2QVBA

Crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
296
Chain Sequence
FGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase 3
publication title X-ray crystal structure of Mycobacterium tuberculosis haloalkane dehalogenase Rv2579.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 113
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qvbA00
3GELA 1DINA 1UKBA 1GPNA 1Q84A 2VATA 3R3UA 4X6XA 4CIBA 1EK1A 1Y7HA 3RK4A 2XMGA 4B0OA 4CFSA 4WFIA 2QXTA 1CIJA 3AFIA 1G4HA 4WDRA 4AN0A 3C45A 1ZI9A 4G9GA 4OCZA 4HVTA 2C5FA 1TCBA 5DYWA 4KE9A 4Y7DA 4AX4A 4AMYA 4CCYB 5K3BA 4J0HA 1W76A 1QFSA 1LPBB 3WK9A 5CTAA 1VKHA 2HFKA 3D0KA 3AIOA 2OGTA 3O0DA 2DCMA 4AO7A 3ZLVA 3LP5A 4KAFA 5JAOA 5KREA 3WIOA 1DQYA 3H1BA 1XZLA 2VJDA 2QS9A 4A16A 4B85A 2XMSA 5DNUA 2R11A 2WJ3A 4HRXA 4YK7A 2OCIA 2X5XA 2UZ0A 4XX1A 4B80A 3OURA 4AXBA 1K63A 1ZD4A 2HRQA 5LZ4A 2WIDA 2XLCA 3DS8A 3PUHA 4QEKA 5ALKA 5K3EA 5FDFA 2H9YA 4C89A 4H0CA 1CUBA 1BN7A 1FSSA 1W1IA 5HKAA 5KWJA 3D2BA 1ZOIA 3W2TA 2Z8XA 1KU6A 4Y2SA 4N8SA 4PW0A 2XQGA 5ALGA 3QZUA 1WOMA 4BRZA 3SC2A 1WM1A 1WCYA 4FWBA 1UK6A 2O2GA 4BC0A 1CUDA 1GQSA 3EQ9A 4BAUA 1RWQA 3ZPXA 1TCCA 3QBJA 2C7BA 5LKRA 4ZV7A 4DMFA 1FJ2A 1VJ5A 5K3AA 4LIPD 3WWPA 4AN1A 1JJFA 1DWQA 4BCCA 3SWWA 1XROA 5IKXA 1XZMA 1MX1A 2PSDA 1OCEA 1CVLA 2OAGA 2IIVA 3I1IA 1IUOA 3WKEA 1QO9A 2HA6A 3IIIA 1BS9A 1F8UA 4UBKA 3GROA 4RNCA 1E89A 4BVKA 3KWJA 1PFQA 3IA2A 5A62A 1LPAB 3FOBA 3FNBA 3GFFA 4QDTA 4GECA 1X2BA 1E8MA 5LZ2A 1XZDA 4C4XA 2YYSA 1E8NA 3I2HA 3HEAA 4K5QA 4BDTA 4OSEA 1FFBA 1O6FA 2CKMA 3D3NA 4CCWA 4J7AA 2WUEA 3STWA 3ZLUA 5LZ7A 3AZPA 2D5LA 2ZJ7A 5YASA 1LPOA 5CT4A 3F67A 3QYJA 4AMZA 3E3AA 4E11A 4X95A 4E15A 3I6ZA 2XUAA 4BRSA 4H7EA 1B6GA 3FYUB 3G8YA 3BL8A 1A7UA 1DX4A 2DSNA 1A8SA 4X6YA 3R41A 1THTA 4BVLA 2P8SA 5AM3A 3VJMA 5T4BA 4W1SA 3W06A 5LZ5A 2GBFA 2JF0A 2AJ8A 3U1TA 3A70A 4CCYA 5AH0A 3FLAA 4X90A 1LBTA 1UFOA 4U2GA 1BROA 1DTEA 3DOIA 3HYSA 5DTJA 5CW2A 1CUZA 4X93A 3WK7A 2HM7A 1J07A 1DQZA 2XE4A 4H7IA 4UUQA 1H23A 1VZ3A 1WB4A 1CRLA 2RAUA 5LZ8A 4HAIA 4UHEA 2XQJA 4MYDA 2HIHA 4H7HA 3WL7A 2V96A 2XQKA 2DHEA 3W05A 4ETWA 4F60A 1XRRA 4EHBA 2D0DA 1RYYA 5CT9A 3HSSA 3G7NA 1Q0RA 4WJLA 3QPAA 2C58A 3EQ7A 4HTAA 4UBMA 2XUOA 2WIGA 3V48A 2HU5A 2GZRA 4Y9SA 1CUWA 2OCLA 3DCNA 3BF7A 2ROQA 2QVBA 5AKKA 5JADA 1A8QA 2PUJA 4DTCA 5EIHA 1VA4A 1Z68A 5E2IA 3WA6A 2VEOA 2FUKA 2ECFA 1HL7A 3WMRA 1SCKA 5JD6A 2WTMA 4J0JA 5FXMA 3WKDA 1R88A 2EDCA 1VE7A 3PI6A 1WB5A 3VVMA 4OPMA 2XUDA 5HCUA 1EINA 2XUJA 3G0IA 4UFPA 1JI3A 5C8ZA 4I19A 4Y2TA 2QM0A 3WL8A 4J3JA 5FUMA 4LHEA 5KWIA 4PSDA 1TIBA 2HDWA 1GT6A 4PSUA 2C0PA 2QR5A 3KOOA 3I2FA 3HJUA 4MXDA 4F21A 1T2NA 1GXSA 1N8SA 2QTBA 2HA0A 2JEYA 4Q3OA 2RGUA 1U2EA 1VOTA 3F98A 4BCDA 3O9VA 1BCRA 2OLEA 3JYHA 1LGYA 2ZYSA 2H7CA 2HA4A 4BC1A 4WFJA 2B4KA 5HF5A 3WWDA 2W22A 3DYIA 2OQIA 1EDBA 2CJPA 2X76A 2V97A 2JGLA 4G1FA 3FVTA 2BJHA 1IUNA 1UK7A 3ESBA 3CCBA 2HFJA 3LCRA 2VF2A 4HZGA 2Y2VA 3I1YA 3AZOA 3H2JA 1MAAA 3G02A 3VJKA 2XMZA 1YASA 3ANTA 4KR0A 1YS1X 1ORVA 1VLQA 2XMRA 5AK6A 3U0VA 2ZSHA 4UFNA 3HRHA 5ALSA 1W52X 4I3FA 2CUTA 5ALTA 1ZD3A 3EBLA 5EHXA 4P92A 1VXRA 3GA7A 5IH7A 1TKRA 1Q0ZA 2RONA 2W6CX 4Y2JA 5HQ3A 2ES4A 3QMMA 1E8DA 1QJ4A 4WY8A 2VJBA 1ACLA 1DT3A 1M33A 5JASA 2XMCA 4KE7A 4C87A 3O95A 3I6YA 1AUOA 1QTIA 1UK9A 1XQXA 5J3JA 5AOAA 2G63A 1D07A 4XVCA 1CPYA 5JAPA 4JYPA 4UBNA 1EVQA 4BBZA 2QT9A 4FKBA 4JUIA 5LLSA 1XRMA 3AINA 3X3HA 3STXA 4XJVA 5ALNA 5IVHA 4KACA 2PL5A 2Z8ZA 4UHFA 2CMFA 3ICVA 5AKHA 4M0EA 4A23A 2YXPX 2BFNA 2AJCA 3CN7A 4G4GA 3KDAA 1CUXA 1XZCA 3DDUA 5HF6A 5AI9A 3WIBA 4LXHA 5DJ5A 4BTVA 4B9EA 5JAHA 3F9CA 4MYSA 4HRYA 1GQRA 3WZLA 3WWEA 5ALDA 2PPLA 2WJ6A 3DYVA 2JGMA 4FOLA 3VVLA 2VJAA 3L1JA 4QLAA 4ZV9A 1XFDA 5AKLA 3F96A 3PFCA 1OXMA 1HQDA 3O4GA 1YB6A 2J3DA 5KBYA 3HABA 4ROTA 3N2ZB 4X71A 2Z3ZA 1JJIA 2OXEA 2Y6UA 3D2AA 4LXGA 5D3ZA 2Z5GA 5AM1A 4UBOA 3BWXA 1H2ZA 1TCAA 1NU6A 4B7ZA 4IH1A 1XZEA 2NW6A 2WQZA 1FFCA 5HK8A 1BE0A 5EIEA 1QZ3A 1ACJA 3OG9A 1E3QA 3BXPA 4LKOA 4OYYA 4B81A 2PSFA 3FSGA 4AO6A 3SK0A 4KAAA 4GHWA 4HXGA 4C01A 4DNOA 1ZJ5A 3STVA 1QIFA 2VQ6A 1SC9A 2WIJA 1WHSA 1XQYA 3H0CA 3HACA 5CH3A 4CIAA 1ORWA 2BGNA 3DKRA 4K6HA 5HF9A 3WKAA 2FX5A 1YA4A 3HC7A 2QUBA 2XQFA 3A2MA 4QDUA 1UK8A 5AI8A 5AHXA 1JU3A 1L7RA 2Y2UA 3KD2A 1EHYA 2ZVDA 3M81A 3R3ZA 5FPQA 3PF8A 2Y1KA 1MNAA 1Y37A 3P2MA 4Y2RA 1J2EA 2WFZA 4L72A 2WIKA 1PV1A 1AMNA 3VDXA 1CQWA 1EK2A 4JYMA 1TK3A 4ZI5A 3VISA 4AZ0A 1Y7IA 3W04A 3VKFA 4WY5A 1XLWA 2HU7A 5T4HA 3ZWQA 3HXKA 1G5FA 2DFPA 1ODCA 4EBBA 3WLAA 5JALA 4CG2A 3D7RA 3EF3A 4Y2UA 1IZ7A 1ZIXA 3R40A 1R4ZA 4OU5A 4QDOA 3DLTA 5DLPA 4MEBA 1SFRA 2OG1A 4EZIA 4G8CA 1AX9A 4BZZA 1P0QA 3GZJA 3H2GA 1XQWA 1CV2A 3QVMA 4J0KA 5LYYA 5AM5A 4Q1VA 3WWOA 2OGSA 4QE3A 1ETHA 1AQLA 1NX9A 4V2IA 1QO7A 3RLIA 3ED1A 3STTA 4UBIA 5IVKA 4DGQA 4JNCA 4MWTA 4GW3A 3E0XA 5ALUA 1AURA 1HLGA 2Z3WA 1QIMA 4UFOA 2Y6VA 2B61A 4C4YA 2BUAA 3V9AA 5LIPA 5LZ9A 1CUVA 2WM2A 3RM3A 3PFBA 2I03A 5FRDA 5T4FA 3S2ZA 2WFLA 5AK3A 1SCIA 2VAXA 2XI4A 2XUQA 5AI6A 5AI5A 4P08A 2R8BA 4MEAA 3L1IA 1TAHA 3I28A 1C7JA 4H35A 4Q05A 4F0JA 4KEAA 2GBCA 4RE6A 