4NE2A

Pantothenamide-bound pantothenate kinase from klebsiella pneumoniae
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
309
structure length
304
Chain Sequence
LMTPYLQFNRHQWAALRTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate kinase
publication title Structural characterization of a new N-substituted pantothenamide bound to pantothenate kinases from Klebsiella pneumoniae and Staphylococcus aureus.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
total genus 100
structure length 304
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ne2A00
1D2MA 1OH7A 2XZOA 1ZCBA 4LC0A 4XH9B 3K1JA 2OLKA 4XWKA 4FMDB 3U7GA 2ZI4A 4TMKA 5EZ5A 4IDHA 2MMCA 2QEQA 2ZPTX 1XX6A 1QHHB 3KQHA 1A5TA 1IN6A 1HE8B 1H65A 2ZI9A 3QF4A 4MRVA 4Y0AA 4ZKEA 4KSCA 2PLRA 5H8WA 4OHXA 4D26A 2SHKA 1NG1A 4TZ0A 1EFUA 1SVWA 2FJUA 2IYQA 4BLOA 3TR0A 2FZLA 2OFXA 4MKFA 5FPHA 1YZUA 4GOJA 4ZI3A 2ZRDA 4ABYA 3UKDA 1W48A 2PCJA 4DVGA 3VNUA 1BO6A 1NBMD 5J4YA 1EGAA 3MWYW 4QNMA 3BAFA 2OESA 2AXPA 2IWRA 3QKTA 3T06B 3B9PA 3KUCA 4DIEA 1ZD8A 1OB5A 4WVFA 2VBCA 3BS4A 4A6XA 1YZQA 2VP5A 3CBQA 1X1SA 4A6PA 2OG2A 2D2FA 1E79D 1J7KA 1OIVA 4C0BA 1OHHA 3BD9A 4HB2A 2EFEB 3ZIAD 3KB1A 2G1JA 4BASA 2JLWA 4Z8XA 1GL7A 3FGNA 1KK1A 4AIIA 3TRFA 3UANA 1OSNA 2ZITA 4IOLA 4NMMA 2FH5B 3CW2A 4AG5A 2PZFA 5L3QB 2HYIC 3LX8A 3SR0A 2JDID 2VLIA 3DO6A 4KJZA 2GA8A 1HA3A 1E2IA 2QGZA 3NG1A 1RVDA 2QP4A 5EUMA 3TUZC 1KK0A 3NDBB 4ZDKA 1PUIA 4QGFA 5FR2A 4DSOA 3A58B 4G5SA 1KMHB 2V3CC 1XB2A 1KSGA 3D3QA 1XJCA 3NKVA 1Q3TA 4TWZA 4MKGA 2R8RA 3QXHA 1UEIA 3W6OA 2WWYA 2YINC 1OXVA 2Q9AA 3NWJA 4M0LA 3EIEA 5KUTA 3WRXC 3QPWA 1P6XA 2DCUA 2GEUA 4DB2A 5AR1A 4PZLA 2DFNA 3T35A 1OT3A 1TPZA 2WPDD 3MFYA 3OEED 4OQFA 4Q1FA 2JATA 2YWGA 2YWHA 1NN3A 1Z0DA 1ZBDA 2UVQA 3THWA 4DIDA 2EFDB 2OBNA 5DHAA 3N2EA 4Z51A 2A5YB 2FEOA 1U94A 4Q1BA 5FOSA 4B33A 4RCYA 3U6BA 2OEPA 2ZE7A 5K8LA 2B92A 4PC3A 1XD2B 2QMUA 2O8EB 3PUVA 4GNKA 3U3JA 2XOKA 1XD9A 2IUSA 2KBEA 5EE1A 5CJPA 1P2SA 4F4CA 1YZNA 4X8HA 3I4LA 3G5UA 1OJLA 2ZRBA 1KHTA 4EUNA 5KNBA 3GEHA 1GFIA 3B1VA 1LFDB 2W2VA 2IS2A 2J1LA 4DBLC 5UKDA 4URUR 4DDUA 1LF0A 3LWNA 3GLHE 1NNEA 4G5OA 3KQKA 4WXRA 2QPAA 4ERNA 4D4KA 4ACAA 4YXWA 2QQEA 3VHXA 2C98A 4TYQA 2OV2A 2VEDA 1Z47A 1XWIA 1A1VA 1N0WA 1Z3IX 2YKGA 4LUCA 4JS0A 3C15C 4MYCA 3QPUA 4ZCMA 1YR6A 3JVVA 1O87A 2OM2A 2WAXA 2IF2A 2N42A 4PHTA 4LJ6A 3NEYA 4U5XA 2QT1A 3AF1A 4TSFA 3CRMA 2H8KA 4MUAA 2GTPA 1E2QA 4HAZA 4NCNA 5JEEA 3RHFA 2PJRA 3K0CA 5SZHB 2MSEB 4PZYA 2BKUA 3EWAA 2WWXA 3UWKA 3ZGXA 3AVQA 1G19A 3BC1A 1VG8A 3TW8B 2ZR7A 1W2GA 2DPXA 2UZIR 4MRSA 2GDJA 2IEYA 4M1OA 1YZTA 4YMSA 1Z08A 3AVOA 3SBEA 1KDPA 1P72A 2QU8A 4QBGB 1KI1A 4NL4H 4G1UC 1KZ7B 5BQ5A 3ZQJA 4KBFA 2ZJOA 5JWHA 4DLTA 1OH6A 2P2LA 3EC1A 2XXAB 4A92A 2OCBA 1BYUA 3LFUA 5GADl 4FINA 4WXPA 5KNDA 2GXQA 5EUQB 4NU0A 1G8YA 1UBEA 1AQYA 1NVXQ 5CM9C 3TVTA 1E2GA 1KI9A 2JLRA 5AUOB 4NH0A 5FUVA 2IYRA 1DG1G 1YR8A 4F7WA 4DUGA 3NHBA 4V0ME 3K0FA 2YHSA 3TKLA 5JI2E 1IY1A 4AYXA 3PEYA 1BKDR 1FFHA 1WBBA 2EYUA 4BEJA 2DYKA 3EASA 1Z6GA 4IFEA 4QHSA 1M74A 3HU2A 4NCHA 4B44A 2A5GA 4Q1DA 4Q9IA 5TXGA 3ZVLA 2J0QA 3B6EA 1A82A 3WXMA 3FTQA 3PR1A 4QFMA 4RD2A 4WZBE 4NHOA 3HU3A 1HYQA 2NPIA 1NIPA 4D0LB 1F2UA 1R5BA 1W4BA 2Z83A 1MR3F 4TZ6A 2UKDA 1T8UA 4JL8A 3WHKA 4DC9A 1G21E 4AD8A 3O8RA 3X1XA 3T1VA 3I5XA 4KHZA 1H8HA 2JLUA 3B1WA 1KNXA 1II0A 2ZSAA 4AKHA 1SXJE 1ZINA 3FMIA 4C30A 4QJ3A 1JXMA 2BMDA 4KFSA 4PPNA 4LCBA 1U8YA 1E0AA 5TY0A 1P5ZB 1CLUA 1P2TA 2V4ZA 2KWIA 2VRWA 1UKZA 3SJZA 3QF4B 4YDHB 2IYSA 4M9QA 1KKMA 5HTKA 2YWFA 4JKYA 1N2CE 4PPQA 4LPSA 4G5QA 4MKHA 4CEJA 2B7BA 4TMWA 1YQTA 2Z43A 1B23P 2QSZA 1BMFD 3A1TA 1J70A 1UPTA 4I1SA 2FSFA 4TT3D 5BXQC 3OF5A 3GFTA 1Z2CA 4TMXA 4L16A 1COWA 3QVVA 2QT0A 4Y0VA 3SBDA 1I4DD 2GJKA 1HUQA 2PEZA 3IIMA 4R2IA 4C0SA 1R5OA 2XTNA 3IQXA 2YOGA 2QAGA 2QE7A 4PC7A 3PENA 2YV5A 5HCNA 3RRZA 2CL7X 4OHYA 1CJUC 2BEJA 3NBYC 2V55B 4OK3A 3ADDA 2RGGA 4UNQA 2WAYA 4YMUA 1G8GA 1N6RA 1R4AA 5LB2A 2QAGC 1SGWA 2V6JA 3QXCA 1ZD1A 1PUJA 4UQOA 3KJGA 2ONKA 4ZIRB 1AIPA 4A8JA 3I8XA 1P4SA 1U8AA 3VR1A 2PH1A 1ZIOA 2O0KA 2CCGA 3I3SR 4C0LA 821PA 3EPKA 3DDCA 4CIDA 4Q9JA 5A5GA 4JLDA 4A8JC 5K8UA 1KY3A 3RSOA 5F2EA 1ZUIA 2Q21A 2XB4A 3DPUA 3IO3A 1AZTA 5JEDA 2QY9A 1CS4C 4GL2A 3EIHA 121PA 3QG5A 4TYYA 1A2KC 1W36C 3LLMA 1TADA 4IHQA 4W5JA 2GETA 1PZNA 3H4MA 1XXHA 4HLUA 1F3OA 3B13B 1OYWA 2HV8A 1KI2A 1KY2A 2ZYUX 3DKVA 3GD7A 1D8TA 1JAIA 1QHNA 3K70B 2CNWD 1NLYA 5L3RA 1G6OA 1TQ4A 1IHUA 3BH0A 4XSGA 2QPTA 3RS7A 2RGAA 2ZRNA 3LDAA 1WMSA 4C3ZA 1N6OA 3VKHA 3SOPA 4DCSA 1NVWQ 2Q3HA 1E4YA 2Q9BA 1OKKD 1W5SA 5B57C 1WXQA 2ZI3A 3R8CA 3THWB 4MRRA 3ZD7A 3AVWA 4OQMA 2VHCA 3AV0B 4HUTA 1E94E 4Q9HA 4ZPXA 1XEWX 1VCMA 1TQDA 4TMVA 4FIDA 1IJEA 2OCAA 3TVDA 1MRNA 2X8AA 4GRAA 4QBHA 3V4RA 3PEWA 3KKPA 3RC8A 3GQBA 4R98A 4ESVA 5JZVA 4DEXA 1PJRA 2ANCA 1WBDA 1O3YA 1NKTA 3BOSA 3LNCA 3OZXA 4Q18A 2JJ1A 1Z29A 3B1YA 2FSHA 2MMGA 3DKPA 3PCRB 3I73A 1RC8A 3EPLA 4ITRC 1U90A 4DLYA 5JS7A 1V5WA 1G18A 2C9YA 3EAQA 4CT4B 1G3QA 2ZE8A 2YYZA 1L7VC 1OPXA 3RYTC 1P75A 3MJRA 2EWVA 3LXXA 4JLOA 4DLZA 2WHXA 1K6MA 4TTPA 4D0GA 3ZLJA 1WP9A 3GLIB 