3QENA

S74e dck in complex with 5-bromodeoxycytidine and udp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
236
Chain Sequence
b'TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 236
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qenA00
5JI2E 4BFUA 4LHVA 3O8RA 1CR0A 1NVVQ 1KJYA 3GFPA 1P9NA 3DM9B 3SNHA 1K5GA 3L2OB 3QKRB 1XEWY 4EAQA 5DI9A 1Z22A 3SYKA 3TJZA 4FMDB 2JIZA 4M22A 3TK1A 3W6NA 2LKDA 2IL1A 3WY9A 1G21E 2N42A 1JPJA 3EG5A 4QHTA 1XXHB 4Q9IA 5H1YA 3VR6A 5SZHB 3TH5A 3FFAA 2NO1A 5L8VA 1SVWA 2QMUA 4D6PA 3IEVA 2VBCA 1N25A 3TW8B 4KFSA 3LQRA 1A1VA 1TPZA 3I92A 2ONJA 1W0JA 4JT4A 3V00A 2CL6X 1E2FA 4P4SB 4Y0AA 3NEYA 2GZDA 4IW3B 5FOUA 1KGDA 3DZDA 1KDRA 1IY2A 3TUJC 4DCNA 5JHGB 1UADA 3FTQA 1UKZA 3KQLA 2GEDA 1IXRC 1QBKC 5JJKA 1CBUA 1AZTA 1GP2A 5UKDA 4ZKDA 2F43B 2WPDA 1N5IA 5BN4A 2XJ9A 4NYIQ 2ZR9A 3KUCA 3U3OA 3NIBA 1J7KA 2BM1A 1WF3A 2D2EA 2RGNA 2ZE5A 3R20A 2VSOA 2WOJA 1US8A 2GCOB 2O8FA 1KZ7B 1QHYA 4Q9HA 4N1AA 1TF7A 2QI9C 1HT1E 1WDTA 4PQYA 4WOPA 4M2LA 1XZQA 3D3QA 721PA 4D82A 3ZVMA 1RZ3A 3ZS9A 1VDZA 3K0FB 2JLRA 1II0A 4TMVA 5GJVC 2RHMA 4QBHA 2VIIA 1UM8A 4FCTA 1JXOA 3TVTA 3KDSE 4PX9A 1IONA 1ZJ6A 5KPJA 2EYQA 1KOFA 4B71A 1E32A 1NNEA 3FE2A 3AP2A 3AP3A 2YZ2A 3EXAA 2WM9B 3QENA 4TL7A 2QBYB 1OT3A 2GXAA 5IHPA 1Q20A 3CO5A 1HEIA 4GMXA 1P7CA 4IOKA 3M0EA 4RFSB 3CNOA 3L0OA 4NCJA 1B0UA 1BYIA 3SQXA 4A8JC 1Z3IX 5JEEA 3GLIA 2VSFA 5FTLA 4JKYA 5B2ZA 1N0VC 2BCJQ 4Q18A 5KSOA 1CJTC 1DAMA 1QG2A 4KITB 4QL3A 1ZUNB 2HLDD 1S1MA 2WHXA 4BE7B 2GA8A 4EPWA 3MRSA 2R65A 1E94E 1O87A 3HYRA 2NQ2C 4GL2A 3CRVA 5FOVA 2QP3A 3IKJA 3A1UA 4ZCLA 3VR3A 5JSZA 2QU8A 4CIDA 4ON9A 3A4LA 2QPOA 3AVPA 5FUWA 4KFUA 1XJCA 5EE0A 4Q7JB 1DAEA 1KMQA 1R0ZA 3P4XA 4X8LA 5CK5A 4A6XA 2AXPA 4A2PA 5AUQA 5KOYA 2IS4A 4B6FA 1E2QA 3QSYA 2YC2C 3H4MA 4D2IA 2BEJA 2F1IA 4BEBA 3T34A 4CT5A 2WAYA 4V0MA 4WZAE 1XD2B 1TU3A 3U3KA 2YC4C 4C0QC 5EE1A 1E2PA 3GJ4A 1N6PA 1H8HD 5HE9A 4HATA 3NHAA 2RGXA 2V55B 3BOSA 3PXGA 1X6VA 1Z29A 4GFDA 1L4YA 1EX7A 2W00A 3X1DA 4AYWA 2ZXUA 1XTKA 1JALA 4OKSA 1C9KA 4NDZA 3DMNA 4TZ6A 4C0BA 4URZR 3GLGE 1KJZA 3SS8A 4FN5A 1JNYA 4Q9LA 3RRMA 4D0GA 1D9ZA 4URUR 121PA 1G8FA 3A36A 4FD2A 4JZKA 4LBWA 5EP1A 4Q19A 1ZINA 2B92A 4IVRA 4MYCA 2X1VA 2OUKA 5JWRA 4PPFA 2JLWA 3UWOA 4ERNA 3B1YA 5BXQC 2GZHA 2AK2A 1TMKA 1TAGA 1YRBA 1KO4A 4BEJA 1U99A 2NPIA 5C1BA 5D3QA 1NVVR 2W2XA 5TV2A 3W5IA 2IYQA 4XVRA 4EPXA 5FOSA 5FPSA 3VKWA 3GP8A 1NSTA 4LBVA 3RRZA 4A0GA 3ZQ6A 2QN6A 3H0KA 1P4SA 2ZJ5A 3AVYA 2CVHA 1P5ZB 4GSYA 2GBLC 3U6KA 1OSNA 3CLVA 1CRPA 1JR3D 2FF7A 3THOA 1L8QA 3VR1A 1LS1A 4Q21A 3MUFA 4DLUA 2P5SA 5EZ5A 4I1UA 5D3MB 3SYNA 4FXPA 1J8YF 3CWZA 3FFBA 1G291 4NP6A 1ZM4A 4B48A 4ASUA 4UNRA 4M9ZA 4O2RA 2QQEA 4LJ9A 3TMKA 2CNWD 1TX4B 3PENA 4GBMA 1NLFA 3UG6A 5AR1A 1HY3A 1TF5A 3AGPA 4HUQA 2VP5A 4FCWA 5H8WA 2BKEA 1E2HA 4FCVA 2PX3A 2NO0A 3EASA 4PZZA 3Q5DA 3T5GA 3N2IA 3OFND 2KB0A 2IUSA 4XVQA 2IWHA 2ZETA 3L0PA 4XTRA 1MKYA 1K8RA 2B7CA 3ND9A 2Z6VA 1UBGA 3T61A 5KNCA 2YKGA 3MMPA 4NYIR 2XTNA 4DEYA 4IKEA 3C7KA 3NKVA 1NN5A 1XEFA 3IQXA 2OFOA 4B74A 2AWOA 1RRCA 4TYWA 5KDLA 1Z2AA 2WWXA 4I4LA 2HJGA 3SBDA 5FBWB 3PEWA 3KQKA 1XD8A 3LDAA 3FKSD 3MWJA 4M1WA 2JJ1D 3TIFA 2DWQA 4TZ0A 3K09C 4BUJA 2G88A 1U2RA 3QXSA 1UF9A 1XD9A 3CF2A 3RC8A 3GLFE 2C04A 1E2DA 2AD1A 5EP4A 2Q6TA 1OF1A 2ZUDA 1EX6A 2CCGA 2KE5A 2ODNA 4TN1A 4DT1A 4QJ5A 4GPTA 5FBQB 3LW7A 3AP1A 2FFAA 4RCZA 3EA0A 2J87A 3K0CA 2ZSBA 4DKXA 4P32A 4D4LA 1KAGA 2EFCB 1ESNA 2E1RA 4KBFA 1XMVA 3SQWA 1MO5A 3LY5A 3K53A 3RS5A 3QXXA 4IXNA 1CJMA 2CEAA 3WP1B 4TYNA 1R5OA 4UNNA 2ZRAA 2OZEA 3IIJA 3JVVA 3KTAB 3PUZA 2KBEA 1W44A 3VMFA 1MH1A 1CR1A 2ZSEA 3FOZA 3K0AB 4RZUA 1E2NA 2FMXA 5FTNA 3CR8A 3P1JA 1IAQA 4KU4A 3U7GA 2A7QA 3W9YA 4V03A 2QMEA 5J4LA 1DE0A 4NMMA 1VCNA 2ZQ5A 4XWAA 3OAAA 3SYLA 2IC5A 3LX5A 2ZUBA 2ZYUX 3LA6A 2OILA 1KI9A 3QQ5A 1EFRD 2FN4A 1FQKA 1OLOA 3AKYA 3T1VA 1G8GA 4MGYR 1GVNB 5KHOC 4TTRA 1H8ED 2ZE6A 1KI8A 4Q1EA 4NZYA 2H7VA 2JATA 2VPPA 2XTMA 3C4JA 4JL8A 2KSQA 3CB4A 4NCNA 2CLCX 4EFLA 4LJ6A 3CNNA 1TQ4A 2CHVA 3B1XA 3LD9A 4MKFA 5JI3E 2A5GA 5TY0A 4CEIB 1Z28A 3UMFA 4ABYA 3CBQA 4KV9A 1G64A 2G1KA 3TUZC 1VCOA 1BOFA 1AA9A 2WKQA 3AEZA 4ESVA 2QTFA 3I61A 2IS1A 1W49A 2EVWX 5J4VA 4LJ7A 1U8ZA 1NN3A 2E9SA 2X2FA 4HZUB 5EXXA 5HE8A 4BQSA 4KO8A 2UZ3A 2ECKA 3K70B 1BMFD 2OCYC 4ZIRB 2XNDD 1KO5A 4Q4JA 4LHXA 2O52A 2HDNB 2VHUA 1BIFA 1N6OA 1YZLA 2GK7A 3IGFA 4DDWA 5HR5A 3NDPA 1G20E 3UK6A 2HV8A 3LX8A 4B3XA 2VH5R 1E2LA 3U60B 2PZFA 1Q57A 4TMKA 2IYVA 2GZAA 5TMPA 4JLKA 2CL0X 1RRFA 1X8LA 2QSZA 1CULC 3IO5A 3KB1A 1NP6A 1LF0A 1UAAA 3O8CA 5P21A 1F60A 3A4MA 3QPWA 2Q3FA 2HCBA 4C4PA 5GVRA 821PA 1ANKA 2ZAOA 4GOKA 4DBLC 5KU1A 3RLFA 1T0JB 1JQJC 2OAP1 3W8RA 2PJZA 4QJ3A 1W36B 2I3BA 3W90A 1AQYA 1YZTA 1FUKA 4YMWA 2IK8A 1G4AE 1SULA 2ZRLA 3JVUA 4LUCA 2QM7A 2C78A 4MUBA 4NBSA 4LWZA 4C0HA 1A2KC 4EUNA 2Q3MA 1GFIA 2GXSA 1VG8A 1U8AA 4H1VA 1W2GA 4D25A 2ZRNA 1S2MA 2OO7A 3PUWA 2HEIA 4XTCS 5DGXA 2D4HA 4P0TA 3QPUA 3BORA 1OXUA 1R6BX 1YZGA 3I5XA 4UJ5A 3GLHA 2CMKA 4XOIA 1LTQA 3TW4A 1OFUX 1WXQA 3MWYW 4OK6A 3LW8A 4KI0A 5A4JA 1HV8A 1XDBA 