27A 4G9EA 3JQAB 4I6GA 1E61A 3VHXA 3WB2A 3KYIB 3H1FA 4BKUA 2FQXA 1VPTA 3EJ6A 4LN1A 4WGGA 4PZDA 4ZGGA 4ZK2A 3CWZA 1UKZA 2VK1A 2O8EB 2ZVJA 4BMZA 1HI9A 1GG5A 1YDHA 1IY2A 3OG9A 1U1GA 1Z4MA 3GLHE 3GX1A 1J1UA 3QOFA 5B5SA 4AT1A 4G67A 4Y2JA 1E1KA 3T9EA 1SB8A 2ZTVA 3F6BX 4BGUA 3GLSA 3TLBA 4GXQA 5EMJA 2YS6A 1P4HA 3JQFA 4ZTZB 1UBSB 3GFOA 3CLRD 3K6JA 1RT9A 5F9HA 2H9AA 3K15A 4R68A 1Z4JA 3MS4A 4QG3A 1IEWA 1U3FA 2PT9A 1H65A 4TOIA 2JFNA 1JAIA 1RM4A 2HM7A 3NHKA 4X61A 3RG2A 3AIKA 3HWWA 1V2HE 2B34A 2Z98A 1M8KA 1TKAA 4W82A 4UUBA 4X20B 3PDWA 5IPFA 3ADKA 4HRAA 4BYGA 4BO4A 4B2YA 4F2GA 2WZCA 3QMMA 4G0UA 3BC1A 1HNNA 4NENA 3EBPA 3IP5A 1IWBB 4OYHA 2IIPA 4LZLA 3S1LA 4ETIA 1PR0A 1XTIA 2R11A 1PL0A 1NN5A 2BV3A 3HKDA 5MGNA 4G1MB 1T36B 3NWOA 4B40A 4DMLA 5C3UA 1IG0A 1CEXA 2HRDA 2VJYA 2PTGA 3O92A 4H7DA 4X1IB 1TM5E 3VHQA 2O8CB 3V46A 5JZOA 3MWLA 5DP1A 2XE7A 3EGXB 2V3WA 1TECE 2REBA 4OLBA 5CW2A 5T67A 2HUNA 2YXLA 2PSDA 4D0NA 5LMZA 1ZJYA 5LMCA 5CD9A 3H8WA 2UXCB 1PTKA 2QUHA 3CH5A 3O4IA 1TC2A 2C4WA 2GYWA 5FLYA 4QATA 1TI7A 3H7IA 4D41A 4QDKA 1QP0A 2A88A 2NVOA 3TMYA 3PHIA 1DXQA 3P4UA 5EE0A 1UBHS 4YP6A 1OX4B 4QKQA 2QROA 2VL7A 1FP2A 3V3KA 2JAHA 1MQ9A 4G0NA 4TMTA 4MR9B 2NQTA 3SBXA 4M1OA 3WWYA 3N2KA 2EJCA 1NVUQ 4YCLA 4XM0A 4RFSB 1NT4A 4YMIA 2OY0A 3WGIA 1C1YA 3C5EA 3GJ3A 2F90A 1J8VA 2PO5A 4WKNA 4DNOA 1FDVA 1BG6A 2QZZA 4XUDA 3ZHVA 1CB0A 1IC6A 1THTA 4GT1A 3MWDB 9LDTA 5EE3A 4MW5A 1A2OA 4FYWA 1WLYA 3MWFA 1WNTA 3MTBA 1F2DA 4IOKA 1XJ5A 1BTOA 4C4AA 3PDIB 3AERB 4ESOA 4YN3A 2B94A 3RC7A 1CRZA 1X6VA 3EXHB 3GHHA 4WOCA 5BPFA 1EFAA 1QX4A 1GKLA 3SEAA 3A2LA 5TQ2A 3CO0S 3NUZA 2WF9A 2PQ6A 2RGYA 4R41A 3OI7A 4I55A 4NDAA 4W7IA 4CPDA 4RKYA 4BWGA 4QYIB 4ECAA 2R60A 5DJ5A 1KSJA 3KHKA 4GD3Q 2YWDA 4CKYA 3QENA 3HPQA 2I0FA 3OIFA 1YRHA 5CH3A 1U5BB 2IBMA 4RF2A 3A6PC 1XPOA 3P2YA 1GYPA 4L9RA 1W9MA 2C3UA 4ZZ0A 4MLDA 1DAKA 4GSKA 1Z6YA 4IP0A 5HW0A 4YP7A 2R96A 1OWPA 1M1ZA 2W4QA 3OPYI 3OZCA 5GONF 1F60A 3VC1A 3BJRA 4ZIRA 3WHKA 5ECWA 3EDYA 1R9NA 2HK9A 3CRW1 5BMVA 1GA6A 4KB5A 4TV8B 4UD2A 2JJ2D 1BJKA 1SURA 3GJQA 3LC7O 3SMQA 3WRYC 4HQNA 4F38A 3RJ9A 2R1TA 3EEFA 4B9AA 1J0AA 4QOIA 2WWYA 3ANYB 3GU3A 5KTSA 4JBWA 5EI5A 4KP7A 4JQYA 1KDYA 1Q1QA 3OFND 2ZYVX 4H6PA 4EUEA 1O2DA 2D6FA 3CVXA 1ZU4A 4J7XA 4FDMA 2X4LA 4F4UA 4J1SA 5G0UA 2O2GA 3D6FA 1IRIA 5FUWA 3BYZA 2CNBA 3A6EA 3JRXA 3VR4D 3Q9LA 1G66A 1QF7A 3NH9A 3L1KA 1F2TA 1NJSA 4ZYZA 2X0FA 3OLYA 3F6EX 3I9LA 1VL2A 2A0WA 4FXOA 4U5XA 1P0MA 1ECJA 1IG3A 1PZXA 2FKAA 5FJIA 821PA 4KO2S 1ADBA 3KJHA 1OPRA 1PJSA 1QDLB 3GGCA 1ST3A 5AK4A 4OMFG 4TKUB 1TTTA 1ZXBA 4E5YA 4FW8A 3JR7A 4GOLD 3S4YA 3LQ1A 3OM9A 1W47A 3BIXA 2PUGA 5HTKA 3DBRB 3AEXA 2O6LA 3V8EA 4OH7A 1XMOB 3IO5A 1K8ZB 1PDWA 3N6XA 4B4OA 1I1OA 2WNIA 1EUDB 2X40A 4P4NA 5CLFA 1MAWA 2O19A 4KMOA 3NNDA 2EWMA 2OTCA 2BEVB 5HK9A 1OHHA 3I6YA 4C3UA 1EP3B 4QDOA 1EJ0A 3U4MA 2GGSA 2D7JA 2XOXA 5E1OA 2ILVA 1UJCA 1AGRA 4LYGA 2YOFA 4B34A 1TA0A 2HI0A 5C1IA 2QRNA 1JUDA 3DHYA 4NLLA 5CVJA 3DVRX 2QMOA 3W6OA 5AK5A 5CDTA 3N2NA 4H7FA 3ZK7A 1IJKA 1X1EA 1P9WA 3PRKE 1JSZA 4V39A 1M2NA 3ULKA 5HUQA 1LDEA 2AOUA 4UREA 2PLNA 1TJ5A 3I9V6 3OURA 3SLKA 1DKMA 1LWNA 2PVSA 4OQYA 1PSZA 3PDCA 4IKOA 4HXFB 4QODA 2C3MA 4IX1A 2H2DA 4QLBA 1MBZA 2NLOA 1OXXK 3C74A 1DU4A 5GP1A 3VA7A 2AKAB 1G64A 1LB1B 4C6TA 2RONA 4GHWA 4N0DA 4QUAA 2F8SA 1QOZA 4X41A 1C8KA 1LJLA 3QU5A 2VT3A 1OC2A 3RFCA 4YRGA 1DWPA 3AV0B 3L1VA 3OVMA 3OLQA 2WC1A 4UXJA 4IVRA 3W0LB 5CB6A 1YS7A 1MAVA 4RVDA 5CDUA 5HIKA 2C9DA 2E87A 1KP2A 1ONBA 5CU7A 3WLPA 1H6CA 2XRYA 3QEKA 4UE3S 3TG2A 5K6RA 3RYIB 2E21A 3PQEA 1E59A 3MWJA 4JDPA 1M6VB 2Y0CA 4LDZA 2PJZA 4QU5A 1FFSA 3E84A 3OICA 1GL7A 2FF7A 2IF2A 3LNTA 3T35A 4Q7EA 3MRXA 