4WINA

Crystal structure of the gatase domain from plasmodium falciparum gmp synthetase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
228
structure length
228
Chain Sequence
YDKILVLNFGSQYFHLIVKRLNNIKIFSETKDYGVELKDIKDMNIKGVILSGGPYSVTEAGSPHLKKEVFEYFLEKKIPIFGICYGMQEIAVQMNGEVKKSKTSEYGCTDVNILRNDNINNITYCRNFGDSSSAMDLYSNYKLMNETCCLFENIKSDITTVWMNHNDEVTKIPENFYLVSSSENCLICSIYNKEYNIYGVQYHPEVYESLDGELMFYNFAYNICKCKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP synthetase
publication title Active site coupling in Plasmodium falciparum GMP synthetase is triggered by domain rotation.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 72
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2014-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4winA00
4P36A 2VDJA 2ZUVA 1P7ZA 4B7AA 1QVWA 1C30B 1FY2A 1GGHA 4UOZA 5SY6A 1VCOA 4UOQA 3NOOA 4RKWA 4GE0A 4ENQA 2ZUWA 4ZGGA 1QDLB 2W7TA 1P80A 2VKTA 3ZJ4A 2AB0A 1IZYA 3PQ5A 4ENSA 4Y1RA 4P35A 1P81A 1PV2A 4RKYA 1GPWB 1C3OB 3BWEA 5SY4A 1VCNA 4P5PA 3WFZA 1GGKA 4P2GA 5IP5A 4B31A 4K2HA 3UMMA 4ENTA 2YWCA 1G2IA 1M6VB 3CZ9A 3PQ3A 1I7QB 3CNEA 3B36A 3EN0A 1SOAA 1IZZA 1CF9A 3UGJA 3UOWA 1GPMA 4LGYA 2IUFA 4UCFA 4QYXA 1GGFA 4Y0NA 2AD5A 2LXNA 1T0BA 1KA9H 3N7TA 2YWBA 1QVZA 3R76A 3RHTA 4ZDIA 4ENVA 1IPHA 4ZDJA 4I46A 5DFAA 3P9PA 4P34A 3PQ6A 4ZDKA 1I7SB 1Q2UA 2A9VA 2XF2A 3ER6A 2GHRA 3FIJA 4GUDA 3P9QA 3NOVA 2ZUSA 3CYFA 4QYTA 3TTUA 4E5VA 3NVAA 4AUMA 4L95C 4OIFA 1PDVA 2VPIA 1S1MA 1QWSA 3L4EA 4MNTA 1R9GA 1GG9A 1Q7RA 4OQ4A 3CZAA 2ISSD 3B38A 4B40A 4ENRA 2YWDA 4AULA 2RK3A 3OT1B 1PDWA 3P9RA 4N12A 1FYEA 2NV2B 3BHNA 4JQSA 1K9VF 3FSEA 1SY7A 5K4AA 4HCJA 3GRAA 4WINA 4BFLA 4N0MA 1T3TA 5LIRA 2V4UA 2ZUTA 3TTTA 4Y1GA 3TTYA 3VU3A 4AUNA 3L7NA 3SF8A 4R7GA 3TQIA 1KXJA 4UZSA 4L7QA 1J42A 4L8WB 4ADSG 1I1QB 1T36B 3NOQA 1A9XB 1CS0B 3PQ4A 3NONA 2RK4A 3SF8B 1CE8B 1JVNA 2R1VA 1KWGA 2OR3A 4MTCA 3L3BA 2R1UA 3MGKA 4E08A 5E9AA 1QVVA 1O1YA 4OJYA 3D54D 3OT1A 1P5FA 4BIMA 4WXYB 4S0ZA 4MGHA 4Y1FA 4LRUA 4BTEA 2R1VB 3ZJ5A 3F5DA 4D1YA 3CY6A 3EFEA 1QF7A 4XLLA 1OI4A 1GGJA 2WJZB 3UK7A 2ZUUA 3ZR4B 2VRNA 3B3AA 3TTWA 2R1TA 4OFWA 2YWJA 5SY9A 3MIIA 1VCMA 2H2WA 4UNIA 3TTVA 3NORA 4L8YA 3P9SA 1KWKA 5JZOA 3R75A 5SYAA 4B2YA 2GK3A 1L9XA 2R1TB 3EJ6A 1OX6A 2VXOA 4B5KA 4AUEA 1WL8A 3EZGA 4I4NA 1OX5A 2FEXA 1JDBC 3PQ7A 1PE0A 2RK6A 4L8FA 1KEEB 4OGGA 4OGFA 3SOZA 1GGEA 3UJNA 5BV2P 1OX4A 4ENPA 3R74A 1VHQA 3PQ2A 4L78A 4Y1RB 5JZMA 2D7JA 4ENWA 3KKLA 2ABWA 1OY1A 1N57A 1BXRB 3M3PA 3TTSA 1OX4B 4PXYA 4AJ9A 1ONSA 1U9CA 3F71A 4I2NA 3PQ8A 1UCFA 2NV0A 4ENUA 3TTXA 4GE3A 3EWNA 3L18A 1P7YA 4Y1EA
chains in the Genus database with same CATH superfamily
4QDJA 4MZDA 3VSBA 4EIWA 3WHIA 1UAYA 5LNK6 1CVIA 2V7UA 1GNQA 1QK5A 2H9YA 2Y6UA 3FRIA 1D1TA 1Y9DA 3ZE0B 1KZYC 2R48A 1BDBA 2Z3VA 1SUDA 1SELA 3F5SA 3IUPA 3PNSA 4G5HA 4YI3A 1WCYA 4ENSA 4RY0A 4D43A 3A7DA 3IDQA 4BLOA 1Y3HA 4MYDA 2QMUA 4KB5A 4WK6A 1IEXA 1MVOA 1NF3A 4CM9D 3ELBA 4U0JA 1I7NA 2E9SA 4PWZA 5B7PA 4FBMA 5FORA 4BEVA 1ENZA 1RYZA 3CH5A 2G40A 2PCLA 3EGXB 4QYIA 5E3IA 5DLPA 3G59A 3MMNA 3REOA 4E22A 4B44A 1IYZA 3RE1A 5HOQA 4KO1S 3ZHOA 3LVFO 3OOSA 3I45A 2HPVA 2PLFA 3CVUA 2GPNA 4X1OA 3T3OA 2P77A 4Q24A 1D7OA 3OURA 2P67A 3BMQB 3CZCA 4BO7A 3QVMA 3TZCA 1IPHA 2P91A 3SF0A 4JSRA 1XRRA 3W7AA 1QGUB 1OXTA 4AT1A 1IBRA 2K2WA 3T41A 4MYTA 2Y0DA 1Y5MA 2WWFA 2ZAGA 1QPGA 3E48A 3UUEA 1AQIA 1KU6A 4Z1OA 5K0CA 1I1OA 3AHHA 3NXSA 1QWSA 2P41A 1QB7A 2WLSA 3GIDA 5CYFA 1D3AA 1ZOIA 3PLAE 1W5AA 5B1DA 5IT9A 4O1IA 4GI7A 4ZKEA 1G3MA 1P1FA 4MCJA 2V6BA 5HZHA 1O97D 1PHPA 4W5JA 2I1VB 4KVFA 5EE9A 3CJTA 3FOZA 1MX3A 2JJ2D 3AV0B 4DIOA 5BQ3A 2BHNA 2ANBA 1FFXA 4I9GA 4TYQA 1OWLA 2J85A 4IKOA 3L0YA 4R7GA 4HWSA 4RGBA 4FOTA 2FN3A 1TTQB 2VDRB 4UXHA 4ZVNA 1R2QA 4KYTA 2RGBA 4CTNA 2WABA 3NM4A 5F7JA 2QY6A 3LUPA 1C1XA 4RS3A 5IX8A 5LP6C 3W2GA 2JEYA 2WM3A 5EMLA 3DZJA 3TD9A 1EP2B 1OBOA 4RUKA 3VVCA 5JNTA 3ILSA 3JQGA 1QH1B 3ZWKA 5AI0A 4UHCA 2ZIZA 4L73A 4YP1A 3SZGA 1EFPA 2BF7A 2WI8A 1PCXA 2GJAA 2ZAOA 1ZINA 2B99A 2Z8YA 3K2IA 1NY6A 3WGZA 2RMKA 4EK9A 3L1HA 2RHWA 2XGJA 4CL3A 4KX3A 1FFYA 2YINC 4D8TA 1W5EA 4GG1A 3N87A 4MUGA 5K0LA 1NBAA 2J3DA 3R8CA 4ZPJA 2NUAA 2IU3A 3O2QB 2OHJA 3QVVA 4PV7A 1B8OA 4V3BA 4A5OA 2TRSB 3ZHYA 1GIAA 2BSAA 2H1WA 3GLSA 4QT4A 3MM4A 3MB8A 4HFJA 4AUEA 3GRKA 1NL3A 1XVIA 3PTLA 3AJRA 1TO1E 3ROEA 3QFFA 3PQCA 4H3VA 2ZRNA 4L75A 3PBKA 1L4YA 5FPHA 3PT5A 2R86A 1XBTA 3ILXA 2VPQA 3QLVC 1Z0AA 3QPUA 4OA5A 4FTWA 1XLTA 3K0FB 2GKSA 3NW9A 3GEMA 4RD2A 4HNTA 4WXMA 4UHFA 4LKRA 5FOQA 2B6HA 4DUGA 1V1MB 1WZIA 3ZHQA 2B30A 2GJKA 1UKAA 3MRTA 5ECWA 4BUJA 1BHQ1 3CB4A 1U2DA 2D8AA 2XBUA 3M49A 1ZIXA 5J63A 4DCGA 5CDGA 3OQJA 4ZYYA 5IT4A 2QPAA 4Y2PA 1VECA 3MLAA 1FRQA 2NACA 3K0HA 1YR8A 2QD5A 3L1UA 1USVA 1MZPA 1UAGA 2D8MA 3NI2A 1NVVQ 1T3GA 3OMLA 4J0QA 2Y4OA 2F00A 3KQKA 5L7TA 5E4TA 4AZ0B 1XXLA 1E4OA 2NQTA 2BEVA 3CRMA 4FMPA 5J47A 1BCSA 2MSDB 1YDWA 4R83A 2B69A 1GSOA 3NTXA 3SZLA 4BATA 5JS6A 1TVEA 5IEBA 1CHNA 1TYAE 3MTQA 4EFNA 1RI4A 4NJOA 4HB0A 5JVDF 2AHRA 4PX9A 4P82A 1A9OA 1QRTA 3H17A 4KQ6A 2ZB4A 3C0KA 2V45A 3E5NA 4HN2A 4RH3A 4BLWA 3P27A 3C74A 1WW2A 1GEEA 2DFDA 