4M1YA 3PCRB 4URVR 2IW3A 2W6JA 3W34A 2P6RA 1JJVA 1AJEA 1SZPA 5FBRB 4Q1BA 1HH4A 2MSDB 4DDVA 2AWNA 2BC9A 1LFDB 5DHFA 4P3YA 4QG7A 3GFTA 1COWA 2P2LA 2VP2A 2XOKD 5HPYB 1US8B 1NVXQ 2O8CA 2KWIA 4QGFA 1QZXA 2O8FB 1FUUA 4PSAA 4IOLA 5HZKA 2C03A 4XSGA 2IF0A 3BIFA 1PV4A 3LXRA 2ATXA 1WBBA 2C9YA 3K0EA 2WJYA 3BWDD 4AWXA 2OG2A 1U98A 3EZ2A 3LWNA 1HE1C 3WYGA 3AM1A 2VF7A 3OEHA 4F4CA 2GJAA 1JB1A 1YR7A 4G0NA 4NPHA 4WZBE 4UXJA 3O8BA 3QBTA 4Q1DA 5JMTA 2G83A 4C2UA 1JQLB 2ZRDA 4IDNA 4B33A 2ZS8A 1IJFA 4OHVA 1GKYA 1RE0A 2IEZA 2B8TA 5HTKA 4BFYA 4N0DA 4KFTA 1SXJA 3T12A 4Q7MB 1NVUQ 1U8YA 1VKJA 421PA 2I4IA 4HUTA 2XZOA 5LD2C 3ADCA 3ZGXA 2ZTSA 1S3GA 4F4IA 1FX0A 4OHZA 4HAYA 3C41J 4LJ4A 3SHFA 5D3MA 1OH5A 2OT3B 2ZANA 1MO3A 1IBRA 3BAFA 4B32A 5JSZB 4MYHA 1G5PA 4W5WA 3LXXA 3MGCA 4CEJA 1ZU5A 1VYVA 3G82C 1E0KA 5J4KA 4PQFA 2NMVA 3BXZA 4NCHA 4AYXA 1OFIA 4R7ZA 2JJ2D 3WRYC 2ATVA 5DI3A 1VYUA 1SVOA 5CB6A 1VG1A 2EW1A 4LHYA 2QE7D 3LFUA 4D4MA 4XWOA 4QM7A 4RD3A 5C4GB 3CRRA 1EGAA 1MR3F 4Q1AA 1TEVA 2BDTA 2PMKA 3PUYA 4PO1A 1YR8A 4Q02A 3TSWA 1NBMA 3R7WA 4NE2A 2PCJA 5F9FA 2FSGA 2AKYA 1Z6XA 1F5NA 2JAQA 3NC1C 2ZVPX 4KLZA 1DAHA 4C0AC 3EX7C 1EFHA 4II7A 4KAXA 3KQHA 3IIKA 1GTVA 3WYAA 2NG1A 5E7MA 1CS4C 3V9PA 1N5JA 4PO9A 3WNCA 3MAAC 3SEAA 3CX6A 1DAIA 3FHOA 1M1YE 5CJPA 1WBDA 3IEUA 3REGA 4TT3D 2DFTA 4TTPA 2MMGA 2CK3D 2VTKA 4QBIA 3M6AA 4B3DA 1FMLA 3R9WA 3NTUA 4QBFA 2OCAA 2EWWA 3D31A 3UKDA 4KHZA 3ADDA 1Q0UA 3LO5A 2GF0A 2QMOA 1F3OA 2P6UA 2VEDA 4LYHA 5IK2D 1GL7A 4JL5A 4Q4AA 4UQOA 3KX2A 1KI4A 5KSYA 5L3VA 3OE7D 1ZD9A 2BM0A 3PUVA 4A0FA 4ESHA 4HAZA 1OPXA 4B47A 1M74A 3IHWA 5AJVB 3AGQA 2V8OA 3LVRE 4NYJR 1E9EA 3SZRA 1U94A 5EE3A 3RNLA 3GEEA 1VHTA 4C0LA 4DLYA 4HLQB 4RZXA 2YNMA 1E2EA 4FIDA 2AFHE 2C5LA 3KKNA 4POAA 4B2LA 1XEXB 4A2WA 1XFAA 2XSZD 2ONKA 3UMRA 1OHHD 2F9LA 2EFDB 3FWYA 1XMSA 4HAWA 1OXVA 4HUQB 1ZU4A 3BB3A 4NCIA 5AJWA 2XXAA 3WYFA 2QP4A 4C3ZA 2A3RA 1FNMA 2ZRHA 3CWQA 4FMCB 5G40A 4OHYA 5EP3A 1JAIA 3W3AA 1G7CA 2FEOA 1VIAA 3GCGA 2RGCA 2ORWA 2ZU6A 3QIAA 1E3MA 3THWA 1YZNA 4AKHA 3B6EA 4KXFB 4JKIA 4PAMA 4YONB 3I4LA 4DUGD 3LAWA 3TRFA 3AF4A 4PSKA 2CE7A 5JCZA 3RDPA 3NH6A 4PC1A 3UPUA 2IYSA 1IN7A 2MSCB 4QGHA 4BASA 2X8AA 1ZNXA 3VR2A 1DARA 3KKOA 2F55A 3F3YA 4BFSA 1KDPA 2ZAMA 4KCGA 2ZM5A 2F1HA 1HYQA 4HZUA 4JBXA 2ZS7A 1XCMA 2FZ4A 1NSFA 3LVQE 3M4YA 4ZIRA 4Q1FA 1AQUA 1Z06A 2AK3A 4ACBA 2W6ID 3NBXX 3C5HA 3GJ8A 4CVNA 3DKVA 1GNQA 2NTYC 3QE0A 1E79D 4L9WA 1W0KD 1KO7A 3HU1A 5L3RA 4DT1B 4YC7A 2G77B 2QUZA 4H9GA 1EFUA 5FTJA 4LPSA 1UDWA 3EPHA 4WAUA 3F0TA 4WBSA 2CCKA 3AVWA 3FHTA 3HPRA 3L8YA 3JZMA 1ZM2A 4X8HA 1WQ1R 1ZC4A 3K70C 4MKHA 1Q3TA 2KJQA 2QT0A 2QGZA 3N2EA 3CRMA 2X77A 3VNVA 3GQBA 4US1R 5BW8A 1IN4A 3VAAA 1XPUA 2JCSA 5CYOA 5G3ZA 4M9SA 2ZRBA 2VHQA 2WJVA 1YHNA 1NF3A 3F8TA 4OQXA 5JFGA 1KI7A 5F9HA 1MABA 3QEOA 1RVDA 2EQBA 1KI6A 1EWQA 1L2TA 4IOJA 3X2SA 1QHIA 2GWHA 4A15A 1P9WA 2AL7A 2JLZA 1ZUHA 1KY3A 2ZYTX 3QF7A 1CP2A 4HDOB 3HJNA 4LHZA 2YOFA 3AKEA 4ACAA 1W36C 5HKKD 2R6DA 3ZD7A 4UNPA 1FTSA 1T91A 1EFCA 1ELOA 4TMXA 2A30A 3PG5A 4B35A 4WW0A 2P6NA 3OIVA 4NTZA 1TQDA 3AVTA 1E1RA 2QM8A 1JR6A 1CF4A 3LLUA 2OBLA 4V02A 5CDFA 2DWPA 1U0JA 3PR1A 4LBZA 4OHXA 1GZSA 1KSFX 1TNDA 3Q5EA 2HLDA 3ND8A 2IT1A 4B2PA 2BMJA 4BLRA 1DAGA 2QQ0A 4Q4JB 3EC2A 4DSNA 1OYYA 4TLDA 2YV5A 4HAVA 1ZNYA 3RSOA 3VU9A 4KVAA 4HI0E 2BMEA 4LK2A 1XTRA 5FR1A 1ZC3A 2IS6A 2J41A 2ZE7A 2RGNC 2OSBA 1YE8A 3VHLB 1T8UA 4QBGB 5A0FA 4F93B 1XJQA 1SVKA 4L5BA 1YU9A 3ECCA 2EU8A 4D80A 5HZHA 2GEUA 2BV3A 4NCKA 1KK3A 4OI2A 2JA1A 1H8HA 3C8UA 3ICQB 2YOHA 4BGDA 1R8QA 4LZZA 4RD2A 3ZVLA 5SZJA 3X1YA 1FOEB 1E0AA 4HDQB 4XJXA 2V6JA 1QRAA 1TUIA 4Q9JA 2BJVA 3BB1A 5FUYA 4QOSA 4DDTA 2RGEA 1G19A 3NBZC 4ZDJA 2Z0MA 2ZI7A 3MG9A 2CVFA 2C95A 3QVVA 1UBFA 1ZW6A 5EE5B 3GLHB 1G1MA 1NMYA 3KXLA 4ZDKA 1CJKC 4DJTA 2XGJA 3AKCA 4NHOA 1P3JA 1S3SA 2WKRA 4OK5A 5K8UA 1D9XA 3FKQA 5E95A 1O3YA 1DS6A 1XRJA 4Q4LA 5BWMA 2FEMA 2JGNA 1XEWX 1UBCA 3Q85A 3TSOA 1DOAA 2ZRPA 4TL9A 4E09A 3MWLA 3QJYA 3TNFA 3BD9A 1SGWA 4PPNA 4YMVA 3OEEA 4UXHA 1QVAA 3BERA 4ZI2A 2BCGY 1CR4A 2EYUA 4OQFA 1Z2CA 4LX0A 2O8CB 2GJ8A 2FZLA 2B7BA 2OBNA 1OIXA 2ZJYA 3QY0A 2CJWB 3B7GA 3KB2A 1GM5A 221PA 1JR3A 4IJMA 5AWFC 1U9IA 2AD5A 5DH9A 4AURA 1SKQA 4LYJA 2R2AA 5TDHA 2WWWA 2ZRCA 3KKPA 1MOZA 3ZYCA 2ANBA 5DLQC 4A36A 4M1KA 1DAFA 3P26A 3TAHA 4I1OA 3E70C 5LB2A 3RC3A 4GOJA 2Q21A 4TLCA 2V9PA 5LD2B 3BH7A 3QXCA 2CNWA 1LW7A 1R0XA 1UKYA 2W2VA 1KDTA 4LV8B 3NEJA 4FWIB 1KY2A 2GDJA 5L3QA 1G8PA 1QHXA 3WNBA 2QPTA 2E87A 4KSBA 3U7HB 2NO7A 2QL6A 2JLYA 1S9HA 3EZ9A 1DADA 1EESA 1NKTA 3EZ6A 3BFXA 3OFNA 3CPJB 4GNKA 4C30A 4BLQA 3THXA 1RYHA 1BKDR 2CDNA 3MJRA 1Q12A 4X8OA 2GJSA 4V0NA 2QEQA 1SXJB 4LJ5A 4XD7D 1KTVA 5EUQB 1ZD1A 1G5TA 4QHSA 3M1IA 1OH6A 1OFTA 4Z54A 1IN8A 4TQAA 3NXSA 1FX0B 1KJWA 5HCNA 5KPDA 1FW6A 2X2EA 4L4UA 1PUJA 1E2KA 2DYKA 1M6NA 2QGNA 2V4ZA 4JJKA 4A82A 3OESA 3GLIE 4G5OA 3AVQA 3ZS8A 1GSIA 3RAPR 1S9DA 4CEJB 2GK6A 3BC1A 2RKOA 3T1TA 4KVGA 2D2FA 3VFDA 3TE6A 3K9HA 4IEEA 2VHJA 5KYKA 2JJ1A 3AF2A 3VR4A 3V4RA 1EG7A 3SE0A 1F2TB 3FMIA 1XEXA 2Z4SA 3H84A 5DI3B 1SVSA 1KYIA 3RANA 