2QLBA

Crystal structure of caspase-7 with inhibitor ac-esmd-cho
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qlbA00
3PCXA 4N5DA 2WDPA 3K7EA 4JR1A 3D6MA 1RHQA 2H4WA 3IBCA 1RWMA 2K7ZA 4QU0A 4EHFA 3DEKA 1RHRA 5K20A 1SC3A 1NMEA 3H11B 4LSZA 1SC4A 2H5IA 4EHHA 4I1PA 1PAUA 3E4CA 1M72A 2QLJA 1RWXA 3V3KA 1RHUA 5IBCA 3R7NA 4QU8A 2AR9A 5LUBA 3P45A 3UO8B 2H48A 3NS7A 4IEFB 1CP3A 2CNKA 2Y1LA 3PD0A 4JB8A 3UOAB 2CNNA 5LU9A 4ZVRA 1QTNA 1F9EA 1I3OA 2J30A 2J33A 2P2CA 4ZVQA 2QL7A 4D3XA 5IAGA 1QDUA 2CNLA 3GJQA 3R7BA 4QUHA 1RE1A 2C2KA 2XZTA 2H65A 1IBCA 3V4OA 4NOKA 4EHKA 2FUNB 3EDQA 4M9RA 1NMSA 4QUJA 4ZVSA 4ZVTA 2HBQA 2XYHA 3SIPA 1RWVA 2J31A 2H54A 3PD1A 2J32A 3V4LA 2HBZA 1PYOA 4NBLA 3IBFA 4QU9A 3H1PA 5JFTA 2QL5A 2C2MA 3OD5A 4DCPA 4EHNA 2CDRA 5IABA 1JXQA 2XYGA 3H0EA 4AWAA 2Y0BA 4JQZA 4NBNA 5IBPA 2FQQA 3ITNA 5H0IA 1SHJA 2H51A 1RWWA 3DEIA 4ZVOA 1K88A 1NW9B 5IBRA 2QLBA 5IC4A 2XZDA 1RWKA 2QL9A 3R5KA 3KJQA 4IYRA 4QTYA 4AW9A 1SC1A 1GQFA 1ICEA 2H5JA 5I9TA 4EHDA 4FGUA 1K86A 4EJFA 1KMCA 4FXOA 1NMQA 3KJNA 4I1RA 5LU8A 4JR0A 4QUAA 2FP3A 3DEJA 3V55A 3DEHA 4QUBA 2XYPA 4ZVPA 3GJTA 3QNWA 4DCOA 2DKOA 2CJXA 5IASA 4FEAA 4PRYA 4QULA 1SHLA 4NOMA 4FDLA 4JJ8A 4D3ZA 3R6LA 4D3YA 1CVRA 2HBRA 3NR2A 4N6NA 4HQRA 4QUGA 5I9BA 3GJSA 4PS0A 4QTXA 3SIRA 4PRZA 4EHLA 4PS1A 3S70A 3P4UA 1GFWA 2CNOA 1RHMA 3GJRA 4QU5A 3RJMA 2C2ZA 4N7MA 2NN3C 4HQ0A 1RWOA 4AWBA 3BIJA 3NKFA 3D6FA 3KJFA 4N7JA 3R7SA 4N6OA 4N6GA 2H4YA 1BMQA 2C2OA 3V6MA 4JQYA 4DCJA 1RWNA 1RHKA 4JJ7A 4QUDA 3V6LA 4HVAA 3S8EA 4QUIA 2QLFA 4QUEA 4NOJA 4JJEA 5IAEA 1F1JA 3D6HA 5IAKA 1I4OA 3EDRA 2HBYA 4NOLA 1RWPA 5IC6A 4NBKA 2CJYA 5IAJA 3R5JA 4JR2A 1QX3A 1I51A 5IARA 1RHJA 4EHAA 2C1EA 3R6GA 1I4EB 3H13A 4ZVUA 5IANA 5LUAA 3H11A
chains in the Genus database with same CATH superfamily
3TZQA 3BD9A 3G9QA 4G9GA 2BFCA 1K9SA 4GKAA 1JP7A 4CKWA 2CVOA 1CZUA 4E2YA 3HDTA 3T0GA 2ISQA 4HFJA 4ZOLB 2FN8A 1U9JA 1W5TA 1Z4KA 4H16A 4YP5A 2WTEA 2Y92A 3NHMA 5EEHA 1W19A 1HEYA 4XX0A 1K8ZB 2R44A 4O4IF 2BEUA 4ARUA 1Q11A 2NNWB 2GZ1A 4OQEA 5C7LO 5KWJA 3H8WA 7ADHA 5K0BA 3I4LA 1RWXA 3FMPB 2QT1A 4B8WA 1RI2A 2I6QA 3HRHA 2QA5A 1NA5A 4YHBA 4MP8A 1M54A 4IMIB 1ODSA 3FUWA 1ZONA 3RYFA 4RGBA 4EABA 2AH5A 1KYYA 4BGVA 2AFHE 3MPOA 2Q4DA 5A9SA 3GFRA 4GX5A 5AIBA 3DL4A 2W8BB 4L0DA 5AKGA 1CR6A 3K92A 2K5UA 4JBNA 1N3YA 1Z3CA 3H2SA 3N0VA 2GSWA 2OG1A 4MA5A 4BP3A 2FEXA 3U37A 1V16B 1CDZA 4EMSA 3FIJA 3AHGA 5KVCA 4PYLA 3HQ4O 4YQZA 5E4JA 4CQMA 4QDUA 5CG1A 2JIQA 3LA6A 2NPOA 1PYOA 3GYGA 3F9CA 1J0XO 1IY2A 3EYAA 2EARA 1LX7A 2JH3A 2PZAA 3MHPA 1NW3A 2GF9A 3BSFA 3M3HA 1N0VC 1VMAA 2QZJA 4GLOA 3UC9A 3CF6R 1ULAA 4GOXA 1DAGA 3OX4A 4UNNA 3ZHBA 1IUNA 2OWDA 1E9RA 2Y0BA 4QGBA 2VF8A 2GLXA 2PUVA 4CYMA 4TMXA 4TWRA 1SHTX 3GLHE 1YL7A 2X2OA 2A88A 1IZYA 2I8AA 3CJQA 5LXTF 1TD9A 2EEPA 1NW9B 3DBHA 5IBRA 4D26A 1ENPA 2OV3A 4QPNA 3DT9A 2G0TA 1MO5A 3FSGD 4R9SA 4E6EA 5HKKD 2EIHA 1AB5A 4KW7A 2V0CA 2E5WA 4D8TA 4PTYA 8ATCA 1NT4A 3C7KA 3DCNA 2AXQA 3A31A 4FXOA 5BSTA 3VU9B 1Z0IA 2VBCA 4PHTA 5FQOA 1LLUA 3Q1KA 4BHTA 3VZQA 3SY8A 1YI1A 4CM5A 5CA1A 1TTTA 5BNWA 2H16A 4E13A 4KHPB 2X77A 2GD6A 3FYUC 3UWPA 2QWXA 5ALDA 5F7ZA 1DO2A 2GAFA 4UEWA 4NCXA 4Q7QA 4NMMA 3KJHA 4BLOA 5DIFA 1K97A 3V32A 4QRDA 4AJLA 2MSCB 3EFBA 5IUJC 2EFGA 1E4VA 5C1OA 1JWAB 1XOIA 1N2EA 4A2QA 1QIMA 3U4CA 2X15A 1DJNA 1N7IA 1RI5A 3PTZA 4HRXA 2DCMA 4I5DA 4WN9A 5GJVC 4D0RA 2OP0A 3VR4H 4P31A 3RTBA 4KXNA 5SY4A 4FIZA 2HMAA 2QX8A 2DXIA 3TX2A 1JGTA 1A7UA 4IW3B 4J0DA 3W4JA 4BNXA 3HYRA 3WLJA 3BK7A 2X76A 2C7RA 4MI1A 3O2JA 1I4OA 1M10A 2FZEA 1STOA 4EARA 2X22A 3Q5GA 4HWGA 3GJ3A 2JGFA 1GL3A 5FHQA 1CV2A 3FZQA 2OCAA 3OTWA 5JLAA 1RACA 4AROA 2O2XA 3UT0A 1Q0UA 3BQ9A 2C92A 3DEFA 5AXBA 5JPIA 2G07A 3TE6A 2X4IA 1M2GA 4RU1A 1UFQA 3IMGA 4MUJA 4PAMA 1PP4A 3QTLA 2VT2A 3WMFA 1ZK0A 2B4QA 3FHOA 1DQZA 4QU0A 4KBGA 3WP0A 1YI8A 2F8SA 2P9FA 3RYHB 3SM3A 1RXYA 3UKDA 4FCTA 2IYZA 1U2ZA 1Y8CA 4MJLA 3TLJA 4L07A 1RRCA 1Z7WA 1EXDA 2IUTA 1YQDA 3NATA 4KQIA 2BRUA 4LRSB 3W9BA 5L95A 1AZSC 2GPWA 1X2EA 3H42B 1E9DA 1GFZA 2GWRA 1M8JA 4I50B 3D31A 5D7NA 1WBBA 4GNKA 4TYNA 1YASA 3RHTA 3W9UA 3OM0A 1GAEO 3KYDB 3J81A 2JIZA 3B51X 2J6IA 4I4TB 3RC7A 3AUUA 4GIBA 4KVZA 3THRA 5HWSA 2WSSD 3BKXA 2Z1MA 3EUEA 3UXYA 4C04A 2X9VA 3GRUA 2IEGA 1T2NA 2HFKA 4BE7B 4BMXA 4GXRA 1KQ3A 1RE1A 1UBFA 4JHXA 1PD1A 4U7GA 3SIWA 3HTXA 2I0FA 4DNFA 3E27A 1FSSA 3WGVA 5HUJA 4FT2A 4OX9B 3LCJA 3OJEA 2NV6A 4R01A 3UY4A 4LWQA 1XCBA 2JFXA 1HL7A 3GRVA 4UUNA 2A78A 2EZUA 2J32A 2BN4A 1UAAA 2OM2A 2LBPA 2BD0A 1XU4A 2XYVA 4QYXA 3IE2A 3RUIA 2BM8A 2Q1SA 4K9KA 4INAA 4HS9A 4PLYA 1E64A 3RABA 1L5GB 2WRZA 5JYEA 4XRRA 4OA5A 2J4DA 2EW1A 4CEIB 2OCBA 1RC8A 3KQYA 2ZRHA 3RIXA 4MR8A 1LNZA 5JBNA 2XTNA 1GT6A 1C9KA 2X0RA 5FLXA 5LD2C 2XWPA 4MV5A 4DR3B 3VU8A 1KAQA 3IBYA 4WLFA 4BVKA 3LVFO 4EJFA 5JDCA 3LSYA 2E5LB 4I55B 1I6KA 1ZIXA 4GH5A 1RXEA 3ODPA 2XNHA 1UBTS 3P52A 4HAOA 1I14A 2ID7A 2ZJZA 3D4IA 4L7VA 3VKWA 5FPKA 1FYEA 4IFTA 2AEMA 4WKOA 1MFPA 2EWWA 4QXQA 3DP9A 4ECAA 1Q50A 4DR2B 3MGGA 4MA4A 4NBUA 1BMFD 5CD1A 4C4AA 5AW1A 3WGUA 3NEPX 1B0UA 3EG5A 2JJYA 