3MMPA 4XD2A 1XHFA 3D5TA 3FMOB 3V1UA 5HM6A 4ENVA 3GMTA 3G9UA 1IEWA 2R6CA 4QPZA 2Y76A 4NCAA 1SUSA 3GXBA 4HEHA 1Z0UA 1Z0FA 1Z7WA 2C03A 5ED0A 4B74A 5F77A 3WNVA 2ET6A 2GPAA 2JBWA 3E84A 4EPRA 2JKYA 2UVDA 3AFOA 3MT8A 4BCCA 2BGUA 1L7DA 1ZN8A 2GLXA 1TAQA 3ANXA 2PRKA 4GI1A 2CY0A 3IX7A 1B42A 4HLUA 4QBFA 3TRJA 4BFTA 1T9AA 4Z51A 1BIFA 2PEYA 1RKXA 2I4IA 3OLVA 1E2MA 1E18A 4AO7A 1GVNB 5IJWA 3LKDA 1QOZA 1UL1X 2FYTA 5FD8A 2CVZA 3R5HA 2GXSA 4ZQIA 1NASA 1ACMA 2Q3HA 3P26A 4YRQA 4HFNA 3IIEA 4BO2A 3P52A 2IDKA 4HN9A 4BJ5A 4I99A 5IT5A 4JC0A 1ZNZA 1I1QB 1T36B 2HV9A 1NOKA 1UBFA 3CCCA 3KOZA 3OP1A 3RGWS 1HMYA 3PE4A 3A58B 4QXRA 3T5PA 4O3MA 3JYNA 3FTNA 4HOYA 1RJDA 3E3LA 1IL0A 1IDOA 1UBJS 2DHQA 4YRAA 1IJEA 4PSUA 5P8WA 3A05A 4RHCA 1T15A 3R8FA 3K0CA 2Q8QA 4V02A 3CURA 3BWVA 3RBXA 2YHIB 3HJGA 1T4DA 1O0BA 1O08A 3CLUC 3RRBA 2AOTA 1EGHA 5ALOA 4N7JA 1WIWA 2P8JA 4IDDA 4FWTA 1HDZA 1BZYA 1BJTA 3KR0A 1IY1A 2OTCA 1N9KA 1DEOA 1Y9EA 3AO0B 5ALGA 4HBZA 1KY4A 2DSNA 2XUHA 2ZYGA 1KWKA 1ODSA 4Z7NB 3IBSA 4RJTA 4UHJA 4AD8A 4JYMA 2H1FA 1EE9A 3BS4A 4KV7A 3W5UA 1CZNA 4I4NA 1FS5A 2C9OA 2GNPA 2PSDA 1N5RA 3T3EA 4TVKA 3R7DA 4EMBA 1PE0A 4P4NA 4ASUA 3WLQA 3AK4A 3JAWA 3KX2A 2EX4A 3DV9A 4O2AF 5AK3A 1UWKA 3PE6A 3I73A 4NXNB 2V9CA 1U04A 4MLDA 5ALSA 2RGRA 3I58A 3OZGA 3C3MA 3UXYA 1JHPA 4ROTA 4ZAXA 1UEXC 2BUBA 1GGVA 2FWNA 4UBIA 4DA0A 1JW9B 1TMKA 3OOJA 1JKMA 1PNVA 3CO5A 3WKAA 3JAKB 1KIFA 4EDFA 3FWZA 2G0TA 4DAOA 4CM8B 4L50A 1XU7A 3NKVA 3TI7A 4QHYA 3FTQA 3H5LA 1QXSA 1APBA 3EGCA 5FBHA 1Y3AA 1QQBA 4CV0A 3KEGA 2Z95A 4H08A 5DHQA 4KO2S 5H9WA 1GCUA 2H4XA 1LKZA 4LHYA 4E2XA 5AVJA 4ER7A 1NVTA 3CKYA 1CY4A 3QU2A 5C8VA 4OB6A 4WACA 1YMVA 4RSRA 3R2JA 4MUEA 5IUNC 4FZRA 1Z4QA 4HGQA 1J1UA 1SCAA 2B98A 5KOHA 1FFHA 2VLBA 5KYYB 1ZJYA 2QVBA 1JQEA 3A0UA 3WL6A 1LPNA 4CBVA 4HAYA 3K1YA 4ZCRA 3PEWA 3OVMA 4LHEA 4DANA 3RFXA 3FHCB 2LXNA 4DBLE 2FPPB 5J4LA 1XL1A 1NI4B 3A32A 1EQAA 1YRWA 4N0EA 1DC7A 2DUNA 1GNSA 3DVAB 1P4HA 4Z9BA 4BTVA 4A0FA 3NIFB 3CW8X 5D6OA 4HQ0A 4IPTA 1A50B 5LMZA 3F6EX 2X6RA 5CP8A 4HQRA 1UMDA 4C7KA 1JDUA 1U1GA 3IUYA 3RVRA 1FUIA 1CY1A 2GSDA 3FNHA 4FHCA 1HEIA 2YC2C 2AOWA 2PZBA 2Z3ZA 2Z0MA 2OV6A 1C7FA 1N0WA 1VM6A 4CKEB 3QEAZ 3KHUA 3SCZA 5MF6A 4MGYR 1MG0A 5TQ2A 1SY7A 3VO9A 3AI7A 3WBFA 3RI3A 2W2OA 2B8WA 5I7RA 1L7XA 4WOCA 1T8SA 3ND6A 4X93A 5JVDA 3LFTA 3NDIA 4HGYA 4KVZA 3P97A 2WVGA 4X24A 4Y2VA 5BO5A 4IMJB 2MSLA 4KXVA 2GM9A 3KVNA 4UBLA 2R9VA 3H99A 2P69A 3QEMA 2IS6A 1LBEA 1Z6GA 4XM1A 4UE6A 1ZZEA 5I7OA 1XTZA 2BMDA 4NP6A 4FEEA 4C2TA 1DJMA 2EG5A 1BSVA 3AP2A 1GKKA 4LTNA 2X8JA 4KSCA 4REQA 3H2SA 4OXQA 4BN5A 3D3KA 5GPBA 4MPJA 1EJ0A 3KWMA 4KQJA 4G1BA 4D9KA 2XOXA 2RH4A 3HFJA 1SIBE 4KR3A 3RTDA 1PYOA 2OK8A 2PGAA 1YBVA 1FJGB 2ARKA 1O58A 4MQEA 1W5BA 3MC1A 2AFIE 3A6ZA 5ALUA 3REQA 4B2LA 5LU9A 1Y5RA 2JFFA 1PT9A 4EVQA 3W7BA 1A9XA 1LZLA 4JBWA 1ST3A 4MKGA 1FK8A 2PEZA 1QH8B 3FJYA 5H16A 5HTKA 2I9KA 3WDLA 1X19A 2NAPA 2GM5A 1E1CB 1JH9A 3EXFB 2QL7A 2IOQA 3HDTA 1VE7A 2XA2A 5D5QA 3RARA 1LF0A 2OAP1 3UKJA 2IITA 5KNCH 1LSUA 2WZQA 3CNBA 3U3RA 3LFUA 4LSZA 4ATNA 4CLRA 5JNWA 2Z09A 1B14A 1DAKA 3S5UA 5ITWA 2VOEA 2A0XA 3Q6MA 1W9HA 4NBWA 3WXMA 3QNMA 2FR0A 1PQYA 5E0KB 4D80A 1RRCA 1EK6A 4FSXA 2PU5A 3OUZA 5FPSA 5AK6A 2NU9A 2H6EA 1J97A 4LEIA 3I9MA 4BX0A 3I4LA 3NVKI 1NSFA 1X38A 3QKRA 1EFHA 3LTEA 2FDXA 2JARA 4GXTA 2O5RA 5B1SA 5JJ5A 1OH6A 2F3UA 4INJA 1N2HA 5DULA 1Q6ZA 1T0JB 1XN1A 4RVGA 4B3MB 2GAJA 2GHQA 3I52A 4XCQA 3ZJ4A 4BNTA 2JCVA 4DCUA 2XTMA 5E1OA 3N7UA 2BH2A 2WB4A 3DE0X 3IPXA 3KAPA 1B8VA 1VIDA 4CQLB 4QD3A 2JGAA 1KY3A 5I3CA 5F73A 1M1NA 5TARA 1UOEA 4OBBA 4D8VA 1U4NA 1AGYA 3IPCA 5FPTA 2OV4A 4Y2RA 3OPQA 3ZBQA 4O2AA 2GR9A 3F7MA 1AMNA 3DOCA 4LY6A 2NO7A 3KYCA 3HDHA 3NATA 4WCFC 3OC6A 3FCSB 1KMIY 2Q6OA 5BYJA 3SKYA 3RYCB 2M6SA 4R0VA 4YJDA 3TLGA 5U4XA 4JSTA 1B0ZA 1NKVA 2CXHA 2YOFA 3WK6A 1SXJB 1V96A 4QOSA 4DLAA 4GW3A 2PYDA 1GPH1 4ND7A 4I1OA 4F8EA 4BRZA 5B53A 3EOZA 1I0LA 1E3MA 4HAUA 2A9VA 2XB4A 1QQTA 3M6AA 2QLJA 1HQKA 1SBIA 1XVAA 2A88A 4K6MA 1S2LA 1CNFA 2QW8A 1QIHA 3GPCA 2V8OA 5EKUA 4R6XA 1UDRA 1QSGA 1G60A 2ZE6A 1RXEA 3Q3JB 1ZD3A 4DLLA 3RAPR 1UPTA 1E3JA 1MKYA 3E9QA 5C5DA 2FSFA 5FO0A 1VSQA 4JLPA 4K46A 3TG8A 1R4NB 4X7MA 1ZI8A 3KQQA 3F2IA 1RDFA 4CM4A 2IX9A 1MBZA 2LKDA 4ES6A 2J9GA 2J0EA 4MUKA 4M8LA 2HH9A 3W9YA 2GJ4A 2G83A 2XKAA 3NIGB 4LHXA 1T2UA 4QTUB 2ATCA 3OKCA 4R3NA 4EYOA 4FFWA 1YZGA 4J1SA 3L0CA 1TM1E 2GKGA 4PN7A 2IV7A 2YN2A 3KG2A 4V0NA 2OXTA 3ZY2A 2X6TA 4IBOA 1IUNA 1AUXA 2CHEA 4DPLA 4L9SA 2HFKA 4X1KA 4KK3A 4BO6A 2CXPA 2QG9A 4FN5A 2QJTA 2UV8A 1L5MA 1U0EA 4H4CA 4XYGA 1RMYA 3GT7A 3SKVA 3WTBA 2WAAA 4ZTUB 4ZIRB 1QRDA 3R75A 3GA0A 3E22A 4PLYA 4XRRA 2ADMA 3SLKA 2BONA 1IY8A 1NR5A 2C9YA 1PWXA 3QVKA 5KYUA 5C1OA 1CR2A 2GD6A 4CR8A 4PBSA 2PAFA 1FS4A 5DNUA 5DLDA 3YASA 4HGZA 2PZMA 3SX0A 5KIAA 1L5NA 1UT5A 3EZ7A 2IH4A 5JI3E 5CAEB 2GESA 2FMXA 2G5GX 3LF2A 2XUOA 4GHWA 4MDYA 3LY5A 2ZKLA 4UUMA 3L8FA 1OWOA 1TRKA 4CIWA 1TUBA 4X64B 3R5SA 2G1KA 3C3KA 1E9CA 4QARA 4ZZ2A 3VR5A 1F2VA 2VHCA 2ZM6B 1FQOA 2Q5EA 4EL0A 2V98A 4DLTA 3MSXA 2IHVA 4DG8A 4MA5A 1YVEI 3LX6A 4IIVA 4AJ2A 3U7QA 3VPDA 3MWDA 4MQ6A 1Z73A 4RVCA 5B1EA 1VMIA 3KWJA 5BMOA 