3QENA

S74e dck in complex with 5-bromodeoxycytidine and udp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
236
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 236
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qenA00
2VO1A 3W5JA 2XX3A 4GMDA 4C4PA 2NPIA 2ZJAA 5EZ6B 4OKSA 2HCJB 3DMDA 5DISB 4JLKA 2V3CC 1EESA 2GRJA 4KFTA 4H9GA 4X8OA 4OQMA 3G82C 1RRFA 4OQNA 3W34A 3WP1B 4DEYA 1S96A 5JEEA 2OV2A 2IUUA 4Q1BA 1CS4C 5TXGA 1W46A 2WAYA 1E2DA 1AA9A 4DLSA 4Q1EA 3FFAA 3BS4A 4Q21A 4PHGA 3U3JA 4XJXA 4F93B 1GWNA 3ADCA 2C95A 3CNLA 2CCKA 2FNAA 2NG1A 4KFUA 4RD2A 1RVDA 1XD9A 1N6RA 1Z0DA 4AY2A 5GJCA 2C8VA 4M1SA 4CT5A 2P6RA 3EZ6A 3KKOA 4LBVA 4JT2A 4HSEA 2VP9A 4B3GA 5SZIA 1IONA 3BC1A 2AKYA 3HPRA 4WXPA 3PENA 4PPGA 4LC0A 2ZRIA 1UBEA 3VKWA 4BFVA 3UWKA 4V0OA 3MUFA 4OI4A 1OE0A 1WF3A 2WV9A 3EZ7A 4MKGA 4DCTA 3TUZC 4A92A 1KMQA 1FP7A 4KITB 2YINC 3VKHA 3AKYA 4Q1AA 5C2JB 4Z1MA 1LW7A 2G77B 4HLCA 3GEHA 2FG5A 1CJTC 3PG5A 4URZR 1GNRA 3CW2A 5KUTA 1ZM2A 1E2FA 1Z6XA 2SHKA 3WNBA 3B1VA 3AVVA 5JSZA 1OFUX 2QMEA 4Q4AB 1L7VC 2C9YA 2YNMA 2YOFA 4QRHA 1W4AA 4TL7A 3OF5A 2VHQA 1N25A 3H4MA 4EQ6A 4ERNA 1XPOA 3W8NA 1N5IA 4EDHA 1JEDA 3Q5DA 4US0R 2JLSA 1W2GA 2RGGA 4DCSA 5JHHB 2GXUA 3LRPA 5TY0A 3BGWA 2QY9A 2VTKA 4PHTA 3SEAA 4KVGA 4R98A 4US1R 5K8UA 2RH5A 2O8CB 5F9FA 2VHTA 1Z07A 3LY5A 1E0JA 3E5HA 3LX5A 3IEVA 3MLEA 1HT1E 3OAAA 3BFKA 2ZJOA 3OE7D 1KIMA 3B7GA 1X8JA 2OEPA 1CJUC 4PXAA 4R9UC 4EAQA 1FTSA 1X6VA 4LPKA 4HZIA 4XD7A 1PVOA 2WMOB 3CX7A 3TVTA 4NKRA 4DIEA 2FDCA 2X19A 4D80A 3PUVA 4QHSA 1F2TB 4JVMA 1E1QD 2RHDA 4JL6A 4EUNA 1CRPA 2ZI4A 1KMHA 3SS8A 2CHQA 2HDNB 3VKGA 1N6PA 2GESA 3Q72A 2J5XA 3ZD6A 2WWFA 3M0EA 1LF5A 5JI2E 2IYXA 3IBGA 2F1HA 1NVWQ 2PZEA 3NBYC 1QHSA 4CF7A 2FZLA 2J0VA 2FZ4A 2ZI9A 4US2R 1DAHA 1QVAA 4AKEA 3C7KA 1MO5A 1IAQA 3CH5A 1ONBA 1F6BA 1NBME 4WZ6A 1G17A 2HYIC 1UBCA 1CF4A 1Z2CA 1UDWA 1IJEA 3B13B 4Q4AA 2XTZA 5FBRB 3Q85A 3R7WA 1KI3A 1YZGA 4QFMA 4AWXA 4EPVA 5EXPA 4A0HA 2L0XA 1FNMA 1ZD8A 3A1SA 4IRUB 2YYZA 3THOA 3IGFA 1G7TA 3EA0A 3ZD7A 2OG2A 3AEZA 5JS8A 5CLLA 4QJ5A 4BLSA 3UPUA 2BMDA 1UDXA 3VR3A 3R20A 1JAHA 3B78A 2CCGA 3DKVA 1VHTA 2JJ1A 4B6EA 4BASA 2GJ8A 2X1VA 1P9NA 2O8CA 6Q21A 2A30A 2JLWA 4AI6A 4GZMA 5EP3A 4W9MC 1CULC 2J0UB 2IEYA 3A6PC 2XOKD 3GJ5A 4XVRA 4IHQA 1U2RA 1FUUA 4FCWA 4LYJA 3SJZA 4D0GA 3QKRA 4ZCMA 2QQ0A 2W0SA 3L0SA 2ZVQX 1S3SA 3EARA 2Z6VA 3AH8A 2OT3B 4IVPA 5JBQA 4ZDWA 4FCVA 2ZUCA 3NKVA 1G64A 5JJIA 4JYCA 4S35A 4E09A 1Q3TA 2O5VA 2DWOA 4TTPA 3FHOA 4XSHA 1T8TA 2EFGA 3ETLA 4EFMA 3JVUA 1G3RA 2ZUBA 3W3AA 2QG6A 1MOZA 2ODWA 2PJZA 3RRYA 5B64A 5FBVB 1DEKA 2WIAA 3DPUA 2IX3A 4N1AA 1P72A 2ZVPX 1KHTA 1OXXK 4XWOA 3X1DA 1OB2A 2TMKA 3VHLB 2FGJA 1E9RA 3ZS9A 3NEJA 2MSDB 3GJ3A 5J40A 5HE9A 3WRXC 4A2PA 4JIMA 1XTJA 2EFDB 1HYQA 1EFCA 4FWIB 2HT1A 1EG7A 2IYSA 3OZXA 4A0FA 4A8JA 2R6AA 4TYYA 5FL3A 2WOJA 1FOEB 4QGFA 4Q4HA 1TU4A 1OLOA 3QVUA 3WNDA 3H2YA 4EPWA 2ZETA 2QUZA 4ACBA 2ZI7A 1NVUQ 2J0UA 4TMTA 3A8TA 4RFSA 4ASUA 3AM1A 3TKLA 1NN0A 1M6NA 3QF4B 3L0OA 4UXIA 4K81B 4EPTA 4DVGA 3BXZA 3U44A 4KHZA 4X8LA 1MABB 2R62A 1GUAA 5IRCD 2WKQA 2GVZC 2D7CA 5AJYA 1AZSC 4TQUS 1NBMD 2FE4A 3U3KA 3X2SA 2GVDC 1R8QA 5FPYA 2IHBA 4TL6A 1UM8A 1KAGA 3MJHA 4MYUA 1Z0KA 2CBZA 3VFDA 1MV5A 3U5ZB 1QRAA 3D8BA 4JT4A 4M9QA 3TAUA 3ZZ0A 2G0TA 3TVDA 1R0XA 5EQTA 2K5UA 1JR3A 1S1MA 4Z51A 4LC1A 1BYIA 1DAMA 2RKOA 3AF2A 1YU9A 5DO9A 3R8CA 4UJ3A 1YHNA 3LBNA 1HA3A 3LQRA 3UXMA 4B76A 1VIAA 2GHIA 1OHHA 2C98A 5GJWC 5EP4A 5EXSA 4IW3B 3A4NA 5IF9A 1E94E 4QGHA 3EX7C 1ZIOA 2WJHA 2A5DA 4QHTA 2BC9A 1OXUA 4IFBA 2HXYA 4QNRA 2QE7A 3SHWA 2GAAA 2NZJA 1SVKA 1E9CA 2P3SA 5KPDA 2IS1A 2BEKA 1BKDR 2BV3A 2NMVA 3CX6A 2OCAA 5FOVA 4BGDA 3AV0B 3FMIA 1DBSA 1Z3IX 3T34A 3VU9B 1NMYA 2PLFA 5JWOA 5KDOA 4LCBA 3UMSA 3CR7A 2WPDA 3C16C 2ZYVX 2WICA 4MDFA 2QM7A 2EVWX 4XH9B 2GBLC 1RFLA 4XIGS 2A5GA 3GJ4A 1QHIA 3PUWA 1NI3A 3VR5A 1OH8A 2Z83A 1U9IA 3L8ZA 3AF3A 4ITRC 3RWMB 3EXAA 1N5LA 4FMCB 2ZU6A 4DDVA 2CCJA 1WBBA 5DI9A 1G9XA 3D31A 4LJ8A 4HUQA 2OM2A 3FPAA 5FUWA 4LJ5A 1IXRC 3BWDD 1ZBDA 2ZRHA 2QMOA 4D81A 5IDVA 5LBIA 5AK0A 1LVGA 3TJZA 4JLPA 3VR1A 4DB2A 1QHHB 1ZP6A 1MO3A 2O8BA 1YZNA 3L8YA 2ZSDA 1XFAA 3KUCA 1G6OA 2NO9A 3KXLA 1P75A 2KWIA 4MUBA 4RFVA 1JJ7A 1TQDA 1E6CA 1BS1A 4K8OA 2NO0A 1UEIA 3BB4A 2G0NA 2OLJA 3CPJB 1YRAA 2VSXA 3IHLA 3GEEA 1R10A 3DM5A 4QGAA 1GILA 2O8DB 1EWRA 4MQBA 4B73A 4A0GA 4YQFA 3A58B 3GJ8A 5JECA 2W58A 4AG6A 2X2FA 1ESNA 2IYYA 4UNQA 5EP2A 4Q18A 2DHRA 3QXXA 2JLUA 4AK9A 3C5CA 5B30A 5EXXA 3EPJA 4DLUA 2DYKA 3CO5A 3VU9A 1HTWA 4B33A 2W6JA 5EE0A 3AVWA 3HR8A 1J90A 4A36A 1JR6A 1KI9A 1SXJD 1AS0A 3AP1A 3WRYC 2AFIE 4RCZA 4RD6A 3FFBA 5TARA 1ZAKA 1E2JA 4AKIA 4LHYA 5C4MA 1E2QA 2B8WA 3MAAC 4PO8A 1ZU5A 4HLUC 4R2IA 3AVUA 2NIPA 3TRFA 4TLCA 2CMKA 2BBOA 3NBXX 4V0NA 2BBTA 1D5CA 1GTVA 4D4MA 4B3XA 2ZRNA 4M1TA 1TADA 4A6PA 4X8HA 2DWPA 3AUXA 1ZC3A 3DDCA 3EASA 3UMRA 4Z1MD 3MMPA 3BERA 4EJSA 2J1LA 1IY0A 2FPKA 1JALA 4L4UA 2AL7A 4BUJA 3QUSA 2ZE6A 4UNSA 1HH4A 4BLPA 2ZSEA 5CK5A 2ZREA 3KQNA 3AQ4A 2GWHA 2PLRA 4O25A 5FTMA 5E7MA 4OHZA 3U3RA 3D6TB 2VA8A 2ZYTX 2ZS7A 4P31A 