3QENA

S74e dck in complex with 5-bromodeoxycytidine and udp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
236
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 92
structure length 236
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qenA00
3GLFE 3CM0A 1PZNA 3L2OB 3NKVA 5G40A 4Q1BA 4Z1MA 3K8YA 4DCVA 4OI2A 5EE3A 3KUCA 2EWVA 2IYRA 4R2IA 2GDJA 1NLYA 4PAQA 5EXXA 3PQCA 4RD4A 3AVQA 1SHKA 1FP6A 2CCJA 3GLIA 1UJ2A 2C9CA 4DLUA 2QT0A 3BB1A 4AY2A 3SQWA 2ODEA 1SGWA 1ZBDA 1CJMA 1P62B 1G64A 4NE2A 1EFHA 4TZ0A 3T1TA 4WZAE 3LV8A 3TAHA 2YWFA 3VR2A 1AQUA 2ZVPX 3T1OA 4EFNA 2YINC 4IDNA 3GLIB 3KJIA 3OIYA 3EX7C 2ZS7A 4M9ZA 3RC8A 3CH5A 1KO8A 2Z5FA 1LNZA 2V1UA 1AM4D 4GPTA 1MRNA 4ASUA 1GUAA 3U4QA 1N6RA 1XF9A 2PZGA 2SHKA 4LBYA 5TDHA 4JZKA 4Q01A 1QF9A 5HE8A 2F43B 1IJFA 1D9ZA 4C0AC 2OCBA 4CDGA 3KQHA 1KI6A 2F9LA 3H1TA 3QXCA 3K70C 4DLRA 2VBCA 2PL3A 4PC1A 3IIKA 2PJZA 5GJCA 3U4QB 1OH7A 3KZ1E 5AUNB 4CEJB 1R0WA 4GT1A 3X1ZA 1MH1A 1WBBA 4MRPA 3CIOA 2ZVQX 3AKEA 2PZFA 1O3YA 1ONBA 2HLDA 4HUTA 3U6KA 3WNBA 4U00A 4AK9A 2QAGB 4G5GA 3IGFA 4W9MC 1E4VA 5SZIA 3F3YA 1NJFA 3FTQA 1KI4A 2F3RA 3EIQA 1KJZA 1GWNA 4Z1MD 1RRGA 4AWXA 5F98A 3AP3A 4Y0AA 2XSZA 2QRNA 3CRQA 2QAGA 1UEJA 2GXSA 4BECA 4RZ3A 2GILA 2O8FB 2ZPTX 2FEOA 4LYHA 1NVUQ 4WW0A 3UIEA 3UMFA 4B3GA 2VO1A 1Q21A 2XX3A 3ZYCA 3U7HB 1IXRC 2IYYA 4A6XA 2ATVA 1VDZA 3D7MA 1SULA 1COWA 3K9LA 3TSZA 621PA 2FA9A 3GJ7A 1TU4A 2O0KA 5FOSA 5FBRB 3WBKA 3DOEA 3TNFA 3UG6A 1E3MA 3BFXA 1E69A 4FN5A 2VLIA 2ZJOA 3KJHA 4M1OA 3C4JA 5JLJA 1XX6A 5D3MB 3KXIA 1XFAA 4WAUA 1AZSC 1JXOA 4I1UA 3B78A 2W2XA 4ZDIA 1XTRA 5HKKD 1LS6A 2FEMA 4D4KA 4TT3D 2WWIA 1UF9A 4NZYA 4QRHA 4YDHB 5DE3A 3PR1A 4HB2A 4MUAA 2ZE5A 1TUEA 1FMLA 3EWAA 2A9KA 1P7CA 2BBOA 5K8IA 1UEIA 1EX7A 2GK7A 2OESA 4JVMA 2FSGA 2D4HA 2GCNA 4AYTA 1AGPA 1VIAA 3NH6A 1N5IA 2J0UA 1SKQA 4U7DA 1MO6A 4ZIRB 3RRYA 4URYR 4WXPA 4BLRA 1OE0A 1HQYE 2F1JA 3HYRA 3GLIE 4C7OA 2OXCA 3NEYA 4PPFA 2FV8A 3H4MA 3BORA 3B1VA 4E5UA 1BYUA 2WKPA 2JCSA 4FMBB 4XSHA 3T61A 3WNCA 4C0LA 1FL9A 3K70D 1G7SA 3BS4A 2CMKA 2B7CA 2PCJA 5JECA 5AJZA 2V3CC 1P2SA 4J0QA 3SE0A 1QHHB 1TF7A 1TQ6A 4Q02A 3U7GA 1TF2A 4NYMR 4B34A 2ZITA 5SZJA 4B3CA 4BASA 2ZSDA 2F7SA 1E1QA 2B92A 3MWLA 2WBLC 4TMTA 5KOYA 1NY6A 1S8FA 2BOVA 2ERYA 1QBKC 2A5FA 3GPLA 3KQKA 3PCRB 1XZQA 4EPWA 5HKKA 1QHHA 4PHTA 4TN1A 2ZAOA 1G291 4Q4HA 2X2FA 5FUXA 4AC9A 3THWA 4IVPA 2IYWA 2ZS9A 1VG8A 4BEBA 4MH0R 3RS4A 4YC7A 4A2QA 4K8OA 5JHHB 3CRW1 1N3BA 3IIJA 3LD9A 4V0ME 4XOIA 2VSXA 4UXJA 1RC8A 2VP4A 3E5HA 4PPQA 4GOXA 2IS6A 2J87A 4A1FA 2IEYA 1XTJA 1W0KD 4DCTA 2ZQ5A 1ETUA 3SYLA 2F1RA 1IBRA 4JKYA 3GLGE 3DKVA 2ZR0A 1CTQA 4A4DA 2C96A 4C2UA 1KI6B 3BD9A 4RZ2A 1VCOA 1NG9A 4RD1A 1XD2B 1E1RA 3DDCA 2G1JA 2UZ3A 4JKIA 2KB0A 1KSJA 3PEUA 3A58B 3RS3A 4G5SA 3ND9A 3RS5A 3M0EA 3I8XA 2IS1A 2JLXA 3LNCA 4D6PA 2FOLA 1OH5A 1QHIA 3RVBA 3FVQA 3WMEA 2KI5A 4IDHA 3VAAA 2AKAB 2PX3A 4ASUD 3SBEA 4ERNA 5HZKA 1US8B 5CK5A 1E2MA 1JQJC 1YZGA 3NXSA 4HZIA 3PXGA 3OEEA 4LHVA 5AR1A 3U2QA 2G1KA 1X1SA 3WYGA 4LWZA 5JI2E 2ZRJA 2PLRA 3A4NA 4CVNA 1G9XA 3MGCA 1XMJA 2C78A 1DO0A 1R10A 2FDCA 4EQ6B 1T4GA 2NTYC 4TQUS 2FGKA 3QEJA 3FMFA 1UFQA 2ASEA 2J7PA 1W0JA 2HF8A 5DHFA 5FI1B 5IK2D 1KO7A 1OKKA 3V4RA 2DB3A 3NH9A 5DGXA 5E95A 1B23P 1E0KA 2IT1A 4RY2A 3IBGA 3SEAA 3WRYC 2EW1A 2RGDA 4RVCA 2C99A 2F43A 2JASA 1W1WA 2XITA 1WB9A 3VQTA 3OAAA 2BBWA 1GRNA 4CGZA 2L0XA 1Q44A 1T3SA 4M1TA 1F2TB 3CRVA 4LV8B 2QP4A 3Q3JB 1W48A 4LJ7A 1E9SA 2HCJB 4R9UC 4AYWA 2ZRCA 4B71A 3A37A 1GP2A 2RGBA 4ZV4A 5B57C 4KI0A 3RDPA 1N2CE 1W2HA 2LKDA 3LW8A 5TY0A 3SU8A 1VPLA 2GZHA 3BE4A 4O0MA 3VMFA 1JAIA 1RFLA 3I73A 4KLNA 1G3RA 4N0EA 4D4LA 3TIFA 5HE9A 2JGNA 3BXZA 5DIFA 5DH9A 1VMAA 2VTKA 3SOPA 1AKEA 1E96A 1R8QA 4B43A 2ZJAA 421PA 3SFVA 2QORA 1E2GA 3H0KA 4M1SA 5B64A 5UKDA 2REOA 2GCOA 1XB2A 3KXLA 1A2BA 2IXFA 2OBNA 3CO5A 3MCAA 1BH2A 1FX0A 1T0HB 3OHMA 2DHRA 3BK7A 2FFHA 3SFZA 2JDID 1XEXB 1SKYE 4IVRA 3TW4A 1ZNZA 2WPDD 1J99A 3HJNA 5GADl 1FNNA 5LBIA 2ZSAA 1C1YA 4CT5A 4L8GA 4RD0A 5B30A 4OK5A 4CYMA 121PA 5BW8A 1GRRA 4XH9B 2PMKA 4DT1A 1JPNA 2ZI7A 1YR8A 3RRZA 1OFTA 1WRBA 2ZI9A 3ZZUA 4I4LA 2DWOA 5AJXA 4QL3A 5CJPA 3LQRA 4LDJA 1VKJA 1Z0JA 2MSEB 3K09A 4DLVA 4JVLA 2A5GA 2Q0HA 4UJ3A 5EZ5A 2ZRAA 2J0QA 3RSOA 3FDIA 1DEKA 3RRNA 3WXMA 3A4MA 3NVAA 4LJ6A 5BN4A 3A1WA 3MUFA 3E70C 2FE4A 3CRMA 1PLKA 3EZ9A 2NMVA 1NMYA 5F2EA 3GLFA 2CBZA 4BFXA 4A0RA 4EPVA 3AVYA 3Q7PA 4K81B 1R0XA 2YKGA 3VKWA 5IF9A 3I3SR 3EZ6A 3ASZA 2P2LA 1RIFA 2OG2A 4HATA 3CR7A 5P21A 3QKSA 2ZROA 3MG9A 4C30A 3GLHB 1D6JA 2NQ2C 2ZRLA 1G5PA 4PO8A 1M8PA 1AGRA 1ZM3A 2CHQA 2CJWB 2YV5A 2A5JA 2ZI4A 2FPKA 4M1WA 3ZVNA 4M8NE 5FI0B 5KNBA 5AJYA 1JJ7A 5DLQC 2NZ8A 2W58A 1QHNA 3EA0A 4PQRA 3SS8A 3WYFA 2O52A 1LF5A 2QP3A 4O3MA 1J90A 2ODBA 3QQ5A 2BV3A 4GNKA 1Z6XA 3KX2A 3KQUA 4ON9A 4FMDF 3Q85A 4I81A 3W34A 3CPHA 2ZSFA 5J47A 1S9DA 4TYNA 1ZVQA 1Y3AA 2VL7A 4YMVA 2EYUA 3IKJA 1SVLA 1QZXA 1PUJA 5H68A 4DHEA 2WOJA 1QHGA 3B7GA 3AV0B 2ATXA 3Q8XB 4HB3A 2QENA 4HLUC 4BLQA 2O8DA 5BN3A 1CBUA 1G3UA 1GKYA 2D74A 4KODA 1TMKA 1YR9A 1ZRHA 3BAFA 3QXHA 3ZQJA 5FPTA 4KBFA 