3QENA

S74e dck in complex with 5-bromodeoxycytidine and udp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
236
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 92
structure length 236
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qenA00
2GEUA 1KI2A 4PQFA 4BQSA 1RC8A 5C1BA 1FUKA 521PA 3ADCA 2GXSA 1GP2A 4LYJA 4TL9A 3QNUA 1N6HA 1MO3A 4B71A 2W6JD 1NVVQ 1II8B 1SQ5A 2D62A 4JL8A 4NCJA 2J41A 2ZJ8A 4TLAA 1GKUB 2IX3A 5HPYB 3OFNA 1DADA 3MFYA 3HYTA 4XVUA 2R6DA 2A5FA 4UNSA 2KE5A 1E32A 3FKSA 3UIEA 4A0HA 4DZZA 2XB2A 4YMTA 1YVDA 3AB3A 3AVQA 1HUQA 2F43A 2W83A 2FN4A 4MGZR 1MRNA 4PHTA 4FCTA 1U2RA 1M7BA 1Z6XA 1RPZA 3MAAC 3NWJA 2IYYA 1FP7A 1XDBA 5KPJA 821PA 3V00A 1NMZA 3VHLB 1XTRA 5B64A 1IQPA 2NO7A 4LGMA 4PXAA 3TUJC 2IS6A 1XTQA 5SZHB 2G1KA 1K6MA 1DO2A 3EZ2A 1SKYE 1MO6A 1SXJD 2ZSDA 3ADKA 4FN5A 4C0AC 2FE4A 4XWAA 2A7QA 1ZD1A 1Y63A 2ZVQX 5A5GA 4JVLA 4TQAA 1K5DA 3LBIA 2ZQ5A 4W5WA 4V0ME 3DOEA 2ONJA 2B8TA 4LY6A 3RANA 5EXXA 3QF4A 4PAOA 5TARA 5JCZA 1N5JA 2ZE6A 3DM5A 2IW3A 1T0HB 3L43A 2JLXA 1DAKA 1N2CE 5FOVA 4TN1A 5J4HA 4HB3A 3THOA 1JNYA 3H4MA 5JZVA 4XH9B 3HPQA 5D3MB 1KO8A 3D8BA 1DAGA 1XMJA 2GXQA 4R7ZA 1IY1A 1T0JB 2ZJ2A 4M21A 1XEWX 3BGWA 1E2GA 1OV4A 4HDQB 2JLSA 4MYCA 4A6XA 3E5HA 3ZDQA 1FUUA 1G8FA 4OI1A 4B34A 1E9AA 3CW2A 4OQMA 1R5BA 3KJIA 4GZMA 2JLYA 1E1QA 2XAUA 1ZC3A 5FTJA 2YVUA 1XEXA 1ZCAA 2Q3HA 3B1ZA 4TLDA 1UJ2A 4DDTA 1NG9A 3NDBB 2A5GA 4PZYA 2QENA 2N1BA 1XD2A 2ODEA 2WJHA 2XJ9A 1L4UA 1GILA 4N0DA 2I1VB 2IUUA 4A2PA 4S2EA 4HZUB 1DE0A 3NC0C 5EUQB 2ERXA 2VRWA 2F55A 4AYWA 4CT4B 3HJNA 3Q85A 4IOMA 4E09A 2ZR7A 5E4FA 2ZRCA 4C0SA 5FFMA 1RYFA 2RAPA 2WWGA 2RKOA 5CJ2A 3A36A 2A5JA 3C7KA 4Q4HA 3ZGXA 2YZ2A 1AS2A 1F60A 2ZJAA 1HURA 4Q7KA 3ZD6A 4US0R 2OHFA 5L8VA 5H68A 5EZ5A 1G41A 3A4NA 2XOKD 4TT3D 1TNDA 2GXAA 1S9DA 4DCNA 4EJSA 3CZQA 3GQBA 4B44A 1TUEA 1WF3A 3QXCA 1V5WA 3SYLA 1R5OA 1YE8A 2FGKA 1W4RA 3LW7A 4BFUA 1EFCA 5G3ZA 4GRAA 1JR3A 2QRNA 4F92B 4PC3A 2XTNA 2GK6A 4IDPA 3ZIAD 3KFVA 1RJ9A 1SXJA 1SKQA 2E9SA 3K9LA 3WMGA 2JJ1A 1MR3F 2QE7D 2C2HA 1XMSA 4XWKA 5AUNB 1F5NA 2HYDA 3K70D 2TMKA 3Q7PA 3R8FA 3A37A 2CK3A 4HAZA 1U0JA 2CJWA 3DM9B 1UDXA 1OXSC 3EW9A 4Q9LA 5K8TA 5DI3A 1T3HA 5KNBA 1PLJA 3W6PA 4DDWA 2EFGA 3CBQA 3D6TB 1ZYUA 3IO3A 1LTQA 4TSFD 3FMPB 4TQUS 3EWSA 4RJLA 1LF5A 5SZIA 3IILA 5KSPA 3U3MA 3U7HB 4P32A 3M1IA 2XZLA 4IRUB 5AJVB 1XB2A 2XEXA 1HH4A 1ZNWA 3UANA 3VQTA 3GLIE 1G8YA 4QG7A 4BLSA 3QPWA 2ZE5A 2J3EA 1U0LA 3CPEA 3VR4A 4UNNA 4FMCB 3CRQA 4RD0A 2CBZA 1Z0IA 2Z5FA 4A2QA 5ANRB 2WVJA 2ZJOA 3I1FA 1I4TD 2RMKA 2VA8A 4G5GA 1T5LA 1CJKC 2UZIR 3W3ZB 3SN6A 4XWOA 3VKGA 3EX7C 1RRFA 1MT0A 4G1UC 4HAWA 1J70A 3TKLA 2VF7A 5L3VA 5F9HA 2D4HA 4YONB 4DLZA 1OB2A 3FYHA 1VIAA 1YHNA 4P4SA 5DISB 1X8JA 4OHWA 2VF8A 5AK0A 1N6PA 5AUPB 3OIYA 3C5HA 5FTNA 1VHTA 3B1XA 4QFMA 4LBVA 4RKFA 2KI5A 4L16A 5HTKA 4LSGA 5CYPA 4TL6A 4G5OA 2F6RA 1CR2A 3BK7A 3GLHE 1OIWA 2FEOA 2NZ8A 2WAXA 3WNDA 4RFSB 3KUCA 3RRMA 1S0UA 2YKGA 3PQCA 1E4YA 2WOJA 3F5FA 1RZ3A 1W1WA 3JZAA 3TGPA 2O0JA 2VP2A 2VLIA 2P65A 1ZNXA 3BERA 4PFSA 2GCOB 1W4CA 1WE2A 2GNOA 3TR5A 3WYGA 2RHMA 5DHAA 3TK1A 3PVSA 1N0UA 1WDTA 3GJ7A 5BYKA 1NN3A 4AK9A 1S96A 1IBRA 5HE8A 4ERNA 2WKRA 3BH7A 4URYR 2CHQA 2ASEA 4L15A 3OIVA 4IOKA 2IYUA 2OXCA 2FMXA 3VKHA 3FMOB 1FTSA 3FMIA 5BXQC 2MSDB 3X1XA 1LW7A 3V4RA 1W7AA 2GA8A 2QROA 4LBYA 2ZE7A 3CX7A 1C4OA 5DN6A 2XB4A 2QL6A 3KJEA 4ZI3A 1TQDA 2RGNC 1XJQA 1HT2E 1ESMA 1S2MA 3N2EA 2QT0A 4OK6A 4D82A 2GJ8A 3R9IA 3QENA 2FPKA 4B3CA 3H0KA 3QF4B 2DCUA 1WRBA 4D4JA 1YR6A 1PJRA 2IUSA 3BBPA 3QG5A 5JWOA 1EWRA 1OT3A 5DI3B 1U94A 2JIZA 1BS1A 2HCJB 4CW7A 2WPDA 2LCFA 3QKRB 1Q20A 1QZXA 2ZUCA 1II8A 4Q4AB 4DUGA 2V3CC 2J5XA 1IM2A 4E22A 1D2NA 4ACBA 2MSEB 1NLZA 4EPVA 4LPSA 4Q03A 2BKEA 4Z1MA 2G6BA 4M1TA 1A4RA 1XX6A 2BMDA 3RRYA 1QHYA 4RZXA 2D74A 4PQRA 5D3MA 4A9AA 2DFKB 3NHBA 3CWZA 4JYBA 1JR3E 3S1AA 4AC9A 2CL7X 2NMVA 2IYVA 1GSIA 1ETUA 3QKSB 4HB0A 3TLXA 1G6HA 1OHHD 5L3RA 4BPBA 3AGQA 2ZREA 3DOFA 3SJCA 1PVOA 1VYUA 4LBZA 1G20E 3FE2A 3CR8A 3OIUA 4XVQA 2JLQA 2OM2A 2WV9A 2ZI7A 4CIDA 2JAQA 4DDVA 4U5XA 2ZANA 2EFHB 4O0MA 1EG7A 4YXWA 4KVAA 1U81A 4QHYA 2FGJA 1ZU4A 1NY6A 1YKSA 1O87A 2F1JA 1ZU5A 1XFAA 2OILA 2RGEA 1T9HA 2ZI5A 1G3QA 4TLEA 3WYAA 4B2LA 2OBLA 3RS2A 2QQEA 4B43A 1OB5A 3QXXA 5JHGB 1HE1C 5CM8B 1R4AA 2H5EA 4MYUA 4PC2A 2CLSA 2V54A 4D81A 1W36B 1II0A 2WZQA 2OAQ1 3NBZC 1KIMA 5JJLA 3GLFB 2QY9A 4DCTA 1N6RA 1I2DA 4GZLA 2C04A 2AX4A 3VR5A 4ZCLA 5FUVA 4E03A 4FCWA 1E2EA 1CR0A 1G6OA 1ZW6A 5B58C 1CLUA 5EP3A 2QI9C 2YV5A 2PJRA 1AM4D 2C77A 1CJVC 1U9IA 1VHLA 5EE5B 5B30A 2G83A 1Z0KA 5DN6D 3AM1A 2CL0X 3DDCA 2QTFA 2RGBA 3G5UA 1OSNA 1W36D 3LNCA 2C9OA 3SQWA 3WHKA 1YRAA 2O0HA 4QJ3A 2NPIA 1IONA 3CM0A 3LVRE 1SVLA 4JBYA 4DSOA 4ZKDA 5M04A 1W0JD 4RD4A 5DH9A 4LYFA 2OBMA 1T8UA 2OG2A 5SZKB 3EA5A 2RGNA 1G5PA 1GITA 4CT5A 2WJVA 4B76A 2GCPA 4Q5IA 4GL2A 1NKSA 3IGFA 3IIMA 2FJUA 5BWMA 4JVMA 2PZGA 4D4LA 3V9PA 3PR1A 1TEXA 4HAUA 2VHJA 4NYMQ 3AF0A 4PO1A 2C78A 1XRJA 3W9YA 5JS7A 5DYGA 2WKPA 3ASZA 3D31A 2BCJQ 4GOXA 1EX6A 1YU9A 2JJ1D 3MRSA 3AH8A 4K81B 1SVMA 2V8OA 2ZRBA 2RGXA 