4WINA

Crystal structure of the gatase domain from plasmodium falciparum gmp synthetase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
228
structure length
228
Chain Sequence
YDKILVLNFGSQYFHLIVKRLNNIKIFSETKDYGVELKDIKDMNIKGVILSGGPYSVTEAGSPHLKKEVFEYFLEKKIPIFGICYGMQEIAVQMNGEVKKSKTSEYGCTDVNILRNDNINNITYCRNFGDSSSAMDLYSNYKLMNETCCLFENIKSDITTVWMNHNDEVTKIPENFYLVSSSENCLICSIYNKEYNIYGVQYHPEVYESLDGELMFYNFAYNICKCKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP synthetase
publication title Active site coupling in Plasmodium falciparum GMP synthetase is triggered by domain rotation.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 72
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2014-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4winA00
4UCFA 4Y1FA 4AUEA 4L7QA 2LXNA 1KEEB 4Y1RA 5JZMA 1P7ZA 1GG9A 4ENSA 1QDLB 2VDJA 4BTEA 4OJYA 3M3PA 4L95C 4B40A 1N57A 4L8WB 4WINA 3TQIA 3CZAA 4RKYA 2ZUVA 3PQ3A 1J42A 4JQSA 1VCNA 1QVZA 1IZYA 4GE3A 2NV2B 1OX4A 1FY2A 2RK3A 3MGKA 1QVVA 2YWDA 3NONA 1P7YA 3TTYA 3TTXA 2VKTA 2OR3A 4UOZA 5BV2P 4P2GA 1I1QB 5LIRA 3EN0A 5SY9A 4MGHA 3UMMA 5SY4A 3KKLA 4B7AA 2R1TB 4ZGGA 5SY6A 1Q2UA 1T36B 4AUMA 4ENPA 3PQ4A 3ZR4B 1JDBC 2R1VA 3EJ6A 3TTUA 3UGJA 1IPHA 1KWGA 1M6VB 1QF7A 3F71A 1GGJA 1SOAA 2A9VA 4D1YA 3BHNA 4P5PA 1A9XB 4ADSG 3B36A 2RK4A 4WXYB 3ZJ4A 4OGFA 2GK3A 3OT1A 5E9AA 4E08A 1L9XA 3CNEA 1I7QB 3L3BA 1OX4B 4ENRA 2GHRA 2VXOA 3F5DA 4ZDKA 2RK6A 4P35A 3EWNA 4ENUA 2YWCA 4QYTA 4L78A 4ENWA 3NOQA 1KWKA 1GGFA 3N7TA 3D54D 2YWJA 4RKWA 4Y1EA 3TTTA 1OX6A 2VRNA 1Q7RA 1T3TA 4XLLA 5DFAA 3TTVA 4L8YA 2D7JA 4GUDA 4I2NA 4Y1GA 3VU3A 3ZJ5A 4AUNA 4ENVA 1I7SB 1VHQA 2V4UA 3PQ6A 3NOOA 4ENQA 4LRUA 1P5FA 3FIJA 4P34A 1GGKA 4K2HA 1BXRB 4B2YA 2H2WA 4Y1RB 1S1MA 4L8FA 1C3OB 1QVWA 3UJNA 2AB0A 3P9QA 4R7GA 4B5KA 4OIFA 2FEXA 4N0MA 1QWSA 3OT1B 2WJZB 4UOQA 4N12A 1O1YA 4I46A 4BIMA 3NOVA 1IZZA 1G2IA 4OGGA 4OFWA 4ZDJA 3ER6A 3NORA 4UZSA 4MNTA 3B3AA 3UOWA 1SY7A 3UK7A 3SF8A 3R74A 2ISSD 1R9GA 1PV2A 4S0ZA 3CY6A 2XF2A 3MIIA 1CS0B 3PQ7A 1OY1A 1PDWA 4AJ9A 3FSEA 3TTWA 4PXYA 1P80A 4UNIA 1PDVA 4ENTA 4B31A 2ZUTA 1ONSA 1WL8A 2R1UA 2R1TA 3RHTA 3PQ2A 2AD5A 3BWEA 1UCFA 2R1VB 1GPWB 3NVAA 1OX5A 4MTCA 1VCOA 1KXJA 3EFEA 1U9CA 3GRAA 1KA9H 2W7TA 3R76A 4AULA 4E5VA 5K4AA 3L7NA 1GGHA 1CE8B 2ABWA 2ZUWA 2IUFA 3PQ5A 1JVNA 3CZ9A 4ZDIA 3L4EA 1GGEA 2NV0A 2ZUSA 5SYAA 3TTSA 2VPIA 3EZGA 1VCMA 3CYFA 3R75A 1CF9A 3SF8B 4P36A 4LGYA 4Y0NA 4OQ4A 3B38A 4I4NA 3P9RA 1FYEA 3PQ8A 4GE0A 5JZOA 1PE0A 3P9SA 1T0BA 1C30B 4HCJA 3L18A 1K9VF 1OI4A 3SOZA 5IP5A 2ZUUA 1P81A 4BFLA 4QYXA 2YWBA 3WFZA 1GPMA 3P9PA
chains in the Genus database with same CATH superfamily
2QE7A 1V48A 1XWIA 3D2BA 2VHYA 4GUAA 4EUEA 4CQMD 3MCVA 2P9CA 1HE4A 5T4BA 3D7KA 5ILOA 5EN4A 3AVUA 2DX7A 2VDJA 3JYPA 1MZVA 3HI6A 3R6DA 4GXTA 2CJXA 1DO8A 1RLOA 3C3CA 4GMGA 3AZQA 1W88A 2CUZA 2D1TA 1JIQA 3PUYA 3TF5A 1D2GA 1O54A 3C4QA 4MRSA 3O2NA 1ESCA 3N6VA 1H23A 3I0MA 3HMKA 4Q4HA 1WWKA 5SZIA 1EG2A 2OVBA 1NLYA 3MMXA 1NF2A 1Z0AA 1WMDA 4W7IA 2F6RA 2CB9A 2GEBA 1OYYA 1PNVA 1E20A 1R0RE 3OJCA 4XIYA 2YNMA 3OY2A 4O0MA 2FZWA 3DLAA 3CLUC 3OEEA 3DTVD 3TK1A 3X44A 1W93A 3B6MA 1PZEA 1AA6A 5KQRA 4NCJA 2R8EA 1ORTA 1P4AA 2OPBA 4IZIA 1ATIA 4GKBA 3ONDA 1C5KA 2JGDB 1JIKA 2EX0A 4R1NA 4I4TA 1SCNE 5CYOA 4XQ0A 2JFPA 1L7RA 3UANA 4YV7A 1MB9A 3L3BA 2CLLB 3PL5A 4EX7A 4ILEA 1BVUA 1PR0A 2BFMA 1IZ0A 3UB2A 1ZBQA 3RAFC 4DNXA 4Q7LA 1NMQA 5FLEX 4DC9A 2WWVD 1JDSA 4IHQA 4BXOA 4URHA 2E7ZA 1WDWB 4MLZA 1AGRA 2D2VA 4YI3A 2ECOA 2EZ4A 3CCBA 4QLBA 1BJRE 1JHUA 2W22A 3EQ9A 3L01A 3P0HA 5FFNA 4HAVA 3S3TA 1GGVA 4DC0A 3PPVA 2HUPA 3L7LA 3IX7A 2VSYA 5KTKA 2E4UA 3K4QA 2KE5A 1P1KA 2IH4A 1S8FA 3U4QA 1YVRA 2P1ZA 3WWCA 2Y1CA 5GGXA 1CK4A 1DKPA 2P2ZA 4XR4A 1R5JA 2ZB4A 3IB3A 1DQPA 3MSCA 1I94B 4AKGA 4FZVA 1TCBA 3D31A 3SZ3A 3TLEA 4AQDA 1LVUA 3LBFA 1I6LA 2VZ8A 1VCHA 3QHAA 4EG4A 2J87A 2BFCA 2Y99A 3I4LA 4PVDA 4NOMA 3VKUA 4F4IA 3OLXA 4I1RA 4YDSA 3GBVA 1HR0B 3GLGE 3UKOA 3KZVA 1S3FA 1X6VA 1PEAA 4MQEA 3KJFA 2FG7C 2I4LA 3SBOA 1CJKC 1CY8A 4WKCA 2GDJA 2JCYA 3I5UA 4EJSC 1XVAA 1IRIA 3EQ6A 3VKGA 1S2OA 3A6JA 5KCZA 4EG8A 3O8QA 3K0HA 5K09A 1JAHA 2PEZA 1XC7A 2Y05A 2D0PB 2WTUA 4X54A 5EPOA 2VJCA 5COBA 2CJWA 1ZOOA 4WASA 5KOHA 4Y6SA 1PT9A 2HT6A 3CRRA 1MUUA 4MVCA 4OM8A 1OUMA 1ZIYA 3GRZA 4MVJD 1XO1A 4GD3Q 1KYVA 3OFSA 4QBHA 3EMVA 2Q2NA 4XR9A 4GVLA 2ZYAA 4JH0A 1KE2A 2J3QA 3RVDA 2Q2QA 4QXAA 2ZU6A 1U1GA 3CLTC 1JDPA 2ZIWB 1FYEA 5FOVA 4BAZA 1GZ7A 1W34A 3JU3A 3QPWA 3I6BA 5IKMA 1T0BA 1XTVA 4P6VF 1MX9A 1SR8A 1BKDR 1NVFA 3KZNA 3BH0A 1CW2B 2PBLA 1ZINA 4Q9JA 5KMGA 2OV8A 1Z6GA 1ONOA 2K2QB 2Q99A 4LXUA 5C3UA 1HUQA 3K16A 3ZHVA 5I3ZA 2QZSA 5D3MB 3ZVNA 1NG9A 3V3KA 3SHWA 2NU9A 1NTOA 4TL6A 4O4IB 3I76A 5AVKA 3U4DA 1U3UA 3UO8B 4KXWA 4PNEA 1M8GA 2NIPA 1LKZA 2IEAA 3I2IA 4Y9SA 4KH0A 1MO6A 1E5LA 3PDHA 3QPUA 4FHGA 4NPHA 1EPUA 2Q6VA 4TTTS 4XGIA 4PN7A 1N2BA 4OBBA 2TMGA 5L3QA 3UHAA 2ZUCA 2NU6A 3GZNB 2DBRA 5FO1A 1U1DA 4KREA 5ULLA 2RGEA 2ICAA 2WJGA 3Q87B 1NL3A 4KHZA 4XJXA 1Y8ZA 2UZ0A 4ZQGA 1TKBA 4LY9A 3LLCA 3MCUA 2FWJA 1KO4A 2V45A 4UHHA 2WT9A 4K9NA 4YRZA 2B78A 1RXYA 1VJ1A 1Q19A 1KI4A 3IOMA 