2QVBA

Crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
296
Chain Sequence
FGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Mycobacterium tuberculosis haloalkane dehalogenase Rv2579.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase 3
total genus 113
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qvbA00
4QWWA 1OXMA 1THTA 1WPXA 1O6GA 1ZI8A 4F5ZA 1CUHA 3QMVA 4KAFA 1TIBA 2IIVA 1DX4A 1VZ2A 3W05A 3A70A 5CH5A 1SCIA 4DLNA 2WQZA 4GXNA 2Y6VA 2OQVA 2R11A 4N8EA 4BZWA 3O95A 2WUEA 5EIAA 2V97A 4BYMA 1CVLA 3D2AA 5EHQA 1QIEA 4QDTA 1DQZA 1MX1A 1Q0RA 1TCCA 1RYYA 4BC1A 2CMFA 5EHNA 2VQ6A 2C7BA 5AK3A 3C6BA 5ALKA 3WLAA 2ROQA 1YA4A 1L7RA 2V96A 4Y2XA 2XMQA 4XVCA 2YXPX 2K2QB 2XMGA 1TKRA 4LIPD 4OD0A 1WPRA 3EQ7A 5DJ5A 4KE8A 1X2BA 4WFIA 4KJXA 1E8NA 4XIIA 3D7RA 3CN9A 4FKBA 5AH0A 4MYDA 1XZJA 4H7HA 4QDOA 2WU4A 4XX1A 4HS9A 3STWA 1ZI6A 1CUUA 5IVDA 1KU6A 1M33A 3WJ2A 4AZ3A 1QIJA 2WFMA 1R4ZA 2WSLA 3WI7A 2PUHA 4BCBA 1AZWA 4YASA 1E5TA 1XRLA 2OLEA 4EY5A 1QIGA 4OYYA 2JEZA 1ISPA 3VISA 1XZLA 1MJ5A 4Q1VA 1QFMA 2JGFA 3G02A 4G4IA 1GQSA 5AI5A 5C8ZA 1XZDA 1T4MA 1LPMA 5AM0A 5AHXA 3GZJA 3KD2A 3PUHA 1R88A 3E3AA 2G5TA 5CT4A 5ALYA 4X90A 4U2GA 3NOXA 3DKKA 5IVHA 2ACKA 2XUJA 4FLEA 1IMJA 3DL7A 3OG9A 3IDAA 4WDQA 4FLFA 1AC5A 2NW6A 3L1JA 1ZD4A 3IUJA 5JIBA 3HYSA 4N5HX 1MPXA 2G4LA 2DFPA 4Y2TA 1QE3A 2HA0A 1E8MA 1N1MA 5CT5A 1WB6A 3RLIA 1VA5A 5T4FA 4AO7A 2ACEA 3VDXA 3C5WP 1CEXA 5ALWA 3WKBA 1T2NA 1XZBA 4KR0A 4H0CA 1CUXA 5JAHA 2E3JA 3ESDA 3I6YA 5LZ8A 4OB8A 4DSZA 3WKAA 2J3DA 2ZJFA 3FWHA 1GKKA 5AKYA 1UZAA 3ESAA 2ZSIA 1EB8A 1UK8A 2OQIA 1HBJA 4UBKA 3HABA 4DNOA 5A62A 1Z68A 1AURA 2G63A 4P9NA 4J0KA 3FVTA 5HFNA 5ALFA 5A7FA 3N2ZB 4WY5A 1ZGCA 2C5GA 3I1YA 3U1TA 5AOCA 3X3HA 4Q3LA 5AK4A 5FV4A 2O2HA 1BRTA 2J4CA 4J0HA 1TCBA 4BAGA 1XRRA 5AI9A 3C8HA 4KACA 4HRXA 2ORYA 3BE8A 1CUEA 4DSAA 4QDZA 1EK1A 1IUOA 2X5XA 4FNGA 3K6KA 2UZ0A 3FCXA 3ESCA 2JEYA 2DQYA 2QZPA 4GHWA 5E4TA 1Y7HA 2PU5A 3V9AA 5ESRA 2XMDA 3IA2A 3D59A 1EVEA 3AZPA 2XUHA 5CT8A 4CFSA 1XZMA 3Q0TA 2OAEA 3UMJA 1MN6A 1D07A 2VTVA 3WJ1A 4B83A 2YH2A 1NU8A 3O9MA 2Q0XA 3M82A 1XZEA 3HRHA 3BJMA 3H2GA 4C87A 1LBSA 4J0GA 4F0JA 3BXPA 2XI4A 2FJPA 2XUQA 3DCNA 1KU0A 5CXUA 3QZUA 4W1PA 3BJRA 3WKDA 4Y2VA 3LS2A 3F96A 3VVLA 3WKEA 5ALRA 1YB6A 2PPLA 3L1IA 5EI5A 5K3DA 5DNUA 1SOMA 1THGA 4ZREA 4UBLA 3WIOA 5CURA 1EINA 2QJRA 4B0OA 1LGYA 3G9ZA 5CRIA 3WKCA 3GBSA 2WIKA 2WHRA 1DU4A 5T4EA 2JGJA 4QE3A 4BZZA 3G9TA 5AOAA 3JWEA 1ETHA 3G0DA 2I03A 2XMBA 1JJBA 3DYIA 1LPBB 1YA8A 5HF6A 5HK8A 1UKAA 4L9AA 4JEIA 5K3EA 3QMWA 2J3QA 1UOQA 3U0VA 3V1LA 1AGYA 4Q3KA 4B85A 2I3DA 4Y9SA 5FPQA 3Q8WA 3STUA 4D9JA 1YR2A 4Q82A 4BVLA 1Q84A 3DYVA 4MEBA 2QVBA 4DMKA 3HC7A 2QS9A 4H77A 3O0DA 3WK7A 2GYVA 3WWOA 4BB0A 2BAGA 1F0NA 1WM1A 1IUNA 4EY7A 2BJHA 3DS8A 4DMFA 5C81A 5CBKA 5D3KA 1C4XA 4K2AA 1N5RA 3MGAA 2XB6A 4FDMA 3FBWA 3BDIA 1TRHA 3FYUA 1GKLA 4IH4A 4B9AA 1YAJA 4J0IA 4EUSA 2O2GA 1LPOA 3I2GA 3WIBA 4J7AA 2XUAA 2WHQA 2XE4A 2GBGA 4X85A 4LKOA 4KRYA 1P0IA 3WQHA 1JU4A 4GDMA 4G1FA 2Y6UA 1YAHA 2RAUA 3I28A 4AO8A 3H19A 1RP1A 3FOBA 1CUIA 1LNSA 3C87A 2HFJA 4MXDA 1CUAA 5DTJA 1XLWA 3A6ZA 3R0VA 3WZMA 1K5PA 3W9UA 5BWBA 5J3JA 2J4FA 4RGYA 4TGLA 3UUFA 3OURA 2BFNA 3AUKA 2HDWA 5EFZA 4HZGA 3H17A 3R41A 2FX5A 4UBMA 4NS4A 2W22A 3SK0A 4DMHA 5HKAA 2QTBA 4OSEA 1EH5A 3D2BA 4GI1A 2WJ3A 4LXIA 5LP1A 4L0CA 4X93A 3PUIA 5C7YA 5JYCA 1UXOA 4FHZA 1MX9A 1EHYA 1HPLA 1DWOA 1ZD2P 4OU4A 3DDUA 2V9ZA 2AJCA 4B7ZA 3G9UA 1L7AA 3W9BA 4UBIA 3FLEA 1AKNA 4ROTA 4AMZA 3FSGA 2O7RA 2RGUA 2JGKA 1F8UA 3DJYA 4FNMA 4AO6A 4K6HA 1B41A 4LXHA 1JMKC 4JUIA 5A2GA 3BF7A 4PO3X 2HA2A 1UK9A 1CQWA 3TGLA 4I3FA 3RKSA 1G5FA 3HJUA 3F98A 3EIOA 3HACA 4BATA 2OGZA 2HL6A 4TVKA 2OCIA 4WCVA 5HZGA 1ZD3A 4K6KA 3FYTA 1XQYA 4XJVA 1VJ5A 1F0PA 3IVMA 4J0JA 2AJ8A 2WFZA 1K4YA 4GEGA 4BC0A 5CH8A 3FNBA 2DSNA 4AXBA 5SYNA 3D4LA 1DWPA 4G4GA 1ODCA 4E46A 3STVA 4ETWA 3M83A 1MNAA 5FOQA 1G4HA 5JALA 2WG1A 1HKHA 3H1BA 3RM3A 4PQEA 4P08A 5AM1A 1CQZA 5IKXA 4N8SA 3PDCA 2H1IA 5H3HA 4PSCA 4BCCA 3T52A 1ZGBA 2P8SA 1LZKA 1JJIA 4M0MA 3DL4A 4X95A 2ZJ6A 4G8DA 5FPPA 3WK5A 5JZSA 4BE4A 3TEJA 4YPVA 3M81A 2HU8A 4OU5A 4FMPA 4Y7DA 3BWXA 2H7YA 1CV2A 1XQWA 3M3DA 1XZIA 2HM7A 4U2EA 2WIGA 3FYUC 5C8VA 4C4YA 4X00A 5JADA 2WKWA 3STTA 1UKCA 4UBNA 4X3CA 5ALZA 3PE6A 3CN7A 4U2DA 4X94A 2HFKA 2WTNA 5E2IA 1EB9A 1P0QA 1CUDA 3ICVA 7YASA 2HA3A 5I7UA 5LZ5A 4QDUA 5AK6A 5IH7A 1YSCA 5ALUA 4JH0A 5FP0A 3QYJA 5CT9A 5JZ9A 2C58A 4UHEA 4BTLA 5ALQA 2XLBA 4FFVA 4WDRA 3GUUA 4RPCA 4BBZA 5CW2A 4KRXA 1EVQA 3F97A 1CUYA 4W63A 4XWGA 3LIPA 1SCKA 3FLBA 2XT0A 4UFPA 5AJHA 4ZV9A 2GBIA 2Z3ZA 4W1RA 5JZBA 3D5EA 1GPNA 4LYEA 3YASA 1QTIA 3DNMA 1GPKA 4NVRA 1BEZA 3F9CA 1VZ3A 4J0CA 4A16A 1OCEA 4FTWA 1XZCA 4GECA 1ORVA 2ZYIA 2VATA 5HFAA 1ZJ5A 4G9GA 4CG2A 2AJBA 4GWLA 3VXKA 2VJDA 4EY4A 3SC2A 5EIEA 2OG1A 4EB0A 2WJ4A 2HA5A 4KE6A 3K2IA 3HSSA 3KWFA 4W1SA 1K6EA 3I2HA 3WL5A 1I6WA 2PKYX 3D0KA 2ONCA 4AQDA 1JT2A 3C8DA 4OB6A 2WU3A 3PF8A 3IBTA 1U65A 1FFEA 2RIPA 3R3ZA 3PF9A 4C6HA 5AKJA 3L1HA 1ACJA 5DNVA 2QUAA 3IUQA 5D3ZA 1F6WA 2CEKA 4WFJA 2H9YA 1BS9A 3H2KA 