2J7KA 2MMGA 3QF4B 4R2HA 2QQ0A 3RABA 4EJSB 4QJ4A 1DAEA 1WF3A 2IEZA 3CWZA 3I32A 4KFRA 2OO7A 5CK4A 5FL7A 3RANA 3V4FA 1A7JA 4GOJA 4LHWA 1EFTA 3SDZA 2J46A 5JMTA 2FPMA 2CHGA 3BH0A 3FMPB 1Z0DA 2QMOA 3KKOA 4XJXA 3T1VA 5FUVA 4HB0A 4KSBA 4C0HA 1UKYA 3GQBA 2FSIA 1KSGA 2VP6A 4GOKA 3GP8A 2QBYA 2AK3A 2BJVA 1X1RA 4LYJA 4OBEA 4A15A 2GF9A 5BYJA 4BEJA 1JAHA 1DG3A 2FFBA 1LS1A 2GESA 2CNWD 2ZXUA 1XEFA 3U44B 3S1AB 1N0WA 2VSOA 2XOKD 3LX5A 2AL7A 4PC6A 1AQYA 1DOAA 3QKRB 1XTKA 1NN1A 5B2ZA 1EX6A 2RGXA 3A4LA 1AIPA 1T0JB 2AN9A 2RGNC 3K53A 2WWHA 3TK1A 2KWIA 2Q3MA 3PUXA 2GZAA 3C14C 1Q12A 3QF7A 1Z3IX 1G8FA 2C5LA 3KB1A 3UATA 1Q22A 1SXJC 2XZPA 2ZUBA 3H84A 3QUSA 1GKUB 4YMSA 2CL7X 5EP1A 2GVZC 4PC7A 2JATA 1E2EA 2P6NA 4XD7A 1RKBA 5IHPA 3GEIA 3KKMA 3OFND 2IL1A 1Z08A 3T06B 2REXB 1E9AA 2F6RA 2HDNB 4JLOA 3VFDA 4LHXA 4BFSA 4QNMA 2V9PA 3J81k 1E2IA 4Z8XA 4W7SA 1HEIA 3RYTC 1P5ZB 2IYUA 4B2IA 3TR0A 3FOZA 4XIGS 4M1KA 4G01B 1J7KA 4ZIRA 4S2EA 3SQXA 5L3SA 1F2TA 5TXGA 3OAAD 1OXUA 4MRSA 3KQNA 2JLSA 3VTKA 4HUQA 4F7WA 4A0GA 2AWNA 2N42A 3ADDA 4LCBA 1RE0A 4H1UA 3N70A 4M53A 3NBFA 1UKVY 2DWPA 4P4SA 4URVR 1HH4A 2ZYUX 2RGGA 2LKCA 3IPXA 2NO6A 1UDXA 4P32A 2CK3A 1MV5A 3VR1A 2CCGA 4YMUA 3DOFA 2C9OA 4G1UC 3CBQA 2XGJA 1MRSA 1GG2A 4QC2A 1IQPA 1TL7C 5EE1A 2HV8A 4ZI2A 5D3QA 2A3RA 1I4DD 1Q3TA 2WAXA 3UK6A 4DLZA 1JPJA 3VU9B 2YC4C 4F4CA 2VP5A 3R20A 4P4TA 3QXJA 4QGAA 3R8CA 4TSFA 4CEHB 4X8LA 4DCUA 3VNUA 3SC3A 4QHSA 4F4JA 2GAOA 2DYKA 1R7RA 1E9BA 3IEVA 4E09A 1DAGA 4ZI3A 1KGDA 5CLLA 3C5CA 4ZCLA 3KFXA 3PUZA 1VHLA 2JJ1D 4BLSA 1YR6A 4GSYA 1NN0A 1ZNYA 2WSSD 2QG6A 4WA7A 3IUYA 1Z2AA 4DKXA 4MKGA 4ABYA 2GBLC 5FTNA 4PQYA 1W4RA 1SVWA 2IWHA 5FOTA 5JJKA 3CRRA 1E1RD 3DM5A 5JWOA 1FOEB 1SHZA 4V0MA 1A1VA 2P67A 4LHYA 1ZINA 3EIHA 4C0BA 1NF3A 1OH6A 1YZQA 1CJTC 2A5YB 3F0TA 4MKHA 4DWJA 5J4KA 4KU4A 4KYUA 2OXRA 4MGYR 4DT1B 2BIFA 3UKDA 1ZM9A 1G6OA 3GMTA 2IHBA 5TMPA 1NVWQ 4BQSA 3SZRA 1OPXA 2H18A 1D5CA 2YC2C 4HDQB 4DDTA 4CEIB 1G4UR 3IIMA 3OESA 3ZQ6A 4PQFA 1Q1EA 3AH8A 3BWDD 1UM8A 3I1FA 1KJWA 3VHXA 4TQ9A 5C46F 3RS2A 5JJLA 2ZYTX 3ADKA 4MUBA 3KTAB 1CKEA 4IOJA 2JLZA 1UADA 2WWGA 4BRWA 4QBHA 5E7IA 3TW8B 2H5EA 3NEJA 4F91B 3FMIA 1OB2A 4QHYA 1HT1E 1P9WA 4C0KA 1HQCA 5BYKA 4TYQA 4WVFA 4G5QA 1GITA 1II8B 1OH8A 3QVUA 2YHSA 4A82A 3SR0A 1W4BA 1UBEA 4LJAA 2JLWA 3V9PA 3MMPA 2ZJ8A 1LFDB 2R2AA 2GCPA 4PZZA 4KFSA 3Q72A 2WJYA 4M9SA 5EQTA 2OBLA 4AG5A 2C03A 1NMZA 1ZCAA 4PC3A 2X1VA 1FUKA 2YNMA 1YVDA 2GXQA 1Q1QA 5CIWA 2ZRHA 3MJHA 1T91A 4V0NA 1RW4A 4MYCA 1FX0B 4UNRA 3CWQA 3GJ5A 5FR2A 4HAWA 2OM2A 3NDPA 2D7CA 2MSCB 4FMDB 1DBSA 2F1HA 3K0AA 1N25A 1KOFA 4JYCA 4Q4AA 1XDBA 4HLCA 3I72A 2ZRFA 3Q9LA 1KO5A 2X8AA 3IEUA 4Q48A 2GF0A 2LCFA 1HTWA 2VRWA 1HE8B 3KFVA 3LXRA 1H8HD 4BZQA 1Z0IA 4HAUA 2IYSA 1JR3A 2GEDA 2OEPA 2EFEB 1QG4A 2CLCX 4TMKA 4ZCMA 1P2UA 3RHFA 4F92B 2H1LA 4V03A 1GDDA 3ICQB 4DLWA 1JXMA 3Q5EA 4N3NA 1SXJA 3B9PA 3B2EA 2FMXA 2QAJA 3Q5DA 1ZM4A 5TARA 2GJKA 1TAGA 1RYFA 5EUMA 3MD0A 2ONKA 5CJ2A 5EE5B 4JT2A 3AVUA 2RH5A 4MGKR 4ESHA 2QPAA 1XJCA 4B47A 1K8RA 2JJ2A 4OJKA 3TUJC 2QEQA 3TVTA 3ONWA 2IUTA 4JLKA 5H70A 1YZKA 3QXXA 1NRJB 2I3BA 3S1AA 5KU1A 2VHUA 1BO6A 4IOLA 1W0KA 4ZDWA 2G83A 2W0SA 5IRCD 4TL9A 3L0IB 3B1WA 1T8UA 5FOWA 3GFPA 2H7VA 1GFIA 2QGNA 4D81A 4DXAA 5C2JB 3KKNA 4LY6A 3GLGB 1G8GA 5L3RA 4ESVA 3M1IA 4PPNA 3CR8A 5DISB 3K0SA 1R5NA 1XEXA 3REFA 2VA8A 2HJGA 4LYFA 5DN6A 2WWWA 3BERA 4CEHA 2IC5A 3W6OA 1MKYA 1E2HA 1NVVR 1R0YA 2VEDA 3B1ZA 5FPKA 1MOZA 4B3FX 3PUYA 4URZR 1KY3A 3RSLA 2XSZD 4LOAA 1U2RA 2PX0A 2QUZA 1JR6A 1CR4A 1LTQA 1GRQA 1QVAA 3FKSD 3MRSA 1GL7A 2PCLA 4IHQA 4JLVA 3JVUA 4W5WA 2C04A 4GMDA 3KXKA 3NC1C 2G6BA 3TLXA 4OI0A 4LZZA 5JRJA 1ZYUA 3OIUA 5JCPA 2IUSA 4F4IA 3A8TA 4DBLC 4BLOA 3N2IA 2OLKA 1ZMXA 2GHIA 1XNJA 2E1RA 3HU3A 4M1YA 3VR6A 4DLTA 3TSWA 4CRWB 1UAAA 2FJUA 4TLBA 4V0OA 5LD2C 1XCPA 2CE2X 1KI9A 3A1VA 3DL0A 2JIZD 3VHLB 3KKQA 4A6PA 3FKSA 1M7GA 2WAYA 2C77A 1YR7A 5KNDA 5E7MA 2YJTD 3ZDQA 4AKHA 4HAVA 4IOKA 1E4YA 1TQDA 3RLFA 2ZI6A 3OF5A 3EPHA 3A1TA 1Q57A 4M4SA 1EFRD 2GEUA 4IKEA 2ZANA 4YONB 2QSZA 4DJTA 4RZUA 2YVUA 3WHKA 2ANBA 1OW3B 3GJXC 4BFVA 1P60A 1XD8A 3W3ZB 1ZNWA 5HZHA 5CM9C 4PSAA 1ZD9A 3HU2A 1UBFA 1Z0AA 2Q9CA 3VKHA 1GSIA 4DCNA 4TZ6A 3SYNA 2IYLD 4RSGA 4PAMA 3UMSA 1NVXQ 1GM5A 3TGPA 4OYHA 1TQ4A 5J4HA 3AM1A 2IW3A 4V0KA 3AVOA 4TTPA 2P65A 4NYMQ 4LRWA 2F3TA 1XD2A 4O25A 3H86A 4MGIR 4TLCA 4MDEA 3AVPA 3TJZA 3QG5A 1Z22A 2Q9BA 5C4MA 1QVRA 5FOVA 3AF2A 2JLVA 2PJRA 2BEJA 4JBXA 1E79D 1XMSA 3LQQA 4B2PA 1SVIA 1ZJ6A 4OI4A 1V5WA 1N6KA 2FWRA 2B8WA 3HP1A 3ZIAA 3LAWA 3ZLJA 4ZO4A 4HLDA 1QG2A 4JL6A 4BPBA 4LBZA 2A30A 4IRUB 1OF1A 2ZR9A 2VIIA 2W6JD 4KLZA 2PZEA 4UXIA 2HEIA 1KK1A 1E9CA 1O87A 4HLUA 1ESMA 1BMFD 1KI2A 5TV2A 1U9IA 5DYIA 4JVNA 1KI7A 4OQFA 4TQAA 2G0NA 2C8VA 3KJGA 1E94E 3P4XA 5JI3E 1KHTA 1GL6A 3BOSA 4FCTA 3DMDA 4LPKA 4E03A 1XZPA 3X1YA 2RGNA 3AQ4A 2GETA 3NBYC 2BBTA 4Q9HA 5FPSA 4NCKA 4PANA 1SVKA 4LI0A 5FTJA 1E0SA 3BBPA 1EFRA 4H1VA 3HU1A 1NLZA 3X1XA 4B32A 1FFHA 4DSTA 2PT5A 3PVSA 2WMNB 1U94A 1M74A 2ZYVX 3A1UA 3R7WB 1CR2A 2CK3D 4C4PA 5ELXA 2HT1A 1OJLA 3LY5A 2FZ4A 