4A3SA 4RKRA 4G8JA 4AS1A 3TIGA 4JVLA 1E1RD 1EDEA 1PK9A 1JDBC 1ZM2A 4Y6QA 2J5XA 3C4VA 3RIGA 4O4IF 4EWLA 2AOTB 1IBLB 2HCBA 3W3AH 3IMKA 2EW1A 3CUUA 4PCVA 4XDGA 1L4GA 2J4FA 4OF4A 2WMDA 2ZZKA 3R0JA 1PJBA 1UEIA 3CSDA 2LCQA 1NVVQ 2PBRA 1TO2E 2HGZA 2II6A 4IRMA 4I8DA 1NZJA 4FI3C 1EP9A 1OHHA 4JIGA 1E77A 1XZFA 2F67A 1DQNA 1OTXA 3ABSB 4JKIA 2CCGA 4GDMA 3QA9A 1JMVA 4OLJA 3RFXA 4YP6A 3COSA 3LY5A 5J2UA 1ZCJA 3EVTA 3H1FA 4LFAB 4C87A 2G0TA 2K4MA 5EEHA 3O90A 1PK8A 5L6MB 2QR5A 2GZMA 4DT1B 3IP6A 5ED4A 4KLCA 1N92A 3WFIA 1NNEA 1YRWA 2XT9A 3T9EA 2EZUA 4RVHA 1YJBA 4UPVA 1CB7A 2FXIA 3QKSA 5CB0A 3P4XA 1BH2A 3HVKA 2YVKA 5DEOA 1U0GA 1HYBA 2Q5HA 1UJCA 1UXHA 1BA3A 2CDRA 4X1YA 3R9IA 5I4CA 1MHTA 1P7VA 1EMDA 4CKCB 4AURA 1V8ZA 4PG4A 3K9FC 3CY6A 4W5TA 5AW0A 2NVUA 4BNLA 1PQWA 4PFJA 5EKXA 4AJJA 1QFZA 1P3JA 3MNFA 3TTWA 3OMLA 5E9QA 2GHQA 5FOQA 4AJ4A 2R62A 2WMYA 1U2DC 2C9MA 4IOMA 1IE3A 2FF5A 2YQ4A 3KJHA 1FP7A 4X1IA 1TUIA 4KWIA 5AM2A 1SZPA 4JI7B 4HQNA 5M2QA 2NXNA 3CRMA 1U2PA 3OP4A 5EHZA 4FZJA 1VL5A 1KXJA 3F8TA 3IJ5A 2DUMA 3PFFA 1MEJA 3O9MA 4GL4A 5IBCA 1CRWG 1SM4A 2GASA 5DXJA 3V8PA 5K45A 4LC9A 5T4FA 3O7MA 4UM5A 1TX4B 1N7HA 3MJTA 5I51A 7GPBA 3GWZA 1WVGA 3ZCSA 2C8VA 2ZB7A 2V0NA 1KERA 2ERCA 1K4YA 4EAQA 3P9RA 3O82A 3QXCA 3CZRA 1LLCA 3GEPA 3F3SA 3HUFA 3W04A 3I1IA 4HFNA 4D81A 1AF7A 4JBXA 1TJNA 2P3SA 4ZVMA 4OQFA 4YJHA 3ZW8A 5IXSA 1Z2PX 5JWOA 3PXXA 1A9ZA 1KKUA 1P4GA 2VT6A 4OI4A 4HB4A 1EVKA 3JZIA 3DS8A 1DSSG 4YT5A 3HV2A 3QGMA 4MB2A 4EFKA 3WNCA 1TQ6A 2ZE6A 1K68A 2RCYA 1HE2A 3EW9A 4P7BA 1WX1A 1E9DA 5DKFA 2V7EA 3BHMA 5CW2A 5JXHA 1WD7A 2CZCA 3BMCA 1KHHA 2Q5EA 3M8KA 5DYWA 2OM2A 4BO4A 3THXA 1J9GA 2WY2D 5JS2A 1EX6A 1ZG3A 3D7RA 4FDUA 1J42A 2G7ZA 4KXUA 4OMFG 4YLEA 4JI8B 3MWDA 4M37A 3O8DA 3SBEA 3C3XA 5I48A 2RBKA 1H2WA 3H87A 2NZVG 1VHTA 1J2EA 1RADA 3D7LA 2CBXA 4LRXA 4B6FA 1NBOA 3D6MA 1EP3B 3B5EA 5D85A 1L4UA 4MMZB 5GONA 2NNWB 4KYUA 5K3OA 3I3OA 4MGHA 3DBRA 1NW6A 3BJRA 5BV1A 4UHDA 5IJWA 1T3ZA 3RTCA 5JQGA 1XP8A 3O8NA 4AZ3A 4DM7A 3WMFA 2DHCA 1CUWA 4I1OA 1ZXLA 3CW8X 4Y9DA 5TPWA 3WLPA 1W0JA 1Y7PA 3GP3A 4MV6A 5DGIA 1OPRA 5HEKA 3U3ZA 4AL4A 4E2FA 3HJAA 4NQRA 5DGTA 5JZBA 4NYIR 1XEWX 4DEVA 2R8XA 4RULA 2WIKA 1G4AE 2XOXA 2VAWA 3OJLA 1O08A 5AHRA 1FXWF 1JQBA 1UR5A 1YS6A 4IDQA 4IQ0A 3W6PA 4B0OA 5K8VA 2VR1A 1GZ5A 1IONA 1VYVA 4NZNA 2Y0CA 2OUIA 3SQNA 4MW4A 1NBME 2FFJA 5CA1A 2WVGA 1Y6QA 1L7AA 3SU8A 4DMRA 5KHLB 2P3OA 2Q45A 1V6SA 4ZJYA 3ED1A 1QRSA 3W78A 4MKIA 1QH1B 2O48X 3VPBA 2GPNA 3COWA 4TLEA 3D3JA 2ZIXA 4QM6A 5CJJA 3WI7A 3ZY3A 1KI8A 4XH9B 5EWJB 3JQ9A 2QQ0A 3DAOA 2GR9A 3D4BA 1CVIA 1WW3A 3WTBA 4CXMA 4S3MA 5HSGA 1JEEA 1W73A 4I55B 3NBKA 4KP7A 3UC9A 2D00A 1T6BY 2YOHA 2ZJYA 3GJXC 3QWFA 3L6EA 5A3SA 3AM4A 2V3VA 3L0YA 4OUKX 2FUEA 2QVYX 5DM0A 3VMFA 3T1TA 3JX9A 1ORHA 3D1LA 2P2NA 1H4SA 3OJ0A 1MHPA 2CYCA 3FLMA 4HSEA 3WSTA 3GVHA 1FX0B 3ZDRA 3QBVA 3GV0A 1XWFA 4R1LA 1YZLA 4DABA 2AE2A 3CNHA 2OAGA 3MGBA 3R3WA 1ICEA 2A4MA 3HVIA 5JI3E 1H9AA 1TE2A 4D6PA 4I3HA 4M0FA 2A7QA 4MVJF 1OLSB 2L0XA 4DCSA 1DWUA 3SQLA 1H6AA 1YCGA 3QEJA 2Q5OA 3M81A 2IE8A 4L51A 2DUUA 3IQDB 3ZIAD 2NSJA 3M2TA 1IATA 1AN0A 5KU7A 4UAVA 3H3XA 5B58C 2PH1A 2QWXA 3LMKA 1F6DA 2AD1A 3PFIA 4MEBA 2NSDA 3SJ7A 3ZD9A 4CT5A 1DUSA 3ORYA 5H68A 5C32A 3UMVA 5IC5A 3DO6A 3SYRA 3SKXA 5EERA 1DJMA 2DPMA 1JJIA 2B7BA 2XTMA 1CRPA 4Y2RA 1NX6A 2N75A 3OIGA 5AESA 1SCUB 1PNTA 4OAPA 1N2SA 5CH8A 1T3LA 1H2AS 1C3VA 4OB7A 3RJMA 1EK2A 3TVYA 3ZLJA 2XVAA 1YVDA 5L7TA 3ABIA 3CLSD 4IIDA 5CURA 1MPTA 4NLLA 3OCXA 4HDSA 1D8TA 4MWZA 2UVQA 4P4LA 1NUUA 1Z13A 3GEBA 2AJ8A 4WLVA 1MC8A 5FEMA 4Q66C 4YRCA 4S05A 4QFBA 1W19A 4GM1A 3ZY2A 4KE8A 2CKMA 3NCHA 3H3JA 1DAGA 1RWOA 1KPGA 1SO8A 1NHGA 3K9LA 4ZN6A 2O59A 2XQGA 4AECA 5HW0A 3E7FA 3F6RA 3K0FB 4LI3X 4A6EA 3VKHA 1J07A 1N8SA 4EO7A 1F5NA 4M9XA 4D8WA 2I2FA 2PMCA 3QELA 4MGZR 1XZMA 1EAMA 1X92A 4IDDA 3RARA 1CV2A 2D4HA 4NH0A 4F7DA 5AIBA 1YZUA 2F43B 2C5HA 4CDNA 5AUPB 3K20A 2EKZA 1E2BA 2DVMA 4IDNA 2IBTA 2AMLA 2FFHA 2UVDA 4EYSA 4FHEA 1FTSA 1QOZA 1QKKA 2P2CA 4ZEVA 2CNNA 3AT1A 4V0OA 4KOEC 1VLMA 3D7NA 3PX3A 3NYIA 4P4UA 5C1DA 2GYUA 4AKHA 1KY3A 4RV9A 4UPEA 1J23A 2V98A 4WNAA 2CUTA 4FCVA 4YV1A 3T5DA 3VKFA 5LZ2A 4PY2A 2HF9A 2RGAA 4BFUA 4ZVLA 1QIMA 2PMWB 3HYSA 3WLKX 2D0DA 4YHHB 4JB3A 4Z99A 2ROQA 3MK31 3N7TA 4FE3A 3ZWVA 2XWQA 2KW5A 2P9HA 2XT6A 3MMPA 3V2UA 4XB1A 3F5MA 3RIXA 5CB4A 3GIDA 4CF7A 2KM1A 2WPDD 1YDGA 5T57A 3T7KA 4G4IA 5AKZA 4P0QB 4IIUA 3WHPA 4ZPJA 3NH6A 1BXRB 4EB6B 1THTA 2X77A 3FNRA 4INPA 3UJNA 4N3AA 5HZMA 1UBLS 1EBBA 3E9DA 4OFZA 2VJBA 4GRIA 3RC3A 2YCBA 3EZ7A 3CR7A 4MINA 4EB0A 5K4GA 3ENKA 4KG7A 5EE1A 3ZKWB 1LBIA 2H4FA 2TMYA 4EBFA 5IKPA 1P0FA 1UJMA 2A9FA 4OUDB 4OHWA 1BMFD 2OHGA 5ALEA 2OXIA 4EHNA 2E4VA 3KR0A 2W2OA 1NW8A 4HEHA 1I7LA 1IOZA 2FWPA 3L1JA 3T1HB 2IYUA 1GCIA 2HCRA 2XNCA 1Z0FA 2YRXA 2C96A 2BF7A 1SFRA 1XZNA 2ZI7A 2IEIA 4MR8B 3BTUA 3D6HA 4NV3A 2WQ7A 3F9RA 1QU3A 5KIAA 1NNUA 2VG8A 1OX5A 3ESBA 5CIWA 4HH0A 1GRCA 5EKSA 5EWLA 5LCXA 3HCAA 3LE8A 4XM1A 3QLEA 4EENA 2AZMA 5JDIC 9GPBA 4O1MA 4X8OA 1S4QA 2YIMA 4P3OA 4RXMA 1HZZA 3QLUA 5I7OA 1IQ0A 2FJUA 4B6GA 4BOYA 5KNBH 3K0SA 5A9RA 3MINA 1C0PA 4HH4A 4IYJA 4KQGA 3HSKA 