3QENA

S74e dck in complex with 5-bromodeoxycytidine and udp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
236
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 92
structure length 236
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qenA00
3FKQA 2Z0MA 2ZE8A 3QXCA 4D25A 3QBTA 4CEHA 1DAFA 2OV2A 4TTRA 3U3OA 1DAGA 1T3LA 4P0TA 5JCPA 2FU5C 4WAUA 1XRJA 4C4PA 4K46A 2AX4A 4HLCA 5J4KA 1GKUB 1XWIA 1TU3A 2NO6A 3UANA 1RRPA 4AG6A 5C18A 4IDQA 1KMHA 4B3CA 4IDOA 4LX0A 4AD8A 4BZPA 1G6HA 1P6XA 3OHMA 3GJ0A 2WBLC 4AURA 2CLCX 3RANA 1OFHA 3K70D 4DCUA 1R10A 4U5XA 3C14C 2R9VA 2OFOA 1F2TA 1VPLA 2ZUBA 2FFAA 3KJIA 3FB4A 3TQCA 5KSZA 2MSDB 3Q7PA 1GIAA 3NEJA 4IDNA 4XVRA 1YVDA 3HP1A 4M9SA 5FUVA 3LLMA 4DKXA 4BRUA 3R7WB 3BRWD 1SGWA 2GHIA 4LBWA 1G4UR 1W1WA 4C7OA 1WB9A 4ZO4A 4EPXA 4XSGA 1NVVR 4FD2A 4N0EA 5L3SB 4IJMA 3AF1A 2ONKA 4PSKA 4CGZA 4MH0R 1E2IA 3BB1A 4KVGA 1Z2AA 4G0NA 2IA5A 4OQFA 3T1QA 2ZREA 3FHTA 2WVJA 4QBHA 4FCTA 1RJ9B 1UKYA 1ZM2A 3L43A 4TLAA 1DG3A 1E2QA 1KI1A 4II7A 1RYHA 1TU4A 2IK8A 3U2QA 2J7PA 4KXFB 1PUIA 2ZRAA 3U7HB 1A1VA 5UKDA 2JLRA 3CRRA 4BFTA 2O8EA 1D2NA 1P61B 4KSBA 2DCUA 2GF9A 4M1YA 4YC7A 1EFRA 1FMLA 2C98A 3BAFA 3FWYA 3Q7QA 4Q1AA 3REGA 5TVKA 1BIFA 3ZDQA 421PA 1KKMA 2R6AA 1JJ7A 1ZM3A 2IYXA 1II0A 4Q4AB 5CB6A 2D7CA 4FMCF 5C46F 4G5GA 2DR3A 2J7KA 4Q5IA 1AGPA 3I5YA 2RGAA 2DPXA 2ZYWX 4IKEA 4M1MA 1E9DA 4AKGA 2R6GA 2XB2A 1GRNA 2Z4SA 4V0NA 4GNKA 2P6RA 1RC8A 4W5HA 4AYXA 1DAKA 821PA 1ZC3A 2ZYTX 1II8A 3CNLA 4TMKA 4OHWA 3I62A 5EP4A 2OT3B 4HUQA 2CJWA 2D62A 2IS4A 3MCAA 4OJKA 1ODFA 3VR1A 1ZD9A 4XJXA 1KNQA 2QAGC 4OI0A 3FVQA 2XEXA 1R6BX 4QL3A 4PC2A 4YDHB 1E2NA 4NKRA 3VU9B 8OHMA 3CX7A 4ACBA 1W4RA 1GNQA 4MGIR 1ZYUA 2J9RA 3TVDA 1P2SA 2AK3A 4DUGD 2ZROA 4EIWA 4NHOA 4M1SA 4ESHA 2KJQA 5FPHA 2UKDA 4EFMA 4LRWA 2EYQA 1XPOA 1W4CA 2JLZA 2CNWA 2J41A 3LNCA 3R9IA 2PBRA 2XNDA 1DELA 4WZAE 4LHYA 4RD1A 1P5ZB 4D4KA 5B57C 2GXAA 3AVPA 4QOSA 5EXXA 4AK9A 3KZ1E 4NCNA 3L2OB 3T1VA 2XJ4A 5JJLA 3KQKA 4POAA 1IN7A 2IXFA 2WM9B 3F5FA 2F43B 3DM5A 1NVXQ 2BDTA 2IHYA 4PZZA 121PA 5J47A 4M1KA 3UWOA 1P2TA 4Q1CA 4LJYA 4RD6A 1KNXA 4AC9A 4C0SA 1NKTA 3UIEA 2OM2A 4CEIB 1BO6A 1MO3A 4LJ5A 2VEDA 3GEEA 3H4MA 1N2CE 4NBSA 3U3KA 5KNCA 1SKYE 2ERXA 3PUVA 4RY2A 1IN6A 3AQ4A 3PUXA 1IN5A 1XEFA 2C96A 3FFAA 3NBZC 3NH6A 4KBGA 3RS0A 2WTUA 4LYHA 3QNUA 4W5WA 4LYAA 1NL3A 3D3QA 4MDEA 5KDOA 3G5UA 1ZCBA 3RRMA 4ON9A 4CZ2A 4JYBA 4ASUD 3X2SA 2QM7A 1TNDA 5CLLA 5J40A 4D82A 2RGGA 4B2LA 1PV4A 2AR7A 1E2KA 1JAHA 2ZR0A 4JBWA 1RRFA 2VO1A 2ZRJA 3BWDD 5E7IA 4O3MA 2GF0A 2JJ2D 1CEEA 1AQUA 2BC9A 3GJ8A 1ZUHA 1JQLB 3OIVA 3B1XA 4B71A 1K5DA 1YR7A 2GJ9A 4Q1EA 4C0BA 2FX3A 2QMUA 3MWJA 3OFNA 1DO0A 2XX3A 1PLKA 5H70A 3SZRA 2HEIA 4B3DA 1WP9A 3LQRA 4HATA 4IEIA 3UXMA 2W6IA 1VHLA 2C5LA 5J4YA 3IIKA 2DFNA 3MFYA 5CIWA 1SHZA 3EG5A 1XTKA 4GFDA 3G82C 3MJRA 4QGGA 4E07A 4BGDA 3NBYC 5AJZA 1OT3A 2R6CA 2W0MA 1VG8A 3TLXA 1R4AA 1TEVA 2PL3A 3WHKA 4DLZA 2P67A 4HAVA 2ODEA 3H86A 4LWZA 3GJXC 4AG5A 4DBLC 2ZRIA 2IYRA 3QEOA 2AWOA 4GZMA 4JT2A 1IQPA 3UMRA 3FTQA 4JL8A 1KK3A 4OQLA 4QM7A 3FGNA 4PHHA 4CRWB 3V9PA 4Q9HA 1ZIOA 1OFTA 1G6OA 1N5JA 1X8KA 3U3MA 1GZSA 1YHNA 4HDCA 3H1TA 2WSMA 5JLJA 4UNNA 4J0QA 5HKKD 4R98A 1E94E 3BERA 2WJVA 3Q8XB 4XD7A 3QF7A 5LBIA 4CVNA 3OE7A 1Z22A 2VP6A 1Q0UA 4DLRA 1XMSA 2XSZD 1QG4A 3QEJA 2UZ3A 5E95A 1II9A 3RS3A 3SE0A 2ZAOA 2C95A 1E9RA 3B7GA 4Q47A 2FJUA 2GXUA 1G8GA 2WSSD 2ASEA 2GETA 1RKBA 3T35A 1UAAA 4NDZA 1N5LA 2I4IA 5E4FA 3HYTA 3CRQA 4UJ3A 3IO5A 1E2FA 2V6JA 4KI0A 2OFWA 4A2QA 221PA 4A8JC 4WVFA 3QG1A 4FMDB 2W6JA 2WKPA 1HYQA 3ZIAA 4PHFA 2QROA 1MV5A 3GMTA 2V7QD 5CJ2A 1CJMA 4TWZA 1M7HA 4GOKA 2F1HA 1OB2A 2XZOA 4A2PA 3SU8A 1M34E 3K70B 2BCGY 1CBUA 2V1XA 3K1JA 1AKEA 2SHKA 3QSYA 4OKSA 1GITA 5KDLA 1NLZA 1H8HD 4MYUA 3K0AA 1P7CA 4E09A 1NSFA 1GKYA 4G5OA 4JL5A 4PC7A 1RPZA 1TUIA 4DT1A 2OEPA 3B6EA 4B73A 4DHEA 1P62B 4PPGA 2VHQA 1NJFA 2HUPA 4RKEA 5EP3A 4MRVA 2VP9A 5FTKA 2F1IA 4CT4B 4P4UA 4D4JA 5GVSA 1E99A 1G291 2C04A 4HB4A 2B8TA 1C1YA 1G1MA 1SULA 4JLAA 5G41A 2ZSAA 1FMJA 4M8NE 2J0QA 1Z0KA 4MKIA 5FPSA 3TH5A 2WMOB 2DFTA 2VH5R 5TB5A 4R2HA 3B9PA 4RD2A 1SQ5A 1VCOA 2PJRA 3GLHA 4MDFA 3U7GA 1N6HA 4HLUA 3V4FA 4I1OA 2X77A 3GCGA 5HZKA 3WMEA 5JEEA 2G83A 2JLWA 2QE7D 1YZNA 2J5XA 4OHVA 4EJSA 3EPKA 4CEJA 4O2LA 3U7EB 1ZC4A 3K8YA 1YU9A 1S3GA 3HU1A 621PA 3QBVA 2B7CA 4DLXA 3VKGA 4NYMR 2PMDA 3NBFA 2CCGA 4QJ3A 4A36A 3CX6A 1KO8A 3AP1A 1OH8A 2ZI4A 2EYUA 3LX5A 3A1VA 1HH4A 4ZCLA 1IJEA 4B35A 3C7KA 1CLUA 1S9DA 3EW9A 3WBKA 2CK3A 2GK6A 2HXYA 2WOJA 2AKYA 2J0UA 4BE7B 3EZ9A 4WZ6A 1FFHA 1FOEB 5JEDA 4NCIA 1T4GA 1U0LA 4FINA 2H7VA 3B8HA 2GWHA 1KJYA 1G5RA 1KMHB 4Z8YA 2F9LA 2HJVA 2N1BA 2YVUA 1JR3E 2N46A 5GJBA 2QN6A 1K5GA 4M0LA 5A5GA 4A0HA 4P4SB 2XJ9A 2EWWA 3ECCA 3I4LA 2XB4A 4NMMA 1G3MA 4DSUA 5KPJA 5FBVB 1XD2A 5KSOA 3TMKA 4B6FA 1FL9A 2A9KA 2BV3A 3RS2A 4RCZA 4JLDA 1N6KA 1U0JA 2C78A 3LX8A 2P65A 1XD8A 4IDHA 5BQ5A 3ZZTA 3KKNA 2G0TA 3MG9A 3BORA 4QXAA 1XEWX 4JKYA 4B3XA 2IW3A 2FMXA 2A5YB 2VL7A 3TQFA 3TW8B 2BBSA 2Q3MA 4DSTA 1NN3A 4XWOA 3VKWA 3EWAA 3B82A 3LWNA 4MKFA 2Q9CA 1E0AA 