3NDBB 1D2EA 2VP6A 5EZ6B 1Z6YA 1SKYB 3QPVA 2OE2A 3DL0A 5J40A 4JS0A 4C7OA 4EPVA 3AB3A 2IX3A 1FQJA 1QF9A 3R7WB 1NIJA 2GAOA 2ZS9A 1UJ2A 1EWRA 1N6LA 4V0ME 4HLDA 4G1UC 1NIPA 5BYKA 5JJIA 3GJ0A 1N0UA 3I1FA 2IXFA 1HUQA 1G7RA 2C9CA 1E1QD 2XZLA 4KLNA 3ICEA 2VSXA 3ZQJA 1OJLA 1SVLA 5KO2A 4TLEA 5AUOB 1CLUA 4NH0A 5DISB 1XMIA 5JRJA 5F3WB 1T9HA 2AXNA 4M1SA 4MRRA 4DLVA 3EPKA 2DFNA 4OI4A 3CR7A 1OB5A 5ELXA 2CL7X 4K46A 5FL7D 3WHLA 4FINA 4EJSB 4CEHA 1TQ2A 4JJZA 2A5FA 5BYJA 2CHGA 1EFRA 5ANRB 4RD1A 1VCIA 1OH7A 5FTKA 1IM2A 1H8EA 4IFBA 4Q47A 4Q4AB 1SVIA 3FVQA 1NG9A 1R5NA 2FA9A 2ZI4A 3Q9LA 2F7SA 3PV0A 2J7PD 5GJCA 3PQCA 1C1YA 2GTPA 4U5XA 1K6MA 3AKDA 2V7QD 3DZ8A 1D5CA 4PC7A 5JRZA 2ZJ2A 2WIBA 4WXRA 2AHOA 3R8CA 3RS7A 4GDFA 3AF3A 3T15A 2R6AA 4O2LA 4C0KA 4P31A 1J70A 4DCTA 1VMAA 5B57C 1DPFA 1N6HA 3DDCA 4A6PA 5DN6D 2GJKA 4Q48A 1YR9A 1KNXA 1PJRA 3FB4A 1YQTA 2IYTA 3R9IA 1KKLA 1BMFA 1A4RA 3B13B 4HB3A 2O8EB 2XNDA 3P20A 1IN5A 2OLKA 1RJ9A 2R6GA 3K0CC 5AJYA 2XXAB 5J4HA 4YMTA 4JLJA 1HTWA 2Q9CA 1XX6A 1QHGA 1XWIA 1W48A 1FNNA 4OQMA 4D26A 1QHHA 2FPMA 4JLNA 3O47A 4WZ6A 3WHKA 5M04A 3DVLA 2O8DA 2QAGA 1IHUA 1WP9A 3AVOA 5FOWA 4PHHA 4QXAA 2C96A 3THWB 1F48A 5J5CA 1LB1B 1JXMA 4O0MA 3GJ6A 1OH8A 4AIIA 4BFTA 3ZD6A 1J2JA 5IF9A 1VPLA 4MRPA 2O0KA 4N3NA 2ZJOA 1I4LD 3Q3JB 621PA 4R9UC 4OL0A 2NO9A 2GCNA 1XCGB 4ARZA 1ETUA 3HU2A 2DHRA 1JPNA 2RCNA 4MA4A 2ANCA 1HURA 2RGGA 2VF8A 3EZFA 4NU0A 4I1VA 4US0R 2PCLA 4WVFA 2BWJA 3AF0A 1E0JA 4G3XA 5CM9C 5FBVB 3Q7PA 1DVRA 3ZIAA 4DB4A 3QNUA 1F6BA 2D06A 5JCPA 1IN6A 1X1RA 1XCPA 2IEYA 4Q7LA 1M2OB 1T6NA 4YXWD 2XNSA 4C9BA 3BFVA 4RD4A 1KK2A 2ZRMA 4FW9A 5IRCD 2PBRA 1RKBA 3CH5A 2IHBA 2WBLC 1Z0FA 2XOKA 4LRWA 1TU4A 2C99A 3BGWA 1G3QA 1N6KA 2QTVB 2RMKA 3CH4B 4GP7A 3GPLA 4NYJQ 1YR6A 1RPZA 3KJEA 2YOGA 5EJEA 3IQWA 1TQ6A 1Q1BA 2TMKA 1XXHE 5K8LA 3U3MA 1IOZA 1MABB 4M1MA 2ZYWX 2AKAB 1R7RA 2R6FA 1EK0A 3BBPA 5GADl 1G4UR 1KI6B 2N46A 1P75A 2VP0A 4C2TA 1DG3A 3VX3A 5BN5A 2WMNB 4RKEA 4RSGA 3U3RA 4ZDIA 2ODBA 5KSZA 2G6BA 4IHQA 1QG4A 1W2HA 1E2IA 3FMOB 1Z6AA 3VTKA 4DXAA 4AKIA 1WMSA 4BFXA 1GOTA 2ODEA 1S4QA 1T5LA 1ONBA 3L82B 1P72A 1ZYUA 2D7CA 2JDID 2JASA 1QHSA 2KBFA 3T1QA 1R0WA 1PLKA 3BK7A 4DWJA 3KJIA 1I4TD 2AN9A 4RKFA 2WJIA 1XB2A 3QI2A 2R8RA 2FX3A 4JVLA 5F2EA 3N5CA 4W9MC 4ZCIA 4HLCA 1Q1QA 2A5YB 2CJWA 2FSIA 1GUAA 1ZVQA 3H1TA 4MDEA 3EIQA 4F91B 3WMEA 4JLOA 3RRNA 4C0SA 5KUTA 2WIAA 4JBYA 4Z1MD 2FWRA 1YJ5A 3PJRA 3IPYA 1NL3A 2Z83A 3U7EB 1JAHA 4E22A 1FPMA 3VU9B 1P2TA 1GKUB 1T3HA 3CZPA 2AFIE 3DKPA 3SU8A 2PT5A 3N70A 1CJUC 4I1SA 5CM8B 4E5UA 4AG5A 4BZQA 2RB4A 5JS8A 2JJ2A 1DO0A 4KFRA 2WOOA 3QKTA 3SI7A 3K9GA 3KQUA 3HPQA 4LCBA 4AC9A 3THYA 2C8VA 4B2IA 2QE7A 4DIEA 1TL7C 2ZJBA 3U5ZB 2WSMA 5FPHA 1LNZA 4HYYA 1OE0A 3A1VA 4PFSA 2BVNA 3NG1A 1NJGA 2WKPA 4B3FX 1LY1A 2OCPA 3P4YA 2HT6A 2O0HA 4BZXA 1E9FA 1UBEA 3CX8A 3NVAA 4RJLA 1Z0KA 1ZAKA 1MO6A 5FI0B 1CTQA 4G5SA 2BBSA 4GZMA 5DNYB 1I2DA 3AF1A 3IIMA 2QZ4A 2W0SA 5FUVA 1OYWA 1KKMA 1DBSA 2VHTA 3EAQA 1M7GA 4WA7A 2W6JD 5CIWA 4TYPA 1AM4D 3CRQA 2OV2A 4IDPA 1B23P 4TSFD 1IXZA 1TADA 2K5UA 1SXJC 3KFXA 4TT3A 2IXEA 2CK3A 2R44A 3QF4A 1XU4A 2OAQ1 1CIPA 1DO2A 1F2TA 3AQ4A 2XAUA 5DHAA 2IUUA 4EPYA 4LYFA 4DCSA 4DVGA 5JEDA 1EXMA 2GCPA 3GLHE 1CRQA 3L0IB 4LJYA 1ZMXA 2RHDA 2WVJA 3U6BA 2MSEB 3EIHA 1UDXA 4WIAA 5IK2A 1RRGA 2GEVA 4MYTA 2ZJ8A 3EPJA 3RS3A 2Q9BA 4G01B 3X1WA 2Q0HA 1DTSA 2ZITA 1UEJA 3OE7A 2DFLA 2QT1A 1G18A 2IYYA 3SFZA 3FPAA 3MCAA 1Z0AA 1OB2A 2O0JA 1AS2A 4JLPA 2J0SA 1JEDA 2N1BA 2O8BA 4Q4HA 2RGDA 3K9NA 1XTJA 1M8PA 4DZZA 3FDIA 4DC9A 4BFZA 2WV9A 3PUXA 3TQFA 3RS2A 1FP6A 5CK4A 2QPAA 4DB2A 2FV8A 4AYTA 4XWKA 1YVDA 2IYRA 3A1WA 3DMDA 5E7IA 3QEJA 3A6PC 1OV4A 2XSZA 2ZSDA 5L3QB 1OHHA 1X8KA 3SR0A 1D8TA 1E98A 1HQCA 3ZVNA 1UEIA 3GJ5A 4EJSA 8OHMA 5E3HA 2OBMA 2G0TA 1KDOA 2ZIAA 3VR5A 4DLXA 5GJBA 1OW3B 2ZYVX 1G9XA 1X1SA 3THXB 3CNLA 1G41A 4KBGA 2R9VA 1AS0A 1W4RA 3CM0A 5G3YA 5C4MA 3QXHA 3HR8A 4PO8A 4TWZA 3I5YA 3AH8A 4I99A 4KYIB 2ZJZA 3I8SA 3IBYA 1VCMA 4DUGA 1P6XA 4Q01A 3B5JA 521PA 4URYR 2ZRFA 4JYBA 4EJSC 2PT7A 4C0JA 3EWSA 2WZQA 3TVDA 1R2QA 3B85A 1PLJA 2QRZA 4I81A 1AK2A 2OEPA 5JS7A 4LC1A 1W5SA 5K8IA 1GRRA 2PL3A 1Z07A 2R6CA 1W1WA 1AKYA 1ZM9A 1X8JA 4DSTA 2WMOB 1FZQA 3CF0A 1KI3A 4GP6A 3CONA 2BJWA 3ZJYA 2O8EA 2J45A 1NN1A 1XNJA 2W6IA 2ZE8A 4G5QA 3KJGA 3DHWC 3KKMA 4LGMA 2P3SA 1E79A 4MQBA 5EP2A 1W0KA 4US2R 4C7OB 4BLOA 1WA5A 3NC0C 4GRAA 5FBLB 3ZZUA 4LDJA 3U44A 3UWKA 2XB4A 3VHXA 2J9RA 1NMZA 2GILA 3BH6A 2Z5FA 1G5RA 2HCJB 1LV7A 1SKYE 3RWMB 2GHIA 1HE8B 5L3SA 2YWFA 3O8DA 2OCBA 2R62A 1X3SA 2LCFA 3A37A 1Z8FA 4HAUA 4S2EA 1NBME 5AK0A 1GDDA 3GJ7A 3B2EA 4ZPXA 3MWKA 4IFEA 4A0HA 1TEXA 1GNPA 3VKHA 2FE4A 1QDEA 3NBFA 3LQQA 1CU1A 1Z0JA 3RS4A 4F38A 2QY9A 2G0NA 2HXYA 4AKEA 3PFIA 2IHYA 1TUEA 3UATA 1E9DA 4O3MA 4EFNA 5CIQA 3DOFA 2YYZA 1MO4A 3B1ZA 3WP0A 2DFKB 4CEHB 2O5VA 4MITA 4TYYA 2FFQA 1Q21A 2VP4A 3ZLJA 4IDQA 3IDQA 4N0EA 3NH9A 5EQTA 3KKQA 3KQNA 2HYIC 4M9XA 4A0RA 2F3TA 2AX4A 1A7JA 2A5JA 2GKSA 1XMJA 3I72A 4D0LB 1GRNA 5IDVA 3RS0A 4LHWA 3MFYA 2ZPTX 2GJ9A 2OFWA 4MGKR 2BBWA 3T06B 1RFLA 3H2YA 4P4TA 