4WINA

Crystal structure of the gatase domain from plasmodium falciparum gmp synthetase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
228
structure length
228
Chain Sequence
YDKILVLNFGSQYFHLIVKRLNNIKIFSETKDYGVELKDIKDMNIKGVILSGGPYSVTEAGSPHLKKEVFEYFLEKKIPIFGICYGMQEIAVQMNGEVKKSKTSEYGCTDVNILRNDNINNITYCRNFGDSSSAMDLYSNYKLMNETCCLFENIKSDITTVWMNHNDEVTKIPENFYLVSSSENCLICSIYNKEYNIYGVQYHPEVYESLDGELMFYNFAYNICKCKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site coupling in Plasmodium falciparum GMP synthetase is triggered by domain rotation.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords GMP synthetase
total genus 72
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2014-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4winA00
2W7TA 1I7QB 1PV2A 2FEXA 3NONA 5E9AA 1KA9H 3MIIA 3R75A 3TQIA 3L18A 3CZAA 4P34A 3SF8A 1U9CA 2H2WA 5BV2P 1P80A 4AUEA 3OT1B 4MNTA 3L7NA 3SOZA 3PQ5A 3PQ3A 1OX4A 2VPIA 4MGHA 4MTCA 2VXOA 4AULA 3NOQA 1VCOA 3PQ2A 3CYFA 3PQ4A 4N12A 3ZJ5A 3B38A 2ISSD 3P9PA 1R9GA 1OX6A 4WXYB 1IZYA 2ZUSA 3TTXA 1C30B 1SOAA 3ER6A 3PQ7A 3TTUA 1QWSA 4RKWA 4L78A 4ZDKA 5JZMA 4ENQA 3WFZA 2ZUUA 1T3TA 1KEEB 4OQ4A 1JDBC 2YWBA 2V4UA 4RKYA 5SYAA 3TTWA 3UOWA 2YWDA 1Q2UA 2R1UA 4N0MA 4OIFA 3P9SA 4D1YA 1KWKA 1A9XB 4ZDJA 4LGYA 5SY4A 2GK3A 3FSEA 4UNIA 1N57A 4AUMA 4ENRA 4GUDA 2AD5A 4P35A 2VDJA 3R74A 3NORA 3SF8B 4I46A 1J42A 1T0BA 1VCMA 2ZUWA 2LXNA 2IUFA 1O1YA 2VKTA 3EFEA 3L3BA 3N7TA 4I2NA 1IPHA 3ZJ4A 5K4AA 4AUNA 1QF7A 1KXJA 3BHNA 1SY7A 3ZR4B 1QVWA 4ENVA 3R76A 3M3PA 4GE0A 2RK4A 4S0ZA 3B3AA 3NVAA 1OX4B 2GHRA 1GGFA 1CS0B 4R7GA 1JVNA 4OGGA 4P36A 1WL8A 3CY6A 2D7JA 1BXRB 2RK6A 1L9XA 3NOOA 4B5KA 1CE8B 4K2HA 4Y1RA 1ONSA 1GGHA 4ENTA 2OR3A 4JQSA 4L7QA 5JZOA 2R1TA 4P5PA 4ENUA 4OJYA 3CNEA 3VU3A 1FYEA 4HCJA 4Y1GA 5SY6A 1OY1A 4ENSA 5LIRA 1IZZA 1K9VF 4ADSG 4B2YA 4LRUA 3BWEA 4UOZA 3UJNA 4B31A 1M6VB 4Y1EA 3TTYA 4ZDIA 2NV0A 3D54D 3EN0A 3UMMA 1GGKA 1FY2A 1G2IA 4AJ9A 1QDLB 3CZ9A 1S1MA 4L8WB 1C3OB 2A9VA 3L4EA 1QVVA 4Y0NA 1UCFA 5DFAA 3GRAA 2NV2B 2VRNA 2ZUVA 1P7YA 4I4NA 4ENWA 1Q7RA 3B36A 1PDWA 4UOQA 4Y1FA 1P81A 2YWJA 4GE3A 4P2GA 3TTVA 4B7AA 4BIMA 4XLLA 1CF9A 4ZGGA 4E5VA 2AB0A 4PXYA 4ENPA 3F5DA 3EWNA 2ABWA 3MGKA 2R1VB 5IP5A 2WJZB 5SY9A 4L8FA 1VCNA 2R1TB 1OI4A 1T36B 4QYTA 4E08A 1I7SB 1P7ZA 3UGJA 4BFLA 1KWGA 1GGJA 1GG9A 4OGFA 3P9RA 3P9QA 1GPWB 4UCFA 2ZUTA 1P5FA 3TTSA 1VHQA 3EZGA 2R1VA 3NOVA 1GGEA 3UK7A 1I1QB 3PQ8A 2YWCA 3TTTA 3RHTA 4L95C 1GPMA 3F71A 4OFWA 4UZSA 2XF2A 1OX5A 3FIJA 3OT1A 4L8YA 3PQ6A 4BTEA 4B40A 1QVZA 3EJ6A 4QYXA 3KKLA 4WINA 2RK3A 1PDVA 4Y1RB 1PE0A
chains in the Genus database with same CATH superfamily
1YZNA 2BHNA 3HK2A 4D4GA 1KA9H 2CFTA 1TT5B 2VA8A 3E81A 1TQ4A 2XQKA 2JVIA 3LHSA 4WNCA 4Y2YA 4C7JA 3DPIA 1SCJA 1ZN9A 4GWKA 5CB6A 2NUAB 5B4UA 1NBWB 1KYTA 4KI0A 3CNBA 4NYJR 5TF4A 4OHZA 2WTBA 5JSZB 1L7VC 1WNTA 3RS9A 1H4SA 1CJSA 2CF6A 2VS1A 2Q4EA 5CHEA 4IIJF 1A76A 1E0JA 2Q1UA 3KR2A 4RHEA 4XDHA 4BO7A 5AVUA 1IY2A 2GN4A 2G9NA 2BMEA 3QPWA 4DIMA 4N6GA 2D6FA 5E6UB 2V3VA 3HUDA 4HDSA 2JHGA 4Q4CA 1P0CA 1KXZA 4BJHB 1RQNA 1WMFA 4MITA 1OILA 1TPYA 1XMJA 1YI8A 1NBEA 4TSFA 1GA6A 3WGMA 5I7WA 3TDNA 1LS1A 2FWAA 3WHKA 1ZSVA 1GY8A 4HDMB 4DMHA 3ABSB 1BE1A 2YBEA 3B1JA 5K0JA 1XALA 4L2IB 2W2VA 1LH0A 2IYOA 4CFYA 4EATA 1VHDA 2FW1A 2H18A 1GYQA 4V39A 4IR7A 3ESRA 2XRYA 3FZNA 2J3HA 3G1WA 4CLOB 1EIWA 2ZYAA 1CZUA 2VHVA 2H7YA 3CG4A 5AUNB 2A7QA 3U13A 4D2IA 3UWKA 2CL7X 1RAAA 1TYCA 1YFKA 5EIWA 2QZ4A 3QJYA 1UDRA 2SCUA 1SBCA 2E82A 2IUTA 2C5BA 2OZLA 3BL6A 4NBKA 4YCAA 5CDFA 1SWVA 1V3TA 2O9JA 3BULA 2D1TA 3L8YA 3NHWA 4RH1A 3ZTTA 1ETHA 1KK2A 5GONA 1YTUA 4YAGA 2W22A 1C8VB 4JP8A 1W19A 3EF0A 1M7BA 2V6IA 2PKQP 3QU9A 2VEOA 3QW2A 2JLYA 3QMWA 5KNLA 1K5PA 1I4LD 4XSHA 5K3CA 3VOSA 3OJ0A 5A5DA 3AF3A 3DG9A 1VLZA 4JJIA 1TU0A 1K9VF 1UK6A 1RC0A 2MSNA 4KRYA 4WASA 4XE5A 4F56A 5JY1A 4WL0A 2Q5EA 3G8CA 1QE3A 3R3ZA 2J45A 4Q3DA 2Z57A 4DV3B 1T24A 2EFDB 2R8EA 2CJWB 2XRZA 5LP1A 1MV5A 4B8WA 1DG9A 1PEDA 2D2FA 2JDID 1X1BA 2VL7A 2Y3IA 2YUIA 2ZBPA 3S1SA 3NTRA 3KUKA 3B2NA 1Q1GA 1APBA 4OFZA 1YSCA 4NHOA 2YXPX 4EPTA 3O8LA 5BN4B 1JLKA 1L0BA 3HVJA 3MWGA 3ZOZA 3WLAA 5K8LA 2OAQ1 3RJ9A 4P0QB 2P6NA 3H1AA 3P26A 3VKUA 1W76A 4CDNA 5ALQA 1JR3A 3WAJA 1UDBA 1T25A 3FETA 4BGEA 4UJ5A 4DCPA 4RXMA 3G2HA 5FHQA 3RFVA 1N6OA 1TCUA 4N9QA 1H2FA 3LBNA 4JJAA 1ZD8A 4A0FA 2VH1A 5ILOA 4PU0A 5AQ1A 2Z9BA 1ZVVA 5BRNA 4DLWA 4NJEB 2A1TS 4R1TA 3W8DA 5KWSA 4O4HB 4ETNA 3E5HA 5EA2A 2QENA 4QBGB 4R54A 1PR6A 2W4IA 4WCVA 1PL7A 1ZVQA 3DW1X 3KFXA 4K9DA 4WOKA 1RQXA 4O2BF 5EESA 3BE8A 3A6GA 4BWYA 4QYXA 2HQRA 3NB0A 3FSJX 3OZSA 1T4MA 1F2UA 3BIWA 2D0PB 3O74A 2H1LA 3WE7A 4LVCA 5K3DA 3WOVA 3GG9A 1T8RA 3OUZA 3RDPA 1J0BA 1P80A 2WWWA 4OXRA 1E3QA 5C31A 1DV2A 1AZWA 2BMFA 3DF9A 4MNTA 4JI6B 1B3BA 4PLFA 3CT6A 3K1YA 1S3FA 3QKTA 4LWZA 5AKJA 1CRPA 1BE8A 3INTA 1R5JA 2J07A 3CE9A 3OQHA 4XDYA 1T5BA 4LG1A 2BEVB 3B38A 3WHIA 4GBMA 1EFKA 1LF0A 5JANA 2WIJA 2WWGA 2O05A 3K94A 1M34E 2VH5R 4OUDB 3UTCA 5FCDA 4ZICA 3VAZA 4QOSA 1NVTA 3HWWA 2P30A 5DMXA 5JHGB 4LY9A 2M6SA 2R7KA 4C4SA 4CKWA 5IKPA 3LLCA 3ACCA 3JQ8B 2PVPA 1ZX1A 3M82A 5DO9A 