2QLBA

Crystal structure of caspase-7 with inhibitor ac-esmd-cho
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
b'TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qlbA00
1KMCA 4QU5A 5IBRA 4JR1A 1ICEA 3R7SA 4JJ7A 5IASA 3SIPA 2XYGA 5IAKA 4I1PA 3R6GA 3V4LA 2J32A 2H51A 3NKFA 5JFTA 4PRYA 5IAGA 4D3XA 5IC4A 1RHRA 4QUGA 4FGUA 2H4YA 3DEKA 4NOMA 1RWXA 5I9BA 4QUAA 3KJFA 4EHHA 4QUIA 1M72A 4ZVTA 1RHMA 3ITNA 3NS7A 4NBNA 3V6LA 3PD0A 3EDQA 4NOKA 1RWWA 2J33A 1RE1A 4IYRA 3H13A 3R5KA 2H48A 2XZDA 2CDRA 3OD5A 1RWKA 5LUAA 2CJXA 2P2CA 4ZVSA 3P4UA 5LUBA 3UO8B 3DEHA 2QL7A 3R7BA 3H11B 2H4WA 3V3KA 4N6GA 1JXQA 4PRZA 2Y1LA 5LU8A 1QDUA 1RWPA 3DEIA 4IEFB 2QLFA 1F9EA 1I4EB 1NW9B 2C2KA 4N7JA 4QTXA 5IAJA 4FDLA 4QUBA 3V4OA 4ZVQA 2QLJA 3IBFA 3S8EA 4DCPA 3KJNA 4I1RA 3UOAB 4NBLA 4N7MA 1I3OA 4QUJA 4NBKA 2J30A 3R5JA 4D3ZA 3DEJA 3H11A 1CP3A 4EHKA 1NMEA 3PD1A 4ZVUA 1NMSA 2C1EA 5H0IA 2CNKA 4JR2A 4EHAA 2DKOA 1IBCA 1SC1A 1SC3A 1CVRA 4N6OA 5K20A 4M9RA 4EHDA 3GJRA 3S70A 3D6MA 2HBRA 3H1PA 3QNWA 2FUNB 2H54A 5IC6A 3IBCA 3V55A 2CNOA 5I9TA 4DCOA 2CNLA 3R6LA 4NOJA 3D6FA 2Y0BA 4QULA 1RHJA 3D6HA 5IANA 4AWBA 4EHFA 5IABA 1PAUA 1K86A 2QL5A 1PYOA 2CNNA 2H5JA 3BIJA 4FEAA 4FXOA 2HBQA 1GFWA 4HVAA 4D3YA 3GJQA 4EHLA 4AWAA 4EJFA 2FQQA 4QUEA 4JQYA 4PS1A 4N5DA 1RHQA 3PCXA 1GQFA 1RWNA 1SHJA 4JJEA 4NOLA 1SC4A 4ZVPA 2XZTA 1RHUA 2FP3A 1RHKA 4LSZA 4N6NA 3R7NA 4JQZA 2NN3C 1I51A 2WDPA 5IBCA 4EHNA 2QL9A 4JB8A 3GJSA 1F1JA 4JJ8A 5IBPA 1RWOA 3EDRA 2XYHA 3SIRA 4QUHA 1K88A 1QX3A 2C2MA 2C2OA 5IAEA 3V6MA 2AR9A 4PS0A 1SHLA 4JR0A 1QTNA 3P45A 4QU8A 4HQ0A 2QLBA 3GJTA 1I4OA 4ZVOA 4DCJA 2XYPA 4ZVRA 2CJYA 3H0EA 4QU0A 2C2ZA 4HQRA 2HBZA 5LU9A 2H5IA 4AW9A 2H65A 4QUDA 3K7EA 5IARA 3NR2A 4QU9A 2K7ZA 4QTYA 2J31A 3RJMA 1NMQA 1RWVA 1BMQA 2HBYA 3E4CA 1RWMA 3KJQA
chains in the Genus database with same CATH superfamily
4D8UA 4JR1A 4Q4CA 4NEGA 1VXRA 1F38A 3MFQA 4LQCA 3U4CA 1T5HX 4FK8A 3WICA 1IDN1 2Q8PA 4L5CA 4AIRA 2H18A 3AU9A 1UJ5A 1V8BA 3MSCA 4GEGA 4ARVA 3QBJA 1U2GA 4YT8A 2WAOA 2GVZC 5FFMA 1PJ2A 3BK7A 4AI6A 3RSCA 2F6RA 1CJUC 2OBNA 2J0QA 2VSQA 1JSCA 3IOMA 3G0DA 3GVHA 1T9DA 3N9IA 3ADBA 1JFTA 4MW4A 1NI3A 1RAIA 4XXHA 1QFJA 3U3JA 5HM8A 3RANA 3W9SA 4C7OA 4K05A 4HFMA 3L7DA 5ALTA 3BAZA 1WLSA 2QNBA 1V8PA 1WU7A 2VH1A 4KO1S 2BVNA 1GGVA 4WBXC 5E2BA 1UBCA 5TMEA 1E1NA 3CR8A 5C5IA 4PFKA 2QTAA 2JCXA 4BJ5A 3M1AA 1ECLA 3QUCA 2WD8A 5AK4A 2LVBA 5FJJA 4YALA 2G1AA 1XO1A 3U39A 4RD4A 3A04A 3UAVA 4JKOA 5CK4A 1JHPA 4ZC8A 4EMBA 1J23A 1GPH1 3D8TA 3AVYA 3JWJA 3COWA 3PNYA 1DB3A 2HO5A 4BWYA 4IRUB 4UQLA 2NQTA 3BEOA 3LPDA 2P41A 1QHFA 2CHUA 2I2FA 4RZHA 1ORVA 5CT4A 2ORWA 1DHTA 5H02A 2PUBA 2AFHE 2CXXA 1HG0A 1ECJA 3EZ2A 4FZRA 4KDFA 2JJ1A 1XKXA 2YRWA 3V4SA 2QUAA 1XTKA 2AT1A 3M9LA 4OQFA 3N74A 3HXKA 1QP8A 1SJ9A 1Z2DA 3H1PA 3O8LA 4I5GA 2A8YA 4WOPA 3A1SA 3E5RA 5ABPA 3PD7A 1KEEA 3KR2A 3R6LA 2PLRA 3QKSA 5EQJB 2BFPA 1P4SA 4YP5A 2Q6TA 3N87A 1GFWA 4IFBA 4XJTA 3G9TA 1L7PA 2XMCA 1GIAA 5IH3A 4FKBA 4YCJA 5E7IA 3HU1A 5LZ4A 2VDJA 2O8DA 3VAZA 1GAEO 4D82A 2OO5C 1VSTA 1FNMA 3DV0A 4XCXA 3V4PB 4L9SA 1IZYA 3JYLA 2GN2A 3OZTA 3HB5X 2GLXA 3FA2A 2GN9A 1WO8A 1QAQA 2QRVA 3WKEA 3B1YA 3DW3X 1NMZA 2OR3A 3VOTA 2IRWA 1J39A 1WXGA 2HZBA 3FFBA 3TQTA 2PCJA 3VC7A 4R1TA 5T41A 1AS0A 4FKZA 4IJMA 1CR0A 1GNQA 2X6QA 4ZV7A 4CF5A 4UUAA 4TLDA 1G7SA 2XWBF 2XRYA 2YZ7A 3ELYA 3GCGA 3HDYA 4KWTA 4XCVA 5F51A 2J3MA 2Z2YA 1EWVA 2Z1NA 3ESXA 3BMCA 2E48A 5CVEA 4J1QA 4F5ZA 1T2FA 3MW8A 2ODQA 1IHUA 2GA8A 4Z3OA 1MB9A 4NMWA 5IUKC 3FTNA 1AHNA 3LGXA 3PUXA 5IARA 3VYTB 5IT0A 1J0EA 1DXYA 3JRNA 4RL4A 1YHYA 1XLUA 3G59A 4ZZ3A 1UOQA 4ALNA 1XL1A 3RT9A 1VHWA 4GM4A 4CLOB 2C2GA 1Q0TA 2IHBA 2QWXA 4AZ3B 2FJ0A 5JJBA 1UMBB 1Z7BA 3X1XA 1NQTA 3DNPA 1CUHA 3OF2A 3HMQA 3FOCA 1DWQA 2PS9A 4PVDA 4YGYA 2C2YA 4CVNA 5BYAA 1Z63A 2PA0A 1Z8DA 2QR2A 2JS7A 4PAGA 4BMXA 3RTDA 3PC8C 2OC9A 1K9SA 5JYDA 2UAGA 1DBPA 2RCNA 3A6ZA 4C2AA 2XAAA 1RRGA 1FP7A 5I9MA 4EX7A 1E6MA 1RI4A 4U6NA 3C6YA 4GAEA 5B5SA 5KSWB 4I08A 3N0RA 1XG5A 3NLLA 3LCRA 4N0EA 4TMZA 3H6HA 4FFOA 2LIPA 3TQOA 2WWXA 1Y5RA 1OW3B 1XLTC 3L7MA 1WD7A 2CYAA 4L9AA 1PT7A 1KFBB 3INNA 1QZTA 3JQ9A 2CCGA 1QYVA 4LOAA 1TYAE 4N3GA 4NCHA 3ZW8A 2ZAGA 4BNMA 5I47A 4TZKA 3MGBA 3CZAA 1U8XX 3H4IA 3MJTA 1UKVY 1NDQA 3QFSA 1XDSA 4W8GA 5E95A 4CMBA 1J0DA 5AP9A 5HG0A 4ZKDA 1GPKA 1ZCFA 4UAGA 3RGWS 4DXHA 5HNKA 1JDBC 2DKFA 2CE7A 3IERA 3R8CA 3EOZA 3TDNA 3BDAA 6NULA 1SUPA 1SU4A 1QP7A 3VKVA 1LZLA 1NXQA 2R7MA 2W43A 3RVLA 5K0SA 3ZVNA 3H7IA 1KH3A 1V47A 1Q84A 1SKAA 2H1FA 2LXNA 1NKTA 4FONA 1HUQA 4PR3A 4BP1A 1ZOLA 4H59A 1Z39A 2OXFA 4HN9A 5T8KC 1A8QA 1KQOA 3HKDA 3UT0A 2IW3A 4EG5A 5IHPA 1TADA 5LL6P 2ZI4A 3MRTA 3QV2A 4DMUB 1RPJA 2A9VA 2Q2WA 2A14A 1CXZA 3A4MA 3ROQA 3T9CA 1SKMA 3U6BA 3HUEA 1OH7A 3G8AA 3OIFA 2AUMA 4Y0VA 2IYLD 1TMYA 1RYEA 2IE0A 4J7XA 2FLKA 2ZYTX 1P1IA 5DK4A 2XOKD 4KVGA 1N8NA 3UB2A 2W6JD 5CBPB 5H8WA 1WB9A 2ORYA 2VSXA 1K8ZB 4OGLA 1CFZA 2QVBA 4AZVA 5JFOA 1G20A 3CISA 3LQ4A 5CA0A 2VF8A 1GYPA 2QD2A 5EWLB 3DZJA 2FPPA 2OECA 4OH7A 1WUJS 3CA8A 4GXRA 3UATA 3HHPA 1S3GA 2B7CA 1IM2A 3OOEA 4X54A 