1EFRA 1UF9A 3EG5A 2O8BB 4Q02A 4BFVA 3QE0A 4KI0A 1Z83A 2L0XA 3PIRA 4C2UA 1RFLA 3IPYA 4JIMA 3PV0A 4RJLA 3CWQA 1E1RD 1OE0A 4X8LA 1KAGA 1G6HA 5EXTA 5CDFA 4P32A 2DWQA 3AF4A 4DZZA 4URZR 4FD2A 4A2PA 2GJSA 1KO4A 4LJ5A 2WICA 2ZREA 1CULC 1Q20A 5L8VA 4KFUA 4M2LA 2QTFA 2QSYA 3WYAA 4OHZA 1N6KA 4P4SB 3QUSA 1HQYE 3OEHA 3OFND 4DDWA 3SYKA 1J8YF 2WOJA 1E0SA 4UNPA 3OE7A 2BMJA 3KB2A 4NYMQ 4GP7A 5KDDA 1VIYA 1OF1A 2K5UA 1BH2A 2HT1A 2OLJA 2RH5A 3I8SA 3TE6A 3WMFA 4D81A 1MRSA 1GWNA 5HR5A 2IC5A 2G88A 3OIYA 1TQ6A 4WAUA 1KSHA 5EP2A 3KKQA 1PLJA 4R7ZA 4TTRA 4RFSB 2CLDX 1KMHA 1N5IA 3GJ3A 4TMZA 3W5IA 4OK6A 1XPOA 2KE5A 4EIWA 2FSGA 3ASZA 1KIMA 1XDBA 621PA 5CK5A 1VHTA 4PHFA 1SXJD 1NN1A 4L9SA 3LQQA 4OYHA 1SKQA 5HPYB 1ZM2A 5TB5A 1AZSC 4AKIA 1DELA 5FH9A 2VP4A 2YC2C 2E87A 2J0SA 1S1CA 1Z6TA 3D6TB 3SHWA 2CHVA 3B9QA 1JR3A 1QG2A 3BERA 1D2NA 2MSDB 2ZAMA 3LY5A 3W3AA 4LV6A 3WMGA 1A7JA 1NMXA 1JQJC 2P6NA 3Q7PA 1WA5A 3BH6A 4B71A 5FL3A 4BFWA 2AHOA 2QP3A 4KCGA 1E9DA 4C0KA 5LPNA 1ZM4A 2J7PD 2NPFA 3CRRA 4OI1A 2BVNA 1XD2A 4NYMR 4M9SA 4WBSA 4BZXA 2HF9A 3B7GA 3AUYA 3EZ9A 3IILA 5AJVB 3H86A 5AUQA 3KL4A 3Q5DA 1NL3A 4QHTA 2FF7A 2DFKB 1F2UB 2B7CA 2JAQA 2NMVA 1GNRA 4MGZR 3S1AB 2OCPA 3C7KA 4Q1EA 4AY2A 4N0EA 2A78A 4NYJQ 3FHCB 4AG6A 1CXZA 2BBSA 3W6NA 2R6FA 5DE3A 1XRJA 4QGHA 3ZVMA 1E2DA 3V00A 3ASYA 3EZFA 3HPRA 3WBKA 4ARZB 3FOZA 3GLFA 4DRZA 3LX5A 2IX3A 3ETLA 1DOAA 1KMQA 3AVVA 1GG2A 4JVLA 2R6DA 1OYYA 1R8SA 8OHMA 2QGNA 2ZUCA 2VH5R 4G01B 1AGRA 2J46A 2WBLC 3ZYCA 4A4DA 5FTLA 1VDZA 1R0WA 5TARA 2ZS7A 3L0IB 2CMKA 4Q9KA 4XJXA 2A7QA 2ERYA 2C04A 3GJ6A 3KKNA 1YZKA 1QHXA 2ZIAA 4TLBA 3U7FB 4EKDA 4A1FA 1GRQA 4IXMA 2QAGB 4POAA 4DB4A 3ND9A 4CW7A 3VR5A 3X1YA 2C2HA 1EFTA 1S2MA 2J7KA 3AP1A 3IUYA 4D25A 2V6IA 4S2EA 1CRPA 3B5JA 1SZPA 3B78A 2OSBA 4MGIR 3W9YA 1XCPA 1PVOA 2RGNA 3K0EA 1CU1A 1BS1A 3ZZTA 3QXSA 3GJ8A 2ZUDA 4FMCF 5D3QA 1G41A 4KU4A 2NTYC 2FFHA 2ZU6A 3T1OA 2HUPA 1VHLA 3U3OA 4OHWA 2RGNC 3TSOA 2CVHA 4Q47A 2Q9CA 5LB4A 1T5IA 2A3RA 2JLSA 1HURA 3CWZA 2GAAA 4OHVA 2ZU0C 4HB3A 2FV8A 1E4VA 1W36B 3VKWA 2A5FA 2ZJ5A 1U0HC 2A9KA 3ICQB 5GVRA 4A0HA 1WB9A 4G3XA 2JLXA 3FKSA 4HLCA 4PANA 4IVQA 2IYVA 1UFQA 4YQFA 1E0KA 2XNDD 3U61B 2W6JA 4AC9A 3IEVA 2RGBA 1I4TD 1OH5A 4Q7LA 2ZEJA 3R9WA 5CM8B 2PMDA 2R6AA 1EX6A 2A30A 4PSVA 5FOXA 2I4IA 3LH5A 3U7EB 5EQTA 3VR6A 3A37A 1XFAA 1DO0A 4LPKA 3IEUA 2DFLA 2OT3B 3CNOA 1KI8A 1UDWA 1FP7A 4JYBA 5HKKA 4D2IA 1F2TA 3JZAA 4HAWA 3VR2A 2VP9A 2Q0HA 4XVQA 1AQUA 1TF7A 5FPTA 4B34A 1VPLA 1G8HA 2P6RA 2QMOA 1ZM7A 5CK4A 3T34A 5JFGA 5KHOC 2FX3A 5IT5A 5FTNA 2GVDC 1DEKA 4JYCA 5CITA 2FA9A 2VHTA 1TUIA 3BWDD 5GJBA 4Q7KA 5SZIA 1Z63A 1T3LA 1DAGA 4B3GA 1V43A 2A5DA 1KTVA 4GZLA 1DTSA 3LV8A 2GZDA 3L8ZA 3DOFA 4JVMA 4O0MA 4QKQA 1LV7A 1NSFA 1TQ2A 2J9RA 2WMOB 3FHOA 3MWKA 3VFDA 4EDHA 3PJRA 4R2HA 4U00A 4QG7A 1OLOA 2IK8A 4C9BA 4XIGS 3R8FA 2IWHA 1G7SA 1Q44A 2VF7A 2BJWA 2BIFA 2WJVA 1C4OA 3QKRA 4GDFA 4WOPA 2ZJ8A 4Q03A 3VKGA 3FE2A 3J81k 2TMKA 5AK0A 5G53C 5ANRB 3OAAA 1E1QD 4XTCS 5E7MA 2AXNA 4RZUA 3QPVA 4WIAA 5C46F 4XVRA 4LHVA 1TU4A 1R10A 2YC4C 3WNDA 2DB3A 1X8LA 4YMWA 3WY9A 1I4LD 4ON9A 3EC2A 3SJCA 2W6IA 3JVUA 2F1JA 4BECA 2G9NA 5DI3A 2DY1A 1WQ1R 2W00A 1UKVY 4QBFA 1H8EA 1UBFA 5FBLB 4RY2A 2FNAA 3BBPA 2ZM5A 3HYTA 4PX9A 2VSXA 5JSZA 4LJ7A 5E4FA 3GJ7A 4N0DA 3RVBA 1T6NA 1XNJA 2PCLA 2YZ2A 3L43A 4B76A 4IDOA 1NKSA 3TIFA 4ZIRA 4LYFA 1VCIA 1Z0AA 3CRQA 3RRMA 2RGEA 3U44A 4V0KA 3GLGB 5EE9A 2AK2A 2IHBA 3QEJA 4YDSA 4M1YA 4UNNA 2XGJA 1E9RA 1N6HA 5HE8A 3EZ7A 5KNCA 1N6IA 5EZ6B 1UAAA 5DI9A 5DN6A 1D2EA 1CR1A 4S35A 4HUQB 4AWXA 1GKUB 4Q4LA 1DARA 4B3FX 3AKEA 3C41J 1KOFA 3BGWA 1NN5A 4US0R 2JJ8A 3FWYA 2G83A 5FL7A 3P20A 5A0FA 1E32A 3B1XA 5FI1B 1S9DA 3K8YA 3WYFA 5M04A 5SZKB 1SHZA 3W8RA 3U5ZB 3QJYA 3E2IA 1TF2A 3W3ZB 4XTRA 1FX0B 3PUZA 1XCMA 4AKEA 3KKOA 3FFBA 1W4RA 1E3MA 1KDOA 3PUYA 1UKYA 2VPPA 4PO8A 4EPXA 2QROA 2AWOA 3W5JA 2F9MA 4RCZA 1Z06A 2J5XA 4B3XA 5TDHA 2VHUA 3K70C 5FBRB 3BFVA 2ZE5A 3MUFA 1YE8A 721PA 3HYRA 2VF8A 2NO0A 4EPVA 4IW3B 3Q8XB 4PHGA 1L4YA 3NBZC 2GEVA 2I1VB 1P9RA 4LDJA 2YWEA 2DWPA 2JASA 1GILA 3E70C 4RD4A 4ZDJA 4YC7A 3VX3A 4M22A 1F48A 2WWFA 3CPHA 2ZRIA 4JLNA 4J0QA 4CT5A 5JJKA 1NG9A 3HDTA 1BIFA 5JI3E 4NONA 1U81A 1VYTA 5DH9A 1W4AA 4B43A 4BFSA 1VCNA 3CR8A 4XSHA 1VYVA 4JLBA 4BLTA 1W0JD 3W8NA 4O25A 1GZSA 1BOFA 3KTAB 5AJZA 3TSZA 2ZJBA 2CXXA 4AURA 4ZCLA 3K0SA 3FHTA 2O8CB 3P26A 4TYWA 1FPMA 3KUDA 4PO9A 4DLVA 3WNBA 3W34A 3CPJB 3P4YA 4QM6A 4KV9A 3LRPA 3GLFB 4AKGA 1JNYA 1SKYE 1XJQA 4GOKA 4V0NA 2XEXA 2WSSD 4JLMA 3RWMB 4F4IA 4IDPA 4RKFA 3GLIA 1RPZA 2O8BA 4LHWA 4UJ5A 4LJAA 2JLYA 3I5YA 2RGDA 4AK9A 2BOVA 1DAIA 1S1MA 3ONWA 4GI7A 1DO2A 4C0AC 5BN5A 4CEHA 1RRGA 1M7BA 4PAMA 1NLFA 2ORWA 3CF2A 3SYNA 2ZSDA 1EX7A 1M1YE 3UG7A 4LZZA 5CLQA 4KLNA 1S8FA 1IOZA 2ODWA 4XD7D 1II9A 5FPSA 3ZVNA 1W2HA 1YJ5A 3A1VA 3BJIC 1RIFA 3L0PA 4FMCB 4P4SA 3THOA 3PVSA 4JVSB 4WZ6A 4C0HA 3SU8A 1DAMA 3A1UA 3LD9A 1ESNA 2WJGA 2ZJ2A 3VU9A 5LBIA 1Z0FA 5EE0A 1L4UA 1EK0A 1KO7A 3AKDA 3WHLA 1KJWA 3CZQA 2GXUA 5BN3A 2GWHA 1TX4B 1MKYA 1RKBA 4FCTA 1Z2AA 4E03A 2RCNA 3HU1A 3EPJA 3QOFA 3TLXA 2C9OA 1G4AE 3B1ZA 3BFKA 4RFSA 2FFAA 