1K4MA 3KEQA 3CUKA 4FDMA 1XTSA 4PGAA 4CM3A 3QV1A 4W9MC 2EVWX 4JJ4A 3UK6A 2J0QA 2B0CA 2GESA 2CYBA 4U9IS 4C30A 3WLHA 1JDJA 3O5AA 4YROA 2W0MA 3NI2A 1XOIA 3UWDA 2FPKA 3WIVA 1XN1A 1R6TA 3SXUA 3LPAA 3GF4A 3NBQA 2K4MA 1F8GA 2H06A 3W5JA 1MR3F 2J46A 5FEUA 3RYFA 2A5LA 4Q4HA 1CQIB 1YMVA 2XAAA 4YDHB 4EWLA 4EMBA 3NWPA 3WLSA 2J67A 5CPFA 4BJ5A 1HORA 2Z30A 4MEAA 1G7RA 2VK2A 5FQNA 1QOZA 4KOEC 5JAMA 1PS8A 1EFDN 1YXMA 1MT0A 3GJTA 4FDTA 3G2PA 4TQGA 5CA0A 3C70A 4F4FA 4N76A 3R9XA 2QU7A 5HVNA 2RARA 1Y4UA 4EUEA 5G1PA 5K0LA 1GEGA 2X58A 4AURA 1XNHA 5C7OO 2LNDA 1B1AA 4L85A 4PC6A 2QYSA 2H7XA 2QYTA 4M7RA 1GFWA 2R87A 4OFBA 3EG5A 2FUG1 3T7RA 1BX0A 3UKOA 1RJ9A 5KSOA 1JALA 1DJOA 3DBRB 3R44A 4JI1B 4MV3A 3T3IA 3ENZA 1YQQA 1NAIA 3IT2A 2YVUA 4QEDA 2WICA 3HFRA 2BGWA 3ZC3A 3EDMA 3LDUA 3QTBA 2G5PA 4DGQA 2FU5C 1GVHA 3CR3C 1R0BA 4QTTB 4MGIR 4QVKA 3NVMB 2ZQZA 4L15A 2IGBA 3PFIA 4JI3B 1SVOA 4AZ3B 2FQYA 4ITRC 5I5EA 2XDQB 4PFSA 3IR6A 3KSMA 1MEEA 1G21A 2IW1A 4Z9BA 4DSAA 4DANA 2DOKA 3I9V6 1PJRA 4B81A 1ZHOA 3TNLA 1MLDA 4K0RA 1PT9A 1U3TA 5DNUA 4TVSA 4RJTA 3F78A 4ETMA 5FA8A 3GA7A 3UOAB 1GPWB 4PIPA 5TR9A 1VLLA 3LC0A 4REMA 3IAEA 1P4GA 2RC5A 4JVMA 4TXLA 3AXTA 3R6TA 4IKEA 1KDYA 2P9JA 3IERA 1XPRA 3I62A 2F2TA 1PFVA 3QQPA 3QVUA 1MEOA 2ZXUA 3OKPA 3RUIA 2QVZX 4B40A 3EAGA 3JRNA 2LTAA 4IX9A 4CETA 5CH5A 4RTSA 3CN9A 1SU7A 4H0CA 1T0JB 3A25A 2OGSA 1EK2A 2X2OA 3OD5A 3E7WA 4II2A 5DWQA 1K8ZB 4NCIA 3TJZA 2CXSA 3ZQKA 4E5PA 4ZZ1A 3EEFA 2EFJA 1VXOA 1SVUA 3IIJA 3VPCA 1VJRA 3NH6A 1T5OA 1WCV1 2H9YA 1YR8A 3VZSA 4X1OA 2JLAA 1WCIB 4X9XA 5F12A 4ND2A 3H65A 5TARA 4C89A 2IF2A 5A06A 1UPCA 2PU7A 2VHCA 4OHMA 2NZ8A 2O8NA 5IWCA 1K8YB 4F11A 5J4YA 2BH2A 4EPYA 4J1NA 1U8YA 2O0LA 4KAAA 1DJMA 3TTUA 2NPFA 3QU7A 2OFFA 1X0XA 2FWPA 1C9DB 5EXSA 2ZRAA 1AKYA 4OXQA 2GYUA 3Q8XB 1II0A 2J5QA 4JI8B 4NKRA 2AN5A 2H2IA 1V95A 1ZK4A 3FUWA 1B8UA 1FQKA 2OO3A 3HHPA 1JU9A 4HNAB 4N0MA 4R1SA 4E03A 1KWKA 3EVNA 3JZAA 4NBTA 4BU0A 3D6TB 2X0RA 5ECDA 3PNPA 3QBVA 4URHA 4EHHA 2HEGA 4KB5A 2X6TA 3EIFA 3HACA 1R5NA 5IH3A 3TZKA 2X4DA 5DISB 2QT0A 3M6MD 2PFGA 4NU6A 3PNVA 3L7MA 2GVDC 1IPHA 4DCMA 2CLDX 2PLRA 3M5PA 3OFND 2FCAA 2Y71A 3QG5A 4B80A 3AEKB 4E5SA 1B00A 3BD7A 3A9WA 4WIAA 4GR4A 1OAAA 1VSQA 4WY8A 2AD1A 3A6LA 1NG1A 5K8UA 4F1KA 3WWCA 3TNFA 3UWPA 1IZ0A 2G04A 2WUWE 4YP5A 4ANFA 4HDRA 1CUAA 4MPTA 4I1YA 3FDZA 4YRLA 4CIAA 3PUIA 3F90A 4JB0A 1FNSA 2BH9A 1KR5A 2G5CA 2ZJ1A 2YN2A 5LLSA 1JQLB 4QX6A 4TMFA 4DR1B 3VKWA 3KALA 1NP3A 2Y9MB 4CM9A 4DG9A 2JDIA 5G1OA 2D1YA 2H48A 2P6MA 2FZEA 4LRUA 3HA2A 1PTKA 2IDZA 3ID6C 3P2EA 3QWFA 4QGHA 4CDGA 3D54D 2JKYA 3DXXA 4KJZA 3LHFA 1ST2A 2O3RA 1A72A 3SIWA 2P40A 2BF4A 3EWAA 1E2DA 3FYTA 4ZRDA 4DDVA 4N5IX 1HMYA 3SQWA 1N4DA 5I7AA 1M6YA 1O6CA 2LPMA 1ZN8A 4H6PA 4CL0A 5GADl 1V1MB 2EP8A 3Q8WA 4Q7MB 5KOJA 1AURA 2JCBA 2P68A 4IDFA 3U26A 5IH7A 1YACA 2ZJAA 3NHUA 4YYZA 4GFDA 1IXSB 1CF9A 4HOYA 4MIKA 1Q3HA 1UKEA 4D46A 2Y6UA 2FK8A 2X3FA 3BA1A 1I30A 1M7HA 1S7CA 4WSOA 2QR3A 1NWHA 1Y7LA 3F6RA 1PQYA 5FH9A 4DR7B 2VF5X 4A6DA 4DR6B 5L7YA 1H2RS 3UHJA 3I12A 5I4KA 1DE0A 2BAGA 1Y80A 1YCFA 2FHPA 5FPSA 2VRCA 1Z4PX 2P0EA 2FWBA 1OW3B 3P9RA 4KQXA 3FB1A 4UQLA 4IOKA 4DE5A 4UPEA 2XXAA 4RE5A 4QL3A 3EC2A 3ZNNA 4HUTA 2FSIA 3E1KA 4GQAA 3KO8A 4I5IA 3N0VA 4QPCA 2C7RA 3CEJA 2ZJBA 3C3KA 4YBZA 4BRZA 4RSGA 4BLSA 4KX5A 5CYFA 3L0PA 4Q21A 2HYDA 3KXPA 1M8JA 3AJAA 3LPMA 5T3YA 4CYMA 1Z2EA 2YDYA 1KY4A 1P17A 1QF9A 2XTZA 1VL0A 1E1CB 3GB9A 2L2QA 2HDNB 3K4PA 4LQDA 4NDAA 3WLKX 4DWJA 5KNDA 1XK7A 4Z0NA 4BB0A 1IEQA 2ERXA 2BJWA 3IEPA 2HIMA 1XN4A 1NJ6A 3M34A 5B37A 4X84A 3W2GA 2OXFA 1AXRA 4F2HA 3M1IA 2WABA 2E1RA 3DL0A 3MRSA 3F7NA 1XD9A 3FZQA 3CW2A 3CUWA 3G79A 5DP1A 3DEFA 4V1CA 4CN9A 4ZALA 1Y8QB 3Q8MA 3GIWA 2BOVA 4QGSA 1WDWB 3AB3A 5GJCA 2QAGC 1QRUA 1QGED 3R1IA 3U0VA 4ALLA 2ACKA 4Z8YA 5JSHA 2IS4A 2VWGA 1EEXB 2IUEA 3M33A 5LVAA 4WZBB 3BGSA 3P20A 5ERXA 3SYTA 4Z6KA 4NR0A 3SZMA 3BD6A 1HNWB 2FI1A 5EFOA 1O87A 2P5TB 2RJ3A 2NU9A 3S44A 3WLOA 1Y1SA 2BJVA 4O63O 4E3WA 1CQZA 2HA3A 2QJTA 4H2DA 2V6MA 1IE3A 4IMIB 2FLVA 2CLEB 3R23A 1EP1B 4K8RB 1ZD2P 3ZHUA 3DVLA 3OTWA 2C5FA 2G88A 3PT9A 3T0FA 1NN1A 1YKSA 4J7UA 4PCUA 1B2LA 4LPSA 4ZMBA 3RREA 3V7WA 1XQYA 4RX1A 4B4VA 1G4HA 4BWGA 3ZDZB 5JH7F 3HMKA 1N9KA 2JFBA 2VHYA 3QVXA 5J9FA 2XYQA 2UVPA 3EVGA 4RGVA 3TKAA 3I5MA 1UC4B 3EOZA 3TOZA 4P36A 1HDOA 3JYNA 4HSEA 4EB0A 6Q21A 4MCJA 4X8LA 4RGBA 3KBOA 4YRCA 1SB8A 3MFYA 2ZJ2A 4K9NA 4QDOA 4LYHA 4KREA 1OI2A 2VG8A 3FR7A 3BB3A 2XSZD 3KQOA 2LIPA 4PAWA 4YMUA 1O6ZA 2HI0A 4IHJF 2PTGA 3HVRA 3PHCA 3KU1A 2ZRQA 1LKZA 1TZMA 3F67A 3FD8A 4X6UA 2FPUA 2JFHA 3RK4A 4C1NA 1KJZA 1YV9A 3FDXA 3OT5A 4WFIA 3L7LA 1L5QA 1SURA 3GWGA 1ZEJA 1U1GA 3E9NA 4YO7A 1VL2A 4FMDB 4HPJB 4J4HA 5C37A 1ZWLA 1MTOA 1QIIA 3CNNA 1KP3A 4L8WB 4MIEA 1SKAA 5IJXA 4URUR 5CDTA 1RWPA 4F3KA 4S0XA 3FGOA 3DEIA 4CF4A 3B48A 1XKXA 4WCFA 3H5OA 8AT1A 3RUFA 4Y6QA 1QH1A 1O0CA 3E23A 3H5IA 3TRDA 4W8GA 1E59A 1OPXA 3R0IA 4I5DA 1PZFA 1D2GA 2GBLC 5BOSA 1G38A 1UIMA 4I08A 4EFKA 1ESEA 3COYA 4MWGA 3ZWXA 4JK3A 2XMPA 3CGWA 3GH3A 5I8ZA 1IUOA 4RDHA 1XV5A 3D1JA 5DN6A 1QTIA 1BWQA 2MTBA 1SHJA 3IQZA 1B23P 2O0HA 1KERA 2QQ5A 3NTQA 2F8SA 4G86A 4IDOA 