5D3KA 2DQYA 1MJ5A 4IQ4A 3WA7A 2QXUA 5ALLA 1QGED 5EI5A 5AM2A 1LPNA 5HQ3B 2V98A 3R3YA 4LXIA 1CR6A 2BKLA 3QITA 2HRRA 3WJ1A 4B0PA 5A6VA 1LPPA 3WL5A 4EY6A 2CEKA 4KYVA 1YS2X 4CG1A 4AQDA 1EA5A 1R9MA 2O2HA 4BE9A 1F6WA 4U2EA 3C5VA 5AKJA 4KRYA 4PO3X 1R50A 4J0IA 3I2IA 4PSCA 2GYVA 3DL4A 3H2IA 1CUYA 3AILA 2XMQA 4QDZA 1LBSA 3FSGD 1T4MA 4ARAA 3T52A 3AUKA 4MJ3A 3DJYA 1BRTA 2DHCA 1VE6A 5CT8A 5DYTA 4FBLA 5DTIA 4G5XA 4D9JA 4B82A 1J1IA 1LZKA 4J0CA 4W1PA 4WCVA 1N5RA 1YAJA 2GBIA 4TVKA 4ZREA 3ESCA 3IUMA 4BP8A 5ALZA 3TGLA 3ILSA 4OYLA 2G5PA 1CUHA 3BDIA 2AXEA 4S0XA 4MQLA 1J06A 1JKMA 1GPLA 3WQHA 2YH2A 4TGLA 5AM4A 5BWBA 5ISMA 5JZBA 2OCGA 2WTNA 4K2AA 3PE6A 3LIPA 1YB7A 2ACEA 1U8EA 2VT6A 1K5PA 5JANA 3MGAA 5ALXA 4W1RA 4OB6A 2GYWA 2WUDA 2BGRA 4X92A 4C88A 3WKCA 3FVRA 2XUGA 1CUJA 1MAHA 4FDMA 5I7UA 4C4ZA 1R9NA 1L7QA 1EB8A 2XDWA 2GBGA 5JAUA 4DMHA 3WI7A 4XIIA 1SOMA 2AJDA 5FOQA 3AZQA 4BP9A 1U65A 2QJWA 5JYCA 3TRDA 1JMYA 1XZKA 4BZWA 3DKKA 1W6RA 2WU4A 5HFNA 1IZ8A 4BATA 1DT5A 4KAJA 2QOEA 3STYA 4N5IX 3ICWA 4U2DA 5D7BA 3G0BA 4G8DA 4DIUA 3BJRA 4X00A 4CG3A 4U2FA 2HL6A 2WKWA 1FFEA 3OOSA 4Q3KA 1WHTA 3A2NA 2WHPA 4XWGA 3FCXA 5K3FB 5AOCA 3I2GA 5AKXA 5JZSA 1MX9A 2XLBA 4P9NA 3AJAA 4X94A 2IX9A 1ZGCA 2CBGA 2WG2A 4H7KA 2O7VA 2PBLA 3B5EA 2BUBA 4DNFA 3K6KA 4W63A 1XRQA 2VSQA 5AP9A 2WJ4A 3I2JA 4UBJA 4Y2QA 5ALVA 1UOPA 1ZI8A 1L7AA 5AKZA 1JJBA 2DHDA 3AIKA 1QOZA 5A71A 3M3DA 3QPDA 1EH5A 4FBMA 2JIDA 1HBJA 1HPLA 2I78A 3DQZA 3QM1A 3ZV7A 3D5EA 1JT2A 3IUJA 1HKHA 2CB9A 1A8UA 4OUKX 3CN9A 1AGYA 2ZSIA 3PF9A 3A2LA 5D6OA 4W1QA 3G0GA 4H7FA 3IB3A 1LLFA 4JH0A 1I6WA 4U2CA 2JGJA 1LPMA 4MWSA 3EIOA 4G4IA 2ONCA 1BN6A 5F4ZA 3PICA 1QIGA 4IO0A 1QE3A 4J03A 1XZBA 1JU4A 4LYDA 1WPRA 2G4LA 5CH8A 3H17A 5AKEA 3I2KA 4OU4A 5IVIA 4BE4A 1YSCA 4BAGA 3OC0A 1CUSA 1VZ2A 4NS4A 3LS2A 1EDDA 4BDSA 1B41A 2AJBA 4RE5A 1ZICA 1O6GA 5DNWA 3R3VA 3WL6A 2JGEA 2HU8A 4AZ3A 2WU3A 3YASA 3C70A 3DOHA 1BCSA 3FYUC 2QMQA 5SYNA 2C0QA 4RGYA 1G66A 2WFLB 3W9BA 4GDMA 5DNVA 2PSHA 3IULA 5JZ9A 2G5TA 3TJMA 2V9ZA 2PSJA 3FLEA 5C81A 3N0TA 1UKAA 4FHZA 2OCKA 4QWWA 5I8PA 1DU4A 1JMKC 1NU8A 3H19A 4L3WA 5EFZA 3TEJA 3C6ZA 3ESDA 4FNMA 1ISPA 2VTVA 1W4LA 3C6BA 3B12A 1CUCA 4TPKA 4I4CA 1K8QA 4IHAA 3L1HA 2XQIA 1AKNA 3A6ZA 2HHAA 4HXFB 3VXKA 3F97A 1GGVA 2QKYA 3SX4A 5AKIA 3C87A 4OD0A 1LNSA 1QTRA 5HFAA 2I3ZA 2JGIA 1DWPA 4LYEA 3WJ2A 4UBLA 2OAEA 3UMJA 1CFJA 5A2GA 5FLKA 4YASA 1XRNA 1GKKA 5ALHA 4QNNA 3G9XA 1IVYA 5ALPA 4QA9A 5K3FA 5ALJA 5AI4A 1QIDA 3BE8A 2EDAA 3DL7A 4QZVA 3NGMA 2GYUA 2HA2A 2J4CA 2WIFA 1MU0A 4H7JA 4ITVA 4BTLA 5SYMA 3BIXA 4BAZA 4KJXA 4X7BA 2J4FA 1XRLA 5CMLA 1GKLA 1YCDA 3IDAA 1GZ7A 1QIIA 5ALIA 2JBWA 3C6XA 2XMDA 3C8HA 4W9RA 2IITA 2E3JA 4WDQA 5CBKA 5EHZA 1QIEA 2ZJFA 1ZI6A 1C7IA 3C43A 5CRIA 5DYYA 4Y2YA 2PX6A 1EVEA 5FPPA 3H18A 2HADA 1VXOA 4EA6A 5T4EA 4B83A 4FLEA 5ALMA 3T4UA 2XUFA 4DM7A 1UZAA 4ZGBA 4FFVA 3H2KA 5I9IA 1G42A 2QUAA 4UHCA 3IVMA 4F5ZA 1LZLA 5A7HA 4M0FA 3UUFA 3HZOA 3MUOA 1ODTC 4PF1A 2XUIA 3STUA 1FFAA 3GBSA 3OTQA 1UXOA 4GWLA 4KE8A 5EGNA 1N1MA 2O2IA 1QIJA 3CXUA 2VAVA 1CEXA 5AIAA 1N5MA 5BOVA 4NVRA 2H1IA 1QFMA 5K3DA 1XZIA 1DWOA 2FJPA 2XB6A 5CH5A 1MX5A 1AC5A 3W9UA 3WK4A 5K5EA 3G9TA 3I6MA 5FV4A 2ZYRA 3WKBA 4AO8A 3G9ZA 1E5TA 5AJHA 2PKYX 4GXNA 1XLVA 2ZJ6A 4E46A 3DD5A 2PSEA 5ALYA 4DSZA 5ESRA 1MPXA 4GBGA 3BDVA 3K2IA 1CUAA 4DNPA 3C6YA 3ANSA 4EUSA 3BJMA 2GZSA 2OGZA 1XKTA 2WHPB 3NUZA 7YASA 4M0MA 1A88A 2Q0XA 3OM8A 4EY4A 5C7YA 3O9MA 1XZJA 4BYMA 2WG1A 2CZQA 1H2XA 4O08A 1AZWA 2WHQA 1SCQA 1QONA 5JATA 5C8VA 3GUUA 1EI9A 1H2WA 2VA9A 3AIMA 4BVJA 1X70A 5IVDA 2B9VA 1F0PA 3QH4A 4Q3LA 2OQVA 1VA5A 2QZPA 1BEEA 1XRPA 1CUEA 5EHQA 3R3XA 4PQEA 3KXPA 3M82A 3BIWA 4K6GA 4ZWNA 3DNMA 1P0IA 3V1MA 1KEZA 3VJLA 4FMPA 3C5WP 1HDEA 3G0CA 1UWCA 2RHTA 4PNZA 2XT0A 3QPCA 1R3DA 4X3CA 4G8BA 4GI1A 1BU8A 4IH9A 3WK5A 3E1GA 3ZI7A 5E4TA 1R1DA 2DR0A 3IUQA 2VT7A 1YR2A 3NWOA 5ALOA 2PM8A 1UOOA 3PUIA 3BF8A 4MQMA 4NZZA 3WK6A 4Y2PA 3JW8A 4N5HX 5BV7A 2WSLA 2XMBA 1U4NA 4BB0A 4KRXA 4H77A 1K4YA 2X8BA 2JEZA 4PV7A 2ACKA 3E4DA 1S8OA 4G9EA 4Y2XA 1XZFA 5CURA 4QWMA 2I3DA 5A7FA 4L0CA 1ZJ4A 2RI6A 5EIAA 4A5SA 2XUHA 1USWA 4KE6A 4N8DA 4C6HA 1MTZA 3MVEA 1F0NA 4X85A 4Q82A 4QLOA 2WFMA 2FJ0A 1QIHA 4E14A 4X91A 4GLBA 4HS9A 4GEGA 1MNQA 4EY8A 2DQZA 1EXWA 4FFWA 2XUKA 3O4JA 2YASA 3PDCA 4JEIA 4B6GA 3WZMA 4H18A 3IUNA 3HLKA 5AK4A 1KU0A 4QDXA 3H1AA 3D59A 1QLWA 3JWEA 3IURA 1E66A 4FTWA 2JGKA 3V1KA 1XZHA 5ALRA 1K6EA 4CI9A 4EY5A 4ARBA 3RARA 3HI4A 1PJAA 4K6KA 4UHDA 1Q83A 3R0VA 3WK8A 5BWCA 3H2HA 1WPXA 1MT3A 1CQZA 1JFRA 3K9BA 3O4HA 5JARA 1UKCA 4H7DA 2WG0A 5E4YA 4DYHA 4Z49A 3FBWA 1MO2A 3F8SA 5E4JA 2OPHA 1CUGA 5LKAA 5JD5A 2XUPA 1LPSA 3R3WA 2HA5A 3RKSA 5AM0A 1MN6A 1IUPA 3FYTA 2BAGA 2B20A 3H04A 3Q0TA 5AOBA 5ALQA 1EB9A 4FNGA 5CXXA 1FFDA 1CUIA 3ZLTA 3EQ8A 4DLNA 3C8DA 3G0DA 1C4XA 5ALFA 2PUHA 3QMVA 1CUFA 5JD4A 2J3QA 2QJRA 5HZGA 3FYUA 1THGA 4YX9A 4NMWA 4YPVA 1GPKA 1RP1A 4J0GA 1WB6A 2ZYHA 1DX6A 5K3CA 4UHBA 2ORYA 5HKBA 5CXUA 2RHWA 4BCBA 1X2EA 3NOXA 4B9AA 2RIPA 4INZA 2JGFA 3V1LA 2HA7A 4Q34A 4N8EA 5HK9A 4DMKA 5A7GA 3D2CA 3D4LA 2LIPA 2EEPA 5H3HA 4DMCA 