3QENA

S74e dck in complex with 5-bromodeoxycytidine and udp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
236
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Deoxycytidine kinase
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 236
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qenA00
3TK1A 4QNRA 5FH9A 1NSTA 3IBYA 1I4LD 3IIJA 1GTVA 5JI2E 2ZRJA 1NI3A 5GJCA 4JL6A 2WMOB 2ZRAA 1OF1A 2ZSAA 4JS0A 5TMPA 3R8CA 1VCNA 3EIEA 3OEEA 5KDOA 3GLGA 5KOYA 5CDFE 5EE5B 1ZP6A 3ND8A 1IAQA 2H5EA 4DHEA 1NRJB 2VP9A 3KKMA 5KSYA 2J0QA 2KBFA 2QMOA 4CEIA 3SU8A 2O8EB 5L3RA 4F92B 1DEKA 1KKLA 2VP4A 1G19A 4RD1A 3THOA 3P4YA 5E95A 4AC9A 1Z29A 2A2ZA 1UAAA 3CX7A 5FR2A 2Q0HA 4E07A 4ESHA 3EIQA 3GLIA 1S2MA 1WRBA 4FI3C 2H1LA 3VR6A 3ZIAA 3KKNA 4MYCA 1Q20A 1XCGB 3H4MA 3WYGA 1VYVA 4PXAA 1XB2A 1ZMXA 3BC1A 4OQLA 2L0XA 1W5SA 121PA 5E4FA 1GKIA 1CJUC 4LJYA 3RNLA 4Q9IA 2W6IA 2XGJA 4NTZA 1DVRA 3I62A 2C96A 2FPKA 4DDTA 5IHPA 2ODEA 2CXXA 2X19A 4RD3A 4JLVA 3ZVRA 4HEJA 5DYGA 1QG2A 4WW0A 2ZROA 5FOVA 2C9OA 2IUTA 1VCMA 1F3OA 4MRVA 3TW4A 1TF2A 1X3SA 4MKHA 1EFHA 3FDIA 3VMFA 3U3OA 1KK2A 3T5GA 4B3GA 1CLUA 2GXAA 1S9DA 2GNOA 4ZCIA 2V8OA 5TB5A 2FU5C 3NH6A 4KCGA 2ZJZA 3DEFA 4KI0A 1UEIA 1YVDA 5B57C 5CITA 2AFIE 2QENA 3VQTA 1IJFA 2F1RA 1NG1A 2I1VB 2G77B 4O2LA 3U6BA 3PCRB 4CYMA 3OEHA 4TMTA 2XTZA 3HYRA 5FR1A 2DWOA 1QHXA 4HZIA 4BFYA 1QHHA 1JR3E 2QPTA 5TXGA 3TUIC 3ONWA 5E7MA 5DLQC 1E2LA 4HB2A 2GESA 4C2UA 2BM1A 1L2TA 4HZUA 1XPUA 1IJEA 1AIPA 4TYWA 2BM0A 2VBCA 2A5DA 3U3JA 4E03A 3TUJC 3EPHA 1QZXA 1UBFA 5FOSA 2IYVA 1Z0IA 2OCBA 4WAUA 4UXIA 3ZVLA 3EZ7A 2GJ9A 4ARZB 1GWNA 1XCMA 2BIFA 2ZETA 3AKCA 5AUOB 1U94A 1KSJA 4O2RA 1TEVA 3KUDA 1QBKC 2VSFA 1Z22A 1EESA 4PSAA 4EPTA 5FBWB 1PJRA 4HDCA 4PQYA 4OK3A 4QJ5A 1R7RA 4QFMA 3EA5A 4AG6A 2YZ2A 1E96A 2GCOA 5FOTA 1IM2A 2C78A 2QY9A 5TDHA 5DN6A 1ZIPA 4EFLA 3VAAA 2OEPA 4URVR 4RJLA 2FZLA 2IYYA 1E9DA 4EQ6A 3TR5A 3UG7A 4XVRA 3G0HA 3AVOA 3THWA 2DHRA 3FMIA 3CUEF 1HE1C 4OK6A 1KDOA 5JRZA 4P3YA 2G3YA 1CKEA 1YR6A 2D2FA 4MDEA 4GL2A 1G8GA 2BMDA 3QXJA 4YMUA 4L5BA 2YYZA 3H84A 1SHKA 4WVFA 1VHTA 3TIFA 4TSFD 4N0DA 2FH5B 5DISB 3Q9LA 4QJ3A 3LNCA 3EPJA 1JALA 1IBRA 2NZJA 3UIEA 2J41A 1MT0A 1XMVA 2I4IA 3I3SR 1G7CA 1NKTA 2OT3B 1CJVC 4DSOA 3U4QA 1COWD 2ODWA 1K6MA 1N6HA 2HLDD 2QT1A 4ZPXA 1AZSC 2VO1A 1T91A 2JLQA 3Q7PA 5JEEA 1PLLA 1X8KA 4MGKR 1S1CA 2A7QA 3K9NA 2AWOA 5AJYA 4TZ6A 4OL0A 4IXMA 1DBSA 1AM4D 4QOSA 1ZM2A 2ZS8A 2V6JA 1KI4A 2P6NA 4V0NA 3K0AB 4DCTA 4LPKA 3CNLA 2G9NA 1J8MF 4LHZA 4Q4JB 4FWTA 3GLGE 3IQXA 4Q9HA 3OF5A 4KU4A 4PC1A 2QRZA 2CHVA 1X6VA 5CYOA 1HQYE 1T6NA 2VP5A 4FMDF 4PO1A 1ZD8A 2IXFA 4BFVA 1E2DA 1OT3A 4LI0A 4US0R 1QRAA 2A5GA 2V4ZA 4Z1MD 3C15C 4PHGA 4KLNA 1VHLA 3WNBA 2AKYA 1OFTA 3SHFA 3KQUA 5DHAA 4G5OA 5K8LA 3A1UA 4GOXA 5FPSA 3IILA 3B2EA 3MWYW 3UMSA 2HXSA 2J5XA 3GLIE 3ICEA 3D31A 1XTJA 1KI9A 3I32A 5E3HA 1DAGA 4U7DA 4DLXA 3SJBA 3MLEA 3I1FA 1Z2CA 3CW2A 3W6NA 1JEEA 3OFND 3ADDA 3L0SA 1S8FA 3LRPA 5LB2A 1P9WA 3D8BA 4TL6A 5H8WA 4AY2A 2VF7A 2DB3A 4ACAA 4KITB 4Q5IA 4XSGA 4OQXA 1RE0A 2LWIA 3NBZC 4Q9LA 1ESNA 1G3RA 2OESA 1N6NA 3T5DA 3NKVA 1TMKA 2DY1A 3HR7A 3CX8A 3EZ2A 4US1R 4K46A 4PPQA 5D3MA 2CCJA 1U81A 2LCFA 3KTAB 4GOKA 5AUPB 4IDQA 1TQ4A 5LB4A 2PMDA 1B0UA 1XX6A 2ZU0C 1Q12A 3UANA 3FKSD 2FG5A 3VR5A 5EP1A 4GSYA 2ZVQX 4TYPA 2LKDA 2ZSEA 4Q1FA 4UXHA 1F2UB 4M0LA 2ZITA 5LDDC 3QPVA 5JI3E 2QTVB 5SZJA 3I5YA 4BFXA 2OBLA 1DPFA 2RHMA 4KBFA 1GRRA 5EXPA 5K8IA 2C9CA 1BMFD 2OFXA 5AJXA 3UWOA 1U2RA 4TLDA 4QRHA 1D2NA 2ZXUA 3DDCA 4EPWA 3SFZA 4EJSC 5IK2D 1DAMA 2CEAA 3A1TA 4OQFA 2OFOA 1OB5A 4JLMA 3LBHA 1SQ5A 4CRWB 3P27A 3QPWA 4DDUA 2QP3A 2R6AA 1OSNA 2WJHA 4LC1A 1LF5A 4LV5B 3ASYA 1ZD9A 2F43A 3EAQA 4ZI3A 4QBGB 4F4CA 3ZZUA 4DXAA 1A7JA 2JATA 3PFIA 2F1JA 1WP9A 1W1WA 3LXRA 4M1OA 1DG3A 2EFDB 2CNWD 4A92A 5JBQA 2AKAB 5EXSA 4QGGA 4C7OA 1N25A 5BQ5A 4KSCA 2G0NA 4BEBA 4I99A 3ZQJA 2R44A 3BBPA 4IOKA 3WYFA 1D9ZA 2CCGA 3QXCA 4M8NE 2BMJA 4Q9JA 4Z51A 5EJEA 1T0HB 4R9UC 2NO7A 4NE2A 3PITA 3H1TA 1P72A 1M74A 5AK0A 4DLTA 5B64A 3D3QA 4HAVA 2R9VA 4HDOB 4XSHA 2OFWA 2NQ2C 2RGXA 3B78A 2GJAA 4A6PA 1JR6A 1E2JA 1ZUNB 3Q5DA 1KO1A 3VFDA 2ZJBA 5GJBA 3LH5A 3CNNA 4QBFA 3CR7A 1N5JA 4IDNA 4ILEA 3QVVA 2CJWB 1E1RD 1W36D 4IOJA 5KTYA 1UPTA 4ZIRA 2N42A 3EWSA 4C0SA 4F91B 2WZQA 3K70D 4Q4AA 5FTMA 2OILA 1II9A 5HE8A 3TMKA 3HYTA 2AXPA 3KKQA 1PZNA 2QE7A 4GNKA 1RRFA 3M6AA 4DKXA 2H7VA 1XTIA 3HU3A 2RCNA 2AD5A 4BLPA 2D3WA 5HR5A 1VKJA 2VF8A 1HYQA 2GXQA 4B76A 1Z6XA 2XB2A 1MO6A 4IVQA 4TSFA 1M7BA 3NIBA 4LC0A 4D0GA 1G9XA 2N46A 4Q7MB 2CL7X 3BAFA 4M21A 4XTCS 3CH5A 5H68A 3GJ6A 1COWA 4F4IA 2D7DA 2HLDA 3A8TA 2FGJA 2AHOA 4Z8YA 2C03A 4HAUA 2P2LA 2FEMA 1T3LA 4DLRA 5KNBA 1QHYA 4V02A 5LBIA 4C0BA 2F7SA 1SXJD 4RFSA 5IDVA 1JAHA 3MJRA 4GOJA 2CCKA 1OJLA 621PA 2N1BA 2OSBA 1N5LA 3QKRB 2W0MA 4PPFA 4JVNA 2QMHA 5DO9A 4AKIA 1XMIA 2WV9A 1VG1A 4P4TA 2ZEJA 4AURA 1YRAA 4F4JA 2Z5FA 3B13B 1Z08A 2WWYA 4WXPA 2ZAMA 3B1VA 4PX9A 4Z1MA 4NHOA 2XXAA 1AQUA 3L82B 3GJXC 2H18A 2GWHA 2Y8EA 4M9QA 1Z6YA 1J70A 5JMTA 1AKYA 3PQCA 2IC5A 3THXA 3FMOB 2KI5A 3PEUA 4LBZA 4FWIB 1KYIA 