1WWKA 3D6MA 3PCTA 3LSYA 5AH0A 3CWCA 3TNJA 2I2WA 2PJUA 1XMVA 4HD8A 3DAGA 4S35A 1OLSA 4DMMA 1J2YA 1YONA 5DOVA 3U7QA 3KPWA 4Z53A 2HPZA 4QSMA 4Z1MA 1MA3A 3PFCA 1FB5A 1EGHA 2G5GX 2FSVA 4UEWA 3W5HA 4D44A 1TVKA 1V1RB 3S2UA 3W34A 1VLJA 3FNBA 4EJMA 4XTCS 3DWEX 2PIAA 2XOKA 3DYIA 3ET4A 1YHZA 1C9JA 2IYNA 3BDIA 4QTYA 4DLAA 4U4AA 1EUDA 3E5RA 4E4YA 5L6LB 1ORDA 2BFDB 2PMKA 4OV6B 2WSIA 2P2SA 4QO8A 3V4OA 5H8WA 2EP5A 4DAOA 1L4EA 3VBEA 3RKSA 4E31A 3UMSA 4HWGA 1A8SA 4TOIA 2JFXA 1JFFA 5L8VA 4UTZA 3I01A 3W5BA 2IPMA 5F2OA 1IHOA 4P80A 2Z0MA 4HQLA 1G8AA 3BMQB 5EEGA 1Z6YA 3QX8A 2A35A 3FFAA 2AX4A 2PZFA 3SHTA 4TWAA 5P21A 3PG5A 3QELA 2CJXA 3K71B 3RG2A 1UWVA 2LCIA 3TCKA 1MAUA 1E2LA 3A4NA 4LXTA 3VOBA 1GXSB 1UQRA 5I5GA 3KB2A 3I9JA 2DR2A 3ZU6A 5HIMA 4DL9A 3L1UA 4YIKA 1U90A 1Z8DA 4ZO9A 2XA2A 3EB9A 3DSRA 1WRBA 4IICA 3NC1C 4BMYA 4O8ZA 5IKOA 3ZX4A 5A4AA 5AI6A 2NU8B 1XELA 1H8EA 3CLVA 4E4RA 1FU8A 2R8ZA 5L45A 4QULA 1QTQA 4YAJA 1W0JD 2QLFA 3LKDA 2VLIA 3HBNA 4BDTA 2IYLD 1KE1A 5JJCA 1CJMA 4C29A 5FI3A 1NNSA 3ZIUA 1OX4B 2XOKD 3B3QA 1E0DA 3T94A 4ETWA 2O2GA 2QTZA 3CUYA 3KE8A 3ANNA 3BN3A 3CRRA 4HRAA 4UPVA 1ML4A 5IC4A 2P5UA 1KI6A 2RONA 4Z4HA 4PGMA 3A2LA 4D42A 1Z39A 4BC1A 1NX9A 3R7NA 4FC7A 3RAJA 3VU3A 3ZBQA 1QHNA 3KOXA 5D01A 3UXMA 3HVKA 4C0QC 4X6YA 4A5OA 2GQ0A 4EKNB 3OM0A 5EZYA 4JA2A 1TA0A 2YY7A 4NOJA 4Q3NA 4DLPA 3V4RA 3MPOA 4KIUA 4QNNA 2AG1A 1BMFA 3WKBA 1M83A 2ZIFA 1Z0KA 4F8JA 1NRIA 1OB2A 1XIVA 4FT4A 1GL7A 1Z7GA 1FTSA 2UZIR 4J9VA 1KAGA 1VA4A 3ETDA 3FUUA 4UAUA 3NWEA 5A6SB 3IP5A 3B9BA 1VRCA 3JQ9C 1JFSA 3LUHA 4D41A 2JJYA 1TU3A 3HS3A 3LW8A 1XK6A 5JCXA 1CP2A 4PQEA 5E4YA 5E6RA 2F3QA 5G0VA 4X95A 2ODNA 1CZNA 1QG0A 2GAAA 1G291 3UFXA 2HH9A 4I1IA 4G9BA 4I55B 2JI6A 3FGNA 3G85A 1P0PA 3JD0A 3ET5A 4G5OA 4RQAA 5I3ZA 1I7SB 3VTZA 2BBSA 4MS3A 3V1KA 3LA8A 4Q3EA 2QM3A 1KDTA 1YJ5A 1OYWA 2A1UB 1JE0A 3II6X 1H85A 4HFMA 4KBFA 3RFTA 1ES9A 2B4KA 1JQDA 2WNSA 3T3PB 2J6HA 3ICOA 1B2RA 4YREA 4LCEA 1Z3IX 2XNDD 3AO0B 1Y3BE 5KMGA 2PBFA 4YRMA 5D84A 2H4XA 3FW1A 3QENA 4EF6A 2F6RA 1V3VA 3TE7A 3G1UA 3PQ6A 4U7WA 2C2GA 2GM9A 2AFHE 4LSZA 3N2ZB 1KE2A 2W8BB 2H1SA 3CX8A 2IX3A 3SN6A 3ZJ5A 3RW9A 2R7MA 1EXMA 4TMWA 3GFSA 3ZGXA 4Q9KA 1AQYA 4G5GA 3RAFC 3M3HA 1AGYA 1VJ5A 1H1TA 5G0UA 3TGWA 5KAPA 1RDFA 3HXKA 3QLUA 4RZQA 4XRRA 5F33A 2XIJA 3L7NA 3THRA 4AJOA 3EPLA 3ORHA 2R3SA 1A9ZA 2Z4RA 1ZLYA 2Q4DA 2BFMA 2X41A 4MTCA 4Y7CA 5AI0A 1U7ZA 4X92A 1V7PC 4CM4A 5B2FA 1C30B 1DT3A 2HJ9A 2GHIA 2G0NA 2ZULA 4B1FA 1PI3A 1ZBQA 1LV7A 4Q4JB 4DSOA 2ZXFA 2R44A 3A1NA 4NZYA 4X8OA 4DA0A 5A9RA 5JNRA 1GV0A 3RFXA 1L8LA 2IZOA 5ESRA 3V8QA 4C0XA 3LPCA 3I32A 1OYYA 3OMWA 3PGVA 3SHOA 1V8FA 4NNJA 5IVHA 3FNRA 2GK3A 1DIAA 2PQ0A 1I7PA 3AB7A 4FSXA 4M9ZA 4WUTA 4KIGA 1DJLA 1YJXA 4CM8A 4D6XA 3KRTA 3SF8B 4ENRA 4G25A 4Q9AA 3SSNA 5KSPA 4I46A 1TJ4A 2A8YA 2YASA 2QRZA 3U3ZA 2R48A 2QN2A 1U2PA 2O5RA 3WAKA 4J7XA 3UXHA 2FRXA 3PTZA 1ZCAA 4F4UA 3STXA 3IOMA 4LZAA 5F5NA 4EYGA 4CMHA 2WPDA 2HMAA 4MV8A 4D8WA 4D8XA 5M7EA 4BB5A 3HNPA 1N0UA 4ER0A 3ETEA 5KYYB 4B3XA 2XV1A 3DH0A 1YE8A 5FV7A 2GXUA 3ZXYA 5JMPA 1XQ1A 2VYVD 4YJDA 1ICEA 3TQTA 5BWMA 2G77B 3K31A 3AYXB 1XTBA 3NBKA 1ZK2A 4NE7A 4Y98A 3T5PA 2F59A 1KJ8A 3AFHA 2AJLI 4P1ZA 3T61A 3KKQA 4DV0B 1ZNZA 4MHTA 1Y0BA 5AM0A 4N47A 2P2LA 4K1XA 4M6WB 5I7EA 3L4EA 3ISTA 1DKMA 4TRJA 3CONA 3OX2A 1OREA 4BMPB 5K09A 1XF1A 3FMPB 4EHLA 4QDZA 3RHSA 4CQJA 5KNCH 3N0WA 4ON9A 2VT2A 2AYXA 3IKTA 1Y63A 5CT6A 1D6JA 4F21A 3IR5A 1DAKA 2GBIA 1X9IA 4X85A 5EY5B 1GNQA 4AC9A 1RBMA 2ABWA 4IRXA 3BH6A 4FYYA 1MGOA 3V8VA 4EG8A 1K2VN 2YWFA 2R85A 3PHBE 3OZFA 3FOZA 3FVQA 2ZBGA 5FD8A 3H2ZA 5EJ9A 1REQA 4QQFA 2AJBA 1FP2A 3JQDA 4XJSA 5DLQC 1BC5A 4N65A 2OB2A 3DCIA 2ZUTA 2KMLA 3IP1A 2X5NA 3EJWA 5F5LA 4YV2A 2E4ZA 1NHWA 3H5WA 2ID4A 3TD6A 1GPMA 2Y66A 3LXUX 2A30A 3AIOA 5AKXA 2PXHA 2OXIA 3PDCA 1V7QA 2AQHA 4L50A 4LE1A 2O59A 5DX1A 1JDSA 2O2XA 3Q5DA 4WK0B 5FPHA 1B7GO 5BSWA 4IF6A 4LMPA 3UAZA 4O3FA 4MUGA 2QE6A 1GQQA 1M2GA 3EGWA 1M2VB 4LHYA 4D7AA 4JU8A 1AQNA 1EZZA 1TZKA 5DHUA 5IM4A 4R4JA 1JAZA 2XZLA 1IUNA 3CO0S 4O4IF 2NQ2C 5C18A 3NBMA 3QUTA 4YIHA 1QGAA 1ZMBA 2VJLA 4Q3OA 3ZY6A 1LRJA 3THYA 1K7SN 3PUKA 1OKKA 2DUNA 2ZTUA 3CINA 4TM8A 3VZPA 3VA7A 1Z2NX 2POQX 4FOPA 3ROGA 4D3SA 4HGRA 2BZ0A 3W2TA 5KREA 3P45A 2KLHA 4EX7A 4QU8A 4AYTA 4UBLA 5IEJA 3N2KB 4LXGA 2R96A 5BPFA 2Q6LA 2P7IA 1KBQA 3PGXA 4GZ5A 2KQUA 4ALNA 3R9KA 1B15A 1JFRA 1CRQA 1YB1A 2ZYWX 3GCGA 3PEYA 5HILA 4CG0A 3EEOA 1USWA 3UMYA 1X6VA 2CNWD 4KV7A 2BFEA 1GUAA 2VJYA 1UJ6A 3IJEB 1W0KD 1U0FA 2AA3A 3MYRA 4IJVA 2IU0A 3AJEA 2UAGA 5HKBA 1EFLA 1N5RA 4U7DA 1IZ7A 1T3GA 3QEJA 3C8DA 5E2AA 1DS6A 4UU8A 4OXNA 5BQPA 3Q11A 4CI0B 1ZRHA 1Q74A 2FJUA 3UB2A 4NI5A 3TSYA 5K2OA 4J91A 2C77A 2H08A 2IFTA 3U44A 4E32A 1XTUA 4MQMA 3WKAA 4RA9B 1GOTA 4A92A 1V39A 5IEBA 4Z2YA 2QUIA 4WY2A 3ZZUA 2C7BA 2RKOA 4Q15A 4EG0A 2QBYA 1X77A 4HF7A 3QY9A 1LC0A 2OILA 1ZMOA 1M2OA 4HRVA 5K8TA 5E38A 3W3AD 3UAYA 3SJAA 3PFNA 1TTHA 4PLWA 2CD7A 4V0ME 1GUDA 4FYPA 2IHKA 2QRMA 2J1LA 2RKWA 3KYJB 3P19A 1CLUA 3TLCA 1CJBA 4W82A 5ALRA 2UXBB 1V5EA 5FTMA 1K6EA 1WETA 3EZXA 1SG9A 3AR3A 2VYCA 1R0RE 3DOCA 4JASB 4PYOA 3W7BA 2DKFA 3M5DA 4EELA 1RYMA 4JEIA 