3WYNA 3G9UA 1ZGBA 5ALEA 2AJLI 4X6UA 1XZAA 1P0PA 2WILA 3B3QA 3OPMA 4RPCA 2WUGA 4WFKA 5C8XA 2PVSA 2PU7A 1YA8A 4P93A 2C4HA 2BCEA 1UOQA 2QRUA 3DEAA 3S8YA 4AB1A 2ZYIA 4EB0A 1IMJA 1CLEA 4B84A 2H7YA 3KSRA 1OILA 2WUFA 4UPDA 1W75A 5AKGA 3WYDA 1XKLA 3FWHA 1ZD2P 3Q8WA 2WLSA 3LIIA 6YASA 2O7RA 3WWCA 1EDEA 3FAKA 5CT6A 2C5GA 3MUNA 4OB7A 1H22A 2K2QB 1TQHA 1XZGA 4DNQA 4UHHA 1YAHA 3IBTA 4U2BA 3FLBA 4DSAA 1ODSA 2WHRA 3M83A 4ZXFA 5HF8A 5FP0A 4X97A 4HXEB 1TRHA 3CCCA 1P0MA 5EHNA 4IH4A 4FLMA 2HA3A 3V1NA 1BEZA 4L9AA 1XLUA 3O4IA 5FKJA 2BUCA 2H7XA 5DWDA 1CUUA 4ZRDA 5AICA 4J0DA 1ZIYA 1ZD5A 3UUEA 5CT5A 1H2YA 1UT6A 2PU5A 5ALWA 1EX9A 5JIBA 5AI0A 4EY7A 1QIKA 5AIBA 1XQVA 3LLCA 4Y2VA 5AK5A 5AO9A 3KWFA 4OB8A 5LP1A 2VJCA 4G4JA 3FCYA 3QMWA 4FLFA 5AKYA 3ESAA
chains in the Genus database with same CATH superfamily
2VJOA 2VRNA 2DJIA 3I4LA 3ZKWB 1ID8A 5K4AA 4FXPA 1FNNA 1Y7PA 3KVVA 2P5UA 2CLEB 3IYLW 3C1UA 1Y8AA 3CYFA 4WERA 4D4HA 1Q84A 4O59O 1FQJA 2RGNA 2AD5A 1YWGO 3K0HA 4L50A 2QRHA 2I55A 2UYGA 4UD2A 2GCOB 1J99A 3R3UA 4BIIA 3C7KA 4F7WA 1B6RA 1G9SA 1HZJA 1S5PA 3PDWA 4B40A 4CIBA 5JSFA 1Y7HA 1F48A 4JKYA 5MN5A 1RLUA 4A7PA 4ENQA 2XMGA 3NBAA 1G8HA 2WJZB 4WFIA 1RXWA 3LJKA 1CIJA 3OP4A 3PQ8A 1ZKDA 3B78A 2ZIZA 2H5LA 4WOCA 2YZNA 2ZVQX 3AR6A 3P1JA 2DKOA 2SCUA 3KR1A 4AN0A 3LVQE 2TS1A 3BUSA 2MYUA 3DZFA 3GLHE 2HF8A 4XSVA 2C2MA 4M1SA 1PWYE 3OF3A 5DYWA 4EUFA 1XCBA 5G4LA 1IN4A 1FUEA 4ZI7A 1J2YA 3OBBA 4IJQA 4M1MA 3I9MA 3ZGVA 4ZT4A 4DCUA 5IYZA 2P6OA 4RIHA 3FIJA 3FM9A 1E1RD 4BXOB 3AEUA 1WMDA 5DHUA 2ZPAA 3E3MA 5K3BA 4CCYB 1U0EA 2DT5A 4IIJF 4Z9FA 1E7WA 1LPBB 4HZIA 1P5HA 2Q3HA 1WU8A 5LP6F 3WK9A 2BHTA 2V7WA 3DO5A 1W0KA 3AWDA 1N25A 3F5QA 4HPWA 5BN5B 4HNUA 2IU6A 5ITWA 2AEJA 3VAAA 1E6MA 1PZFA 1C7QA 5DN6A 4EGSA 2I3BA 2RK3A 3CRRA 3TW0A 2W0SA 2B30A 4UVHA 2ISSD 4U1RA 4FUTA 1H1LB 3PXUA 4C43A 2BGIA 4C4RA 4E5SA 2WB2A 2AYZA 5BV1A 3BGVA 4KLNA 5B1IA 2C42A 1UMDB 3O3CA 3WIOA 4IDPA 3LK7A 4BYGA 2H1VA 5F7JA 4RK6A 4TYMA 1EQ2A 1E2IA 3WG9A 2HSZA 3CVUA 2JJQA 1ZMBA 4OFZA 1PJLA 2BC9A 4TLCA 3K6RA 1SQGA 3PD1A 4WVFA 4B85A 1HG0A 1MT0A 1QTQA 4R7GA 1SXJB 1Z22A 5DNUA 1KC3A 2R11A 2ZTVA 1KVSA 2C96A 4MWGA 2YQZA 3GJ6A 2ZIXA 5BUCA 2CCKA 1MVOA 1UADA 4YK7A 5FF9A 4QXMA 3RYHB 1H3FA 1PSZA 4AXBA 5FYDA 2B8JA 5JAQA 1FNCA 4D8UA 4TKMA 3VO1A 1FMCA 1ZD4A 3P5SA 2PT9A 1FVXA 2WIDA 3DS8A 1FX0B 1GVNB 4QEKA 4HGQA 2IUSA 1E3EA 4C4TA 1WXHA 4R1LA 3H1EA 4JVMA 3RODA 5CW1A 3N3BC 3PXCX 1YL7A 3GBPA 3WLSA 1W1IA 4F2HA 3G89A 3UMSA 2B2CA 1EG7A 3C16C 1ZOIA 4MH0R 4J6FA 1CZNA 1GQFA 1KU6A 2Z8XA 1XU4A 1PCXA 4N8SA 2NPOA 1W4CA 3R0JA 1FSZA 5ALGA 3TQSA 2VDVE 2W2QA 4I9UA 5BW5A 4NULA 3T1OA 1TDJA 4XDGA 1KH3A 3JQ9C 1TU3A 3GWGA 1MXHA 3OE7A 4GPZA 3TRKA 4DA6A 4TVSA 3SC2A 2JI4A 1JHXA 1G2IA 2DT8A 4IUBS 4AZTA 5C9ZA 4GFDA 2P41A 1UK6A 3OCZA 4KXLA 3R8CA 3GZNB 3IVCA 1Y5NA 1GNPA 4FSXA 1YZKA 4GGMX 3EQ9A 5KO2A 3D54D 1RWQA 3FH0A 1H4VB 4YXWA 3VNRA 2EXXA 1HE4A 1K92A 2O7NA 3H8VA 2FGKA 3D9QX 1TCCA 2Y1CA 3U61B 5AOVA 3PC6A 2PMCA 4JR0A 3EVAA 5B1DA 1ISMA 2QYOA 4GLFA 4OL9A 5B57C 3FYDA 4WZAB 5K3AA 4DMGA 2B4TO 2IXEA 5DM4A 1DOAA 1DWQA 3KQVA 1DUIA 2VUTA 1IG3A 2I33A 3PNKA 4L85A 1XZMA 4V1CI 3GT7A 3NYRA 4FS3A 2PXHA 1BFDA 3N8HA 4TM8A 4KTVE 4TWAA 3BMXA 2PRYA 4KO8A 3R7WA 2ZRFA 3UY4A 4MWDA 2QN7A 3WKEA 3AVOA 3HY6A 3SZUA 1M2JA 3FWZA 4EM6A 5F9HA 1RABA 1ZHFA 4V3CA 3U6KA 4UBKA 2FPRA 4MVJI 2FSVC 4KQXA 1UPXA 2HMYB 1Z7EA 4Z9XA 5A3SA 2IHYA 4HFRA 1NF8A 2FWBA 2QN1A 2ZVJA 1EXMA 2G28A 2PCJA 3FBGA 3KD3A 4OHKA 5ES4B 1TJ5A 2XR1A 4LBVA 3G2JA 4M9RA 5KAPA 4MDYA 5F1OA 4IV0A 5A62A 5JI3E 5KNDD 3KDSE 1Q95A 4O4LF 2ZT6A 4QRIA 3GAMA 3U16A 5HIAA 2WEKA 2D6FA 3ZHTA 4TQGA 4L8YA 2UU9B 4HK4A 2C7VA 4QDTA 4NSNA 3KSZO 4RJKA 1NY5A 3DE0X 4D9IA 3GLHB 5DLQC 5JCOA 4P4LA 2LKCA 3TSZA 1IQRA 5LZ2A 5J2TB 5FUYA 1VL8A 3E7WA 5HE8A 3U9TA 2NVUB 3KFXA 4EHFA 3DE3X 3H5IA 1G2PA 1D5WA 4QVGA 1L4FA 3HEAA 1L1FA 2JVJA 1OWMA 2KBEA 3L0ZA 1AHNA 1GNVA 2BCJQ 2C83A 3D7NA 2R87A 4TTPA 5FWYB 4XVQA 4CM8A 4M89A 2D5AA 4QXPA 3T9CA 1CDDA 2RKOA 3II6X 1BE1A 5T67A 4BP3A 5KYKA 1O4WA 2P2NA 2GKGA 2B92A 2FUG6 2WUEA 3MGGA 3AF6A 4FYVA 1BOFA 1UWLA 4AD8A 1TMYA 2X8JA 5LZ7A 5H7XA 3AZPA 1NNLA 2D5LA 5IJZA 2P0EA 2WU0A 5C5IA 2QSUA 1JA1A 2FW9A 2YHIA 4NQZA 5YASA 2OBLA 3WGVA 1C3JA 1PR4A 3QYJA 4AMZA 4KLAA 3A10A 1JLSA 3GPCA 3RTEA 3BD7A 4X95A 2ZSUA 4CI0B 2PUDA 3ZKWA 3JQ7B 1MRZA 3WGLA 5HZHA 3LDAA 3A0UA 3I6ZA 2P9FA 3EG9B 4RY2A 3W8NA 3E0QA 1XF1A 4PQYA 4UQOA 4L2IA 1K5GA 3EXFB 4H7EA 1P4RA 3FYUB 4RJLA 2RHBA 2RH5A 1XP8A 3BL8A 1Z5PA 3MOGA 3TINA 3NG1A 2DSNA 4KO1S 5CVVA 4YJ2F 5D5QA 2QD3A 1J0EA 4UDXX 5BSRA 2QM7A 5BW6B 1N0HA 3WXBA 2P4UA 2YVQA 4KN5A 4ZC1A 2P7IA 2IZOA 3HJNA 4XJSA 1GY8A 3R7LA 1JB9A 3VTZA 3AP2A 1G1AA 4FIZA 4ODIA 3FRHA 2J3MA 3VJMA 2UVPB 2ZTMA 2IS4A 1W5EA 1DKPA 1H2HA 1OI2A 1P2BA 5TGZA 1RXVA 1IPHA 2JAOA 1C5KA 2LXNA 3SDZA 5J58A 2CF5A 1RZRA 3LZ6A 4NCKA 4LXUA 3E58A 4IEFB 4EGCB 4CCYA 3VDNB 2Z9DA 1U0OC 2IEIA 5EQTA 5MDHA 1TW3A 4U2GA 1DTEA 1A9ZA 1LW7A 2VBIA 4LRXA 1L5FA 1KAQA 1XHEA 3GJ7A 3VR3A 1YMQA 2L82A 4IV8A 4CW7A 5GINE 3O82A 5DTJA 4D79A 2FSHA 3JD4A 1YZ3A 5CW2A 5CB0A 3DWIA 3WB1A 1FVOA 