3U7HB 3AVQA 4ARZA 2OXRA 4OI1A 1CRPA 1FNMA 5HTKA 4W7SA 1NSFA 1ONBA 3OFNA 1HA3A 1Z6AA 4AYTA 1XD2A 2DCUA 4OHVA 1CXZA 1NIJA 4B32A 2MSCB 2IXGA 2WIAA 2ZRMA 5FI0B 1QHGA 1QHNA 1OXSC 2P5TB 5BYJA 4ZCLA 2ZSBA 1W47A 2CLCX 2JLVA 2QSZA 3R20A 1SKQA 2QG6A 3QBTA 2NGRA 4V0LA 3VU9B 1CJKC 1KJZA 4BZXA 1II8B 1UKZA 2EYQA 2ZYVX 1I4TD 2UZ3A 4LSGA 4QHYA 3KJGA 1KDRA 3FKSA 1QF9A 2VYFA 3P32A 3KQLA 2ZUDA 1UF9A 4DLZA 1E2QA 3U5ZB 1KY2A 1G7SA 4LYJA 2PT7A 4LCBA 4W5HA 4LV6A 2XNDD 3B1YA 2Q21A 1J99A 3K9LA 3AF0A 2ANCA 3LWNA 4PSKA 2VL7A 1S4QA 2W6JD 4M1WA 1CS4C 3HPQA 2QT0A 1VECA 1BMFA 3RS5A 1GDDA 3CRVA 4DJTA 4D6PA 4F93B 1G4UR 1KK3A 3WP0A 5IK2A 1EFCA 3B9PA 4NH0A 1SVIA 4OHYA 4H1UA 4ZV4A 1E9RA 2DBYA 1AZTA 4PC3A 2GBLC 2R6DA 1YRBA 3HR8A 5FOWA 3B1WA 2P6UA 3K0AA 2GTPA 2QAJA 6Q21A 4C0HA 1FTNA 3I73A 4JL8A 4HATA 3NH9A 4Q4JA 3AKYA 4NU0A 4JBWA 5C46F 1IY2A 2X77A 1KKMA 1DELA 3KB2A 5DHFA 5DIFA 3GEEA 1N6OA 2HCJB 1TF7A 2CNWA 2O8CB 3H0KA 3NWJA 3Q72A 2E9SA 3DMNA 1VG0B 4ZDIA 1E9BA 2OV2A 4BGDA 3VR2A 5JLJA 4TT3D 3X1WA 3KZ1E 3VNVA 4LYAA 1JXMA 3GJ7A 4LV8B 1NLYA 2P3SA 1OHHD 2O0JA 3KL4A 3F3YA 3U60B 1TEXA 4H1VA 1KI7A 1P3JA 2AFHE 5L3SA 2VHJA 2JLYA 1UKYA 2G0TA 1W49A 4C30A 4CEHB 2PMKA 1RFLA 1SZPA 2JLRA 1TU3A 4POAA 5SZIA 4DEXA 3V4RA 2V9PA 2BHRA 2CE7A 4DSNA 4A9AA 1GZSA 3BB4A 1R5BA 2F6RA 2QBYB 3CF6R 4WOPA 5HZKA 5HCIA 2X8AA 4CVNA 2ZI7A 4EJSB 3CB4A 4C0LA 4PC7A 1R2QA 3CLVA 4MYTA 1E1RA 3WNDA 3SNHA 2IXEA 1MV5A 4MRNA 3KJHA 4LJ4A 3WMGA 3I8XA 2NO6A 3KTAA 4Q00A 2A78A 4XJXA 4S35A 5IF9A 1ZC4A 1CR0A 1JI0A 4DT1A 3WBJA 2JGNA 3HDTA 2IWHA 1ZCBA 1N6IA 4DRZA 1DAHA 5JCPA 4HLDA 4WZ6A 1E2HA 4FCTA 4CT4B 5JJLA 4I1SA 2ZJ8A 3RC3A 4AKEA 4BFZA 3REFA 3BE4A 3KDSE 2CVHA 3K09A 1M8PA 2IS2A 3K0FB 4D0LB 1I2MA 5KDDA 1NKSA 1IOZA 3IHWA 2BBTA 3QUSA 2PX3A 2VRWA 4PHFA 1GRQA 1VCIA 5JSZA 4BLQA 1VDZA 5JWHA 1Z3IX 2ZI6A 1UFQA 4PC6A 3S1AB 4B2PA 4IEEA 1EFRD 4AKGA 4JVMA 4LRWA 4CGZA 2OCPA 2ZRIA 4M1TA 2QL6A 3IEVA 4QG7A 4CDGA 2IW3A 3SE0A 4HB3A 2QZ4A 1R0XA 2B7CA 1KOFA 1FP6A 4GBMA 4PO9A 1SXJA 3AVYA 1JEDA 4C9BA 1Z0KA 4LPSA 2XSZA 2QN6A 2HCBA 2ATXA 2GF9A 2BVNA 4Y0VA 4PANA 3U3RA 2ATVA 2IUSA 5EXTA 2XNSA 4LK2A 3O8RA 3W5JA 1RC8A 2P5SA 1OXXK 1ZW6A 1CF4A 2RHDA 1JB1A 3GD7A 4GZLA 1TU4A 1W4CA 2FPLA 4YONB 1KZGB 1D5CA 5JFGA 2ZRGA 4ON9A 3X1YA 4MQBA 3UMRA 3O8BA 4UKDA 3QPUA 4Q02A 1RJ9A 1OYYA 2J0UA 2CDNA 3O47A 5JHHB 4CW7A 1P6XA 1ZAKA 3T1OA 2KJQA 2D62A 3NC0C 3A4NA 1EXMA 5CJ2A 1D2EA 4B74A 3EARA 1SHZA 4LHWA 4Y0AA 5C18A 1AS2A 4KAXA 2ZRFA 3GJ3A 2HXYA 2O8FA 2B8WA 5JJKA 1W36C 1E4VA 4X8OA 5BN5A 4GP7A 5FTKA 1AKEA 1KSHA 3MSXA 4OI4A 1A2BA 4AD8A 1AJEA 1FQKA 4ZDKA 1JPNA 2QRNA 2W0SA 3DOEA 2R6GA 3LBNA 4HLQB 3M4YA 3B7GA 5FOXA 1OFUX 1X1RA 1SKYB 3BORA 3T1QA 3IBGA 1GUAA 5KPDA 3SBDA 4IHQA 3U7EB 2ZYWX 3WNCA 1VPLA 3VHLB 3RRMA 2AK3A 4P4UA 4FD2A 2EWWA 3K9HA 5KO2A 4BZPA 2PCLA 2F9MA 1Q1ZA 1M7HA 2GA8A 1LB1B 3FFBA 3K8YA 2GVZC 2XNDA 2NPFA 1N0VC 1OIWA 3AF4A 2MSEB 3EC2A 4I1OA 4QBHA 1ODFA 4RD6A 2A5FA 4A0HA 2JLUA 4IFBA 2W6JA 2ZSDA 3LFUA 1M6NA 2IYLD 2QTFA 4TLCA 4UXJA 4HI0E 4DC9A 3K0CA 3DM9B 2A3RA 2GDJA 3T12A 1T0JB 1OH8A 2RGDA 3TKLA 1R5NA 2YV5A 1CP2A 1G291 4Q47A 3A4LA 1Z83A 3EXAA 4PC2A 4P4SA 4B75A 3CWQA 3IIKA 4FIDA 1MABA 5BYKA 4DDVA 1JXOA 3F0TA 2MMCA 2OO7A 5CK4A 2ORIA 1U8ZA 1EFUA 1Z47A 4N1AA 3C7KA 4Q21A 2JLZA 1GNPA 4PFSA 2G6BA 3X1ZA 1CBUA 2QTHA 1BIFA 3V9PA 3X1XA 1Y3AA 4PHHA 3UK6A 5DI3B 1G20E 2GXSA 3I92A 5GJVC 4DB2A 1HQCA 1U9IA 4LHVA 2K5UA 4Q1EA 1R5OA 3JZAA 4PPGA 4XTRA 1AGPA 2BMEA 1AGRA 4TT3A 3CM0A 1IN8A 1CR1A 2KBEA 5KNCA 4KBGA 1O87A 1OHHA 1YR9A 2J7PD 1XPOA 1NVUQ 2C04A 4L15A 3Q3JB 3WHLA 2REXB 3OAAD 5B2ZA 3AF2A 3L8ZA 5CB6A 1J8YF 4PZYA 2W2VA 4LJ8A 2FMXA 2WWGA 1G3IA 2GEDA 3FVQA 2WMNB 1ZCAA 4A15A 2JLXA 2Z4SA 3PEVA 1MOZA 4UNNA 3QKSB 1G18A 1F6BA 2ZU6A 2ZE7A 1XEWX 2YC4C 4MRPA 2NMVA 1UDWA 2W83A 3VU9A 2QGZA 2OLKA 2D7CA 3AEZA 4RFVA 2KE5A 2GVDC 1XTKA 1SXJE 5J4YA 1AA9A 1U0JA 2HYDA 2FA9A 4MUBA 4A1FA 4AYXA 2NO1A 1OE0A 2YC2C 1XMJA 1NMZA 3SQWA 2QORA 4GMDA 4DCUA 1QVRA 2IF0A 3WMFA 4URXR 5F2EA 4WA7A 1YZKA 2QM8A 2REBA 3HU2A 4TMKA 2ORWA 3OIVA 2BWJA 1PVOA 3K0CC 3BFVA 2JCSA 2WHXA 4U00A 4B2IA 1Z63A 2VP6A 4NP6A 1VMAA 1H65A 1TL7C 3BFKA 1G3MA 1HT1E 3CPHA 3U2QA 1EFRA 2QE7D 4IDOA 2KWIA 3NBYC 1Q57A 2BCJQ 5J5CA 4B44A 1ZBDA 1KK0A 1GKUB 4LJ6A 5JWRA 3BD9A 2GILA 4HLUA 3E5HA 4TQUS 3SJZA 2Q3HA 4MKFA 2ASEA 3K1JA 5JZVA 2V3CC 4OK5A 4BFTA 2OLJA 5KUTA 2OZEA 2WWIA 1AS3A 2QAGB 1MRSA 2R2AA 1E9FA 4RD4A 1XXHB 4NYIR 2VHTA 3TAUA 1G5PA 2TMKA 8OHMA 3O8CA 3K0SA 4DWJA 2J45A 5KU1A 2FSFA 5A4JA 2QQEA 2QMUA 2O8CA 1BYIA 1VIYA 3AF3A 3QF4A 2G88A 4V0KA 2ZJ2A 3AQ4A 4I1VA 2CE2X 2DWPA 2QI9C 1ZRHA 5AWFC 2DFNA 2W2XA 3THYB 2JA1A 3Q5EA 3VX3A 4TMZA 4G1UC 3CIOA 4FW9A 1IY0A 2UZIR 4B73A 1IN6A 1PLKA 2GEVA 3B1ZA 5AUNB 2DPXA 5BN4A 3R7WB 1BKDR 4KYUA 4KV9A 3GFPA 3ZS8A 2VP2A 3SYLA 3QKUA 3H86A 4DLYA 1R4AA 3C5HA 1T3SA 2AD1A 1IN5A 3GLHB 3GLFB 1E2EA 4OBEA 1SGWA 3ECCA 4A8JB 721PA 1DAIA 1RRGA 3BIFA 3ICQB 4QKQA 4BLOA 4MGIR 4URZR 1WDTA 1Z0DA 1GNRA 3SBEA 1G1MA 3MUFA 4RKEA 2WM9B 1Q1EA 4B35A 4B6EA 1YR8A 1ZNYA 2FZ4A 2ZPTX 4QL3A 2BV3A 1HE8B 3W90A 4CF7A 1CJTC 4BQSA 