5HQ3A 3ZD9A 3UXYA 4WZZA 1Y5IA 3K0CC 3RVJA 4B31A 4AKHA 1AXRA 4NAVA 4ARBA 2SCUA 4ZVMA 5BT8A 1DKNA 3U7GA 5AKLA 4CM8B 1K27A 5HKAA 3BCUA 4ZDKA 3OM8A 4GPEA 4L4UA 1XEAA 4MWSA 4R2MA 3ENNA 4ALJA 4ZDIA 4BNXA 1CQJB 3SFZA 2V6GA 3WHIA 3AT1A 3GGGA 4MS1A 4W6QA 1GV0A 5DCUA 4K87A 3OQMA 1RXUA 2HPZA 3RFVA 2DPYA 3IP9A 2P1ZA 1NBEA 1YR7A 4A0GA 3MUOA 2IUEA 4HX5A 4UM5A 5ADUS 2XZOA 3HB1A 4B6FA 1GAQA 3PP8A 1FDWA 2VIIA 3GEBA 2OORC 4HH3C 2HFKA 4QULA 1JF8A 4QOEA 2JBAA 3QLTA 1U2DA 4TXHA 5JVDF 2DT5A 3MRSA 4IIJB 1YE5A 3AR8A 4OI0A 3CKKA 5J59A 3VZBA 3ZEIA 3KSDO 4OB8A 1NI5A 4QXPA 2OQVA 1N9GA 3GPIA 1W48A 3QVLA 3GR6A 1DQPA 4EG8A 4MVJD 1KQOA 4IF4A 4AJNA 4A0RA 1GPYA 4WESA 4F3TA 3HSYA 3AR9A 4RHEA 1XRMA 2AKYA 3CHYA 3DDSA 2CUZA 3LF1A 1UBMS 1US8B 2I1LA 4M76B 3BK1A 3OZTA 4ND1A 1MJHA 4RPJA 1RNLA 4Z3KA 3Q7QA 4FDVA 2BZSA 4O3FA 2QK4A 4OHZA 1O9GA 4H18A 5AW8A 2PKWA 5EAIA 4E51A 1RJDA 3PUIA 2J59A 2YV3A 3B36A 1KAMA 3CW2A 4GBMA 5ALPA 2XKKA 1C3LA 4XIFA 4LPKA 3UK0A 1QIEA 2P9GA 3FHLA 3PGKA 4R1UA 1RYYA 4L1KA 4RH0A 3RSCA 4AWBA 1YZKA 2FG6C 4R31A 3B8HA 4YRMA 2H0RA 2I3AA 4ZO9A 2RHMA 3WLSA 5JG7A 2BISA 1LW7A 3RW9A 5TMDA 3DL0A 1DKQA 3IUQA 2BI7A 2ZE8A 3PGA1 5JAMA 3PHGA 3PE3A 2XE4A 3GJ8A 3Q3HA 1T8PA 2HO4A 1QPGA 3I12A 4QFMA 4EEZA 2PUDA 5GJVC 3HDGA 5A6VA 4JBGA 3QVKA 3L92A 3D0QA 2JI8A 4Y1GA 4JXZA 1ISIA 2GEFA 4YT2A 1PNOA 4O6VA 4ZDJA 1R8XA 4CKWA 1C9YA 1IIBA 3PRYA 1QBGA 3REQB 5I45A 2O1EA 4MRPA 2WWRA 1SN7A 3KXDA 1KF0A 2BIFA 2FP4A 2PL5A 2XVAA 1M7GA 3CJRA 1PZNA 3COYA 3GCZA 4ZYVA 4A6PA 4ZTBA 1UDCA 4BU0A 3G59A 4AROA 4HAVA 1C0IA 4OD0A 3RVDA 2C2YA 2FE4A 2JGIA 1F0KA 3VR6H 2R6DA 3AEUB 3ESCA 1GKIA 1KO5A 3MQ2A 3QKIA 1K7SN 2BFNA 1NY6A 2ZB7A 4AMZA 1I3MA 1KI8A 2BEWA 3GZJA 4RK5A 3O8DA 1PGJA 5KSWB 1U1FA 3S8YA 1N77A 2AH5A 2DPXA 4EKYA 5B64A 2HFJA 3PHLA 1L8LA 5JWOA 1NW6A 1PL8A 4OF4A 1P72A 3PFBA 1JV2B 4WK2B 1ZLYA 3TPFA 2H9YA 2WJYA 2NVUB 2JLUA 5DCYA 1YHNA 2V6IA 5KDLA 3TRFA 1E1NA 1Z35A 2GOYA 2HV9A 4NBVA 5LM3A 2W42A 2PGAA 3DEAA 2F1JA 4H60A 3WI7A 1TLLA 5GJBA 2HUPA 1DBPA 1U0GA 4R3UC 3DJFA 4TT3A 4BJHB 4EJSB 5IXJA 4GSLA 5IMBA 3R5FA 3ZWXA 2JG3A 2O8BB 1VJCA 3MBIA 5LOVB 1COWD 2XECA 5H0IA 5SZKB 4RFVA 2DPGA 3WZMA 1EIWA 3AF3A 3VNVA 2GCEA 1DS6A 2OO5A 3II6X 1H42A 1JDBB 1NT2A 1POWA 5EZYB 4IMJB 5BN4B 1UC4B 4Q19A 1A9XA 1Y7TA 1L9XA 1KQGA 3O74A 2G0TA 3GAMA 2NZXA 1KEKA 3RK4A 3CRQA 4QL3A 1Z62A 3PR3A 1U31A 1OXKB 3G1TA 4CMBA 2XZLA 5JJKA 2C4NA 3FRIA 3T7KA 4Y2HA 2GJ4A 3KE8A 5H68A 4FMCF 2YJ4A 4LZZA 4ZQBA 2ZSKA 1YVRA 2ZM5A 4B75A 1E2FA 1FTNA 2MHCA 4IQ4A 3WLIA 1P74A 3TZ6A 4O4IA 1L7BA 1N57A 1RQ2A 4IXNA 4OOFA 2Y99A 4H3KB 1IEXA 4JYCA 2B1IA 1SG0A 4N7RA 3OQIA 3G5MA 4RELA 1BCRA 1OPXA 1QO0D 1YQEA 4DL9A 4O08A 3KYJB 3KZOA 4B6GA 1ZL2A 5EGNA 1H0RA 3B53X 3G13A 3CF4G 2AEMA 2FWMX 4NECA 3K0FB 1GQQA 1G18A 3B78A 4MUKA 5B1SA 3CN9A 2WY2D 2O6HA 4RQTA 3K6SA 1W5AA 4U9HS 4BKMA 3K31A 3GLGA 2XITA 4C3OB 1OH7A 3RU7A 3LBIA 2YHAA 4IGIA 3LPNA 4LTMA 5EJ7A 5AHKA 4M46A 3JARB 3F8SA 3CX3A 2B21A 5IEBA 1DVRA 3GDFA 1V5WA 1GNPA 1JHAA 3OIVA 4FC6A 1NF8A 2BGKA 3QI7A 3OCUA 4GYYA 4PPYA 1TVKB 3RUCA 3L04A 1QRUA 3DAHA 3NU1A 3PS9A 5CJJA 2FX5A 4G5OA 2NQ8A 3QVTA 2A5LA 1IL0A 5F3RA 1BCSA 1T34A 1CULC 2HT6A 3T3EA 2D2XA 4MUYA 4C4OA 4J4HA 3PC4A 5LNK1 4HRXA 1B8NA 3JYPA 4RGYA 4DM3A 3O2NA 5IYZF 4EGFA 2I7CA 2JJ1D 4FIDA 2XNJA 5E0KB 1XXHE 2FPKA 4HDCA 2QT9A 1GSOA 4UTXA 5FBRB 4DG5A 4Z1OA 1XE3A 3GLQA 4Q4JB 5GVRA 4M88A 2CNNA 2E5WA 1VB3A 3CZQA 1FJHA 3QOWA 1XD9A 2PX5A 3AQ4A 1ZI6A 3C3XA 2W2LD 2ZIAA 3H11B 4KE6A 1JTFA 2XYVA 3NMUF 3H16A 2G9ZA 1ZXXA 2ONZA 1ZICA 4JB8A 1V45E 1ICIA 2DBQA 1RRFA 1QHXA 1WB4A 2PN1A 4X6LA 4YJFB 1JEQA 3A9RA 4LJYA 4B2IA 1G21B 2XMZA 2WINI 1G98A 4MPJA 2B8EA 1QH0A 3TECE 3PD7A 