2XVAA 2HM7A 1RXIA 5K4GA 1IOZA 1PFYA 1Z7GA 3D8SA 2GNAA 4KLCA 5FO1A 3TUJC 4EJ2A 3GIDA 2CNBA 1K68A 2Z1NA 4NARA 3QVKA 4UUQA 3AW9A 2FMFA 4FCWA 4YA6A 4KXNA 5LPNA 1VZ3A 4G07A 1Y8RB 4YRSA 1MOQA 1E9DA 3DQPA 3H65A 3IUSA 1J8MF 2RAUA 1UQTA 3NBZC 2GZ1A 4UHEA 3TQFA 2DYKA 2ZRCA 1F3OA 1K7SN 1R6DA 4EYSA 4F9TA 5K0ZA 1CHNA 1DPFA 2A0YA 2WVHA 4MS4A 4QGSA 2DECA 3H2SA 3WL7A 3CZQA 4O02B 3PX7A 2Y1DA 4MMYB 1XXHA 4KR9A 3MLAA 3UQYS 5AFSA 1YDMA 5CNJA 3F5DA 2QTNA 4RLQA 4JK3A 4BOYA 1YBHA 3HSSA 2OYRA 5C18A 3G7NA 3GHYA 3KAJA 3MT9A 4W6QA 3TZBA 2HQRA 5EMLA 2NT3A 4IXTA 4R0MA 5DXFA 3VU3A 4DREA 1ECBA 3EQ7A 1NQVA 2YDYA 4HTAA 3ER8A 3HVRA 3A7DA 3DR5A 2OBYA 2ZTUA 3CBQA 3KX2A 5AUNB 2WIGA 3V48A 2QG9A 3AUFA 3WLMA 3J81A 3ETGA 1WR8A 2JGAA 2OV2A 2GZRA 1E1CB 4HI0E 5BSUA 1AE1A 2C31A 1MUUA 2OCLA 4ZYLA 1DGQA 1KFBB 1U7OA 2PS0A 3FPJA 4RV5A 3ZDRA 2YFYA 4IINA 4BGEA 1BJTA 3CRVA 1W0KD 5KJEA 3MXTA 4UCQA 5DTMA 2BBTA 1PR6A 1OREA 2WKPA 3RB8A 3A9TA 4YRCA 5LMNB 1HFEL 1CE8B 1CS4C 1VA4A 1N2CE 1Z5VA 2E49A 1OI7A 3RVBA 3PFFA 5AVTA 4BC1A 4E31A 1NHWA 5LP6C 3NORA 1YK0A 4ND6A 4G0YA 3QE9Y 2ANCA 3TW8B 1JFFB 2E4YA 2VEOA 1KPHA 3X1KA 3VAYA 3DDNA 4BU1A 4IAOA 3PTZA 4Q1AA 2YNMC 2BZGA 3ROXA 5I3CA 5M34A 4HYTA 2GA9A 2NV2B 1DIHA 1B3BA 2ECFA 1INLA 2REOA 3CNHA 3N0WA 2PX5A 4L8GA 3OCVA 3HKEB 2H9IA 4G1BA 1T5TA 3GZNA 4RLFA 1IY8A 4UU1A 5E1MA 3WMRA 4ZDIA 2WTMA 4Q9LA 4TYWA 5H59A 2GPNA 1D8AA 4WI1A 4DV4B 1O2DA 2GN2A 2Q9BA 2Q9AA 2ID4A 3ORQA 5IT0A 2EDCA 2VPQA 2ZU0C 3ANMA 5EXTA 1CRPA 1KRHA 1KVQA 2VTBB 3DB2A 3VI3B 5IPFA 4Y0AA 1WB5A 4COKA 1I1NA 1KY5A 2Y1OA 1G16A 4CL3A 2XUJA 2H2FA 2XD9A 3D3WB 1UPUA 1H6AA 2O1SA 4DCTA 5IT5A 1I3OA 4Y2TA 4JLJA 2QM0A 3MBKA 4GLJA 2VPPA 1IXYA 3T1NA 1W49A 7ADHA 2AE1A 3LBAA 1I32A 2CDBA 4A0HA 5FUMA 3EC2A 4ND2A 2SKDA 1PV2A 4IJ5A 2DMRA 3PNOA 1ZL0A 2P90A 3UFBA 4EB3A 4Z0HO 1CYEA 1OLXA 1S4MA 4F92B 1Z4OA 2BBWA 3IT1A 3LHKA 3ORHA 4MGEA 4HZUB 3B6JA 3KOOA 3IMCA 2G6TA 4MXDA 4E22A 4BMVA 2VQ3A 2EKPA 3HB0A 2PKWA 4O5OA 3RYFB 4OJQA 1ZIPA 1U2EA 2OOKA 4E94A 1VOTA 4H6XA 3V8QA 5K0CA 2XUZA 3HJRA 3EZFA 3KJQA 4DWOA 2O3QA 3MN1A 4ZK2A 4NBUA 4YRNA 5FD8A 1SB8A 4AQ7A 1AT1A 4F85A 1BCRA 4JQCA 3JX9A 3ADKA 1NATA 2OHIA 2OLEA 3CX7A 4X1IB 4F4DA 3WRYA 3ZIDA 1PQPA 3GRPA 4XQ0A 5I9NA 4J8PA 2OXTA 4DAOA 2H85A 3I2YX 4AJ4A 1CZHA 1B2RA 2QMUA 3RIYA 2CSXA 1EDBA 1Y48E 3BOSA 3GLHA 1KI2A 2RGDA 2VRBA 4K46A 1NMEA 2YWDA 2HHCA 3HHPA 4R6XA 5CYPA 2JGLA 1UEIA 5DE3A 2A88A 3TLEA 2F90A 4WTOA 4YXWD 3WGMA 4UNQA 3CUVA 4UXIA 4RHXA 2H29A 2Z9BA 3DE4X 4G1FA 3FVTA 4TUYB 3AF3A 2BJHA 3BMOA 4FHDA 3I72A 2IIBA 3KHKA 4GLOA 2HFJA 4BO5A 2VF2A 1SHTX 1UBCA 3BQMB 3B85A 2J6HA 4QM7A 5CFRA 3PWTA 3H2JA 5EMMA 1MAAA 4KVGA 3G02A 2PJDA 3E7DA 2GH1A 2VAMA 3R6WA 3KELA 3LA8A 3VJKA 5JHGB 1CZKA 1KKUA 3H3FA 1N77A 2A4MA 3IP6A 1GZ5A 2BYTA 1VIAA 4XH9B 3ANTA 2HYDA 4KR0A 3WGKA 5HSGA 4QUEA 1YQTA 3WNCA 4CPDA 3TF5A 3EVCA 4M1QA 3KYCA 4EJSB 2LE0A 1V8PA 2QW8A 4UOZA 4I0WB 4O4HF 3AEQB 2BHRA 2O52A 2ZM6B 1ILEA 1BWQA 1CR0A 2QRKA 3GB9A 1L4UA 3CRNA 4LZAA 4DNXA 3ZD6A 1QQ5A 2YN2A 3ND9A 4P98A 4LYFA 1U94A 2HN9A 2G9RA 3NT2A 4RIGA 3GVIA 4D0SA 5JQWA 1JFTA 2C54A 3EG9A 2VXBA 5ALTA 4A6EA 2ZANA 2YV2A 2HSDA 4S3MA 1FB5A 3EBLA 2IGBA 3RS5A 4YCAA 5IH7A 4KRFA 3A31A 3CFYA 3QLVA 4TKUA 5EE5B 4ER0A 3MWDB 4EYEA 1DAEA 1I4EB 2W6CX 3E2IA 1V6CA 3R1IA 4Y2JA 1XTRA 2OFXA 1Z06A 3QMMA 4JI1B 4MV6A 3QJ5A 2C5BA 2UVPA 3AHCA 1BO6A 4LNUB 4YALA 3IT3A 3W5HA 3Q41A 2A5JA 4DLPA 2FB9A 4NX2A 4U2KA 3ISJA 3ZHUA 2YWXA 3NB0A 2CBXA 4G89A 4KQHA 3O95A 4FFBB 3I32A 3BGOS 1Q74A 2NTNA 3DCJA 4A0FA 4ZOBA 1FLDA 2O0HA 1UK9A 2O2EA 3P96A 4KNWA 1IIRA 2D74A 3LL4A 3MJSA 2MYTA 3UF0A 2WNHA 3OX1A 1JGTA 1XQXA 4Q3EA 1S2MA 2AL7A 2X6QA 3FCSB 4NCBA 5AOAA 1US8B 3IV7A 1N2CB 4YAKA 3CEJA 4HATA 4YCMA 4IS3A 2FAXA 3LP8A 5CGQB 3DMGA 3UUGA 1KJIA 4JYPA 3IQXA 3KFLA 5CFLA 2AWNA 4H6VA 1XL0A 1S7CA 2P11A 3GRFA 3F7TA 3ECSA 1KZHA 4V03A 1XRMA 3AINA 1Q1BA 1ZWLA 2XAAA 1WCIB 3CRQA 1D6NA 2H1WA 3F49S 3O6VA 3QA9A 4GAEA 5ALNA 5FUVA 3CIFA 4KACA 3ZDQA 5JZOA 1EFVB 4DIDA 2VNJA 3M6WA 1F8GA 1Y6ZA 2B78A 3GFOA 4JFRA 1XN1A 5CIQA 4CHGA 2Z8ZA 3KWLA 3QUQA 1T5HX 3L82B 3FGNA 3GGDA 1SY7A 3PP8A 1DDIA 2CDCA 1STOA 3FUVA 1YHNA 1VG1A 1Y34E 5LQSA 5TC4A 4R8LA 2EF1A 4B6OA 1D2MA 4W6ZA 2P75A 5E7IA 3D5QA 1NW6A 3IH5A 2HRCA 2H4YA 1FDWA 4O8ZA 2XNCA 1K98A 4GE3A 4NR0A 3DLCA 5F7XA 1XZCA 3EMBA 4JP8A 3EGIA 3UOAB 3KZ1E 1D0SA 2A57A 1WBJB 1TO6A 3IIKA 4FR5A 4Y2GA 5TV2A 4RIFA 1RZRD 4RD2A 2ARKA 2DFTA 2LCFA 3BRSA 2ZBFA 5C0OE 4WBNB 2R7MA 4B9EA 1XB2A 2DPHA 2QORA 2M6SA 4RXMA 3NHZA 3IDQA 5EJ7A 5JAMA 1TADA 4MZDA 3UV3A 2GVZC 1XPRA 5TSDA 4R68A 1WXIA 1M6WA 1XUOA 1QK3A 1TA0A 2X7JA 2YN0A 1C8VB 4MWZA 3EH2A 2PGLA 3WAGA 2FFRA 3VR3D 2WTBA 4PXSA 1U1GA 2O14A 3OZFA 4KO4S 4FMCF 3FGZA 2PPLA 1M1UA 3D2LA 3E53A 1QS0B 3O38A 4OUDB 2WJ6A 4TN5A 5SICE 3VJRA 1IQPA 3EHDA 4FC6A 5CB4F 3P97A 3GLVA 3VU0A 3L43A 4NE7A 2C04A 1KWKA 1D9XA 1WV1A 2Y66A 2Z5LA 3BMQA 3QYFA 4P3KA 4Y1EA 3ZDFA 2CT8A 1K2VN 4WVLA 2VJAA 5HXAA 4PM4A 1CR4A 4RJTA 5IJ0A 4N3NA 2C84A 5DASA 2PZBA 3ZHXA 4OH7A 1VYHA 1VMEA 2JK1A 1XTUA 1Z0ZA 2WD7B 1JIKA 2VDRB 3HKEA 5AKLA 1FFXB 2COKA 1YOBA 1Y6FA 