3PR1A 3E70C 1C1YA 4AG5A 5D3QA 4YLGA 1G64A 4UNPA 4TQ9A 3KFXA 1XTSA 3KB1A 4GFDA 2FX3A 1LTQA 4DLSA 3K0FA 3NEJA 1NVXQ 2FN4A 3TQCA 2GF0A 4G5RA 2Q3MA 4D4JA 4YMTA 4ABYA 2FJUA 5DNYB 5BWMA 3CR8A 3WXMA 2X1VA 4D82A 1OH5A 1ZM9A 1JQJC 2PCJA 4PQFA 4C4PA 4CEJB 4D4KA 4R2IA 2H17A 3HWSA 5JS8A 3RWOA 4DSTA 1QG4A 2ZRKA 4TTRA 4GDFA 1NY5A 2IHBA 1F2TB 4EPYA 1MKYA 3VR4A 3W8RA 2QROA 5H70A 5TV2A 3TR0A 4TLEA 1MRNA 1UM8A 1V43A 4AWXA 3MCAA 4HB0A 1H8HD 3BGWA 2DFTA 1RIFA 3VR3A 1RVDA 2C99A 4L4UA 3QKTA 4OQMA 1U8AA 2ECKA 1T9HA 1SVOA 2I3BA 2IYQA 4TTPA 2OAP1 4A4DA 4C0QC 2J59A 1KGDA 2ODBA 4TMVA 3U6KA 3EZ6A 1YR7A 3ZH9B 2B92A 1ZVQA 1CEEA 2SHKA 4B71A 4M9SA 4PHTA 3AV0B 4IOLA 4PTLA 4DLUA 5CM8B 2YOGA 3NC1C 3A4MA 2ZANA 4N0EA 1NLZA 1T5IA 3QG5A 2YNMA 1Z6GA 3AB3A 3FKQA 2NO0A 4NYIQ 1XRJA 4RKFA 1UDXA 3C41J 3WP1B 4HAZA 2ZE8A 2J7PA 1M2OB 4W5JA 1EGAA 4OKSA 1OLOA 3OAAA 2O8DB 1ZUHA 1US8B 1KDPA 4P0TA 2V6IA 5JRJA 1Q21A 1JPJA 1YKSA 2JDID 3C4JA 4TTQA 3GFOA 4HSEA 1RKBA 4MKIA 1YHNA 4PZZA 2YINC 4D0NA 1Z0AA 5AJVB 1W5TA 5FBLB 5FTLA 2R6FA 3ADKA 3QQ5A 2D74A 2O8BA 3SJCA 3T1TA 5F9HA 1R6BX 3RSOA 2C77A 2EWVA 2IYZA 2YKGA 4DZZA 3SEAA 1FW6A 4RCYA 1LW7A 2ONJA 5J4HA 3DOFA 1U0LA 1ZJ6A 4W9MC 2IYSA 2XB4A 4OQNA 2IYWA 4Q4HB 3ADCA 1ZIOA 1G8FA 1S0UA 3KJIA 4PR0A 2B8TA 3FOZA 5FL3A 4G5SA 1SULA 5L3QB 2IEYA 2O8EA 2WKRA 1E2GA 2R8RA 1LFDB 3K9GA 1L4UA 1QHSA 1A82A 2OBNA 3BH6A 2ZI4A 3CPEA 4JSYA 3DM5A 2ZIAA 4NL4H 5EE9A 2RGAA 1ZD1A 3U44B 4JLAA 1BH2A 3RABA 2Z4RA 1IHUA 4KFSA 2A9KA 2RGNA 2J0SA 4XWKA 3C14C 1OXTA 2GCPA 5CIWA 3TSOA 3ZS9A 4IVRA 1ELOA 1IXSB 3LV8A 5DE3A 1XTQA 5FBRB 3IDQA 1W2HA 4QM6A 3AP3A 2Q9BA 4KODA 3DKPA 5E7JA 3V00A 1DO0A 3MD0A 1E6CA 4CIDA 3SI7A 4GP6A 3IO3A 1KZ7B 2XZPA 5DSZA 3KQHA 4PQRA 4PZLA 3CF0A 3F8TA 3TSZA 3GLGB 2IT1A 3IPXA 4A82A 5EZ5A 3PIRA 3MWLA 2VIIA 4NONA 1DAEA 3QNUA 2QU8A 2XSZD 4IXNA 1ZM7A 5EUMA 4CEIB 4IDPA 4GMXA 3A37A 4JT2A 3ZDQA 4E5UA 1XP8A 4KJZA 3HJNA 4C2TA 3SZRA 5ANRB 4YMSA 1JJVA 1TX4B 1E9EA 1WE2A 3MRSA 2ERYA 3NDBB 2YHSA 5F98A 1IONA 4LHYA 2BBOA 2HT6A 3CRW1 3GLIB 2ZRHA 1ZNXA 1OFIA 4EUNA 1Z0FA 2X2EA 2AR7A 3BK7A 3EX7C 2ZI9A 4B48A 4JLNA 4WXRA 2IYTA 4G5GA 1F60A 1K5DA 5IT5A 1GOTA 2Q9AA 4KFTA 5KSPA 1UBCA 2VSXA 3MGCA 1G41A 2CLSA 3RWMB 4Q7LA 3A58B 1JBKA 4WIAA 4DLWA 4FINA 1LS6A 4GZMA 4RSGA 3SYNA 4MGYR 4TLBA 2OBMA 3CX6A 1E2KA 2BBSA 2WWXA 3R9IA 3TNFA 4B47A 1WB9A 4IRUB 1UBGA 2QPOA 1VG9B 1ZM3A 1S9HA 1S1MA 1UJ2A 2V54A 1AK2A 1Q3TA 3OZXA 3QG1A 3W8NA 1KTVA 1VTKA 1G3UA 3QXXA 3TBKA 821PA 4IJMA 1YZQA 3FTQA 4YQFA 3FHCB 2QP4A 1EK0A 1HTWA 3CKLA 1DE0A 4OI2A 3TVTA 5KHOC 4TL8A 1XJQA 4ZO4A 2BCGY 4JT4A 3RRNA 5FTNA 2Z43A 2GHIA 1JNYA 3QIAA 1YE8A 3QSYA 1OIVA 1RZ3A 4BZQA 2IX3A 3DHWC 3QXSA 3AVWA 4URWR 4JLJA 2ZUBA 5FUXA 2PLRA 4JBYA 5KNDA 2OM2A 1H8HA 2OG2A 4D4LA 3R9WA 4HZUB 2QAGA 1OKKA 3ZVMA 4LJ9A 4Q48A 5FBQB 2NIPA 3B6EA 3H2YA 3LLMA 4A0FA 3IQWA 4EDHA 1DS6A 2WSMA 3AKEA 1P75A 4JKIA 1XDBA 5KYKA 2EVWX 1Z5ZA 4IVPA 4LZZA 2BJVA 3CZPA 2ANBA 3KKOA 2UVQA 3I72A 4L9WA 2WJJA 1K8RA 4E09A 1CTQA 3UATA 4Q9KA 2GCOB 3DMDA 4TYNA 3ZD7A 4MDFA 1E0SA 5JCZA 1G8YA 3L8YA 2CVFA 1WBBA 2C8VA 4A2WA 2HT1A 4LDJA 4TMXA 3OIYA 2VPPA 1G21E 2GAAA 1DAFA 3THWB 4M4SA 3GLHA 5EE3A 3GLFA 3Q7QA 2JDIA 2WKPA 1AS0A 4A8JA 2Q6TA 1G16A 3Q85A 2VHQA 2C2HA 2ZS9A 1NLFA 3T61A 2GZHA 3EPKA 4B3FX 1T3HA 1KNXA 3AVPA 1GITA 5F9FA 5CDFA 2AL7A 2WICA 1KDTA 3U4QB 1RYHA 4DLVA 2KB0A 4JVLA 2BEJA 1XFAA 2QPAA 5G3YA 3UPUA 1TAGA 3GJ0A 3AUYA 3CBQA 4BLSA 2IA5A 2DFLA 5FFMA 4EKDA 3FHTA 2F3TA 2GCNA 1G6HA 5G3ZA 5J4VA 2Z83A 4D25A 4Q03A 2EU8A 5FBVB 3PJRA 4MYUA 4O3MA 5HZHA 1E2NA 2FF7A 4PO8A 2BBWA 2EYUA 4CZ2A 5TY0A 4B6FA 4CEJA 4BLTA 1FNNA 4KYIB 3DVLA 2ZYTX 4EPRA 3WRYC 1F2TA 4D4MA 4JYCA 4OI0A 1N6PA 2FV8A 4RZ3A 2IWRA 1E9CA 2Z6VA 4IEIA 1XTRA 3GCGA 1T4GA 2G1JA 3LW8A 2GK7A 5G40A 1T8TA 1F2UA 5EQTA 3RRYA 4M53A 3FYHA 4II7A 3FPAA 3GJ4A 3GPLA 3GFTA 1W48A 2W2TA 5JEDA 2AX4A 3N2EA 4OJQA 1S3GA 3CRRA 2P65A 1HY3A 4IW3B 4K8OA 3FMPB 4UNRA 4EPXA 4Q1AA 3AP2A 4HB4A 4TYQA 5BXQC 1TTTA 5FUYA 4MUAA 4EIWA 2EQBA 1UEJA 2EFCB 2WJYA 3QBVA 3PV0A 5JHGB 1LV7A 2F1IA 4HYYA 2OAQ1 4FN5A 4D26A 1HEIA 2JEOA 1JR3A 1KI6B 3TH5A 2HF8A 1TNDA 5CK5A 5D3MB 2YOFA 4NCIA 3A6PC 3PG5A 4NZYA 1US8A 1WMSA 3AKDA 1P2UA 4XOIA 3UMFA 4H9GA 4RD2A 1XEWY 1G8HA 4ERNA 2ZJYA 4ZKEA 3NTUA 4QC2A 4RY2A 4DCNA 1E4YA 4C0JA 2RGGA 4YDSA 1XF9A 1BO6A 2Z0MA 3WY9A 2PZEA 4JVSB 3CONA 1Q1BA 4ZDWA 2QM7A 1KMHB 2WWWA 2RAPA 3WRXC 3UKDA 4NDZA 5KSOA 2DYKA 4B3CA 2ZRNA 1G7RA 4I4LA 4JLOA 3ND9A 3SN6A 1TQ2A 3QI2A 3ZZ0A 4OJKA 3UXMA 4O0MA 5J47A 2JASA 3WBKA 3PEYA 3M1IA 3CNOA 3EC1A 3GQBA 1IN7A 4NCJA 1NNEA 3C5CA 2REOA 2ZM5A 3EASA 1C4OA 4FMCB 5TARA 4QBIA 4Z8XA 1Z8FA 4YMVA 2BEKA 1LY1A 2C95A 2FNAA 4ZKDA 3K70C 3EZFA 3SS8A 1N0WA 2CJWA 1G5RA 4Q1CA 3RYTC 4CT5A 3GP8A 2PT5A 1R0ZA 2F43B 1GM5A 1R8SA 3LXXA 5HCNA 3RVBA 1QVAA 4I1UA 3RAPR 5J4LA 4JZKA 3MG9A 1E94E 2OE2A 2EFHB 3MAAC 3HPRA 4RZXA 2XOKD 4L8GA 4MYHA 5LD2C 4FMBB 4YDHB 3T1VA 3K09C 5DI9A 2QQ0A 3U44A 4IKEA 4C7OB 2XEXA 2VA8A 2HEIA 1YZUA 4US2R 1E99A 4X8HA 1KO7A 2P67A 2WSSD 3QJYA 4F7WA 2QP9X 2XAUA 3GLHE 5FOUA 1FX0B 4BPBA 2OHFA 1W0KD 1P9RA 2ZE6A 