3QENA 2IF2A 1T0JB 1XTSA 2C5LA 2FFBA 3WYGA 1VPLA 5FTNA 2Z0MA 2EFCB 1OXSC 3T5DA 1R5BA 4BRUA 1E1QA 4HAXA 3K9GA 3FOZA 2PT5A 1SVSA 1VMAA 4NYMQ 3ZLJA 2AD1A 3GJ6A 1UBFA 2CVHA 2QAGB 4O2RA 621PA 2WWHA 1SVOA 2VSFA 3RSOA 4ZCLA 1IXZA 1GIAA 5BN3A 4IFEA 1T3HA 3SBEA 1LFDB 3BH6A 1WA5A 3UG7A 1DPFA 4EKDA 4P4SB 2W0MA 4RSGA 4F4CA 1CRQA 2WJJA 4AYWA 1Q12A 2ZRMA 4JL5A 4MYTA 1VG8A 1YZQA 5CM9C 3LVRE 1ZM9A 5GVRA 4B3BA 2E9SA 3KL4A 1US8A 5TB5A 1XJ0A 1RPZA 4PFSA 3U4QA 3PEWA 4OHWA 2O8FB 5B2ZA 4Q02A 2NO7A 2Q0HA 1P2UA 1OW3B 2PMKA 1KO7A 1TUIA 2R6CA 1WRBA 2QU8A 4JLOA 3T06B 4HATA 3RSLA 1KSHA 4TYNA 2XOKA 3TQFA 3KZ1E 5C4GB 5H8WA 2X2EA 2AWOA 5KOYA 2HYDA 1F2UB 1JR3E 3DVLA 4J0QA 4QKQA 3DO6A 2CXXA 4DLYA 1LY1A 4D2IA 3LO5A 1O3YA 1IN5A 3CNNA 3WYFA 3ADDA 1ELOA 1E96A 5DGXA 1NJGA 2GXAA 4YC7A 2QAGA 1Z5ZA 2QGNA 3OIYA 5J5CA 3UMFA 2NO6A 2OBNA 4C2UA 2OBMA 1F3OA 3UG6A 4MH0R 1G16A 4D4KA 1A2BA 1OXTA 2AD5A 1PLJA 2EFHB 4R7ZA 2DFKB 4C7OA 4UQOA 2GJSA 2C9CA 3I62A 2CE2X 1VCOA 2QTVB 4Q9IA 3ZQJA 3DEFA 2EYQA 2NQ2C 2G3YA 4KVAA 4MKFA 5EE9A 4BFUA 1NNEA 4JMPA 2B8TA 2V6JA 4DSNA 3EIQA 3MSXA 3DM9B 2CJWA 2ZSBA 1M2OB 2HF9A 2CLDX 3RS4A 1I2MA 3GJ7A 2IUTA 4HZUA 3QXJA 3KUDA 1ZC4A 4HAVA 2YOGA 2WWXA 4CZ2A 2VPPA 3U3OA 2C77A 1R0YA 1GRNA 1BYUA 3CRRA 4JKIA 4NH0A 1NN3A 1KI6B 4PSVA 1DAEA 5EP1A 4URXR 4L9WA 2C96A 1NKTA 4LJ4A 4L9SA 4JLNA 4BZQA 4BZXA 1XF9A 2REBA 2BDTA 3H0KA 1QG2A 3FB4A 4PC1A 4KFSA 4B43A 1Z63A 3ZZUA 3K09A 2BMFA 5C1BA 5TVKA 2ZEJA 1KKLA 1L4YA 2JLRA 1KSGA 2GZHA 3VNVA 2FH5B 4LBYA 1RRPA 1XDBA 4BPBA 4U02A 2V6IA 3RS5A 3NTUA 2R8RA 2ZI5A 3NH6A 4CEHA 4MRPA 3RRNA 1FFHA 2QM8A 3QSYA 2QT0A 1T9HA 1NKSA 1C1YA 3MJRA 2GF0A 1KGDA 3OEHD 4D82A 2IS6A 2AFHE 4KSBA 1IN6A 1DARA 2XZLA 2F9LA 5JCZA 2GETA 2IYZA 3B1WA 3AVXA 2FEOA 3N70A 3IQXA 3Q7PA 4A82A 4TN1A 3SR0A 4DLVA 2WWIA 4Z8YA 4YMWA 5J47A 1G5TA 1XXHA 2Q3FA 2XNSA 1PZNA 1ZNWA 2EYUA 5G3ZA 4Q9KA 5HZHA 3W5IA 4A15A 1TEXA 4KLNA 3KTAA 3AF4A 2KBEA 1Z2AA 1JAIA 5DN6A 1RYFA 4GRAA 1YZTA 4Q1FA 4QNMA 2YVUA 3O47A 4LOAA 5CK4A 2VEDA 3NC1C 1BO6A 3I1FA 3Q3JB 4B2IA 4KBFA 5JHGB 4TMXA 2BOVA 3B1ZA 3TIFA 2RGNA 2J7PD 4JVLA 5DYIA 2OBLA 1W4RA 4TZ6A 3RS2A 1CR2A 3B9PA 4LRWA 2PH1A 4GBMA 1F5NA 2C03A 3L0PA 1OH7A 2H92A 1HUQA 5H68A 4DSTA 2BKEA 4D0NA 3I4LA 3MG9A 1G3IA 1DELA 4LJYA 1ETUA 1XPUA 4MRVA 4NYMR 1L4UA 1RC8A 1UKYA 4M1MA 1PLKA 2YWGA 4LGMA 1U8YA 1ZCBA 4PZYA 4PHFA 2I1VB 3FVQA 2WJGA 2WPDD 3KDSE 4JLBA 2PEYA 3DKPA 2GA8A 4JSTA 1DO2A 2FF7A 4TYQA 4V02A 4IDOA 1RJ9B 4G01B 3X1ZA 1W0JA 2ZANA 1KO4A 1IY1A 2ECKA 5JSZB 1JQLB 1GL9B 2N46A 2PX0A 1ZMXA 1CJVC 2FFAA 1NG1A 2MMGA 3CF2A 2ORWA 3FE2A 1PUIA 3EWAA 4PPFA 1II0A 4TMKA 2RHMA 4EQ6B 4LJAA 1EX6A 1S4QA 3KJEA 2H17A 4JLAA 4IDNA 5J4KA 3C5HA 1HEIA 1P9WA 2N1BA 4RJLA 5KTYA 1EFTA 1KJZA 1SKYB 2OFXA 2ZQ5A 3IPYA 4BZPA 2BIFA 5BQ5A 4B32A 4MYHA 4D26A 4JJZA 2C2HA 1OV4A 3C8UA 2BJVA 2ORVA 1VKJA 2IYRA 3PR1A 2ZRJA 4TMVA 3KXIA 4G5RA 4UKDA 2EWWA 4H1VA 1CXZA 2ZRKA 1SXJA 4UNPA 4YLGA 4BFXA 4TYWA 2EU8A 3SU8A 2HCBA 1Q1ZA 3CF6R 2VP4A 4C30A 2XXAA 4PQYA 2R65A 3THWA 3EAQA 5JRJA 3A1TA 3AP3A 3X1WA 1KMHB 1SQ5A 2HT6A 2IYUA 3TK1A 8OHMA 2IF0A 3GD7A 1XZPA 3MWYW 2W6JD 2B6HA 1FMLA 1CJKC 2OLKA 4C0QC 1AM4D 1XCGB 5GJBA 4ZCIA 2HJGA 1E9FA 2IXGA 2GEVA 1RJ9A 4NE2A 1E1RD 2V9PA 1VCIA 3GLHA 1MKYA 3PEUA 3AB3A 3ASYA 2WJYA 4D4JA 3R7WB 4ACAA 3G5UA 3DOEA 3CR8A 4PAOA 1Q3HA 3NC0C 3SFZA 4O3MA 4IOJA 4PC7A 3AVTA 4CEIA 1DVRA 3SFVA 4G5QA 3U3MA 3QNUA 3SJBA 3UATA 5CDFA 2XSZD 3LLMA 3VR6A 4DHEA 5HZKA 2R6FA 3N5CA 4HUTA 5JZVA 2WVJA 3V4FA 5FPTA 2XJ9A 3P4XA 4BFZA 1SKQA 2ZRFA 5GVSA 1VECA 3B82A 4BRWA 4D25A 2H5EA 2QRNA 4W5HA 4HLQB 1QHGA 3QVVA 4TLBA 3PFIA 4AKGA 2X8AA 1AK2A 1YZLA 1KDTA 4Q7KA 1YR8A 4XTCS 3KQUA 2WHXA 1E2EA 2DY1A 3QKRB 2N42A 3T12A 2D2FA 3IO3A 3VR4A 2F3RA 2WBLC 4LWZA 2B7BA 4TSFA 3HPQA 4I4LA 4OHXA 4QJ3A 5CM8B 4G3XA 2REOA 1S0UA 4IXMA 3MFYA 5J4LA 1H65A 3SYNA 4A9AA 4IDQA 3NDBB 1L2TA 1KYIA 3EZ9A 1RIFA 2J7KA 5ELXA 3C15C 3BAFA 3ZS8A 4RVCA 1B0UA 1GFIA 3QQ5A 4MRNA 4P33A 4MGKR 2ODEA 5AUNB 4GNKA 4G0NA 4JLMA 2F9MA 5BWMA 5BXQC 1BOFA 2HUPA 2OFWA 1HV8A 1E2LA 4DC9A 5EXTA 4KXFB 5AUQA 3VAAA 1I4DD 3NWJA 1W36C 3K9LA 1CKEA 4PSAA 5JJLA 4LYFA 4BEBA 1NP6A 3CUEF 1E2GA 3NIBA 4L5BA 1Q1EA 4GSYA 1M7BA 3KQHA 2QP4A 4Q7LA 2FFQA 1P2TA 3O8DA 1WCV1 5FFMA 1GM5A 1P2VA 1Z47A 4LJ9A 1FQKA 1OYWA 3WBJA 4GOJA 1H8HA 2G6BA 4JYBA 1K6MA 4L8GA 3CBQA 1XXHE 4A8JB 1OB5A 4PX9A 4DBLC 1D2MA 1DAIA 4Q4HB 4HB0A 3WMFA 4TYPA 4E03A 1CIPA 5E7IA 3SOPA 3PQCA 4B75A 4EIWA 4C0KA 3UWOA 4PPNA 4RFSB 1UBGA 2BMJA 2IXEA 2J87A 2OCBA 2RCNA 2FMXA 2JGNA 3AF1A 4BLOA 1NY6A 1WXQA 2IXFA 3LVQE 1G18A 3U44B 1M7GA 2ZAMA 3BK7A 1ANKA 1E9AA 2QMHA 2J59A 3IIKA 1M34E 4HI0E 1N6KA 5FI0B 5DLQC 1P6XA 1OJLA 2ZE5A 4TL9A 1NIJA 4TQAA 1N6NA 3PUYA 3MD0A 2IYQA 1R6BX 5FOTA 4BFTA 4DXAA 5A4JA 1JECA 2ZRDA 4Q1CA 1M8PA 1DG3A 3THXA 1U98A 3ECCA 3NVAA 1VYTA 1Y3AA 3CPEA 3EA5A 4E5UA 4XSGA 5EZ5A 4M22A 3SYKA 3AVPA 2VYFA 4F4IA 5KNDA 1KTVA 5F98A 2PCJA 2IYTA 2IYVA 4ON9A 3TH5A 3U2QA 4XWKA 1SULA 2FPLA 4KODA 1YZKA 4OK6A 5KU1A 2QPOA 4PZLA 3TSOA 2YKGA 2V1UA 2XGJA 5KSZA 2HF8A 1U94A 3T35A 2E1RA 3Q5EA 1N6IA 1W4BA 