1NNEA 2R62A 4HEJA 2ECKA 3LQQA 3I4LA 3QI2A 1PV4A 1W0KD 3IEUA 1G7RA 4LV6A 4S35A 1JR3D 1NN0A 5EUMA 5B2ZA 4BLRA 5KUTA 1G7SA 3C14C 4LC1A 1GL7A 3O8DA 1XXHE 3OE7A 1DARA 2D7DA 2QE7A 1N6NA 3EWAA 3DKVA 3K9HA 4KBFA 1KZ7B 1JAHA 3QKSA 3U3RA 2JA1A 5FOXA 3S1AB 1I4DD 4Q18A 3ZS8A 1Z63A 4RCYA 1HQCA 3E2IA 1KSGA 4EPRA 2V6JA 5JSZB 1OYWA 4F93B 3F3YA 3WP0A 1WBDA 2FPMA 1G8GA 3LH5A 3BH0A 2JEOA 4Q4AA 4IXMA 1G3IA 1CJMA 3GJ5A 3K8YA 3K09C 1JI0A 2J0UA 3WRXC 3EXAA 3VR2A 2DFNA 4MKFA 1ZVQA 1Z8FA 4M1OA 1E4VA 1KGDA 1J8YF 3SQXA 1EGAA 1JXMA 3IPXA 4GOKA 4PSVA 3VX3A 2GJSA 3IIKA 3IQXA 1E9DA 2BEJA 2VSFA 4URVR 2YJTD 1CRQA 2IYXA 4LJ4A 2NO6A 2AD5A 2O8CA 2ZI4A 3VR1A 4DHEA 1XNJA 4Y0AA 2R6AA 3BH6A 3NXSA 2X2EA 3GLIB 2V55B 3KXIA 5EE1A 3RHFA 2P6NA 1TU3A 1W46A 4D25A 4AIIA 1E79D 2ORWA 3B1VA 5C2JB 4UXHA 3CNNA 2HF8A 3BAFA 1KAOA 3KFXA 4TYQA 5IRCD 4IOLA 2QPAA 1TU4A 3M4YA 3FFBA 3R9WA 4KJZA 1E69A 4TMTA 1KO4A 1OYYA 1A5TA 3TVDA 3K70B 1H65A 5F98A 1X1RA 1AN0A 1DAHA 2FSGA 5DNYB 3W5IA 3ND8A 2DYKA 4PHGA 2GF0A 1T3SA 2IL1A 1P5ZB 2OO7A 4V02A 1G7CA 2RH5A 2AFIE 3WMFA 3OZXA 2FNAA 2XXAA 1KDRA 2IS2A 4XOIA 3I5YA 2ATXA 1ODFA 2WM9B 5DI9A 4DLTA 3TSOA 4OQFA 1RFLA 3OIWA 1HT1E 4AD8A 4B3FX 2RGAA 3CUEF 4Y0VA 5FOTA 5KNDA 1VCOA 3B5JA 2GBLC 2QAGC 1UKEA 1RE0A 4NCIA 2P2LA 2AK3A 3HPRA 1N5KA 1OKKD 5F9FA 3G82C 3GLHB 1XZPA 3C16C 3EARA 2J0QA 4O3MA 2GTPA 2HLDD 2IEYA 1BOFA 1C9KA 3SBEA 1KK3A 2W00A 5BW8A 3T1TA 1IHUA 4IVRA 3WP1B 3TUZC 2XTMA 4F7WA 5KDDA 3NHAA 2IYSA 1IN4A 3O8BA 3KTAA 3LLUA 4OHZA 4KFRA 2H17A 2IYZA 1X8KA 3MGCA 2ZI9A 2WOOA 2EW1A 4Q00A 3LXRA 4RVCA 1EESA 1OIXA 5BN4A 1G291 1XEXB 5UKDA 1FL9A 3B82A 4M53A 5C46F 1PLLA 2F9LA 4US1R 1RRGA 3RS5A 5KSYA 2QORA 4MGYR 3K0EA 1GIAA 1OIVA 2JATA 5FBQB 1Z2AA 4LJAA 4LHXA 5JWRA 2VPPA 3NG1A 1DPFA 4OYHA 2WPDD 3SDZA 4PPNA 3CH5A 2EFEB 2QAGA 5BN3A 4D4KA 5JI3E 1HQYE 4LWZA 1QRAA 2BBTA 4Q4LA 1BO6A 4AYTA 3IO5A 3UKDA 4O25A 4FMCF 4LHZA 2NIPA 4K8OA 2CL6X 2F9MA 1GKIA 2ZRJA 3GJ6A 4TYWA 2PH1A 1KDTA 3X1DA 5AJWA 1IY0A 5JSZA 2ZUBA 4NCKA 3P27A 1QVRA 3W3AA 3V4FA 1D2MA 2DB3A 2GCNA 1Z0DA 2QSYA 3A8TA 3CWQA 1P6XA 4KV9A 4URZR 5TXGA 1H8HA 2QP4A 3LBNA 4LJ5A 4BEBA 5CK5A 5ELXA 4D6PA 5JCPA 1P61B 2XNDA 3AVOA 2ATVA 3TSWA 4NBSA 1KSFX 4H9GA 4JVSB 4L4UA 2A30A 2G1JA 3U60B 2VHUA 1TPZA 5JLJA 2HV8A 5L3SB 4D0NA 3AVPA 3F0TA 4EUNA 2JLVA 2O8BB 3MD0A 4PAMA 2LKDA 3T1VA 3A1SA 2Q3FA 8OHMA 4MA4A 3T5DA 2OXRA 3KB2A 4Q4JB 4LYAA 3WNCA 3BC1A 5G53C 4URXR 1A2KC 1XP8A 4D26A 1KJWA 2H57A 2OV2A 3B2EA 1W44A 4PZZA 1AKEA 1KI6B 1E2FA 2QEQA 2NG1A 3MWYW 1LS1A 4NP6A 1UKZA 4OK5A 4QGGA 4M1MA 4V03A 4C30A 1OKKA 1P60A 5JS8A 2ZJZA 2C9YA 3QBVA 4JLNA 2CCGA 2JCSA 1GTVA 4AKEA 2AXNA 1CIPA 2XZPA 3ZS9A 3K9GA 2WKQA 3DMDA 4K46A 3WXMA 3CIOA 3C41J 2EVWX 2P5SA 4OJKA 4X8OA 4EAQA 1NMXA 1TQ2A 1BYIA 2AKAB 4Q48A 2WWYA 1ZIPA 1NKTA 3QKUA 1CRPA 3SZRA 2VHTA 3SYKA 2BMJA 4PO8A 3Q3JB 1G8HA 1FNMA 1NSFA 4M9QA 2BJVA 1N0WA 4KXFB 4MRVA 3QPVA 3TSZA 3KJHA 1VTKA 3GLFE 5JRZA 4P31A 3KZ1E 1OXTA 1L7VC 1R0XA 2HCBA 2VH5R 4DLSA 1Z47A 5FOWA 1VIYA 2NO1A 3ADDA 2QG6A 1VG8A 5JMTA 4HLUA 3K1JA 2W0MA 4PO9A 4LHWA 3C15C 1DAEA 3PUVA 3TAHA 4L9WA 2QMHA 1RKBA 3I8SA 5TDHA 4WBSA 4YMWA 1QBKC 5CJPA 1CTQA 1ONBA 4PZLA 1U8ZA 2D2FA 1P9RA 2BHRA 1J7KA 1YZNA 4MRSA 5JI2E 4JS0A 5LBIA 4LOAA 4CEHA 1U8AA 1OH5A 1TEVA 4MITA 5F2EA 3CPHA 4I81A 4EPWA 3BOSA 2QM8A 4XSGA 4QJ5A 1F2UB 2BM1A 2OE2A 4LI0A 4II7A 1WXQA 5HZHA 4TLBA 3R20A 4YC7A 4QOSA 4R9UC 4BFTA 3Q5EA 1G9XA 2JDID 3QKTA 3KB1A 3OEHA 1KSJA 2VP9A 1JR6A 4D0LB 2Z0MA 4EDHA 3B13B 3TUIC 1IXSB 1FNNA 1SVKA 2QTHA 3FKQA 5K8LA 1N5LA 2CNWA 3SOPA 1E98A 4B3DA 4BZQA 2VEDA 5GJCA 1G4AE 2ZPTX 3W90A 5JRJA 1NI3A 1ZM3A 3FB4A 3L8ZA 1ZNZA 4Q4HB 1OFHA 4HAXA 2FSHA 4LPKA 2ZS7A 5J4LA 2QA5A 3N70A 1XXHB 3VR6A 2EYUA 5FUYA 4LHYA 4KFUA 5E3HA 2R65A 5KNCA 1FPMA 3RABA 1W4BA 4C0LA 1NF3A 3VU9B 4CGZA 1P2SA 2QMEA 1SGWA 5DLQC 3Q9LA 4TYYA 3BD9A 4Q21A 1VYTA 4OI2A 2BIFA 1KY3A 1J2JA 3NH9A 2PCLA 3B1WA 3IKJA 1ZM4A 1O3YA 2V7QD 2ZRLA 2KB0A 4BECA 2XGJA 4Z1MD 1UPTA 1ZP6A 2ZUDA 4NL4H 4RD6A 5FI1B 1E9FA 1U8YA 1X3SA 2B7CA 3N2IA 3P20A 4JBXA 1Y3AA 2QM7A 2EFCB 3LX8A 3ZZTA 4YMVA 4NYIQ 1R6BX 2PEYA 3DZDA 4IDHA 5DGXA 5DO9A 4DUGD 1CR4A 1E1QD 3P4XA 1W5SA 1ANKA 1IOZA 2CCJA 3CRMA 3CX6A 2ZETA 3TVTA 1NY5A 4OL0A 3AVYA 2GVDC 1BIFA 2Y8EA 1M6NA 2ZSFA 1VCIA 2OT3B 2GF9A 4HLUC 2C8VA 4JKYA 2QAJA 5KPDA 2P5TB 3DHWC 1UBCA 2JJ2D 3U7GA 3AEZA 2WWWA 3ZYCA 2QQ0A 3FPAA 4U00A 2R44A 3U5ZB 2ZAMA 1HV8A 1FW6A 4IKEA 4BFSA 4CVNA 2H92A 4A8JB 3K9NA 4PSKA 3SBDA 1E9SA 2ZTSA 3KJGA 5TV2A 4YDSA 4EPXA 1KZGB 1FFHA 1JXOA 1W47A 3K0AA 1GAJA 2MMGA 3MJHA 1Z0FA 3PIRA 3QKRA 1NIPA 5JBQA 3SYNA 4OBEA 5FTMA 3W5JA 3I72A 3CO5A 4FINA 1OXVA 1ZUIA 2OLJA 2XSZA 1XZQA 3D7MA 4OJQA 4A2WA 4LZZA 3LLMA 2BVNA 1XTSA 1NBME 1S9HA 2PLFA 3NH6A 2OUKA 2J59A 2XX3A 1XBTA 1P72A 2ORIA 1UEJA 3CRRA 1M8PA 3KDSE 3HYRA 3E1SA 1KJZA 3UMFA 4M1SA 3ZQJA 4TMKA 2C5LA 1JPJA 1VPLA 4U7DA 2CE7A 5G41A 1AGPA 3PUWA 4M9XA 4Q1CA 3A6PC 3VMFA 5FPYA 4IXNA 4POAA 2WJGA 3BJIC 2IWRA 3LV8A 3M0EA 1JALA 4G3XA 3MWKA 1OH6A 1G1MA 4UJ5A 3W6OA 4MRRA 2W2VA 5J4KA 3AKDA 4XJXA 4P33A 4W5HA 5C18A 3GJ4A 3QOFA 2I1QA 