1R1DA 5AKGA 3C5VA 3V48A 4EBBA 1BROA 4LHEA 4EHBA 1MU0A 1MAHA 5ALOA 1TK3A 4HAIA 2VJAA 1QFSA 5AIAA 1QIKA 4A23A 4Z49A 1JJFA 2RHWA 2GZSA 1AUOA 4UBJA 4C4ZA 4W9RA 1G42A 1AX9A 2WG0A 3IB3A 5K3FA 1BEEA 5ALGA 1QOZA 4NZZA 3WK9A 2XMZA 2JGEA 3WA7A 3H2HA 4CCYB 2RHTA 1E66A 3WZLA 4AZ0A 3NWOA 4B0PA 3G7NA 1R9MA 1AQLA 3ZLTA 5AI4A 1H2YA 5HF8A 3ESBA 4HXEB 2C0PA 4WFKA 1G66A 2CZQA 2CJPA 2VAXA 4F21A 3BL8A 1EDDA 4G9EA 4LYDA 2ES4A 1WHSA 2XUDA 4Y2SA 4B84A 3AINA 3CCBA 4YK7A 4MWSA 1ZD5A 5CTAA 2O2IA 5FDFA 3PICA 3LLCA 1CIJA 1YCDA 4FFWA 2PSEA 4CG1A 1FFAA 4X6YA 2C4HA 4UPDA 1VKHA 1U4NA 4O08A 2Z3WA 4ZGBA 3I2FA 1BN6A 2BKLA 2VJBA 1H2WA 1XZHA 2JBWA 1QZ3A 2PL5A 5HKBA 4OB7A 3D2CA 4DNFA 2XQIA 3QBJA 1XLUA 5FKJA 1C7JA 5BWCA 3FLAA 5LYYA 4KEAA 3GELA 4CG3A 5ALHA 2GYUA 1USWA 2CKMA 2OCLA 2HU5A 4MJ3A 4EY6A 2Z5GA 5IVKA 5JD5A 2WIFA 3DQZA 3ZPXA 3NUZA 1W6RA 5IVIA 5LZ2A 2Y1KA 5AM5A 1CUBA 3R3VA 4HVTA 3AILA 1QTRA 1PFQA 2WILA 1W52X 4AX4A 2B61A 2H7XA 2HIHA 3PI6A 2JF0A 3C6XA 3C45A 2VF2A 1MNQA 1DTEA 4UHFA 4GBGA 5DYWA 1YS2X 3VJLA 5LZ4A 5DWDA 4KE7A 2HADA 1K8QA 2BUAA 5AIBA 3R3YA 1ZOIA 4ZI5A 3DOIA 5F4ZA 1XLVA 3B12A 3VJKA 2XMSA 4BDSA 1J1IA 4X7BA 1Q83A 1HQDA 1DWQA 3F8SA 5DYYA 4WJLA 3GFFA 5LIPA 3CXUA 1XZAA 3JW8A 3K9BA 3WL6A 1H2XA 1HDEA 2WIDA 1UKBA 4EA6A 1LLFA 2AXEA 5AKZA 1ODTC 1LPPA 1XQVA 4HXGA 2B9VA 1J2EA 1ORWA 2VJCA 2DHCA 2XUOA 1PJAA 5FLKA 4BE9A 1QIFA 1VXOA 3EQ9A 5CT6A 3W2TA 1BU8A 1EDBA 1W76A 5DTIA 2YASA 3ZLVA 5JD4A 3IURA 2D0DA 4M0EA 3PFCA 2QKYA 1JFRA 2OCGA 3H1AA 5K3BA 1A8UA 3STYA 4UHHA 5LKAA 2PUJA 1RWQA 2O7VA 5ISMA 2V98A 1A88A 4KAJA 2DHDA 3QPAA 2OXEA 1CRLA 1JKMA 2QM0A 5DLPA 3BIWA 2WHPA 3LCRA 5ALJA 1CLEA 1DT3A 4I19A 5ALIA 5JAOA 2X8BA 3W06A 2ZYSA 4G4JA 4RE6A 5JD6A 3G0CA 1CUGA 5AKXA 2G5PA 5ALEA 1QLWA 2OCKA 2XQGA 4QA9A 5A7GA 1J06A 1WB4A 3AIMA 4Q34A 1UOPA 2HRRA 4H7IA 5DNWA 5ALDA 2OGTA 4FBMA 4L3WA 1E3QA 2XUPA 4JYPA 2QMQA 3V1KA 4H7JA 5A7HA 4JYMA 1O6FA 4OCZA 2XMRA 4AB1A 4HTAA 5FRDA 4C4XA 3STXA 3D3NA 3WYDA 2B20A 1FSSA 1EDEA 1A8QA 1CUSA 1UK6A 1CUJA 4C89A 2XUIA 1PV1A 2WG2A 3EQ8A 3WWCA 1Q0ZA 3OM8A 3AZOA 1HL7A 3O4IA 3C6YA 4ZRDA 1QIDA 1DQYA 3IIIA 4IHAA 4HRYA 1E8DA 2XQFA 4DIUA 1TQHA 2EDCA 2XUFA 4B80A 1A7UA 1GT6A 3QVMA 4E15A 5AO9A 2BGRA 4OUKX 2WLSA 1NU6A 1XRNA 3I2JA 3OPMA 4OPMA 3JYHA 1U8EA 4FLMA 4AN1A 4OYLA 3V1NA 4J0DA 2W6CX 2WTMA 2EEPA 2OAGA 3O9VA 4X92A 3UUEA 4IH9A 4UUQA 3S2ZA 2ECFA 4ITVA 4DTCA 4IH1A 2I78A 1EA5A 3DEAA 1EK2A 1ZJ4A 3R3UA 1YS1X 2VSQA 3MVEA 5AOBA 3QH4A 3RARA 2ZSHA 2QJWA 1MTZA 2QXUA 3WYNA 5AKIA 4HXFB 4KE9A 3KXPA 3MUOA 5A71A 4YX9A 2QR5A 5HQ3A 3SX4A 4U2FA 1QGED 1ODSA 2PVSA 4H7DA 1IZ7A 1XRMA 3MUNA 1UFOA 3HI4A 1LPSA 4P93A 4S0XA 5SYMA 3FYUB 2FUKA 3FVRA 5AI6A 1IZ8A 3OTQA 3HXKA 3O4JA 2DCMA 3R3WA 5JASA 4PNZA 1J07A 5D7BA 4UHBA 2JGMA 4DNPA 4AN0A 1H22A 1FFBA 3A2NA 3KSRA 5YASA 4UFNA 1XRQA 5T4HA 3I2KA 4EY8A 2JIDA 4BRSA 2GBCA 2HA7A 3G0BA 3WA6A 3WMRA 1X2EA 3QMMA 2HA6A 4DM7A 1QIMA 2LIPA 3G0IA 1MT3A 3FAKA 1B6GA 3AIOA 5LKRA 1JU3A 1MAAA 3FCYA 2YYSA 3ANTA 1BCSA 5AI8A 1K63A 1YASA 2WIJA 1XZFA 2PSJA 3PFBA 4ARBA 1XKLA 4GLBA 4BP9A 3C70A 4IO0A 4UHCA 3EBLA 4CCWA 1CUZA 2QRUA 3H18A 4MQLA 4QDXA 1XFDA 2AJDA 1VE7A 2WJ6A 3AZQA 1YB7A 1W4LA 3RK4A 1UK7A 4P92A 1IUPA 3WWPA 2GYWA 5AKKA 3R3XA 3C6ZA 5AM3A 1E89A 4BTVA 1EX9A 3ANSA 3OOSA 3BIXA 5AKLA 2B4KA 2ZVDA 3WL8A 1KEZA 3AIKA 4LXGA 4U2CA 4BVKA 1Y37A 2XUGA 2IX9A 5BV7A 3BF8A 4JNCA 4H7KA 1QJ4A 1VOTA 2PU7A 4BAZA 4DGQA 2OPHA 4J3JA 3TJMA 3LIIA 2X76A 2CB9A 1ZIXA 4Y2UA 1WOMA 4PSUA 1GQRA 1XZGA 2C5FA 4M0FA 4QNNA 4H7EA 1BCRA 4DNQA 3C43A 4J03A 2PX6A 5ALLA 4BVJA 5FXMA 5KREA 4QZVA 3CCCA 5JAUA 1VLQA 1SC9A 5EIHA 4INZA 2JGLA 3TRDA 1SCQA 2VT6A 3GA7A 3QITA 2C0QA 4X6UA 5AM4A 1VA4A 3I2IA 1CPYA 1QO7A 1LBTA 2WUDA 4DYHA 1P0MA 5AI0A 4BCDA 5AP9A 2ZJ7A 4X91A 4Y2JA 5HF9A 3ZLUA 3H04A 5CMLA 2Y2UA 2WFLA 3VJMA 3WK8A 3H2IA 2QUBA 1ACLA 5JAPA 5KWJA 3S8YA 4BP8A 5LLSA 5AKEA 2Z8XA 1CUVA 1UWCA 2DHEA 3G9XA 4MYSA 3N0TA 1WB5A 2WM2A 1QO9A 3DD5A 5AK5A 2BGNA 2AJLI 2EDAA 5HQ3B 4MQMA 3FSGD 4PW0A 2PM8A 3E4DA 3WWEA 4Q3OA 4QLAA 1UOOA 4N5IX 1P0PA 3LP5A 5ALVA 4B9EA 5D6OA 2GBFA 5DYTA 1GXSA 1H2ZA 1W75A 2WHPB 2CBGA 5ALMA 1BN7A 4G8CA 4RE5A 1ZIYA 3P2MA 4QWMA 4C01A 3A2MA 2VT7A 1OILA 4F60A 1LPNA 4X71A 5JARA 4Y2QA 5CXXA 6YASA 5ALPA 2RONA 1HLGA 2WFLB 2PSFA 3EF3A 3I6ZA 5EHZA 4CIBA 2HHAA 4CIAA 3ZI7A 1EXWA 4MEAA 2RI6A 4PV7A 3A2LA 5K5EA 3VVMA 3WL7A 2HRQA 4FBLA 4GW3A 3B5EA 4KAAA 1SFRA 4Y2RA 1VXRA 2PSDA 5JATA 3HLKA 3HZOA 3I1IA 1QONA 3E0XA 4B6GA 3G0GA 3V1MA 5I9IA 3AJAA 3ZV7A 4ZV7A 3ZWQA 4IQ4A 5K3AA 3H0CA 2VEOA 2XQJA 5T4BA 4A5SA 2ZYRA 2Y2VA 3WK6A 5JANA 3DLTA 2QOEA 1ZI9A 3BDVA 2XMCA 1W1IA 4BDTA 1XKTA 3E1GA 2BUBA 2HA4A 4B82A 3O4GA 3AFIA 5K3CA 2QT9A 4AMYA 1DINA 1S8OA 2ZYHA 3QPCA 4V2IA 4MWTA 1CR6A 2Z8ZA 2R8BA 3DOHA 4K5QA 1MX5A 3ILSA 1JMYA 4ZXFA 1CUFA 2IITA 4UBOA 1LPAB 1QIHA 1MO2A 3QPDA 1N5MA 5E4JA 5AKHA 1TAHA 4UFOA 4DMCA 4U2BA 2XQKA 1A8SA 4FOLA 3IUMA 1U2EA 5ALNA 5LZ9A 4L72A 1QIIA 3DKRA 2VA9A 1VE6A 4TPKA 5FUMA 3KDAA 3OC0A 4CCYA 3G8YA 5EGNA 4Q05A 4Y2YA 5EHXA 2FJ0A 1CFJA 4G5XA 4EZIA 1CUCA 5C8XA 2HU7A 1BE0A 5HK9A 3GROA 2XDWA 1IVYA 2CUTA 1XZKA 2GZRA 1R50A 1JI3A 1WCYA 4FWBA 5E4YA 3R40A 5I8PA 2I3ZA 4Y2PA 4G8BA 3ICWA 3IUNA 2H7CA 5CH3A 5ALTA 1DT5A 2VAVA 1XROA 3QM1A 3H2JA 3KWJA 4W1QA 5AICA 3KOOA 1UT6A 1Y7IA 3HEAA 1N8SA 2WUFA 1XRPA 1WHTA 1NX9A 4H7FA 5ALSA 3WK4A 4C88A 1R3DA 5HF5A 3ED1A 1ZICA 2PBLA 3WWDA 4B81A 2BUCA 2PSHA 5K3FB 5KWIA 5BOVA 2QXTA 4WY8A 3I6MA 3O4HA 4E11A 1XQXA 1FJ2A 4QLOA 2DR0A 1H23A 3NGMA 2OGSA 1C7IA 5LZ7A 4BRZA 4ARAA 4NMWA 4ZWNA 1R9NA 3SWWA 4BAUA 3T4UA 3B3QA 2D5LA 1DX6A 4H18A 4N8DA 1EI9A 4KYVA 1TCAA 4I4CA 1GGVA 4CI9A 1L7QA 4QEKA 5AM2A 4K6GA 1FFDA 1FFCA 4PF1A 2BCEA 5A6VA 1GPLA 1CUWA 4RNCA 4X6XA 5KBYA 2JGIA 2WUGA 5ALXA 3W04A 3F67A 3VKFA 4X97A 2DQZA 1AMNA 1X70A 2XLCA 1LZLA 1GZ7A 3IULA 5HCUA 4E14A 2XUKA 4UHDA 4PSDA 4H35A
