2QLBA

Crystal structure of caspase-7 with inhibitor ac-esmd-cho
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qlbA00
3UO8B 2CJXA 2QL7A 3SIPA 3D6MA 4QTYA 5IC4A 5IAEA 3V6MA 5LU9A 4QUDA 1SC4A 3EDRA 1I4EB 4D3XA 3E4CA 2XYPA 4NBKA 3UOAB 2H5IA 3NS7A 4N7MA 2C1EA 4LSZA 2J31A 3ITNA 5IANA 2HBZA 1M72A 2FUNB 4QU0A 1BMQA 3R6LA 5IARA 1QX3A 2QLJA 3PD1A 1GFWA 1I51A 1QDUA 3PD0A 2H51A 3R5KA 1RHMA 2C2MA 1GQFA 3DEJA 3R7BA 3D6HA 4I1RA 4QU5A 4D3ZA 3R7NA 1F9EA 5IC6A 1K86A 5IASA 2HBQA 2CNKA 4NBLA 4ZVSA 4AWBA 4HQ0A 3P45A 5LU8A 4QTXA 1RWOA 4HQRA 4QUBA 4NOMA 4NBNA 3GJSA 5IBCA 1IBCA 3PCXA 3D6FA 3R6GA 5I9BA 2CNNA 4QU9A 2J32A 3SIRA 1RHQA 5LUAA 3R5JA 1RWMA 5IAJA 1RWPA 3KJFA 2J33A 4JQYA 3IBFA 2C2OA 4DCPA 2H65A 3K7EA 1NMEA 4QUJA 2H5JA 4JQZA 2QLFA 2HBRA 4DCJA 1NMSA 3H1PA 4AWAA 4NOJA 1QTNA 4N7JA 1PAUA 4QUAA 4ZVTA 2XZDA 4EHLA 4JJEA 4NOKA 4PS1A 4EHDA 2CNOA 2QL5A 3V55A 5IABA 4EHKA 3P4UA 1RHJA 2XYGA 4ZVUA 3KJQA 1RWXA 3S8EA 4I1PA 3KJNA 3H0EA 4M9RA 1CP3A 2XZTA 2Y0BA 5IAGA 1RWNA 4N6GA 4ZVPA 4JJ7A 4EHNA 3H11B 1F1JA 2NN3C 4FXOA 4QU8A 3BIJA 4EHHA 2H4WA 1JXQA 3EDQA 1RWKA 2WDPA 4JR0A 2DKOA 3GJQA 3IBCA 5LUBA 3H11A 3GJRA 2HBYA 4ZVQA 3V3KA 4QUGA 5IAKA 4FEAA 4FGUA 5H0IA 2J30A 3GJTA 4QUHA 4EHAA 2CDRA 2C2KA 3RJMA 3V6LA 2AR9A 4IEFB 4JR1A 1RWVA 1K88A 1RHKA 3DEHA 4EHFA 4QUEA 2FQQA 4JB8A 4HVAA 1KMCA 3OD5A 1SHJA 3V4OA 3R7SA 2QLBA 3S70A 4IYRA 3DEIA 2H54A 2XYHA 2Y1LA 3V4LA 2P2CA 1NW9B 2CJYA 4JR2A 2QL9A 5IBPA 4EJFA 1ICEA 3NR2A 4PRZA 1CVRA 2FP3A 2C2ZA 2H48A 4ZVRA 1NMQA 1RE1A 4PS0A 3DEKA 5JFTA 4ZVOA 2H4YA 1SHLA 1RWWA 5IBRA 1PYOA 4D3YA 1RHUA 1RHRA 1I4OA 4DCOA 3QNWA 4N6OA 1I3OA 4N6NA 4NOLA 4PRYA 4JJ8A 1SC1A 4AW9A 3NKFA 4QULA 3H13A 4QUIA 4N5DA 4FDLA 1SC3A 5K20A 2K7ZA 2CNLA 5I9TA
chains in the Genus database with same CATH superfamily
4JWKA 3FYUC 2O2SA 5HF5A 1BWPA 1J97A 4ZHSA 3HDQA 1K68A 2P1RA 2QHXA 2VRNA 3JALA 4IMJB 5KX5B 3GL9A 1EWKA 4LDJA 1VPEA 3BILA 3W34A 6ADHA 1XTSA 5JS7A 3JD2A 1T0UA 4G1EB 4EA7A 1VE9A 3N2ZB 3P8ZA 3LNCA 3QMPA 5TPZA 3AKZA 1GFIA 2FSIA 2P5UA 1SVIA 1H85A 3L4BA 1TZ2A 4LRWA 2NGRA 4F2HA 2X0RA 4YAFA 4PN3A 4HD8A 4IY1A 1VIMA 3H2JA 1I51A 4K7JA 2D06A 4PQFA 3G68A 3PICA 4R2JA 3LIPA 5DYTA 5DF1A 5AW7A 2JGDB 2ETVA 1G60A 1L4FA 5LQKA 3RW9A 2IS4A 4I36A 1DADA 2C83A 2HDOA 5CX1B 1GLVA 3BQMB 4NNJA 5E9WA 4UHHA 4GXTA 3AVOA 5B3LA 1WU8A 3PDHA 3LX8A 3C87A 4LVOA 1NW4A 2GRJA 4R16A 2VDPB 4I81A 1ISJA 4MVJD 1VXRA 4NYMQ 3DBHA 3KT8A 1WB5A 4NP6A 4OQ4A 3TL3A 5I9LA 2PJRA 2OGUA 2P6UA 3QLVA 4ZP1A 3V2IA 2E21A 3I2JA 4OD0A 2PXCA 2F17A 5DNVA 3A2NA 1JHZA 1SVLA 3ES9A 4KQ9A 1B6GA 4BQFA 5LQAA 1X86B 4W8GA 3WV4A 1JEOA 1X8LA 1AK9A 1OZ0A 2OFPA 3OWHA 2JJ1D 2ZWVA 4L9AA 2R1TA 2ST1A 3E9ZA 4AG5A 4RMJA 1GGMA 2JLQA 4H1VA 5JIBA 1P18A 2HGZA 3R5FA 3ZGVA 3KZNA 2VSOA 1U99A 1N6HA 1H4TA 3NC4A 3WMWA 1YCDA 5DM0A 2BFPA 2E4YA 3AXSA 3MWGA 4RENA 4ZAFA 4DJDC 1RFLA 4EHJA 2IYXA 3ZE0B 2W7TA 2PHZA 1UBSB 1G20E 3KM0A 3IAAA 3LA6A 4E6EA 2Q0XA 3WKBA 1EK1A 3S8EA 1AQYA 3HCOA 2L82A 3EZYA 1C4WA 1ODTC 4QT4A 3MHTA 4QBHA 1T8UA 1UFOA 5DN9A 2O2DA 2ODEA 5CB4B 4RW0A 1DI0A 4PZYA 4A0QA 1MC8A 4LHXA 3FHTA 2F59A 3ESZA 1B1AA 1X2BA 3OZXA 1P2DA 4J0HA 3MIZA 5FO0A 1C4KA 1LY1A 4C0JA 1XYYA 1GCOA 2Q5LA 2QVCA 4CT0A 2QUBA 1UKYA 1WOMA 2PL9A 3GYGA 1QNFA 3H75A 4AYWA 5JHHB 1Z6AA 1T5HX 4XM1A 1TVCA 4N39A 1CIVA 5DVZA 3PDCA 3TR5A 1YDGA 1EVJA 2GPAA 1WIWA 3ISJA 4G6ZA 1NSFA 5DM2A 2A9FA 3F6EX 2PH5A 3AJRA 2WM2A 3EXFA 5G3ZA 3CUKA 5U4XA 1VPVA 2RK4A 4OLHA 3T9AA 2UXCB 2BEWA 3PVZA 3L7IA 2HOQA 1FS6A 2AWOA 1IQRA 2G9RA 3HJRA 3LT0A 5AKXA 4ZAZA 4ETWA 3FTCA 2X8WA 5HDBB 1EU1A 2QY9A 1YZTA 4ZVOA 4RH0A 1N7GA 3VPDA 4OU5A 4D3YA 2JA2A 1RHRA 5JATA 3FNBA 1ND6A 3BYZA 4AECA 3SG0A 2WRZA 2QMYA 5DMXA 4AW9A 1EVLA 3CB4A 2ZKIA 3GH1A 4MPDA 4HATA 2OZLA 4YCSA 2X2OA 1XVIA 4E2XA 1U02A 3RBXA 4INJA 4KO8A 4Y6QA 4ZK6A 2IWHA 1IAVA 1T34A 1XNJA 2FPMA 2HWUA 4BJ1A 2PGOA 2IZ1A 1QGYA 3NOOA 1FU8A 3ICPA 3T4EA 2V9PA 5D3ZA 5TGDA 1U0HC 4BVBA 3RS4A 3OIUA 4Y6OA 5JS1A 3AEQB 4BQOA 3L18A 3DVSX 4EJMA 4I1VA 3HXLA 2VIIA 2ZB7A 2W48A 4GPAA 2XX3A 4PX5A 2ZZNA 2PX4A 1OC2A 1TTHA 4MARA 4N8SA 4HUQA 3EZGA 3RKSA 4GPBA 4K9NA 4TZTA 4I5GA 3H6KA 3O8QB 4DSTA 1DAIA 2ZSKA 5TJ9A 5KU7A 2KQUA 4J6EA 1VKRA 3HDVA 4IXTA 4OHZA 4EPXA 2ZSJA 4E2FA 1WCV1 4ZODA 1PS9A 3JATA 5JDCA 3B3JA 4MKRA 3G7SA 2I4MA 4URUR 1KC1A 3RFFA 4A03A 4EO7A 4P86A 1E2HA 1KS2A 4M1SA 4F5YA 2Q3MA 1D8AA 1YZKA 4XM0A 5AFSA 5K6RA 4MVJF 5LR6A 4TQAA 1N1MA 1UBFA 2JFNA 4CMAA 2AYXA 4ZRDA 1G6KA 1QE3A 3ITDA 3SAJA 2JIZD 1R00A 3CEAA 4G37A 2A5LA 3CG4A 4PRLA 4RTKA 4KNYA 2W90A 1GQSA 2PR2A 5JROA 4MTLA 5TGZA 1JHXA 2BR4A 2NNLD 3W1EA 2FEPA 5L7TA 3OC6A 1DGQA 2B1IA 1AB5A 2PM8A 4M37A 4BKPA 821PA 1F20A 1WDTA 4IVNA 2OTCA 4REQA 3BMQA 1XN4A 5AI4A 2OCDA 2RGDA 2YS7A 5BMVF 2BI7A 2IPNA 1XNGA 5EIFA 4RQAA 1D4ZA 1G42A 4PLFA 2PRJA 1G5PA 2GLUA 3PC7A 5EMJA 4A0FA 1H0SA 1YQDA 2RH8A 1MG0A 3RAEC 3E84A 5EIBD 3FAZA 4OP3A 1G3IA 1VYTA 1ZIDA 4G56A 2ZJ1A 1D2NA 4ZV9A 1EVZA 1KIMA 2FQ1A 4IBOA 1HYBA 2XQGA 3PPVA 3M6FA 3RWBA 5IN4A 4BNGA 1NJ5A 3R5SA 4WRRA 5GONB 3U7QB 4Q3AA 4U00A 2NO9A 4NS4A 4MUMA 4TUYF 