4JLVA 1KAGA 4Q1AA 4E07A 1LF0A 4OI0A 1E0AA 2B6HA 3ND9A 4Q4JA 4EFNA 1F3OA 3FGNA 1I4LD 1A7JA 4L9SA 1QHNA 2GJAA 4FMDF 4R98A 2QP9X 1CR1A 3LRPA 1BYUA 3U3JA 4DLUA 3SEAA 4DEYA 3CR7A 4BLOA 4ZCMA 2R6GA 1IN5A 4LJ8A 4EKDA 2RHDA 1II9A 2ORVA 3O8CA 4URUR 4XVRA 1P73A 3ZLJA 3RS7A 2OBNA 3OESA 2IXGA 2ZR0A 2BMEA 4GT1A 1BH2A 4DLVA 2G0NA 4JJZA 2CK3D 5KSOA 4KFTA 2QMOA 4ACAA 4EPTA 5EQTA 5TY0A 5JEEA 2XZOA 2ZE8A 3D3QA 3GD7A 3PG5A 1UFQA 4GOJA 3IUYA 1JEEA 1G8PA 1KSHA 1XCMA 1YR7A 1ZC4A 1SULA 4JT4A 1E2MA 4WXRA 4WAUA 1S1MA 4Q02A 1KI8A 4QKQA 4ZIRB 3BRWD 4HB2A 4NYJR 2BEKA 4Q7MB 2OCAA 1IN7A 4RD2A 1KK1A 4FWIB 1E1RD 1MH1A 1KTVA 2G88A 4FW9A 3ECCA 4F38A 2V1UA 3PUYA 1U90A 4R71A 3PEWA 4NPHA 3CNLA 2ZS8A 4ZDKA 3TNFA 2F3RA 2NO9A 4PSAA 2REBA 2ODWA 1E2HA 1KY2A 1LFDB 2H1LA 3U44A 1CS4C 3W8NA 1R5NA 2PT7A 3CLVA 1P7CA 1OE0A 2CVFA 2GESA 1E99A 3U6BA 3VAAA 1ZINA 2MMCA 3OFND 2IYQA 4B33A 1GDDA 5GJVC 2N46A 4YDHB 4P4SB 4V0MA 3WMEA 3SC3A 5TB5A 4RZ2A 4QHSA 2QZ4A 5HZKA 4EQ6B 1M34E 2ZRMA 2O52A 1KYIA 4G5QA 2K5UA 4F4CA 1FQJA 1UKYA 4M1WA 1XF9A 4LX0A 3RSOA 3EZ9A 4B48A 4B35A 1DEKA 2DBYA 2VBCA 2AHOA 4AURA 4KVGA 4JSTA 5E7MA 2F1RA 2WBLC 1CXZA 1P2TA 2FV8A 4WXPA 2R8RA 1KMHA 3LDAA 3U6KA 4A36A 1WMSA 2G3YA 1R0ZA 4P4UA 2H16A 4MUBA 3TAUA 1Q1QA 2RCNA 1RW4A 5P21A 4Z8YA 1Z0JA 2XXAB 2JJ2A 2IA5A 3A58B 4KLZA 1W0KA 1AJEA 2FEMA 2AWOA 3GLGB 1ZBDA 4PC7A 4Z51A 1E3MA 2VP5A 2Z6VA 3L0PA 3AF4A 1CP2A 2I3BA 2QBYA 2WIBA 1UKVY 4PC1A 4TMXA 4AKIA 4C3ZA 1QHGA 1G3MA 4WZAE 1P9WA 2ZR9A 1N3BA 4YXWD 1JQLB 1MRSA 4ZO4A 1E2KA 1KKMA 1NVWQ 2J7PD 4MKHA 4M0LA 4QC2A 1Z08A 3FWYA 1R0YA 3CF0A 5J4YA 2CVHA 2VYFA 4HUTA 2HT6A 1EFHA 1UADA 1YRBA 2D7CA 3EC2A 2IK8A 5A0FA 2ZSEA 2B21A 4RD1A 2PMKA 5AUOB 1R7RA 4I1OA 5EJEA 1YZTA 4DLWA 2XTZA 2IC5A 2REOA 2FFBA 3W8RA 4JJKA 4L8GA 1Q3TA 2FDCA 3IHWA 4HZUA 3AVXA 1Q1ZA 4DSTA 4IDOA 1NMYA 1SXJB 3WRYC 3HP1A 3LA6A 1VKJA 2FFHA 2F3TA 4WOPA 2QN6A 4BEJA 3GEEA 3RRZA 4MDFA 3P1JA 3NVAA 1C1YA 3L0OA 3HU2A 2B7BA 3AP2A 4QXAA 1E6CA 3T35A 4DB4A 1T3LA 4NYJQ 4WZBE 3THWA 1NL3A 4LJ9A 1WCV1 1XPRA 1A1VA 3U3OA 1KI9A 1G4UR 2O8FB 2Z43A 1XCPA 4N3NA 5EE3A 1LVGA 3I73A 2GAOA 2KBEA 1F2TA 2H7VA 2PMDA 4LBWA 1Z6YA 4IJMA 2JGNA 1J90A 1SVSA 2HF9A 3RS4A 1Z0AA 3UWKA 1YZUA 2IS4A 2O8FA 4LCBA 2FZ4A 5EE9A 3U61B 3QF7A 3IBGA 4NKRA 1MABA 1NN5A 1D8TA 3MMPA 3SU8A 4YMUA 4CRWB 4PPFA 4FI3C 5K8IA 4C0JA 3EZ6A 2PT5A 1AZSC 4TT3A 3NIBA 4ITRC 4DLRA 4A4DA 2DHRA 2NGRA 2OFWA 4IDNA 4C4PA 1PUJA 2IHBA 4HDCA 3ASYA 1JBKA 1OHHA 3KKNA 2RGGA 4GPTA 5L3SA 3BWDD 2IYWA 1HE8B 3NBXX 2UZ3A 3TQCA 3HU1A 3QPUA 1XWIA 4DRZA 4D4MA 5G3YA 4F4JA 1GUAA 1SXJC 1OXXK 1ZCBA 1CEEA 3VFDA 2O8DB 2Z4SA 3N5CA 1MO4A 4MGIR 4ZDIA 4BFVA 1UAAA 3ONWA 1GZSA 4US2R 2A2ZA 1U9IC 3AGPA 4MYHA 2X19A 5IHPA 1DBSA 4FCVA 1IXRC 4DKXA 4QRHA 4ZCIA 2RGCA 4KODA 5IF9A 1CULC 5AJXA 3AF2A 5BQ5A 1LB1B 1Q12A 1UBGA 1YZQA 5EXTA 4Q7JB 4WA7A 3DO6A 2IF0A 4HLCA 1Q21A 1KK0A 4DBLC 1HTWA 2IUTA 4JLPA 2DWOA 3KQUA 1P2UA 3Q72A 5FL7A 2P3SA 1YQTA 2FOLA 4KI0A 1NSTA 2QBYB 1VCNA 2JLRA 1E96A 4PX9A 2F7SA 2FFQA 1L2TA 3RS0A 5KTYA 1GWNA 1U98A 1Z07A 4H1UA 2CMKA 3CB4A 1KNQA 1FP6A 2G77B 3IBYA 1QG2A 5CDFA 3EPKA 5HCIA 4EPYA 4YMSA 1XPOA 3LWNA 3K53A 1OLOA 4FWTA 4LYHA 5FR1A 3T61A 2GDJA 1ZM7A 3Q5DA 2D2EA 1MOZA 4WVFA 4QBHA 3JVVA 1OF1A 2J46A 3GCGA 3O47A 5IK2D 1E0JA 3NEJA 1S4QA 3PXGA 1H8HD 4IDQA 1UBEA 4Q19A 3BB1A 2NTYC 5CLLA 1RVDA 1K5GA 1KI1A 3PUZA 4V0KA 1YZLA 1PZNA 2WSSA 1QF9A 2PZFA 1FZQA 3RC3A 3THWB 2B92A 1GG2A 3K0FA 3AVUA 3U4QB 2P67A 3AP3A 4OQLA 3RWMB 4M1YA 1G3UA 5FTLA 1OW3B 3KKMA 5EZ6B 5FPHA 5JEDA 3P32A 3RDPA 1UBFA 4Z54A 1W4AA 1F6BA 3CONA 3H1TA 1Z5ZA 2C9CA 2BCGY 5CIQA 4C7OA 3H86A 4TL8A 2FZLA 2QTVB 3QE0A 3K0CA 2CHVA 1DVRA 3KX2A 3K70C 3QSYA 4DT1B 4MDEA 2GVZC 3DVLA 3WBJA 1OH7A 2EWWA 1WA5A 1B0UA 2ZSAA 4MQBA 3Q8XB 2IBMA 3T06B 2AWNA 2ZROA 4DLYA 2CCKA 2ZITA 5E7JA 2QU8A 2ZU0C 3B85A 1HYQA 2QP3A 1CKEA 2AD1A 2WWFA 3PITA 2ZYVX 4JLBA 3DZ8A 4NONA 2ZI3A 1FOEB 5A4JA 1IJEA 1OFTA 1XEFA 2VP6A 2VTKA 1TUIA 3ADBA 4HZIA 1QVAA 3ZD7A 2CHGA 4MRNA 1D9XA 3MG9A 4Q1FA 2Z83A 4GBMA 4Q47A 1X1SA 2AKYA 3KKQA 2YWFA 2DWQA 1US8A 1G5RA 4CEIB 3RVBA 4OHXA 2CLCX 2EFDB 3GMTA 1KO7A 5FPTA 4QL3A 2C99A 3UK6A 1L8QA 4C0HA 3T34A 3PFIA 1G5TA 1CJTC 3KKOA 1SVOA 5IK2A 1YZGA 5EE0A 4QGFA 1J99A 1Q22A 4ZI2A 2Q0HA 1T4GA 1UF9A 2OSBA 1D2EA 4WZ6A 3BB3A 4RD3A 1BKDR 3EPHA 2BBSA 1S3GA 3R7WA 1BMFA 5DYIA 5KOYA 3J81k 1QHXA 1NLYA 3H2YA 3HR7A 1DG3A 4JBWA 4GMDA 3X2SA 3THYB 2ZM5A 4ARZB 3THYA 2KBFA 4XIGS 1ZUNB 1QHHA 4BRWA 2WJJA 4I1SA 2JLZA 1E9CA 3EZFA 2VSXA 5EXSA 4AG6A 4LV8B 3LFUA 4JKIA 2BBOA 1DAFA 3KXKA 2XJ4A 2ONKA 4DDUA 4C2UA 5FBVB 3M6AA 1W2GA 4X8HA 3BXZA 5CM9C 4N1AA 1XEWY 2Q9BA 3GPLA 4JYCA 1XTKA 2VL7A 1DAIA 2C96A 3GLGE 4DCVA 5JJKA 4O2RA 5FBWB 4DEXA 1W5TA 2R6CA 3X1WA 3SJAA 4BZXA 5J5CA 5CB8A 1QDEA 3QJYA 1PLKA 4OK3A 4A15A 1UDWA 4IFEA 2PX3A 4PHHA 1EFUA 1CJUC 1DS6A 1R2QA 2ZYWX 3QQ5A 1KK2A 4KLNA 3T15A 3PJRA 3MUFA 5LD2C 2HUPA 4J0QA 3KUDA 4V0OA 1SXJE 5AWFC 1D9ZA 2NO0A 2YWHA 1M7HA 5L3QB 4JLOA 4MKIA 2O8EA 1B23P 4KYIB 3CX8A 3KXLA 3MLEA 1VMAA 2VIIA 4OI4A 5JWHA 3GLIA 4XSHA 2B8WA 2W2TA 2QSZA 3CPJB 4BFZA 3GJ0A 