4BNIA 1QV9A 3EMBA 3ROFA 5BYAA 9GPBA 3AERB 3DYBA 5ENVA 1B3RA 3LUGA 4MUBA 4NBRA 5AM5A 4KHPB 4HH4A 2CNWA 2VC2B 1I14A 1X15A 4L4UA 1YS9A 4FBGA 3G7NA 4HYEA 5HUHA 3PE6A 3N53A 3WXBA 3WVNA 5ABPA 3QVLA 3IQIX 4UPDA 4V38A 3I9OA 1DIGA 2MOKA 3SSAA 4DUGD 1PU2A 4D02A 1RYZA 3I05A 1HYEA 5G40A 2XNDA 5ARDA 4DABA 3RAPR 4CKZA 1DHRA 1QGUB 2A5FA 2F3SA 2PV0A 2VP6A 5DHPA 3HWSA 2BVNA 4YRKA 5CW2A 2WMDA 1P44A 3IRUA 3LK7A 4XPZA 5AOCA 1M8PA 4RYDA 4BQEA 4PSKA 3K7EA 2RBGA 3FTFA 4IIBA 1U0NA 1QNFA 2X5XA 3EIHA 3TQCA 1EFRD 2Q5LA 2TMDA 4Y9DA 4C7BA 1B41A 9ATCA 1VKJA 1GADO 2P79A 4KZPA 4BP9A 5KTSA 2FGJA 1UBHS 3JX9A 1CDZA 3WGKA 3HWRA 1AMOA 4KVGA 5KC9A 1RE1A 3V1LA 4Z2AA 4TWBA 1EVIA 3GFBA 3RH0A 3S1LA 3DJYA 2ZAGA 2DUWA 4EHAA 3WNDA 1KVSA 2JLUA 2F3PA 2QZJA 1C7RA 2OECA 2QR2A 1P7CA 3DVRX 3L8FA 5HKLA 4DDTA 4RJJA 1O5TA 2YL2A 1ZIYA 1YVEI 2VJBA 3GT7A 4KSYA 1YQXA 2V4MA 2HWWA 4PYLA 2OKCA 6ADHA 4GXNA 4WWHA 4UNPA 3GX1A 3CFYA 3MTJA 2NVWA 1ZIDA 4BOYA 4BLVA 1ZVMA 4AN1A 3I52A 4J6EA 4EYQA 5KUTA 4B0PA 3EVDA 4BMZA 4C3ZA 1DBIA 1AC5A 3ASUA 3KE9A 3NBXX 4MQEA 1D7OA 3HUUA 3R7FA 5IWAB 2HHHB 3H2YA 5EL0A 3S2SA 1JB9A 2D00A 1RKBA 1IHUA 1KO5A 2CXOA 1R8XA 2I1QA 3PDUA 4GUDA 4MS4B 4MROA 3IV7A 3EEBA 4BAGA 4ZOLF 3KU4A 2VKTA 3LW7A 1KVUA 3HYSA 2GNOA 1MQ9A 1QYWA 2AYYA 3A32A 4HNSA 3CJTA 1KJYA 5FBRB 3BTOA 5J4VA 2PUVA 1RMQA 1ZGJA 1ESMA 2H8KA 3H1FA 1ZQ1A 4LF9B 3T7SA 2D5LA 3GLFA 1BXRB 1L3IA 4PRLA 3K0FA 3KEFA 2BMWA 3IMGA 5F7OA 4KGVA 3JZDA 3W2IA 2PZEA 4HAWA 4FYXA 2QL6A 3QX9A 2IP1A 1U2RA 1CB0A 1HZZA 1U3FA 5EJEA 4KKVA 3BOSA 3BH0A 3AKDA 3I2YX 4GOLD 5KKAA 1J06A 2H17A 1OFVA 5KQLA 4KQIA 3STYA 1A5ZA 3CM0A 2P5SA 4NABA 3M1LA 2Q49A 4BEJA 2H57A 5CD9A 4GAEA 1ZICA 3CW8X 3VTKA 1A9RA 1BS2A 1DAOA 3W9BA 4MRNA 1RZVA 5FQOA 3V48A 5I47A 1F8UA 1PZMA 3EULA 4YECA 3ZD8A 2H63A 4CHGA 1M0WA 1NW9B 3NWOA 4HYYA 2GZRA 4R6WA 4WN9B 1L7NA 3DDCA 3LUCA 3RTGA 3ZJVA 4DLZA 1RS0A 5A5FA 1QV6A 3IDZA 2PXXA 1ZCFA 4HZUA 4QFBA 4DB2A 1JRLA 2OP0A 3FMIA 1M5UA 2OBMA 3Q0TA 3ZU5A 4YR7A 1PJZA 1VCIA 5IHPA 3PC8A 4AJ2A 4YNBA 1NPTO 5LXTA 4L57A 4EJ0A 4Q16A 4OU5A 1U0SY 3AQ4A 1UDCA 4J16A 3WL5A 2HIAA 3W3AH 1LWNA 3GJ3A 1ELOA 1E99A 1T6BY 3VSDA 3GXBA 1NTOA 1GL6A 1DUVG 1S2MA 2PR2A 1JYEA 3OQ6A 3OPMA 4YASA 1KC1A 3B8HA 4N5NA 1B6RA 4EPXA 3GRYA 1U1FA 2DTXA 1WVIA 5JCJA 5DE3A 4TYWA 1H0HA 2BFCA 5ALSA 1XB2A 4YUVA 5CBPB 3SIRA 1JWLA 4YJGA 1PE0A 1U9ZA 2EZTA 2XTMA 4LGMA 2IV3A 3HFSA 4OKIA 2HSDA 3A1TA 5BUZA 3PDHA 4AT1A 4CMIB 2L18A 4NNPA 2QNRA 2R4QA 3L49A 4N0QA 1EM8A 1ZOSA 4M7WA 4OAQA 4P4LA 1PUXA 4JP1A 1O58A 5KO2A 4XD7D 4NS1A 3JY6A 4MKZA 1MOQA 3DQQA 5FOXA 5J2UA 1W75A 2CNOA 1P74A 4INJA 1DQRA 3Q98A 5DP2A 4B9AA 4YR9A 3K9QO 5DWVA 1MEJA 3E8MA 3PBKA 1RNLA 1G16A 2OV1A 1ADFA 4QJ3A 1WP9A 3WFZA 5CITA 3HBLA 4Y3UA 1VB3A 4Q9HA 3A8TA 4EO4A 1L4HA 2Z98A 1XLTA 4IEEA 4U7GA 1XVTA 3COWA 3T7JA 2BWJA 2OO5C 2WYUA 3N0TA 3ORRA 4Z9AA 3ZWOA 3S3TA 4GVXA 3HRIA 4LBYA 3BL8A 3FOAA 4H60A 1TVMA 5C4IA 1VSUA 3LLVA 1FS4A 3NALA 3GXOA 4G09A 4TLEA 5CA1B 5DM70 2C8KA 4V2IA 2M1XA 3ZLJA 4GX5A 1A82A 2AWOA 2PA0A 3KDAA 3U5ZB 2G3YA 4JP3A 5CM8B 2HA6A 5J4HA 4OF4A 5JCJD 5ITVA 4QNRA 4G1FA 9MHTA 1MZVA 4ER7A 1EDBA 2YN4A 1ZZEA 2A58A 5FPQA 3VNUA 1I3CA 3QTLA 3VPGA 1YB7A 2WM3A 5G02A 5JD6A 5A0TA 1Q12A 3DLCA 4ZVNA 1ZD5A 4DC0A 1U2SA 2I4RA 3I2GA 4C7OA 1DQZA 2R6JA 4L5CA 4QBHA 3MILA 5BVHA 1XZHA 1SA0A 2Y2UA 3KWJA 2EZ4A 2H85A 6AT1A 2ETVA 3CB4A 2NVBA 4KNWA 4LK2A 1JKJA 1Z88A 4MJLA 1S8AA 4UMDA 1NXSA 2NSHA 4UATA 3CZMA 4QQNA 3ZI4A 4FX5A 2RHDA 5E8RA 3UJNA 4W1RA 4M21A 5ALFA 5BNZA 4K9SA 2GNPA 1O89A 1C1DA 4QG3A 2FAXA 2XWQA 1WP4A 2A5DA 4LNAA 4FZRA 1GPKA 4REQA 5H9VA 1G2IA 5LBUA 1LPAB 2BDEA 1VYHA 2YQ4A 3OUUA 2ZT6A 4YMHA 2HKIA 1M34A 4JX9A 2FA9A 3ZS8A 4D4LA 2Q4BA 1VFPA 1UBJS 1IOZA 5EKTA 5IT5A 4IQ8A 4JQOA 1TYEB 5KDOA 1ULBA 2YWHA 3C24A 3HFGA 4RF4A 5H68A 2I9PA 2XLBA 4POAA 5L7WA 2BCGY 3GN1A 2C8VA 4P0TA 4P31A 1XZEA 3C41J 2MSCB 3V80A 5EXPA 3BEOA 2Z4SA 3NHKA 4GSKA 3PQFA 1RIIA 2P9HA 1IJBA 4GOMD 1DAEA 2I7DA 2Y1WA 3MCTA 4JA0A 5GGXA 2BR4A 4DYHA 1ZIOA 3QVVA 4RPLA 2ZYDA 1ZRNA 3CPSA 1SG0A 2JI4A 4L9WA 1RYFA 3T3MB 3MUOA 4PYMA 2ONYA 3GV0A 5C53B 3JAWB 5CVCA 4JL5A 1RRFA 2IYWA 3E22B 3P4UA 3B9QA 4Y2GA 1JHXA 1IC6A 1VJDA 2IEZA 2PCJA 1RT9A 4CIDA 1J7JA 4DQLA 1SUBA 2DH6A 3KQHA 4H1UA 1L4GA 3ETLA 4Y1RB 3SZUA 3OPYA 3T0IA 3KKNA 4HK4A 3ZZ0A 1QIGA 1PX2A 2MHCA 3ENQA 1U3CA 2HD4A 1UBUS 4RV4A 4BQRA 2XVXA 4U2FA 1HC7A 2VH2A 4ESEA 4K03A 5D8DA 4KUEA 5AI8A 4QYIA 1ZJZA 2O1EA 2SECE 3FCAA 2AKAB 3OKAA 5H7XA 3RRZA 5F9FA 1XUOA 4N12A 4A23A 1X7GA 1ARZA 3RUHA 1EUZA 4WEOA 4B4KA 4BJ6A 3OQIB 3SK0A 4EVIA 3F3SA 1M2NA 2Q3JA 4RY2A 2B6NA 2QMQA 4L0QA 1EWRA 5D1NA 3RVQA 3KQKA 1XP8A 3ZBTA 3PRHA 5BW5A 4B7XA 5I9MA 3UJHA 3PIDA 2PQ2A 1MKYA 1IM2A 1FUKA 3A4VA 3BXFA 5FAXA 2CZGA 3R2JA 2AXQA 5J5AA 4HDQB 4D5GA 1AN9A 4NPHA 5AJUA 1FRVA 1Z6XA 4O1IA 3WLTA 1HXHA 1YZKA 2E6UX 2EJUA 4G24A 1BFUA 1RVV1 2NYUA 3K9HA 3H7IA 2OOKA 2RGGA 3IAM6 4CTJA 4X64B 5B1DA 3TLXA 3UPDA 3OBIA 4K86A 1UXOA 4DV2B 5K0GA 1NYTA 1JKIA 3OKCA 1M1YB 1R4ZA 2IEAA 3Q7IA 4LHWA 4R9RA 5HDQA 4CKEB 4EY3A 3ZR4B 3GHHA 4FUTA 1O4VA 2GM5A 3WXMA 1ISPA 3O4GA 4CM6A 1GGFA 3U3KA 4DR3B 2WJYA 1PQPA 1XXHA 5FYQA 3TG8A 5T41A 2C2OA 