3EUAA 2WY2D 4OFWA 3R7DA 2H63A 4MVJA 5DYTA 4TLMB 4Y0AA 4G1CA 3RWMB 1TT5B 2GHRA 2O54A 3PU6A 3ND5A 5L4NA 2V7QA 1FFXA 1JQLB 3P32A 1OFTA 1ULBA 3OM9A 2ZXEA 4FWBA 4NE7A 5IAAA 2VNIA 5JH7A 2IUUA 2VYFA 1TM2A 1UXHA 5C37A 2IYOA 2OBFA 4QD3A 3EBLA 3FPLA 3IHWA 4FOTA 4AXXA 4D97A 4M7RA 1SXQA 3EW9A 4MWOA 4FFBB 3BA6A 4YDHB 1V3TA 1ZVMA 2G9ZA 1XSEA 2V4MA 1QP8A 2R00A 1FL9A 3L7YA 4EG8A 4P4SB 2Y9PB 4KQHA 3L05A 4LBWA 1ZNWA 4PX3A 4DQVA 4WCDA 1XDGA 3OBIA 3R7AA 4DLVA 1AK9A 3K1TA 3IKMB 4OHCA 1MRSA 3BB3A 4QBIA 2GJ4A 3I1JA 3SEFA 6GPBA 3CZCA 2VN8A 1KEUA 2AYZA 4HCJA 4I46A 5AP9A 4BC0A 4AQDA 3TL3A 1DJMA 4I1OA 2WVJA 4JENA 2BIFA 4Y1RB 2VYVA 3ZWVA 4ER3A 2O6HA 4X85A 5HZHA 1GNVA 2C2WA 5DYWA 3P0RA 3IHKA 2GNPA 1HFJA 4TN1A 4CR7A 1A9XA 1A5SB 4FMDF 1NLYA 2Q0QA 4JC8A 1M0EA 3AEUB 3FSEA 3FVWA 4IDPA 1EX1A 1ZY2A 2A1TS 3AHJA 4LI3X 3DAPA 3M34A 4N03A 2A59A 5ALFA 3W79A 1EQUA 1GNQA 4MMZB 2JKYA 4GOJA 2XVXA 3TBKA 3WNBA 4NDAA 6ADHA 1UBKS 3FZGA 4RCVA 4B6JA 4BNWA 3U3DA 4RLSA 1JPVA 5TB5A 3LAWA 4UDYX 3TRHA 2IOFK 3M1YA 5HJ5A 4FYYA 3OIVA 4R1MA 1UQRA 5CVUA 4EK9A 4RM3A 3ACDA 1ZP6A 4WJZA 5KJCA 3BXXA 4MZDA 4Q66C 5LN1A 3G6WA 3QWBA 4CFZA 3DPUA 2C7GA 2ZJ1A 1YI0A 4BATA 3T9FA 4TMFA 1YFKA 3PC6A 2I6GA 2WJJA 2JIDA 4ZCSA 1C8VB 2SKEA 1XHFA 3DOOA 4WY2A 3HUTA 4Y0NA 4BNGA 4G9EA 1B4DA 2A5JA 3LC2O 1SIBE 1TZMA 1GNPA 4NAUA 1OE0A 4Q05A 5ER6A 3P71T 1NJ1A 3AR9A 3PXGA 2GERA 3LL4A 1K92A 2BZ0A 4A6DA 5CYGA 1L0BA 4M46A 4YNBA 4LGMA 3MCWA 3RVOA 2XDYA 2C83A 1TYAE 2E4VA 2CXHA 3GN2A 3MF4A 2JFUA 1UT5A 1FOEB 1ZSVA 2QL9A 3OFSA 4IYRA 4RYLA 4UE3S 4BMYA 4D9EA 1F48A 1RXWA 4EMTA 4RSHA 2IZ5A 4F1WA 7REQB 2C61A 4HDOB 4WZAE 1E1CB 1GGKA 5TJ9A 4RXUA 2QAGC 2DPMA 1KORA 2QS9A 3RIEA 4BVAA 2F90A 1A9OA 1IWOA 1FYXA 1P3DA 1QOQB 3VO1A 4QA9A 2HA3A 3KHKA 5BR8B 4MR7A 3PXEA 3U1VA 3I76A 1T3HA 4TTVA 4BVGA 1VMIA 2BISA 3LT5A 2D5IA 1MG0A 3MMNA 4UQOA 4ES6A 2UZ4A 5C34B 3TTVA 4XX1A 2JI6A 1DG3A 2ERXA 4FCCA 1MAAA 3UCEA 2FE4A 2CNWA 4CG0A 4H0NA 4Q34A 1LSSA 1ZHHA 2XF2A 4QU5A 4DUGA 2ZVDA 3KOWA 2E21A 4JKIA 4QTTB 1MC1A 4S1PA 3UNXA 3VI3B 4RIGA 3TSYA 1XL1A 1TAQA 1Z4MA 4FE3A 5F51A 2C9CA 4OFZA 2GRUA 1CQWA 1Y8RB 1A9TA 3D0QA 2PMEA 1OH6A 3BH0A 4LOIA 5GP1A 4XVUA 4OVKA 5BWBA 2AK3A 1U90A 3R1IA 4P32A 4WI1A 4BMOB 1EUYA 5TPWB 3LP5A 3PQ8A 3AIKA 1EGMB 4B3DA 1V11B 3Q3GE 1KYVA 1GRNA 3DBRA 1B6GA 4HBZA 4MRMA 3AERB 4MQ5A 1EFRD 5KKNB 1TVCA 2YWBA 1ETUA 3FJ1A 1KDVA 4MINA 1PUIA 2BMDA 3IBSA 1MVNA 1NR1A 3UH0A 5FBQB 3P96A 4IVNA 1YRAA 3ECSA 2YZMA 1AGXA 5TSDA 5FOXA 3WRVA 3P8ZA 1US8A 2ZR7A 1I7DA 5FOSA 1RM3A 1AXGA 2I33A 2IXFA 4FFOA 4PVCA 3I9OA 3N9IA 4OGKA 5AKKA 4J07A 4Z8XA 3PPWA 1C2TA 3H3FA 1G2QA 1ZHOA 3DMRA 4M8KA 4F3TA 4ZDWA 4ARZA 5SICE 2JIMA 5EIBD 5AW7A 3G2JA 4EJ6A 2GZ2A 2H4XA 1GGHA 2O2HA 2QVYX 1QONA 2VCYA 3N6VA 5K51A 3ABOB 4BV8A 1U9ZA 2R8YA 1KTIA 1SD2A 2FPGB 1E7YA 2ID8A 3ET4A 5IT0A 4YYEA 4MLPA 2GHTA 5ICGA 3OA0A 3R7BA 1F1BA 1KI6B 1V6AA 1A8UA 4S05A 2EHDA 4UTVA 2ZUDA 5AK3A 4ZIRA 2DERA 2DUNA 3WLOA 2PX6A 3G0HA 2A8YA 1K5DA 4MUKA 2GEDA 2IZ6A 4OLJA 3L4BC 4PPNA 2PSSA 4PSAA 4OQLA 2Z58A 4Q4DA 3F9IA 4UARA 5KTPA 3TQHA 1AZWA 4P3YA 3UMVA 2VHWA 4M49A 3CN7A 3EY9A 1P18A 5IABA 4IVRA 1IPEA 2C54A 1WM1A 3M6VA 1FW8A 1R3DA 1M1XB 3BJZA 2WHPB 1HY3A 2JLAA 4XQCA 2O3TA 2CXUA 5KQMA 4C7OB 3U7FB 2DWPA 3ANLA 3OC0A 3EXHA 4JVOA 4L8GA 2IV7A 1CC1S 3OY7A 4Y2GA 2JAPA 2BSAA 1XMXA 2JDID 2P0EA 5BSUA 3GZNA 3CVUA 3GGDA 1UQUA 3H1BA 4S1WA 2OHHA 1BTOA 1F2TA 2WFAA 1GO2A 3CHYA 3R5KA 2WOOA 4ZO8A 1EH5A 2RH8A 1ZXLA 5L3QB 2VUUA 1MJHA 1QZ3A 4IOLA 4E46A 1BX0A 3IIJA 4X1YB 1XEWX 4Q4CA 3UXEA 3L7OA 2VJCA 2C4HA 4QUAA 4X24A 5DT9A 5FTKA 3RK0A 4CIAA 3Q8LA 2HR1A 1HQDA 3F5MA 4ZREA 1PZFA 4ZQHA 3U31A 4C06A 1KDOA 3I53A 2Q07A 3Q4GA 1YDGA 2IPAB 4P4GA 4U9UA 2A7QA 3SQLA 1ZIOA 1VE7A 4O2AA 4D5EA 5F4BA 2PX3A 3EHDA 1X7ZB 1WNFA 2F1IA 4RA9A 4XVCA 4V1CI 2R1UA 1E4OA 4ER7A 4I1UA 3EQ6A 4II7A 1U5AA 4S3MA 3V4FA 4B3IA 1UWVA 3OAAA 4DZZA 1RYZA 2NU7B 4IMRA 5B3JC 1BDHA 2H1RA 5SYMA 3LF1A 4MAAA 2YWFA 3KYJB 3CLUD 4QFCA 4HVAA 5AHRA 3A1WA 1YKSA 3W7BA 3KAQA 1X7HA 4UFPA 3PC8A 1NYRA 2XE8A 1XR3A 1PSDA 1UADA 1DOAA 1BS2A 3DE5X 4P98A 1DX9A 3DR5A 3VR1A 2GBCA 3KUKA 4DRXA 1QC5A 3GCWA 2A3RA 4XAQA 4JWKA 2MOKA 4EGFA 3RTAA 1WLSA 1G20E 1YA4A 5I47A 4EUEA 1AMNA 3L43A 1AE1A 1KC1A 2UVDA 2HPHA 3L1IA 3ORSA 4GU5A 1XN4A 1TKBA 2X0KA 5K3EA 3AI7A 3HXKA 1WUTA 2OAP1 1NMXA 3K4PA 5ESRA 4ZJPA 3FVRA 2EWVA 4EHFA 1U0HC 1DIAA 1XDWA 4I9HA 5ESWA 1EAMA 1U81A 3AWDA 4HB2A 1XZFA 2JANA 5J40A 4F5ZA 5BV2P 4ZPJA 2UV8A 4IDBA 4ZI3A 1LI5A 2OD2A 2QU8A 1GSHA 4A1FA 1E1LA 4TZ6A 5L3SB 4EW6A 5CA1F 4KUEA 4OM7A 4LXHA 3V9AA 1PZGA 3V4ZA 1I7QB 1XWIA 4HLDA 4POOA 4Z4EA 4FVTA 4PLFA 4A6XA 3PC4A 4RTMA 2BEJA 5DNCA 3FA2A 2ZUEA 1OU4A 3OX1A 4Q6BA 2BOVA 4TS3A 1UFVA 2Q5EA 5F9FA 1YL6A 3QVVA 1SU4A 5CLFA 3EZYA 1JR2A 1NKVA 4MVJH 1NW7A 2JBAA 4DJAA 5A03A 3WL4A 4WY5A 2PJZA 3A04A 2ZRNA 5EE1A 2QTMA 3FPKA 1RYFA 3OKCA 1FP4A 1R16A 2RBGA 3KAKA 4WOPA 1NULA 1PR3A 3N2GB 1SQ0A 1T0BA 1KP2A 3AM4A 4FLEA 2P67A 4EFKA 5CLQA 5C46F 2HBZA 4J1QA 4U6NA 4HYEA 4GGOA 3C3EA 5EIHA 1A9RA 3OZBA 2VP3A 4COKA 3L0IB 5A5DA 2QX4A 4AJOA 2XVAA 