1K97A 1XP5A 3DVAB 3PFCA 1LDNA 1OGJA 4JZYA 4NZMA 5DSXA 4JVSB 2O59A 1OX6A 2GCNA 1FFWA 2QB5A 2P65A 3DC7A 4BO4A 5KDOA 4PG4A 1HQDA 4EGFA 1JKJB 4MKGA 4HWOA 5KVQA 1UT5A 2IYFA 1QCZA 2YJGA 3D3WA 1CEQA 3EMKA 3IDZA 5G1PA 1V1MA 4X71A 4ZMBA 4BTEA 5IDWA 4JLBA 2C5EA 4AX8A 5KSYA 4MW2A 3VPFA 2Z3ZA 3TECE 5C46F 3HXOA 1EFPB 1JJIA 2DTDA 3ODGA 4J76A 5DEOA 4DSUA 2EP8A 3P9PA 3GARA 4CUZA 3QTBA 3F74A 1YS4A 1QK5A 4GL4A 4J0QA 4BVFA 3AHHA 3N86A 4MGYR 2J08A 4E2FA 4DV5B 1JG3A 1NE7A 2A6PA 3TVYA 4RGBA 2I91A 2AN1A 3ZGYA 4HZUA 4DLYA 4P38A 2FHSA 4UBOA 4CL2A 1ZM2A 3T35A 3BWXA 5ER6A 1NU6A 2XEXA 5I4CA 1B42A 3HYCA 5IC4A 1XZEA 3CLTC 4RYLA 2NLOA 5D1HA 1NFQA 1T25A 1SOAA 1UT8A 2QUHA 4DDUA 1BWSA 4PYKA 1OLSA 4C2TA 1GSHA 3WADA 4GF5A 4MKXA 3T7RA 4DQDA 3ZYCA 1WXGA 3GUYA 3OG9A 3Q0IA 4LJ8A 2GEDA 1R9JA 2CNOA 3O91A 5DV9A 4LOLA 1SCBA 5CNIA 3IHWA 2F1IA 2KE5A 1C8LA 4LKOA 1UR5A 4X1IA 4F7DA 5EJGA 2I8LA 3FD8A 4OYYA 1RQXA 5IZCC 3K6JA 2NO5A 2UYHA 4WKGA 1W4AA 3PHBE 1SKUA 1JAZA 2EZUA 4LHZA 2Z2YA 4MCHA 4HWPA 3JZMA 4P8RA 2Y0DA 1T8PA 3N1UA 2V7UA 3MTEA 4RQTA 4QUHA 3SK0A 1P73A 2NP6A 3ASYA 4GHWA 4HXGA 1G20B 4HBZA 4C01A 2Q8QA 3VU8A 1XNHA 1YNOA 5KHAA 1XKQA 1ARZA 1W0JA 1ZJ5A 3W1EA 5K3OA 3GA0A 4FJ1A 4LGCA 2X0EA 3I6IA 5CDTA 4IMIB 2FQQA 3RSFA 4A6PA 1PJ4A 5JW6A 1SC9A 4YRQA 3T5MA 5TNXA 4DABA 2X3UA 5CTJA 2UUAB 1TUEA 2YJ6A 1CY0A 4D9NA 2FOLA 3H0CA 3HACA 3ZU5A 1WUIS 3P27A 4FT4A 3RK1A 4EJSA 3NCTA 4ZO6A 2C9BA 3AEQA 3D8TA 2H54A 3NZEA 1AS3A 5TVKA 1S02A 3FZYA 1W5TA 4QFCA 2IU3A 3TYXA 5E7JA 2Q2OA 3S44A 1L2TA 3WKAA 3GVHA 3OPNA 4C03A 2Y68A 1E2PA 1JLRA 4D9KA 4B4WA 2AKYA 2NACA 2XJ4A 3KFVA 1O5TA 4HS4A 3THYB 3PR1A 2XQFA 4HQNA 4Z7JA 2IOHA 2Z8YA 1J00A 2VAPA 2I62A 4QDUA 4UUPA 2VHEA 1OLOA 2G5GX 3MM4A 1JU3A 1L7RA 3P4YA 2Y2UA 3D7MA 1OXXK 1EHYA 3KD2A 3QWBA 2XGJA 1WULS 3M81A 4YRMA 3R3ZA 4KQIA 2NUBA 3LC0A 4GKAA 5EESA 3L2OB 3PF8A 2CXUA 2LGJA 4BEVA 3LRTA 3P2MA 4OI4A 3QEMA 3WVNA 4EENA 2C77A 1J2EA 2WFZA 4C14A 3HBLA 4FFBA 4PYNA 4GZ6A 5KJ6A 1FSFA 3ZJVA 4IDGA 2DU8A 1MOZA 1C2YA 1PV1A 1AN0A 3WZ2A 1OYOA 1PGNA 2VBCA 3CR7A 3CKKA 2AV6A 3HCPA 3RE1A 1KO5A 3GCZA 4DJFC 4JA0A 4KG7A 3HV2A 2DWCA 3CH7A 3RG2A 4G84A 3GO4A 3U40A 2OAQ1 1T4BA 5FBQB 5KC9A 1F0YA 1VIDA 1N2CA 1WCXA 3Q1LA 2QN8A 4Y1FA 4ZI5A 1VGRA 2YXLA 1YUBA 2G3YA 3DJFA 4C7VA 2CLFB 5ARCA 3VR5A 3NXSA 1Y7IA 2Q9UA 5ENZA 3TQHA 5JJKA 5DHFA 1A9PA 3VKFA 10MHA 1QF6A 3TSYA 1Q0PA 3O3MB 3GYBA 4UOEA 1VL0A 3HXKA 3ZWQA 2DFPA 2W2OA 1ODCA 2D7JA 4XASA 4J49A 3WLAA 1I9GA 2ZRKA 4P0TA 5TPZA 2X4LA 1JWAB 2KBFA 3H9JA 4CG2A 1JZQA 2V0NA 4O2AF 5K6AC 1N5LA 5F73A 3VSBA 5FEMA 3IAUA 5KNBH 5AJYA 1IXZA 2GD1O 4IVPA 4P84A 5B7GA 1ITZA 4WXHA 3K5IA 3U3JA 1BTOA 1DO2A 2FXIA 3KJIA 4OU5A 1ZHOA 4GMFA 5LQCA 1YF3A 1U2DA 3EJ6A 5DLPA 3WLLA 2HCBA 1MB0A 1SFRA 1KI7A 3ENZA 3DXZA 4O25A 2IIQA 1H2FA 4YMWA 5B2FA 4Q7EA 4EZIA 2AEFA 2QRPA 1A9TA 1A8IA 3QUSA 1P61B 1XG5A 3PIDA 3SYRA 3CM0A 1G6Q1 3UNXA 5BNZA 4NEQA 3P4XA 3WLKX 8ABPA 1C3LA 1ZITA 2J1LA 5FL7A 2QEQA 2Y76A 4N18A 4CR8A 4D46A 2V7EA 3C5EA 3O84A 2QQFA 4YJHB 821PA 1F4PA 4G5RA 4IGKA 3FA2A 4NICA 1VBNA 3EW9A 4WECA 4JCCA 5HDQA 5LYJA 2J32A 3L8CA 3OQPA 1KTVA 5BMVB 4QJ5A 3SQXA 4O4IF 3IVAA 4GL2A 2YIJA 5I45A 2ZU6A 4PCLA 4RCVA 1Z83A 4QE3A 2H7VA 1ETHA 1AQLA 4GLLA 4GX0A 4YRKA 4DKXA 1P5FA 1KZYC 2FSUA 2J0EA 3MCZA 4LQDA 3PCRB 5E2AA 2DC1A 4R2IA 2R1VB 5EJ2A 3ENWA 4MYTA 5IAJA 4KR2A 3QPUA 3SE0A 3ZGLA 4YI3A 1OTXA 3L8MA 5EJ4A 5IVKA 5HHTA 3NDIA 2GJ8A 3DEJA 4TLBA 5EXDA 1U2SA 4XX0A 1IN5A 4G0UA 1U8CB 2FUG1 1MGOA 2BMWA 4MWTA 1JXQA 1PJRA 5LQDA 1SHLA 1RHKA 2B34A 3GGCA 3QU7A 4GXQA 2X9LA 1AURA 2Z1MA 1GYPA 2ZR9A 1JHOA 1HLGA 1OBOA 1O96B 2FMUA 3DVAA 4JT8A 9GPBA 2VJMB 4RHYA 1QIMA 1WSWA 1OYYA 4R2KA 1ZO8A 3EVEA 4II7A 1P80A 3ABZA 1EFRD 4HXYA 3IAXA 3V9AA 2AOUB 2AZDA 3NM4A 1JKJA 3M34A 5JNWA 1N34B 2CDAA 3DDSA 3SF8B 3GNTA 3RM3A 3DYBA 1X1TA 1G9TA 1U2GC 2ENUA 2I03A 4LXYA 4KGXA 5JAZA 2OZPA 4OGKA 5J63A 2F9FA 4OM7A 4BL5A 2XVYA 1EFPA 4EYGA 4YO7A 3PLAE 2YS7A 4TL9A 5JRDS 4M8KA 3GV0A 1EGVB 3EA4A 4PXYA 3BKWA 2J3EA 3RLFA 4J7XA 2O48X 3VH3A 3U4GA 4NEGA 1SXGA 1JW9B 4JDUA 3LWZA 1ZVKA 1SCIA 5HMLA 5ADVA 2JC3A 1F6BA 2ECQA 3TH5A 4HP8A 3AUXA 4WESA 3W5SA 5KX5B 4BNMA 4AS1A 4M1YA 5C4MA 3QBVA 2NSHA 4R6WA 3H42B 2VKQA 4XI9A 4HR7A 3UWDA 5AVOA 4GH5A 4EX6A 3KQOA 1HFJA 3EWSA 5GZ6A 3ESRA 3T5GA 1JYSA 4GRAA 4O3MA 1QTNA 1TAHA 3I28A 1RXSA 2EZ9A 1ML3A 3UJNA 1FDIA 1M34E 4H35A 3ZCSA 2NQ8A 3RHTA 3GRKA 2NQ2C 1QP0A 1QDUA 3I1JA 2P5TB 1NZJA 4KEAA 1ZVVA 1QE5A 3ABIA 3OCJA 1DG9A 2A30A 1DIGA 4HDQB 5F9FA 4MKRA 1NNI1 1UBJS 2JDID 3ONWA 4ERNA 4HUTA 4ZPJA 4G1MB 3FN4A 1PQ4A 1RBQA 1S3IA 1TKCA 3V9PA 4RIEA 3S2IA 3H97A 3BQNB 1J8DA 1JF8A 3L6EA 4LRYA 4MGKR 1NLUA 4XUCA 2Q5EA 5EI5A 1WD7A 3UW1A 1LDYA 3FRJA 4JEHA 5HQ3B 2ZLBA 1MG5A 1JTVA 5A04A 2GTIA 3S2YA 1ZUHA 4OLFA 2FZEA 3GEMA 5EEHA 5EYPB 1E6KA 5FOVA 4HMQA 3RFUA 4P5EA 3AEKB 4PZLA 2DWUA 3R6DA 4QSMA 2YXEA 3HTXA 1CR6A 2RGGA 1T8SA 1ULHA 1XC7A 3QFFA 3C74A 4M36A 4PPYA 5TF4A 1E5LA 2BFAA 3RPEA 2BKLA 3H1FA 3TJRA 2V03A 1JG6A 3ZK9A 4EDFA 4UM9B 4GPAA 3NC0C 1EVLA 2TMYA 1IEQA 4MS1B 4NNOA 1D6MA 4IZ6A 4GRDA 1E64A 1RADA 4EY6A 2GB4A 1QG2A 4KYVA 