4FXPA 1J7KA 2V1UA 3SC3A 4AIIA 4Z54A 1W44A 2V55B 3T15A 3RC8A 4Q66C 4G3XA 1I2DA 3VKHA 1SXJC 3ZYCA 5A5GA 1VCOA 3P4XA 3OIUA 1BYUA 1NY6A 3C8UA 4B3BA 4R71A 2C5LA 4DSUA 5HPYB 3HU1A 1CRQA 1NVWQ 1W4AA 3DL0A 4M9XA 4NYJR 4ZIRB 3U7FB 4Q4AB 2VP0A 2HYIC 1F48A 2IL1A 4JSTA 5EXXA 3QKRA 4PSVA 1XNJA 3P1JA 2OXCA 3D7MA 4XWOA 4MA4A 1RPZA 4A2PA 3NXSA 2X2FA 2FGKA 4L9SA 4TWZA 3KX2A 5AUQA 1NN1A 5JECA 1LS1A 2FFHA 1KO8A 1LNZA 4NBSA 3RLFA 1YU9A 4G5QA 4LOAA 1DOAA 1KI1A 4DDWA 5EE0A 2RGCA 1L8QA 3X1DA 1E0AA 3ZLJA 4JLBA 1HH4A 3TE6A 2WVJA 1KJWA 1NBMD 5FPYA 2R62A 3KQNA 5AJWA 4GPTA 1KI3A 2D4HA 3K0EA 3FWYA 1PLJA 1GRNA 5C2JB 1UKVY 3LBIA 2O52A 4Q18A 4GRAA 4URYR 4KO8A 2ZRCA 3L0PA 4HAWA 4XWAA 4A0RA 1P2SA 4DB4A 5DYIA 2FFBA 4X8LA 3SFVA 1E9AA 2HUPA 2O0HA 3MMPA 3D6TB 1WCV1 1DAKA 1ZINA 2I1QA 1AQYA 4RFSB 4TLAA 1PUJA 1E9SA 1XEXB 4FCVA 3QE0A 3V4FA 3W34A 4D2IA 4DIDA 5DGXA 3I4LA 1OYWA 3QEJA 1II8A 3PVSA 3QOFA 4E22A 4M9ZA 3VTKA 5CB8A 3BFXA 2VSOA 3OE7A 2XTMA 2GKSA 2VH5R 4JKYA 5FPTA 3EIHA 2B6HA 3LX8A 1JAIA 4A2QA 5FL7D 1P60A 4AYWA 3ADBA 2IS4A 1NMYA 2WBLC 1IXZA 3KXIA 2HJGA 5AR1A 3AGPA 2XXAB 1E3MA 4MRSA 4XD7D 3DZ8A 2IEZA 2JJ2D 1XJCA 4BFSA 2DFKB 1E2MA 3VHXA 4G0NA 1G7TA 2IF2A 1G4AE 2JLWA 5EZ6B 3P26A 3THXB 3VX4A 421PA 5CLLA 2F55A 1A5TA 3IGFA 3RRZA 2ERXA 4ZCMA 2VEDA 1MH1A 4QGFA 3TJZA 3G82C 4Q7JB 4ACBA 4B34A 3B82A 1KY3A 1WXQA 1XD2B 1X86B 3LA6A 4TN1A 1K5GA 2YJTD 2WOOA 4DUGD 4HLCA 3LX5A 1NL3A 4J0QA 3B60A 5J40A 5IRCD 5G53C 4JBXA 2NPIA 1RW4A 4UQOA 3ZJYA 1U9IC 4LJ5A 3W6OA 4TYYA 2MMGA 1YZNA 1YZTA 2FOLA 1KSGA 3B8HA 3TRFA 5SZKB 3OESA 3LAWA 3NVAA 1FMLA 1KK1A 1FPMA 1NMXA 3A1WA 2VHUA 3WHKA 4NYJQ 3I5XA 1CU1A 2BDTA 3LO5A 3TW8B 2RGEA 1OXVA 2BC9A 2FE4A 1ZYUA 2AK2A 1GIAA 1OW3B 3T34A 1DG1G 4QGHA 1EX6A 2ZJOA 2ZJAA 2V1XA 1E2FA 3JVUA 4KFUA 2FFQA 1W0JD 2ZRPA 3RSLA 4N3NA 5LPNA 1MR3F 1MO3A 3TAHA 4EFNA 4R7ZA 2ZI5A 4CEHA 4V03A 1RRPA 3KQKA 3DO6A 4LYFA 1W4BA 3AP1A 3NDPA 2WJGA 2ZRLA 3BERA 3AVUA 1FUUA 1GFIA 2JAQA 5EP4A 2QBYA 4OHXA 4M1YA 2A5YB 4W5WA 4MGZR 5CM9C 4EJSA 5CYPA 2V7QD 4KVGA 4UJ3A 4Q01A 3TQFA 1BOFA 2LKCA 4RZUA 4LJAA 1OH7A 4WZAE 2WWFA 2W00A 5K8UA 4G01B 2XOKA 1DTSA 2WJVA 5M04A 5C4GB 1FOEB 1GL7A 2H92A 2AXNA 1MO5A 1I4DD 3KXLA 1D9XA 4P32A 1ZM4A 1XZPA 1NN3A 1NN0A 3CH4B 4TQAA 1KAOA 1DO2A 2WSSA 3LVRE 3KXKA 2JJ1D 1OFHA 5BN3A 4IDHA 1FQJA 1TUIA 1FP7A 1W0KA 1M1YE 2DR3A 2GXUA 1KAGA 3BB1A 4U5XA 3S1AA 5L3SB 4EAQA 5B30A 2ZUCA 1GVNB 4BUJA 4HLUC 3TUZC 4ASUD 1E1QD 2H8KA 3L0IB 1IN4A 4PAQA 3NEYA 3TVDA 4M1KA 1TPZA 1WA5A 2VLIA 1KI2A 3BH0A 1XMSA 2HF9A 1W2GA 2EFEB 1OPXA 1D2MA 3SR0A 3B9QA 1W36B 2IS6A 2R65A 1X8JA 2WTUA 4JLPA 1KI6A 1OKKD 4BE7B 4EFMA 3K70B 5K8TA 4LJ7A 2ZS7A 3JVVA 4B3DA 4OHWA 3BOSA 2BKEA 1YQTA 4WBSA 3EW9A 4ESVA 4DT1B 2GZAA 1IQPA 2PZFA 3A1SA 4ZI2A 1SVKA 5CLQA 1OIXA 3FGNA 4HAYA 5JWOA 5SZHB 4BFUA 2NG1A 5LD2B 4LBWA 4LBVA 3CRQA 3UG6A 1KMHA 2FDCA 5UKDA 1NBMA 1TADA 3IHLA 3QXHA 1ZNZA 2A5JA 3FHOA 3L2OB 2PJZA 5JSZB 4P31A 4L16A 3FB4A 4NPHA 3SOPA 2QMEA 2ZR9A 4C0AC 3BXZA 5TVKA 1XU4A 1Z06A 5FI1B 1S3SA 4O25A 2KSQA 4QXAA 4PAMA 3Q8XB 3BH7A 2FEOA 3FMFA 4I81A 2MSDB 1GAJA 1E98A 1P5ZB 3G5UA 1XCPA 1N3BA 1SXJB 2IHYA 4ZDJA 1R10A 1V5WA 1E2IA 1X8LA 2FFAA 2ZSFA 2IYXA 4FCWA 1MO4A 3E1SA 3DPUA 3LLUA 1A2KC 2FSHA 1R0YA 2PH1A 5KPJA 1ESMA 3ZGXA 4LBYA 2WAYA 4FMDB 5FL7A 3IO5A 1HT2E 4LYHA 5FUVA 1W4RA 4AI6A 4A0GA 4XD7A 2JJ2A 2GZDA 3IPYA 3X2SA 1FX0A 4P33A 1J2JA 1B23P 3ZZTA 4LHXA 2UKDA 2JIZD 1RJ9B 2RB4A 4KVAA 2J0UB 1EG7A 1IXRC 2CLDX 2ZJ5A 4M1MA 1Q1QA 4NYMR 4DVGA 1ZU4A 1G6OA 4R2HA 3WYAA 3PUXA 1GNQA 4NCNA 4U02A 4QHSA 4V0MA 4TL9A 5ELXA 2ODNA 1FZQA 1E79D 1ZU5A 1IY1A 2ZR7A 1S96A 2O8FB 2Q9CA 2PL3A 4DIEA 4Q1BA 1G3QA 3TSWA 1W46A 4DUGA 1T5LA 5EE1A 2PEYA 4HUQB 1NG9A 2F3RA 3AVTA 2J1LA 3LDAA 4LWZA 1E0JA 1N5KA 2C9YA 3NG1A 2QA5A 1NN5A 3NBFA 4LUCA 1BS1A 1ZNWA 3SDZA 2CL0X 1A1VA 1TQ6A 1U0HC 4RCZA 2PJRA 1P9NA 1U98A 4JLDA 3LVQE 3PUYA 4UNQA 3GMTA 5DI3A 1L7VC 1N6LA 2O0KA 3U3MA 3ZD6A 2PBRA 3ETLA 4C3ZA 3VNUA 1EWQA 1P4SA 4TMWA 1NJFA 1Q44A 3HP1A 1XWIA 3LY5A 4QM7A 2GETA 3AF1A 1YZGA 4OHZA 2ZI3A 4BEJA 1W0JA 5FPHA 4NCKA 1FL9A 1JR3D 1ZUIA 3CPJB 3SYKA 1A4RA 1E69A 1O3YA 5A0FA 1RYFA 2YWEA 2XJ4A 1N0UA 3OIWA 1HV8A 3QENA 4M1SA 4DCVA 1VYUA 2XZLA 2RKOA 1NVVR 1CULC 2YWGA 4V0OA 3U7GA 1P2VA 3W5IA 4M2LA 5C1BA 2ZRBA 5JJIA 5FTJA 2J87A 2CHQA 3QKSA 4MKGA 2V7QA 1GILA 3QY0A 4P4SB 5KSZA 1KHTA 2CK3D 2GRJA 3EA0A 4R98A 5FPKA 1OH6A 1MABB 221PA 3RANA 1KJYA 2GBLA 2NTYC 1AN0A 3N5CA 1OXUA 3BB3A 1XEXA 3QEOA 4KSBA 1OB2A 1XJ0A 3U61B 4AKHA 1SVSA 3JZMA 2E87A 1KO5A 4WZBE 3LW7A 1OV4A 1R8QA 2G1KA 3QF7A 2OCAA 1JECA 1N6KA 4IFEA 2WPDD 5JS7A 5J4KA 3DKVA 3BRWD 4RZ2A 2B21A 4LY6A 2J46A 1SVLA 3IKJA 1G5TA 4BWYA 2ZRDA 3GEHA 4DBLC 2JJ1A 3REGA 1II0A 1X1SA 3AH8A 2NO9A 4HDQB 5CIQA 5GJWC 1H8ED 5EUQB 5HKKD 3IUYA 2F1HA 2XITA 3NBXX 4PPNA 1TUEA 4YXWD 3CZQA 3FFAA 1E32A 4NCHA 2G83A 5F3WB 2EFGA 1NBME 2RGNC 3O8DA 3VKGA 1PUIA 4ASUA 5HE9A 1E1QA 1XPRA 1QHHB 3LD9A 3MWKA 1E2PA 3I61A 4NYMQ 1NIPA 3KUCA 1D6JA 3VKWA 4QNMA 4C0KA 1W7AA 2VTKA 1WF3A 3NHBA 4TL7A 2XX3A 2XZOA 4XVUA 1D8TA 1RRCA 1LF0A 1XXHA 1KSFX 1YZLA 1Z28A 2F9LA 