4Q4AA 2O8FB 5EUMA 3O8DA 4UNSA 1E4YA 1ZUIA 3KB2A 2CCKA 2B8WA 3ASZA 4LV6A 5BN3A 1UF9A 4B6EA 4KYUA 1OKKA 5FL3A 4BFZA 2XXAA 1JPNA 4BECA 1SXJD 3D6TB 1LY1A 3VR2A 3JVVA 5CB8A 2QMHA 1E9SA 1KAOA 1CJTC 3ZH9B 5L8VA 4IW3B 2VA8A 4TYWA 3B85A 2QQ0A 1HQYE 4IOKA 4YLGA 4X8HA 1E0SA 1L7VC 3C41J 1DARA 2W2TA 4XOIA 3AKDA 4KU4A 2O8EB 3BC1A 1DAHA 2ZI6A 2FFBA 3HU3A 1AS2A 4TQUS 5FOUA 4BFUA 5DHAA 5FTJA 3NDPA 3BE4A 2TMKA 4RVCA 3W34A 1TQ6A 5KDDA 1DPFA 1RRCA 4D0NA 3UK6A 1N25A 3DL0A 4KSCA 1GOTA 1Z6AA 5L3VA 1H8ED 4Q4JA 4LJ8A 4Z51A 3PR1A 3NVAA 1NLYA 4KJZA 5JRZA 5GVRA 1Z0AA 1T9HA 3TBKA 4A0GA 5JWHA 2V8OA 4MQBA 1XZPA 1Z6XA 5AUNB 5FUXA 2HLDD 4RD0A 2IYVA 3QKRA 3W5IA 2YZ2A 1KIMA 1WXQA 2C77A 3DKVA 2WMNB 4YMTA 3ADKA 4F93B 1R0XA 2C9CA 2D06A 4Q4HA 1L2TA 1U90A 1XTSA 4Q48A 5CM9C 2O8BB 1OSNA 2WJIA 1PUJA 2JJ8A 3C5CA 2GJAA 5C2JB 5DI3A 5J4HA 1UKVY 3KJGA 1XEXB 1ZIPA 4PX9A 3THOA 3OESA 3N5CA 1YZKA 5DGXA 3B9QA 2GCOB 1F2UA 1NBMD 2GVZC 3RDPA 5FBRB 3AVUA 3S1AB 3EPHA 2BEJA 4M53A 1AQYA 1Q20A 1UBGA 4U02A 4A82A 2VSOA 4OL0A 4FN5A 2JGNA 5GADl 5KTYA 2W6ID 1GNRA 4TYQA 2EU8A 2WKRA 4MYHA 4DEYA 5HTKA 2ZSEA 1F5NA 1OYYA 3KX2A 1RIFA 4ITRC 2BVNA 3THYB 1G21E 4N1AA 5KSYA 1KDPA 2A30A 3DMDA 3ETLA 1W36C 4LHVA 4QNRA 3VR6A 1JALA 3K9LA 2AD5A 1ZBDA 3EXAA 2AKAB 4B32A 2GVDC 3EZ2A 3TUZC 1XPRA 5F9FA 1MT0A 4D80A 2ZXUA 1OFIA 3KFVA 3HR8A 4URXR 3IPYA 2BMDA 4LCBA 1FZQA 1YR8A 4PO9A 1W49A 4RZUA 5EZ6B 3SJAA 1WBDA 2VF7A 2Z6VA 1OXVA 2NGRA 4W5JA 3U3RA 2F6RA 3PITA 2GZAA 1OJLA 3ZYCA 2ZUDA 4AKHA 4DDWA 1IONA 2OCAA 5C1BA 3B1VA 1EK0A 5JS8A 4AI6A 3O8CA 2NPFA 3ZJYA 3OIWA 2ORWA 3IGFA 2BBWA 1ZNZA 2R44A 1VIAA 3CZQA 5AR1A 3KB1A 3MAAC 1JQJC 4PAOA 4U7DA 4FIDA 4JKIA 1S96A 4BZQA 3AVXA 1KZGB 2VQSA 3BFVA 1AZTA 1GVNB 3CB4A 3CF6R 1W0KD 1R8SA 1S1MA 5HE8A 1KK0A 2R2AA 1VDZA 1N5KA 3H2YA 1DS6A 2REBA 2QENA 1EWQA 4QBIA 3LW8A 3ZVMA 4G5QA 3HDTA 4B47A 2E9SA 4DT1B 3K70C 1TTTA 4EJSB 3OEHA 1LF5A 1NIJA 1CKEA 3RYTC 3EC1A 4DXAA 2GTPA 4DLYA 5SZIA 4TN1A 2Q0HA 2X19A 2PCLA 4AIIA 3T34A 1R5OA 3DEFA 2EQBA 1I4DD 2FZLA 2WWYA 2XITA 1EWRA 1CF4A 5CM8B 1IY1A 2GNOA 3SDZA 4URUR 3BK7A 2FN4A 2BCJQ 2ZU6A 3ZGXA 3VR3A 2C99A 3E70C 2REXB 3RHFA 1ZCAA 3NC0C 4L15A 1GAJA 4WA7A 2Z83A 4LK2A 3THWB 2LCFA 2IYSA 2IYWA 1H8HA 2OO7A 2QG6A 5KNBA 3RRNA 5CDFE 4Y0VA 1US8B 1D2MA 3ZS8A 5FR2A 1MABB 1PJRA 4RFSB 5DLQC 4ARZB 4LJ7A 4OI2A 5FUWA 4V0OA 4C3ZA 3THWA 1GRRA 2IT1A 2H92A 3EPLA 1FTSA 4A9AA 4G5SA 1W7AA 2ATXA 4GL2A 1K8RA 5FFMA 1TMKA 1SVOA 4WIAA 2O8CB 3W8RA 1JPJA 2FEMA 3O47A 1VCIA 1U9IC 5FL7D 1RJ9A 1SKYB 1E32A 4PAQA 4V0KA 2R6DA 1QHSA 1QVRA 2FE4A 4CIDA 3AF3A 4EAQA 1G41A 1HA3A 1O87A 2IS2A 1TEXA 1GFIA 2Q9BA 3A37A 3AVVA 5JS7A 1KI3A 1Y3AA 1VHTA 2QE7A 2GCOA 3EARA 1YE8A 2KB0A 3IO3A 3RNLA 1NG9A 5CYPA 4A2WA 4EFLA 5JMTA 2NO1A 4US0R 3WRXC 1EESA 3MLEA 5EQTA 5JI3E 1TAGA 1T8UA 5E7JA 1AM4D 3A1WA 1AA9A 2VHUA 1E9AA 2GZDA 3FOZA 2OCPA 2OFXA 1LTQA 5CYOA 3VMFA 3BOSA 3PUYA 5DO9A 1XTJA 1R0ZA 1CRPA 1E1QD 4IVRA 4F4CA 5J4LA 4QGAA 2NZ8A 1KSJA 3EAQA 4KFTA 1XMVA 4LJ6A 2WJHA 4WXPA 4GI7A 1A2BA 4JLJA 4DLSA 2QRNA 2ZI9A 1SXJB 2UVQA 4MA4A 2YC2C 4Q21A 2P3SA 2FV8A 1J99A 2RHDA 2HYDA 2DFLA 1X1RA 2IHBA 3BIFA 3CWZA 4QHYA 4UKDA 1GKIA 2RB4A 2NMVA 4ZDIA 3VR5A 1JXMA 1Z28A 4A6PA 4HI0E 1IHUA 1XJCA 2F55A 2KI5A 4Q19A 5DIFA 4NZYA 3MJHA 5FPKA 3K09C 3BFXA 4HB2A 4EDHA 2IF0A 3GFOA 1LB1B 2ZE5A 2PT7A 3CPEA 4PHTA 5JHHB 3U4QA 2GAAA 1UDXA 2F9MA 1MOZA 1XXHE 1JR3D 2IEZA 2IXEA 4QJ4A 4NONA 4PPFA 3AUXA 1KI4A 3KJEA 2NO7A 3PXGA 1P9NA 2L0XA 1KJWA 2OXCA 5H68A 4BRWA 1KO7A 3UMFA 1OH7A 3GJ6A 3ZVRA 3U7FB 2O8DB 2J87A 1F3OA 4KFUA 3T12A 1SVMA 2YWFA 3LVQE 3TSZA 4BFSA 4C0KA 1NIPA 1NVVQ 1XDBA 1VMAA 2EVWX 2OCYC 1OXTA 3BH7A 4NE2A 2WIBA 1MR3F 4RSGA 3N2EA 1Z0JA 4JBYA 4X8MA 1OKKD 1VCNA 1FNNA 3WNCA 4FW9A 1ETUA 4R7ZA 5FTLA 1KSHA 5DI3B 1F2TB 2P5TB 1YZTA 4XWAA 2A5JA 4MRPA 2XNDD 3IHLA 3CUEF 4C0HA 2G3YA 1QHGA 3KQLA 4TL7A 4GT1A 2ODBA 3U5ZB 3ZLJA 3GLFB 1NN1A 4D6PA 4LBZA 1G8PA 2AXNA 3RRZA 3T06B 3N70A 2OBMA 1KTVA 1OF1A 2FSGA 4FMCB 1XFAA 5JZVA 2ORIA 1MH1A 4OYHA 3NTUA 1WBBA 1YR6A 2AHOA 5FPYA 4HEJA 5FBQB 1XXHA 2NG1A 5AK0A 1JNYA 2VP4A 3WXMA 2VHJA 4UNQA 1R0WA 1JR6A 2ZETA 3V4RA 2PZEA 1LVGA 4MRNA 2OG2A 1P72A 4URYR 1HQCA 4DEXA 3EPJA 1T5IA 2FWRA 3LDAA 2P5SA 3LLUA 5F98A 5JBQA 1WQ1R 5AWFC 2IL1A 5AJXA 4JVSB 5JECA 1E79A 1L4UA 2J3EA 3FMOB 4KFRA 4EPRA 2YYZA 4R9UC 1N6IA 2EFGA 4ZIRA 2D3WA 1COWD 2NTYC 4F4IA 4FWTA 1MO4A 2YWGA 3RSLA 2F7SA 2JDID 2JATA 1A5TA 2XZLA 1Z6TA 5BN4A 3TUJC 2V9PA 1DADA 3I61A 2H5EA 4ACAA 2XTZA 1W46A 1S8FA 4TLBA 3VTKA 3VX4A 1D9ZA 1D5CA 3CRVA 1TPZA 2V6IA 1GRQA 1TADA 2O8FA 4N3NA 2BEKA 3DOEA 2LKDA 1BKDR 2GEDA 2I1VB 3RSOA 2ANBA 2ZRKA 2QPAA 2WOOA 4RZ3A 1XJQA 1XCPA 2QP3A 4Q9JA 4HAZA 3VFDA 3GLGE 2QMEA 5AJVB 4QM6A 2O8CA 3HWSA 1S0UA 3Q72A 1MKYA 3CRW1 1KHTA 2D7DA 1EFHA 4F91B 3I3SR 3LW7A 5EE3A 2YKGA 5TY0A 2OUKA 4Z1MA 3L0PA 3ND8A 2JCSA 2RCNA 3IUYA 5B2ZA 3CW2A 4WBSA 5EUQB 1J70A 2O0HA 1KYIA 1IAQA 1UBFA 3LBHA 4PPNA 1E1RD 2N42A 2ZSFA 3QY0A 3OAAD 2OSBA 1Q1QA 4TLEA 3GLIA 5EXPA 3DMNA 4JT4A 4LPKA 2GKSA 2W83A 5TXGA 1OXSC 5K8UA 1ZMXA 5D3MA 3MUFA 2JIZA 1T3SA 2ZYVX 2ZQ5A 5FTNA 