1ZUWA 5FYDA 1V5EA 2Z08A 3D1JA 4QRDA 2DUUA 5B2EA 3G1UA 3FMFA 4PRYA 1CUXA 1WPGA 5BV0A 4QZVA 2PQ2A 3AIIA 4N01A 1JSLA 1WW3A 4QT0A 1UDXA 1EZZA 1FYWA 4BS9A 2IOYA 1D8TA 3GN2A 4DSTA 3TRHA 3WIVA 3A6JA 2NO1A 4LPSA 4Q47A 4BV8A 2PQ0A 3TAXA 1RQ7A 1B43A 1Z12A 4UUNA 2YIMA 5BR4A 4JQOA 3G2KA 4KGVA 4RTKA 1FIUA 1G6HA 3LO5A 3I4LA 4PO3X 1R1DA 3IXQA 3PCXA 1Z0AA 2VXOA 1E7SA 3SHQA 1KMHA 4XQ0A 1OI2A 2NWQA 5IK2D 3N8DA 4GMFA 1IPFA 1VJTA 4MUAA 3IURA 3OT1A 1W7AA 2AXPA 2R751 5EIHA 3ZCVA 4D0SA 3CF2A 4JEHA 3ZE7A 2PRKA 1SKMA 1NQ5A 2QXUA 2EL7A 4UU1A 1E63A 1GRQA 1OI3A 3EIXA 2HIGA 4M86A 4RTPA 2UAGA 3VHRA 2HSEA 4ZCSA 1B0AA 4BJ5A 3QEOA 1IXRC 3K9HA 4J16A 4CU2A 2CUNA 1LLFA 3R44A 5FDFA 4ON9A 3JQGB 1VJ0A 1WHTA 3IQFA 4UMFA 3CLUD 3IJ5A 1LZLA 1NE7A 2XCTB 1PZEA 1RLUA 1RC0A 1WSAA 3JXEA 4X71A 3UGQA 4UEOA 1C3OA 3OAAD 1QQAA 1UH5A 3T41A 1AQUA 4Z7JA 3IJPA 3W5JA 5T3UA 5ALZA 5EPEA 5C7LO 1UXIA 3A3PA 2GDJA 3D7RA 3R5XA 4CFZA 4RZIA 1A9OA 5LYJF 1H4QA 2BTEA 1GQRA 4XX0A 5D3MA 4O2BA 2IP4A 4KDEA 4WLOA 2RFLA 2XBUA 2H5IA 4P2BA 1PZMA 3WL4A 1ESCA 3VO8A 1IJBA 2ISSD 4PZ0A 4ZT3A 4YJ2F 1UWVA 5AM3A 1WDMA 2CNDA 2IDZA 4GDMA 2Q07A 3UANA 3TFQA 2QIOA 2DHCA 3ZK8A 3IUBA 3SX4A 5IMSA 3SC2B 4GL2A 1W4CA 5M2QA 4OJTA 2ORVA 1VKOA 5D85A 1AKTA 5AP9A 1YIOA 4XW2A 2PUFA 1IQRA 1DRJA 1ADFA 1OVMA 4ZYTA 3A4MA 3UFXB 5AVXA 3LD9A 4M6WA 3ME5A 4MUBA 1E2IA 1VKJA 1CG6A 3C4JA 2VSFA 2X9GA 2OHGA 4AO8A 3TTVA 3WDLA 3I8XA 4HVTA 3RVLA 1OA0A 4O3MA 2XTJA 2VZ0A 4B83A 1KJ8A 4G56A 3EISA 3NIDB 2B35A 2O06A 1T2EA 2ACWA 1JDVA 1LFDB 1GQFA 2DR3A 3ICWA 3KK0A 1L5SA 5DRTA 2JLWA 4DRXA 3LRTA 1G20E 4JODA 4L5YA 5CTAA 1SUBA 3SF8B 3WBJA 2WP0A 1JYEA 2QS9A 2GBFA 1GU0A 3RFUA 1KOGA 2AN5A 5CA1A 4O8CA 3BILA 2JIQA 4CM3A 4U6NA 2HA5A 2ICAA 5CFZA 1ADGA 3DZKA 3T3NA 1Z34A 5ALUA 1HNWB 1CK4A 1KEPA 2JRLA 1EXVA 1NW3A 3GK3A 3ZHZA 2BM8A 4P81A 1XEWX 2IIVA 5CNIA 4LRXA 1M3SA 4C03A 2JGRA 3PPVA 3SXUA 2QQEA 5IJ0A 2SNIE 4QQ8A 1SXJC 1ZS9A 1JA0A 4RLFA 4WXMA 1JZTA 3V4SA 5FTKA 5HRAA 3LP6A 2OK7A 1NPTO 3DDOA 2R2AA 3JAKA 4D8YA 3N2GB 1EESA 3NWEA 2ORWA 1UZUA 4KO1S 4YX9A 1GDDA 2VT7A 3CW8X 4ACBA 3CPSA 2C04A 1DC3A 1S5PA 2JAOA 4YRFA 4KQJA 4LW8A 5AICA 4FEGA 4RPKA 2YWGA 4UXIA 2WKWA 5FL3A 4S04A 1XV5A 1Y5MA 3O8NA 4GL4A 5EWJA 5BRJA 1HNXB 4OHPA 2QUAA 1AJEA 3VVLA 2WUFA 3SICE 5GIPE 3LG2A 3OUTA 1S2NA 1G8GA 3QKRB 5ARCA 4ZV4A 5HNKA 3LVQE 1F7UA 1I30A 4H3SA 4EY5A 5EXXA 3CLSC 4NG5A 3T3DA 1DJLA 2MDTA 2Q9UA 3LDHA 1LQUA 4G0XA 5EXTA 1BE0A 4YECA 1E1DA 2WWVD 1DCTA 5DX8A 1FFHA 2AF4C 4JQSA 5KTTA 1GXSA 2O7QA 1Q17A 3IRUA 5IT9A 1R6XA 1V37A 4A2WA 4B3HA 5FXMA 1T8SA 4EARA 3QKUA 1TM3E 4YACA 2KMLA 5K8UA 3HN7A 3OJWA 4L6IA 4M9ZA 1YSCA 5IU6A 4QO7A 1LLDA 1L7XA 3IMEA 4CL3A 3DEKA 3GY0A 4WOJA 3KQHA 4MMXB 1LTQA 3IUJA 2H7CA 2I33A 5CK4A 3RIEA 5K7SA 4L72A 4EG0A 4LWZA 5I5GA 2A3NA 1VP3A 5GMOA 4GLBA 2WBLC 3KQVA 2WU1A 3FPGA 1XNGA 2CGEA 3MQ4A 3DFZA 3KL4A 4LQLA 4YY3B 4LF4B 3TLAA 2YNMC 2Z2ZA 3FWHA 1N32B 3Q4GA 3ILVA 3UCFA 1K8RA 1U04A 1IN8A 1NVBA 2QTGA 3TGPA 1ETHA 2G83A 4CV0A 1R18A 3PNYA 2R8YA 2Q3HA 1DADA 2WZBA 2YIDA 4ER3A 3BH7A 1KHTA 4RHCA 1BFKA 4YMSA 4I2VA 1WQ1R 4RS3A 4PLPA 2KQUA 1JBEA 4UBMA 4AC9A 2OCXA 3JWHA 1D2CA 4LVCA 4XVHA 5CFOA 3PEWA 2PMFA 3NGMA 1XJCA 1BXKA 1SELA 5E3JA 2OXIA 3WRXA 3LXXA 3PPIA 4BFYA 4E4RA 3LXUX 3UJ7A 3FNIA 2NO9A 5L3QA 1SM4A 1OVGA 2Q28A 4I50A 3HL0A 1ORDA 1UCFA 4K9OA 2R5FA 2CMKA 4ENVA 1KZ4A 2ANBA 2Q9CA 4K5QA 3P97A 1A71A 1XUOA 1HPLA 1YZFA 3PJRA 1KIFA 4AJJA 2WKQA 3K0AA 2HHCA 4XASA 3I6MA 3K0KA 4GR9A 5J40A 3L8GA 2HMUA 1ZOOA 2JFGA 4G3XA 3AKYA 1I4TD 1VMEA 4M2LA 5DSXA 4LCJA 2NZ8A 3JQBA 3T4PA 1FP4B 2GN0A 3HKEA 3E7FA 1VGQA 4JA0A 4D45A 1JQBA 3MUFA 5G3YA 1DG9A 4A8JB 4DUZB 2CNLA 4WBNB 2GEJA 5CDFE 3HU5A 4L22A 