3THXB 1H8ED 1Q1BA 1G19A 3SHWA 4GNKA 1GNQA 3KQNA 1EFRD 4KU4A 3WYFA 5L3QA 1XD9A 4A0FA 2AN9A 3GEIA 3TIFA 4TZ0A 1N6LA 4IOJA 1E2NA 2FH5B 1GL9B 3LO5A 2JJ8A 4B32A 3A1UA 1AIPA 5CITA 4BLQA 4KITB 1X8LA 2A5DA 3KQKA 1MV5A 2ZS9A 4HLQB 4IHQA 5DIFA 3B1YA 2X2FA 4MRPA 4FXPA 4XTRA 1EK0A 5C4MA 2KSQA 3FHCB 5FPSA 4QM7A 4OHYA 4LUCA 2PBRA 4B3GA 5JJIA 2GHIA 4BUJA 2WWIA 4Q9JA 1F2UA 4BFYA 3AVVA 4IVQA 3LX5A 4QHTA 3QXJA 3TE6A 2W0SA 4W5JA 1E2IA 4PANA 1KDPA 4A0GA 1GVNB 5F3WB 1GL6A 2WJYA 4KAXA 2OAP1 4YLGA 4HAYA 3Q7QA 4ZV4A 3RLFA 4Q1BA 1XXHA 1MO5A 2YOGA 3EZ7A 1KO1A 3CF6R 5FPKA 1E2QA 4UNPA 5LDDC 4CEJB 2YHSA 2L0XA 3A1VA 2VO1A 2E87A 3QUSA 4FIDA 1Z06A 1XMIA 6Q21A 4A92A 1ZRHA 2IYLD 5LD2B 1RJ9B 1KNXA 3DMNA 4PTLA 4DLXA 2P0EA 1D6JA 5EP4A 4B47A 3MWLA 1S8FA 4ESHA 1JJ7A 3RS3A 4LHVA 4KBGA 3B9QA 2RGDA 1DAMA 1R0WA 1ZM2A 3K0FB 1M74A 1VYVA 3QVUA 4HUQB 1J8MF 3CRW1 2GAAA 4TMWA 1WB9A 2HJVA 2DY1A 2DFTA 3SJZA 1G21E 2PCJA 4RCZA 1E2PA 3REGA 2QAGB 1AQYA 2ZVPX 3H84A 4I99A 3I61A 4DVGA 4B6EA 1Q57A 2SHKA 1N6OA 2IT1A 3TW8B 3QY0A 4D80A 5FUWA 5FH9A 2QMUA 1DTSA 2QGZA 1COWD 2WIAA 2YOFA 4PHFA 4ZDWA 4NCNA 2WSSD 3W6NA 3B6EA 3L0SA 5C4GB 2A9KA 4XD7A 2HEIA 4IEIA 1IXZA 3KTAB 4CYMA 1EFRA 3AKEA 4DXAA 5HR5A 5K8UA 2FG5A 3LXXA 4HUQA 3F8TA 2UVQA 1K8RA 3ETLA 3SFVA 2JIZD 3CKLA 5EP2A 2ZRAA 2ZRDA 2ZYTX 1RYHA 4GP7A 2V6IA 3NBFA 1G3RA 1KMQA 1NBMD 4L5BA 1U0HC 1ZAKA 3NEYA 4LJYA 1GRRA 5CIWA 3QXHA 3GLHA 1WBBA 1KI3A 3GFOA 1T8TA 4LDJA 2WHXA 3MWJA 2C98A 3KL4A 3IHLA 4PR0A 4W9MC 1FX0A 2JDIA 1W0JA 3O8RA 2J0SA 3PEUA 4QGHA 1RRPA 2CEAA 2YWGA 4Q1DA 2HLDA 2A3RA 2EQBA 2QGNA 2W58A 4RZUA 1G18A 2CNWD 1F48A 4KCGA 1ESNA 2F1IA 5KO2A 4AI6A 3PEVA 3EA0A 1E9EA 3UG7A 4G5SA 3UG6A 5GJWC 1GKYA 2I4IA 2IF2A 2ERYA 2ZJ5A 2WWHA 5FR2A 2HXYA 2BJWA 2IS1A 2ZYUX 4NZYA 4OQNA 1JECA 4I1VA 3L82B 3UXMA 4JT2A 1G7TA 2V1XA 4PPQA 1AKYA 1KI6A 3MCAA 1F2TB 5FL3A 3ZJYA 2HJGA 3EPJA 3ZVNA 4TTRA 5LB4A 3I62A 2IEZA 4MGKR 5AJYA 1JPNA 1TF7A 3B9PA 4A0RA 4DC9A 4G5RA 3X1YA 5JECA 3OAAD 4C0BA 3LY5A 4JZKA 3FHTA 2A5YB 1FX0B 4CF7A 1T91A 1W48A 1TADA 3T1OA 4QM6A 3T5GA 4TMVA 2ZRGA 5D3QA 3SI7A 2WAYA 5H1YA 4CZ2A 1OJLA 4A6PA 4X8LA 4Q01A 2GRJA 4ABYA 721PA 3EASA 1NVUQ 5CYOA 1VDZA 2DR3A 1JQJC 5JHHB 2ZXUA 3A1TA 1IN8A 1VCMA 4P0TA 1E94E 221PA 2ZRFA 3LQRA 4NU0A 3K0AB 4JL5A 2IXFA 4NYMR 5KU1A 4AKGA 121PA 2X77A 4B2IA 2PJZA 1Q0UA 2YWEA 3U7FB 4PQYA 2C03A 2PEZA 4D2IA 1EX7A 3KQLA 4TTPA 3C4JA 1TX4B 4C9BA 1X6VA 4HB4A 4Q66C 3QVVA 4JLDA 2D3WA 4JLKA 1P9NA 1ZNYA 2FSIA 2O5VA 5IDVA 3GP8A 2ZRIA 1W49A 2CE2X 4X8MA 4XTCS 3T1QA 2WSMA 2Q9CA 1NBMA 2Q6TA 3L0IB 2Q3MA 3BS4A 2AK2A 2WWXA 4GI7A 2WMNB 1W2HA 2AXPA 4ESVA 3VNVA 3K09A 3CRVA 4TL7A 1EXMA 1OH8A 3PV0A 2HT1A 1ELOA 4HI0E 1ZUHA 4WW0A 2YYZA 3B8HA 4UNRA 3CF2A 1SVIA 3GFTA 3C8UA 3MJRA 3OEHD 2ZU6A 4DIEA 1A2BA 4HLDA 4U02A 4TYNA 4KHZA 3VNUA 3NTUA 2P6UA 3L8YA 2O8BA 2G9NA 1FTNA 5LB2A 3GFPA 5J40A 4V0NA 1RIFA 1UM8A 3ICEA 4BWYA 1OFIA 1Z6AA 2WJIA 4OQXA 3EPLA 1XJCA 3GLGA 4RZ3A 3U4QA 4M4SA 2QNRA 4E5UA 3JVUA 4ASUD 3WHLA 1E2JA 3AF1A 2LKCA 3AKCA 3IPYA 3RWOA 3SJBA 3TR0A 2NZJA 5HE9A 3B60A 3BORA 1TQ4A 1XMVA 2ANBA 3EIEA 4A8JC 2VQSA 1V43A 4BE7B 4HYYA 1US8B 2NOAA 2ZI6A 1TL7C 2OLKA 4W7SA 4RSGA 3PUXA 4B75A 3AQ4A 2H8KA 2PL3A 4EFLA 2V7QA 1E0KA 3I92A 621PA 2YINC 2EU8A 3SNHA 4B74A 4V0LA 3AP1A 3HWSA 5EP1A 2ZJBA 2ANCA 2EWVA 4I1UA 4IVPA 3BFKA 4RKEA 4GP6A 4GDFA 3U3KA 2W6JA 2BKUA 5TMPA 4GMXA 4HSEA 2J45A 4AY2A 1OXUA 4Q9IA 2DPXA 4FMBB 4NHOA 3TMKA 4KYUA 2W2XA 2ZRKA 1P4SA 4QNRA 3RRNA 3CZPA 2WICA 3WBKA 4BFWA 5KHOC 4B6FA 2VHQA 4DCSA 2OZEA 1Z6TA 2GBLA 1X86B 4GFDA 4CEJA 5AR1A 2YNMA 3AF3A 4M9SA 5BN5A 2GXUA 1XTJA 1DOAA 4OKSA 1NRJB 1QHSA 5FI0B 1MKYA 2ZAOA 1XTIA 1Z83A 3A1WA 3TBKA 4DB2A 4C7OB 1QHIA 1NP6A 1Q3HA 4URWR 3WY9A 4BLTA 4TQ9A 2BWJA 1TTTA 1T5IA 3W34A 3GEHA 4BGDA 2P6RA 2XNDD 5LPNA 4C0QC 4ASUA 1S3SA 4OHVA 5FBRB 3QBTA 2QPOA 1Z2CA 1YZKA 5E95A 3AVTA 3FDIA 3K0CC 5SZJA 2OEPA 1ZMXA 2KJQA 3I8XA 3LBHA 3AUYA 4RY2A 5GVSA 2MSCB 4QGAA 4EFMA 2GZAA 4G01B 1N6IA 5CB6A 4P4TA 4EQ6A 1N5IA 2H18A 3BFXA 1WP9A 3OHMA 3PCRB 4JLAA 2OFOA 3TRFA 3VU9A 3QIAA 1FQKA 2WMOB 2YC2C 1S1CA 2FWRA 3VTKA 4Q9HA 3ZVLA 4B73A 1Z29A 5E7IA 3EG5A 3AVWA 4Q9KA 4B3BA 1ZD9A 2NQ2C 5DHFA 4TTQA 3TW4A 3BFVA 1OPXA 2F1HA 1XD2B 3UMRA 1KKLA 1ZJ6A 3U2QA 4TWZA 1AQUA 4RFVA 2X1VA 3EAQA 4UJ3A 5FBLB 1KHTA 1HEIA 4XD7D 4C0KA 5J4VA 2ODBA 3DPUA 3FHOA 3P4YA 4TYPA 5GVRA 1SKYB 3X1ZA 1W36C 2CJWB 3VR3A 3TJZA 1XPUA 4AKHA 4FMDB 5DE3A 1G17A 1KI7A 4BZPA 3WNBA 1SZPA 1R8SA 1NIJA 3FKSD 1PUIA 4LC0A 3VX4A 2OCBA 3FVQA 1DELA 1Q1EA 3KKPA 1A82A 1TF2A 4EJSC 4AYXA 1E2DA 2Q21A 2FU5C 1HY3A 5B57C 3IIJA 4KSCA 2DWPA 5FTKA 4ZIRA 2LWIA 2FX3A 2EYQA 1KOFA 1E2LA 1TAGA 2FFAA 3L2OB 4PAQA 3I32A 3OF5A 4EIWA 2GCOA 1VG9B 4NMMA 2AL7A 1YR9A 4I4LA 4KFSA 2PX0A 1JB1A 4IW3B 4LK2A 4DCUA 2BC9A 2BOVA 2G0TA 4ZDJA 5HCNA 3PEYA 1EFTA 1XU4A 3QXSA 4LRWA 4DIDA 3ZH9B 1YJ5A 2V4ZA 3ZVMA 4DT1A 2AR7A 1N25A 4TMZA 1Q44A 1E9BA 3OAAA 3LAWA 2VP0A 4YQFA 4ARZA 2XITA 3LD9A 5HKKA 2F43B 1R10A 1AGRA 1U99A 4N0EA 2ZJYA 2R2AA 1IY2A 3GJXC 4HAVA 4M22A 2O8EB 1P62B 1GNPA 1G64A 1VG0B 2W6ID 4KO8A 5BYJA 1NLFA 