5DWQA 1HZJA 3QVTA 2QJWA 2VTEA 1A9XB 4JS0A 1NU8A 5JD6A 4IUYA 1KAOA 2X5OA 3GYBA 1QGUB 3SC3A 1TT5A 5IMBA 4D45A 3HKEB 4RWEA 1JWLA 3OEED 1DVRA 2CXHA 1U7ZA 3A36A 5CDYA 2E4ZA 1UPUA 3SBOA 2QTCA 1A5TA 3MWEA 2HEGA 5F2EA 4Z4IA 2VJLA 1ZYUA 4JJFA 1XP8A 5E8RA 4AZWA 2HNBA 1PTJA 5GAJA 4E31A 3NIGB 2I4IA 3PX7A 1ML3A 4P4UA 2WBLC 2J45A 3PQ5A 4O4JB 2WJPA 4X1KB 1X1AA 4FBLA 1O6CA 4Q1AA 1MJNA 1VJTA 3IV7A 1WR8A 3QRWA 1LQUA 1CSEE 1NR1A 4AYXA 1GZ6A 3IMFA 3NR2A 2FP3A 3V8EA 2X0IA 4YECA 1RKQA 2I6QA 2OFFA 2R65A 4HZIA 3ZK7A 2QS9A 4AY4A 5HRCA 4N7RA 5LA6F 4U3JA 3JQ7B 4R5HA 5JI3E 5KREA 5LQUA 3GROA 1VMEA 1WMSA 4NPCA 2IYVA 4RDXA 3A4VA 1I3OA 3GY0A 1AQNA 1U1IA 3HA3A 3N8NA 3QOWA 1SVWA 2J3KA 5JD4A 1M2VA 4ND7A 2YQZA 2ZVDA 4A23A 4LJKA 1L5OA 1DX4A 3BD8A 3V4FA 1I1HA 4RWZA 1JDBC 5AJVB 4D0SA 3EB9A 1Q3KA 3OLQA 3AHIA 3GAAA 2GMWA 4HNQA 3TKYA 3CNHA 3P0JA 3PJGA 1P2VA 2LPMA 2NU7B 1XI2A 4L7VA 5FL3A 3PX2A 2PUGA 2HA2A 2DR3A 3K94A 2GD6A 1R3UA 2B20A 2ZOSA 1DPGA 1XPUA 5IDQA 5KNCH 4IIUA 1LBTA 3HCEA 3HUEA 4QU0A 2JIOA 3G23A 2WJ6A 1QQTA 3I6QA 3MQFA 4K81B 2LW7A 2VSFA 3T99A 5JH7B 3VR2A 2HA4A 3B1XA 3PD0A 2DFDA 2YHAA 2P9EA 4F7WA 3TE7A 1UFVA 4Z8XA 4DA0A 1PZFA 4EY3A 1A8UA 4LTNA 2B83A 1Z36A 3PQEA 3SBXA 2IYNA 3UT0A 2RGWA 5CK4A 4RZHA 2FPLA 4CF4A 4KAAA 2B4KA 1AN9A 3P2IA 5BNFA 1MN6A 5JVDF 3GVCA 4HEA1 1QZXA 5EE5B 3I45A 3GN2A 2H2IA 2WFMA 3E2IA 3R5JA 1JP7A 1DKQA 3DZBA 4HDNA 3NW9A 3TMAA 3ZY5A 5CFZA 1JUDA 3FUCA 2G1KA 5K0FA 1O77A 5J2UA 3FNGA 4MINA 5LYJB 4ARCA 2PCJA 2VZ8A 3COZA 2QDKA 4L6AA 3BRWA 2QJOA 5KWSA 5U9CA 1XOIA 2HBRA 4S1NA 3G8YA 4D6PA 2PR7A 3TVTA 4HH1A 4AZ3A 1W88B 1QFJA 1AE1A 1WPXA 1A9PA 3AT1A 5B58T 4D4GA 3TQRA 5J43A 4QDJA 3N9IA 4S1TA 1USVA 3WGUA 2EHJA 1IMJA 1QAOA 3NEJA 4W8HA 3WO1A 1XTTA 2RAPA 2ZGVA 1YCHA 2NPIA 3WHPA 1INLA 4EZEA 1RKXA 3EIUA 2FW6A 3UFBA 1QCZA 2AA3A 3JVDA 4B87A 4J7UA 3X1WA 2ZWIA 1NDHA 1K7EB 1TVMA 2WUGA 3R7LA 2J4FA 3MINB 1JZQA 5KSWB 1X6VA 2IGBA 3ZI0A 4D4LA 4U7WA 4AP9A 3AP2A 1T36B 1LNZA 3ENNA 2HHJA 3QZUA 4RK5A 4Y7CA 1A4RA 2IPAB 2A9PA 3OCCA 4ESEA 1A0OA 2C8JA 3LDHA 1THTA 3OCXA 3E7DA 4X1YA 1NBMD 4L5JA 5DHPA 1NWCA 4URHA 5DULA 5HK8A 2AKEA 1NN0A 4LJSA 3WNBA 2GNPA 3KR9A 2VXOA 2PLFA 2R86A 2E0IA 1OXBB 4B32A 1W44A 2HQOA 1SVSA 3TJMA 5KNDH 1FC0A 3I8OA 3K72B 3DYBA 2DBQA 4L5IA 5E3JA 2F1IA 3R75A 3EMDA 2G9VA 4HLQB 3TMYA 3ZHUA 3N0WA 4ZOQI 3P32A 1NXWA 3I0NA 4K87A 4MB6A 1T43A 4R05A 4N03A 4G2TA 4O4LA 1RZ3A 4JLKA 1R6TA 1PJAA 4REOA 1JIQA 1L2TA 5HKOA 4BNWA 1N8NA 1XDZA 3FFBA 4K9PA 1A8HA 1YH3A 1P29A 2JCXA 2YXPX 2IV3A 5L6LB 2SKDA 1PCXA 3KAPA 1TEXA 2WD7B 4Q48A 4U7TB 2EKLA 4UE2A 4EY4A 5HQ3B 2N46A 5AOAA 1DPFA 7MDHA 3QPCA 3T5TA 2YICA 1KK3A 2K6GA 1JECA 4HYYA 1EGAA 5ADUS 4G4GA 1IZ0A 1QCDA 3PUJA 3ZC3A 5JW6A 2QR5A 4O2AF 1I32A 1AOXA 1O03A 3SIPA 5J4HA 1W4AA 3QW2A 2WW8A 5FXMA 1TCCA 1JQJC 3EVEA 2NU8A 1RE0A 3IVGA 2I5PO 5T67A 5INTA 3D7MA 1SG0A 2WLSA 1Z6XA 3PJFA 3AVPA 3FVRA 1UT5A 3UJDA 1I36A 1FYDA 2Q7OE 2IQ5A 2C9ZA 3OD1A 3O84A 3QKUA 1P5RA 2QTHA 4NEGA 5D87A 4YP9A 1ECCA 1P33A 2ZANA 5EYPA 2PWPA 5FWYB 2WMYA 1RBZA 1MJHA 1SWWA 5FL7D 5CURA 6REQA 1K5PA 1F6BA 1X74A 3PPXA 1I4LD 3W8DA 2NXWA 3L8HA 4CM8B 4FE4A 3E5HA 4ROSA 3ZI4A 4NOMA 1D2CA 2TECE 5AIBA 2OY0A 4GP6A 4CL3A 2I7TA 3PUZA 2AG6A 5BUSA 2Z4RA 1FVXA 1ZXXA 2J0UB 2WV9A 4GRDA 2O3RA 1IM8A 3GZNA 1L9XA 4RMHA 1F6DA 5C1IA 1P0CA 5C8ZA 1H2ZA 5ICEA 2C2YA 1M73E 2Q1WA 2GN4A 3FPLA 5E7JA 4A92A 3EF0A 5LMCA 2Q3BA 3PTAA 3VYVA 1RC0A 5KSPA 2FFRA 3LNTA 2TMYA 1P9LA 3W77A 4P7BA 4DV0B 5FCDA 1CS4C 2ZRGA 2ZU0C 2B4QA 3NHKA 4OEHA 4IIEA 4UE3S 2ISSD 3AW9A 2I6TA 3Q7QA 4H3HB 3PIRA 4MEJA 1L9KA 3B9PA 4M6WB 1ATIA 1I2BA 1DT5A 1PAUA 2EBWA 2PFKA 3WQHA 3ZLUA 4MOWA 5IHPA 1N33B 1I10A 2H1LA 3L0CA 1B0ZA 1C7RA 3WB0A 3RBZA 4P3KA 2Q1TA 4X20B 4AP6A 1V8OA 2VQEB 2GD2A 1KH1A 3CUEF 2P3LA 4JJ7A 2HZ7A 5K4AA 3ZGOA 2EW8A 2ZZMA 1NP6A 2SBTA 4MA0A 2MSKA 2XZLA 1PWXA 4EPYA 2DH5A 5EUQB 1W36B 2Q6IA 421PA 2DE0X 1YFZA 4CN8A 1JHDA 2CYCA 1G291 2R6CA 3B5JA 3SXUB 1HFWA 2G70A 1RSZA 3NDJA 4FKBA 3H9CA 4NATA 3QX7A 2AG8A 1V8PA 2ARKA 4M4SA 3HDJA 4RUKA 2Q1XA 3W1VA 5DJ5A 1FYWA 4ME6A 3PRJA 4ZAXA 1CV2A 4Q93A 5EE1A 1G98A 3DPUA 2J8ZA 3JWHA 2PZMA 5T4FA 3TCXB 4FZ5A 4XQEA 5T6BA 3RAJA 1Z34A 1GKLA 1Q1NA 4PLHA 2WG0A 3V9PA 1RPTA 1D5WA 4HKTA 1CUHA 4Y6GB 4N47A 2C8VA 2FPXA 2HCFA 3ZIAD 1T8TA 3HVHA 4TXLA 3ROPA 3RM3A 4KAFA 5GINE 4RV4A 2X6RA 5AQ1A 4M7PA 1ISGA 3SMQA 1VMKA 5K5EA 1R18A 1J1IA 2PYZA 2VHWA 3I5AA 5JWRA 1DJNA 2YJ3A 1RNLA 1U65A 3GLKA 3Q7RA 4KVGA 5C1OA 4OSPA 5CA0F 1PL0A 1B26A 3C4VA 2HCRA 1WHTB 4Q9NA 4LQ4A 2Z2YA 1E8DA 2GR9A 2C9DA 3RT7A 5HJ7A 1TJ5A 2XWSA 3AR6A 3Q3VA 1YB1A 3VQTA 1H1LA 2V7VA 1BHSA 1EZ4A 1WP4A 1Z4LA 2ZYHA 4MQFB 4LNUA 1A4XA 1PSWA 4NZPA 4OQDA 1GLGA 4KSCA 4BJ5A 1XYVA 3HCPA 2RAFA 3WQBA 1TC2A 1JI0A 4IG9A 1RQ7A 2CE2X 1TGYA 1U94A 1X39A 4W8OA 3U60B 3CF2A 1W7AA 4MWSA 4XFJA 4XFKA 3SX4A 2ZRIA 2ET6A 1XDSA 2IXDA 1DUSA 2QW0X 2WFAA 3IULA 3TFQA 3UJ8A 1J2EA 4WFIA 4KGDA 1ETHA 4QGBA 2AD1A 2A35A 4HB4A 4BO0A 1N3IA 1SZDA 3CUUA 2JGJA 4II3A 1KERA 1H0HA 4J7AA 3RQSA 3TSCA 1HYHA 1QOQB 3PHLA 4I1IA 1NUQA 3DQQA 2JANA 1E7WA 2IP2A 4TS3A 3CW9A 