1YRQA 2ONKA 5EWMA 2D2FA 1A27A 3IKLA 2PYIA 2FQWA 2A1UA 3VZPA 5CA1F 1DX4A 1NGSA 5KYXA 2ABWA 2GO7A 4BNFA 4FFWA 1C9KA 4PCUA 3ZCTA 3WYCA 4B7XA 1YTUA 1L4BA 1M6EX 4PPYA 1JA1A 1ZGGA 2B0JA 4X90A 4WECA 5HPYB 1YOBA 2PSEA 4BLPA 2SHKA 2P9JA 2FVYA 2XNDA 3G5AA 4TXNA 3INYA 1NM5A 3DE5X 2I7VA 4A9AA 5HWSA 1KNXA 1FUEA 4Y6SA 3T0IA 2C2MA 3T52A 1U3UA 3VPBA 1Z4JA 1B6TA 4HDRB 4R1NA 1BOFA 3T35A 1FFXA 3O8BA 4LVCA 1AIPA 2F8LA 4CM4B 2OGTA 3IL2A 5GJVC 5AUOB 3DKRA 3ABIA 1M2HA 3EE6A 1FDWA 1SHUX 2ZE8A 3FB4A 5KTKA 5CJ2A 4YJFB 2V9PA 2O3QA 1XVIA 1AK9A 2P3OA 2P67A 1UZAA 2CUKA 4WACA 4LF8B 4HBZA 2AJBA 4RNCA 2ZUTA 4JLBA 1VGQA 5DYYA 3TBHA 4FNMA 4DPKA 3FWPA 2BGTA 5IDWA 3M9XA 4UCWA 2IOFK 2ZG6A 2H1WA 3CZ4A 3A3NA 4CTJA 4DDKA 1YS7A 1AJEA 3R7SA 3RVKA 3CUWA 3EN0A 2HNAA 3E6AA 4V24A 3BCRA 3RIXA 4DW8A 5KNDD 1Q22A 3HR8A 4HH3C 4EY8A 1Y9JA 1SIOA 1M6VB 3FKSA 1C8LA 3FBWA 5JD4A 1XZHA 4CF6A 4DG8A 1U8EA 4XPIA 3LNCA 3GLFE 2JASA 1N32B 2NO9A 2EBWA 3PDIA 4ZVMA 1B3RA 2C5EA 4FYVA 3WZLA 3ZIUA 4DLRA 1A4RA 1KOFA 2Z4SA 3PGVA 3HKCB 2Y76A 4IZOA 3NMUF 2AOUA 2BP7A 5AVSA 1ZJZA 3R5XA 3B85A 4DLWA 1LXCA 5IPFA 3JVDA 4RIFA 2BN4A 4X20A 4DWOA 3GD7A 1ZVJA 4QVGA 3I0NA 1T3LA 1F2TA 1UPTA 3BILA 3M6WA 4YMWA 1KZYC 2W6MA 5GONF 3U3RA 2XGMA 5KEIA 4YRZA 3G0BA 4CG3A 3AVWA 3M6FA 3WBBA 3CNBA 3TNYA 5AVWA 2QTGA 3IXQA 4C4AA 1BHSA 3U4HA 2MYNA 2HMSA 1R9MA 1JJIA 3R1IA 3PYLA 4ITRC 2Q46A 4EFKA 4R2LA 3L02A 2X23A 3IBFA 3ZE0B 2G1PA 3GEMA 4JBYA 1VYUA 3FMIA 1OXVA 1X94A 4JXJA 4QUJA 3UC5A 3ZUGA 3F3YA 1JPUA 3EGIA 4UDXX 5DKFA 3H11A 1G2OA 1J8VA 4BLRA 4C4PA 4F4FA 1FDSA 3PD1A 1F3LA 1IQUA 2GEKA 5DSTA 5EXSA 1V6AA 4C7MA 5E8JA 1TB4A 4HJRA 1MBZA 2FPMA 4M46A 5A6VA 1X7XA 3TXAA 4Q9JA 3F90A 3EZYA 3RAGA 1N5IA 4B0PA 3SS9X 3UKOA 2XGJA 3C41J 2OENG 3MGKA 4HG2A 2HFJA 3U1TA 2OM6A 3C4VA 5K8JB 3U31A 1Q12A 4A8JC 4BEBA 1WOMA 1JR3E 1G38A 1GA1A 4ZT2A 1E9BA 2R85A 2ZCVA 3E22B 3K0FA 3O8QA 3L1IA 3FPAA 4BKRA 3BICA 4W9NC 5EE9A 1XU4A 2P11A 1MX1A 1NSYA 4B3RB 1YCDA 4J1TA 1QQ5A 1P31A 1ECFA 2IF0A 2XZTA 1IFXA 4R7ZA 3ZOZA 1Z15A 4QOJA 2YIMA 2E85A 4LGVA 5JNTA 1T35A 2IZZA 1TVCA 4QGBA 4C29A 1NIPA 1TCAA 2V8BA 1XYYA 4LZOA 4R1MA 1I80A 3PXEA 1R37A 1I3LA 1ZMTA 4J1SA 2IK8A 1GNPA 3A6DA 3GGDA 5DM4A 3DNFA 2FX3A 3G9UA 5JS2A 3LMKA 1AH2A 4I6EA 3OJWA 3LPLA 1OT5A 3GD5A 4GOND 4Z9AA 2B6NA 4ARZB 3QUAA 4P81A 4NU0A 2G5GX 4AZWA 1JFFA 3V8MA 1CHNA 5AM3A 4WA8A 3UXYA 3IUJA 4C22A 4EKDA 4NNOA 2HWWA 4XJVA 2PQ0A 5FLYA 1JG1A 4AZTA 4E94A 1D7AA 1ZSYA 3LYHA 4M7PA 1ZGBA 3COZA 3PQ4A 2A5JA 4WK0B 3SSOA 2C7OA 3OU6A 1K6IA 2AZMA 3OKFA 3I2GA 3P5SA 4WKPA 5ALRA 3WRYC 1H3EA 3DXYA 4IXNA 5I7FA 4GKKB 1SCIA 1E2KA 1XDGA 1Z29A 3CYFA 1B8VA 2D7CA 2G6BA 5BR1A 4BP9A 2KJQA 1W4LA 3EIQA 2PN1A 4TWZA 3UGQA 3RASA 4EJSB 2O6HA 4KFTA 1E0SA 5IRCD 2DM6A 3R3ZA 4X8OA 1QK4A 3K35A 4EB0A 4RKQA 3PFCA 1C7IA 1SOVA 3FF4A 1Z37A 2I78A 3OHPA 3Q8LA 4PNZA 2WJVA 5JSYA 1U63A 4WLUA 1IOZA 5HKKA 1OJ7A 1DU4A 4LXUA 5LDDC 2X41A 3DDHA 1H5NA 3HA3A 3WYBA 5JCZA 1Q0SA 2P8JA 3FMOB 4F21A 4D9KA 3EAGA 1QVAA 3BH6A 5BNIA 4RTLA 2OXCA 4YYEA 1ETHA 2WKRA 4Y2HA 1ZXBA 5CYPA 5DMXA 5TQ2B 1MJFA 1YE5A 4OIFA 3BBLA 1A9RA 3L8FA 3DVQX 3R9KA 4IJ6A 3SU8A 4KV9A 3BHIA 3OOJA 4D8TA 2JJMA 1MB2A 4NQZA 3CXRA 4ATNA 3L7KA 3M4JA 4NKRA 4Y2RA 1E2QA 3NHRA 4RXMA 1CUBA 4QHTA 1PK9A 3OT1B 3P2IA 2WM3A 3A2MA 3BD7A 3TRJA 3COYA 4JJGA 4R1PA 5WRFA 2DKNA 2Q2QA 4U2GA 2AMLA 2QX9A 4A3SA 3KVYA 4LIPD 1GTRA 4LV5B 1SKBA 3J7AC 4RAOA 3GLGA 5EL0A 1Z0SA 5DASA 4EKEA 1X9IA 1X7ZA 2DF8A 2GZHA 3RDPA 4F4UA 4DV5B 2JZNA 1IBRA 3OLCX 1ZIXA 1KHTA 2GKOA 1POWA 3ZDYB 1VMKA 5CA1A 3PC4A 4FHDA 4EBBA 3EW9A 3LLVA 1YXMA 1IWPB 4ICIA 4UPVA 1KMQA 3GJ7A 3IIJA 4KI0A 4WFKA 5AH0A 5FR2A 5B12A 2FN3A 2V5AA 3SPXA 2GYVA 1MIHA 1J2JA 1TRHA 4ZQHA 5EZYF 5CEEA 1BS2A 1QQAA 1GNSA 2CZQA 3BIJA 4FEAA 1DAFA 1HEUA 3AP2A 2XMBA 3KZVA 3RYIA 1WCV1 3QEKA 1AN9A 1N75A 1YB2A 4U2KA 4QLBA 4EJFA 1WF3A 1BKSB 4ILEA 4MNTA 3AHEA 1A7JA 4YDQA 1E1CB 2NUPA 2REQB 2WWHA 4MR7B 3ZZMA 5HUQA 1Z5VA 4MW1A 2F00A 2FP3A 3AR2A 5D3MB 2V97A 4J03A 5DGIA 3V2UA 4ES6A 2JFGA 4N6NA 4C7VA 1B93A 4DLNA 3VC2A 5LQNA 2ACKA 1S5PA 2HTEA 4GNRA 2Y2VA 4PFJA 4JCOA 3EVAA 1JXAA 1ZQ9A 3KSDO 2P2ZA 5JDCC 3AY6A 5FBHA 3IGFA 4EI8A 2WQ7A 5HJ2A 4KG7A 2NGRA 3A9WA 1H9CA 3TFQA 2Y27A 2WIGA 3FBGA 1IY9A 2VJQA 1NWHA 4E11A 1A04A 3KJEA 2QV0A 4NSNA 1PR3A 1HDGO 1Q1BA 2Q5CA 2WSSA 4KO4S 5I9NA 4RSHA 4XZ3A 3UA3A 4I99A 2GARA 4LXTA 1ZXXA 4DIEA 5JZBA 2G80A 2Q9CA 2VJCA 3PPYA 7YASA 3DL0A 3K4PA 1T2EA 3Q6NA 3K0CC 4IUBS 3LWZA 4Y6OA 3NNSA 1GLGA 1RI2A 4H3HB 4B3IA 1X2BA 4Z1MA 4FJ2A 4D5GA 1EZZA 3N58A 2BHNA 3E7XA 1RXEA 5ALWA 4C7OB 4NR0A 5GONA 2AOXA 3K9GA 3MT0A 5A03A 2J5QA 3H05A 4F7DA 5T6MA 3JU3A 3UV6A 3ZQ4A 3T7SA 1X8LA 3V1YA 5FUMA 3QEMA 4ZQCB 4NICA 3IA2A 3PGKA 3TMAA 4KN9S 4O4JF 1D1QA 2YH2A 5FI3A 1BDMA 5C34B 3T5CA 3GDGA 4ZVKA 5DCYA 5K51A 1I6WA 5LVAA 3OJLA 2ZSUA 1PE0A 1W25A 5G41A 3LYLA 1DC4A 2VEOA 5DRYA 1UMKA 3NZEA 1YJAA 5HILA 2SNIE 2YFQA 3CX7A 5JNRA 3HFSA 1GUFA 5E4FA 2CFOA 1TU4A 1K7EB 1P2GA 1U04A 3FHLA 3OA2A 3U1BA 4JI0B 3EHEA 4LF4B 1TM5E 1OKKD 1P1HA 1PSZA 2GM5A 1VIYA 2HGSA 3NOXA 4RSGA 1RZRA 3OM8A 3JD4A 2C7GA 4ZFNA 