1G5FA 2WJJA 3T9BA 3BORA 4OQYA 2XNDD 3EXHC 4RJLA 4BGIA 3LKDA 2Z4RA 3NEPX 4GSKA 1PJCA 4BTLA 2ZE5A 4ZAVA 2H0AA 4BLTA 3EODA 1UBFA 3EMKA 2WUVA 2NSYA 1WOYA 5AWFC 4B3DA 2LXNA 4IWYA 3KLOA 4QXRA 2FR8C 1M1NB 1TVKB 1Z18A 4U2GA 5JRDS 2PM8A 4PSAA 3SS7X 5HJ2A 2ZREA 4HBGA 4RCYA 4G5SA 1P0PA 1NN5A 1UAYA 5EPEA 3IULA 2ZSDA 1KQGA 1QUFA 1WPXA 2MSDB 4G1EB 1C81A 4NWIA 5JCOC 3ZVRA 2HCTA 3PX7A 3DV2A 1KOLA 2L69A 4OX9Y 2VUHB 5HQ3B 3GFRA 4KXQA 4L6IA 2GCGA 4POAA 4BN4A 1BU5A 4LPSA 1SELA 4GKKB 4CM9A 3DOOA 2P65A 3TQQA 1H6CA 4G37A 1KVRA 4MVJP 4BWGA 3KQNA 4ARVA 2QM8A 1QK5A 4Q4AB 3DFIA 5SICE 4ZGGA 3IMCA 4C7JA 4MW6A 5IX8A 3LCJA 2IUTA 4M1TA 1STOA 1X7XA 2DR0A 2GLXA 2ZT5A 3N07A 3ROFA 4JLWA 4EGJA 1FTWA 2P5YA 2IVZA 4FFPA 4TWAA 2QMUA 1U7HA 3ZTWA 2FLVA 5LUAA 3AR4A 5K0JA 5KX5B 3EGDA 4Q9AA 5TX7A 2HBQA 1C7IA 1NQXA 2RK4A 3S8YA 4FNOA 4ER6A 4IDPA 5GQSA 2PH5A 2JD0A 4G2NA 4G5RA 5AVTA 2XODA 1QIDA 1H2XA 2OO7A 5LZ7A 3MWEA 2C9BA 3UXYA 5MN5A 5A71A 4JP3A 5KNDH 2IOFK 2IYTA 4HFJA 2RDMA 4X91A 4XDZA 1I1HA 4BX0A 4NBTA 4D3FA 4RVSA 4R2JA 4YQFA 4JXXA 1XQYA 4RQUA 4DB4A 4OYHA 2D7JA 2JVJA 3HKBB 2H5EA 2EDAA 1I6WA 3L7BA 1T13A 2EJBA 4UEOA 3UTDA 4DKJA 2C9YA 3JQQA 1MB2A 1P5FA 4EPVA 5KO2A 1CNMA 4I9FA 4B5KA 4EQZA 4FB5A 5KX5F 2WKSA 1EXDA 1FFHA 1QWSA 3BYZA 4GEKA 2ONJA 3RRNA 3TG2A 4GOKA 1OQAA 3NOVA 1AQUA 1G8HA 1RCUA 1RRPA 3OZDA 3QXHA 1P39A 2ASEA 4KXYA 5JNRA 1M2VB 1N2JA 4LJ5A 3V00A 4HPJB 3SM3A 1JIUA 4P82A 2P9FA 2O4CA 4HMQA 2B4TO 3A4TA 3RBXA 2BUCA 4GF5A 2B36A 1PDWA 1N0HA 1Z26A 2DZDA 3KKPA 3OIFA 4IFIA 1M2NA 1XTTA 2ZSEA 1QJCA 4NABA 3TRFA 5KWVA 2GFIA 2Z2KA 2JZCA 3FFBA 1EM6A 4U2DA 2G4LA 4Q7QA 5JRJA 3BWXA 3I4CA 1LDYA 1F0NA 4O1HA 3BL6A 1A9PA 4LTMA 2HSWA 4DTCA 2OCKA 3LT4A 4E5VA 3LBYA 4ZI7A 4ZP1A 1N5LA 2CNWD 3CLTD 4O4JA 1YXMA 2HX1A 3H13A 1C50A 1WIWA 3CVUA 4KR2A 5MHTA 3N9IA 2B35A 2P4EA 4UUMA 4KWTA 3ITDA 2LDXA 1KQ3A 3LD9A 4KV7A 1NRIA 4TN1A 5HF8A 2DM6A 1JEAA 1XDWA 4QO7A 3RS4A 4MRAA 3Q4GA 2X6TA 2JHAA 2I29A 4JL8A 2QTMA 2EV9A 4BRUA 5A4AA 4R2IA 1YRQA 1PSWA 1DC7A 2FGJA 3OE4A 5FWAA 2QTGA 2X4GA 1VOTA 3E7XA 5DNDA 2KYRA 3M1IA 2MHCA 4UCFA 4AI6A 4KKVA 2ZDGA 5HCNA 1R0ZA 2E21A 4RTPA 4YBZA 1O97C 1ZUNA 5REQB 5TVKA 1B8VA 1PSDA 2VBCA 4G5GA 1PTJA 3ZWCA 1U90A 4YJ3B 1ZJ5A 4G36A 2NN3C 4HX5A 2JIQA 5TV2A 1L5KA 2FEAA 2BFEB 1PFQA 2YQZA 3TW8A 4DDHA 3TNDA 5IKEA 1EFAA 4K87A 1M1UA 1T29A 1B6TA 2ID4A 3HA5A 4R54A 4ZRDA 2WJPA 3PA8A 5KYXB 2AFIA 3RU9A 2PDAA 5J2TB 2HA3A 2PGOA 3DUWA 4Q00A 2MR6A 4YRSA 1FA9A 3UCEA 3U4MA 5FHRA 4QPZA 4MWEA 1LK5A 1ELOA 2BZSA 2PX2A 4U02A 1DS6A 3WC4A 1OGYA 3FFWA 5DCLA 4G0VA 1PS8A 1N36B 2OO3A 1QZXA 1U7UA 5IDWA 4IR7A 5FPHA 3FOWA 3K2QA 1U5BA 2IVFA 3AV3A 2YX1A 4L3OA 1UP7A 2AHOA 2PHZA 3FNGA 2YV3A 3MELA 4ITUA 3RFFA 2P91A 3BK2A 3UFBA 4J0JA 2EQBA 4EJFA 3ESYA 2PYIA 3E3MA 3GT3A 2HHLA 5IXYA 3EBOA 4NATA 2BTEA 3ZWPA 4J1SA 1VRVA 1X2BA 3C6YA 5H82A 4KPEC 1Y1QA 4DM4A 3OLQA 4RFVA 2VWHA 3BMNA 3S2ZA 3SICE 3TFQA 3V7YA 1XTZA 2I55A 1H3NA 1MKYA 1XGKA 2VRNA 3GCXA 2FY8A 2W6JA 5J2TF 3QK7A 3OOSA 4J6EA 4JQCA 1PW5A 1UH5A 3O1IC 1AQNA 4MUYA 3I45A 3G68A 1GWNA 2E1RA 5CT6A 4ZIRA 5KNCD 3T1OA 2J9FA 4R8LA 3RFTA 3OU7A 3D8HA 3FPFA 1PX2A 1QTIA 2JI8A 2ZUBA 1FYWA 1OXKB 1JBQA 3V8EA 1WSDA 5FPPA 2VZ0A 1UBHS 2NZXA 5GJBA 5A03A 2I7DA 4FYPA 4TX1A 1P3Y1 5KDDA 4DYDA 1Z4OA 1ML3A 2RHLA 4OV6B 3SJCA 2B5VA 4HFRA 4PANA 3DR5A 3PG5A 1V2GA 1SA0A 3MXTA 4MRMB 1P9RA 4OA8A 1CZRA 4UXJA 4WRRA 4OI1A 3TLMA 4E2YA 5CW1A 4DQLA 5LQUA 1KDOA 1PJ2A 1S2DA 2D5IA 2H65A 2LV8A 1YQ9A 2Z83A 4IV5A 4YHBA 3L5OA 1NMYA 2EJUA 4E1AA 3A7EA 1IC6A 2HWUA 4BJHB 1OJ7A 1A8SA 3EYWA 1K7YA 5AD1A 3A6GA 3K1TA 1XYVA 4DNPA 3ZZNA 4FC7A 2N46A 3NWBA 3VR5D 3P27A 4S2UA 1G59A 3G7SA 5KAPA 3EOAI 4NCNA 2PBZA 2WYWA 5K4AA 1RW4A 2BKEA 5F1PA 4ZC1A 4LSWA 1LGYA 3WLRA 1NFFA 3K1AB 4FX2A 3AEXA 2ZRMA 2X0JA 3D8RA 3FSJX 3BTSA 3IDZA 4JA2A 4UHEA 2E89A 2QD3A 1GADO 5AK0A 5T67A 3IQIX 3VZQA 1DX6A 2ZYDA 1CY7A 3MB8A 2HBRA 3MSXA 1CQJA 1IIRA 1XE3A 3FMOB 4K9KA 1NUSA 3DD1A 1AOXA 5AW3A 3GJ5A 2JJ8A 4MWBA 1J22A 4BB9A 3CRQA 4J0FA 1VTKA 2ZUUA 1UBMS 3PNPA 4JL6A 4FSHA 3PEEA 3W9YA 1TJ4A 5ABPA 5A0TA 2V59A 5GJWC 1FFEA 4WACA 4GL2A 1ZUIA 1JLLB 1GTVA 2ORED 3JYQA 2Q1XA 4IIEA 4MHOA 4EW3A 1YS2X 2EHDA 2BEUB 4HEA6 2VZLA 5C53B 3P9NA 3W34A 1G8GA 2JGDA 3L8HA 1XA4A 3WA7A 5LLSA 1K6EA 4R9VA 5AR1A 4YRLA 1JA1A 4PYRA 2Q1SA 1GR1A 3D02A 4JS0A 4YONB 1I3OA 4LIPD 4YX9A 5DYIA 1DWPA 1SBCA 1SJ9A 1U1IA 4GSYA 1QHFA 3WIVA 2QY6A 5K3FB 3PHIA 3BWDD 1KNXA 2RI6A 2ZZMA 1T0PA 2OLKA 2BL4A 2CFSA 2X6QA 3CB4A 3DQQA 3IEIA 4X3OA 3FI0A 4UQLA 1PKEA 4H35A 4NICA 2CFOA 2FPWA 1PWEA 1L6IA 1S6YA 2PLFA 4ZCTA 2HR1A 3DWEX 3TZKA 3GJQA 4XUGB 4EY8A 1JLSA 5GZ1A 4P4SB 2WPNA 3CZ4A 1IVSA 3H9UA 1BJKA 4BNVA 4DQKA 3ZI4A 2GZ1A 3OIYA 4LDNA 5EP1A 2JA1A 1P74A 4PSUA 1G38A 2HDWA 4YLGA 1V3VA 3F1KA 2R47A 3B12A 3GNTA 5FDFA 2PUFA 4LMAA 2JAHA 1GT91 1M8KA 1X9IA 2FPMA 3NVMB 3LCCA 4ARSA 3K05A 3T6KA 5LLDA 1HDYA 4JP1A 3S2EA 2VATA 5E7JA 2UZAA 2G82A 1Z29A 3QXSA 4NL4H 2GO1A 5ENVA 4CLHA 4JBYA 4Q7KA 1RKQA 4RSGA 2R68A 1B74A 3LT1A 4W5JA 4GP7A 2O8EA 4TXHA 4CL8A 1HX7A 2RHMA 3O92A 2H00A 4GMDA 4D9GA 1BW9B 3EOZA 4ZKEA 1NP6A 2VFAA 2VLIA 3N2GB 3O4HA 1FMJA 1X1RA 2O8CB 1QRDA 2H1VA 2FEXA 3CB2A 