2VHTA 4NCHA 3QY0A 3LDFA 4WTOA 2AF4C 4CDGA 4EH1A 4XTRA 2YCBA 3NBZC 2PEZA 1EBFA 1OFGA 1TCUA 3I76A 4N01A 3HDHA 1L5LA 5C32A 4AT1A 5KSOA 1SUCA 3SIRA 2ZUVA 1PG5A 2QMUA 3OJCA 4PQRA 5A4AA 1IVSA 3IALA 2J08A 4QG3A 4OKSA 3R6TA 1AHHA 3EAGA 3OEHD 1VIAA 4FE7A 1K2VN 4FGJA 5JSKA 4AZTA 2ZBEA 4QHTA 4QBIA 2X9NA 2RCNA 5CXXA 4LHZA 2XTAA 3RBVA 2C9BA 3BMCB 3EEBA 5AQEA 3ZX5A 4ER5A 1LVHA 1QHYA 4WFKA 2O8DB 4M0UA 1O2DA 4HGOA 2Q6KA 2AC2A 3KTDA 3MOGA 3ZHOA 2OORA 1IRIA 3FSGD 5KOJA 3IV9A 4OFXA 4J76A 1X92A 3TTXA 1XJWA 1V35A 3D6NB 4I9UA 1FJHA 5AHWA 4OLAA 2QL5A 2XYGA 3HN7A 3WYFA 2NYAA 3A1NA 1WG8A 4FC7A 3SDBA 4JODA 1ZJYA 2AN3A 4JXZA 1AV6A 3Q2IA 1HXHA 2PMDA 4E94A 5L40A 3TLZA 1R8XA 3OX4A 3T7CA 3ZVNA 3RVSA 2LP4Y 4QU8A 4HV4A 2H2DA 4H16A 1OA0A 3SU8A 2BGRA 3TE6A 2X58A 1NRJB 2A9QA 4QSMA 3ER8A 3JSXA 3HBNA 4F5DA 1WL8A 5JY6A 1UODA 3SQXA 2O4CA 3VU9B 1N2EA 3FB4A 5E3HA 1Z08A 1JNYA 3BN3A 1R9MA 2TSYB 2JJ1A 3MRTA 3TTSA 1ZEJA 4YR9A 3I4LA 4RA6A 5FV4A 2DWPA 5K8IA 1EFDN 4IDFA 3MGKA 5EKXA 1KO7A 1M8GA 5BMVA 1RYFA 2ZSUA 5KO2A 2M9MA 2QJRA 1N5JA 2VJYA 3MJSA 1KMCA 3V4OA 3ER9A 1D2GA 3Q3CA 2ZTSA 3QSGA 1XLTC 4H7EA 4OL9A 3RJTA 3DEIA 3UT5B 2MSLA 1J22A 1FRZA 2CHQA 2X0JA 3EQ2A 5MFPA 4W63A 5KYGA 2Z2XA 2I54A 3H99A 1Y5NA 4IINA 3W79A 3BL5A 3E1GA 2BYTA 3JAWA 1KK1A 1WJGA 1USKA 3BSSA 1YQ9A 1LDMA 1ENYA 1FFHA 3EX7C 4TVBA 3CE9A 3U7GA 3T1NA 4ZIRB 4NX2A 1KAEA 2HDNB 2RFLA 3JD3A 3E7XA 4BQEA 3N7AA 4WLUA 3DKKA 1EQUA 1YVRA 2OAEA 4HDKB 5JSYA 5JCXA 1IUKA 2R48A 3ECCA 1JSLA 5EIOA 2A1TR 1B6TA 1RJDA 1W35A 3IT1A 2WUEA 4JVLA 1C7ZA 5A5GA 4Q4AA 2VRCD 2FOIA 4RA9B 2VSQA 2X8LA 4HX2A 3QM1A 4XCQA 5COAA 4EQ6A 2D5CA 5F7XA 4F3TA 2HA7A 1I4DD 3ANMA 4MKHA 1OYVA 4UBNA 2FDCA 4L4ZA 3TOXA 4X00A 4ZYZA 1ZBDA 5I47A 3A4LA 5EPOA 3AEZA 2I1QA 4HXFB 3VKUA 4E14A 2ODTX 2AHRA 4ISCA 4CGZA 1E1LA 4WMLA 3DVLA 2I3AA 5LA6A 5DSXA 2COEA 3S6JA 3IEMA 5ABPA 2NTYC 3LHFA 3PQ3A 5E0KB 3IUYA 4HS4A 2F43A 1LFDB 5GV8A 2G07A 3CJTA 4QTXA 5KVAA 3VO8A 3GNSA 4G84A 1T0PA 4P81A 3DR3A 4WWHA 1AD2A 2VJMB 4NRDA 1RQRA 5ESXA 3FNRA 3L0BA 2ES4A 1J07A 1LF0A 2R3SA 1KP2A 3C8HA 2PCLA 1XCPA 2XE6A 3JQGB 3QVGA 4FYXA 4MJ3A 4Y18A 1LNQA 5ALUA 1BOOA 4LNHA 3VOBA 1K9VF 2GSWA 2WMOB 5MGBA 1DAFA 2VYFA 3PGXA 4XWGA 4UULA 3AR5A 2VJBA 2FWPA 4YRFA 4BDSA 3DYVA 3FKSD 5DTEA 2GJAA 1PIWA 4GH5A 5AICA 1VJ0A 3NKVA 1J0BA 2EZ8A 2ODWA 3CF0A 1DC4A 3IOCA 3NQ41 2OECA 3DG9A 2UZ0A 3GDWA 3DE1X 4FZRA 4WNCA 1CF2O 4DM7A 1YS9A 1GKYA 5LXTF 5A1JA 2Q1YA 2VDVE 4KH1A 3ETCA 1QZ3A 4N7JA 3HY3A 4V3CA 3VSAA 4EA8A 5JSFA 4K9OA 3TG2A 1PL6A 2KSQA 2PD3A 2DR2A 5IJ9A 4IDQA 2BCGY 3WWPA 4PONA 1GUFA 3WLJA 3IAS6 4E15A 3HO1A 2PX0A 3MWJA 2PJUA 3NNNA 3BPSA 3OTWA 3VNVA 1A7JA 3ROKA 3QVLA 2Z5FA 1VPWA 4TSKA 1ZIXA 2X5JO 1YRAA 2LV8A 3UXEA 2IHJA 1J8DA 4C5CA 1F8YA 3FROA 4JB0A 5JVDA 1KPGA 2WJ3A 3H18A 4MS3B 1V9CA 1NGSA 3RFTA 1EUDA 2V4MA 1U8TA 3WNDA 1YMQA 3IA2A 3PT9A 3PXEA 5FBRB 3R9KA 2L0XA 1J39A 1QVRA 3DTYA 3ODGA 3HVUA 4AX8A 1NF9A 4ALIA 3IQHX 1NVUQ 4FGUA 5JLJA 2XB4A 4OFZA 3F97A 4JLUA 1TA4A 3U7JA 1OBFO 3TPFA 4OIMA 3UYKA 3FOCA 2I3BA 4KFSA 3DZKA 1X7DA 1Y89A 4B4WA 4F56A 4L8YA 4BFUA 4FVTA 1F0KA 3Q6MA 3L8CA 1XCMA 2YDYA 3R24A 2W0SA 5BUQA 3KLOA 1C3XA 1DWPA 4MR8B 2W2KB 1QH1A 2WTEA 1Q1BA 1VL8A 4ZVVA 3MUOA 1TPYA 2ZRDA 1J2RA 3IILA 4PEVA 1BZYA 3X2SA 4YXWA 4YUYA 1HDCA 3DCJA 4MGKR 1YDHA 2AFHB 1MTOA 1HDGO 4Z0TA 4N6OA 5AHRA 1BWQA 2DUMA 4ECAA 1N1DA 5EJ4A 1PR5A 1RWBA 4JP3A 3UOWA 1EFTA 1Q19A 4GYKA 4I4TB 3AZOA 2PL3A 3RAFC 2C3OA 1TK3A 2HPAA 2WWIA 1EK6A 3HGTA 1PD1A 2C3PA 4GOOD 3G2LA 1IXZA 1XF1A 1CR2A 2DMRA 2R5FA 5FR2A 1Z7GA 5CYGA 4TRNA 4DMKA 4BYMA 5TMDA 3WIBA 1UZAA 4DBLC 4UHFA 1D03A 4OK6A 3ZLVA 2IHNA 1MFPA 3ZXSA 1UP6A 2E2WA 3R3SA 4WE3A 4UPEA 4GDFA 3CWCA 1VZ3A 1CZOA 1WDKA 2HBZA 3KFVA 4LZJA 5BSGA 3UAVA 1A8PA 1CNMA 4HAIA 5CW2A 3M1YA 1GLNA 2E1PA 3OWXA 3LO8A 3EDMA 5DM70 1ULBA 2FWIA 4XD7A 5IJXA 5K3FB 3FPCA 1MB0A 2HU7A 3R7NA 1K75A 1NFQA 3ZHQA 1DAEA 3VKGA 4D02A 1G4AE 1OR8A 4G5SA 2VNAA 1P2UA 1M3SA 1H23A 2AWNA 2AXQA 2X1HA 3A3NA 4G3XA 1E2MA 2R8EA 1E8NA 4G0XA 1KTIA 16PKA 3K9FC 3AL2A 1OTHA 4O2AA 3IQIX 1HDOA 1RHQA 2ONCA 3EVAA 3TXAA 2WU3A 3ZWKA 1W6UA 4OF4A 2YJZA 4ARBA 5E7MA 2BGMA 1KP9A 2B4AA 4JLBA 5C7OO 3BCSA 1Y8ZA 2NP7A 1UDRA 4WN9A 4LFAB 1ML4A 3FSJX 4KI7A 3G5MA 4NZOA 3ZBQA 4DIOA 1OAAA 2I66A 2YZGA 3LLCA 3I61A 2YVLA 3CJRA 3WQSB 4G8DA 3F96A 1KU6A 1SXJB 2ZRPA 2QRGA 4MPTA 2GVNA 2WJYA 3DV0B 1XJQA 3L7DA 1GTG1 3G5AA 1OZFA 1NN5A 4RK6A 5JQWA 4CMHA 4AZ3B 4CLOB 3D3WB 1ADBA 1XCBA 2CBGA 2DTDA 3GC6A 3OQPA 5C53B 5BN4A 5JWHA 3EVCA 2ZT5A 1RIIA 5JNUA 1Z4NA 1I9GA 3C3EA 4BE9A 3KJNA 1V8DA 3RADC 3RWMB 1FTQA 1JWAB 3B7GA 3MD0A 2G6TA 2MINA 4ZVNA 4AY2A 3ZKWA 4UMEA 2P8SA 3PRYA 2IOQA 2R6R1 2NSDA 2PSJA 1YE3A 2X2FA 2WTAA 4KXQA 4MV1A 3N58A 2F8TA 1L4MA 2VK2A 1GPH1 1S01A 1XNQB 3LBIA 4E70A 1UPFA 3W9SA 2Q4DA 3OOYA 2YWBA 1R4MB 2W70A 2EX1A 2IYEA 2DG2A 2X7JA 4LWPA 3H86A 2IUUA 2H11A 1GTL1 4RY2A 5IVHA 3IAEA 1DJQA 1THMA 1CLEA 2DULA 4H1HA 4H60A 2HJSA 5CMLA 1B74A 4YUXA 4BEWA 3EQ9A 2O2JA 2IY8A 4TQUS 1CRPA 5AKKA 4TTVA 3BK2A 4CR7A 2FFQA 1MQAA 1IBMB 3KOXA 2PSSA 5ALSA 1CQJB 3DMTC 2ADMA 2OCLA 