5IK2D 2AD5A 2X1VA 4P33A 2ZSFA 3KKMA 5GJWC 1Q12A 5GJVC 2PZEA 5FTMA 4PC2A 4EAQA 2REBA 5L3SB 1N3BA 1KNQA 3DVLA 1U0JA 2JIZD 2VHJA 1R0ZA 3QBVA 4U7DA 1G3UA 2WKPA 2BC9A 3KXLA 2GESA 5BW8A 5J4KA 3UPUA 5LD2C 1E2KA 3LBNA 1Q57A 2ZI7A 2BM0A 1X1RA 4HAVA 2VP2A 2B6HA 2ECKA 4P31A 1J2JA 2W6JD 4C0QC 4KYIB 2GCNA 5CLLA 3GJXC 4JBXA 3FPAA 1U9IA 4MYTA 1AM4D 3IDQA 1IY0A 2HXSA 3C14C 1E2FA 3I62A 3Q5EA 4K8OA 1F2TB 2CK3A 1HE1C 1Q1EA 3K0AB 3L0SA 2ZQ5A 2ZRKA 4RD6A 2OBMA 1NMYA 1CJVC 3VX4A 1A4RA 1U9IC 2BMEA 2J3EA 4LJ9A 1E9SA 2GAOA 3NIBA 2LWIA 4DCUA 2CHGA 2KBFA 5HKKD 4XOIA 4Q1AA 2V1UA 4Q4HB 4ASUA 1DBSA 4Q21A 1SHKA 1TF5A 1VTKA 2IYZA 1G4UR 3HR7A 1G17A 5B2ZA 2CEAA 3W6PA 5C1BA 3S1AA 2GCOA 4G5RA 1E69A 3NVAA 4OQNA 4BFZA 2JJ2D 3DL0A 1RYHA 3WMEA 1NVUQ 2BEKA 2C5LA 1U98A 4B73A 3Q3JB 3AF3A 2AR7A 3FFAA 1Z28A 4TQ9A 3QKRB 1R0XA 2P65A 4LV5B 1LF5A 1IM2A 2OILA 3RSLA 1LS1A 1J90A 1C9KA 1XTSA 1KKLA 2Y8EA 4KVAA 1IXZA 1JBKA 3B2EA 4PFSA 4QGAA 3EPHA 4KO8A 4QOSA 1GRNA 3OIVA 2CL0X 3WNCA 3O8CA 2GNOA 1KI3A 3R9IA 5CJ2A 3Q7QA 3X1WA 2HJGA 4HI0E 4K81B 5BN4A 1UBGA 2BDTA 3UXMA 3ZS9A 2NO6A 1WE2A 5DI3B 3GFPA 1A2BA 1XTJA 2KI5A 4JBWA 2BJVA 4IEIA 1EFCA 4PAOA 3G0HA 1QG4A 2LCFA 5JSZB 3F5FA 3DMDA 3QIAA 1GNQA 3MG9A 1CR0A 1OFIA 1QZXA 2AN9A 2EFHB 1VMAA 3ND8A 3OESA 4Q7MB 1N6PA 3U44B 4DKXA 4Z1MA 4XWOA 4HATA 5J47A 5JMTA 1GITA 1IXSB 2J45A 2FPMA 3AB3A 1CJKC 1FUKA 1OHHD 1SVOA 4AYTA 4UNSA 1ZW6A 1XTKA 3CRVA 1EWQA 521PA 4L5BA 4V0OA 3M4YA 4DLXA 5JS8A 4US2R 3GPLA 5A4JA 1QHSA 1Q1QA 3GJ4A 4M4SA 3Q72A 4V03A 4RSGA 3CH5A 1JQLB 2B8TA 3PXGA 4QNRA 3RC3A 4JSYA 5LDDC 4A36A 5G3ZA 1Q1BA 3KQNA 1P3JA 1S3SA 4LYHA 1YKSA 2HJVA 3TMKA 4DDVA 2QRNA 2JEOA 2GJ9A 3QY0A 1B0UA 5FL7D 2C03A 1P2UA 3SDZA 2ZRPA 4NZYA 4TMTA 1IN4A 4JJKA 6Q21A 4M1TA 1Z6AA 4JKIA 5JHGB 4LC1A 4BFTA 4OBEA 2WTUA 1QBKC 2GXAA 2FMXA 2ZR0A 1DAHA 4OI4A 2F7SA 1LNZA 2CL6X 1ZNZA 1M7GA 2NOAA 2NQ2C 1TEXA 5HZKA 2V7QA 5H1YA 2WIAA 5GVSA 3GLHB 2P5SA 1HY3A 3D7MA 3U3MA 4URWR 1YRAA 1ZJ6A 5KOYA 3ZZUA 4ZKDA 1P61B 3IIJA 1FZQA 3TH5A 1P60A 2H5EA 2X77A 1JXOA 1CTQA 3I32A 1UADA 3CR7A 2CBZA 1FNNA 1QF9A 1AS2A 1JAHA 1UBCA 1SVKA 2O0JA 5EJEA 3FVQA 4DJTA 2VHQA 1RW4A 5DLQC 3QKSA 3TQCA 2BBTA 2V1XA 2XOKD 2ATVA 3G82C 4G5GA 1NRJB 2ZRHA 5KPDA 1T8TA 4DLWA 4ESHA 1OIWA 2PX0A 3GP8A 4BWYA 1NJFA 1Z8FA 2PZGA 1P73A 2O8FB 1IXRC 1XXHE 2AK3A 3QVUA 4M9XA 4B74A 1M34E 1YU9A 3I1FA 2Q3FA 1QHGA 4IDQA 1N6NA 1ZIPA 2QTHA 4Q48A 1G5TA 4NTZA 3SEAA 2R6GA 2WJHA 1ZC3A 3L8YA 4N1AA 1E0JA 4I81A 2B8WA 4UNRA 5F98A 3BORA 3QXJA 3N5CA 1FW6A 4CEHB 4YXWD 2D7DA 4KYUA 2RGCA 4C0JA 4UXJA 1KZGB 3H2YA 1FMLA 3LW8A 3AEZA 5AUPB 4RVCA 2B21A 3AUXA 4B2PA 1JR6A 1NSTA 2OBLA 1S0UA 1NBMA 1DG3A 5CIQA 4I1VA 2IXFA 2RKOA 3CUEF 2EW1A 3SN6A 1NMZA 2ZJAA 1P2VA 2ZRMA 3AQ4A 3LA6A 5TMPA 3GLGA 4H1VA 4PQFA 4BFUA 3DMNA 2ODEA 3A8TA 4NYIQ 2GF0A 1E79A 1UJ2A 1KSFX 2ZROA 3BB1A 4TSFD 3HWSA 3VU9B 5E3HA 4A2WA 4CVNA 4A15A 3ZIAA 5EXPA 3VR3A 3AVXA 3THXA 1E2HA 2PMKA 1G8FA 4HDQB 2IXGA 3ZH9B 1E2EA 1NN0A 4HUQA 3RLFA 1JPNA 2QI9C 2Z0MA 4JLPA 4JT4A 4TL7A 2GZAA 4ARZA 1ZU5A 2BWJA 1G8PA 3QEOA 4Q00A 1E98A 4LBVA 2DFTA 2JDIA 2BHRA 1R0YA 1FX0A 2IYYA 4MRNA 3M1IA 1XEXB 3IHWA 2JLVA 5LD2B 4QBIA 2W83A 3MGCA 3H0KA 4HDOB 4YLGA 1E9FA 4HAXA 4Q19A 1LB1B 1RRCA 1VG0B 1VCOA 1D9XA 1KAOA 2ZANA 2UZ3A 4OQLA 1U0LA 3GEEA 3REGA 3LAWA 3P1JA 3B82A 3BB3A 3ICEA 1SXJB 3PFIA 3LVRE 2WJYA 4W9MC 1G16A 4D0NA 4E22A 4XVUA 4DT1A 1KI6B 3B8HA 3EZ2A 3T5DA 3TR5A 4ZV4A 4HSEA 1W7AA 4OI0A 4BLSA 3V4FA 1XMVA 5AWFC 4DUGD 2VSOA 2W0SA 4HZIA 4P4UA 5D3MA 3ZJYA 4BRWA 5FUWA 1Z6XA 3OEEA 3AVTA 5G3YA 2FU5C 3IHLA 2YJTD 4GMXA 4BGDA 2YOHA 2CK3D 2ZVPX 4A82A 2ERXA 4QC2A 4EJSA 1D5CA 3KTAA 3KQUA 1JEEA 5JRZA 2GCOB 2A5JA 3GEIA 5KDLA 1GKYA 2J0UB 2NZ8A 3FDIA 4GSYA 4NP6A 1GKIA 2ZAOA 2O8CA 2C8VA 4EJSC 2QMHA 4TLCA 2ZYWX 1OXSC 3FB4A 4GP6A 4HLDA 1ETUA 1ANKA 4MYUA 4M1WA 2GJAA 1WCV1 2HCJB 3L2OB 3MRSA 1H8HD 1OXTA 1IQPA 1U99A 2QMEA 2YVUA 4MGKR 3T15A 4HB0A 4AYWA 3RS3A 1TU3A 4DCVA 4WZAE 2IYTA 1NP6A 1ONBA 3ADKA 2F43A 2JCSA 1DAKA 1EFHA 5C4MA 5JHHB 1TTTA 2OO7A 4D82A 4EQ6A 5FPKA 3CM0A 2GXSA 1JALA 4JLAA 3CNLA 2GVZC 3REFA 2IA5A 3LXRA 4HDCA 1FUUA 3NHAA 4QJ5A 4KAXA 4GT1A 2F3TA 1AA9A 4I99A 1MO4A 4WA7A 5DISB 1YR9A 1NIJA 4URXR 3QNUA 1COWD 1G7RA 1HTWA 2VQSA 3OIUA 2WKRA 1FP6A 5JCPA 1EESA 1HT2E 1Y63A 2QE7D 4JVNA 3ADBA 1NF3A 3CPEA 3F3YA 4FN5A 2PLFA 4Q66C 1EXMA 3X1ZA 3R20A 5DYGA 4HAYA 4NYJR 4RD0A 4KITB 2PEYA 3BRWD 4NE2A 4JL5A 3U2QA 5K8TA 2QL6A 2ZE6A 3FYHA 1E99A 2BKEA 1FMJA 1XZQA 1SVMA 1T3SA 1IAQA 1FTSA 3SI7A 5AJXA 4HEJA 1DE0A 4KFTA 5L3SA 2O52A 1KGDA 2W2XA 4OI2A 1TMKA 3VTKA 2C95A 2F55A 2J0VA 3KJEA 2Q6TA 1KDRA 1P62B 2JA1A 4LRWA 1W36D 1T9HA 1SULA 2IUUA 2ZSEA 3QXXA 5JCZA 3NBFA 1W4CA 2ZXUA 4D4JA 4IOMA 5DYIA 5KSOA 3UIEA 3NBXX 4YMTA 1G7TA 3BFXA 2G3YA 3DZ8A 1J99A 3C8UA 3GFOA 3K9LA 1Z22A 5B30A 1VECA 3B85A 1OIXA 2IBMA 2RAPA 2VSFA 4DLSA 2D62A 1AKYA 2XNSA 2H57A 3K0AA 4JLJA 4OJKA 1OXUA 4LHZA 3CO5A 1CF4A 2C77A 4F92B 1NY5A 2C9CA 3N2IA 4Q4HA 1OB2A 1T0JB 3T61A 3ZD6A 2XSZA 5DO9A 5JBQA 3QBTA 1JECA 2VIIA 3BE4A 3SQWA 1CEEA 2X19A 4UJ3A 4MDFA 1GAJA 1KJZA 5FI0B 1RJ9A 3TNFA 1G5PA 2F1HA 1MABB 1W5TA 1X6VA 3IPXA 3ZZ0A 