3UPUA 1UEIA 2IYTA 2O0KA 4MYTA 4Q7LA 2WTUA 3TH5A 3NBYC 4TZ6A 3I3SR 1P2VA 3NKVA 1R8QA 1E79A 1FMJA 5DSZA 1MABB 1RRCA 1GRQA 1M2OB 5G40A 2GZDA 3UATA 3BB4A 2GZHA 2Q9AA 4DWJA 3P26A 1WQ1R 2J87A 3GJ3A 4UNQA 2VSOA 4PPGA 1CU1A 1BMFD 1H8EA 4HATA 2GK7A 2GILA 3HDTA 421PA 4AG5A 1Z3IX 4LJ6A 2GETA 4CEIA 2J7KA 4FD2A 4LV5B 3QEJA 2BMFA 3DKPA 1E9RA 5AJZA 3DEFA 4UQOA 2CXXA 2HXSA 1I2MA 1AS0A 1LV7A 4NH0A 2QRZA 2E1RA 3UMSA 4BRUA 4DSNA 4F91B 1IN6A 2ODNA 2X8AA 4M8NE 4A1FA 4UXIA 3EIHA 2JLUA 2C95A 2GKSA 2JASA 3OEEA 4TLCA 2VP4A 3A4LA 4ZKEA 2GWHA 3SHFA 4NTZA 4A8JA 1L4YA 2ZRHA 2DFLA 1P3JA 2BM0A 1ZM9A 2FA9A 2R9VA 3IQWA 3OEED 3CNOA 1XCGB 1E1RA 2PZEA 3HU3A 2R6FA 4ILEA 1QHHB 4ON9A 1E0SA 1AK2A 1ZD8A 4JLMA 3FFAA 2HYIC 4P3YA 2BV3A 4IFBA 2CLDX 3EC1A 4HDOB 4PC6A 4KSBA 4DSUA 3AV0B 2BBWA 5KDOA 3HR8A 4D0GA 2OCYC 1NG1A 2O8CB 1LNZA 2J1LA 1KMHB 1QG4A 3R7WB 1KI4A 1SHKA 2REXB 3NC1C 4BFXA 4F4IA 1CF4A 5FOSA 4MKGA 2D06A 4DJTA 3QEOA 3R9XA 2YC4C 2OFXA 4UKDA 1IJFA 1VECA 3VKWA 4EJSB 2W6IA 1LY1A 4NCHA 2IXEA 2J7PA 4R2IA 4G0NA 3OE7D 4BASA 3MSXA 4JLJA 4NDZA 4TSFA 1DO0A 2IYRA 5EXPA 5HKKD 2FSFA 1T6NA 3ZZUA 3NDPA 3C5CA 3UWOA 5GADl 1JJVA 4CDGA 3ICQB 3LW8A 1JEDA 1G16A 1N0VC 4WIAA 3T12A 2N42A 1GNRA 4QBGB 5IT5A 1KDOA 2OESA 2PLRA 3RC8A 1VG1A 3REFA 1GM5A 2GEDA 3ZZ0A 3DL0A 4GSYA 2V9PA 4H1VA 2GEVA 1KJYA 3RAPR 3ZQ6A 2KWIA 3U7EB 1LS6A 3AKYA 4MUAA 5AUQA 4C2TA 3BIFA 3ZVRA 1COWA 1EWQA 4JVNA 4R2HA 5FUXA 1SHZA 3JZMA 5TVKA 3PENA 3TQFA 3FTQA 1YR8A 1GRNA 3RSLA 4B3XA 2ZEJA 1N6KA 2VHCA 3U44B 2J0UB 1CBUA 1AS3A 1Z28A 2FF7A 4M9ZA 3QG1A 5H70A 4QJ4A 3CH4B 4O2LA 1ZIOA 2J0VA 2ZRNA 3I5XA 2GJ9A 1NVXQ 1NVVR 2CDNA 4NYIR 1D5CA 2XNSA 1AA9A 5CDFE 4Z8XA 3R8CA 2AFHE 4ZPXA 5FOUA 2JLWA 2OCPA 3A4MA 3EIQA 3SFZA 5KSZA 2YOHA 3G0HA 4QNMA 2QT1A 1DG1G 2XOKA 4JMPA 3SS8A 1GOTA 3GLFA 1M7GA 4BLPA 3RNLA 4M2LA 2QPTA 1HA3A 1IAQA 2A78A 3RYTC 5CLQA 3FMFA 2ZIAA 3KQHA 2BDTA 1KO5A 2QUZA 5KDLA 4A82A 3B78A 1XD8A 1P75A 4QBFA 4B2PA 3B7GA 4UXJA 1M1YE 2UKDA 2Z4RA 4JIMA 1NJFA 3ZIAA 2O8DA 3FOZA 1Z22A 5KYKA 5H8WA 1AZTA 4CEHB 5JFGA 4Q1EA 2J9RA 3IEVA 4QBIA 1TF5A 4RFSA 5FL7D 1TQ6A 5J47A 1GFIA 1NJGA 2RB4A 1SVWA 1NN1A 1Z6GA 2XSZD 2ZRPA 4NE2A 3SR0A 3THXA 3K0SA 3GJ8A 4IEEA 2ZSBA 4AWXA 2IHYA 5CK4A 4JSYA 1XJ0A 4MH0R 2IWHA 3AUXA 4M1KA 2NPFA 2HDNB 3IDQA 2FPLA 1TMKA 4LJ7A 3VHXA 3SE0A 3E70C 1OFUX 5GJBA 3LVQE 3BE4A 1FMLA 2GJKA 1JAIA 4JL6A
chains in the Genus database with same CATH superfamily
2GEUA 4HMOA 3EXG1 1RACA 4QPJC 3AXTA 2H2DA 3PUKA 2SKCA 1K92A 3OZWA 5ALDA 1KPHA 2GXSA 4LYJA 4OM7A 4TL9A 2AG8A 1N6HA 1MO3A 4JB2A 1C2TA 3C39A 4JL8A 3KD2A 2ZJ8A 1PT6A 3KOWA 1NUQA 4FYPA 5HPYB 1XYYA 5IZCA 3GN2A 1PJCA 3A25A 5B7PA 3R3UA 3FRHA 1W5BA 2C1XA 4BGIA 2QD2A 4YMTA 2EL9A 3SIWA 1YVDA 4ENRA 1CY4A 4O2AA 1FFSA 4GD3Q 4PHTA 3H7AA 1K6EA 1G20B 3HACA 3IMEA 4LZLA 1Z6XA 2A59A 3WLSA 1U9YA 2JFHA 4UARA 1EQUA 1M8FA 2E4WA 1QTNA 1FP7A 4YLYA 2C4WA 3ZW7A 1NMZA 3IESA 3VR0A 1XTRA 1XC7A 4CV3A 1KC1A 1IQPA 3L4BC 4PXAA 1ZK3A 3EAGA 2H4FA 2IZOA 3K20A 3RIXA 1KL7A 2WJ6A 1SKYE 3AL3A 1NTOA 2BFDA 3JZDA 3IR6A 3WL5A 1HSOA 2NSJA 4FJ2A 1NZFA 1TZKA 4LY3A 4XWAA 5E0OA 2Y6VA 1N4DA 2Z57A 2I80A 3I30X 3Q3GE 1Y8CA 4AT1A 4TQAA 2NQ8A 1K5DA 1O1YA 3BWYA 3LBIA 3BXEA 1P29A 2ZQ5A 2M32A 4W5WA 2QL5A 5B3JC 5CB4F 2B8TA 2NN3C 4LY6A 1L8OA 1UKCA 3KHSA 3OCWA 2XW6A 4Y6LA 4J16A 5EXXA 1W5FA 3JV7A 3QF4A 4KXVA 4O4HA 4OFBA 3AHIA 5TARA 3VXKA 2GR9A 1G2QA 3NOOA 3NNNA 4BNFA 1N5JA 3JYQA 1LCIA 2JFVA 3QJ5A 5D6NA 2AN4A 1CQJB 2IW3A 3BCSA 5TPZA 5AD1A 1VSVA 1ONPA 2QLMA 2VRCD 4GLOA 5JATA 1CQJA 1U02A 1WW2A 2PJUA 2GPYA 1DAKA 2HD4A 3KKZA 4OLFA 2ZCUA 2A9VA 5FOVA 1XNGA 1JNYA 5EMJA 3GCZA 3RB8A 5J4HA 2VAMA 4I4TB 3MJEA 3TD9A 4IWXA 3IQZA 3OKFA 2O3QA 1L7MA 5HFNA 3D8BA 1DAGA 4XJTA 4ZMSA 2QTAA 5A2QA 4L8FA 1ZNQO 1Y9JA 2N3ZA 4R7ZA 5KYNA 1A4IA 1T0JB 2ZJ2A 1TCAA 3BGWA 4TLLB 1YI1A 1XNHA 3E5HA 5JDIC 4C05A 1PK7A 5JSYA 4L9RA 3PNYA 3W79A 1FUUA 1WW3A 4BYGA 4LJRA 4OI1A 1E9AA 3I52A 1RLTA 1SUFA 4GZMA 1EDBA 2OCGA 2K2WA 4OQMA 1CUIA 4PFJA 4S1NA 4XDYA 4YT4A 5CEJA 4TLDA 4DDTA 1O9GA 3OPMA 1OA0A 2OOKA 4C3UA 5IEJA 1JWBB 2EIHA 2QENA 1VFNA 2N1BA 3IPLA 5GV7A 1Z4JA 3OZFA 3EYAA 4MP8A 4R31A 2ODEA 5CW2A 1N8KA 3REQA 1L4UA 4P3OA 1G20A 4A2PA 3JQFA 4S2EA 1O6FA 1XWWA 5EZYF 5TMBA 3NC0C 4DA4A 1FP4B 1QIFA 5JNSA 2RH8A 5B36A 3AI2A 2G08A 2XCOA 3C74A 2RAVA 5BP7A 5E4FA 4NMLA 4EG1A 2WWGA 3ANXA 3OOJA 3MINB 4AULA 5MGBA 3WJ2A 3H6KA 1AS2A 5BUQA 1OZGA 3IKVA 1WB5A 3AX6A 5DNWA 4H08A 3ZLUA 4H15A 7MDHA 1PT8A 1UBTS 5L8VA 4C3VA 3JU3A 5EZ5A 3KOXA 5JFOA 2R751 2YIVX 1Y8QB 2OK8A 5K20A 1EUZA 1EP3B 4P7FA 5IWAB 1R88A 5BPHA 3F4BA 1APBA 2XCSB 3BMXA 1S9DA 3KPJA 4E5PA 3ZDZB 2I87A 1GL3A 1LBSA 2PTHA 4ND3A 2WM2A 3MELA 3RCBA 1HEUA 3VSCA 3SYLA 3JYOA 4BFUA 4AMUA 5F7JA 5G3ZA 1K6IA 3WWZA 1WOMA 4PC3A 4YJFA 4IDPA 1KYTA 3ZIAD 2WYVA 1QIMA 3NHZA 4WACA 3OJ0A 2E9SA 4F8JA 3U4IA 4GQAA 4Q9NA 3K9LA 3WMGA 4DMMA 4XWYA 2ZSUA 1XMSA 4X3OA 1URPA 5CGQB 1S2LA 1RYEA 1GZDA 4HAZA 1LTHR 4K28A 3UAWA 3H4TA 3DM9B 3E2MA 1OXSC 3ZD8A 3OM8A 1YC5A 3DOIA 5FWXA 3T6KA 4JQSA 2XMPA 2XMDA 3ORYA 5DI3A 5EJ2A 2PKQP 1CVRA 2ID7A 3ENQA 4MDYA 3AF6A 