4G5HA 4RVOA 1CRZA 2ZJZA 3KFXA 4N12A 1CQWA 4DMLA 4YBRA 3SI7A 5ELXA 2D3WA 1RHUA 1QIGA 1PQ4A 4EG7A 1IWBB 5BSRA 3FOZA 5KJ1A 1BH6A 1U8YA 3DLTA 1HE4A 3EC2A 2WT9A 3BHJA 3DYIA 3ORHA 4W5HA 2FPOA 3TAHA 1SC3A 1P4HA 2NX2A 3EIOA 3TOCA 1NBMA 3C1TA 2QE7D 5I9TA 2ZYWX 3NHRA 5C18A 4O08A 1EGVB 2C57A 2R6GA 3EULA 2GHIA 4MP8A 4RACA 3WFZA 4BMCA 3RTBA 1DV2A 4WN3A 3VU1A 3T0FA 3NCHA 3FPFA 3W5IA 4LV5B 3M4JA 2DPGA 1ZLYA 5IN5A 1IWOA 5T3UA 2HK8A 5AVRA 2ERCA 5HTOA 2HR1A 1MCZA 1SBHA 4KLRA 3JAKB 1NA5A 1AQLA 2QLJA 3I5UA 4WBSA 2BDTA 3BWVA 4ZARA 2O8FB 1JEQA 1QC5B 1G8SA 1EQAA 5D5PA 3EOZA 4HYEA 3T9FA 2J1LA 3LUBA 2XE4A 4MAAA 1AIPA 2PNJA 4OHYA 3D3EA 4JT8A 1MX1A 4O59O 3RV3A 3ZK8A 1KC3A 1L5RA 1GR1A 5IAAA 2OPHA 3OA0A 1MOQA 1L3IA 1ADFA 1AK2A 3D8SA 4YMTA 3JYOA 1X7ZA 1U2DC 1QFMA 2MSCB 1FQWA 1HFKA 4EVQA 1VKHA 1Y0BA 2DP4E 2VJOA 3K0HA 4L9SA 4FGWA 2LIPA 3CUTA 4PCUA 4LHVA 5GONF 1IEWA 1Z56C 2X9QA 3ZOKA 2KX7A 1KIFA 4XFDA 2JLUA 1RCUA 3P0EA 3SF0A 4Q9AA 4LOHA 2PUHA 2Y76A 3D3NA 5EERA 4G5XA 4QELA 2YWJA 4GOJA 4Q3EA 3HNPA 4DIMA 4LE0A 1F51E 5SZJA 1ZN7A 4YJKA 3QI7A 3JR3A 1NN1A 4RVSA 3ZHXA 1Z2PX 5J2TB 1C30A 4DA6A 3I12A 4X95A 1QU2A 2O8EB 4DT1B 1PX0A 1UAGA 4E5VA 1ES9A 2H4JA 4B6QA 4BO9A 2ZAIA 2XWQA 5AO9A 2J3JA 2HJGA 2UXDB 3TOVA 1E1CA 1X7XA 2VUIB 1YGPA 1NURA 2NAFA 3B1VA 3LIIA 3QVSA 1FMJA 5TE9A 2OSVA 1E1KA 5B7NA 3X1KA 2H4XA 2BKUA 2WZQA 3KJGA 2QGZA 2OMKA 4BMDA 1L8OA 2QRQA 3EQ6A 2A1IA 2Q07A 3DXXA 2VDNB 1WY5A 2WU4A 3WBKA 5C3UA 1U8XX 4OP1A 5EESA 2E1RA 5JG7A 2ZFUA 4EKGA 3PX3A 4LZAA 4E5NA 2DRIA 3DDZX 1PJ4A 4EVIA 4YRJA 5IZCC 1G4HA 1WXGA 3F6YA 3CLHA 3GUZA 5DCYA 2QPTA 3H04A 2CMHA 4PXSA 4HNGA 4PM4A 3TKAA 1Y8QB 3LH5A 1JHQA 4FDTA 4WW0A 3A4NA 3DMRA 4X6LA 4E88A 2D74A 4KX5A 1BQ3A 1E2PA 1SELA 3M0EA 5G02A 4XB1A 1EDBA 2Q0SA 4B3XA 1T10A 2QRNA 2Z1DA 4PU0A 2NZUG 3EXIB 2Q1UA 3CZRA 1YV9A 2H4YA 4MWTA 1RQLA 3NO4A 4B2LA 3K53A 4BO7A 3WYEA 1DJMA 1QHIA 5AJZA 4PFQA 5CT5A 4FFBB 2G88A 1BAPA 1S2GA 2FMKA 1YO6A 1FMCA 3AY0A 3K0AA 3NB0A 4CCWA 5KC9A 4Z7NB 1J1ZA 4TN5A 1LB1B 5FBVB 2YHUA 1SEPA 3BAFA 3AR2A 4NCIA 4Z3KA 5C51B 2Q2NA 1PWYE 2HSZA 3M70A 4NU5A 1D6NA 4TMKA 3UAGA 4TV8B 3MT0A 4XR9A 1LPBB 3V6MA 3ZHSA 4ZYUA 9LDBA 3MRVA 1HRDA 4KW7A 2BSAA 2J85A 3WGVA 1JTVA 4FFRA 1JMYA 4X6XA 3UOAB 4FYMA 1EE2A 4HTFB 2BELA 3A1DA 5CIYA 4FYYA 2ECOA 1ILWA 4QYIA 3UAOA 3VA7A 3HB5X 1YJXA 3STWA 4HF7A 3DQZA 2DQSA 2Y4NA 3FLEA 4NFHA 3VDQA 1QRSA 3VNUA 5AM5A 4QDXA 2QVZX 1TFRA 5BQOA 2C7VA 1L6RA 1C14A 1KPHA 2G04A 4QRIA 1TUGA 3ZIAA 4AWXA 4F3NA 3BWXA 2PEYA 2X1MA 4NH0A 2OM2A 4BLWA 3RSSA 1R8QA 3D3KA 3Q7PA 1RABA 4I0WB 1RYBA 2QAJA 4BB0A 1KO8A 1LDEA 1X80B 2C3YA 5DBIA 3V4ZA 4XX0B 2W43A 2CNNA 3J7TA 4TKUA 1L5FA 1QHHB 4YAGA 3QELA 2OHVA 2KJQA 3S40A 1A7KA 1HDIA 1NI4A 1LD3A 2GXQA 2ZJYA 4JQYA 3U26A 4LN1A 4TX1A 3Q7SA 3OIWA 2LKDA 2BTEA 1Y1PA 4FBMA 1NMEA 2DQ4A 2BFDA 4FMBB 4KN8A 1OAOC 4EGJA 3RRMA 4UTVA 1LJLA 2ECFA 2OCGA 2KHZA 2DZDA 3H5TA 1XALA 1YZ3A 3KPWA 4ZALA 3IUEA 5M2QA 1R66A 3DW1X 1NQOA 3WR5A 1G8JA 1UMCB 1P80A 4IILA 3EUEA 4LTMA 4CI9A 2X3UA 5MF6A 4IGIA 1DO2A 4DMFA 2QTTA 3EIHA 3IE0A 3GPCA 3KUDA 2EJCA 2WKQA 2VBIA 3RUCA 4IG4A 3G9ZA 2C4VA 2YOGA 3EXHC 4IV5A 2FN9A 1D6JA 2VBFA 1LTKA 1ZK2A 2I2BA 4OBBA 4R9SA 5LLDA 1VE6A 1L5HB 1MIOA 2Y1GA 3JQBC 2CJWB 3KKMA 1BJRE 3OOHA 2FDRA 1JQDA 3ZHCA 1VBNA 1FTYA 3OEHA 2BBOA 2I71A 1BD3A 3DFUA 1CKEA 5TLSA 4RAQA 2PXHA 1F2UB 5JS2A 5BWCA 3ZHTA 1E4EA 2FKNA 3VOAA 4TMTA 3MMZA 4XVQA 1R0WA 1SWVA 3EHDA 4AIRA 4HPJB 5DNCA 3IBGA 2WIFA 4Q4JA 5AESA 2QGNA 2M1XA 1T1JA 3F6CA 2HTEA 3C7DB 3QWAA 4M87A 1U8FO 2ENWA 3FSGA 4IXWA 1RJFA 6NULA 4LAFA 3HHPA 2B36A 3CG0A 1V8ZA 1QXSA 3QMVA 1E3MA 3LFTA 2WSIA 3Q8MA 2VLBA 2C5SA 4L0CA 4MGHA 3T1QA 3PGA1 1BMTA 1RJ9B 4A8JB 4D81A 4EABA 3DCIA 3TL6A 3R74A 3VR0A 1O9HA 2D2FA 3PXXA 4TKLA 4ES6A 2N0SA 3KB6A 4XLZA 4MW0A 1JX6A 1FP4A 5EE9A 5FX2A 4N54A 1T3SA 5CVDA 5B3AA 5IHXA 3RS9A 5IJ0B 5KUTA 5KTTA 1G19A 3K8OE 5T8KC 1IY2A 1EBUA 4DIDA 3BE6A 2WUDA 3IAM6 4B3JA 3HR4A 1UUFA 4AVYA 3JQEA 5EWJA 4IO0A 4OY3A 2NNWB 3NT2A 3H2SA 1L7VC 1KS9A 2A1UB 1PQYA 3OIVA 2I22A 2J3QA 2VWPA 3KTOA 1W1WA 4Z9AA 2D2VA 1M6NA 1QKIA 1T5LA 4M1EA 1QSGA 3VKWA 2NO7A 1WVGA 8GPBA 4PQYA 2JFFA 1Z8NA 2ODBA 1CRQA 1ZI8A 4LDNA 3F8WA 3Q7TA 2JIBA 3GFSA 5ED0A 3IXMA 3AXTA 1QGDA 3IXLA 5IXSA 2XQKA 3DSRA 3JVVA 3LC2O 4QGFA 5TQ0A 4UAVA 5KX5A 4LYJA 1SMKA 4L4SA 1XTIA 4X3OA 3G7NA 5DNWA 3ZN2A 1NVFA 1M67A 4PLGA 5FYQA 3BGDA 1BS1A 2L69A 1EHYA 2A67A 4FFPA 4YTEA 3U0VA 4Q1FA 1K7CA 3K2QA 4NBLA 1I2ZA 3W7AA 2OSBA 3AHFA 3KJIA 4MUIA 1CZRA 3QE4A 3KKOA 2CKDA 4MEBA 2VS1A 4FINA 1VSUA 2JGDA 1JHYA 3TXYA 5IP5A 4KTVE 1KYWA 3F49S 2XY4A 4S3MA 4L0MA 3W6NA 2W4MA 2PBRA 5C1DA 3E0XA 2D1YA 2HO5A 4BX9A 5CX1A 2O20A 4A15A 3LD9A 2C2BA 2IEAA 5HQTA 2VRCA 3ZCRA 3K0SA 1UJ2A 3U7IA 4H7JA 4A0HA 2GB4A 4HTAA 3I2KA 1G2OA 1NQAO 5DGTA 3SSMA 2PGNA 4B31A 2HF8A 3O26A 3IB6A 1C9MA 4YFVA 4A2QA 1FA9A 5DOZA 1R5OA 3T3NA 5HBGA 2ECQA 1QTRA 1AQJA 2RI1A 3SJBA 1DCKA 4G81A 2YMPA 2V4UA 3C48A 3GDGA 1WTAA 4C0LA 2CXSA 4NK5A 3GP8A 1Y9JA 2FPKA 3OURA 3AB8A 4IJKA 5KPJA 2LDXA 3I5YA 3QKWA 4LBWA 2YVKA 1NKTA 4PZUA 4LFBB 1WMDA 3BFJA 