1KI8A 3JYLA 1E9VA 3FHOA 1EVKA 1MPTA 3NNNA 1FUYB 2WD7B 4J7AA 4M46A 4XH9B 3QF4B 2CXQA 3I2FA 1IQRA 4GZ6A 2JAUA 4NTZA 4KZKA 1ZK3A 4PTYA 1T9KA 5ISMA 2E4YA 4M0DA 3HMQA 4OQNA 2OENG 4KLRA 5BWLA 2B4QA 1I0LA 1YWGO 4HUQA 4M87A 4PRZA 1CYEA 4BX2A 3AUXA 4J0CA 2X9NA 2QM8A 2I55A 5LQJA 3EPJA 5EI5A 4Z3KA 3AY3A 1S3IA 2C31A 2IZ1A 4MMXB 1SG6A 1LLUA 4IUCS 4MUEA 2MMGA 2ZYTX 3B2EA 4Z4EA 3MM4A 5LMNB 3L0BA 3QYFA 3QVGA 3G9TA 4OSOA 3PFKA 4Z54A 3GRAA 2XBLA 2CL6X 3OQVA 4I4NA 4RCVA 1ZO8A 3SEAA 4P2GA 1ZUIA 1WXXA 4ND7A 4CIWA 3O92A 5HKKD 2NXEA 4I81A 4O4LF 5EEHA 5BWCA 5JSKA 2C20A 4UARA 1YS2X 4L8VA 1DUIA 3V4FA 1G0OA 5IJWA 2R751 2B36A 3VKHA 3PQCA 1ZQ9A 4X91A 3U61B 3VDXA 4ALIA 3RARA 4LTDA 1UBSB 4EO7A 3KJHA 1DQNA 1SXJE 4MI1A 3K0EA 4A0QA 5FOQA 2XA9A 3LUBA 2PZJA 4Q4AB 3PXGA 1T5DX 3PLNA 1SIUA 4LSWA 1H42A 5U4QA 3K0BA 5KHAA 3PGMA 4OJKA 3H2GA 4YMTA 3IAAA 1EBUA 2ZJYA 3JVDA 4XPIA 2QTMA 3R41A 4FFRA 3ABIA 1P1JA 2G5TA 4GS5A 2WG1A 1SUIA 4MOWA 2JHCA 3L6BA 2D59A 2FZ4A 4DNXA 1HYHA 3H04A 4FLFA 4P93A 4BVGA 5JRDS 1Z0UA 5FFNA 3KJQA 3I73A 4PZZA 1FSSA 1R27A 4ZREA 3IT0A 3TQIA 1YRLA 3LSTA 1OAOA 3KKMA 1EP2B 1RM4A 3RBAA 2WD9A 1TEXA 2XYHA 4CLRB 2GDZA 4RFSA 4F3CA 3KL2A 1K6XA 1T9AA 3OCVA 4O1MA 1IY9A 4WE3A 4HYQA 4C6RA 3B9RA 4PNZA 3K3PA 4CTNA 4DMCA 1U8EA 4OAPA 1CXZA 4P98A 1IIBA 2WWXA 2RGNA 4TMZA 1T43A 3E4CA 2X0JA 5HKKA 4RKWA 1UZMA 5FNZA 3EXHC 2J4DA 5J40A 3C1TA 4UM9D 4HAVA 4TLBA 2YWBA 2ZIAA 4HRYA 3UNXA 4QIHA 4MA5A 3V4ZA 2CVOA 4Z7JA 2W4MA 1FXUA 2QJWA 3F1LA 3QKRA 4TMVA 5ICMA 3LF1A 4FBMA 1H2WA 5MFZA 1NY6A 4WX2B 4II7A 3RRYA 2G40A 4NEHB 2GN1A 1VIMA 4X7BA 3EGDB 5I7RA 1NW4A 1ZOOA 4WVLA 4YAFA 3NP7A 3GEPA 3JXEA 1UZUA 2BDUA 2BGKA 3D2LA 4M0FA 5DI9A 3W04A 1W4AA 3NO4A 4FKBA 4IQ0A 5CVJA 1XXLA 2VHQA 2NNLD 2Z5VA 2C97A 1ONPA 1Y1QA 3QUBA 2PUHA 4F71A 1OWPA 3DHWC 4WFQA 5FX2A 3SX4A 4BRWA 4JOSA 3ZDXB 1Y3IA 1E18A 4A27A 3VTAA 1KORA 4IIDA 3ZY5A 3I0NA 2O19A 3GJSA 4GX2A 4NXMB 3LBAA 3EIWA 3WGQA 2HO4A 3AEQA 3BGDA 3HBMA 4OX9B 3QOWA 1FP6A 2VSXA 1EFVB 2B69A 2QRVA 4WZAA 2BFOA 3HSYA 3AV0B 1FMFA 1SJ9A 3EN0A 2XEDA 1X94A 3H05A 1KEWA 5HTKA 2Q8PA 2XUAA 3A9SA 1LTHR 3EVCA 4JYMA 5DB4A 1EVZA 5KU7A 1IONA 3RUDA 2XKAA 5ALWA 4JBXA 2EOAA 3W6NA 4I0WB 4LOHA 1M2HA 5KS2A 5SZKB 5FOWA 4IV5A 1N6KA 2PJZA 3BG5A 5E6SB 4RVHA 2NO9A 3MUNA 4XJTA 1M76A 2WOJA 3HB0A 3OEYA 4NV3A 2HSJA 1N5KA 3RRBA 5FLYA 1YRHA 4DS3A 3ORSA 2NO5A 3PK0A 3QXXA 4WTOA 4IIJA 4QM7A 2VDUE 5TJ9A 4D3FA 5HJEA 1Z7BA 4IMPA 3B3GA 2IYFA 1UBNA 2VDVE 4PYNA 4U2CA 3T9FA 4MVJG 1R9NA 1UP4A 3LZ6A 3H42B 1JI0A 5G3YA 3N6RA 1AVTA 1QYVA 3DLPX 4U8GA 2YFYA 4L7VA 4AKHA 1SUPA 3QMVA 4UUNA 3LVRE 1CQPA 5B1EA 1CNMA 4OFWA 2JRLA 3I6YA 4A8PA 2XQFA 1SBTA 4E5NA 3DTVA 3AF5A 1FVOA 1NMEA 3QITA 1OJLA 3BZBA 3MMPA 1FFHA 3AUAA 1T34A 3EEYA 4U5XA 2GETA 4FMDF 2HCFA 1DAIA 1B0AA 3HB7A 3HKEA 3L18A 1GKIA 3LCUA 1XCPA 2HCTA 4JROA 3TL3A 4POOA 4KUHA 5BMVF 2YC2C 2IYQA 2A0XA 1Y6RA 4Q7EA 1YZGA 5DTMA 1R50A 1UC8A 2C61A 4S2UA 4J0QA 4V24A 5A7FA 1N9GA 5KNDH 1NVKA 2F64A 1Q83A 4MAMA 2UXDB 3F74A 2KI5A 3ITNA 2XE6A 2ZYSA 3KOOA 4KFRA 1AA6A 4XUDA 2JFFA 3U3XA 1T3TA 3DMTC 3WJ7A 4TYQA 3ST7A 4G0QA 1Z36A 4RVFA 1BDJA 2AZTA 3IHKA 4O2BB 4Y2SA 1Q2UA 1U0RA 2J6CA 3KQLA 1YH3A 1E5VA 2JCVA 2FQXA 2PGOA 3PEEA 2QTBA 5CJ2A 2ZT7A 1GU0A 3WIUA 1TYZA 2XI4A 1ZG3A 4B46A 2FQWA 4P7BA 3QMMA 4EPVA 1XJCA 4NFSA 3KETA 4RCYA 3PTLA 3RC8A 3BFPA 1K3UB 4JT8A 5HMLA 2YVQA 1G5FA 1NOIA 3FYCA 3ICQB 2ICAA 2GK4A 4I2NA 4G4SO 4CEIA 1JHDA 3D59A 5EHZA 1L5LA 2JIOA 2JF0A 2RHWA 2PKXA 1XNRB 5I9SA 1X80A 2ATIA 4ROSA 4TUYB 5ALJA 5JS1A 2WVJA 3FGPA 3I23A 4R8RA 4XWAA 1A2KC 1PFGA 5EZSA 5DJ5A 2FWNA 3SKXA 1I13A 1CY6A 3GJ6A 3KSAC 1NZJA 1N6HA 3AV3A 5ICGA 1NFFA 1TO2E 1XCLA 1E8MA 2BF7A 2XUOA 1X38A 1A71A 4YLYA 1K66A 2VAVA 1X86B 1YC5A 3L43A 4YQZA 2NO1A 4PM4A 4BMDA 5JQWA 4I7EA 2PH7A 2FPIA 4ARIA 4MO2A 2WVAA 2WMNB 3P97A 5LKAA 3BCRA 4Q9JA 5LA6A 4FOTA 4B2YA 3ZQ4A 1HDEA 4WERA 1QFJA 3LGXA 3JCZA 2FQQA 1IWOA 1QO7A 2WFLB 5KVAA 3GLHA 2JZOA 1ZGBA 2IOYA 2EDCA 3NANA 1ZH8A 4JJGA 4K3VA 2ODTX 4RV9A 3SG0A 2QRUA 5IMBA 2W9XA 1ZGGA 2W6IA 4HNTA 2V7WA 4TS4A 3LVBA 1S5PA 1OH8A 3RBVA 3PNMA 2X5OA 3EA0A 3T5TA 2AW3A 5L3QA 4RTKA 1L5HB 1E60A 3UG7A 1F06A 4XLLA 3I9V1 2IYSA 1ULAA 2YJZA 4EIWA 2CLHB 1J25A 3AC0A 3K0AB 1EBFA 3PYXA 4G2TA 3TRIA 5MF6A 2X8LA 3DZDA 1GTMA 4UFOA 2G25A 1UFQA 3V97A 3G6KA 4BLWA 1OI4A 2I78A 2XPCA 4NARA 1DU4A 3Q7QA 5JQGA 1TX4B 2GCOA 1S89A 2CHQA 2VWPA 4JR2A 1E3EA 1GSOA 1P2GA 2EKBA 2IZ6A 3IOCA 3TAUA 4HAIA 4BQNA 4ZCMA 4PAGA 1Y5IA 5K1ZA 4MRMB 3SOPA 3S2GA 2NP6A 5EP2A 1N5JA 3VYSB 1VSBA 4XQ0A 2DHRA 1RXUA 3F71A 1M6HA 4P3YA 5IT0A 2TMKA 3PD1A 2A5JA 2I7CA 4B2IA 4EHBA 2I03A 1WCXA 3EJ6A 4R2MA 3WZMA 3A26A 1IM8A 4JL6A 2LGJA 3EGCA 2VO1A 1I7QB 4GQBA 4NCXA 2W90A 3AG5A 3FDFA 1AV6A 3KCQA 3RWMB 5KWVA 3NH9A 3FRIA 3ED5A 3P0FA 3QU2A 2KPOA 4EJFA 1JSXA 4LDPA 2PM8A 2QL9A 1XO1A 4K46A 4EGFA 5KVVA 3L7YA 3EGEA 3KOYA 4HXYA 3X1ZA 1HURA 1E9RA 4EG6A 1E1QA 4GC5A 4MQ4A 5K6AC 4K26A 1G3UA 3KJGA 1T6XA 4PVDA 3P32A 3RV3A 5JAQA 4IEFB 1F4LA 1GFZA 5IW8A 5AM4A 3VISA 3M81A 3MAGA 3I01M 4RM2A 4S12A 5LIPA 3ZKWB 3PA6A 4HFRA 4WZBE 1LEHA 4H7DA 5JPDA 4OQ4A 3BSYA 3TTWA 3PEWA 3WO0A 2WYOA 2CFOA 2X42A 4ZVQA 5LZ7A 3DDOA 