3AUXA 4K9RA 1CW2B 3M0EA 4IUCS 3V8BA 3U3XA 4OI4A 3N0WA 3UEOA 3R75A 3GJ0A 1V5FA 2ZVDA 4DZRA 3QKSB 3F6EX 3VBEA 2R2AA 3OZDA 4HZUA 2JK1A 2AC4A 4WCFC 1SXHA 1LDGA 4BB5A 3N6XA 3K1ZA 4PSCA 1T9BA 4EHDA 3GMIA 2YYYA 3VPXA 2UXDB 3GJRA 3U56A 3L6OO 1Z75A 2OGUA 5JCOC 2YVKA 5JI3E 5L4SA 2O8DB 3LCVB 3DV0B 1ILWA 4DCOA 4NC9A 5TPZD 4LMRA 2BE7A 4ZQIA 4GX5A 5ALOA 3PGJA 4N8SA 3TPFA 3TBFA 3OAAA 5PNTA 3R76A 1C2TA 2M1XA 3QX7A 1OHHA 1BH2A 2ZB4A 3F97A 5ECDA 3AV0B 4KHZA 4XDHA 4ABTA 2ZZKA 3HABA 2B99A 2ZRBA 3EJWA 4MPRA 5DULA 1FTNA 4ZCRA 5KOHA 3SX2A 3U1VA 1FLNA 2ZBUA 1X86B 2C59A 4WNIA 3K2BA 1SVWA 2FRXA 1L7EA 4M9SA 1GU0A 1U2SA 2BRUA 4FQ5A 4K3UA 4COKA 3BMCB 1CUVA 1G55A 3PNKA 2RI6A 2XYQA 2EKQA 2WDPA 1FNBA 4TSKA 4UTOA 2PYZA 2YWDA 4AUNA 4GHWA 3IDSA 1TC2A 3T41A 2R6ZA 4G5XA 4OATA 5GJCA 3TF5A 3ZGZA 4M2LA 2QLTA 4AKEA 1VCNA 4Z7NB 2DUWA 3W6ZA 2WJZB 4GOJA 5CJPA 3OFKA 1N92A 4Q19A 4JLNA 1MFZA 4W6QA 1DL5A 1I4OA 4R1SA 4W9RA 2YQ5A 1HZZA 3DKVA 3N7UA 5DLQC 2Q5FA 3S2GA 1WSAA 2GUWA 5EIFA 1B2LA 1V37A 4PO1A 3DOUA 2R5FA 3EVCA 3EPHA 3C5WP 4I2NA 4Q9DA 1J21A 3TMYA 4QOEA 1ZD1A 3EA5A 3QTLA 2AN5A 2OSVA 2J07A 5DLYA 4ENUA 4B71A 4YJKA 2CZGA 3DZKA 4KMMA 2PKRA 4WLEA 3WG9A 4CW7A 2IYOA 1M8JA 1SMKA 3X1JA 4K6OA 2Y1EA 4LXHA 1QYRA 1USVA 2GF2A 3CKYA 4HYYA 1SPBS 1T9AA 5HOQA 5IWAB 2QT0A 2O7QA 2ZAOA 1BE8A 1J9ZA 4UM8B 4U1RA 4YHBA 5IBQA 4DPMA 3PYMA 3NOOA 2HSEA 4ER7A 2XRFA 4POAA 4KWCA 4BX8A 3OC6A 1C3JA 1EHCA 1BD4A 3L92A 4WHMA 6AT1A 3ZLBA 1DJMA 3TTVA 4QUIA 4YRIA 1EINA 1AE1A 1TL7C 1W1IA 1ZSNA 2PU7A 4LJYA 4OQQA 4U6QA 3HJAA 2WF7A 4F3YA 1E77A 2GZSA 3K0EA 2PX5A 1VLVA 2C88A 3AR3A 3JZIA 2H1HA 3NWOA 4O25A 4Q4HA 3R3YA 5ALMA 1Z4IA 4GVXA 4F86A 3GMTA 1V8FA 4MI3A 1RM3A 1G18A 1T3GA 3ETGA 3HKDB 4HAUA 4KQEA 1L3CA 3MG9A 5EG5A 1BVUA 2AOWA 4GUDA 1ZZGA 1QDUA 1U8AA 3P9PA 1I2AA 2IP4A 4PPFA 3RFCA 1HTWA 3IEPA 3SOPA 3F49S 4QWMA 2A84A 4Z4IA 4OEHA 1CLUA 3EISA 1ZFNA 2HXGA 1WCIA 4FIDA 4N5NA 5AOBA 4TL9A 4DA4A 3VNUA 2EG9A 2PVSA 5CDFA 3ET5A 5EZYA 1JVBA 1FRZA 1OGIA 1CEYA 3L1KA 3OX2A 3ZD8A 2WPDD 2A0FA 4LF5B 4RZIA 4EHAA 5CA0B 4QBFA 4D9NA 4C0KA 4C6HA 1P74A 3GRFA 1NSFA 2FPPB 4S24A 2BEWA 5CXXA 4WQMA 4BX9A 3H5VA 2A67A 5ICGA 1I4WA 1UQTA 3TVYA 2GTIA 1BEEA 1YB6A 1ZBQA 4JLMA 2BFOA 5EWMB 1A50B 1JSLA 4MUEA 4RM2A 5BSTA 5LQRA 1WXDA 2G3YA 1IHDA 4QAJA 4WERA 2A1UB 5KYXB 4CCAA 3SCZA 1ZD4A 5IVPA 1YZLA 3W4IA 3FI0A 4E5MA 1RJWA 3LD9A 2ARKA 5IT9A 4B6OA 1RYYA 1DT5A 1SUSA 3C3WA 4IDOA 2XVAA 4HVAA 1U3CA 3DEAA 4MQEA 3WLTA 3IUMA 1L5SA 4TWAA 2XODA 1TNDA 2VTBA 3NNDA 3PKIA 1XWWA 3SDBA 1NG9A 4OHKA 3WLEA 2CHVA 1BIFA 1KO1A 1RLJA 1D0SA 1FFXB 2B83A 2I3DA 2XF8A 3K3PA 3KAPA 4KSBA 3THYA 3ZNNA 2B1RA 1QRSA 5D5PA 3SS8A 1HF3A 1E2JA 2A9RA 3BWCA 3HQ4O 2V4UA 1K8QA 2VRBA 3TQQA 1MZPA 3E70C 4DLYA 4UD2A 5F9MA 3D0KA 2H1SA 1MC4A 3BIFA 3BCUA 2GAJA 2HDHA 3KNZA 1U7DA 3NWEA 4TN5A 2VHCA 4A2PA 2BUAA 4MI1A 3V6MA 1Q1GA 2OCXA 4XM1A 3RRNA 3VR4D 1YE3A 1MNAA 5G3YA 3TBKA 4CPDA 1PT9A 3PXUA 3G02A 5JAHA 1R0SA 2B3TA 4TWBA 1GEGA 2DT5A 3I72A 1TQHA 1I7NA 1ORTA 3NU1A 3QG1A 1RQRA 3L6UA 1H69A 2BC9A 2JI4A 4J7AA 4AWXA 4JSRA 2H17A 3JQDA 4J8PA 3KKLA 3LX6A 5DGTA 5KVAA 3PXCX 5TY0A 4XPIB 4N7RA 3AL3A 1K63A 3PDIB 3REOA 1GT91 3D59A 1NW6A 3QWFA 1KSFX 1SXIA 4U7JA 3ZDZB 2CMHA 2CLCX 1UXJA 2CFIA 1XF1A 2AOUB 2BP7B 4O4JA 4CQLB 3HDVA 4EW6A 5HGXA 2P62A 2ZCJA 3E8SA 4RKFA 3UWPA 5KVCA 2H2HA 3E5HA 3M3PA 1XMQB 2H00A 2LGJA 2Q4EA 4DSUA 1KAMA 4IHAA 1BN7A 3EYWA 4X20B 3Q0IA 4YDRA 2J3EA 4QHSA 3BM5A 4EUKA 4M0CA 1F2TB 3R4CA 1J7KA 1ZA2A 4RPGA 1UKAA 1IRXA 2CCKA 2ZP1A 3ED1A 3TLBA 5HOEA 1PRYA 2C4MA 1KS9A 2KW5A 4BP3A 2F9MA 1C2YA 2V96A 3H1BA 3SZMA 2Y0PA 4JLPA 3H9JA 1O97C 2Q7OE 2PYDA 3JPWA 3LUCA 3N39C 2BM1A 1DBRA 4V1CB 2OHOA 3SR0A 4HQKA 5FOQA 2WE8A 3DYBA 1VPLA 2J5KA 5D1NA 3ZY3A 1W19A 4E0BA 1I24A 2Q5JA 4JJ6A 3NATA 3O1IC 1O87A 3KK0A 4X97A 4Y98A 2X15A 3H11B 1GADO 2M2IA 2G82A 1AUPA 4ZOAA 1K2VN 1NVDA 3EQ8A 3M82A 1PEKE 2R6AA 3CUSA 3LLCA 2GS9A 1KSJA 2GEBA 2PLAA 4A5SA 4EG4A 3T1TA 1PS9A 2ZDQA 1MRNA 1X7XB 2A57A 2OBXA 3OPQA 4KEAA 1UDRA 2ZUSA 3M34A 1X42A 2RGCA 3PGMA 1A8HA 4NBLA 4MPJA 2ISCA 1GKIA 2AHRA 1P62B 4IGEA 4ZZ0A 3M33A 3H1AA 2QQGA 2BGWA 3CNHA 4TS9A 4DQUA 2AA3A 1ZUWA 5T64A 4IZHA 4BTEA 1K7YA 1RCTE 4KLRA 3IHTA 3PXAA 3SZGA 4D9CA 4EEZA 1DEKA 1TGYA 3C3AA 1ZJJA 2WJJA 2WYUA 3BF7A 1TD9A 3K0FB 1X0XA 2JEZA 2O07A 3O8QB 2O2CA 2B21A 3ZNOA 2B34A 2MSCB 3RARA 2IH2A 2GESA 3KT8A 5DX1A 4BUJA 4D80A 2OO5A 2H4FA 1ZI6A 3S3TA 2ZIUB 4KQ1A 3U81A 4PSVA 3K9LA 2JCYA 1E2BA 2TSYB 1R6AA 5IXSA 1TECE 2H1RA 4LGCA 2VCHA 1BVYF 3L07A 4JVLA 4ND3A 1C0IA 2PPVA 3I64A 1QQ6A 4Y8VA 3DE0X 3OESA 1R8YA 1USUA 3S2FA 3V4RA 1JEAA 4PBRA 4R16A 3RC2A 1IMOA 1O5TA 4DRYA 3GFTA 3AF3A 1WEHA 3IJRA 1ISRA 4Y2VA 3W5DA 5F33A 2VPIA 2ZWPA 3GN2A 3KBOA 3KOYA 1H3FA 3IR5A 2DU8A 2Z8YM 4L7VA 3TW6A 4C4OA 2NMVA 1JFFB 4MTCA 1SCKA 2I7XA 2C9OA 3RWBA 2Y0DA 4TGLA 3T7KA 1E5LA 1JHZA 3C3EA 2CXHA 3A4NA 4W6ZA 1OF1A 1T6XA 2VDNB 1JJ7A 3IAM6 3NOQA 5KMGA 1T10A 1H0HA 3IIKA 4RU1A 4U8HA 4LKOA 3KQKA 1GGFA 3GEIA 1QP4A 1QZ3A 5JCJA 4OAPA 2O1SA 4YTEA 3OPNA 1I8TA 1XMPA 2EKDA 3FUVA 3I3SR 4XJXA 1TF5A 4K3VA 3VSCA 3WTBA 