2GK6A 3PEWA 3RHFA 1GG2A 2IS1A 2IK8A 1JQLB 2BMFA 4JYBA 3W3ZB 2JLSA 1FUKA 5DH9A 3WMEA 4QGAA 2H57A 5GVSA 3J81k 3OEED 4Q19A 5P21A 4B43A 3GJ8A 2WOJA 1KO4A 4IOMA 3ZVNA 1EFTA 3T06B 3THYA 4GI7A 3C16C 2H16A 4HUTA 1GP2A 1SKYE 2A30A 2IUUA 5L3VA 1CJMA 1L4YA 4B33A 5L8VA 3AVVA 1EX7A 1EWRA 4KFRA 2Q3FA 1T8UA 4Q1DA 3AM1A 3A1VA 1J90A 3R7WA 2ZTSA 2PLFA 4EQ6B 2VHCA 3GEIA 5C4MA 2CBZA 2DWQA 3W9YA 4PAOA 3MFYA 2W58A 4JIMA 3L43A 1U8YA 2VQSA 1GKYA 1Q22A 1QDEA 3UWKA 3ZIAD 4KLZA 1CIPA 1HUQA 2ZVPX 3E2IA 4XIGS 3AVXA 4A36A 1R0WA 3AGQA 1SVWA 2ZE5A 2FSGA 4V0ME 1N5IA 1Q3HA 3B5JA 2W6ID 4EPVA 3CF2A 2HV8A 1NVVQ 4HAXA 2BJWA 3DZDA 2JJ8A 5H1YA 4KHZA 2NOAA 4RD0A 5BW8A 3K53A 1XZQA 1E0KA 2YWFA 2GJKA 4YMWA 1PV4A 2QSYA 2WJIA 1LVGA 3B85A 2J9RA 4M22A 4FMCF 4LGMA 2IBMA 3IEUA 1ETUA 3QF4B 5EP2A 2FWRA 5G41A 2FPMA 3MJHA 4D81A 4URUR 2O5VA 2WWHA 1KI8A 3SHWA 1M7GA 1P61B 4XVQA 2J0VA 2NZ8A 1TQDA 1KMQA 1P62B 2C98A 2JIZA 3PUWA 1GSIA 1U99A 4MITA 3CRMA 2RMKA 3LQRA 3EG5A 2J7KA 1TF5A 3OEHD 4BLRA 1E79A 3OE7D 2R6CA 3R9XA 2OCYC 521PA 2CMKA 2YVUA 4JL5A 1UBEA 1VIAA 1QHIA 3BJIC 3F5FA 3RS7A 2QAGC 4MRRA 4NMMA 5EP3A 2WIBA 2PEZA 3AUXA 3KJEA 2ONKA 1YJ5A 3TLXA 4ITRC 1C9KA 3B1XA 1KIMA 3EZ9A 1KNQA 3RS3A 5GADl 1NP6A 1JJ7A 4KXFB 3TGPA 4B2LA 1HURA 2ORVA 2D2EA 3OHMA 4BASA 3KFVA 2WAXA 2WKQA 1GL9B 1FFHA 1P7CA 3BS4A 3SJAA 1Z2AA 4DEYA 3N2IA 2YOHA 1WBDA 3CO5A 1XBTA 2GJSA 1DADA 3T35A 1M34E 3VR1A 2CHGA 1VYTA 4JMPA 3I8SA 3SQXA 1Z0JA 1NF3A 4Q4LA 4JJZA 5GVRA 4AK9A 3IIMA 1G17A 2ZYUX 3KKPA 3RS0A 5DN6D 2PZGA 4QJ4A 2P6RA 4GT1A 3A36A 3PUVA 2XTNA 2B7BA 2QGNA 2ZAOA 4NKRA 2FSIA 5AJZA 2O8DA 3ASZA 3GJ5A 4JJKA 4A8JC 2QNRA 2YWHA 4JLKA 3EWAA 3EPLA 4YC7A 2RGBA 4X8MA 4D80A 4BRUA 2GEUA 4BFWA 3W6PA 4S2EA 1SVMA 3QVUA 3RS4A 2D06A 4K81B 2ZQ5A 3RDPA 3FE2A 2CK3A 4LX0A 3CWZA 5KDLA 1VG8A 4Q7KA 1Y63A 3PUZA 1Q0UA 2XJ9A 1CR4A 5B58C 2P0EA 5E7IA 2E1RA 5FUWA 1F5NA 2BKUA 4XH9B 3LQQA 3P20A 2PX0A 5CJPA 2QEQA 3N70A 2WPDA 1FMJA 3W3AA 2J3EA 4Q4HA 3R8FA 1P73A 2CL6X 1XXHE 1NJGA 1UKEA 1G8PA 2AWNA 3PENA 5L3QA 3BWDD 2HJVA 2BOVA 1Z6TA 4MH0R 1Z07A 2IYUA 1U90A 3NHAA 3MWJA 1H8EA 2IYRA 4DCSA 4RVCA 1XD8A 5HKKA 2HDNB 1FTSA 2ZR0A 4UJ5A 2EW1A 4QHTA 4BRWA 1DARA 1N6RA 1XEFA 1CR2A 2GJ8A 4YXWA 3PXGA 4A6XA 4BECA 2OUKA 3M0EA 4B3XA 1ZC3A 1WQ1R 3ZQ6A 1N2CE 2ZREA 1P2TA 3U3KA 2GAOA 4F38A 3RS2A 1ANKA 2RH5A 4HUQA 4TZ0A 1UADA 3L0OA 2AN9A 3GLFE 2QUZA 2O8BB 4UNSA 1GL6A 4OYHA 1XD9A
chains in the Genus database with same CATH superfamily
3A1EA 4OPMA 3CT4A 1GV0A 3C85A 3PEFA 5BSUA 4QNRA 4IJ6A 4QUHA 2P41A 4Y0NA 3R7AA 3TK1A 1EWYA 1H2ZA 1BVRA 2C4HA 3HCBA 3RYHA 1NNSA 4UPVA 1NI3A 2FWIA 5GJCA 2CV1A 3T9DA 3VYRB 5MN4A 3FG9A 1Z4QA 4ANFA 5JQGF 3WWOA 5KDOA 5KOYA 5EE5B 4F96A 5AKJA 2NYUA 1CY0A 2H5EA 3DSRA 2VP9A 5CVDA 4DQVA 3FHJA 3R4VA 4II3A 4HJXA 5SY4A 4R3WA 1QGUA 2GUGA 3RT9A 3TKYA 2YXPX 3P2IA 1M6EX 4ZO9A 2V7UA 2VYNA 3ZCQA 3GMDA 1G0OA 4NPAA 5I7EA 5M34A 4UAGA 1KKLA 5AD1A 3QLEA 3IOCA 4RD1A 3S2GA 5J2TB 2FG6C 1NF8A 3AFMA 3DHVA 3P4YA 4UHKA 1HWYA 3RUEA 3THOA 3AL3A 2JI8A 3SKXA 3V32A 4XQCA 4DQUA 1K86A 5DNCA 2ALJA 5DBFA 3AERB 3UB2A 5CG1A 4EY6A 5AXDA 1S2MA 4FI3C 1IN1A 4KE6A 3OLCX 3FRJA 2OZLA 4C0WA 2PFKA 3NAGA 4PYKA 1ZMXA 2HU8A 3BC1A 3ANYB 4OQLA 4U2EA 3EDYA 3GJYA 1U2GC 2X9VA 3LKZA 1CUCA 1GKIA 3GGCA 1JG4A 2W6IA 4Q9IA 4ZODA 4EY8A 1H0SA 3I62A 3LM8A 1Y6JA 4JLSA 3DOOA 5E4YA 2BF4A 4BYGA 4DDTA 2ODEA 2CXXA 1ATIA 3C2QA 3WG9A 1WW2A 5D6OA 4CKWA 4HEJA 4BMYA 3JZIA 2XOXA 2UXDB 3E3OA 4WW0A 1VCMA 4MS3A 5DM4A 1A0OA 5AW7A 1ZVKA 4LVNA 5FX2A 1VE3A 1OTYA 1EFHA 1NBOA 2XMBA 5KWSA 4CLRA 1CLUA 1SZDA 5E4TA 3GW8A 4HQ6A 5TB5A 2XUHA 3P97A 4KE9A 1D6SA 3AOEC 2J4CA 2MINB 2LIVA 2GN2A 4LE0A 4MR7B 4MPTA 1ENZA 5CITA 5B57C 1NONA 1T35A 3GJQA 2QENA 3CMCO 5GAJA 4C4RA 4B7CA 3HVHA 2A84A 1BVYF 2F1RA 1FCJA 2L17A 4YIKA 1YQUA 2B0CA 2EZUA 4BO2A 4IQ0A 4DRYA 3U6BA 1AUXA 4CYMA 2JL1A 1KU0A 3OEHA 3AY0A 2LXNA 1HRKA 3HYRA 4FYMA 4BNGA 1VLQA 1CWUA 1L4NA 1QHXA 5A0VA 1JIJA 5L51A 1QO7A 2CUZA 3NOVA 3WRVA 5TXGA 5ALSA 2A4MA 2HSGA 3O9VA 6REQB 2ZOSA 4LZJA 1TO2E 1RZUA 3GCWA 2XT9A 1AIPA 3G6WA 2BM0A 4H27A 3U3JA 2B99A 3PX7A 1C8VB 1I7QB 3MJCA 5K0ZA 1V41E 2OGWA 1HDCA 2IYVA 1Z0IA 4WAUA 3L9XA 4I55B 2X9LA 2FMUA 4J0CA 1EGHA 1XCMA 4JNKA 3D8HA 3KR0A 1KSJA 2FDXA 5EJGA 1XZJA 3CEAA 1TEVA 5HIKA 3KUDA 4QQRA 1ORVA 1WDWB 1QBKC 3CEJA 2Q62A 1Z22A 1LFAA 3MEQA 3N0RA 5FBWB 1NI5A 1WHSB 3CN7A 1GGVA 2Y1LA 3GUZA 3QLVC 4HD8A 4OK3A 4PQYA 1R7RA 4P2BA 3EA5A 2IDMA 2C7VA 4DCOA 2JGAA 2HPZA 2QT9A 4AG6A 1XAHA 2GCOA 4Z9FA 3VC2A 1IM2A 2OBYA 1JEQB 2QY9A 5DN6A 3JALB 5TSDA 3H8SA 3VAAA 3CUYA 4RJLA 3STYA 1M5TA 3MINB 2IYYA 2IBTA 1CT9A 4QPJC 2J6BA 1T6YA 3IYLW 4Y1FA 3G0HA 2B4KA 4Q7EA 1RCFA 1T1IA 3FZEA 4D9JA 5MGNA 1KC1A 1FYFA 3CY6A 1HE1C 3TO5A 2BEUA 4YN3A 2QVBA 2UUPA 4KZKA 5FA8A 3USCS 4BP9A 3CVUA 1YR6A 3JZFA 2MSKA 3NP9A 1CB0A 4L6AA 1G8GA 2BMDA 2PZLA 3QXJA 1JQDA 2EKPA 5JW6A 4WVFA 2BJHA 4HAOA 4X1IB 4TSFD 4N0DA 1GTG1 5DISB 3EPJA 5D1NA 3OZ7A 1IBRA 1CQJA 3D1VA 1F7UA 2I4IA 3I3SR 1G7CA 1NKTA 1W88B 2OT3B 4H3SA 3UCFA 3EYAA 5KVCA 4B3MB 2JD1A 4LWPA 4EG7A 3U4QA 5LWHA 1K6MA 1N6HA 2IV3A 2HLDD 1QUFA 2P1ZA 