1F1BA 4U02A 1TUIA 1FBNA 1Z7YA 4B3BA 4HVCA 4EKYA 1N57A 1QRAA 1PLLA 1RI4A 3LHDA 1E2MA 2B98A 4JVOA 2WB2A 1PFWA 3VHQA 2M2IA 4JBLA 3CN7A 1PT8A 2CN1A 4CJXA 3B3FA 3NUZA 3C3WA 1NBMD 2W2LA 2VXBA 2OHXA 4HEQA 1YS6A 2PK3A 1U02A 1W48A 5IAEA 5L7TA 3NJ8A 5AM2A 5HKOA 3TIGA 5JSUA 3I42A 3I6BA 4DIUA 2JVKA 3JYHA 4PQFA 1EE1A 1XKLA 3KZNA 4BBPA 1YJAA 2QF7A 1XA0A 2BGUA 1Z4OA 2HRDA 3ESDA 2VDLB 4I1UA 4N40A 1KH3A 1YJ8A 2Z04A 4OHVA 4E07A 4ZQEA 2OUIA 3LMKA 4KQHA 3WMFA 1AJEA 3VU9B 4OIMA 1DB3A 2X15A 2OC4A 3IQGX 3OPXA 4GM4A 4AM8A 1DO2A 4XR4A 2VSNA 4DUPA 3PIIA 3AL0C 1ADGA 2PAAA 4KXMA 4BY9E 4PS1A 1AS0A 1VHLA 3Q5GA 4PLCA 3RQSA 1YUNA 1G7CA 2P9EA 2FMKA 3AI2A 3ROTA 2FE4A 1PEAA 3BCSA 1LLFA 1M1ZA 1AHHA 1DFHA 1P7PA 2H1CA 5FBHA 2J09A 5BSEA 4QKQA 3ETJA 3G0DA 3HU1A 5JS7A 5CM2Z 4FFMA 2C8LA 3LECA 3DE4X 5EE0A 4IFBA 2RGAA 3ZUGA 4F5YA 4QRHA 4ZIRA 1SCQA 4EARA 3IA7A 2C7GA 2Z3VA 4UTXA 3LUAA 3PZBA 3FHLA 2FEKA 4U3JA 4PIMA 1K3FA 1WMAA 3E48A 4P7FA 4KPUB 1HO3A 2FRDC 3ZN2A 5IBQA 1E94E 3CNHA 2FW9A 1WLYA 1RRGA 1TYDE 2CW5A 2I29A 2PZKA 5AHRA 3TCXB 4P3PA 1W9MA 4NV1A 4YUAA 4KC0A 3OHSX 4OUKX 2D13A 3W8EA 1Y8QA 3WHLA 5C8YF 3PWSA 1H3EA 2R1TB 2I3AA 4ALJA 3HVUA 3IBYA 5GVRA 3Q7EA 4YJ3B 2GILA 1IB0A 2AJTA 5JRZA 3PX3A 2WYWA 2VQEB 4C07A 4LJ8A 4KFCA 1N5MA 2B1QA 1XZFA 3A7DA 3CO5A 2WJ3A 3C6MA 4B3TB 4PRYA 4OYYA 2I66A 3B1FA 4ZZIA 5IPFA 3U4QB 1XD8A 3PX2A 3AGPA 2PZAA 2X5KO 3JZIA 2FFAA 3TL6A 4DLXA 3F5FA 1EINA 1URPA 4UW9A 4JXXA 3MQFA 2FMTA 1GFSA 1JW9B 1X8JA 2GF2A 4FJ0A 4NL4H 5DGDA 2CNDA 3ZLBA 1NM5A 2EEZA 1PV2A 2W2XA 1V11A 3H1EA 3NONA 3P8ZA 4YJ2B 4YN3A 2M6KA 4UFPA 5IXJA 3PLAE 1VRVA 1FMCA 2GFHA 2JH9A 4I14A 1X9GA 1YQ9A 2J5XA 4ZRMA 3SCZA 4EK9A 2NUTB 1ML3A 1N7JA 4XB2A 1K5GA 1XF9A 2C5HA 2NU7A 4JGGA 5T4EA 2GN0A 2PX8A 1RXWA 5EJ6A 3KL4A 3E9CA 1VHTA 3IAFA 4GYKA 1A4RA 4EGAA 1HX7A 2WU4A 2EJWA 2E37A 3Q1LA 4XLZA 4ESVA 2ZJ4A 1JAYA 1UP7A 2M1ZA 4NX2A 4BE7B 3HEBA 4Q03A 4RAOA 2XVMA 1GM5A 3EG9A 4TZKA 1UFKA 2ZRGA 4EG7A 4MB6A 2R65A 4OGWA 1H5QA 1I8TA 1JR4A 2GBGA 3TLBA 4FSHA 1AX9A 1CD5A 3S70A 3HDVA 5CB8A 2ZR8A 3AUYA 4MAFA 1YOVA 2O2IA 2HA5A 1RHUA 1DPFA 3A3YA 3HI6A 4PINA 2H2HA 2G83A 3DB1A 5BYBA 1UPXA 3BIJA 1Z17A 3BH7A 3SXJA 2COUA 1P2SA 3L1IA 1IBKB 3OECA 5CEEA 5DGXA 1MIOB 1O6BA 1ENYA 3PDJA 4MQFA 4A73A 2JLWA 3FCSB 3HGQA 2BZ1A 4I50B 4LE0A 2X0EA 1FDUA 4MVJE 1M0SA 4PGGA 1CB7A 5KQGA 4OJNA 5KPJA 2C7OA 4OLHA 1FLVA 2C2HA 3LGAA 2VPZA 2HR1A 5TLSA 3GEHA 2C8JA 2QN1A 3ZY4A 3P0EA 1CHDA 3K9CA 4CUJA 5CFLA 3ASYA 2ECFA 3DJFA 2XUFA 3FYSA 3LDHA 4W5TA 4CN8A 3MT8A 1S2OA 1W88B 4B9EA 3H83A 1GZ7A 2ZI9A 1WW8A 3DP7A 1JNXX 1SR8A 1YB5A 4K81B 2P2NA 1SD1A 2V97A 3HJAA 4XWKA 2WB4A 3ABRB 5TQ2B 2XB8A 1P72A 3IBGA 4GMHA 2QS9A 4N18A 1BXZA 1HOXA 3ZDYB 4B17A 3ZPXA 3K70D 3KHUA 1MOSA 1YRQA 1CUGA 1X8XA 2JATA 1AB5A 3A1CA 1D6MA 5TMEA 3RBXA 3F8TA 1FVXA 4AJJA 4XFDA 3GLGB 2CT8A 2X0FA 2ZDGA 3FXAA 4F3YA 1TRHA 4MUKA 1BRTA 1H4QA 1ZD4A 4Y0NA 3ZUPA 3LY7A 4Z7OB 3R09A 4OHRA 2MSEB 5JYEA 1MJHA 4ZZ3A 3H99A 2QDXA 4X1IB 1H3FA 4KE9A 3A2KA 4PXYA 4AN4A 2NSYA 5CUQA 4EF4A 1L7DA 3HCCA 4BXOA 2EIXA 1I1NA 1GPYA 2CB0A 3ESBA 3F9IA 1P8AA 4MKHA 5H3CA 4EDFA 1FK8A 4MR9B 2AOWA 3O84A 1OXMA 2HBYA 3O8QB 4D9FA 4DNOA 5JCOA 5C8YB 1ZK1A 5TPWB 2BFFB 2RI0A 2H3EA 4DT1B 2E3JA 3EC7A 5ICEA 1W44A 4PCVA 2PX2A 1AGRA 3H7AA 1LQUA 4AY5A 3TLYA 4F6RB 1XEAA 4ZCIA 3ERCA 1ZJ5A 2ZPTX 3TEJA 4MYRA 2PUEA 2Q41A 4B71A 1EHCA 1CT9A 2YY5A 4AD8A 2C9YA 4L8YA 4RD0A 1SOUA 1KNXA 1A5TA 2WWIA 3L84A 1RQGA 1F3OA 3NATA 4LVUA 4F92B 2EZ9A 2Y0PA 2ZCUA 4WY5A 3RSSA 1DC6A 2TMYA 1SQSA 4U2EA 3OMLA 1UOPA 3FPGA 4GRDA 4FR5A 4HY3A 3DLAA 3UATA 1ZM2A 1NOKA 1TQHA 3L0IB 4FP9A 5BSHA 5JH7A 3RVLA 1NHGA 1NN3A 3ZEIA 4JLMA 4TQAA 1E1RD 3M8KA 4V0MA 5BYKA 3H2SA 1OX4A 3DOEA 1J2RA 2Q5CA 4FYHA 1DARA 4X5OA 2GZHA 4GQIA 2XT0A 2GVNA 3CEMA 1U0EA 3CGGA 2HA2A 4RW0A 4BKMA 4UBKA 1A2OA 1I9GA 2GA8A 2PMBA 2P9ZA 2ACVA 3PDIB 2PRKA 1NBIA 4ED9A 4A8JB 3G0HA 3O3OB 4BQSA 4ZK6A 3JALA 4PCAA 4NHEA 1PSDA 1P0QA 2GZAA 3WRYC 5KNCA 3MGCA 3GOQA 2YCBA 1R6UA 4NP6A 5HZKA 2EARA 1J8DA 2HGZA 4Z4GA 2P77A 4PZLA 4KJXA 4RLHA 1G9SA 2M98A 2QGFA 3I0ZA 1VOTA 1J5XA 3LCVB 4RIFA 3U5TA 1JWAB 2OKGA 4IV8A 1LNZA 3EARA 5IC5A 2YOGA 3ANTA 3NYIA 3THSA 4NMWA 2LV8A 5K9ZA 3JATB 3ZX5A 1S2GA 4K28A 4ZYXA 3SDSA 2SICE 4WACA 3WGVA 5A6SA 3VR4A 4ISBA 2D62A 5EXXA 2IY9A 5EXEA 1Z07A 4HRXA 4KXQA 5JXIA 3QM1A 1Z5ZA 4DPKA 4RHXA 3OQMA 1UK9A 5KYWA 4COOA 1QHEA 4KWCA 5JZVA 1NXTA 2FV8A 1IN8A 5IK2A 3E7FA 3Q0IA 3TFQA 1PEKE 3JQEA 2FPGB 3AJDA 3T8YA 1DIBA 1NR5A 1RAFA 2I4MA 3LS2A 1R6VA 1ZKDA 2FY8A 4DXAA 5JSZA 4V0LA 2O8FB 2FDRA 1UMDA 2GARA 2I4TA 3DMRA 3ZHYA 3EHEA 5FV4A 1P5RA 4MP8A 4MW0A 3CJQA 3DAFA 3IJPA 2ZRBA 2Q5JA 3QV2A 4CGZA 4RTMA 4PYRA 2R86A 1BOFA 3PC3A 3CNQS 3E7XA 3HLKA 3U7JA 1VE7A 2QUHA 3ZWDA 3PZRA 4X1YB 3RTEA 4Z1MD 5B7NA 3DBHA 4WBNA 2HLDA 1I7NA 2PWZA 3AETB 2WJWA 3GEBA 4WOCA 4F12A 4ZYVA 1JFTA 5AOAA 3ICEA 1JJIA 1TZBA 3RPEA 3AUFA 4FOOA 1G19A 4ZT5A 3AM5A 2A1TR 3CVYA 3NHFA 1ZVKA 3E6AA 4YRGA 3ZD7A 4FFPA 3G5MA 3PUHA 2OVFA 1NVXQ 4O33A 4DRZA 2OCIA 1JGTA 3L0YA 3ESXA 3LNTA 4Z9FA 3OJFA 4UCXA 4IFIA 3NHLA 1XD2B 3BXEA 1DX9A 1OLXB 3EQ8A 5A4MS 2X9GA 1B14A 4L9SA 1UEIA 1SVKA 3ZWYA 4KIJA 4MQBA 4WI1A 