3SYLA 1NJFA 1TQ2A 2B21A 1E4YA 4JLDA 2W6ID 5D3MA 2IC5A 3K70D 1E69A 1QHXA 2CHVA 3OEHA 1YRBA 5DNYB 3SQXA 1JPNA 2OCPA 2QTHA 4WBSA 4C0LA 2YWFA 3QBTA 4M9ZA 4FD2A 2F43B 3QIAA 3TR0A 4M9SA 1B23P 1EFRD 4HAUA 4HUQB 1XD8A 1ZUNB 3RANA 1G7RA 5E7JA 2GCNA 2OAP1 4MUAA 2ZM5A 1FNNA 5L3VA 1OIXA 1SXJE 2QTFA 1TQ4A 3QG1A 4C0SA 5J4YA 1F60A 2O8BB 2VH5R 1MH1A 1TU3A 4TLEA 3QEOA 4YMSA 4F7WA 3I92A 4WZAE 2G88A 4LBZA 4KCGA 2W83A 1ZNZA 5AJWA 1J7KA 2WIBA 1J8MF 1RW4A 1S8FA 2J7PA 4OBEA 4PR0A 3U61B 1G20E 5GJVC 1QVRA 1JI0A 4OK5A 1GAJA 1Y63A 3LDAA 2WWWA 1WMSA 4IDPA 1CEEA 3E70C 3LWNA 2DR3A 1G21E 3P27A 4X8MA 5DN6D 1E0AA 4UJ5A 1Q57A 2PEZA 2J0SA 1Q44A 1FX0A 1HQYE 4QBFA 2H18A 2VP0A 3GLHE 2XZOA 3VHXA 2GK7A 2ZRGA 1T91A 1XMSA 2QN6A 2GKSA 4QHYA 1XRJA 5E95A 5EJEA 1ZYUA 2F1IA 1Z06A 4WZBE 2GCOB 5C46F 1NRJB 5DI3A 3O8CA 4NU0A 1XCMA 4QBGB 4TZ0A 2I3BA 1KDRA 2CDNA 3VX4A 1NN1A 4WXRA 4M1WA 2W2VA 2R9VA 5CDFE 4MGYR 4GDFA 1UAAA 5HE8A 1KI8A 2O0KA 2REXB 5J4VA 1SKYE 2F6RA 4MA4A 2NOAA 3S1AA 3W9YA 5B57C 4GMXA 4KBGA 3I73A 5D3QA 3EZFA 2F43A 4RKFA 3I8SA 3I61A 1U90A 3MWLA 1AS2A 4TTQA 2CL0X 4E22A 2RGEA 1X1SA 3EPLA 2Z43A 3AVYA 5AJXA 2R6GA 4LJ6A 2ZJ5A 3HYRA 4ZI3A 2B92A 2F55A 2PT7A 1QDEA 3I5XA 4I1UA 1YQTA 4F4JA 3ONWA 1HY3A 4LHZA 4EJSB 3BRWD 3B60A 1XTKA 3CNOA 5EE5B 2ASEA 1W0JD 2F1JA 4DLZA 4URVR 1AIPA 4HAZA 4ESVA 5CB6A 5FTLA 2LKCA 2BEJA 1CU1A 4B74A 2FPMA 1G3MA 2PBRA 3H86A 1S9HA 4M4SA 2AWNA 1KI4A 2C78A 2VIIA 3AP2A 2J46A 3CKLA 3TW4A 4Z54A 3CH4B 4A6XA 2JJ2D 2ZR0A 2Q9CA 4WVFA 3GJXC 2OSBA 3KQLA 4JSYA 4MRRA 3O8RA 2QMUA 2J9RA 1D2NA 2A2ZA 2GF9A 4CYMA 3ZYCA 5FR1A 3KXKA 4GZLA 2ERYA 1IQPA 4Z8XA 1OH5A 1OH6A 3VQTA 3GLGA 1E79D 2OXRA 3EC2A 1XTQA 1TF5A 2GCOA 3OFNA 4G5OA 4ESHA 4NL4H 4EPYA 4OQLA 2BCGY 1GG2A 1R0WA 2QT1A 5P21A 2A5JA 4FXPA 4AURA 4DLWA 3QXSA 1E2KA 3GQBA 1UKEA 5G41A 1KK0A 1KSJA 4A0RA 1C4OA 1T3SA 5HCIA 5IT5A 2H57A 2O0JA 1E1RA 2C99A 2VP5A 4H1UA 2WZQA 4PPQA 4YMTA 4EPXA 1UPTA 3SJAA 421PA 4JBYA 3NXSA 1IBRA 4FMBB 1G19A 2P6NA 4PAQA 2GXSA 2F7SA 221PA 3I32A 4M1OA 2JLVA 2ERXA 1T4GA 3F5FA 5JWHA 2UZIR 3AKCA 3KB2A 2OZEA 1V43A 5FBWB 1US8B 2XAUA 4FMDB 2XSZA 3MWKA 4LZZA 2Q6TA 5FTKA 3N2IA 3U4QB 1G5RA 4CGZA 1CTQA 2QNRA 1IJFA 1TTTA 3BH0A 3ICEA 1Z83A 5L3SA 5L8VA 2GNOA 1XNJA 3CRQA 2ANBA 2RGAA 4DUGD 2G1JA 3QPUA 2FX3A 1O87A 3TQCA 1N0WA 1W49A 5CB8A 1YR9A 3QE0A 4D4LA 2XB2A 4V03A 4ZPXA 3O8BA 3T1QA 3C14C 3MWJA 3A4MA 1D9ZA 3NBFA 2FSHA 2JIZA 2OO7A 4DLRA 2UVQA 3K0AB 3NHBA 4C0JA 2CK3A 2IUSA 4A2QA 2XTMA 2QQEA 3EG5A 4JLJA 5K8TA 1KSFX 4W5WA 4NONA 1KY3A 2QI9C 1HE1C 4DRZA 4L15A 2RGXA 1V5WA 1D6JA 4HB3A 5HR5A 3TUIC 3OEEA 4GOXA 2CNWD 1KDOA 4Q4JB 1XEFA 1Q1BA 4C3ZA 2DBYA 5BYKA 5M04A 1IY2A 4C7OB 2QGZA 1II8A 1DO0A 4KU4A 3ZVMA 3KQKA 4TSFD 4HLUA 4XVUA 3CZQA 4DT1A 3FKSD 2B7CA 5HCNA 5KSOA 3IO5A 2RMKA 2PX3A 2CJWB 2A5FA 2P2LA 4NYIR 2EW1A 2A5YB 3B9QA 5DIFA 2AN9A 1XBTA 3R9XA 4HZUB 1E99A 2PJRA 3LX8A 3CB4A 3T61A 1QF9A 4GL2A 3TLXA 4PO1A 4JBXA 1AKEA 2DFLA 4GI7A 3GP8A 3C41J 5SZJA 5ANRB 3F8TA 4O0MA 4LYHA 2XZPA 4AKHA 3CONA 2Y8EA 2O8EA 5CIQA 2Z5FA 1G3QA 5BN5A 1PUJA 3B1YA 3K70B 1VTKA 1U8AA 3R9IA 1JPJA 1JQJC 4PSKA 3J81k 1VG1A 1H8HD 3PV0A 2BVNA 2XEXA 3K0AA 1G3UA 2ZJYA 2VF8A 1GITA 2XB4A 3K0CC 3T1OA 4AYTA 2AKAB 2ZJ8A 4B6FA 1EX7A 4P32A 4ZKDA 2ZJZA 1OKKD 3M1IA 3AUYA 3RVBA 4CEHB 3M4YA 4BEJA 2D06A 1XD2A 1VDZA 4OYHA 1WBDA 4CEJA 2FGKA 3PEYA 5H1YA 1SVWA 3LAWA 2QPAA 1NSTA 3GLIA 3RABA 4AIIA 4ARZA 1A1VA 5AJVB 3X1YA 1JBKA 1G5PA 4WAUA 3QKSA 1KNQA 1R4AA 4Q4JA 2OXCA 3PIRA 3TW8B 1T6NA 4QXAA 1GZSA 4DCUA 2R6DA 1ZW6A 1YJ5A 1Z6YA 3WMEA 1XXHB 3F3YA 2WJIA 1XU4A 4F92B 3DZ8A 2DPXA 4DSUA 4LBWA 4XOIA 1OFIA 2CE7A 3KTAB 5FL7D 2XJ4A 1P61B 3CRW1 3K0FB 3KJGA 4HEJA 4URUR 3FMOB 4Y0AA 4DDTA 1AKYA 821PA 1XEWX 4TTRA 4RD1A 1W36D 4Q9JA 1JB1A 4DCVA 4YXWA 2GJ9A 2V1XA 3WHKA 2W2XA 1R7RA 2JDIA 4E07A 2W6IA 4DCNA 721PA 1IN8A 2GXQA 1VIYA 2W2TA 3LD9A 1OT3A 4M9XA 2CLCX 3P32A 3THYA 1J2JA 1K5GA 4P4UA 2ONJA 3T5GA 1JJVA 5HTKA 5HKKD 1IHUA 3F0TA 2R44A 3KKPA 4IEIA 5FUVA 4MITA 4B3FX 1EFRA 4ZDIA 1NL3A 1SHZA 1E2NA 2RB4A 5DH9A 1FW6A 4QBIA 2RGDA 2QRZA 3OIWA 1YZUA 1GL7A 2LWIA 4B71A 4UXJA 2AHOA 2JATA 1S1CA 1JEEA 3LW8A 2GDJA 2CEAA 2GEDA 4C2TA 2VHCA 2FU5C 3UKDA 4JL8A 4LX0A 3QXHA 4NZYA 3U7FB 2ZJ2A 1A5TA 2D3WA 2ZU0C 3FKQA 3LBIA 2FEMA 2LCFA 3LH5A 4RZUA 5KNBA 3GLGE 3RRMA 1W0KA 4FINA 4BWYA 4KFRA 2FWRA 4B35A 2JAQA 4IVQA 4JVNA 3BIFA 3AKEA 3RHFA 1Q21A 3CWZA 4RKEA 1TUEA 1NMZA 2ZYUX 2JASA 3K0FA 3AF0A 2QPTA 3DOFA 3BFVA 2H8KA 3T15A 1JXMA 4IXNA 2WKPA 3W6OA 5L3QA 3HWSA 4OHVA 4PANA 1ZNYA 3W6NA 5TMPA 3PITA 121PA 4QJ4A 4DB4A 3NBZC 3R9WA 3P4YA 1MR3F 3DMNA 3ADKA 2PMDA 3FMPB 5GADl 2WM9B 2GILA 2FN4A 4A4DA 2KJQA 3EPKA 1WE2A 1NG9A 4U7DA 3V4RA 4LHWA 2QENA 5LD2B 1SXJB 2X77A 5FH9A 3B1XA 4M21A 3K0SA 2QA5A 2GTPA 2QSZA 3HU2A 4MRSA 2JLZA 2XXAB 3QY0A 1U0JA 2QP3A 3BB1A 3WP0A 3THWB 2ZRCA 3JZMA 1I4LD 4S2EA 1N6OA 4JZKA 4I1VA 3PUZA 2NTYC 4AD8A 4ZKEA 2VHJA 1A4RA 1R8SA 2VBCA 3IQWA 4KV9A 4M53A 3BD9A 4Q00A 3CPHA 3FDIA 4B34A 2P0EA 3GJ0A 5TV2A 2YHSA 1X8KA 5J4HA 3CLVA 5EE3A 1E9EA 4OK3A 2Q3HA 3ZH9B 2WWYA 3GLHB 2ZS8A 2KBFA 1LF0A 1XCPA 