chains in the Genus database with same CATH superfamily
2G9QA 1OBFO 1T26A 3A06A 1OXMA 3ZCRA 1Y3HA 4OQNA 4BWVA 1TVKA 3G2PA 2H3EA 4P98A 4Y30A 1JPVA 3RUPA 2F3UA 1WPXA 3V42A 1H0KA 1O6GA 3GR6A 3Q8LA 3NRCA 1QORA 2PJZA 4HWKA 3R5FA 4ZJZA 2QVYX 3RC8A 4X7MA 4CQMB 4F5ZA 3FE2A 1CUHA 3L02A 4BLOA 1SOAA 4J91A 3K1TA 4KAFA 4N12A 1TIBA 4LGVA 2W42A 1DX4A 1ZXLA 3DEJA 1XPRA 1E64A 5TQ0A 2KPOA 1HT2E 5CCEA 3VBCA 2H1OA 5E9AA 1TMGE 4LYJA 4N0EA 1NMXA 1VBNA 1H2HA 2Y1LA 5F2EA 1NR5A 1YH3A 4ND2A 4YJFB 3VSBA 4WACA 2H16A 3W6PA 2Q3HA 1KKUA 3DSRA 4DAEA 2GJKA 2CYBA 4NBSA 3FZEA 3HO6A 4BYMA 3D2AA 4LZPA 3AR5A 4KLNA 5EHQA 1O6ZA 2AIRA 4JHXA 3S2GA 2REXB 2X1LA 3NTXA 4ZVOA 3U7QA 1JEJA 3GVXA 1U80A 1RQRA 2B9EA 2VH5R 3TSWA 4AULA 4MWGA 4N18A 4BC1A 4TSFA 1P5ZB 2GKGA 3MFYA 1RVDA 1TEXA 1HFEL 1JHRA 4J1TA 2FPIB 1JEAA 1V4BA 3PJGA 1XZNA 3AJ9A 3JVIA 3SZGA 4ENRA 1SPBS 1YIOA 1KE2A 3B1VA 5ALKA 3RG8A 4GVPA 3KVRA 3WRXC 2BWJA 1D6MA 4AECA 1GPMA 2XYHA 4I14A 3LLUA 1MRSA 4GH5A 1VJGA 4N41A 4M0PA 4DR5B 3GIDA 2P5SA 1GZ6A 1KYWA 4QYWA 3KBBA 2XRMA 4E0BA 4WHMA 3FPCA 1YIAA 3AOEC 2ZWAA 5JJIA 4CF3A 4F86A 4TLLB 4OQZA 4GOLD 5DULA 5E6UA 4CTOA 2C3MA 3C5EA 3SF8B 2AKAB 4C0WA 1C7FA 2E2WA 1PT9A 3B36A 3EC7A 4YRKA 2YWJA 1AQNA 1EUZA 4GL2A 1N0HA 1EXMA 5I9LA 1Z0ZA 1DZ3A 2R65A 2PPVA 2XCUA 2XZPA 4OBWA 4WFIA 4AZ3B 3KJEA 4EATA 3THRA 5J47A 5GJBA 4JJKA 4X7RA 4KBGA 4OP3A 5H9WA 4XIIA 4XH9B 5JISA 3KT0A 1XZ8A 1JHDA 2IW1A 3IDOA 2C95A 4FOPA 2V5AA 3PXUA 2P30A 1UBGA 3SFVA 2QJFA 1G8JA 3WJAA 1B76A 1Y1RA 1GXSB 4ZPJA 2WJPA 3PE4A 4YECA 5KKAA 1Y82A 2ECKA 1ZUIA 2AG8A 3F4LA 2IE0A 1A7AA 2PFGA 1Z0KA 4X63A 3NP9A 2EFYA 1WXFA 3W4KA 2CVFA 4QM7A 2WFMA 4JYAB 3PFFA 3M4NA 1OPXA 2PCLA 2YXBA 4MVJA 2IDMA 2PWYA 1ZL0A 3KL2A 4JKYA 3GUZA 5TGTA 4GKKB 2LBPA 4FN4A 2DKOA 4PR3A 5E9QA 2IY7A 4BB6A 2ONKA 3JWHA 3NHMA 3M1YA 1ISPA 1BTOA 1L5QA 2J6CA 3GGCA 4Q0MA 2C99A 1DRJA 1XDDA 3G2QA 4P0TA 2W2QA 1TA4A 2BGMA 1Q17A 1FS5A 5DEOA 5F7OA 1AUPA 2X7JA 2BFAA 3AG6A 1SKAA 2JGFA 1LQ2A 3H9EO 1YMVA 1Y48E 4TV9F 4L7QA 4I1PA 1E61A 2COKA 3KKOA 5CVVA 3TG8A 1JAZA 2YWCA 2CUNA 3IELA 3PEFA 4ZYUA 3T3PB 2D62A 4ZI7B 1Q0TA 4G4IA 4FYMA 1T1SA 3SHTA 1LFAA 2FG5A 2GRAA 5EUCA 2PQ2A 3D3QA 1P1RA 4LMRA 1K97A 3PQ3A 4IWXA 4J7XA 1RQ7A 3G0HA 1ZINA 3LUKA 2OVFA 4PNEA 1T9CA 2NP7A 3HFSA 2AGVA 2AKYA 4RF4A 2NZXA 4E94A 1Z0UA 3SY8A 4L1KA 2BKEA 3AIIA 5JCXA 3PUHA 3UPTA 3E3AA 1L4HA 3GGGA 3ZDZB 2G5TA 4TV8B 1W1WA 1EZ4A 3A4VA 4GPD1 5CT4A 4YUVA 3S4YA 4BVAA 4D9CA 5B2EA 2JCBA 5HM6A 2ZJZA 1YFJA 5KSZA 5IMBA 4Y1FA 4I1SA 4CM4A 3C1AA 2DPXA 2FSPA 1JU9A 1DJMA 3TQTA 4A82A 1LKZA 3KPUA 2X8WA 3U81A 5AJWA 4KNYA 1EHIA 1G5RA 5IVHA 3DHYA 1Y81A 2EJBA 4PAWA 2VSXA 4E88A 3HKDB 1RAIA 5EKUA 1T35A 1IBCA 3JALA 2A1TS 5ED0A 3W5IA 5L4LA 3FOFC 2XUJA 1NZJA 1R6AA 5KMGB 4FLEA 4IPTA 1WDMA 2R8EA 3IDAA 2IDKA 1YZQA 1NIJA 2IV3A 3VO2A 1LVUA 2YMLA 3EISA 5IAGA 2FXVA 1TZKA 2X6RA 3AHEA 2PUEA 2G6TA 4ZI7F 2GF9A 1Y0BA 2ZYWX 3UATA 4FLFA 4KU4A 1A7JA 1ZOLA 4TTRA 3OZXA 4YGYA 3SGLA 5HDBB 1OIVA 4KFUA 2RHDA 5E2AA 3ZQ4A 1CQIB 1ND6A 3L1JA 2AN9A 4P3YA 3ZE7A 1X1RA 3GJ3A 3BGIA 4IMRA 2RB5A 5ARDA 3UXMA 2P0EA 3FGNA 1LD3A 3HYSA 4E32A 1MB2A 2C54A 2RH4A 1MPXA 3BIJA 3PUJA 2DHQA 4Y2TA 4F38A 4R0NA 3H9UA 1KJ8A 1ISFA 1E8MA 1KY2A 1N1MA 2O1XA 1W0JA 4HG2A 1IHXA 3VQTA 4NHOA 1QHIA 1E2LA 2EP5A 3H3XA 5AHOA 5DGCA 1KDZA 1WB6A 4QGFA 3RLIA 3TIXB 4RA6A 1GRVA 4M88A 1VA5A 4Q6BA 5DB4A 2JI4A 2F9FA 4HMPA 1QOQB 1H3NA 4GNRA 3HZRA 3E9DA 4QRHA 3DVSX 4ZN6A 1G6HA 3PCTA 4G09A 4KUEA 5COBA 4Z0TA 3VDXA 4C6SA 4PG6A 1YXMA 1JDBB 3OQBA 4PZCA 3TIIA 3U4AA 2FPXA 3AY3A 2ZRKA 1YB5A 5KNDA 4CL8A 4BLVA 2DLCX 1BX3A 2CVZA 3LF1A 4HWOA 5K99A 4XWTA 1XZBA 4EAAA 2VPZA 3OJXA 4K9SA 4YT4A 3DO8A 3AI3A 1CUXA 3CH6A 3DM9B 3N3AC 4AYXA 5GAJA 3ZCTA 4EA8A 1R9JA 2XTAA 1WCWA 3ESDA 5HIMA 3B1XA 5LZ8A 3M6LA 1RPJA 1T29A 4FT4A 4UTVA 5E3IA 3HWSA 4FI3C 5DYNA 4Z7JA 1A4RA 4ZEXA 1OB2A 3PHLA 2BMAA 4D4HA 1TO6A 1WUJS 3MS7A 1Y3FE 3LV8A 5L7TA 3FPBA 3HABA 3H0EA 3IOCA 1YQWA 2PMWB 1ODKA 2A33A 4MQ5A 2PEZA 1AURA 3CZCA 4G4SP 4EQ6B 3VTZA 3ONNA 1DIAA 4ZZIA 4X1YA 3EUEA 3FVTA 3JZAA 3PWKA 2HF7A 1PNRA 1XMOB 3R6TA 4L75A 3HCPA 5HFNA 1JR4A 4LC1A 3HVUA 3OE4A 5EHIA 2P69A 1W4CA 5ITZB 1T2UA 3PJRA 3HA5A 3N2ZB 5EINA 3VSDA 4WY5A 1B8NA 2NPOA 3G89A 5L3SA 4ND7A 1MJHA 3I1YA 3OLQA 3TZLA 4CQLB 1ZK4A 4YP5A 1Y5IA 3A3PA 4DNXA 4EZBA 5G02A 1GHTA 4Q3LA 3F78A 5JC8A 1YD7A 