1D4AA 3TD2A 4AJKA 5KCZA 4JBXA 4ZAWA 1WXEA 4L5AA 2XMCA 2F9MA 3KD3A 3TLKA 4Q4CA 5BSKA 4QVGA 2ZBEA 3PF8A 4UU0A 5IKPA 3VFDA 1GPDG 3EXIA 5L6LB 4ISCA 1ZNWA 2XEXA 4UZFA 1I7DA 4QTYA 3GAZA 2R7AA 1SCDA 3NBXX 3M6FA 2GNOA 3WLRA 3BSYA 3QXJA 1X9HA 1QFZA 1BAPA 3BXGA 2VP2A 3AB8A 2HA0A 1FSSA 1LPPA 1XA3A 1ZRHA 2MSDB 2B4QA 1FRQA 4G63A 4PZUA 4ZVSA 3KB1A 4IDGA 4MTLA 1O96A 5F2OA 1P2FA 4RX1A 2V97A 1G42A 2AHRA 3BIFA 4II3A 5KNBH 4GMGA 4HDOB 4J4BA 3TLXA 4PIMA 3OBIA 3DLCA 4ACAA 1TQ2A 2AFIE 1B8OA 3LKVA 2NUAB 3UXMA 4KSCA 1J25A 2PWBA 2WJIA 3JQQA 3SJAA 4OHCA 3S40A 4LGMA 3I2KA 4BB9A 3W9BA 3G9XA 2I2AA 5H4HA 4M8SA 4MDYA 2FN4A 4YMTA 5G4LA 2BMDA 2FUNB 3Q0EA 3DULA 4TWJA 4AP5A 4YQZA 5C4MA 5IFKA 1Q92A 1W5FA 3QQ5A 4ONEA 1Z38A 1U7UA 3I73A 1Y3IA 4G8JA 4YRJA 2HBQA 4GGOA 1L7RA 4GKJB 5EIWA 2R6FA 4KUHA 2V3CC 1T43A 3MS2A 1XB2A 5LN1A 2J6HA 5IC6A 2ZTUA 3MTQA 4ETNA 2FEAA 1F4PA 4I0WB 4J1TA 3I9V1 2DLNA 4WN9B 5D2CA 3CINA 2LCQA 3UMBA 4TV9F 1GG8A 2EKDA 3TQCA 4ZHQB 5AW1A 4KITB 1QR2A 1YD7A 3AWDA 2HQOA 3GARA 1JHQA 1OAAA 1QFMA 2DLDA 2X9QA 3M6WA 4LE1A 4QPJC 4C7VA 3A9VA 4FD2A 1RWPA 4ZQFA 1MEJA 4E46A 5A1JA 3T5CA 2POQX 4GBED 4WFKA 3KZCA 1CQIB 4F5ZA 3L4BC 2YJZA 4UNIA 2BBWA 1LVHA 5G1NA 2WU3A 1QG4A 3OA2A 2RH9B 2OCIA 4PGFA 4P7GA 5CM8B 5A3RA 3TFOA 5HS4A 1UJNA 1QRTA 1QONA 1V1RB 1ZCFA 2BMVA 4GE0A 4U6QA 5LIPA 2K87A 1J21A 1NW9B 1RCFA 2ISCA 5DXAA 2XSZD 3I0ZA 2X5JO 3JD4A 4P4SA 4R2HA 2OP1A 2PNJA 2PIDA 1P75A 3WK5A 4RJLA 4EHIA 4LF6B 3UJ8A 4E2ZA 5FHRA 2F8TA 5EERA 2WSLA 1EXDA 1E5QA 3EARA 3RRJA 2QGNA 3O9VA 1QU2A 4CU5A 1KJIA 4EJMA 2C4UA 1CY1A 1XCLA 3OTWA 1KI6A 1PQPA 1M7BA 2ZXUA 1K98A 4HXYA 5B7GA 4M0DA 3QA9A 2DFVA 3PX3A 2IKSA 2JGEA 4KGDA 4OM7A 3I5YA 1ETUA 2UDPA 3CISA 4B84A 2CSUA 1O3YA 2H4HA 1Z82A 4FQ8A 1ULHA 4MGYR 1J1IA 4JGBA 1YIAA 4UFNA 5BQPA 5AW9A 3V7FA 3LT2A 2Q5LA 3OZ7A 4C0HA 5L6MB 2Q3DA 3EXFB 4F06A 3R23A 4OI1A 4BNUA 5JSFA 3ORYA 3GVHA 2GN1A 1B76A 2ASEA 3AZQA 6REQB 2G17A 1T6XA 3A1NA 1JJBA 2CL0X 2XTZA 3ILXA 4YJDA 3RS3A 1RXYA 3E3NA 3S5JA 3WISA 3BK2A 4A8TA 4BDSA 7ABPA 4YUZA 3K0SA 4DQUA 3F5QA 1HYEA 3M4JA 4UOQA 4F60A 4J3FA 2H1CA 1VXRA 1XAGA 2PT5A 2B4TO 2WRZA 1SIOA 5DHSA 4OA5A 1NQWA 1HT0A 1JYSA 2OUKA 2I54A 2ASVA 1I5RA 2VP5A 4PWYA 2YWEA 2PX4A 2MWMA 1D2RA 3FETA 4PINA 4RCZA 7REQA 3FVWA 3BHJA 4C78A 4LOJA 3KYDA 1WV1A 1B6SA 2HL6A 4LZAA 1JH9A 3CUYA 5AJVB 2DWOA 1CF4A 1NL3A 1O7JA 3NX4A 2AR0A 4CKCA 4PICA 2ZOSA 1X87A 2IZ0A 2VEOA 5FO1A 1XRJA 4UM9B 3VJMA 4EWLA 1U9YA 4O4JA 3U7IA 1NBME 1S6YA 1T4CA 3A25A 3KKMA 1QIMA 3I9MA 2MU1A 3L0OA 3S1AA 1HQDA 1GA4A 1XQXA 1YR9A 4DAEA 4Y2GA 4CDGA 4OHBA 1IVNA 1L1RA 1V7CA 3OLCX 3AUXA 3G2JA 4KIUA 5KVVA 4OLAA 4LYAA 2IYYA 3JTEA 1Y1PA 3VISA 3BMNB 4GDFA 4FFWA 2JLRA 1LNQA 3B2NA 4Q4AB 4YLEA 2JGJA 2RK6A 3QVSA 3RSZA 3UPDA 4Z4FA 3WVNA 1IWOA 1NUTA 2ZUCA 3C70A 4RC9A 5H02A 3U9LA 4BX9A 3OX1A 3TH5A 2V1UA 3KTAA 4M89A 1Q0UA 2PD4A 1ZJ4A 2ZU6A 4Q9KA 5F2NA 4BMPB 2P3OA 5AKHA 4JLSA 1UANA 2X2OA 3HC7A 3ET5A 3ORSA 3WRVA 3AHIA 3D8BA 3P32A 4ZMSA 1BW9A 1M1YB 3I34X 4JVMA 4X6YA 1AV6A 2FDCA 1LC3A 3FMPB 5HX7A 3JQ7A 3EC7A 4DLAA 1JWBB 2H07A 2ET6A 3KB6A 1MJGA 3OOJA 2ECQA 3H5LA 1UPUA 4KLRA 1ZA2A 3G2PA 4CEJA 4WCDA 2RGDA 3FGOA 3VHXB 5LR6A 4OGWA 3Q3EA 2SKEA 3NHBA 3H5RA 4CT4B 2QRJA 4HAUA 4ALLA 1EM6A 1K8XB 5AVVA 2IW1A 2IH2A 3EHDA 5T3YA 2OG2A 2VTDA 1GL6A 4EB8A 1G4AE 2HZBA 3FVTA 4P2GA 3BPSA 4UU7A 1BH6A 3LKZA 2VF7A 3RFTA 3HRKA 1U8AA 1OZHA 3DEHA 2X9LA 2QM0A 3FR8A 4FW9A 1OGIA 1SQ0A 1T8UA 2LKDA 4LGCA 1YFKA 3FHJA 4ZYWA 1YGPA 4RIGA 4CI0B 1GQOA 1LX6A 3ZDDA 3DL2A 1RHQA 4LMRA 1HL7A 3ABSB 1P1FA 1YA4A 4N5DA 2R7LA 4WXHA 3REFA 3W2EA 1JLSA 3ZU3A 3MHPA 2FR8C 4L0DA 4TV8F 5IHXA 3H1EA 2P9FA 1DBSA 1KEWA 3QUTA 1OFUA 1ZIYA 3GNTA 2YMPA 