3V1UA 3BWEA 3C97A 3LCCA 2EYUA 4JI5B 3O74A 4AQDA 1EA5A 2GHTA 4MVJM 1C4KA 2P6MA 4JLDA 4D02A 4OQ4A 1GYQA 1K06A 3N2IA 1SU4A 4OMUA 5AW1A 1G7RA 5ICFA 1FUYB 4ZV4A 4BVHA 1F6WA 2W7TA 5DXAA 4WA8A 4NPAA 3BA1A 4D45A 3QX8A 4FYHA 3JYLA 3HYNA 4ZVLA 4PSCA 3IOCA 4CLEA 4G24A 2FX3A 3THYA 3O90A 5EKXA 3ZDBA 1ULBA 2ODTX 2ZSBA 4FCCA 2I4NA 3JALB 3WIEA 2QRJA 2QU7A 5K8IA 3L07A 3NASA 3DFUA 2X9VA 2Y67A 2GBLC 2Q29A 4JLSA 2XMQA 3H5LA 4KQMA 3TKAA 1M0TA 4D25A 3SIRA 5DULA 3VH1A 2HSWA 2PUWA 1V5WA 3K1TA 3P9RA 5FOSA 2ZJ3A 3AIIA 3FPCA 3O5AA 1QJCA 1QR6A 4IFTA 7GPBA 4M88A 5K0EA 2PV0A 3AB7A 1KMCA 5KSPA 2WDZA 3PUZA 1BFUA 4IIBA 4Q12A 4C0WA 3RHSA 3ISTA 1T4MA 4D8VA 3N05A 4ARAA 1E18A 2W2VA 4TKVB 2NU8B 4EABA 1DC5A 3NJ4A 5SY6A 4HB0A 2ZUEA 4YP5A 2YMLA 3E9EA 1W0JD 3KB6A 3T52A 4RTJA 2GXAA 4UUBA 3GD7A 3AUKA 2RG7A 3DJYA 2O6HA 4HGZA 4TLAA 5CT8A 5J4HA 3UXYA 3CSDA 4FBLA 2OMEA 1AQUA 2CUNA 1RLJA 1FMJA 2PT6A 3TK1A 3ME5A 5FPYA 2PX4A 2X22A 2E4ZA 1O54A 3L7YA 5D51S 3LVFO 4EQ6A 1RRCA 4GVXA 3E9MA 2W8BB 2VQEB 2I7DA 1NXQA 1L5HB 2XZDA 1Z08A 1LBQA 5IDYA 1U8AA 1AGNA 2G25A 2KLHA 4IO1A 4TLMB 2DY1A 4HEQA 5CJ2A 2R1UA 4CKYA 4QM6A 3TG8A 1AA9A 3VGPA 1IZYA 4TWIA 2PR2A 2BFDB 2B7CA 1B74A 1SBHA 1TCUA 4O6VA 1TECE 4Q9HA 1ZY2A 1J5XA 2EFDB 2QAJA 1QZZA 4MQLA 2YIDA 4KRGA 4S04A 3HZZA 1XTBA 4UQPA 4L9RA 3UICA 4Y8VA 4FNOA 1JI0A 2HIMA 4PYIA 4KHPB 2Q5FA 4LZLA 4GI7A 5ICMA 4JIGA 3DPIA 3PWSA 4UDOA 1PFVA 3ZX5A 2ZETA 5F23A 1NL3A 4JI4B 1SELA 2OCGA 5E3IA 1FP2A 1E3TA 2WTNA 3OPQA 4I9NA 4WN3A 3G0HA 2G8LA 4WKBA 5CA0F 4IDDA 2BDEA 2C4UA 2DBYA 4PRLA 4OMCA 1GTG1 3DGFC 4LE2A 3TPCA 1PJQA 1U8EA 1XJCA 2A59A 3LX5A 1SHZA 4FZRA 4NI5A 4YJHA 4IJKA 3W2IA 1OPXA 2D7DA 2EGHA 1S8NA 5IARA 4JXZA 3ZDZB 3UMFA 2IF0A 1UJMA 3SC6A 3L5OA 1ODFA 2ODWA 4P4GA 4OB6A 3SSNA 2JZCA 5AXCA 1T2AA 1EE2A 1PUIA 2GYWA 3GVPA 2FWMX 3VZDA 4C1BA 2EG5A 5M2QA 2UZ1A 3Q3GE 4ZVTA 1HDCA 4WA7A 3KS9A 4LSZA 2C92A 4DR1B 3JQAB 4C88A 3EIQA 4WOBA 1WEHA 1S89A 4AJHA 4ZYVA 5KWEA 4ASUA 1EX1A 2XUGA 3QSYA 1MAHA 2YKGA 1ZM9A 5ICSA 1NVBA 1L7QA 3IODA 1EB8A 5TPZD 1BS1A 5LQNA 5B55A 3JATB 2G06A 2XWSA 4P81A 4DMHA 5A9SA 3WI7A 4L5IA 4XIIA 1QC5A 4HGYA 1SOMA 5HFJA 4LRTB 1OB5A 4X44A 4HMOA 4UNSA 1K75A 4I50A 2V7PA 4KGVA 4QUDA 2AI2A 1PJBA 5KOJB 4NFYA 3Q9SA 1U65A 1T24A 1CEYA 5LLTA 3B2QA 2VJMA 1QHXA 3E1SA 1BJKA 4EB8A 3DAHA 5CDFE 1JMYA 5JYDA 1YR3A 1BHO1 2AJTA 3UAOA 2VCEA 4L74A 2N1MA 1G2QA 4GOLD 1NI4B 5EY5B 3SF8A 4JJ7A 2BMJA 4ZU3A 1DKQA 1E7MA 1TGVA 3FUUA 5HFNA 4RTKA 4Z5XA 3QKWA 4BATA 3BXEA 2Q4TA 1Z6PA 2RAPA 1YL5A 5FL7D 1RKBA 3ROZA 3OZAA 3W3AA 1HF3A 2Q27A 5I8WA 4QAJA 3G0BA 1K88A 3UV6A 1N5IA 4DDVA 3BJRA 3KNZA 3WL3A 5KX5A 3OZUA 4LJSA 3S1AA 3V8RA 2ZXFA 4UAUA 1E2HA 3URMA 1T1GA 3UTDA 3QQPA 1YIOA 3OOSA 1UPCA 4PANA 1Z8DA 2ODQA 4M9CA 1MC1A 2A1IA 3QENA 3T0IA 2VDKB 5IC6A 2O5CA 4OF4A 4E1BA 1AD2A 2WE8A 3UPDA 2OKCA 3CX3A 1XK7A 2AVDA 3P32A 3FMOB 4K1LA 1DIBA 2FEPA 3RREA 2BF4A 4NH4A 4HFJA 3FOZA 2KJQA 4ZVUA 3UHJA 1BDJA 4AG3A 2ZWAA 2AB0A 4O63O 4RZ2A 3WSVA 1YZGA 1IONA 4NP6A 3BORA 1ONOA 1GITA 3W5VA 5AVQA 1IVSA 1T5IA 3B8HA 2PBRA 4D80A 2WPNA 5INTA 4JJGA 1RWOA 2A92A 3ZCUA 3R5FA 1GFIA 1DBIA 4P9NA 2FPWA 3AJAA 5COQA 3KB8A 2IWRA 3VZQA 4BO3A 3HJHA 4B7XA 1T9DA 1XQ6A 1JQBA 1E1NA 2IX9A 4PBTA 3IMKA 1XDZA 3AVUA 4HFNA 4Q3CA 1U8UA 4K8RB 2FWNA 2XIQA 1HG1A 3RHFA 1Z0JA 1VCIA 4OK5A 5FCDA 4OHPA 1YZHA 2BUBA 4DNFA 2C3YA 1Z4PX 1M1ZA 2RSLA 4IDCA 2E6UX 5DTQA 4DBVO 3SJCA 5A4IS 4UBJA 1N0VC 1I14A 2BH2A 3WJ7A 1QHHB 3FPAA 2GKOA 1ZI8A 4XW2A 1M6HA 3QHPA 1ABFA 4G67A 1ZD8A 2AN3A 1MB2A 5G0SA 3WMFA 3AIKA 2FSPA 5E1OA 3ROGA 1ZKMA 3ZBPA 2X2OA 3FPBA 4X84A 3GLGE 5E2BA 4GS5A 4GPEA 2CFCA 3KV1A 4XFKA 1HPLA 5I6DA 2O8BB 4QOIA 3GX1A 4QNRA 4JC4A 1QF7A 4Y3UA 4B3RB 1I6KA 2ENWA 3A9SA 4HAOA 1B1AA 1UZNA 4ZA2A 3UWSA 1MFZA 4M4SA 2C5HA 1U3DA 3BSWA 4GSYA 1R37A 4TLEA 3HN6A 1EAMA 5K2MA 3SS7X 1V11B 1K0UA 3SIWA 3TE6A 4JGGA 3T7EA 5CDGA 4GOOD 2OO3A 2C7RA 3FUTA 4NCAA 3B7WA 3D8BA 3VZSA 1HKHA 2EFEB 1KK1A 2CB9A 3C24A 1HEYA 1KERA 2ZI7A 1AGYA 1FUUA 3KQTA 2ZSIA 4FSHA 2VHQA 1ND5A 3A2LA 1WUHS 4OMFG 3UOWA 3VPDA 4UNRA 3ZJTA 3L6OO 5KNLA 2QR2A 2H2WA 3BWVA 3RYCB 5HMMA 4JXXA 2P6RA 3G0GA 4H7FA 4RY8A 4TL8A 5LCXA 1J8YF 5EZYB 4F3RA 1LU9A 3T38A 1YHZA 4YFVA 1VPWA 3PC8A 2H11A 2VBFA 1TT5A 3LUPA 3MEQA 1I6WA 4KQ6A 4LDRA 2OGWA 3PG5A 4XGKA 6NULA 5J23A 4M7OA 5KHOC 2JGJA 1ZJWA 5FBZA 3VDRA 5CFMA 3DHWC 5FFNA 3EIOA 3M6XA 2A9JA 4TMVA 1QHEA 3Q2IA 5JNRA 2C7OA 3FDZA 3PXDA 1BN6A 2UZ3A 3AEZA 3HDJA 3NR2A 4R0VA 3CB2A 1QIGA 3PICA 4UM8B 3LKZA 4LMPA 5KYTA 1QE3A 4BNDA 1RPTA 2M1XA 1XZBA 4ZOLB 2A78A 2B6NA 3EIEA 3WGIA 1SBQA 1SKBA 2M32A 1JU4A 3HZRA 3LVBA 1KS9A 4R54A 3ZQJA 5K0FA 2EIXA 4LYDA 4R9UC 2QV0A 3OM1A 1GRRA 1D6SA 3CWQA 3E3LA 4C6SA 5CH8A 1YS7A 3HHEA 2GT1A 4PPNA 1N3LA 4OP1A 2JJYA 3R5TA 4RY9A 2HK9A 1SA0B 3LY8A 2ZJ2A 1TIPA 4UUMA 4HAYA 2IYXA 4X20A 5LDGA 5EAIA 1KY2A 3I2KA 3T3NA 1RWNA 3FZNA 2B2NA 3UAGA 3E61A 5IJWA 4KFRA 2JCBA 2X2PA 2BFOA 1D4FA 2ZT5A 3CJTA 3M1LA 3OC0A 1SURA 1GN9A 5SZIA 4U3JB 4B1FA 5CITA 1LD3A 4R9NA 1CJKC 3C3DA 4C76A 3I62A 3TXYA 5IJXA 4F2PA 5B4TA 1IMOA 5CLQA 1WLYA 2RAVA 3L0DA 4JLNA 4OY3A 5EJEA 3R76A 4CXMA 