4US0R 3WYAA 4E22A 3GJ8A 4B44A 4L9WA 1HY3A 2MMCA 3I61A 2OCAA 4EKDA 4OQLA 4HAZA 4ZKEA 3GLGA 3THXB 3KTAA 2X19A 5ANRB 3TRFA 2O8CA 2OFXA 4JSYA 3ASYA 2R65A 2OSBA 2EVWX 3EASA 1EWQA 1Z8FA 3BH7A 4RD6A 2QN6A 3DKPA 5DI9A 1KIMA 4X8MA 4I1SA 4IDQA 5FPYA 3HR8A 2WZQA 3U3KA 2RGAA 2XEXA 1YKSA 5CB8A 1CS4C 3LLMA 3T5DA 4EPRA 4DC9A 3G5UA 4QGFA 3IO3A 4QFMA 1KNQA 1R2QA 3ZH9B 3F5FA 5KO2A 5E4FA 4HLQB 4BLPA 2W83A 1CR1A 1EK0A 1KZGB 3X1WA 1EXMA 2BCGY 3FKQA 2QPOA 4PTLA 3LX8A 3U3MA 221PA 1SKYB 5JWHA 3OFNA 5L3SB 2HF9A 3WP0A 3CX7A 2ORIA 2HLDD 1H8EA 1LVGA 2I1QA 5KHOC 1D2MA 5BWMA 2OZEA 4FWTA 4CF7A 2PH1A 1RPZA 3QXSA 1K5GA 1OXXK 4IJMA 1PLLA 2B7BA 2GXAA 3QBTA 4TLDA 1DAKA 1WMSA 4LX0A 1VYVA 4V02A 4EFLA 4UKDA 4ACAA 4BFZA 4HAXA 4DZZA 3AVTA 1DS6A 5IK2A 1Z28A 1XTSA 1JI0A 2FSHA 2V6IA 3KB2A 4NCHA 5FOUA 1NMXA 2FFAA 1SVOA 4Q4JA 1AS3A 2JJ2D 4Q1AA 1L8QA 4BWYA 4NYJQ 3VNVA 1U99A 2PBRA 3M6AA 3PFIA 4FW9A 1I2MA 1G16A 2OV2A 4D26A 1EFCA 4ITRC 3C7KA 2XB4A 4AD8A 2P0EA 3I4LA 2XNDA 4TLEA 1MABB 2OHFA 5CYPA 2AWOA 3JZAA 4Q00A 5J4LA 4TTQA 2QE7D 1E2DA 4PHFA 4Q19A 4UQOA 1XPUA 4D4JA 1XD9A 2Y8EA 5CITA 4POAA 1F2UA 1H8HA 2D62A 4BFYA 1NBMA 4YMTA 3GJ3A 2W0MA 3LH5A 2BM0A 2QL6A 4Q9LA 3P32A 2QMUA 1XWIA 2FG5A 1DELA 5L3VA 4NYIR 1BMFA 1FZQA 1NP6A 4MITA 4NP6A 4XSGA 1NBMD 1JB1A 4Q4LA 2FF7A 3NHAA 2P5TB 1G7TA 3TBKA 3VR3A 4Q1DA 4NYJR 4M9XA 4JLNA 4KSCA 2C95A 4Q1FA 4L9SA 4D0LB 5HTKA 1XCMA 4EQ6A 3K0CA 1VCMA 2Q3HA 3PITA 2WTUA 2TMKA 3LA6A 1Z47A 4EDHA 1T3LA 3ZVRA 3B8HA 4LJ5A 4TWZA 5FBLB 4IDOA 1N5KA 2Z83A 3RNLA 3ZD6A 3B9QA 4YLGA 4D2IA 5EP3A 4B33A 2Z0MA 3ADCA 2QMHA 1F5NA 1NSTA 2XZOA 3CW2A 1AS2A 4OK3A 521PA 1YU9A 1TEXA 5TB5A 4QNRA 1G41A 2AFHE 1Z0FA 2CXXA 2D2FA 4ZDKA 3VR4A 1PVOA 1G8YA 3SNHA 1OFIA 1WCV1 2QRZA 3IPYA 4KHZA 3QPWA 4P33A 2ZRDA 3ECCA 4D0NA 1IY0A 5FBWB 3W9YA 3K9GA 2IYXA 5GVRA 5EJEA 5FH9A 4RFSA 4AKEA 3AF1A 3FFBA 2A7QA 3AF0A 2JAQA 2ONJA 1Z29A 5FBVB 3BB4A 5HCNA 4C0QC 3QI2A 5CB6A 1H8ED 3L0PA 3SJAA 1ZCBA 1XRJA 3AGQA 2ZRGA 3CB4A 2J0VA 3CKLA 3GFOA 4LYAA 3VU9A 5AUOB 4EJSA 1G21E 1IN6A 4HDCA 5GJBA 4QJ3A 3U3JA 3E2IA 1WP9A 4IOMA 3QKTA 1ZP6A 2QU8A 3CNLA 1NKTA 1ZUIA 3GLHA 2O8BA 1N6IA 4EPYA 2JLRA 3PV0A 3QENA 4XVRA 5JEEA 2GJ9A 1S1CA 1KKLA 1OIWA 2DBYA 1XTQA 2OCPA 2FH5B 1CF4A 1KK3A 3TKLA 4XVQA 2WVJA 2QNRA 2WSMA 2IXGA 5JSZA 2WICA 2HCBA 5L8VA 5KPDA 3C15C 2JLYA 1ZC4A 2QGZA 2QTFA 3CF0A 2R44A 3CNOA 1E2QA 1F3OA 3ICEA 2NO0A 3THYA 3PUWA 4WOPA 1E9EA 4JIMA 5FBQB 3RAPR 2PLFA 4JL5A 4LJ9A 1G7RA 1K6MA 2GVDC 4KVAA 1QDEA 4UNNA 1CR0A 2BHRA 2ZYWX 3L43A 4YDSA 4C2TA 5L3QB 3PENA 2JDIA 2OBMA 1S3GA 5D3MA 4S35A 2QE7A 3THYB 1VIYA 2X2EA 4XTCS 4G5RA 4Q7LA 4OQMA 2G9NA 1Q1BA 2J3EA 2OUKA 5C1BA 2NZJA 4TLAA 2FZLA 1KI8A 2KSQA 4QBGB 2HXSA 3LWNA 3BRWD 3R8FA 3BC1A 4B3DA 3ZS8A 4LK2A 5G3YA 4AKGA 1XTIA 4AIIA 2VQSA 5J4VA 4ZPXA 3NC0C 1A5TA 2ZSBA 1KMHB 2F55A 3GLFB 1JALA 4A36A 2NIPA 3ZVMA 3DM9B 1AKYA 3DHWC 3W5JA 4XVUA 1VYTA 2VYFA 2DFKB 2VPPA 2DFTA 4LPSA 1S0UA 1P2TA 1DAMA 4N1AA 2VHCA 4XTRA 1KMHA 3FWYA 2C98A 4IFBA 4PO9A 3THXA 3WNDA 2E87A 1L7VC 5CYOA 3IILA 1IJEA 1SXJD 1TEVA 1F6BA 2Z4SA 3NG1A 4GL2A 1US8A 4JL8A 5LD2B 1VG0B 4RFSB 2ODNA 1CULC 5JHGB 1RJ9B 3DZ8A 1SQ5A 1W2GA 5BN5A 1NI3A 1W46A 3MWYW 4I1VA 4PAOA 1S96A 4B48A 1VHTA 4MA4A 1MO5A 2JA1A 3HPRA 5DI3A 1ZD1A 1NIJA 3GCGA 4IXMA 3RS7A 4I1OA 4GDFA 1JBKA 3QSYA 2OT3B 1E32A 2WOOA 3A36A 1ZAKA 2YWEA 3K9HA 2AKYA 2OLJA 3B82A 1OXSC 1IONA 3WMGA 3O8DA 2FU5C 4KCGA 1CIPA 1G17A 3AP2A 4OK6A 5J5CA 4PSKA 2IXEA 4NBSA 1DE0A 4PHHA 3X2SA 3I5XA 4WZ6A 4Q03A 5EE0A 2D06A 4C9BA 1IN7A 1JEDA 4W5HA 4KYIB 5GVSA 1N6NA 1E9RA 3CH4B 4RD3A 4KAXA 4B74A 1ZU5A 1XP8A 2NO1A 1DTSA 2WWFA 2QTHA 2WPDA 3E1SA 4HDOB 4YMWA 4OI1A 4FMCB 3EARA 5LB4A 5EXSA 4ARZB 3ZD7A 1W36B 1NL3A 1TX4B 2RKOA 1XBTA 2N1BA 1ZIPA 3OIVA 4US2R 3BGWA 4PPGA 1DO2A 2IYVA 4M9QA 5DHAA 1CU1A 1YHNA 4QM6A 1IXSB 1ZM7A 4W5JA 3GEEA 3ZZTA 1ZC3A 2QZ4A 4FWIB 4U02A 1X86B 1IY1A 1RRFA 2RAPA 2IF0A 4Q18A 4CIDA 2R8RA 4HB4A 1U0JA 2B8TA 4BLTA 1NLFA 1E0JA 1OYWA 1IN5A 1Z6TA 1MT0A 5E7JA 3CZQA 4DDWA 721PA 1SVMA 2CEAA 3CONA 2ZETA 4FIDA 5AK0A 2IYZA 3WMFA 1J8MF 2ODWA 4KFTA 4UNPA 2ZI3A 4JT4A 2WJIA 4E07A 2CE7A 4PX9A 1N5LA 2QSYA 2ZRMA 3LLUA 4OHVA 2R6CA 5F3WB 4A8JC 2W6JA 2O8BB 2UZIR 3LFUA 3UWOA 1W7AA 3I8SA 3QBVA 3NTUA 2Q21A 5G53C 3FB4A 4WBSA 5B58C 4Y0VA 1QRAA 2HXYA 2ZRIA 4RKEA 1Q0UA 4HEJA 4DB4A 2AK2A 2YOFA 2RGEA 4Q9JA 4FXPA 2EU8A 1KJYA 2FFQA 3EZ2A 5FR1A 1PLJA 1Q1ZA 1RJ9A 1G1MA 2X77A 1KKMA 1NN3A 1JECA 1XCGB 3QJYA 1Z6GA 2R62A 1C4OA 3AF4A 1LW7A 2J7PD 1CJKC 4M21A 2XOKA 5JS8A 4D25A 2V7QD 4BFUA 2C9YA 2CNWA 2NO9A 3RWOA 3KL4A 4DLYA 1C9KA 3FGNA 3CX8A 1GILA 2EWWA 2ZRNA 1KAOA 3B85A 3UMRA 1KK2A 4R98A 1U8AA 3CX6A 2G88A 4NKRA 3TH5A 3CPEA 2BC9A 3LO5A 4C0JA 4TYYA 3TR5A 2P6RA 4KVGA 2Z4RA 3DVLA 1FUUA 4RCYA 1VCIA 1SXJE 4PXAA 2WWYA 4P31A 2R6DA 1KNXA 5FL7D 5G41A 4B3XA 4MRRA 4EFMA 4NH0A 1V43A 4JLDA 4TMVA 3OEHA 4GBMA 1XJ0A 1JR3E 3W90A 4F38A 4Q21A 1XXHE 3K1JA 4US1R 5SZHB 3RRMA 2O8EA 3B1XA 1GVNB 1ZD8A 3D3QA 3WY9A 3KDSE 1DADA 1X8KA 3HPQA 4EPXA 1M7HA 2BWJA 3IO5A 1M7BA 1S9HA 3CNNA 1R5BA 1FNMA 3BJIC 5EP2A 1KZ7B 1G3QA 4X8OA 3CUEF 