5HKKA 3JZAA 2EWVA 4MDFA 3C5CA 1N5KA 4UNQA 1KO1A 4EPRA 4U02A 2IYUA 1T3LA 1R0YA 2BBTA 3B9QA 2EFHB 4V0KA 5JECA 3FMPB 1NRJB 2GESA 3W8NA 4AY2A 1N3BA 2PEYA 3A1TA 5KTYA 4OI0A 1SQ5A 1OKKD 4HLUA 3E2IA 2J0UB 3B9PA 4JVNA 3IUYA 4IDHA 2CCJA 2WSSD 2YINC 1RJ9B 1GL6A 1XZPA 4LPKA 3KFVA 3QVUA 3BJIC 2ERYA 1Z6TA 2FGJA 4XSHA 1FTNA 1IY1A 4MRNA 1E69A 1BO6A 1KIMA 1NJFA 1QHHB 1UKVY 2QA5A 2VHCA 4K81B 3KXIA 2GNOA 4PZYA 3ZDQA 2O8DB 2OFXA 2QAGB 1SVMA 1KSGA 4A92A 4URWR 4ZDWA 2BMFA 2BBOA 4TMZA 3WBJA 4PC6A 1E9AA 3OZXA 2IA5A 3C14C 1ZCBA 2J3EA 1N6RA 3ONWA 1V43A 2WJJA 4HLUC 2RH5A 1GKIA 1E4YA 1R5BA 3VX4A 2XJ4A 3BS4A 4B44A 5FH9A 3TKLA 3ZVRA 2RAPA 1R4AA 2ZU0C 4ZO4A 5FOTA 4R2IA 2YWEA 4EIWA 3HDTA 3K70D 2JLUA 3LRPA 5LPNA 2ZEJA 4UJ3A 4KSCA 4DRZA 2PH1A 3LH5A 3T1OA 1DELA 1Q3HA 2V6IA 5DYIA 4PAQA 1Q22A 2D62A 5AUNB 3PITA 2OM2A 1W47A 4Y0VA 1G3UA 1E0SA 1L7VC 2YHSA 4ARZB 5CYPA 4HAXA 4L15A 2H5EA 3F5FA 5CB8A 5TXGA 4HB4A 1RRPA 5EUMA 4B76A 3QXJA 1Q1ZA 3S1AA 3TBKA 2ZR7A 4HB2A 2A2ZA 2BOVA 1ZUIA 3H86A 3TAUA 2ZREA 3K8YA 5FTMA 4DSUA 2H1LA 2JIZD 1FL9A 3KUDA 2D7DA 1CJVC 2FPLA 2IWRA 1P2SA 1D2MA 2H92A 1Q44A 4B34A 3GLGA 3REFA 1W36D 1NVWQ 4FWTA 4B3BA 2DY1A 5CJ2A 1AN0A 2AR7A 4LV6A 2WJGA 4J0QA 3U3JA 3I62A 2OXRA 1W0JD 2QAJA 4HB0A 2ZI6A 2QRNA 4DLSA 2VP9A 1AS3A 4AI6A 1NI3A 3SC3A 4PC2A 4A8JA 4CYMA 1RYFA 1U81A 4TL8A 5EXPA 2GF9A 4BLPA 3CIOA 1LVGA 4DLTA 2HT1A 1A2BA 2ASEA 2WJHA 3QUSA 4P4UA 3SJCA 5FL3A 3TQCA 4S35A 2WPDD 1RIFA 3TR0A 1MT0A 1J8MF 4Q1CA 4NYMQ 4QJ4A 1GAJA 1E2GA 5JWHA 4B43A 4Q03A 4PAOA 1XJ0A 5DE3A 2NOAA 1P62B 1E1RD 1JJ7A 2ZI3A 5AJZA 4ITRC 1PZNA 1A82A 5HCIA 4V0LA 4G5RA 2UZIR 1TF2A 1K5DA 2REOA 4M53A 2PEZA 1M7HA 1M34E 1E99A 1U0LA 1LS6A 1NG1A 2DBYA 1E9CA 3WBKA 1MRSA 4XD7A 4R71A 3DO6A 4LSGA 4Z8XA 1F2UA 1HA3A 4JYCA 5G53C 4CF7A 1P73A 3U7FB 3TUIC 4PHTA 3VNUA 4JL6A 3GEIA 1FMJA 4TTQA 2NPFA 3MSXA 2UVQA 1U0HC 2G1JA 2ZRIA 1FP7A 1C4OA 1DG1G 4RD0A 2A5DA 4HEJA 5CDFE 1EFTA 1KO8A 2H16A 1T5IA 5G41A 5C2JB 4AKGA 4JLMA 5DSZA 2P0EA 1P2UA 4BRUA 3B78A 4QM6A 2HYDA 4O25A 4IVPA 2GXUA 1JI0A 2BMDA 3THYB 3MJHA 4QGAA 4K8OA 4BFWA 4BLTA 4GZLA 1I2MA 2ZSAA 1IXSB 1U9IC 5JWOA 1N6NA 1Y3AA 3W3ZB 1AKEA 1NY6A 2WAXA 1GIAA 4EQ6A 4PHGA 1G3IA 1MRNA 2C98A 1KSHA 3QKUA 1II8A 3EWAA 2NZ8A 1NLYA 3HP1A 4BZPA 2ZUCA 1E1QA 2HJVA 2OXCA 1GITA 1S8FA 3GLFA 2GBLA 2V1UA 3DEFA 4HZIA 1CEEA 3G5UA 5LDDC 3AVUA 3I3SR 1ESMA 2LWIA 3SHWA 2J0VA 1N2CE 3AVXA 3ZZ0A 3W6PA 4B75A 5C18A 4BPBA 3A4NA 4DCVA 4LV5B 1ZM3A 2QROA 3OEED 3FKSA 4RZ2A 3D6TB 5FL7A 4F7WA 1WB9A 3QF4B 5H70A 3CX7A 4LJAA 1P61B 2ZI5A 1ZBDA 5DYGA 1YZUA 2XITA 4M1TA 4F92B 2F6RA 4CT4B 4QHYA 4A4DA 4D81A 5FR2A 4Z51A 1WCV1 2ZSFA 3VKGA 2QTHA 3CUEF 2JEOA 3P32A 2WWGA 4Q7KA 2WWYA 3UMSA 2J7PA 4W5JA 2FNAA 5BQ5A 5SZIA 1JECA 3SFVA 4YDSA 4XH9B 1E2MA 2V7QA 3EW9A 4G5GA 1AGPA 2O8BB 5KDOA 2DB3A 4Q4HB 2RGBA 4A2QA 5JHHB 3VQTA 3AUXA 3U4QA 2DPXA 3TLXA 4MGZR 2F3RA 3HU3A 1G7TA 1JR3E 1YZKA 1HQYE 1KMHA 1H65A 1V5WA 2Y8EA 2W2TA 4FMBB 4NKRA 4OYHA 5DN6A 2WTUA 1G17A 3UG7A 4BWYA 3BRWD 2GAAA 1W4CA 1R10A 4TLAA 4FI3C 1Z47A 2W58A 2JLVA 1XTQA 3K09A 3SDZA 2NZJA 2V1XA 2SHKA 4B3GA 1VECA 3D8BA 3RABA 1CKEA 4U7DA 1PVOA 2WWHA 4YQFA 4GT1A 1G6HA 2HXSA 4DLRA 3A1SA 3UANA 3B60A 1WE2A 4GMDA 1XP8A 2J59A 4E07A 1Y63A 5JZVA 5CLQA 4JSYA 2X19A 2I1QA 5CLLA 2ZRJA 4ASUD 3EIEA 3PEYA 2OLJA 2FSHA 5EXSA 1MV5A 3CKLA 2V3CC 4OQNA 2Z43A 4MUAA 3V4FA 2ODWA 3RWOA 4JLVA 2G9NA 2IYXA 3OIUA 5FPTA 4AG6A 3B1VA 2HUPA 4PZLA 3OIYA 5CITA 2VO1A 4TYQA 2FU5C 1XPRA 4A1FA 3J81k 3D7MA 2NO6A 2NIPA 1G8HA 1AZSC 1PUIA 2JJ8A 4URXR 2J0UA 2HF9A 2IF2A 3GMTA 4H1UA 2IUTA 4BRWA 3CRW1 5FOXA 4LY6A 5FUXA 4CZ2A 4XIGS 3FGNA 3QKRA 3MLEA 3SJAA 4NYMR 5TB5A 2GVZC 3KL4A 5AJXA 3U44B 2P67A 3OIWA 4JLAA 4HSEA 4LYAA 5FPKA 3TSZA 5KDDA 4YXWA 1Z63A 3OF5A 1XXHA 4W7SA 2C77A 1GG2A 5L3SB 1G6OA 3P27A 1E9SA 2J1LA 3LBIA 4Q5IA 4KJZA 2XEXA 2F1JA 3B1WA 3IHLA 4IRUB 4UKDA 2EFEB 1GWNA 3RSLA 4L9SA 2CLDX 3K0SA 5JJLA 1E9RA 2PJRA 2ZI9A 2H17A 4CRWB 3GFOA 3FMFA 4P4SA 1G3MA 3LV8A 3QKSB 2A78A 4Q00A 4BECA 3SJZA 4YDHB 5B30A 2QAGC 4OJQA 4ZKEA 2PX0A 2P65A 3CZQA 2VQSA 1KZGB 1E96A 1KI1A 4OI1A 2PLFA 2PZGA 4UNSA 4LJ8A 1J90A 2F43A 4NONA 1VG0B 5J47A 2YVUA 3MD0A 4LC0A 1ZNWA 1UFQA 4QC2A 2YWGA 2EFGA 4LBYA 2FFHA 4R2HA 1E2JA 4TQUS 3T35A 4MH0R 2LKCA 4OQLA 1BYUA 2JDIA 1XTSA 2FOLA 2FH5B 2GCOA 3BFKA 2W0MA 2Q3HA 1A5TA 2MMCA 3BH0A 1E4VA 4IDOA 4JT2A 2WWFA 4PPQA 2QENA 1IQPA 1IY0A 3K0FA 3OAAD 1AGRA 1E6CA 4Q9KA 5C46F 4RY2A 2CLSA 3CW2A 4E03A 4QNMA 3K9LA 2CE2X 4EFMA 5EXTA 3WRXC 1LF5A 3NWJA 4Z1MA 4PR0A 2CBZA 1J99A 1P9RA 4IXMA 2H8KA 2W83A 3B82A 3EARA 4IEIA 4QGGA 4R98A 1XF9A 4TQ9A 3WXMA 6Q21A 3FHCB 4JVSB 2QG6A 2QBYA 3PIRA 4OK3A 1R8SA 4RFSA 3TGPA 1DAKA 3ASYA 2VA8A 4PTLA 3SN6A 3IBGA 2F1RA 1CXZA 1SHKA 1WRBA 1ZRHA 4A9AA 1D6JA 2H57A 1YKSA 1PLLA 3EA5A 4D0NA 1M7BA 2ERXA 4ZI3A 2ORIA 2VLIA 2P5TB 3GEHA 2BEKA 2Q9AA 2ORVA 4RZ3A 5DIFA 5KNDA 4LI0A 3DM5A 4DLWA 2BIFA 4EPTA 2PMDA 4KYUA 3GJ3A 3EZ7A 4FMCF 3SOPA 1U90A 4RFVA 3EC1A 1G3RA 3ZIAD 2FDCA 4DLZA 4P33A 1S1CA 4GOXA 2IS2A 1ZD8A 4D4JA 3I8XA 2ZVQX 3S1AB 1TTTA 4RCYA 2PZEA 3Q8XB 5A5GA 5BN3A 2IYZA 5IT5A 