2XBLA 2D0OB 1JGTA 1AZSC 3E7WA 4BQNA 3EVAA 3UCEA 5JEEA 3FW1A 4Z3OA 4K9MA 3WLLA 2RI0A 3LS2A 1AD2A 1SEVA 1YQXA 2AVNA 3K1YA 4IF6A 1WBJB 2I65A 2PH5A 2H4JA 3K9NA 5EQDA 3WLNA 5KNBD 1L5MA 1XL1A 2HBQA 3KL2A 4XRRA 1AM4D 3FGOA 4YJ3A 4WLOA 5A9RA 5JMOA 4YGYA 3DCIA 3KPVA 2LD4A 3INGA 2ZBVA 3AX6A 3EBLA 1DAPA 3CH6A 3PKIA 4ZVKA 1J8MF 4O29A 4RIHA 4DMMA 1QPZA 3DZCA 3PE4A 3OPYA 2IPMA 3CLTD 4QIHA 1YDWA 1EJ2A 1LA2A 3OF5A 4KU4A 3IT3A 3D2LA 1X6VA 3FPGA 4ZEMA 4DPKA 5I7WA 1T6NA 3V1TC 4LW8A 4ZVMA 4ECEA 3C1AA 3V4SA 3WB2A 4YCBA 1QRAA 1XZNA 3QVWA 2V4ZA 2O5CA 1QSGA 1CNFA 1FNDA 2AKYA 2HQRA 3MGKA 2X2OA 4OY3A 5TQ2A 3KQUA 1NXWA 4EUEA 2B3TA 4UZEA 4G86A 2ZUTA 3MWYW 2VPWA 4CLDA 5AW2A 5CG2A 3DR5A 4IJKA 1XA3A 1T1EA 4L95C 4OO3A 2FP3A 5KCMA 4MK4A 4MUIA 5E3HA 1DAGA 4JEIA 3SJBA 3OMLA 3H1EA 1U1FA 1Z2CA 1JEYA 4GKJB 1MQAA 2ZBDA 4HPWA 2OHXA 5ICFA 4QD3A 3SZUA 3UV6A 4EYEA 1JEEA 3OFND 3L0SA 5LB2A 5CW2A 4ZQHA 1A9RA 4M1QA 4FOPA 1VE7A 2LCIA 1M8GA 3LL4A 3HA7A 1L4GA 1JP7A 3PNQA 1J0CA 1IH8A 4Q9LA 1T3GA 2OESA 2W37A 3NM4A 1F9AA 2A9RA 2DY1A 2H9AA 3NYWA 4NJEB 5DP2A 4CIVA 5K3OA 2WTBA 3MZ0A 3AC0A 4I46A 4K46A 4FOOA 1FU7A 1IEVA 1ZO8A 2CCJA 2DAPA 2JH9A 1XTTA 1GQOA 1AKUA 5AW4A 2HO4A 2F8LA 1JWLA 1G0NA 4FMPA 4EHNA 1RI1A 1P18A 2HNBA 1HFJA 2C2XA 3D3NA 3M2TA 3QOYA 3QVMA 5EP1A 2LKDA 1ZD3A 2ZSEA 4RV5A 4BDTA 3SPXA 1F2UB 4B3TB 2ZITA 4ZVLA 1DTEA 3RF6A 3AL2A 2WFMA 1L5YA 4HWKA 3WDKA 3U19A 3RFFA 1MVNA 2VRNA 3VV2A 2IVFA 1WMDA 5EHNA 1UM9A 4BYMA 3VYVA 2OBLA 3NHZA 1DPFA 3AETB 4BPRA 3TCXB 2I22A 5CB4B 1EE2A 2BKVA 4NV3A 2ZTHA 2BFCA 3UWOA 1E5XA 4CR8A 1GGMA 2C5HA 3G6KA 1D2NA 3T4XA 3DDCA 2ZXUA 2X1HA 5F7XA 1F1BA 2NSDA 1YV9A 1AV6A 4OQFA 2GF2A 1EB8A 4J1QA 2YVLA 4MGHA 1YVUA 5A9TA 3MERA 5CLFA 4JLMA 4DREA 1SQ5A 1EWKA 4GDMA 3EC7A 2CZQA 2QP3A 2R6AA 4LC1A 3KETA 3H4TA 1UOQA 3LY7A 3RIXA 4QBGB 1VJCA 3TL6A 3ZZNA 5IJ0B 4UAVA 1WO8A 2BFBB 2QRVA 3DQPA 3MILA 3GLQA 4A91A 4YUZA 4JUDX 4OHPA 1QKIA 5A3VA 1SXPA 1PSDA 3X44A 3LP5A 2F1JA 1WP9A 3PFIA 1CF9A 4D0RA 3OZWA 1A5AB 2CNWD 1K89A 5JJIA 2G67A 4J76A 4QGGA 3WDMA 1V5GA 5F5NA 1UCFA 1N25A 1T5OA 1Z33A 3ABSB 4RK0A 4WA8A 5TMDA 3W2TA 4BX8A 3AIOA 3W7AA 4BEBA 3GDHA 4YA6A 5F3RA 2GHQA 4KWTA 3FRIA 1V1MA 4WGFA 2H6EA 4AZVA 3MW8A 3EGDA 3DBVO 4E5NA 2C5GA 4UATA 2D8MA 4M8NE 1LLQA 1VKNA 4D7AA 1V95A 5EJEA 4IILA 2ZSIA 4LJLA 4UD2A 1UMCA 1O77A 2XUAA 5B3KA 4KPUA 1IUPA 2WQ7A 1M74A 4DLTA 2OV6A 1B8NA 1U7UA 4CMEC 1OI2A 1FUYB 2B35A 1LPOA 2R9VA 3A26A 3GQBB 1IB0A 1V7PC 2RGXA 1GCIA 4FQ5A 3B78A 2GJAA 4UBOA 2F2TA 1VXRA 3CKMA 2GO7A 3Q5DA 4MQ5A 4MVJG 1GZ3A 1P9OA 1VI6A 2OCLA 2XUGA 3V8NA 4JYMA 5GJBA 4WRRA 1IHDA 1E1RD 1MN6A 3LRXA 2BHTA 4HN9A 1JLSA 1PS9A 1S8OA 4IOJA 3RRJA 4ZIRA 5K8LA 2I62A 4C0SA 2WZQA 1Q0TA 3OJWA 2HJ9A 1R4MB 4GQIA 5FTMA 3GJZA 2RONA 4DJ5X 4IDDA 4IG9A 3HYTA 2AXPA 3KKQA 1XRPA 1GNVA 1PZNA 2WNSA 3SM3A 2QE7A 1T6XA 3CQ9A 3NU1A 4NBUA 3SLGA 3R3WA 3BVPA 3E23A 3OF2A 1ADFA 2VYVD 2VNAA 4F8EA 4NI5A 4BNTA 5CT4A 2AD5A 2ODPA 3PIDA 4BLPA 1LXCA 1U7ZA 4KQHA 2BKAA 1CUUA 3K32A 1DO8A 1WXGA 3UB4A 5BWOA 5JOQA 1HYQA 3LA8A 4B76A 1Z6XA 2WFAA 4F1JA 3ZXIA 1J2UA 1FSPA 3S2ZA 3U4IA 1OU0A 4TSFA 5JZBA 3ZK8A 1FNSA 5CP8A 2VYQA 3M7IA 1L3IA 1G9XA 3Q3HA 2N46A 2CL7X 3BAFA 2VZ0A 3ZNQA 1A8HA 1JTVA 2D8AA 1Y9ZA 2OY0A 4M21A 4V2UA 3QX8A 3WZMA 5I7UA 3M89A 4PG5A 1L7OA 4E13A 1BFUA 2WW8A 1U0TA 3AILA 4F4IA 5HKBA 3GU3A 1YIDA 2HLDA 5DNEA 2FGJA 2Z1MA 5HS6A 3L6RA 2XB2A 2PS0A 2QX9A 2VQ6A 4PYLA 4Z8YA 1H0HA 2FDRA 4EW1A 2P2LA 4KV7A 1YH3A 5KYUB 1ONPA 4JWKA 3EBOA 4FBMA 5KNBA 4BVHA 4ETIA 4RKWA 2JANA 1T36A 1EEHA 3U3XA 3V8QA 4OX9B 2F7SA 3Q1KA 1QZTA 2I7XA 4RFSA 2FZCA 5IDVA 2HHAA 3ME5A 1V48A 1W4ZA 4GOJA 1PU2A 4RTNA 4EOGA 1OJLA 2CJXA 3NHSA 1FP1D 4WECA 1IG3A 2OSBA 3QKRB 1ICIA 1HZZC 2AYYA 2P2ZA 2QMHA 3PU6A 4TKUA 5AW0A 3LF1A 5JAPA 5AI4A 2WV9A 3GEGA 4UZSA 1H66A 4BHTA 3F2IA 1Z7EA 1QQ6A 2Z5FA 2ZTVA 1C14A 3H7IA 2DLNA 2CXTA 2Q29A 1YNSA 2ZAMA 4PX9A 4U7WA 2XXAA 1O96B 1AQUA 1QX4A 3F6YA 3GJXC 2KPOA 3K94A 4RACA 3NBUA 3IDOA 3UV7A 1Z6YA 2YN4A 3OX3A 1J70A 4CE6A 3K15A 3PQCA 2IC5A 4GICA 4REQB 1ZOPA 3FMOB 1FRVA 3PEUA 4CM3A 4QXRA 2NUAB 4FWIB 3ONFA 1KYIA 1ICEA 1L5FA 2D1YA 1JIXA 3DOIA 2H4HA 3N1UA 3O1JC 4NKRA 4ADSG 4ARZA 1XRQA 3INYA 3LYAA 5F5XA 5FQOA 1ZGGA 4W7SA 1EP3B 1IDOA 1YR3A 3ENKA 4L1KA 4Y6PA 3OFNA 5JMPA 3ESBA 2Y9PB 2BGUA 4F4DA 3KCQA 1Z6AA 3RVDA 1DWPA 3FRHA 3IAM1 4S1OA 1CXZA 4QQNA 2ZRMA 1KDVA 3RE1A 5ED4A 1EVEA 1ZH2A 2P5TB 3HWRA 4GXNA 3RAJA 4ZCLA 2O7QA 4G2TA 1IWPB 2OWEA 1N7JA 3R20A 2AOUB 4NXMB 2O14A 5AM0A 3QBTA 3O21A 1RQ7A 2NGRA 2WA1A 3VU9B 3SDBA 1P74A 2QRMA 2YZ7A 3Q9SA 1BXRA 1NXOA 2G76A 1T2AA 2QL9A 2BI4A 2WLTA 1WOYA 2Q6OA 3QKIA 4MX8A 4Y6QA 3VH2A 5I7AA 2DOKA 1VBKA 4BNJA 2NMVA 3ZGYA 2V74B 4QHYA 1Z6PA 3M5CA 2VYFA 3WRYA 1CQXA 2ID4A 1RYZA 3JS5A 3MJSA 1XMOB 2QZPA 1YR1A 4F86A 2QSUA 5KQRA 4LYJA 2WSBA 4FDTA 1W5BA 4WBSA 3PQ6A 4J0GA 2VDLB 3H4VA 1EQAA 4HRVA 4LV6A 2UZ4A 2D6FA 2IZ0A 5I45A 3Q3IA 3HB9A 2OPBA 2VL7A 1KU6A 1HDYA 1S4QA 3BBLA 4DARA 1HDXA 4R3UC 1QGOA 1CS4C 3L40A 2IXDA 1GG8A 2QTNA 4DNXA 1HR0B 1E3JA 1KL7A 2PJUA 1VECA 3E03A 1PGPA 13PKA 1GDDA 3CRVA 4MQUA 3O92A 1W5AA 4NZ9A 