1KO1A 1HYQA 2D2EA 3UANA 4TT3A 5J4YA 1OB5A 3X1DA 3AP1A 2EFDB 1EESA 5C18A 1QHSA 5A4JA 4PZYA 3AEZA 2XAUA 1E9FA 4RKFA 3IBYA 4K46A 4TTRA 1PJRA 2OFOA 4PZLA 3K0EA 2F9MA 1G5RA 4KO8A 3TQCA 2RMKA 2IS2A 3AVVA 2AHOA 2J59A 3EG5A 4XWKA 4HSEA 1G7CA 1J70A 1KI1A 4DLSA 2QY9A 4MKFA 4LJYA 1CJUC 1Z5ZA 4B2LA 3U7EB 1K5DA 4B35A 2EFHB 3KQLA 3W6NA 4Q66C 2BMFA 1ESNA 1X3SA 1CLUA 2H8KA 1TU3A 1M1YE 2FGJA 8OHMA 2RGCA 2CLDX 2H17A 3QOFA 2YYZA 2V55B 4C0SA 1QHXA 1KI3A 4IEIA 4MRNA 3LDAA 4Q9IA 4DDUA 2IBMA 1NIPA 2J0UB 1E2NA 4BE7B 1Z0KA 1IM2A 4IW3B 2J5XA 4Q1EA 4EAQA 4BZPA 5F9FA 3QEOA 3QIAA 1GNRA 1GNPA 4XWAA 5F9HA 4C7OB 2AXNA 2YWHA 2JJ1A 3EXAA 3FPAA 3M4YA 1MO3A 2XXAA 1IXZA 2CCKA 2QI9C 5J40A 5JJIA 1RYHA 5SZKB 1U0LA 4DUGA 5AWFC 4BFWA 1KDRA 1FPMA 3R7WA 1IOZA 2AD5A 1HV8A 5K8UA 2QAGC 1KTVA 1E2LA 5AJVB 1VTKA 4B6EA 4TSFD 2VP9A 3HDTA 2VHTA 5G3ZA 3REGA 3TSOA 1BKDR 4DIDA 3EPJA 5JWRA 2J45A 4FCWA 2W6IA 3EC1A 4DIEA 2K5UA 4HZUA 5KDOA 2BCJQ 2G77B 3K0AB 1XU4A 3QPUA 1KAGA 1D9XA 2WJHA 4Q47A 3I62A 2O8FA 4Q1CA 1HT2E 5GJVC 4CT4B 3JVVA 4QKQA 1P72A 3GLHE 1GNQA 1VCNA 4DRZA 4QM7A 4MRVA 3DO6A 3VX4A 3C41J 2AXPA 2FSFA 4JMPA 2HYDA 3UWKA 2O0JA 4GMXA 1I4TD 1T3HA 3O47A 5CLQA 2D7DA 4JLMA 1Z06A 1GOTA 3AUXA 4IDPA 4A8JB 3QG1A 1YZTA 2BBSA 1NVVQ 1YRAA 4M1MA 4M22A 2ZE8A 4Q4JB 5FTMA 2JEOA 4MYUA 1T8TA 5CM8B 2QROA 1I4LD 3OE7A 4QHTA 2ZREA 4TMZA 3ADBA 4CEJA 5BQ5A 4OHWA 4Z51A 1B0UA 5EP4A 2DWQA 3LRPA 4RCZA 2AX4A 3K0FB 3W5IA 1GKIA 2UVQA 4MDFA 1YZNA 1DARA 4PSVA 3MFYA 4DB2A 4AI6A 2BEKA 1R8SA 1YQTA 1AS0A 1G5TA 2A78A 4KFUA 2IX3A 4NU0A 1XXHA 1XPRA 4WZBE 2OE2A 3SJBA 1ZUHA 3FFAA 1II9A 4KBGA 4QOSA 3SHFA 2P6UA 3LBHA 3OE7D 2YOGA 2A5DA 4RFVA 2JLUA 3B13B 4L16A 2VF8A 3WBJA 1XJQA 2H92A 3QKUA 1AZTA 1IY2A 1W4AA 1XXHB 2W2VA 4QBIA 4D80A 4ACBA 1U98A 3ETLA 4FINA 4D0GA 1ZU4A 4II7A 4V0LA 2FN4A 1G18A 1PUIA 1U81A 1E98A 2KBFA 2XJ9A 4Z8YA 1WXQA 2ZJ5A 3OEED 2NGRA 2R6FA 1GAJA 1NKSA 2F1IA 1BYIA 5DO9A 1IN8A 3QVVA 2XZLA 1KO4A 2H16A 1E9DA 1E2KA 3U6BA 4DVGA 3C16C 4DEXA 1ANKA 2O8CB 2ZEJA 3R9IA 4EIWA 4H9GA 1GTVA 3W8RA 2GJ8A 5IDVA 2DCUA 4JLBA 1OYYA 4QBFA 4Q5IA 4X8HA 2EYQA 2ORVA 4AG6A 1OLOA 4B3BA 2ZUCA 1X6VA 1NNEA 2ORWA 4D4MA 5HPYB 2ZJ2A 4WIAA 2CLSA 3MSXA 3SJCA 1D2EA 1P3JA 3B60A 2VP2A 3KKPA 2BKEA 2J41A 2VH5R 3K70B 2VSFA 1X8JA 2Q3FA 4KXFB 2I4IA 1Z6AA 4HYYA 2YZ2A 1OXTA 3LVRE 3K9NA 4PHGA 1UBCA 3H2YA 4URXR 3ZZ0A 5JZVA 2OILA 1AN0A 3MLEA 3GD7A 4KJZA 5KSPA 1R6BX 2FPLA 4N0DA 2PMDA 1VECA 3AVXA 4LV6A 4TYPA 3PEVA 4FCVA 2CVFA 2R9VA 5H1YA 1IAQA 1KYIA 2AD1A 3FHCB 4FMCF 4NCIA 3B6EA 5DI3B 2ZE7A 1N6PA 3F8TA 4EJSC 1SVSA 1NY5A 1S4QA 3QF4A 2OAQ1 3MWKA 4OHXA 1XPOA 4OHYA 4JBWA 5A0FA 2QPTA 3TUZC 4MYHA 1G8PA 3BH6A 2XTNA 2ZAMA 6Q21A 4PFSA 2RHDA 1PV4A 1P73A 2KBEA 3K09C 4XD7D 4NYIQ 5EE9A 1S2MA 2EQBA 3V00A 4AYXA 5JCZA 2A2ZA 3L82B 5KTYA 1TF5A 4GZMA 1XMIA 4GP6A 4R71A 5K8TA 1IHUA 2QTVB 1TPZA 3GEHA 2WJJA 3U3RA 2IS4A 2FX3A 2H57A 3DPUA 1YZUA 3QE0A 3QNUA 4LBWA 3NWJA 3AGPA 1F48A 4I99A 4ARZA 1Z63A 1UKEA 2ZJZA 3NBZC 4JSTA 3RS0A 4LC1A 1Y63A 5KSZA 1WBDA 4Q7KA 5JRZA 2ECKA 3TAUA 4YQFA 2W00A 4C3ZA 1BOFA 1NG1A 3IQWA 4GP7A 1RRPA 2ZRBA 1P61B 3L8ZA 4LC0A 1G6HA 3O8CA 2OCYC 1OFUX 2CVHA 1W47A 3IHLA 4DUGD 1RVDA 2JIZA 2O8DB 4GFDA 2V4ZA 5KPJA 4A8JA 1LB1B 3T5GA 5L3QA 2GXUA 3SN6A 1YRBA 1CEEA 1EWRA 2ZTSA 5CDFE 5JFGA 4B73A 5TVKA 4RZXA 4OQXA 1F60A 1P75A 2ZE6A 5EUQB 4JBYA 3DZDA 2XTMA 2BMDA 1A4RA 3K0FA 4EUNA 2JLQA 3OEHD 2BVNA 3W6PA 3WP1B 1KSFX 2WV9A 1A2KC 4Q7MB 4JLPA 2QP9X 2BKUA 2BJWA 2NO7A 3AF3A 5FTLA 2LWIA 2NOAA 2GA8A 2HYIC 1HURA 3NIBA 2E9SA 3EC2A 2DR3A 2FNAA 1R0ZA 3CF6R 1Z07A 3P27A 2YWGA 3EAQA 1TADA 4A2PA 1E2JA 4A9AA 3Q7QA 2RCNA 1M34E 2XB2A 3IQXA 1FMJA 1T5LA 1QHYA 1GL9B 4IEEA 2V7QA 1N6OA 3IHWA 1DG1G 4BUJA 3N2EA 4UNQA 1P2VA 4JLJA 2Q9AA 3CPJB 2J0SA 3B1YA 4Q4HB 4Q7JB 4URWR 4M0LA 1DAIA 2QQEA 1RZ3A 1T9HA 3HR7A 3FE2A 2ZJYA 4M2LA 3THOA 3R9WA 3D6TB 3LW7A 4L15A 1YJ5A 2IYTA 1N6LA 1G3IA 4BRUA 2ZS8A 3FHTA 2D3WA 4A0FA 1BIFA 5EXPA 2OAP1 2IA5A 4ILEA 1OHHA 3AKYA 2V1XA 2ZRPA 3PG5A 3AKDA 821PA 3NHBA 2QA5A 5LB2A 1RRCA 5KDLA 1I2DA 3EIEA 2IUUA 3PUVA 3EZFA 2HUPA 4L4UA 3IDQA 4HAYA 1SZPA 2GEVA 2IHYA 2BDTA 3DMNA 1OKKD 1E99A 2B6HA 2PT7A 3HWSA 4QXAA 5CIQA 1JEEA 4URUR 5FL3A 1KDPA 3K0CC 2HT6A 1S3SA 4KITB 1VG1A 3ZJYA 2ERXA 5KUTA 4P4SB 1CJVC 3PEWA 2XNDD 4A92A 4OKSA 5FOXA 5CDFA 1NJGA 1MR3F 1W49A 4JLAA 1WE2A 3AKCA 1R4AA 1DPFA 2WMOB 1II0A 5KSOA 2O5VA 4UNSA 2AR7A 1D2NA 4RD2A 1M2OB 3CF2A 3MWJA 5KDDA 3U5ZB 5AJWA 2IF2A 3SJZA 3OIWA 1X8LA 2B21A 3UG7A 4AURA 5FFMA 4DSUA 2YOHA 3W3AA 2GRJA 2V8OA 1AA9A 4P0TA 3VX3A 4R7ZA 2Z6VA 4L5BA 3QKRA 3L0OA 1E2FA 1E6CA 5HCIA 4BGDA 3UXMA 4BFTA 2V6JA 3FMOB 5JEDA 1II8A 2HJVA 3GJ0A 1E79A 1KK0A 1TQ2A 2DY1A 2GNOA 3P20A 4UXHA 3SHWA 2EFGA 4EPTA 1FQJA 2GZDA 4JVSB 3WHLA 4DEYA 3I92A 1W44A 1G4AE 3A6PC 1TUIA 1L4UA 2KE5A 4TL7A 2XTZA 3BIFA 2QT1A 5K8LA 1S1MA 3UPUA 1G19A 4ZCIA 3PIRA 4GZLA 1N0UA 4GRAA 1FTSA 1U90A 5A5GA 5M04A 3NDBB 1OXVA 1LV7A 1U8YA 3KJEA 4DCSA 4QG7A 1A82A 4AKIA 2GTPA 1DAHA 1G8HA 2G0TA 1CXZA 1P6XA 1E0AA 5DYGA 1JJVA 2I1VB 2REBA 3QKSB 3N5CA 4G0NA 2GAAA 4DSOA 2J9RA 2O8EB 1TNDA 