1XD2A 5JISA 3UN1A 1E5DA 4FWTA 3CX7A 2Y2VA 4O4JF 4B8ZA 3THWB 1LBHA 4PAWA 4NFSA 2PUAA 3QUTA 2O8CA 1GYQA 4DA6A 1L4HA 1MB9A 5CAEB 2QSZA 1J97A 4L8WB 1DMSA 4NAHA 4OP2A 4DNXA 3GQBA 4IJUA 2QUBA 4UDXX 3H05A 1UDXA 1MEEA 3KPYA 4WCFB 4EHDA 4KQMA 5KOHA 1KO4A 4C88A 2ZVPX 2IDJA 4BNHA 4D9GA 1MJGA 3OOJA 3GJYA 1TC1A 4Z4FA 4YAOA 3MK31 4XDHA 1Y7PA 1GY8A 3L1HA 1Q0PA 1YS2X 3GU3A 2FPIA 2JGMA 1QLJA 1GG5A 5I4BA 4ZYWA 5AW0A 4U00A 1C4KA 2Y9MB 3GJ8A 2C3PA 4NY1A 1P17A 3WLHA 3A1TA 3LLUA 4H60A 1Q1QA 5BWCA 3ZQKA 5JRDS 4ZTUB 3U0BA 2C5FA 3LQ2A 1BCRB 5L9AA 4G56A 1ESEA 4KVGA 4AMUA 5JNUA 5HSGA 1V41E 4IXDA 3DWGA 3FCCA 4WACA 3TSZA 2DE0X 1N8KA 2XXAA 1DAFA 4EF4A 1HE5A 2YNMA 1HDRA 4EI9A 3TIVA 1MG5A 1M7HA 3ZZUA 3II6X 2KMLA 4MRPA 4AFNA 3DNFA 4V24A 3ILHA 2OCPA 4G24A 1X92A 3DHNA 3B7WA 3MGKA 3I42A 3RANA 1N32B 2P7HA 1BQ4A 2PS0A 2FKNA 2ZLBA 3F6EX 4QQKA 4HN9A 2EYQA 4FYXA 2OGTA 5C1BA 4G0OA 1JHDA 2FR0A 2NU6A 5EP3A 1KDPA 2EV9A 3D6AA 4WZBE 3EQ7A 4L5AA 4B3GA 1UANA 2E7ZA 4D74A 1Y9DA 2RBKA 2VHEA 4IIXA 4A0FA 1Z16A 2BKUA 3G9TA 3G9ZA 3NYQA 4MEBA 2FTKE 2EAUA 3S2YA 5IULC 1Z0SA 4FW9A 2UKDA 4AUKA 1KH3A 3LCUA 5BWNA 3ZTYA 3D2CA 2Q1UA 4GPTA 1P7WA 3U3MA 2HRBA 4I4NA 1XYVA 3NUQA 4I1PA 4WGFA 5DGHA 4C0AC 1V3UA 2HMYB 2X58A 3EAGA 1R18A 5CYFA 3ZE9A 4AY5A 3BFVA 3IQHX 2UUAB 4MW4A 3WIDA 1R12A 4BIIA 2NUPA 3B7GA 4ZZIA 5B2ZA 3TBFA 1PO7A 4AP6A 1SCNE 2CNNA 3QTBA 4BBPA 3H2ZA 1EFPA 2X0IA 3AVYA 2AC4A 1X77A 4UM9D 2YS7A 3DTTA 2DOKA 2HCJB 4MVJF 3KQLA 3I28A 3HLYA 3MCVA 1E1DA 1FQKA 2P68A 2V3CC 3T7CA 3EDQA 1OAKA 3JYLA 2HQRA 3RIGA 3TOVA 4AJ1A 5KJ6A 4JI5B 3RM3A 3D0KA 1DUSA 2JAXA 1FP6A 3Q6IA 5JH7F 1WSDA 2H07A 2GJ8A 4BO1A 1GAXA 4RDHA 2QJTA 2H8GA 2Z9CA 3ZNQA 4MCHA 1RKVA 4D99A 3M6LA 4NTZA 2CVQA 1DO8A 2J3MA 3S2SA 1W2GA 3ITEA 1OKKA 2FOIA 3KCNA 3NHUA 2NZUG 5KDLA 1XDBA 4WTOA 1DIBA 2LXNA 2OV8A 4PGFA 2A0UA 1ULHA 2MIIA 2GTPA 2PX4A 4YH1A 1YJQA 2FUG1 2Q9CA 1V39A 1VLZA 2DBZA 2FN4A 1EK5A 3WE7A 3KEOA 1BYUA 4TYQA 3IPYA 4MUYA 4IV0A 1J39A 4UZFA 2IYFA 5HCIA 3TFQA 5ELLA 4MW7A 3ZE2B 4DBLE 3J7AC 4IEIA 1C3JA 4Z3KA 5EHZA 3FOFC 4GGPA 3A6PC 1WMFA 3R3JA 3CNQS 4COOA 5KNLA 2HUPA 4O0LA 4ALIA 3MGAA 1VZ2A 2R7AA 3KOOA 1E60A 4GZLA 2JJMA 1DJPA 1EM6A 1K0UA 3L8EA 2D8AA 3K4QA 3NCHA 4FT4A 4LZWA 1S3GA 2KBEA 4G4GA 3F98A 3C3PA 4JYCA 4V38A 3W77A 1TUEA 3DBOB 2EZ8A 3HNOA 2FSPA 2VFAA 1Q2UA 5DBFA 1BVRA 3K6SB 1KERA 3RJ5A 4B6RA 1SHLA 2OECA 3G8YA 3UT6A 4KV7A 1HYHA 4HRYA 4OHUA 1RPNA 1FE8A 3L7NA 1LRKA 1LSJA 1Z33A 3AZPA 3PDIA 4KMOA 4MVXA 3R7WB 2DHDA 3A6FA 2LCFA 2JGDA 4M83A 4KYTA 5AMXA 5G1OA 3B53X 4QQRA 2FDXA 1O6GA 5D1NA 5FUYA 4C03A 2G6TA 2MSLA 2R87A 2RHWA 5K8UA 1SGWA 3I8SA 4RMIA 1QK3A 1XCMA 4U7DA 3EN0A 4MIOA 4CI0B 4W9MC 1KIMA 2WM8A 4L4RA 2CSXA 1WABA 1I3CA 2NTVA 1Y8AA 4RQBA 3D6HA 5KNDD 4FB5A 1COWA 2E0IA 5DK4A 2GM9A 2HQOA 1DOZA 4JB2A 3ZJYA 2JGJA 3RUEA 2JFPA 2HF7A 2YQ5A 2ZDQA 2C7QA 2AZTA 1KO8A 2AYYA 2O3RA 2ODEA 3BMXA 3GXOA 4V02A 3A25A 5DV9A 2CXOA 2QW0X 4QNNA 1H9BA 3PHCA 1E3WB 3SXJA 3T3GA 2I6TA 1F6WA 3ZKWB 4HD8A 4CDRA 2WZQA 2A9QA 1PIWA 2JD2A 2ZT6A 1ZESA 4IOKA 1AS2A 4ACBA 3B3QA 2FWPA 4GECA 3KDSE 5DSXA 2PUHA 3O6VA 5LB4A 2FPRA 1NQXA 1XA4A 3PPXA 4MV4A 5TMEA 4C20A 4ZKDA 1NVMB 3K2IA 4OL0A 4QWMA 5DBHX 3JQDA 2OT3B 1C9EA 5C51B 3W6NA 2VK8A 1FDVA 3QKSB 1KI3A 2O2CA 4LE0A 1KDYA 3H19A 5FJIA 2YVAA 3VNAA 1G3UA 2UZ1A 3QA9A 4P82A 4RTLA 3AP2A 1SXIA 4RH1A 4PXAA 3PBKA 3LJKA 4ESOA 1Q1EA 5BP7A 2UZ3A 3G2IA 1THTA 3BK2A 1GU0A 1DC4A 4BRWA 5EUMA 4D4MA 4JLKA 5CXUA 1XZ8A 4J90A 4JI7B 2VDLB 3VRHA 4HO1X 2O19A 3A4TA 3S2EA 1Q7GA 2WNIA 1BDJA 3UCXA 2XZTA 4LXQA 3UAGA 1IOVA 1TAHA 1V7CA 1XZGA 4UAVA 2V74B 1HK7A 1SC9A 3W8RA 3ZD9A 4ZVTA 5GOTA 3TLAA 2IWHA 1L4EA 2ZQZA 3L7MA 2IYAA 2QLMA 3QBDA 2FX2A 4DNQA 1DAMA 5H3LA 3NTLA 1LZKA 1E2JA 1Q22A 1X7XB 1TCAA 1QQAA 1MC5A 2VHXA 1YMQA 4IUYA 4P7JA 4RWZA 1H66A 3ZHVA 4HB0A 3MJDA 3DKPA 3G9UA 4ZHSA 3EF1A 2BRUC 4MNTA 3WL6A 5DN9A 3IJPA 5JY1A 2YHBA 4UVGA 2XBLA 3OUZA 3VQTA 3JASB 2A9OA 4KO2S 4IIEA 3IV6A 4WAUA 3EX7C 4YB8A 3QPUA 4IHJB 2IEAA 1O94D 3U4IA 4DA7A 3U7GA 2HU7A 2JGEA 3GFSA 3ZGVA 4CV0A 4RGYA 2QJOA 1Y4DE 3CWCA 1WV0A 4F06A 2D2FA 2PNJA 1KEKA 3GLIA 4LPKA 1FNMA 2DFVA 1E94E 4CLRB 2WNSA 3RU3A 2F4VB 3K35A 1PQWA 3FFWA 4JKOA 4GPAA 4O8CA 1SXJE 2I66A 2YY7A 2IHVA 1I3NA 1OXVA 2W6PA 3QQ5A 4O02B 2DKOA 2QN9A 3C3KA 4YMIA 5E38A 3V8QA 3JQGA 4A6PA 1G9TA 2H9AA 2JBHA 2RG7A 1C4WA 3KZXA 4AO8A 4XUGB 5CB0A 1AGPA 2WG1A 1KI7A 2VJPA 5C32A 2HNKA 3KKNA 2N1MA 3IULA 4TWAA 2RIRA 1W4BA 1D3AA 1Z2EA 2DZDA 4ARBA 2PT9A 4M7PA 2I3AA 5PNTA 2R4QA 3EDOA 2HNBA 3IUNA 6ABPA 1E3JA 4C6SA 1NPTO 3SGLA 2PD3A 3GZ4A 1YIOA 3EBPA 3VV3A 1YH3A 1UFOA 3OUTA 5KINB 1DGQA 1J22A 2EL7A 4G1BA 2XCQA 1PHPA 4LYGA 5HIJA 4JJEA 4RXTA 1JTFA 5JC8A 2W2LA 1QORA 2AKAB 2HXSA 2X13A 4TVSA 1ABEA 4JP2A 4OHWA 1EG7A 3UQYS 4CDMA 2BHLA 2QMEA 1SVKA 2W2QA 3CUSA 4QFMA 1CR1A 2AEEA 4W8GA 4HK4A 2YYSA 4WXRA 3IYLW 4ZOLA 5JDCC 3TZBA 4UMDA 1HC7A 2HSEA 1VL0A 1A9YA 1R5JA 1LWNA 4L8VA 4WD3A 1TZBA 5BW4A 5KYKA 5DTIA 2GBPA 2EVWX 1WNTA 3CMCO 3JR3A 3DMDA 5AD1A 3PCXA 1PKEA 5I7AA 4WLNA 3L4JA 1K0FA 3DVAA 2OCXA 5B2FA 4R7ZA 3QKIA 3AV0B 1Y9JA 3AF2A 