3ED5A 2OAP1 3E9RA 4CKEB 4L5JA 2YTZA 3TVDA 5JEDA 3VAAA 4JOQA 3R1IA 3UK0A 4OHFA 3LFHA 5EVJA 4HHEA 4Q47A 5JU6A 4BBAA 4BQOA 4PZ9A 3ITEA 3VR4A 3W7VA 4D42A 2FR0A 4M9ZA 5T3UA 1UZLA 5AW2A 2XVMA 1BXGA 4OI2A 4OOFA 4DIKA 1HRKA 1WJGA 3E82A 4K8OA 1Z0JA 4WAUA 5CVVA 1LPNA 1SHTX 1ECBA 2OCDA 3KHTA 1DKRA 2XRZA 1WM1A 4PX9A 3BWEA 5H1YA 1AKUA 2GD6A 2ORIA 3VVMA 2FDRA 5ALVA 2FZLA 2HFKA 3DFFA 5D3MA 5E38A 3CMCO 5EP2A 4QBFA 3EJWA 5BSWA 3T0GA 1NLUA 4E94A 2O2ZA 4O4IA 3WGKA 4WBNB 1ZO8A 5DBOA 4PLYA 4L5IA 4PRZA 1NVAA 4BVGA 1Z25A 2BBSA 3A6LA 2J3MA 4H3VA 4KJXA 4ZMRA 3TCKA 1MMFB 1FDUA 3ZY6A 3D4OA 4EECA 4C14A 2XNJA 1K89A 1VIYA 3DBVO 4TKVB 1ULHA 2YW2A 3MRXA 4B6PA 4LXYA 4ZEMA 2OGSA 1EUDB 1KI6B 4MKXA 3GZNA 3VH2A 3EIXA 4BZPA 1Y3BE 4P5EA 3RVQA 4BKPA 5FBVB 3Q8KA 1K9VF 4HQRA 3AVWA 1IXKA 5BR1A 1TEZA 1MJ5A 5F4BA 1AKMA 1LC3A 3JSAA 4R1OA 4UMVA 5EINA 1QIFA 4UAJA 3HDTA 2PXHA 3DOFA 4YEDA 1TK2A 1N5KA 3HYNA 3H1PA 4IDAA 4NFYA 4Z8YA 1B7GO 1PFUA 2VF4X 4Q9NA 5FLYA 1KSFX 3CCFA 2AFRA 4W1RA 4Y2PA 1K7EB 3WL4A 2O3TA 4Z4FA 4FR0A 2AOTA 2Q5LA 4GMKA 2OZLA 3FZQA 1JVBA 2HXSA 2RHTA 3SDZA 3P8ZA 4QU5A 1CDZA 4HGQA 4L5CA 3ZV3A 5I7WA 3PTAA 3Q11A 2JLBA 4D26A 2QJOA 3KXIA 1EUCB 2J41A 3IJPA 1V45E 2ZB2A 2HRBA 4FI3F 5ESDA 3VNBA 2IS4A 1JR3A 3GLRA 5E6UA 2C0PA 4X62B 2JKVA 1FFSA 4D9IA 2WU1A 1TCCA 3NHBA 5U9CA 3PUVA 5A6VA 2BGRA 4F8EA 5C7OO 2QGZA 3WMGA 1W7AA 1LI4A 4BCBA 5DN9A 1SXHA 2QRMA 3G2OA 5J5AA 2XZOA 5JARA 4JSYA 1EESA 3O4VA 2XR1A 1E32A 4ZFNA 3FG9A 2B30A 5AVQA 1GTRA 4PZUA 1CUAA 1EGAA 2ZW9A 3OJFA 3VDQA 4OU5A 4CFZA 1QP7A 1W47A 5EKUA 1FYFA 2FW9A 4M1YA 3RADC 3ZWOA 3BTVA 4NNOA 5BNTA 1ZCAA 1G291 2FX5A 4M2LA 4QOHA 4CKCA 5CLJA 5HKAA 1MXHA 2GPSA 5JDCA 1E9CA 1QV7A 3C3YA 3AIMA 1PN3A 3HEMA 3JR3A 4ZQFA 2BGNA 1CQZA 2QL7A 2GPBA 3FVWA 4ZV9A 4CQMA 2VJKA 3OT5A 4XOIA 4FHCA 4PAOA 3KVYA 4DSUA 2P9GA 3RAEC 4ZOQI 1OA1A 3GK3A 1PS9A 2HD4A 1THGA 4OK6A 4P80A 3SN6A 4DCJA 1ZS9A 4EA8A 4RLFA 1XQ6A 5ALFA 2ODQA 3JQ7B 3L7JA 4M7PA 1Z6QA 1T26A 4KQXA 3V4FA 5ITVA 4IHJF 4WY5A 4B84A 3U56A 1A82A 1REQA 3A9RA 4TTQA 1E6WA 4HC4A 3L6DA 4J1QA 3JQGB 5A4IS 4NCAA 1NVWQ 1T1GA 1TEHA 1MORA 4YXFA 1H3FA 1VYUA 4Q3AA 3KCQA 4UM9D 5CYPA 1QHHA 3NHUA 1FX1A 2EWWA 3V6LA 3DTVA 1DAHA 1GL9B 3G2MA 3GUUA 4YJGB 1JAZA 4FYXA 4RHEA 2V3CC 2AJBA 1YJCA 3BIXA 5I3CA 5LU9A 3UPTA 1K4MA 2W11A 5FR1A 2XJ4A 4LRSB 4U00A 4F5ZA 4KK4A 3W2GA 2R1UA 1GFSA 2I7CA 2ZQZA 3ZNNA 2C5SA 4CTKA 1I1OA 1I4EB 2G5PA 1HFEL 1NYTA 2CVOA 3OZRA 3OZBA 4PYJA 2WT4A 2OOKA 4L08A 4P93A 1D5WA 2R48A 3F49S 1K9SA 1G8YA 3IA7A 1Z7YA 2VL7A 3QY9A 5FUWA 4FR2A 4D9BA 1GGHA 4NONA 5KB3A 2F4VB 4FEEA 2X0FA 1RABA 2PSSA 3ABRB 3AVQA 3I28A 3B9RA 4CETA 1L7EA 3DDUA 1U3VA 5A62A 1Q22A 1PFYA 4I6EA 1L0BA 2GKGA 3H2JA 3MAGA 1FXWA 4I81A 2O3QA 3Q12A 1U1EA 2OBFA 2FP4A 4KSYA 4OQ4A 5LBTA 2HZBA 1ISHA 1N8KA 4QTUB 4BNIA 1H2YA 3CX8A 1BEUB 4KHPB 4LDQA 4BEJA 1EK6A 4DANA 1X7DA 2PLRA 4O8ZA 4DLXA 4PHHA 4DWJA 1DV2A 2VQDA 4NX2A 1MR3F 2GAFA 1RHQA 3D4IA 4TYPA 2FE4A 3SFVA 3ZE6A 5BQFA 2WSYB 2X8JB 3I92A 3U16A 2PCLA 2ZS9A 4LCJA 1UMKA 2PUVA 2Y1LA 3A1EA 4V0NA 3O4RA 4P4NA 4YV0A 2PTGA 1FJGB 4YCDA 3LQ1A 1OWLA 1JTVA 2AL7A 2H1SA 4JYMA 3V6MA 1E9BA 1EQUA 1OW3B 1OV6A 3BE6A 3IT2A 2EU8A 1KPHA 2WF8A 3UAWA 3BSWA 2WZBA 3FPBA 3LVQE 4U1RA 2D1FA 3M4NA 3NAMA 5BSRA 4RD0A 4RZSA 2RG7A 3TXAA 3VZDA 3I9V6 3SSNA 3MTEA 2O1WA 3BULA 4R9SA 1AZWA 4KMSA 3EZLA 2LTAA 5JHGB 3IURA 4J2TA 2C2KA 3T3GA 4EHDA 1JWBB 1JJAA 3CJQA 3NHMA 2I1WA 1EFLA 4E11A 1EUZA 3IPLA 1ZA2A 5FBLB 1DIGA 3G0DA 3G6WA 4E4TA 2FE1A 2NVWA 5JNWA 3KKLA 4GICA 4K5QA 4I14A 2YRWA 4RL6A 4RGBA 2J3JA 4WUVA 1R0LA 3M6UA 3VYUB 4I50F 3ZU4A 2EYUA 5AW1A 3ZNOA 3V7UA 4CIVA 1MQ8B 2YZMA 4XWWA 2P5UA 3FSGA 3BHNA 1NXWA 1Y6ZA 3LVRE 1P9NA 3GNQA 1I51A 4U63A 5EWJA 5JXJA 2R0QC 1IB0A 4GYWA 1P1FA 2HO5A 1KBQA 4MYTA 4I55A 2JARA 3IDQA 3X1YA 4ZZ1A 4MS4B 4G0MA 5B4UA 3OFJA 4ZDKA 4UATA 2Z1DA 1NVGA 4QYTA 1GGFA 3H2BA 3CISA 2YXEA 4ZYWA 1ZNZA 2JK1A 3S2YA 4M53A 1FX0A 1QR6A 1IWOA 1HT0A 7YASA 2PGNA 1A9SA 2PUJA 4H0CA 3BRSA 5CFQA 1LEHA 2EFGA 3A32A 2UUAB 1BS1A 2WV9A 1IZ7A 4ZQIA 1NF8A 1OLSA 1X1BA 5FXMA 1KEUA 3NBMA 5UKDA 3TLJA 2ZR8A 4G84A 4WOBA 4LJ7A 3CNOA 1EHCA 1PT6A 5B36A 5ANRB 2HB6A 1UFRA 1GLGA 4FW8A 5D00A 4JXJA 1YZFA 1QX3A 1XTIA 3GMSA 1Q0RA 3LX8A 3ZWKA 2FGKA 5T6BA 2P5TB 4HZIA 2H7VA 2PZ8A 2QN7A 1XSEA 2ID8A 1BZYA 1E1RA 3LVFO 1ZOPA 2BP7B 4OQZA 3CCCA 521PA 3V2HA 4B85A 4GM4A 5EJ7A 1SCUA 3EHDA 3PFKA 4F5WA 4UTPA 2XXAB 2A9RA 1Z2AA 1RQ2A 2QG4A 3OWOA 5AW8A 2QTCA 3B5JA 4KK3A 1KO5A 3BWBA 2CSUA 3NZEA 2RHCA 2GT1A 1RHJA 2WT8A 3VM6A 3OM9A 3WYBA 1F2TB 1ZYUA 3ZE2B 5D1NA 1Z2DA 4YPVA 5JD4A 2CLIB 1TJ5A 4DRXB 1RI2A 2WAAA 3E1SA 4GRAA 1JDUA 4KMMA 2YWRA 2ZPAA 4KI0A 5JO9A 5IAAA 2Z2IA 4PZDA 2HU5A 3PHHA 4FKMA 4Q02A 2H17A 4JL5A 4QLAA 4RACA 2J0QA 2Z2ZA 2AX3A 1DC6A 4EFMA 4Z4IA 1H4TA 2W8ZA 4PRLA 3DDNA 4QO8A 4LF6B 1O97D 3VNRA 5KQMA 1C30B 4IUDS 3JZFA 3C3MA 2F43A 5BW4A 1E3QA 3MRSA 5KU1A 4QYXA 1LBTA 2Q4EA 4IDOA 1JVSA 4UZEA 3TR6A 2AJLI 2D8MA 3GG2A 1L8AA 4ZA2A 5BQ3A 4KAXA 4MQBA 2Q1YA 5E6SB 4HRVA 1LDMA 1TIPA 2XUQA 1XQXA 4RHFA 4IY1A 3N3AC 4HNHA 3VPGA 2JRLA 1SHLA 2PMDA 3M6LA 3WP0A 3NDBB 4IW3B 3I9MA 3WAGA 1RVV1 1I2BA 1HXHA 1XCOA 4LV8B 4Q1CA 3DO5A 