4D79A 4F4UA 3UJCA 5IAEA 2PTHA 3K30A 2F3SA 4WY5A 3ORHA 2WU1A 2FE1A 3ZY5A 2IXEA 2GWRA 3N7AA 3DOIA 3NHRA 4BKMA 2FLKA 3PNMA 3FB1A 3DXYA 2POCA 5EZYF 5LM3A 1VJDA 2EZ9A 1JAHA 1LVGA 2HU2A 4K0RA 4EPWA 1K5PA 1XHLA 1JKJA 2F8SA 2DERA 2YMPA 5DEIA 1Q0RA 4JB0A 5DMHA 1SBZA 2PE5A 2Q41A 4Q7LA 3V1LA 1ODKA 2QTBA 3R4VA 1RXCA 2R62A 3BD6A 4CFYA 1GQOA 2R96A 4OGWA 1E9VA 4R8KA 3O8QB 3KPYA 3JU3A 4GL4A 2C4UA 2HBQA 4YJFA 1GQFA 2M2IA 3HTXA 1BHJA 2FWJA 2HWUA 2ID4A 1KI8A 2UVPB 4Q5IA 3K9NA 1PUIA 4QELA 5BNTA 3DAYA 1L4MA 4WXHA 2J5QA 5JAHA 4D3YA 4DQLA 2ZVPX 4BQNA 5LD2B 3DWIA 1C4OA 2VUIB 2QPLA 2ZW9A 3LZDA 1BD3A 2D6FA 4HXFB 2GCOB 4IO0A 4DG5A 1A97A 3L0PA 3EIWA 3GN1A 1JFFB 1JXMA 1K6IA 1PFQA 3QBJA 3RS3A 2HRBA 4L16A 1NW4A 4MGIR 1E6UA 3U3JA 1Z08A 4JA0A 3LKVA 5FWXB 5KQRA 5KNDA 3TW6A 5KQSA 1SHZA 1E63A 2X0KA 4PCVA 4RULA 4GGOA 2Y9MB 3B89A 1HE8B 4YRFA 1AX9A 1Z45A 2VHYA 3PL5A 4HEQA 5LQSA 5EE3A 1LWNA 4XB1A 1G20E 1QKJA 3EQ6A 3VH2A 1YCGA 4EF5A 5C4MA 2BR4A 3NHLA 1GEGA 4DCNA 3S1AA 1MV5A 3L7JA 1GKIA 4GOMD 2AFRA 2F1HA 5HBGA 1ZS9A 4WZBB 2CL6X 1T29A 1TFUA 1ILWA 2ZJ4A 3AILA 4JQYA 1KJIA 2IE0A 4JGBA 3GLQA 2QN3A 3WGIA 1T9CA 3WAGA 2G67A 5EJAA 1L7BA 2W0MA 621PA 4GYJA 3TINA 3GD5A 1VCHA 5IMSA 3WLKX 3ZJYA 3RT1A 2HMSA 2ZUUA 3W4IA 3Q7QA 2P6OA 5A9SB 1OI7A 1NATA 3VHXB 1Y7TA 2C04A 3RSZA 1MRNA 1CRPA 1AH2A 3KTOA 1EVEA 5DYGA 3EBLA 5BPHA 4QEKA 3K1ZA 3W2HA 3MMXA 1E9DA 3BILA 2QPTA 1E1RA 1FXWF 4G36A 5KTTA 3WGJA 3FSJX 4UU0A 3A4MA 3OX4A 1JVSA 1UBEA 3PNBA 5CRIA 3NHZA 2H0QA 3QKIA 1BFKA 3G0OA 3JY6A 3H2ZA 4JJAA 2C59A 4FKZA 2Z08A 3GZTB 5LUAA 2XQKA 4BKUA 4H0CA 1IN8A 2F3RA 3GDWA 4U6QA 3KEQA 4QASA 4UEOA 3MCTA 2OBFA 3WHKA 3FWHA 4ZTZB 2XRMA 4PXAA 2QAGC 1P1KA 3B78A 5EJIA 3LOQA 5DRYA 5TJHA 3RSGA 1LNSA 3JQEA 1NM5C 4L2IB 5EE0A 4ALKA 4UBNA 1EIWA 2HPAA 3IV9A 2PO5A 4EM6A 4TMXA 4LSMA 4W8HA 2AZ4A 2M6KA 2F43A 3KJIA 4UBJA 1N6OA 3RC3A 3QE2A 4V2IA 2PL5A 2VTEA 3CRVA 1JTVA 2PKRA 4PRZA 2Q3FA 4MS3A 5FWNA 7YASA 2BVNA 1P80A 5E0OA 4FS3A 4KN9S 4ND2A 1Z0DA 2VF8A 2YV4A 1FVHA 2WYIA 1LX6A 4BFUA 5K0FA 2VQEB 1Z62A 1N5DA 1ZI9A 2TMYA 3LBNA 3HP1A 1ZK3A 3E4CA 4QQRA 3TJRA 1EUDA 1ULTA 4HQFA 3DFFA 4B3FX 3RLFA 5KREA 3MTEA 2HA0A 3TR5A 1JBKA 4H60A 1JDTA 4PYKA 1NUHA 3V4LA 1BX0A 2DH6A 2NWQA 1VLLA 1POXA 5EP2A 3BG5A 4NENA 5D3QA 2M32A 4LOLA 2QW1A 4LXUA 5K3SA 5L3RA 5JS2A 3OIWA 1GCIA 4RIHA 1QIKA 2BBSA 2GEBA 1EFTA 2GRUA 5D51S 1QH0A 3SR4A 1XWFA 2Q27A 4QYIB 3UV6A 2J6IA 4RZUA 2LWIA 3OUTA 5B37A 2ERCA 1QQAA 3I3OA 3QSYA 5EUCA 3GPDG 3NDJA 2QB5A 5AKLA 2GHRA 4BQEA 3ZZ0A 1KEZA 2FWIA 3CLSD 2FPXA 2F6RA 2W6MA 3NP7A 4WKBA 3TEMA 5DX8A 3NIBA 4QU0A 2PL9A 3E9CA 2AJ8A 2RKWA 2IXFA 3DD1A 3HVJA 1H2RS 4URVR 3A04A 1HO3A 5EZYA 4ZT6A 2FMIA 1HTTA 1LVHA 1MIOB 1JDJA 5AHXA 3K0SA 4IH1A 1A7UA 1NE2A 4PE5B 4AQDA 4D8WA 4R3WA 1D07A 2FQQA 3RFUA 3NGLA 3RBZA 3Q9UA 2ZJ7A 3GEGA 4LPSA 5CVJA 3AVVA 2O2IA 3IRVA 3VHQA 2PJRA 3A6EA 5B6PA 4X60A 4N5IX 4NU6A 4PAMA 1VA4A 4A1OA 1PX0A 2DAPA 3DLHA 4LRWA 5H70A 1JMKC 3IVMA 3RUCA 1RYBA 2FU5C 4HYQA 4XQ0A 4EHDA 4RX1A 1FFXB 4UNQA 4V1CA 4R71A 1V7PC 2FUKA 2GBIA 1BNCA 1YRQA 4FIZA 4MWDA 3LO5A 5L3SB 1RAHA 1AOXA 2Q7XA 3M6WA 2IHBA 3I9OA 4O29A 4XFKA 5ENZA 5IABA 1C1XB 2OBLA 2R8OA 5BVHA 1FRZA 3W5SA 2VT3A 1RKBA 4DUYB 1T9DA 2FSIA 3LI2A 4C7VA 2VXCA 4JENA 5JSKA 3JQGB 3EEOA 4I14A 1X86B 1QHIA 5ALVA 4C7OA 4DSZA 4V0OA 2ZIGA 4P83A 2V7TA 5SYAA 4I5EA 1CT9A 1NJ1A 1WWKA 4ZEWA 1PNQA 3I8OA 3KAKA 1AB6A 5K3AA 2X41A 1AO3A 2R5FA 2RK6A 3TB6A 1AQNA 2QI9C 2XVAA 1QFSA 4WHMA 4WZAA 5LUBA 1YZKA 1WZEA 2AZMA 4HDCA 4CETA 2V7BA 1USIA 2GB4A 2ZS9A 1F20A 2H1IA 4AB1A 3EUWA 3S4YA 2Q0QA 5F1PA 3EW7A 5BV0A 2DLCX 4AK9A 1EUCA 1Y9AA 4FC6A 4DIEA 3UK6A 5KYXA 1GUBA 1HDCA 2MIIA 1R0SA 4TYYA 3K8ZA 1P18A 5DTRA 2ZSBA 4EY3A 1FY2A 1UXKA 1U3FA 2XTJA 3CLUD 4IQFA 1KMQA 3UJ8A 4R0NA 4BBZA 1GR0A 2Z5GA 5ERGB 4AP6A 4N0QA 1D9ZA 1PFYA 4MRVA 3GJSA 3B8EA 2HRDA 2WG2A 3ETCA 4O2RA 4UHHA 4QUAA 3BHMA 3ZCRA 1QU2A 2P68A 1K9SA 1IEQA 1PJCA 1FXWA 4OGLA 3RIEA 3V7NA 1JLMA 1S8AA 3U4IA 1GTMA 3UK2A 1SN7A 3PGXA 2EFEB 3OBIA 3V00A 2ERXA 2IYLD 4TLAA 4ZA2A 3RD5A 1DKNA 3VDMA 2BEVB 5EJ7A 2E6KA 4U9UA 1OXMA 1HE3A 5IZCC 1HGXA 4DMCA 4N5NA 1WCIA 3ZX5A 5AI6A 1ABFA 3CU5A 4X6LA 1DUVG 4JV5B 1XD9A 3A1UA 5GJVC 1Q20A 4YRCA 4ID9A 2D59A 4OIMA 3UJ9A 3K0EA 1M66A 3LUFA 3P9CA 2AWOA 5H59A 5TMBA 2FWBA 1U2RA 2JK0A 3D7NA 4OMFG 2OV2A 4WWHA 4GYYA 1E1RD 1RYMA 2GZ1A 2HUPA 3CBQA 3IVRA 4LWQA 4NS1A 1F5NA 1CZHA 4F7DA 4E5VA 2DPGA 4Z6KA 4XXHA 3E15A 3TGLA 2Z5VA 4OJMX 5TEVA 3UXMA 4UULA 2DBYA 4B8ZA 4HEA1 3W90A 2EBFX 4CEHA 4RXTA 3ADKA 3LLMA 1QU3A 1FP1D 2IU6A 5EEGA 1XKLA 3UK0A 4EKNB 1XRJA 3PFBA 4XZ3A 4QPPA 1ZAKA 2INGX 3LQ2A 1FU8A 1Y42X 1V6AA 221PA 3VC7A 4B4DA 2XUDA 3EOBI 1YA4A 5ITZA 4G4SP 1U2ZA 4ZREA 3PYMA 4UW9A 4OKNA 3WIUA 2WU4A 3JD2A 4OLJA 4EO4A 3EEFA 3IE2A 3RF6A 1XF1A 2I6QA 3WIDA 4AF8A 4B1FA 2VJDA 4IUCS 5AW8A 1U0FA 4QLBA 3PC2A 4Q18A 3BTUA 1RM3A 1IM5A 2GEVA 3OT1A 1X2BA 4DNXA 2VC2B 1E2HA 4LHWA 3TLAA 4NZNA 3LCVB 3KQLA 1IRIA 3OT5A 2SICE 1U2QA 2EJBA 2H0RA 3G8AA 3ABQB 5KKAA 4LZNA 5E4JA 2GBLA 4X85A 4MV0A 3DNPA 4YCCA 3RT9A 2OV8A 1LGYA 3SLGA 3VU9B 3ZW9A 1NBOA 2POQX 2QLFA 3SICE 2WAMA 5EEHA 4EYEA 3JQFA 1XMJA 3DFKA 1G291 3RC7A 3C41J 4EZEA 