1QS0B 4L76A 5BW8A 5KKNB 5KAPA 1SCIA 3C1AA 2DX7A 1B00A 4KN8A 4HBZA 1WBJB 4HD8A 4RL4A 2CLEB 1QQ6A 4FLFA 4NENB 4XQCA 2F4VB 2IGTA 1FLAA 1HTBA 1NMYA 3DMNA 2OO7A 3HKDB 3KQLA 3I1FA 3Q8MA 1AO3A 1I1QB 3AHJA 8AT1A 4EF6A 2PEYA 1R9MA 1CZLA 1PEAA 3TSAA 3DKRA 3O26A 1I24A 4X65B 2DF8A 5KWIA 3L06A 3E7PA 2BRUC 5FT9A 3UENA 2NZVG 2QJFA 2RB4A 2I6GA 4JR2A 1W59A 1BKDR 2QSJA 3FJYA 4LA4A 1T3LA 1G9TA 1CY4A 2DQSA 2HLHA 4HUJA 5IJXA 1ZR2A 5A7FA 1NKVA 2GBLA 5FBWB 1NYQA 4BZZA 1X7YA 2A0UA 2V54A 5FV7A 3K16A 4R16A 2G67A 5DIFA 4GXRA 1YR1A 4K0RA 1U7OA 2OOSA 4NK4A 5ESWA 4JJEA 1PQUA 2PWYA 4E0BA 4A16A 4WIAA 3C3DA 3D6HA 5HYVA 1OXSC 4ZK6A 5EJ5A 4JBIA 3GLIB 1LV8A 3PUVA 3MA0A 4FTWA 3ROQA 4D4LA 4EFLA 2O7NA 3LUCA 1KPIA 1V4BA 2ZTSA 3LA6A 4HQKA 1S1CA 5EEGA 4DABA 2N42A 2OQIA 4QO8A 4TT3D 3ST7A 3N2KB 3G7UA 5SICE 2FK8A 3CKLA 3E1KA 5TXGA 5B6JA 1X1RA 3NKFA 4TN1A 2K2QB 1NWHA 5HTOA 3QVJA 4FYKA 3TL3A 3UG6A 1LTKA 2EDAA 3N7AA 4D0LB 5JAHA 1A8PA 5DMHA 3P9SA 2ZYWX 1YB5A 1ZG3A 2ZRLA 4ID3A 1YL7A 3GVXA 2W2VA 2O0LA 3DONA 3IB6A 3LUFA 4Q15A 4AJIA 4CV3A 3RIYA 3G8AA 1NIPA 1OCEA 3E5MA 1QHIA 4JQCA 4OYYA 3V00A 2JLQA 4DC0A 2FYTA 1K1EA 1DAMA 4RWZA 5TQ2B 4R0NA 1PS0A 4DZTA 1DLJA 4Q1EA 3U3ZA 4I55B 3L4KA 3WGQA 3CSSA 2CT8A 1FQWA 2O2DA 4KQXA 4RQUA 4A36A 1D1SA 1GN9A 3TJRA 2VNSA 2FRVA 4BB5A 4DJAA 1LBQA 3ZGYA 2FKNA 3KCNA 1BKYA 5G1OA 4TM7A 1TQ8A 2O2JA 1MFZA 3TNYA 1S2LA 1NXPA 4GXNA 3NTLA 4F1JA 1ZVQA 5CCBA 4OMUA 4Y2UA 5A4MS 1JVSA 4OHVA 4DHWA 3ITDA 3FPJA 4K9MA 2OCAA 2MR5A 1H3FA 1V8FA 4LJAA 4IMRA 2DOKA 2AJLI 3DO6A 2JAXA 5BSMA 2I8LA 5HF9A 3W77A 4ZIRB 1Z75A 5BURA 2PUCA 3PQ3A 3REGA 2OHVA 2WE7A 4OTZA 5BMVB 4PAWA 4DMKA 2Q49A 2P3SA 1M54A 1IHDA 1ENOA 3KKOA 4UHJA 4W1PA 2FEWB 5TY0A 5DNUA 2XCRB 4IFTA 4YT5A 2R1TB 4C6RA 4TMKA 3DFUA 5BV7A 2O48X 4U7HA 1Z5UA 3K0EA 5IUNC 2L2QA 3SHWA 4ZMBA 3X43A 3NFYA 2JZNA 5HIIA 1LPAB 4L4ZA 1D3AA 4C0JA 1GOTA 3C14C 4MMZB 1ZRSA 4P4TA 2C07A 1H3NA 3VPFA 4BMOB 3QMVA 4S0XA 4E2WA 1CUGA 3B7GA 5HDBB 1F2TB 3LWNA 3GUUA 4DDVA 5KYWB 4LXHA 1PJ3A 3I3OA 1V3QE 1NUQA 4DLBA 2AMVA 3ETNA 2O2YA 4X3OA 1GGEA 5HF6A 1W87A 2LP4Y 2XVYA 1Q19A 2VYVD 2WMDA 4WBXC 3V8MA 5JEEA 3RS9A 2WFZA 3NP9A 4RVGA 1VBNA 5A4IS 1QRAA 4IWXA 4KBYA 1Y6RA 4QTTB 4RABA 4YCJA 4TN5A 5IJWA 1E9VA 4IIJF 3T7AA 4H1WA 1A50B 5D5HA 5EA2A 2XUOA 4EECA 1RXVA 2W6ZA 4BFZA 1LQ2A 5AK6A 2AMLA 2CN1A 4PGAA 1J7JA 1H23A 1MXHA 3E70C 1BO6A 2WVGA 4IZHA 2WYVA 3FM9A 3X2SA 4IFIA 1KEZA 3NPMA 4NRDA 3Q8XB 1PHRA 5IAJA 4LKOA 2PZAA 1W1UA 1GZ5A 3SVTA 1WF6A 2QVBA 5INTA 3L0PA 1S4MA 1D04A 2VP9A 3UM9A 1DIGA 3BJMA 4LAFA 4F2PA 5JYEA 1I80A 4TVKA 4H31A 2YN2A 4URHA 3K4HA 3TGWA 4LXIA 1ZEJA 1S0UA 2DWUA 1X7XA 1LI4A 1R6AA 2AOUB 1NC3A 4EG6A 2ACVA 2ZJOA 2YUTA 2QE7A 5G1PA 4ZCQA 3RS8A 2GHTA 1RHUA 3DZ8A 1IDOA 2QPLA 2FPWA 2K7FA 1YQDA 4MGHA 4YBRA 3PHBE 4GC5A 1ZD2P 2G4LA 4YLGA 5T4FA 2LPMA 4QSHA 1DPFA 1W2GA 3ICPA 3PFWO 4IOJA 4C6TB 4OB6A 2HF8A 3N2YA 4D4IA 3D2CA 1XN1A 3PNSA 1FCJA 2H92A 4MQ6A 2G72A 1G3RA 1E6MA 4D9HA 5E2AA 1X86B 2R7KA 1HT2E 2AYYA 4A91A 4EPXA 5MHTA 5I8WA 1MAAA 3IQEA 3L77A 4R01A 1U1EA 1E60A 2OGUA 5KJ1A 1JFLA 4AFNA 1QRSA 1KMQA 1DB3A 2IXFA 1GWNA 3OZVA 5IJAA 3QTTA 4KE7A 4BL5A 4JUAA 2W2QA 3DV9A 4PSKA 1DJOA 3PKIA 5FPHA 5KYUA 1QCZA 1TJ3A 5HQ3B 2CD9A 4DDWA 3AZOA 3ZHBA 2EOAA 2B99A 2SCUB 3LNCA 3F5SA 4XTRA 2BMJA 3UWKA 3EW9A 3UJ3X 3W78A 3JVIA 1BQ4A 3C97A 5CG1A 1APBA 2RBGA 1UADA 1WR8A 5EC8A 4YAFA 4TSRA 4AU1A 4MS1B 4XPZA 1N4AA 1DE0A 1E99A 3V2HA 4OI2A 5HCNA 1HYQA 1WY5A 2VZ9A 3WL6A 3ZZ1A 1D07A 3WJ1A 1ATIA 3PUXA 2BCJQ 2H31A 5LA6B 3KVRA 3NIGB 1S2MA 4OCZA 1X13A 1R8QA 4FFBA 1IJFA 5KTYA 1NONA 3IULA 1M7HA 4F9GA 2R0QC 5IAKA 4M8LA 1YMVA 3WIBA 2Q6VA 3EQ7A 2YJTD 3L8YA 3MF4A 5DYNA 1DZIA 4FPXA 