3P4YA 1VHJA 1EHCA 1EWTA 3I1IA 1R9JA 4YCJA 1C0KA 2IWRA 4DIMA 3FPGA 3V1UA 1S1CA 3DR3A 1XRJA 3OZVA 5DHTA 4Z54A 4IIJB 1SC3A 1UMCB 3U26A 1NRWA 2W70A 1G55A 2CSUA 5HZKA 3VISA 1EMDA 3SC4A 4MVCA 5KNBD 3HY4A 2B7CA 2WVHA 3SS7X 1AK1A 3T3IA 2R7KA 1AKUA 5DB4A 1WTAA 4WBNB 2BEVA 1OH8A 1C3VA 3NS7A 2EJVA 4X95A 3KKPA 2ZE7A 1OCEA 4DTIA 3Q7TA 5JFGA 1Y7TA 2IU3A 2BI8A 1G21B 3I23A 4CUKA 2J0UB 3N8DA 2QPTA 2PV0A 4I5IA 2HGZA 4O2AF 3UG6A 3O47A 1G2PA 2R00C 2NNLD 3GDFA 1M83A 2P35A 3RIMA 4EDHA 3AVUA 1MVLA 4JLDA 4PQRA 1GZVA 4P9NA 1S8NA 3QFSA 4XM2A 1TYBE 4O59O 2CYCA 3KKEA 3PRYA 3NT5A 2YZ2A 4KKXB 2DULA 1JEAA 2FF5A 1Z2PX 1CUSA 1VRCA 1WV1A 5EHGA 2IS6A 4LY3A 1FSGA 1VG9B 2E18A 1E4YA 3HCEA 1YJCA 2GLTA 3L2OB 4BGEA 1D2CA 3PFKA 1CJKC 1QOZA 4MVJE 3WMXA 5C1IA 4DA4A 1NUAA 1B3RA 1JXQA 1ZIYA 2XT0A 4KRGA 4KGZA 4JQZA 2AA3A 1NBAA 1JXOA 2JAHA 4Y6GB 3ZU4A 4C0HA 3W5DA 1WXFA 3MILA 3IFSA 3ZHCA 3HZHA 3QSYA 3VU9A 2GO1A 1J8VA 2Q62A 1K2VN 3ME5A 2XB6A 3IR5A 2J6BA 3IR7A 5DEOA 3GGGA 1UODA 1GOTA 1YB4A 5K4HA 4X7MA 4E5UA 4EFDA 4DS3A 5HYVA 2IW1A 4H1UA 4OIMA 1UC8A 3RAGA 3KNZA 2W98A 3KSZO 4X1KB 1T1IA 2G1UA 4Y6PA 4UEOA 4RMHA 4RAOA 5K3CA 3UXMA 1G3MA 4YJFB 3CCBA 3ZJ4A 1GL9B 2PA3A 4Y30A 2WYUA 4Z53A 2HIMA 4LBVA 5FV4A 3ZVNA 3EYWA 2P4HX 3WL7A 4OOFA 3OCUA 4R71A 4ZVPA 4FZVA 4U2GA 1YOVA 1M2NA 2OXEA 3C3MA 4BCBA 16PKA 1EBBA 4E22A 1KEZA 4UTPA 4Y6RA 5KNCA 4NC9A 4N3NA 1NQUA 2ZCVA 3NTRA 2GZRA 2FMIA 2I62A 2WIAA 3NJ8A 3NWOA 3PEFA 4PS0A 4YRCA 3RSFA 2CV0A 3ESYA 4ZT5A 5JSKA 4H27A 2CVPA 3F90A 2I3GA 2MYNA 1XZCA 3D2AA 2M1XA 4GAEA 4OI1A 3SPXA 4MUAA 4Z1OA 1T2AA 2VVTA 1KI1A 1CZRA 2EP7A 1Z17A 3HEBA 3JCZA 4P83A 4PIMA 2ONJA 2CUZA 3N58A 2VUIB 4O4HA 4YJDA 5KC9A 4XB1A 2CBXA 2CKDA 4L9WA 2VDNB 4ZVLA 3W5CA 2EKLA 2V58A 2IH2A 3JQEA 4HXYA 2QGZA 3ZYZA 1EWVA 4J0GA 3BDVA 1VJTA 1VKOA 3KUXA 4P38A 4MV7A 3HYLA 5HDQA 4M89A 5FTNA 4OHBA 4BVJA 2WD9A 3KDAA 3ZE6A 3A3KA 3HC7A 3NTVA 4AYWA 2OYCA 5ALLA 4G0WA 1EWQA 2WDPA 1XRRA 3L8ZA 2FJ0A 3FTNA 5P21A 1EEHA 2BR5A 2GCOB 1U31A 3C15C 4I50A 1RYEA 3T99A 1VPWA 4Q3KA 1S96A 2YN4A 5GQSA 2P30A 3KYDA 4MV0A 1NN3A 2QTLA 4PBSA 4I4TA 2C3YA 4IIFA 1SC4A 3U1TA 2VEOA 5KWVA 3ABQB 4YACA 1I2MA 3DH0A 1Z15A 2CVFA 1F60A 4P5DA 3OP1A 3UHJA 2Q2OA 3E6AA 1WY5A 4MIYA 5JV5A 5JS8A 1ZCAA 2PKQP 4P2GA 3UK1A 2HO5A 2IHJA 3MTJA 5NLLA 2HCRA 4OM8A 1L2TA 2AFRA 2DPLA 3IP8A 5MN5A 3MVEA 1NUSA 3EA0A 3G5UA 3NB0A 1VI6A 1QKKA 1GSAA 1ZSNA 2FFHA 2RONA 1S8AA 4ZODA 1XRLA 4AN0A 1NM5A 4MW9A 5JR3A 2ZULA 3K8YA 2VXOA 1LJUA 3SF8A 3IKJA 3TBHA 1L4YA 2Y1FA 1E3IA 2R1ZA 5FPQA 3SBDA 2EZ4A 4UQPA 2QBYB 5CBKA 4OEHA 1SK8A 3O83A 1WWKA 5AVYA 3TW0A 3V2UA 4AIIA 1ECJA 3AH8A 2OENG 3PL1A 2BKXA 2MSEB 4FE4A 3K20A 1L4UA 3NETA 1ZKDA 5HCUA 5B1YA 1KH1A 1VYTA 2XDAA 1IM8A 1ZI8A 3A9CA 2Q3MA 3CB4A 4JJIA 5DNAA 1R88A 5FBRB 1JT2A 3V1KA 1X42A 4J1NA 4EYEA 2W6ZA 1EJ6A 1ECBA 1FMCA 2XWQA 1V4VA 1E7RA 2TMYA 2YC4C 4HWPA 3F1KA 3LPCA 4JZKA 4DYVA 5B30A 4W5RA 5FULA 1U3WA 2P0AA 5IC4A 3DLBA 1XK7A 1EDZA 2J41A 3EGXB 2PR7A 2D2EA 3NP7A 5KX5A 3Q7PA 1ZKMA 3FRIA 1U04A 3ZY4A 3ECCA 4YRDA 2HJRA 1QYWA 1CVLA 3ZWKA 4E5MA 3SZRA 5JYBA 1VPDA 4HYYA 5IKOA 1PV4A 4YRMA 3C5WP 3CE9A 1HTBA 5ARCA 3B2NA 4G0MA 1KYXA 3A1CA 2WWTA 2NWQA 3PEWA 1A7KA 1EXNA 5AVQA 5IKXA 3ER6A 4JSRA 1NLFA 2QT0A 4G8DA 4ZT6A 2LP4Y 3FOWA 5DP1A 3U3ZA 1HLFA 1E6KA 2WJIA 4ZYYA 1W5EA 3LWZA 3Q11A 4HF7A 4RPJA 2H1HA 3KB2A 3N6RA 4ZDIA 1XVIA 3RAEC 4HQ0A 4UM7A 3EXHC 4FFBA 1O97D 2V1UA 3DDUA 1L7QA 1J8DA 4OQXA 3Q0TA 4PLCA 4QUDA 2XGMA 1AHPA 4EGJA 1K66A 3I9LA 3KHTA 4HTFA 4B4KA 4KQKA 2WFZA 2LVBA 5IAKA 5CW2A 4EPWA 3SFTA 3G0DA 5GVRA 4N5MA 5E1DA 1UCFA 1H0KA 4EHAA 2P9ZA 3MGBA 2P0YA 2GJSA 3CEMA 3V1TC 4WPGA 3MTQA 1Z4QA 2JGAA 2JNWA 2XUZA 3D1LA 4UM9B 1AV7A 2CJWB 4NULA 1Z5WA 4R1OA 4Y1RA 5JJIA 4MRRA 4MV3A 3GEMA 2B9EA 2CEAA 2OZLA 3L0DA 5E4YA 5B1IA 1ZEMA 2IHBA 2FZLA 1A4RA 1FPMA 4C7KA 1KGSA 1USWA 3HI4A 2RHJA 2WT9A 3OCXA 3KL2A 3KYIB 4B40A 3NIDB 4RY2A 1NZJA 3B13B 1V6CA 3EY4A 3QV2A 4FHDA 4WKGA 1LI4A 5CNJA 3Q3CA 4X6XA 1QTQA 2ACKA 4PYQA 5ALSA 1AJEA 2DHRA 4AMVA 4QYWA 2BUAA 4FYKA 4I4IA 1XRSB 3RC2A 1NUQA 4YR9A 4TYMA 2WYVA 3PC8C 1ZLYA 2VHVA 5CX1B 3VYWA 4DLZA 2QTNA 2J4FA 4FSHA 1PEDA 5LNK1 1ATIA 721PA 2LRHA 4QT0A 3TB6A 3UCFA 4LDNA 3SSNA 2CMHA 3O8CA 5FUWA 3V4OA 5GTDA 1CRWG 3FLBA 1N36B 2F17A 2ZIVB 3VNQA 1N0IA 4TQUS 4AF8A 4IZIA 2H4HA 1PEKE 1H0RA 1MUUA 1V48A 2PGOA 3DW3X 4ZZ1A 1RT9A 1T35A 1B8UA 2NZYA 1R6UA 2PCJA 2COUA 1YB2A 5J2TF 1IRIA 3RKSA 3THOA 3OMXA 3WA7A 4DQUA 2IDKA 3QENA 4IS3A 5AW2A 1Z35A 4YCBA 1T1EA 4L5YA 4ALMA 2ANCA 5J23A 3PYMA 3C6QA 4L4ZA 3O3NB 1D4FA 1G8GA 4PYOA 1CKEA 4UM8B 4D3SA 1N6PA 4DPLA 5FLYA 4GR9A 1DKPA 4UNPA 1MB3A 4ZRNA 4DUZB 4LJ8A 3LRTA 2PYIA 1YC2A 2A92A 3MWGA 1E62A 4EI2A 2NVUB 4ABYA 1FFYA 1E1CA 2XNKA 2E4WA 4I9UA 2VA9A 2PXHA 2YFKA 4RVOA 5LB2A 3W1WA 5WRFA 3ZC3A 4R3NA 1XZIA 3PPIA 3EMVA 1CRZA 2C4WA 3K09A 1MORA 2QZZA 2REOA 3C87A 3L9WA 3UMJA 4K9SA 4UU1A 5HFJA 2CD7A 3G2PA 4LG1A 1MCZA 5IKPA 5F76A 4XUDA 4BQSA 2BBOA 2BFPA 1SC6A 2XE7A 1YB5A 4Q82A 4UM5A 3H9UA 2ZSUA 1KO1A 1S7GA 4MVJG 4AP5A 3K71B 3WR5A 4HQNA 1IZ0A 3E22A 4N0MA 4FFWA 4RPLA 3WKDA 1ISMA 