1V6SA 1Q7RA 2F3SA 3P4YA 2P9GA 1Z8HA 4TLAA 1N3YA 5CUQA 4C08A 1I01A 4ZVPA 5AK6A 4JBXA 3IX7A 1S7GA 2FRDA 4LXTA 2MWMA 4FXOA 4OM7A 4TLMB 3QX3A 3WHKA 2EJVA 1NW6A 3CEJA 3JS5A 4HWRA 2MYPA 2F62A 4DW8A 2BHNA 1TZKA 2MIIA 3A31A 4KI0A 3CO5A 5FFFA 1ZKMA 1KJWA 4XJXA 5CB4A 3T0GA 3H8VA 3WGZA 3ZCQA 2E4AA 2GLXA 2Z9BA 4KLZA 1Y34E 3PL5A 5EMLA 5DE3A 3DBRB 3ZZ0A 4P4SB 3O1JC 3TS1A 4PSKA 4KL8S 4KQWA 3TD2A 4EHFA 3CRZA 1M2HA 1TA9A 3PZRA 3SF8B 4EYQA 1ISIA 4C01A 2YCLA 4KH0A 1K8RA 1P77A 3MJTA 2FCRA 5KYWB 3FD8A 4Q21A 5F5LA 2CHFA 1MNQA 3KSRA 3AG6A 1M6EX 1K6XA 3DZCA 4CTJA 3ACBA 2VP2A 3ZJYA 5A4MS 4M9CA 3IDFA 1KSFX 1ZCBA 3PWZA 3S1SA 1A1SA 1T25A 4F5WA 1RWWA 2JD0A 4LVNA 3SC4A 4MUNA 1TZCA 3W78A 4ZYLA 2NZVG 5E9JA 4B0OA 1A97A 3L0IB 1XMIA 2ZUCA 4AUKA 2H1WA 1VIYA 2ZRAA 2CNWD 5TQJA 5KINB 4EI8A 1XD2B 5DNAA 4XYLA 2XKJE 5EJEA 1AS2A 2PDAA 3TLEA 4MGEA 4IEIA 2CLFB 3FTQA 3NG1A 3D4OA 1JEDA 2OM6A 3UCFA 1W19A 3BSYA 2YDXA 3IAS1 1P2TA 1XRQA 1WVMA 3QLUA 4GPIB 1CQXA 2ZWPA 5GJCA 1LI4A 2FZ4A 3ELUA 5ALOA 2FU5C 2JH8A 5JDIA 2W71A 2ZUFA 3GRUA 1GPBA 3RFVA 4GI3A 1R74A 4M7RA 4PBSA 1T6BY 5F78A 1ZN9A 1Y4SA 3AEQA 4JFRA 1PK8A 3AV3A 4KRYA 2AYYA 1GVHA 1V4VA 3C15C 2E89A 5F4BA 3X1XA 3UH1A 4CQMB 5KYTA 4QATA 4QNRA 1URPA 1E9BA 2XUOA 1QNLA 3CBQA 2FWBA 3BZBA 4Y8VA 1KY5A 3O8QA 4NI5A 4PXAA 3K0FB 2HN9A 2JFPA 1YU9A 3EXEA 1O5TA 3VU3A 5JXWA 3GUYA 3PK0A 1KVTA 1NOJA 2QVXX 3E22B 1LX7A 3JZAA 4KRXA 4ACAA 4ZHQF 3REOA 5EOVA 2KWIA 5J4LA 2G1AA 1T5SA 1ZD1A 3AM3A 4EB3A 2KYRA 3MJCA 1J20A 2NT3A 4NG5A 5F5NA 1ZR4A 3TLKA 1BFUA 4O02B 2JBWA 2J9ZB 2HHAA 4FMDB 1E9RA 3QF4B 1YVUA 4ZANA 1XXLA 3WSWA 1VCNA 3ROXA 1Z4PX 3VSEA 2CW5A 1VA4A 4GWLA 4Y2VA 5LMZA 5FFMA 1DBWA 1CJSA 3S2EA 4QOJA 3I6IA 4ZZ0A 1ZMTA 2UV8A 3GMTA 2XUQA 1LTHR 2XD9A 1V16B 1TU4A 3EODA 3ITEA 4RSRA 1NIJA 3WK4A 4ZT2A 3N70A 2G1PA 1O8BA 4P31A 4GYJA 3SIXA 2W2XA 4YB8A 3I1YA 1T2DA 3QEJA 2FMUA 1J9GA 1YZLA 3LGSA 1TQ6A 3ML1A 5CH8A 1M5RA 2PMKA 1ISPA 3PSHA 4B3TB 4Q3OA 4EGAA 1L3CA 4DC0A 1CUVA 1X9IA 4L15A 3B3QA 4QAJA 1GIAA 3INRA 3ZE6A 1U90A 3U7QA 5GONA 1H22A 3GMSA 4DLNA 1KQNA 3DAHA 1BU8A 4F2WA 3G8BA 3NTVA 1XJCA 3M6MD 1UP7A 5B1SA 1UQUA 1A9XA 4HI0E 2R68A 2B2NA 3V6LA 1QGUA 2C99A 3D1VA 1CRWG 2F90A 1C41A 3ETGA 3HKEA 5K01A 2OFWA 3TL2A 4BP9A 1TKCA 1LF5A 1T2VA 3KALA 1TOAA 3H2HA 4LRUA 4KOAA 3H19A 4GQBA 2AOTB 3WBBA 1FW6A 1A2QA 2E49A 1R8YA 1PGPA 2JH9A 4G4IA 2YV2A 4IIJF 3SR3A 2YHBA 3DKPA 4M8KA 3VPHA 4HWOA 2OCBA 4O4JA 1SHLA 4X1KA 4CR8A 4FTWA 4ZAGA 1WBBA 2JC3A 4X41A 1G5FA 2PQ2A 4D9IA 2SKEA 2XOEA 2YVQA 4G86A 3RUIA 1CR4A 4RGVA 4AXXA 1V4BA 4BWFB 3OQOA 4D0LB 1NP3A 1DIOB 3JQ7A 4QOEA 1JLRA 1NHWA 3W8RA 3DC7A 3HGMA 4D4MA 4GMDA 4XH9B 3BE8A 1Y82A 1SVMA 1KORA 2WE8A 4IHJF 4A73A 2DETA 4LGYA 1VJGA 1IPEA 3KR1A 1HZZC 4WA7A 1Z0JA 4Y6SA 5G4KB 5TSDA 2UUBB 1K3FA 5TEVA 1KJZA 2JCVA 1YT5A 3DQPA 3ND9A 1E2BA 1ZOPA 4EP1A 1C0KA 2DT5A 3QUSA 1MQ9A 1A9ZA 2KW5A 3JZFA 3L40A 2ORWA 1FXUA 2DTXA 4JOQA 3T3MB 3HXMA 4TVSA 5EJ9A 2Q45A 1P1KA 1C3VA 2WJWA 1NW3A 3NGMA 1FRNA 2FJUA 4TM7A 1C81A 5LOVB 1RHMA 3WRYA 3NV7A 4WCFB 4L8VA 2NG1A 2G72A 2O0HA 4EUNA 1HC7A 4Q7JB 1SBNE 1XQ1A 2VFAA 5JH7A 1PJ2A 3CRVA 2OGTA 3RU9A 3H6HA 1R16A 1JL3A 2RGUA 2QRHA 4HQRA 4PZAA 2E37A 3AI7A 5COQA 7AT1A 1K4KA 1PT8A 2GYUA 4MUAA 4OI4A 1AHPA 2B7LA 4FHFA 3VC2A 2O3UA 5I9BA 4DYVA 1USIA 4JZYA 4HWSA 4JFAA 2XMCA 4CM4B 3GJZA 4FT4A 4XDZA 3PQFA 4ZA2A 5J5VA 3JQQA 5EIWA 4K6GA 2BSQA 1ADGA 1DSSG 4LBYA 1MMFB 4Q16A 4N0MA 3TRIA 3EF1A 5G0VA 4JEMA 4H4EA 3MF4A 2YXEA 4ZAWA 1KZYC 2FXIA 3W9UA 5IYZB 3UV7A 1CFJA 1R6VA 4ND8B 2VO1A 3TOSA 3CX6A 2IZ6A 3IOMA 3L92A 4GI7A 4W1PA 3ZW9A 1AKMA 3R5XA 2IOFA 2VL7A 1HDYA 5LYJA 3D2BA 1QH8B 2IPXA 2JHGA 1TVKB 4MMYB 4MVCA 1NQ5A 3DONA 4N5NA 4NJEB 2ZJ0A 2XNSA 1PK9A 1RKBA 3H2ZA 3OZRA 1VGRA 2AMFA 4F46A 1Y8RB 2G28A 4YMWA 1JKFA 4FD2A 5AVZA 1KDOA 1J2TA 2QTZA 5EZ6B 1W88A 4JYBA 4HK4A 1VMIA 4PHHA 5C3MA 4IW3B 5LQJA 3LZCA 2G7MC 2VDRB 3OOJA 3KD3A 3F9RA 3LY9A 1MAVA 4QDTA 4BMNA 2G5CA 2R7AA 2E18A 4YAUA 3EBPA 5LZ9A 4OXKA 4JT4A 5KYNA 2BFWA 3UCEA 1LLFA 4BFVA 1RXYA 5F4ZA 1DMRA 4GL4A 3GJRA 5TR9A 2W2LA 1E3SA 3KFLA 2YMLA 2EHDA 4DNPA 3MINA 2OQIA 4KIGA 3ZTTA 4B0PA 4I4TF 5EJ8A 2B5OA 3LUDA 4L57A 4J8PA 1T36A 1Y7LA 3NAZA 3CVOA 4HMQA 4HSEA 5DYGA 5IVDA 1Z22A 4HDAA 1UP4A 1QCCA 4BJ6A 5LM3A 4LZNA 5FF9A 1S1CA 1VKNA 1V25A 4BZZA 4HWGA 4A5SA 4MVJI 1W1IA 1ECFA 3HFSA 3R3UA 2O5RA 2Y1LA 3P5SA 4L4UA 3RTDA 1XMQB 3E1KA 3DOFA 4WUTA 2AS0A 2QWXA 2ZRBA 4RFVA 4C0KA 4YV7A 1FFXB 5DKFA 2YWDA 3E2MA 1IJBA 1WMAA 2AFVA 1R3DA 3HCRA 3IPXA 3K5HA 1SD1A 2QM7A 5DYYA 3L6EA 4LDQA 5ALHA 4EKEA 3U4GA 4LX0A 2C29D 3AEXA 5I7UA 4FU0A 5FOWA 1SQGA 2FA9A 3KR2A 3LMKA 4FNMA 4DJFC 4F04A 2G8NA 2WD7A 2BR5A 4NICA 3ZQUA 4HOYA 5HQ3A 5E9AA 5F9FA 4UNRA 3VKHA 2POCA 3KKZA 1Q57A 3L4SO 1UFRA 5DEOA 4ZCSA 4YRMA 1E1YA 1SC4A 4W1RA 5AKHA 3WSVA 5JSUA 3L6OO 1KVSA 4OCZA 3SNHA 5B2EA 1NVMB 4MUEA 1U7OA 4N7MA 4N48A 2AI2A 5KAPA 1R50A 4P3YA 4XUDA 4ZQBA 3S1AB 1CUFA 1G20B 5IEJA 4RIHA 3HDYA 4FM9A 1LBIA 1NNEA 3PWTA 3UW1A 2O5EA 4XYMA 3DEYX 4NSNA 4QSHA 1KBZA 3WVNA 2FYTA 3HA5A 5JJCA 4EIWA 1WMEA 2PSDA 1EEXB 2WM9B 1WUHS 3I3SR 1N2GA 