2JJYA 3CG4A 1JBEA 5IAJA 1HNWB 4JBNA 4YAFA 1RPNA 2BR5A 2CFTA 5A0FA 5C5CA 4HATA 1RPJA 2QAIA 4ZJPA 3LLMA 4UREA 5BQ5A 5AJVB 1GRNA 1W85A 1TVMA 4G3XA 5GVSA 2ETVA 3VU1A 3Q8WA 4HGZA 3DF9A 3IP1A 3ZWWA 3OOEA 3UT5B 1DPFA 1TZBA 1UWVA 3OPNA 4F3TA 5FYQA 2QYTA 1VPDA 3L04A 4NY1A 4I8IA 4NYMR 1SOWA 2P78A 3JWJA 5FUBA 3U2QA 4WOKA 1KU6A 3H6KA 3GFOA 1Q1AA 3EIEA 1BA2A 4CL3A 2IY9A 1R0KA 2PJUA 3DDOA 1EG7A 4FOTA 1BXRA 4UM9B 4HVCA 3CH6A 1XZEA 4N40A 1X8KA 2Q8QA 4WNYA 2NLOA 1PG0A 5K8UA 5I7UA 1VGQA 6NULA 5DN6D 4CWAA 5ICEA 1LPOA 1Z35A 3WICA 4F3YA 2DH5A 1SZDA 3JWGA 3JS5A 4GPIB 2CW5A 4ZEOA 3ZKWA 1ZUHA 4G0OA 4GEGA 4OUDA 3NYQA 2JI4A 4YQZA 1KJIA 3OX2A 1R2QA 2WIFA 5DOZA 3UOAB 1YDHA 4PPNA 1JPJA 2QXUA 3HJGA 3FROA 1ZHHA 1ZL2A 3URMA 1E79D 3BCUA 4Q03A 4XEUA 3EXHB 5CP8A 4BFCA 4AAYA 4XQ9A 4PIPA 3ZKAA 4Q15A 1L4KA 3I9NA 2O2SA 3PI7A 3F73A 4KRYA 1SBHA 5C8ZA 1I30A 1MA3A 4REQB 1EDZA 4POOA 4F6RB 1E9VA 4NAHA 1E6MA 2W6NA 5DTJA 1Y4UA 3D3KA 3LUFA 4BQPA 3K8OE 2ASVA 1VHDA 3P19A 3PC8A 1G63A 1HC7A 2Z04A 4JDUA 1DX9A 1R6AA 4E33A 4E7PA 1QH9A 1P9WA 4FBLA 3ZWYA 1RKBA 3RJZA 4RVFA 3BTOA 3IT0A 3IH5A 4ND5A 5H4HA 2EJTA 2C3OA 3IUSA 2D1RA 3CU5A 3E6AA 4HDAA 4RQBA 4KO1S 4EA9A 2YY7A 4WMLA 4YAUA 3FGNA 1YDEA 3B6EA 1V41E 1JLHA 2ZAOA 3PGVA 4FYWA 4JQZA 4CKWB 2CDBA 1V16B 1JI3A 1ULTA 1N2GA 1W4ZA 1F0PA 3GXOA 3DJFA 4EGAA 1M1NA 1TVKA 5BNFA 3FGPA 1ETHA 1JSZA 4HUJA 3NMUF 1T3HA 4Q5IA 3OD1A 5ECYA 2GXSA 1Q91A 1WBJB 2VP0A 3LZDA 4H59A 3VRHA 1KJQA 2B20A 2IIBA 1OC4A 3IPXA 2DH6A 4LWZA 3ZK8A 3GLQA 3D1VA 5B1HA 3C6XA 5KVAA 1BC5A 2FK8A 4DWWA 3JWEA 3JQBA 4U2BA 1CT9A 4F4JA 2PGIA 4MIKA 3BIJA 5THQA 3I4FA 3FMGA 3CKMA 4BVJA 1AY0A 1A69A 6PFKA 9LDBA 2F8LA 1CQPA 4PINA 3H9QA 4CEIA 1PD1A 3T3MB 1BHO1 3IAAA 3ZCUA 3ZJTA 1VLZA 1QDLB 4ZT4A 3UXHA 1CKEA 5K0EA 3QFCA 5KX5A 2DCMA 1E1MA 1FFBA 4P1ZA 2XE6A 4V1CI 4LVUA 2GJSA 4NBKA 2OYRA 5LQJA 1YR8A 4QTYA 2Q6IA 3OY7A 4BX9A 2BCGY 4HDKA 2H4WA 3W05A 3QEMB 3TS1A 1H8EA 2WJIA 4OBEA 3HA7A 4C0KA 4UTOA 2G72A 4IQ8A 3RPEA 2G77B 2OZEA 2PXAA 4AMZA 2NT3A 2WWWA 1HDRA 4PWYA 4TM8A 1X8JA 1HYQA 2AOXA 3ZIAA 5K2OA 4N4AA 1Z6XA 3A1WA 1ZP6A 3T1NA 1XMSA 2COUA 4RJKA 5A5GA 2AC7A 3HKBA 4FIZA 5AW6A 3A26A 4RLQA 1F8UA 1QDUA 4D3ZA 2Z6AA 4KO2S 5CT5A 2E4WA 3BD7A 1RU3A 2Z5FA 4GQAA 5HK8A 3UGJA 3DW1X 1YZGA 2XD9A 4OU4A 4JI6B 2CLEB 5LZ5A 3EIHA 3FNIA 2H85A 3Q2OA 1L9XA 5F2NA 1N3BA 3ML1A 4H0NA 3LLSA 3RVRA 3IO3A 4CCSA 1M2VA 1QHEA 1U9IA 3EISA 4MQLA 2DQYA 4JLDA 2XDAA 1VMDA 3WLEA 3OSZA 4IINA 4BFTA 1BKSB 2OHXA 2Y92A 1FMTA 1JLRA 5C4IA 4DA4A 1T5DX 1O89A 4OJTA 5BURA 2FDXA 1RC0A 3ELUA 1DRUA 1KK2A 3BQ9A 2EKPA 4HRXA 4UAUA 4X60A 1SUWA 4FEYA 1YQXA 1D2CA 4EJ6A 1KEEA 3SC2B 4TTVA 4KMRA 5JSUA 4LOAA 1FFGA 1LJLA 1DKNA 2JGRA 4N12A 1I5RA 4V0KA 1MQAA 4WDRA 4TRMA 2ZEJA 3P4YA 1QLJA 4HH1A 2PBFA 2EL7A 1JFLA 3E4DA 3AFGA 3LQKA 5BP7A 1AD2A 4KN8A 5K6RA 2I8LA 5ERYA 2VYQA 3QLVC 1V7QA 4UE2A 3OZFA 2XTJA 2EFYA 1KY4A 2LCIA 2IZOA 4EMBA 1SVMA 4XAQA 4EK9A 3EG9B 3WISA 1ZR4A 4Y6GB 4HLQB 2BGWA 2XGOA 4W5HA 5KQLA 4L76A 2JPDA 3D0KA 4CUJA 4QBKA 1PYGA 2NO9A 3GLUA 2ZYUX 4DR2B 1JILA 1X2EA 5REQA 1ECGA 2XEDA 3KDPA 2LIPA 3WDKA 3WK4A 2Z5GA 3TZBA 1RRKA 2RARA 3PBKA 3SMQA 4C6SA 2A9KA 1MF7A 2BFEA 5DF1A 1LDBA 5BW6B 3WVNA 4L3WA 2WPDA 1Y1PA 3P52A 1NBMA 3AHCA 1JEDA 3CH7A 3RUHA 5KYXA 1R64A 1QAOA 2C5AA 1O96B 5AW9A 5J2TA 1FBTA 2YHIB 3N8IA 3R5TA 2GKOA 2AZDA 5EA2A 5K3AA 1QANA 1OYVA 1OVMA 3AM3A 3UWKA 3VYSB 2EBHX 2BBWA 2OO5A 2WEKA 3H9BA 2CEKA 2G80A 4ZHQB 1FJHA 3PQDA 3NAGA 3PSAA 4LYFA 4EI8A 2DFVA 1SEVA 4NCBA 1DU4A 2XTZA 1N9KA 2CEAA 3N5KA 4X20B 4W5RA 4B40A 3CPJB 1CYDA 4B3CA 4AJPA 1P77A 2EGUA 3ETCA 4MROA 4FDMA 2JFNA 2A8YA 1SIBE 1U4SA 3IVXA 1AO0A 3THYB 4R84A 1Y63A 2TRSB 1GQRA 2ZETA 3KDSE 3U39A 3NANA 1HK7A 5F9FA 3L7OA 2CLFB 4GLLA 1I3NA 3HLKA 3T3NA 1A4RA 1QSGA 1XPJA 3D3WB 4TTAA 1YQQA 1MU0A 4U8GA 4AP5A 1O9GA 3HO8A 1NX9A 2RJOA 4QUGA 4ZVTA 3IVMA 1NM5C 4Z0PA 4HDMB 1JJBA 1Y8AA 2G28A 4FDTA 4BIIA 4CYMA 1IQPA 3F8SA 4X7PA 4GLJA 5D7BA 4ZHQF 1YV9A 2A7XA 4N39A 1QF7A 5AM3A 4RY9A 5T4HA 4D4HA 1H0RA 1DBSA 2ZE7A 3GJZA 3D0OA 3H1GA 3NI2A 3NRBA 2F55A 4QJIA 1SB9A 3KWFA 2IHUA 3DHWC 3RGWS 3GAFA 1O6GA 2IHKA 1JIXA 4E08A 1K5HA 2XNDA 4FS3A 1L5HB 2Y77A 1JQDA 1DQSA 1XQ1A 3BDVA 2B94A 3H0EA 3O8LA 4ETMA 1NVKA 3RAGA 4CKBB 5BN5A 2FUG6 1VL2A 2J3LA 4MRMA 1TVCA 4PEVA 5CT9A 5LN1A 1G6Q1 1JKXA 1HFWA 3DT6A 4Q05A 2YC4C 1KEKA 1B0AA 1JYEA 4JQYA 4B2LA 2EDCA 4CMGA 2VK8A 1VHQA 2COKA 4PN3A 1YTUA 4L7VA 3A28A 3BRCA 4QTZA 3R3XA 3EGEA 4Q82A 2BJHA 1JHRA 1O5TA 4H4DA 4YP1A 2IH5A 3L41A 5FBQB 1T4CB 1E8DA 2E37A 1GTMA 2H51A 4JJIA 4PLCA 3K1AA 1O3YA 1QYDA 2B4QA 1AHIA 4C5CA 1EGVB 3ABQB 3ZXYA 3P20A 2I7XA 3PLRA 3KWJA 3SP1A 3VPFA 3HTXA 1QG0A 4F3NA 2O2HA 3HA2A 4OFBA 4JWTA 4MOWA 3THSA 2AA3A 3KQTA 3R6GA 4JLNA 1F0YA 2YFKA 4PO1A 3WZLA 4QKQA 2JGIA 2PGLA 1ZISA 4JEMA 4J94A 3OMXA 4EFNA 1MAHA 4DLPA 5CCEA 1QMPA 1JQ5A 2PV0A 3PE4A 4WLNA 1N77A 1B3BA 4LE1A 1DCFA 3I04M 1LJUA 3O1JC 3QVMA 3D4NA 3EQ2A 3EZ2A 3UV3A 1GL7A 4FHDA 1JLLA 4BLSA 5L3SB 2CL6X 5D01A 1HG0A 1PYOA 2ERXA 1R0XA 2JH9A 2ZBFA 3EHEA 4U5XA 3WMEA 3ZXXA 3QOWA 2OC4A 5D7NA 1K7FB 1J2YA 1QYWA 4NZPA 3RE1A 3RK1A 4CV3A 4G0YA 1C29B 2YBDA 1ORRA 2EFJA 4NZYA 2YV2A 1HNZB 