3ICQB 3R8FA 3WY9A 2RGBA 1E2GA 4EJSC 4TL6A 4HZUA 1GUAA 1W4BA 2ZRNA 3AF4A 1OXXK 3OIUA 1XNJA 1HE1C 1T3HA 5FUYA 1Z83A 3GJ7A 3L0OA 2E87A 4XVQA 2HCJB 3OEED 1A7JA 3RS7A 2CHGA 2IS1A 1SVKA 2CVHA 2IEYA 3UWKA 1KMQA 2QTVB 3FFBA 3QF4B 4B44A 2GDJA 2DFKB 3U6KA 5BWMA 1MRSA 2GEUA 1XCGB 2ZJOA 2ORVA 5IK2D 2BJVA 3CF2A 4LHZA 3PEUA 2AFHE 3OEHD 4CEIA 3TAHA 4HSEA 2GESA 1C9KA 3DDCA 2GA8A 1FP7A 4IHQA 4NYJR 4AYTA 4OK5A 1KI2A 3QXSA 3UMSA 1XTRA 2BM0A 4OJQA 1RYFA 3A58B 3KKMA 3LVRE 1JEDA 3B13B 1OH6A 3C4JA 5F3WB 3AKYA 1D6JA 4A15A 5KUTA 1OPXA 5L3QB 1TQDA 3SJCA 1N0WA 3EC2A 4TL9A 2CDNA 5LDDC 3JZAA 4ZDJA 3NHAA 2AD1A 4UQOA 4YMVA 4GP6A 4JIMA 4LV8B 4LBVA 4LY6A 4Q1DA 1MO6A 4PQFA 3R9XA 4TYYA 3K9GA 4DDUA 3A1SA 4QKQA 1E2JA 1ZNXA 5TDHA 5JWRA 2FG5A 4KITB 2F1JA 3GD7A 4P33A 1SVWA 3NHBA 1L4YA 2QGNA 2BBTA 3ICEA 2WICA 3EWSA 4C0JA 3X1YA 1XPUA 3PEYA 4CW7A 4G5RA 5K8LA 1YRBA 3LY5A 3J81k 5CDFA 3O8BA 3ZQ6A 1NN0A 3EASA 4CYMA 1GL7A 1G18A 1U8YA 5CJPA 3QPWA 3QI2A 1IN4A 3ZS9A 2CJWB 2GBLA 3CR7A 4K8OA 3MD0A 4C2UA 2JLVA 1KK1A 3F8TA 3NIBA 4DCVA 1W47A 1LS1A 1SKQA 2ZM5A 1EFRD 2RMKA 3MSXA 4ILEA 5L3RA 4Q1BA 4ZDWA 3KFXA 2FDCA 3PFIA 4HDQB 2DYKA 2ZJYA 2C9YA 1FQJA 3CO5A 4MITA 1ZD1A 3C8UA 4YMSA 1HT2E 1ZU4A 1KSFX 4Q7KA 2VIIA 3TUIC 1J8YF 5B58C 5F2EA 3ADDA 3VNVA 2PJZA 1OH5A 2OCBA 2RGDA 1K6MA 4TQ9A 1E9EA 2C2HA 4M9ZA 5HR5A 1P73A 2NPIA 4FMDF 4B3GA 2FH5B 4EPWA 1N6OA 2QAGB 4B2PA 4WOPA 1X8JA 2FPLA 3NH9A 5F9HA 1G19A 4I4LA 4H1VA 2CK3D 4NH0A 5IT5A 4Q4LA 3EIHA 4OI4A 1N6LA 2G77B 2XTMA 2JEOA 1NKSA 1CR0A 2PCJA 2YWEA 3C16C 1R2QA 3Q3JB 3QOFA 4LYJA 1YZQA 3BXZA 3EZFA 3TW4A 2W0SA 5HPYB 2MMCA 1JJVA 1ZM7A 4H9GA 3M0EA 4GP7A 5IF9A 2VHTA 3OIYA 2E1RA 2DHRA 2VRWA 4S2EA 1NI3A 3X1DA 4DDVA 2D2EA 1XMIA 5CK4A 4DUGA 4EFNA 1DOAA 2IYZA 2NO0A 3DVLA 2JJ1A 2KE5A 4KBFA 4UXIA 4V03A 1XBTA 4CF7A 2F43A 2PEYA 2UZIR 5CLQA 4HZUB 3GLIE 3ND9A 1LFDB 2FF7A 1II8B 4RZ2A 1VTKA 2ZRCA 5H8WA 2WWXA 2ZVQX 5LB4A 1W4AA 1E0JA 4M1WA 1CR2A 2OESA 4PTLA 5SZJA 3R7WA 4ESVA 1FQKA 4C0LA 1VECA 3IDQA 1VG1A 1VYUA 3SHWA 1FX0A 4HAXA 1E2MA 1P3JA 1D2EA 3U4QB 1KI6B 1ZRHA 3KKQA 2HT6A 4C9BA 2ZJ2A 2X1VA 3F0TA 1QHXA 3QKUA 4UXJA 3TE6A 2PEZA 4O25A 4ZIRB 3BH6A 4LYFA 1IXSB 2H18A 2QEQA 4Q4HB 1NMYA 2DBYA 1Q12A 3UKDA 3SQWA 3NDBB 1CS4C 2RGXA 2ERYA 5DNYB 1CP2A 2IUTA 1Z06A 4TLCA 5EXTA 3IEUA 2IWHA 4IEEA 4HB3A 4JJZA 2ZRBA 4XH9B 4WXRA 3LBIA 5L3QA 4ASUA 1ESMA 5KSPA 3K9HA 1P4SA 4ZPXA 2BMFA 1KI8A 4B74A 4JLOA 1GG2A 2CE7A 3C15C 2XOKD 2ZAMA 3R20A 2F3TA 2KWIA 3WP0A 3RABA 1W0JA 4MGZR 2Z4RA 4D4MA 1WF3A 4LI0A 1P9WA 2QAJA 1WE2A 3B1WA 4RKFA 3KXLA 2D2FA 1OB5A 2CL0X 2HXSA 2CVFA 4D0LB 1NVUQ 3QKSA 2BOVA 1KDRA 3BB3A 1G64A 1C4OA 3SHFA 1VCMA 1Z29A 4ZKDA 2R8RA 5P21A 3QQ5A 2IUUA 2JLQA 2ZIAA 4G01B 1R8QA 1W36D 2GXQA 2X8AA 3U44A 5DHFA 1AJEA 1XMJA 1OHHA 5EE5B 4TT3A 2IC5A 5BXQC 3D31A 2ZRDA 1X8LA 1D9XA 3IPXA 1EG7A 1JB1A 1SZPA 4HB0A 1BH2A 1JAIA 1E3MA 1FP6A 4D81A 2QPOA 1UKZA 2G6BA 3LD9A 3GLIB 2WIAA 3UG7A 4DCSA 2ZJ8A 2GJSA 2NO9A 1U98A 3X1WA 1Q44A 3TKLA 1G16A 3IBGA 1VYVA 5FTMA 1FX0B 1UEJA 4EPVA 4B76A 2YHSA 4C7OB 2GILA 2WJYA 1GL9B 2BM1A 2YINC 3N2IA 5J4VA 3IHWA 3FHCB 3AVYA 2ZRGA 3SFZA 3QKRB 3QUSA 3CH4B 4QRHA 1TF2A 5FI0B 1T5LA 4DB4A 3AKCA 3BD9A 2KSQA 2VLIA 1BOFA 3W3ZB 4BLQA 3VR4A 2NZJA 4A92A 2XSZA 4OI1A 2QUZA 2OLKA 2V4ZA 1N5IA 1XP8A 4LSGA 3U61B 2WSSA 4Z54A 1E1RA 2GJ8A 5LD2C 3AKEA 3SR0A 1WDTA 2G88A 4KHZA 4OBEA 4WW0A 3RC8A 5FBWB 2IYLD 1E2HA 2XAUA 2BHRA 1DVRA 5SZKB 5BW8A 3ZZUA 4Q18A 2QPTA 4AYWA 1X3SA 3W6NA 1UBCA 5ANRB 1U99A 4PC6A 3HJNA 1KO5A 4JZKA 3ONWA 3TJZA 3TIFA 2FEOA 2IUSA 2BJWA 1G9XA 5BYJA 2J1LA 2J7PD 3ZIAD 1Z0IA 1UPTA 1M2OB 1CJVC 1N6NA 2IYQA 2NOAA 4TMTA 3UG6A 3C5HA 3KXKA 4OQNA 1CU1A 2YOGA 1N6PA 2VBCA 1A4RA 3CR8A 1I2MA 4JSYA 4BPBA 1E98A 2XNSA 4DC9A 1YJ5A 2ZUCA 4DIEA 2D74A 4B3BA 1G3RA 2HCBA 1ZJ6A 1Z3IX 4IVQA 2X2EA 4HAUA 3RAPR 3VU9A 1IXZA 5GJWC 2AN9A 2FGJA 4NYJQ 3WMFA 4ZI2A 4RJLA 2QY9A 4BFXA 3A4LA 2XTNA 4IDPA 4DIDA 2RGNA 1DE0A 2QNRA 2OHFA 5HE9A 1KJZA 1YZUA 3RVBA 3ZD7A 3I92A 1ONBA 5KNDA 1I2DA 5EE1A 3VAAA 5DYIA 5EE0A 3QPVA 4MKGA 3CM0A 3AVOA 4QNMA 4ERNA 1M7GA 1CJKC 4XWKA 4RFSA 3RRYA 2QGZA 4ARZA 3MGCA 4HLUC 2XZPA 2ZRPA 4DLWA 3CH5A 4A8JB 3VKHA 4HAWA 3TAUA 2V1UA 4Q66C 3TGPA 1F60A 4DWJA 4OQMA 2CMKA 3LAWA 3L8ZA 3PQCA 4TTPA 1E9FA 5FOSA 5JHGB 2OE2A 3LO5A 1ZU5A 2ZU0C 5AJWA 3A4NA 4Q00A 5EZ5A 1NF3A 3CKLA 2A5FA 1RRGA 4DRZA 4LC1A 1XX6A 2QP9X 4GOJA 1YRAA 1TL7C 2CNWD 4Y0AA 2G1JA 3Q9LA 2OLJA 3P32A 1DEKA 1G7RA 3KJHA 5H1YA 4HZIA 3CLVA 4A6XA 1NMZA 2YJTD 2BKUA 3HPQA 2A78A 2WJJA 1Q22A 4JLPA 4P31A 1OXUA 1XEXA 1QVAA 1SVLA 2RGEA 3I73A 3M1IA 2PZGA 1KZ7B 1KDTA 1NG1A 1GDDA 1VYTA 2K5UA 3OF5A 4KAXA 5L3SA 5BYKA 2C03A 2P6NA 3KL4A 4TMZA 3REFA 1H8EA 1EGAA 1GSIA 4B3FX 1GWNA 4KFSA 1Z07A 2W58A 4UXHA 2G9NA 4OHYA 4R2IA 4JSTA 5JJIA 4AKEA 4Q9LA 4I1UA 4BUJA 4YQFA 3IIJA 2NQ2C 1LV7A 4TMWA 5EXSA 3FYHA 3IQXA 3UPUA 2GCPA 2QAGA 1G3UA 4PFSA 1RFLA 4Q02A 1VIYA 4P4SA 1IBRA 3V00A 1DAIA 4FCWA 2JLUA 2ZS9A 2HYIC 4B43A 1HV8A 4PAMA 2GZHA 3E1SA 1Q1BA 1Q57A 1XD2B 3B1YA 2JJ2A 2Y8EA 3SYLA 2ZRFA 2YOFA 4LOAA 3TK1A 4HLQB 3SBEA 4I99A 1RE0A 2ZRHA 2PH1A 1QHNA 