4TYMA 5BVGA 5MN6A 2HWKA 3LX8A 2PQ2A 4K7JA 1PV4A 3DM9B 3VPCA 5B6PA 2ZZNA 3AMVA 5CX4A 1OFTA 4JJIA 2G07A 3R4VA 4MH0R 4J76A 2J67A 4TVKA 5M7EA 1XTIA 3ETNA 3SQOA 4P2BA 1XDWA 4J2OA 5G2OA 2X86A 3BBPA 4PG8A 5LIPA 2QR3A 5C51B 4QU5A 4I8DA 1MXHA 1L7XA 3V48A 1EM8A 3D2LA 1NBME 1FNDA 1DKOA 2OV8A 4H08A 3ANMA 1K7SN 1RP7A 2E55A 2E7ZA 2JVKA 2W2PA 4KK4A 5AW2A 1SIWA 4RULA 4LC9A 1VPWA 2F8TA 1XLTA 3JY6A 5LBUA 3QIVA 3R3SA 1EJ0A 4OJNA 4P7FA 4A0SA 1DRWA 2FK7A 3ESAA 4RPLA 4EG8A 3W6NA 1F4PA 1K6XA 4WJZA 2QR5A 2JIDA 4UASA 4L74A 4XB6B 3VVMA 2H8GA 4MVJH 4RD3A 1NNSA 3HB9A 4C5BA 3O4HA 3ZPXA 1LW6E 3VSAA 4D26A 2VG8A 4H2DA 1AHIA 4L78A 3EGWA 2FEWB 2E4AA 5KU1A 1XZQA 5T57A 1UK8A 4HXYA 4B47A 1QO9A 1MX5A 3MUNA 4JJKA 3FSJX 2NACA 1U5CA 4RTNA 2WB4A 2F8MA 1P80A 3QVLA 3FWNA 4K9MA 5T8KA 4AYWA 1WHTA 2XOKA 2EQAA 3LHKA 5KOIA 2JC3A 3QU9A 3CZQA 3GLGB 3IP5A 1SFRA 4NPAA 2FJPA 5JWOA 4H3SA 1X7ZB 4G07A 2Q1XA 1Z5WA 3ONDA 1R0WA 4LECA 3F8TA 4BV9A 1UXKA 3GNLA 3CV3A 1HOTA 3MOIA 4H15A 5CA1B 1E3DA 3I8SA 3TL3A 1WLYA 4L5IA 3UZUA 2PMCA 3ITKA 2IODA 4MUNA 4K81B 3ROGA 2ZRMA 1BE0A 1V3QE 2HHHB 1F3OA 1S8AA 3JVUA 3K8YA 1C8VB 1JDPA 1YJ8A 1QJCA 3PBKA 3S28A 3D6MA 4N8EA 1GGJA 3BMNA 3QLUC 1Q91A 1IAVA 2XTMA 3O26A 4GICA 3VFDA 2NUPB 2P6MA 3O9MA 1JNYA 2BZSA 2CXNA 4BNWA 2IZ7A 1SCNE 2I2WA 5K2MA 2DRIA 2QQFA 5F2NA 1DAHA 1KP9A 3E81A 4GQIA 2VJMA 4U9UA 1P3DA 1NBAA 3A9CA 5D5HA 4JLJA 4JGIA 1UBUS 2QJWA 3F0TA 3P9YA 4EFNA 2FQQA 2WM9B 4FP9A 4FPXA 2PUDA 4L73A 2WVGA 2LUOA 1HRDA 3L5KA 2ZLBA 1W5BA 2EFJA 1JNXX 3LO8A 4AX4A 2UYOA 4Z8YA 3OHSX 1NJ2A 3SEQA 4CM8A 1G3RA 5BWNA 1FTQA 3ZWMA 3OCJA 3RC7A 1XQWA 2O3UA 3PQ3A 3E2PA 3BJEA 1CERA 1U1IA 2O2GA 4A8TA 4QBGB 1GNLA 1RWOA 2CN1A 3LG2A 3EX7C 1P1KA 2L18A 1OX5A 4I3FA 5DXFA 5KNDA 1SHLA 4HSGA 4O59O 4CQMD 1P1CA 5DGXA 2QXTA 1NVUQ 3A31A 4RVDA 2H06A 521PA 1M7BA 2D5IA 1F6WA 2ESRA 3C8DA 4TWJA 3N6RA 4XYEA 2XZLA 1HNXB 1K8YB 4Z2YA 2MR5A 3RLIA 2RJNA 5K3CA 3WSWA 5TGDA 5LR6A 1PNTA 4RADA 4WN3A 1MJGM 2R8OA 4WOCA 1PWZA 3UHOA 4FOTA 1DFIA 2IOHA 5AQ1A 1ODCA 3A4TA 4EYGA 1J24A 3IQIX 1CUAA 1C3LA 4X7PA 3ZX5A 1WMDA 2GILA 3QEMB 3RVOA 4PYQA 1ZYUA 4IXDA 2PT9A 1SVOA 1KMHA 4JBIA 3IVCA 2Y99A 1OXXK 1C7EA 3JAWA 4Q01A 3VNQA 2O3RA 1M6WA 2XDWA 3HV2A 3Q7IA 4WI1A 5HEKA 4C30A 1GITA 1O8CA 1WDWB 4AS3A 4RD1A 2EKZA 1PSDA 5ALEA 3EGVA 4RGVA 1DIHA 3V1TC 4C2TA 1Y7LA 3QXGA 1NXSA 4Z0HO 3VC3A 4ZYTA 1WAMA 3HA2A 3N2YA 3E7PA 4KFSA 1L0BA 4EYSA 1WXQA 1SCAA 4WRRA 1E1DA 2GPBA 1Y42X 4QYXA 3JWGA 1NUTA 1W8DA 3E7DA 3KKPA 4E5UA 2BKEA 4ZJUA 3IMKA 5KQMA 3L4KA 2PSHA 1IXSB 2QI9F 2IHYA 4LDPA 3RU2A 1ZVMA 3KTOA 3OIYA 1YMUA 4M1ZA 4H1WA 1RPNA 1W581 2Z04A 5DHFA 3G2LA 2QYSA 4AL4A 4L9RA 5A06A 4YONB 1P17A 4B46A 2WUFA 3FSEA 2I3AA 3FSGD 4QRDA 4Z9YA 4HZUB 1WVGA 5A02A 5HTKA 1L3BA 1Y37A 2X5OA 4IILA 1CUYA 1YZ3A 3OZRA 1QIDA 3BXOA 1M0SA 1HQKA 3EWIA 3GWZA 4P08A 1NJ6A 4RC9A 1Q6YA 4KTTE 4LQ4A 5G0UA 3VNAA 3LKBA 5AOAA 3S8EA 1LK5A 1FSZA 3E3MA 3VOAA 4K9QA 2G83A 4MVCA 2AJ8A 4GE0A 4NCKA 4BGUA 4HNVA 2P9ZA 1W4BA 4KBFA 2PMEA 1HE2A 3EF3A 4PNEA 4YA6A 1RD4A 3CH7A 1O6BA 4RZQA 1OV6A 1A9XA 4JT8A 2E18A 4YMSA 3UK0A 1H94A 5KJ6A 1JWAB 5CJJA 5TB5A 1UPXA 3Q10A 1Z0KA 2EFEB 4UDYX 4WMLA 3TFOA 3VR5H 2B8JA 1I94B 1Y1RA 1II9A 3L3BA 5KOHB 2IQ5A 3LY5A 3IKTA 3I42A 3SZUA 2O4CA 4W9NA 1RIIA 2PUFA 1RBQA 5C0OE 2AOTA 3W8RA 2WJHA 2NU7A 5LZ9A 4BYMA 5FPPA 5IJZA 4D25A 3QVTA 1Q95A 4PHGA 3ZWYA 1SAYA 4MWZA 4TL7A 1KRWA 2YVAA 4TLMB 5LCXA 4DF3A 1CTQA 6GPBA 4FTWA 1AB5A 3CCFA 4GZ5A 4ZCMA 3OU2A 2CT8A 2Q6VA 2XR1A 2AFVA 2G9NA 5KHOC 5GJBA 1AQNA 1H2XA 4RQTA 3D1LA 3UMRA 3EC7A 4CEHA 1DBQA 1W4CA 3DHVA 4QKQA 5YASA 2C7PA 2B2NA 2FDRA 2J9YB 4ECEA 3SLKA 1N5OX 1W76A 2D5LA 2PX2A 3H9UA 1PDVA 3IDFA 5JWHA 3WS7A 4BGIA 4B3CA 4MUFA 2C3YA 2VXOA 1XZJA 3RFUA 3VI3B 3M70A 5TE9A 5DWQA 2H08A 2Q0QA 4Q4DA 4NCJA 1VMEA 5HQJA 3KLPX 5BQOA 3RYTC 2QRJA 3CUYA 2SCUA 1SVKA 2EJTA 4M89A 3B9RA 3A6LA 1MAAA 2R97A 3B38A 3MCAA 2ZKLA 1GL7A 4PCVA 2A4KA 4CGZA 1G5PA 5JI2E 1RVV1 1REQA 5JAZA 2PS3A 3TD9A 1NN0A 2VBFA 4IJVA 4FW8A 3GA7A 2I67A 1XTJA 3QVJA 4K2HA 4LF9B 1FFSA 1DMRA 1HYEA 1ZNYA 2Y1OA 4LK3A 3I2KA 4AP9A 4JAVC 4ML3A 3WGKA 3DSRA 3EUEA 2IL1A 1JEEA 3H2SA 2CCJA 4RQBA 5G40A 3H5TA 4HVLA 2F17A 4A0RA 3V9PA 1V9CA 4HRYA 2ZETA 1UOOA 2AQKA 3NHUA 4JLOA 3WJ7A 4J0DA 5L3RA 4ONEA 1BGVA 4AY5A 4XWWA 5FPTA 1HEIA 2Z5VA 1B00A 4RK4A 1FX1A 1NPYA 2BM0A 2I87A 3BD8A 3P4YA 3ZQJA 4BLUA 4P6VF 1YDMA 1ZRSA 1WCIB 3RSSA 3T9DA 4EL0A 5FUVA 4A0FA 5CG2A 3DLCA 1JL3A 2XXAA 3OU7A 4EGAA 1B76A 3BQMB 3NVMB 1G66A 1R8QA 3G0IA 4LQLA 1D6JA 5EZYB 1JH8A 2JIQA 2H4WA 2PMWB 5F2EA 2ECPA 2FDXA 3HVIA 3Q4GA 2Q62A 4EAAA 4H18A 4YUVA 3RADC 3REQA 3O2JA 3DYVA 3SOZA 1A8SA 5JUWA 2RHBA 4KR0A 1RAAA 2BEWB 2VT6A 1ZM9A 2CVOA 2R62A 3CRMA 3KEOA 3PGLA 3X1WA 3LL4A 1PNQA 3DPUA 5FHRA 3TDMA 1IQRA 4WZZA 3PHLA 3WHKA 1NKSA 1PGJA 3N3BC 2RB5A 4WFIA 5DIZA 3F3MA 4NBRA 5IM4F 1ZHFA 2OGSA 4FQ8A 1KH2A 1AQUA 1OSNA 4XLLA 4UOEA 4OHZA 1R9NA 1GUBA 1C29B 5K6AC 1JV2B 4MQEB 5KNBD 5SV2A 4Y9RA 5LMCA 2VTBB 2O8VA 2QRPA 2Q5OA 4WH0A 5DYIA 3T34A 4M98A 4WL0A 4PN3A 4Z99A 5HK8A 3RAPR 4UM9B 4HR7A 4EYKA 2ZS9A 2P4EA 4QULA 2I99A 3RGGA 