3W7VA 1X1QA 1KK3A 4R84A 4B2YA 1ABBA 2OMKA 4X85A 3HO6A 3JTEA 4EVRA 2PRZA 1YFLA 1SVIA 1TZMA 2XODA 1EK5A 4H1UA 2DBYA 4PC3A 2FYTA 2GOYA 1XEAA 1L7RA 2AZ4A 2GBLC 4QQKA 3DZGA 2XQJA 3DAPA 4DV5B 1HETA 2GTPA 5A3JA 4HEA6 3K92A 1Y9DA 1JMKC 4DLNA 4Q4JA 4UUBA 4JBWA 2B30A 1DELA 5JXJA 4ZI5A 3K7EA 3GYBA 1XVIA 3GEEA 1BD3A 3SC4A 2M1XA 3L6OO 2CNWA 1TDJA 3H0KA 3IAS6 3OFSA 4FT4A 3QLJA 1H1TA 3NWJA 4RK4A 5BR8B 4Z7NB 1RZVA 3P9KA 4TWAA 5K6AC 2VZEA 4E15A 1U7DA 4BGDA 1DBVO 1L4HA 1P0FA 1Z8DA 2V3VA 3A9SA 3D4PA 3KZ1E 3QYFA 1VZ2A 3L02A 4HN2A 1CQZA 2BGWA 3WK7A 3RVMA 3N2NA 3BZUA 3HN2A 3OQVA 4ROTA 2A59A 3KL4A 1WEHA 3KSMA 4UUAA 1D6MA 1P7WA 1ZMRA 4H1VA 4KLRA 3H5NA 1P3JA 3D0OA 4P3XA 3I42A 4TQGA 4G8JA 1UKYA 3E82A 5CXSA 4WVLA 1T1GA 1W49A 4EUHA 3AR4A 4JJ7A 2YXLA 1MHTA 4KSYA 1TVKB 1SZPA 2K7ZA 1Z45A 2JLRA 5SZIA 2GZ1A 1TECE 4DEXA 2NO5A 1AUPA 4KLAA 3ORSA 4HC4A 4DSNA 1WX1A 3E9RA 4X63A 1RNLA 4OOEA 4ZT4A 4FSHA 3ZOZA 2PKWA 2JVKA 2NWQA 3NS7A 4FJ2A 2ZIUB 4UQLA 4PC7A 3CLVA 1E1RA 2UYHA 2Q2QA 1PW7A 1YASA 3WNDA 1KRWA 1WB6A 2IXEA 3KEGA 3WKCA 1LKZA 2R85A 4LJ4A 2BDUA 3I8XA 3WL7A 2O2YA 2A78A 1DX6A 4YO7A 5KWIA 1ZC4A 4WNAA 3NHLA 3QP9A 2AI3A 2QTTA 2JGNA 3HDTA 2VSQA 1ZCBA 4RA9B 4WNCA 2VYVA 4DM7A 2RGUA 3IUEA 4HLDA 4WZ6A 3SC2A 5C35A 1E62A 1JFFA 3HJHA 4WCDA 2F4NA 4CT4B 2X1LA 5E6UA 3DDWA 3EOBI 3RC3A 1JMYA 2XNHA 2EW8A 4N49A 4WKPA 1N75A 2Q46A 3LX6A 1I2MA 4AULA 3QTLA 1IOZA 4J49A 4KVFA 1Y7LA 3QUSA 3ZLUA 2IBSA 2VRWA 3SXPA 1NQOA 1YBFA 4UEKA 2QW1A 1RLMA 2ZB3A 2Z4TA 4BLQA 5ICEA 1L4KA 1UFQA 3PF8A 4IEEA 3N8IA 3HS3A 3RIYA 1PR5A 3PNMA 4LISA 4CGZA 4G0XA 2O3UA 3MTBA 2BH9A 2ZRIA 4M1TA 1E77A 2J5KA 4NECA 4NNJA 1WB5A 4QG7A 4CDGA 1QO9A 1XZAA 2X7JA 2QZ4A 4X24A 3RODA 2PX8A 2B7CA 5HQTA 5IWCA 1FP6A 4PO9A 3C43A 1KP3A 1DQYA 1JEDA 4CF4A 5M29A 4B6QA 2HMUA 5ER9A 1RE1A 3TX2A 1RLUA 1XU7A 1Q2XA 1U2TA 2VXBA 3DTNA 2PQ2A 3V1YA 4BNFA 1Z5NA 4W7IA 5K6RA 2IPXA 2Q2WA 1I01A 2Z2JA 2VQDA 2XNSA 4LK2A 2OUIA 5IW8A 5IMSA 1RC8A 4TTTS 1VRCA 4DMKA 1FSSA 3IP9A 3CUWA 5BO5A 2HMAA 3TLAA 2HBYA 3GD7A 4GZLA 5DULA 5JFGA 2O2ZA 3FLBA 4GLFA 3T3NA 1INLA 1TZKA 3NHFA 4FYJA 1KP9A 1C7RA 4YPVA 3K2IA 1USGA 3IKLA 3UMRA 4Q02A 1OWPA 4R2WA 3JYLA 2J0UA 2FOXA 2PS3A 5JHHB 1AMUA 1ZSYA 1P6XA 1BD4A 1ZAKA 1OAOC 4OYYA 4BMNA 1M76A 1K5PA 3TOXA 4ZGGA 3KQYA 4M6WB 3W5DA 3BX1A 2EW2A 1D2EA 1GAEO 1WNFA 2FN3A 2Q8NA 2GGSA 3RKRA 4BO7A 4Y0AA 3WMXA 4KAXA 3WL5A 5LUBA 3UWMA 2W48A 1FIUA 4C78A 5HIJA 5AH0A 5JJKA 2XDQB 3Q3GE 4UAUA 4GXRA 2XYVA 3EGWA 3K2EA 4HFNA 2VNHA 4GP7A 4IM7A 4CCSA 5FTKA 1KSHA 1KEVA 4A5OA 4G5YA 2HIMA 1A2BA 1J9ZA 3U3DA 2VHXA 4KXWA 3VUEA 5A6SA 1RI5A 3QTTA 2FPXA 3ORFA 4TT8A 2A8YA 3A1NA 4FJ1A 4FLFA 2B2CA 2G07A 3WLKX 2PUJA 1BQ4A 2R6GA 2WIKA 7REQA 1QQTA 1NC1A 2QUBA 2YHUA 3IAHA 4MP6A 4W82A 4GQAA 5FBKA 4EYSA 5EKTA 3GFQA 2FG7C 4GYYA 3SHTA 5KPDA 1RQ2A 1JLHA 3CZ5A 4Q12A 3WNCA 4D9KA 1E66A 4HUJA 4P4UA 3RRMA 4FD2A 2EWWA 5A7HA 2O2HA 1XLVA 5ES4B 5KO2A 4ZZ3A 1Q1ZA 5A02A 1YFJA 4LDQA 4WLEA 5E2BA 5FADA 3K8YA 2SKEA 1U7OA 1EDDA 1TXGA 2NPFA 3TZHA 1OIWA 1TI7A 2R5WA 3EC2A 4RD6A 4A0HA 4JOSA 2OHOA 4HBGA 4IFBA 2TSYB 5DM2A 4P86A 3OO1A 2WE7A 2IYLD 3CURA 1Z4MA 1BXGB 2QTFA 4TLCA 4UXJA 4YJHA 1NC3A 1NAHA 1E1CB 3DM9B 4BB6A 2DUWA 1YT5A 2WF7A 1RWOA 4CT0A 4F12A 2A3RA 4LI3X 3FJ1A 2YR0A 2O8NA 1AT1A 2BTEA 5A0TA 2I5PO 4GPBA 3D81A 4FFWA 4AW9A 2GFIA 5CH8A 1IOLA 1L7DA 2QJOA 3AJRA 3D54D 4Q47A 5IVHA 3A4LA 3OLWA 5DDIP 4JMLA 3EXAA 4B75A 3B3FA 3CWQA 1I6WA 2VRCD 4MUXA 3ZBPA 1MABA 4Z4CA 5IKXA 2C2YA 5DV9A 4DDVA 5DM70 2RJNA 3UW3A 2AJ8A 2OO7A 4BVKA 3I23A 4CL2A 1U8ZA 4XJTA 1ECCA 1Z47A 5DGCA 4PFSA 3PIIA 3NVKI 3UO8B 1BIFA 2H4XA 5EJ8A 5BSGA 3H5VA 3ROFA 1MT3A 3IEXA 4TMFA 3L8FA 4LHVA 4CU2A 2GPNA 4I3GA 4QODA 5KNBH 3PXAA 4XTRA 1YZ3A 5TT1A 2BMEA 4NOMA 3RVOA 5FI5A 2I3AA 2YNMD 2BHSA 4HGNA 3ODPA 5GPBA 3JR7A 2I6SA 5CLHA 1MDBA 1N2JA 2ZT6A 3GD5A 4BV8A 3DE2X 3HV0A 5JRDS 4COOA 3IQEA 2V3WA 1YS7A 1M6WA 2O7SA 3D3WA 4QLAA 1KERA 5JZ9A 1T5TA 2C04A 3PFHA 1ZHFA 3I9KA 2X1MA 3CA8A 4JUAA 5B2ZA 3AF2A 5B12A 1J8YF 2R7MA 5GONA 3T99A 3SY8A 2JG3A 1E3EA 1L6IA 1WP4A 4KMRA 1O5OA 2OG1A 3I52A 3R7FA 2FMXA 2FXIA 3VU0A 3ZD9A 5LWQA 1G3IA 2GEDA 4UDOA 3CF4A 1OQAA 2WV7A 4A15A 2GM5A 2XTAA 4LMAA 4N03A 3ZY2A 2E6KA 4W1SA 4Y6RA 4DMGA 1ESZA 1F6BA 3M6LA 1EUZA 4PLGA 2OO5C 4C2AA 4DG5A 4E5YA 4GPAA 3FB1A 3JQ9C 4V0RA 1YR2A 2D1SA 4ZICA 3LT5A 5FOQA 2OLKA 5ERXA 4U2FA 5ALFA 5ALNA 3FBWA 1IDN1 1AA9A 1P44A 2OCKA 4A1FA 5CCXA 2J48A 2PIDA 2P5UA 3Q0IA 2FI1A 4ZC8A 4JQCA 1SC4A 3AY3A 1YDGA 2JGMA 3RHSA 3SQWA 2YFHA 3WI7A 1QVRA 2IF0A 3R0JA 3WIBA 3SX2A 3ZQKA 4WA7A 3W6UA 4TMKA 2WF5A 3I6YA 2QRKA 3MPUA 5AMXA 1SIUA 2BWJA 1TT7A 3PDUA 2G4CA 4ZOLF 2A1TR 3KOWA 4N39A 4B2IA 3P9PA 1Y1LA 3MTDA 4KN9S 1P2GA 4LXHA 1YMVA 2Y2UA 2BELA 3F78A 3BFKA 4WJZA 3SE7A 4CETA 1AMOA 3T6KA 4P0QB 4ROSA 2JI6A 1TO1E 4KR2A 3P27A 5B6IA 2KWIA 1XELA 5FV7A 1W2WB 2AUTA 2BCJQ 2FZGA 4H77A 4OGKA 3QFFA 3O3MB 1GKUB 1B42A 6PFKA 1Z5GA 1Y3CE 1JWBB 4AXBA 4TQUS 1S8NA 3SJZA 2Q3HA 2YRFA 2ASEA 3K1JA 3OCZA 5EJAA 1QIHA 3NPAA 2PD3A 2OZKA 3IP1A 1IM5A 1HDEA 1NVTA 3OHPA 5CGQB 5KUTA 1ZK4A 4HXGA 1AS3A 2V4MA 2J67A 3FLAA 3PQ4A 3NORA 