4OATA 1Q6ZA 3KYBA 2D1YA 1NVXQ 1XJWA 2RGYA 5AHKA 2SKDA 2J4CA 2DH5A 5DHSA 5AYVA 4EB8A 1MJFA 1RJEA 2Q6OA 1ZJYA 4JBGA 4WW0A 3JZIA 4BB9A 2B4AA 4G5HA 2IZ0A 2H4XA 3C8HA 3ZU3A 3JATA 2BZSA 3PWSA 4KACA 4HRXA 1VKZA 1OAAA 4GSLA 4WESA 4X1KB 5CLLA 2RH5A 4KV9A 4EJSB 5IX8A 2RHCA 1VIVA 2E87A 2DPYA 5LQMA 4QDZA 3TW8A 4DT1A 1RQPA 2H1LA 3DWEX 4FNGA 2UXDB 2HDNB 1IQRA 1L4UA 1QFYA 2OTCA 2R6HA 3GWZA 4KCGA 4RKYA 3VHLB 1E3DA 2UKDA 2UZIR 2O5EA 1LNZA 4A0FA 3LX8A 3QXJA 4CDGA 3PR2B 1Y7HA 1OC2A 4LGYA 2VKQA 3WLIA 3RYFA 2DY1A 4MS3A 4EFMA 2XIJA 3U7HB 3IPLA 2D1RA 4LDZA 3AUJB 3DC7A 1D09A 1PR2A 2PFKA 1P3Y1 1DELA 2X5OA 2XMDA 2ZSUA 4IJUA 3T35A 4EPTA 5CG1A 4MITA 2D3TA 2VXBA 4Q3AA 3AZPA 2ET6A 4D0RA 2XUHA 3OLYA 4NBLA 5CT8A 4ZVLA 3ZJYA 2L42A 4AF7A 3HDQA 4WY2A 3CZQA 3RUIA 3UMJA 2OAEA 5MN4A 1MN6A 5BXQC 2VTVA 3WJ1A 1RJGA 3GGJA 1H69A 3PT5A 1KO8A 4ZOLF 2YH2A 3PQ5A 5AXCA 5TJHA 1QZXA 5IJWA 3OM9A 4G2NA 5I9SA 3LTNC 1PRYA 3DNPA 4OAOA 4CM9D 3DF9A 4FHEA 4P35A 2OG2A 1LBSA 3EIXA 4C87A 4J0GA 2B82A 4YJ2F 5L9AA 5BNTA 5MGBA 2HRCA 3KE8A 2VHYA 4XM2A 4DZZA 2JAQA 2XUQA 3DCNA 3O7MA 2RIRA 4I0WB 3RYCB 2BMWA 3LLSA 4Q1CA 4PX2A 5FOWA 1X7GA 5A6SB 3ZQ6A 4B47A 1E94E 5P8WA 4CIVA 5B4VA 4W1PA 4FQ5A 2WV9A 2X2EA 1K08A 1KSGA 4M1QA 3AW9A 3QEKA 3D0OA 9GPBA 2D1QA 1U7PA 5JI3E 4WT7A 1U2RA 3VVLA 3SFZA 3M89A 4RF3A 2KS6A 3FDFA 2A6PA 4MVJI 1X1BA 2HCBA 4ESEA 1JHQA 3VAYA 2WABA 1UDAA 2AN5A 2H5IA 5EI5A 4DLRA 1IHUA 3SPXA 1BO6A 1UPCA 1W4AA 1VJDA 1SOMA 1KO1A 2V6BA 2BDUA 1THGA 4Q18A 1V2HE 1D2CA 1RXSA 4MTCA 5D1HA 2GS9A 3G2KA 1SCAA 1U5BA 3M6VA 1EINA 3LOUA 3OIYA 3JU3A 1BKDR 1RI2A 2PKQO 5HOQA 3M5WA 4JL8A 2CXTA 1JDPA 2GD6A 3AERB 2ZPAA 4TN1A 3DCYA 3FWZA 4I4IA 4E7PA 2E85A 3FAZA 2ZIFA 1UBKS 2VR1A 1NN3A 2QDKA 4PCLA 1SIUA 4U7GA 4QUIA 4NV0A 1I8TA 2IFTA 1L5RA 2OEPA 5HKKD 1QGYA 2CHVA 4YAKA 1ZGHA 5JQGB 4F11A 4DY6A 2ZSEA 2WHRA 3ZWMA 1WU8A 5BV1A 3R76A 2A8YA 2PMKA 3G9QA 4HPXB 4EKGA 3AHIA 3QVUA 2AMVA 1CX9B 2XIQA 2A1IA 3CPEA 3PGMA 1LS6A 4HX2A 4BFLA 4CIDA 3JR7A 2V3WA 5HJ7A 3OQMA 1XVVA 4YMSA 3G0DA 4RS4A 5THXA 3OE7D 3TXYA 5LXTB 1ABFA 1RJ9A 2XZDA 4YHBA 3WL3A 4ADSG 3BCRA 3G1WA 3KEMA 3KPJA 1UJCA 1W9MA 4M98A 4OI4A 3N87A 5HF6A 5K4GA 4BVBA 2REOA 3MT8A 4RLHA 4EYSA 2WWFA 2ZCJA 4JDPA 5K3EA 3QMWA 5GIOE 2DR3A 4IO1A 1A9QA 4YMLA 1UOQA 4WADA 2CLDX 3T9AA 3KFXA 4JASB 1GA1A 4DIKA 3LE8A 4E5VA 4EJ6A 1AGYA 1KJIA 3B82A 1IN1A 3QXCA 3K32A 1QP8A 4IIFA 4ALMA 1SEPA 4G25A 2DJ5A 2YRWA 1K6IA 2PO5A 2Y92A 3P2EA 4NJMB 5FPQA 3STUA 3FR7A 2V7WA 5EXDA 4BMCA 4D9JA 1YR2A 2O0LA 1M5UA 2ZE5A 4ASUA 4BVLA 4IMJB 3VDNB 1N5DA 3DYVA 2MYPA 1E9DA 1Q22A 4CG0A 3HBNA 5DCLA 1NOIA 3TLBA 2K7ZA 1NF8A 2ZBGA 3OZSA 3N0XA 4A5OA 2J9XB 1W8DA 3FUCA 3L07A 3NIDB 3O0DA 2Q1WA 4KI7A 2ID4A 4PC2A 3RFXA 2AN3A 2G07A 3HA7A 3S7ZA 4EY3A 4BB0A 5B1IA 1Q16A 4W6QA 4M1TA 1F0NA 2GRJA 1CJCA 3DDWA 1QHYA 4P33A 2X0KA 3GZNB 4PIVA 5EVJA 1WPQA 2BJHA 1S8AA 3A4TA 2D7JA 1ZMXA 3LVRE 4NBUA 4DMFA 2OO5C 3OEHA 1E2IA 4QIHA 1KQFA 5B7QA 1GAEO 2XDQB 2IVZA 2XODA 3E05A 5D3KA 4OFZA 3FN4A 5EIOA 4DQVA 2GT1A 4KO4S 5JJLA 1AUXA 5B58C 2XB6A 3A1TA 4YLGA 4RA6B 2X77A 1RXUA 1QANA 4YQEA 4BNXA 4MV7A 1JMVA 1GKLA 4IH4A 4BO7A 1O94C 1YAJA 3COYA 4I8IA 4ZTBA 5A3SA 3BGDA 1YZTA 1NM5A 1WUHS 2Q5EA 5LLTA 3F2IA 2XYQA 2I7DA 3TF5A 4EUSA 2O2GA 2VDJA 1QOPB 2DF8A 3CF0A 4MHOA 2NTYC 2XB9A 1AKUA 2J45A 4GI5A 4J7AA 1PEAA 2Q1UA 4I50A 2WHQA 2W2OA 2WTAA 2WSSA 2XE4A 4YDSA 2GBGA 4F4FA 3F3MA 1E7YA 4MRMB 4X85A 5BYAA 3PG5A 2CN1A 3WQHA 3KPWA 4GDMA 4YUAA 2GHTA 3F47A 5FAKA 5KYXB 1BX0A 4BXOA 1I4LD 4J1TC 2OV4A 1P1FA 2XCIA 3MSCA 4QVGA 4CM8B 4QUJA 2PCJA 4L2IB 3S29A 5U9CA 2ADMA 1YS9A 4JFAA 5FYDA 4HB0A 1QHXA 3V8PA 2VF4X 3RC7A 1ECPA 1U7OA 4Q4AB 3OAAA 2XRZA 3ASZA 1JNXX 3ZX4A 5IF9A 4QQRA 2NXCA 4OQYA 5AK0A 3B60A 3ZWDA 2A0XA 1B8OA 2PGJA 4F45A 1XLWA 1U8UA 4A15A 2OL4A 1LJUA 1N2OA 4C04A 4ZCTA 4EKNB 2QN6A 1CHDA 4LHYA 5KU7A 3PEEA 5BWBA 4AK9A 4XX0B 2RK4A 3FCSB 1TKBA 1VHJA 2J4FA 2LPMA 1MW8X 2BFNA 3A10A 2HDWA 4DPKA 4D7AA 5ER6A 1A1VA 2OZVA 3MJSA 3KJGA 4DDVA 4L73A 3OQIB 3LW7A 2XXJA 3F5QA 4HDOB 4UBMA 3RRYA 3KETA 4D25A 2G8LA 3AV0B 1VDMA 3JQ8A 3HKCB 4ARSA 2VXYA 2FVYA 3GLHB 2ERXA 4OHXA 4R2MA 5DOZA 3LBNA 3NDJA 2O4CA 2L18A 3OEYA 3O8CA 1KXJA 3NMUF 3L9WA 2WU8A 3TRIA 2DX7A 2JIPA 3WIUA 2KYRA 2M1ZA 2G8NA 3L93A 4IQ8A 3SS9X 4JODA 1CIPA 3VPHA 4DDTA 3LDFA 1RZRA 1P75A 3K72B 3D2BA 3JQBC 3NPMA 4JUDX 1M34E 4GI1A 3U6KA 4FGJA 1E6LA 3CVXA 2GZ1A 4LXQA 1BW9A 4W8OA 4A4DA 4D46A 5DGIA 1GAQA 1IDN1 1AK2A 3PUIA 4MV3A 2J9YB 2IXFA 5JCOA 4JR1A 1MG0A 3DDNA 4LKRA 2C31A 3IHTA 3K15A 4QG7A 3R44A 2W58A 3FA2A 5DLDA 5EOVA 3PXDA 2IH5A 5EXTA 1HNZB 3DEYX 2ONYA 3EXHC 4RDHA 4BL5A 3SVLA 1E20A 1S4MA 4G5YA 3UOAB 3FTNA 4NU6A 4DBZA 5BSTA 3B5JA 2CHQA 3AGPA 4ZQCB 3D81A 5I7HA 2JFXA 4RSHA 3DDUA 4WCDA 4J4BA 4YRCA 1T9DA 3T8YA 5LQSA 1XCPA 3JATB 1MG5A 5FUYA 4B5KA 1Z12A 2DFNA 2WZDA 4H1VA 3SQLA 4QYMA 3E7PA 1Z5OA 2FZVA 2ZTMA 3M5CA 4I9NA 4RADA 3UEOA 4ZZ1A 5FI5A 2IW3A 3KLNA 3GY0A 1A3CA 4ROTA 1OYWA 1P1KA 4ZQEA 4QVKA 5CJJA 2O7RA 2RGUA 5DHUA 2AV6A 1ZM9A 2R60A 5HIKA 3CJTA 3OX3A 3CUSA 3OE1A 3Q98A 4FNMA 1L1FA 5IJXA 3ILYA 3TI9A 3V00A 4XRRA 5BNFA 2ETVA 4AO6A 