1Z56C 4XRGA 2X8JA 3EMVA 2WPDA 5BORA 2JBAB 1AN0A 1QIGA 1NN1A 3IOBA 5H81A 1CUWA 3TQIA 3U7HB 3OJOA 4KHPB 1QOPB 1U7XA 3KUCA 1N9GB 4D4HA 4DCTA 5HM6A 2H5JA 1I32A 2NQ2C 3AH8A 1UJ2A 3ENZA 3ELUA 4V0NA 4WESB 3A2KA 4NI5A 4OBBA 3O03A 5AIAA 4DQDA 3MJDA 1TTHA 5ALOA 2QZ4A 1N1GA 3DVQX 1QE5A 5JAQA 4QOFA 1R74A 1YRLA 4CF3A 3RTAA 1GZ6A 2XUGA 4TRJA 2W2KA 1L4BA 3QPUA 3MOIA 5GOZA 2AG1A 3TW0A 2RI0A 3O3NB 3W3AH 2DKNA 3BMOA 2VPXA 4U0KA 1Q12A 3T4UA 2XMSA 4DFDA 4X00A 5DH9A 2IS4A 4LHWA 3ITNA 4B17A 4OV6B 1Q6YA 3BXPA 3NHLA 5H3LA 5A7GA 1DC7A 1HURA 1GRRA 1LA2A 2R9VA 3OQJA 4L75A 3MT8A 4AJ1A 1JEOA 4E31A 3HO1A 3GJXC 1KOJA 1VZ3A 1UDAA 4G5SA 3VH4A 4GZMA 3RT1A 2QM8A 2IYQA 1GM5A 3QE0A 1WXGA 1P4AA 3D8TA 1EAMA 5LBUA 3HXTA 1NQVA 3O94A 2XUQA 4E5NA 3STYA 4ZKDA 5LU8A 2YR0A 1QE0A 2MINA 3NRBA 2I7TA 1ZP6A 1SRRA 1ZZEA 3EQZA 3O1LA 1TUEA 4HEHA 3ROKA 4CKWB 1WP4A 2IV2X 2EJVA 3IR7A 1L0BA 4A15A 4Q7JB 4OFWA 1GITA 1P4JA 2V7TA 2ZYGA 1QORA 3ZCQA 2FP4B 1FPQA 3H86A 4HLNA 3ZHCA 1E8NA 5TMPA 1W0CA 2A5GA 3T3PB 3N1UA 1HR0B 2VOJA 4YUVA 3S5UA 1DHRA 3FWKA 1KI9A 5T57A 3UPTA 1ZHHA 2ZB4A 1Y8CA 2C5EA 4M0LA 2HW8A 3U7FB 4PCVA 4PIPA 5E4JA 1SHLA 3CB2A 3ZZUA 1QX3A 1Y37A 5C8ZA 3QMWA 2GTHA 4NYIQ 2WM3A 3NBYC 1R8YA 2VAVA 3VR4H 1L4EA 1TU0A 1JG6A 1JHYA 3LBHA 3T15A 3M5WA 2BEWB 5I4IA 4RJIA 2QMHA 3RVBA 3C7CB 2IKQA 3GBSA 4MV3A 1FXWA 3THRA 3IQXA 1TAUA 3KLOA 3GOHA 1LV7A 2ZBRA 3OJXA 3D2AA 1NJFA 1MVOA 3K5WA 4G8DA 1UUFA 3J7TA 4GI2A 4EY8A 1DEHA 3KFXA 3WSVA 1RRVA 3QY9A 4AY2A 1G8AA 3P94A 4FM9A 4JYMA 2CBXA 1P9LA 4FOTA 1M83A 1GG2A 2M1ZA 1ZHFA 5A0FA 1PR1A 3V6LA 4IRUB 1ZVKA 1XDZA 3HB0A 2H3HA 4RZUA 4DA7A 1LSJA 4S05A 1BVUA 3UAOA 2Q29A 2M6SA 1EWVA 2PZLA 3FYCA 4Y2PA 2G9VA 4II7A 3RT7A 5H3HA 3Q7RA 4I3FA 3EW7A 1IB6A 2GKGA 1XRSB 4MQ4A 4MRSA 3CCFA 1SKUA 4TRRA 1V0JA 1K8YB 1D0SA 1PJAA 4WNAA 5JS7A 2ALJA 1AIPA 1A9XB 2HD4A 4H7IA 4LZNA 2YX1A 3SS9X 3GAFA 3CVWA 1AV7A 2IYUA 3DAGA 4TRMA 4B81A 2GKOA 3HJCA 3O91A 3VNRA 1FJXA 1L4FA 5BSFA 2VDKB 2EW1A 1Y9ZA 4FEEA 4WX2B 1U1CA 1XTTA 1ISHA 4PX3A 2IW3A 4V1CA 3P2OA 1A4RA 4QD3A 2W6JA 3R5TA 4FE7A 4KE9A 4CBVA 5FBVB 4QPCA 1XTJA 3U4AA 1Z2PX 3N3BC 1I6LA 4MP6A 4RHFA 3WIEA 1IWPB 1DO8A 1ZBQA 4AZWA 5ADWA 4NXNB 4PYJA 1XNRB 1GAJA 3OQIB 4H7HA 1BCRB 2TMDA 3HE3A 2DR2A 2GBPA 4FUQA 5KMGB 3A0RB 1NC1A 5TVGA 5HFAA 3GA5A 1ZKMA 3O93A 5F78A 1B41A 1QRRA 3JPYA 3DAPA 2II6A 1VL6A 2PZMA 1SD2A 3EN0A 3K6SB 1ISRA 4CR8A 4B6SA 3GLGB 2I4MA 3RAFC 2QX7A 3JATA 2B5OA 2CZGA 1JWLA 2PGJA 4B33A 4Q1DA 2ZBGA 4IRXA 3HDTA 3STHA 5ADVA 1L8QA 3LUDA 1U0TA 3K6RA 3L6RA 1JDNA 2GTIA 4J75A 4XYGA 4FCVA 5F35A 3A1CA 2QD2A 4KR9A 3RHSA 4TLMB 2E85A 1G19A 3COVA 3IUMA 5FB3A 3TQTA 1BCSB 5BNIA 3PITA 4AS1A 1ENPA 3OOEA 2O8DB 2GH1A 3CNEA 3DG9A 2DXIA 4NZMA 3KG2A 2WOOA 4HFMA 3H9CA 4MUMA 1WB5A 1FW6A 5FUYA 4WHMA 1XZDA 3AEZA 4MZXA 5DNAA 3W06A 2FQYA 2Z5VA 4B48A 3D6TB 5FRDA 2VJPA 3OF2A 5F12A 3KQTA 2WU8A 3ZV7A 4NBLA 3FNQA 1AZSC 3A6ZA 3I2FA 3T06B 3D3WA 1E8DA 4L5IA 2I03A 1BU8A 4JITA 1ZM7A 3ZHSA 1G3IA 4MS4A 3C15C 1JEQB 3AEKA 4OLJA 4KG7A 3HBLA 4Q39A 3VBEA 2DJIA 2JCSA 2AR9A 4L08A 1KK2A 3T3IA 2EW2A 4MVJF 4ALKA 4CKZA 1E0AA 4WJKB 4DARA 1RIIA 4L8GA 3IEIA 4KWHA 4CN9A 4EZEA 1R0XA 2XT9A 1YIDA 2WA2A 2ZB2A 3FNEA 4BBZA 3ZU4A 3OUUA 3L8ZA 4WY2A 3DDNA 3MNFA 1X1CA 5A4FS 1N9KA 3A06A 3FJOA 1G7TA 4IIFA 2RC6A 4FFRA 2YMQA 3D1VA 4JASB 3NV7A 3QITA 4E2XA 1K6IA 2P62A 4XZ3A 4H77A 2EJTA 2Y0EA 2GKSA 2J6IA 3AJ9A 2OCPA 4LTDA 4B3IA 1Z3IX 5BUCA 1OB5A 3H04A 4PCUA 1ZXLA 2G6TA 3ZVMA 1DDGA 2CLHB 5DULA 1MX1A 3ICCA 1KMHB 3QEAZ 2V0GA 4DC1A 3GH1A 4FWBA 4JJ6A 1RKBA 1W9HA 2YQ5A 2Z95A 4M1YA 4X54A 3W2IA 1TEZA 3OT1B 5JARA 2BYTA 2JIOA 3P9PA 5BSTA 4RKWA 3LVRE 4XDGA 3SDSA 4B3BA 1DBQA 1TJYA 1JALA 3CTPA 2AW5A 