2HM7A 4DV5B 4C4AA 3WMWA 3WRYC 1JQ3A 1BYUA 1Y82A 3RH0A 5LWQA 5EJ2A 1Q21A 3KEFA 4GRIA 4M6WA 3FYUC 3MJDA 3MJSA 5T5QA 5EHXA 3PZRA 4G01B 3LBFA 1NNSA 1S96A 3U3XA 3NHWA 3TG2A 1CXZA 4QBTA 4DR4B 4F5EA 1U0LA 2ATEA 2YV5A 2NSJA 4Q47A 5ILQA 1TLTA 3V4PB 3JAWB 1XZMA 3R24A 3DVRX 5B7GA 1D2RA 5DX0A 5FFNA 4R8RA 4UQPA 2VPWA 2WJVA 4ZT7A 5IBCA 1JVBA 2AA3A 3EIOA 2AR0A 1E9EA 1JEYA 3OKAA 3T9DA 3CVYA 1TF7A 2XR1A 4LZWA 5KJ6A 3EMVA 3O93A 4URFA 4D0RA 4A8JC 3EDYA 4DV6B 2RIPA 3IQEA 4KNVA 4F21A 3K70C 3N39C 4A4DA 2HMAA 1K06A 5T8KC 5JO9A 2Q5FA 2GM4A 1TK9A 1UMKA 2QGNA 3B5JA 3MQ2A 4IVRA 3DLIA 4JC8A 2CFRA 1KOGA 5CLQA 1CUFA 2DFNA 1PR1A 3EGVA 4CI9A 4B6PA 3KQOA 4Y30A 4F5ZA 4NE7A 2YN4A 4GKBA 1C3EA 1KAEA 3HVIA 3KB2A 3KSMA 3NQ41 3QLEA 3QYJA 2VDVE 2QF7A 4C1BA 5CIYA 1P91A 1PBTA 5KOHB 2BMJA 1P60A 2Y1DA 3K31A 2AD5A 2JJMA 3VPGA 4NMMA 1RPZA 2O8FA 1A88A 4NE9A 3H11A 3BN3A 3PT9A 4OGKA 5T64A 4DVJA 5JECA 2OQRA 2VYVA 2XQIA 2PKEA 1NN5A 1FVOA 2B1QA 2IOHA 4XIYA 1YCDA 2OLJA 5CLGA 1TB4A 4RYLA 3IFSA 3NHUA 5AVKA 4V1CI 1YS4A 1X9IA 1EFAA 3C1AA 3S1LA 4WFIA 3AHFA 4PYQA 4CLOA 1N7HA 1ADGA 2I29A 1XZJA 1DHRA 1N8KA 2C1ZA 4K9MA 4NJEB 4H59A 3AY6A 3VJMA 1RKUA 4QM6A 2GCGA 3HL4A 1UMDB 2WZCA 1L7NA 2KBFA 4FMDF 1CUYA 3VTZA 2FPGB 4HX2A 5TSDA 5LBTA 3OD5A 2WM8A 4IDFA 2VQ3A 4J1NA 2H5LA 4Q9IA 3ZXYA 3PPVA 2CWWA 4C7MA 1N5OX 4C76A 2Z43A 2V5UA 5MN4A 4ARIA 2J3HA 3JATA 3AHDA 1C5KA 2GAFA 1PZFA 3MOSA 1ZHFA 2WY2D 4BX8A 2Y0CA 1VJ5A 4YMIA 2GS9A 1KVSA 3HXTA 4M8NE 5AM2A 3OEHA 4IOKA 2D3WA 1OSNA 4IDGA 1NWHA 4ZQFA 5JU6A 3ZWMA 3EB9A 4I9HA 4GVLA 3RADC 3RIYA 4B43A 4EVSA 2OV1A 4CTMA 1N77A 3QEMB 4G1VA 1W9MA 1KYIA 4OQYA 1D4AA 4YJGA 1L5YA 5BSEA 2GTIA 2X8JB 3FUTA 1M34A 1CQWA 1S2NA 2LE0A 4REQB 4WA8A 5CB4F 2ZYAA 3AI1A 2C7VA 3GLTA 4PGGA 1RZRA 3V34A 3QLTA 2JFPA 3EFOA 1MNAA 2WFAA 4ZYXA 4RD6A 1ORVA 4XGKA 3AJAA 1DBIA 2QQ5A 4MQEB 1DCMA 5DTQA 3F6CA 2Y05A 1ECLA 3FPAA 4QEZA 4DCJA 1P2BA 2EARA 4Y18A 4GR4A 4NCKA 1OVGA 1TQHA 4EUHA 2VTDA 5KQMA 4QREA 3N0VA 3KVYA 4F56A 2Q28A 1SVUA 1TQ2A 2GBGA 5LMUB 1NW9B 1AB5A 5FBWB 3RAFC 3OM0A 4KH1A 4ZODA 3RF7A 3HP7A 2ZYUX 4HH0A 4LYDA 1M1YE 4OQEA 3UO8B 1T13A 3NBYC 5MGBA 2G88A 2Q8PA 1QTNA 2DHEA 2X7XA 3OZAA 1VHDA 4G63A 4CLRB 1JIUA 3PICA 2GO1A 1LXCA 3SVLA 3UGTA 4TV9B 2IF0A 1Q83A 5T4BA 1OAAA 1KO7A 2MYNA 5FLXA 2ONYA 5JBNA 2IXBA 4BO9A 2B82A 1GGHA 1Y8RB 3A6KA 2NU9B 2W6JA 1OGYA 3UUFA 1TGVA 1VCOA 3GDHA 3LPAA 4FQ5A 4GWLA 1K4KA 3S8EA 2QENA 3I6ZA 3QKRB 1YVUA 1TQ8A 2W00A 2X0EA 3UJPA 3QA9A 5CU7A 2IWRA 4GXRA 5AVVA 5TMDA 2C2OA 1Q0PA 1WX1A 2FZWA 3OOWA 2GPBA 1VCNA 5GVRA 1A71A 3HPRA 2AMVA 2PRIA 3DCNA 4FCTA 2XCSB 1WV1A 5TT0A 1K27A 1HQCA 2I3AA 2W4IA 3ILYA 5F9MA 1BVHA 4MR9B 4Z0NA 4Y2HA 3CNEA 3AVUA 4GOJA 5CJJA 4UMEA 4H7EA 4PGHA 3A7EA 4Q3DA 1DWUA 2PWPA 4UM8B 2B9EA 1VL6A 1P2FA 2FCAA 4J03A 4MR8A 4GPIB 4RWEA 4AYWA 2AYXA 2JLCA 4MB0A 5JNVA 3HV0A 2JNWA 1SHTX 1XYYA 2HDNB 2P4UA 3S2GA 3WL4A 4AG3A 4DS3A 4K28A 4G0YA 4YLYA 5C8ZA 5BR8B 3G1WA 3HKCA 3TX2A 3TLGB 1K5DA 2PNFA 4U0KA 4BEBA 1N9GA 2HRRA 4BFZA 1LD3A 3BAFA 4KQ9A 5AESA 1JUDA 1GUZA 5AWFC 4TXMA 1L6IA 4JYAB 3OLZA 2EATA 4TWZA 3JV7A 2VUUA 4R98A 4YQZA 1F8XA 3VPFA 3ZLJA 3KKNA 3HWX1 1QV6A 2XE8A 2EW1A 3IUJA 4HRXA 2G1PA 1DX4A 3ZW7A 2G77B 2JJ8A 4HTFA 3GUUA 3AZQA 1F0PA 4GOND 1BDHA 1G5IA 2NO6A 4XYMA 3GFSA 1ZOPA 4JMLA 4IH9A 3VPXA 5FBKA 3E7WA 5K8CA 1J8MF 1YGPA 1HYGA 3IHLA 4QDZA 3VYVA 2H2AA 3D8TA 1XEFA 2G9RA 4CM4B 4MUFA 4G5GA 3FVQA 1IN6A 2AXQA 4R2XA 4JBNA 8MHTA 1FYXA 4P7JA 4A2QA 2F8TA 1Z07A 1VPVA 3F5DA 1L5KA 4U39A 3A10A 4L07A 3FHOA 3BBPA 5KPDA 3MPUA 4ZI7B 5EXXA 2GDJA 4KDEA 4LF5B 2P78A 2ZZKA 3WZ2A 2AZDA 4Z49A 2PUAA 4D8XA 3OFSA 5FRDA 1TAGA 1CJUC 1KEVA 2ONZA 3JR7A 1PGQA 3CZQA 1GL9B 2CFOA 4L8YA 2QXUA 3P2IA 1U7DA 2B7CA 3RPEA 4PY2A 3UB2A 4MUXA 3BPSA 3JTEA 3LHFA 3P9KA 3R7WA 4RTSA 3N0RA 3PPXA 1Z4OA 1FBNA 2VYVD 2WNSA 1AS3A 2NSYA 4GMDA 4JT2A 4MGKR 4ACBA 3L4KA 2WG1A 4E5NA 5GJBA 8ABPA 3LS2A 2HTFA 1KDPA 2PKXA 2DHDA 3E22B 5E4YA 2ZWVA 4AY3A 4E4RA 4NZMA 1OB5A 1J8QA 4GGMX 3W34A 2QRMA 3ECSA 1BN7A 3RUDA 2ACKA 4C7BA 3E9ZA 3AJ8A 5LDHA 1C41A 5JNSA 2VRBA 1JE0A 3BICA 1KH1A 4Z7JA 5DIFA 3MTIA 3VKVA 1TUBB 3B7PA 3AF6A 3IT2A 3TTXA 2PN1A 5C53B 2F9LA 2CWDA 3DCJA 2QDKA 3M6MD 3PUJA 3Q7RA 4MQFA 2G9VA 1P0IA 1N7JA 2A9QA 1V25A 2RSLA 1P5ZB 3OEHD 1TYCA 3MWDB 3Q1KA 4KIWA 3D8RA 4R1OA 3M2TA 4YTEA 3VHLB 1G1MA 1OC2A 3MJHA 3V3KA 3L04A 2BR3A 2ENWA 2H4FA 2JH9A 3R7SA 4CTOA 1GFIA 3A2MA 3FRJA 4A92A 1R7RA 1QRRA 4BZXA 3S3TA 4EY6A 5KVAA 3O83A 1W25A 2ODAA 1AVTA 4R2HA 3RT7A 4EAAA 3WBKA 2OYRA 4D3DA 3NAQA 4J7AA 1P1HA 3E82A 5CVCA 1JI3A 4B5LA 3D1JA 3LRPA 3WVNA 1UMCA 2CBXA 4R7TA 4O3FA 1RZRD 1YQWA 4Q7KA 1IN5A 2DQKA 3DKKA 2CV2A 1QB8A 3FYCA 2H2DA 4CV1A 3I34X 3PZBA 1U6JA 2ZUEA 5JPDA 2X40A 4QFMA 3O8DA 1RBMA 2QGZA 1FUUA 2ZJ3A 3H4TA 4HNRA 2CF5A 4II2A 5BSUA 4EB6A 1SR8A 4QGSA 5IHPA 1DOZA 5LZ7A 3GLHB 1BMTA 2JHGA 2HCBA 1ADYA 1PHRA 3U17A 1W4ZA 1E77A 1A04A 1HBJA 1SD2A 3NBMA 1AT1A 4DCSA 4BO0A 1E0DA 3L4EA 3N0XA 4LDJA 1SVWA 5ADUS 4XRGA 1MQAA 4KGVA 2QIOA 4Z4HA 3GGDA 2BJWA 4PM4A 2QNRA 3SQXA 3A2KA 2Q4DA 3KQYA 2C98A 4YIKA 2C5GA 1C50A 1DIAA 1PR3A 1Z16A 2D1SA 5DNCA 2GETA 3TTYA 3UWPA 1Z13A 1MG5A 3ZCQA 1JGTA 2Z04A 3HEBA 