1J0XO 3VNVA 5G1NA 5K3FB 3U6BA 4F0JA 3GCWA 3LPDA 5IN4A 3L5OA 1L3CA 3EC1A 4NYJQ 4LK3A 2OXRA 2Y1LA 3HKDB 1T2VA 1HSZA 1I3LA 5H59A 1V8BA 4HV4A 2EKPA 4X65B 3KDSE 3FZGA 3W1EA 3A6PC 3RAGA 3K9NA 3M49A 4IILA 2O3TA 4GKAA 4RQBA 3VGPA 2ZVDA 4R7ZA 2ORED 4QDUA 1A5AB 1H8ED 3M6XA 3QOFA 2J9GA 1E32A 4J8PA 3CCBA 3PD0A 3QE3A 4X62B 1QF6A 2W71A 2AYZA 1Y9EA 4B2PA 1NLYA 4E12A 2WBLC 4JGBA 4MA0A 4LWOA 3F6EX 3NV7A 4W5OA 3HZHA 3CTPA 5E4FA 5H16A 5AJXA 4AY4A 5AK0A 3PFHA 4JC0A 5CYGA 2YUTA 4JV5B 4GLJA 1OX6A 4E5KA 4QJ5A 2FOLA 2NAFA 1USVA 5JO0A 1QP4A 3NYWA 2V3CC 3N8KA 4J4TA 4PCLA 3WLMA 3HKBA 4DV6B 4Q47A 3NR2A 1HDRA 2CWWA 1KQGA 4HMPA 1JH8A 4MUFA 1J90A 3KHTA 1JH9A 3V8MA 3IILA 3M6IA 4DQUA 2CUKA 1E2NA 1JF8A 3LQ2A 4PHTA 4EEKA 1ZFNA 4NQZA 4ZVTA 2RB4A 3SF0A 5GIOE 3FNEA 1NVBA 4E2WA 4B6OA 1BMFD 3HJNA 5GP1A 5JS2A 1T3ZA 4KWIA 1PQ4A 1G18A 2QVLA 1P45A 1PHRA 3L4KA 3ZDFA 3IDFA 4EG3A 2I76A 3O9VA 4CG3A 3AH8A 1XRJA 3T1QA 2VPYA 4JVSB 4LI3X 1QAOA 1TZ2A 2XCUA 4Y8VA 2EYUA 1HV8A 1TJ5A 2Z8ZA 3EPHA 1NE7A 1QKKA 2GBFA 3G7SA 1B42A 2OXCA 3QUSA 1L9XA 1VA5A 4TROA 4CV0A 3BPSA 3UK0A 2RAFA 2X0NA 5EVCA 4NICA 3OPQA 3UMGA 4MEBA 2XMSA 2QUZA 4WKBA 3X2EA 4D8VA 1QGYA 1PTJC 4DLRA 3V5NA 1E3DA 5CX1A 7REQA 3QLVA 1CS0A 4KLNA 1GDDA 4MTLA 3N28A 3UH1A 2GYYA 1PR3A 1QHSA 1M2KA 3COVA 1QE5A 2VDWA 3KLBA 1GKUB 4BB9A 1ECJA 5F51A 4GMXA 3O7MA 3GPCA 3KVYA 4KI7A 221PA 4ZDIA 2O8DA 3GUZA 4D97A 2JGDA 4CPDA 2H16A 2QTFA 1PJLA 3GLSA 4D82A 1RI2A 1DZ3A 2WOOA 4AN0A 3CB2A 4MGZR 1MVOA 3RVSA 3UAVA 4KO1S 4V03A 3KLMX 5E7QA 2C2BA 5K8JB 1VC2A 1GSIA 1CCWA 1VZ2A 1SC3A 3VR3A 3IE1A 2OORC 3WL6A 3WDSA 3DMDA 1WEKA 5EIEA 4LHEA 1RJWA 1BE6A 1ETUA 1RXIA 1T8YA 2BHRA 4HHEA 4K5QA 3BBPA 1HH4A 5K6TA 3CJRA 5KYUB 4ND6A 5C4MA 3AW8A 4QUGA 1UT6A 1E4EA 4QU5A 5E6UA 1WVMA 3B6IA 4F4IA 1L5RA 3VPHA 4BV3A 3LUDA 4G36A 3CF4G 2AZDA 2FEMA 3PL1A 4X1KB 4BLRA 1D03A 1TW2A 1JEQA 1L4NA 2D2XA 4D0NA 3L7BA 1SRRA 4ZTUB 2GCIA 2V7UA 4MIYA 2X7JA 4MAAA 1XZCA 4G1VA 3IEIA 4E5MA 5DEOA 2PMFA 5FPKA 3J81k 2PGAA 2AXNA 2I1VB 4ETIA 4V0QA 5IFLA 1QQ6A 1E98A 5JI2E 3VAAA 2ZJFA 4B3JA 1JIIA 2EL9A 1C8LA 4LNUA 5G0SA 3B82A 2Q9UA 3FUTA 5ALLA 1Z2PX 3CQ9A 1F8FA 1IQ0A 3TZCA 3V1MA 1IIRA 3ILVA 2CC2A 4JLSA 3PQ5A 5EIOA 4JCOA 5HQJA 5BRAA 2AIRA 2AN9A 5DI3A 4LFBB 3WLFA 1OC2A 1Z47A 1OZAA 5D3MA 4KQ9A 4OBBA 3F2VA 1F0PA 1B6GA 2CCJA 3VNBA 5T4HA 2PUJA 5ESXA 2E5LB 3RR2A 1N9ZA 2B78A 2J4CA 2UZ0A 3HNOA 2BL4A 3EWIA 3THWB 2FDCA 4XASA 1YL7A 2GYWA 3QGMA 1CU1A 2VNHA 4KW7A 4EDHA 1VI6A 4YRIA 3E3OA 2PSSA 5JROA 2IPNA 2GBPA 2UYYA 5IRCD 3UCFA 1A7AA 3GFGA 1MRZA 3WTBA 1SZPA 4CV2A 3L8GA 3UJAA 1JQJC 1KJNA 1EVLA 4DCGA 1KYQA 1Q1NA 3IB3A 4PG6A 5EKUA 2DRIA 2GVZC 2X4LA 3NETA 2YZ2A 4L4XA 5JZ9A 1XHFA 3GD5A 3ORFA 4W5JA 3EK2A 2XGJA 2C4NA 3I04A 4YAIA 1H9CA 4KMOA 1VB5A 5AP9A 3BTUA 1PGNA 4RJLA 1GRCA 1JFLA 4EITA 1YMQA 1CY4A 1EB9A 1M8GA 2R79A 2Z5FA 3MGAA 4MI6A 4LDAA 3RRXA 1RRCA 1A8HA 2I7TA 4H0FA 5JPIA 3LQKA 1HETA 1M6NA 1OA0A 1TIKA 2AS0A 3WDLA 2IIQA 4C4TA 3V7NA 1ZPDA 3FKQA 2G36A 3GPLA 1DG3A 1FLAA 1YUBA 1Z74A 4KR7A 1J24A 3VHXA 5KVQA 2FHSA 4RLFA 2REBA 5IAGA 3TLGA 4IXMA 5EWLA 1KNQA 3U40A 4ENSA 5BW6B 3M2TA 4NJOA 3CEAA 1DO8A 2C83A 4S05A 1JP7A 3T41A 3NFRA 4O4HA 1P5JA 5AXBA 3VQTA 4UREA 1L4MA 2XWJI 4S1PA 4XYBA 1RWQA 5GV7A 3UUFA 3K16A 4GZMA 1MOZA 3D4PA 2GN9A 2UYHA 1FA9A 2CCGA 3KB6A 2QD5A 4N7RA 3CWQA 3FWYA 1S2DA 1YDWA 3QFCA 3A6JA 3KEOA 1QHHA 3EXAA 1P7YA 4C7MA 3H5AA 2ZVJA 4GUAA 4N3BA 4P6VF 5FBQB 1C7IA 1G17A 3V7FA 3WYEA 5K0CA 2DFTA 4MW9A 3GEDA 1CIVA 1TM7E 4Z9XA 1WUYA 3EFHA 2V9ZA 4LRTB 4UNSA 3EWNA 1GZHB 2OB1A 3FAZA 2HNBA 4EUSA 1OKKD 2Q28A 4QXPA 5BNFA 4I99A 2VUSA 3AMVA 3DZFA 1C2YA 1CETA 4OJQA 1QOQB 1T5HX 5FO0A 4E08A 3I61A 3PGLA 1U28A 2O50A 3NAGA 3W0LB 5IT4A 3TIXB 1GUYA 4OI0A 1F51E 3A05A 1HDXA 3WNZA 1SUCA 2VUHB 2PEZA 2YXEA 2DTDA 5FWYB 3KHKA 3E9YA 1XKQA 4K1LA 4YP7A 3GFPA 1AS2A 3VYUB 4BWVA 4UQPA 2HBRA 3OCWA 1NRWA 1QCDA 5K51A 4ERXA 1QU2A 5A6VA 2WIFA 1AF7A 1U7PA 2BKUA 3OO0A 2BT4A 2Y67A 4KQKA 5JNSA 1WE2A 1X1AA 2IV7A 1YA8A 1DCKA 1KS2A 2DU8A 2J8ZA 2X9QA 4RGQA 1XQVA 2NZWA 1DC3A 1SUSA 5AR1A 3L4BC 2WTEA 3U7GA 2G9QA 1NYQA 3GZNB 1T29A 2FG5A 4I6JA 2V03A 3UIEA 1EQ2A 3DEAA 2Z95A 3GA0A 1OFTA 3AR6A 3K9LA 4LJ5A 4NEGA 5DW0A 5IJ9A 3OSZA 1LLCA 1YCGA 5IKMA 4K6HA 5HW0A 1QZTA 3Q3CA 1OBVA 4FWBA 3VI3B 3WKCA 4D9BA 1OHHD 2J7KA 3UJ6A 4DY4A 4ZDKA 1L1FA 3TKLA 4D80A 4DQDA 3CMCO 2WF5A 1EM6A 1JDBC 4GMGA 4ZODA 2FTKE 1WMSA 2AJCA 2B6HA 4JAVC 3R0VA 1RJ9B 2HBQA 5A04A 3E7PA 1Q0LA 2OTCA 3DAOA 4NAUA 1RVDA 4YQFA 3TR6A 2JLSA 5MGBA 1SUWA 1W4BA 3AKYA 4DV5B 2OL4A 4ZI5A 4UHKA 3BKWA 4RWEA 2V55B 4UUOA 3TBFA 2X3UA 2WG2A 2NT4A 5IDXA 2PQMA 2EX0A 5K2MA 5EUMA 3DMYA 4TS1A 4EKEA 4G1MB 2N46A 4RJIA 1C3VA 2JD2A 3KV3O 3JQAD 4HMOA 1H05A 3I6ZA 4HADA 3ZNPA 5BVGB 2FPPA 4IMRA 1OU0A 2IS2A 1G21B 3OLXA 1H1LA 1ITZA 3RC1A 5CXUA 1CE8B 1Q3KA 3KTAB 3A4TA 3BWDD 1DTSA 4K9PA 4U9UA 5AKZA 1Q3TA 1QIMA 1RCFA 1WXHA 2D2IA 2Q6TA 1SFRA 2R2GA 2X1HA 3DA8A 4UVDA 1OR8A 1TQDA 1NXXA 5DM60 2WLSA 3I64A 4BTVA 3UYKA 4X97A 3D3EA 1LQTA 1NONA 1SVNA 2PGDA 1KFEB 4CV3A 5KHLB 2CLMB 1GQ2A 3MJ4A 1SCIA 3OLCX 4YALA 2VJQA 1X92A 4Q0MA 1EGVB 4RACA 4KK4A 1UWCA 2Q4TA 1DL5A 3H9QA 3UMMA 2OYSA 2QX9A 