1W36B 1WUKS 1UQRA 1EIZA 3A70A 1IDN1 4RLHA 4D0GA 3E4CA 1DXOA 2I8CA 2OXFA 1VYHA 3REOA 4KFUA 4U9IS 5KKAA 4EJSA 1XCGB 4UKDA 3FHOA 4R6WA 1YA6A 3TGLA 3BIOA 2X9GA 3A2KA 2XUOA 3D0QA 3H4IA 1RQPA 2PS0A 2FWIA 3MS4A 3PHJA 3ZQUA 3TN7A 1ZNYA 3RS8A 2QN1A 3OT4A 1UXKA 2I6UA 2FFQA 1R50A 2WSSD 1NWCA 2R1ZA 3F3MA 2X5OA 2VP9A 3OX1A 4M99A 4Q6WA 1JBKA 2OR3A 5TS2A 2XMDA 4OOEA 4OTZA 3ANLA 6GPBA 3EEIA 5L95A 1KI7A 4OQMA 2CNWA 3EN0A 3OIUA 1YA4A 3WXBA 1Z6YA 1QX4A 1YOBA 3G6KA 4P3XA 5BSGA 1L5YA 4Z3KA 3JWHA 2FCAA 1XPOA 3FBWA 1E58A 1I80A 5AICA 5T7BA 3VNVA 1DT5A 2G07A 2Q7XA 4HQFA 2FAXA 4I9NA 2W90A 1NW3A 4DLYA 3U3KA 1BW9A 2O8CA 4U7TB 3N2GA 1J06A 3NT5A 2CNOA 1E4OA 1IOLA 4B81A 4UARA 2CDNA 5ES4B 4CKEA 3TNLA 2Q27A 1JDTA 1DOAA 1PLLA 4ER3A 1OWOA 3W6ZA 4Y2VA 3FCAA 2UXDB 5ALXA 2CUNA 1PK7A 4IJQA 4RKWA 1VBNA 1ZQ9A 4JSRA 1ZXBA 2OB2A 4TKUA 1MT3A 4BVLA 3F8WA 1USVA 1JHXA 2W2MA 3QKWA 1KMMA 2Z2YA 1UDXA 3KSDO 4K9RA 2ZRHA 3PZRA 4XX1A 2XF8A 3ZJ5A 4DW8A 1RWWA 1U5CA 1IJFA 3KD2A 5T64A 1HOTA 3DLTA 2OBXA 4FD2A 1XP5A 3GLHA 1FW6A 1VXOA 4F2HA 2WWYA 2AQIA 4YROA 4NTZA 5DLDA 1R9MA 1H85A 2VTDA 1ZKMA 2AYYA 2OYCA 5FNZA 2CLOB 1TKAA 3E27A 3ETLA 1XTRA 1TZ2A 3CQ9A 3EXIA 4FKBA 2XECA 1SC1A 2ZI6A 2X1HA 3ZTYA 1I4WA 4XSHA 4N9WA 1JHAA 4RIEA 1MQSA 1F9AA 3N28A 4ABYA 2C2GA 4XRGA 2OFXA 4TKVA 4YAGA 1M0SA 3F4KA 1MOZA 1ISFA 1KI6A 1KF0A 3IAS6 2IEZA 1NNI1 1BO6A 2O1EA 3KYJB 3IOBA 1P62B 2ZTLA 2R1TA 5IARA 3BFPA 2QTLA 1E62A 4HFMA 4I5GA 4KRGA 1U9ZA 5EHQA 3IILA 3GRAA 3COYA 4TQAA 4RHUA 2GEUA 4GMHA 3K5WA 4GI3A 5FKJA 1L8XA 2Z09A 2AVDA 1HTBA 3DZGA 3ZHTA 2BN4A 1PGPA 2IYYA 4Q3OA 4CF4A 4B3HA 1W59A 3PFNA 4FOSA 4KR0A 4NDNE 4ZCQA 1CJMA 2OCAA 2X3YA 4PHTA 4QAJA 4FBGA 3MCTA 1ZRMA 3BFJA 3MWYW 2E5FA 1B2RA 1XIVA 4FMBB 4TN5A 4U7DA 3OQVA 4KR7A 3ND8A 1VLLA 4UTRA 3N0VA 4LZZA 3TDMA 2PKEA 1EUCA 2C1EA 3TW0A 3QW2A 5L3VA 4FEGA 1XPUA 2Y1GA 4EEXA 1SD1A 2AMFA 3G9XA 2OP1A 3M5DA 5K8TA 1U2DA 2W4QA 3G5LA 2I3BA 4EYOA 1AE1A 3RV4A 3A3NA 2CHUA 4PLHA 4UVHA 3G7NA 2HTEA 3GQBB 2WYUA 2XMGA 3V4ZA 2OBYA 3FVQA 3U6KA 3KT8A 2H2AA 1BGXT 1YCDA 4IHJA 4KL8S 3S5JA 2MOKA 3S99A 5FEUA 3ZZUA 2XZPA 4FNMA 2EP8A 4HQLA 1I2ZA 4L72A 5B7PA 4HNQA 3TD2A 1KOGA 1RYFA 1Z56C 3R4CA 4RCVA 1AJEA 3MAAC 5IT5A 2GAJA 4YV2A 2NZJA 1T10A 4BUZA 2NYUA 2PEYA 2Y2VA 4U0KA 4NMWA 1MX3A 3B1YA 4QRDA 4CT4B 1ABEA 1I01A 5HGXA 4IDHA 1E6CA 1OB5A 4BO0A 4ZVRA 3AEQB 4DY4A 2ZTSA 4PGAA 1KFJB 2R8PA 1SG0A 1Z8DA 1N0WA 4RXUA 5FAKA 4QG7A 2JFHA 2XMSA 2B9VA 5DHTA 1FTQA 5KYYB 2O7NA 4OQLA 3RB8A 4BVEA 5A4MS 3DWGA 3MWFA 4Z5XA 5F1OA 1J0BA 1JN0A 2GN9A 2I62A 1TM2A 2J85A 3JQ7A 3ZJ4A 4BASA 1RYNA 4RQAA 4UDOA 2JLVA 2VQEB 1XZLA 4KQMA 3BH7A 5F9HA 5G3YA 5I7AA 5I5GA 2XCRB 4H27A 4QELA 1VIMA 3B6ZA 3JQGA 4FFDA 3ROQA 3SNHA 5B7NA 2D2EA 3R3HA 2IF0A 1QH0A 4MI3A 5BW5A 3FLEA 3KETA 4XVHA 1MAAA 2VC2B 4DCUA 4CKYA 1E2PA 1V1RB 1G42A 4NI5A 2FSVC 3AI3A 2VA9A 4KQJA 5IJ0A 5I01A 3PNSA 1NI4B 3ETNA 3PEYA 2FSHA 3FX2A 1A4XA 1BX0A 1GQSA 1Q2XA 1N4AA 1ZVMA 3T4PA 2D2FA 3GPBA 2H11A 2X14A 3KOUA 4X6XA 3VR5H 3RQIA 5IT4A 1GUYA 4FE7A 1K66A 2LIVA 1TLTA 4OEHA 3R7SA 1Y37A 1SCAA 2NO5A 3ROXA 2C42A 1CHDA 4RZUA 2CHEA 1THZA 2JD2A 3L0ZA 4V39A 1EU1A 1GPYA 3GELA 1L7OA 1LF0A 4QXMA 4E88A 3I0NA 3A1TA 3I2JA 1PV4A 1DG9A 1X15A 3IUJA 1JA0A 2HO4A 4M1MA 4ETIA 1V7ZA 1I4OA 1FQJA 3ZLVA 1FU4A 2ZOSA 5M29A 4Z9YA 3WL3A 4HI0E 4QOJA 1DFHA 3ZS8A 3SHFA 1E1QD 4CM1A 3R3SA 2P0AA 3EOBI 4LDPA 4WA8A 1DQZA 3LIPA 2X8JA 5KNLA 1I3KA 2FEMA 4MTCA 1U9CA 1A9TA 4I50A 4JJ4A 4HVTA 4AY5A 4CIDA 1GJRA 1YZKA 2B5WA 4BPRA 5HOEA 3DPSA 5KWEA 3BFKA 5K0FA 2I4NA 3A10A 2B34A 3PQ5A 3AF4A 3X1DA 3ZLBA 3CNLA 5ARCA 1SHZA 3B51X 3ESDA 1NTRA 4LBWA 4J16C 1PD0A 1VSBA 4Y0NA 4I4NA 3PICA 4K6CA 4ZAGA 2B25A 2PR7A 4LYAA 2IV2X 3EX7C 1L5MA 4I7EA 1WXQA 3MJDA 5EZQA 3PLAE 3BJMA 1EFPB 2XKKA 5JC1A 5BVGA 3QPDA 1U2TA 4CV2A 1VMEA 3R0QA 2V8OA 5JXGA 1BQ4A 1AA9A 1KIAA 1Q17A 2YASA 2QLBA 3O73A 4OHZA 4D96A 1QV6A 5G1PA 3E8MA 1AU9A 5DM1A 4URXR 3H97A 5CNJA 5TGDA 5H3LA 1VL0A 3WGJA 5KOYA 2A0UA 1R6DA 2L17A 2OCBA 3E53A 3EDRA 2VSXA 4BRZA 1KAQA 1N1EA 3MJSA 4US1R 3UQZA 4AD8A 5BY2A 4M0KA 3TLYA 1N7GA 3L1IA 4WLEA 1QYCA 1OC2A 4CRWB 2IP2A 3AKDA 3IBYA 2VH2A 1XJ0A 3N0RA 3VHXB 4BMSA 4DKXA 5FWXB 4C4AA 2XVYA 3M4ZA 3M1AA 3UK1A 3IV9A 1I24A 4CL2A 3U44A 1R4NB 1WW8A 1BDMA 1GFWA 1T5LA 4OX9B 4MGKR 3DHVA 1M10A 4J4TA 1P5JA 4ED9A 1E94E 1QLWA 2WWTA 3FKJA 4G6ZA 4TYWA 4MARA 1D1PA 1OPXA 2A6PA 2GZHA 3CF2A 3SFZA 2UUBB 4ND2A 4XI9A 3ISVA 3LUCA 1XTUA 1PQYA 1XVVA 4YYEA 2JLAA 3O1LA 3MUEA 1V11B 3DMGA 3O4IA 3AIIA 4KQFA 2IY8A 4N0QA 4Q1VA 3TB4A 5CFZA 2WG1A 4GGPA 4RF4A 1BFDA 1VE5A 3A9TA 3CRVA 4PC3A 4YDHB 2NXCA 5FOSA 5K1ZA 2BYTA 1R1DA 1AMNA 1CS4C 1NP7A 1WPGA 2A1TR 3KJZA 4LDZA 5BWMA 4TTSA 3ZBUA 1M2GA 3QPCA 1EZ4A 4DV6B 4A10A 3O0TA 1RHMA 3OEHD 4X61A 2XXAA 3X1KA 3S4YA 1V37A 2B8EA 3PQ6A 4RS3A 1RXWA 4JYZA 4FBMA 2DERA 1EVJA 2F48A 3NAQA 1F2TA 4K2HA 2BKVA 1RMTA 4ZOAA 4B5LA 1XK7A 3BDIA 1C3OB 1T5OA 2D1YA 3D7MA 3I42A 2AB0A 2WJVA 1VKJA 5DXAA 4DRXA 3MGGA 2HAEA 1ENZA 3OTIA 1A50B 1Q57A 1P2FA 3CWCA 5IWCA 3RWMB 4TXNA 1JGTA 3T5MA 2WRZA 3Q3JB 2C5FA 2GCPA 4MP8A 1ZITA 3NASA 5F3WB 5KVQA 1K92A 3QX7A 1O9HA 2Z6VA 3AIKA 3QA3E 4AROA 2PQ6A 1KYYA 3KB6A 1ESDA 