1G3IA 1K5DA 4P3YA 1CKEA 3E1SA 3NDPA 5SZJA 2FE4A 3IGFA 1G64A 4JLKA 4B3BA 2D4HA 5KSPA 1N6LA 3NC1C 1JI0A 3QKSB 4B3CA 5JRJA 2CDNA 1T5LA 1NVVQ 3MLEA 2H18A 4G0NA 4U02A 1FOEB 4NPHA 1D6JA 2WWWA 3SFZA 2JJ1D 2YNMA 3D31A 2IW3A 3CRW1 2IS1A 2PT7A 5F9HA 1QDEA 2ZRCA 1NLZA 2IS4A 3RANA 2R2AA 1G5RA 3EWSA 1OFUX 2HF8A 3GCGA 1QVAA 2IL1A 4M1KA 5H70A 1K8RA 1W46A 4C4PA 3DEFA 1JPJA 5J4LA 4IDNA 1ZNXA 4P4TA 3VMFA 2FGKA 2JLZA 4FWTA 1XD8A 1BMFA 1EFRD 2F1IA 4DWJA 4TT3A 4IVRA 4R9UC 1LVGA 3RRNA 5IF9A 3UMSA 1GM5A 2WZQA 2ZJZA 4ILEA 3AF0A 5EXXA 3LBHA 1GP2A 2H7VA 1P9NA 2IYXA 4KBGA 4TL9A 3UG6A 2R6CA 2ZS8A 5FOTA 5J4HA 2CHQA 3IIKA 4L8GA 2QBYB 2ZTSA 4LYAA 1ESMA 2GZHA 2D7CA 4CF7A 4C2TA 5DIFA 1I2DA 4A0GA 2ZRFA 2R65A 4ACBA 2DWOA 3C4JA 4URYR 1N5KA 1TEVA 1UKEA 3OEHD 2Z5FA 4M9ZA 3RAPR 3THXB 1GL6A 4N3NA 1NVVR 4II7A 2LKDA 4LHXA 4X8MA 4YONB 421PA 5CIWA 3OE7D 4B32A 3QENA 3I72A 1ZUNB 4URVR 4MKIA 1XP8A 2DBYA 4V02A 4TLAA 3HR8A 2FGJA 4JJZA 1FTNA 1E2JA 1W0KA 5EE5B 3T1TA 4Z8YA 4QRHA 3CKLA 3PEVA 3X2SA 1R8QA 3HP1A 1Q1ZA 1HT1E 5GJCA 3T5GA 1M2OB 4BZQA 2NO9A 2VL7A 4KXFB 2D2EA 1T91A 1E2NA 1KSJA 2QPOA 3U3RA 1R7RA 4A2QA 2OAP1 2AL7A 5KO2A 2OXCA 2ANBA 2ZYVX 5DHFA 2D06A 3AKCA 2CCKA 3P32A 5DNYB 2CNWA 3CF0A 4L9WA 2Q3MA 4LV8B 4D4LA 4DT1B 3GLHA 3SZRA 1JR3D 3ADCA 1AS0A 4JSTA 2EFCB 221PA 1Q22A 1XTRA 2F1RA 1P7CA 2QTVB 1JJ7A 2FPLA 5D3MB 4FWIB 4O3MA 2AWNA 4X8OA 1E2PA 1OKKA 2QAJA 4B3DA 4BQSA 2H16A 1XU4A 1ZRHA 3EW9A 2VTKA 1W1WA 3TQFA 1OFHA 4DHEA 4BE7B 4LYJA 4EJSB 4IJMA 2OFWA 3KFXA 4HZUB 3W90A 1MH1A 5HE9A 3UATA 3X1DA 4RD1A 4LY6A 3VHLB 2BM1A 3AGQA 4M53A 1KO5A 3EIQA 2VP0A 3CONA 4FMBB 2OCYC 3EA0A 3T12A 2WMNB 2O8FA 3VQTA 4L4UA 1X3SA 2WWIA 4PPFA 2ZVQX 5JJLA 3WYGA 1YR7A 3SQXA 3CX8A 3MJHA 4MUBA 1PV4A 2F43B 1JB1A 1KDTA 4DEYA 2OZEA 3Q9LA 3FMPB 4MH0R 4NBSA 3FMFA 4EQ6B 4CDGA 2JGNA 2Z4RA 4QXAA 2V54A 3GJ5A 3F8TA 3IBGA 2XX3A 2W0MA 1GRRA 1LW7A 1RRFA 2D74A 2QUZA 2ZRLA 4CGZA 1US8B 2F9LA 3R9XA 5JWOA 3IO5A 2IHYA 5K8IA 1MO5A 2PJZA 5KSZA 2FOLA 2KB0A 4PO1A 2WKQA 1E1RA 1E96A 3PUXA 2DR3A 1YRBA 3KX2A 2Z6VA 3TUJC 3U3KA 1XJ0A 2OE2A 3O8BA 4C7OA 2YOFA 1AGPA 1YHNA 4PSKA 2FZ4A 2RMKA 1IJFA 2WVJA 4AI6A 1E6CA 3GMTA 3K9HA 4QHYA 1SQ5A 4V0MA 1BYIA 4EPTA 1MT0A 3AP3A 1FNMA 2G0TA 3U60B 3B60A 3OFNA 4PPGA 2QN6A 1R2QA 2GKSA 4BLQA 1XTIA 3K53A 3P27A 3RNLA 3ZDQA 1CBUA 3K09A 5KTYA 2XB2A 1GIAA 2QA5A 4OKSA 1XEXA 1LTQA 1GUAA 2AD1A 4HAUA 4Q5IA 3RRYA 4DCTA 4DLRA 1KJYA 3LVQE 1ZNWA 4NCJA 1KYIA 4EFLA 3IQWA 4BUJA 3K09C 2FWRA 4LBWA 2V9PA 2ORIA 2G1KA 3K0CC 3M0EA 3TAUA 1MO6A 1OV4A 3GLIE 3A6PC 4K46A 5JECA 3A1WA 2ZJYA 2I3BA 2FPKA 3FKSD 3RABA 4Z54A 1X8KA 3O47A 3EZ6A 1SXJA 1XMSA 3AF2A 4LBZA 5C4GB 3HJNA 1Z0KA 1ZD9A 3TBKA 4F4JA 1VG1A 2HLDA 2OUKA 5J5CA 1KI7A 1KI6A 2FEMA 2GF9A 4B6EA 5HZHA 3R7WB 1RRPA 4LSGA 5B58C 4Q9LA 3H1TA 1SXJC 1XF9A 4MITA 1ZM3A 4JL6A 1G20E 5JWRA 1IBRA 2GHIA 2CVFA 3SC3A 2ONJA 5EE3A 4A0RA 4CYMA 1L8QA 2OHFA 2GEDA 4IOKA 2N1BA 1UEJA 2EFGA 1Y3AA 4E07A 3THYB 4M1MA 5BYJA 2GK7A 3O8DA 4M21A 3SE0A 4B47A 4R71A 1Q3HA 1Q21A 5EP1A 1DADA 2CJWB 2J7PA 5L3VA 4WW0A 4TQAA 1E9BA 1OXXK 1T3HA 2AKYA 4DCNA 1FQKA 3PUWA 2OFOA 1RJ9B 2J0UA 4TLEA 3TAHA 1K5GA 5C2JB 1E9AA 2XZLA 3DHWC 3L0OA 3QKUA 1IN5A 4QJ4A 1TNDA 2XSZD 2H1LA 5ELXA 1XEFA 2I1QA 1KO1A 4Q4AB 2ATXA 1T4GA 1TAGA 5KPJA 5C18A 1ZYUA 5HCIA 1VIAA 4H1UA 1KO8A 2HDNB 3ZQ6A 1YZLA 2IYWA 1N25A 3RS2A 4QGGA 2KJQA 1P9WA 4RD3A 1F60A 1NJGA 4TYNA 1OFTA 3MWJA 3SJBA 4RZ2A 2ZS9A 3MD0A 4GMDA 1U2RA 2EVWX 3OAAD 3BIFA 1U8ZA 4ZI2A 3LBIA 2BMFA 3NTUA 1TL7C 2O0HA 2N46A 5FBQB 4BEBA 2XITA 2IYUA 3RS4A 3ZVRA 3T1QA 2IS6A 3AVUA 1IN8A 2AFHE 2QM8A 1II8A 2W6ID 5G40A 3VAAA 4IEEA 4D4MA 1HV8A 4JLVA 3MSXA 4IOJA 4MRPA 4US1R 1H8ED 1IY2A 3DOEA 2VA8A 3IBYA 3PEUA 1XTQA 4MDEA 3KJIA 3AH8A 1D9ZA 1RYFA 1W47A 3LW7A 2WJJA 2P67A 1CIPA 1VYUA 4CEIA 4EPYA 1M7HA 4ZCIA 2J41A 2VYFA 3K9NA 4A9AA 4ZDIA 2PX3A 5B64A 1ZAKA 4TL6A 2FN4A 4O2RA 3VR4A 1XZPA 1CJTC 2X2FA 3KFVA 2REOA 1EG7A 1L2TA 3NC0C 4BRUA 5DSZA 5FTKA 4JT2A 1MOZA 1DAFA 3CX7A 4DXAA 1G3MA 1ZP6A 2EQBA 2ODNA 4FW9A 4MA4A 5AUNB 5DN6D 1NI3A 3PG5A 2J59A 4I1UA 3E5HA 5BWMA 5AJWA 5EXSA 4UXIA 4DDTA 3K9GA 5CYPA 1OW3B 1VG9B 3JZMA 2G0NA 1W0KD 2IUTA 2XNDA 2RHDA 1Z6YA 2CE2X 3C16C 3L82B 2EYQA 4IFBA 4GOXA 1TUEA 1S9HA 2CLCX 3LLUA 2AX4A 3UMRA 3K70D 1FL9A 2ZETA 5KYKA 2X2EA 2WWGA 3SYLA 2XTZA 4MGYR 2FFBA 1PLKA 2O5VA 2JLQA 2FFQA 3KDSE 1ZM9A 2ZSBA 1GOTA 1SKYB 3U4QA 2QG6A 4OQXA 5FOUA 5IHPA 1GDDA 4BFYA 4W5WA 2MSCB 3AGPA 4HLUC 4GFDA 4PSAA 4Q4JA 1QHIA 1X8JA 1DVRA 1XBTA 4D6PA 2WSMA 1MABA 1QRAA 2NG1A 4KLZA 3TK1A 2Z4SA 4LJYA 1C1YA 2HT6A 3UMFA 2FG5A 3C5CA 3RS5A 5FOWA 1YZGA 1OH8A 2P3SA 4NKRA 4KVGA 2O8DA 4BLRA 4F38A 3A4NA 1XMJA 5CYOA 1S3GA 5J40A 5JLJA 1G3RA 1ELOA 2A2ZA 2BV3A 3PITA 3UK6A 5FR1A 5IRCD 3F0TA 3CH4B 2ZI6A 4PAQA 1GVNB 5EP3A 5FFMA 2GRJA 4RZXA 4E09A 2D3WA 4LWZA 3M6AA 3EX7C 1Z0JA 1W44A 2XTMA 3A4LA 1XPRA 5JJIA 1WRBA 4EFMA 5H68A 1DAEA 2QENA 4GZMA 2XJ4A 3FMOB 1QHHA 4OJQA 5BYKA 4FMDF 1E1QA 1MO3A 1CJMA 1HQCA 3TSWA 4IXNA 2EU8A 4GPTA 2BCJQ 4NDZA 3I92A 3BH7A 3OIWA 3BXZA 2PBRA 3CIOA 4B48A 2OXRA 3MMPA 4LHYA 3WRYC 1F6BA 5E7IA 4EPRA 2IYLD 1T0HB 2ASEA 1HH4A 1AKEA 1G291 