1NRWA 2V0CA 2ZSKA 4Z4QA 3TAUA 1L8LA 4PG7A 1ZGAA 3T7EA 2BI7A 3K0SA 2QQEA 2H5LA 4Q37A 4WCVA 5KHLB 5I8ZA 5DBHX 1AX9A 4B80A 2ZJ2A 1DU4A 4I1VA 5KZMB 2CE2X 2DWPA 1TKRA 2A0XA 3QY9A 2W2XA 3PGMA 4KO4S 5AWFC 5K0EA 3EGCA 4RVOA 3ZR4B 2E4XA 3ZOKA 4FEAA 2UZIR 4NBTA 4PWZA 4BWVA 5L6MB 1PNRA 4IIHA 3A2MA 3IEPA 4LFBB 1KQ3A 4U2GA 3QW4B 3UMYA 3R7WB 1T5SA 4KYUA 4KV9A 1SXHA 2VP2A 1S2GA 3N9IA 4KACA 3IQIX 2AD1A 1IN5A 3S1LA 4MQ6A 3W5SA 4LYDA 1SGWA 1L5WA 1UQRA 3A05A 3OOEA 1EE9A 2A9JA 721PA 3BIFA 1Q17A 3OPNA 3VO8A 3OTGA 4FI3F 2CXRA 5CW1A 5EERA 3VOBA 2EAUA 1I1NA 4N4AA 4AZ0A 4BLOA 5KYWA 3L7CA 5J9FA 1JDBC 2UYYA 4QEKA 1Z0DA 3PHCA 4DN6A 4DV7B 1GNRA 2FUNB 1RTTA 5DU2A 4CL0A 1KS2A 1WEKA 1DG9A 1YR8A 2XQGA 2X2PA 4RA6B 3WYNA 3W90A 2EJWA 3CVJA 4KQFA 1CJTC 4BQSA 3NQ41 3PR1A 2OXTA 1MB4A 5CURA 3E70C 4BKQA 4DDKA 3FZYA 5GP1A 4YLGA 2PA3A 1KPGA 4WKBA 2WD7B 1KE1A 2DPGA 1XTSA 4GFDA 4P7KA 2CF5A 3C3CA 1PYDA 3NEJA 2EFYA 1S2DA 2O5RA 2GF0A 4G5RA 1YRHA 4HDOB 1SWWA 1PR6A 2BHLA 3CR8A 4HMQA 4L9RA 1OH5A 1PZFA 5A3QA 4IDGA 4BMZA 4J0EA 4C4PA 4O6VA 1ZJ4A 3G9TA 3INNA 1BEZA 1LI5A 2BFEB 1PFWA 3HWSA 3IVGA 1A7AA 4D4KA 5C3MA 9ATCA 3TSCA 5K8JB 1G38A 1QQAA 4GDFA 1BRTA 4PIPA 1JL3A 4EPYA 2CWDA 5AIBA 2C42A 4F45A 4G4GA 4CLHA 4F6LA 3NTVA 1HNNA 1RQGA 4NXNB 5H70A 4HDSB 3TR0A 3M1YA 1PJQA 1UM8A 4AECA 5KNDD 4RVGA 1H2RS 1I3CA 3BGWA 1Y7TA 1RIFA 2VRCA 1CQIB 4K1LA 2C99A 2QLTA 5T4BA 4OQMA 1PIWA 2ECKA 4RF4A 3HB1A 2ADMA 1JHQA 3W2HA 5CEFA 1JH8A 2J59A 1KGDA 3OVMA 3JWEA 5BVGB 1QWOA 2C97A 3ZH9B 1ZVQA 1BJKA 1T9CA 1CFJA 4BU0A 3HJUA 4B71A 1OLSB 1T3ZA 5BSHA 1KZ4A 4M9SA 1OLUB 1QANA 4AZSA 4JYPA 4PTLA 2K87A 2AFIB 1R0BA 4CKYA 3UTDA 4DMCA 1T5IA 3FTPA 3I1IA 2YNMA 3AB3A 3FKQA 3IB3A 3IIIA 1M67A 1X13A 4NYIQ 4QYWA 5DX0A 5TVGA 2HD4A 3OSUA 5CA1A 1BEUB 1U2SA 3A25A 1P0MA 3JATB 3SYRA 1GUFA 3G5LA 4CMHA 3BXXA 3WP1B 2G80A 3I9LA 3L1KA 5KTKA 2GBPA 3W5BA 2EATA 2OD9A 1XPJA 4W5JA 4XOUA 1TVCA 2FY8A 1CEXA 1JX6A 3HDGA 3NFRA 2H1VA 1M75A 2VZ9A 2EF1A 4JNCA 4L0MA 2GJ4A 4KTVE 4B4UA 4CIYA 4RGBA 2V6IA 4L3OA 3VC7A 5C7YA 3DBHB 1JPJA 3C4JA 2O3QA 2C1ZA 3GFOA 4J43A 4MA0A 4MHTA 3N2LA 3LNTA 3QPDA 1M0TA 4LXYA 4PZZA 2INGX 3TPZA 3JRWA 4FFMA 1Z0AA 2Q6LA 3L6BA 2Q3JA 3I2GA 5AJVB 3WV4A 4DA9A 3ADKA 3GPBA 3DV9A 2QU7A 1SELA 3OA2A 3OM0A 3QQ5A 3QPAA 1WSDA 1YBHA 2QK4A 1CZKA 1ONNA 4PSCA 3T1TA 1AGNA 3RSOA 3IEKA 2PTGA 3A6DA 4CKBA 5A03A 2C77A 2EWVA 3OPYI 3SWWA 3KD2A 2AX3A 2WZDA 5GONF 2NSHA 5TPWB 4YRKA 3WMRA 3DO5A 1FW6A 3HXPA 1ZL0A 1U0LA 3KAPA 1TUBA 2GAFA 3M3DA 1R9JA 2IYSA 2Y27A 4EAAA 5DEIA 1C0EA 2H2IA 2IYWA 1NE7A 2RHOA 3VGPA 4D44A 1ZIOA 4S3MA 3UOGA 1U3CA 5BSVA 4PE5B 4PR0A 4XFDA 4G5SA 4Y6SA 2N75A 3HXQA 5L3QB 1G60A 1IL0A 5COAA 3GZNA 4F21A 4KQ2A 2WKRA 2X4DA 1E5QA 1IY8A 1WV0A 1NWCA 1LFDB 3UAOA 4CG3A 4JROA 1QHSA 4Z7OB 4PZ0A 1A82A 3L0CA 2QVGA 3VJKA 1Z8NA 1ZW1A 1T0BA 2ZI4A 4RMIA 1K2WA 3ZX4A 3N2YA 3OKFA 1FDSA 4ZP1A 1HDRA 2JFUA 4B9AA 5C3UA 1VMKA 3GG9A 1WXWA 2ZIAA 3AERA 4ZO6A 5LQAA 4MUFA 3HXKA 4MVJD 2FN9A 5CHYA 1P7ZA 2I8LA 5T8KA 1VDMA 4I9GA 3ROTA 5KQGA 1DMRA 3TQRA 1AHNA 2R97A 4M98A 3NJ4A 3COVA 5AXAA 5HF5A 3T7CA 3DL2A 2BUCA 3TI9A 3FUXA 1RWMA 3ONDA 2QLLA 1W2HA 3IDQA 2F1KA 2HWWA 3I0ZA 3JQDA 4QM6A 3AP3A 2OL4A 2H1CA 1QGYA 1WHTB 2PDAA 1I4OA 3DKPA 5E7JA 1KIAA 4MP8A 3UENA 3V00A 1JWAB 1E6CA 2MDTA 4CIDA 4GP6A 1YSCA 5EGSA 1KZ7B 1N1EA 4FHZA 4PQRA 4YRDA 3CF0A 5ILOA 4J7XA 4QTYA 1QYIA 5SY9A 1ZR4A 2HLNA 4O4LA 5GTDA 4PO3X 4QU9A 3MLBA 1B15A 2MINA 3TW0A 1X7XB 1OXBB 3NTOA 5D85A 3EUEA 2PMCA 2VPXA 2YRXA 4IDPA 4JT2A 3FF1A 2EJCA 2XMCA 5FLYA 4RZSA 3ZDQA 1XP8A 5HM6A 4NF2A 1SAYA 1H4QA 2V9ZA 4KJZA 5JY1A 4YMSA 1Y3IA 3UUFA 1E9EA 2PH3A 2Q0QA 3P5SA 1KEWA 4BNXA 1AC5A 3K5WA 3UTCA 4E32A 1RBZA 1IONA 1DJMA 4I1YA 3GLIB 1X15A 4BB0A 4ZTZB 1H1DA 4QJBA 4EUNA 1BAPA 3H97A 3JSAA 6REQA 1KETA 3BK7A 2JH8A 1E2UA 1BE8A 4LGYA 4G5GA 1Y9EA 2GBGA 2CNOA 3AUSA 4RKQA 4KFTA 4TS3A 5DFAA 5GZ1A 5G2OA 5K3SA 4Q7LA 1SQFA 4I55A 1JBKA 4WIAA 2FF5A 4L74A 1NM5C 5LR6A 2D00A 4DLWA 4G0UA 4YAKA 3Q7SA 2ATEA 2B5OA 2EX4A 4RSGA 1XUOA 4TLBA 2C20A 2NTJA 3WO1A 3LCUA 4EUKA 4Q3BA 4IJUA 2SCUB 1WHSA 3LO8A 2QPOA 1LVUA 1VG9B 3H5TA 5JH7F 4LEIA 1OU4A 1ZIDA 2V54A 3Q7TA 5DJ5A 1DC5A 3DW3X 3ZHOA 2DBZA 1Q3TA 3QG1A 1E1YA 3PBKA 4K40A 3W8NA 3JALA 2NLOA 1FSFA 3QXXA 4PVDA 3TBKA 4CVNA 4FGSA 1Z7YA 3JYQA 1EJ6A 4FFNA 1EGQA 4IJMA 3ROEA 3C6XA 3MINA 5JYDA 1XMPA 2FSSA 1SCUA 3FHCB 4YROA 1CUWA 1MVLA 3H42B 1VJTA 4RF3A 1J1ZA 1XJQA 4EA8A 2XA1A 4XDYA 3RRNA 3QWIA 3EHEA 1WPQA 1WY5A 4TOIA 2R1VA 4Z0PA 2WWTA 1GZ5A 2GHIA 3EEYA 4ZQGA 1PN3A 5ALGA 4CMBA 1KWGA 1C0KA 4E4YA 4INOA 2NTNA 1P6UA 3DHWC 2GVNA 2FW7A 5DBEX 4CMJA 2Q3BA 3G9QA 3GEPA 2PLRA 2BHNA 4FR0A 4JBYA 5DGIA 5KNDA 1RHQA 2R86A 4X1IA 1EKXA 1KEEB 4YJFA 4RPHA 2BSAA 2VZLA 4LJ9A 4BX0A 1W88A 4ZN6A 1XCOA 5CRIA 2OZVA 4KNVA 1P2FA 1QPGA 3HJCA 1QP0A 3DW1X 3KBOA 5F1PA 1P75A 3DMYA 4XSHA 2EVWX 1Z5ZA 3CX4A 2Y0EA 4BNNA 3H9JA 2BGKA 3IBSA 2NU7A 4XYBA 3UHAA 2DQ4A 5H16A 3TPCA 5CYGA 4D4IA 1P1HA 4DCMA 5K0NA 3NX4A 2UVQA 4J0JA 2WJJA 1K8RA 3FSRA 1O5IA 4LSZA 3HVUA 5LZ5A 3WX0A 2QX8A 4LS3A 4MDFA 3EXHC 3K9QO 1E0SA 5JCZA 1OREA 4WNYA 2VJCA 3K4PA 1XQ9A