2YWHA 4TSFA 3B8HA 3DOEA 4U00A 1XD2A 1CR2A 2QSYA 1VYTA 2WWIA 3L8ZA 1W7AA 2KI5A 5EE9A 4B3CA 4F4JA 1T4GA 4PPGA 3BE4A 3QOFA 3UXMA 3U2QA 4UXIA 3ADBA 2IYLD 3KXKA 1GILA 5FPYA 3GLGB 1SHZA 2BKUA 1YRAA 2FSFA 1NKSA 1DEKA 1VG9B 4TMWA 4KODA 5LB4A 4JLBA 1W5TA 3CPHA 1YZQA 2GETA 2QORA 1N6IA 2ZR0A 4L8GA 1N0WA 3SBEA 4A8JB 2B6HA 3NHBA 1OXTA 4NL4H 1T0HB 1OIWA 4DIDA 1QHNA 2IXGA 2J46A 4QNRA 4LOAA 1KSJA 3K1JA 4RVCA 1NN0A 4BFVA 2Z4RA 4CGZA 3PVSA 3AUYA 3KJHA 1X86B 1P2VA 4OJKA 4DHEA 1XBTA 4FMDF 5FI1B 2B8WA 4YLGA 1IJEA 4YMSA 1VHLA 4XVUA 1KK0A 3AV0B 1BS1A 2QNRA 4CW7A 1COWD 4MKIA 3GLIB 4DSOA 3ETLA 4V0OA 4B73A 4OHWA 1NLZA 5LBIA 2J7KA 5DO9A 3X1ZA 2CXXA 3RYTC 3ZH9B 2PLRA 3PEUA 4MRVA 5E4FA 1F2UB 3T5DA 1RC8A 2REBA 1Z0DA 1OFHA 2GVDC 2GXQA 4EDHA 4Z8YA 3L43A 5H68A 1XTIA 2FPKA 1P60A 4TMTA 3QG5A 1D2NA 3KZ1E 3W5JA 2JLSA 2FFBA 3OEHD 5B58C 1I4DD 3X1XA 1N5LA 1Z83A 4PC3A 3UIEA 2V54A 1KAOA 4B6EA 2J0QA 4GI7A 1E9BA 1UKEA 1SXJD 1ZM7A 4QRHA 3LNCA 2FGKA 1W4AA 3A58B 1ODFA 3RRYA 3QBVA 3TR5A 2XX3A 4AK9A 3PEVA 3C15C 4DEXA 5B64A 2WICA 4TL6A 5JLJA 3E5HA 1NY5A 4ZCMA 1FFHA 1NMXA 4EQ6B 2B21A 2HF8A 5KNBA 2H18A 5K8TA 4X8MA 1ZIPA 1II8B 3LBNA 2J5XA 5AUPB 2YJTD 1T8TA 5KSPA 3L0SA 3GLFB 1Q1EA 2C2HA 1SXJE 4MGIR 3I32A 2IBMA 2IYWA 2I1VB 2BHRA 3WNDA 3CF6R 3AVVA 5FFMA 2VRWA 3EPLA 2XB2A 1KHTA 4WXPA 1RW4A 4M1OA 1G7SA 2D74A 3RVBA 3BB4A 1GRQA 2A9KA 4M4SA 2JLXA 4JBWA 1ZIOA 2ZROA 1HT2E 2JLQA 2DWOA 1NBMD 1T3SA 1Z5ZA 2D3WA 2XZPA 4D4KA 1S0UA 4QKQA 4QFMA 4M8NE 1KI2A 2F9MA 5TVKA 3ZZTA 1KNQA 1Z6GA 4ZV4A 3R8FA 3NBYC 2FJUA 1VIYA 1BH2A 1JBKA 2RGAA 1L4UA 2REXB 3KTAA 3LBHA 4YMUA 1G8YA 2VYFA 3IPXA 4IOMA 4DDUA 4L16A 3GJXC 2QP9X 4DCUA 3Q7QA 4W5HA 1AIPA 3HWSA 3K0AA 2G3YA 3WMGA 2GRJA 5SZKB 3W6OA 4TLBA 4CDGA 3U4QB 1OXXK 4EKDA 5J4YA 1W46A 4HDCA 2DCUA 3A8TA 3C16C 1KMHB 4PSVA 3RHFA 1OKKA 2OESA 5GVSA 5F98A 3E1SA 2ZRKA 1G16A 2L0XA 4PANA 3QKSA 4IVQA 1XPOA 2CHQA 1JEEA 3ADKA 3OHMA 2WSSA 1Z08A 1S96A 1VTKA 1GNRA 3FYHA 3DPUA 3GD7A 4JSTA 4PQRA 4AD8A 2NGRA 2QMHA 2DR3A 4M0LA 2ZJAA 2C9OA 4JLDA 4MKGA 4MYUA 3G0HA 1KK1A 5TARA 3I73A 4JIMA 4M21A 3SJBA 4CEIA 5GJWC 2XTZA 4BLSA 2OHFA 3R9XA 4M9QA 3WMFA 4JVMA 3QG1A 1OIVA 3U61B 4JMPA 1QVRA 1GL9B 4Q66C 4RD6A 1II9A 3HR7A 3HYTA 1W4BA 3LLMA 4PXAA 3Q72A 5E7JA 3IILA 4OBEA 1ZCAA 2ZRGA 4ILEA 1ZP6A 1Z0IA 3IO3A 2VL7A 2UKDA 1OXSC 1ZNZA 4PHFA 3CPEA 5JBQA 1UPTA 3ASZA 2FG5A 4MRSA
chains in the Genus database with same CATH superfamily
1V47A 3IV6A 3W3AD 4BFUA 4AWBA 2G0AA 3O8RA 1CR0A 1JHOA 1D2CA 3BG5A 4X0EA 3DEHA 1HNWB 4PN7A 1CZRA 4Y30A 1YJ8A 5AKYA 3QKRB 4R41A 4YAFA 2BGKA 1PR9A 4E88A 3KD3A 4EMBA 5DI9A 1VL2A 4GWLA 4FMDB 3V8VA 3F6RA 1B76A 3OPYA 1VRWA 2CFTA 3EG5A 3K4PA 4DLNA 5H82A 1UPBA 1R27A 1XXHB 2NVWA 3CU5A 3U9TA 1PT9A 4LNAA 1WULS 3VNBA 3TH5A 1P18A 3NDJA 1ARZA 4X90A 2YFYA 2XYGA 3SDBA 4M1EA 4D6PA 5JTUA 3HJCA 1V8ZA 3RHZA 4XA8A 5DYWA 3TW8B 3D5TA 1VE1A 2OORA 2UVPB 3LQRA 1GUBA 1A1VA 1TPZA 3OVMA 2AOWA 5CFZA 5B53A 1RHMA 3O8LA 3EGXA 4F3RA 3NEYA 5FOUA 2JCGA 4ZICA 5CVCA 1KDRA 2HMVA 5AVWA 5ER9A 3G2LA 1O5OA 5CA1B 2EKZA 2EHDA 3NHSA 1K4KA 2GD0A 3I9JA 1IHYA 5T5QA 1QBKC 2IP4A 2YJ5A 1CUIA 1F2VA 3ZJTA 3SKYA 1AZTA 1GP2A 1KEVA 2BJHA 1WUTA 1WHTB 1F9AA 1DQRA 1RDFA 2F43B 1NVEA 4L7QA 3VH2A 3W2GA 1I0ZA 5A3JA 4QPCA 4H7HA 5I4CA 1UBUS 1PZGA 4MRMA 1T43A 3NIBA 3U3OA 5JNSA 4B31A 4DNXA 2AYYA 2OBXA 3UWSA 4Y1RA 2Y92A 2V59A 2YZKA 2D2EA 4AVYA 5EA2A 1KJQA 3CEAA 3LHIA 5AKZA 4ZHQA 4ZVUA 3JAMA 4JX8A 2JH3A 1RCFA 2VDOB 1ICEA 2EC5A 4Q9HA 3BE8A 3WHIA 3FWZA 4N5IX 3W5VA 1SR8A 3V8RA 3CEMA 5EGSA 1DTWA 1QIIA 4FC7A 4G37A 2XUHA 3IVXA 1XZQA 3D3QA 721PA 1Z4KA 3TPCA 4DIOA 2PYDA 3K0FB 2LRHA 4PLCA 3P9XA 2RHMA 3VSBA 1D5WA 5IM4A 4PNZA 5CVDA 1N5DA 1UM8A 3LY9A 4HN4B 1JXOA 2XD9A 4GS5A 4WK4B 3TVTA 3PRYA 4IIDA 5LLSA 4BL5A 5JNVA 5HXAA 3DEJA 4H0FA 1IONA 2B4KA 2PQMA 4PX9A 2EYQA 4B71A 2BEVA 2W9XA 3N76A 4K3VA 4BB9A 5LJIA 1NNEA 1ISMA 3AP2A 3F74A 3TI7A 1JTVA 5IJWA 1NXXA 4AMYA 4BE9A 4RE6A 1V4NA 4TL7A 4JJEA 2COKA 3LUJA 3AHJA 2GXAA 2YN2A 1YDEA 2YHIA 3DD1A 1HEIA 2OZKA 1P7CA 1WCIB 2YY6A 2ZLBA 1S6YA 3M0EA 4GMXA 5DHRA 4NCJA 2D0PB 2HJSA 4LF9B 4IVNA 1G8MA 1RAGA 1BYIA 3SE7A 2RBGA 3VKUA 1T2AA 3OTIA 4PLYA 2VYND 3T5TA 1LPPA 4JODA 4JKYA 3EUEA 3TTWA 1N0VC 3OLWA 4YP5A 1DAMA 4KAJA 5JNRA 4KITB 5CFLA 2DQ4A 4CKCA 2HLDD 2F17A 1QO9A 2R65A 5EKSA 2PWBA 1O87A 1L7PA 1BSVA 4L2IA 3A1UA 2ECFA 3T7CA 4XEUA 3VR3A 4AULA 1NKVA 4E70A 4CIDA 3EF3A 1OPRA 4ON9A 5TT0A 5J2UA 1WZ2A 3A4LA 2QAIA 3AVPA 3B9RA 5I7VA 1CQPA 2B8JA 2GKOA 1XAIA 1T0IA 1QC5B 5EE0A 4EVIA 5FWYA 1QFYA 3G2HA 4X8LA 3DYBA 4I3GA 3WA7A 3GRAA 2CKDA 4ZT7A 2QD1A 2F67A 4A2PA 4YT2A 1WMBA 1Y6QA 4R0NA 1Y1KE 4OMCA 2OQRA 1FRNA 2BEJA 2F1IA 3EK2A 1TT5A 2WAYA 3JQPA 2CC2A 3OCWA 3GLKA 2YC4C 3BMNA 4C0QC 5EE1A 2DCMA 1Y7PA 5TPWA 2M6SA 3F6YA 1N6PA 1H8HD 2CEKA 2DLNA 3S99A 3FG9A 3UAVA 4GKBA 1NYTA 3KOUA 3T7IA 1VI6A 2OHHA 4C4SA 1JT2A 2BF7A 3PXGA 5C1BA 4ARVA 1ILWA 3DO8A 1EX7A 1O5TA 3PHIA 1XTKA 3E9EA 1C9KA 3VSDA 3PQ5A 2NADA 2B9VA 4MSUA 4YCCA 5AKHA 3HCEA 5IH3A 1C8KA 5EIWA 2XHZA 5EYPB 5JD6A 2VNAA 2C5HA 3RQSA 3ER9A 3Q87B 121PA 1JLKA 1YL7A 3HKBA 