1QKJA 1GU0A 2Y0PA 4LVNA 4H18A 4DDWA 4LSWA 3ZDEA 3SF8A 1IIRA 3RSFA 1OI4A 1TAQA 3D6TB 3NGMA 4MWCA 3D8UA 2QQFA 1V9SA 1N9GA 4PLCA 4QYIB 3AUUA 4TQUS 4KTTE 4ZQFA 2CXUA 3IILA 1SELA 4TV9A 1D09A 1YZVA 5L9AA 2PWZA 3DLPX 4KGDA 2XZLA 1D2CA 2D5BA 5GIPE 3IPAA 1ZNWA 3KQSA 1O6CA 3GLIE 3MUOA 1G8YA 3D6JA 4QG7A 2I4MA 4Z4HA 3CW8X 4EHJA 4QQFA 4OP3A 3VR4A 1AY0A 2Q49A 2QUJA 1RZRA 3BRSA 3PS9A 2XTJA 1FMCA 1TCBA 4KKVA 1OMOA 1Z0IA 2PVCA 3HCPA 3EC7A 2ZJOA 3ZDXB 3E82A 2C7BA 1I4TD 4FW8A 2SBTA 2VA8A 4G5GA 2UZIR 5HW0A 1EK5A 1HMYA 1P7ZA 4I08A 1TM5E 4CDNA 4CUKA 3J80A 2C7RA 1DNPA 3LPDA 3IV9A 4HAWA 4L4RA 4CCYB 5F9HA 3ND6A 2VCYA 2GD0A 3LOQA 6REQB 1WNTA 2W11A 2J4DA 3FYHA 4B8YA 4P4SA 5EPUA 3NMUF 5DISB 3UHPA 4OHWA 4YCLA 1THTA 2VF8A 5AK0A 2RJOA 5AUPB 2B8EA 1REQA 3C5HA 3RC2A 4QFMA 1Q7TA 4LBVA 4I1RA 2Z2XA 3W2TA 4HTFA 2X1MA 4J2OA 1X42A 1XQ9A 3P52A 2C4VA 4ZOCA 1M76A 4RIFA 4TL6A 4HQNA 3S27A 1Z73A 4G5OA 5F4BA 1CR2A 2EHDA 3BK7A 3CURA 3EULA 1XZLA 4G1BA 4AJEA 4XM1A 4F2GA 4REMA 1DTWA 2VK2A 3ITKA 3V33A 1L5QA 2UZ0A 1Q0HA 2YKGA 4CMBA 1K6XA 1KPIA 5KOIA 2VF4X 1C30B 1JLSA 2W8BA 1Z7EA 3TOSA 3TGPA 4Q93A 1QTRA 3UZUA 1UT8A 2OHGA 4JK3A 4WFJA 5JDCA 2PHZA 3KYDB 2R00C 1KU0A 2AFHB 2QD3A 3LE8A 3P2IA 2HJWA 2B1IA 2RHMA 5I3ZA 3G59A 4KWTA 4NJOA 3TK1A 1M5RA 3I0NA 2B1JA 2HNBA 2QV0A 1QYRA 1EVJA 1N0UA 1WDTA 3LCCA 4TX1A 5AXAA 5HRAA 3OKCA 4AK9A 1ZONA 2XYVA 1S96A 1IBRA 4N7BA 4LVCA 3KEFA 4FPXA 4FFBA 5HE8A 5FADA 3Q8MA 1MFZA 2PVSA 3GPDG 2CHQA 2ASEA 1M1YB 5FLXA 1Y33E 2OXCA 1E3DA 3FSRA 4HVTA 4RZQA 5KJ1A 3FMOB 1EIWA 1FTSA 3FMIA 3AETA 5BXQC 2R4UA 4NBVA 2WT4A 4D97A 3W5DA 4QPNA 1PEYA 2GA8A 1BCRA 2DPLA 2QROA 3AG5A 1C4OA 1H5NA 1LBTA 1RADA 2QTMA 2QL6A 2WA1A 2WZBA 2XB4A 3Q10A 1XZHA 1U0GA 1XT6A 3JPWA 1S2MA 3DCJA 4D82A 2QT0A 4OK6A 2GJ8A 1RI4A 3I2HA 3GYBA 3QENA 5ECGC 4KEAA 1VJ5A 4ARIA 1P1BA 3QF4B 2WU1A 1TT7A 4U9UA 5AM3A 5CFRA 1FFXA 2P7IA 4ND7A 1HDEA 1PJRA 2WUVA 3BBPA 3QG5A 4FDTA 1EWRA 3EH1A 3STXA 1OT3A 2Z1MA 3TEMA 1OJ7A 1EXWA 5IKPA 2BGTA 4PLPA 5AVZA 4J7CA 2OD9A 3NM5A 5GWXA 4M0UA 4GR5A 1BU5A 1S7GA 4ACBA 1NLZA 2TRSB 4P5EA 4FJ1A 4TYWA 2G6BA 1G63A 2DUNA 4Y2QA 3LQFA 1X74A 3RRYA 2H2WA 3GP8A 3JD4A 4K9MA 1M6HA 4AC9A 1JR3E 1NX6A 3S1AA 3GZNB 5KU7A 4NOMA 1CEYA 2OXTA 5FUQA 1ETUA 4W5NA 5B7GA 4CM7A 2HA0A 4P83A 1G6HA 1GPJA 1NUTA 5L3RA 1SUAA 2ZREA 4C4RA 3IEMA 4EEZA 4UHFA 1DUSA 1LH0A 3VKUA 2CNOA 4EGJA 2Q4TA 5K6TA 2A9QA 4X92A 2VYND 1PR5A 3I9V6 5A5FA 3OFKA 4BN0A 4ND2A 1B15A 3MCUA 1ZH6A 4FCCA 4LX8A 4O0MA 4PONA 5CLIA 4KVAA 1WKVA 1D7OA 2FGJA 3VKVA 5IM4A 4LOLA 4KXWA 4BNXA 3CEJA 1NY6A 2F1JA 1ZU5A 1XFAA 2RGEA 1Y1QA 4HAIA 3UYLA 2ZI5A 1KZHA 1N7HA 4TLEA 2I3AA 3DHNA 2B3DA 4B43A 3HYNA 4H27A 2OZVA 3QXXA 4BKMA 5B1YA 3OMLA 1NWHA 5JHGB 2O5EA 4JI0B 2OO5C 3MT7A 1PGJA 3TLBA 1GZHB 3MCTA 1YJBA 4DS3A 4Y2RA 4B85A 1II0A 4ERXA 4MO2A 1YH3A 5IDYA 5JJLA 3F71A 3GLFB 2QY9A 4DCTA 4TOIA 3FF1A 4GZLA 3NBAA 3L8HA 3ZWPA 1SKBA 4ZCLA 2Q28A 4FCWA 3PRYA 1XRLA 5TGZA 3KOOA 5EP3A 4S05A 2QI9C 3LK7A 4GXTA 3S5JA 2VDUE 4B45A 4KR2A 2XWBF 4NV3A 1Q14A 3EJWA 3NDIA 1NX9A 5E4TA 1RWBA 5B30A 5HSGA 3ITEA 4JQYA 5GGYA 1N8NA 3AM1A 2CL0X 3NV9A 3G5UA 2RGBA 1AMUA 3N87A 1W36D 1Q6ZA 3LNCA 4QTYA 5DZSA 3HL0A 3DW3X 3WNZA 3CM0A 1YGYA 1Z18A 3LVRE 4JBYA 5AW0A 4ARVA 4RD4A 3HLYA 4JFAA 4PAWA 2YBDA 1T8UA 1H2RS 2P8JA 3TB4A 4F5DA 1PF7E 1T10A 2Y27A 3D5TA 4Q5IA 4GL2A 1KMNA 3KXPA 4BRSA 3IIMA 2XE4A 4YIHA 3AYXB 1J1UA 2PZGA 2JD1A 3PR1A 1T0PA 4U7PB 1ZLXA 4B4WA 1UBRS 4K86A 4PO1A 5ICEA 1XRJA 2C82A 1WHTA 4J49A 2AYYA 2WKPA 2AEMA 3F5SA 2BCJQ 1TEZA 4EYOA 1UZMA 4D02A 1M1NA 3IMFA 2CL5A 1B14A 3AFMA 3AH8A 4K81B 1SVMA 3G0OA 2F67A 5ALOA 1TO2E 2EGGA 5H3CA 3TD6A 5K0TA 2OVFA 4HEJA 3C5WP 3MJVA 3LQQA 1PV4A 2VPXA 3ZY6A 1DFHA 1G7RA 3GUHA 3LCRA 4GWKA 4JBGA 1LVHA 3G17A 1DQSA 1GPDG 5B2ZA 4RTNA 1E3EA 3DCYA 3TRIA 5KTKA 4RMNA 1MHPA 4PZDA 2XNJA 1XXHE 3OE7A 5E4YA 2VJQA 3A7EA 3FPCA 3H5AA 3DKVA 2EJWA 3E84A 3C7AA 3L4BA 5LA6F 3AI7A 3RVSA 1JAHA 1U1IA 4L6CA 1LSSA 5JBIA 3U3RA 4YCNA 3BEOA 1Y42X 2PD4A 3S1AB 2PKYX 3OMWA 5I9TA 3E2IA 4EPRA 5KREA 1OYWA 4AQDA 3DVSX 1PG5A 3FHLA 4EKIA 1PYDA 4L8YA 4M8LA 4UEKA 4W9NC 3WQQA 4CBVA 2FPMA 5AW4A 3NNDA 3MLBA 4YEDA 4EL5A 3HFJA 4IUDS 3TAHA 2G63A 1MQAA 1N8TA 4OH7A 1NP3A 1WVMA 1ZICA 4YYEA 1J42A 3HADA 4IXMA 2I1WA 2H06A 3ZCXA 1XPJA 2CZGA 4JI1B 1BFUA 5I45A 4U2CA 3TPFA 5LMZA 1ZD5A 4I5EA 3DKIA 1E61A 1WS6A 1O4WA 1Z8FA 1E4VA 5FWYB 2Z56A 1J8YF 3EE6A 1UDRA 1KEPA 4M0PA 4DRXB 1E8NA 5FP0A 4JWKA 1P8AA 5EJ7A 4IS3A 1EGVB 3U49A 2GJSA 3ITNA 4MRMA 2BEJA 4URVR 4XCVA 3Q0IA 2YJTD 4R0MA 1ORIA 1VGRA 2AD5A 2O8CA 1Z74A 3FWHA 2IYNA 2JH3A 4Z3DA 3RT7A 13PKA 2R6AA 4FDVA 2HNKA 3VSDA 1R8XA 2Y93A 3OBIA 3GLIB 3HUDA 2AE1A 2WTBA 4D4HA 1KE2A 2ZTHA 4OKIA 2P6NA 3MA0A 1ZR2A 4AIIA 3L1IA 1G8KA 2CVZA 2ORWA 1CUAA 2QRHA 4ZJZA 3CNNA 2HF8A 4FBGA 5TQ0A 4KR9A 1KAOA 1CUJA 4TYQA 2P2NA 4J0HA 5I51A 1A4UA 2QPAA 3QGMA 4BWGA 1IZYA 3FFBA 1GFWA 3EGXA 4MS4B 2KM1A 3Q2IA 3RG2A 1C0IA 3V42A 1AKUA 1E69A 2JGFA 7ABPA 3K70B 3W7BA 4HGQA 3DLBA 1P1IA 2FSGA 4GKVA 3TRJA 3IVCA 4PHGA 1VHDA 1ENYA 2IL1A 4V02A 2YZKA 5A03A 4GU5A 2RH5A 3VBEA 2AFIE 5KTOA 4EG8A 