2OFWA 1NN5A 2CJWA 4OHZA 1M6NA 2ZI5A 2WIAA 2G3YA 4LJ4A 1EGAA 3U61B 1LY1A 4MGZR 1W0JD 2QBYB 3I5YA 1P9NA 4JJZA 2CHVA 4B76A 4TMWA 5FTKA 5KSYA 3GFTA 1ZM2A 4DSNA 3AB3A 3BFKA 1YE8A 4NONA 4NCNA 2BMJA 5FUWA 1H65A 4MQBA 4TL8A 4JJKA 2CL6X 2R6GA 1FP7A 2NPIA 2W6ID 3L8YA 4O2RA 2EFCB 4HI0E 1EFUA 1NBME 4GI7A 4B75A 4BZXA 5LDDC 5JBQA 3EZ7A 1OIVA 1OIXA 1J8YF 4JYBA 1T6NA 1OV4A 3DEFA 2V54A 4TYWA 1HA3A 3B5JA 3TE6A 4IVQA 1Q3HA 1J2JA 1N5JA 2NPFA 4FI3C 2W2TA 1AK2A 3EPLA 3WRXC 4G3XA 3L0SA 4UJ5A 4CZ2A 1OFHA 4LSGA 4OQNA 5GJWC 4P3YA 3TMKA 1XEWY 2WJGA 3P4YA 3VKGA 4WXRA 5EXTA 1UBGA 4Z54A 3P26A 4Q4AB 1ZUNB 1DVRA 1ODFA 4KV9A 1WDTA 4QJ5A 1WQ1R 3MAAC 2WM9B 2ZU6A 3THWB 1Q20A 3OZXA 1VYUA 2CL0X 4LHZA 2DFLA 3FYHA 1E2PA 3SI7A 5DN6D 2ZSEA 3G0HA 4ZDJA 1LF0A 1HUQA 1KDTA 2VHQA 4A0HA 4PO1A 4O2LA 1CRPA 4LBVA 4NPHA 2GKSA 2ANCA 3KUDA 4TL6A 4RJLA 3U60B 1HE1C 2VF7A 2WKRA 1FTNA 3O8BA 1MABA 2DFNA 5JS7A 1W4CA 1N6HA 1OT3A 1ZNXA 3BB3A 2GJSA 5DSZA 3TUIC 3R9XA 1SXJB 2BMEA 1L4YA 3ND8A 4YXWD 4LUCA 2QM7A 5HR5A 4HUQB 1F2UB 2J1LA 3C8UA 2XNSA 5AUQA 2R6AA 2WIBA 3EA5A 2CDNA 4NHOA 2WHXA 2GBLA 3T12A 3EPKA 1COWD 3PJRA 2XJ4A 4NMMA 1R5OA 3D31A 1CRQA 1U8ZA 2DPXA 1FW6A 2GK6A 3LVQE 3HYTA 4DDVA 3VR5A 2VHJA 3O8RA 5H8WA 3LBIA 3C5HA 3GJ6A 4OJQA 1P9RA 3A1SA 2ZM5A 4DLXA 2ZU0C 2IK8A 2RHMA 2VP0A 1W36C 1XMVA 1JR3D 1T5IA 3SBDA 1AJEA 4B6FA 1VG9B 2UKDA 3ZS9A 2P5SA 5DNYB 5KYKA 3AUYA 2PEYA 1GZSA 1BS1A 3TQFA 1E1QD 1XEWX 1IN4A 1Z6YA 4F93B 3EWSA 2QM8A 1N0VC 1KY2A 4Q9KA 2AFIE 2GJAA 3GJ4A 3G82C 1ZW6A 1NSFA 2MSDB 4A2WA 1UKZA 1WA5A 3EW9A 4IXNA 3JZMA 4HZUB 1W5SA 2KJQA 2ZJBA 3CLVA 3U3OA 3LBNA 3RC3A 3W8NA 1Z83A 4XWOA 2WKQA 1FQKA 1G3MA 1JQLB 2WWXA 4ZKDA 1KDOA 2N46A 1JNYA 4MYTA 3QY0A 3SYKA 1ZIOA 4PC2A 1W5TA 2ZIAA 2BM1A 3ZGXA 3ZVLA 5E3HA 4FD2A 4CW7A 2ZRKA 1U0HC 5AUPB 4TMXA 4LV5B 5BXQC 1U9IC 5EZ6B 3D8BA 3NBXX 3TVDA 1D8TA 1KSHA 4CEIA 2NG1A 4NL4H 1P4SA 2RB4A 5IT5A 1EG7A 2ZUDA 1L2TA 3BFVA 1Z2CA 3MJRA 3LXXA 1UPTA 4NTZA 4NCJA 1OSNA 2Z43A 4LGMA 5JSZB 4YXWA 2WJVA 1ELOA 2GWHA 3FHOA 4PR0A 2Q6TA 3CZPA 3AVWA 5FUYA 3T35A 3RWMB 3PEYA 1GIAA 2QMEA 4QGGA 4OL0A 4IFEA 5LPNA 1UDWA 4G5OA 2ZR7A 1TTTA 1KMQA 1YZLA 5C4GB 1DAFA 2IYQA 2PEZA 5KNCA 5FPHA 4U5XA 1CP2A 2C2HA 2IWRA 4QGHA 3ZIAD 3T15A 1W36D 3P1JA 4LJ8A 3T1QA 1OHHD 4JS0A 3U44A 4D82A 3U7FB 4MKIA 1MO4A 3QPVA 2P3SA 2XXAB 3T34A 4P4UA 4NDZA 2WSSA 1G20E 2JJ8A 2GCOB 2O0HA
chains in the Genus database with same CATH superfamily
3EYWA 2Q3JA 1PZNA 3CM0A 4N40A 4Q1BA 3K8YA 4DCVA 4AJLA 4V1CI 3REQB 2JVJA 1M2JA 3PQ6A 4FQ5A 5EE3A 1XA0A 4R2IA 1FDRA 1PO7A 2V7BA 4PAQA 1NLYA 3MT0A 1U0TA 4BO8A 4RD4A 3AVQA 1L1FA 4CKYA 1FP6A 4QUBA 2BZSA 4Z4CA 3B48A 1HM5A 1SY7A 1UJ2A 3FIJA 2QT0A 2XQKA 2J6HA 2GPNA 3DE1X 5E4YA 3OJCA 4AY2A 2GSWA 1EJ0A 1TYEB 1CJMA 1G64A 2B0JA 1EFHA 4BYMA 1VHWA 4G8CA 5CXXA 4C7MA 4TZ0A 3TAHA 4IHJF 5LA6B 3VR2A 2EG9A 3LQ4A 3ROGA 3VV2A 4JI8B 5SY4A 3PFFA 3KJIA 4FLMA 2HI0A 1DUVG 5E6RB 2ZS7A 1MEJA 3H5TA 3E0QA 3RC8A 2PRKA 1M1YB 1KO8A 2QRJA 4ZJYA 4KLAA 4MARA 4CLXA 3EVZA 3VVCA 4DR6B 1UH5A 1D1SA 3I37X 4R0MA 2V1UA 2P77A 5KQGA 2WYIA 1PG2A 4ASUA 4FE3A 3W3AH 3ZQKA 4OMFG 4LBYA 5TDHA 1O0SA 2IZ5A 1OVGA 5HE8A 1LQTA 5AW9A 2F43B 1ZH8A 3MBIA 3EFOA 5EN4A 1M76A 3PICA 4YJFA 3VO1A 4GMGA 4D8YA 3K70C 4DLRA 1B7GO 2DBZA 3CXRA 4QUKA 1OH7A 2PJZA 4FFNA 2IBSA 1D0IA 1GA1A 2GYUA 4Y0VA 2VNJA 4GT1A 1SCNE 1XMXA 4G1CA 2FZGA 4MRPA 1QHEA 2ZVQX 3AKEA 3EGDB 1RI5A 5CBPB 1YUNA 2X13A 2X5NA 1ONBA 2ZYGA 4AIRA 1M1NA 1UOPA 2MOKA 3LCCA 4AUNA 2ZSUA 3D8RA 4QLAA 1TIBA 2FVXA 4AK9A 2JAUA 1UJMA 2QAGB 4G5GA 4QXQA 1JLLA 5HW0A 5K6RA 3OOYA 1ECBA 4PICA 4OHRA 3FTQA 1DXQA 2ZJ1A 4TKUA 3EIQA 1KJZA 3L06A 3NOVA 2YXPX 5DJ5A 4XVHA 4YRNA 3C5EA 3C3DA 4Z1MD 4PIVA 3GRFA 5F98A 2P8SA 4IHKA 1QAOA 1RWVA 3S2IA 4ZT2A 2FN3A 3MHTA 2IZ7A 1W6UA 2GXSA 1FRZA 3HYSA 5AKLA 5TT1A 1Y7IA 2GILA 4R8LA 4BNVA 4HVLA 5KREA 2O8FB 5B6IA 1RVV1 5C80A 1XWWA 3ZJTA 1LSUA 3Q4GA 4WW0A 3UIEA 2BGWA 4PF1A 3U0BA 1L5HB 3WIBA 3RG2A 2IYYA 1XLWA 3DLIA 4BVAA 1AUQA 1FFGA 3NTVA 2ZIZA 4JJFA 1SULA 4JLSA 5JQGA 1V8PA 3ZLUA 5DPMA 2FA9A 3CNEA 3GJ7A 1TU4A 3WO0A 4RHCA 2XVZA 3CLUD 5K3AA 1EFPA 3B70A 3DOEA 1HRKA 1NBHA 4IY1A 2WDPA 1MRZA 4FN5A 4MV6A 3SE7A 3UG6A 1QTQA 1M8JA 4TXJA 3EPRA 3C4JA 4DBLE 4OX9Y 3PPXA 4AJIA 2HPZA 4WL0A 1HNXB 3R5HA 5AFSA 4W5NA 3VM6A 1OX4A 1AZSC 1JXOA 5MN5A 1W1IA 1AQJA 4X93A 1Q0PA 1LS6A 2QL9A 1VI2A 4ODIA 5HKKD 4Y1RA 2PT6A 2BJHA 4LY3A 3NR2A 2NU9B 3E22A 1OZ0A 4LHSA 2VDVE 1XRLA 3UT5A 2D1QA 2FPIA 1U0RA 1O9GA 4X95A 5IKMA 4BX0A 2BBOA 1BE6A 4JBIA 4JVMA 5BSVA 3ABQB 2BFCA 3WG9A 3WRVA 3N76A 4RULA 3FWHA 2FSGA 2Y66A 3KAQA 2R2GA 1RM0A 3OE4A 1MXFA 4YCCA 1VE6A 1AHHA 1FP4A 3AERA 1A88A 3NH6A 4HVCA 3D5TA 4IIJB 4HADA 3O84A 1ZSNA 3GHHA 1WZNA 2QYTA 3L1HA 3L3BA 1YZVA 4WXPA 3SEQA 2F1JA 4TV8A 1UBMS 3HYRA 2QTMA 4EVQA 5DZSA 4BTLA 1SQFA 1O6GA 2FWMX 3GCZA 2W4QA 2Q2NA 3PCTA 5GMOA 4C0LA 1FL9A 4EEZA 3BS4A 3QWIA 2PCJA 5ICCA 2FPSA 2UYYA 5AJZA 2V3CC 4J0QA 5TPWB 3M89A 4Q02A 3G7UA 3U7GA 4NYMR 2VJOA 1ENZA 2ZITA 1VE7A 2AV6A 1WV1A 1UDBA 2QD3A 2F7SA 2B92A 4IRXA 4KMMA 3TI9A 2HO4A 3JQGB 3USES 1QS0A 2BOVA 3ZCXA 1PR6A 3WLKX 