5TF4A 2J9GA 4MKHA 4B45A 2IY9A 5E8RA 5BR8B 1LSOA 3Q7PA 3L8MA 1K86A 4QD3A 3RD5A 4YQFA 5JYCA 1CE8A 3FKQA 1F2UA 3QVGA 2C94A 1RPAA 5HRAA 1LBSA 3E7WA 3L6EA 4ND2A 3OO1A 4YWHA 3K1JA 4L5YA 5PGMA 2X2PA 1X80A 2HJRA 2WTBA 3P9KA 4GZ3A 2GVDC 3HLTA 5COBA 5CAEA 5TVKA 2ZBQA 1N77A 4MVYA 4UULA 3C3MA 3IOBA 4X95A 2XVXA 5B7GA 1ZLYA 3ZI4A 3AEZA 1IQ0A 2X7JA 4NTZA 1QHEA 1IJFA 2WR8A 4GD3Q 3RK0A 4PM4A 4D9HA 2HYDA 3FHJA 5I3ZA 1R8JA 3R7LA 2E4WA 2RAPA 3BULA 4D8WA 2FWAA 4EOGA 1F14A 2AR9A 4K1LA 1UBEA 3OQ6A 3UXMA 2WNIA 4RZSA 1FYFA 1CF4A 1FDVA 1CZOA 1Z7YA 3AZQA 3WRXC 4HUTA 1HDCA 3OZUA 3BIOA 2IYNA 1KY3A 4IDNA 5DZSA 2V3CC 4GMKA 2ECQA 3K0CA 3QPCA 1VSVA 1QVRA 3WY9A 1U3GA 1XEFA 1G42A 1FLAA 3RRBA 4BBPA 3SQLA 1WR8A 1ESNA 4FMCF 4M0LA 3LH5A 4OQNA 4UMDA 4A91A 2H2GA 3F73A 3G13A 3PQ8A 3S4YA 1AV7A 1DKRA 4PO8A 1G4UR 1VQ1A 3RR2A 3UHJA 1P7WA 3CRW1 1Z7GA 2DP4E 1NVFA 5F4BA 4TQAA 3IUBA 5EJ5A 4W1RA 1AN0A 1B8PA 4Q1DA 1LPBB 3UW1A 2ZR7A 1R1DA 1FFWA 1OKKA 3HBMA 1DV1A 5FO0A 3E7FA 3ADOA 1OB2A 2OT3B 3RIGA 1OA0A 3MD0A 4DMGA 2DPYA 1U9CA 1MEJA 3PA6A 3DMGA 5LQDA 1MOSA 1RT9A 1RXSA 2FZEA 4FFMA 3VYWA 1GZVA 4F4CA 2JGJA 1QIMA 2Z6VA 3CNNA 4GOOD 2NO5A 4L57A 1IDOA 3PB3A 1IJEA 2IXDA 2MTBA 3REGA 4HMPA 4K88A 3UJ6A 3NDIA 3KXLA 5FTWA 1T3HA 4M36A 5BP7A 721PA 2ACWA 4GX1A 3CF6R 5AXDA 4MWOA 3ZV6A 3VTZA 5TPZA 2HXSA 2QLFA 4DFDA 3GW8A 3D7NA 3FN4A 4J75A 1UK6A 1YIOA 2AC7A 3L41A 1VKZA 3DMDA 3ESQA 4Q34A 4ZEXA 3RVPA 3P2JA 3LBHA 1ITZA 2WFLA 1VLJA 3HJGA 3K2IA 4JIGA 4JSTA 2IBMA 3L4EA 5JCOA 3RO7A 2AX3A 3UMSA 4A8HA 2FPUA 2P4UA 3HKEA 3B6ZA 1EBBA 3PWSA 4CMCA 2OC4A 1P0QA 1XA3A 3AHHA 3FGZA 2WIAA 4YR9A 1EWQA 3GP3A 2WINI 5IDXA 3GGSA 5GIOE 1E94E 2WU3A 4Z9BA 3I9FA 1U2TA 3AESB 3RH0A 3RC1A 2R47A 2QM7A 2GR9A 3E9YA 1L8OA 1CQZA 5E0KB 5CFLA 1U2QA 2X3FA 1O5IA 3R3JA 4AROA 4BKQA 1K6JA 3NTQA 1DOHA 2R4TA 1E1RD 1NN3A 3RVSA 5BQ3A 1SZDA 5GAJA 2HHCA 1R16A 1ZGCA 5A9TA 1P29A 2N75A 4C78A 1GQOA 2WJ6A 3E23A 4INPA 3FZQA 2JH8A 2WVHA 4FYWA 1ZM4A 4Z0NA 3U0VA 2DUUA 1A5ZA 3FYTA 3IPLA 1IM8A 3DDCA 1B3BA 4RMHA 1MTOA 4JKYA 4IIDA 4UXJA 4C3UA 3PJGA 1G9XA 3A6EA 4YACA 4ZQGA 1KK0A 1V25A 2R44A 1UM9A 3P9QA 1C7QA 1XJCA 3KSUA 4EJ6A 2HDWA 4R3WA 4E4TA 4DV4B 4LHEA 3ZLUA 3ODGA 1KKMA 1TT7A 2ECKA 4HQOA 4G1BA 1KQGA 3D8SA 4J0JA 4OBWA 2JA1A 1RYDA 1N6NA 1HT1E 4R31A 4YV2A 1SOUA 5F5LA 1BQEA 3JZFA 4UPEA 2YJ4A 4UNNA 4DA6A 3Q7QA 1P6QA 1X1CA 2PWZA 4DR4B 4ZT5A 1GTZA 3KUXA 4JB2A 2PRIA 2X76A 2OHIA 4FDTA 2X8JA 1EK1A 1H2EA 2WM8A 2AXQA 3F7MA 1UKZA 4UUPA 4XPZA 1EI9A 3GBPA 2WF8A 4JHLA 2V5VA 3GN1A 1Y0BA 2HF7A 2VLBA 4OXQA 1GCIA 4ZICA 3BX1A 5IJWA 4A23A 2Y2UA 5AW8A 4REOA 1VECA 3LDUA 2HDOA 1WZ2A 1WJGA 5IU6A 4QUGA 4P93A 1YS4A 4QJ3A 2LDXA 4MS1B 1A9YA 3B7WA 3N8GA 1NIJA 2UZAA 4NNPA 4U5XA 2QZ4A 3SFVA 4FMBB 2PGXA 2X7HA 4PO9A 1FUKA 1AKTA 3ITNA 4DNFA 1WHTB 1PCXA 4GBGA 5U9CA 1AXGA 2C98A 2FSSA 2B4RO 3P27A 4CIDA 1XCGB 4KVFA 1W36D 2WPDA 4Q1FA 4KO8A 1S3IA 1HY3A 4UNIA 4DJ5X 2CV1A 1V9LA 2A5LA 2J5RA 3RVQA 2P0YA 3WWZA 4V1CI 1U0JA 1NBOA 1YRLA 5IM4A 3DE4X 3P2KA 3C3KA 2HLDD 4ENWA 2UYQA 4FWBA 4W8OA 3NHSA 1U2ZA 1JXQA 2GKSA 2R8PA 5KYNA 3VSDA 4MW2A 5I7RA 4MDEA 3ZU6A 2GPNA 4MAFA 3O74A 4N7JA 4K1XA 3OMLA 4MEAA 2PV7A 2E4UA 4B3XA 3CZRA 1WOYA 1Y3BE 1RXIA 3BMNB 1GL6A 1PQPA 2UZ3A 3U7JA 3DPSA 4NBKA 9ATCA 2B35A 5F1PA 3RPEA 3GLTA 4G2TA 1NHGA 4JYZA 1EZ1A 1MRSA 2WHQA 5THKA 5LNK6 2LCQA 5K09A 2VJMB 1P2UA 3GDWA 4O1IA 2XHZA 4QXQA 3CF4A 1SZCA 4RCZA 2EDAA 3IJPA 3JVVA 5BWMA 2QX6A 4CG2A 8ABPA 5LIRA 1ZVVA 1Y9DA 3NV7A 3K6SA 2FUNB 3EIUA 2CNOA 1BVRA 1E0DA 2OXRA 2X0KA 3AJRA 1VCHA 4GT1A 4QFCA 1OFGA 1OC4A 2W2OA 3BFKA 3O84A 3SNHA 3AJ8A 1W49A 4AMBA 4CM8B 3VR4A 5AW5A 4C7XA 3RFXA 1M1YA 1LY1A 2PJZA 1X70A 3WO1A 2QJTA 3CJRA 4XR9A 2P9BA 5FBZA 2DBZA 2HMYB 4H35A 1DG9A 3NM4A 3N2ZB 3GJZA 5AICA 4Z9XA 2J0UB 3ANYB 3CTPA 1R0ZA 4YEDA 2VNIA 2X7XA 1DO0A 4WCDA 5H4HA 4BTVA 3V1LA 3FMGA 3VXKA 4ZYVA 5DBIA 5ALSA 1CUDA 1LBHA 1S3FA 2FW1A 4RHCA 3TM4A 3SF8B 3TW0A 3U4AA 2VDVE 2W42A 2PWYA 5KX5F 4IM7A 1QORA 4YRGA 5I45A 1TI7A 2R00C 2YYZA 1NQUA 2ZYUX 1KVTA 5B3JC 4N03A 3W34A 2Y4NA 4YI3A 2Q28A 5JS8A 3TGWA 2AMFA 5SZKB 1BAPA 4WBNF 2IZ1A 3KYJB 4OSEA 1QTNA 4PZAA 2VZ9A 2PKEA 2ID8A 3QPAA 4ZQEA 3K32A 5BN4B 1H2ZA 2BMAA 5JTTA 3DJYA 2QZJA 4KE8A 3S2UA 1VYVA 3VJKA 1RMTA 1Y6QA 4BO0A 1UODA 2Q8QA 4Z1OA 1KMHB 4RJLA 3OUZA 4YT4A 4BVJA 1AD2A 1QQ7A 1RI1A 3JAWB 2A9OA 5FKJA 1N36B 1IYZA 3VU1A 2W7TA 4R1OA 3MHPA 3VV2A 4EDFA 2P69A 3BZWA 4AG6A 1RQPA 1E5VA 1LGYA 2X0DA 5H80A 1OI3A 3G2KA 5TSDA 3GLGE 2B7LA 2Y6UA 3OTQA 3CX6A 2IY8A 3LOQA 1N6RA 4LC1A 1R0BA 1XCOA 4X61A 4ZRMA 4NJMB 4FT4A 1TUEA 3AY0A 3KAKA 5DBHX 3TE7A 3ZS8A 2PY6A 2AMYA 2QTHA 3ODPA 3ZJYA 1J4AA 1WMBA 4D4LA 1W7AA 1E99A 1AKWA 1R4AA 1DMSA 3O4FA 5FBKA 1R12A 4ZGBA 1PG5A 5FOTA 3FUWA 1NUPA 3AF2A 4NV0A 2OV2A 3UAXA 2RJ3A 2IPXA 3KXPA 3MFYA 3KKEA 3NALA 1DJQA 4HRAA 1XPJA 4KNVA 4BHTA 5H4GA 2GXAA 4TLLB 2ZWAA 3ISTA 4IVQA 4U4AA 4W9MC 2FMUA 3H6GA 3RC9A 1YU9A 4WADA 4F3NA 2FI1A 4X1KB 1FB5A 2P6PA 3ONWA 2ONZA 3FPBA 1RM5A 4WGGA 3H1FA 1OZGA 3CZ5A 1W5FA 3H04A 3EGXA 1NVEA 1U7TA 3NKVA 4YPOA 5AVUA 2XT9A 5HJ5A 4W5NA 2V6MA 4N0PA 1FFDA 