3FCAA 3V32A 2W6JD 4D4IA 4FX2A 1QIDA 1KZ4A 3F7TA 1GDDA 4J29A 4K88A 4KMRA 4XIGS 3RCBA 1OLUA 2DWUA 3S8MA 4AS3A 3D6HA 4K87A 1KOFA 3QXSA 1R0LA 1DXOA 5FL7A 4B2PA 3U7HB 3WIVA 2C2BA 3S1AB 1NC3A 1Z82A 4OXIA 4WE3A 1JMYA 3T7AA 1YC2A 1DAMA 1OFHA 3IULA 2OCKA 4N6GA 3NAMA 1SIWA 5EXPA 2I6UA 1JA0A 2ZATA 4XSHA 2J5XA 4G89A 1II8A 3MD9A 2XNSA 3MERA 2HK7A 4MGZR 1DWQA 2DCUA 1C8LA 1HKHA 2D5AA 3DT9A 2IFTA 2IOFK 3FPSA 6REQA 4YIHA 2CV0A 4K26A 1MVNA 5FDFA 1NLFA 4QFBA 4HDSA 3FOWA 3HUUA 4TKLA 2Q0XA 5HIJA 1Y8ZA 2PZFA 1TF2A 3PYXA 4UTPA 3S28A 3NTVA 4QPJC 2A1UA 2X8LA 5LB2A 1F8GA 1O89A 3BKXA 1NMSA 4UE3S 1M72A 1CDDA 1CRZA 1U1EA 1O95C 2IY7A 2W2QA 1PNTA 4FLMA 2VFAA 1HTWA 1TKCA 1BOOA 2CLEB 5ADWA 1E7SA 3GLGE 3PGVA 5LL6P 2DH5A 2Z9BA 1HYQA 4WFKA 4CLXA 3AH8A 5BWNA 2XEDA 2J67A 4HB2A 3F7OA 1OFGA 4EI2A 2YIVX 3N1UA 2PJUA 3PC4A 1NDUA 3H7AA 5E1DA 1NLYA 2F8LA 4TMZA 3Q8XB 4FNAA 3ADCA 4YMGA 4JJ8A 5SY6A 1I10A 5C5CA 2XE6A 5EZ5A 4O0LA 1B6GA 1OA0A 2DT8A 2X3UA 2GTPA 1HFJA 4N49A 3X1KA 3ZEIA 2I1WA 5JAZA 3ZU2A 1F2DA 4HH1A 2N1MA 3WP1B 4MS3B 4RQBA 4DMFA 2ECQA 3HO1A 2YS7A 2RI1A 1M2WA 1KVQA 1OILA 3SHFA 4P5PA 4PC6A 3U3ZA 3VC2A 3RRZA 3DEZA 5DTMA 4BE9A 3Q15C 3TDMA 5I4KA 4GM1A 2Q07A 4ER5A 2DU8A 3OO1A 1W5FA 3EODA 1DB3A 1EUDB 2Q2OA 2YXBA 3MJEA 2AUTA 1DBVO 3LXRA 1R0ZA 5ETJA 4OUDB 3SEAA 3V2GA 5EIHA 3HCBA 1UPAA 2RKOA 4OUKX 4RORA 4C3OB 4K0KB 4ACAA 1F60A 2RJOA 1N3LA 4ZZ3A 2JAHA 2YIDA 3O75A 1XQ6A 4L08A 4UEQA 4OHRA 1UDAA 1IXYA 2FRDC 5EMHA 1AA6A 4W7HA 2XAAA 2BMFA 3EVBA 4MS1B 1L5SA 2FQXA 4IVNA 5AXAA 3UB3A 3JQPA 1J0DA 2EP8A 3ER6A 2M6RA 4J1QA 3AJ9A 1L5OA 3FPHA 2EXXA 2GZDA 1JQKA 1ZDMA 3PX3A 4Q1AA 1X1BA 3SJ7A 3ADOA 1FA9A 4IEIA 2KSQA 3BGOS 4G1EB 1M74A 2B8EA 4WN9B 5JAPA 3SWWA 1ONNA 2ZVJA 2RGCA 3O1HB 4AAYA 5ARCA 1FYEA 1GZSA 1MF7A 5EZYB 3G7UA 2PGIA 3KUKA 3N2GA 4IX9A 4L6IA 1Q1BA 3PXEA 2NLOA 3TR6A 5ALRA 1KI6A 1R0WA 2A1IA 5K8JB 1FSPA 1T6YA 4GICA 4D4HA 4NCNA 3IAAA 1J0XO 2ZG6A 1B73A 2FWRA 5A05A 4BN4A 2WD7A 3B9BA 1BXKA 5FAKA 5BURA 5JFTA 4X65B 3ADBA 3EC2A 4C1NA 4G85A 1SVOA 2WSLA 4FGJA 5JEDA 4PFJA 5EKXA 2ECOA 3QOWA 1CG6A 3KXDA 3HI4A 3NTRA 4RACA 1ZOLA 3ASVA 4V1CB 5HS4A 2MSCB 5JARA 4D1YA 4NXMB 2HLNA 2JD2A 3U4QB 3T52A 1E5TA 3TO5A 3EZNA 2FW1A 4BGUA 1RYDA 2HK6A 3GPLA 3WJ1A 4TKVB 2GF0A 5BVHB 5E7JA 3N58A 3LXUX 4Z0TA 1QZ3A 2G5PA 3A1NA 1P6UA 2QL6A 4QDTA 4CLDA 1V71A 2OORA 2CDRA 3FH0A 5E1BA 4LRYA 3T1OA 5CT9A 1O94C 1MTZA 3QE4A 5L95A 3F0TA 4P4SA 5CNMA 1JE1A 4Q15A 5EY5B 1VB5A 1MX9A 4DIKA 3H65A 3ND5A 3OF2A 3B3FA 4MV6A 1X1TA 3FKSA 2P8SA 3B6EA 3C7AA 4LYHA 3TGWA 3NTOA 1YHYA 1E79A 5BV2P 3PR2B 4U9IS 3FETA 4A6EA 5A7FA 2Q7OE 3F1LA 5EL0A 5FLEX 3OOHA 1U99A 4ZV4A 1FCJA 1LDNA 4LQCA 1N0HA 4GNRA 5ICEA 5EE5B 3G7NA 1UBRS 2WMOB 3MAGA 4M8IA 4NC9A 2P79A 3KR9A 5JUWA 2UYYA 3ROPA 4YJHA 1Z6QA 1ZEJA 2AIRA 4PZEA 4IWYA 3B9PA 3E3MA 5KYXB 2ESRA 3JRWA 4RKWA 3RK1A 4UFOA 4OP1A 3AIMA 4X95A 3WIOA 3KXPA 4FK8A 3DWFA 1ZHHA 1OV4A 2FPWA 3KPJA 4IDQA 9ATCA 4C6TA 5JXIA 1IBCA 4G8BA 1NG9A 4YV2A 3VJKA 2C3MA 2ZBPA 5DH9A 5FL7D 2DR0A 3M6XA 3PWZA 2ZYDA 3ZDXB 2O59A 4YRSA 4QJIA 1J07A 1QCZA 3I6BA 3FFBA 2CLDX 1PR9A 1LLFA 1XDWA 2G8LA 2JFBA 5DU2A 5JJKA 1T4CB 3I1JA 1CJCA 1MA3A 1YBFA 1CW2B 3ZE1B 4YRGA 4O2BF 3KNZA 4ARSA 3S2UA 5K7SA 4RHFA 1XYVA 5KVSA 1CF4A 2EW8A 2H85A 2LIPA 1US8B 3DE4X 4AG6A 3IAM1 3O4JA 4KRYA 4OHYA 1RWVA 2F1RA 1PQ4A 2XQFA 3AB7A 1WCIB 1V2HE 1CR1A 3AETB 4LCJA 4UXJA 1Z28A 2FPUA 3QITA 5AKYA 3ZCVA 2LW7A 4YAOA 2GZHA 4NAHA 4JVSB 4WZAE 3DYBA 4J91A 1Y8QB 1HH4A 2VTVA 2C61A 4FW9A 4M46A 4Y6RA 4YACA 1NU8A 4YRPA 3FBGA 1DADA 3FIJA 3QBDA 3DAFA 1UXOA 2FZKA 3DE5X 2QQ0A 3C8ZA 3HABA 3NBKA 2V0GA 3ZJTA 1II0A 4JB2A 3VOTA 3C1TA 1XEWX 4O0MA 4Q48A 3IGFA 5DT2A 1Y6RA 4BJ3A 4JLBA 2W6PA 1E9FA 2QM3A 1V26A 1E1QA 1Q7BA 2X7JA 4QGFA 3I8XA 3L4JA 4HMQA 4M0DA 4D6YA 2XYHA 3BWCA 4IDOA 4TVSA 5COQA 2G70A 2ZAMA 4ZEXA 1IBSA 2ZCUA 4R0MA 3LQYA 3W9SA 5LP1A 3DTVA 4GLFA 1M67A 1Z4IA 3E2IA 3FXAA 1KTIA 2DY1A 5LNK1 1KJJA 3PHLA 1AZTA 4HD8A 5EMKA 1JT2A 1G8FA 1NKSA 3LBYA 4L8WB 5B6JA 3LUHA 4RLSA 4FE7A 1BFDA 1YOBA 4GSLA 2EL7A 3MCUA 1NFRA 3AB8A 3C6QA 4N3BA 2GRJA 2A92A 1ONPA 5K3FA 4NAVA 2JFZA 3ST7A 3PJRA 4DNPA 3ONVA 2I4NA 2ZVQX 4OQPA 2M98A 2C58A 1CQJB 1SKYE 3C15C 4RYDA 5ALPA 4Q03A 1P9NA 2UUOA 2EG9A 2GN8A 1Q1GA 1P0MA 2IW3A 2ZYWX 4YMUA 3R9XA 2BCJQ 3MFYA 5B58T 4NFSA 3TLCA 1WMDA 1EDOA 4FINA 4BGVA 1H42A 5AXBA 3PV0A 1M6WA 2MWMA 1PG5A 4YT5A 5FX2A 4FEAA 3TE7A 2ZDQA 5FPQA 9ABPA 3T1HB 1AO0A 5TB5A 4F3CA 3GH1A 1U7TA 1K3TA 4K05A 1IK4A 2B94A 4JI6B 4QDOA 2GJ9A 5CDTA 2G28A 1N0UA 5BPFA 1F17A 2WICA 4JFRA 1GZ4A 3SOZA 1D2AA 4P53A 5AD1A 4RY2A 1GU0A 1LB1B 4K9OA 1SHLA 1C8BA 4M6WB 5DCUA 2ONJA 5B4TA 2R6JA 3R5JA 4A0RA 4ETMA 4BCDA 4AJNA 1G6OA 3DZBA 5EHNA 4JOQA 2XDAA 4P80A 4FR2A 1RMQA 3BULA 2OXFA 1LV7A 1AC5A 1VMDA 2PZKA 3F8TA 1PSWA 4LZAA 4EF4A 4F4JA 4RVHA 1DMRA 4TLMB 5HF9A 4LFCB 3DGFC 4GE3A 5I7FA 1NNI1 4KXMA 4BWVA 4RQTA 2OEPA 3GCZA 1LC3A 1XHEA 1XP8A 3B1FA 3UQZA 2XYGA 2F59A 2VSQA 4YT8A 3NJRA 1TM4E 4KMOA 5K0SA 1D4ZA 1JEYB 5F52A 4XIIA 3ZVNA 4DBVO 4AIRA 3G8DA 5E2BA 1P1IA 2IW1A 5F2KA 3UJBA 4IG4A 2D1FA 3GARA 5D1NA 5FO1A 4AY4A 1KKLA 1PJLA 4M9RA 1FXUA 2O7VA 4AJPA 4FJ0A 3ENKA 5I7HA 3C7CB 4E1BA 