1XAJA 2A5FA 3MB8A 4U2EA 1V9SA 3O0TA 3HI4A 2XRYA 3PKZA 3K30A 4K7JA 1FE8A 4DG8A 1QK3A 2ZSKA 3IPRA 3KLOA 1T10A 5E6SB 3UB2A 1WAMA 2R25B 4JU9A 4M38A 4CIWA 4GLJA 1X7XA 2JRLA 4MS4B 3D4PA 4H4CA 4A2QA 1PQPA 2MYUA 5AKIA 5JHHB 4H31A 4ETMA 1U8XX 1Z3CA 3F7NA 3IYLW 4ND7A 3CY6A 2B4YA 3TKYA 1SB8A 4JFAA 4JJIA 3IIJA 4V0ME 2C2BA 1JU3A 4H15A 4LXHA 2VSXA 1RC8A 3FM9A 2VWQA 3ILYA 3E5HA 4PPQA 4LMRA 3UQZA 5K3EA 5D3ZA 2G25A 3UAZA 2J87A 2IEYA 4DCTA 3ZDZB 1BHQ1 4HYTA 3BMCA 3PHJA 2ZQ5A 4R3NA 4C21A 5LUAA 1ETUA 1D6MA 2F1RA 3MQ2A 5IARA 1AKVA 2JNWA 2F9FA 1W85B 1CTQA 2UYQA 4E70A 2X8JB 5I8WA 3HNRA 2OCKA 4RD1A 1JXQA 4RPGA 3DVQX 1P7PA 1ID1A 2UZ3A 1YOVB 1HSZA 1NQVA 1NI5A 2RBGA 3DT8A 3MRVA 3KHUA 3OPXA 4MICA 4UOQA 3NYIA 3S44A 3Q9UA 3DZBA 4RHXA 3PVZA 4ZVTA 2YIJA 4H6PA 3ESCA 3GA0A 1O77A 3KU1A 3PEUA 4GZ3A 2VAPA 3ASVA 1FMTA 3TNYA 3BG5A 5G1NA 4G5SA 3PVCA 3FHLA 2EW2A 3RHZA 4OAQA 4XCVA 3S1LA 2XCLA 2DX7A 4H0CA 4ZYTA 5KYUB 3I8XA 3R6TA 4A6EA 2IS1A 2FOLA 4I14A 4X7PA 4EMTA 4FZRA 2CXSA 2PX3A 5HZKA 3SBEA 1GGJA 3CF4A 3QMMA 2AUNA 1JJAA 1JQJC 4LCJA 1D4ZA 3PXGA 2FEAA 3OEEA 1PVVA 2B5WA 5IKEA 2RONA 5K3OA 2PLRA 4XEHA 2WFMA 1K7XB 3CEJA 3BJRA 4L9RA 3E2MA 2O1SA 2RBEA 3GRKA 2VQ6A 3TIGA 1EWKA 4HNVA 2XNCA 3UCEA 4DV0B 1EHYA 1WABA 1X2EA 4E2WA 2GPWA 5JQGF 1LX7A 3QEJA 4WSOA 5HRCA 2CF5A 1PGPA 2P78A 3F6YA 4NU5A 4D56A 3QELB 4RCVA 5H4GA 3MOGA 5DHFA 2H4FA 2VTEA 4JN6B 1YDEA 2NPOA 1XK7A 3H9JA 3NH9A 3BMNB 2C82A 1E0KA 3S28A 3DC2A 4K6HA 3ZXUB 4DV6B 2HU7A 3RKUA 3NJRA 3WRYC 4DIMA 3O31A 2C99A 1NQWA 4FFBB 1D07A 5FF9A 2GAJA 3FI0A 3TB4A 2WJ4A 1GU1A 3UWPA 2PWBA 2QM3A 3QU4A 1S3IA 2Z30A 3PXEA 3DLTA 3QU9A 4GSKA 1NBEA 1KPIA 2QW1A 3NASA 4M1TA 4NESA 4P0QB 1RHUA 3ST7A 2RD2A 4Q6BA 4L5CA 4KQ1A 3CRVA 4X1IA 3KTFA 3MXOA 5JNTA 3O90A 1L9KA 1QB8A 4N41A 4F72A 2JGRA 2O2CA 4LJ7A 1N2BA 3GUVA 2IEBA 3BIWA 2DFDA 3U4GA 3AFOA 2VCEA 3SK0A 5EOVA 1RE1A 4BKOA 1PF7E 4HMQA 1SHUX 2AZ4A 2JEZA 1PEDA 2VHYA 1N2CE 3D9QX 1W2HA 3L0BA 1O5OA 3IKVA 3LW8A 3ORHA 1AC5A 1VPLA 3BE4A 3QVXA 4HUJA 5TEVA 1G8MA 1AZWA 1U4SA 1V6CA 2ZJ3A 3G0BA 4JU8A 5JAUA 4D4LA 1TJ5A 4GKAA 1U2SA 3FVVA 3F2VA 2QI9F 4EKEA 1PT5A 1VMAA 3R0XA 4AMZA 4UARA 1CUIA 1C8KA 1U0SY 2V0NA 3ORFA 1TPYA 3AUTA 421PA 2E4YA 1QCYA 3UAXA 5LIPA 1Z2NX 4M1SA 2V6MA 5B64A 3GEMA 4GRDA 4NAHA 1DWQA 2IXFA 2OBNA 3CO5A 4Q3NA 1JEJA 5EZYF 4PE5B 1CYEA 2H3EA 2DXIA 1FX0A 1LVUA 3IMGA 3T4EA 1WWKA 3OHMA 3WZ2A 2R7MA 3L0DA 3GIDA 4KUHA 1WY5A 2JDID 2L18A 4TPKA 1ML3A 4MV8A 2W8ZA 1SKMA 1YB1A 1Z7EA 1ZNZA 2WYUA 5L4NA 2XUZA 1TTHA 3HJNA 4R2JA 1LA2A 1ESZA 1FNNA 4RD0A 4DLLA 3NHPA 4WXYB 3UJBA 1MAUA 1CRZA 4BWVA 3M9XA 3G2LA 3ZZUA 1OFTA 2YJNA 2Q3LA 3ZDCA 1ZN7A 1FYDA 3DFZA 1VSUA 4QL3A 5CJPA 5E38A 1GGMA 4OJMX 3S7ZA 1HFKA 4YJ2F 1KXZA 2MSEB 4K0RA 1XZKA 1SIOA 3L9XA 3TEJA 2JAHA 3HM2A 2Q0HA 4UJ3A 1DTWB 2ZRAA 3KAJA 4ROTA 3WBBA 2J9XB 2ZDQA 1V5FA 3RSOA 1DEKA 5CVVA 3A4MA 3NVAA 5I7HA 1I7DA 3HCEA 3MUFA 5F1YA 1DFHA 2ZTVA 1NMYA 1HSOA 5G1OA 4ZVQA 1XHFA 4LOLA 3OPYI 4GS5A 5DTMA 1PQUA 4XLZA 4BVLA 1R0XA 2R66A 3I34X 5IF9A 5K0NA 3GAMA 1ORDA 1XZAA 4HGRA 5U1PA 3M4XA 4FTWA 1RIFA 5CBPA 5C53B 3CR7A 4Z7JA 3OLCX 5P21A 2ZROA 3MG9A 1QIFA 4ZEOA 1N0HA 2OYSA 3DP9A 3OE1A 1D6JA 1BXRA 2IRWA 4LRSB 4OG2A 4K05A 2NQ2C 4PQEA 4YASA 3X2FA 3HN6A 2NV6A 1ZM3A 2CHQA 3GRYA 1MPXA 2CJWB 4D6XA 5HM8A 1YZYA 2ZI4A 4PRKA 4ME6A 1I5OA 3I04A 4ZT6A 4BNDB 1D4FA 1XQVA 4N5IX 5FI0B 5J2TF 3OP4A 1TZBA 2Q4DA 1RAGA 2NZ8A 2WG1A 2W58A 3AW8A 3EA0A 5DLQC 3ZNPA 1MF7A 4AZ0A 2O52A 5KKCA 2VUTA 3O5AA 4NXNB 3COWA 3K6JA 1YQWA 1GQSA 2ODBA 3LUBA 4O59O 4PYMA 2IHZA 2BV3A 4E94A 5F7OA 5DT9A 2I22A 4FMDF 1XTBA 1I1OA 2Y9MB 3K2IA 4I81A 4BMXA 4UBKA 1XZBA 1ZRNA 3CLTC 4D42A 1BWRA 3GRPA 4OA8A 3X44A 1ZVQA 3OWOA 5K9ZA 5BNTA 3CSUA 1PK9A 2ODAA 4G63A 3TL3A 3B7GA 3FRHA 2IKQA 5K8CA 4IG4A 1M3SA 4U2DA 1E3TA 2HRBA 2QENA 4BQRA 3JQ7A 1R88A 1H6BA 4KODA 1GYRA 4QUDA 3E7XA 3QXHA 4MCHA 3CUTA 3O8LA 3SKXA 1PK7A 3W7BA 2C54A 1UJ5A 5LP1A 2AEFA 4XX1A 4DV5B 2A1TS 2MMGA 4XGRA 1L5OA 5EQDA 4F9EA 5CG2A 4J3NA 4EJSB 4GM4A 4HKTA 2ZKIA 2IEZA 3B6JA 3G0DA 3HNPA 5CK4A 4Z99A 5FBZA 2ZWIA 3V4FA 1A7JA 5JMTA 3HBLA 2FPMA 4Z2YA 1PX0A 1WW8A 1Z0DA 2Q3BA 1Z2PX 2QMOA 4ZO6A 5REQA 4P8RA 3SSMA 3T1VA 3IA7A 4OIMA 4JZYA 4BEWA 3B9BA 5AW5A 5H0IA 5JPDA 1W8IA 1UKYA 2XMBA 3FOWA 1LJ8A 1CHDA 2QBYA 1I4WA 1FP4B 2ZYHA 4P3NA 1GZ6A 1DBPA 1X1RA 2D1TA 3MLAA 4OBEA 2X7XA 3T3MB 3L01A 5L9AA 3LWZA 2G17A 2RI1A 2GKOA 1BROA 1A72A 2QDXA 2FFBA 1U2TA 4J91A 3GMIA 3MLBA 4RHEA 5KYUA 2CNWD 2ZXUA 1CZKA 1XEFA 4X60A 4Z5XA 5KNBH 1IEQA 3GNSA 1WW2A 3ANTA 3LX5A 4L95C 4Y9TA 2OD2A 3H4TA 1NFRA 3AXSA 1RTKA 5HJEA 2PGNA 1Y5MA 4AJ1A 3O8OB 5E1OA 5ARDA 2RGUA 4L0CA 4UQPA 4OHOA 1AIPA 1T0JB 2AN9A 2RGNC 3K53A 4ZJZA 3K1ZA 1JHQA 1MQSA 1A8UA 2GZAA 3U80A 1ZN8A 4JEHA 3IP8A 4YT8A 1GT6A 5DB4A 1KIAA 3OTOB 4QO8A 1H2HA 4MW5A 4MPPA 2VJCA 3DDWA 1KS2A 4I4CA 2ZUBA 3UJ3X 2PO5A 2PO7A 2ZIXB 4I50A 4BMOB 3ZW8A 4PAWA 4ZVPA 5K0JA 4EDFA 3QVOA 2F3UA 2CHEA 5IHPA 1KERA 7MDHA 1KOGA 4TWBA 3A6EA 1JQBA 4IWXA 3OCYA 1E9AA 1HNZB 2CFRA 5DASA 1GFZA 2Y93A 1VA5A 4N01A 3EA4A 4LHXA 4BFSA 2I7VA 2V9PA 3PI6A 1ENOA 4OH7A 4WKOA 1E2IA 