4F7WA 2O52A 2Q3HA 1QZXA 2YC4C 4QHTA 4DCNA 1HT1E 5IDVA 3FPAA 2JASA 3I1FA 5KYKA 1IY0A 2QTFA 1YKSA 2AWNA 2W2VA 2G0NA 3P4YA 3AF2A 4KCGA 4W7SA 5CIQA 3W5JA 4CEHB 1Q21A 1JR3A 4Z8XA 2OBNA 2FPKA 1RVDA 1NBME 3EIQA 5FOVA 2EFCB 4AKIA 3B78A 3P27A 5E3HA 1N0UA 3R9WA 4Q03A 4WZBE 4RD4A 4NCHA 4NTZA 1AN0A 5EP2A 1T0HB 2HDNB 2WWWA 1AKYA 1A2KC 1KY2A 1QHHB 1KGDA 2WV9A 3FDIA 2HJGA 3IKJA 3SEAA 1NN5A 4P32A 3GEIA 3SJZA 1W2HA 4G3XA 4Q01A 2CLSA 1JXOA 3SN6A 3L0SA 2LWIA 2PZFA 1J8MF 3L82B 2GXSA 1XTIA 4GPTA 1RZ3A 3QPUA 2P0EA 2B6HA 2VPPA 3RLFA 3ZVNA 4FWIB 1G7CA 2ZE7A 2IYYA 2ZE6A 2Q21A 4Q1FA 3B60A 2OZEA 4P4TA 1ZUNB 1Z8FA 2VHCA 3MWYW 4JVNA 1PLJA 4XIGS 1B23P 1UEIA 4M22A 3NXSA 1G7TA 3K0EA 2DWPA 2WPDA 5FI1B 3HU2A 3GLHE 1W0KA 1L8QA 4MGKR 2FNAA 2BKEA 1OYWA 3FKSA 3T1OA 2CEAA 4KLZA 3K0AB 3P1JA 2Q3FA 1Z63A 1G4AE 2VP0A 1NBMA 4N0DA 5CITA 4UNPA 1MABA 1WA5A 3EZ6A 1UBEA 4TL8A 3P20A 3HR7A 5AUPB 3PEVA 1M8PA 2DB3A 4JYCA 1W2GA 2CL6X 2J46A 4O2RA 4V0MA 4CDGA 1XF9A 2PLRA 2ZJZA 4LJ9A 2VYFA 2ZITA 3DPUA 1BMFA 1ANKA 4B48A 1OHHD 2H8KA 4QHSA 1Y63A 4TT3D 3LH5A 3K0FB 2V7QA 3PCRB 1COWA 3T5DA 1G3QA 4LGMA 1I4TD 2H1LA 4JLNA 2PX0A 4QFMA 1NJGA 2NIPA 2WJGA 2GEVA 3KDSE 1VKJA 2C8VA 3T5GA 1BYUA 1CR4A 1AGRA 1GILA 4XTRA 4RFVA 5B64A 4IOMA 3BGWA 5DN6A 4YMWA 4LUCA 2J0VA 4FXPA 1CJUC 5DH9A 3I72A 3TVTA 1F48A 3VNUA 1XXHB 1OLOA 3S1AA 2IYTA 4IXNA 1OIXA 4GRAA 2GK7A 4EQ6A 2IS6A 4XTCS 3DHWC 1CR1A 3ZZ0A 1U0HC 2RHMA 3Q5EA 4P3YA 4BLOA 4L5BA 1QF9A 1EFTA 3UATA 2QRZA 4MRRA 4B75A 1OE0A 3QE0A 4MKHA 2ZS8A 3QVUA 5HKKA 5JSZB 4I81A 1M1YE 1MRNA 2EW1A 1US8A 3FMFA 2WWGA 2OAP1 4XD7D 4F4JA 3OE7D 5G53C 2RKOA 4QBGB 2ZTSA 2JA1A 2A3RA 2J45A 3AVTA 1R5NA 1U9IA 4IOJA 2BMJA 4IFEA 4TZ6A 2CXXA 4MUAA 3A8TA 1EX6A 4C30A 1P75A 2QSYA 3OAAA 1QRAA 4DLVA 4G1UC 1R0YA 1HURA 2HF9A 5BN5A 1ZNYA 1DTSA 4M1OA 4KO8A 2JIZD 4A8JA 1S2MA 2ZRMA 4BFWA 3Q85A 1G7SA 1BS1A 3GLFE 4TYNA 1CRQA 4IFBA 1SVSA 3RWMB 5E7MA 3K0SA 2QM8A 3KQNA 5C4GB 4US1R 5FOWA 3T1TA 1U2RA 3GPLA 4U00A 5JRJA 4CEJB 3SFVA 3OZXA 1CTQA 5C4MA 4IOLA 1TF7A 4RZXA 3PEWA 2G1KA 5A4JA 4C0AC 4KLNA 3LXXA 3LBNA 1QHHA 2J59A 5B30A 4LV5B 1GM5A 4ZI3A 1N3BA 4LHXA 3THXB 2IBMA 3LA6A 1VG0B 3IBYA 3KQHA 1M6NA 5IRCD 1OIVA 1MO5A 721PA 2FPMA 2QORA 2FGKA 1YZLA 2ZS7A 4HUQB 4EKDA 2WHXA 1Q1EA 3SOPA 2AXPA 2IF2A 4HLDA 4LZZA 4AWXA 4OK3A 4V0ME 1IXRC 3WBJA 3WYAA 3LFUA 4BASA 2OAQ1 5IHPA 3MWKA 4PSVA 3ADBA 3U44B 4F92B 3K09A 5GJCA 4B2IA 4A0RA 2HV8A 1HE8B 2GJKA 1DO2A 5FL7A 4E5UA 1GTVA 2DY1A 1G5PA 3DZ8A 4V0LA 2VF8A 3IQWA 3JVUA 4L9WA 2QQEA 5EP1A 3GFTA 5DE3A 3ASYA 4RCYA 3K0CA 1DAEA 3HYRA 1DAMA 4NYIQ 3KXIA 4X8OA 5FR1A 4D2IA 1XU4A 3U3JA 4TMXA 3CRMA 2MSCB 1HY3A 3GLGA 3TNFA 2X2FA 4Q4JB 3DKPA 2ANCA 2A5GA 4D4LA 5JFGA 2W2XA 3CNOA 3QENA 5KHOC 4DDTA 1E2EA 1SXJA 2DWOA 2EFEB 5KPDA 1E4VA 4JL6A 2C9OA 2AFIE 3TRFA 3TR5A 4TZ0A 3AGPA 4XVUA 1XCMA 4BEBA 2HT1A 4NPHA 3L0IB 2A5DA 4MGYR 4R71A 2V55B 2J0SA 1HTWA 3QXXA 4JLKA 4KV9A 2A7QA 3LRPA 4O0MA 2R62A 2H17A 2QT1A 2RGNC 2VP5A 4DLUA 4NCJA 3ZVLA 3VX3A 1R7RA 3AP3A 2F3RA 3QJYA 5DYGA 3TSOA 5TMPA 2W00A 2LKCA 3VQTA 3KKOA 4GMDA 4PHGA 2CHVA 2O8BA 3KUCA 3A6PC 1H65A 1IOZA 1LS6A 1I4LD 1W36B 3KKPA 1TF5A 1NP6A 3M6AA 4JMPA 4OHXA 2BBOA 4GDFA 3IIMA 5JJKA 2YNMA 4Q9KA 4S35A 4GOXA 4BLTA 1AS0A 3KQUA 5LB2A 1Q3HA 1AS3A 2JDIA 1IY2A 3CONA 4IRUB 2Q9AA 1JBKA 3BB4A 1M74A 1G8YA 1QHIA 5SZHB 3AVWA 1OW3B 3GJ4A 1NMXA 2EWVA 1WRBA 3AM1A 2VSFA 4IVPA 4QGFA 4EQ6B 5KOYA 2QMOA 1TQ2A 2JJ1D 1DG1G 4ABYA 3A36A 5DISB 2QTHA 5AUQA 3SJBA 4D0GA 4GMXA 2CCJA 3AEZA 1A82A 4DCTA 2QZ4A 2CHQA 4JLBA 2B92A 2ZI5A 1U81A 5HCIA 4DZZA 1QG2A 1SVIA 3MMPA 1G8HA 3I8XA 1P9RA 1QBKC 2P6UA 2QSZA 2FSFA 2A2ZA 4YXWA 3QKTA 1AK2A 3RC3A 3LQQA 1OFUX 3RS5A 3W8NA 5M04A 3M4YA 1T8TA 3PG5A 2P2LA 1QDEA 3T61A 3AVQA 2FSHA 4GZLA 2B7BA 3GJ5A 2QL6A 1Z6GA 4Q9IA 4E22A 3E2IA 5G3ZA 5FH9A 2JLYA 4PXAA 4DSNA 4TTQA 3FMIA 2Q6TA 4URZR 3K0FA 2Z5FA 1PZNA 1E0KA 1EFUA 4PANA 4PC3A 4UJ5A 1XEWY 1KDOA 4TSFD 2O8DA 2O0KA 5LPNA 1E6CA 2ZSDA 3E5HA 1TQ4A 1SXJE 3FMPB 4KYIB 4LC0A 2CLDX 1IN8A 4Q7JB 3WP1B 1UKEA 3CBQA 4PQYA 3GQBA 5FOTA 2VSXA 1D8TA 3QVVA 1E79D 2W6JD 2VP2A 3WYFA 1U8AA 2IWRA 1Z0DA 3QKSB 2FSIA 3BBPA 2WPDD 2BWJA 2WAXA 4NYMQ 4A1FA 1R5BA 3AB3A 3OEEA 2ODNA 5K8TA 1PLLA 3LXRA 2H57A 1AIPA 3FKSD 4LJ4A 1W0JD 3NBXX 1RW4A 2OILA 1X86B 5IK2A 3NEYA 4PSAA 5GJVC 3WMGA 1YR9A 2ZJ5A 1N6RA 1G3IA 5FBLB 2ZRLA 4L4UA 3SNHA 3W3AA 4H1UA 4YDSA 3SYKA 2V3CC 4YMUA 4ZCMA 4QC2A 4BQSA 3DO6A 3X1ZA 2I1QA 4LBYA 1ZP6A 3U60B 1AZSC 4I1VA 1KI7A 4QGHA 3BJIC 1N0VC 4JLMA 3SI7A 1BMFD 3EZ7A 3NWJA 1CXZA 2MMGA 3QXHA 1XJ0A 2ZR9A 1G20E 1P2UA 3I32A 4PO1A 4M4SA 5D3QA 3W9YA 1OV4A 5TV2A 2ONJA 5KU1A 3ZQJA 2PLFA 2QT0A 2WKQA 4EPTA 3AGQA 1EXMA 3CWQA 4BWYA 1T91A 4DLTA 5LD2B 1V43A 3CPJB 4LDJA 2PX3A 2QBYB 2RAPA 1KY3A 3AH8A 4M9QA 5JCZA 4L9SA 5EJEA 3BS4A 5DN6D 2YOHA 4BLSA 3GLGB 3SC3A 3PUWA 4TYPA 4A0FA 1F2UB 2FZ4A 4M1TA 5AJYA 2R6FA 3PVSA 2ODWA 4YONB 4EPYA 2QBYA 3W6PA 1JI0A 3GLHB 4MYTA 1W5TA 2ECKA 2ZSBA 1KSGA 2ZR7A 1SHKA 4L8GA 1Z0FA 4TQAA 1TUEA 3LV8A 4QBFA 3VHLB 2FFHA 1NLFA 3JZMA 4M21A 1KK2A 1J2JA 1SXJC 2BMEA 3EIEA 4OQXA 5JSZA 3THYA 1FPMA 