3FHTA 4KYIB 3IUYA 3LV8A 4LHXA 2JJ2A 4HYYA 4PC3A 1TEVA 1P5ZB 3B2EA 4R2HA 4CEIB 2WMNB 1UKZA 2VRWA 5JMTA 2EFEB 1J99A 1WDTA 1DS6A 5LB2A 2R2AA 4LDJA 1MO6A 4Q48A 2AR7A 2I4IA 1Z8FA 1G291 2NO1A 1DAFA 2BM0A 1HE8B 1WQ1R 3P20A 4HDQB 1E79A 3T1TA 2FJUA 4TLAA 4LV8B 1N2CE 2IWHA 1VCNA 3HP1A 4BFYA 1VHLA 2IT1A 2E87A 4DLXA 1E9SA 1XMVA 1BMFA 3RLFA 4KAXA 2DB3A 1N5JA 1W1WA 3HJNA 2W00A 3L82B 4G1UC 4II7A 2I1QA 4KYUA 1LS1A 1FP6A 3KFVA 1NMXA 2BMEA 2IW3A 3CRMA 4DZZA 3U7EB 1CP2A 3QJYA 2WKRA 3WXMA 3OFND 3UANA 5IHPA 2QBYA 1UKVY 1IN7A 2BHRA 3ZQ6A 2WSMA 1U99A 5KDLA 3TMKA 2OE2A 4PZZA 1G8PA 2C04A 3A1WA 4WA7A 1EXMA 2ZE8A 3D3QA 3DL0A 3K8YA 4A2WA 4B44A 2CHGA 4I99A 3NG1A 3W8RA 2MSEB 4DUGA 4QM6A 1U0LA 3GLIE 2H16A 1MT0A 1P3JA 4TWZA 1D9XA 1RZ3A 5CIWA 3FMFA 4PTLA 1KZ7B 3A1UA 4B2LA 2AX4A 1G1MA 1SHKA 2PZFA 5FOWA 1LB1B 2V8OA 4MGZR 1W47A 4HB2A 4IOMA 2F1RA 4OQFA 1ZM4A 2V7QA 3QKTA 2OFOA 3DZDA 1EFUA 1M74A 5E3HA 4OQXA 3GLFA 3Q7QA 4Q01A 4P0TA 2GCPA 3CIOA 4ZIRA 3JVVA 4K46A 1KO5A 1GNQA 2XNDD 2QSYA 2AK3A 2QZ4A 5A0FA 2BJWA 3V00A 2CNWA 4Q66C 2ZR7A 3W6PA 1KI7A 2RGBA 4QG7A 4AG5A 3FHCB 2ZRAA 4AC9A 2YV5A 3NEYA 2JIZD 4V0KA 1XTIA 2HEIA 4DWJA 1BIFA 1CR0A 1SZPA 1W2HA 3IIMA 2CK3D 2BWJA 4TQ9A 4WIAA 3KFXA 3FKSA 2VL7A 4GT1A 4B3DA 1KI2A 4BE7B 1J8YF 1KK1A 3GFTA 5B58C 3K9HA 1COWA 2YC4C 1X3SA 3LLUA 2UZ3A 2ZITA 3KX2A 3OEED 3ZZTA 4YDHB 3SJCA 4POAA 4ZDKA 1G41A 3LW7A 2DWQA 3SE0A 5JS7A 3TR5A 1GDDA 4NBSA 1QZXA 1Q1QA 1MRSA 1A2KC 1P62B 2C9OA 2QROA 3AGPA 3IIJA 5A5GA 3THXB 1TAGA 1GRQA 2Z4RA 3HR7A 1NLZA 3VTKA 1W36B 1NSFA 2WSSD 2IBMA 5BN4A 3MCAA 3B85A 1IN4A 4A1FA 1NLFA 3TUJC 2BBWA 5CYOA 1M1YE 1XEXB 3WYAA 1NF3A 4JVSB 1E4VA 5F3WB 1U8ZA 5KSPA 1D2EA 4ZO4A 3M6AA 3T1VA 1FTNA 5JFGA 5JLJA 1G4AE 2YOHA 4IKEA 1F48A 2ZUDA 5CYPA 2IK8A 3ASZA 4DKXA 1OKKA 4XTRA 5AJZA 4C0BA 1DAKA 5D3MB 2WTUA 3EIEA 3SN6A 1YR6A 1AQUA 2GZAA 4LJ7A 2D4HA 3OIVA 1Q20A 4GFDA 1Z28A 3EC1A 3NDPA 3UK6A 2JCSA 3K1JA 4JLVA 5FOXA 3BBPA 1ZD9A 2FV8A 4UNRA 1P7CA 4QOSA 4Q7MB 2JEOA 2ZIAA 2D7DA 1ZINA 2GAOA 2JLQA 1SGWA 1FL9A 4YDSA 5DHAA 3RS3A 3LXXA 4Q03A 4A8JC 4RZXA 1LS6A 4GP6A 4OHYA 3IBYA 2P67A 2ATXA 5EE1A 2GK6A 5FL7A 2HV8A 1X86B 2YWHA 3BORA 4CVNA 1XJQA 4Q9LA 2FSFA 1ZIPA 3CF0A 3UIEA 1QG4A 1F2TA 2ZROA 4MKIA 3IILA 4UXHA 3REGA 2FOLA 1Z0FA 3B6EA 1G7CA 3ZIAD 3ZVNA 3SDZA 1KKMA 4Q1DA 3TAHA 1XEXA 5LDDC 5FUYA 1R2QA 5FBQB 1FX0B 4RD0A 5HKKA 5JWRA 2AXPA 1OXVA 3K53A 1KO8A 1G4UR 4YXWD 3LFUA 3QOFA 3VR2A 1E9BA 2ZR9A 1PV4A 1UEJA 1P2SA 2JDID 5DI3B 1DADA 4NTZA 1YVDA 1EGAA 1IOZA 2ODNA 4QGGA 1WB9A 4NMMA 4AYXA 1M7HA 4NCIA 3QF7A 3LBHA 1Z0IA 4OI2A 1ESMA 2ZI3A 1UFQA 3S1AB 5KNCA 4MKHA 3A4LA 1TX4B 5IK2A 3U6KA 2GZDA 4MDEA 2ZSFA 3A36A 5HPYB 4RY2A 4Q9HA 1QBKC 4FCTA 1FQJA 4QC2A 3WMGA 4NYIQ 3QG5A 4NCKA 1VYUA 3L43A 4LK2A 2WOOA 1KO1A 1UJ2A 3EZ2A 4DEXA 2V54A 1P9RA 1J70A 4N3NA 4FW9A 2P6UA 4I1SA 3I8XA 5KSYA 1T3LA 2HLDA 3PUXA 4BLRA 4FWTA 2RGCA 2VF7A 3CM0A 1MRNA 1E2PA 1LV7A 4LPSA 1W0KD 4D6PA 4U00A 2OESA 3ZVLA 1H8ED 1U9IC 1CJMA 1Z6GA 1G8GA 5JRZA 1XB2A 1XZQA 2ZRBA 1YKSA 1FZQA 1XMIA 1Z6AA 2EQBA 3A37A 4URWR 4PAMA 3WHLA 3ZDQA 2ZYWX 3U7GA 2VSOA 3TSWA 2J3EA 1HURA 4DDUA 4RD4A 4IDHA 2DFNA 5EUMA 2FA9A 3QXCA 4XWAA 3GLGB 1XTRA 2V55B 3B5JA 3OESA 4C0AC 3U60B 1RKBA 3CX8A 1Q22A 3NH9A 4LHVA 4IOLA 4RD3A 3SNHA 2IYWA 3U6BA 2A7QA 3PCRB 1C9KA 1E2IA 2VLIA 4D0LB 2QORA 3I5YA 2JLYA 5K8IA 2F3TA 3QBVA 4NCNA 3PJRA 1ODFA 4C9BA 4URYR 3GLFE 1E3MA 3MGCA 5FOUA 4MYCA 1I2DA 1AZTA 1NIPA 2NZ8A 2Z4SA 1ZVQA 1KOFA 1VG0B 4LV6A 4B2PA 3QEJA 1KZGB 1TPZA 5F9HA 1DG1G 2VQSA 4P4TA 4HAYA 3BJIC 1XMJA 1W5TA 2QAJA 4HDCA 5UKDA 3QF4A 1SVLA 2FSGA 1BH2A 2BBSA 1GRRA 3LNCA 1E2MA 4JJKA 5L3SB 2A9KA 2WAXA 2D2EA 4JS0A 3ZVRA 1ZRHA 1MABA 2VP2A 4RCYA 4TT3D 5FBLB 1UF9A 1ZJ6A 1AQYA 2A78A 5FTJA 3IEUA 4Q7JB 4UNNA 4TMZA 1WP9A 1NLYA 1LTQA 1ZD1A 1OIWA 5LB4A 4ZDJA 2IS4A 1OPXA 3CZPA 4KSCA 2YC2C 4OJKA 4KLZA 1N3BA 1W44A 4EJSC 3RDPA 2P5TB 1R5NA 3BE4A 4WOPA 2IL1A 4QL3A 3PVSA 2GBLA 4DJTA 3X1XA 4PO9A 1KDPA 1BMFD 1II8B 3B8HA 1QHYA 3SBDA 3ICQB 4OL0A 5F2EA 5BYJA 1YE8A 3LXRA 1ZM7A 4DT1B 4NPHA 1X8LA 2OUKA 1G8YA 2ZRPA 1RRCA 1T5LA 3RYTC 2YWEA 5E4FA 4M1KA 1GOTA 2XTNA 5CJPA 3RAPR 2ZTSA 2DFTA 4CRWB 2BM1A 1OYYA 5KDDA 4BFSA 4ZV4A 4LYAA 2ONKA 1N6LA 4V0MA 5CJ2A 3ADBA 1W4CA 2P65A 1AGPA 1HT2E 4ZI2A 4KO8A 4NCHA 2ANCA 3RS0A 2J41A 5FPSA 1N6HA 4HLDA 1KI1A 2H7VA 2WWGA 2RAPA 5FPHA 2O8EB 5JCPA 4NDZA 1GL6A 2XNDA 3EPHA 4LSGA 3BFXA 2OHFA 2VHUA 3I72A 5LPNA 1A7JA 3FWYA 3TBKA 3Q8XB 4NYJQ 3C4JA 4LUCA 2LKDA 3PXGA 5CITA 2QP9X 3AVOA 3REFA 2GJKA 2V7QD 1QHHA 2HXSA 1Z0AA 2G9NA 1R0ZA 4PC6A 3IHWA 1E0SA 1S2MA 1XD2B 3CWQA 3QKUA 4LI0A 4O2LA 4CEJB 4TMWA 2AK2A 3GLIB 2ZE7A 1KY2A 3HYTA 4ARZB 1W5SA 3BOSA 1GKIA 3OE7A 3QKSB 1P60A 1SVIA 2O8DA 1FUKA 2IA5A 2D62A 1DTSA 1N0UA 2ATVA 1XX6A 2FFHA 3AKDA 3GFOA 4I81A 1DAGA 3A1VA 4M2LA 5K8LA 3OHMA 3SHFA 3GEIA 3DHWC 2WSSA 4EPRA 1AS3A 1TNDA 3QPWA 4WW0A 1NVVQ 1UADA 1COWD 1CLUA 3BB3A 4OI0A 3OAAD 2G83A 5SZHB 5KHOC 1ZM3A 2QAGC 4FN5A 5KYKA 4XD7D 1GVNB 5DYGA 1E9DA 4N0EA 1GSIA 4Q19A 3KB1A 4IVRA 3MRSA 2VP6A 3CRVA 3W3ZB 4OI1A 1KAOA 3R8FA 4KI0A 1T5IA 2EWVA 1A82A 