1WQ4A 4LI3X 4UKDA 3NDRA 3TSWA 2DE0X 1ZMOA 4HFMA 3KOWA 1XZPA 5JQWA 2CNWA 4DLRA 1E94E 1OZFA 4H6WA 5DB4A 4CMAA 2C84A 1KAOA 2JIRA 2W6OA 1Z5PA 3MBIA 3NV7A 3TQFA 3BE8A 1NP3A 4Q3BA 4L9WA 3S0JA 3G2KA 4MRSA 2BZ0A 3P9PA 4OQMA 4WV3A 3TDNA 1K7SN 2IY9A 4C04A 3H11B 4D42A 1G21A 1MEEA 2BKXA 2CE7A 4H31A 2LNDA 3FZNA 1IHXA 1I3NA 2O2XA 2QTNA 4KDCA 4Q1BA 3QPWA 4UUAA 5C80A 1ECJA 1UKCA 1E79D 2JA1A 3AF4A 3I1YA 1DU4A 4PNPA 5KSWB 1FNCA 2VNKA 5DXFA 1PQWA 5GWXA 3ZH9B 1ZVVA 4X45A 1KYWA 4NPHA 3AEQA 1KZHA 4DV7B 2O8EA 1F0KA 1QX4A 1T8RA 2R8YA 3ELDA 3H9EO 4S24A 3DFUA 5DTEA 3UMGA 4LF4B 3ZWXA 3ESXA 1QFZA 3IP1A 4G5SA 1UMBB 2I2DA 3DFMA 4GO1A 4BASA 4O2BA 2YKGA 3R20A 3L6UA 4AC9A 4N5DA 5G4KB 3LX8A 1S8NA 5TF0A 4TQUS 1L5FA 1U0RA 2PL3A 4PRLA 1C9DB 2PS0A 2NXNA 3DL4A 2Z8ZA 4TTPA 4POOA 3RAEC 4RDIA 3L0OA 2PS1A 4Z86A 1NVMB 1P2SA 5HJ5A 3P9ZA 2V6JA 1BRTA 2GA8A 3DXFA 3HY4A 5A5EA 2NT3A 2CNOA 4V0KA 4JYZA 1P9WA 4ZT3A 5LZ2A 2FPMA 1EA5A 1XDBA 3HXLA 5TV2A 1I30A 3KALA 3NX4A 3CPJB 5AKHA 2VRNA 1DFIA 5LDDC 1RYEA 2BKVA 1CB7A 3L6RA 1IXRC 1RHQA 2WJGA 4HDOB 1BXGA 1M34B 4KXYA 4Y9DA 3WWPA 5KDDA 3THXB 4QLAA 5LZ5A 5JS8A 5EJGA 2UUPA 3EFOB 1E3SA 4D74A 2Z1NA 3CR3C 3SQMA 4BVKA 4HUJA 2Q3CA 2BYTA 3C5EA 3GQBA 3MT7A 4N4AA 5K0JA 5IS2A 2C3PA 2WHPA 1NUTA 3PF9A 1A3CA 3IOYA 4TXHA 1YFKA 4V0ME 4ECEA 4ZQGA 4QVIA 2C78A 3L49A 1A5AB 1J33A 1HT1E 1S2OA 2ZJOA 3QF4A 4UATA 1E2NA 5K0GA 1BDJA 1E1QD 3NZEA 1RWOA 5EJ9A 3G0IA 5K9ZA 3HDGA 2XW6A 3EZXA 1DUSA 4RM3A 4QO7A 3D4NA 1GO2A 3QPAA 3IMFA 1A4UA 2G1JA 3DTVD 4GVXA 1P7PA 1PGPA 3A9RA 3HE3A 5BN4A 4LXHA 3VZDA 1P29A 4NZZA 4B87A 2O8BA 1T34A 3KUUA 4PX3A 3C8MA 1PUXA 1P0PA 1GITA 4PPGA 3L6OO 5IM5A 5IEJA 4QYMA 4YAFA 3W5CA 1AA9A 2CVOA 3IBTA 2RH8A 4ZO8A 3RB8A 3WNQA 2H2IA 3N8GA 5CFMA 2BTEA 1XFAA 1PT8A 1UBGA 4MYUA 4DM4A 2BGKA 1K7FB 2WTAA 5HEKA 4BVGA 1RI3A 1MAVA 1XU4A 3WQQA 2P9ZA 3C3JA 3ASUA 2C9ZA 1RCFA 3SQOA 2I6FA 2BPOA 4XPIA 1FDOA 2IUFA 3H16A 2RE8A 4JI8B 3FPFA 4WOJA 3OZCA 1YAJA 3PITA 1WP9A 3O74A 1ORHA 4L4XA 3LUCA 3CRRA 3H04A 3TKLA 1KHTA 2QYHA 3U31A 4LBYA 4KWEA 1I13A 5FJJA 1LRJA 3ULKA 2HL6A 2UKDA 3ZXUB 5FEMA 4RKRA 2J0UB 4NIMA 3QW2A 4RJIA 5AJVB 4E4YA 3QKTA 4MR8B 2QP4A 4OB8A 4OM7A 4PSDA 1OXVA 4PTYA 3RC1A 3W5AA 1NA5A 4ZCTA 2OFWA 1T0PA 2WUGA 3DSRA 3X1WA 3HKCB 3F96A 3SVZA 3HU2A 3LPMA 4OB7A 2PUJA 2I9PA 3K2EA 1N9GB 4UBOA 1GG9A 1LDYA 2CNBA 5I5GA 1MC8A 3QBEA 3RANA 3VOAA 1EVLA 4YDSA 5HE9A 5BUSA 1QTIA 2E37A 4NU0A 3WADA 3OTGA 1I7LA 3Q7TA 1OIXA 3EBPA 2VP6A 3K0AA 2V96A 1BMDA 2O6LA 5GV8A 4B09A 3VAZA 3I01A 5ARBA 3HMKA 2PH3A 4AKSA 3B1XA 1E4YA 3NHYA 1OXSC 5E8RA 1SVNA 4I1YA 3OFNA 2C07A 1XCPA 3RHFA 5J4KA 2JD0A 4GLOA 5F3DA 4S12A 1XZGA 3DUFA 5CCXA 4BC1A 1SCJA 4TZ6A 4ZO7A 2XCRB 3PC8C 5HA5A 2V4ZA 2CW5A 3L4BC 1G8YA 4GDFA 3JVIA 3VX4A 4JI3B 4IMRA 3VNBA 4DQ0A 6YASA 1RXYA 3RTGA 1Q44A 4Q16A 4EG7A 4DR1B 1BGXT 3BXXA 3NH9A 2R11A 1JEAA 3BWXA 4BMCA 3HVHA 5F7ZA 2AKAB 2AN3A 3I28A 3WAJA 4DFDA 2CNWD 1X6VA 3B5IA 3B9QA 3I9NA 4GAEA 1BU5A 4B76A 2VAPA 2FG7C 3V5NA 1R64A 4ZALA 1NNLA 1BEZA 3R7BA 3TPZA 4ESOA 4OMCA 1H2ZA 3I1FA 1ITZA 2A9PA 5JZVA 1X80B 3BJIC 2YH2A 1FW8A 1P45A 3AHCA 4NHEA 2QX7A 4K6OA 3R7WB 3SN6A 3F47A 3TZLA 3VFDA 2J31A 4KNWA 4JJGA 1KAMA 5DN6D 3ACDA 4L7VA 4QU8A 4CEIA 1YDEA 1Y9JA 4DHWA 5JH7B 4NESA 1BGVA 1QVAA 2VWQA 1KO1A 5HR5A 1CQXA 3EOAI 4NBVA 1NQUA 1P2GA 4PXYA 4KYUA 5JTTA 1PBNA 1P7VA 1NJ6A 5FR1A 2O2CA 1XTSA 3U0VA 1JU3A 1K89A 3WYBA 1HDGO 1LLDA 3UWSA 1L7VC 4P36A 4YQYA 1L5GB 2ZCVA 2GGSA 3U80A 4EZBA 1K66A 3STTA 3DB1A 3PXBA 2PGDA 1YNSA 4MICA 4RV4A 3D8NA 4GE0A 4EI8A 3PUKA 3JQAA 2P2DA 1ZXBA 2H2HA 3PNLA 5AJYA 4PYOA 1TRHA 2KJQA 1YJXA 5FNVF 1X7YA 3LQ1A 4PLGA 3ETLA 1XPUA 3ZQ6A 3IT1A 2B3TA 4TTAA 3VSAA 4WJLA 1QIGA 5A0VA 3T61A 1UFKA 5L7WA 1U28C 4M1SA 1QCCA 1HZJA 4P4TA 1O95D 2J30A 1SXJE 4O4IF 3NWJA 2YBEA 5B1YA 3MB5A 3PDIA 1IZZA 4MJXA 2G9ZA 1Z5WA 2Q2NA 5U4QA 3VNAA 2EKLA 4YAKA 2V74B 5B58C 3H1FA 3EVZA 5CR9A 2J9XB 1K6MA 4YAEA 2WWXA 3FZQA 3GIWA 3HA7A 1IZ7A 1QVZA 2HTEA 1UJBA 2ID9A 1NBWB 3OQVA 3QPVA 4LXQA 4MVWA 3L1KA 4X3OA 4D4LA 4UJ3A 4ZARA 5J1SB 4FWIB 1SBYA 4XM2A 5D3MA 5IU6A 1XEAA 4MINA 2RGEA 5DNVA 2W93A 1H4VB 2CNLA 2QT1A 1YA8A 4Z2YA 2O2EA 3GFRA 4KFTA 2JK1A 3NEJA 1FMCA 1YI1A 2HPHA 4GOOD 4JJ6A 1S1MA 2I1LA 3VPSA 5JJBA 2P9BA 1UT6A 721PA 4Z99A 1CR0A 2Q6IA 1G16A 3BIFA 1TO2E 4V38A 4CL8A 1WABA 3GAAA 4P86A 2AZXA 2YMLA 1K9VF 3DDSA 1YAHA 2HOQA 3DFIA 3IMGA 1ESDA 3GRZA 1PL8A 4FGZA 1WCV1 3ORYA 5IVDA 3DO5A 5MN6A 4H27A 2ZJAA 3EF3A 2IIVA 2Q50A 4MPPA 1R6XA 2ONKA 3DO8A 3JASB 5TPZA 1F9AA 3QGMA 2AXPA 4TZ0A 4PCUA 2FLVA 3ZZ1A 1AKMA 2W6IA 1M1XB 4MTCA 1HI9A 4J0GA 4GYKA 2B1IA 7MHTA 3D8SA 5CX1A 1IY0A 1PWHA 5C37A 3EXG1 1OLUB 2EP7A 4K9DA 1R74A 4MGEA 3T7TA 2X1LA 1DBPA 1RYHA 2XTAA 4BUCA 4RF3A 3ZDYB 5C35A 4HYEA 2QK4A 3CY6A 5A3VA 3IVGA 3WXBA 4UBMA 5G2OA 5AKIA 1LBSA 3SXPA 5HG0A 3K09C 3KLMX 5LXTB 3PHHA 1SUFA 4JITA 1VYHA 2ZI5A 1SOUA 5HM8A 2WWGA 4CM7A 3CZRA 4UPVA 5KQPA 4AXBA 1OWNA 1II8B 1JAIA 1R0BA 1L5HB 3A3PA 2DUWA 5F2OA 2M1XA 6REQB 1P1CA 2RDMA 3S27A 3FPEA 4YQEA 4C6SA 4HDSB 5DDIP 5DYWA 2WUFA 4KRFA 1FP4A 4DBZA 5KWEA 1X0XA 2FSUA 1H05A 3UH0A 3JTMA 1U5BA 2NUBA 3ROMA 1A82A 5JZMA 3M6VA 1Z0IA 4EEKA 2AFHA 3DMGA 