3O03A 4K6HA 4MCIA 3BMOA 4RD0A 2GF2A 1GAJA 2F1OA 2QTMA 4MICA 1JBEA 3QLEA 3ZE9A 5FV7A 5A2GA 4KPGA 4KDCA 1HEYA 4HDMA 3CRZA 1G2QA 3ZY4A 1TLTA 4RJ2A 2C9MA 2R6R1 3RNLA 3TGLA 3PEYA 3ACCA 3F9RA 3N2YA 3RKSA 1N6HA 3TMAA 2B5OA 1VDZA 2IHYA 3HJUA 2JGAA 3ZDRA 4HWPA 3ABIA 3OOJA 4LOLA 4ZP1A 2PH1A 4BATA 2OGZA 2HL6A 3PJEA 2SCUA 4TVKA 5IHXA 1RQGA 3BWDD 3R2JA 4O1HA 1E4YA 2PWAA 3QTBA 4L5YA 1C1YA 4O63O 4RJJA 3TSAA 1C1DB 1M75A 2JCXA 1GRNA 2OT3B 4WCVA 3UTCA 4O25A 4WZBA 1JZTA 4OAQA 5JVDF 4NE7A 3M9XA 5ITVA 3CGGA 1RWVA 4R4JA 1HG1A 2A9KA 5CYFA 3HN7A 2ZBDA 1XQYA 4RVFA 1VPVA 4XJVA 3KZMA 4BV8A 4OXIA 1HL3A 2OV1A 4EF5A 3O7WA 1KOGA 3HK2A 1F0PA 3Q7PA 4WOKA 5KYYB 4EI8A 2FPGA 3SHWA 4QGAA 2XA9A 2GN4A 1EGAA 1K4YA 3KAQA 4AI6A 5F64A 1TVCA 1BZYA 1ADCA 1DBWA 4JLPA 5CX1B 4JMPA 3CJRA 4AU1A 2WKQA 1I10A 4XB2A 2ZTUA 4XYEA 4J2HA 1CHNA 3FPKA 1GDTA 1TGYA 3STVA 1Z45A 3M83A 4FWIB 1MBZA 1OFUA 2DMRA 4FXPA 3G2MA 2BGKA 3NQ41 3RIHA 5CJ2A 1VLJA 1NN1A 5JALA 1U7ZA 1C5KA 5PNTA 1CIVA 1Z88A 2EHDA 1UBMS 4L51A 4KX5A 5LM3A 1KZ9A 2DBYA 2H1FA 2ZIZA 3K9CA 3T0GA 4P08A 3UANA 3SQMA 4PXYA 3L6CA 4ZFNA 3M6XA 1CQZA 2P65A 2I76A 3VR5A 2O48X 1P4SA 4XB1A 3VMFA 5H0IA 2BGGA 1GDDA 2R4QA 1L7PA 3I12A 5H3HA 4QKQA 1V3TA 1RYMA 4CRWB 3PEUA 4AIIA 3IUPA 2RG1A 2IPXA 4V1CB 4M0MA 5EFOA 3KOMA 3QKSB 5TR9A 4X95A 2G36A 1NIPA 2L82A 2Q6LA 2Q28A 2PL3A 3CWZA 4Q21A 4QJIA 4BE4A 2X2FA 3L41A 2XB4A 1SKMA 3C3BA 621PA 3IMKA 4C7BA 2WQ7A 4EYEA 2PAFA 3TEJA 4YPVA 3ROFA 1MEJA 3L0PA 2FMHA 3QNUA 4RVHA 4YCMA 4EJ2A 3RAGA 4RHCA 4LRYA 3AF6A 1UINA 2C07A 2QG4A 1RI1A 4CFZA 1QQTA 1V1RB 5KQGA 3D7KA 1RC8A 3MWLA 3H9BA 3N3BC 1UPFA 2KI5A 2JJ8A 4FU0A 3V46A 1CV2A 3WQRA 1Q50A 2ECOA 4H3HB 1CLUA 1XZIA 1L1RA 4TRRA 3RSZA 1XN1A 4U2EA 3DXYA 4RDIA 3SJBA 2WIGA 1GV0A 3CS3A 1WMSA 2AJTA 1ZVKA 3FYUC 3UFXA 3TDMA 2QENA 5IT4A 4B79A 4C4YA 2NU7B 4UCFA 2C4MA 3EXG1 4X00A 3B1KA 3O90A 1ONSA 1VIAA 2QG9A 4RYDA 2ZVQX 4ZI2A 1CY0A 1W2WB 3VDRA 4N7BA 1RI5A 1JLKA 3PFKA 3IAM1 3SMVA 2GZAA 1U8ZA 2X2PA 4QO7A 1UKCA 2A0WA 3ND6A 4CGZA 4C1NA 1SURA 3OO0A 4RK4A 1E79A 1DC8A 3PFNA 4CZ2A 4B3DA 3PC8C 4XOIA 1JLLB 2JLSA 3QEAZ 4TZ6A 1T2DA 2GVNA 3HDVA 3PE6A 5ALZA 2Q5FA 4UD6A 3K0BA 1JVBA 2ZYVX 3G2NA 2HXGA 5ICCA 1JG3A 3ITKA 1LBIA 3D4IA 3AL2A 1KARA 4IJQA 5EZYB 4ZZ0A 5JFTA 4QPZA 2BYTA 3FRIA 1PW5A 1WP4A 3K9WA 2FEAA 2ZRQA 3HKEB 1SVWA 3KHKA 8MHTA 4PC1A 2IPAB 1W87A 2HFKA 3N8HA 1GTMA 1UXGA 1YZGA 4IXMA 4OFBA 4LDNA 2E4AA 4S3MA 3H9QA 3AV3A 3PIRA 1NJ2A 1XF1A 2Y99A 3BMCB 3ICVA 4KXXA 3PFGA 4A2PA 3KPYA 1Z47A 4RFVA 2QBYA 5ENZA 2ISQA 3K3PA 4MCHA 3AETB 3S70A 5I7UA 4REQB 4KHPB 2QT1A 4JDUA 3S1AB 1Y3CE 3P0FA 3LKVA 3JQAA 1NJFA 1XJQA 3WJ7A 4QDUA 1H8ED 1DJLA 2ODNA 2OLJA 3TX2A 2JIZD 4CLDA 2XA2A 2OB1A 2VAWA 1PIWA 3ETEA 3PNKA 2PBZA 2C8LA 2VI5A 3NAZA 1N0VC 4JH0A 3C16C 5CT9A 5T64A 1LDEA 2C58A 2I2FA 3HJAA 3JAKB 1TIKA 1NE2A 2R48A 3HB1A 1I2AA 4LTMA 4O4HB 1Z75A 1PJQA 4ZQBA 1IAQA 4JOSA 4QGBA 1II8A 1WXHA 3KZOA 3NLLA 3P27A 4UVDA 4H31A 2J5QA 1PTJC 3FMOB 2XWQA 4EW1A 2FKNA 3B1FA 2E37A 2JD2A 3BXEA 3QVKA 1GTL1 2IH4A 1K8RA 3ZU4A 2UYQA 4O0LA 3K1ZA 3B38A 2JAPA 1SH7A 2YOHA 3GARA 4KR2A 3LZCA 1UBNA 3QOXA 1TVKB 1SCKA 4MDYA 1HTWA 5I9BA 3FLBA 4NOJA 4U5XA 5ILGA 4UFPA 2GA8A 3PLAE 3VHXA 1YS6A 4OG2A 2BMJA 4TMKA 2FE4A 3QTTA 4WASA 3QENA 3LT2A 3G2LA 5DLYA 2ZI5A 5BN3A 5DCUA 4S24A 4Q00A 3LT0A 3TVYA 3ZIUA 3BT7A 3F6SA 5GM2A 1DV1A 1A8HA 3EAGA 4MW4A 4PICA 2PUFA 1ZH4A 2FW1A 5TSDA 2GAJA 1C8VB 2XSZA 4L9SA 1SVUA 3RSQA 5KYWA 3QFHA 2QI9C 1LFDB 1WQ4A 1JJVA 4LOIA 4EECA 2NVWA 2QAGB 1H65A 2XRFA 3H2ZA 3ANYB 3OKAA 4U3JA 4W1RA 2AQKA 3BSWA 3K05A 3OZAA 2Q8NA 2W00A 5TX7A 3WRYA 3D5EA 2FG7C 1GGHA 1DPFA 2ZBUA 4XWWA 1PKXA 2FAXA 1QK4A 3DNMA 4DXAA 2YHUA 3EHDA 4NVRA 1BEZA 4Y6RA 2ZI7A 3WV5A 4C6TB 1CZRA 1ECGA 1USIA 1GZDA 1W0KD 4UU8A 4A16A 1J2TA 4G81A 1KC3A 1OCEA 4FTWA 1Z07A 3EK2A 3MWDB 1B3RA 1UIMA 2CVHA 1D9XA 1KP9A 2JJ2D 3UAXA 2IDJA 4GECA 3AKZA 2CLKB 3GH3A 2VATA 1C81A 1ZJ5A 2BEUA 2BSXA 4G9GA 4XA8A 4CG2A 3NDBB 2NO0A 2Q3MA 3U39A 2EG9A 1LDGA 2WWWA 4TYYA 1NONA 3CCFA 2ZP1A 4XDZA 3G13A 3SC2A 4QT4A 2EF0A 4I8XA 4MUBA 5DW0A 2I2BA 1H85A 4BQFA 2QM3A 4FS3A 3U31A 4F4DA 5ICMA 5F77A 4QU8A 4S1PA 1KL7A 1QH1B 1A7KA 4KE6A 4MVWA 4B7AA 5KYGA 4FGWA 4HTFA 5JPDA 4KWEA 2CF5A 2ZTVA 2NU7A 2WJGA 1JW9B 1SKUA 4K3VA 4WOPA 5JY1A 2XZLA 3O82A 2C2OA 4I4LA 3DMTA 4W1SA 2P35A 3DVLA 2QGNA 1I6WA 3TZKA 1ZESA 1C2TA 1T25A 1SQSA 1T9AA 1RC1A 3LRXA 3VV2A 4EBFA 1WSWA 2ONCA 4GT1A 3ZDQA 1CJUC 2EC5A 3TTTA 3PF8A 4RFSB 1KYQA 4M9QA 1GZ3A 2CJWA 5IAOA 1U7DA 2W0SA 4YTEA 4PONA 1U65A 4QBHA 4Y0VA 3GGDA 4EG0A 2RHRA 1FFEA 1AGXA 2RGWA 1FMLA 2ALJA 1CBUA 4XWOA 2XNJA 3EZ2A 3P4XA 1K6JA 3OFJA 4BNUA 2N47A 2E5FA 521PA 1YFKA 5HIIA 1SBHA 3BERA 3DOEA 3JRNA 3PF9A 3BYZA 3UWDA 4DFDA 1ZMBA 2C7QA 3QQ5A 1GR0A 2BHRA 4P4UA 3TR0A 5HBGA 4BXOB 1KJYA 3TS1A 3KHTA 2PQ6A 2ZAIA 5AJTA 1ZVJA 4IZIA 2NAPA 3AHFA 3HSYA 3UCEA 3UG7A 4D5GA 5KQSA 1M76A 4RLSA 3COJA 1DEHA 3U4QA 3LUAA 3BE5A 3IUQA 3WLQA 2VO1A 1XQ1A 3I4CA 3UAGA 4U8GA 3KC2A 4IHJA 3VR2A 3IQXA 3WMGA 1AZLA 2BD0A 2H9YA 2VDWB 3GWGA 3QFRA 2Z8YM 1BS9A 4BBPA 4NCBA 4TWBA 3K8ZA 3H2KA 5MFPA 5AKGA 2W8ZA 2ONJA 