3VNUA 2H1LA 2GEUA 1G8HA 3VX3A 4QM7A 1L8QA 1W48A 4IOKA 3BH7A 1Z6TA 2ZI6A 5AUPB 3THYB 3FGNA 3TNFA 3V9PA 2YJTD 4BFWA 4YMVA 5H70A 3SC3A 3EIHA 3IKJA 3K9NA 2ZXUA 1Z29A 1K8RA 1ZU4A 4GP7A 4M8NE 1OIVA 2JA1A 1EWQA 1S3GA 1E0KA 4BLTA 2BCJQ 4IJMA 1ZCAA 1JNYA 4CDGA 4EFLA 1PLLA 1YR7A 1ZNXA 2A3RA 2ZS9A 4NP6A 5G40A 5JI3E 521PA 3OIUA 2OAQ1 1KNXA 2G1KA 2QL6A 4W7SA 1U0HC 4IEEA 3EWSA 3K70C 5JEDA 5SZKB 1QHNA 3HDTA 2UKDA 4LV5B 1T8UA 5DHFA 3K09C 4JKYA 2JJ1D 1EK0A 1OF1A 1G8FA 2Q3MA 4YMUA 1AJEA 1TQ6A 2QEQA 3ZIAA 1PJRA 1P4SA 4M0LA 3D7MA 3KJHA 1OSNA 4NCJA 5AR1A 2J45A 5BW8A 4DIDA 1GKYA 1T0HB 1RRGA 1TF7A 2NGRA 2PZGA 3I3SR 3KJIA 2IWRA 1RE0A 3H1TA 4ILEA 2D74A 4PQFA 1XWIA 1ZUIA 5L3QB 1E32A 2CL7X 4DDWA 4YONB 2ZJBA 3K0EA 1K5DA 4P4SA 3TGPA 3KKQA 1CBUA 3P1JA 1D8TA 5DE3A 3L2OB 3JZAA 4LY6A 5DSZA 1DOAA 3H84A 1HQCA 5G3YA 4MGIR 5FUXA 4CIDA 3RWOA 2IYLD 3ZGXA 1AN0A 1E2HA 1CR4A 2XITA 1XP8A 4FI3C 2WJVA 3K0CA 4EFNA 3TE6A 1E98A 1XJCA 4QBHA 1GP2A 4G5GA 3GMTA 3PEVA 4RZ2A 3VMFA 2O8FA 4FMCF 4HDOB 5FOSA 2O0HA 1NN5A 1KJYA 3HU3A 1GKUB 2J0QA 2V4ZA 5L3RA 1JXOA 1Z08A 3IPXA 4HAWA 4Q5IA 2IS2A 1OFHA 1FPMA 1G7SA 2KSQA 2RGNC 3WY9A 3HU1A 5KPJA 1SVMA 1ZUHA 1IXSB 4N0DA 4BECA 4R71A 1F2UA 5IK2D 2CL6X 3FTQA 3IDQA 1OFTA 2KI5A 5FI1B 3SI7A 3G0HA 3W90A 3EW9A 1H8EA 2OCYC 3WNCA 2Q9BA 1S9DA 1P73A 3LA6A 5JJKA 3RRZA 1VCMA 3AGQA 1AGRA 1NBMA 1VYVA 3ND9A 3N2EA 2MSCB 4F91B 1KK2A 1GNPA 2CVFA 4ASUD 2ZPTX 4B48A 5AUOB 5C18A 4NHOA 3SQWA 4L16A 3RC8A 5KO2A 1N5KA 2Q9AA 2HLDD 1XEWY 3GFPA 2PCLA 3WBKA 1TMKA 3NHAA 3RC3A 4FIDA 2ZAOA 1FMJA 4BLQA 1RYHA 2IEZA 3Q9LA 4CT4B 2JJ8A 4PC2A 2BKUA 4TLDA 1X1RA 4M1YA 2P5SA 1N0VC 1NVXQ 4V0ME 1NY5A 1LNZA 1MO4A 1R5OA 4OJQA 4C0HA 1IM2A 4GPTA 2JLXA 4NYJR 4Q4LA 3RNLA 1XPRA 3ZJYA 5FPKA 2ORIA 2Q21A 2ZRLA 4HB4A 4GOKA 4KJZA 1JR3D 2DCUA 4PQRA 1G6HA 4G5SA 3ND8A 1Z22A 4Q47A 3E1SA 1Q0UA 5TDHA 4V0LA 1OHHD 3TSZA 2QBYB 1KI6A 5G53C 2O52A 4U5XA 4DSOA 1KK3A 1TL7C 4PHHA 4JBWA 2NPFA 3U7HB 3QI2A 3LQQA 2MMCA 4Y0VA 2HJVA 2QE7D 4I1OA 2GJAA 1VG9B 4P3YA 2YZ2A 1U81A 4FMDF 2KB0A 2AXNA 4XVQA 2KE5A 4F38A 5LD2C 1CR1A 1SXJC 3RS7A 2ZSAA 3FYHA 4TL8A 2CLSA 1II9A 3L0IB 3GCGA 1NVVR 4TT3A 4DLTA 1W7AA 2OILA 3KKMA 4B47A 5FR2A 3GPLA 4W5JA 3SZRA 2PL3A 2ODBA 1EFHA 1I4TD 3P26A 4BQSA 5EUQB 5AWFC 2IHYA 2FSIA 1TF2A 3AVQA 4CW7A 3GLFB 4RZ3A 3KKNA 3QPVA 5CLQA 1Z0JA 1KJWA 1DE0A 3E2IA 4ZIRB 4B3CA 4ABYA
chains in the Genus database with same CATH superfamily
3W5JA 1U9JA 4GMDA 2VNHA 5GZ6A 2NPIA 4AM8A 3DV0B 2Q6OA 1FFXB 4II2A 4LXQA 2NSYA 2WNIA 4MV8A 4WCFC 3OWHA 1I1NA 2IUFA 2XGMA 2BHLA 4X8OA 4ZVLA 3B1JA 1XV5A 1Z68A 2ESRA 4IIFA 4OQMA 4QU8A 3KU1A 2M6LA 4GRDA 3WP1B 4DEYA 5JEEA 3G2JA 2IUUA 2FPGA 1CVLA 1CS4C 3HLYA 4Q1BA 1W46A 5FOQA 1EBFA 1H2YA 1LK7A 1P9OA 1RWMA 3KEMA 3VO8A 3WGTA 4IJWA 4FSDA 3VV3A 1T0PA 3CN7A 3FFAA 5EA2A 2INGX 1T15A 1KIAA 4PHGA 4JSRA 2FVXA 3TI7A 2FNAA 1X0VA 4RD2A 5B6JA 1RVDA 2P9YA 3FYCA 4RA6A 4BO2A 2C8VA 4FIZA 1TKBA 2C07A 4Y9DA 5G0UA 1WXWA 2W2PA 1HFEL 4LDAA 4UBNA 4PSDA 4EHDA 3MJSA 4F46A 4OHMA 4J75A 3WFJA 4AULA 3IHKA 5LNK6 4P5EA 4WXPA 5ICSA 4OV6B 1ZSNA 3ELYA 3ZE1B 4IDGA 3EIXA 4U2FA 2ZRIA 3H9EO 3VKWA 4H7JA 4O4HA 4BFVA 1MHTA 3TUZC 5ALTA 2B61A 1I14A 3DMYA 3ECAA 3KR0A 3P0IA 2CDAA 4GICA 3DAFA 4NSNA 2VNJA 1E20A 2QJOA 4HADA 1KQOA 4GKAA 3L84A 1C4WA 1YTUA 4QU0A 4MYSA 4PXSA 3NU1A 3F5MA 3RC7A 4MLCA 3CW2A 1XRSB 2H07A 4NU6A 2RC5A 1ZM2A 4NNJA 1WZ2A 1E2FA 1Z6XA 5C81A 2JKZA 3AHEA 3P96A 3WNBA 4R1QA 4MV1A 3E84A 5JSZA 4Q4AB 4F0JA 1L7VC 4KVZA 1SB9A 3HP4A 3I6YA 1H1TA 2YOFA 4CTKA 3CW8X 4TL7A 6ABPA 2VHQA 3H4MA 1E5VA 4CPDA 4P54A 4EQ6A 5IVIA 5JBIA 2OKCA 1C9NA 4HDMA 2BGTA 4EDHA 5BR8B 4YB8A 4AICA 3K6JA 3GNTA 5FP0A 1IZYA 2RGGA 3EY4A 5JHHB 1ISJA 1V95A 3BGWA 2VDRB 1PP4A 2C00A 2QY9A 4ZOLA 1JHMA 1JMKC 3A32A 2O20A 1EP1B 1GTZA 4US1R 2O8CB 3DOHA 2I1LA 2VHTA 1Z07A 4AMYA 4DA0A 1RQ2A 1E0JA 6LDHA 2RIPA 3LX5A 4RVGA 4Z4FA 4OSEA 4EUHA 3EC7A 4IO0A 3DLBA 1X15A 1KIMA 3LDHA 3CURA 5EVCA 2YQ5A 4CM3A 3IPRA 4YI5A 2NVBA 2ECFA 2G80A 4RUKA 1DOZA 2P5UA 2Y1DA 4FJ2A 4HZIA 4LPKA 3T99A 5JXHA 3TVTA 2WVHA 4ES6A 2X19A 3PUVA 2XD4A 4L1KA 2RHDA 1Q7GA 2NZXA 4EYGA 1JYSA 4JL6A 3P7MA 3FJ1A 3HDGA 3JQBA 3H6GA 4K3VA 4H15A 3RHZA 1KMHA 1ZD3A 3SS8A 3WGOA 2W8ZA 2CDRA 3WJ1A 4CNQA 2CHQA 4BMPB 3NT4A 2BMWA 1XQVA 3NFYA 2IOFA 3KZXA 5A4DA 3DLCA 3DA8A 3M0EA 5COQA 5C31A 3EGVA 3NWEA 3QWAA 3L8FA 4JHLA 3IBGA 2F1HA 2O2HA 1JR2A 2Q99A 1XRPA 3AOGA 3D6MA 3S2UA 4BV9A 1UOPA 2D0OB 3SF8A 2ZIUB 1X7ZB 1B00A 1V5EA 2FZ4A 2XV1A 1DAHA 2ZI9A 2CZQA 3MTGA 3MXTA 4OH1A 4UUOA 3V6LA 3G2HA 4IQGA 1IAQA 4AKEA 4C5CA 3QLEA 4EEKA 1ONBA 4ZTUB 1UBCA 3PXAA 5EIHA 4OTZA 5GIPE 5TPZD 3R7WA 3WYBA 2YHBA 3MB5A 3EDQA 1KI3A 3OETA 3Q85A 2IZ1A 1O5TA 4FCCA 2L0XA 5DXJA 1FNMA 2XDAA 4IRUB 4O2AF 5H9VA 3THOA 4I3GA 3ZD7A 2OG2A 5IH3A 4BNUA 4UFPA 2OHOA 3QA9A 1N32B 1CQIB 4BLSA 2BMDA 4U2KA 4ZYZA 4A3SA 3JYNA 4CKWB 3VR3A 1JAHA 4OLAA 1F0KA 4QOFA 3ZCTA 3V7UA 1FJGB 1YS9A 5G1PA 5IDYA 3N2LA 5EIEA 4GZMA 4H7FA 4EKEA 2J0UB 4W9MC 1VHWA 2EJUA 3NHLA 3A4TA 4DCJA 3QKWA 3OA2A 3NJ4A 4IHQA 4XVRA 4RXMA 2V65A 1SC4A 5ALNA 3G0DA 2WAAA 2V7TA 1KJIA 4FCWA 