1L7NA 4NZPA 5AVOA 2JVJA 5BR7A 4NSNA 2B0CA 2AE2A 3ZV3A 3RG8A 4OGKA 1PUIA 4KQ2A 2ZI4A 5ED0A 4ASUA 4K9DA 3ZIDA 4D6PA 4PGHA 2P6RA 4NJEA 1CUHA 4UFPA 1XPUA 1MAHA 2X6TA 3FWYA 3I09A 3DHVA 1RJEA 1WHTB 3U1VA 1U3WA 3I2IA 4ZOEA 1NQAO 3ZWCA 1E6EA 2OD9A 3P9NA 3BWVA 2BSQA 5B4UA 1PGQA 2IGBA 4C7BA 1C3OB 3VO1A 2JJ8A 4EA6A 1OIVA 3HU3A 5G0SA 3AXTA 4DG9A 1B7GO 1O9BA 2RHHA 4YWJA 1C3JA 4HO1X 4LJRA 4Z7QB 2HWWA 4K28A 3UMFA 1A2KC 3GFBA 1CQPA 4UUQA 3ZTWA 4CUJA 5A2QA 5JMOA 3V4RA 2UUAB 1YKSA 1IHOA 4C0BA 4HDRB 3WYAA 4XX0B 5K20A 5D3MB 3FZGA 2J9GA 3I1IA 4O2BB 3KQYA 1FA9A 2HBZA 3HEMA 5IAAA 2WNHA 4FEYA 1MJNA 1K6XA 4YRIA 1YKFA 4Y6GB 3MGKA 3DOFA 1GPKA 2QMEA 3ZGOA 1AUXA 4NMWA 3W90A 2NACA 1W94A 3UOGA 3AUTA 4YJ3F 1U0OC 1GTZA 2WFLA 4NOKA 1Y1SA 4JBNA 1KJJA 4Y1EA 5D7BA 3TLCA 1A2BA 5JNTA 3E7DA 4N4AA 4INAA 1BRTA 3DCYA 3G5TA 4FN4A 4MYCA 3RV4A 4M6WB 4MW2A 5DNDA 1BHQ1 1ZCJA 1USIA 1KY2A 1JQJC 5FPQA 4CWAA 4R1LA 2R65A 3H2JA 4R8RA 3EIOA 1KOLA 1GAXA 4GKBA 2B4RO 1XYVA 2RGAA 2OL4A 3GPLA 2OKCA 4KQ1A 1N5MA 1ODLA 2LVBA 4W7HA 2VP6A 3ABRB 3IERA 2OCKA 3UJ6A 2H1SA 4B7XA 3RJ5A 2ZIWB 7AT1A 4DRXB 2W70A 1WX1A 3C4QA 1TVCA 4JUCA 4DMUB 1CUFA 4UQOA 4WKPA 1HRKA 3HV2A 3MUNA 4L51A 4AKEA 1RPNA 5CA1B 1GPBA 1MVNA 1CZOA 2AOXA 2GZAA 4HCJA 4W5HA 4QNMA 3GFRA 3EDQA 5HE8A 4MYHA 4WCFC 2C2GA 3M1AA 3QBVA 3LXRA 3O2JA 3EWNA 5FH9A 4WBNF 3WRYA 3GROA 3O95A 1RJGA 2YICA 4FR5A 5AJWA 3SXUB 2R6CA 4MJ3A 5DN6A 2SKDA 3WICA 2LCIA 3KUUA 2AQKA 2VP0A 4R6XA 3RWMB 2LWIA 3ABZA 2OCBA 3JAKB 5AKEA 3RHFA 4RORA 2GM4A 3EPHA 1ZI8A 3X1ZA 1AU9A 4F4IA 2WHRA 2GEVA 2BE7A 2FSPA 3LY7A 3M3HA 4GUAA 1C30A 2H52A 4GI3A 3W9SA 4F85A 3PEFA 2FETA 3EEIA 3PHHA 1KWKA 1ONNA 5IKOA 2AN3A 2ID7A 4P1ZA 1U0NA 1P80A 1AN9A 3B5EA 2PSJA 1WOYA 3V7YA 3ZY3A 4R8MA 4BVKA 4IICA 4O2AA 2VFAA 5EWJB 4AMYA 2IHZA 2FZGA 1SR8A 2Q2WA 4OP3A 2FN3A 3AP3A 4PFKA 1DUIA 1M34A 5CCXA 1JR2A 3L8DA 5TSDA 1QMPA 4N3CA 4AJEA 5AXAA 3KJZA 2IX9A 1F20A 1QVWA 4MDHA 4QGHA 5EKTA 2HOQA 4YRNA 4RF4A 4QTUB 1A0OA 3M1YA 4B3FX 1YMQA 1LQTA 3GO4A 3U13A 2VSYA 3NETA 1WUTA 3WQRA 3U40A 1PBTA 2ECKA 1MC4A 3EDCA 4DY4A 4ICIA 4QDUA 1KAGA 1MJFA 2JA1A 4MI3A 5ALLA 1GXSB 3R7SA 1TYZA 4YUAA 1XJWA 5CUQA 1ST2A 2ZE7A 1UAYA 1R0WA 1ZK2A 3R0QA 3M7IA 4C4ZA 2ZM6B 4ER5A 1J70A 3IGFA 2BCGY 2GVZC 2RH8A 1GLVA 5LKRA 5TJ9A 5CLJA 3VTZA 1XZKA 3CNHA 3H2GA 1VCMA 3LYUA 1JT2A 1DC8A 3SC4A 2H18A 2Q3EA 3GUHA 4RANA 1PFQA 4UPVA 3UH1A 1JDJA 3PFCA 4DUGA 1RKXA 1ZIDA 4ESEA 2DWQA 2VKQA 3GLFA 3PFHA 2Q2QA 4D43A 4IDBA 3B9BA 3R7AA 2Z6VA 2IHYA 1J97A 1W2WB 3A32A 3ONDA 5DHQA 3AI7A 5DCWA 3O7WA 4KR7A 3ZW7A 2B2XA 1C3EA 2HMSA 5C34B 4N54A 3L49A 4Z2YA 3DDUA 3R77A 5D84A 4AKGA 1TRHA 2VNAA 2I3ZA 4AN0A 2RB5A 4DV3B 4KWCA 1DUSA 4F6CA 3GGDA 3CKYA 3RKSA 3UOAB 5ALQA 2GERA 2GFHA 2PS9A 3R3XA 1SIBE 3WK9A 5L3QB 1XU4A 4QYTA 1Z3CA 4I50B 3U5ZB 1I3KA 1Q7EA 5KSZA 3O6VA 5FEMA 5DGXA 2IODA 1IEVA 1Q57A 1UBOS 3FDXA 3OTHA 4CNQA 4D4MA 5JJ5A 3FI9A 4X8LA 2ZIUB 3K0AB 1Y80A 1PDOA 1U2SA 1SXHA 3D81A 4AUEA 1OFGA 2FZCA 2JANA 3E22A 4QXMA 5K0TA 4IIVA 4Z3OA 5SZIA 3ND6A 5M5BA 4WY5A 4C89A 4XIJA 3Q5GA 3T5DA 3PPWA 1Z83A 4R2JA 3DAFA 4JLUA 1JBQA 5SY6A 1E77A 3K0CA 3QKWA 3ZG6A 2H7VA 4GWKA 4L57A 4PPFA 1ODTC 4HOYA 4ARZA 1G4HA 5A9TA 4QYXA 4G0VA 4KI7A 1KSFX 4MW4A 3HK2A 3CB4A 1B6GA 1UFQA 5ALFA 4EH1A 2AG6A 2OB1A 5BYAA 1UBJS 4LMPA 4IX9A 4I3GA 2MT9A 4DMGA 3TR0A 4CTMA 3C8HA 3HWX1 1GTVA 4QJBA 3EXIB 1DDIA 2ZRDA 5DDIP 1P39A 1TADA 2Q3MA 4MRMA 2FFHA 4HNUA 1V3UA 3ZDEA 2Z6UA 1TF7A 2HIHA 3MCAA 1EE9A 3B82A 3HUTA 4R4JA 1SGWA 4XVCA 4I1RA 3RSFA 2A9QA 4X97A 1MV5A 4PLFA 5TC4A 1O96B 2QJRA 3HKCA 4F96A 2WAMA 1VOTA 5DO9A 2CK3A 1V25A 2CXTA 4CG3A 1E3IA 3DTVA 1U9ZA 2OHIA 4YLYA 3TKYA 4O8ZA 4C2UA 1EFLA 3TCNA 2A9KA 1G2IA 