3PDJA 2IYRA 1B8OA 1U5BB 5HMMA 5LJIA 4NL4H 5FL3A 1QHIA 4EGQA 1K7XB 3K2BA 5IK2D 2VJBA 4O63O 1Z6YA 3AFHA 4NIMA 3U4QB 3M70A 4MS3B 1MA0A 4UNQA 3ZW7A 4EECA 3U9TA 4TXJA 1ZVQA 3GFOA 4OKIA 3NHAA 3ZCXA 4PF1A 5IUKC 2GVZC 1V7QA 3BHIA 2OPBA 3G8DA 1JDSA 2V9PA 4LFBB 4BJ5A 2HM7A 2APJA 1V11A 4N6GA 3DZGA 2JI4A 3E84A 1UC9A 1PR4A 1ZIPA 2VZ0A 3FWKA 2DTEA 5H3CA 3SHFA 3TW8B 2F7SA 3AERA 4OD0A 4PYMA 1E20A 4XSVA 3SG0A 2VNKA 3K9NA 2AFIA 5EESA 3U40A 5CFMA 1YAJA 3IR6A 2OCYC 3AV3A 3TD2A 4EUHA 3QBVA 3SF0A 1J7JA 2QXUA 3ANYB 1EHIA 3LMKA 2HUNA 4UW9A 5EZQA 1UBSB 3BIOA 4TZ0A 3CUWA 1VRVA 4U39A 3COSA 5DM1A 2O1XA 2BC9A 1EP1B 4DKXA 2I1WA 5IEJA 3I9V6 4YMVA 3TRFA 4XLTA 1ONPA 1ZPDA 5BN3B 3RNOA 1XTRA 1XEXB 3VH4A 2FXIA 4B33A 2BGRA 3QY9A 3CT4A 2J0SA 4LJ5A 2Z2KA 4MR9B 3K0FB 4WLEA 3GIDA 4Y1FA 3WV4A 3KKLA 4DLXA 2WKPA 1AZLA 2VNSA 2DB3A 2A0KA 2FB9A 1K06A 1UJNA 3BZWA 3BULA 4OI2A 5HIKA 2GKGA 3U9SA 3D6JA 2I99A 3FBWA 4JQSA 2BFMA 4FKMA 4N40A 4PIVA 4J0QA 2WZBA 2FETA 5DM0A 5JZ9A 2DGDA 1Q95A 3OEHA 1KI6A 3TNLA 5EE3A 1SPBS 2IY9A 2YNMC 4IRUB 2PRZA 1Q74A 2FLKA 1C3EA 1L5LA 1RXSA 4GS5A 2YWCA 2R86A 3K5HA 1U0FA 3CVVA 1G5RA 4UUPA 1A97A 1HYGA 2YQ4A 3Q3IA 4FJ2A 3VPSA 4JC5A 3ZQ4A 1Y3CE 5B55A 1E98A 1ISPA 1DC5A 1Z9BA 3KL4A 4IRXA 4Q9AA 5F1OA 2JLXA 4M1EA 1F14A 3PFGA 2VT3A 2FK8A 3SC2B 4RJ2A 5ITZB 5FNZA 5D86A 3OOWA 2XIQA 4Q24A 2NU8B 4BZPA 1RMTA 4IFIA 1N2JA 1DBVO 1DE0A 2YMMA 1XVUA 2EFCB 3BL5A 3KBBA 3NHYA 4QDZA 4B44A 3BTUA 4DG9A 1NI4A 3KT0A 4C7OA 1N2ZA 1XTUA 3WIBA 1NVDA 3VYSB 4J7AA 5J4VA 4G85A 4DY4A 1JJAA 2AJ8A 2Z6UA 2O05A 3PE6A 2XOKD 1AVTA 3RYTC 4B48A 4UBOA 4MRSA 4ZOLF 5JAQA 3O8OA 3AZQA 4XM0A 4NG5A 5JWRA 2C97A 5L3QA 4E33A 3SKYA 3OLZA 2HWXA 3OPYB 4LV5B 3TR5A 3HNPA 5F9MA 1PZMA 3I9FA 4ZC1A 6AT1A 4ATNA 1QP0A 3I37X 4UUBA 4B3JA 1Q21A 5E8RA 1E2UA 1H1LB 4PICA 3KE9A 3M2PA 1TM4E 3B2EA 1EZ1A 3FPJA 3UUFA 2ZYRA 3HNRA 1ST2A 1MHPA 1NOIA 4OFBA 1B8VA 1UWLA 4H7IA 2DP4E 3K9GA 4XWTA 5HP4A 3ICEA 4AY4A 4N48A 2P69A 4O29A 1T10A 3H3XA 4EO4A 5KDOA 4D9JA 1R8JA 3ZY2A 2EFJA 4IVPA 1OH7A 3AEQB 3LZDA 1GGJA 3RDPA 3CKMA 3IOBA 5B5SA 1ADFA 1CTQA 2I1LA 2X6QA 1HWYA 3LDGA 3Q5EA 4OXKA 2NU7A 3TIXB 2CMKA 1T2DA 1L6RA 4BJ1A 1P4RA 2MTBA 3AI1A 3PUJA 5LBUA 1JMYA 2ZRKA 2QN2A 5L6MB 3SXPA 5CPBA 3KALA 3ZY3A 5DNYB 2FOXA 1U2QA 3FW1A 4OH1A 4GPZA 4DXDA 4NJEB 3CTPA 2PGXA 3KZKA 2AW3A 2ZRCA 3F5DA 1OZ0A 3GWGA 4FCWA 4JD5A 4F4IA 4QBTA 3EPLA 1KE2A 3T38A 3X1JA 5B7NA 2Q2NA 1PCXA 2WMYA 3G02A 3H99A 1H8HA 4UZSA 5AK6A 3P19A 1V0JA 2XEXA 3IAUA 5CK5A 1T9GS 3IVMA 1J99A 3GEPA 4YDSA 4AKSA 2ECFA 2QM8A 2ONYA 4KAAA 4M38A 2HRCA 2NV0A 4NYMR 2AW5A 1SUBA 3PUZA 3W6PA 1RFGE 2GH1A 3JQ8A 4GWGA 4ZAXA 1IC6A 3DCYA 4W5QA 4OAPA 1J0BA 5JS7A 4Q7KA 1II9A 2GASA 2NUBA 3RUPA 1EUQA 2FGKA 2WKRA 4NNOA 2O1EA 2O14A 3IODA 2JVJA 4QOEA 3SSMA 2JD0A 1HRKA 1I0IA 1NN1A 3EXAA 3W5IA 3ICVA 5LQUA 1UEIA 3EVZA 4WXMA 3EFOA 5DCUA 4L08A 1DOHA 1MB4A 2GK3A 5KAPA 4PVDA 4L72A 3DOFA 2WYOA 1J0CA 1L5YA 2L17A 1W0JA 3G8CA 3R4VA 2WJAA 4LJ9A 3MCTA 4CPDA 4D41A 3VNVA 3KFVA 2EQ5A 1O03A 4PG7A 1MRZA 1LRJA 3STXA 2Q1TA 1NYTA 3G8AA 2CLEB 3H5RA 1RZVA 4JV5B 3EGCA 4WKBA 1TA0A 1GN8A 2B83A 2I1QA 2NT3A 2PS1A 2RGEA 3AJ9A 4KSYA 1CJUC 3ZWDA 1O4WA 4GM0A 1GNSA 2GUGA 2HLPA 2VF7A 1JEOA 1SRQA 4DC1A 2AGVA 3WI7A 4FJ1A 4NPCA 1F9EA 5HKKA 2CMFA 2R5WA 4ETMA 3N2GA 4TWZA 3RVMA 4UAGA 1KY4A 2MSDB 5GIPE 1O57A 4NSNA 9GPBA 2PH5A 5D5PA 1MH9A 3MJCA 1XRNA 5HK8A 5LMNB 1C3XA 1H3NA 2PMWB 3CVOA 3IB3A 2PUJA 2FP4B 4KDFA 4L57A 2WTXA 3QPVA 3VPAA 4F60A 2EHJA 3I8XA 5U9CA 4NZZA 2LR0A 3JPYA 3IQZA 2R8ZA 3H3JA 3LCVB 2O2YA 3C8DA 3THWA 4DSTA 4O1MA 3S8YA 2IEBA 3D5QA 1K4MA 2PT7A 2Y2UA 4W5OA 4BRUA 1E2PA 1O2DA 1OHHD 1U98A 3LUCA 4K0RA 2A94A 1I1HA 1PJAA 1I4LD 3L7LA 3K16A 5AXDA 5BW8A 4YO7A 5CAEA 5EJ6A 4L78A 3OFNA 5EJGA 1TQ2A 3NGLA 4MW5A 1WXHA 3OURA 4JLUA 2QJRA 1F5NA 2C5AA 5BPFA 2F9LA 4K86A 4KXUA 1WDLA 5AM4A 3K9FC 1G0NA 1XAJA 3FSRA 1A2QA 3GZTB 3D0RA 4MLDA 3UC5A 4AZTA 1M8PA 2UVPB 3F78A 1SUWA 2F3SA 1FMJA 3WHPA 4Y7CA 1EP2B 2KI5A 2XZDA 4I50F 3UAYA 2YJNA 4B35A 2GPTA 3IQFA 2P40A 4BX9A 3DWFA 1HNWB 1NRXA 1ZM3A 1AXEA 2GPSA 3OU6A 2F8LA 3K5WA 4I4TF 1IMOA 5TS3A 1RYBA 2ODNA 1JAYA 4JL6A 2UUBB 4M0CA 3ZWOA 4OUDB 1CERA 1E8DA 3IPRA 3PL5A 1L5KA 2H2IA 4AQYB 2BJVA 3OJCA 4B3XA 3RRFA 1QK5A 5B7PA 1BCRA 2ZIFA 3DQPA 4ZV7A 1G2OA 1JQAA 2ZCJA 4BFUA 5JWOA 2Q3BA 2VJLA 3G2QA 3NR2A 4A4DA 2HEIA 3EZXA 3N76A 3OWOA 3B6ZA 1N5JA 1UOEA 1W59A 3OPXA 1Y9AA 1YUNA 4LZNA 1VSBA 2NN3C 3IRUA 4U4AA 3RS0A 5HRCA 4R2XA 5FP0A 4HZUB 4ETIA 2EU8A 3H5VA 1EA7A 4CIVA 2RC5A 3OQ6A 1Q0ZA 3PHGA 4JGBA 1RKQA 2REBA 3I73A 3JD3A 3UMRA 3C7TA 4G8CA 3CO5A 4Q4HB 1HA3A 5JW6A 4A27A 5J58A 2ETVA 3QELA 1E2LA 1EX7A 3OZIA 2R751 1I51A 2IUSA 2WG2A 2B0JA 2OBXA 3P9YA 1TPYA 4ON9A 2TECE 4P80A 5E9AA 4ZI2A 3QU4A 1U1DA 4MCAA 1PWXA 1Z6XA 4R8MA 3FVQA 4H4EA 4LZOA 2CV1A 1A5TA 3HJCA 3VR6H 2BCEA 3ZCPA 3BL8A 4B7ZA 4WIAA 3ABRB 1KARA 4I55F 4JBWA 1GUDA 2VPZA 2XLBA 3A6GA 4HV4A 4OB7A 1TO6A 3BRCA 1LPOA 2GUWA 3EQZA 4TM8A 2ZUUA 5KX5F 3GLGA 2N46A 1TA9A 1Z06A 2ZBDA 2P2LA 3P0HA 4MRVA 2OCIA 2LPMA 2H5IA 1V95A 1KL7A 4YCDA 2BUBA 2QXTA 2IU4A 4ZI5A 