1VG0B 4PG5A 4EJMA 1A2QA 1BROA 5H5JA 1T0IA 2HJWA 5AQ1A 3GRYA 1YKFA 1JWLA 4TYPA 3DUWA 1UEXC 2P2CA 4PPFA 1KEUA 1OY1A 1UOEA 3AEUA 3CEHA 3MWJA 2BGLA 4M1MA 2VJAA 3OIVA 2IYXA 1CZOA 1S8NA 1T36A 1CY2A 3VGJA 2BFMA 1RBMA 4RXUA 5IYZF 3LDGA 3LHFA 1L7VC 1JJFA 2WMYA 4C4RA 4GXTA 2BKVA 2JD0A 3GLGA 1SCDA 2GZSA 1AUOA 4UBJA 4IX9A 2NNWB 5E7MA 4Z53A 2DPMA 4C4ZA 1NXXA 3TB6A 1JQDA 1TTHA 4HPJB 4HAOA 5DWQA 4E1AA 2WG0A 1DZIA 1WR8A 2FEMA 1AD2A 3OLVA 4HDSB 1PV4A 5ALGA 2F3RA 4ZDIA 1DC4A 2NADA 3IMCA 3IS3A 4N01A 3WK9A 3LUCA 4CE6A 3S5JA 2CFOA 3WA7A 5HQTA 2BM1A 4Q9IA 3BSSA 3GDOA 1ECFA 2VJKA 2ZI9A 4GLJA 4IDPA 4ICIA 3ITEA 4HNAA 5I5GA 5U4XA 1JXAA 3U4CA 4BQOA 9LDTA 5LYJA 3WZLA 1QFJA 1C0KA 2XX3A 1E3LA 3UM9A 4E09A 4FB5A 1U99A 2RMKA 1ZUNA 3FPGA 4V3BA 3D8BA 1GT91 2WJVA 5KHLB 4NLLA 2NZ8A 3TX6A 5AI4A 1H2YA 1OBHA 1GY8A 2ZB3A 5HF8A 3CYFA 3S28A 1LRKA 5H80A 1QP7A 1MENA 1TAGA 4C29A 4UASA 1X0VA 2I2WA 4HXEB 5DMHA 2VPPA 1W5SA 3QELA 4DQ0A 1AA9A 4CIWA 4TUYA 2OXIA 1MKYA 1Y1SA 2HMSA 3I8XA 3BX1A 4FCTA 4PC6A 5GJCA 2JHPA 3MJTA 2EWWA 4XJXA 5TQ0B 5LLDA 4HLQB 4LRWA 2YINC 4UDOA 1G5TA 3CPHA 2ES4A 1JQAA 3L06A 3MC1A 5I7AA 3FTQA 4KMSA 1L9KA 4R9SA 4B84A 1QYVA 1W7AA 2R751 3PUKA 4OKIA 5LP6F 1GN9A 1V9SA 3UHPA 2OYCA 3G49A 3BMQA 3MAAC 5B1YA 2DWPA 5BWMA 2WJAA 2I65A 3L8HA 3JVUA 1SG0A 2OBMA 3H11A 1RZRD 1LRLA 1SKQA 4FDTA 1JBKA 1UDRA 1FQWA 3Q4GA 4HGRA 4Q1EA 5CTAA 5JLAA 4F8JA 1CTQA 2PRYA 1RC0A 5AR1A 5M04A 5EP1A 4H9GA 2JNWA 3CE6A 4PZUA 4Z4GA 1U9IA 3LLCA 4I99A 3ZZTA 1LLUA 4PQYA 1SAYA 4JLKA 2HOQA 4LBYA 3REQA 3W1EA 1DC7A 1Y6ZA 2JATA 4IUBS 4KP7A 4X6YA 1AHIA 4MRPA 3AKEA 3T3HA 2J0UA 4J49A 3L5OA 1W85A 5CB4F 4Z1MA 1AQUA 3KQTA 5K6AA 3KV1A 5D3MA 3AUSA 4M8LA 5AUQA 4ZGBA 4QHYA 1JDTA 3BWBA 5HBRA 1ZM4A 3HBFA 4JJIA 2WLTA 4BLWA 6ADHA 3F73A 8LDHA 3DFFA 2GX6A 4PZAA 2PN1A 1VSTA 1EK6A 2VJBA 2YICA 1H2WA 1A77A 3D6NB 1OH7A 1PVVA 2PL5A 5HKBA 1A04A 2LCIA 3CB4A 3SHFA 4DNFA 4E2ZA 2DLNA 2AHOA 1W4ZA 2WNIA 2XQIA 3G7SA 3KYCA 4RF5A 1P5JA 1U31A 4PX3A 4Y67A 4ARVA 5BWCA 1H1LB 4B46A 4EGFA 3I9V6 5FBRB 1DKRA 2JGNA 1CWUA 4IX1A 5FBVB 2GYUA 3LA8A 4H59A 5EXPA 2O8FA 1BXZA 3B8EA 2B1JA 4C2AA 3IP6A 2CKMA 2P2DA 1JXOA 3CSUA 4Q4LA 1L5GB 1AG9A 5IABA 4KK3A 5JXWA 4C0BA 2OCLA 2HU5A 5JWOA 1LDNA 3NV9A 3Q7IA 4EY6A 2DPHA 1U9IC 1XMXA 2PK3A 1YGYA 3AC0A 3QUTA 2NUAA 4QTTB 1NKSA 1MVNA 2JCVA 4DDHA 4L6CA 2WIFA 4GE0A 4M60A 3KS9A 5BMVA 3K2EA 2QL6A 4CNBA 4NXMB 5HW0A 1ONBA 2GZ2A 2V3VA 1FXSA 1UFQA 5CIQA 5LZ2A 1J1UA 4ZCLA 3RCBA 4I5IA 1X3LA 3BH0A 3R3VA 1EUDA 4BP1A 1ILEA 3ZE2B 4F4HA 4DSNA 2PKCA 1PG2A 3K6SA 1IHYA 1RU3A 3O5AA 4HGPA 1L4LA 2WILA 1MGOA 4ZOBA 3MTDA 1ZY2A 3M4XA 5FWXA 1W52X 5AJVB 3OQOA 1TFUA 5CEJA 4Q7MB 4YEDA 3QBDA 4ZICA 3CXRA 3I0ZA 3FOAA 3OCUA 4IIXA 1GLGA 1SC4A 4WCFC 4ETMA 1W73A 2CDAA 1PJ8A 2JF0A 2WF9A 1PNOA 2QPOA 3ODGA 5KWVA 3OIFA 3RAEC 5BSGA 4MX8A 1UAAA 1KH1A 2P4SA 1H3FA 2VF2A 4DA9A 2XYRA 4ND6A 1MNQA 2QR2A 4XAQA 1NGSA 1JR3A 4JJGA 4LPKA 1DTEA 1KO7A 1DDIA 3QLTA 1DAPA 3TQRA 3WOVA 4UHFA 1WS6A 5DN6D 3IDFA 2IP1A 2BP7B 1Y4UA 5DHFA 2WF6A 3HR7A 5DWDA 4EG7A 3ICOA 5LZ4A 2SCUB 4MB0A 1UKZA 3HUDA 5FL7D 5AIBA 3BG5A 2X8LA 1IWOA 3F4KA 1IH8A 4WLUA 4YUXA 1NNLA 2YXEA 3K0SA 2EU8A 4QOIA 4D4MA 2QUKA 4HNHA 1MGPA 1FYEA 1GPH1 4IFIA 4IOKA 5EHGA 3ZCVA 4BGDA 5KSOA 2PWBA 1BXKA 2YXDA 2CLFB 1WUTA 2AEEA 4DCSA 2O8EA 2R1VB 2FP4B 4PEVA 3N0RA 3UT5B 4AJEA 4TMTA 2GSDA 4N47A 3ZGLA 3KBOA 4C7OA 1N0UA 1EUYA 2GAIA 2WB2A 1AH2A 4BDSA 4PZZA 2BISA 3MTEA 4S35A 1LU9A 3FJOA 3ONFA 3KT6A 3ZC3A 2IS1A 1KKLA 1U2SA 4CV0A 1II8B 1HQDA 2V4UA 2H18A 1UPXA 3F8SA 3C8UA 4OOFA 3ZGNA 1N3BA 1HNXB 1SCBA 1TUBA 4HXYA 4ZCIA 2VTBA 3TQFA 1XZAA 3EFBA 2NO4A 4MAAA 3JW8A 1O2DA 3WYBA 1M2NA 1E2KA 3GEIA 2H4WA 1YS7A 1WHTB 4KODA 4Q9DA 3X1KA 1O89A 2WIDA 4EA9A 1UBRS 3KWLA 2K87A 2YS6A 1EFVB 4UULA 3GPLA 2XNSA 2IXAA 1AO3A 5LP6B 4M21A 3VV3A 4JLUA 3RYIB 3TBHA 1OV6A 1R00A 3D8TA 5DEIA 1QYIA 1VMDA 2DC1A 2FB9A 2O52A 3LCCA 3CZ4A 3PI7A 2VJCA 4H3SA 3H9JA 1UBCA 1VBMA 1YZVA 1XC7A 2A1TR 5EWMA 2DHCA 1NYQA 2WVAA 1JFTA 2XUOA 3A25A 1N5LA 1REQA 1XTVA 2Q1SA 1OF1A 4MWOA 5FLKA 1KRWA 4LY3A 4TSKA 2D2IA 1AKRA 1ZOSA 3O0TA 5KPJA 3G2JA 4MUFA 2FZCA 3A6EA 4LZWA 2Z95A 1M8GA 1EDBA 4NOKA 4GL4A 2PZLA 5JD4A 3EF0A 2D0DA 4UM7A 4M0EA 1E7MA 2ZUSA 1R0CA 3NOQA 2I2AA 2DBRA 2X0NA 4O1MA 3RRJA 1PO7A 1L3BA 3PITA 4WK0B 2QKYA 4DV1B 3AVYA 2ERYA 4R6XA 5CA0F 1YR8A 1OKKD 3JAWA 3MRXA 1OLXA 1V8DA 2ATIA 5E6RA 5K3BA 1N3IA 3VR6D 1EX1A 1P2TA 4WZBE 5LKAA 3I4LA 3LSTA 1RWQA 3IKLA 4JLDA 4DUPA 4Q47A 5ISMA 4A8JA 1FS6A 4KAJA 3SJCA 3TM4A 4WGFA 1UT5A 2H1SA 2FPUA 2X13A 5AMXA 4DMGA 3KQWA 4I4TB 3V2HA 3H65A 1FDOA 2KMLA 4DLTA 1UBOS 2HPVA 3E9QA 4UAJA 1N78A 2O0HA 2ID9A 1XFAA 4XFKA 5BNZA 1GN8A 2OXEA 3PYLA 2NX2A 1CRLA 1I33A 2CCGA 2QM0A 5J59A 3HA2A 1SXGA 1Q7TA 1Y80A 2JVKA 3ELWA 5ALJA 1YI1A 4KR7A 1CLEA 3L8EA 5JY6A 4DTIA 5KDLA 5TMEA 4WUTA 2Q5LA 3NC1C 5K01A 1ZHOA 4N48A 2QN2A 4HFJA 3TFWA 4F6CA 2LP4Y 2P0YA 5CFLA 2ZXUA 3DLBA 3ES9A 1Q44A 1P4HA 5A6SA 2L0XA 1GQFA 4ZAVA 3ZCUA 4NYJQ 4L4ZA 2NPFA 3G0CA 5AKXA 2GWHA 1Z5VA 2PUAA 5BURA 2OCKA 5KYXA 4KL8S 1KEWA 4E1VA 2XZOA 2BVNA 1J06A 2UVPA 3D1JA 1O95C 2VHVA 3HCNA 