2JGEA 1M7GA 1JHPA 4YWHA 2ZCVA 4BO1A 4LI0A 3GFVA 3KLPX 4OFWA 1C9NA 3QOXA 4ECEA 1DJMA 4FZ3A 4OKNA 1VPEA 3K9CA 4PC7A 3ZN2A 3HEMA 3K70C 5JAIA 1YBFA 3BCRA 3DOHA 2AOWA 4MR8A 4DZZA 2ZI5A 2DY0A 3BAFA 4RV9A 2GGSA 4TLLB 3TMYA 3V55A 4UMFA 3TSAA 1M34A 1NDQA 4L8FA 1EU1A 1U7PA 2CVFA 2IHVA 2P6PA 4LNHA 3L4BC 4PNPA 4PTLA 2VUIB 3FHJA 1Y81A 3IO3A 5IDVA 3EGWA 4CMAA 4TTAA 1PR0A 4AURA 3GMSA 1CP2A 1JB1A 4OXRA 1P4HA 2G4CA 1XN4A 3C3EA 3NT5A 3T4PA 5LP6B 1F38A 2V3CC 3NAMA 3I5MA 3NLLA 5AK0A 2QJTA 5DYIA 1DAGA 2R1TB 1CU1A 3EDMA 3PD7A 4FHZA 4LDPA 2UVQA 5EPEA 4QWWA 1G59A 3BXXA 1KEUA 3FPLA 1Z5WA 1IOVA 3WX0A 2FQWA 1XVVA 1I0ZA 3QQ5A 4M8SA 1MO4A 2WWHA 5EIBC 4RTQA 3IP8A 1NOKA 4L3WA 4EZBA 3TEJA 1A9YA 4F5EA 3INNA 4IJWA 3V7WA 1NVMB 1IPEA 4K9LA 4C29A 4EJMA 2I8AA 1OFUX 2SKEA 2ZTHA 4TPKA 3L1HA 1ZC4A 4RHUA 3RFTA 4NQRA 1D6JA 4Q4AB 2DERA 2G0TA 3H5WA 4C4AA 3MSXA 3E9YA 1Z28A 3F97A 3KJXA 5FNZA 4F45A 3OPVA 4KK3A 2IDMA 3WNDA 1UPBA 3NM6B 1QM5A 3SX4A 4R8SA 1NX6A 1PS8A 3CGWA 2WRZA 4H15A 2ZBRA 4OD0A 2EBWA 3GLGB 2CW5A 1VP3A 1OFVA 1W93A 2IW3A 3I39X 3KP1A 2I6TA 3GRVA 1T1IA 1GSIA 4Z9BA 1NW4A 2G9UA 5GP1A 3WJ2A 3DM5A 2M2IA 2OAEA 4YCDA 1E6WA 5FLKA 2NVBA 3RBXA 3KR2A 16PKA 1BFKA 1TZJA 4GG1A 2X8WA 1XRNA 2YINC 3PUXA 4PX2A 2XXJA 5KWVA 1ZOSA 1KJNA 4IHJF 3QIAA 1L5KA 4FE3A 3TL3A 1IVYA 1I36A 3EZXA 3NWPA 2GS9A 3X1WA 2W6OA 1PT5A 3O8CA 3QX3A 1UJNA 5ALJA 3BE8A 1G38A 5EXXA 2I1VB 1B0PA 3M3PA 2WWRA 1OH8A 4OHYA 1R8QA 1UJ2A 3RBAA 3SP1A 3WQSB 2J3HA 1GCOA 4BTLA 1AK9A 1UJ5A 3BIXA 4G0OA 2HB6A 4KXFB 3VO2A 4EHLA 4X7BA 1VMKA 2NZYA 2J4FA 5CMLA 5EUQB 3ZNPA 1GKLA 1NV8A 4JODA 2ZB2A 2I7CA 3KXDA 2ORED 4YRDA 1CNEA 3CNEA 4BFZA 4ZJYA 1JA9A 1XXLA 2J31A 3AR8A 4XM1A 1DV2A 4JBXA 1GLVA 4N0PA 3L0SA 3D8RA 3VX3A 2FMKA 2OXRA 3EBOA 2BEWB 4O2LA 4QOFA 2JBWA 2ZK7A 3C6XA 4MITA 3SHOA 3C8HA 1BGVA 2OUKA 5EQFA 4M9QA 1SC3A 3B53X 4W9RA 1RACA 2HXGA 3IEUA 4QECA 1J8QA 3DV9A 5CA1A 1C7RA 4QVKA 2AX4A 3U3RA 2VLBA 3M7IA 1QIEA 5LBTA 3T9EA 1PGJA 2BDTA 4Q37A 3U4DA 3AKCA 1LBHA 1T6NA 4P36A 2LW7A 1NE2A 4FFDA 5LBUA 3V97A 2JIBA 2AQHA 5LU8A 1MHPA 1NUHA 3A3NA 3B9PA 5CXSA 1A50B 3FKSA 1LLCA 4M37A 3H18A 1LH0A 2O8VA 2HLDA 1ESMA 1Y4ZA 2BKAA 3GJSA 5F21A 5TQJA 2JLVA 3HUUA 3K35A 4EW2A 4BLPA 3PUVA 2YWCA 1OPRA 3L46A 5DB4A 3S6JA 1K5DA 5ALMA 2FE1A 4DEVA 2RBKA 1EE9A 3U48A 4DJTA 3OCWA 1V11A 1OD6A 2EJVA 4NEHB 4WBSA 1QDEA 3ZQKA 2NZXA 3B36A 1H2EA 3B9BA 3AC0A 3F8WA 2XNDA 3HM9A 2WJAA 1P75A 4OQZA 4UHCA 1KEKA 2XB2A 3NONA 4XOUA 5AW8A 4R2MA 5FQNA 5FYQA 1LVHA 4X5OA 5A7HA 4M0FA 4KQ1A 3S99A 1GEGA 4N01A 3HZOA 3UUFA 1X86B 3MUOA 2D1YA 3OZGA 4O4LB 5IVPA 3T3OA 1ODTC 5BNWA 3IEPA 3T0GA 1SUDA 2RHGB 4ARZB 3GBSA 3OTQA 5EZYA 1J22A 3IVGA 1N1MA 2BEUA 1TQ6A 3WLIA 3ZIAA 4B79A 2LRHA 1FOEB 3ON5A 3WISA 1ZNZA 3GMTA 5L95A 2MIIA 1APBA 2J0UA 3THWB 4N1AA 1K7EB 1DQNA 1JJAA 4E4TA 2A4KA 1HV8A 3LOUA 1NXPA 2H0RA 2W93A 2EIHA 2ZXEA 1TIKA 2VAVA 4EG4A 2BRUA 2JHGA 1QU2A 5C1PA 3JAMA 2FZGA 4QO8A 2DUWA 3L79A 1MKYA 3ESZA 3QLUC 1YZVA 4ZOLA 3Q6MA 3V6LA 4DE5A 1R7RA 1D4OA 2QX6A 2AK3A 1PTJA 3OUZA 3R6TA 4X60A 1QFMA 3BVPA 5K3DA 4F5WA 2OE2A 4OQMA 1XDUA 4OP2A 2FTKE 3FDXA 3T9DA 3GRZA 4KR3A 1WS6A 3M1AA 5LA6A 2F64A 2X42A 4ZAFA 3ZU3A 5CH5A 1V37A 2G8NA 3ZHVA 3BFXA 2R65A 5H3CA 5CDFA 4ZN6A 2H1CA 4FGWA 4KOAA 3OA0A 4PGHA 5ADUS 3AJEA 2E4UA 4CN8A 4K6CA 3X43A 2CFOA 4I66A 1UFRA 1AQ6A 3QU2A 2C9YA 2Y9PB 4EITA 4FINA 3NNNA 1VLLA 3WKBA 1FRFS 3DCYA 5G0UA 3DEYX 4AN4A 1J0DA 1DVRA 1T2CA 1XLTA 4ID9A 5AJHA 4QG3A 2GJKA 4LYGA 3I05A 2D1QA 3EUAA 4MB6A 4G86A 4RH0A 4RD3A 3OMLA 4HL6A 2FEAA 4YJ2B 4BEBA 3J81k 1LLQA 1DAFA 1N9KA 3NCHA 2WUVA 4FZVA 4H31A 2QQ0A 4BASA 4IIEA 1BE6A 3BB1A 3CW8X 3EASA 3DE7X 4X1KB 2BM9A 4JT2A 3RIMA 2H1RA 3DD5A 4YAGA 5B1HA 2C5LA 3MGKA 2PSEA 2Q21A 3WGZA 1Z39A 3CW2A 5ARDA 1AG9A 3ZW7A 5HPYB 2CXOA 4E12A 1EGAA 1FYWA 1YR9A 3BDVA 3H84A 3R6LA 4YB8A 5AUQA 4D41A 1UP6A 2FWRA 1YDEA 4A0SA 1G6OA 4ON9A 3NVAA 1E9EA 5FUXA 1RRMA 5JDCC 3OLVA 3LPAA 3ZKAA 3C6YA 4DRXB 4UU8A 4ZYZA 3C5HA 4EUSA 5C53B 1EM8A 3QW2A 1POWA 3T1YB 1N6NA 1T0PA 2LNDA 4M0MA 1Z0DA 3EFEA 4U5XA 4UM7A 3HFJA 3X1DA 3UGKA 3P2OA 4UJ5A 1I1QB 1OWNA 2Q0XA 4Q5IA 4L51A 2AI3A 1GSOA 2V7VA 4UVIA 2YV5A 1PHRA 1FYFA 5AW0A 1PFKA 3F90A 1F9AA 2R2GA 1ZWKA 2FW0A 2XH8A 3HXPA 3OCCA 4NCJA 5TJHA 3B82A 1Z6XA 4Y9RA 1SEPA 4RBNA 1AZWA 5AVKA 4W5HA 4YHHB 2O3UA 4EVQA 1WZ2A 3TKYA 5JATA 5C8VA 3THRA 4C0QC 4FPXA 1DBVO 2P1DA 3DH0A 3FNGA 5KYVA 4PFKA 3WE7A 3ZVRA 4EX7A 1Q1NA 4B7CA 1ZYUA 2GJSA 2A1TS 1RKQA 2IH4A 4HNHA 4CG0A 3OZTA 3C3BA 3HCAA 1YQXA 4HWKA 3TQQA 5FBWB 2B9VA 2OVBA 1A7JA 4N0EA 3U26A 3VZBA 1MGPA 4BNHA 4Q3LA 1C7ZA 4CF7A 3VSAA 4YMUA 3BD8A 2O3TA 3DFKA 3PI7A 5IASA 4MI6A 3R3XA 3H4MA 1QB7A 4PLWA 4B8YA 1VC2A 5JH7B 3VC1A 1KOJA 4XDHA 5EKTA 3QELB 3BIWA 5BSTA 2IBSA 3Q3IA 5EWMB 3TSWA 2PZJA 2PMWB 1P0IA 1P6XA 4YPOA 4G0VA 4Y6OA 5U4QA 3V1MA 5F2EA 2IEYA 2FEWB 3LHFA 1YR6A 3ZUGA 3E9DA 4FMPA 3DAGA 2P0AA 3HY4A 3V4PB 4G65A 4CKBA 1UWCA 4QSHA 4NZNA 3SIXA 2RHTA 4E32A 4XRRA 5BQ3A 2MYNA 1PW5A 1W0CA 5T6BA 1H6CA 3KOYA 4MUXA 5SY9A 4AUKA 4IMPA 2DVMA 3MMNA 1L9KA 1R3DA 4X3CA 2YOHA 2ERYA 4V38A 4BHTA 1KAHA 1A2OA 3SFVA 4GI1A 4MUYA 3IJPA 