1RLTA 5JATA 2X14A 1OGYA 3OE1A 2NPFA 2BYTA 3HO1A 1CQPA 1KJ8A 3KTAB 5LUBA 1UXGA 3PQ7A 1KU0A 3GHYA 4B82A 4JYBA 4PC1A 1N5MA 4TGLA 3WDMA 2VOJA 4M54A 3GC6A 1QWOA 1ZZEA 4DLAA 4YRKA 3TJRA 1YCFA 1Q83A 1GGMA 1LVGA 1NIJA 4RHFA 4JYZA 1ITZA 1B6RA 3N39C 2PUTA 1U8UA 2BGMA 4Y9RA 3WWCA 1LQTA 4MWTA 1U1CA 2II6A 2L42A 4G89A 5ALKA 4EX7A 4IDAA 1NMSA 4XFKA 3WBJA 3OMLA 4CLHA 4JSTA 2QUAA 3JVDA 3WAGA 2ZUCA 4MV8A 3NHJA 4P3PA 3P2IA 4E7OA 2PVCA 1XTSA 3AZOA 3DJYA 4HAZA 4UNRA 4JL8A 1KFCB 3WLAA 2NTNA 2YJ3A 4RPGA 2VKTA 4BL5A 4OJMX 1T1RA 1K6IA 1R74A 4RE6A 3SZUA 2QP3A 3U2QA 2XDWA 4JB3A 3WO0A 4F1KA 5ES4B 1XRQA 3L41A 2VAMA 5LQAA 4PCAA 5I7OA 4UZEA 1JYFA 3C41J 4R31A 5I9NA 2X4DA 3HFGA 4JUIA 4MARA 1SQGA 4MDFA 1SCUB 5KOJA 1CFZA 3PRHA 3ZU2A 4FHCA 3U3KA 4MYTA 3FMOB 1TYEB 3SHOA 3ZTWA 2QM3A 4P7GA 3INNA 1T0HB 1F20A 5DBGA 4YP7A 3EOZA 3R9IA 3JQRA 3T7TA 4E5NA 5EP4A 4QTYA 3EJ6A 3GL9A 3N2LA 5AI5A 5K0FA 4M9SA 1WVMA 1E1YA 13PKA 2EBWA 2IH5A 2CL5A 5F33A 1S6YA 2HSWA 3LVRE 1LQUA 1NMQA 1QIHA 1QFMA 3KYCB 1A27A 2XRYA 4K5QA 2FJUA 4CR6A 1XF1A 1YV9A 1L5SA 4LNHA 4F5YA 1IRXA 1K7SN 2FP3A 1H6AA 3SP1A 1HSOA 2O7RA 2ZE8A 4NVRA 4FMCF 3Q85A 4Q93A 4ZGBA 1CIJA 1GCGA 1TC2A 3BORA 3ZXXA 5IDWA 1ZGGA 4BS9A 4GM4A 4Y2RA 4N0PA 2JRCA 3QF7A 3QZUA 1W4LA 5FI3A 3KJZA 4KGVA 2C00A 3RCBA 2HT1A 2EF0A 3AEYA 3T7AA 1E99A 1ZN2A 2YWEA 2PZKA 1T91A 2I78A 3GRYA 2G5TA 2IXBA 4ASUD 1MP0A 3LW8A 3OKAA 1WULS 1W35A 3CBGA 3DHWC 3KQSA 1GQYA 3ZKWA 1E3WA 5FBVB 4X62B 1NVTA 3PP8A 3FYDA 2VQ3A 3IP6A 2JRLA 3VPHA 1K8XB 1DS6A 3T7DA 4WESA 1OFUX 5IHXA 1MH1A 2C94A 2J6HA 4BN4A 3UOGA 5E3HA 5HRAA 1E18A 2ZSIA 1EE2A 3O4JA 3OIFA 4LYFA 3VOBA 4KPEC 2QMOA 5E1BA 1BN7A 3N2ZB 2Q5QA 5AOVA 4PLTA 3C4VA 2Y66A 1N5LA 1FC0A 2JFYA 2I4LA 4DSAA 4V1CA 2HA4A 3KE8A 3EPPA 4R68A 3IAHA 4KBYA 1E7WA 5M7EA 3DEKA 1RHRA 3GUHA 4KN8A 4LYJA 3JZDA 3NTQA 2D54A 3JQ7B 1E79D 1JHAA 1MQSA 3QLTA 2BGIA 3SJ7A 1V45E 1RYMA 3VMMA 2Y99A 1E1QD 1E9CA 3K5PA 4V0NA 4A91A 2CBZA 3U3JA 3STYA 1Z3IX 1F9AA 3OQBA 3W8NA 3TD9A 2BONA 3U7RA 3TDKA 1J25A 3ROGA 2PNFA 1HOXA 4Y3UA 3T8YA 3G5AA 4C5AA 3HBNA 4IG4A 3U5ZB 2J30A 3K0BA 1V8PA 3NHZA 1JLMA 1L7AA 4OGFA 5D87A 3OQHA 4LSMA 1DO0A 2W5UA 3BWBA 5AOCA 3UF0A 3ZIUA 1C8KA 1T13A 5T4BA 4UPDA 1GNTA 2RAUA 4YRGA 3BDIA 2V9ZA 3E1GA 1O3YA 5BOSA 1A76A 3FTCA 1QHNA 2P2YA 3PSHA 4M36A 1R0SA 2FMTA 4JGGA 4IIHA 3I2GA 3X2SA 1IVSA 3SJCA 1L7XA 1RWVA 4MXDA 3DCJA 2WUDA 3H8JA 4L16A 3WRXA 5AJTA 4YXWA 3TZEA 3REOA 1FDUA 4YPVA 4IDGA 3F3KA 2HX1A 3A4MA 4YGXB 2J3LA 5EERA 4IHJA 4B1FA 4XUCA 1FNNA 2HJ9A 1AS0A 1UKYA 2A58A 2GBFA 2OHJA 3CF4A 3P9PA 3D7RA 2WU1A 2VYQA 4N8EA 1OJ7A 5GZ3A 4UHBA 3SQXA 1V2GA 3PWZA 4JL5A 1ZGHA 2DC1A 3L49A 4HJXA 1FLDA 1YHZA 4RX1A 4RADA 3WB0A 3QJ5A 1S1MA 3OHSX 2RK3A 1D2AA 2NUTA 3FRJA 3LDAA 2VAPA 2E55A 2GGSA 3OOHA 4OSOA 4PEVA 4U9IS 1AQNA 3DKKA 4AYXA 3BXFA 2BBTA 2ZJ5A 1BE6A 1E9EA 1KMIY 1Y1SA 2V6JA 1G9XA 4M9QA 4PLPA 3UWDA 3VU3A 2BDTA 3R3UA 1VHTA 4IPTA 5C7OO 4EB8A 1NM5C 1UZAA 4UCWA 4CI9A 4NU5A 3EWNA 3SU8A 1NLZA 4EM6A 3DFFA 3SYKA 1RQLA 2CE7A 2QN1A 4IGAA 3QBTA 2CGEA 4IINA 1G8MA 2ZYTX 3QHAA 2OHGA 3JQAD 4J0EA 1YZKA 3DB1A 1JQ5A 3MTDA 4K28A 4U1RA 4D0LB 3A6KA 4DEYA 4FB4A 4BTEA 5FL7D 4MW6A 1FS6A 1GSIA 2UUOA 4DDTA 5CB6A 1Z68A 4EG5A 5HK9A 3T4PA 4Z4GA 1U4OA 3PC2A 3ZNOA 1LDYA 1E2HA 4GPEA 4JJ4A 2OWEA 4FD3A 4QPDA 1FDWA 1MO6A 2DFPA 4NZNA 4TKMA 3SHVA 3B1FA 4QIHA 2WE7A 1T1JA 2VEDA 2TYSB 4M1WA 1T3LA 3ZWBA 4OJTA 2VT6A 2R5NA 1KQOA 1RWPA 3Q9LA 3QF4B 1BWQA 1W85B 3VYTB 1GADO 1JWBB 3R6GA 3O2QB 4PNPA 2FEMA 2O8DA 1O6CA 3EWSA 1XNHA 4IIJA 3VDQA 3KKKA 3H6HA 5IZ4A 4AQ7A 4NZPA 1KY2A 3R8XA 1B73A 4HKTA 1S5PA 2I9PA 1RWMA 3D3WB 1JHYA 1NQTA 2QUIA 3KO8A 2MT9A 3EFEA 5FNVB 4X65B 1MD9A 1KS9A 4WBNA 2R0QC 4Q1EA 3H5IA 3DE1X 4CGZA 3GRCA 3VGJA 1XPUA 4UU0A 1QANA 4JASB 5DX0A 4BFZA 5FI5A 4MWSA 2PO5A 2J0UA 1MGPA 3CZAA 4M0PA 1LPNA 5CH3A 4A9AA 4C0BA 1ZI9A 4EHJA 2Z83A 1D5CA 1XTQA 2M98A 3O9ZA 3P45A 5TGZA 2PQ0A 3EMBA 1Y5IA 4LE1A 4GR5A 4F4HA 1WZIA 4PYRA 5FH9A 1FBTA 1ZH2A 1T6ZA 1OLSA 2ZRGA 4LYAA 1SVNA 3ZJVA 3NJ4A 2ONZA 5BSWA 1E0SA 2R25B 2AKYA 2L0XA 3HYNA 4K6KA 4DVJA 4Q9KA 1CNEA 2PWPA 4W5NA 2M6SA 1UFRA 3QNUA 2BMAA 2V5UA 2G5PA 1BWSA 3PNPA 3NDJA 1UJ2A 3CEAA 3SAJA 4FI3F 5FLKA 1MAHA 1T4CA 5EMLA 2AFHB 3GPIA 1XK6A 2OEPA 5ARBA 3NUGA 4C14A 3SM9A 4YBRA 4WGGA 2I8CA 3PB3A 3COVA 1OFHA 3BMCB 3IS3A 4J4BA 1J0DA 3RSZA 4RNDB 3RO7A 1BU5A 4CL3A 5A3RA 3W5HA 5KTSA 5KHAA 1R0RE 4YJFA 3W1EA 2EP8A 2HCFA 4FDMA 4ISCA 5BXQC 2DYKA 5EWJB 3TLMA 4BP9A 4IIUA 3I2IA 4NCJA 1YS6A 5FUXA 5EQJB 1KBOA 3GJZA 2ICAA 5CYPA 1W0KA 3RHSA 3AL3A 5IXJA 5AHKA 2ZIWB 7ABPA 1FVXA 3J7TA 4I9NA 2Y67A 3H5NA 4C9BA 3F2VA 4UFOA 4URUR 1WZEA 3DBLA 4IJKA 4KV9A 1T4DA 2HPVA 3BHJA 1I2AA 1Z7BA 2BMVA 3RHFA 3U56A 4WLUA 2QENA 2OO5A 2ZDHA 1KOFA 3GLHB 1VHDA 3SR3A 3OZRA 2P9HA 1ORWA 1PGQA 2O3JA 1R50A 3EH1A 3Q9UA 5IC5A 3KVNA 3ZHXA 3LNTA 3MWKA 3UMBA 1R8YA 3AKCA 3OE5A 3IXQA 4F6CA 3U6BA 4NCNA 3SIRA 3LWNA 3OIGA 2HRQA 4L6IA 5LNK6 1RAGA 1PX0A 1TTQB 3VR5H 3TX6A 3VX3A 4ZQFA 1VHQA 1WHTB 3KHUA 3NBXX 4CT4B 4YHHB 2VJAA 5KTRA 2BGWA 1SIOA 4PM4A 2H4YA 2HMTA 3IIIA 1WQ3A 2QD1A 4LXUA 4QC2A 