1YQTA 2OBLA 2WWHA 4GBMA 5D3MB 2ZJAA 3GP8A 3O8RA 1UFQA 3HPRA 1S3SA 4BEJA 2GBLC 4V02A 1G5TA 3PENA 1NNEA 2ZI7A 2CBZA 4HDOB 1UADA 4XSHA 3CZPA 5CK5A 1J90A 2JLXA 2WWIA 3MWLA 1Q3TA 4M2LA 1JEEA 1E96A 2REOA 3FE2A 4IXMA 2KBFA 3QIAA 2J0UB 5EE9A 5AUOB 5A0FA 2IYUA 5JI2E 3I5XA 3DZDA 1ZAKA 1FUKA 4AY2A 1FNMA 2O5VA 1E1QA 2CE2X 2OXRA 3CIOA 5JWOA 3G0HA 1G17A 1G8FA 2V54A 2XGJA 3K9NA 1U94A 3PV0A 3TSWA 3WNDA 1XD9A 1NY6A 4M9XA 2QI9C 4E03A 1KO1A 1ZW6A 2EFDB 1EFCA 2YWHA 1W44A 1ESNA 3TR0A 4HUTA 4NYIR 1YZGA 3W90A 2ZI3A 1M7BA 2GRJA 3H84A 3FHOA 1ELOA 4X8LA 2Z43A 4URVR 1OIWA 4JVLA 2D4HA 4OHZA 1GNPA 4KODA 2R65A 1EX7A 2QA5A 3D8BA 3VHXA 1V5WA 1UDWA 1GP2A 2ZEJA 4DJTA 4NU0A 1Z2CA 5HZHA 1X6VA 1IJFA 2PMKA 2ZJBA 4BLRA 1JECA 1E9BA 3SQXA 3AF0A 2JLSA 1Z5ZA 3P26A 1X1SA 4I1SA 2GAOA 5G40A 2ZANA 1E69A 2DWQA 1HEIA 3B1ZA 3K53A 3CX8A 4D26A 1F6BA 4UNRA 1KOFA 3THXA 3KUDA 4NL4H 1TX4B 3GEHA 1ZM9A 1UJ2A 4DSOA 3U6BA 1ZINA 2BIFA 5DI9A 5K8IA 3QXJA 5J5CA 2QU8A 4C0QC 2ZVPX 2HLDA 2F1RA 1B0UA 3WYGA 3AP2A 2RGCA 3A1TA 1P2VA 2FFQA 1Z47A 5FPTA 3F3YA 4OK6A 1WCV1 4HAYA 4PR0A 3WNBA 4ZV4A 1T6NA 3MRSA 1ZM4A 4URWR 3SBDA 2MSEB 3A1UA 3W6OA 1NVWQ 4BFVA 4PZLA 4BLPA 4ZDKA 4PPQA 3SS8A 3T15A 4PC1A 1BYIA 1NY5A 4Q7MB 1S9HA 1S1CA 4JJKA 1XZQA 3DM9B 2AK2A 1LW7A 4DB2A 2ZPTX 1CIPA 3I8SA 1NSTA 3OFND 4PQRA 3X1XA 4DVGA 4BZXA 1FW6A 4NCKA 3GLFA 1P60A 1GL6A 3A4MA 1ZD8A 3D7MA 1O3YA 2RH5A 1WMSA 4CT5A 1E9CA 3NG1A 3RWOA 3AUYA 3H0KA 3PJRA 3QG5A 4TLDA 4K81B 4KVAA 5TARA 1W48A 3GFPA 1DBSA 3K0CC 4TMVA 3B2EA 1KKLA 4ZKEA 3BFKA 5G3YA 3GJ3A 4JVMA 1PVOA 3R8CA 1E2PA 1KO4A 4FCVA 3PIRA 1E2DA 2I3BA 3AV0B 3EA5A 3Q5DA 4NP6A 2WAYA 1VG9B 1E2LA 3EA0A 3NC1C 1ZNWA 2AL7A 4LJAA 4B34A 3L8YA 1Q1ZA 1Z6YA 1T0JB 1KAGA 1ZVQA 3ADCA 1NRJB 1LNZA 2QP4A 3ZD6A 2PT5A 4W9MC 4BFYA 2B21A 6Q21A 4Q7LA 4GSYA 1W5SA 4PZYA 4PO8A 4MYCA 4RD3A 2IX3A 5HCNA 2EFHB 4HYYA 4QJ5A 1FTNA 2WZQA 1CULC 4JBXA 4YXWD 3EX7C 4QG7A 4FI3C 5KO2A 2HF8A 3SYNA 2FOLA 1J7KA 4MUBA 5FOXA 1XB2A 2XXAB 3IILA 1S4QA 4EUNA 4MRSA 4F38A 3BH0A 2KBEA 3PUZA 4C2TA 3CF0A 2XOKA 1Z08A 4FMBB 4B33A 4Z1MD 2GCNA 4JLVA 1LF0A 1QHYA 3KTAA 1U8ZA 3CNNA 3QF4A 521PA 4A4DA 3B5JA 4ZCIA 3WRYC 4LPSA 2WWFA 3WHLA 3P4XA 1XTQA 2ZYUX 2O0JA 4LHWA 2YV5A 3RS4A 2JAQA 4L16A 5DSZA 1KI9A 1IM2A 2IXGA 3DOFA 2H16A 3CPHA 2VTKA 1HUQA 4TSFA 1UM8A 4JS0A 3NKVA 5ELXA 3KTAB 2FA9A 2CL7X 4US2R 1KI6A 3IEVA 2ATVA 1FUUA
chains in the Genus database with same CATH superfamily
2G7ZA 1Q3KA 2CXUA 3PWTA 5IKOA 4PN7A 3A9CA 4DCMA 3QBTA 2OV2A 2ZIZA 3EAGA 2IV2X 2Q6OA 3S2ZA 2IZOA 3Q0EA 4J4BA 4MCAA 3U3OA 4M0PA 2YW9A 3DZKA 5KWSA 4BB9A 4WAUA 3SJ7A 1LBTA 1NFRA 1GQ2A 1YO6A 2CB9A 3FYUC 3O5AA 1MJFA 3P9NA 2NTNA 1RRPA 3BL5A 3S7TA 4B3CA 4HWRA 4IDOA 1VIDA 4G0MA 1FRQA 2BT4A 4BZPA 4RXUA 2R0QC 4YCAA 1PHPA 5IBCA 4R3WA 5GY7A 2HMYB 4Z3OA 4CTKA 3IMFA 3RANA 5C3MA 6REQA 3LCJA 3V8QA 4C6HA 1ZJJA 2R9VA 5CCBA 1MPXA 1F2TA 1FFXB 4LMBA 2G70A 4FGJA 2C1XA 5KSZA 2BY4A 1PQPA 2HHLA 2MSDB 3DJYA 1YQXA 4UATA 4EDFA 1WNTA 4X9XA 5IVDA 2ZIXA 4IDNA 3TOVA 3UFXB 4M9SA 2WU4A 5FUVA 3RARA 1UXHA 4DKXA 1DX6A 2Z2YA 3BRWD 2RJNA 3N76A 4KXQA 3I23A 3LC7O 1I2AA 2A9OA 3HLKA 1AU9A 2OWEA 4LBWA 4ALMA 1G4UR 2H9YA 2HLPA 2OD9A 3ZWPA 1P5FA 4YBRA 1NBOA 5MGBA 1WB9A 3TZHA 4ZO4A 3P0RA 4C3VA 1NVVR 2YFYA 3CKKA 3D6HA 3R0XA 4M1ZA 5FAXA 1H42A 4TYMA 3Q6NA 5HUHA 1FW8A 3PHGA 3GARA 1MB9A 1P4GA 4CGZA 1ACJA 2Q5LA 5E2AA 4MH0R 2XUGA 3I01M 1Z2AA 1OCEA 5BMOA 4KIJA 5I7HA 1XCBA 1Y4SA 2QD1A 1UKYA 3O1HB 3L43A 2MU1A 3UICA 4DV4B 4YRCA 1KI1A 4II7A 3TMAA 2Z30A 1RYHA 4OFXA 4WOKA 4A16A 4B6JA 1EGQA 3P5BA 3PE3A 3I39X 2RBKA 5CYGA 4WCVA 3JYHA 1LVUA 2J7PA 3U2QA 2ZRAA 5GAJA 3K1AA 1RCUA 4QDJA 3OETA 1WMEA 2QL9A 4Z9XA 4A91A 1DIHA 4RZIA 3V42A 4BNIA 1DX4A 4BFTA 2YY5A 3P9IA 4CETA 1D2NA 1YJ8A 3ZU2A 2DCUA 3CRZA 3A14A 4PYQA 4UC0A 2G82A 1FMLA 3QKIA 2C98A 3BAFA 3S27A 3FWYA 3REGA 3ZU3A 5KVQA 5JVDB 1ZXXA 4IDBA 4PXYA 2B2XA 4D9JA 3H5NA 1ZM3A 4Q4AB 5K1ZA 3UMCA 5C46F 1TMYA 4G5GA 3KQOA 2AIRA 3K9QO 1P1IA 2ZKLA 2J7KA 3PDHA 1YOVA 3HYNA 4S1WA 5AOBA 1IL0A 3I5YA 1TCUA 1W6UA 3ZZTA 2PUCA 4LEIA 3JWGA 1MRZA 1OXKB 2JB9A 1V3UA 1D6MA 2HIMA 3LBAA 2R6GA 4E21A 1E3WB 2XB2A 4V0NA 2WG1A 2AW5A 4GNKA 1Z4OA 4Y2RA 3FSJX 1NNUA 1Q7GA 1DAKA 4W5HA 4GR5A 1W85A 9LDBA 5K9ZA 4L9AA 5IVHA 821PA 2ZYTX 2JIDA 1XAIA 3LRTA 4K40A 4AG3A 5LKAA 1QYRA 4R69A 4W1PA 5EFOA 3SYMA 4D0NA 3I62A 2Y93A 3ZGZA 1YJAA 4ZYUA 1BHO1 3A3KA 1V5EA 3OQPA 4OJKA 2WNHA 2BFPA 3UCEA 4XJXA 2QAGC 2Z4TA 2PU5A 1FDVA 2XEXA 2ZBRA 4QSHA 3W77A 5DBFA 4ZAGA 3U4CA 3DYIA 1W4RA 4P4LA 1JZSA 4LXTA 5KQRA 1JKJA 3TVDA 2AK3A 3WRVA 2H1WA 4EIWA 3OIFA 1UDRA 2PKWA 3C3CA 3DAPA 1QDLB 4EG5A 3NIDB 2KJQA 1FJGB 4EFMA 3PD1A 4LRWA 2I6UA 3D3KA 3LVBA 1K7XB 3KZVA 2HRCA 4TWIA 1ZUD1 5CT5A 5E2BA 3TLKA 2WFZA 3AHIA 1LSOA 1KWGA 4RD1A 4NCBA 1GTL1 2NAFA 1JFFB 3BGSA 4H4DA 4C4SA 5JCJA 2XUAA 1ND6A 2VEOA 3KZ1E 4HGOA 3L2OB 4I9NA 2XJ4A 3OG9A 5AHRA 3UUEA 3C3AA 1Q50A 1IN7A 2IXFA 4OB7A 4R2WA 1FRVA 3QGMA 3DM5A 4JB0A 4KWTA 4ETNA 1E77A 4QO8A 3KBOA 1J0EA 3AR4A 3FI0A 3BXFA 5FNVF 3DLCA 3T4PA 1YKGA 4PZZA 5J47A 1NJ5A 4KR3A 4Q1CA 4LJYA 1BCSB 1JQ5A 2PT6A 4LNUA 1KNXA 