2PL1A 1KDRA 3HJBA 2D0DA 3HBMA 4XOIA 4AO6A 3QPAA 2HMTA 3WLJA 2BZ0A 1QRRA 3H1BA 5T8KA 4DLTA 3LUJA 4FGKA 3BJZA 2O8NA 3TSOA 3KSRA 3UT5A 5JCOC 1RFLA 5JY6A 3OIWA 1HT1E 3CUEF 4Y0VA 1CJBA 5KNDA 5LNK6 1JFLA 3K5WA 1YV9A 3DFMA 1VCOA 3DF9A 4IMJB 4MR7A 2J3KA 4GMFA 2FWJA 3Q15C 2C2BA 3WAGA 2P2LA 1CE8B 4ZQHA 1IATA 3AEUB 4E46A 5F9FA 3I9NA 3C16C 4HQ6A 4PPYA 1KZYC 2AOTA 3IMGA 4HBZA 1BOFA 1C9KA 1Y34E 1NJ2A 2FQYA 5MFZA 1EVZA 1QIEA 5BW8A 3WP1B 1ESCA 2QXUA 2XTMA 4GL4A 3CJRA 1SA0B 3WRVA 3DP9A 2QTBA 2IYSA 2J6HA 4WN9A 3KTAA 5I9SA 1TUBA 3L8GA 3GR6A 4H7DA 2H17A 3D2BA 3UOAB 3AJ8A 1WM1A 3VC1A 3HJAA 4E5SA 2PXAA 2EW1A 4Q00A 4UCQA 2A92A 2OBYA 3EOBI 1QLWA 1RJDA 1GGKA 2GERA 3DOCA 4UBKA 3U1TA 4AS3A 4F86A 5BN4A 5LZ9A 5C8ZA 1QP7A 4DR1B 1QYDA 5J2TA 1QTIA 4EMBA 5C46F 2Y99A 2JGMA 1PLLA 1Q11A 3IFSA 1J0AA 4AVYA 1OWOA 4I8DA 1EB9A 1XTUA 3IOYA 4PZ0A 1Z2AA 4LJAA 3HE3A 3N74A 4LHXA 1T6ZA 1UXIA 4AG3A 5JWRA 2H7CA 4B31A 3NG1A 1DPFA 1SFRA 3HRKA 4C76A 2HTFA 4IRMA 1P80A 3QUTA 4KZPA 2PMWB 1YR3A 4JX9A 5AI0A 1S2GA 1BE0A 1F9EA 1HQYE 4LWZA 1MGOA 4IZOA 1TXGA 4R8SA 2CD9A 4Q4LA 3UYKA 2YFYA 3SEFA 4GNRA 5ESXA 4ETMA 4FMCF 1EWKA 2ILTA 3BK1A 4IH4A 3E9DA 3HN7A 3I5AA 4H6XA 2O05A 1FLDA 4KXXA 5EIHA 3GJ6A 4QICA 2PH1A 2XQVA 1W94A 1H6AA 2Z2ZA 3C8HA 1ADYA 5JSZA 2QVBA 2FUKA 1L6IA 2PMEA 1MN6A 4PNEA 2FLWA 2ENWA 3OFVA 1G5HA 2GCNA 2QSYA 1ADFA 1H1LB 3U9LA 3II6X 3L9XA 3WLRA 3ZKWA 4AZVA 4CM1A 1J1ZA 1P6XA 1UP7A 2NZXA 5C5DA 1NVMB 5ES4B 3LDGA 1OBCA 3K92A 4PLYA 5I7FA 1X7HA 2VBGA 3WZ2A 5FJIA 1P2GA 4JHLA 3LI2A 4GOOD 4D6PA 1AB6A 1P61B 1DC8A 1PBNA 3AVOA 1J23A 2ATVA 3TSWA 1BN7A 1KSFX 2G1UA 4H9GA 4JVSB 4L4UA 2A30A 2G1JA 3BPSA 3EVGA 1TUGA 4MVYA 3G68A 3EMKA 5JDIA 2VHUA 1TPZA 4F3TA 4DCPA 4MIYA 4TN5A 4BVJA 3H97A 4WA8A 1CUEA 2Q3FA 3D6UA 3E3MA 1E7YA 1EAYA 4G41A 4GVLA 4WJLA 3DBRB 4XYLA 1KVRA 2HA5A 3ISVA 3KQPA 2V7PA 4FXOA 1YB5A 1QKIA 1XP8A 4RIHA 4YMHA 3RIHA 2B82A 1HNXB 2QX6A 5IG2A 1HL3A 2HK7A 1JKFA 4TVSA 3Q1LA 2H57A 5KNBH 4UCXA 1AKEA 1E2FA 2B94A 3MWYW 4NP6A 4OK5A 1A7KA 1DKNA 1NR7A 4F1WA 3DSRA 1A95A 1IZ0A 1P60A 5C3UA 1T0IA 5NULA 5A7FA 4RPCA 3IT0A 4WSOA 5C8YB 1SJ9A 5HM8A 4QYMA 3AC0A 3OX1A 4CKYA 1T36B 2O57A 1LV8A 2XY4A 4MS1A 3S2ZA 2XZPA 4Q4CA 1P1HA 3ZS9A 1BJRE 4LYDA 2WKQA 1QK5A 5LCXA 3WXMA 3E9MA 2HU2A 3ANNA 1FFWA 1Q91A 3ICCA 1USUA 4RSMA 5LQNA 1BYIA 1EA5A 1ZIPA 3QKUA 1FFCA 1WAMA 1N78A 3Q3JB 1X1QA 4FYJA 1RWOA 4QLOA 4JT8A 5LWHA 4XVCA 4COOA 4M9QA 4DMUB 3IUSA 2F8SA 3DEKA 1KERA 1GTL1 4BQOA 1I3LA 5K9ZA 2X6TA 5FI3A 2PLAA 4FE3A 3TSZA 1I5RA 2CHEA 2XUHA 1E7SA 3FPBA 3KJHA 4HVCA 2R87A 5JADA 2JAXA 3O21A 1B93A 5JR3A 3DA8A 1VKHA 3GLFE 1L7VC 1R0XA 1IVYA 1U2GC 2ACWA 3G2QA 4DLSA 3CEHA 4DY4A 2NO1A 3GRCA 1IIBA 4QSHA 3V8NA 1VG8A 1SQ6A 4RHCA 1JDUA 2GRAA 1GAXA 1K9SA 4YAOA 2ZB8A 4LHWA 1DAEA 3PUVA 4LRSB 1I7PA 1C1XA 1I9CA 1ODJA 4OXRA 3HCEA 3PNOA 3RVRA 3I8SA 5TDHA 4JP5A 4YS6A 3EF0A 1QBKC 3PD1A 4UE6A 1CTQA 4ZOLB 2O2EA 3AEQA 2W4IA 3GGSA 2VH2A 2YV4A 2BHRA 1M54A 1YZNA 1ONOA 2QG4A 5JI2E 1GGNA 4OD0A 5AHWA 5DGTA 2IXTA 3K1ZA 1I14A 3NBMA 3OZRA 2IUYA 1TEVA 3OU6A 3WLOA 1IG3A 1M6WA 4WLVA 4EPWA 3A3OA 1SY7A 6AT1A 3QHQA 4XSGA 4LI0A 4RK1A 2PKXA 4MP3A 2FSVC 1GQRA 1T1GA 4FT2A 4JLUA 5ADUS 4QOSA 1MZPA 1FC0A 5SY4A 3PDHA 1XALA 2BZSA 3DP7A 1V47A 3QKTA 2FWMX 3QU7A 1B8NA 1ZUNA 1EJ6A 4IIJB 3I04A 2XAAA 4I5FA 1SVKA 2MOKA 3FKQA 3PFBA 3PGMA 2XGGA 1E98A 4BZQA 4DIBA 5TVGA 2VEDA 2B9EA 1ODIA 2VJCA 1WKCA 3MTDA 4W8GA 5CBPB 4ZOQI 2WNIA 5JRJA 2F4VB 5B5SA 3OIGA 1POWA 3L8ZA 1U7HA 1ZNZA 3N2LA 3OC0A 1QR2A 4EI8A 3D8TA 2PUCA 3O8LA 4WBNB 3S2IA 1FYVA 2JLAA 3M3HA 4G6ZA 3VMMA 3W9UA 4EKGA 3VR6A 4DXHA 5FUYA 4LHYA 3QLJA 3F90A 4KFUA 2MWMA 1K89A 1ZWKA 2R65A 2EDCA 1I3KA 3OUUA 4OQDA 1MB4A 4ND1A 4RF3A 5E3HA 4W5RA 2JGIA 2QMEA 2DH6A 2B30A 3EOAI 1SGWA 5LZ2A 3PYLA 4BLWA 1BX1A 4L78A 3A3NA 1JQEA 1WLYA 1SB9A 1PZGA 3AI3A 3OLQA 3P9IA 2W2LA 2WUWE 2C5GA 1GQOA 4DA8A 2B61A 4Z7JA 2ADFA 4NK5A 2BIFA 1BOOA 4MUFA 4P3KA 2V7VA 3A70A 1A9SA 3IKJA 1O3YA 4BECA 1ZP6A 2ZUDA 2FZVA 5FI1B 5TJ9A 1GYRA 2FUCA 3P20A 1E8MA 2PGJA 4BVBA 1R6BX 4QAJA 3G0IA 5DGXA 1CR4A 3CA8A 3UMYA 1K5PA 4C7VA 3FGOA 2I7CA 1T24A 1U0OC 1FYFA 1JQ5A 2IPAB 3GAFA 4EG3A 3MNFA 4RMJA 1SHTX 2ZSFA 2J85A 3D1VA 1I6WA 2DG2A 3Q40A 4KRXA 4Y6SA 3RF7A 3BXFA 1LI7A 3DD5A 1ZKMA 2QAJA 5KPDA 5C52B 5CR9A 4U39A 4URHA 2M98A 1EDZA 1UBCA 1XQ6A 1XYGA 2VXCA 1UOEA 3SX4A 5BXYA 3U7GA 4JP1A 4N8SA 5EVCA 5I7RA 4QOHA 2J8ZA 1LGYA 2XXBA 2WD7B 4CVNA 4JOCA 1U9CA 4G63A 4OGGA 2ZTSA 5TV2A 1X87A 4YDSA 3DZIA 3IYLW 3K0AA 1V6AA 2IDMA 3IT3A 4TSKA 1I36A 5DP1A 4JUFA 3QKRA 1JP7A 4QDKA 1WUKS 2R1UA 3AEUA 3N75A 4W9RA 5J2UA 3BT7A 3QKIA 3SYNA 3W5JA 2AFIB 2R8OA 4NEHB 1J9EA 1VHJA 2VG8A 3COYA 2ID4A 4FINA 2XMSA 2IUEA 1OXVA 1ZUIA 2KMLA 2O1WA 1XZQA 3D7MA 3TECE 5DB4A 1NVTA 1DO8A 3ESZA 4X64B 1FNBA 3CLUC 4N8EA 4L3WA 4QUGA 3U80A 1I1NA 5BOSA 3LGAA 1UXHA 3AR4A 3LUBA 4KOAA 5IANA 3FWZA 3TDKA 1TU0A 2B1RA 3E1SA 3L4SO 4M1SA 3EEBA 4AJ1A 4KPUB 3CJTA 4CL2A 1YTLA 5BSMA 4BS9A 1YMQA 5BSFA 1QPGA 2QV7A 3LZCA 4L0CA 1X1DA 1YB7A 2DRIA 2G4VA 2FRDA 3JYLA 4M98A 3P9NA 3VR6D 3U0VA 2WJGA 3BJIC 3HP4A 2IWRA 3U26A 4BMVA 1X39A 