3CLUD 1G8FA 1RI3A 3HZRA 1SCUB 4HQ6A 4R9RA 2IX9A 4IUDS 3KQTA 5KYWA 3C5EA 3G59A 4BXOB 2XA9A 3S81A 4L73A 4MJLA 5JSHA 4LSMA 2Q0XA 4RIEA 1EAMA 3C74A 4ERNA 5IMSA 3L1UA 1RWQA 2BFWA 3WFJA 1Z73A 3DDUA 1QK4A 4JBHA 1TMKA 1YRBA 4OQ4A 2Z4TA 3K16A 3EXIB 1Y4SA 4EHLA 3HXLA 4BEJA 3KWLA 5TV2A 1AHIA 1VGRA 4C1NA 1X7WB 3GP8A 1C7ZA 1N5RA 5EVCA 5FOSA 3WYCA 4DM7A 4HRAA 4LBVA 2TRSB 3O4VA 5JZSA 1WXWA 3AY3A 3U49A 1MQ9A 5F2NA 1F0NA 3AVYA 1U2PA 3OM0A 3CLVA 1VL8A 3VNQA 3LUHA 4WFQA 1CRPA 1TMGE 5IFLA 1KEEB 4N8SA 4S1OA 5EZ5A 3SYNA 4FXPA 1TQHA 1B1AA 3CWZA 1RBYA 1RHJA 1F1BA 1X1DA 5AI6A 4RADA 1G291 4IZ6A 4NP6A 4B48A 2RHBA 2H1RA 4UNRA 4O2RA 3ZHSA 4FYJA 4B8YA 1J39A 4E2FA 1BDHA 1BEEA 1U1IA 2I7XA 2WJAA 1TX4B 3HCPA 1Z26A 3EVAA 1H1DA 1RM0A 3LKDA 3A26A 3RM3A 4WN9B 4FCWA 1XFDA 3JZFA 2PSJA 3ML1A 3EASA 2PAFA 3BIWA 4PZZA 3N2ZB 1XZJA 5GIPE 3T5GA 3U7RA 2X58A 2VWQA 2WHPA 1JSZA 3KEQA 3OFND 2IUSA 4DPLA 1NUSA 2ST1A 3RIYA 2AVDA 4OKNA 1CHDA 3B1KA 3K4QA 5ITZB 3BMCA 2PMCA 2I22A 4MGEA 3J7AC 5AW3A 1F5SA 1GSHA 3HB5X 1BGXT 1JE0A 3DPSA 1UBGA 1Z88A 2E2WA 3BQMB 3T61A 5LQJA 4NYIR 4B8WA 5BQFA 1U9JA 2XKAA 4NQZA 4NZNA 4DPKA 4MVCA 1L1QA 4REQB 1NN5A 2QLBA 1ZH6A 1TA4A 4K9SA 1DWUA 4FDMA 1ULAA 3I6YA 3QKIA 5KDLA 1MAHA 4CR6A 2JVJA 2NU9B 1QVWA 2WU4A 4YRFA 5IM4F 2B2CA 1QAOA 2XTAA 2QJFA 3NYWA 3HLKA 1Z6PA 3PT5A 1J2YA 3A2MA 2UV8A 3ZDBA 3WLQA 2NZUG 5IWCA 3DD5A 4M1WA 1SBQA 1XVTA 3TIFA 2DWQA 2WHEA 1Y6GA 1QV6A 3F5MA 3OCJA 4BUJA 4DLLA 3PP8A 4S04A 3HDJA 3AX6A 5EMNA 5JVDF 2G88A 1U2RA 2P62A 1XD9A 3QXSA 1PT7A 2C04A 2Z30A 1E2DA 2XB8A 2AD1A 2Q6TA 1EX6A 4KI7A 4DT1A 4QJ5A 3LHDA 3SHOA 3I42A 3PWTA 2EJBA 2EARA 2J87A 2V7GA 1FPQA 4Y2PA 5IMBA 3K0CA 3U5TA 2ZSBA 4CQNA 4P32A 1XQ1A 4LDRA 5I6DA 2EFCB 2HF2A 1ESNA 2ATIA 3PC7A 4FHEA 5K8CA 3SQWA 1J9GA 2QX4A 4O4JB 5KWJA 5IC4A 1F3LA 4W5NA 3WP1B 1MQAA 4LRYA 1R5OA 4PSDA 2ODTX 5BV7A 2HPHA 2MSLA 1XWFA 5T57A 4ALKA 2V7BA 3IKTA 1J49A 1PK9A 1W44A 2DUNA 3A25A 1YA4A 3N0RA 4LFCB 3T9EA 1MH1A 1RQ2A 3UUWA 5J2UF 1CR1A 3FOZA 2G5CA 2FMXA 4UUBA 4WNAA 1AKUA 1KYWA 5GAJA 2PWYA 1SXIA 5HIAA 4ZRMA 4NJEA 3W2IA 2OOKA 2ZW9A 3LBFA 1QE3A 2VQEB 1QYRA 3VNSA 4KAFA 5AI5A 3OAAA 3LX5A 4U7TB 1T34A 1FX1A 3LA6A 2HK9A 4EHIA 1YC2A 2FN4A 7ADHA 1FQKA 4NCXA 4C6TB 5ALVA 1Z13A 2HQSA 2WR8A 3AKYA 3VPFA 3TEMA 1SBTA 5FA5A 1VSTA 2JBAA 3ORRA 4OB8A 2JEZA 1K8QA 2FZ5A 2JATA 1B8UA 2XTMA 1RJWA 2XQVA 2YH2A 3BWXA 3CO0S 2KSQA 1I3NA 4G5FA 3U7QB 3CB4A 3D8NA 4DM4A 3BUSA 1S8AA 3A6FA 4B6QA 3CNNA 4EFLA 2CHVA 1YVRA 3TOVA 2R79A 3HJGA 3WRWA 4ZYLA 5TY0A 1FFYA 5IASA 3FOBA 2YFHA 2ILVA 3CBQA 1U3VA 4J91A 4RHXA 2JL1A 4BNIA 2QSUA 4KWEA 3PR3A 4WKCA 4EUHA 1WZIA 4KNWA 3AEZA 3IMEA 1AA9A 5DXJA 5GV8A 3JWJA 4BIMA 3N7TA 4ESVA 2IS1A 1TJPB 1D6SA 2VLBA 4K26A 2QUBA 1Z2EA 1BU8A 3BIXA 4O8CA 5J4VA 4HGZA 3HO8A 1L5SA 3T0IA 2X2FA 1XLWA 1L4MA 2H5JA 2BUAA 2AFIA 4KO8A 1UAYA 2A9RA 4QLOA 3RAFC 4DV1B 1W30A 5MDHA 1CNEA 1DCKA 3F97A 4J1NA 2KYRA 5DIZA 1Y8RA 4MAMA 1TAUA 3WG9A 1CQJA 5IULC 2BGGA 1BIFA 1XN4A 1YZLA 4DDWA 1CVIA 2I2WA 4QUAA 1XRSB 2XRZA 3F2IA 2HV8A 1I3CA 2GYWA 2I99A 4HADA 3GG9A 4PFQA 4B3XA 4DNPA 3UN1A 4DRXB 2NSHA 4AJLA 3ANNA 3IDOA 3PGXA 3HUTA 1JU4A 4MUGA 3SVZA 3HSKA 4BJ5A 1S8OA 5K6TA 1TJ4A 1C9DB 4JLKA 2GJ4A 1GLNA 1KZ6A 2E49A 2CJXA 2QVXX 4MMYB 3IO5A 4GKJB 2QN1A 4I66A 1UAAA 4ZALA 1Q0HA 1EEXB 1PSWA 2O7QA 3QPWA 3IP7A 5E1OA 4C3VA 3OQ1A 4NMHA 4C4PA 3UFXB 1V95A 3DZJA 4L0DA 4L0QA 4ENPA 3K1AB 2A1IA 3U9LA 4O29A 4BV9A 2OAP1 1U7ZA 2PJZA 5KYVA 1L5LA 3RJ5A 2HMUA 3HN2A 3F5SA 4BO3A 3UPTA 2IK8A 4LUCA 3JVUA 2WUDA 3KPVA 2QM7A 3G2IA 1LLFA 1C9EA 2JFWA 1D7AA 1A2KC 3AHGA 4RACA 4UVDA 2BKLA 4XW2A 5SYNA 1R0KA 1U8AA 4IS2A 3QWBA 2G06A 4D25A 3W5AA 2Z2JA 1C5KA 2ZRNA 1S2MA 1KQ3A 1ORHA 4XTCS 5DGXA 4G0MA 3QFTA 2EJUA 1WB5A 3AJ9A 1I94B 1F4LA 4R40A 1NJ5A 1OY1A 1BA2A 3MWYW 5A06A 1MVOA 1XVLA 2R4UA 5A9SB 2GTHA 4ZYXA 4M1YA 3GPIA 1WDKA 2OAEA 2RBKA 3HGTA 4KBYA 4UBOA 3P52A 3UCXA 1HH4A 1W76A 4IJWA 4BNZA 1KFCB 2HLNA 3JQCA 4KPYA 3UC5A 2VP2A 1ABFA 3DDHA 4RTNA 5HPYB 4LFBB 5JYEA 4N48A 1US8B 1QZXA 3PYLA 2RHCA 2O8FB 1OI7A 1ZL2A 1IPHA 3CUVA 1RCTE 4RC9A 1IZ8A 1IL0A 4MPTA 3MGAA 4MW1A 4PSAA 2O20A 3EF1A 4IOLA 3HY4A 3S2IA 5AW9A 1K4MA 2YY5A 3HC7A 4XSGA 5EHNA 4P3PA 1DIAA 2IF0A 3BIFA 1XMOB 1CV2A 1OGIA 1WD5A 5CT8A 2HMAA 2ATXA 3HZOA 1PV4A 2VR1A 4Z7OB 1P1IA 4MROA 3KOWA 4EKNB 4O4HB 3CVVA 2WJYA 1K3UB 2VJQA 1U98A 3EZ2A 1HE1C 3ETNA 4F3NA 1SPXA 2VF7A 4M7RA 4WL0A 2YV1A 1JB1A 5FBHA 1TCCA 2VT2A 1XAJA 4PY2A 1I6MA 2OCXA 3FSRA 4WZBE 3O8OA 4UXJA 3RYFB 3U7JA 5FO0A 3KOZA 3O8BA 3VA7A 1FRQA 1J42A 2TMYA 1NBWB 5FNVF 4D74A 3QJGA 1JQLB 4U0KA 1OXBB 5TGDA 3CYFA 1RE0A 4TV8B 3OO1A 1SUFA 4U8GA 5HTKA 1T1RA 4BFYA 3FH0A 2W2KB 4W1QA 1K9VF 4GL4A 3D0QA 1NVUQ 3QEAZ 4BQQA 2RHTA 1U8YA 5ADHA 3G1TA 3UUFA 2X0DA 1G8KA 1U3GA 3EXHB 1RKVA 3LGSA 4HUTA 3C0KA 4HYQA 2EG9A 1XL0A 1X0XA 3ZGXA 2ZTSA 1XNGA 3C7TA 2X9VA 3JW8A 5CFQA 5LL6P 4Y6RA 5LXTF 1MH9A 3COPA 3M4JA 3SHQA 3AJDA 3GRCA 4H35A 3UJAA 3UMVA 2Q46A 2WYWA 5D3MA 3UT5A 2ZANA 4A73A 4URFA 1GDHA 5JSZB 1F6DA 4NOMA 4W5WA 1WVMA 3EXG1 4G0WA 3MCZA 1LZKA 2I7CA 2BFCB 4UPVA 4PAWA 4PQFA 2H5IA 2NMVA 4N47A 2O06A 