4A8JB 3AI3A 2CDBA 3G2LA 4KLNA 1JTFA 1QYXA 3EASA 3EDQA 3VYUB 1NVWQ 3ENWA 3GO4A 1T2VA 1W75A 4IGIA 1L7EA 2V5VA 3N5CA 2IZ6A 5FV7A 5FTMA 5TEWA 1DSSG 2E4ZA 3Q98A 5ERXA 4TSKA 4QOIA 3HN6A 2C7PA 1ZMBA 1KQOA 1T6XA 1I0ZA 1DBWA 1IMOA 1MIHA 1DIGA 2HCJB 421PA 5HNKA 1SHUX 1T9ZA 1G17A 2I1QA 3IVAA 3BIXA 4G67A 1V11A 3MXOA 4KQMA 4YLGA 2OCDA 3SR3A 4DDHA 1XZQA 2EW2A 3OFND 2FZEA 1VIYA 2VQSA 1KYZA 5CTJA 5EXDA 3COJA 1O94D 3R6DA 4QDUA 4YRNA 4CLHA 5C9ZA 2HQ1A 1HPLA 2XXJA 3I9JA 3KDPA 2FPSA 4JUIA 3EK2A 1QAMA 2PH1A 5B3AA 1Y4SA 4DF3A 2ON6A 2XZOA 4LZLA 3W04A 4ZJZA 2HK9A 2COKA 5EJMA 2OM6A 4OPMA 1REQA 3OQIA 1X1RA 1F7UA 2PIAA 4EITA 1BS2A 1E62A 3LU1A 2IV3A 5LQAA 4FWBA 2FXIA 3JZIA 3SM3A 4QGBA 3OC0A 3TJZA 1C29B 5T7BA 1U11A 4OQQA 1JYEA 1JKXA 2VHXA 1M5UA 1SXHA 4LOJA 4TN5A 3JRNA 2VBCA 2FFRA 4JP8A 3VH1A 1LA2A 5FNVA 3HXQA 3ZV4A 1AG9A 2MINA 3PCRB 4BGEA 1JQ5A 3LWNA 1E2EA 1HL7A 3HY3A 1A2QA 1WF3A 1ZGBA 3BXOA 3L43A 3OI7A 1KU0A 2ISSD 4I6GA 2H4HA 1YZLA 4RAOA 5ECGC 5EXSA 5G4LA 3BFPA 4AN4A 2PFGA 1GQYA 1T4BA 4KE7A 4NMXB 3EIXA 1GDTA 1ND6A 2IYXA 1WA5A 4AKGA 1DRKA 1ZNYA 2N0SA 4IXTA 5CXUA 5HIAA 2AOXA 2M9MA 1ILEA 4P0PB 4O4IA 2PKQP 1WZNA 1SB8A 1EHIA 2FAXA 3L82B 2CGEA 2D5IA 3OQPA 3TIGA 1E7YA 2W6QA 3VC1A 3LC2O 1YDMA 3QY9A 1VZ3A 3JQAD 2FN9A 4E5KA 3ESRA 3GXOA 3Q12A 3TD6A 1KI6B 3UM9A 2EKQA 3KJNA 4HL6A 1EXVA 1RPTA 3LHDA 3OLCX 2WOJA 2GA9A 1M8JA 4KOEC 1CYEA 4FVTA 1Z12A 3CPSA 4OU4A 1GSAA 2QV0A 1D9XA 1SKUA 3EISA 3RK0A 3ZJ5A 1CY7A 1USWA 1Q95A 2ODBA 3OEWA 3T34A 1BWSA 3DULA 5CA0F 5IUJC 2PLRA 4J7CA 2ZS8A 1PWZA 2JAQA 2YWJA 3MXTA 2GPTA 2XMBA 3B12A 4OL0A 4AN0A 4B6QA 2BKUA 3PNVA 1A0OA 4MRNA 2SBTA 1PGOA 1WDLA 1DX6A 2XDQA 1Q57A 1TVCA 1V4NA 3IXLA 1NLMA 2Q29A 2RHCA 4I9NA 4WNAB 2RHHA 4Z9YA 8ATCA 1YTUA 4HQOA 3RR2A 1SM4A 1A4XA 1OE0A 4D9JA 2HX1A 4FDMA 5GQSA 3WE7A 1PLJA 4P4SB 4LVCA 4DLBA 3BMCA 5HCUA 2P9JA 1QLHA 1XVLA 3H84A 1DTWA 3QFTA 5F51A 3SQLA 1ZMTA 521PA 4DT1A 2WTUA 1V5EA 2VHQA 3W5HA 5TE9A 4ZGBA 3JQBC 4ESVA 1SC4A 1L4HA 1GZDA 2ORYA 4AJ9A 3F5FA 1Y6FA 4M88A 2ZI4A 4JYCA 2VHEA 3ZG6A 1YI8A 2HWKA 3F74A 3VR4H 3UA3A 2IHKA 4CG1A 3GG2A 4DL9A 4F93B 1KIAA 3TZ6A 4Y1EA 3HYLA 4JBLA 3EX7C 1J9EA 1QC5A 1JHOA 1A9TA 4WFJA 4NNPA 1RLMA 1X2EA 2J33A 1AHHA 2O05A 4MUYA 2IYUA 4S1NA 3VKWA 2F9MA 4BNZA 3NHKA 5TPZD 2XBLA 3B5EA 4KWTA 5IDYA 2O5CA 3GZNA 3N2ZB 2Y0PA 1SG6A 4OEHA 2W6ID 5IJ9A 2YHBA 1DCKA 2VJMA 2DWOA 1KH2A 1BW9A 2B8TA 1ZH6A 1O03A 5J2TF 5J2UF 3T4UA 1LPMA 4LQ4A 2IC5A 2LKCA 3OMWA 2WWHA 3A6GA 1BQEA 5T3YA 4M0UA 1ES9A 1KPGA 5E9WA 1CDOA 2FZ4A 4LGYA 4MDHA 3PENA 3A4NA 2IV2X 3NBAA 1C1HA 2BEKA 3QF7A 1OIVA 2W71A 1ZIDA 4NDAA 5D5PA 5TMEA 4OI1A 1K7EB 1TLLA 1DKOA 1GCOA 1XTPA 4YHBA 3DMPA 1I3LA 2JCGA 3BK2A 1J2UA 4FHEA 2A0WA 3ZYCA 3DYVA 4RIIA 3O7MA 2PBLA 3SHTA 2QQFA 4DV4B 3EY4A 1TUGA 3G88A 3Q5GA 1FFSA 3RW9A 5K99A 2HBYA 2PZJA 4PO9A 4TWJA 2R60A 2ZSUA 1OA1A 5EJFA 3S2ZA 2J87A 8LDHA 1JFRA 3FBTA 1YDHA 1FFBA 4RA9A 4LCBA 3KYJB 2ZYIA 2GEKA 3L7BA 5FAXA 2YC4C 4WOPA 1PVVA 2L0XA 1E32A 3LQ4A 4FZ5A 2R5WA 4GNKA 3UHFA 2ZK7A 3IOCA 1DCFA 4V03A 3WGUA 3DTVB 3ME5A 3M89A 5C51B 2J0QA 4NEHB 5IC4A 1C9NA 2DRIA 3F49S 4MO9A 4PQGA 1MV8A 4DJ5X 4OLBA 5FI5A 2IE8A 1PW7A 1GAXA 1NVAA 2BV3A 2HIAA 3HXKA 4WXEA 2R8EA 3EF0A 2V3CC 4AJ4A 1ZRSA 4CM3A 3EC1A 3Q0IA 3RV3A 2IUTA 3TLKA 1TEXA 2H4JA 2OGSA 4G25A 5MN5A 5DM70 2XT6A 3TW8B 2JKVA 3OU2A 3E35A 3FHLA 3HR8A 3E61A 5SY9A 5JZ9A 3WRXC 2B6NA 4N3CA 2A5FA 3PS9A 3TIIA 3NT5A 1DO0A 3U62A 4UUQA 1B6RA 3RVDA 1UC5B 2FRVA 3MRSA 3SXJA 2CLHB 2NUPA 4TWBA 5DZSA 5FPYA 4L5BA 5DGDA 1K8YB 3DXZA 1XT6A 4KQ1A 1TJ3A 1ULZA 4G97A 3NIDB 3HWWA 1RZ3A 4IXMA 2XWQA 3FMFA 5DLYA 1FFEA 3MN1A 4NTZA 4MKXA 2IZ1A 2YHAA 2OKGA 3MLEA 1HTBA 2ZYTX 4MPDA 3W0LB 3ZU6A 2NPFA 3NT2A 3DXXA 1NFFA 3TTSA 1N5MA 2JAUA 1H1DA 3JARB 3VAYA 5EJ6A 3L7IA 5ICMA 3GLIA 2JCYA 3KOMA 2UYCA 2WT8A 1Q0SA 1ZM4A 3HYRA 3ETJA 5CA0A 1E1DA 1EIZA 3PDJA 2IH5A 2QX4A 4IOJA 4RY9A 3W05A 4X71A 1RM0A 2UXBB 2ZJ5A 2R6FA 4IS3A 3A06A 3UUGA 4A6DA 4BVEA 1GTRA 3NNDA 4NFLA 5CXQA 2RHJA 2UUBB 1BCRA 4U6SA 1XYGA 3AVPA 1UK9A 1ZESA 2P0AA 1AXGA 2L18A 5IZ4A 2WSMA 4KQHA 3K6JA 4B85A 1A2BA 1MC4A 5L4SA 2FR8C 1ZN7A 2FP4A 3BIOA 3OO0A 5CGQB 4AUKA 4LXXA 3RK4A 3ZJVA 3NUGA 4WLOA 3DT6A 3OESA 2HU7A 3AFIA 2J5BA 5LOVF 1M0TA 4DPKA 3S8YA 2WWYA 2MU1A 2BGNA 1NQWA 1SCDA 1WSAA 4X54A 3KYDA 4WN3A 5DNAA 3VPHA 4BLQA 2W43A 3ZI7A 2ZXFA 1RWKA 5M2QA 5L6LB 1HC7A 1MXFA 4UDNA 4TKZA 1EG2A 1ZW6A 1N5KA 4NZ9A 3Q8LA 1J2RA 3ELWA 1IY9A 4B6RA 4FHFA 1QGDA 2XRYA 5G0SA 1S9DA 4UTNA 5L3VA 4OXXA 4CE6A 2PRYA 3G5TA 3C7DB 4HMPA 2QVZX 1RRVA 2ZGVA 3SY8A 3O8NA 1KI9A 1KO4A 1G7CA 3EQ9A 5EZSA 3WLSA 3TXXA 5E6SA 5J2TA 2AK3A 3JYLA 5J2UA 5F9FA 2WLTA 3H5AA 1XF9A 1P0CA 3HLYA 4DLUA 4Y9UA 3AZPA 1JJBA 5KNBA 4PC7A 3KSDO 3C97A 5L51A 1QHFA 3W6UA 1C9KA 1TW2A 2J3LA 1PTJA 5FUMA 4HS9A 4LRQA 2VHJA 3BHJA 3KPWA 4KHZA 2O8EB 1V5IA 4YRMA 1Y34E 1E7MA 5BOSA 2ZB7A 4QUJA 3NDPA 1RRPA 1YR3A 3SLRA 3AEUB 4LG1A 4NR0A 1DI0A 4O2BB 4JLJA 2NV6A 4FYHA 2D1YA 3G23A 1KYYA 3B7WA 3A4LA 3D6FA 3D3JA 3VPBA 4G4IA 4HNHA 2AN1A 2J46A 2FQ1A 1JIKA 1X42A 4QULA 1WY5A 1RLJA 1KE1A 4GMKA 2HYIC 3OPYA 1QS0B 4PLTA 2BGGA 3MCWA 3MRXA 3HS3A 4RD0A 1V1RA 1FVFA 3IIIA 3KT0A 3RS9A 4RTNA 2O54A 