3GAZA 2F1IA 4ARBA 3GRVA 2QRQA 3V4ZA 2HO4A 1TZJA 1A9XB 1SVLA 3PTZA 5EPOA 5I4BA 1UZLA 3ZD6A 5G0SA 4LJ4A 1YCHA 3S5UA 2C3MA 3RT7A 3FD8A 2HX1A 2P2SA 2YL2A 2QU8A 3ICOA 2X58A 2XGOA 4KITB 5LLDA 1ZBDA 4HGOA 3OTWA 1UUFA 2G25A 1BFUA 2EU8A 1GSIA 1Q1EA 2WJWA 2AOTB 4NDNE 2Q4RA 3AP3A 6ABPA 5ER9A 1NXPA 2FLWA 4TKVA 3IYLW 1OGYA 1QDLB 3WK4A 2NU7B 2DUMA 3L6DA 3K6RA 2VXCA 4LNUA 2AEMA 4G09A 2BGGA 5FFFA 4GDFA 4UFOA 1EAMA 2WPNA 3FPKA 3W9YA 3LUJA 1JEJA 5E6RA 3VISA 5BNFA 3ZV7A 2KB0A 3M4NA 3VR3D 3E9EA 4CT5A 4MUYA 1VJ0A 1K2WA 5H9WA 4LVOA 4LNAA 4G5RA 4ND5A 1QH1A 3ADDA 3DMTA 3CFYA 2PTHA 4RZ2A 1KDTA 4CEHB 2HK7A 1VIAA 1LTHR 3HNRA 2G4LA 1BW9A 1FXUA 1XDBA 1XDZA 4FUQA 4OYRA 1YS6A 2Y66A 3JWHA 4ZO7A 4C7JA 5BSGA 2D5AA 3JYQA 1I7SB 3OWHA 4X6YA 1J99A 2NU6A 2VK8A 4BFLA 1CJBA 2B1GA 1FS4A 3WL4A 2FEXA 3EZXA 4CKYA 4QECA 1SOMA 1T2DA 4FXPA 3MJCA 4QGGA 3FFWA 2SCUB 4WN9B 1NOIA 4DE5A 4BNTA 3AVTA 4O0LA 2A94A 4G0MA 2I8LA 1N7HA 2J3QA 1AKEA 3TR5A 1TE2A 1FJGB 2FFJA 4QEZA 1QIJA 1TO6A 3GLVA 3U2QA 1VG1A 1REQB 1A77A 1FP4A 3BE8A 2I6QA 1YO6A 3IBYA 3ROPA 3M83A 2WC1A 2FVXA 4HZIA 3T5MA 1UH5A 4QYTA 1IM5A 1S96A 3D2BA 1N2JA 3I12A 2IF2A 4IF4A 4JT2A 3C5CA 4PX3A 4QE3A 2Z57A 4RVOA 2Q5EA 5JS7A 1LB1B 3T4EA 2W37A 2XOEA 5EGSA 5LB4A 2P6OA 4IFEA 2HM7A 4QU9A 1DBVO 4MWDA 4WOJA 3N6VA 2WT4A 4ZK2A 1FMCA 1GFZA 3W3AH 1CF2O 1KO4A 1KK3A 1YL5A 4H3VA 3PA8A 2P6UA 4JX9A 4ACAA 2L82A 2PO7A 4G5GA 4GI7A 1HOXA 4B2IA 1V95A 3VUEA 5K03A 3ABZA 3MK31 4DN6A 5LQAA 1P0PA 3QPUA 4DDTA 1N4DA 1GYQA 3EXHA 3LVBA 2X3UA 2MYPA 4PZPA 2CLLB 2BFEA 1L5GB 1QDEA 2AFIA 2XXAB 3LQ1A 3R5HA 1TM4E 3SEAA 2HD4A 3O38A 4QUAA 1ECPA 2YJ6A 3F4KA 1W87A 1QRTA 2WJ3A 1PR5A 3M6VA 4IQ4A 1XMOB 2GHIA 2UUBB 5EYPA 1LS1A 3KKZA 3REQB 2C2XA 1XQ6A 5KAPA 2AMVA 1QZZA 3U48A 1DRVA 3DZGA 1Q6ZA 5BSWA 3BFVA 1PF7E 1ZOIA 3ZQUA 2ES4A 5TS2A 4CKXA 3MTAA 3TAXA 3HXOA 1FFEA 4I1UA 5LUAA 3SHFA 4BBAA 1TEVA 2FW6A 4FUTA 1XN4A 4E5DA 5LMZA 1WB4A 3PU6A 4R8KA 2PD3A 1N6IA 3DCJA 1A8UA 1RQ2A 5IAJA 5L7TA 3BREA 1SZPA 1BU8A 4C0BA 1M75A 1UJ2A 2QLMA 3OQIA 3K1YA 2X4GA 4IQ0A 1R3DA 2FPOA 1E0KA 6YASA 5JQGF 1QIIA 1HO3A 1TTQB 2AVNA 3JQGA 2YV3A 3L06A 3O8CA 3BIWA 4B80A 1E7YA 2J41A 1NMSA 1T26A 4TL8A 1ZJ4A 5EMJA 2NYRA 1D0VA 1NJ1A 3NIWA 2KI5A 1QKKA 4OY3A 4Q3AA 4R98A 4JQSA 1CE8B 3UCEA 3T38A 1F2UB 2GNAA 3QVGB 1YMQA 2ZU6A 3UYLA 2M32A 3AHFA 1JA0A 3AHDA 2WNHA 1U8YA 3PT9A 4RH1A 2B8TA 4UHFA 4YCAA 1E79D 5CMLA 1Y9AA 3OEYA 4MRSA 3K2QA 3T1HB 2GM4A 1P9NA 3M5CA 4WY8A 4H1HA 1QR6A 5H1YA 3I52A 3PE4A 4B6JA 2AZ4A 1DDOA 4HGQA 2Q41A 3AFGA 3ROTA 4P83A 5KX5A 1SVUA 1NNUA 1TXGA 1C50A 3KQPA 3I9MA 1WVMA 4CQMA 4DV7B 3O31A 1VC2A 4G5SA 1SH7A 3GJ6A 3LOPA 2ERXA 3N28A 4IV8A 3W5SA 4FB5A 3K9FC 4WBNA 2REXB 3FYDA 2QORA 1K1EA 2MJLA 3JD1A 3SYLA 3RFVA 1GQFA 2MOKA 2PXXA 2YS6A 4NBSA 5HS6A 4E08A 1LDYA 5JHGB 3QE9Y 1Y7TA 1P2FA 4CU5A 3OPYA 1KJQA 4FSXA 1BVHA 1E69A 3GRUA 4UDOA 2W5UA 1AY0A 5TMBA 3C7KA 2WU0A 3NAZA 1Z6PA 1KFEB 3OBBA 1L7AA 2PX0A 1ESEA 1J8YF 2XNSA 4ZHQF 3L4BC 4MRPA 3JQAD 4A36A 1TK9A 2GD0A 1DINA 2A78A 2OPBA 4H31A 2JLVA 3MYRA 5AK0A 3BWDD 2CJYA 3WK9A 3NDRA 1MX9A 3A28A 4N41A 4JYMA 1TJ3A 3TKLA 2MSWA 4AKHA 5IJ0A 1TEZA 1PL6A 2GXSA 3HYLA 1VDZA 3ZGXA 2GBFA 2BKXA 1XAGA 3PE6A 3TPCA 3FCXA 3E27A 4MGHA 3OMWA 4EGCB 1M3SA 3KD2A 4BQIA 2HOQA 3KOOA 1CJKC 1DAMA 2Z2IA 1ICEA 1O08A 2KLHA 3EG5A 3FGOA 4FT2A 4AJLA 2C3PA 5HJ7A 3OX1A 4MKGA 4XJSA 2PGAA 3EZNA 5CH5A 3FSGA 4KXWA 1BSVA 3OCZA 4LE2A 5AVKA 7AT1A 4V2UA 2AEFA 1C14A 4PIMA 1LNSA 4ZZ1A 3IUEA 3WKDA 9GPBA 2O8NA 2HKIA 2YY6A 5D84A 5AQEA 5DBOA 5ALXA 1ZAYA 2D06A 3WHPA 1EVYA 2P5TB 2W6CX 3CLRC 2NQ8A 3NS7A 1II0A 3L0CA 4OGWA 1PTKA 2VDMB 3EIWA 2QRHA 4YV0A 4PC1A 4YFVA 2FEKA 5JIBA 2V7QD 1P1RA 2W22A 1IULA 2ZI5A 4WCFB 3WXBA 4PC7A 3BMXA 3EUAA 3PUYA 4OQPA 3CURA 4B81A 1EFDN 5A2QA 3E48A 1B41A 1IAQA 1MNQA 1O4WA 1WW8A 4HGYA 1KEWA 2WFLB 3CLRD 3TFWA 3WL7A 5HXAA 3FUCA 2IS2A 3ZBPA 1BKDR 4MR9A 3GMDA 1L1FA 3TVDA 3RTBA 1SELA 1WSWA 4AMZA 1UIRA 1F5NA 2X0IA 3OMXA 2Z09A 2CJWA 1B42A 1DUVG 1TM2A 4S3MA 4O63O 5TQJA 1U99A 1B7GO 2RAUA 3ORRA 3U3DA 5IZCC 1OH5A 4L4RA 3M5PA 1MA0A 4TMWA 3DL7A 2NTEA 1C9MA 2M9MA 1T1IA 2NZ2A 2BGUA 2VF5X 5JTUA 3FYSA 4FC7A 4R5MA 1Q11A 4OFBA 3GEBA 1N8SA 4HLDA 3HB0A 1VLLA 2ZRLA 4MS3A 1S2NA 4K0KB 2OWDA 1N0IA 1V71A 2Y9PB 4LMAA 2HZ7A 4RKEA 3RVJA 4WNAA 1ISGA 4OP1A 4HEA1 2OHJA 2HIHA 1RYNA 2J6BA 2Y1FA 1JALA 2FQ1A 3GIWA 5E9WA 5IDVA 4C0HA 3GU3A 3KAQA 4V0QA 3AOGA 4FS3A 2ZFUA 4W4TA 1BJTA 2EGHA 1VLMA 2GT1A 1X8JA 3LC7O 5KVSA 2BH2A 1UM9B 4MUGA 4UHHA 2IX9A 4JSYA 4OFWA 3TSOA 4X8HA 3N8DA 2B6HA 4MARA 3H75A 3RUAA 3E8XA 3MAAC 2JIOA 2PX8A 4JBLA 2GYWA 4IL5A 4YQEA 1JQKA 1LJ8A 3QVKA 5LD2C 4REMA 2CMKA 5ALIA 1ZW6A 1HURA 2BZ1A 3LWBA 5FTJA 4C0WA 2NTNA 4P7KA 5K2OA 4OGKA 4TUYF 1PFVA 3HCRA 1G9TA 3PKJA 4X7MA 4DCVA 2XADA 4HAYA 3SBOA 2C2OA 3P94A 2XT0A 4WN9A 3E05A 5EZ5A 7MDHA 2HCRA 2AZXA 3QMVA 4U5QA 3B51X 3S8YA 5F3RA 2X8JB 3PP8A 4G0XA 4M9UA 1ZVQA 3L0BA 3KSMA 1QKIA 5TDHA 5A5FA 1K06A 1EFLA 2P5SA 1UBLS 3GRYA 1WM1A 4D92A 1I1OA 2YICA 4GMFA 4I50F 1PQYA 1CPYA 3U3KA 4CRWB 5C80A 5KTSA 1NVTA 3QEOA 4MUXA 5KDDA 3V33A 1JI3A 1QF7A 2IT1A 3L01A 