2QG6A 4W1QA 2YRXA 4ZEOA 3SEAA 1P7VA 3FI0A 3K09C 1SH7A 4KG7A 3EIEA 5AH0A 2YY6A 3TNYA 2F1OA 1ZYUA 3RS3A 1P1BA 3IQXA 2DT5A 1Z38A 3Q1LA 4N9WA 3VPCA 3QVXA 2HHJA 3KQOA 1AGYA 3IMCA 5I3CA 4XQ0A 1KK0A 2I7DA 2IC5A 4Q1AA 3BBLA 8MHTA 4Q7MB 3CM0A 3A14A 4H35A 1YR9A 1ONOA 3M82A 4J43A 4W5WA 4AZ0B 4QVIA 1U5CA 2IXEA 1XQ9A 4Y8VA 3PFCA 3K7EA 2EZ9A 2PV7A 3HFRA 4DE5A 3LLSA 3X1MA 4KVAA 4OXNA 4IUCS 4IWXA 3R6DA 1HTWA 3H2JA 5U1PA 3EPRA 3WGIA 1RZRA 2E48A 2JL1A 2ZREA 2Y93A 3HDYA 4C4ZA 2H9YA 3ZJ5A 1QAQA 1A96A 3B6MA 3ROQA 1W87A 3TQCA 2EJCA 4YMLA 4RF4A 1AKQA 4CODB 4Q3DA 4B2LA 2SICE 1DWPA 1F8FA 2BLLA 1SZDA 1YBVA 5LIRA 3C7CB 3UOAB 1O0CA 2H5LA 3FYUB 4DW8A 1QVVA 1E77A 1ULSA 1H5UA 1U8EA 5DNEA 3ANSA 4FZRA 4K1XA 3AFNA 1MZVA 1TJPB 1DMRA 4YASA 5DMHA 2FWNA 3U62A 4FFSA 3EXEB 3QG1A 4IDEA 3P97A 4Z86A 5FO1A 4HLUA 2W71A 3REQB 3Q3JB 2O0KA 5DULA 5AM5A 4KR9A 3OJ0A 5CEFA 1KE1A 4RKEA 1H4TA 3RQSA 2TSYB 4JVLA 4A8PA 2VJNA 3OEWA 1M6HA 1SPXA 1U2SA 3GO4A 2EX4A 3CKLA 1C8LA 5MN6A 1MR3F 1PS9A 1QGZA 2GVDC 3G7NA 4LSWA 1G38A 5FPSA 2B4YA 3EGXA 1GQ2A 2GCGA 2QZ4A 4DCVA 1SRRA 4LBZA 4Q18A 2AZXA 1LCIA 1IBRA 2IFTA 2A9VA 1Y3BE 1NQOA 1QTIA 3LKZA 4PTLA 1KZGB 4CNBA 5ADHA 1C4OA 1UJ5A 1JKXA 1V4NA 4DNOA 1I6WA 5CNMA 3WV5A 1E0JA 2H6EA 4TTSA 3S2ZA 1RBYA 4WZ6A 4XSHA 4BLWA 2AFIE 4C3ZA 4DR5B 5IAOA 3T3OA 3R24A 3OT1B 4IO0A 4IV8A 2H11A 3AF3A 5B6JA 3R3HA 1TVKB 1ZGJA 2G25A 2Z6QA 4F7WA 1JMKC 4YJGA 3HJNA 4D9IA 4LTMA 4NXNB 1CLUA 1EP3B 3DEJA 1OYWA 4XDZA 3GGJA 5EJAA 5DHFA 1OAOA 4BNUA 5LKAA 1T9ZA 1R7RA 1W25A 1ZJ6A 2OA0A 4WL0A 4E08A 1QRSA 2TMDA 3A9UA 4MW1A 5AUPB 4R6WA 2XWBF 3IP9A 4CJXA 3IEUA 4EKYA 3NANA 5AJZA 4NLLA 1UIRA 4PLHA 1KHHA 2FG6C 1B7GO 3N0RA 4B2IA 4DLPA 3QYAA 2ZU6A 3W3AH 3DBIA 1RQRA 4I6JA 1R0XA 2F3TA 4GOKA 3R3XA 4JJ6A 3RJMA 1RABA 2X9QA 2QJFA 2O7NA 3TS1A 4LTNA 1PD0A 1BIFA 1HBJA 2FN3A 4KWCA 4R1PA 4EPTA 4FDVA 2FVXA 3VDMA 4CT0A 4MVJP 5C52B 1LSUA 2J3JA 4P7KA 1K2WA 1T8TA 1X7DA 3U4MA 1T5DX 2CJWA 2DUWA 2EBHX 1GUBA 1W5FA 3MWLA 4FUTA 4G5QA 4EEKA 4ZPXA 2QX6A 5I01A 4BXOB 4CQNA 4JGIA 5JCJA 4KWHA 3TLKA 4C0QC 2Q4TA 2Q3JA 5BQPA 4P7FA 4X66B 1UT8A 3OZTA 3V97A 4E14A 2GPBA 5AKZA 3AY6A 2C4KA 2XI4A 2J6CA 3K1YA 3KR9A 3TLGB 1DTEA 5H7XA 3RK4A 2KSQA 3L6EA 4MSUA 1VTKA 1F6DA 1OOEA 3ND6A 4FOLA 2EKDA 2H4ZA 2YHIB 3IKVA 5TC4A 3RS2A 3KJEA 4UEJA 3EODA 4A5OA 5DWQA 4MYDA 3UAVA 1OUMA 3OLWA 2I7VA 3O3CA 5EUBA 3TINA 5CX1A 3USZA 5LD2B 1P1FA 4GFDA 3JQPA 1JNYA 4GMGA 1K3UB 4MLZA 3ZDRA 3C48A 2X8BA 4ZALA 3VSEA 4KO4S 1XTTA 4D4IA 4AJHA 2FEKA 1QHYA 1RJFA 3CX8A 3KP1A 2G40A 2PYZA 4FI3C 4TVBA 4XH9B 5ICFA 1KWKA 4ZK2A 2VTBA 1LTHR 2A1TR 4QSHA 4DJDC 1ZJ5A 1ISGA 3BTSA 4OU5A 3PNLA 1HNZB 5H68A 4CKYA 2NZWA 1FUYB 3DLIA 1IXKA 4FDUA 4FFNA 4A0RA 4Q5IA 1U7UA 4YRTA 4JJFA 4KWEA 2G36A 1HI9A 4DLUA 2X2EA 4JLPA 1IBSA 3KETA 4YUZA 4CM8B 3IUQA 5H9VA 3ESXA 4ARAA 4FEEA 4KX3A 3RVQA 4BO9A 4V0MA 4CMGA 4R0NA 1UL1X 2FW0A 4RZHA 3MHTA 3EVBA 2P3OA 3GMIA 5T3YA 1A2BA 5A4IS 3CW9A 3HWWA 1UC4B 3RTCA 2NW6A 4P4LA 2Q28A 4QAQA 1RQ7A 4O4IB 4BQQA 3ZV3A 4CQMD 5AVOA 3QU9A 1NF3A 1NYLA 5F78A 4UMEA 1QF6A 1V9LA 2C88A 4QGAA 4JEMA 1ORVA 3EGIA 3LIPA 4QASA 4DMKA 3DDSA 2I6FA 2JHCA 1JHMA 3Q7QA 4HUJA 1M76A 2ZBVA 3ETDA 5HGXA 5TNXA 1WQ4A 2V97A 2Y4NA 3IMKA 4KFUA 1U5BA 4Q4AB 3PIIA 3ZOKA 2QR3A 4S1VA 2BBSA 4Z2YA 4DG8A 3GEHA 3U4QA 1A8SA 5LCXA 5LZ8A 1P72A 3HK2A 2XGOA 3H8SA 2XQGA 1C8BA 3CPEA 2NIPA 3HG7A 5LMZA 4LJYA 1IXSB 1KQGA 2CT8A 2CJXA 3JQ9A 2FA9A 4PZ0A 3DW1X 5ALIA 1B16A 1EGHA 1P7CA 1EFTA 4M0KA 4P3NA 5JAIA 3KZOA 1FTYA 1NFQA 3WL8A 2P27A 3EW7A 4J6EA 3OI7A 5TQVA 2KWIA 5FLEX 4D9NA 2EW2A 4EYSA 1E2EA 2NSLA 1WSWA 3TW8A 5K6TA 3UQZA 3P4UA 3R5SA 3GJRA 4UHJA 4UE6A 5BSRA 2ATVA 4WZAB 3KLOA 4AG6A 4DLSA 1BFKA 2QE7A 2FE1A 3HB1A 4JMPA 5EXXA 1LJ8A 1J8FA 2Y0DA 1A71A 1C80A 1CWUA 1DAHA 1DQNA 1ZBQA 2BFOA 3BJEA 3FWYA 4G4IA 4S1TA 4HEA6 4JUCA 4N1AA 4X6LA 4Z3DA 5CDFA 2AMYA 4B79A 1RCUA 2DBRA 1UP6A 3K6RA 1KETA 3MJVA 1TF7A 4C6RA 1XNJA 4JP5A 4IHJF 1XEXA 2BUCA 4CEHB 5IH3A 2R1VA 1QK4A 2XV1A 3K0FA 4IR7A 2VP0A 5K03A 4TKVA 4D9MA 5C3MA 3SMVA 4V2UA 1T4GA 2AKEA 2BM9A 2WPDD 3M3PA 1BZYA 2Y1XA 4BKOA 5LQRA 3QH4A 1P80A 3JYPA 2MDTA 3AR5A 5ANRB 3IBTA 1WUYA 2Q3HA 4DVGA 1PJSA 1SXJD 2HEGA 3OJFA 4YRIA 1OX4B 1S01A 2VK2A 1R4AA 5JD6A 1OTHA 2A1UB 1BAPA 3LWDA 1CEQA 5LC1A 4CM9A 2WAMA 3NHFA 1NL3A 5KBYA 5L40A 1JA0A 5J2UB 3SXUB 4D4KA 2XMPA 2ZZNA 1NMYA 2QAGB 4PC7A 3I9JA 2CXNA 1T8PA 4K6FA 1VP9A 5M29A 1F8YA 1D6NA 1REQB 3SC2A 3UVEA 1IK4A 1II0A 1UZLA 4C7BA 3F8WA 4RPCA 5ITZA 1JHXA 2HU5A 2RHOA 3DO8A 1Y7IA 3BSWA 2GXSA 1RXUA 2C4NA 2KB0A 3DHEA 1BG6A 5C31A 2ZUTA 5EJFA 2ZJ2A 2JIZD 1CZKA 4NNJA 2M32A 3ZH2A 2A3NA 4L0MA 2P62A 3IOEA 3Q7RA 5NULA 5GM2A 1Z5NA 4G97A 1NW4A 2YIJA 2QD3A 1UOPA 2GFQA 2FPUA 3Q88A 1A7JA 4H6VA 4HPJB 5DGIA 2X5JO 3WGYA 1ADJA 2PJRA 2XQFA 2I7TA 1UJCA 4RGQA 3H83A 1FZTA 4RJJA 3MMSA 3DFZA 5F1PA 4FM9A 2UYOA 3SOPA 2XMRA 3P9CA 1ND5A 4E5SA 3NYWA 5AOAA 1Z8NA 3E0XA 4A6EA 4O08A 2ZJ0A 3VU1A 2OQIA 4QKQA 3JQAB 3GMTA 4FD2A 4IIJF 5LDDC 1CEEA 4NZ9A 4GXTA 4LGVA 1I1OA 3BSSA 3LS2A 1XYGA 4PZCA 4EUKA 1MVOA 2EDCA 3R0ZA 4EX6A 3W5AA 1V6SA 5ALGA 5TIIA 3WKBA 