1P17A 2ZRHA 4GBMA 4MV5A 4MV1A 4PLCA 5IARA 4JLVA 1O3YA 1RWKA 3COSA 4Q34A 3TCNA 3GG9A 4ZU3A 1J8FA 4NH4A 1LB1B 3LL7A 1IEWA 3AR3A 5BMVB 2DULA 3I0NA 3QE0A 1X74A 4JP1A 1J8MF 3OP4A 3UAYA 1H1DA 1VHWA 1YULA 1T1GA 3SEZA 4IG9A 2OGTA 1M1YE 3JQQA 3PNOA 4LJRA 1ZMTA 4RO0A 2FW6A 1E3QA 1JKXA 1CK4A 2XUPA 3FBGA 3VI3B 2QMQA 1FYXA 1T0BA 5AVRA 3VKUA 1F9EA 5LQNA 1WW3A 1YKGA 2JFYA 221PA 3P9PA 3MGBA 3DR3A 4F1WA 5TS3A 2D5BA 4PTYA 5KX5A 4CQMD 1OVGA 2WYHA 5AW3A 3BICA 4RZIA 3ZE0B 4WFQA 4C4XA 1SU6A 3O8LA 3VC3A 4Z4QA 1UDWA 3DYBA 4KQ6A 4JY7A 1ZBQA 2R00A 1FSSA 5IJ0B 2QHXA 5IT9A 4B4KA 5DISB 5B12A 1CUSA 4C89A 1CUJA 4RM3A 4F04A 3M1AA 4XDYA 1CULC 3H1TA 1N5KA 3U80A 3WAKA 3JQRA 2P79A 3WWCA 3HGMA 3LD9A 1TM2A 4RK5A 1JLRA 3O94A 1MAUA 2P9CA 1SOVA 3N28A 2YIJA 3AZOA 1N7IA 4EW3A 2E9SA 1MHTA 2VJQA 3EPKA 1DQYA 2FLWA 2ZM6B 3WGNA 5JMOA 1TQ6A 3RU3A 1BGWA 2AX4A 1C3XA 1SVIA 4BIMA 1EGMB 4TVOA 3OJEA 4X20B 2GEFA 4V0KA 2IEGA 3RVMA 1DIBA 3QKIA 2CVPA 3P9YA 1ECJA 3T15A 1Y5RA 1E9BA 1LK5A 3CR3C 4OUKX 1J20A 1G2PA 3AL3A 1X80B 4K2HA 3OHSX 1Y89A 3OPMA 4OPMA 2QD2A 4GKJB 3JYHA 4JC5A 3H83A 3ZWYA 1OWMA 2JHCA 3HG7A 4OYLA 4E33A 1ZAYA 1KC1A 3D3WA 2PGXA 3FUTA 4EPVA 4FPXA 4EGQA 1HDRA 2EV9A 4N3NA 5HYVA 4ZTUB 3IJPA 4R68A 2YFYA 1H9AA 3GH1A 2XXBA 5KKNB 1VLLA 2OAGA 3R5TA 4EUNA 5CFMA 1T0PA 4G5RA 4EGJA 1I3MA 4IH9A 4OHPA 2OE2A 3RDPA 3I09A 2F43A 1K7YA 1M6VB 4PGHA 1QS0B 5A3JA 4WBNB 4DTCA 1JFVA 4FX5A 5B36A 5IBCA 4G1BA 3DTYA 1PGJA 1QV7A 2IOHA 2ZBPA 1ZJ4A 3R3UA 4KDRA 1YS1X 3P9CA 3S81A 1QG6A 4FR0A 3R74A 2AYZA 4RLFA 3OQHA 3PENA 1II0A 2X7XA 3PXXA 1JAYA 3RARA 1O58A 1G0NA 3OWXA 4QECA 1TIPA 1GJRA 4GP6A 2QXUA 3RSLA 3U2QA 3WYNA 4TT8A 4BNYA 2GETA 3WGIA 3ABSB 2EL7A 5LYJF 1B8VA 3R0IA 3H5AA 2W6NA 1UBUS 4YJ3A 2GPSA 2P1ZA 1NKTA 3IXQA 3SYMA 4CMCA 5AW1A 4DUZB 2UZ1B 4U2FA 3GT0A 1ODSA 1U9CA 3A4LA 3ND7A 4MDEA 4NCJA 421PA 3SQXA 2VRNA 4DHEA 1C0EA 2ZTSA 3QRWA 1FRNA 2Q27A 4U0JA 4MMXB 1LPSA 1EFTA 3ZOZA 2P67A 3FWPA 3IFSA 3T1OA 2DYKA 4RPIA 2GGSA 4QXQA 1H0HA 2FUKA 2AVDA 3NB0A 4WIAA 1DTSA 1SIWA 3AW8A 1DMSA 3NRBA 1E9VA 3GJTA 4L4XA 1CE8B 2V8BA 4EELA 1K5GA 2B3TA 3AVWA 2ZRBA 1NI4B 2Q3DA 3Q9NA 4MV8A 2CLHB 2FRXA 1M2FA 2Y0PA 3IL2A 1N6NA 5GMOA 3KNZA 2G9NA 1J07A 4I8DA 4FCWA 5CM9C 3RT9A 2VSFA 1C9KA 1H22A 3ZE6A 1PP4A 3ZDCA 1OUMA 4HGYA 1RBZA 3F8WA 2VNIA 4D57A 1IONA 2YR0A 2G72A 3IO3A 1YJ8A 4J29A 3WIOA 4BOYA 2E0IA 1AKEA 4KPYA 4IQGA 3WB9A 3I2KA 3QKRB 3Q7RA 5FL3A 3BVPA 4JB3A 3ZV6A 1FX0A 2X8JB 1ECCA 5GONA 4C0KA 5HVNA 1IXYA 1V41E 3PX3A 4MARA 4OHZA 1G20A 1J39A 2HA7A 1N8KA 3KRTA 4RMGA 4WVFA 5ADUS 1H4QA 3WA6A 1JILA 2PD4A 2WVJA 3QMMA 1FYWA 2HA6A 2ZSDA 3E3MA 2AF4C 1NI5A 1Z5PA 3LK6A 4IILA 1G21E 2ZUTA 1E0AA 2W11A 1H42A 4TTQA 1D1SA 1XD2B 2FX3A 3SSAA 4AURA 4BN4A 2LUOA 5ADWA 5HP4A 3FMFA 4D8YA 6NULA 1XNHA 3ZR4B 2B94A 4G5FA 3Q9SA 4MP6A 5CYOA 3F90A 4IDDA 3G85A 3HVIA 3RVKA 2RKWA 3S40A 2RAFA 3ANTA 3BDAA 3SR4A 4LJYA 1E9RA 5C4IA 3C8MA 1K63A 1YASA 4ARBA 1XZFA 2PSJA 3G6WA 1YL5A 1XKLA 3UKOA 1EXVA 4IO0A 1JEEA 3GEDA 3J7TA 3WICA 3VPCA 1B3BA 3LKZA 5D7NA 3R8CA 1QXSA 4MHTA 3LRTA 5DV9A 3EGVA 5JG7A 5KO2A 1GR1A 2AMLA 4IEEA 1LWNA 2LKCA 1GNTA 4MGHA 2CK3A 1C3JA 2J48A 2ZWOA 2WAAA 4N1AA 2BFWA 5FNVF 5TQVA 3T5BA 3W8DA 4LSMA 5EUQB 1ES9A 1FP6A 4Z0PA 3H18A 4F7WA 1JIUA 1C30B 1NASA 2QTNA 1CY7A 1BFUA 3IQDB 4MQLA 1L0BA 1P9OA 2NWQA 2QRQA 3IBYA 4NH0A 1SZPA 1M5RA 4DV5B 4JP3A 4JP8A 1X94A 2J87A 1VE7A 1W4LA 1YB7A 2WJ6A 3IPAA 1WF6A 3RK4A 1JA0A 2OZLA 1M2HA 2G4CA 1XCOA 2V7GA 3T3EA 2OXCA 1V5WA 4TMZA 4CGYA 4Z4EA 3RLFA 3SEFA 3JARB 1NSFA 2PS9A 2XZTA 3FGZA 2Q7DA 2NGRA 1L8LA 4XW2A 3OLXA 4IOLA 4BTVA 2ODWA 2TMKA 4M2LA 2GD0A 3N74A 3ANSA 4CL0A 3OOSA 3O2JA 1EGVB 3E9RA 4CTNA 4C2BA 5LQKA 4UPEA 3UWKA 5AKLA 1GPDG 2ZVDA 3UJPA 3NWEA 5EJAA 2WWIA 3FTFA 4AMBA 3AIKA 3GLKA 5EA2A 4LXGA 4DMRA 1GPAA 1YO6A 4BVKA 5ERGB 1K8XB 2XUGA 1SQFA 4M49A 5K45A 5KOYA 5EIWA 3P9RA 3BF8A 3G82C 4A10A 3QLUC 2D06A 3AVTA 4R1UA 4H7KA 1VJRA 1K7SN 5JRZA 4JJ4A 2ILVA 2PU7A 4MUAA 1JTEA 5IS2A 1EWKA 4NJEA 3O8QA 2OPHA 1UWVA 2IWHA 2WIAA 4ER0A 4YN3A 1VLZA 4UUAA 4BNKA 4HDNB 1ISJA 2Z3VA 1A9PA 2IF0A 2ZI4A 2X76A 4R9NA 1W49A 1Z2AA 4JKOA 3TIFA 3V4OA 1EBFA 2OM2A 2ORED 1TI7A 2QM8A 1ZN8A 3FPFA 2VDLB 1Q21A 3BORA 1NYTA 2H5LA 1VE5A 3GQVA 2AEJA 4JBNA 4XYMA 4ESOA 5IP5A 4AL4A 3PSHA 2EWMA 2P2YA 2DCUA 1S5PA 2XE6A 3E8SA 4Y2UA 4QSHA 3RVNA 1TUBB 2PO7A 4A2WA 4YRZA 1MIOA 2JAXA 1KQNA 2RE8A 3COZA 2ZW9A 4MLPA 5EESA 4FYIA 4DSUA 1RS0A 1BCRA 1N2EA 3PV0A 4PO9A 3C43A 4TSFD 5FWAA 4BFXA 4DNQA 1YOVB 5KJ1A 7REQB 1PX2A 2PX6A 3QY0A 4LZAA 2JGDA 4MS1B 1AHHA 1BSVA 1YZUA 2V5VA 1U94A 2FZLA 1ZP6A 2PT7A 2Y1WA 3FZYA 3HZZA 2E1RA 4G23A 5B1SA 4F4JA 2R1VA 5BQFA 1IBLB 1GNRA 2BLLA 3CCCA 5D5HA 2ZS8A 5FNZA 1C1HA 3N86A 1SC9A 2C82A 2F59A 3TD6A 3TNDA 4LJLA 4JVNA 5EIHA 4N3GA 3QG1A 4INZA 4FFPA 2JLCA 3DE6X 2JGLA 2OKGA 1SCQA 1I2MA 3OTWA 5B37A 2J5BA 2I4IA 1CRPA 3HFGA 3GA7A 3V1UA 1GVNB 3UHJA 3IDQA 1F0KA 2QGFA 4B8YA 1XMVA 3KEOA 3C4QA 3NFYA 1G8GA 3QMPA 1ARZA 4FJ1A 3O31A 3QUQA 4UJ3A 4B6JA 5JNWA 2WUDA 3OJ0A 4XGRA 1FXWF 2R6CA 4DIDA 4EFDA 3DFMA 3M2PA 4BCDA 2NZYA 4NYIQ 1VL1A 5FUXA 1ZD8A 2P9JA 2ZJ7A 1G7CA 1AXEA 