3KL4A 5D6NA 3LCMA 3CN9A 1A8QA 4IIVA 1C30A 4BB5A 1RD4A 1AB6A 1KR2A 3SFTA 2BUAA 4KQHA 1FL9A 3A6ZA 5E0KB 5AXDA 1IHXA 2M6LA 1GPWB 3KLMX 3N2KB 1GQOA 3AQIA 3HP4A 3W5SA 6LDHA 4FMDB 2B3DA 4XX0A 5E6SA 5A3RA 1E5TA 3GZJA 3WQSB 2ZUWA 3D6JA 4BO5A 4URUR 5BOSA 2D13A 4AY2A 2IOFA 2ZR7A 4EH1A 5A1TA 2XV1A 2ATVA 2KBEA 4ON9A 4Y98A 2FLKA 3HNPA 4P33A 2QBYA 5IBPA 5I6DA 3OI7A 3SIWA 4LQCA 3X1MA 5EJ8A 4LFCB 2BFOA 3A58B 1NY6A 1T8RA 3INRA 2O5EA 4W82A 1OROA 1Y5LA 2DBQA 3P9SA 2COEA 1WQ4A 2IDZA 5EE5B 1LS1A 3VVLA 3LCRA 4EVQA 4MWSA 1B4DA 3RSLA 1NSFA 2NTYC 1Y81A 1RHUA 1SC9A 1II0A 3D6FA 4I0WB 3UT5A 4ESVA 1W52X 1HORA 3AUTA 3I2GA 1SBYA 3P2IA 4PYNA 4YR7A 4EHLA 1R6VA 4TWRA 5JJIA 4OCZA 5FTLA 1DLJA 2M1XA 3EUWA 2I3AA 4I9HA 5AK4A 1WEHA 5F64A 1UJBA 3QRWA 5TPZA 4RJJA 3NT2A 5JDIA 4M21A 3OFND 3PK0A 3RG2A 1QFSA 3G0IA 4K81B 1E4VA 3LBIA 3GOHA 3I72A 3WWDA 4WN9B 4DR4B 1Z3CA 4G8DA 4N3GA 4ZO6A 1ISSA 3RVKA 1V4BA 2B37A 1M34E 3UGQA 2D5CA 2LBPA 2X41A 1W35A 5FFMA 5LIRA 3SWWA 2B92A 5HR5A 3T1VA 2DBZA 3LGXA 3EC2A 3T3PB 2Q7DA 5LQDA 4NDZA 3EXHA 3ZWAA 2R1VA 5CHEA 3B1ZA 3V33A 1G0OA 2RAUA 2ENUA 2ES4A 1G21E 4B7UA 3EEYA 4O63O 1XEAA 2D0IA 3SC3A 3WLOA 1HDCA 3N5CA 4REQA 4C5BA 4COOA 5E4JA 4PX5A 1J5XA 3HDYA 2FR8A 1LLQA 2VDKB 3HP1A 3KAQA 3F5DA 4K88A 5G3ZA 3J80A 1IG3A 1KGSA 4X1OA 1ST2A 3ETEA 5JAHA 2BOVA 2DQ4A 3BJZA 5JCOA 5ALJA 1O4VA 1KH1A 1DXYA 1UPBA 4UNNA 3I3SR 2QTVB 1Q7RA 1MB4A 2ZJ3A 4ENVA 1PGNA 3GNSA 2ODEA 2VI5A 5CYFA 3W3ZB 5IDXA 4Z9FA 3RKUA 2QYHA 3UXEA 3SJUA 4Q9KA 3G1UA 1DTEA 1DHRA 4S2EA 1DC5A 3USZA 4AJHA 1AMOA 3WIUA 4FM9A 1M5UA 3PDIA 5GM2A 1SQ6A 5EJ2A 3FE2A 4AQYB 1T3SA 3ROPA 4E51A 4BNWA 3A4VA 3L92A 1P17A 2H1OA 1HDEA 2VNIA 2X2OA 4I19A 5K05A 4N9QA 3VKVA 5J3JA 1ZM9A 2O54A 1UINA 2J9YB 4OL9A 4PTLA 4RMNA 3DE7X 3Q3EA 4ML3A 2W6PA 4D5EA 4PC7A 1YS9A 3WJ2A 2JFUA 3NWPA 2R86A 4PXYA 1J21A 3V4SA 4G0WA 1M1YE 3LY7A 4R01A 1LV7A 1R5NA 2CLCX 5CPBA 3ZJUA 5ERGB 3IV6A 4BWYA 2CF6A 1T2AA 4XXHA 4X44A 2WD8A 4BFSA 5C1PA 3C16C 2YY6A 3P1JA 1KVTA 1Q7BA 4OMUA 3NS7A 4A8JC 3DVQX 2O8DB 1YQTA 1ZUD1 1KTVA 2X2FA 4AP6A 4UHBA 5DHQA 4YMGA 5BV0A 2IUSA 3ZJVA 1GCGA 3HABA 2XGMA 2BCJQ 3AWIA 3TTSA 4ZU3A 4ZVKA 1GAJA 1DAEA 4JC4A 3T7SA 1DOZA 4TRJA 3FCCA 1U99A 1LDEA 4C1NA 2P2SA 5FBWB 3HK2A 3KZMA 3QEMA 3PQ8A 4B1FA 1ESEA 4J0EA 1T1JA 1M2FA 2Q62A 1U81A 3EPPA 1FUEA 4ND8B 3IHKA 1F20A 1P2DA 4LJAA 1IMJA 3AOGA 3V4RA 1K27A 3OQ6A 4BWVA 5JMPA 1H9BA 4GR4A 1A2KC 2P8JA 3BRQA 4K86A 1EEHA 3T54A 1F1JA 1Q20A 4DDMA 2W2NA 3GL9A 4DCVA 3PX2A 4CKXA 1ND6A 2WB4A 2LRHA 3DFMA 4C0LA 3SY8A 5I5EA 5IS2A 2HCFA 3QNMA 1J24A 4BVFA 2ZP1A 3I37X 2QR2A 4L8VA 4E7OA 2P8SA 2WTNA 1C0IA 1DNPA 5JASA 1IOWA 4JLBA 5A9SB 4RE5A 2JVIA 3DV0B 1RZVA 1Z4QA 4HUQA 2IF2A 2VNKA 4X1KA 1OH8A 3NLLA 5DI9A 1M1XB 3TRHA 4FGSA 3TTXA 3GP5A 4GMFA 3OIVA 3W5CA 3KLNA 5K0SA 1SRQA 3BSYA 1BAPA 5IM5A 4ZO4A 3HXOA 2OGZA 5CDUA 4OXNA 4LXXA 1N1DA 2FJPA 5CNMA 1X0VA 3FOZA 3CX3A 4C22A 3AYXB 1X3LA 3RF6A 3ZQ4A 2GPYA 4H4EA 2HJ9A 1UEJA 1ZCBA 3RU3A 1T5BA 2P6UA 5TT0A 7MDHA 4KGVA 1IQRA 5ADHA 3D43A 4CL0A 4MO2A 4RTNA 5DE3A 5IMBA 3PHBE 2EAUA 3TLCA 3ZGVA 2F3SA 4QPNA 3ZYCA 3HN6A 4M1EA 3ROTA 2IKQA 3IEKA 5A4FS 2CHQA 1JQEA 2AYZA 2WHYA 5LWQA 4DJEC 4ZVOA 1AS2A 3LL7A 3F9IA 2LKDA 5F52A 2A57A 1U8UA 4O2AF 2IXAA 2KLBA 2Q46A 3RSQA 3DWFA 3ISTA 3NTOA 5LXTF 3ZZ0A 3ZHSA 221PA 3PR1A 4KVZA 4M8LA 1C0LA 1IHOA 3D3QA 2NYRA 2QM0A 5ADWA 3ZCPA 3V3TA 3EG9A 3W2HA 4AXXA 1CCWA 4V1CB 1NJGA 3AVPA 3F2VA 3G2LA 5IUKC 4BP3A 2WAMA 5ICCA 3W9BA 4MW9A 4IMJB 1Z68A 4RYDA 2FRVA 2GTPA 4IQ4A 2FFBA 5FL7D 3KOWA 1KMHB 3GLGA 3ENWA 1H2ZA 2C94A 1ZJJA 2CDAA 4K9MA 3QV1A 1WB9A 2MMGA 3DE1X 1L4EA 3M4YA 4MUGA 1JR6A 2R85A 3PJGA 4G01B 2VF5X 4LC0A 1JQJC 1PI3A 2CK3D 2NSHA 2V6GA 4OK3A 4YAWA 4KPFC 3FUVA 3B70A 1KP3A 1O96A 1TJPB 4M1SA 3UFXB 5AW4A 1DCMA 1L7XA 1FJXA 3NPAA 1CB0A 2CNKA 5DN6A 1V6AA 3EFEA 3PEFA 1NLFA 3IBSA 4A2PA 2XQVA 4RD4A 2JEOA 2WIAA 4UFNA 4ZHQA 3DXYA 3W5BA 2ZQ5A 4XWGA 3F46A 4Q4JB 5K8IA 4Z51A 4L28A 1ULSA 4HTFB 3U7IA 4D3YA 3NEYA 1CF9A 2QPAA 1G7CA 3AI7A 3VVBA 4DLSA 4BGUA 2A78A 1I8TA 1DKLA 1N0IA 2XD4A 5J1TB 3VC2A 3WDMA 1A9QA 4A03A 3IAXA 3IYLW 1UAAA 3PUKA 1ZK4A 3C87A 3HHEA 3X1XA 1OREA 5CG1A 3QNUA 1Z4KA 2ONZA 4PNZA 3O4FA 3QFRA 3K0AB 3RKSA 5B30A 1G6OA 1I6KA 2EW8A 3D3WA 3AEUB 2WHQA 3K9GA 4Q37A 4TS1A 4C0SA 4Z3OA 5DWDA 4XARA 3WFZA 1DIAA 2FPKA 1F8GA 1ZU4A 2WVAA 2WIGA 1Z17A 2C0CA 2X0IA 1FP6A 5F35A 3OHSX 3SYMA 4HDMA 4UBOA 4D0NA 1NVUQ 2Y76A 4IS2A 2P77A 4IO0A 1SBZA 5A4JA 3GROA 1C14A 4Q9DA 4X3CA 3A4LA 2C00A 3TM5A 4B46A 1ECPA 3HCOA 5EIAA 3QFFA 1WCV1 2YZ2A 3VU0A 1OWMA 4LV6A 4ME6A 5L51A 3EGIA 4BGVA 4A0FA 1SCKA 2P7HA 3GCWA 1TTQB 4CKBA 4RCZA 5IF9A 4LZOA 2DKNA 5FNVB 5B3JC 3C6BA 4R83A 2FU5C 2J3EA 5BNZA 1A5AB 4L85A 4QSHA 2GARA 4AG6A 2MWMA 2YS7A 3G2QA 2IU6A 1CR2A 1A7JA 1K6MA 4N3BA 4ARIA 1RWPA 1RVDA 4LYGA 2WSMA 2FZCA 4HNAB 3E3AA 2QX4A 2NAFA 2JASA 2ZIVB 4XIGS 2PXCA 1MAWA 4P5PA 4PLTA 1T4CA 2DPXA 4PYQA 2HF8A 4C20A 3SLKA 4OL0A 5KTSA 2ERYA 3ELDA 1SVLA 4LK2A 4INZA 3VGPA 4DQDA 1SG9A 2G67A 4NAUA 3K0CA 3OPYI 2NU8B 4C4XA 1XQVA 4NARA 3AY0A 4EGFA 4HNVA 5JAUA 1P7PA 4JYBA 2QRQA 4F5YA 1ZD4A 4IMRA 4QDUA 2HIAA 4WBNA 4PQGA 2PZFA 4LHZA 3COVA 2R6R1 1KI2A 3QU2A 3NOOA 