2JJ2D 4MW5A 1VYUA 3GJYA 1OUMA 4LHYA 1GAQA 3C1TA 3LFUA 3M6FA 1I2ZA 2RARA 5CLIA 5ITVA 4C7VA 2IZOA 3A9VA 5C4GB 2VTBA 1BFKA 1CZNA 4Q1AA 3WHPA 2UYGA 3OT4A 1VA5A 4HBZA 3PUYA 3M1AA 4UFNA 3RYCA 4N7RA 5GV7A 2ZXEA 4Q02A 1L5YA 1FJGB 1CEQA 3FZGA 4NE2A 4ZP1A 2QLJA 5FUBA 5I01A 2ENUA 2AKYA 3AUJB 3M2PA 1F5NA 2BFBB 2JAQA 1P33A 1AO0A 1RXWA 1EGQA 1AU9A 4UFOA 2P78A 3K5HA 1HLFA 1T9KA 3FUWA 4II7A 4KAXA 4LY0A 4U2BA 2Z3VA 4CF4A 4HVTA 2PUGA 3HDYA 1HORA 3OLYA 1UL1X 3WYAA 3AIOA 5E7MA 1BVRA 3WLAA 1N5JA 3WIEA 3R4CA 1G63A 5A05A 2OM6A 3K96A 4YCNA 1EM8A 3CX6A 3NYRA 3W5CA 3DDSA 4UM9D 5G0TA 1AKWA 1YKGA 2ZIFA 4WHMA 3IR6A 2C88A 3REGA 2FP3A 4ZD6A 1I2AA 5BNFA 1PRYA 4GU5A 4QBIA 2FDXA 1IHOA 3FNQA 3NTUA 2I2BA 4DV7B 1X80B 2VRBA 4QBFA 2V3WA 3D8HA 3D31A 2PGIA 3PDIA 4KHZA 4P08A 3OQJA 1GVHA 3BA1A 2V3VA 2OC9A 3LO5A 4QYIB 5H80A 5A9RA 1F3OA 2P6UA 2VEDA 3KZNA 1P4HA 1TO2E 3KAJA 2RGYA 1ZOOA 3LECA 2XPCA 1Z12A 1BA3A 3TRIA 3DPIA 5CB4A 1P0QA 4B1FA 3CLHA 1GQYA 3NONA 5G0SA 1Y3IA 5BWNA 2ZYRA 1OPXA 5B4TA 5EJ8A 4LZPA 4DCNA 3CSUA 3DOJA 2JGIA 1KHHA 3IUMA 3R6GA 1U94A 5EE3A 1IBKB 3SD7A 4C0LA 4YWJA 2X23A 5E2BA 4RZXA 2GPJA 1C7IA 3E48A 1E2EA 3FI9A 1E3LA 4FIDA 2AFHE 5JZ9A 3UJ6A 4MP6A 1VP9A 3GRRA 3TQIA 3LU1A 1XFAA 3VRHA 4QNNA 2XSZD 4HUQB 2F9LA 2EFDB 3FWYA 5AJWA 1Z0ZA 4HAWA 4B79A 2IOFK 3F7TA 1QGOA 2HCTA 4P5EA 4BV2A 3UAYA 2B2XA 1NXQA 2BRUA 3ZWOA 2OENG 1A8SA 1WDWB 1YZHA 5G40A 3NHKA 3M5PA 1G7CA 1GXSA 1Q92A 1R1DA 1SG9A 2FEOA 4ILKA 1YI0A 2I6GA 5CK5A 3S27A 3P0EA 1VIAA 3GCGA 3B6JA 3THWA 3HY6A 4CM3A 3F73A 2R00A 1YS6A 4AP6A 4BNVA 1I7DA 4AKHA 4YONB 3ISTA 4N4AA 3GCWA 4AUEA 3TO5A 3ZWWA 5KYGA 4PSKA 5T41A 4CNBA 1WNFA 2PRYA 1BMTA 4EECA 5KYUB 4H15A 4BX0A 4PC1A 1KZ9A 3WE7A 2JGDB 2JS7A 1IN7A 3MJEA 3PXXA 5DBEX 5AK0A 3F9IA 2Q1WA 3W9BA 3IX7A 3C3PA 5JH7A 1ABBA 2ABWA 2G9UA 2F1HA 1YUNA 1LUAA 2CXNA 3QLVA 1P29A 4JOSA 2D0DA 4X93A 4FSXA 3RJZA 2VC2B 4AMZA 4F4JA 3EJ6A 1XCMA 3SOZA 2FZ4A 2P9HA 2V7UA 3WI7A 3AEUA 4DWWA 4DA4A 4EKGA 2EKBA 2FCAA 3HSSA 3KD2A 3LVQE 4OB6A 5G02A 1AQUA 2ZDGA 1EUQA 3ZYZA 1LDEA 3C5HA 3GJ8A 3DKVA 1KVRA 1K2VN 2QNBA 3QE0A 1I80A 1E79D 1NMSA 2R1TB 3PCXA 4L9WA 4X1IA 4AZ0A 1JIVA 5DW3A 4J0FA 1EXVA 1NQUA 4G1BA 2G77B 3LDGA 3B20A 1LEHA 4G36A 3WJ7A 4ND4A 3BYZA 5C9ZA 5CTAA 1AH2A 4WSOA 3GBVA 1MRZA 3F0TA 3UBMA 5I3CA 1U9YA 3HN6A 3AVWA 3FHTA 2EAUA 3ZD8A 2FHPA 4BWVA 1WD7A 2GH1A 4L3WA 4X8HA 4EO9A 4OYLA 1BS2A 1XZ8A 3VOTA 3LDFA 4PU0A 3H5VA 2KJQA 5ALOA 2IHZA 4OHUA 3BTSA 4U1RA 4BVBA 2HHAA 2NW6A 2QGZA 2XD4A 4OP3A 4YNBA 1YCGA 5DM60 2H7YA 2BM9A 3HJRA 2J3JA 3TS1A 2Q5IA 4UUPA 4C78A 5CFOA 2DY0A 4LK3A 2QTVA 3JQ8A 5EHZA 1CFZA 4TWRA 3VYUB 4EYEA 3TECE 2WJVA 2WZDA 1KF0A 3IQFA 1YHNA 4GNRA 1VPVA 4XDGA 4GECA 3KHTA 3F8TA 2JD1A 4Z4HA 1UMCB 1KJJA 1KI7A 2ARKA 2QN3A 2WDZA 4P3KA 3WADA 1KEWA 3JRNA 5EPOA 4BO9A 4IG9A 3FHJA 1LSJA 2RIRA 3V33A 2C07A 2EQBA 2FUG1 3OTOB 1VLLA 4PIPA 3RREA 3OI7A 1KI6A 2H1OA 3X2SA 2WM8A 4CLHA 4DUZB 1QHIA 1QOZA 1RJGA 1WPGA 2ODAA 3EDRA 2VJYA 4GLBA 1ZGAA 7ABPA 4PGMA 3WNZA 4GZ5A 3H0CA 1LH0A 5BVGA 2ZYTX 5C5EA 4RF3A 3AOGA 3A1DA 1ZMRA 3ZQKA 2ZB2A 1TVEA 3HJNA 4JJGA 4ACAA 3TQOA 1E3WB 1BN7A 2CHFA 3V6LA 2R6DA 3EW7A 3K1TA 1C7RA 1N1MA 4HTFA 4ZQIA 1PFWA 4TM7A 1P9OA 4QEKA 4TMXA 1H1LB 1MA3A 3DXZA 3WVNA 1IQUA 4JI2B 5IKPA 3KDPA 1T5BA 2HMSA 1BJTA 2OGTA 4FT2A 1XDWA 2IP1A 3ROZA 3KKLA 2V98A 3RYIA 1P8JA 4V02A 3VO2A 5JXWA 1Q17A 1EUCB 2H5LA 5CDFA 3TNLA 3PR1A 1LI4A 2P7HA 4CLOA 1CZHA 1KYVA 5I5GA 2EJWA 3T7RA 3WLPA 1P2GA 4PX5A 1W5FA 3Q5EA 3KV1A 5L6MB 3L7JA 4RCVA 3VHQA 5M29A 1OGJA 4UFPA 3X0DA 2Q6KA 3QU5A 1HDRA 2FEWB 4MI3A 1DAGA 2QQ0A 1JYEA 5A7GA 1CUYA 4P8RA 1WUKS 5KKNB 3ONNA 4HAVA 1V8PA 5DLPA 4R84A 3QMWA 1TZ2A 3ORYA 3QEMB 1YGYA 1Z7WA 2VDUE 3ZWDA 4WN3A 4JI6B 3ZDYB 2ZE7A 5JU6A 1IHPA 5F52A 2GBCA 3TCXB 5A0FA 2A33A 5KOHB 4DVJA 1XJQA 3TLMA 2GLTA 2CYBA 3KV3O 3TSYA 4L5BA 2GBGA 1YU9A 3JR3A 4D80A 1QR2A 5LNK1 2H2WA 5EWJB 2OWDA 5GM2A 5F2KA 2IVZA 3GUHA 4KE9A 5MN5A 2XE4A 1QLHA 4QWMA 4TS9A 1F0PA 5BWCA 3PQEA 4RD2A 5AXCA 4NC9A 4KOAA 4HDQB 2REQB 1U2GC 1PFYA 1IULA 1GR0A 1QRAA 5HIMA 4Q9JA 5J1TB 4MEAA 4OSEA 2G72A 3JXEA 3PRHA 3URKA 1Q6ZA 3TIIA 2BEWB 4NFLA 1LKZA 3UAOA 3H7AA 2RDMA 2Z0MA 3MYRA 5IEJA 3BKWA 4II2A 3JWPA 2P11A 4HRXA 2C95A 1N0HA 5D3ZA 2EDCA 4A10A 5JQGB 4JVOA 4IYRA 4HDRA 2GN0A 1MAWA 4M0KA 5EE5B 1IB0A 3U48A 3HCNA 5LCXA 1JDZA 1KFKB 2PIDA 4KXMA 5F5LA 2XGJA 3KAQA 2QX7A 4WEQA 3W5HA 3UMBA 1S3SA 4HH3C 2HX1A 4ER3A 5LQMA 1C41A 3BZWA 3QVTA 3EXHC 5JG7A 5KJ6A 2BE9A 4JJ6A 1XEWX 3Q85A 1X70A 3LWDA 2X5OA 3MJSA 5A6SA 3PR2B 3TNFA 1Z4NA 4E15A 3OOHA 1GPYA 4FBLA 4R0VA 3G89A 2C61A 3ROFA 2CF5A 2D1RA 2BCGY 2QD2A 2WUEA 3MMSA 4BHTA 1TXGA 3IAFA 1AXGA 1CUZA 1HXHA 2EG5A 5JADA 1L7XA 1VGVA 2OBNA 3OJCA 4MR8B 2QDXA 1Z38A 2ZJYA 1U4OA 4LYGA 5CT4A 3ROQA 4BNMA 1DWPA 1BHSA 1VE9A 4IJMA 2CBGA 2AD5A 1IG3A 4LDPA 1BX0A 1SKQA 1TVCA 4LZNA 4LYJA 3NHRA 4XUCA 4F72A 5AHKA 3O8QA 4I50A 4JUDX 3GNLA 3M8KA 2H06A 1YSCA 3MWEA 3N2NA 5DLQC 3WICA 1DAFA 1GZVA 2HFJA 3EXFB 4OQYA 3TFWA 3KSUA 3P9QA 4J6FA 2I76A 4DXDA 3R74A 4TLCA 5CYFA 5KQGA 3ZLUA 1H93A 4TV9A 1IATA 3MOIA 2IYAA 4O4IA 1R0XA 2VRCD 