5IFKA 4GBMA 1KXJA 2XDQB 4ZI3A 4F4CA 4B44A 2EKQA 3LRPA 1I4OA 1UBKS 1DJLA 2QY9A 2JFGA 3DM9B 3N2LA 3ZI7A 5J47A 3V4ZA 2BEWA 3JQFC 4EJ6A 3NHYA 3BRWA 3EUWA 3ZDYB 3NWOA 2WV7A 1UOOA 4B35A 5BR4A 3VPHA 2QQ5A 5K8TA 3O7MA 3BTOA 4IDFA 4I1SA 4RZHA 3T9AA 1AH2A 4NWIA 2W4IA 3BJIC 4LJ7A 4LUCA 4MV3A 1T4CA 1UIMA 2E6KA 1VIVA 4N5HX 4Y2PA 5ECYA 5BUSA 1CZRA 3NIWA 2JLUA 3L7LA 4KRXA 3TOZA 1OASA 2RK4A 4DJEC 2OQRA 3TTVA 4Q15A 4CUKA 2OYCA 4BV2A 4ETNA 2XMPA 4RETA 1E7SA 4G9EA 4R8MA 3ECCA 4Y2XA 2V9CA 3SG0A 3H4IA 4UKDA 3L7NA 4YJKA 3UT5A 1JRLA 4ENVA 1HTTA 4YRTA 2G71A 3IJ5A 3RABA 1CDOA 3Q7SA 1F8FA 3LD9A 4OA8A 2F6RA 4ETIA 4A0GA 4LC1A 4NU0A 1KF0A 1L4KA 3BTSA 5JFTA 3Q40A 3AF4A 4EG0A 5GGYA 3QP9A 4Q4CA 1MPTA 2Q6OA 1USWA 2B3TA 4KE6A 1VTKA 4PZEA 4H6PA 3T9FA 1JDNA 1MTZA 1DE0A 3MVEA 3WMEA 3UPTA 1F0NA 1U0GA 1G18A 3VKHA 1W36C 1WW8A 2R8YA 4A8PA 1MH1A 1CS0B 3S5UA 5FWYA 2Q5QA 2JEOA 4EG8A 2QF7A 1Z82A 1U4OA 2PQMA 2FJ0A 4K9QA 4DR3B 2F2TA 4E14A 2FMTA 4XCVA 1FQKA 5COBA 1G9XA 1D2HA 2YXNA 4RD1A 2IHZA 4GEGA 1MNQA 1PK9A 2DQZA 2K4MA 2VHCA 3CISA 1XTVA 2I7TA 1DAOA 4JNKA 3Q7TA 3S70A 2IPNA 4DMUB 2BJWA 2YV4A 1NT4A 4GWGA 1SG0A 1GL6A 1VSVA 1CJTC 4QUIA 2FP4A 5MF6A 1U3FA 3NKLA 4ZT5A 5EWJB 1I9CA 4BFCA 4EFDA 4NXMB 2JNWA 1WV0A 4A73A 2VRWA 2X0KA 2WAXA 2ZQ5A 3E15A 1BCSB 4MA5A 1YI0A 5TEWA 2YMQA 4OK3A 5FFFA 1LDGA 5FOXA 4DADA 1RZVA 1T15A 4JZKA 3PXGA 1TPYA 2WWXA 3CQ9A 3TLAA 4IICA 2O7QA 3QI2A 1L4EA 2WYIA 3AK4A 2HLDD 2IQ5A 3JU3A 3KZNA 1C8BA 1QLWA 4BWGA 3A7EA 2GZ2A 3OY2A 1BYUA 1E66A 1R10A 1S2LA 1C81A 3TNYA 2E85A 1EM6A 1BGWA 1IU9A 3LPMA 1GFZA 2V3VA 1W5BA 3ORYA 2IU4A 4O4HB 2C4TA 5JSKA 3FR8A 2GAOA 4LZPA 5ALRA 3VNBA 3IA7A 3A1SA 4D1YA 5IXJA 3EFHA 3TBFA 1KEPA 3TLZA 2XNDD 1Q1GA 1ZGZA 1L5YA 5F12A 4UHDA 4MTCA 4D3DA 5HRUA 2J07A 4OQQA 3EUEA 3QXHA 1BVYF 3KQSA 2WK1A 1Z4LA 1XEXB 1QP7A 1ESNA 1OFGA 3B1WA 4D6XA 1Q83A 5IAKA 3CLUC 3GG2A 4J6EA 1XHLA 1ZINA 3R0VA 4I4TA 1OY1A 4ENTA 2RGYA 3KEFA 3JY6A 4YQEA 4ZALA 5BWCA 5JZ9A 3BGIA 1MHTA 2GA8A 2HY7A 2ZJ0A 4LHVA 1MT3A 3N39C 1CQZA 1EAYA 3Q5GA 1GQQA 2JHPA 4JX8A 4X1KA 3R75A 2XKAA 2IC5A 1K8ZB 3GNLA 1K7CA 2I6XA 1U2RA 3OZXA 5K8JB 5B4VA 1BKDR 2NWQA 4HJRA 3DAOA 3QU4A 4BQPA 5JARA 3K3PA 5FI0B 1UKCA 4Q3DA 3GUZA 3BXHA 2WG0A 4IG4A 3QG1A 4ZKDA 1AZTA 4DYHA 2VH5R 1MV5A 4PC1A 4KREA 3SAJA 1MO2A 4HDRA 5TMDA 3F8TA 1KXZA 3EDYA 3UJ3X 5BNTA 1E9FA 1M0WA 2FEMA 2JCYA 1NJ1A 2P4QA 1KI8A 2C57A 3UMRA 2VJYA 2A0FA 3F6SA 4Q7QA 1J0XO 2OBMA 3HO8A 3BYZA 4JUDX 1Z7BA 1WZNA 2DE0X 2PIDA 3FYTA 3PYLA 3IOYA 4L28A 5C7IO 1BW9B 1GPWB 1TF7A 3GNSA 2O8EA 2ZROA 4P3XA 3KVYA 3Q0TA 2B20A 2IPAB 3H04A 2FR0A 4XWWA 1XMVA 3JQBA 1ZEJA 3RJZA 3MJVA 3N5CA 2SICE 3OPYI 2GK6A 4GI5A 1FFDA 1MMFB 3SXPA 4JROA 1UBFA 3Q3VA 1DRUA 4NMLA 4JYAB 4RPHA 1EJBA 2ZJAA 3PNBA 1ODKA 4BQSA 5C52B 1WZCA 3C8DA 3PA8A 3NTRA 3VSEA 4LJ5A 2BN4A 1NYLA 3DLAA 1YVEI 2PUEA 3QMVA 5K6TA 1WDMA 4W8GA 1FQOA 3L8DA 1KP2A 1CUFA 1KTIA 4TTVA 5BSWA 1FPMA 4RSHA 1SQSA 4KNYA 1GU1A 3IB6A 4YX9A 1C41A 2FW7A 4NMWA 4YPVA 4E13A 1RP1A 2CNDA 3TL6A 2VEDA 3T5AA 4J0GA 1DMSA 4NL4H 2WOOA 3E7FA 1KNXA 2AR9A 2JFZA 2PKXA 2ZQYA 4K86A 4P3PA 2AMLA 5HKBA 4C0BA 4NMMA 1CRZA 2QPAA 3HO6A 3LQFA 3QELA 3NOXA 3ACCA 3IBCA 4MV8A 3O31A 1RVDA 5EWMA 5KOYA 4BY9E 4ER5A 3KM0A 3NU1A 1SC1A 2JGFA 3Q3HA 4JWKA 1GCIA 3H1PA 4HB2A 4I2NA 3SZRA 5DCWA 1SK9A 2NZUG 4N8EA 4FMCB 3GLFE 4G0XA 1GDDA 2EEPA 1MV8A 3PGXA 3I01M 3PX2A 4ZIRA 1JLLB 5IZCA 3K9NA 5K1ZA 1F1BA 5CB4B 4QTXA 3MRVA 3JSAA 4CL8A 1VRWA 4JP1A 1PNTA 4I5EA 2AJLI 2FPLA 2I87A 3FWKA 1LF0A 2Y1EA 3C6KA 4ALMA 1Z13A 2WILA 2HAEA 4RPCA 5AW6A 4LVNA 2GFIA 1FNSA 1XTKA 2OYSA 3AH8A 3AHDA 4BNWA 5CDHA 1TVKA 3LBNA 2HQBA 5K0NA 4A36A 1U1FA 3O26A 3SM3A 2J9FB 2E4VA 3PEWA 3MQ4A 2F9MA 3I30X 4QOGA 4D0GA 4EKEA 1NLFA 4CVNA 1VE9A 4ZANA 3DEAA 1OV6A 2YWRA 3W7AA 3DTYA 1P8AA 3B20A 4XJTA 4AB1A 3U19A 1P7CA 3H9BA 1E2KA 2G7MC 1GGMA 4P31A 1U11A 1EDZA 1IL0A 1DXYA 1UIRA 4QPCA 3Q7QA 2B8NA 3IHKA 1E2JA 3MJTA 1ENPA 3R8FA 3MTAA 4MRAA 4LYYA 4CBVA 4XWOA 1W75A 3B7PA 4HAXA 3IV6A 1NBIA 3GJZA 4BO0A 5KQMA 1P17A 2J48A 2HXSA 4GQBA 1DC4A 4L02A 2PXCA 4XVHA 1RHJA 4KQJA 1R16A 2WLSA 2Z1DA 3ROTA 2F3RA 1QYVA 2O7RA 3A8TA 4JSRA 4TVBA 4Y9DA 3WWCA 4RY0A 1S96A 4CM9A 4HC4A 4Z4HA 5KVSA 2XNSA 2F1RA 3CF2A 3MUNA 3PHCA 3A4MA 4OFBA 4CLHA 2K2QB 4QQNA 1BH2A 1TQHA 1XZGA 2VYCA 4LTMA 5C7LO 3ZHSA 2EYQA 4KQFA 1CS0A 1TM5E 1Y0BA 1UUFA 4KP7A 4N40A 4RTPA 4HGRA 4RCZA 4ZQBA 1XPUA 3MFYA 1OAAA 1U7HA 1J2RA 1HLPA 3AVYA 3D6TB 1MTOA 1S3SA 4P4UA 5HWSA 4WXMA 2R48A 1D04A 1ODSA 1P45A 2JFBA 2V59A 4MAMA 4RH1A 1YVPA 3RHZA 3FCEA 1Y6QA 4CKWB 1IEWA 4BE7B 4JV5B 2FDRA 2HF2A 2ZJBA 1NG1A 5EIWA 3THXB 4QHYA 3IMGA 1NN5A 3TD9A 2YRWA 3QNWA 2WUWE 1Y1RA 4HXEB 5EUMA 5KJCA 1TRHA 4Z53A 4JBIA 2AYXA 3QWAA 1P0MA 1C1YA 2IYLD 4E2YA 3FKJA 2VZ8A 4FLMA 4L4RA 2HA3A 3LOPA 1PGOA 4YMHA 2PO5A 4MNTA 4YBZA 4PLTA 5IT4A 3HG7A 3SQWA 4MVCA 3K0KA 1NFFA 1WDKA 4XQ9A 1XLUA 1YVRA 4RABA 3PNMA 1FFHA 5CVEA 3SQMA 1I2CA 3KKKA 1FTYA 1XWWA 2H7XA 2DG2A 4QYMA 1P81A 3GJTA 5DWDA 1NQWA 2ZCJA 2I4OA 3Q3CA 3IX7A 4RK7A 1CUUA 1B16A 2VHZA 3BWDD 5B1YA 1ZGGA 2GRJA 1FDVA 1GFSA 4Q7JB 5CD9A 1WXQA 1UDWA 1WY5A 1G8PA 3MAGA