2V8OA 5FTJA 1G7CA 3MAAC 1CP2A 2DHRA 2QBYA 4C7OB 3QG1A 4IRUB 2BBOA 3NH9A 3KXKA 4UKDA 3PQCA 5J4VA 4DSTA 1E2MA 3RDPA 4FCWA 1DPFA 5F3WB 4LGMA 1Z5ZA 2WV9A 5FBVB 5TVKA 3U6KA 3CF6R 3OHMA 2LKCA 1SVLA 2IT1A 3LQRA 1G9XA 2RGXA 5FOVA 2ORVA 4B2LA 2QM7A 4UXHA 2W2TA 4TYPA 3NEJA 2QP9X 3AVYA 4I1OA 4OL0A 5P21A 3Q85A 4PZZA 3NH6A 4F91B 1GNPA 1XCGB 5IDVA 3H84A 1ZNYA 3ECCA 1ODFA 1GTVA 4B6FA 1R6BX 2NZJA 1XEWY 2ZRGA 3KZ1E 3CX6A 5L3QA 2PT5A 1ZC4A 5EP4A 1I2MA 2ZRJA 4KFRA 4IVPA 4EPWA 4DSNA 1M6NA 3NXSA 1SVIA 4M8NE 2PL3A 4H9GA 5KDOA 1X86B 1E9CA 5TV2A 5CDFE 1QVRA 4EFNA 1Z0IA 3LO5A 1ZMXA 2P5TB 5G41A 4B35A 1VKJA 4DLUA 3MWLA 4B75A 2C78A 3CB4A 5CB8A 1N5JA 1NBME 2E1RA 3EARA 5F9FA 2IF0A 3DM9B 2WPDA 4LX0A 2HLDD 4NYIR 1G1MA 3P4XA 4LK2A 3GLGE 4OK5A 2NO7A 1FQJA 2QNRA 3EA5A 2IXEA 3A4MA 4LBYA 1J8MF 2CE7A 4O2LA 4BLPA 3IKJA 4KODA 1DS6A 2GJ8A 4TTQA 3K0FB 4B2IA 4HB4A 4HZUA 4XWAA 2RB4A 4TL8A 4ASUD 3U7HB 4TLDA 4JZKA 1W0JA 4Q01A 2GCPA 4CRWB 4PTLA 2QORA 1N0UA 1AN0A 4PR0A 4BZPA 2O8EA 1GL9B 4LI0A 2ZI5A 2H92A 2BCGY 2W58A 2CCJA 2AFIE 2QZ4A 3RS0A 4D80A 3DZDA 4V0LA 2FSIA 3UWOA 2G6BA 2GILA 1XMIA 3D8BA 3TJZA 4BFXA 3BK7A 3BB4A 2REXB 4Q1CA 1JR3E 1CRQA 3KQLA 2XAUA 4IKEA 2WSSA 1ZU4A 1US8A 1E9EA 4TQUS 3CLVA 2E9SA 3TW4A 2NO1A 2WWHA 3SHFA 2AKAB 4FXPA 4Q7JB 4M1SA 1II8B 4BPBA 4NCKA 3KXIA 2GK6A 3A36A 1ZVQA 1HEIA 4CEJB 1N5LA 4LOAA 2F6RA 1WF3A 4KSBA 4QL3A 3SS8A 3TGPA 2J87A 3N70A 1WDTA 1LY1A 3AVPA 1JEDA 1N0VC 3QI2A 3V9PA 4XD7A 4PQRA 1XPUA 1JJVA 3EXAA 3C5HA 2ZR9A 3A1SA 4PC6A 1F5NA 4QM7A 1W49A 2NGRA 4CEIB 1AK2A 2R9VA 4P0TA 3SFVA 2ODBA 4MYHA 2RHMA 3WP1B 4PHHA 1IONA 1LS6A 1ZCAA 2KSQA 2P6UA 3KJHA 3WP0A 1KK2A 2WOOA 4Z1MD 1SVSA 1EWRA 4DSUA 3QQ5A 4JMPA 2HEIA 3QF7A 2FDCA 5E95A 3GLFE 2R44A 4MQBA 3TUIC 5FUXA 2NIPA 5FUYA 4ZDWA 2HCBA 1KK3A 2ZRAA 3AM1A 4PXAA 1Z07A 2F3RA 2OAQ1 4A8JB 5IK2A 4HLQB 2QQ0A 5FBWB 4YMVA 1ZUHA 2EWWA 3VNVA 4HYYA 1MV5A 2HYDA 2IEZA 4RKEA 3FKQA 2VP6A 2P0EA 2QRZA 5FPYA 1IN7A 1AJEA 2ZUBA 2JIZA 4A0FA 3QSYA 4FI3C 5AJYA 2XXAA 1S96A 1NY6A 5KSYA 2C96A 5E7JA 2BBWA 3R7WA 1UM8A 2XJ9A 4LJ4A 3ZS8A 1Q0UA 3AP2A 3SJAA 1CR4A 1QHYA 1XXHB 2ZYTX 4W5HA 4PC1A 3U4QB 1GSIA 1R5NA 1KI4A 3I61A 3THYA 4NCIA 1AS3A 5CB6A 3AKYA 3CNNA 2WJIA 3RWOA 2H17A 1M8PA 4LJ8A 2CJWA 1S4QA 2V7QD 4FCVA 2G77B 4Q4JB 4PQYA 2WM9B 2R62A 4I4LA 1RE0A 3DM5A 2WIBA 4W7SA 4Q4AA 1YVDA 5DGXA 1PLLA 5KU1A 2GBLA 2O8DB 4CZ2A 4ZO4A 4RFVA 4TN1A 1UDXA 1E2LA 1CR2A 4L15A 2HXYA 1RZ3A 2JJ2A 3MCAA 4GBMA 2CLSA 4RZ3A 4F93B 3CZPA 2GBLC 2VO1A 3WBJA 3HPQA 4JBYA 2C99A 4E5UA 2XZPA 3SNHA 3GJ0A
chains in the Genus database with same CATH superfamily
1OH7A 1VE9A 3BFJA 2WYHA 4KR6A 1XZ8A 1PNTA 3TZQA 4WXMA 3QE9Y 2XKAA 3MQFA 3W5SA 5TEWA 2ZIXB 3DQPA 2AEMA 4BNZA 4YCDA 1NF8A 4OA8A 4ZVMA 4CF6A 3KQHA 1N5DA 2EX4A 1K75A 3CT6A 1X92A 1FPQA 1HE8B 2ZI9A 5JQGA 3PXEA 3TIIA 2VJDA 2XRYA 1Q7EA 3EQ8A 3QF4A 2AG6A 3FYUA 4Y0AA 3DLHA 4GEKA 4X63A 2NSYA 1RCUA 1YOBA 2SHKA 2P9YA 3DSRA 2CMFA 3GIWA 3PL1A 4OHFA 4B46A 1RXIA 2P9HA 3MT0A 4QPDA 4K40A 1P7ZA 1PGOA 2PWYA 2FZLA 4MKFA 3TR0A 1NR5A 2J3HA 1NPTO 4KUHA 3WKAA 4AG3A 4GR5A 1Q2UA 3KOUA 2W90A 1YZUA 3R4VA 1D4OA 3RAEC 4N76A 4P86A 3D2BA 3DW1X 5AM3A 3UKDA 1KAEA 1UKBA 1NBMD 2OKCA 3KOYA 5G0SA 5I9MA 1F7UA 2O4UX 4PYIA 1ISRA 4ENUA 3ABZA 4ARUA 5HF5A 3IKVA 1XVVA 3OCZA 1XP5A 4V24A 4CV3A 1OB5A 2VBCA 3TRIA 4C6TB 3L7CA 1JHVA 3VPBA 1TOAA 3CBQA 1X1SA 1X94A 4YV0A 3QRWA 5IJ9A 4BNHA 5FPQA 3O2QB 4AFNA 1JW9B 3T8YA 4PFKA 1G6KA 3FZGA 4LE2A 4QOHA 1OHHA 3EDYA 3AT1A 5LM3A 1QGOA 4BASA 2JLWA 2B1GA 1WCYA 3SSOA 4Z8XA 3W1VA 2QVLA 1GL7A 1JHOA 4G1BA 3VPFA 3ZU6A 1PI3A 3DEKA 5L7WA 4AIIA 1I80A 2XZTA 4X54A 3TTXA 4RTSA 1XA4A 2ZAIA 4NMMA 1TYCA 2QXUA 5ARCA 2FH5B 3CW2A 3B5EA 5KWSA 2C97A 2PZFA 5L3QB 3LX8A 4DZTA 2QLMA 2HU7A 2YXBA 1BWQA 3LWZA 3PJGA 2VLIA 3D4NA 2GA8A 5BR1A 4H3KB 1HA3A 2N3ZA 4HS9A 1ZY2A 2JI6A 1EWVA 1Z8DA 1YB5A 2HQSA 1RVDA 2R97A 3FPGA 1M9NA 1T0UA 3I5UA 4MKZA 3WA6A 2IHTA 4CG2A 4YWHA 1QE0A 3DXYA 1PJ8A 1RM5A 3NYWA 5CRIA 3SG0A 4KQJA 4DSOA 1DC5A 3HN6A 3MN1A 4QFDA 2WFAA 2ASVA 3D3QA 2WJ3A 3NKVA 4XGKA 5CXSA 1SD5A 4J0HA 3WRXA 1T6XA 1ESCA 4K1XA 1UJ6A 3A9WA 3JQFA 3W6OA 3CEPB 1K08A 3TQTA 3QVGA 3T1HB 1TLFA 2J9ZB 4M0LA 2OSVA 3PGXA 3IDZA 1MX5A 4CLXA 3SC6A 1ISMA 3DLCA 1G63A 3QPWA 3QEBZ 1P6XA 4JJIA 1PT9A 3DGFC 4DB2A 1SCDA 1IUOA 4MUEA 3G0OA 3OOHA 3NWBA 5DWDA 3FYCA 4EGFA 3VKUA 3HDVA 5C8DA 3R6DA 1B76A 4QYXA 3IOMA 3INGA 2V3VA 3IDOA 2DWCA 2BZ0A 2ZZKA 1X13A 1NN3A 1Z0DA 2GPWA 5DHAA 2C59A 3OTIA 1EFKA 1U4NA 4NS4A 3TLGA 3TW0A 4RC9A 2EQAA 2CUNA 2X8LA 3HB5X 4YRZA 1DLJA 1Q19A 3WX0A 4FGWA 3CC8A 4HNAB 2P9GA 1XQ6A 2QMUA 1G9SA 4KIGA 2O8EB 3GA7A 1OOEA 3PUVA 4D9KA 4R41A 4KDRA 4XSVA 1IHXA 1C9MA 2EJUA 4FYPA 3JD2A 4U5QA 4CIWA 4GBJA 5AK3A 5EYPB 1BW9A 4R2LA 5CJPA 1P2SA 2K2QB 3G2MA 2BGRA 5IH3A 4ED9A 4EHIA 1PDWA 2B1JA 4L9AA 1PK7A 4P58A 5KNBA 3AWIA 3GEHA 4PCVA 1NBAA 1BDBA 3NWEA 1CB0A 2DU8A 2XKJE 1NNUA 3HL4A 4JK3A 1V11B 4J94A 4GR4A 1FRZA 3LWNA 5LJIA 3CLRC 5IDWA 3J81k 1NNEA 2DG2A 3I34X 5J43A 5A9TA 5EEGA 3FI0A 5FNZA 2QPAA 2Z5VA 4BWVA 2JJQA 2NZXA 5F7JA 4V1CI 4YXWA 3SK0A 5CNIA 5LR6A 2C98A 3QEAZ 4PIVA 1PKEA 4B0PA 1XHLA 4I1YA 2VEDA 