3M1YA 4LYJA 5FNVB 3SJZA 2DQ4A 4ZCRA 4NV0A 2W0SA 2ZVQX 5HF8A 1S3SA 4YEDA 2Z6VA 1BG6A 3K2QA 4HX2A 1ULUA 4M99A 1U0TA 1J8FA 3UAZA 2RKBA 3WOHA 1RRKA 4ZDWA 3D5TA 1NJ8A 1G64A 3B51X 4TWJA 4YIKA 4JYCA 3GZTB 4CG0A 2J5BA 4FTWA 4EVIA 1X0XA 4E09A 1Q3TA 4EJ2A 2MSNA 4MQUA 3F97A 4M36A 2DWOA 3N5KA 3AFIA 3OX3A 3K9QO 2W5UA 4CWAA 2O5CA 4H08A 1NX9A 3NONA 1KU6A 2GVNA 4FEAA 4XSHA 5EIXA 3W3AA 3ZE9A 1KDZA 4UBIA 1UFVA 1FVXA 2WEKA 5C1IA 2JFUA 1GFSA 1YD7A 2OORC 4AMZA 2QG6A 1NXVA 3DKIA 4YMGA 2Q5CA 5B64A 2GNAA 2I7DA 3E5RA 4NIMA 5FBVB 1DEKA 1LPPA 5BT9A 1VPEA 4TKLA 3AEYA 1YFKA 3DPUA 3ZU4A 1MORA 2ZVPX 3A6FA 3X1DA 1XN4A 2I4LA 1UZUA 3DXFA 3ILXA 3LYUA 4X3OA 4UM8B 1U1CA 2GN0A 2G67A 3VHLB 3ZS9A 4BVEA 2Z3ZA 1E4OA 5GONA 2IY7A 3PFKA 5HE9A 4DV0B 1RTKA 4OU4A 4D5EA 2FN8A 2CUKA 1SU6A 2IYSA 4NFLA 4Y2PA 4LI3X 1THTA 2P9BA 4LSMA 4R1NA 3SZ3A 3ZCRA 1HOTA 4RTRA 4H35A 1AUQA 4UMDA 1MENA 2DY0A 4L2IB 3BZWA 1OLOA 4BEVA 4EKGA 5K3SA 2SKEA 2ZI7A 5EWJA 5LZ5A 2BTQB 3S99A 1G2QA 1NVUQ 1CEQA 2I1WA 3I1JA 1GKLA 1OY1A 2WJ4A 4HQ6A 4RFSA 3I2JA 2AE2A 2W2LD 2A1TR 4IJ6A 1M6NA 5J1SB 4TZKA 5DTJA 1CQWA 2ZUSA 1YCGA 1EDZA 1ZN7A 2AI3A 3HB7A 4GYYA 4EPTA 1USGA 5ENVA 5EWMA 2B30A 2OD9A 2PV7A 2DULA 3BXZA 1MXFA 3W78A 4OQYA 3EUWA 3FPHA 4PYIA 1QNFA 1B1CA 2WKQA 2GVZC 3I2KA 1AZSC 3H2SA 3TKYA 1NBMD 2QQFA 3PXCX 3IV7A 3BXHA 3S44A 3KKZA 3SEFA 4NZ9A 2IHBA 1KZ1A 4NBWA 3F6RA 4HEHA 5JNRA 5C51B 4UOZA 1MV5A 2ODQA 2H2WA 1QRAA 4JT4A 3V34A 4CLOB 4ZT2A 2G0TA 1UKAA 1PDWA 2K5UA 4UAJA 1IEVA 1B4DA 2CYBA 2RKOA 3AF2A 5I9SA 4CNBA 3D7NA 4DQLA 4YUXA 1BS2A 1YHNA 4LWPA 4B76A 3KD2A 3KJNA 5EP4A 1M2GA 2JIPA 4MMXB 4ND1A 3STTA 3K8ZA 3WB1A 5M5BA 1E94E 4CL0A 5LFAA 1JZTA 5KYWA 1CY4A 4IFBA 4NZZA 3EGCA 2A59A 3MCVA 3KZVA 2P3SA 1E9CA 4X20A 1P6UA 1VLZA 4FJ0A 1W75A 2RAFA 3ZK9A 1T8RA 1UDBA 1BKDR 3GR6A 3GVXA 1NRIA 4M0MA 4OUKX 4XIFA 5J43A 2EF1A 2NMVA 2DR0A 3D0OA 5IYZA 4CG1A 2R7MA 4YRSA 2FSUA 1WZIA 5BSWA 2FWBA 3T34A 4X6LA 1NMYA 5KDOA 2I6UA 5TS3A 1K27A 2G82A 5AK4A 3SNKA 2EP5A 1J5XA 1WHTB 5A3RA 4ZRMA 2WICA 2DVMA 3L06A 2EVWX 4XIGS 4D9EA 1QHIA 5KJFA 2IITA 4JP5A 3RBXA 2AIRA 3AF3A 4JV5B 1H1LB 4MQLA 3HNOA 4RESA 1B0PA 1FYDA 2GB4A 1TYZA 3EXAA 4R9SA 4UDNA 4WEOA 5FBKA 4ER3A 4RDXA 5J23A 2VJLA 3OJEA 4F4UA 4Z4QA 1OGJA 4I55B 5SYMA 3HJRA 5EJ8A 2B4YA 4RGVA 2P9TA 2C5SA 3C39A 4LJ5A 3VBCA 3C97A 3SYMA 4HGYA 1WPQA 2ZRHA 1S2LA 3D0RA 3GBPA 3PKZA 5C0OE 4D81A 1KP9A 5LBIA 1V16B 1EQ2A 3R5FA 5AK0A 1YB7A 4BB9A 2I6GA 4ZZ2A 1V9SA 4CKEB 3O8QA 3VR1A 4H18A 3G9QA 3WL4A 1I80A 4DUYB 3P2IA 4RFVA 1JJ7A 3KBOA 1E6CA 2WZDA 1XZDA 2AJ8A 1J20A 1Z33A 2JA2A 3BB4A 4BWVA 1U4SA 1T8SA 3GEEA 1R10A 1UJ6A 1V1RA 2O8DB 1BA2A 1EWRA 3ROZA 1EM8B 1CUAA 1P5HA 3O31A 3AW8A 4CMIB 4X6YA 4YQFA 3A58B 2O8CA 3NDRA 5IULC 5JECA 2D6FA 2YUIA 5F33A 4KGXA 4AG6A 2JGDB 2X2FA 1GFWA 2JVIA 4UNQA 1GGKA 5EP2A 3NUQA 1XZGA 3PDCA 4I8DA 2YCBA 3ETDA 3QXXA 4OXXA 4R2XA 4YAOA 4TRMA 2D5IA 3C5CA 4MPRA 5DGTA 5B30A 3M4ZA 1UPXA 1AUXA 3ZV7A 1KKUA 4QXQA 1NJ1A 3LUGA 1XGKA 1K8YB 1XKLA 4C1BA 2WW8A 2BFPA 1QIJA 2WMYA 3VU9A 4B33A 3O8NA 5I01A 4JHXA 1YBAA 3H5WA 2H4JA 2EDCA 4YQZA 3GFVA 2GPSA 3OE1A 2D1YA 4K03A 4M0FA 3DFMA 3L6DA 1SXJD 1TMYA 4RMNA 3PI7A 1NVFA 3EBOA 1NBIA 1YB1A 3WRYC 4E08A 2GN6A 5EHZA 5HUHA 1JJAA 4EY4A 2CYAA 4AKIA 4DQVA 3RC2A 5C4MA 3WB2A 3F2VA 1R6XA 1NKVA 1E2QA 1UC9A 1HT0A 1SXGA 1WHSA 1ZN9A 2IKSA 2YW2A 3ENKA 5AD1A 4HLUC 5CA0B 4X91A 5HWSA 1PR9A 5KWIA 5JXJA 3DBLB 3NBXX 2BBOA 3BX1A 5K9ZA 2NU9A 3L0CA 1D5CA 4ZCPA 4X1YA 4ZMSA 2ZQZA 4YY3B 1I1OA 2DWPA 2Q0QA 3TNJA 4CXMA 3DDCA 3RU2A 5IVDA 3OLYA 2P4QA 1T5SA 3UMRA 1P3Y1 2HLNA 2Y92A 3L6CA 4KIWA 4MPJA 2IZ6A 1JDSA 2N9UA 4FSXA 1L4FA 1WD7A 1OVGA 3BERA 4IUCS 4AY5A 5JJ5A 2G1AA 1QP0A 2EZ9A 2FPKA 1JALA 3QOWA 8GPBA 5IUKC 5JADA 1UBKS 3N7TA 2ZE6A 3OOEA 3A70A 2ZJ1A 4UNSA 1C0IA 1B42A 1L5ZA 1F2VA 3BTUA 5CK5A 5IVPA 2BGIA 2B83A 1KEEB 2ZREA 2YNMD 5F3RA 4DREA 3HVRA 1L4KA 1L7BA 2O3TA 4O25A 5E7MA 3OMLA 2Z3WA 3QENA 4EELA 2VDPB 5I7EA 3MTIA 2C5LA 3O92A 1JIKA 3I01M 5IJXA 1CV2A 3JR7A 1U28A 1XJWA 3NAQA 2EV9A 4G5FA 4HDKB 5TF0A 1OXSC 4BRUA 3P9ZA 3MT8A 3F78A 3C1UA 1SIOA 3VKUA 4HX9A 2QAGB 3OQIA 2FB9A 1PV1A 1SVOA 5DEOA 4M8SA 4OM8A 4ZCLA 5LU9A 2P62A 2ABWA 4ARCA 3A14A 2OP1A 3GNSA 4KI7A 4Q6WA 1XRMA 3LUAA 1J5EB 4CQMB 2FPPB 4QUJA 2XVYA 3RWBA 3GFQA 1LFDB 4DNOA 5KQSA 1WA5A 4KX5A 3ZHXA 1CD5A 4WJZA 2XQGA 1QXSA 1K6EA 1Z12A 3QNMA 4P4SB 3GEGA 3TYXA 2W0MA 5KYYB 3GT0A 2IPOA 2FDXA 2UUCB 4INPA 1Q12A 1XXLA 2HHJA 3C1TA 4F3RA 4Y2JA 1CZUA 3UWSA 4RTNA 3A9TA 1H2HA 3G7NA 4G1MB 3A3NA 4MYTA 1VG8A 3TX6A 3FTCA 1S5PA 1V8PA 2XF2A 4PZDA 4Y98A 4MR8B 4UTNA 4D9NA 3KL4A 1DKNA 1KMMA 1D6MA 1HZZA 1NVDA 1A9QA 3IAFA 1H6AA 3I8OA 4X85A 5TB5A 4HWRA 5I4IA 3U4QA 4BFCA 3K32A 2O8FB 4B31A 2DKOA 2Q0HA 1OXBB 1P2UA 2FZ5A 3M2TA 5JC1A 3KIPA 1USIA 2PMKA 2JGLA 5FWYA 1IDOA 1YR1A 2QU8A 4JLOA 4MXDA 1WUYA 4JI5B 1Y8ZA 1MPTA 1ZIYA 5F1YA 4N0QA 5JD6A 1JQEA 2X0RA 3EEFA 3TQFA 3DE2X 5F5XA 3K4QA 5C4GB 3ZHQA 2C2OA 2JD1A 2X2EA 2QJTA 3THRA 3DB1A 2HYDA 3ZV4A 1F4VA 1TEHA 4QKQA 3DO6A 2VJQA 3GJZA 3H2IA 3M1AA 5T4FA 3RYHB 1RSZA 4XGNA 2W2QA 2P11A 3RFUA 1D5WA 3P94A 3WYFA 2BSXA 