3T38A 4K6MA 1OBHA 1QHXA 1GADO 1RLUA 3FVTA 5B3JC 4KSBA 4X65B 2JVIA 3QVLA 3EZ9A 3EVZA 1DADA 1EESA 3DLHA 3JQAA 1DAPA 3CPJB 3QUAA 1V6SA 1PQPA 1RYHA 2Q1XA 2WTAA 3O0TA 4D8XA 2E85A 5I9IA 4ZVLA 3DQZA 1IY8A 2C0CA 4V0NA 5AHRA 4Z4EA 2DULA 3O90A 3A4VA 3K2EA 2ZCJA 1KTVA 3P71T 3NEAA 5FUQA 4WXHA 1G5TA 2G4CA 4TRRA 2R1ZA 4QHSA 3M1IA 4GLLA 5BNIA 1IN8A 4TQAA 4EYSA 1FX0B 1KJWA 4L4UA 4YP6A 4WJLA 1WLYA 4OOEA 1NAHA 4PYIA 5I7HA 4G5OA 2WIKA 4YGYA 3SXUB 1ZMOA 3QGMA 1PJ4A 4GXQA 4EB0A 3ZS8A 3V55A 4MW9A 2ISCA 1PEKE 2QU7A 5FT9A 4E1VA 1Y3FE 1NMEA 2OSVA 2RKOA 3BC1A 4XQ9A 5ALDA 3ZY2A 5IT0A 1QIDA 3UY4A 4ECAA 2ZJ4A 2JJ1A 3AF2A 2XCRB 4HH0A 2BPOA 5ALQA 4AF6A 5LZ4A 2DERA 1XEXA 1T36B 3H84A 1SVSA 3X1JA 2VAXA 3NDBB 3TZ6A 5BYAA 5LU9A 2B34A 1PX0A 4RKRA 2I6SA 3D6UA 3MMXA 1YQ9A 2GI4A 2FSSA 3SVLA 3VZBA 4F6LA 1EK5A 1I7QB 5K0NA 3B38A 1FQJA 4P6VF 1DIOB 1HC7A 1EUZA 1Q77A 1NIJA 2GAOA 1M6VB 1R18A 1VKZA 2MIIA 2Q29A 3GFVA 2ZS9A 3H4TA 3H9QA 4NESA 4XD2A 1FZTA 4XYGA 3VPHA 5JJIA 4DQ0A 1ZRNA 1V48A 3B3QA 4ECEA 4QQFA 3EFOB 4E5VA 4HDSB 1JVNA 2JJYA 1VJTA 1QZUA 4PE5B 4QX6A 3O92A 2VSXA 3WL7A 3RVOA 1FBTA 2H1WA 1MG5A 2PUDA 5ESXA 3CJRA 3TMYA 4AY4A 1SVLA 4PGGA 4TLEA 8ATCA 4BO4A 1APBA 1HFKA 1NW3A 1XUOA 3JWHA 5DISB 3OCZA 5JRJA 3EPKA 3N9IA 4HFNA 4OI4A 2CNLA 2OV8A 1RRVA 3ROPA 2CL7X 1YB7A 2O2CA 4PICA 5FL7D 5BSFA 3AW8A 4L51A 4FINA 2J48A 4LOKA 1U8FO 4EJSB 3STUA 2QL7A 4RABA 4EYQA 2AH5A 3LLVA 5K3CA 1PFGA 1UJCA 1USGA 1HRDA 4ESEA 3V7NA 2JFZA 2C9ZA 2QN7A 1ST2A 1CB0A 3GRZA 3I0ZA 2ATEA 3MYYA 4H7PA 1G8JA 2JEYA 4Q47A 3FZNA 5C8ZA 3FTNA 4RK1A 1NG9A 2FA9A 1HR0B 1NHWA 1KYTA 1NUAA 1J5EB 1KWKA 2XYQA 4QECA 1EP2B 3OQMA 3CZAA 5ES3A 5TRTA 3SS9X 5AI9A 4U5XA 1YMUA 5AIAA 1QLWA 1YVUA 2IGBA 2CLIB 3QFHA 3DZ8A 1O97D 3KE9A 1O96A 3B6MA 3QBJA 2NVOA 1GQSA 1OA0A 1YOBA 2G9QA 4L27A 5ERXA 2JZCA 4B2YA 1TLFA 2I6UA 4R3WA 2GCGA 2P4EA 3A05A 4XFDA 3C43A 3TLJA 4C0KA 5GINE 1PR4A 4CM4B 5AVRA 1Z34A 2Q4EA 3AONB 1IB6A 1DPFA 3L7KA 3FF4A 2X42A 4RGVA 3R40A 3S2GA 3DDCA 3KQWA 2W6CX 3ABOB 3AFMA 2GJKA 1NVKA 4BP8A 5DN6D 4CKWB 1KNXA 1PJRA 1YASA 3FB4A 4O2AB 1G6KA 1XQWA 3RYHA 1P1HA 4JI5B 2NPOA 2BGLA 4INAA 1KMIY 1U2TA 2XNDA 1G21B 1IN5A 1K7SN 1T0UA 2ECQA 2HCRA 1ZSNA 1AOXA 2RH9B 4IGAA 5J4HA 2V45A 3DC7A 2JGJA 1QHGA 5DPMA 4E2WA 4ZOLA 2LP4Y 2FPMA 2XCIA 4JLNA 4MCIA 4NEHB 1I30A 3CURA 4H77A 4WV3A 3E9CA 3E9ZA 3IMKA 4GZ6A 1DNPA 2GM3A 5JAQA 4QXAA 3UK2A 5J63A 4PGFA 4J0IA 4O0MA 5DEOA 3OY7A 3WDSA 4KX3A 1NAIA 3GJ6A 2OVFA 4ZZ1A 5CLFA 1ZJWA 3DTVA 2L19A 3NV7A 3G2OA 4I50F 3NIDB 4QELA 5LP6B 3WTCA 1T2NA 2O0KA 3C3XA 1E3DA 4KQ9A 2X1HA 4RY0A 4QVIA 2OBFA 3ZUPA 1LSSA 1A5SB 1I4LD 1ZA1A 2O3RA 1AUXA 4XLZA 1DXHA 2ZTMA 4E5PA 621PA 1AG9A 4O4IF 4OL0A 2Q50A 3LNTA 3MMNA 4R9UC 1X7XA 5AVZA 1E4OA 3DEAA 2E55A 1M66A 5KX5B 1AKNA 3ICOA 3HRKA 3PGMA 3T52A 1SIWA 1G60A 3SAJA 2PCLA 1E4EA 2BWJA 5BT8A 1WPXA 5CM9C 3MOGA 1WVGA 1UK6A 1D09A 2D2VA 1JMYA 1L1EA 3DL7A 1C50A 3QNUA 4HPJB 5I7EA 3AWDA 1PNRA 2D06A 1QK3A 4RVHA 1IN6A 1X1RA 1X38A 1JVBA 3BSWA 4TUYB 1THGA 3TLEA 2J5RA 5DWDA 2IEYA 4B3MB 1GT91 1M2OB 1XTTA 2PRSA 4LF4B 4DCJA 1JFVA 2R60A 1A76A 1A9SA 2ZRMA 5H3CA 1T15A 1IWBB 3P9ZA 5LMCA 3EDYA 3N6RA 2WVGA 2X0RA 1T4CB 4L5AA 4R81A 2WBLC 4TS1A 2A6PA 3ABQB 2XOKA 2PKWA 3LCVB 4G1MB 4IHKA 5IZ4A 2HU5A 4ID9A 3LWBA 5DT9A 2RMKA 1N6KA 4FSHA 3LLCA 4HAIA 4YN3A 5C7YA 5IDXA 4LZJA 2OFPA 2YOGA 1LC0A 5EJEA 1TQ6A 2LR0A 1GPAA 1IOLA 3DEYX 1XXHE 3L8EA 4F71A 1SA0B 1OZAA 4ZXPA 3DMFA 1R7RA 1TFUA 4MUMA 4JP1A 5EIEA 1JSLA 2PA0A 3ETJA 1OFUA 2Y1DA 2SNIE 1YAHA 1T6YA 3NB0A 3O4IA 3I37X 1UKCA 2YRFA 2EEZA 4R2KA 1RWOA 2FRVA 2ODBA 2G6BA 1JHYA 8MHTA 2ZYDA 2GN8A 1W2HA 2XUPA 3CLTD 6NULA 1Z6AA 3KLOA 3DCYA 3T3GA 4BUZA 2ODEA 3DBRB 3OF2A 1S4QA 4BKQA 1T5LA 1G5IA 1ONBA 1P72A 1ZYUA 1DRKA 2HI0A 2D7CA 1UOOA 2RHJA 2JASA 4IXWA 4L50A 3KTDA 5FQOA 1LWOA 4ALIA 4DSZA 1QYXA 4YMIA 4PNEA 3DVSX 3BGOS 2DJ5A 3I6ZA 2EZTA 1PWEA 1QFMA 2AN9A 1UBOS 2D5IA 2WJIA 3PGLA 4G1FA 1CZKA 2R8RA 1M6YA 3GMSA 5JH7F 1CR6A 2OGZA 4IY1A 3K6SA 3Q2KA 4BKOA 4HCJA 4HQNA 4PBSA 4MTCA 3W06A 3CFYA 3JV7A 3LHFA 2YZMA 4MUIA 4BGIA 1JHMA 1ZVQA 3PNLA 4WZAB 2NUBA 4MPPA 2PMEA 3RRNA 3UH1A 2WIAA 5KUTA 3PJRA 1YJ5A 1OLUA 2DPLA 3RFXA 1JKMA 3U7EB 5KINB 1BHJA 1JAHA 3U7QA 4E22A 1JHZA 1H2YA 1T3HA 3ZJ5A 4DJDC 3NHYA 2PT5A 3N70A 5CM8B 4K9OA 1SUPA 4E5UA 5ARBA 2GK3A 3QOYA 2E4ZA 1IOWA 2RB4A 2C94A 4LNHA 1DBQA 3AUAA 4OO3A 1D04A 4IDBA 5JS8A 3MPUA 4KFRA 1QH8A 5C81A 3SI7A 1QB7A 3AI7A 2EX1A 3HV0A 3TTVA 4WMLA 3EJWA 3DULA 1NW6A 1EWKA 1TL7C 3H8SA 2WIDA 5FPHA 2G4VA 4HYYA 1C7JA 1OE0A 4B6GA 1PJAA 2ZQZA 2WF8A 1NJGA 2WKPA 3F96A 5DWVA 4ES6A 2GBFA 5K3FA 4C4OA 2ZB7A 3VNAA 3NQ41 1E9FA 3WB2A 4OSPA 4BX2A 2PN1A 3ZK8A 5K2OA 1V9CA 1VPEA 2XIJA 3NT2A 4BN0A 1CTQA 3BK2A 5BQOA 5CLGA 1IM8A 1XQ9A 2BBSA 5DNYB 2JZNA 1XTVA 2BY4A 1I2DA 1EVQA 2CZQA 2W0SA 1MFZA 3PVCA 1ZG3A 3A6ZA 3H5NA 4WA7A 2FPIB 4PZ9A 1DBPA 4TYPA 1I33A 2IXDA 1B8NA 1KJ8A 2N0SA 4XASA 1GPDG 4ZOLF 5ALFA 2ET6A 4K9KA 2NT3A 3ITDA 3CUWA 4N3AA 1WPQA 4M36A 5AM5A 3IAS1 3I2HA 4D3YA 2CK3A 5JUWA 2R44A 1XU4A 2QJRA 1DO2A 2XI4A 1IEXA 5I7AA 4LYFA 4CMEA 4DVGA 5JEDA 1EXMA 3L0IB 3GLHE