4R01A 3ZU5A 2V9CA 3MWKA 3CLTD 5JQGA 1X7ZA 3NVKI 2P3OA 3MXTA 3PDUA 4ZVPA 1JNXX 3U81A 1JMYA 1TOAA 3MLAA 4GO1A 4H3SA 1O8CA 4MRRA 1TFRA 1O57A 4JHXA 3SKXA 4XVHA 5E1BA 1NOJA 1USVA 5C18A 4Y2UA 2JAPA 3EB9A 3IURA 2UUOA 1LSOA 2I1QA 4JLVA 2O0LA 4Q1AA 4QVKA 4E07A 1LF0A 4GVXA 4OI0A 4MINA 1E0AA 3ANLA 1WP4A 1SURA 1Y6ZA 1UK7A 4MHSA 2L18A 1SA0A 2NVUA 3FGNA 1I4LD 3S99A 4G36A 4BQFA 1QHNA 4ETNA 4URFA 1CR1A 1ID8A 3BL8A 4DLUA 3C1AA 4BEVA 2R6GA 2WYHA 1QLHA 3JR7A 1T6XA 4URUR 4XVRA 1XJWA 3RS7A 2Q3DA 3ZLJA 4UEWA 3K1YA 4DYHA 2QTVA 5I48A 1YHYA 1JA9A 2YJ3A 1FFYA 1Q7BA 3ZVKA 2HBZA 4D0SA 4JJZA 4R9NA 5DXJA 1OTHA 3GXBA 2H5JA 4EPTA 1BVRA 1V3UA 3N2YA 1KDVA 2XZOA 4NJEA 3UAZA 1GD1O 1XA4A 2TMDA 2JD0A 4JCOA 5EWLA 3P9SA 4HRVA 3F7TA 1YR7A 1JEEA 3R0IA 2QD1A 1SULA 1WQ4A 2R7LA 1RWKA 1TJNA 2P30A 3R3WA 3UW3A 1VJGA 3ONNA 5KTMA 4L8WB 1K3FA 4HB2A 4QA9A 4NYJR 5KYWA 4Q7MB 3GQBB 4AUEA 4RKYA 4WXEA 2HHHB 1MH1A 1Z2PX 5JMWA 4AJ2A 1AUOA 5NLLA 3ECCA 2BFEB 4LRUA 4XA8A 1R8JA 1U90A 2ID9A 1ATIA 4TKVB 4R71A 4EK9A 3C4VA 1JB9A 3GRZA 1GN9A 1KH1A 3PNKA 4OB8A 1CFJA 3TNFA 3UUWA 5KC8A 3PLAE 3HDVA 1MT3A 2NADA 2EERA 3HKBB 3FNBA 4BMXA 4Z4FA 1CS4C 3W8NA 3PPIA 2PT7A 1OE0A 2CVFA 2QF7A 4ETIA 1BEZA 4P86A 3VAAA 2HZBA 2FPIB 3OFND 3EZLA 5JSQA 4MV5A 2B69A 4J0JA 1CUUA 2N46A 2O8VA 3KKLA 3TSAA 1YE5A 4P38A 3CUSA 5CFOA 3SHTA 3SC3A 2QZ4A 3SHOA 1PDOA 3F98A 1TGYA 3I9KA 1S3IA 2PWPA 3V2IA 4MUEA 1NOKA 4RY0A 3UFXB 1UKYA 2E4XA 3HGTA 4Q12A 1MV8A 1CK4A 2UYQA 1VLQA 1NQ5A 4NC9A 1BXZA 3DC7A 2W43A 4ZXFA 2DBYA 2OV8A 3S2FA 4B7AA 1AA6A 3R7SA 2O50A 3IV6A 3LF2A 4DWOA 1PZFA 1ZZGA 3I3OA 3Q2OA 4KVGA 5K8VA 3SVTA 1CXZA 1SKMA 1T2UA 1K7SN 2VPTA 1CWUA 2YH2A 1CEXA 4MARA 4QWMA 3UKOA 1VCHA 4KDFA 3ZGYA 3LDAA 3U6KA 2Q99A 2AZTA 2GFIA 4MUBA 4Y8VA 2RCNA 4E1AA 1J22A 5LYYA 4LTMA 1NPDA 1M83A 1W0KA 4JROA 3BHIA 1ZBDA 2GQ0A 4L75A 3ZY3A 2FN8A 3L0PA 4W7IA 3AF4A 2AOUA 3DKRA 4J0FA 1PYOA 2I3BA 2WIBA 4BO4A 2O3SA 1DEOA 1ZZEA 1PQ4A 4UUPA 3BE6A 1RHUA 3OHPA 2W2KA 4FYKA 4X94A 4E1BA 4JN6B 1Y5LA 1JQLB 2WYIA 1FDUA 1NVWQ 3LT2A 4ZO4A 5CVVA 5LXTA 4M0LA 2HLHA 1O9BA 1RCUA 1Z08A 2BTQA 3R5FA 4M0EA 4HUTA 4UTNA 1UADA 1YRBA 4UOZA 3LRTA 3C1OA 2D1TA 2PMKA 1R7RA 4I1OA 4LNUA 5REQB 2O5CA 1PKXA 3O5AA 4DV7B 1E92A 3B52X 1PJZA 1R3UA 5KOJB 3GMSA 3EIFA 2FDCA 3IHWA 4HZUA 3ROKA 1J0XO 1GARA 1O96B 1LK5A 3E05A 3TTVA 4DSTA 2FFHA 1HDYA 5JU6A 2NUBA 3UF0A 3RRZA 4A8PA 3P1JA 3D3JA 4M7OA 2Q0QA 4MV6A 1NT2A 5CTAA 2BHNA 2PGOA 1JZTA 4HNQA 1EUDB 1T3LA 3QU4A 4KK3A 4NYJQ 4WZBE 1MD9A 1CY8A 1ZGBA 1A1VA 1UBHS 2OYSA 4EH1A 1RJEA 1KI9A 4S1OA 3SYTA 5HGXA 3CUKA 2Z43A 4ZTBA 1QX4A 1LVGA 1UBKS 4JA2A 2KBEA 1JJBA 3HVIA 4KSYA 5IKEA 4CDMA 1MW9X 3F96A 2Q3JA 2Q29A 1DBRA 4YDRA 3SZOA 4ZYLA 2HF9A 2AYXA 3RS4A 1IK4A 1Z0AA 3F5MA 3GJQA 3PSHA 2O8FA 5EE9A 4NKRA 4P8RA 1MABA 1CPYA 1Z5UA 1D8TA 3BWBA 4GPIB 4YMUA 3NWBA 4DC0A 4A6DA 3EZ6A 5JS2A 4PCUA 3ESBA 1L8XA 3HKBA 4DLRA 3NIBA 3H19A 3FDZB 3NKFA 3I9MA 5KQRA 4YMGA 3FYTA 3BGVA 1M0WA 4JIGA 5GONA 3JWHA 2CMFA 4IDNA 2Y1WA 2I34A 1PUJA 3C0KA 3GFVA 3V97A 2IHNA 3WGJA 5JCJA 4JBNA 1NRXA 3UA3A 4BN4A 4K6KA 1OHHA 5YASA 2RGGA 4HG2A 4BJ5A 4O5OA 5L3SA 3ORHA 1IHOA 3EGEA 4ZU1X 3CEAA 4GX2A 4LAFA 2W2NA 3FGZA 3VI3B 4OB6A 4C6HA 1H0HA 1HDXA 2BSAA 1NU8A 2IYFA 1ABFA 4D4MA 4Y6RA 1CUYA 3B3AA 4QUIA 1CEEA 3JW8A 2AN5A 2WYUA 3GJZA 2P9EA 4WXHA 1WHTB 4QT4A 3R3JA 2QRVA 4KQEA 3VTFA 5EQDA 1SCAA 1S7CA 4OQQA 4QUDA 2VSNA 3KT8A 3WRYA 4KIFA 3DT6A 4DZRA 2A2ZA 3P0JA 4EX6A 4KQ2A 4ZYXA 2AQKA 5IABA 3RW9A 1U9IC 3AGPA 1U3UA 2GSDA 1UH5A 1ZIYA 1ISSA 4O4IA 4Q7QA 4WOBA 1OOEA 1IXRC 4DKXA 4QRHA 3ZZ1A 2PPVA 4P82A 5TEVA 1CZLA 1UAGA 3L8DA 5JH7F 1WG8A 4RTOA 1IQ0A 5BQ5A 1Q12A 4ZZ0A 1C3OA 4RK7A 1TA0A 1DC6A 3DO6A 1EFAA 3RLIA 3IPRA 3L7AA 4J9VA 2XUIA 1Q21A 2SECE 3T94A 1JAYA 1IH8A 4RHYA 1J00A 2IUTA 2CFOA 3C3JA 1LPNA 4D74A 2O7NA 1A8PA 4IGKA 4JMLA 2FOLA 4KI0A 1M6EX 1B8VA 1YBFA 1XHLA 1NSTA 2QW0X 5D5PA 3RGWS 2JH8A 3TQTA 4FB4A 1PFKA 2XKJE 4V1CA 4MCJA 1FP2A 1NV8A 2A1UA 5TEWA 3CSDA 1L2TA 5KTYA 1BWQA 2A94A 1GWNA 1BNCA 3FCSB 4H1UA 3JD3A 2VNHA 5IJWA 3T7RA 1FP6A 2G77B 2ECOA 5L7WA 5BSHA 4WN3A 5HCIA 1EGMB 4ZJYA 1FRZA 1EDOA 1W88A 1SCJA 4DA7A 1UMBA 1IC6A 4DL9A 4FWTA 2NO4A 1PEKE 2RHBA 4NWIA 3WQBA 5EY5B 5ICMA 2FG7C 5FR1A 1ZM7A 1RS0A 2P78A 3RBVA 1D07A 4WVFA 1MOZA 3QMMA 5K99A 3MMNA 3JVVA 3DMHA 3PVZA 1DV1A 4MWTA 3R77A 5HRUA 1PWZA 4Q3AA 3X43A 2QQ5A 1NM5C 1QO0A 1B3RA 1KYQA 4UUMA 3RKRA 2O3JA 5LJLA 4YRNA 1I4EB 3TI7A 5BOSB 5G4KB 1K5GA 4I5GA 3PUZA 2E89A 2HJHA 4TV8B 5KJ6A 2WSSA 3DZKA 4ZT2A 4CM8B 5KIAA 5F2NA 1U8CB 3THWB 2B92A 3GLQA 3PK0A 4U6NA 3ZHXA 1YACA 4MKXA 4B82A 2FR8A 1M75A 1JZSA 2P67A 4YRQA 1G3UA 3JQCA 3AUAA 3M3PA 3N8HA 4MVJM 1X38A 5EZ6B 5FCDA 1YRHA 1TKBA 3W2GA 5EIBD 3WIDA 1HNZB 3RVDA 3H1TA 4DNQA 3UENA 1M2EA 5CIQA 5KQMA 2FP4B 3H86A 2WD7A 4IJVA 2FZLA 5A6SB 5CVCA 3DUFA 3RAFC 3KAPA 2FWBA 4AZWA 1I5OA 2JAUA 2P62A 4B4OA 1VRCA 3EMDA 3H9GA 2AVNA 3EDRA 3NTOA 3QSYA 4MDEA 2NUTA 1Z38A 3M49A 4RJ2A 2V74B 1WA5A 4D3ZA 1ZJ4A 1EE2A 2C2YA 1NF2A 2OGUA 1A71A 2HV9A 2IBMA 3IDOA 2H7YA 3IP8A 3JQ7A 3J7TA 4U7FA 3ZXSA 4C22A 4DLYA 3TEJA 4YP9A 3O1HB 2ZU0C 3B85A 5DSTA