3P4YA 3K9HA 2YXDA 4HNQA 2VJQA 1NI5A 1OFUA 3H5RA 4JXKA 3DZ8A 4JBYA 1G21E 4U7PB 5GJCA 1VL0A 1Q7EA 3ZE6A 3G2MA 2CFIA 2QNBA 3EJ6A 2RAUA 5BYKA 1PQUA 2HEIA 3OOYA 5H9VA 2O8NA 2DGDA 2PX5A 3G2IA 4PHTA 3UXEA 2J5RA 3U09A 4RGVA 3UJNA 4R7ZA 1TC1A 2MYUA 5DSTA 3WI7A 2IYYA 3NASA 1JB9A 2YW9A 2ZIWB 2QI9F 2C8JA 2CEAA 3WL7A 3SOPA 4B4KA 5KTRA 1ECPA 3QLUA 3VTKA 5F35A 3TOVA 2ABWA 1C3LA 3NGMA 3M3PA 2UDPA 2HJHA 1E1MA 1V47A 3TLEA 3Q40A 3N05A 5AK4A 3VR6H 5JFOA 4P8RA 3I72A 1L7RA 5AIBA 3CVVA 2Q5LA 1FQJA 4X92A 3VPCA 1XZAA 2ZB2A 5TLSA 3TQIA 2A5DA 2YWEA 3IMCA 1K8QA 3IQFA 4S35A 3CVXA 1OH7A 1KEUA 4LBVA 4HX9A 1G59A 4L8LA 2VSXA 5BV7A 5M34A 3PEYA 2DECA 3PC7A 2GQ0A 2ZFUA 3QYAA 3OTHA 1C3OA 2IU0A 2KW5A 2DG2A 1JWLA 4JI7B 3DYIA 4ZYZA 5BN4B 5JS7A 1BD4A 1A9ZA 3L41A 4F4DA 2IUUA 3SMQA 1QRSA 2ZS7A 3HZRA 3KQNA 1T1EA 4QXOA 3RVKA 5EXEA 1ND5A 2XQGA 1YSCA 3FE2A 1E3WA 3K3PA 4CL0A 4ENTA 3O9ZA 3U1BA 1BJRE 3S2EA 2PMFA 4GR5A 5CHEA 2GN6A 1TYEB 4P08A 3SSOA 1DT3A 4NONA 2MYPA 3PCTA 2EKDA 1NF2A 5AM4A 2XD4A 3H05A 4IJWA 3QLJA 1DXHA 4KQWA 4YUAA 3FF1A 5M04A 1HEUA 4ND4A 5FV4A 4TLDA 4GF5A 1AIPA 4M0FA 4BV9A 4EWLA 1UUFA 4FYPA 3L9XA 4WCDA 1N36B 3BEOA 3DQQA 2HNBA 1YCHA 2ATXA 5FQOA 2C5SA 3F4LA 3SP1A 4J0KA 3T12A 2ZSJA 3LLCA 3VKHA 4LC0A 1TPYA 4M8SA 2X58A 1TCVA 3FLAA 3DM9B 3EIEA 1FZTA 4F72A 4PSKA 2ZIFA 5BW4A 2BM0A 3KAQA 3LVRE 1RAAA 1COWA 2Q9CA 4DCPA 5KYGA 3UBMA 4ZU3A 2VCYA 2NU7A 3VH3A 3LCCA 3OUUA 3VRHA 3WSTA 1IJKA 1P9LA 4FZ3A 1XLUA 4GPTA 3MCAA 3HWRA 3DE7X 3C5HA 3P9XA 4M1YA 2V7WA 1PZNA 3C3AA 5LOVA 3DDUA 1G5RA 2ZSIA 1KXJA 1W1UA 3VNVA 1JSCA 3EEIA 5I7UA 2CSXA 3A4YA 1GL7A 4RMJA 1R88A 1XMIA 3JYOA 2IK8A 1VB3A 3DBRA 3OZEA 2YNMC 3AEKA 2WNHA 1DKRA 1UBMS 4RVNA 4ZDWA 4E5SA 1ABBA 1KFCB 1OLXB 3MJCA 1E6LA 4NOMA 3WDSA 4I5IA 4JLAA 4EY4A 5JTUA 1JECA 3O2SB 4JEIA 4ZI3A 4A73A 1RAEA 1XDDA 2WD8A 3IXMA 3M1LA 3PIRA 1L1RA 3CFYA 3TYXA 4KPUB 4J0CA 3V2IA 4N8DA 4D5EA 1ORTA 4H3SA 4LRTB 3I32A 4QFCA 3SC2A 1BOFA 3T7KA 1KFBB 3KQVA 3GP3A 4FFMA 3WWCA 3EGDA 3W3AA 3G0HA 3O8CA 3GRVA 3Q87B 4Y8VA 3V48A 1KSJA 2EAUA 5DP2A 1ESNA 3AWIA 5C34B 1VRVA 1RJWA 3W6PA 5GOZA 1OU0A 1UQTA 3GW8A 4N47A 5IXJA 4OYLA 3BH6A 4JVOA 1P5JA 5HHTA 3HYTA 1Z38A 3VJLA 4C4YA 2EQ5A 3HBLA 5H3CA 4OAPA 3QI2A 2B83A 2GVZC 3ABRB 4KIUA 3SDZA 2VBIA 4I8IA 5J5AA 2FMKA 3SHOA 4KREA 2IOYA 4UU1A 3KXIA 2R65A 2VK8A 4DYDA 5G40A 2YDXA 1H3FA 4RV9A 3PA8A 1G4HA 3QNWA 4F12A 3PQ8A 1YS6A 3LQRA 1YQUA 2G80A 2OHVA 3L84A 4HH3C 5KHAA 5T4EA 4L7QA 4NJMA 2CZQA 5KNBD 3ZBTA 2R4QA 4EGSA 1LWOA 2YHSA 3RJ9A 1T8WA 4ZXFA 1WXHA 4TRMA 3TAUA 2CL7X 5HKKA 5K6AA 1XPOA 1DG3A 3UFXA 2O2HA 2W8BB 3ABZA 1PVOA 2W42A 2Q6VA 5FBZA 2X3FA 1KC1A 1PFWA 1IUKA 3QYPA 3V8MA 5K01A 4QXPA 3COZA 4DV2B 2QORA 1U3TA 1X7YB 2CXSA 2JFQA 5GIPE 4D9NA 2H52A 1NYQA 2I78A 1SOMA 4DR5B 4M3NA 1D2HA 3PNQA 2X4DA 1H2HA 2DXIA 2ZIUB 4J0DA 3OP4A 1JU4A 1Z83A 2VP0A 1HE2A 2KS6A 1MC5A 2WRZA 4P3OA 3U3DA 4B4VA 2HZ7A 3A8TA 4H35A 1CZKA 4UCFA 2WSBA 4CL2A 4R5HA 4AWXA 3KDAA 1M54A 4BJHB 3D4IA 3NNSA 3RHTA 3WB9A 3F3MA 5BNFA 3I83A 4GBGA 1FTYA 2REQA 3D0OA 4GX0A 2ZR9A 4LNUA 2D0PB 1ZICA 2YZKA 2FPOA 3RABA 3USES 3N28A 1USKA 4MVYA 2BFDB 1OU4A 5L45A 4FNGA 5D3MB 2W6CX 2UZ3A 4E12A 2F3QA 3ZZTA 1V4VA 3GD7A 4KIGA 4IOMA 3C6ZA 3ND9A 3KWFA 4W5NA 2JAPA 2OBXA 2XT0A 3HACA 4I4IA 4ZOQI 2UYGA 3OPYI 4N12A 2ERYA 4LNHA 4WVFA 1J23A 3SHQA 4HCJA 3BIWA 4YYEA 3DBOB 4R1NA 2BRUA 2R3SA 1KRXA 1QDEA 2R8BA 1N1EA 3BTVA 4CZ2A 2ORIA 2OCLA 3F3KA 2JCXA 5DGIA 4OFBA 4JR2A 3GU3A 4ADSG 2R8ZA 4OA8A 3O9VA 1RQ7A 1X94A 5CBPA 5E38A 1JU9A 1EEHA 3AT1A 4EH1A 4F4HA 1MA0A 4L57A 1TADA 3DOEA 3LUJA 4XDHA 1VHWA 3N8DA 1KJYA 1ZH2A 1O6ZA 5EWMA 1R9MA 1MOQA 3AUSA 1FX1A 1SVLA 1T1RA 1FQWA 3CF4G 3HB9A 4ZGWA 1AMUA 4TWRA 2OBBA 1ADFA 2ZI7A 4A0SA 3Q8WA 3UK7A 2JI4A 3NRJA 4D99A 2XMGA 1RXUA 3K1TA 3G9TA 3PXXA 5E2AA 3U40A 3ZDEA 5BUQA 3TTVA 2BIFA 1XTQA 1K7XB 1A9SA 1TYZA 4JL5A 1TKRA 5ALYA 5EAIA 2NM0A 1R6UA 5FWYB 3G6WA 1JEEA 2FEWB 4NCXA 4U5QA 4M86A 4MI3A 1JPNA 4X91A 3IJRA 4MW1A 1L6RA 2IP1A 3JVDA 4GEGA 4JKIA 3DJFA 3CR8A 3R3JA 5JW6A 1LDBA 2RC6A 4PQEA 4PTZA 2RFLA 4LFAB 2CYBA 1N5JA 3TPCA 2W4QA 3WGGA 1FP4B 1SG9A 1TCBA 1FMFA 1Y6ZA 1E5QA 5K6RA 3WLTA 2PNJA 4ENWA 3RUFA 1GVHA 2P0YA 2BUCA 1GZ6A 1U5BB 4D81A 1M5TA 2VK2A 2VA9A 4Q3LA 1O4VA 2PMBA 5GADl 3LHKA 1YQ9A 1KZGB 3GDGA 3WQBA 3KHTA 5JXWA 3MVEA 5B3JA 4YPFA 5KNCA 1CUVA 1NC1A 1G4UR 4BX9A 4K81B 4E7OA 3QVSA 2W2PA 2X2EA 2YYSA 4G1MB 1YZNA 4IDEA 4R8MA 3VDRA 1JWAB 1MAHA 2W6NA 2X4GA 4MJ7A 4JZYA 4UVGA 1N33B 2JLUA 4MDEA 2FDRA 3DZHA 4NZPA 5COBA 1V11B 4C5CA 1E6MA 2A35A 1I36A 3QUSA 4KDRA 2FSVA 4PZDA 2FFBA 5ANRB 5GMOA 3SSNA 5KTYA 1JQAA 3E5RA 3TD2A 1MOPA 5SICE 3CCBA 2FKAA 2P1RA 2XMRA 2XMPA 5D5HA 3WB0A 3DBHA 3OM8A 4Y67A 3LCRA 3ISJA 5P21A 3GLHE 3U3KA 1TXGA 5AOVA 1HMPA 1JRLA 2E87A 4JVLA 2PSEA 3CUVA 2C77A 1K3UB 2GHTA 1PJRA 1REQB 2VNHA 3M9LA 1YU9A 3ON5A 3DLAA 3AR5A 3MBOA 3W3AD 4HWOA 3TLJA 1LS1A 3QMMA 3IKTA 4FHZA 1FNSA 1CJTC 3MMSA 3T9BA 4GXNA 3NANA 2XOKA 3D7SA 2PKWA 4CUZA 2HA2A 2AFHE 1W35A 2XCOA 3FDIA 5COAA 2J9RA 4UPEA 5HW0A 2IBSA 1WB5A 1FB5A 4OYRA 4MV7A 3E9EA 3GCDA 2YVUA 3IV6A 4NYJQ 3IP6A 3TTUA 3UCFA 1I3CA 4LJYA 2I7DA 2LGJA 1XTIA 3KJEA 5KKCA 1FYVA 1IONA 3F1KA