1RHJA 1XOIA 2ZIXB 3K6JA 4FYJA 4ISBA 4QX6A 4Y2JA 3UMYA 3E22A 4QBFA 5GZ1A 1J5XA 3B1YA 4IIEA 4ND8B 3GEGA 2YC4C 3ZD8A 2YUTA 1LBHA 3HL4A 3HL0A 3OZBA 4ZQHA 2QUBA 5CCDA 4BO1A 4W5TA 1U90A 4RM2A 3EWSA 2WTUA 2FKAA 5KVVA 1IHOA 4BP8A 1C9NA 5KYNA 2DFLA 5AKEA 1C3OA 4X84A 5B7NA 1PGOA 2DH6A 2J0VA 1ZMRA 1JQBA 2DHEA 1UWLA 2QSJA 3CH7A 3LHSA 1EFAA 2B4YA 3G9XA 1DJPA 1Y8QA 2QZSA 5CFNA 1GRCA 2Z04A 2LD4A 3KQYA 3N0TA 1WB5A 4MUXA 4RZUA 4TL9A 4DXDA 1YU6A 2W6IA 3DDOA 1ND5A 4FZRA 4NBKA 5H7XA 1DXQA 4DB2A 4ERNA 2CYAA 3G8DA 1MFZA 4JX9A 4P8RA 3TKYA 1P73A 3UBTA 2CNKA 4PPYA 3U40A 2FPWA 1DBQA 5T5QA 2AJLI 3IEIA 2H1HA 1U4OA 4R3NA 1E2JA 4RETA 4CW7A 3HJBA 1LTHR 2EDAA 4MGEA 3MGGA 1A97A 3DE7X 3UJCA 4L50A 5HQ3B 1QGAA 3LQKA 1OXUA 2W4IA 3DMNA 1TX4B 5HCNA 1TJ3A 1E1NA 4KXNA 3Q2OA 3EJWA 4AY5A 1WSAA 2H1VA 3FFWA 4JLWA 5FD8A 1W0CA 1OI3A 4A27A 16PKA 4TQAA 3T7DA 1VCNA 3IGFA 5KNBH 3DDSA 3TO5A 2UVQA 3A6DA 3B7WA 4GXRA 4HNSA 2YUIA 2HWYA 5IDYA 1FEZA 3GAAA 3GLHE 5ALVA 1OLUA 1WXIA 3JTMA 2VPYA 3GMTA 1E79D 4NR0A 3RHTA 4B9EA 4JBXA 1DSSG 4JMLA 4ZCQA 4DZRA 4GQBA 1JHOA 4NPCA 4DIOA 2PD3A 4MAFA 4QJ3A 3HGTA 5FQNA 3NX4A 1GXSA 3HU2A 2Q4DA 1GNQA 4B33A 4PN7A 2NT3A 2VCEA 3ITNA 1R0KA 1G20B 2WF7A 1WABA 2RHOA 1PS9A 4AUKA 2FR1A 2Z8YA 3AF2A 2P1RA 2WKRA 1ATZA 1MOSA 3I83A 4QAQA 4BKMA 5BXYA 2YX1A 3U61B 1NM5C 3OD5A 3P2MA 1DC3A 2H11A 5T6MA 3CNOA 2YWEA 3B89A 3KFVA 4F8EA 3OPYI 3NDIA 1VRVA 1E3SA 3VUFA 3VR4D 1FDSA 2OWEA 2VT7A 1OILA 1QH8A 3KOYA 4AJPA 3AEYA 3LWDA 4KJZA 4X71A 2DUMA 4UCQA 1L7EA 1M8FA 2QTGA 2Z2JA 5FADA 3PKIA 5CXXA 6YASA 1AU9A 1NUQA 1HZZC 3PL5A 1HURA 3UN1A 2VP0A 1UDCA 3I6ZA 3MT7A 4S0ZA 3DXXA 4ZYYA 1QPBA 1Q1QA 2C5AA 2Q07A 2A0FA 3CLRD 3GVPA 1O0SA 5BUSA 1KYYA 2QGZA 4JA2A 1FFXA 2GK6A 2NO9A 4KPFC 4UEQA 3GPDG 1NW6A 3U48A 4PSKA 4PV7A 2FQWA 2JZCA 3CLVA 4G41A 3CVYA 2J5KA 3CEAA 3IPXA 5I48A 5K5EA 5J2UB 3HNOA 3TDNA 2HRQA 1SXIA 3BD7A 4GW3A 3OJLA 4AD8A 3WRXA 5JFGA 2DB3A 4J94A 5DFAA 2FSGA 4AMUA 2D1SA 5AW5A 2A57A 4UDYX 2A5JA 3N05A 2VTEA 2MJLA 2PSDA 5IBRA 3RJZA 1WMAA 3VYSB 3WNDA 4AZSA 1Q20A 1W29A 1CY8A 1MDBA 3RSCA 4AYTA 1FSPA 3L0DA 1V5FA 3I1IA 3BCUA 2O05A 3BK7A 3DOJA 3K9LA 3NTOA 3TJRA 2VJNA 3DJFA 3WNQA 4F93B 3NYQA 4LPSA 1JIKA 3E0XA 3SLKA 1EK5A 1TT5A 1UEJA 3KELA 4X6LA 4Y0AA 3V1MA 4A73A 2IIPA 4BKRA 5JVDA 3ZV7A 4KGXA 5CB0A 1R0WA 1U2PA 1TZBA 2EJCA 1G64A 1SVSA 4M8IA 4P7JA 3T3IA 4MVJE 2WDPA 2OHGA 3ECCA 4PXSA 3VPSA 1GGNA 4YAEA 2HREA 1ONPA 2FR8A 2IRWA 1V37A 3NONA 1QV6A 3ZWOA 1N5JA 4LYGA 2F64A 3CEPB 2Y2VA 5CB4B 1GL7A 4MJXA 3FPSA 4CQMA 1IXSB 1YRYE 1PTKA 1KPHA 2J6BA 2P6NA 3CLSD 3RIYA 3SR0A 4F91B 4N65A 1C7RA 1POXA 5JS6A 1ZHHA 2G82A 1JFLA 4GLOA 2J30A 3O73A 5JMTA 1OROA 2IDZA 4DUYB 2PBFA 2VRCD 3OFVA 1MAVA 3PQ6A 1XKTA 1JHAA 2OBLA 2XE8A 4K6MA 3GJ6A 2WY2D 3ICEA 3AEUB 4HDNA 4EL0A 1ZSYA 5BSFA 2CLSA 4NJEB 3SYNA 3N2GB 1MO6A 5CCXA 1NQAO 2IXEA 3PD0A 4NZYA 2WT9A 4BMXA 4DRZA 2LR0A 1S8OA 2NM0A 4O02B 4WNYA 4EMSA 4G0XA 4UXIA 3U17A 2Q5OA 2R8BA 3NM4A 1U3FA 1T6ZA 3LUDA 2FFJA 4K5QA 3WTCA 4I4TF 1JMYA 3A2KA 3CX8A 4ZXFA 2ONZA 3RVQA 1HWYA 4QEDA 2B4QA 5I3ZA 1FDIA 4LRUA 2A4MA 3IVRA 4XXHA 5BSWA 2H4FA 4UUPA 2FPIA 2VYVD 5I9MA 3N7TA 5B4TA 3ZGZA 2JFZA 2OV2A 4DWOA 1CZLA 1KOFA 4QL3A 3MS2A 4C0QC 4A0QA 2JAOA 3LAWA 4PXAA 1SUAA 3PKJA 2VPQA 1IOZA 4HAUA 1O97C 4ZHQA 1KDOA 2CJXA 2V4ZA 2B34A 3CNBA 3JSXA 5BWOA 5JSQA 4NE9A 2FWNA 4LJKA 1A8SA 2C03A 4FOLA 4NG5A 4HNUA 2ORWA 5ELLA 2QBYB 1U2EA 2CL6X 4KSCA 5KJFA 2WU1A 1YWGO 2ZDGA 5GVRA 3E81A 5IKPA 4HB2A 3BGSA 2I6XA 3DKRA 3TVTA 4CBVA 3OQNA 1CERA 4P22A 1OI7A 4M7WA 1OAOC 2JZNA 1T3GA 4YMUA 3GOQA 5K3SA 4RHTA 5E4FA 2NO1A 1DKLA 4KNWA 5EGNA 3VO1A 2ANCA 4KQHA 4N7JA 4DS3A 1K75A 4TRMA 3PQ8A 3UV3A 5JQGA 1XU9A 3D7NA 3TTWA 1TVEA 2ZKIA 1CUCA 1YI8A 1RW4A 4PGGA 4JLAA 2RGDA 4G37A 3T7JA 5JSHA 3DGFC 4JFRA 4B6PA 5FBHA 1Z8NA 4RK0A 1GUFA 3KYCB 2JLYA 2X0DA 2O3TA 4ZT5A 1JH8A 2I4OA 2XDWA 3NDRA 5B3KA 3FPHA 4D9GA 1JA1A 4MVJM 3FOWA 1GYQA 5FLEX 4OXYA 5CLGA 2CUTA 3M6AA 2C00A 1FLNA 2JFWA 2GZRA 3HNPA 5C1OA 2R8RA 3Q11A 3MQ2A 3EY4A 3ZZMA 4B34A 1VCIA 4R31A 4JZKA 1JI3A 5JQWA 3AUYA 5A1TA 1XHLA 1Q0LA 1WRBA 1UC9A 2BV3A 2QX7A 1M9NA 2X42A 3A9VA 2RGNA 3IMFA 2IZ1A 4FWBA 4ZOQI 2W2MA 3GRKA 5BSMA 3OZUA 4AKHA 1Z7WA 1KA9H 5A05A 1G1MA 4E70A 1Z26A 1F5SA 2Q29A 4EHDA 3V34A 1ABEA 2FSIA 2IZ5A 4K9DA 4U4AA 1DO0A 1XK7A 1Y4DE 3AUAA 3SEAA 3TOXA 4DUGD 2GSWA 2PNFA 3WHKA 3MWEA 1BEUB 4C7JA 3S68A 4HMOA 1L4MA 2AFHA 4QC2A 1E62A 2QRGA 3ENWA 3MS4A 4L5IA 5FNVA 4BMPB 2JH8A 4CVNA 4E3ZA 1TT7A 3H2JA 3IPCA 4IFBA 4C0LA 4QARA 1HEUA 3QU5A 4EJSA 2LRHA 3S27A 1L6IA 5AICA 1QH1A 4D3DA 2CF6A 1GKUB 3KOOA 4FGZA 5ECWA 2XNHA 3TR5A 3PUYA 5KYTA 1P5HA 3F4BA 4RPKA 4HSEA 1FC0A 2J3IA 1XU7A 3W3AH 3N0WA 3BFPA 3FVVA 1KGSA 1VTKA 4QDKA 1G5QA 3E53A 1WKCA 3LHIA 4EF6A 5ALSA 1AKYA 1X7ZB 2NV0A 1E2DA 1DTWB 1XZQA 3WWDA 2FSUA 3R6LA 3D7LA 4NI5A 1BMFA 5DXAA 4N4AA 3D8RA 3D3KA 4OK3A 5LWHA 5K3FB 3H4VA 3TTUA 4TS3A 1JRLA 4X1OA 1MF7A 3PWZA 4MKRA 3IEKA 3IVAA 1W5AA 2PZ8A 1OGIA 3EIFA 1SU4A 2C92A 2EBFX 2QXTA 4Q12A 5E8JA 5F7ZA 3T4EA 4C7XA 2B6NA 2NSJA 1WXXA 3HJTA 3QW2A 5BUCA 5LIRA 2X4DA 4R1TA 4CXMA 4GDFA 2JJQA 5CLQA 1FJ2A