5JBIA 2Y1CA 4KQCA 4O6VA 3EZGA 3LT0A 2DWUA 3B20A 1CRLA 1EJBA 4WBNF 1Z2AA 2P79A 1G8AA 2NQ2C 3MJHA 1TYCA 5HM6A 4REOA 1RKXA 3K31A 4ND7A 5BN5B 2YXNA 3WNVA 3W2HA 4OK6A 1VIVA 2PKQO 3UFXA 1B41A 1P39A 1CY2A 3HR8A 3C98A 5E3JA 2QAIA 4YUYA 1RAAA 1CUAA 3DAOA 5JYCA 1WKCA 4HX2A 1V2HE 1VLVA 2FF7A 3G79A 3BILA 4L2IB 4UATA 4ERNA 4WFKA 1C14A 3CMMA 4NU6A 2IV3A 2FW7A 5B64A 4URXR 3GLGE 1E2IA 1EK1A 2FYTA 4D3YA 1NX6A 1V9SA 1G7RA 1EHYA 3RUHA 2WYWA 4KYUA 4MTCA 3U7IA 5ENZA 3UGQA 4I3GA 1H6DA 1VBKA 3CCFA 4IKPA 3L5KA 4KE8A 4LVUA 5ALWA 2DRIA 4CMIB 2RGDA 3O91A 2SKDA 3PPYA 4J7UA 5I48A 3P9KA 2B6HA 6NULA 4ECEA 2J7PA 4KXWA 4MVJD 1OWMA 3WHLA 4A03A 4G65A 4OK5A 3NJRA 1U8XX 2ZVJA 1RRGA 1WMEA 2W83A 3CPHA 4HLNA 5DASA 2CVHA 3CZ9A 2V7QD 3QXHA 4GUDA 4BQIA 2BMJA 3P0FA 4TPKA 2OV2A 3GFQA 5ECDA 4TXNA 5FI1B 2AOUB 4UKDA 1QYIA 3RU7A 1CJVC 2OGSA 2IX3A 2IHUA 4OF4A 4BQNA 5BYKA 2WSYB 3JZIA 2FV8A 4OB6A 2W2TA 3WNCA 4E2XA 3GJ6A 6REQB 3TGLA 1U0BB 4D25A 3H1GA 3OLVA 2XADA 5AVRA 1K68A 4XZ3A 1G6HA 2X8JB 5EGSA 4GUAA 1ECPA 4MUFA 1ZU4A 2GB4A 1CULC 3JW8A 3HU3A 4ARIA 3IMFA 4KK4A 3TAXA 5JCPA 4I8DA 2YOHA 1TEVA 3REGA 1IDN1 4KQ1A 4FYIA 3AF5A 1G20B 3O0TA 4RFLA 4YS6A 1MJ5A 2DBYA 3TYXA 3VSBA 3Q3VA 2ZS8A 4EHIA 1EVQA 3PRKE 4B0OA 3EE6A 3NAGA 4UXJA 2FP4A 4DREA 2XB2A 4GMKA 1SCKA 2VYVD 2YRWA 3GG2A 5C8XA 4OQ4A 4OI4A 1R00A 2ZI4A 1JHVA 3KOUA 2OXIA 3W2GA 4B4WA 3LZ6A 1WB9A 1E0KA 3QKTA 1C3LA 2H65A 1EGAA 1U28A 1W49A 3OE4A 3PENA 3MQ4A 4IOMA 2ZRJA 3A05A 1BD4A 2VRCA 4X63A 1KSGA 4DSNA 1LBTA 4K46A 2DSNA 5FOTA 5MN4A 1FQJA 1LFDB 4Z4CA 4GMFA 1D4ZA 1EUZA 3WSVA 3D8HA 3ASUA 2CF5A 1IXYA 2YINC 2H59A 3C5HA 3HA3A 1UXKA 4YAFA 2OB1A 4Q9JA 2NZ2A 1O08A 1PRYA 4DC0A 1GJRA 3SC6A 3UGKA 1SIWA 1JKFA 1JEDA 2Q5LA 5HS6A 1XDUA 4LK2A 3TR0A 1KYQA 2GD0A 3L6RA 3H4TA 1B1AA 4C2AA 3C8MA 4FNAA 4DLTA 1Z4JA 2R2AA 2C4VA 2I6XA 1XFAA 3D6VA 3EZFA 3P5BA 3IVRA 2ECPA 3M9WA 4I4CA 4YIHA 2P4SA 4F21A 1E4EA 3CF0A 5TV2A 5KB3A 1TCUA 3RR2A 1AKRA 4B73A 4C1NA 2VUHB 2C2BA 1VIMA 2OAQ1 3WS7A 1Z39A 2CE2X 2MMCA 3QKRB 3DE3X 3O75A 2XA2A 2AR0A 2YYZA 3H16A 4PGAA 4U7PB 5JAZA 4JELA 3A6DA 3A06A 3SYRA 2CXSA 1T0JB 5FTJA 1VJCA 1NOKA 4GKJB 2FPMA 3L6UA 4KSBA 1MF7A 1YR6A 3OEYA 1FLNA 4H0FA 1AZTA 2GHQA 4DIBA 3WRXC 4UNSA 5EINA 5E2BA 3PFHA 4JXZA 2POCA 3PA8A 4IQGA 1JIKA 1AKWA 2RH9B 1ZUWA 4HZUA 5IKEA 4PPQA 1M1UA 2XHZA 2QZSA 3DV2A 3GJSA 4N9QA 2JFOA 1TF2A 1O9GA 5ALXA 4MPRA 3VHLB 1VL8A 1MPTA 1NG1A 1YJBA 1Y9EA 4FK8A 3IAS6 1YB7A 4ILKA 4KXVA 4Q4HA 1Z6AA 4US1R 6Q21A 3UH1A 1E9BA 2B5WA 2QX9A 3R5XA 1S3FA 1DG9A 2E9SA 1LC3A 2XT9A 2OK8A 2NZ8A 4RV5A 1BMQA 1D9XA 3PUHA 3AL0C 4ALNA 4CG3A 2PUGA 2X3FA 4Q47A 4TYYA 3U3XA 1TO2E 4DUGD 2FQ1A 2HWYA 1XZKA 3ROTA 1GUZA 5K99A 1DKMA 1EYZA 4PPYA 4FSXA 4KQFA 2OQVA 3QKUA 1E9AA 5J4HA 1A9SA 4KHZA 3U4HA 4M8LA 4MHOA 1TQ8A 3E5HA 4GGMX 3AKYA 3LDHA 3E9DA 3L0PA 3VJRA 4UREA 4MQMA 4UBJA 5CW1A 1WU8A 2PY6A 2HADA 1WY7A 4C0XA 1IONA 3VVCA 3KTAA 2RGYA 4RL6A 1RS0A 2CNDA 5FR2A 5KSWB 3VH2A 4AVYA 2VZ9A 4LW8A 1NMEA 1YQUA 2G3YA 3PR3A 4RW0A 2VUTA 2H1FA 4V0OA 3IT2A 1UBLS 4BEWA 2PUEA 1KEEB 3AVPA 4D56A 5IBQA 2FWAA 2O4CA 2ACVA 4GXNA 3FTQA 5HJEA 4IXTA 4ARCA 5EG5A 3IGFA 1TM1E 3P9ZA 4IEFB 4WZBB 1W52X 5FEMA 1BXRB 3FUCA 4KIUA 3ORHA 5CU7A 1FRVA 2D1FA 4ZEXA 4LFAB 3E2PA 5AICA 2C9MA 4GBJA 3X43A 4E2ZA 5CT4A 4RIHA 1TB4A 4B81A 1FP1D 4DM3A 1YA6A 4P0QB 3Q2IA 2VQEB 3RUFA 5L4LA 2XD4A 3R77A 4HAXA 1KI8A 2AC7A 4NYIR 4HYTA 4HAVA 4UAJA 4ZWNA 2HTEA 3FM9A 5K9ZA 2F6RA 4KWIA 1OGJA 4NYMQ 1I01A 4NE2A 2OP1A 5DNVA 4ZI7A 3FF1A 1HDEA 1R66A 1RJEA 1SCUA 3FHCB 3GARA 3SQMA 1EM8A 4AJKA 3NO4A 4X8HA 1RPZA 1K8YB 4C05A 1LK5A 4ETNA 2CL7X 2WJYA 1T2CA 2D5AA 4QQNA 2CHUA 3ENVA 4E15A 4Q00A 821PA 3F6RA 2AYXA 2XMSA 1XI2A 2NO7A 2XTMA 4XGIA 2JCBA 4Q3CA 1EP9A 3RTGA 3WMWA 5K0NA 3NGMA 1P77A 1J90A 2IEYA 2E2WA 3D6UA 3LFTA 3KYCA 4RDCA 2FQQA 4S24A 4REQA 2Q1XA 1ODTC 2PBRA 5SY6A 1ZWLA 2IU0A 2J07A 2VAVA 1IU9A 3RAPR 1EB9A 2EOAA 3BXPA 2JD1A 2CFIA 3K0EA 1MDBA 1L5HA 5DTJA 4XJVA 3MC1A 1W29A 2F2TA 3CG4A 4AS2A 2A30A 5IZCA 1VA4A 3GJ4A 3Q12A 1X86B 4KQ2A 1QXSA 1VFNA 4K3VA 4MMXB 2OO3A 4S1OA 1Z4IA 4C5CA 3AVWA 1ZCJA 4IKEA 3IOMA 3HZRA 4UBIA 1JVBA 4QUBA 2H9IA 2WICA 4MGYR 4LXGA 4AYTA 2R8OA 2LTAA 3CX3A 3HZOA 4FDLA 4W5HA 3QFRA 3VZPA 2LDBA 2QQGA 2AEFA 1TK2A 3RSQA 1IAQA 1NGSA 4IDCA 4IQ8A 4L85A 2R6FA 3UK0A 5ES3A 5I4KA 5CRIA 2JFQA 3C85A 4E51A 1RM5A 1MIOB 3EVAA 3G2KA 4Y9SA 3RUAA 3S8MA 4D9BA 4E5YA 1TMKA 1NDUA 1EWKA 1W88B 3Q3EA 3DMPA 3RV4A 1G8KA 2W6OA 1BU8A 4ZXFA 3V8RA 4DCUA 1GNRA 2G04A 2X0DA 1Q57A 2B2XA 2DPHA 4EO9A 3IP5A 2HNAA 1RC0A 4G1UC 1L8XA 1MMFB 4FYWA 3MTGA 2MCFA 1V5FA 3HCAA 5T41A 4KQWA 3ZCQA 5GJBA 4MO9A 2BEUB 1P33A 2IY8A 1C3OA 3ON5A 1IE3A 2XQVA 4QT4A 1ZITA 2DUUA 1QO0A 4R84A 1KPHA 3NWJA 2MHCA 4AZSA 2OO5C 2QUKA 3A6HA 5D00A 5DZSA 3ODGA 4TXLA 1VG1A 4DXAA 3RYFB 2G1AA 3C97A 3L5OA 4B2PA 2ZWAA 3G7SA 1TQ6A 3VC2A 3SLKA 4BTVA 5A9SB 4Q7EA 3CH6A 1KQFA 3IUMA 2C5LA 4HMOA 4N41A 1ZRHA 3KS9A 4W63A 2C8VA 4D4GA 4JUBA 5A02A 3TGPA 4A26A 5AI4A 3PX3A 2JH8A 3ELYA 4TN5A 1FS5A 1MXFA 2JAWA 3PGXA 1Z29A 2IHKA 1T2UA 4ZCTA 3STHA 1WBDA 2AF3C 2Q6LA 4GPIB 2L19A 3L0