2QG9A 2XD4A 3V9AA 1N0WA 1Z3IX 2XB6A 2YKGA 4G25A 5CHYA 4W1PA 2PS0A 4OG2A 2QR2A 1QZTA 3PJEA 1O87A 2A3NA 2AJTA 2IF2A 2NAFA 4RJIA 1K4KA 3BMQB 4F4DA 2QLBA 5I9NA 1DJLA 4LJ6A 2CDAA 1GV1A 1U31A 3NEYA 3Q7TA 2RC5A 4WESA 5IVDA 4C4TA 2FR8C 2O3RA 2GTPA 3ZBPA 3ZDCA 4QOFA 4IJKA 1UPUA 1S2GA 1EM8A 3RHFA 4TVSA 5HOQA 5JEEA 3EVNA 4IP0A 4LJLA 2ERCA 4O4IF 5SZHB 2FW9A 2MSEB 2R25B 3HCFA 4NX2A 4MINA 2F4NA 3ZWDA 2RKBA 1K68A 4HK4A 2IU4A 1A0OA 1GUZA 3AVQA 1R4NB 4HGNA 3W8EA 2B3TA 1E62A 5DXAA 3S7TA 1MOSA 3TW8B 1FUIA 4Z9BA 4FCCA 2NO4A 3QX3A 2ZB3A 4JI7B 1P72A 1O96A 4QBGB 4BQRA 1V1MA 4NL4H 4UD2A 4KI7A 3LJKA 1J0EA 4GX1A 5BQ5A 3O31A 4HAOA 5J59A 1H85A 4P2GA 1FLVA 3B5IA 1KFKB 1GGKA 2ZJOA 3D5TA 4GMHA 2P2LA 3EC1A 4YEDA 2CVQA 5JWHA 1AZLA 2OCBA 3ZI0A 4A92A 5EHNA 4D44A 4KWCA 1Y1TA 3TB4A 2YHAA 1N2HA 2BR4A 2RHRA 4K6OA 2XYQA 4IUCS 5KNDA 2GXQA 3QP9A 4NU0A 5EUQB 2AEJA 1XZEA 3OTHA 2JGDB 4JUDX 5E8JA 5F5LA 5K2MA 7MDHA 3J80A 4KXXA 2DPMA 3TVTA 3ZE9A 4IVNA 5IULC 4JI3B 2O2XA 4NH0A 1LW6E 1WV1A 2IYRA 1YR8A 4UBNA 3W2GA 5JAIA 1YQ9A 2BW0A 3NIWA 4H1HA 1E6WA 3OPVA 3TKLA 1AHPA 4AF6A 5H5JA 1E89A 1NTOA 3MVEA 1FJHA 3WGLA 1O9GA 1L5GB 3D7NA 4DRXB 1WBBA 4P4LA 4M3NA 3WV5A 1U11A 4BEJA 2QVYX 1GZ3A 3EASA 4N5LA 2DXIA 2BHSA 4NCHA 1RT9A 2A5GA 3U4GA 3B6EA 1A82A 2VLBA 1ECCA 2XMSA 3E61A 1NUUA 1VSVA 4QU5A 4ROTA 4KPUA 3IE1A 5JJ5A 4N3AA 4FE3A 1JFFA 5TE9A 4R8VA 3E4DA 1ML3A 1HYQA 1Y5MA 3R44A 5C7IO 3QW4B 2BCEA 1F2UA 4M8KA 4BN0A 3O9MA 3UT5A 4C4AA 1EFVB 3H8JA 3PE4A 2XRMA 4L8VA 4MXDA 3TQSA 3X1XA 4ECAA 4QA9A 1NVDA 1QPBA 3I5XA 1ZVVA 1X9HA 2JLUA 5K3AA 1X7HA 2H4JA 4WGGA 1XJ5A 3NETA 3ZQKA 1JXMA 1VRVA 2HF7A 4CTOA 3ZE0B 3DAOA 3CTPA 3CW9A 3DBVO 1CV2A 5TY0A 3ZC3A 3EIOA 1CLUA 3H16A 5BWBA 3RVMA 2AG1A 2KWIA 3HBMA 3NR2A 2O2SA 3Q7RA 1UKCA 1VIMA 2QF7A 3O2JA 4QAQA 3A2LA 2YWFA 4FU0A 2GZRA 4PPQA 5AOBA 3SVTA 3Q8LA 4G5QA 4MKHA 4UNIA 4EHDA 4CEJA 2A0FA 4BKOA 1Z68A 2JFGA 2Q2WA 4XM0A 3UH1A 2BUAA 1YQTA 2FOXA 3TVYA 4CL3A 3FDZB 4Z53A 2A33A 2QSZA 1TM7E 4IIXA 3G8YA 4R1PA 4XR9A 3ZY2A 3TI7A 4BHTA 4AKSA 4HMQA 1H2AS 2FSFA 2P3OA 3COZA 3D81A 1MH9A 1NBHA 3DJFA 3M6MD 3QWAA 4FFVA 5AK5A 4YV7A 5BOSB 1COWA 1OLXA 5HMLA 3X0DA 4W5QA 1YKFA 2Y77A 4YECA 1R5OA 1VLJA 2XTNA 2JZNA 2QAGA 2ZUVA 4PC7A 4BX2A 2GN9A 2YV5A 3CF4G 4MYSA 5HCNA 2NT4A 4INAA 4ZVUA 4OHYA 3KEFA 4U9IS 1RQNA 2YWCA 4OK3A 1URPA 2RGGA 1I9CA 2EDAA 1G8GA 3MJCA 3BRWA 1SGWA 2V6JA 1JDNA 3QXCA 5F52A 3RC1A 4XUCA 4P7JA 4P7KA 1Q95A 4UQOA 2F59A 1PJAA 4PPYA 1AA6A 4HVLA 1QIEA 1QYIA 4G0VA 1VPEA 5DX0A 2F4VB 1U8AA 4NMHA 3BXFA 3VTFA 4GZ5A 5CM2Z 3RHZA 4IZ6A 2X8JB 2PRYA 2O0KA 3A9SA 3JQGB 2H1SA 4HXGA 4ZXFA 3H7IA 4G9GA 4MS1B 821PA 4CIDA 4B84A 3KP1A 1D07A 1M10A 2D5IA 3O26A 5K8UA 4NFYA 3RSOA 1ZUIA 4BNWA 5J2TA 4ZMSA 2QY9A 4LA4A 2G28A 5EWMB 2OGSA 1QU3A 1YBFA 4RADA 5TQ2A 4LJSA 4JFRA 3F46A 3JD0A 4N0PA 2PX4A 2DFDA 4XASA 4IS2A 4AJKA 5JNWA 3LLMA 3URMA 5LMCA 3T5MA 5A7GA 1FE8A 4EZIA 2VXYA 3PXBA 4NFHA 1K5HA 4IHKA 3NJ8A 4K9MA 2Q0SA 2OD7A 3S81A 1F3OA 2BE7A 1C81A 2R6JA 2HU5A 2YASA 2VR1A 4BQIA 3IA7A 3LHKA 3PKZA 3KYBA 4AJPA 2YFQA 3K70B 1EDZA 5JS2A 4ESOA 1Q7TA 4IH1A 5L3RA 1U0BB 2BI7A 2BGMA 2FZGA 4XSGA 4ZV9A 1J9ZA 3S2UA 2BTOA 1JEOA 4H60A 3OVMA 3U4AA 3RS7A 1P44A 3C1UA 1RCTE 2RGAA 5JNUA 5LOVA 1N6OA 3BXPA 3L1UA 3MTBA 1T6BY 1R8YA 4AZTA 3LHFA 5IC6A 1NVBA 3ODPA 1JHXA 3CA8A 1OKKD 2QZPA 3AFGA 5B57C 1ISPA 3EY4A 3I42A 1MB9A 2H7CA 3I53A 2ZI3A 4Z1OA 5JANA 1C0IA 1N77A 4DHWA 1KPGA 2VHCA 4GYJA 4HUTA 2JGLA 4EKEA 2C2GA 4Q9HA 5JCXA 3HWRA 4MCJA 3HGQA 2I7XA 4BJ1A 1THGA 2CVPA 4DYDA 1PNRA 3BZWA 4FIDA 2PS1A 4UTXA 1DC6A 1JMVA 1TJNA 1DQSA 3FWPA 2WW8A 4R98A 4WKOA 4ESVA 4KAJA 2RGUA 1N9GB 5JZVA 3IP9A 4L4XA 4EY7A 3KOMA 2ANCA 3I30X 2HMUA 3HEMA 1JHRA 1MGOA 4EB6B 3LNCA 2VTBA 4Q18A 4NAUA 1CUVA 3L8MA 5IS2A 1C0PA 3EVGA 3QIVA 4ETWA 16PKA 5BWCA 3FVVA 3DEJA 4WOCA 5KYTA 4DLYA 1U90A 4ER3A 5JS7A 2HHAA 1V5WA 3D02A 4EZEA 1PNOA 4YMIA 5HJ7A 1EGVB 3EAQA 4MIEA 1HT0A 5IDXA 2HMAA 1FIUA 1Z25A 1RHJA 3UZUA 2ZE8A 5F4BA 1BTOA 3RYTC 1F8XA 1OPXA 3R40A 1P75A 3DL2A 2EWMA 2EWVA 4K3UA 4DLZA 1SU8A 1UH5A 2QB5A 1FFAA 5BVHB 1O97D 5CYGA 2R2GA 3RM3A 4D0GA 3LL7A 1WP9A 4X1KB 3GLIB 1UF9A 3EG5A 3ZCPA 2X9LA 1FTYA 4Q02A 2F17A 4BFVA 2EQ5A 2D0IA 4HJRA 3PIRA 1BGXT 4LVCA 1IEWA 2X9GA 3AFIA 3L7LA 3PV0A 1SEVA 1OE0A 4RJLA 1QK5A 1KAGA 1G6HA 2CT8A 4P32A 1YR2A 3LKBA 4FEYA 1N5MA 2QLFA 5FFNA 4MEBA 1T13A 4CCSA 3NDIA 3DVAA 1QXSA 2WICA 4UAJA 1VQ1A 3V4SA 5L8VA 2QTFA 3PUKA 1S7GA 5FOQA 1YCDA 3NIDB 4F3RA 2M6KA 3W1WA 4CL2A 1WCIB 2XGSA 4G4JA 3O73A 1OWLA 2QDXA 3OEHA 2AEFA 3R5TA 2OCXA 3GEBA 4MICA 4O8ZA 1N2JA 4OYRA 5FPPA 5CA0A 4OOFA 4UNPA 1GRVA 1R18A 4LF9B 4CM8A 2GOYA 5KDDA 4RCVA 4FGLA 5JSYA 2ZDQA 2IPMA 2WZBA 3I8SA 3WMFA 1HFKA 4D81A 3OJLA 5ETJA 4WAUA 1OWPA 1KSHA 5EP2A 2PRKA 1I9GA 3WFIA 1XKTA 1KMHA 4G0YA 1N5IA 1XTVA 4PSCA 1XPOA 4NH4A 1I01A 3AMVA 4ZOEA 3VZQA 1JHQA 2YJ4A 3HVRA 1XDBA 621PA 3L4KA 5D6OA 3GNLA 5ENDA 4PHFA 3E2MA 1WZCA 4L9SA 4KWEA 3LCMA 5CYFA 1KEEA 2HNKA 5LMZA 3HDJA 1AZSC 4J1TC 1CC1S 4FBMA 5JT1A 4CFYA 3HLYA 2Q50A 4O02B 5H82A 1SHLA 3I5MA 5KJFA 2J0SA 1C1DB 2XUKA 3SHWA 3NM6B 2BEVB 3B9QA 2CFTA 3UC5A 2ZM6B 5LNK1 1D2NA 4BLUA 2ZAMA 3ER6A 