3O2SB 2AOTB 4C0SA 1G21B 1QIKA 1JHVA 2RAVA 1IK6A 3UIEA 1I7SB 2VEDA 3H4MA 1GPYA 3E9QA 4HAIA 1IEWA 4LXXA 1PJAA 1MC8A 2XQKA 3DE3X 4FNGA 4RY2A 5HHTA 3AQ4A 4KBGA 1RE1A 1XEFA 2C96A 3FFAA 1Z2PX 1IJBA 3NBZC 2P75A 4LYHA 3VV2A 5FLYA 3D3QA 4MDEA 3IESA 4HOYA 3AIIA 3STVA 1ZSVA 3PC6A 4YV0A 1JLMA 4GBJA 4EF5A 4YMLA 4CZ2A 4NE7A 4YRRA 4ASUD 1CUVA 1DIAA 3Q7SA 3D0RA 3TGWA 4AF8A 1YR2A 1KL7A 4D82A 4B2LA 5AVUA 1D1QA 4QLOA 4DLKA 1B14A 1NI4A 2VDWA 5C53B 4DUZB 3K5IA 4KQ1A 2ISQA 3EDQA 2UXBB 1CUFA 3DL7A 3N3BC 3MQ4A 1AQUA 4QELA 2WQ7A 1CEEA 2HBYA 4B71A 4MUKA 4C0BA 3MJDA 1QR6A 1DKLA 3OFNA 4L4YA 5G0TA 1RRKA 1L1QA 4B3DA 3I5UA 2Q7DA 1XNGA 4IEIA 1PW7A 4AKTA 4MW7A 2HJRA 3G5LA 1OX4A 5LOVA 3T95A 1VHLA 3LQ2A 3VJRA 1LDEA 3TAXA 3IIKA 3MFYA 2QAIA 1SHZA 5EIOA 3GLQA 4E07A 5E4JA 5FYDA 4YUYA 3DKKA 2H7XA 3LHSA 4B6QA 1U7OA 3PL1A 4CL3A 1NW9B 2R6CA 4IIXA 2A86A 4LGYA 1SC1A 1X39A 4O8ZA 1YTUA 1MZPA 1R4AA 2QDKA 3FH0A 4B3MB 1AMUA 4Y2PA 2G1AA 2P0AA 2ODEA 4YREA 4QYIB 4BOYA 3U9LA 1UK7A 2YMPA 2QN1A 1XZHA 1CG6A 1NI5A 3KYIB 2PGNA 4X00A 4MR9A 5F78A 3JSXA 3GJXC 4FHDA 3ZY5A 2ZRIA 5HCUA 2IPLA 3TXXA 2P69A 1K1EA 1IHPA 4EWLA 4K9OA 5L9AA 4MGHA 1IQPA 2I0FA 3AJEA 3AR5A 3HC7A 4TTIA 3TQHA 3FTQA 4JB8A 3WLPA 4L5JA 2X0NA 1RWBA 4CMGA 3D3EA 4REQB 2NYRA 1JIIA 3E18A 4Q9HA 3OE1A 2G5PA 4J1SA 4KH1A 2GAIA 1G6OA 4DR2B 1GZSA 1XT6A 4HDCA 1BE8A 2QVXX 3H1TA 5FJJA 4BC0A 1KZ9A 1OOEA 5IC4A 5JANA 1E3SA 3JQRA 3NW9A 4AULA 3D6NB 4UNNA 5JLJA 5JYEA 1GDTA 1MTOA 2E5WA 4AUNA 3P96A 3J81A 1GPBA 1SOMA 3KHUA 3LUDA 3QF7A 5LU9A 1Z22A 2Z2KA 4PZEA 4U8HA 1Q0UA 2DG2A 2X13A 1O0CA 3TI9A 4RV4A 1ID1A 5E95A 3RROA 3GDWA 2CF5A 2ZAOA 3B7GA 1H2YA 2FJUA 3MW8A 1PK8A 4FUTA 1I3KA 2JAXA 1CUUA 2ZB4A 1PBTA 1ZN7A 3A2MA 4PGHA 2GETA 2QX6A 2RKBA 3OPYA 1I4WA 1IXYA 2Y1EA 4NDZA 4NULA 3R3WA 2G1PA 1PD1A 1KA9H 1WZNA 3CRQA 2UXCB 3AXSA 5C8VA 1Z4MA 1VLLA 2QVCA 2O2HA 4NNPA 4OKNA 3VOAA 3CUKA 1SCDA 2FR0A 2NTJA 2XXBA 2A9FA 3KR2A 3KOXA 3NAGA 2H9IA 1RPAA 1GZHB 3OKCA 4KI0A 4M87A 1VLHA 3AHDA 4RO0A 221PA 5B1DA 5LN1A 1I5RA 3PPXA 3EGXA 2COUA 2W6JA 1R1DA 4EG0A 2HX1A 3PNSA 4PHFA 4U3JA 2XGOA 1V39A 5AJUA 2V7QD 1CJMA 2XYGA 3EZLA 3EGOA 5EFZA 4Z0HO 3RC7A 2XZOA 4UTNA 1WVMA 1CS0A 2KS6A 3HUFA 3P2JA 5TLSA 4EY3A 5CAEB 1AKMA 1QIEA 3ET4A 1CBUA 1H0RA 2WWRA 3K1JA 3Q10A 5L95A 3ANTA 5JSFA 2HZBA 3HVRA 3DOHA 3DCIA 2JD0A 1H8HD 4MYUA 3RJ9A 5ARBA 1SD2A 4ZT6A 1P7CA 1QP7A 1C14A 2JVKA 2XLBA 4GMFA 2PUEA 1TC1A 2HW8A 4G2NA 4JL5A 4UDOA 3HDQA 2ECQA 1GZUA 1TUIA 4M99A 3VO2A 4AMZA 4X62B 5DM0A 3ROXA 1A9QA 1Y7HA 1P62B 1SIWA 4PPGA 5LP6C 2FEPA 3IBTA 3W3AD 2HUPA 4DHEA 4MRVA 4EGCB 5FTKA 2FQXA 3EEQA 3U1TA 3OLZA 1BG6A 3ZHVA 4MAFA 1VJCA 3EQ7A 3LHKA 5D3KA 3LGSA 1E99A 1MXFA 5AVWA 3K5PA 3BGVA 1NXOA 1DEHA 1DNPA 4ISCA 2BH9A 2YDXA 4LRSB 1TTQB 4RJJA 5IYZF 3WB9A 1J49A 1XO1A 4UBLA 4ARVA 3WGUA 2DHCA 3GZ4A 2JGDA 3HFGA 5J2UB 4C04A 1QS0B 4I9FA 8GPBA 4RD2A 3W7VA 2Y1WA 4B9EA 4ZAVA 4OX9B 2WFLB 4G84A 3V4FA 1WCYA 4I1OA 4ENWA 1J6UA 1FSSA 2BRUA 2X77A 3GCGA 5HZKA 3ZU4A 1GLNA 3EUWA 3UGJA 1AV6A 2QXUA 3O7MA 3QPDA 3VV3A 4ZTUB 4XIJA 1FLDA 1ZHOA 2QYSA 4IY1A 4CEJA 5EKSA 4XFJA 2IV7A 5BNTA 5FV7A 3UA3A 1LSJA 3M6XA 1N2GA 4WE3A 3VJLA 3GBSA 4LVCA 1S3GA 1FXSA 3TLCA 1DV1A 4GNRA 5FADA 4EGAA 1TO6A 4OGLA 3TNDA 3NBFA 5FQOA 3AY0A 2PV7A 3CX6A 3AP1A 3CF4G 3GT3A 2D0PB 2EBUA 1ZLYA 1ZMOA 2EYUA 1G2IA 4KQEA 4WCFB 4XSVA 4DC0A 5JDCA 4ZCLA 1PVVA 3MINB 4DW8A 1CLUA 4QPZA 5JLAA 5BQ3A 3RVDA 3EW9A 2LDBA 4GYWA 5LQRA 1CNFA 3TLZA 4ENUA 1N8TA 4MWEA 2AOUA 3EZ9A 1FFHA 3DE7X 4Y6OA 4TPKA 4ZO8A 3MSCA 5HBRA 5LVAA 3NGXA 3LLCA 4G1BA 5CXXA 4PYNA 4G0OA 2P2CA 3EOZA 2AFVA 3F97A 3QE4A 1I4OA 2GWHA 3WDLA 1G5RA 2VAXA 2YQZA 3QEMB 5TSDA 2FZVA 1XQWA 4ITUA 2HJVA 2UYHA 1J09A 2GKGA 3CW8X 1KIAA 5GJBA 3B9BA 2FR8A 2QN6A 2O19A 2WNSA 5T67A 1DCKA 2EWWA 2XB4A 4NMMA 4BQIA 2PX5A 4O5AA 1RLOA 1C3LA 1TIBA 2A9PA 1RHQA 2QTNA 5KPJA 1COZA 3AETA 4UCWA 4G65A 4MW0A 3TMKA 3UJDA 1SIBE 4CM9A 4KQ9A 2BCEA 3NWPA 5E0KB 4DZTA 4JLDA 2P41A 2H5LA 2WP8J 1U0JA 4O2AA 2JGKA 2UZ0A 3MMXA 5LXTF 4OQYA 1E3QA 5J5AA 1MQ9A 3F3KA 2Y2VA 4G8JA 1PFQA 2AJLI 4PVDA 4CQLA 1CHNA 3PL5A 3AK4A 2VL7A 3OPXA 4J0DA 4DSTA 4OU4A 1P33A 3EWAA 1KYTA 3F9RA 4MNTA 3LWNA 3LVFO 4MKFA 1XLTA 4Q1VA 5HA5A 2XWBF 1QUFA 1LW6E 4JCOA 3ZK7A 5EUMA 1N2XA 3FN4A 3ZU5A 1VYHA 1E4YA 1QO0D 2V7EA 3KB2A 3ZHZA 1XZNA 1YL7A 1JLLB 1UP6A 3ASZA 2E18A 3KPWA 3R6WA 5A06A 4KYUA 1OKKA 3IVRA 2XXAA 3EY4A 4EHFA 1U2DC 5F1PA 5FA8A 1K6IA 2Z3ZA 4EA6A 2AXEA 1KQ3A 1S8OA 1CJTC 4KGZA 5K2MA 1XE3A 3NNSA 1DC4A 2V0CA 4QT4A 3ZH9B 1QHEA 4IW3B 1HK7A 4YRBA 3TB6A 1DTWB 4AMGA 4QXPA 2INGX 5DBIA 2X5KO 3SC4A 4RC9A 4IOKA 3A6LA 1PL8A 2D5IA 1ZD3A 1E0SA 2CZGA 3C41J 2W2TA 4NFSA 4E6PA 4EVQA 1EAYA 1HDYA 2KPOA 5JBNA 4KRFA 5ECDA 4IV0A 3RASA 2W4MA 2ZI6A 1YUBA 3R41A 3PI7A 1AS2A 1WPRA 2BEWB 2D4AA 2X8BA 5DHAA 4BFLA 4N3GA 3SWWA 1ESZA 2Z8YA 1TCVA 4RGVA 4RVCA 3W34A 1TQ6A 2A84A 4DE5A 5KDDA 4NS4A 4BO8A 3GFVA 1TKAA 4P2BA 5L3VA 1H8ED 4UZEA 3NUQA 2IZZA 3KL2A 1Y1PA 3V34A 2QTGA 1SCBA 4FFOA 5IF3A 4YP1A 2JFOA 4WOJA 2FLKA 3ZHYA 1RAIA 3GVCA 3A6HA 3E5RA 4WN9B 2VCEA 1A0OA 1H2FA 5CNKA 5FUXA 5TX7A 3U0BA 4RENA 