1MNQA 2FWAA 2I65A 2QIPA 4GWLA 1A8QA 5CEJA 4GQBA 2I3BA 4HATA 1GN8A 1YK1A 4KH1A 1SPBS 2OYSA 3QG1A 4BPRA 1YDGA 3JALA 3FYUC 1I2DA 1N2HA 1YJCA 5HJ5A 2KW5A 1HO3A 3IKTA 1V8OA 3AO0B 3KUXA 4Q9DA 1L4UA 3G0IA 3SHTA 3D6NB 3AOEA 5LQSA 2GCOA 2Y76A 3DE6X 5T64A 3UK7A 2HMYB 2YWCA 2HT1A 1C0EA 1WHSA 3BH0A 3OO0A 5FOTA 5A6SA 8GPBA 5JV5A 1BDJA 3E2PA 2D5CA 1P1HA 3TJZA 2GESA 3DDZX 4C4SA 1IZYA 3K2QA 3ZNPA 1AUOA 4AJ4A 1ZHOA 1E1RA 1EDEA 1EJ6A 3GDOA 4PE5B 4ZCRA 1E2KA 1EHYA 1MUUA 5AW7A 4KX3A 5ITVA 1RCTE 4AYWA 4HTFA 2JH8A 2WJ3A 4C14A 1E5XA 3HNRA 3NORA 1Y3DE 3IS3A 5FUVA 3WHPA 3X1MA 4M7WA 3C7AA 1J2JA 3RROA 1GD1O 1KY3A 1V8ZA 4DRZA 2NSYA 3N2IA 3GVPA 5FOXA 5HOQA 3RS0A 4ZGBA 4V03A 3KAQA 3DP7A 2ZIXA 3KQQA 4ZI2A 4L3VA 4H7PA 3GEEA 2VSNA 2XT6A 4TMWA 4TYPA 4U7FA 1FSZA 3V2GA 3WLMA 1QXSA 3ZTYA 5HJ2A 1VRVA 2GUGA 3QNWA 4GZLA 1NWCA 3IVAA 1A72A 2J32A 4P4SB 4XIGS 3WRWA 1MW8X 1OILA 4EI9A 2CVFA 3CEAA 3D7KA 2JAUA 5CH8A 2PR7A 4JIMA 5EPUA 2G08A 4Y2TA 3OO1A 5E9AA 3RRBA 4DNXA 4ZQCB 2P3LA 3UGJA 1N0IA 1U2TA 2BMWA 4U9UA 3A9SA 4IV0A 4PSDA 3AM4A 3AJ8A 4BTEA 3RTGA 1Z6ZA 3PRHA 4PG4A 3FWZA 2DUMA 5A3QA 1XC7A 4B3GA 1F3LA 1GGKA 2P8JA 3KV3O 1KI6B 3MT0A 6ABPA 1AT1A 3VDMA 1SBHA 3X1KA 1X8JA 3MXTA 5CA0F 4JVSB 4JXKA 1WETA 4D25A 1CUBA 4AZTA 2VJMA 5JPDA 5KQMA 1XCMA 4B3CA 1LPOA 4KQWA 2I4RA 1ADYA 3ZV5A 3MPOA 4LJ9A 1V9LA 2WHQA 4AIRA 1ZI9A 2F17A 1Q77A 2VWQA 5AI0A 2WYOA 3RTCA 1YFLA 1CRQA 1V9CA 4JJ8A 5B2ZA 4U7JA 3ZQ4A 2EFHB 2WSMA 1QYWA 2QE7D 2C31A 3BDAA 1ZUNA 1J8QA 4GR5A 4D8XA 2WUEA 1NULA 2V58A 2CJYA 1ZWKA 3GRYA 5HE9A 4RMIA 2HCJB 2FDRA 3K1AB 1FXSA 1T0BA 2Y6VA 3BEDA 4KGXA 2CVPA 2WD8A 2ZTHA 2YXEA 1G38A 5ILQA 1VE1A 2C4HA 5C1OA 3ZKWA 3L18A 1JKMA 4WAUA 2IEAA 3OQ6A 2YZNA 4LE0A 4NJOA 5HXAA 5FI0B 4A5SA 3AXSA 7REQB 2QI9F 1KJYA 2CHUA 3ZXUB 1OFIA 4GMHA 4NYIR 4DIFA 3F73A 3OQPA 3KYDB 1N75A 1YMUA 1AA6A 4S1WA 4R3WA 4QJ3A 3JQ9C 4DGQA 4CR7A 1J06A 3TTXA 4CKCB 2LNDA 4GGPA 3AVYA 1JKJA 3MIIA 1EGVB 1XP5A 5DWVA 4O4JB 3FROA 1USWA 2F3UA 3E4CA 3IKJA 2OGWA 2P8SA 1Y5LA 4CQMA 3LY8A 2QUKA 3P9QA 4A5OA 3K71B 4PRLA 1T4GA 3GRUA 4POAA 5EEHA 3S1AB 2XTNA 1GZDA 3FCEA 3OPYA 2VRBA 3F5MA 2XB9A 3A26A 1VHJA 3TTYA 4YT8A 1ZY2A 2IYWA 2QRUA 1R0BA 5T8KA 1YJBA 2W0SA 2DLCX 1X8LA 4YO7A 4TVBA 1GUZA 1MRSA 1XPRA 4K8RB 4N47A 1P6XA 2VHXA 3ZWPA 2RAPA 1LDGA 2FRDC 1YXMA 1A76A 4EPYA 3PR2B 4ENWA 3IOYA 5EKUA 2BFMA 3KTAB 4IMIB 1PI3A 2WF8A 2FR1A 3HXKA 4W9NC 4DQXA 5AVTA 2PAFA 1KI3A 4DNFA 4NBWA 3D6MA 4MCJA 1MPTA 3KAJA 4JIGA 3LQQA 5BQOA 3V34A 5BRAA 1GPAA 4MKIA 3OKPA 2WPDD 1LSSA 3LYLA 3F6CA 1OYYA 1QANA 4IUDS 1YBFA 1RJFA 2QRPA 3I4CA 2NAPA 1PS8A 3E7WA 4YP9A 3WIUA 3X2EA 1KZ7B 5EMNA 4YR7A 5I51A 3JQ7B 4MZDA 4CIBA 2WYHA 4RGQA 1SNYA 3NR2A 4AG5A 5CEFA 3TE7A 3BSWA 3VJRA 3VC2A 2ODBA 1LPBB 4JYAB 1QZXA 3HYTA 1RXCA 3H9QA 4R9SA 1AVTA 3IHWA 1FXUA 4CEJB 3T1NA 4URZR 3TD9A 1L7MA 2BSAA 2W0MA 4K6CA 3M4ZA 3RUPA 1H5QA 4B2PA 3UK2A 2GCNA 3PXDA 4ZJUA 1WZUA 3G9ZA 5CCDA 4ZI3A 2B92A 3I2YX 3U37A 3ER8A 1JHOA 1U28A 4AJHA 2O8FA 1CUVA 4KXYA 2BDEA 2XA9A 5REQA 4CQLA 1NBHA 3F2IA 4EDHA 4C2BA 3SIPA 2IYEA 3IFSA 3QX8A 4BO6A 5KC9A 2Q46A 3RI3A 4G01B 4XIIA 3VYVA 4C06A 4MVCA 3BREA 5T6MA 3VV2A 1CIPA 3GYGA 1QP4A 5IRCD 3VTFA 9MHTA 1ECFA 2VO1A 4JEUA 3N75A 4JFRA 5KOIA 2VDPB 4PPGA 5E4YA 2QTFA 4HFJA 4LK3A 1CUCA 3HQ4O 2JFQA 5KJEA 1S02A 4REOA 2GA8A 2IDMA 3PNOA 5BMVF 2IPMA 4ZI5A 3W1VA 4AF6A 4F21A 3FCXA 3MMSA 1IBSA 3UH0A 1AG9A 1NRWA 3L8CA 3LIPA 3PPXA 4GMKA 4P31A 3OFVA 4KSYA 1VRWA 2MMCA 1AQYA 4JP1A 2YH2A 1NDHA 2AMYA 1RAEA 2DWPA 3EGWA 4J2TA 4UARA 4WSOA 1X1BA 2DFDA 3C45A 4G0YA 3DOOA 4PQGA 1YI8A 2Q6TA 4AECA 2OBFA 4F3KA 1DCFA 4ZFNA 3HSSA 3SM3A 1MX9A 3G3EA 2EX0A 3KSUA 4OP1A 1GDHA 1U8XX 1EWQA 2XQGA 2BEJA 2FFQA