4HV4A 1S2LA 2BFCA 4RJKA 1FQJA 3AL2A 4YMLA 2XA9A 3E9MA 1P7CA 2HWXA 2OAP1 4M3NA 5AWFC 1MT3A 2WWFA 2QZPA 3ZHZA 5ALVA 1LRLA 3ZK9A 4B34A 2PE5A 3HU2A 3GNQA 2RKOA 1FP1D 1JG3A 3HB1A 4TYNA 3B6EA 2IH4A 1YZQA 4RFSA 3BKXA 1JEDA 1CZKA 1CZHA 3E58A 4RM3A 3RK4A 2BSAA 3QKUA 1EVQA 2Y6VA 4BOYA 4RTOA 1TRKA 4DTIA 2RHMA 4XWTA 5IC4A 4C05A 1T8SA 3IILA 3KBBA 4ZWNA 2X1MA 5HIJA 1RNLA 3W8EA 4EUNA 4EHHA 3UW3A 2H5LA 3KVRA 3CLHA 1U0OC 1JW9B 4KX3A 4L16A 5DV9A 2UZIR 4WK6A 3KLNA 5HRUA 2QXYA 3A11A 1Z5UA 4L3WA 3A58B 3EZ7A 3HY3A 1P39A 4KYUA 4NQRA 4D6PA 3GELA 2I9KA 1VSBA 3DMPA 4KAJA 3UWMA 5JQGA 3NM5A 2Q2NA 2QMZA 3PIDA 5KNBA 4P3OA 3DEHA 2QL7A 4G89A 4QJBA 4ZTZB 4GOKA 2AIRA 1GQRA 2W00A 4B73A 4GQAA 2G1UA 2IBSA 4D57A 5AVTA 2ICAA 1KQFA 1T6ZA 4PYLA 2F59A 3A9UA 3HRIA 2R5WA 2HA3A 2Z8ZA 4X64B 4MRAA 5K6AA 2B30A 3BPSA 4OMDA 1ZSVA 3K6SB 2ZBFA 4DJFC 5IWCA 1MB0A 3FF1A 1XTSA 3E9ZA 1YQUA 2QRMA 4ZZIA 5CFRA 3RF7A 1XZFA 5LM3A 4NEHB 3DO6A 2CVFA 5DHQA 1UK7A 4ALJA 4H1UA 1M1YB 3H5LA 4LXYA 1JKFA 8GPBA 3ENVA 3R6WA 1YHZA 3UA4A 4DJDC 4D0SA 1CUSA 1DEXA 2ZW9A 2D1FA 1LX6A 2ID7A 2NV2B 4BNVA 2V7WA 2VJDA 2XUOA 1OYYA 2PDAA 4EGFA 1FF9A 2JRLA 2NYVA 2NPFA 1U8ZA 1YJXA 1G1AA 1PFYA 1K08A 3D3JA 3WKBA 1NW5A 2XCOA 2ZJ0A 1GSAA 1D09A 1U6IA 4CMHA 2TMYA 4F1KA 3KZNA 3DFUA 4C20A 2XIQA 3USZA 1BZYA 4RDCA 3T99A 4A92A 4PAMA 4PZ0A 4F2GA 2ZR8A 3HM9A 2BGRA 3WRXA 5DU2A 4PYJA 3GPLA 3GPDG 2VJLA 1EUQA 2J0SA 3CMMA 1CQJA 2VDWA 1XCPA 3JYHA 3H87A 3LW7A 1L4HA 4GP6A 4PLTA 3WLAA 3TRHA 1OZAA 2QXUA 3EQ2A 1S9DA 2QQ5A 3WLSA 1RR6A 3N59A 4IY1A 4U2DA 5EI5A 1SN7A 4EABA 3HCFA 2E6UX 2ZIAA 3V46A 2FEAA 3G8BA 2INGX 1QYIA 4HDKB 1MP0A 4DQXA 2ODWA 1OLXB 1NQWA 2O52A 1CK4A 1ESDA 2QRGA 2VHZA 3ENKA 5JNWA 2JFVA 3CY6A 2YXBA 4RANA 4F5EA 1R5JA 5HE8A 3TCKA 1GR1A 5LZ2A 1YOVA 3WTCA 4NU6A 5IUNC 4U00A 5FUBA 3T5DA 4JBNA 4L3OA 3EGDA 4WDQA 5G0WA 1ZH2A 2O0JA 1KMCA 1W94A 3WHLA 4IRMA 1XAIA 2Y67A 4RMGA 4UUOA 1NONA 3DQZA 2PMDA 3KOXA 4NMXB 2Q7DA 4GQBA 3DQPA 2IPMA 3QY9A 1GRVA 1XEXA 5FJIA 1ULBA 1KRXA 2F3SA 2CXQA 2J48A 3JQBC 2VA8A 2VDOB 4FSHA 4AKGA 1JAZA 1BWQA 3EGXB 4A4DA 1H85A 1DUSA 3KUUA 3ZTWA 3Q9NA 5AKJA 2VHQA 1N3LA 3NYQA 4DSZA 1E4VA 5IF9A 1AOXA 3KQSA 4GMDA 4GC9A 2MCFA 5T7BA 3HADA 3QW4B 1VBNA 1IPFA 4IDQA 3NT2A 2XE7A 4NATA 3K16A 2NLOA 2OP0A 4B85A 2GK6A 4DAEA 1HT2E 3V9AA 1YR1A 4II2A 2HTFA 3SDZA 4MK4A 4BVKA 2DZDA 5BSEA 1LFAA 1R4MA 2WAMA 4Q93A 5IUJC 3GQBA 3ICEA 4D99A 4A16A 3ZZUA 1NR1A 1NX6A 1SB9A 4MUMA 3AR9A 3HMKA 2PWPA 2DCMA 3PUVA 5AVQA 1Y7IA 2I2AA 4QTTB 3D0OA 4AF6A 1KQPA 4HH1A 2M6LA 3T5BA 4LNUB 1HL7A 1L4UA 1E1RA 3GRAA 4G0NA 3W0LB 1CZRA 1IOLA 5E6RB 3RHTA 2AN9A 3OJFA 1ZIYA 4IP0A 4URVR 4DUZB 3TS1A 3KWMA 4MS4A 2DKOA 1T2VA 1DP4A 1HPLA 4PG7A 2ZS7A 3SXUA 4B4OA 1QH1B 4DDVA 3CKLA 1MEEA 4YIKA 3Q2IA 3ZJVA 1KO8A 2WW8A 1T0HB 1L1EA 5AVVA 1OWMA 1BW9B 2XQKA 2P3SA 3OLVA 4OSPA 3AVUA 2H1IA 2YMMA 1I30A 1V2HE 4KNWA 1LZKA 2NU6B 2XTAA 4H4EA 4FR2A 2HDNB 1TJYA 3ZYCA 1XZLA 2A5YB 1Z5GA 1ZKMA 1JI0A 1KDRA 1RQNA 2AG1A 3P0IA 4TUYA 2JGFA 5EIEA 1QH8A 2BW0A 3SNKA 5CHYA 4ZGGA 1QFYA 5B6IA 3MIZA 3QE3A 1ZG3A 1RJ9A 4XTCS 1N6PA 2RC5A 3ZCUA 1V43A 3NJ4A 2R8XA 1D9ZA 1RBZA 4P36A 5LDGA 3LC0A 5LZ8A 4MKXA 4M0PA 5LDHA 1VBFA 1FP4B 1D5CA 3AGQA 2WI8A 3W90A 2V0CA 1YZTA 2RI1A 3D31A 4I50A 1I1QB 3EYAA 5IBPA 1IN5A 4ZEMA 2BHSA 2O0HA 3U4QA 2BKVA 3KB2A 1QX3A 4DHWA 3D5TA 5DBEX 2NYAA 1JAXA 4C1BA 2WV7A 2L2QA 4DG9A 1DLIA 3ULKA 1NE2A 2GEVA 2P9CA 1KFCB 3DR5A 3NBZC 3MT9A 5ICMA 4AN0A 3U09A 3DOOA 2VHEA 3UWOA 2G6TA 4K87A 2XRMA 4D79A 1UDBA 2QRNA 5B55A 2BFEB 3WGQA 1AX9A 1E8NA 1GGHA 2AFIB 3PSAA 4N0MA 3K9CA 3ZWKA 2Q99A 2IUYA 3F6YA 3F5QA 3PZRA 1NHWA 1ZIPA 3BWYA 2FCRA 4HWTA 1ZRHA 3VH4A 4QG3A 1COZA 2ZTVA 3L43A 1BO6A 5JBNA 1B1CA 1TFUA 1MQ9A 1FDRA 2HLDA 4NDZA 4X1YA 5EYPB 1FRQA 1E7SA 1KE2A 2M6SA 1EVEA 1W5EA 2IEYA 5IAKA 4C0SA 1W1UA 4EF4A 2OCIA 2ZM5A 1E64A 3QVXA 3BWMA 1M0EA 3ON5A 4FGUA 4KFUA 2ZT7A 2ZUWA 1G5QA 621PA 4QARA 3IV9A 1G5FA 3HCDA 4I5EA 4NE7A 4RV5A 3V32A 1ZMXA 1ULZA 4HY3A 4Q48A 5IFLA 5IHXA 2R8RA 2I1QA 3LO5A 3HEMA 3G9QA 1Z38A 3FRJA 4BN0A 2FPGB 3EWSA 3OKCA 1GGNA 3SAJA 3OQIB 3D54D 4HX2A 3RBZA 1S2OA 2VTDA 1USGA 1OWLA 3PT5A 4ZO4A 4Z54A 2BYTA 1E5DA 4O2BF 2P2CA 4UHJA 4DJEC 3HS3A 1B0AA 3KJHA 4CV1A 4OHPA 3U7QA 4NXNB 2QAIA 2KPOA 4H6WA 4I1YA 5KREA 2ON6A 5IVIA 2AD1A 3K5IA 2Q5IA 1XI2A 2PS1A 2HLNA 2PT7A 2RSLA 3KCNA 4G81A 4HZGA 4R9RA 5JOQA 2OG2A 3EFBA 5M3BA 2QRKA 1WETA 4S2UA 5KYYA 1VFPA 4Z4CA 1NNLA 4X6XA 4DXAA 2W8BB 1S89A 3I9V1 2H7CA 3LFHA 1UJNA 4K6KA 5A62A 3VH1A 3VR4H 4KP7A 5KX5B 4C6SA 4TSRA 4D8XA 4I1SA 5J63A 2BBWA 1C8BA 3K05A 1CVRA 2GO1A 1TU3A 4L0DA 2CB9A 4CQMB 4YUYA 1JE1A 3HJFA 4HLUC 2Q29A 4BKMA 2C95A 3T7IA 4BY9E 3C3XA 3T1QA 1I4DD 3DBRA 3BJMA 3OE4A 4FE7A 1ZCAA 4R1UA 5FT9A 3TLZA 3HY6A 4WBNB 4OLBA 2ZYSA 1G3UA 4CLXA 2R8BA 3Q98A 4MVJD 1CIVA 2WLSA 4HN4B 4EHFA 1P9RA 1QC5A 1JDTA 3OPYB 1KMMA 1KDZA 5JE8A 3HDTA 3QUTA 2IHNA 1TW3A 3NHBA 3HXTA 5AO9A 4DZTA 1V1JA 2VP5A 2R00A 2IXEA 3B3AA 3UWSA 4US2R 1OBCA 2R96A 4G8JA 1P3Y1 5B3JA 3I2FA 1OC2A 1ZL2A 3MJ4A 5TT1A 1QHSA 1ZP6A 1T15A 2WYOA 1Q1AA 1E5TA 2DBRA 4R81A 3TCXB 5IS2A 8AT1A 2BV3A 