1LBEA 1UAYA 1CZRA 2IYVA 1RAFA 4IHJA 1W93A 3T7JA 1Z2DA 2ARKA 3ZV6A 4JH0A 3AL3A 4ZN6A 4EEZA 1ADCA 2PVSA 4QVGA 1KRWA 1B00A 2ZBGA 4OXQA 1I30A 1L0BA 3FVVA 4BE9A 4G67A 3AFNA 4OYRA 4Q48A 5CM9C 3NOXA 5JJIA 2VHYA 1QIFA 3C5CA 1PUJA 5C2JB 4X66B 3ZY6A 4NY1A 1J2YA 4PX9A 3IUMA 1Z5PA 3EWIA 3OESA 4EX6A 3BGIA 4BHTA 1SCQA 2IY7A 1YZKA 4TWAA 4EYGA 2NT3A 3EPHA 3F3SA 4WERA 3TXYA 1V95A 3KZNA 1Q20A 1HOXA 2VDNB 4JUBA 2VSOA 3AY7A 1MMFB 4OL0A 2JGNA 1ZIYA 5EKTA 3VNAA 3HXLA 4PBRA 3S44A 2F3PA 4PFKA 2EU8A 1SRRA 2WKRA 4MYHA 4Y7CA 3ZE2B 4DEYA 4MA5A 2VWGA 1LDBA 3LF1A 3S2EA 1RIFA 5AM5A 3THYB 1G21E 2ZQYA 4WLOA 2CD7A 2WAAA 5JXGA 5KSYA 3KVRA 3RS9A 4DDKA 1TVKB 1QTRA 3B7WA 3BE8A 1QE3A 3KXDA 4QNRA 4FBLA 5LFAA 3OZ7A 2R00C 3C8MA 5JARA 1AHHA 4ZAYA 2QUKA 2DQYA 4B32A 1KYVA 1UZMA 4BAZA 4E08A 1Q77A 2X5XA 2C07A 2YMLA 3JQAB 1S5PA 3AFOA 1ZH2A 4KQHA 1I6KA 3BD8A 2EEZA 3COVA 3DEIA 4G56A 2FW9A 2QN3A 2NUAB 3RKSA 1V0JA 3GLSA 5IVKA 4URXR 2BGRA 3A28A 3HR8A 4PVCA 4FLFA 4RQUA 2CGEA 1W49A 4PPYA 3T4UA 1YS2X 3N0WA 5HIIA 3TO5A 3MS4A 3ZYCA 4WMLA 4FC6A 1EXVA 1IONA 5F9MA 3TRHA 2GN1A 4V0SA 4NENA 1ESEA 3O8CA 2F62A 3GP5A 3HEAA 1EUDB 3C6KA 1ZNZA 2C88A 4XX0B 3CZQA 3MAAC 1QH8A 4AY6A 2O8NA 1SQFA 3PRJA 1G2OA 4FIDA 4JKIA 1S96A 1W8IA 2HQSA 5KQGA 4H7FA 4HTFB 2NXWA 2PX2A 2POCA 3CB4A 3VR5A 2P3LA 2PQ0A 3CF6R 3LPLA 1UR5A 4ND8A 1K8QA 4BKMA 1N5KA 3INTA 2XYRA 3X44A 1C7QA 1DS6A 3C6ZA 4NNJA 1EWQA 3ZVMA 2Z9BA 4OHUA 1V7ZA 4B47A 3X1MA 2PZBA 4EJSB 2WIKA 2JFNA 2XGGA 1NIJA 2Y76A 1M1YA 1RHRA 3EC1A 5AW2A 5SYMA 1DUSA 3HNOA 4TN1A 4E2WA 3M81A 4F86A 4ND8B 2B5VA 2X19A 2ZYGA 1BQ4A 1X42A 2WYUA 2FRXA 2ZTUA 2EQBA 1OI3A 1RI3A 2FZLA 3OZFA 4NQZA 3UKOA 4BXOA 3WRXA 3OOHA 2MSLA 1JVBA 4ZVKA 1CF4A 2IZ6A 4DFDA 5CM8B 3ZQ4A 1FXWA 2XCQA 3E53A 4IJ5A 2NU8A 3TIIA 3D9QX 1DQRA 3SS9X 2OB2A 1T4MA 1M6YA 2FWIA 3ZGXA 3CEMA 1GGKA 4KQ2A 4AJ1A 4AJPA 3E70C 4CKEA 4EKNB 1Q15A 4TUYA 2P4QA 3IYLW 3E9NA 1GAJA 2FRDA 2JAOA 2Z83A 2HSWA 2ZIGA 2LCFA 4L02A 4G0VA 1T9CA 1WABA 1RM3A 2IYSA 2J0EA 3RSCA 1M0TA 3HJHA 3THRA 2Z57A 2QLBA 1J07A 2IZ1A 4FEGA 5CDFE 4Y0VA 8ABPA 1NXQA 1ZI9A 4EAAA 3ZS8A 4WADA 1MABB 4CFYA 4ZHQA 2DOKA 3K4PA 4HJRA 4C3ZA 1F8UA 3KQYA 2ZB3A 3THWA 4QG3A 3V1MA 2QY6A 3WK7A 1P4AA 3EPLA 1V26A 1OTXA 4QEZA 4QRIA 1W7AA 2ATXA 3D7KA 1SNYA 5FFMA 4WIAA 1WVGA 5AOAA 4BWGA 2O8CB 4LY9A 5CR9A 1KYXA 3TOCA 3N2NA 3BWYA 4ZVQA 1HFEL 4KR9A 4RTRA 1A2OA 4A10A 2PVPA 1QHSA 4LSWA 2FE4A 4WCFC 2AUTA 1O87A 4FGLA 2FF5A 4J0IA 5AKIA 2D5LA 2Q9BA 2YJ5A 3A37A 4HQLA 3DP7A 2E4ZA 2Z58A 1KI3A 4IGAA 5AMXA 1ZL2A 1A9TA 2HMWA 3MBIA 4EF4A 1YZVA 2VDQB 3EF0A 2ACEA 4K1LA 4OL9A 2GZRA 2BE7A 2NADA 3PJEA 3RYFB 1KMNA 4GOMD 4LYEA 5ALLA 1O89A 2EW2A 2H1RA 2OLEA 3HP7A 4H77A 4A2WA 1NXPA 3DCNA 4ZTBA 2CKDA 2ZUWA 3HABA 2VZ9A 2H4YA 2I6TA 3H2ZA 2PK3A 4DA4A 4ROSA 1CY2A 2NYUA 4PCVA 5FAKA 5E7JA 3AETB 1IIRA 3ONVA 1L8OA 1JE1A 2VHUA 4NBLA 4B9AA 2EX0A 4LZAA 5E9WA 2FSSA 2FZWA 3Q7RA 3LA8A 4GD3Q 4GPAA 4H1TA 3LWDA 5CYOA 5BW4A 2P68A 2V6FA 1V7CA 4NF2A 2Q0SA 4JJEA 4K8RB 2YWDA 3PJGA 4BB5A 1X8XA 4HDRB 1XMVA 1HEUA 3JQ9C 1XL0A 3VZRA 1FSFA 3ILYA 2WJHA 4DLSA 2PRZA 2QRNA 2ZI9A 3EYAA 4MA4A 5FIUA 2GM4A 1J56A 1I13A 1MNAA 2OUIA 1J99A 1KRXA 1E63A 2SECE 4L3OA 4NWIA 2DFLA 3Q9NA 3ZXIA 1BD3A 3PHBE 3TKYA 3F67A 4S0XA 3EXEA 1EJBA 4S1OA 5BNWA 3MINA 4HI0E 1IZZA 3FOAA 3L8FA 1XJCA 2F55A 4TUYB 1V8DA 4TM7A 4YQEA 1D6SA 5FPKA 2DT8A 4R9SA 1ZMBA 3ESQA 2L18A 1X2BA 3BFXA 4EDHA 1KERA 1UT8A 1VJ5A 2ZE5A 2C3MA 1ZJWA 1S2NA 4PHTA 2GAAA 4F0JA 4YJFB 1DTWA 3DV0A 3SQMA 3C6XA 3CNHA 4TVOA 3B7PA 3O1LA 1Z34A 3PXGA 3M5CA 2OXCA 4X7MA 5I5GA 1BVHA 1YQQA 3B89A 2VZ0A 3ICWA 5EEGA 2HA5A 3NM4A 4YCLA 3AIKA 3VPDA 5EWMB 2ZSJA 4KFUA 3HM9A 2QLLA 2FY8A 4WXMA 1OPRA 2ONCA 4IUBS 4MPDA 4QVKA 1NVVQ 1VMAA 4O4LA 5JSYA 4CQNA 2EVWX 3ROKA 3KJXA 5EZSA 3UJPA 3HJUA 3BH7A 2FP4B 2AA3A 4NE2A 3HB0A 4YJGB 1H1LA 4X97A 1EM8B 2VPIA 1N9GA 2R25B 2O7SA 4PZ0A 1USWA 4X8MA 3WGOA 1K98A 3NRCA 4ZD6A 1ETUA 4WNIA 5DI3B 1HTTA 2O2SA 1H6AA 2V65A 3PI6A 4DJEC 1QE0A 1REQB 3OKAA 3RM3A 3ROZA 4OXIA 3QSGA 4C0HA 1PJZA 1GRCA 2G3YA 4BKOA 3KQLA 4TL7A 3IR5A 2VK4A 1CQXA 1P4HA 4X94A 4RPCA 4F6RA 3D4LA 3DTVB 1UPBA 3HN2A 3GLFB 1NN1A 4LBZA 1H2AS 1GR0A 1HMPA 1TT5A 3FJOA 1MB2A 3NP7A 2IITA 1KTVA 2XXJA 4H60A 1CUXA 5F7OA 3TVYA 3K20A 4NVRA 4YWJA 5BP7A 1XXHA 2K7FA 1J42A 3WXMA 4UFPA 2VDOB 2SCUA 3ISJA 1JMKC 2Y1KA 3G88A 3HB4X 3SX4A 2ZETA 4GGMX 4L8VA 1H4SA 2PZEA 1LVGA 1DC6A 2HIGA 5IZ4A 4WOCA 3M3DA 2J6CA 4HBGA 5GGXA 1HQCA 4RLQA 4UDNA 5GONA 1PKEA 3BMNA 3LLUA 3FKJA 5JBQA 4W5TA 5JZ9A 2IL1A 3NRBA 4I8DA 4XOUA 1ODKA 4NZOA 2VPXA 4KWCA 4N01A 1INLA 3RBZA 1EUZA 1L4UA 3VDQA 3EEYA 1MHPA 3FMOB 2QTMA 1BH6A 4S1TA 5KHLB 4R9UC 2HCFA 1W25A 3E0XA 1N6IA 2HQOA 1WM1A 4UD2A 2D3WA 3I9KA 1COWD 2NYVA 3CLTC 4HKTA 2JFHA 1WW3A 5D85A 4F4IA 5HX7A 4DRXB 5C5EA 1PSDA 1NONA 2JATA 2WLTA 4CUZA 1Z6TA 1HKHA 4HGQA 4KXMA 4RDHA 4G5HA 1T15A 2V9PA 2H5EA 1GADO 1TLTA 2XTZA 5GM2A 2FPPB 3PCTA 3VX4A 1Z33A 3DTNA 1D5CA 1QQ5A 3F5MA 4QREA 2XUDA 3TX6A 4R2XA 1TADA 4YJDA 3AOGA 2O8FA 1T4BA 4EHKA 5KAPA 2MJLA 1TYAE 2GK4A 5FDFA 4G2TA 2NVUA 3OLXA 4FHFA 1DRWA 1DKMA 2ANBA 4W8OA 3VOSA 