2XMCA 4KW7A 1EUDB 2XQJA 3QA3E 1YWGO 1DEOA 1A7JA 3ICOA 3F49S 1C8KA 1JQJC 4QXMA 4O59O 2F1KA 4X62B 1N4AA 1WA5A 4IXDA 2Y27A 4B71A 3HR4A 5FL3A 3SYTA 1KJJA 4KCGA 2QP3A 3F1LA 3UV3A 4BNIA 5LPNA 1E3JA 3OETA 3LT1A 3T5CA 3VC7A 1DHRA 2BVNA 1QBGA 2C4KA 1BFUA 1TMGE 2GS9A 1U2TA 2I8CA 2R7LA 3E82A 3EZ9A 3H42B 1MOPA 3H8VA 4KDEA 5BV7A 5IKXA 3T0IA 4QHTA 4WL0A 2NVWA 4J7XA 2GX6A 4K28A 5JAQA 1DDGA 5THQA 3WGGA 3K5IA 1NJ6A 2NMVA 4P36A 2YHIB 3C7KA 1KYVA 3NT5A 4UUMA 4CIXA 3IT1A 4DEVA 5IH7A 3J7AC 4AY2A 4NYJQ 3LTNC 3NM4A 1CXZA 2BBSA 4X61A 2R6FA 1MU0A 2FCAA 5DE3A 3GXBA 1B6TA 5E6UB 2H4ZA 5I45A 4QGHA 3ZVMA 1KXZA 3ASYA 4WADA 1CEQA 2EBHX 1OTHA 3HPRA 3JTMA 1V7CA 3U4DA 3WBKA 4UAGA 4ZJUA 4ZYTA 2WB2A 5JDCA 1JG6A 2EW8A 5ENZA 4Y6RA 4JIGA 5BUCA 1EE1A 1RABA 1CQJB 3ABRB 3AVVA 4JVLA 4PVDA 3ZDBA 4L4SA 3KELA 3WL4A 2QGNA 1XLVA 2HMSA 3EG9A 2E4AA 1AGRA 5B6JA 3A3OA 1P0QA 3KHKA 4GXRA 5ICGA 3HHEA 3C7DB 3HUFA 3OPXA 4PNPA 3L0IB 5TARA 3P9KA 1J8QA 3G7NA 2XV1A 4CBVA 1DQRA 2ERYA 2GO1A 3AXTA 4XM2A 2X8BA 2UYOA 2ZIAA 1I10A 3OPMA 4G8DA 3S70A 4MV3A 1GPMA 2X5XA 3FUXA 4A1FA 1RXWA 4DB4A 4GRIA 1Z2DA 1XJWA 2C2HA 4KIWA 1S2MA 4B3SB 4D25A 2V6IA 1SZPA 3B78A 3W9YA 1PVOA 1N2XA 1RWWA 1KJ8A 3FWHA 1TIBA 5CAEA 4D4GA 4ZRMA 3ZIDA 2Y1KA 4B5LA 3ZJ5A 1SKBA 3QYFA 2GHQA 2Q49A 3LPNA 4FMCF 4G1MB 1G41A 3E27A 2FFHA 4KIFA 4AUMA 4HDKA 5TMBA 3UB4A 5I7VA 4OH7A 4KQ2A 5IMSA 1E7MA 4Q47A 5DEOA 4YP1A 3DO8A 1T5IA 4YAGA 5BPHA 4Q9DA 2A3RA 3DDZX 1HURA 2JCBA 3CWZA 3FNEA 1D03A 3O84A 1EHIA 3Q88A 5DBIA 5HGJA 2GAAA 1V7ZA 3H4TA 1CUAA 3LECA 2DUNA 4RH0A 3S2YA 5LUBA 3QPDA 4UHDA 2F3QA 2VAPA 4WLOA 1QCZA 2A5FA 5FO0A 4H0CA 1R16A 2A9KA 2H0RA 3ICQB 5GVRA 3L6UA 1YVPA 1DKOA 1G55A 4A0HA 5BNIA 4YV1A 4V0RA 1E4EB 4G3XA 5AH0A 1ZDMA 3JALA 2IIPA 2GRUA 1UP4A 3U61B 1E0KA 3L7DA 4OV6B 4QO7A 4RULA 5KOJA 1BVRA 5CB4A 2RGBA 3R7BA 3O21A 4LVOA 2ZEJA 4TRNA 4BFLA 4EKIA 2B6NA 3AJDA 4MCHA 2BR5A 2A30A 5DPMA 3KYDA 2I4IA 1EIZA 3LH5A 4CQNA 2ZB7A 3H6GA 1DC7A 4F6RB 2NXEA 1HDRA 1JA1A 3UQYS 2P79A 3GOHA 3D4PA 3H5NA 1KI8A 1UDWA 4RTMA 4B83A 4DY4A 5HFJA 2D2XA 1VL6A 3B8EA 1T5OA 4EAAA 3OA0A 2I33A 2YTZA 2PYIA 3B20A 2UV8A 2Q0HA 2WABA 4U7JA 1AQUA 1JDBC 5FPTA 4IQ4A 4BVHA 4EUSA 4QD3A 3WGOA 2P6RA 1MMFB 3LZDA 1ZM7A 2HADA 1JZSA 5C0OE 3G0DA 5KHOC 4QG3A 2FX3A 4URHA 2OC4A 1MAHA 1PG5A 4NIMA 1QS0A 2FEXA 1RHKA 5CITA 2OHXA 3WDSA 3AXSA 4XCVA 4X0EA 5SZIA 1Z63A 4RESA 1YMVA 1TVCA 1NBWB 2Q1YA 4C4ZA 3PC8C 1DTSA 3LV8A 4IS3A 3C98A 2VA9A 1QZ3A 1IZ8A 2BRUA 3L8ZA 4OXNA 1INLA 1TQ2A 2J9RA 2HLHA 2WMOB 3I76A 4F5YA 4ZVVA 4DL9A 3HSKA 4HN2A 3ER9A 1GA1A 3P0FA 1OZAA 3B9RA 4ARAA 1NUPA 3PYMA 1Q44A 3TGWA 1IUKA 1GKKA 1C4OA 4PE5B 1A8IA 5LZ8A 3FLAA 3GZNB 4J2OA 1W0CA 1C4KA 2L18A 3HU5A 1CJSA 4HDNB 4R8SA 3FE2A 4A91A 4ANFA 1U2SA 4EVQA 2HRZA 1TW3A 2XMQA 5DYYA 5AK0A 5AQ1A 1JG2A 2W2KB 1ONPA 5JZOA 3PHHA 4QSHA 1CY8A 3T1NA 5E7MA 1VL5A 4AMBA 1UAYA 4RZUA 2UYYA 3QHQA 5C46F 2BR3A 2O7NA 4LHVA 3HVHA 1R10A 2YC4C 4HEA6 1X8LA 1KQPA 3KG2A 1EUZA 1IMOA 4WLEA 2XB9A 4L85A 3PHLA 3DEZA 4LKRA 2B25A 1OFUA 3MPUA 4QDZA 4C04A 3FAZA 4BECA 1WQ1R 3FNQA 3DMGA 2W00A 1I1NA 5HDBB 3ABOB 3PA8A 3CLTC 1FFCA 4RY2A 4V1CB 3NUQA 1DDIA 3HYTA 2IE8A 1S8AA 4PX9A 4U7FA 1QDUA 4MP8A 1U0GA 5PNTA 4OHRA 3E22A 4H6WA 4OU5A 1VGRA 2I65A 1J8DA 3N0VA 3L43A 1EFAA 1ZK4A 4HGYA 1K0FA 2VQ3A 4D9NA 1J21A 4ZIRA 1T9CA 4EATA 5DB4A 3ZBQA 3LXUX 4V0KA 4H31A 4AMGA 4BJ5A 1GHTA 3LP5A 3ROZA 4F6LA 1UJMA 4FILA 1N2EA 4KP7A 4FMPA 2XGJA 1SQ0A 1XRRA 1K4YA 1N6HA 1PQ4A 3QZUA 4PG4A 5DM4A 5CCEA 2I99A 1NW9B 1V35A 3PE6A 4KUGA 2JIRA 4MVJG 5JW6A 4PRZA 1SU7A 3IQGX 3E81A 4NBLA 1UAAA 4QOIA 1AK9A 1ZONA 1CR1A 4S35A 2H52A 4B3FX 1O7JA 1WPXA 3AKEA 4JUIA 2MSNA 4QOGA 5HBRA 1APBA 1QE3A 4NFLA 5FL7A 1Y9EA 3WYFA 1KBOA 4ZV7A 1Y5RA 1KY5A 3FCYA 4TM8A 3S2GA 3W8RA 8ATCA 4PY2A 1WG8A 5JVDF 1G59A 1H69A 3W3ZB 1G60A 1PTKA 2P9JA 4XTRA 3FVRA 3BF7A 4JD5A 5TR9A 1NFRA 2X0IA 1WTAA 3G23A 3KKOA 2WQ7A 5LMUB 1JB9A 3JASA 2FP4A 3CE9A 4WZAB 2Q6IA 1OPRA 1L5SA 1HLDA 2P1RA 3NNSA 4BGEA 1U8EA 2Z30A 2VJMB 2D3TA 2IU6A 4B6RA 2CJPA 1CZOA 1A1SA 2NV6A 2PUJA 2FWIA 2VDVE 3CEMA 3W5JA 1M67A 2NLOA 5I3ZA 2J5XA 1EVJA 3Q4GA 1JYFA 2VHUA 2QMQA 3BFVA 1YE8A 2W37A 3HYRA 3O1LA 3NBMA 2VCEA 3BTUA 3C3DA 1OFGA 3DTYA 3NBZC 3D8UA 4Z0HO 1P9RA 3GVPA 3I9JA 4AAYA 1GILA 4DBVO 1CZLA 4YC7A 4OA5A 3VX3A 5AW3A 1TI7A 1XPUA 4J0QA 4PLFA 1DINA 1KP2A 2VAVA 5JJKA 1TZMA 1EE9A 1EUYA 4EA8A 3SNKA 4YUYA 5DH9A 5IYZB 5IAKA 1DKLA 3G8CA 4H0NA 5AHXA 1SG6A 3B36A 4FIZA 5FNVA 1E5QA 2GZ2A 2PUWA 4WBNB 2W4QA 1VYVA 2EV9A 4TKVA 5K6AA 3W8NA 3HFJA 3TQRA 1GZSA 1R5JA 2YUTA 1FSSA 4PRYA 5KZMB 2WTMA 2ZJBA 1L4HA 2FHPA 3WG9A 5A2GA 2WIJA 1I14A 2WSBA 4ZCLA 5C7OO 1LLUA 2O07A 4IF6A 3IJ5A 3I2HA 4HBGA 1H2ZA 3UA4A 3P26A 3W04A 3AEKA 1KH1A 1YDGA 2IOYA 4G37A 3LC0A 1U3VA 1NVAA 1KMNA 2C4UA 4GGMX 4I50B 3CPJB 3N8KA 4PWYA 2D0DA 1ZN8A 3QKWA 4PBRA 3CY6A 2YRFA 3WGMA 3EBOA 3HDQA 4BS9A 5CXXA 3OMXA 2WSSD 3THSA 3IUNA 2EZTA 1SK8A 2JARA 3WK4A 1NHGA 1JI3A 1HPLA 3CT4A 2A1TR 3AUTA 4FXOA 1RPZA 4TS9A 4C4YA 2F64A 4BVGA 2JIOA 4IZOA 3TTSA 3T3NA 1L3IA 2PU5A 3N2ZB 2BOVA 4X00A 1EH5A 1HZJA 3R0IA 4GOOD 2PTHA 1N33B 1WB6A 4CEHA 1NBIA 2VYVA 2VAMA 1FFDA 3CF2A 