2FHPA 2G1JA 2H0AA 3PR2B 5DP1A 2YS6A 1HEUA 5LQMA 6LDHA 1XK7A 2OUKA 4IUBS 3L43A 5FWYA 1MX5A 4RL4A 1E4YA 1P5HA 2FR1A 1YDMA 3AR8A 3KETA 1MO2A 1UADA 4M36A 5JU6A 4OMFG 2DERA 4B3BA 3DWIA 3GW8A 3CWZA 1U3WA 3U4HA 4C6HA 5A2QA 4M53A 2BP7B 2GJ9A 2R79A 4UPDA 4WK4B 5DK4A 2CFSA 3SEQA 2CXNA 5FOQA 2JIDA 1V5EA 4D9MA 2GM3A 3B1ZA 3DC2A 5EGNA 1MEEA 1LV7A 2ABWA 5A7GA 5C4IA 3VTFA 2I1WA 2J0UA 5CDFE 1QAMA 4PZDA 3G0GA 5BQPA 1GCUA 1WWKA 1G55A 2JNWA 3QKTA 3P7MA 4B4OA 4G1FA 3HU1A 2KBEA 3L0PA 3UVEA 1JH9A 2VNHA 1Q7TA 3DD5A 3RS0A 1HWYA 1KO1A 1QPZA 4WIAA 3GLIE 1ZGZA 3FM9A 1P6QA 3I01M 3NBUA 3T5GA 1T2NA 2BRUC 3K9HA 2VH2A 4NAHA 4Y0AA 3EQZA 1P4JA 2ERYA 2VF4X 1L5QA 3ADBA 3VNQA 3KU1A 4M6WA 4D5EA 2V6MA 3A3YA 3K73O 2HJ9A 2JBHA 4ATNA 2OZPA 2PQMA 3BXEA 1NW7A 2NN3C 3U5TA 5KYKA 3ESXA 1X0XA 3EC1A 4Q3CA 3WYCA 3DFKA 4X20A 1DLJA 5TDHA 5G0WA 3ZUPA 1VL5A 1LZLA 2CL0X 3WWYA 5LPNA 4LF8B 1Y4ZA 4RDHA 2DFNA 2ZTLA 1GT91 1NJ8A 2QIPA 1KSJA 2GD0A 1P0IA 2QP3A 1PDOA 4IJ5A 5CP8A 2D6FA 2XCLA 1NY6A 1COWA 3AJAA 5EJ2A 5H0IA 2IXBA 4O1HA 1FYFA 3BT7A 3CLRD 2JATA 4C9BA 3HCNA 4P4TA 3VHQA 1XZLA 2REBA 1K9SA 1TAHA 3M9LA 4LYAA 4KCGA 4DHEA 3WDLA 3ZVKA 3QEBZ 2W22A 3ENWA 3J81k 3FA2A 2ZS7A 3L49A 1TO6A 1UJ6A 2BLNA 2VF7A 3D7LA 4R2IA 4E30A 2Z6AA 2C3UA 3SXUA 4B73A 3PL1A 3FLMA 4L75A 1I7DA 5K0EA 1H6BA 3B9RA 4H4CA 4OA5A 3WGNA 2IYWA 3TGLA 4J16C 1N2CB 1GSIA 4WKPA 5DBOA 5DHUA 4CZ2A 3DAGA 3QEKA 5M7EA 1Z4JA 1EB8A 3L7CA 2ASVA 2CT8A 3G0HA 3CUYA 2B5WA 1AF7A 1E5LA 2CL6X 3PUVA 4I4LA 4WINA 3WI7A 3OU6A 4PRYA 2ATXA 4RJLA 4UEWA 1IHPA 3SHVA 3PR1A 2EW2A 3OCVA 3Q1KA 4RD4A 2WB2A 3DTTA 4RX1A 3ZGYA 1CP2A 4KMMA 4HGRA 4GL2A 2XH8A 3TNYA 1EE9A 4LYGA 1CUSA 3VAAA 3H1TA 4PCAA 1CDDA 5BN1A 2EF1A 3R0ZA 4HEQA 4AROA 1H42A 1H2HA 2PZJA 3F3KA 1IN6A 4FR0A 2G0NA 5H70A 1FXWF 4Q39A 2AR0A 2P9QA 2Q6OA 3BWYA 2CXUA 3O4RA 2QZ9A 3HBJA 3MJEA 4NDAA 4QLOA 2JDID 1LDBA 3LK6A 2ZM6B 4FPXA 5LYYA 2DXIA 1QRRA 1VCHA 1ZH4A 1E6EA 2PKEA 1WMFA 3DB1A 3QFTA 1JDVA 2G9UA 3IKJA 4L27A 4MQFA 1OIXA 2Y0PA 4RJ2A 4TSRA 4DLXA 1B00A 3AY7A 4P9NA 4E03A 1ZIPA 2W2PA 1ZJJA 1HETA 4OXIA 5C31A 3RUHA 3C5EA 3T5MA 1E5VA 1OSNA 2IY7A 3NIDB 4XEUA 1HYEA 5BYBA 1WKCA 2FN7A 3DL0A 5AKJA 3GMIA 4AF8A 2RHLA 4E46A 1O3YA 4R8LA 2WQ6A 1L7XA 2BW0A 3K1ZA 1FDVA 3HUTA 2JVIA 2UDPA 2YHSA 4FHCA 3G9TA 5SY6A 4M0FA 3WWOA 3B60A 4TL9A 4UOZA 4LGVA 1KJIA 4NK4A 2IFTA 2V7QD 3P20A 1ZJ5A 1ZW1A 2XLCA 4EKDA 2H9YA 3GZJA 1RAAA 1LI5A 3OOWA 3WL6A 5C5DA 1DMSA 2E4VA 4JLVA 1VM6A 5EJIA 1T9BA 4RAOA 4K0RA 4MLDA 1PK7A 5CM9C 5DHFA 4TTSA 4HNUA 1JZTA 3SQWA 1F1BA 4D96A 3IAM1 2P78A 4DPLA 4YJFB 5GJVC 2D62A 3CY6A 4QBFA 5HW0A 2FPGB 2Z58A 3BMCA 3E4DA 3QBTA 3RSQA 1YBVA 5CU7A 4E5YA 1JYFA 2HIGA 1TTTA 2O8DA 4WXEA 3BQ9A 5HP4A 4U7FA 3GH3A 1J00A 3HUDA 5DPMA 4JLMA 3HWWA 3IDSA 4MIKA 3F5DA 2ZJ4A 4MWGA 4LC9A 4Q18A 4TTQA 3KEOA 3UANA 3FOAA 2OHJA 3OAAD 1MP0A 4IQ4A 3KYBA 4RHYA 4X1IB 3AVVA 2I76A 1D6SA 1NM5A 1P39A 1WD7A 1Z6TA 5DK6A 1A88A 4C29A 4YLGA 1BJTA 4ND2A 4YWHA 3PFGA 3UHOA 3CZQA 1T24A 4TSFA 1NVVQ 2GN8A 3NPAA 3DT8A 4XQCA 1QVWA 4FFVA 3COSA 4US1R 1QMPA 1LX6A 3VU9A 1GPUA 3HEAA 2WJ4A 3C24A 4AP5A 4NE7A 1MO3A 1QS0B 1KYVA 1U80A 3EASA 2IIQA 1DBSA 4M9QA 3RUEA 3ZTWA 4UXJA 4BCCA 2DF8A 4D80A 1W52X 1MO6A 1OB5A 5TJHA 2WPNA 3TLJA 1EDZA 3I6ZA 3ZZUA 3P2KA 2G4LA 1IUPA 3REGA 4DAEA 1V3TA 2QQGA 3LT2A 4R1OA 1P9OA 2EIXA 2O7NA 3NHJA 1PG2A 4FOTA 4XWYA 1S2NA 3UT5A 2VK8A 6Q21A 2O2HA 1QHGA 1PT5A 5CEFA 4RVUA 2Q49A 1WCIB 1OXUA 4CNQA 1M0WA 1WZ2A 4MIYA 4HY3A 5DISB 5JT1A 1Q1ZA 2KMLA 3EISA 2YUIA 1JHVA 4N5DA 3HXKA 1SXIA 3MYYA 1OU0A 5J4VA 1SCNE 3E53A 3C39A 4LJ6A 2YW9A 3UAYA 4JXJA 3ND8A 4ZIRA 3BD9A 1MV5A 2CJXA 2IZOA 2QPLA 3IUBA 4X8MA 3ZE9A 1D4AA 3ZHYA 1W9MA 5ALYA 5DHTA 1DFIA 4HDKA 2OYSA 1Z0FA 1GARA 1RQNA 3BFKA 2R5WA 3OIGA 4AS3A 3WS7A 4DYDA 1E3EA 4G5RA 1V1JA 3RPEA 2CD9A 1XO1A 4M38A 3M3DA 4J3FA 1X9HA 3G13A 5CVJA 3ISTA 4BCDA 1XZAA 2BUAA 2YN4A 2YR0A 3FCEA 1F8FA 1M1XB 1GUDA 2JRCA 2ZT6A 3QLTA 5AHXA 2Y6UA 4BMYA 4IJQA 5TS2A 1ORHA 4PNEA 2UZ4A 4MR7B 1JJBA 2C78A 1WXQA 5COBA 2OD9A 2YVUA 2Z09A 1Q50A 2JFXA 3RG2A 4PTLA 1V3VA 4M8LA 3GLGB 1MTZA 2BE7A 2QAGC 2Z56A 2C9YA 5FJJA 5GZ6A 3S5JA 1Z25A 4B45A 3VZDA 1NMZA 5EKSA 4JV5B 1CY0A 3CX3A 5AIAA 1SG9A 4TMYA 4FGKA 4XJSA 3I01A 5KB3A 1OXMA 2JF0A 2Q28A 1PLJA 2VJMA 4A0RA 1LS6A 4XSVA 1GD1O 3NDPA 3SSNA 1ID8A 5K6AC 3EIXA 1NQUA 2O0MA 2ON6A 1SH7A 3G2KA 5HBRA 5IAOA 4MGZR 1UKAA 2IEZA 4BMZA 5M34A 4RHCA 1YL7A 4F11A 1IY8A 2EEPA 3L1IA 2ZJ7A 1Q1EA 8OHMA 2H0QA 4C06A 1KZ1A 2JVJA 2Q5HA 1GYRA 2CVOA 2FY8A 2ZCUA 3DWFA 3M9XA 1PGNA 1PNVA 1B3RA 1KXZA 5FNVB 4AS1A 4OJNA 2OE2A 1OFVA 4DV6B 4WOCA 1HQCA 4R54A 4DXDA 1PNTA 3CURA 1EWRA 3OQ6A 2VRWA 4BUCA 5CLJA 2JZNA 2DTEA 3C0KA 1NMYA 1Z7WA 3O7WA 4UBJA 3PRKE 13PKA 1RJEA 3KYCB 3LLSA 1BE0A 1U0RA 4IGEA 4MXDA 1HTTA 3ZVRA 1DP4A 3OZUA 2VC2B 5LQCA 4KDCA 5GJBA 4QJ3A 4JIGA 4ICIA 4NBWA 2WIJA 2QZSA 3ESCA 2J9XB 4JWTA 4GX2A 4OB6A 3TZHA 4Y1GA 2VZEA 3P94A 1P2BA 4U9UA 2WJVA 2FR8C 3SX0A 1UDBA 4AQDA 2VZ0A 1ISRA 1H94A 1LKZA 4MS3A 2C2GA 2WZBA 2JAWA 2P41A 1II8B 2QSJA 3BL6A 2JLYA 2PT7A 4LKOA 2J9GA 5KBYA 1DBPA 1PT6A 2O2GA 1BMDA 2QUHA 