1U02A 4IILA 2QPAA 2WOOA 3TQRA 5EQFA 1XJQA 1P3DA 1XCPA 4RPJA 2QP3A 4Q9JA 3KKZA 3VFDA 3CCCA 1MVNA 4GAEA 5AJVB 4IJWA 3N6XA 1RYYA 3VNBA 1MKYA 4RDXA 4E15A 2JRCA 1EFHA 3WQQA 1N2CB 4PGFA 3EXIA 1HDRA 1QFMA 4Q0MA 5I01A 1DHTA 2CW5A 1M0EA 2QRHA 1XRLA 4LYYA 4M3NA 3L05A 4WZBA 4KTVE 5AO9A 1OFVA 1QDUA 2OUKA 3DOCA 1M8KA 2IIQA 2RCNA 3ED5A 1ZK4A 1A69A 3CW2A 1I7NA 1LZLA 3IUYA 3OX3A 1RYZA 3REQA 3TFQA 3WWEA 4YV2A 4HDMA 4K1XA 1DKRA 2QJRA 3QY0A 4RJIA 3TTVA 2VYND 5MGNA 4C6TB 2E55A 1Q1QA 2Q2VA 2ON6A 1KBQA 1U8UA 1B8UA 2X9QA 5EGNA 5EVCA 3ROQA 3ZOKA 3DMNA 4ARAA 1L5ZA 2HPAA 3HI6A 3L7LA 5TXGA 4YQYA 5K8UA 1ZMXA 2PFGA 3A3NA 4GLJA 8LDHA 2VXBA 5JTTA 1O4VA 5H16A 3WY9A 2Y1CA 3R4VA 1E2GA 4CM8B 4BWFB 2ZTVA 3QFCA 1Y4AE 1GUAA 1W4BA 3AF4A 3IUBA 4D46A 1SKMA 1YQWA 4NXMB 1JDUA 3NT4A 5IBRA 4DA9A 4LRYA 3ZGNA 3L40A 3TIXB 2M6RA 4LFAB 2GNAA 1P8JA 4L08A 3SZMA 3CV3A 4H6VA 2ST1A 5FUYA 1Z83A 3GJ7A 3JRNA 3M8KA 1GPWB 1GYQA 2CNOA 1RQLA 2P7IA 4ZC1A 4OX9Y 1QO9A 3E23A 3FHLA 4MCIA 3RS7A 1JEOA 1SVKA 4XEUA 1YD7A 1J8VA 4J0HA 1GZVA 1KMQA 2MIIA 1E18A 3IQZA 4ENPA 3NR2A 1CW2B 5A71A 3QF4B 3SKVA 4B44A 4E7PA 1T4CA 3U6KA 5DLEA 1DMRA 3CINA 2ATIA 2GEUA 1XCGB 2MR5A 1I2CA 2FPSA 2R7KA 3O0DA 4ZQGA 5C3UA 3VH3A 4QLBA 3CF2A 4AWAA 5KQSA 3PEUA 4PZ9A 3VH4A 1XIVA 3A6KA 4HSEA 4CFSA 5BNFA 2GA8A 1FP7A 4P0QB 4NYJR 5JADA 4AY3A 3DGFC 3URKA 4JOQA 5A4IS 2QLTA 2ECPA 4Q3EA 4IUCS 3A3OA 3A58B 2G07A 2OZKA 3ZBTA 1JAZA 4C1BA 3KHKA 3LDHA 2ZRQA 5JE8A 5F3WB 2PUJA 3AKYA 3PK0A 3R7FA 2D1YA 3G9XA 1OPXA 2CHFA 1ODJA 1TQDA 2B2CA 3CLHA 3SJCA 1B1CA 1N0WA 2R3SA 3AR7A 3M2PA 5WRFA 1IUNA 2CDCA 2SNIE 3O8LA 1GAEO 2QNBA 1EZ4A 3HXKA 4PG5A 3BRSA 5FQNA 3RJMA 3HHPA 4JIMA 3A2LA 2WTBA 1UC5B 2SBTA 4ZQFA 3K9GA 4DDUA 4CMHA 3W7AA 3H4VA 3EZNA 2C61A 4C22A 2CB0A 1ZNXA 3PQEA 4XKJA 4I66A 4N0PA 4W9NA 1YOVB 3WB2A 3ZNPA 3GD7A 1Y1SA 2A8YA 2H7CA 1SRQA 4RVOA 2PO5A 5A4FS 3P9CA 4G97A 3SMQA 2FSPA 4YJ2A 2YHIB 2WICA 3B36A 3OSZA 2E5FA 2F1OA 1NBAA 1U0TA 3RFUA 3CJQA 1SCJA 3LX6A 3H2SA 5K8LA 5DM1A 3ZQ6A 2WHRA 3TDNA 4YRIA 4UU0A 5CJPA 1G18A 4OG2A 1K5PA 3PSAA 3D1VA 3ZS9A 4R2JA 3NOOA 4QUAA 2C7RA 1A98A 2GBLA 4C2UA 1JGTA 1S4MA 1VZ2A 1BD4A 3F8TA 1L5KA 2OO5A 2WZCA 4PCAA 3AX6A 5DYTA 4ZV9A 5CXUA 4DCVA 2BJHA 3OZBA 1W47A 5TRTA 1SKQA 3L1VA 1RXWA 4ZOQI 1IB6A 2BISA 2RMKA 1XNQB 4Q1BA 2Q1XA 1MDFA 3KOMA 2XMCA 2UZ1A 3EMBA 1R15A 5KMGB 2O2JA 2W5UA 2ZJYA 3HY6A 1H2HA 4UUBA 2AZMA 2C3UA 3WDMA 5J23A 3D59A 3SVZA 3DKRA 3H4IA 3IBSA 4FJ2A 3QX8A 1KSFX 1G0NA 3HDVA 2OSVA 1J8DA 5BSTA 3H04A 3Q5GA 1LLFA 2Q0QA 5ARDA 3ADDA 3LT0A 1BE1A 4DDMA 4DLLA 3MLBA 2V3VA 1YJXA 3QHPA 1K6MA 4XR4A 1LLDA 3U49A 2G4VA 3IALA 3HEMA 3MZ0A 4HGNA 4Z9AA 2IXTA 1AVTA 2V03A 3DS8A 3H1BA 4JWTA 4WOPA 1X8JA 3M6UA 4YI3A 1XU9A 3B3FA 3LT1A 3NH9A 3DTVA 2ZJFA 4TKUB 3VU8A 3VXKA 2XODA 3KYBA 4X20A 5EZYB 4B4WA 4ZCTA 3WGIA 1D03A 3IH5A 2AN3A 3NTXA 4C4AA 6PFKA 4WQMA 2YWEA 5HUQA 2JEOA 3Q3JB 4P34A 4N7JA 1T1RA 1VKZA 2JFQA 4MW4A 4I55B 5G1NA 1REQA 5HPYB 4KX3A 1ZICA 2REQA 3ADPA 2NAPA 4CM7A 2EKPA 4LNUB 5IF9A 2NZ2A 2DHRA 2LE0A 5SY6A 3QJGA 2YUTA 5DTRA 1QQ6A 4EI9A 2NO0A 2JJ1A 4QDOA 3H11B 2J0SA 2PEYA 1ZJ4A 1ETHA 1NI4B 1QLHA 1RXCA 2VDWB 3ZD8A 4OP1A 1ZLXA 4HZUB 4JBHA 4YP6A 5BVHA 3DDSA 4ZP1A 3RFTA 1ISGA 4KO4S 1P81A 1P2BA 4PNPA 5DWDA 4ER6A 1RXSA 1PJ3A 2J30A 1ID8A 5H8WA 2ZVQX 1FJXA 1A76A 1GGHA 4D3FA 1S2GA 1FQKA 2HFKA 4C78A 1I4EB 1ZN9A 2G8LA 1VECA 1VG1A 3HG7A 4H35A 4ND7A 4HAXA 1IBCA 1NMEA 3SHWA 5JYBA 5KJ1A 3HB5X 5CLJA 3RAGA 4B4VA 3RUIA 4F2HA 2HT6A 1FUEA 1UZNA 3C3WA 4C9BA 1NOJA 2ZJ2A 4IIEA 3F0TA 2VK1A 3TZLA 4RTJA 1TZJA 1Z8NA 1QHXA 5KTTA 3TE6A 2PEZA 3LF2A 1PT7A 4O25A 4ZIRB 1ENYA 4K9QA 3E81A 4Q4HB 4D8XA 1Q7RA 2OY0A 1NMYA 5HG0A 4DNOA 4F4HA 4JNCA 5JQGB 5DT2A 1FK8A 1K08A 5ED0A 3RVPA 4JGIA 1TK9A 2ERYA 4G8CA 1CDEA 2EC5A 1JI3A 4MS1A 1EYZA 1MA0A 1KAQA 2NT4A 3IEUA 5FF9A 3S0JA 3DZFA 4ZI7A 4TOIA 2ZRBA 4WXRA 2I6XA 3N05A 4MV6A 3JR3A 2W90A 5DX0A 3KJNA 4ZPXA 3ZCQA 1BXKA 4BP1A 5KWIA 4B74A 4HDAA 4R31A 4JLOA 2XVYA 2CE7A 1ZVMA 3R20A 4LE1A 3WP0A 5KYVA 2V59A 4J16C 3S68A 1XR3A 4D4MA 2QAJA 2BMWA 1GG8A 3AR9A 2PQMA 1APBA 2DBQA 2D2FA 1DRVA 4EJFA 4XGRA 1IBMB 2HXSA 3GT7A 3I2JA 3MTBA 3VDRA 2G80A 3QKSA 2BOVA 1KDRA 4ZVPA 1G64A 4WEOA 1PT5A 4X1YB 1C4OA 5B3JA 3VZPA 2OG1A 3A3PA 4JDUA 4CKEB 4CNQA 2R8RA 1D6NA 5F2NA 2JHAA 3WGLA 4LDNA 4DR3B 4OQPA 3RBVA 2JLQA 2ZIAA 1WZIA 3AESA 1OQAA 1YHZA 4GXNA 4EHDA 3S2YA 1R8QA 4RXMA 4CF6A 3F5SA 4BXOB 2XT6A 2Q5EA 1OHHA 2OO3A 3ZHQA 2NSJA 2CNNA 3CCBA 3TJRA 3HYCA 3QV1A 3KVYA 1YULA 2ZRDA 3EFBA 4GLBA 1D9XA 1EG7A 2ZIUB 2HU2A 3KQMA 1EDEA 4HB0A 1NAIA 3H18A 5BT8A 1GARA 1V1MB 3O93A 2O06A 3E7WA 1GFSA 3E82A 4PX5A 3FMGA 2HU8A 5A9TA 2ABWA 3A9SA 4C4RA 2HXGA 4Y2YA 3LUFA 2PKQO 3QMVA 2A4MA 2WIAA 1F8XA 4YT5A 3UG7A 4DCSA 5C51B 2GJSA 4ZCQA 1G59A 1N5RA 3H2KA 4HQOA 3RUDA 1V8ZA 1E3IA 4Z4QA 1YNOA 3P2KA 4N12A 5DHTA 1GYPA 1E7YA 4EPVA 4ZI7F 5IXJA 1V1MA 3JQGB 5KREA 5CHEA 4XQEA 4HNTA 2IHNA 3UHFA 3NTQA 2B9VA 3MRTA 1DBVO 4KXLA 4O4IB 3BZBA 1MTZA 1SIOA 1IWOA 1TGYA 2ZIXB 3DLPX 3RC9A 2FLWA 2P1ZA 3CY6A 1YXMA 2PSHA 1TF2A 3DZCA 3ZXXA 3HMKA 4I5EA 1EQ2A 2AJDA 3AKCA 4B8YA 4CUKA 3EXHB