4QNMA 1TCVA 4FLFA 5D3ZA 2X3FA 1ZOLA 1CSEE 1LW7A 1JF8A 1QG4A 4KEAA 1I4LD 4R9NA 4KWEA 4R68A 1R37A 1S9HA 1V5WA 2JIDA 3K1YA 4NYIQ 4PAGA 4RKEA 2M6KA 4DBVO 4UQOA 5L3SA 5JNSA 1L5QA 5CFRA 5IC6A 3D5EA 2Z9BA 1OMOA 4MNTA 4U8HA 1MAVA 2X8BA 2A0XA 2P4HX 3KWMA 5CDFA 1BMTA 1X39A 2QA5A 3FCYA 3KTDA 2Q5CA 1Y4ZA 3NHKA 1KJNA 1RPAA 2XCQA 3V55A 4F2GA 1LQUA 1PG5A 3L8YA 4H6VA 5EQTA 1PDVA 2XB4A 4FZRA 3CLHA 2I4RA 4YRDA 1OFUA 1MOQA 2NW6A 4YJDA 1KI9A 2WYIA 4GYKA 1G19A 4NNJA 3MOGA 4W7SA 2FPOA 3NCTA 3O38A 4BQFA 3DLHA 3H3FA 1U2SA 1U6IA 1EJBA 3I52A 3L7IA 1FSFA 3FWHA 4B17A 4F04A 3FWNA 2ID9A 3OZIA 4Q7JB 2YL2A 1D2AA 2AEMA 4QTTB 2FN7A 5ICMA 4YCLA 1LTKA 4QYIB 4C04A 3CVJA 1USKA 2YUTA 2WMNB 2J0UB 3X3HA 5AVWA 1M34B 1VPWA 2XUHA 1BH6A 4B45A 2RHBA 3V9PA 2JIZD 1QVRA 2BR3A 1SCJA 1VMAA 3L05A 2OXCA 2FK7A 2H92A 4R1QA 4U2EA 3FUUA 3HLYA 2QJTA 2Z98A 1IBKB 4DG8A 5C8XA 1K8XB 3NTRA 1G21B 2GBFA 1L5NA 4Z7NB 3OM8A 3Q7EA 4GLOA 5JZMA 1TMKA 3ABOB 4LYJA 3AFHA 1SVWA 1AK9A 1EP2B 1N57A 1RLTA 1Z62A 1E99A 2VJPA 2W6QA 3H4MA 4WBXC 2ATCA 4CLDA 1XF9A 3AJ9A 5ALDA 4EY7A 1AKQA 3KR2A 2H4XA 4ZK2A 2CMFA 2NTVA 1Q1EA 4RK6A 4EPXA 3CUTA 1XKQA 3I61A 1OLXA 1E0KA 1GN9A 3AF0A 1N6PA 1W76A 2CLHB 1QFJA 3RRMA 1VGVA 1UK9A 3LPMA 1TB4A 1M8JA 2GM5A 3BG5A 4M1ZA 5SY4A 1IPEA 5DYTA 1Q1QA 5M5BA 1ZVVA 5AFSA 3L8FA 2W0MA 1QH8B 5BSTA 3KX2A 1KETA 1LK0A 3QVSA 4JT2A 2QL5A 3IPRA 3O75A 1KWGA 3A31A 3PXDA 1X7ZB 1GL3A 2ZWAA 3GYGA 3EB9A 3ACCA 4FFSA 4YJFB 3TKLA 3ZGNA 4LJRA 4RY8A 3VR6A 1GZ6A 2NWQA 2XQJA 3F4BA 1E0SA 5EIHA 3LWNA 4BMCA 2C4KA 5CG2A 1I3LA 2BHNA 4N54A 2HK6A 2YDYA 3RKRA 1CRZA 3VTFA 1PJ3A 3D4LA 2VNAA 3DSRA 3WLTA 1N0UA 2CXXA 4M6WB 1M1YB 1TL7C 3BWCA 1UKBA 2IZ5A 4UU0A 5I9LA 3HB4X 4JU8A 3E1KA 4AUNA 3RIYA 1GARA 1IWBB 3GD5A 3QZUA 3VR1A 4D80A 3H84A 4LJ6A 3DAYA 2O0JA 1KFCB 2ECKA 2ZRIA 3OJOA 4TTPA 1QQBA 4RF5A 4C7BA 3IQGX 1OTHA 5DASA 4WQMA 3T5GA 4DHEA 2W6ZA 2R44A 4PCAA 5HPYB 3R6LA 4AYWA 4WZZA 1DDIA 3MG9A 4PPYA 1BVRA 1U0RA 1SUBA 1Y3CE 2CFRA 3WWEA 2ZJ2A 3OKCA 2GYVA 4HEA1 5EFZA 5AHOA 5F78A 3L1UA 4ESEA 1JH8A 5BV7A 6REQB 1XLTC 3U26A 3INNA 4W6QA 5FA8A 2Z4SA 4YCCA 3R9XB 3MWKA 1Q3TA 4HG2A 4C9BA 1XRSB 2B6NA 3FY4A 4TUYB 4A23A 2QP3A 5T4EA 4J2HA 1AGXA 2NACA 3MD0A 4GYJA 1XLUA 2R7NA 4QOSA 3FNEA 4MCHA 5BT8A 4FGZA 5LYYA 5IU6A 2P4QA 1D2EA 1V35A 4RORA 3NBAA 4GR9A 5CB8A 2WOOA 3FVRA 2V1XA 2XLBA 5EIOA 3W4IA 2QTAA 2YH2A 3KZ1E 1A7KA 2OCXA 4W9RA 3RVBA 2ABWA 2JI7A 2ZTHA 1C7JA 3GQBA 5H5JA 1RM3A 4L3VA 3DE6X 1W30A 1JDJA 4F84A 3LX5A 4OA5A 5LUBA 3RABA 3SHTA 1OAOC 4KQKA 2W2LA 1E69A 2KX7A 3CFYA 2PK3A 4EB8A 1XEWY 5D8DA 3L1KA 2HK8A 4XW2A 4RMIA 4O4LB 3ONEA 4J0HA 2RHJA 4NFSA 3DNPA 2DOKA 1ZJZA 2NZWA 3QX8A 5B57C 1XR3A 4OYLA 4GVXA 4TUYF 1GCUA 1HQCA 2EIHA 2QMOA 4WEQA 1NQWA 1WMSA 2XNHA 3N7AA 2XWJI 2K6GA 3AEQA 4RH3A 4KCGA 3EEFA 1FUKA 2C2WA 5L8VA 1M5TA 2P75A 3HJTA 5FUVA 4LJ9A 2QENA 5CNKA 3UBTA 3R8FA 3LY9A 1GNLA 3X2FA 5KYYA 4MHTA 2FN9A 4A0GA 1BE6A 2X19A 4CM8B 1AQJA 5LQSA 1DAMA 3OHMA 1AGPA 1HE1C 3V42A 4RH0A 2GPJA 4AN1A 2HJWA 1Z07A 5DBFA 3W9UA 1RAEA 3M2PA 2V6IA 2IP4A 1S2IA 4JBGA 1FY2A 1P7WA 2A4KA 2NQTA 2BSAA 2CWDA 2XQFA 1YC2A 2XKBA 1GPNA 2ANCA 3DZJA 3K5IA 1WZUA 2AQHA 2HWKA 4O4LF 1F6BA 1TRHA 5ES3A 3AMVA 2O0HA 2VDUE 4UUQA 1K8ZB 4CLEA 3GJSA 3FCSB 3KEGA 1TMGE 2XRFA 2WDZA 5EP4A 2AYXA 3GLFE 3ZR4B 2GHIA 1NI4A 2PD3A 5DRTA 3NFRA 2IZ1A 3QLUC 1JQ3A 3NUGA 4MPDA 5JYDA 1ULAA 2PKQP 4TMXA 3P5BA 2QE7D 3ZUPA 5C18A 1A2OA 1DRWA 2FHPA 4P54A 4OGFA 4F2DA 1V8BA 5AI4A 3L02A 2AQKA 3LUGA 1ID1A 3WA6A 3L1VA 3R2JA 4XE5A 3SKYA 2Q4TA 3B5IA 3LUJA 2Q21A 3D54D 4FGLA 4MCJA 4PAQA 4QQRA 2C61A 1D9ZA 3KTAB 4NK4A 1P72A 2OHOA 4UD2A 5KHAA 1GNQA 1NFRA 3EDCA 3CXUA 4BE7B 1G98A 4B83A 3RTEA 2PJDA 4EX6A 2C7PA 1ZOSA 1M67A 1VPVA 2AN1A 3SXPA 4ZYUA 5M04A 2ZRNA 3SQWA 1VKNA 1HPLA 1W9MA 2JIBA 3OEWA 5B6JA 4OH7A 2F1KA 1FVHA 3DEKA 3ZHZA 2EBUA 1RLUA 1QXSA 2QDKA 2YNMD 2OGUA 5EYPB 2WSSA 1WUYA 2A84A 3CS3A 4BS9A 1SRRA 2XZLA 1L7PA 3GGPA 1EVZA 2NQ8A 1T1RA 3JARB 4MB0A 1O8BA 1N8NA 4C0HA 4DS3A 3GC6A 1VLQA 4OSOA 3B6KA 1DCKA 4JBWA 4A5OA 4R3UC 3SHQA 1NUPA 1Z8NA 4TROA 2OCYC 4OKSA 2ZIFA 2OHJA 2FV8A 4P53A 2V54A 1EFPA 3FM9A 1LUAA 2IDKA 2J9XB 3FPJA 4B0PA 2QGNA 4QRIA 3GN2A 5LDHA 3G17A 5KWSA 1QAQA 4Y2SA 1DWOA 4H9GA 3AZOA 2O8BB 1XZIA 1U7PA 4KLZA 4FX5A 4J91A 1G5IA 5HHTA 1GG5A 2XUKA 3K73O 1EQ2A 2HC9A 1QTQA 3I12A 5AI0A 1PWYE 1N8TA 4I3FA 3F6SA 2UXBB 2Z6QA 4RHYA 1E1LA 5JCPA 3R9WA 3OKAA 4NCHA 5CDHA 3FKSD 3NIGB 4EI7A 5JPCA 5DBGA 2JGAA 2VAVA 1X70A 2I2BA 3EA5A 5HXAA 2ACVA 1SKAA 3CEPB 4XQCA 1Z7GA 4LZPA 5DNAA 5FWXA 1LF5A 1LCIA 3RVOA 3JRXA 1C1HA 5C81A 4HCJA 3L18A 1U31A 2KJQA 2HMYB 1P8AA 3ICCA 3LYUA 3ZDEA 3L8CA 3ZYZA 3LHDA 1R4NA 3A1CA 3LT5A 4KFTA 4KMOA 4TVKA 5FP0A 3TI9A 2YV5A 3TRDA 5JMTA 1WETA 1IM8A 3AR5A 4YMTA 1UXGA 3HVHA 5CBKA 1YKFA 2EKLA 4UEJA 3L4SO 1VLHA 2D7CA 2GHTA 3TL2A 2BDUA 3V1UA 2J3DA 2PGJA 3VC3A 1Z0KA 5KI6A 4CKZA 3KHSA 1OFHA 1PR1A 1W0KD 5E3IA 1FU8A 2YY5A 5DHFA 3H86A 4JLOA 5HUHA 2O8FB 2DETA 2HSGA 4G1BA 4JJ6A 3MMSA 4CU5A 4YH1A 1V11A 1YZ3A 1NUQA 1RYHA 3G2IA 3IUYA 3L43A 4C89A 4DDTA 2C7GA 3HM9A 1Q44A 4MMXB 3DOHA 4RX1A 2C5GA 3OVMA 4MJ7A 4EHBA 1QIJA 3B3JA 1GPKA 3QI2A 4BNKA 1Y5MA 3MFQA 1TYZA 5A5VA