4D82A 4CU5A 5AW9A 3DJYA 1O58A 3GGOA 3GNTA 3B85A 1DWOA 3TK1A 1PNQA 5FPKA 2OO5C 1IG3A 3A28A 3C4QA 3BXFA 4RV9A 1M2FA 1CUZA 1KE1A 5HUQA 1U1EA 2Z9CA 2FJPA 3CVUA 2Q3DA 4M76B 3DKIA 3L7AA 3IPRA 4QTZA 1PJLA 1H6CA 1CS0B 2GNAA 2P6OA 4JENA 2I7CA 4HJXA 1GA4A 4KWIA 2KPOA 4A16A 3I9MA 2Q8NA 3U2QA 2R9VA 4WK0B 1O1YA 3M34A 2W2KA 5B3JA 3GFGA 3EXG2 2ZI4A 1HYGA 3DCNA 5EQDA 1DRWA 1I6KA 1M8FA 2A9OA 1ZAYA 2AFHA 2K7ZA 1H2FA 5BP7A 4HRYA 1YJ8A 3OT4A 3W1WA 3ZDYB 2BFCB 3F6RA 2QORA 4KQXA 5F3DA 1OGIA 4I4TA 2R7MA 3L02A 1QFYA 4MJXA 1WDLA 4FIDA 1DAHA 1EI9A 2XNCA 4QDUA 1PQPA 3JPWA 2VUHB 1NXOA 2H2WA 4R2HA 1E5TA 3M5WA 3KVNA 5TQVA 1B76A 3ORRA 5EZ5A 4H7PA 1DXYA 4CG0A 3EH2A 1KJJA 4YUZA 3OMLA 3QG5A 4C4SA 1MW9X 4BJ3A 5JYBA 5LZ5A 5KNCD 1E94E 2BUBA 4OK5A 5AUNB 4C2AA 3FCXA 1CVLA 3HKCB 1M6YA 3UXYA 3TH5A 3ZDFA 1E1QD 1GQRA 2LUOA 2P6NA 3GF4A 5G1PA 4L5AA 5AW8A 4CLHA 3G5LA 5FPTA 1GZVA 4GOLD 1QWSA 2QRKA 4J0FA 5K3FA 5ICSA 1I5OA 1H0RA 1L4NA 4UJ5A 5FTLA 1HNWB 2DWCA 1E2DA 5DN6D 1RRMA 2NXNA 4KVAA 2J87A 4WY8A 4KIUA 4Y2TA 2FUG6 3HRIA 4XGKA 2CL5A 2D2XA 4UOEA 1VIVA 2JFQA 3MWYW 5GP1A 3HB0A 3RCBA 3OLCX 3NGLA 3I9FA 3X1JA 4JLJA 1RFGE 1UEJA 4BFCA 1M83A 3WMXA 1FS4A 3CZMA 4G0MA 3CR3C 1QVAA 3QJ5A 1A1VA 2CNBA 4KFRA 3G0OA 4R8SA 5FPQA 2Z08A 5C4GB 3OVMA 2FXVA 3HCWA 4QPCA 2GEVA 2ODQA 1X1RA 1IN8A 3ZBTA 1U7XA 4NOKA 5F35A 1ABFA 1O57A 5JPIA 5IF3A 5DNDA 3HY4A 3JQ9C 1SXJA 2AOXA 2C4UA 1W5EA 3RRXA 1LLQA 1U0LA 3DV0A 1SJ9A 4ZCPA 4D0RA 4DS3A 4HXGA 5JSQA 3U1BA 1IM5A 3EPRA 2X15A 3SS8A 3VYRB 3IJ5A 4FE3A 3M6IA 2DECA 4MRMB 1GNSA 4N6GA 2VQ6A 1OMOA 2BHRA 2WUVA 2G40A 2JEZA 1TYAE 3AESB 4MQ4A 2J67A 3FG9A 5EHQA 4DQUA 4N8DA 1T3HA 3M6VA 4UVHA 1JLHA 1SXQA 3A25A 2GWRA 5DOVA 5I4CA 5GMOA 4IMRA 3L4JA 4BNIA 4R8VA 1GT6A 1UJMA 3WZ2A 4RJTA 3FPSA 4YPOA 2ZBRA 2ZE5A 1AKWA 4CQNA 4HAWA 1TF2A 3GQBB 3RT9A 4JVNA 1RHKA 2VP9A 2GJ8A 4U2KA 3CVXA 3AIKA 1R4MA 2JI4A 4D9JA 3M3PA 1O4VA 2W6PA 3BSWA 4HLCA 4IL5A 4IYRA 4LE2A 5KNDD 3HXQA 2WG2A 5EKUA 4BMSA 1TEZA 2IH2A 2VCEA 2Y67A 5LMNB 2ZSAA 2RHGB 3ETDA 4EDHA 1O6ZA 1QMGA 1T9GR 3DBVO 1Z6ZA 4DCSA 5E4JA 3DD1A 3IEUA 1NYTA 3OJXA 4G26A 2EWVA 3T3HA 3ILSA 4BVGA 3QUTA 1RYHA 1EAYA 1CQJA 2AKAB 4KODA 3HRHA 2WWTA 5BMOA 1N8TA 1D2MA 2WSBA 4H7FA 3M81A 1FRFS 4RPKA 1YONA 4PIVA 1G8FA 1GDDA 3HB1A 4LOAA 1EG2A 2J3IA 2YV1A 4AJPA 3PA8A 4DE5A 5L8VA 1Q6ZA 2P30A 3VO1A 4UZEA 4JEHA 5JNTA 4BFXA 2DAPA 5AVXA 1X7HA 1FDWA 4E7PA 3NHBA 1TMOA 3NBKA 4LFCB 1L5KA 4RL6A 4IH9A 5JY1A 3NM4A 3U3ZA 3GDHA 3O92A 2BTOA 1WLYA 2C1EA 4B8WA 3NFYA 4QLBA 2I87A 4ABTA 1K4MA 1UK9A 4LX8A 5TX7A 3SCZA 1U1DA 3FBTA 4IUDS 5JR3A 5AHOA 1I9CA 4EJ6A 3FBGA 2G4CA 3IERA 4OK3A 1W4RA 4M89A 3UPUA 1MOPA 4XKJA 5DW3A 3LUJA 5DT9A 3D4PA 4MRPA 2B8JA 1T26A 3JAKA 4U5QA 3ZZ1A 3A9UA 4EB8A 1NULA 4P1ZA 1QC5A 1C9DB 1BIFA 1RLOA 2DPMA 3O73A 5HSGA 4M1QA 4MIOA 3BJIC 5J47A 3D9QX 1JDZA 1HQYE 2R85A 3AILA 3H4IA 5JASA 1R6DA 3SJUA 3RS8A 1EZZA 3L01A 3QX8A 1THZA 2FZGA 2E4WA 3GT3A 4FUTA 4TWRA 3U1VA 1U63A 1T29A 4BBAA 2NTJA 2CZQA 3Q98A 4PPGA 3VJMA 1PTKA 1DAGA 3OP4A 3EUFA 3INGA 5HZHA 1WABA 1KFBB 4JB3A 4LG1A 4ISBA 1DAOA 3IE1A 3SHTA 1IOZA 4B4VA 3N0TA 4KGZA 5KNBH 4Z53A 1RCFA 1PJQA 1NLFA 1KRXA 4XJTA 4C0QC 5DLPA 1IQPA 5L3RA 5H3LA 5CFOA 2JHAA 2O7VA 2BZ1A 3A6DA 4YQYA 1FXSA 1E92A 1MA3A 2GBLA 2V4ZA 4X45A 3UNXA 3OQMA 2I99A 3UIEA 3CH5A 3BD6A 1C1YA 2CF6A 3NBXX 3D7RA 1B8OA 1Y1RA 2CEKA 4ZO8A 3HK2A 3QITA 1WB6A 1L1EA 4HDMB 5J2TA 2ZSEA 4G2NA 3HC7A 4DA4A 2ZWOA 1R0CA 1SKMA 2CYAA 4QOSA 1NLYA 3JQFA 4D5GA 2O8EA 3MFYA 5CR9A 5FUVA 4JZKA 4DR1B 5A0VA 3VZQA 5CTJA 4DLAA 4HLNA 2HWYA 1J8VA 1OZAA 3BIJA 3C98A 1USWA 2IRWA 1UBMS 4FONA 1AKYA 4K8RB 4DIEA 4J75A 2ZWAA 1ZA2A 1K8QA 2VHZA 1E2KA 3P9XA 2QL6A 4R9NA 1CUAA 1NXTA 1PV2A 5ADVA 4ZVQA 4LDPA 1FSZA 5D7NA 4ENVA 4DNFA 5HE9A 3ZDQA 3L4EA 3DF9A 1GO2A 2R8RA 3RROA 2QUAA 3B78A 1DG3A 4D4JA 1SA0B 3WRWA 2V58A 2R6DA 3FWZA 1PO7A 4ZJPA 4UOQA 1WLSA 5CCXA 4TMWA 1X8KA 2IVFA 3A4MA 3S70A 1B7GO 1IU9A 2P69A 3KJZA 2CZGA 3I28A 4O29A 3M1IA 3O74A 3G1WA 1Y8QA 3AINA 4RLHA 4CT4B 1HA3A 3Q72A 1KR2A 1GN8A 1O94A 3S2IA 4RFSA 2CLHB 1VB5A 1BDBA 3RVPA 4EYGA 2Z8YM 2J3LA 2XXBA 3QENA 4I4NA 1C7QA 3QPVA 4M1TA 4D56A 3IPLA 4GD3Q 3RABA 3PGMA 4BP1A 2WWYA 3EXIA 2Q7XA 2PRYA 2XODA 3ZCSA 2JB9A 3FZYA 1ZU4A 3BJZA 1N92A 4RYLA 5F52A 3ZS8A 1PJ3A 1Y6FA 2R00C 3K15A 5TGTA 5JCJD 1Q15A 3JWPA 5AI6A 2VPZA 3MS4A 4FFBA 2AHOA 2HF2A 1H9BA 4X7BA 4R69A 4I99A 1YDWA 3U3MA 4AJ9A 3GFPA 1HO3A 2OCYC 2XWPA 3T6KA 1IBRA 3O1HB 4RK7A 3ECAA 5F5XA 4WASA 1Q77A 4FKMA 4TV8A 3WIDA 4H1TA 3H0CA 1I1OA 1ORWA 4XB6B 3N7TA 3ED1A 5HUJA 1RCTE 3R6LA 1N6IA 4DLLA 3DVAB 5EJMA 5IYZF 4HTFA 2OBMA 1SVUA 3VTAA 4BFSA 3RG8A 4M1KA 4DXHA 1R5BA 1WUJS 4KO2S 4IV0A 5ECYA 4V0QA 5A4JA 1UZLA 5JMOA 3LTNC 2UUPA 1YMUA 2AFIE 3OPYI 1XU4A 5FH9A 1Z9BA 2D2EA 2OHIA 4YJ2F 1HG1A 3SDSA 3GR6A 1L8AA 3PKZA 1OFIA 3B6MA 2IUSA 2WYOA 3GJ0A 2WF8A 4O3FA 1E69A 5CLGA 1YI1A 3TZLA 4C3UA 5AM1A 4BRSA 3KQSA 1S5PA 2NU6A 3NUZA 2WWRA 5CRIA 3GFTA 1VKJA 4M9SA 4XX0A 3HSKA 3WWEA 3MRSA 1J0XO 2JDIA 3OLXA 1SXGA 4JC4A 5FLEX 3VV2A 2B6NA 3TEJA 5FWXB 1TYZA 1QHHA 2I34A 2UAGA 2J09A 1WKVA 4KYVA 