3FIUA 3KLBA 2Q7XA 2G1UA 4F4HA 1HEIA 1ZWKA 4XUDA 3KC2A 5CA0A 1P5ZB 1Q6ZA 3QLUC 5JZMA 3M3DA 3WGYA 4JUDX 5IWCA 5JCOA 4S12A 4DQKA 4G01B 2BFFB 4NBLA 1DBIA 7REQB 3L4SO 4DG9A 3WLLA 5B7NA 4S2EA 4NE9A 3N8IA 1F2TA 4RH0A 2ZBUA 3RD5A 1R6DA 3KSAC 2REQB 3ZEIA 4GP9A 1BKYA 2F3PA 3Q3GE 2JK0A 4F2PA 3U5TA 3KWFA 3ADDA 1GPMA 3IXQA 5CLFA 2PSDA 1UEXC 2XVMA 1Y9AA 3C3JA 3W4JA 3EEBA 4CL8A 1CT9A 3N70A 4M53A 4R9NA 4ETWA 4Z4FA 4JHXA 4AF8A 1HH4A 2ZYUX 4WD3A 3IPXA 2NU6B 1UDXA 4XRGA 1P17A 1BS9A 4YMUA 5BSFA 1CDOA 3DOFA 3S68A 3STWA 1F4PA 6PFKA 3E7DA 4WX2B 5B55A 1Z4LA 3MUEA 4ITUA 2VDMB 4YRRA 4DLAA 1TL7C 2DTEA 4K6MA 3U7QB 5H9WA 2XYGA 1YDWA 2YIDA 1Z4IA 4QDXA 1DX6A 1JEAA 1DCKA 2WAXA 3QLTA 1AQNA 4RA6B 1A9RA 1JPJA 1V25A 3AR6A 2ETXA 4KQXA 3TOZA 3VU9B 2YC4C 5BURA 3TZBA 2VP5A 3R8CA 4MJLA 4TSFA 4YS6A 1FU8A 4CEHB 1U2EA 4RVNA 1D6NA 1H69A 2VHVA 3OF3A 4MAMA 5C0OE 2Q0XA 2C0CA 4DCUA 2Q7OE 5I7OA 4ZICA 1I1NA 5IM4A 3ZOZA 2I7DA 3IBFA 1E9BA 3PDHA 1BAPA 3V6MA 3H7AA 5IBCA 4S3MA 2HBZA 3VZRA 1TJ3A 3C6YA 5LQNA 3IEVA 2C2ZA 2UVDA 3OZ7A 5KVAA 2HAEA 1YMVA 1NA5A 1VPEA 3AETB 3PHBE 2BGJA 1NQ5A 3LVFO 1VHLA 4UUNA 4YWHA 1YR6A 3GJYA 2CLKB 3NAGA 4WA7A 4GECA 2O1WA 3EOAI 1M1UA 3PFHA 4DA4A 4ABYA 3ENVA 1L7RA 4L5JA 1A9ZA 4K9OA 5FTNA 3T3PB 1I2ZA 1K8YB 1QNLA 1W4RA 1DIOB 3LBFA 1K75A 1SVWA 1KDZA 1PJ3A 1RJFA 4O4IB 4FHEA 2CUKA 4PZDA 5JWOA 2ES4A 1Z9BA 3BULA 3P8ZA 4LQ4A 3TTXA 1A1VA 2C9MA 2V7EA 4V0MA 2P67A 1G42A 3SQOA 2AEEA 3P9CA 3FWZA 3EIHA 4C0BA 4CM4B 4R1MA 1CJTC 2XUFA 1R4NA 2Q0QA 3FF4A 3TLKA 1Z4NA 2GHQA 4JP1A 2BHNA 1QOQB 2R4QA 4DLPA 1ADFA 3AIKA 3VPDA 4LJRA 3E18A 1MC4A 4E5YA 3RFXA 2CUZA 1OPXA 4JYZA 2WUEA 5ESDA 4HDQB 4H1WA 4CEIB 1YUMA 2CNKA 3OESA 1QLJA 3KOOA 4BNMA 1A5SB 3AH8A 1UM8A 2JI6A 3VHXA 2H5IA 1PDWA 5C46F 3ADKA 3CTMA 4G97A 5ALVA 4MUBA 3ITEA 3MTBA 5I01A 4RIFA 4RVHA 2CNDA 8GPBA 3PLAE 2J4DA 1YFLA 2WWGA 2DH5A 4QBHA 3F4BA 5E7IA 3R7DA 2H5EA 1QDLB 3FMIA 1GLGA 2HNBA 2Q2VA 4UEJA 3INGA 1HQCA 1WUJS 2DLDA 3ZY4A 1BWPA 4TYQA 5BYKA 4JXXA 3X1KA 4Y9RA 5EEGA 1WU7A 1TM3E 2WABA 4EBFA 2YHSA 1SG6A 1X7YA 2JGDA 1I3LA 4GICA 3DDOA 5LWQA 3LUJA 4L76A 3SR0A 1SU8A 1A77A 1DX4A 4C7VA 1XOIA 1LFDB 3F9IA 3OQMA 3NHSA 5KQRA 2WJYA 1DTEA 3D6VA 3DFKA 2GN6A 2CFTA 5B3JA 1GZUA 1NMZA 1ZCAA 1BE0A 1JLSA 1M2FA 3HUEA 2X1VA 1FUKA 1M0SA 1YVDA 4CF3A 4TKVA 2DJ5A 2WLTA 5CIWA 5FD8A 2XDAA 2ZRHA 4JP8A 1RMYA 2G82A 2WD9A 4BYGA 5KC9A 3GJ5A 2C2KA 3TX2A 2D7CA 4YTEA 5CFMA 4KE8A 1DB3A 1OAOC 3BWCA 3D6AA 1M67A 3OLVA 1XO1A 4HLCA 3I72A 3O0DA 3RI3A 5KBYA 4OGFA 1I3MA 2BTQA 2X8AA 3LG2A 3C45A 5COBA 3ZV5A 3KEGA 3HB4X 3WHIA 5KOIA 4RY8A 4IEFB 5F64A 2OD7A 3KFVA 1F2DA 4BKQA 3UMCA 1JR3A 4BO5A 4DIFA 1MAHA 1QG4A 5B2EA 1FFBA 2CLCX 2RC5A 1USGA 4KK4A 5DFAA 4ZCMA 1H85A 3D7SA 4M0FA 4K9MA 4V03A 1UANA 1E3EA 1PTKA 3G85A 1L5ZA 3EVDA 2PKWA 1JXMA 3Q5EA 4FGKA 4PBSA 1WKBA 1TIPA 1KYWA 4XGNA 2FMXA 2QAJA 2QL5A 3SZGA 2GJKA 1TAGA 3LE8A 5EUMA 3MD0A 4LRQA 1BTOA 3DTVA 3WV5A 4EFDA 2RH5A 4MGKR 4ESHA 5CD1A 1XJCA 2LTAA 4DA8A 4E4RA 2SBTA 4EATA 4HFJA 1VJTA 2Z2XA 3AL3A 2DKOA 3QJGA 4OHFA 2GBPA 4OHKA 5KU1A 3LRXA 1TUBA 3M3PA 2JLBA 2G83A 4O4JB 1EE2A 1HTBA 2IU3A 2EZUA 3OCZA 2WDZA 1A96A 2JBAB 1T8UA 2DLCX 1F8XA 3CLRD 4YJ3A 4IWYA 2P4SA 4IFTA 2QLTA 3F1KA 1AG9A 3Q6IA 2HPVA 4DXHA 1ICEA 1TUBB 5EMMA 3TTYA 2PGOA 2WFLA 1Y6GA 1K08A 1Z18A 1LZKA 2PGAA 3ME5A 3S7TA 3K0SA 5LU8A 5DYWA 1XEXA 3G49A 2VA8A 1TO6A 2HJGA 4LYFA 1EZ4A 2H5LA 3BWEA 5DXJA 1E2HA 1NVVR 3BHJA 4U4AA 2HM7A 3H5AA 4FX2A 2BKVA 4URZR 1OTXA 4A23A 3IQEA 1KY3A 3EZGA 3R44A 4U2CA 1YNSA 2GZ2A 1KFBB 5GGYA 2PX0A 3DCJA 5FBKA 3ZE6A 1FQOA 1T4CB 2C5EA 5HRAA 3QOXA 4N4AA 4B9EA 1CQJA 1QVAA 1T9AA 3QHQA 3A1NA 2XGGA 3ABIA 3PQ5A 4XQCA 3AETA 5IXJA 4PX5A 5A04A 4JLVA 3FCUB 1OAOA 4GMDA 1BU8A 2YDYA 3BWVA 3H83A 3KXKA 3NC1C 2NSHA 2CFSA 2QJTA 2Q4TA 1ZYUA 2CLMB 2HIAA 3OIUA 4JGGA 3UH1A 4UBJA 2WF8A 3E9QA 4BJ5A 1JHZA 3JD0A 2R7NA 2O05A 3JQ8B 4PM4A 3MQFA 3WXBA 1H1TA 3GW8A 5EMNA 4DBLC 1Q17A 4YAIA 1P6QA 2HLPA 1QE3A 1ZGAA 1CUFA 1SQ6A 1XNJA 2E1RA 2OLKA 4M1YA 4Y8VA 5C8YA 4CRWB 2FJUA 4PLPA 4TLBA 5CNMA 1XCPA 2QZPA 1KI9A 1J9GA 3A1VA 5EIEA 3VHLB 3AFNA 3FCYA 4Y30A 1YR7A 1N7HA 4PN3A 4YRZA 2YJTD 3ORQA 1DQSA 2P9YA 1I2CA 3RPEA 3U62A 1Y1KE 1W76A 4LTNA 4CIYA 3SGLA 4DM7A 1E4YA 4OHUA 4L0MA 4TWIA 1TKRA 3EPHA 3S5UA 1EFRD 2G40A 2LCIA 4IKEA 4R84A 3NYWA 3GG2A 1KBQA 1SCUA 2HUNA 2QSZA 3GYGA 1OMOA 2YVUA 2QD4A 1D4AA 4PIPA 4ZVUA 3WHKA 4YGYA 5CEEA 4R9RA 1OW3B 3MWGA 3OBIA 3ZCPA 5F21A 1XD8A 4BFVA 1YKGA 4EG4A 1ZNWA 4B48A 1NQTA 4RUKA 2ZJ6A 3VKHA 2Q9CA 3A06A 1NNLA 4TZ6A 1GSHA 1U0NA 1EK2A 3OCWA 3WYEA 3UMSA 4ZAGA 3AJDA 5IN4A 3UXYA 4UDYX 2C3MA 1BDMA 2Q8NA 4EHJA 1GUDA 2D8AA 1BXZA 4EHIA 5J4HA 2FSSA 3SQNA 3CVYA 4IDEA 4MX8A 5C34B 4TTPA 4NYMQ 1SPBS 4UM8B 1CY0A 1ZMRA 2OO5C 2QTNA 3IDZA 4C04A 4K0KB 2F3TA 2GLUA 3QX3A 4KR2A 4MGIR 1YZ3A 2ABWA 2WF9A 3CB2A 3JARA 3R5XA 3QG5A 4KQHA 5D5PA 4HZGA 5BQFA 1OYOA 3AF2A 2JLVA 4J1TC 5ER6A 2BEJA 1XMSA 2RJNA 3I0ZA 1KP9A 3H65A 2W2PA 4QXOA 1SVIA 4ZVKA 3VYTB 1DXOA 3HP1A 3Q2OA 4HN2A 2W11A 1V3UA 2HHLA 3HZRA 2ZJ7A 1V35A 4MV5A 4JL6A 3FGOA 4LBZA 4IRUB 1GR0A 4FOOA 5ENVA 2G06A 4KLZA 5DGIA 