4MV5A 4RKQA 3LFTA 4S1NA 3P9KA 2ZUFA 4AW9A 1NW3A 3WGNA 2K7FA 1AV7A 2B1IA 4OHKA 4S1TA 4AY2A 1GTVA 1W8IA 1ZLXA 4UOQA 1JJBA 4IGFA 2PT5A 5EGNA 3ESAA 1J39A 4A0GA 5HRCA 2FLKA 4DTIA 1QG4A 2AG0A 1ESNA 3HY6A 3JARB 4X45A 3HCEA 2ERYA 3DDUA 1Z3CA 4OB7A 2PBLA 3MC1A 3HR8A 1AK9A 2JHFA 4OGKA 4RV5A 5F23A 1BSVA 2A67A 1UADA 1G9XA 3DDZX 5L3ZA 1RRMA 2PA3A 4X8MA 3ZI7A 3HFJA 4ZEWA 1LFDB 3ZVRA 4EHKA 4YJ3F 3ILSA 5BO5A 4ND8A 3BRSA 2NVUA 4N5DA 4KIFA 4OGFA 3C3PA 2BGRA 3G0GA 4XRGA 1BH6A 1LK7A 1TJ3A 2JJMA 2Q99A 3DZIA 1HDGO 4IGKA 5CJPA 2W2KB 3WK4A 1IHDA 3CF6R 4WK2B 3GPBA 3STVA 3WB9A 1J1UA 3GGDA 1PF7E 2O20A 2I1WA 4JUCA 4OG2A 1KFKB 1P1RA 2JBAB 3OOEA 3EUEA 3GLUA 5BSUA 4BUCA 2NP7A 1JAXA 3MS4A 1N4AA 3NTOA 3GEGA 3AF2A 4KLCA 3SX2A 1DFGA 1Y1TA 2DY0A 2Q4RA 4IDAA 3F47A 3HSSA 1ST3A 1OMOA 1Y9AA 2V7QD 1N2CA 1U7TA 2OV2A 4I4TB 1N6NA 1Q0QA 2I7VA 2ONCA 2P4QA 2WSSA 4D81A 5IJAA 1BGVA 1E5XA 1C4OA 1XZDA 4AUEA 3LXXA 2QP3A 4GDFA 5KJ1A 3K2IA 3ZGVA 1E2IA 3GJRA 1PRYA 1V4BA 2Z6AA 3TQQA 4YS6A 5BXQC 1K5HA 1PN3A 4NNOA 5T4FA 4TV8A 2WTUA 4UULA 1D8TA 4GXTA 4HO1X 4JR0A 2DF8A 4CMKA 1WULS 2YNMC 4DDUA 4Y2TA 2F17A 4XQEA 5H4HA 4RTLA 5AJZA 4F3NA 4HX2A 1F3LA 3LX4A 4OQXA 4Z3OA 1MRSA 2WIBA 2ADFA 2RJOA 2BGGA 3H2JA 4OB6A 3A36A 1RI5A 2AK3A 4O2AF 4OHOA 2CEKA 4BN4A 4D0GA 4HWPA 5EIFA 1A7KA 3N2IA 3VYRB 3EA4A 5DHQA 3CKLA 4FLEA 3R6DA 1NLFA 4ZGBA 5A1JA 1FE8A 2FSPA 1V71A 3CUSA 4P4SA 1O8CA 4LA4A 4AIRA 2BHLA 3Q3JB 4PLVA 3KOUA 5FNVA 1J0AA 2YFKA 1XNGA 2F48A 3ENKA 3RV4A 3BFKA 3VO2A 3INYA 5LZ2A 3KLOA 4DVJA 3JAMA 1MCZA 3IEUA 4MV6A 3VAYA 3KB1A 3IBFA 4DMRA 3LLSA 1P9NA 2PLNA 3FPAA 3IIIA 1K92A 2OK8A 4R8VA 4Y9TA 1E6EA 4YPVA 2YY6A 5DNCA 3VR5A 5FDFA 1CBUA 4FCCA 1N0WA 1Z0FA 1GTZA 1DLJA 3ICWA 2NXWA 4L1KA 4DPLA 2CMDA 1LPPA 1GL3A 3PVCA 4BFWA 3W9SA 4DCOA 3R3YA 1LXCA 2JC3A 1HM5A 4TXJA 3VOTA 2Z8YM 4BVLA 5ALVA 1N1DA 3MW8A 3S2YA 1CUIA 3NAZA 5I7VA 1MW8X 4EZBA 1N8TA 4QUAA 3RANA 3OIGA 3OTOB 4BU1A 5AW8A 2R6R1 5J1SB 1CW2B 4PZPA 1XQXA 4RY9A 3ZDRA 3P7MA 1XG5A 5EINA 3KYCA 4JOCA 2QTWB 1NIPA 3RBZA 3T7TA 3WGTA 4CU5A 1WKBA 1JEYB 5CH8A 3ZDBA 3N7UA 4OAOA 3FPKA 4P54A 4W4TA 4QASA 5EQDA 2MCFA 1DGQA 4AWBA 1UOOA 3BB4A 4TWJA 3FJYA 3G5LA 1NF3A 5EHQA 2AQKA 5GJWC 3USZA 1J21A 1P81A 1YHYA 3T7EA 4LQCA 1KAHA 4KUGA 3VBCA 3NP9A 4XB6B 5EE9A 1CV2A 4C03A 1M74A 1F8YA 2R25B 3OZ7A 1B0UA 3ZY3A 2QP9X 1GPDG 3IXMA 3IVAA 4LYJA 3V1YA 4B35A 4IP0A 1A4UA 4FFWA 4NJMA 4W1PA 1KJ9A 3KOZA 3VU0A 2J7PD 1RI1A 2PLWA 2XUDA 4YI5A 4BLPA 4F2WA 3PR3A 1GG9A 1R9MA 3I1JA 1E0KA 1NKVA 1QO0A 1SGWA 1XDGA 2FX2A 3OOSA 5IARA 3W9UA 4ZZ0A 4Y0VA 1NVUQ 4XUEA 1ZM9A 4TKMA 3RIMA 4DMFA 4LHSA 4EAAA 1CY0A 4Z4IA 5FTJA 1VL5A 3OH8A 2ESRA 4CM1A 1BMTA 3N9IA 2XW6A 5CA1F 6REQB 5L6MB 3UAWA 2QW0X 1GVNB 4BASA 1O9GA 4LZZA 2B5WA 3QWIA 1NQTA 1NZFA 3O9ZA 1TTPB 3BRWD 4X8HA 8ABPA 3TUZC 4M49A 1CTQA 4DMGA 4ZU1X 1N2OA 2Q2VA 4NC9A 5LQSA 2QG6A 5IABA 1Y8AA 1TEZA 4YRPA 1VE3A 3M5CA 3JRXA 5FXMA 3W79A 4PHCA 3LY8A 4OHXA 3KHSA 2FN8A 4RDIA 3PWKA 1V16B 4K8OA 1ENZA 2WQ7A 1LLDA 3C8MA 4PW0A 4MW7A 5CIYA 1CEQA 3AR5A 2INGX 1XWWA 4KNYA 2HUPA 3O2SB 5DGTA 4PLZA 2WD7A 5HF8A 3R7DA 1X1EA 2OHOA 3PPIA 5ALEA 4PC7A 3M9XA 3Q6NA 1VYTA 1Y3HA 2BKVA 1OF1A 2NUPB 3NBYC 5A3QA 2ID8A 4AXBA 4HT3B 4N4AA 1Z5UA 1JHVA 3L77A 2VRCD 3HYNA 4YXWA 2YYYA 3CX3A 3BWXA 4XWGA 4UBNA 1TUEA 3BMOB 1GV1A 3R3VA 2OZVA 3QE2A 4R9VA 2QV7A 4ZT2A 2OZLB 3WYGA 1RQ2A 1U7DA 3GT0A 1O6FA 2JEZA 5A2GA 5JEDA 1QFSA 3B53X 2Z58A 2CHFA 4GVLA 5IASA 3B60A 4WZ6A 1DTEA 4D3DA 3EZ7A 4H7EA 2ZIGA 1PQWA 2JIZA 4RJ2A 5E4JA 4V0KA 3ENNA 1E9EA 3JPYA 2YWGA 3I3SR 3NWBA 2FZ5A 1HDIA 1OAKA 4BVBA 4DBVO 1FW6A 2PX5A 3DVQX 4F2DA 3ROKA 4OP2A 3DT8A 2R0QC 1UKYA 5GV8A 1O94A 4WNAB 3ZY2A 4IEIA 2CJYA 2X2EA 2MSWA 3O8OA 1JAHA 4BAUA 3G8BA 1EDDA 1P3DA 1QC5A 5AM1A 5HCNA 4CRWB 4W7IA 4X20B 2OZEA 2V6FA 3GYGA 4TWIA 1JKXA 4B75A 4OA8A 4UOZA 2Q6VA 3RVJA 5E3HA 2B25A 3DTYA 4Q3CA 2W2QA 3RIGA 5BWOA 3DFZA 2Z6UA 4HATA 1GAWA 5DVZA 3GAFA 3S6JA 3ZCQA 1LW7A 3O91A 2VYVA 1KEUA 2PWPA 2YOHA 9ABPA 1EGQA 4RHFA 2I22A 4W1SA 3L01A 1NPDA 3WL3A 1AOXA 2DPGA 5A9SA 1U8ZA 1EJ2A 1XTTA 4O8CA 4XW2A 1EMDA 2J87A 3JQBA 2V9PA 1P9LA 4MRAA 1C9NA 1KIAA 4Q3LA 4RA6A 2LBPA 1JVBA 3GCZA 4HDMA 3ROMA 2WUVA 3MUFA 4BFUA 1RFLA 2V59A 1S02A 1Z15A 2HQOA 2OWDA 1L5SA 1D7AA 1VCNA 2VYND 2ZRNA 3H18A 3WNVA 4B83A 3UBTA 1T0UA 4W5QA 1NNUA 1EGAA 1Z35A 3BMQA 3M5WA 4IUBS 2A78A 4C2TA 2YJ6A 2CZQA 2PZMA 2X8BA 2PZGA 3DL4A 3FPSA 3LT5A 4O4JB 4RK5A 4IDEA 1GWNA 4RWZA 2D5AA 4OQQA 4U39A 1OSNA 3HL4A 5TC4A 3GLIA 1QORA 2HXGA 2DERA 3NKLA 1C14A 1M8KA 3R0QA 4JLJA 5T8KC 3DVAB 3LDAA 3H9GA 1JEEA 1E7RA 2J48A 4UVEA 1OFHA 2QLMA 3BSFA 1R5OA 1DBSA 1BE0A 1PJSA 1TKAA 5HGXA 5FOSA 5ADVA 5HUQA 1JPVA 3FTDA 4F5EA 1CLEA 5CEJA 3E03A 4CU2A 3MRXA 5DASA 1GZDA 5E4TA 3V4VB 4DSZA 4X3CA 3TYXA 5DNEA 4MS1B 1E7SA 2W00A 2YJNA 2DJIA 2FCRA 3H8VA 3PIRA 1TO1E 1T2FA 3WJ1A 4AP5A 1MO5A 4G9GA 5IM4F 1LX6A 3M1YA 2GI4A 4JITA 2OV3A 2P69A 3B3JA 2ZUCA 3DAYA 4DWOA 1IBMB 5AKIA 2Y8EA 1UBOS 5BN4A 3OD1A 3VHRA 2X76A 3LRTA 2Q7OE 4HMQA 2L69A 3TOCA 2PUFA 3WNCA 1E0AA 3NBZC 3PHGA 4JYPA 4CODB 1DC8A 1QP0A 3ES9A 1KOJA 1UBTS 3RYFB 1MV8A 1H2XA 4JFRA 2BGIA 1A5BB 1BO6A 2PWAA 1U0GA 2FUCA 3GLVA 3JWJA 4K6OA