5HF6A 3VNVA 2R87A 2VBIA 1LJLA 3UGKA 2HFKA 1LDBA 3OM0A 3KSRA 5IJ0B 5JJ5A 1UT5A 3VSBA 2QUZA 5GP1A 2QLBA 2D3WA 2G40A 4LE1A 3TTTA 2WTAA 4AKSA 4RUKA 4BWFB 1GV0A 2FB9A 3Q88A 2GYUA 2ZTLA 5DI3A 3ZD7A 5T67A 1GA6A 4BKPA 2D1SA 4AW9A 1OLSA 1TCBA 2P9FA 1TF2A 1KJJA 3WNVA 1E3EA 1M0TA 1Y5LA 1GPDG 4UEJA 2HJVA 1B8OA 2R1UA 2V45A 5DM0A 4EUHA 1S7GA 4IEIA 3RS2A 2Z2XA 3DP9A 4OMFG 2YQ4A 5LJLA 3F5FA 4HNQA 2L17A 5AI0A 3PJFA 2QVXX 4YMTA 4W5TA 3KQHA 1VKJA 3GEGA 3OZIA 3P7MA 1Y5NA 1SHZA 3ESZA 5ALHA 3WLNA 1UZNA 2QTCA 3O4GA 3QELA 4B3FX 2L19A 4XUGB 3C7DB 3R0XA 2H4YA 3NEJA 2A3NA 3NAMA 3IOCA 1GTL1 2SKDA 4Q9KA 4AX8A 1NVXQ 2OOSA 3T54A 1O2DA 5ADHA 4HH0A 4O6VA 4WUTA 2E21A 4MR9B 2AI2A 3NHWA 3OZBA 5C8ZA 5JSZA 3ZBQA 1TKAA 2NUTA 3ZDDA 2HU2A 2GZ2A 1AK2A 5T6BA 1DOAA 2CJWB 4TOIA 4S1PA 4Z2AA 2Z4RA 4GZLA 4QM7A 4HPJB 3G8CA 4BMPB 2WAYA 3G68A 4HB3A 3THRA 1XK6A 3K9NA 1ZO8A 3WLFA 3SJUA 2E4ZA 4US1R 3CPHA 5BMVF 3KKKA 4DR5B 3KYCA 1PQUA 2I4RA 2PGIA 4LJ6A 2EZ4A 2MHCA 3PFBA 3RS8A 5KTTA 5KNCD 4DB2A 3V6LA 5CX1A 3O9ZA 1JTFA 3VR3A 4YMUA 4AULA 4YY3B 3EWAA 2A0YA 4WTOA 1CT9A 2J1LA 3NHMA 4MS3B 3FOEC 2CNBA 4PG4A 2NVUB 3BORA 4CBVA 5KNDH 2JJ8A 4FZ5A 1AK1A 2RAVA 1I13A 4JVOA 4KRXA 4AG5A 1GZUA 1R4NB 3WMRA 3UHPA 3WV4A 4E1VA 3F3SA 4WNAB 4OBXA 2YXPX 5CNIA 3MJSA 1MC1A 2QV7A 1IBCA 1HFEL 4LJRA 1RXYA 1E1LA 1QOQB 1XRRA 2NTYC 3A6GA 3DCYA 4FOSA 4C3OB 4HFNA 3OZFA 4K8OA 2D1RA 3MLAA 5EIBC 4OB6A 3O3OB 5DYGA 2GSDA 3A26A 3AW9A 3RNOA 3CNEA 1DEHA 2XB8A 3QA9A 4V02A 2FZVA 1GYRA 4DOMA 2XUFA 4BQSA 3TG2A 5FBQB 3L46A 1SM4A 4YYZA 5F78A 2FLVA 1Y48E 3DL4A 1DJLA 2AI1A 4QRIA 3TKYA 3TRIA 5EIBD 3VM6A 2FFAA 2CHEA 3I04M 4BMDA 3I5XA 1Y8RA 2A5GA 2C03A 4JQYA 4ZVNA 1BA2A 1ZXLA 1DVRA 4EA6A 2GCEA 4ZN6A 5JZMA 5KSOA 3HFJA 2X9NA 3LX5A 3L79A 1QK5A 2NXWA 3R6TA 1U3VA 3LYAA 4O4HF 3T15A 2ACEA 3GYBA 1P9LA 3VYVA 2PFGA 4CR7A 4JGGA 4LVNA 1R6XA 4HWPA 3W1WA 3O93A 3EDRA 2A1TR 2H1CA 2QTMA 4FQ7A 3KJXA 4IX1A 5LQCA 1P7YA 2QUKA 5L3QB 2BFCB 2P7HA 4Y0NA 2ZT8A 3NUZA 4KU4A 5DT2A 1LLUA 5SYAA 4IDBA 3N05A 4HRXA 2D0DA 4GDMA 2JGDA 4O3FA 4TL6A 5IG2A 4ARCA 2VQ6A 3PC7A 3VR5D 1OY1A 4C9BA 2EX4A 3TJRA 1SVMA 3DLHA 1THMA 3HWX1 2ZJ5A 2JLZA 4RK1A 4TX1A 3BGOS 2GXUA 3R7AA 4EATA 5CCEA 1IZ0A 1KZGB 3CRQA 4IIGA 2PUGA 4AYTA 4XVCA 1L5WA 3ZCXA 1TT5A 1OAOA 1V35A 1L7DA 3F9RA 2MT9A 4AUEA 2XB9A 2EFYA 3LIPA 3UJHA 1ADBA 4CU2A 3GQVA 2G0TA 1Z8FA 3VDMA 4AECA 1M5TA 2OV4A 4LMPA 5FLEX 3R9WA 4LRYA 4CLDA 2WU4A 4ZI3A 1EX1A 4F38A 3FG9A 4RACA 5CNMA 1Z0JA 4Q82A 4O2BA 2D7JA 5BUZA 1SXPA 1GG9A 4E09A 3BOSA 3FJYA 3SS7X 2V7VA 3IQDB 2YUTA 4L07A 3JYPA 1R6BX 1LH0A 1R6UA 1FU8A 3QXJA 2TMKA 4MOWA 1OCEA 4W5RA 2QP4A 4Q3KA 4ZDIA 1GAQA 4BZXA 4NI5A 1S4MA 1UPCA 2FWRA 3DEFA 3GYGA 4G86A 3TSCA 2G7MC 3HCAA 3L8HA 3HJHA 3OFND 2W4MA 3LL7A 4NPHA 4EEKA 2ZUEA 2A9KA 2ZJZA 4NFSA 2F48A 1E79A 2XDAA 4OBEA 3KE8A 1SBYA 1M6HA 3A9TA 1N57A 4DSTA 1QAMA 2VEDA 5CR9A 5EHQA 1QYWA 2J9RA 4KQCA 5I01A 1Y1PA 1OAAA 2ZWVA 5K3DA 3PLAE 2BCEA 1DC7A 4OFZA 1DAPA 1JHXA 2D13A 4S12A 1BD3A 1MH1A 5CT8A 3UMBA 3I61A 1U4SA 1ZMOA 2CFTA 3DNMA 1WZCA 2IYTA 3C5HA 5JY1A 1U9ZA 4YJHB 1N8TA 2CNKA 2P9YA 5DYNA 1N2CA 3UPUA 1K66A 3P0JA 2HSGA 5FFNA 1LFDB 4J9UE 2Q0HA 3ICPA 1Z18A 4GMHA 5MFPA 1PS0A 1R3UA 3OSUA 1K0FA 4PSUA 4EJ2A 2ZYRA 1VB5A 3FETA 4ZI5A 2XBMA 4TM7A 4QXPA 4KLCA 1XLWA 1Y9EA 3PFGA 1AZLA 1EWRA 3PR3A 4YAEA 1DIGA 2W4IA 3I9LA 4OHMA 3WQQA 3DHYA 4CQNA 2KMLA 3JQAA 4JT9A 1CQJB 1YS9A 2VDWB 3MB5A 3X1KA 3ZWBA 1AT1A 1YQEA 4PLFA 4AO6A 5AXCA 2O0LA 2OZLA 1SQ5A 3IRUA 3LZDA 4F06A 3PUHA 2PXAA 4QSMA 5G3ZA 4KXVA 5F21A 1Z22A 4WIAA 3ROXA 3M8KA 3ZYZA 5AUPB 4KRFA 4FCVA 3IQFA 1TPZA 1C0KA 2FMIA 2QSYA 3DTYA 4LSZA 5AKLA 4DC1A 1E3IA 4R3UC 4INAA 4ZU1X 4DEYA 1K75A 4F4DA 3EH2A 1RAFA 2VNHA 3P0RA 4RV4A 4BN4A 2NPOA 3VR6D 4ND8A 1YOVB 4H6PA 5IAEA 2P90A 3C1UA 1HYBA 3IULA 4KUHA 1LWOA 1LKZA 5ANRB 3EGDB 1GTSA 2A0UA 3VZQA 1ZEJA 1S4QA 3ZZNA 4ZO8A 4D0NA 4C4SA 1KI1A 2H2AA 4OGFA 1NN1A 3GFFA 1IPHA 2P79A 5JHHB 2QENA 4EENA 4EKIA 3GHHA 3UG6A 3VHLB 2XUQA 2IYFA 4WKCA 5A4IS 5CCXA 4YCCA 1XEXB 2H63A 4CFYA 2PLFA 4K8RB 2V7QA 1RPTA 4UE3S 3ZHYA 5SZIA 4DUPA 2ZSHA 4LXXA 2FPXA 2QX4A 1ZH0A 2ZSDA 3BG5A 3JCZA 4JYBA 1UIMA 2IPOA 4WEOA 1VGRA 2J3HA 2XLBA 1LPSA 2C9MA 4QEKA 2CL7X 2Q4TA 3D2AA 1CU1A 1BMDA 2EBFX 2ZBGA 1S2MA 4UREA 1V16A 3Q7SA 2E9SA 3THXA 4B2YA 3LGAA 3WNCA 5BMVA 1R4MB 3ZJ5A 3KJFA 5DT9A 3GQBB 5HCIA 3IAEA 3H8WA 1SG9A 2O48X 3ZCPA 4B7UA 3BE4A 1M1YE 4NOKA 2ECOA 4JLWA 3RS3A 1OFVA 2WLTA 1Y89A 3IKJA 3KT6A 4IOJA 2HQSA 2XMSA 3HCPA 5CIYA 3UFXA 4OAOA 3KQTA 3ZXXA 1TJPB 3ZJ4A 2WZBA 4JJAA 1CCWA 5IZCA 5FV7A 1N4AA 4NYJR 4G3XA 1UPUA 2CF5A 2ZSEA 3OBIA 1WDKA 2SBTA 2JLWA 3NVDA 2IYSA 2FSHA 4MS4B 1LPMA 2J4CA 1Z0ZA 3ZZ1A 2UVQA 1CY1A 2GAAA 4Q05A 1RRPA 1U7HA 4M22A 4C4TA 3SXUB 2ZJBA 2MINA 4FMDF 1GRRA 2WUVA 4RHEA 4N7MA 5KWEA 1PV1A 5K1ZA 4FS8A 1CZNA 2XE8A 1PL8A 3LRPA 4KQIA 1QV9A 3D4LA 4PAQA 2BL4A 2QD5A 4UD6A 4I4TF 3TNJA 1Q14A 1Z4KA 3Q12A 1QRDA 3L84A 3IVXA 1R9JA 4TYPA 1KO5A 1QH8B 3CNLA 2E1RA 4NZPA 4DGSA 3OY7A 5EUBA 1FNCA 1RRFA 1KIAA 1WB6A 2GJ4A 3ANXA 1RJ9B 1Z2CA 2AQIA 3KU1A 3DMHA 4XDYA 3ZWVA 3D4BA 1U31A 4WA7A 1B0UA