2GN4A 4MZXA 1Y1QA 1ZH2A 1R0SA 2GEJA 1YZVA 2GYWA 2MR5A 3MJ4A 2E85A 3S55A 3ZVNA 2HZBA 1QQ6A 1W2HA 4IMIB 3BJIC 5HFNA 4G1EB 4P4SA 3WLQA 1NV9A 5HS6A 1C3XA 4ZYUA 5IASA 3BK1A 3S44A 4C0HA 5MFPA 3W7VA 2WQZA 2RAFA 3RV3A 5KYXA 2WJGA 3N2YA 3ZCQA 5MGNA 3ZR4B 2WDPA 4E3WA 3UAVA 3SDBA 4P5EA 1EK0A 1TJPB 4OJTA 3CZQA 3GRVA 5FJIA 2GXUA 1TQHA 4BGUA 1NE7A 3D7RA 1LPSA 4L9RA 3UB3A 4DS3A 5BN3A 3TBFA 4EYSA 4GKJB 1Z2AA 5CB0A 2PUEA 1XNRB 1G4AE 3B1ZA 7ADHA 2AD5A 4P33A 3TPCA 3UJ6A 4BNUA 4GF5A 4TZTA 2JKZA 3G2OA 2P2DA 2PZEA 2ZTUA 1HFEL 4M7PA 4NATA 5FTMA 2XCIA 1N3BA 4EAQA 4F04A 1KNQA 4ID3A 3MB8A 5BV0A 1G38A 3GUHA 5CA1F 3DVLA 1H93A 2EIHA 1L4LA 2B82A 1NXPA 2FY8A 1U0JA 3I1YA 2A0WA 5ITVA 1KVTA 3DR3A 1SPBS 1ST2A 5FUBA 5JAPA 1H0SA 2GESA 2DBQA 3K1TA 1A9SA 5J4KA 5LD2C 2CV2A 4C7MA 3LBNA 4TV9F 4HAVA 1X1RA 1MTZA 3PNQA 4P93A 1QVVA 1IRXA 1V4NA 4HYQA 4P31A 4Y9UA 5ERYA 4YBRA 5CLLA 3IPRA 1ZIDA 1JDBB 2AA3A 3IBSA 1BS9A 2NQTA 2C1EA 4F8YA 1AM4D 3L49A 3IDQA 3LGAA 4FFRA 5DGHA 2Z9CA 3H05A 1Z17A 2AFHA 1LLCA 3DGEC 3Q1KA 4X6XA 3K0AB 1T24A 3DS8A 4RK6A 4YO7A 4MIYA 3R76A 1OBOA 2BMEA 2J3EA 3CEJA 4CQLA 2NU9B 1E9SA 2GAOA 5AQEA 1NU8A 2LWIA 2CHGA 2KBFA 2RG7A 3FJYA 3IESA 4QREA 4XOIA 2ZJ4A 3M34A 2NP6A 4EM6A 4Q4HB 3I45A 2X0RA 1OR8A 2AJLI 1CQIB 2WHPB 1SHKA 1W9HA 4BVAA 3HR7A 2IYZA 4YRRA 1KDVA 1LSUA 2PUGA 1QWSA 5B2ZA 5C1BA 3S1AA 2GCOA 4G5RA 1E69A 4J7AA 5EIWA 1UT5A 3IEIA 2FPGA 1RKXA 3DL0A 4XX1A 4U2KA 4Y1GA 2QK4A 1NVUQ 2BEKA 3OZEA 4N49A 4ZOLF 5EJAA 3UJPA 1O5IA 2FZ5A 1TO2E 3K92A 2AR7A 2FPXA 1Z28A 2WSLA 2WUVA 1U9JA 1H9CA 2OILA 2GD6A 4TPKA 2ZK7A 3RSLA 3U49A 1BEEA 3WSWA 3VMMA 1J90A 4UREA 3PDUA 1C9KA 1QTRA 1ULTA 1XTSA 1Y3HA 2Y8EA 3M4JA 4KVAA 4QQ8A 3IYLW 4TTAA 2QKYA 4Y98A 4ZXPA 3B2EA 4BX3A 3EPHA 4OJMX 4MQ6A 4QOSA 3OICA 3G8DA 2Q1WA 5G1PA 3O8CA 1TDJA 1M0EA 4ZVRA 1NNI1 2GNOA 2X9QA 1WB4A 4R51A 1SG9A 2XHZA 1KI3A 1GAXA 1IN1A 5CJ2A 4HI0E 2F48A 4ME6A 4AZ0A 5BN4A 3UXMA 3WK6A 1BCRA 2IYPA 3WR5A 4C03A 5I9SA 2IU0A 3SMQA 3GFPA 2NU6B 2IQIA 2Z6AA 2EKBA 2B5OA 2FAXA 3IQDB 5AW6A 4N65A 4UMEA 5ICMA 1XTJA 2BJVA 1L4BA 1EFCA 4IEIA 4BUCA 2RC6A 3BE6A 1JQEA 4D79A 5JBIA 3R77A 2LCFA 2JEYA 3AHCA 2G9UA 3KHSA 1WOMA 2QM0A 3QIAA 4EK9A 4MV7A 1AHIA 2HUNA 2ZGVA 3E5NA 1QZXA 4ZTBA 4N39A 2GSWA 4U7GA 3JQRA 4NCXA 3UENA 4JYMA 4JC0A 3ND8A 3OESA 3DEHA 4AS2A 1ZAYA 2VRNA 1YRQA 2W8ZA 3TXXA 3AX6A 4E14A 3SIWA 2FPMA 3AB3A 3HTXA 1FUKA 1SVOA 2WF7A 4HQFA 4QAJA 4UNSA 5T67A 4BYMA 4EYGA 1A5AB 1XTKA 4CR6A 3CRVA 4ZT4A 4CG3A 5LLDA 2O1WA 1YMQA 2Q6LA 4K9OA 4QYWA 1B4DA 4L5BA 1Y0BA 3FMVA 3HDHA 2AEEA 2HOQA 5IJXA 2GD1O 4GOMD 3VZSA 5F3DA 3GPLA 1QIHA 2O2IA 2I3AA 5C3UA 1EQAA 1TU0A 1SUWA 3GJ4A 3Q72A 3BIWA 5A05A 3PXGA 3ROMA 4CKBA 1IHPA 4XLTA 4MWDA 3HM9A 2XI4A 4HJXA 1H1TA 4ZA2A 4A36A 3TRJA 1QF6A 3PEEA 3IP7A 2QTGA 2SCUB 3P4UA 1YKSA 1ZSVA 1KF0A 2HJVA 5D87A 5FB3A 5K51A 3QOYA 5L7YA 5TC4A 4CM9A 4MHOA 5EIAA 5DSXA 3C4QA 5LKRA 1C3OA 3KL2A 1U63A 2JEOA 2ZAGA 3QLJA 4UHCA 2BT4A 1W1UA 5FL7D 3FOBA 1VXOA 3ZJUA 4YMHA 3M5CA 1HE5A 4O2AB 3AFHA 5C7YA 1F12A 3WFZA 4OUDA 2JFUA 3RBZA 2PBFA 3FH0A 4FFOA 4M98A 3BX1A 1B0PA 4AO7A 1QBKC 2Q3CA 3JD3A 4BU1A 1OWMA 4WWHA 3MBIA 1RYNA 1DB3A 2NT3A 4WKPA 1U3FA 2NQ2C 2X3YA 2A9RA 3OLWA 2PU7A 2CJYA 4BLWA 5EHIA 3U3MA 3PA6A 1AKRA 3HGTA 3UKJA 1B93A 4E5PA 3IUEA 1P61B 4TRJA 1Q5PA 1OLSB 1XV5A 3QI7A 5NLLA 1LA2A 3TH5A 1R8JA 4D3YA 5AVZA 1V5GA 1UZNA 4D8YA 2KLBA 1OJ7A 4RZIA 4EMUA 2LGJA 3DZJA 3IP6A 4AZVA 4Q12A 2VKTA 4N3CA 3VM6A 1T2DA 1QMGA 4N7MA 1H0HA 1UBCA 3KYJB 1SVKA 2O0JA 4NABA 5FORA 5EJEA 5AOVA 5E9QA 1NJ8A 2J5RA 1ZEMA 3TQCA 3LZCA 5L45A 1JQAA 1ZICA 4NNOA 4MGHA 2P7IA 5COAA 2P3LA 3KPWA 1Y8RA 2QM3A 4L7QA 1IDOA 3CEAA 4QO8A 5CVVA 3VNRA 3BSSA 3EXFA 3RU3A 2LRHA 1T8TA 2XXBA 4ESHA 1BE1A 1QB7A 5I4BA 3DVQX 1RJWA 3USCS 1Z8FA 3FG9A 4QYMA 5ERXA 2O8FB 4C05A 1XXHE 3QVUA 4DA8A 5IN4A 1B1CA 1YMUA 4F5DA 4BTEA 1QH8B 4R3WA 3V2IA 1JKMA 2HK8A 4YPVA 1UWKA 1V9CA 1PK8A 2WMDA 2XMZA 4LMRA 2QTTA 3PX3A 5D6NA 5EPOA 1PKXA 2WJHA 3DTTA 2XCLA 4N1AA 2B8WA 1G2PA 4C4OA 4CQLB 1TKBA 1EB8A 3BORA 3JZDA 4FVTA 2D7DA 4GRDA 1ZI9A 3HA2A 1Z2EA 3F3KA 1H9AA 4RVCA 2B21A 4B2PA 2UYGA 1HDGO 3NTVA 4YJFA 3JYLA 2OBLA 4ZT7A 1S0UA 4JBLA 4ER7A 3SXUB 1RAFA 5BMVA 2B2CA 4I1VA 1PJTA 1IBSA 5BSEA 2QRHA 4RQUA 4ALIA 1TE2A 2ZJAA 4YRLA 1UZLA 2ZRMA 5EQFA 3GRKA 3IDFA 3U81A 4PQFA 4XUDA 1D0VA 4F2PA 4NHEA 4DA7A 5K0ZA 4FSXA 4NYIQ 3WGUA 1AKWA 3IELA 3T3OA 1E79A 1UJ2A 3BB1A 2ZROA 4TSFD 1G2QA 2EHJA 5GZ6A 2Z58A 3SZOA 4A2WA 4A15A 3ZIAA 2CBXA 5EXPA 4BMNA 3KPYA 4HG2A 3AVXA 2E5WA 2PMKA 4JC5A 1XCJA 4HDQB 2JAWA 3KBBA 3ZH9B 4XVHA 4EG3A 1ZO8A 3LHSA 4OQPA 4QT0A 5GV7A 1Y5LA 3JWPA 4DGSA 4E5DA 4F8JA 4TL7A 1DC4A 4GVLA 3L9XA 3VPCA 1ESDA 4ARZA 1EDBA 1QCYA 2DKNA 3UM9A 4Q00A 4ZYZA 1E98A 1B6GA 3V7UA 2XT6A 2H5IA 5EIOA 2E18A 1FX0A 3OTWA 2XUHA 3AJAA 3C6BA 5EIHA 1L5FA 1XEXB 2Q4RA 3IHWA 5LD2B 1K8ZB 4Y18A 2JLVA 4S0ZA 1U7XA 2Q2QA 4HDOB 1NAIA 1XKQA 1M75A 2JKYA 4RHTA 3ROXA 3WQHA 4J07A 1VE6A 4Q3OA 1J23A 1D9XA 1KAOA 4S1VA 5DGIA 4OQLA 2UZ3A 4D3SA 3T3MB 3REGA 2C9MA 1X7YB 2D8AA 4HVTA 3DZCA 3B82A 4P7BA 4PTZA 4TKUB 4ZOAA 4QSMA 1J33A 5FLKA 3PFIA 4B7XA 1PDOA 3WSTA 3GAFA 4ZAVA 4YRGA 1ZK2A 4E22A