5FA5A 1E9CA 3WNZA 4E7PA 1E8DA 1BMFD 1KI2A 8ATCA 4JNKA 3L7NA 4JVNA 1XIVA 1VLLA 2AA3A 5EIOA 1E94E 4UHEA 5BORA 2J8ZA 5JI3E 1KHTA 4OVKA 4B4DA 2BFMA 2NM0A 3BOSA 1Z45A 4F8JA 2D0DA 5AM0A 4WNAA 1LQ2A 4YJGB 2HRCA 3AQ4A 1KJIA 2C97A 2YY5A 3AR8A 3LO8A 2GBGA 2R6ZA 4O4LA 4N8EA 2IH5A 3EQ8A 3KLMX 1P18A 1QPBA 1BJKA 2RGYA 3AC0A 3EIFA 3L8EA 1DUSA 1Y42X 4LI0A 4I6JA 4RTMA 1KZ1A 5ERYA 1DSSG 1ICIA 4NS1A 4U6QA 4GMKA 2P35A 3QE2A 3G23A 3X1XA 3UWDA 3ZWMA 1F4VA 4B80A 1U8FO 2AXQA 2WMNB 3BL6A 1MLDA 2PN1A 2PSEA 1XNHA 3KEFA 2ZWVA 1ZI9A 3HY3A 5ELXA 3EBPA 4P2GA 5BW5A 2FPGA 1GNVA 4US0R 1T2EA 2GZ3A 2XAAA 3WYAA 4B44A 4LWPA 4B7UA 3R6WA 2OCAA 1RSZA 5CB4F 1U3UA 2VUSA 2JFNA 2XMGA 1DDIA 4Z1OA 3KYIB 1HDYA 5ANRB 2O8CA 2ZYAA 2P2DA 4OXIA 4JSYA 4PYRA 1JHMA 1NJ8A 4XPIA 3EASA 1EWQA 2FP4B 3BH7A 3MBKA 2FB9A 4RD6A 3DKPA 4L02A 1EVEA 3DPIA 2OO5A 2XECA 3Q5GA 2WP8J 4JT9A 1NLUA 4I50F 3VVBA 4CL3A 4UE6A 5EQJB 5FPYA 3P97A 1JX6A 1PVDA 3R3VA 1X8XA 3SDZA 2RGAA 5CB8A 4R7GA 3IESA 3AHCA 3JRNA 3DW3X 3CH6A 3F71A 4EPRA 3JY6A 4G2TA 1VL1A 4DC9A 1VKHA 2Z9CA 2H1SA 4CMBA 3INYA 2O2XA 3N74A 2YWJA 3DQPA 5KO2A 2VH1A 3IR7A 4TKLA 1O54A 1SHTX 3UAVA 5BP7A 1CUCA 2JFXA 4PX2A 3E23A 1DAPA 1VIVA 4KO4S 1WDMA 1XMPA 5AW3A 4MULA 1EXMA 1RYMA 5KI6A 3U3DA 1U7OA 3LX8A 1JDNA 4YDQA 1VMIA 3KCNA 3G68A 5JO0A 3OFNA 2HF9A 3OECA 4W5TA 3GLRA 3CX7A 4RPLA 1PL8A 5EZYA 3IEMA 1B00A 1OU4A 2BGLA 1V5EA 2Y68A 4INAA 1LPNA 1RNLA 2IY9A 4R8SA 3UJAA 1B1AA 1SCIA 2I1QA 5HDQA 5GTDA 4O63O 5KHOC 5LBTA 3Q9NA 5B1YA 3QXSA 2A0UA 1OXXK 2JIPA 1R0RE 3Q40A 3AU9A 4KO1S 3GVIA 2B7BA 2H29A 4YECA 5CVTA 3ZTTA 4KW7A 3DDZX 4LX0A 2G1PA 4EFLA 4UUBA 3G2PA 1T1IA 3GQVA 3OEWA 4ACAA 1WETA 3OJXA 4DZZA 5A71A 2HGZA 3FNBA 4J4HA 3EGDA 5IK2A 2HWYA 3V8EA 2V6IA 1WEHA 4IIJF 5GONA 1K63A 4KWCA 1G66A 2XKBA 4DDKA 1ABBA 4BWYA 1O97D 2DUWA 3G9TA 4OUDA 4X71A 3O8QB 1U99A 1NRIA 4EA6A 3PFIA 4BX3A 2EX4A 2RIRA 3HHPA 3D1LA 3H11B 4NQZA 1GZHB 2ZSHA 1O2DA 3NT2A 4AD8A 5LNK1 4YJGA 5IW8A 1H2YA 1MABB 2OHFA 5AIBA 1Y37A 4QOJA 1ST2A 5EHZA 4Q00A 5J4LA 2QUJA 1LH0A 1FFWA 4BN0A 1E2DA 4KLRA 4UQOA 4CM3A 4DREA 5A9RA 1XD9A 2AW5A 2Y8EA 5B53A 3UT6A 1F2UA 2D62A 1YOVA 3H4VA 1SU4A 1OT5A 1IWBB 3GMSA 4J4TA 2OYRA 3LH5A 3O8NA 4JI0B 1WR8A 4DL9A 3GB9A 2I4MA 5EYPB 2G0AA 3F4LA 3LUAA 4Q9LA 4ESEA 1J2UA 4KGXA 5L3VA 3E48A 4PYKA 5ALXA 2HTEA 4LRYA 4MITA 4XSGA 4M6WA 1EFPB 4CF5A 2CXPA 5JXHA 4P83A 4YRAA 2HF2A 5JVDB 3GBSA 3TBKA 1ZD3A 2YJ6A 4M9XA 1Z4MA 3SX0A 3W5DA 4W82A 3C5WP 5LL6P 3R6GA 3RB8A 3FSJX 1VCMA 1Y7HA 3FRJA 3BWBA 4KREA 2ODQA 3PITA 3DB1A 4FFWA 1Z47A 3R5TA 4M8IA 2CLEB 2FEXA 3B8HA 4BQEA 3TW6A 5FBLB 1N5KA 1T2VA 3H9QA 3I58A 1SUEA 3LM8A 4E5VA 1KAQA 4B33A 2Z0MA 1JW9B 1IIBA 3ADCA 1YL6A 2X0RA 5JC8A 3VNSA 1QIGA 4P93A 5IMSA 1FX1A 2OV8A 3HA2A 5DP2A 4HQ6A 4AQDA 5BT9A 2A35A 4TSRA 5A02A 4TUYA 1YRQA 1Y4DE 2CXXA 1FRNA 2DAPA 1Y4AE 4KOAA 2UZ1B 3NATA 3IPYA 2X9NA 1PL0A 1SG9A 5B1EA 2HK6A 2IX9A 4ITVA 4P33A 4UFNA 1CVLA 1ULHA 4UUQA 2IYXA 2OXFA 5CMLA 1R64A 1SCUB 1EVQA 4RFSA 3WJ1A 5FH9A 3AF1A 2C4MA 8ADHA 1Y6FA 2A84A 2BI7A 4M55A 3GDFA 4CV3A 1EI9A 4OMDA 1NP7A 1H8ED 3T9AA 3L0PA 4CG1A 2W9XA 5DM2A 2YQ5A 4ENWA 4GX2A 1XRJA 2YASA 4JQOA 1EK5A 3E9CA 3ED5A 1H3EA 3CB4A 3W8FA 5A4IS 3G6KA 1FYXA 2VZ0A 1H05A 1ZIXA 4U9UA 2PUCA 3BXOA 3E2IA 4RA9A 1WP9A 4R2XA 5CNJA 3UPTA 4IOMA 2PR2A 2YY6A 2QU8A 5GIPE 2R6R1 3MD9A 1ZUIA 3GLHA 2CFCA 4I7EA 1UT8A 4I6EA 4UM7A 4C08A 2JLRA 4CNBA 1A9XB 2RH9B 1QRUA 5JEEA 2GJ9A 1WVIA 3DDSA 3R24A 4QOGA 2RKWA 1P4HA 4XVQA 2G07A 2JAXA 2WVJA 4ZCSA 4QSHA 3QU7A 2WICA 4RLQA 4EOGA 1ULSA 1TK2A 1Q7EA 4QOEA 4YMHA 2A7XA 5JYCA 3JU3A 1E2QA 3QP9A 4DARA 4MQEB 4L7VA 3THYA 2PUFA 1LD3A 4JIMA 4J7XA 5A7GA 1QF7A 2LNDA 3I6ZA 1U0BB 4ZD6A 1MJGA 3PIIA 2ZYWX 4BEVA 4DA0A 2FTKE 1UPUA 2OCGA 1U1FA 2OBMA 1OTHA 2CNOA 4S35A 3FYSA 2QE7A 2XMDA 3THYB 2XQGA 4BAZA 4XTCS 4G5RA 1DIHA 4IUCS 4OQMA 4BLWA 4WECA 2G9NA 3ZH2A 1QZTA 4AJNA 1AA6A 2H7YA 3JX9A 2O2DA 4RPHA 4TLAA 1X1BA 1KI8A 2FW1A 2FWJA 3F96A 3NPMA 4AT1A 2AFHA 3B3JA 3BSWA 4L27A 1O5TA 4D57A 3IVRA 2WD8A 4AY4A 3NUQA 2G9UA 3ZCRA 1FTGA 2IITA 4QYSA 4AIIA 2VQSA 4K5QA 1XVUA 5JUWA 2CD7A 2NUPA 4C01A 4BMPB 1A5TA 2KW5A 1HFWA 2C0QA 1Y8RA 4LFBB 3GLFB 1IL0A 1VXOA 1L4MA 1VL8A 2PVSA 3DM9B 2P75A 3GH1A 1AH2A 3ROFA 1VJRA 1VYTA 2BEWB 2VYFA 3ABRB 1J2TA 1X1TA 1S0UA 3ZHSA 4DYDA 1FFDA 4WBNA 2VHCA 1EVIA 1ZHHA 2CV0A 4HD8A 1QP8A 2NU8B 1J0BA 2VT7A 3HXPA 1TM1E 2VJYA 1ZGJA 2DPHA 3HY6A 4HL6A 4LC9A 4Y6LA 5CYOA 5LCXA 1J8QA 1SXJD 1Z56C 2PM8A 4QLBA 4GL2A 5C32A 3G3EA 2BZ0A 3E82A 1N4DA 3B9RA 4G89A 3S2UA 2DR0A 2MU1A 4ECAA 4EGSA 1X74A 3RVKA 4RFSB 2I91A 1P81A 5KQMA 3D8NA 5DK4A 5JHGB 3DZ8A 1PW7A 2GOYA 1BKSB 2PS0A 3VZDA 5BN5A 2DKFA 2B1JA 3F6BX 4PAOA 5HIIA 1GARA 1SUBA 3TQRA 1MO5A 2EF0A 1YK1A 5DI3A 1G98A 4YJFB 1JDVA 1ZD1A 2YXBA 3Q1KA 4TLLB 1PFVA 3GCGA 5AH0A 4BNUA 2FMHA 4ISCA 4BX8A 2WB2A 3QSYA 3MTEA 2P9FA 4N7JA 2O2ZA 1Q95A 3IDAA 3RF7A 1PR5A 3TG8A 3IHKA 1GAQA 3PNVA 3TCXB 3ZG6A 2ZIUB 1ISFA 1V0JA 2PH5A 2VFAA 3JRWA 4KK3A 4L4YA 4EUFA 5JMOA 3HZHA 3UA3A 3WMGA 1PWXA 2FU5C 4LVCA 2CKMA 4RENA 3DNPA 1CIPA 4YNBA 5C1IA 3SG0A 3VC3A 3T5AA 4PSKA 3I5XA 4HBZA 1DV1A