1QPBA 3DW3X 3KD3A 2YCLA 1E1LA 4V38A 3AESA 5DGXA 4LXIA 4YC7A 2NT3A 1X7DA 2M6SA 4U0KA 3HZOA 5J5CA 2G06A 2NO6A 3OM8A 1RI1A 4KXXA 4E5NA 5DCUA 4C2UA 1RAEA 4TKUB 4MH0R 1G16A 2XMDA 1XK7A 2D54A 1PDVA 2EFHB 1TO1E 4XM1A 5B58T 2KW5A 1D04A 2CW5A 4BN4A 2C9CA 1DTWB 3SKVA 4G86A 1B93A 3LKZA 2QTVB 1SEPA 3ZEAA 2EYQA 4KVAA 4NXMB 1JEYB 1NNEA 4AJOA 3V1NA 3HCEA 4DSNA 4L5JA 3ULKA 3RUPA 3S29A 3A3OA 3DM9B 2KMLA 1P1BA 4OUDA 4C4ZA 1HFWA 2PRSA 3AIOA 3GRKA 2QLJA 5TGZA 1QZ3A 4S0XA 2H5JA 3FPKA 1CQJA 4IEFB 4UM9D 5J2TB 3C6BA 3RV3A 1EJBA 3GCDA 2IZOA 1YUNA 3IXMA 5H4GA 1V2GA 3VHQA 2V6BA 3IPLA 2NQ8A 2WSBA 2NACA 1P2BA 1W8DA 4JQSA 1R0YA 1GRNA 1B16A 3CRRA 4B8WA 4XGIA 4ZZ3A 5CBPB 1NN3A 2RHHA 4HFMA 2X8LA 3KV3O 4FS3A 2R1ZA 4AO7A 1K97A 5T5QA 4Q15A 1H22A 1NKTA 1Z5OA 3TQHA 5IAOA 3R76A 4BZQA 1XF9A 2RONA 4N8DA 5SY9A 2IIQA 3HVUA 1IL0A 2HCFA 4KB5A 4KQEA 5DHRA 3RH0A 3WZ2A 4B43A 4ZRDA 3ZZUA 2RD2A 4K9PA 3WK5A 1N7IA 2V5UA 3ZTWA 1SUWA 5C1BA 5KOJA 2ZEJA 5JOQA 2QVGA 5JATA 2JLRA 2FRDC 1CFZA 3PGLA 3G8AA 3ROEA 2FH5B 1DWOA 3C7AA 1A72A 3RBZA 4KWTA 4U02A 4M6WB 4NULA 1DJPA 3PNVA 3PQ6A 3TLGB 1MH9A 5I6DA 3QVGB 3JATB 1WDLA 4MRPA 3QVTA 1UM9B 1ZLXA 3IAUA 2OBFA 4U7FA 5EUCA 3RRNA 5BMOA 1E3WA 2AUMA 1C1YA 1MP0A 1YRHA 1KGDA 2EAUA 4F5WA 2PNFA 4H6PA 1LH0A 1DAOA 2IYZA 3BJRA 4TUYA 2J3KA 3P8ZA 4PGAA 3R7LA 2WHYA 2R7KA 2JLCA 3TL6A 3LG2A 4NG5A 4B7UA 3IQXA 4A82A 3UK2A 3SR0A 1PQ4A 1Z7BA 3SZUA 5J47A 3QU4A 1CNMA 1NOIA 2Q3FA 1PZNA 3EXIA 4WFQA 3PNPA 1X87A 4RTJA 3GVPA 2OOSA 4LS3A 1CNFA 5CD1A 3TIVA 4B7XA 5DTIA 3C8HA 3V3TA 3OSZA 2HBQA 1EUQA 4IICA 2X14A 1X80A 4A15A 1TEXA 1ML3A 4KLNA 1F3LA 2RI0A 3AF4A 2NUPB 3WWOA 5DN6A 2QLTA 1RYFA 5JSHA 4XSVA 1NUTA 3VUEA 1E5XA 2C1EA 4Y6RA 3O47A 4PYOA 1FK8A 1EDEA 3Q3JB 5EKSA 3TOCA 4KBFA 2XUIA 1DRJA 4QVGA 4KPGA 4QWWA 4MX8A 4RHXA 5BQXA 5AW3A 1J00A 3B1ZA 2XNJA 3MOGA 4ME6A 3TIFA 3LKVA 3BEOA 1LJ8A 5EL0A 1W4RA 4HMPA 2YVLA 1CR2A 1JWLA 2WTMA 4L5YA 1GY8A 3T1NA 1AN9A 3OIGA 1F5NA 3L0PA 4KDEA 4G25A 1T4BA 4OYLA 3Q2KA 4DMGA 2H92A 2NUBA 3HVHA 1S2GA 5H68A 4MPDA 2BKEA 4UMEA 4DSTA 5BSKA 5JVDF 1QGED 3L4BC 2H31A 5EPOA 4XX1A 4FCTA 5HZGA 5KHLB 1XPUA 4J7UA 2WD7B 5ALUA 4FDMA 1L4UA 3V97A 2OV4A 1OBHA 4RIIA 3RGWS 1PLKA 3AM3A 5FXMA 1KFEB 1ZCBA 1RYDA 3K2IA 1FU8A 4G1VA 3HV2A 4JUBA 5H3HA 3PU6A 3V8MA 1XQ6A 1C0EA 1VSUA 2GYUA 2WPDD 3FVQA 4Q3OA 5DBFA 4E1AA 5MN4A 1HYEA 1ADGA 2MWMA 4JSTA 1KVRA 3WLJA 3HXLA 2I8LA 2H9AA 1POXA 1MDBA 4RF2A 3JX9A 1B8VA 1RJ9B 1AKVA 1XSEA 4FN4A 3O75A 3GVHA 3ZWYA 4BX2A 1ZR4A 1QOZA 3WLMA 4NK4A 4BEWA 1XLWA 1F0YA 1O89A 2J3IA 1S89A 1IY1A 1DWPA 1GPNA 3FBWA 5MN5A 5DWDA 5D00A 2N46A 3S7ZA 5E38A 2MMGA 2YN4A 4LOIA 4DQKA 4TMKA 1FIUA 1PUIA 5C35A 4PX2A 1MQAA 1GZ5A 4HWGA 3AG5A 4Y7CA 3TZHA 2J32A 3CFYA 3C5HA 3E9ZA 1YIDA 1T5TA 2N1BA 4BFLA 4HH0A 1EFTA 1SKYB 2OFXA 3IPYA 4BZPA 2Q3JA 1LA2A 2JRCA 2BIFA 3MGGA 5F73A 2PUGA 4B32A 4BL5A 4MYHA 5HGJA 5ITZA 4BKRA 3H75A 3NWOA 1GZVA 2XGOA 1N2HA 2VATA 4X1KA 4XVHA 4AY6A 3AZQA 4WESB 2IYEA 3TIGA 4GD3Q 1A5BB 3ZWCA 3PR1A 5DBOA 3SE7A 1Q0ZA 3KXIA 4I5DA 4KVFA 3KPYA 2O54A 1Q0LA 2IIVA 2YMLA 4H1VA 4UNPA 1SXJA 4YLGA 5D87A 3VTAA 1K7CA 3HL4A 3O1LA 3N58A 2HCBA 5JS6A 5K1ZA 2XXAA 2Q4EA 2GOYA 4X41A 3TM5A 4N12A 4BMOB 2P1RA 3AP3A 4DZRA 3EY9A 2O2CA 2HT6A 5BR7A 2QG9A 3EQ7A 1JEJA 8OHMA 5I5EA 1GGFA 2C9MA 4FKMA 3EXHA 5L45A 1EK6A 4GF5A 2W6JD 1G20A 1X1TA 2B6HA 1FMLA 1N7HA 2V7GA 3JQ8B 3RM3A 4MVJF 2Z08A 4L5IA 1QU3A 2HL6A 1RBYA 1G21A 3R8XA 2X4IA 3S7TA 3IOCA 2CXQA 1E9FA 4BC0A 2GEVA 3GFSA 3N2KB 3PHIA 1VIMA 3HC7A 4NE2A 4C1NA 2ODAA 4L6AA 1TJ4A 2W6MA 1C7QA 1T9DA 4YGYA 5SY6A 4JC4A 4CCWA 2PRIA 2D5CA 2Y0EA 2WJYA 2GPTA 2P77A 3THSA 2LVBA 3ZHBA 4C89A 5THXA 1KH3A 1Q3HA 4RA9A 2QUIA 3OD5A 4WZBA 1X7GA 3O4RA 5C80A 1E6EA 1JEQB 3FETA 5EQFA 3JYPA 3O6VA 1DVRA 3SFVA 1T2FA 2I5PO 3PF8A 5SYAA 3RUDA 2HBZA 5AKYA 3SIPA 4C0XA 4MV6A 4YJ2A 4DHEA 1KQPA 1V48A 2R6FA 3R9XA 4DM3A 4HUTA 1ODKA 4JCCA 2XJ9A 4TWAA 1BVUA 1SKQA 2X86A 1QUFA 2C8JA 5GVSA 3EQZA 3FJYA 4QUHA 4MWCA 1DC7A 2H5EA 3T5BA 2JHAA 4AJEA 3S40A 4OHKA 3TMYA 2DQSA 1QHGA 3QVVA 4FHZA 4HLQB 4JU8A 4O3FA 5CNMA 4HTFA 4FUTA 3WQBA 1AK2A 2C5GA 1YS1X 1KDTA 4Q3EA 4L76A 1UZMA 3UK7A 4XTCS 1P0CA 5EZQA 2WHXA 3KYIB 1E2EA 2DY1A 3D4BA 1QIHA 5KAPA 3OO0A 2FMIA 1C30A 5IWAB 1E64A 1I24A 2D2FA 3BMCA 3A7DA 2WBLC 3OBIA 4X94A 2NX2A 5AT1A 2WJ6A 4E2YA 1MBZA 1WQ3A 4I4LA 4RMJA 1FUEA 3F4BA 4OHXA 5CM8B 1NU8A 1SPXA 2REOA 1S0UA 4ICIA 3MFYA 4IP0A 4IXMA 4YRRA 3VDMA 4QSHA 2WU0A 3Q9SA 4IDQA 4LMRA 3NDBB 2IHJA 1JSXA 1GT91 3WIOA 5A3SA 4Y2SA 5BV1A 4N5DA 5ELXA 1JDBC 5G0TA 4OO3A 3BAFA 1ONSA 1P2DA 2BLNA 2FOXA 1B0UA 1GTMA 2PH5A 2VUTA 4NI5A 4Y30A 2EGUA 4QYXA 1LLQA 1HL3A 3R0IA 2VS1A 5AKKA 3SXJA 3DYVA 2BEWA 2HBRA 3RVQA 1XALA 3S28A 2F9MA 2ZBFA 4UTOA 4C07A 5BWMA 1BOFA 3BWEA 1FRVA 2XDWA 3HKCB 1E2LA 1J4AA 1V3UA 4CMJA 5J3JA 1VYHA 4KXFB 5F78A 4ML3A 1CUZA 5AUQA 3R7FA 3RIHA 3VAAA 5CFRA 1CNEA 1FCJA 1FYVA 1YACA 4BEBA 3QLUA 1NP6A 4KR3A 3CUEF 1MA0A 3ESRA 1SEVA 2QP4A 3HYLA 2W2KB 1MUUA 3GGCA 4RQAA 4P6VF 1RT9A 2PV0A 3EXFB 1Z47A 4LJ9A 4MW7A 4CKXA 5KX5B 2JI8A 1O97C 2QRVB 3QV1A 2XBUA 5ECGC 5AYVA 3VSCA 3WBJA 4EZIA 1M5TA 