3KKNA 3QEOA 3MVEA 3OG9A 1UJCA 2HRDA 2QJTA 3USCS 4MS1B 3I04M 1XRRA 5IXJA 3NHYA 1FLAA 2BLLA 3KDAA 3Q3IA 2Z2IA 1QM5A 4AWAA 4PX9A 2PKWA 3RS3A 5J4KA 3FYDA 3WWDA 5TQ2B 1UOEA 1QV9A 1FNSA 3CS3A 2VQFB 1U2SA 1I24A 4N18A 1UMCA 1YR6A 2V45A 1QHNA 3E3OA 1MORA 3K4QA 4PAOA 5EAIA 3BZUA 3DE3X 1YI0A 2UZAA 4Q9KA 3LLVA 1WHSB 1IBLB 3CCBA 1IN1A 4ILEA 1EFKA 4L50A 5EPUA 1GCIA 2PKXA 3BK7A 1T9CA 5DTJA 3G1TA 1VFPA 5HKLA 1VPLA 5JTTA 1SCJA 3HHEA 1NLUA 2CJWA 2X19A 2AW5A 3RS5A 4Q4CA 1P1FA 2YNMC 1ESCA 4JLNA 4KUEA 1F4VA 1CLUA 3WWZA 4LC0A 3P2YA 5K6TA 1PJZA 1QOPB 1BN7A 2CDRA 4GLJA 2B92A 3R3ZA 4NEHB 2IC5A 4YPVA 3KD2A 3O03A 2FMTA 2DB3A 1P7YA 1XZPA 1U5AA 2PMBA 3PDUA 3P9NA 5F2OA 4AJJA 1F2UA 3R6WA 1U3VA 3NDBB 3NVKI 5AOCA 3RASA 1Q16A 3UATA 5B58C 5LFAA 3ZY3A 4AQ7A 5CD1A 1PWHA 3IQDB 1T8RA 3EFHA 1ADYA 4DR6B 5EG5A 3RU2A 4RXTA 2J5QA 3CEPB 4ZVLA 4F85A 3B8HA 4IYJA 1FMTA 3IUPA 4I8XA 3ASYA 3DB2A 1XFDA 5EHXA 1TCBA 3OAAA 2H1OA 1WCWA 4EWLA 2EJWA 2IT1A 2VEDA 4KIJA 2F7SA 4ITVA 4L9WA 1RJ9A 1L8QA 4A8JA 3AFGA 2EL9A 2VSNA 3L4BC 4Q7KA 2BHLA 3IJPA 4KIWA 4TOIA 2WR8A 1W75A 5ANRB 2GT1A 1QRDA 2YFHA 2QSYA 4TL7A 2VDMB 5E7QA 4BVEA 4EB6B 1OGYA 5IJ0A 1EXDA 4ZGGA 2V5AA 4AD8A 2B1RA 4K46A 2HM7A 2HCJB 5JAUA 3S68A 3RYCB 3E15A 3LPDA 3I8SA 1OWLA 4H6WA 4C0HA 1XRNA 5LU9A 3S1LA 5LL6P 5LZ8A 2WKSA 1R2QA 3ETHA 3BJMA 4NBKA 1G8KA 3CLKA 2A1UA 2R1TB 4Q5IA 3PYXA 3ROMA 2FRVA 3AM5A 3R0JA 4EDFA 1QP8A 3KQMA 4GRAA 1GU0A 3C6MA 3B2NA 2H9IA 4YDRA 3QLVC 3VR5A 1C8BA 3PE3A 3ICOA 3MSCA 3NBQA 4G1CA 4RLFA 1XVVA 3DM5A 3GN1A 1C3OB 2R7LA 5HEKA 2VDLB 2WINI 3T7EA 4OHVA 1SKUA 4JI8B 4XGQA 3PTZA 2YBEA 3UB3A 3C97A 4B3CA 2EC5A 3D4IA 3GJYA 4PTZA 1OUMA 3DLPX 4C78A 3LQFA 3PV0A 1GQQA 3Q5GA 2FLVA 2O5VA 3A1CA 4H0CA 3B48A 5TARA 1I6LA 3X1YA 3EPKA 3G49A 2PBLA 4X92A 3O90A 2AI3A 4JU9A 3IVCA 1GL3A 2OO3A 4JYAB 4XR4A 4PIPA 3QPUA 4QE3A 4WSOA 2CFIA 3B3AA 4GXQA 4BX8A 4RJIA 2Q27A 1HR0B 2RI6A 3MN1A 4LJ5A 4OQQA 3INNA 3FIUA 4MR9B 4ASUD 1L5ZA 4QQRA 3AEUB 2N42A 4MW2A 2WHEA 1R10A 3TRFA 4C4PA 5JNLA 1GITA 1H4VB 3FUXA 4N3AA 3WZMA 2R5NA 2YZ2A 3FCSB 5KDLA 3I9NA 5JAZA 1OWMA 5EJ6A 3FHOA 5EJ7A 2BBTA 1S96A 1ZM3A 2ORIA 2FUCA 3P4XA 4PS1A 1JIUA 2QD4A 4BNVA 4ZI7F 3A10A 4XJVA 2PGAA 1QF6A 3B82A 4D8TA 3PRHA 4QBGB 2BVNA 2O3JA 3LPMA 2PWYA 1NAHA 1U28A 2C96A 5CFNA 3B1WA 4MYTA 5T64A 1UT6A 2JLSA 5AM2A 3SKVA 2ZJ3A 3PNLA 1FYEA 1PBNA 4FYIA 4E0BA 2O8BB 5KJ6A 4WEQA 4XVUA 3T3PB 3DPIA 3DLCA 4ZYTA 3TW4A 2OESA 1HH4A 4H7HA 4ON9A 3VFDA 1TM2A 1IIBA 1I6WA 4EEXA 4LKRA 3SZLA 1W87A 3LOUA 3LP5A 4FCWA 2FE4A 3KP1A 1UCFA 4I9NA 2Z8YA 4OGFA 4XQ9A 5BR7A 1M5TA 4OXXA 3WGTA 5JMWA 3PHHA 1I1QB 3MTEA 3OC0A 2JW5A 4IQFA 5IWCA 1JMKC 2HLNA 3K3PA 3IVRA 5LZ2A 4FD3A 4DR5B 3G02A 4ZCIA 1UWKA 1BC5A 3DBRA 3VBEA 4P4SA 1SCKA 2DUJA 2HQBA 2YASA 4KXWA 2E7ZA 3MAJA 2Z98A 3N8KA 2I8LA 3IP7A 3BJEA 3SF8A 1ID1A 2UXBB 3PUHA 5KYWA 1PZXA 3M1LA 1LDYA 3BICA 2IIVA 4RH1A 4P92A 2P40A 1RS0A 2QROA 5LQNA 1X2EA 1E2NA 4GNKA 4QFCA 4F9GA 4OX9Y 1AKEA 1VYVA 4RBNA 3LXUX 4ZQHA 1C9YA 1JT9A 4R9VA 4ZYWA 3PLRA 3IQGX 4KWCA 5DFAA 4ZXPA 5JDCC 4MMXB 2OHHA 4OQFA 5DMHA 3ZWPA 7YASA 1XD2A 3N8IA 2FPSA 1KEZA 4XVRA 4EMBA 1QRUA 4NXNB 5GTDA 3PFNA 2FN4A 4CE6A 3FHLA 4YRZA 1OBVA 2Y6VA 4PXYA 4RD6A 3S44A 1EEHA 2CLOB 3HABA 1TJPB 3FWPA 2UYGA 4YO7A 1IHDA 3WOHA 1JMVA 1M72A 1RPNA 3G5UA 2VDKB 1E7SA 2C4TA 3ELYA 2GASA 3QE2A 3DT9A 4TRJA 1TADA 2Z04A 3KXPA 2F3PA 1YB5A 2RKBA 5K8UA 4RMNA 3K30A 3LS2A 3P45A 4DJJA 4J0DA 3WK7A 3J80A 4FFMA 4U2GA 3LUKA 4JXKA 4CQMA 2H9AA 5ELLA 4C3OB 3LXRA 1VG1A 1GGHA 2WLTA 5H4GA 4Q4HB 3PIIA 3Q9NA 2O1WA 4N0PA 3PEUA 3K0FA 1BVHA 1WW8A 5FI5A 3W05A 2ZVJA 3RI3A 1CDEA 2VWHA 3NWOA 1UL1X 3IR6A 3E22A 1AKQA 1II9A 4WBNF 3DVQX 1W49A 4DV7B 2WNHA 2R8XA 4QO7A 3LVFO 5AK0A 5J58A 2XW6A 1HLDA 1OBCA 3K9WA 2DBVO 1UM9B 3TTVA 3QWIA 4ZC1A 2C92A 4KKXB 5IH3A 4FOLA 2Y05A 4CLEA 4FGLA 4NTZA 3VNRA 3QF4A 3IXQA 3R41A 3TOZA 3KT3A 2C0PA 3IBSA 1UOQA 2ID9A 3DVRX 3FDIA 3OE1A 1DUIA 4O5OA 4QZVA 1E1QA 2VHCA 1R37A 4UTRA 1PFKA 2IPLA 3FGOA 5LWHA 3C16C 1RXIA 3I6YA 4COOA 1V16A 2E9SA 2MYUA 2RGNA 3V1YA 2XRYA 3VDMA 4P84A 3EN0A 3F47A 2IJGX 1PTJC 1SGWA 3O7MA 4PSCA 2MSEB 4Z9FA 4YP6A 3L8ZA 3C85A 5ES3A 4X93A 2I78A 5DN6A 1N5RA 3ZXXA 4DY6A 4BE4A 1Z2OX 5K0SA 4FQ8A 4KQGA 1DQPA 1X8XA 1K7SN 3IT2A 4DN6A 2FWAA 2Y99A 2QRPA 3GIDA 3KLNA 1GAXA 3NEPX 4DV4B 3ZU5A 2J59A 3BKWA 3HV2A 3OPNA 4M0DA 3UXHA 4DG8A 4DVJA 2PGIA 3O2QB 4RHEA 4BLVA 4KHZA 4A3SA 1ZHFA 3GLQA 4WY2A 1J42A 1X1DA 4HS9A 4JR1A 1RWVA 1O08A 2CEAA 3TM5A 4I5FA 4AG6A 1ZD9A 4URXR 1ND5A 3WL3A 3OIYA 1Z63A 1V47A 1WW2A 2B0CA 4KRGA 3E2PA 4AJNA 2NZ8A 2QOEA 5BNWA 2FUG1 1V9LA 1RAHA 2Z1MA 3LP8A 1CCWA 2Q9BA 4MWCA 3LKDA 4UCWA 5CCBA 3ZBUA 1Z7YA 4BAUA 1OT5A 2F4VB 2AOTA 1KBOA 4O4IB 5C9ZA 1XVLA 4LSGA 4M0MA 2FPIA 3IIMA 1YS6A 2WVAA 5AJUA 3SJCA 5LOVF 3ZJTA 3AFMA 1IG0A 3DOJA 5EXPA 4W82A 4DDKA 2RONA 2V3CC 1H9CA 3NI2A 4CUZA 1YWGO 3TQTA 1RTTA 3A27A 3ZGXA 1GNTA 4X24A 3TFOA 2EWWA 5CFLA 1KGSA 1AUOA 5CM8B 2Q6LA 3ZLJA 1RTKA 2A92A 3C14C 3E23A 4DZTA 2CLCX 4HQFA 4CPDA 2JJQA 2XEXA 2KB0A 2HV9A 3BWCA 5KNDA 2ZIGA 3SHFA 2MU1A 2B21A 4H27A 3N0VA 4JSRA 5G4KA 2B1QA