3O0DA 4ALNA 3KVRA 4RK5A 3A9UA 1FQOA 5DM2A 1NVKA 4BNJA 4DBLC 4F21A 1HDEA 3NANA 1BROA 1E61A 1N9GB 3DSRA 3WMFA 4AF6A 4ISBA 1H66A 1SBZA 3PQCA 4ENTA 1XAHA 1IRIA 1WXFA 3M5DA 3SHOA 2BMJA 4FYWA 1RXVA 1A7UA 1IMOA 1NI4A 3UTCA 4RHCA 2UUPA 4YUZA 4Z7OB 4JDUA 2Z2YA 1WXQA 1EI9A 1VJ0A 5DX8A 1H2BA 3JD2A 4KAAA 2R47A 4ERXA 1GPAA 5KVVA 1E9AA 4IL5A 2PUJA 3OY7A 2ATEA 2VZEA 3IKMB 2PN1A 4IV8A 4IF6A 3IIKA 4NJMB 3TR6A 1N6KA 3LPCA 5FI0B 4NAHA 3EVBA 3OT1B 3EFBA 5K8JB 1V4NA 2WAOA 2REQA 3W4JA 4K8RB 3BQ9A 1UKCA 2ZGVA 3A4VA 4QXPA 1OWNA 1QRRA 5HJ5A 2VXBA 3PUYA 2NZ2A 5CX1B 2VTBB 1T6XA 2PRKA 2G28A 4JJGA 5DVZA 1UZNA 1NC1A 3JY6A 4PLHA 4UUMA 1M8PA 1DG3A 1V5FA 1DBIA 3BICA 3NVAA 4RELA 5LP6C 2VLBA 3ZE2B 2ADFA 2RHCA 3HB1A 3PPWA 5EZ5A 3AVPA 3OWOA 4ARUA 3IUJA 3I30X 1MW8X 5JMPA 4LXYA 3MRTA 1KTVA 4TKMA 3WB9A 2C97A 2H65A 1JBEA 5K5EA 3CZMA 1BX0A 2IYTA 1DXQA 4QTXA 4EYSA 5CFQA 2J9FA 2IYVA 4AZTA 2PL9A 4MP3A 5E6UB 1A5AB 2J6IA 4OK6A 4PLWA 2YKGA 4BXOA 1RWXA 2OECA 2X2PA 3TSOA 1IB0A 1TCVA 2HF8A 3A6HA 4Z4CA 4YT8A 1J97A 1KR5A 1COZA 4XA8A 4E4TA 1DCMA 1PFVA 5GOTA 3SYLA 3SQLA 1Y1LA 3KDAA 1KEKA 2PL1A 3ECSA 4LMPA 1JU3A 1E4YA 1VIDA 1ZVKA 2HHLA 1EJ0A 1JZSA 3IRVA 3LPMA 4FDUA 4GEGA 4M8IA 5EINA 5KIAA 3OHSX 2XOEA 3EBPA 5AW5A 3HB5X 4MGEA 3JSAA 1QGAA 4CM6A 1Y1SA 4Y2VA 2OCPA 4UBJA 4WBSA 4C0LA 4LG1A 5DBHX 2C4HA 3QBTA 2R86A 5KHAA 4D56A 1XKQA 8MHTA 4WOKA 3RC1A 5KYGA 2ZR8A 1D0SA 3HS3A 1L5HB 3OA0A 4B3MB 4EI2A 1DV1A 3T7AA 1LPAB 4JZYA 1T8PA 1XEAA 3OFJA 5BNFA 2Q07A 2X1HA 4URFA 3RANA 4BBAA 1G7RA 2Q5OA 4PYRA 4QA9A 2XGJA 2WSLA 1YC2A 5EXDA 4LDNA 4I4TF 2WFZA 2JH3A 4DJAA 4GNRA 4RJTA 2X15A 2WSIA 3QG1A 4BQEA 4IF4A 1N4AA 3DAOA 1U31A 4C0SA 2CXHA 2FSSA 1K3TA 1TU3A 3QEOA 5KTMA 4IDCA 3BQMB 5L4NA 3DH0A 2W6QA 1O6CA 7REQA 5AW4A 3F6SA 2G88A 4PGMA 1RYBA 4KCGA 3QPDA 2W83A 4PYMA 3AUUA 5AJWA 1RW4A 5I8PA 1BHQ1 1QVRA 1JI0A 4OK5A 3MQ2A 1CUVA 1GAJA 4PXYA 2VRCD 3RVJA 1WMSA 1WULS 3BIWA 3OQ1A 2FCAA 1P7WA 3LWNA 1V7QA 2DR3A 1P81A 2RH4A 3P27A 4PWYA 3UXYA 1ZSYA 2PEZA 1E0AA 4X61A 4R83A 1F2DA 1HQYE 2IU3A 4K9OA 1TM1E 1W93A 2HGSA 2VP0A 3A27A 3GLHE 4I8IA 1JSRA 4KQFA 3V8VA 1T91A 5AW0A 1X7YB 3N59A 3WA6A 2HJRA 1T8YA 1L9KA 3PC4A 5EJAA 5E95A 2QUAA 3R6GA 1GPDG 3TD9A 1ECBA 4OF4A 5KMGA 3M7IA 1D7AA 2SCUB 2PKCA 1XCMA 3BSYA 3E5NA 4QBGB 4TZ0A 2I3BA 1ZI8A 2FZCA 3HCDA 3VX4A 1U2GA 4WXRA 1UMDA 2CNLA 4M1WA 3RYFA 5T6MA 1YNOA 3LUHA 4Z3DA 4GDFA 4QOIA 2OTCA 2JLAA 3NHWA 5HE8A 1VPTA 4OIMA 3TINA 1P2FA 1YJAA 2CLIB 3GXOA 2OK7A 5D3QA 5TT0A 2ONCA 3SIWA 3LT1A 1JH8A 1MD9A 4CMHA 2ZTUA 2ZKIA 4QXMA 4CIAA 4XGKA 1DBQA 2CL0X 1P4HA 2RGEA 3I2IA 1VKZA 3IVGA 2Z43A 4E22A 5K3OA 1ZCZA 2XDQA 4ZI3A 2B92A 2PT7A 1TT5A 3MNFA 5JT1A 4MR7A 4Q34A 3E22B 3WK9A 2XYRA 3TOVA 1Z9BA 3ONWA 1S8NA 2DFVA 3HR4A 4JIGA 4P7KA 1TT7A 3HWRA 4INOA 4L3OA 4RNCA 1JTVA 3AJRA 3BRWD 1M2WA 3O82A 5D6OA 4UE2A 1XTKA 5ALPA 4ZVPA 1G9TA 3CGGA 1HE5A 1W0JD 3B12A 2BFCA 4DLZA 4XJTA 1TC2A 4HN4B 3FCOA 2IBTA 2LKCA 2BEJA 1X42A 2AQIA 4PGGA 1GZ7A 4TWRA 5BURA 1BRMA 1R6UA 2QN8A 2C78A 3S55A 2FLKA 3Q9UA 4UUQA 2NTNA 2HSZA 3CH4B 2JJ2D 2Y6VA 4QYWA 5LR6A 2Q9CA 2XXJA 3KQLA 4NVRA 5KKAA 5DM4A 5IDWA 5IWCA 3CVUA 4E5SA 3X43A 2J9RA 3DZBA 4I9FA 1D2NA 1G66A 4FS8A 1P7ZA 4CYMA 1UMCA 3PE4A 3N6XA 1FFDA 4XUCA 1TM3E 1VJ1A 1OH6A 4Z8XA 3EPPA 3IMGA 4G5HA 3GLGA 2P30A 4MW9A 5AJHA 5AHRA 1WDMA 1DKOA 1ULBA 3ZE7A 4F2DA 1N3IA 1XZ8A 4W9NC 5AXCA 4C7KA 4D9IA 5BN3B 1XWWA 2B7LA 5P21A 4DLWA 2MINB 4GPBA 4P84A 2IEIA 3EF0A 1UKEA 4RJJA 5BN1A 4MRAA 2YN2A 1Z7EA 5A04A 1YK0A 1T3SA 5HCIA 5IT5A 1VMIA 4PE5B 5JSYA 1G8JA 4I1RA 4GGMX 1XROA 2Z3VA 2PNJA 5IXYA 2VP5A 1ADFA 1E7RA 2HTEA 4EUEA 1UPTA 2B1JA 1CPYA 3SJAA 4BP9A 4JBYA 3I6BA 5ICGA 5FBZA 4FMBB 2AS0A 1ZVVA 4PAQA 2G9UA 221PA 2P3QA 4M1OA 3P0RA 1UINA 3VPAA 2GLTA 2B94A 3DTTA 3WL6A 4HQKA 5A6VA 3VOSA 1RXSA 1T4GA 2BGNA 2YQZA 4FNOA 1Y4DE 4WDQA 5EWLA 2OZEA 5LJIA 1M1UA 5TPWB 3KKLA 1A95A 3D4PA 3MWKA 3S8MA 3N2IA 2BJHA 2PD4A 3WHPA 1HNXB 4EVQA 4EGFA 1TTTA 1D2RA 1R6DA 2VN8A 1Z83A 3DD1A 5L8VA 2EGHA 2GNOA 2XWSA 1TM5E 4MHTA 4J4HA 3MBOA 2ROQA 1O87A 2ILVA 4F97A 5KVQA 5CB8A 1YR9A 3QE0A 2NUTA 5BOSB 1K6IA 5CVEA 3ZJ5A 3CJQA 3O8BA 1Y7HA 3MWJA 2H3EA 3L46A 4XUEA 5GTDA 2FZEA 4BKPA 4DNQA 3NBFA 3U9SA 4F6RB 2D13A 1OJ7A 2VPWA 2H4WA 2I6QA 5LP6F 1A77A 4C0JA 4MVJH 4LX8A 2HNKA 2JFHA 2QQEA 2P3OA 4DSAA 5K8TA 1KSFX 5FULA 1FNBA 5TVGA 3KT0A 3I28A 3I39X 4TLMB 3F96A 1HE1C 2J6BA 3UC5A 5JXGA 3AETB 2RGXA 1DQNA 2A0UA 4HB3A 3TUIC 5KYXB 4NENA 2BSQA 3QYAA 1PZXA 1CE8B 4RMGA 4Q4JB 2D2IA 2QD1A 1Q1BA 3B6ZA 2DBYA 3WAKA 4O59O 4DQ0A 1U3CA 1W5BA 4QSMA 1QO0A 1II8A 4IUBS 4GL4A 4BVAA 1BC5A 4DT1A 2B7CA 2CB0A 2PE5A 3K8QA 3PCTA 3GH3A 4GLBA 3JU3A 3V4PB 3SVLA 1UOOA 2RMKA 2PX3A 1XRRA 2XHZA 3MPUA 4YCLA 2FQYA 3V1YA 3FZYA 1TOAA 1XN1A 2VHWA 1DSSG 3R6WA 3B9QA 2YR0A 2AN9A 2VP3A 1FXWF 3ZLVA 1E99A 4QDJA 4WI1A 2PJRA 1C7ZA 1EIZA 1RWOA 3N2GA 2X22A 3STHA 4C43A 4CF5A 4EHKA 3CB4A 1O0CA 4OX9Y 5M3BA 2DBVO 3TLXA 4PO1A 3LUJA 3GCZA 4RL4A 3VC2A 2DFLA 4GI7A 3UJBA 5LYYA 2D1FA 2VCHA 1UPFA 4O0MA 4P4GA 1U63A 3ZI7A 4Z7QB 2GO1A 2Y8EA 3PEEA 2Z5FA 4RFLA 1RLMA 1JZQA 3W06A 1E5DA 1Y9AA 1U1EA