4NE2A

Pantothenamide-bound pantothenate kinase from klebsiella pneumoniae
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
309
structure length
304
Chain Sequence
LMTPYLQFNRHQWAALRTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pantothenate kinase
publication title Structural characterization of a new N-substituted pantothenamide bound to pantothenate kinases from Klebsiella pneumoniae and Staphylococcus aureus.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 100
structure length 304
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ne2A00
1YR9A 5TARA 1J70A 4YMTA 1NRJB 3CZQA 1P61B 3ZZ0A 2HYIC 3I62A 4PC6A 4U7DA 2DBYA 1G21E 2JJ1D 1TUIA 2XSZD 4GP6A 4LX0A 4TMTA 2BBWA 1OYYA 4OKSA 2XGJA 2DFTA 2IS2A 5JEDA 5KSPA 3MGCA 5L3SB 3U3MA 3I61A 2A5FA 3K0CC 2JIZA 2OFXA 2W00A 1CRQA 1G7TA 1ZM3A 3PXGA 2O0JA 3SBEA 2Q3MA 2ZJBA 3QKUA 4URYR 1KSGA 2EW1A 2KBFA 3AF0A 2ZIAA 3Q7PA 2WJVA 1E9DA 2ZETA 2PX3A 5EE0A 1I4LD 5JECA 2WTUA 4AURA 3P4XA 2FNAA 1CKEA 1G5RA 4E22A 4LBVA 4JKYA 1XTSA 4NU0A 3N2EA 3BFXA 1P2SA 5LBIA 1EWRA 1XX6A 4PZYA 4U5XA 5AR1A 1X86B 2WHXA 4KYUA 4C7OB 4TZ0A 4LK2A 2WWWA 1US8A 1T3HA 3NBYC 4DCNA 2ZJAA 2Q6TA 2IA5A 4QJ5A 1DG1G 2WM9B 3K8YA 4CF7A 3DDCA 1Z28A 2FSGA 2JJ8A 5ANRB 4CEHB 1CBUA 3FDIA 3BFKA 1DPFA 2F3RA 4GZLA 2HLDA 4CDGA 2VHUA 4PSKA 4TLEA 2GJ9A 3ZIAD 3K9HA 4TYWA 3I5YA 1T6NA 4JBWA 2BC9A 3F3YA 4B33A 3IEUA 1N25A 3BB1A 2A3RA 1GILA 4DLRA 4F4IA 2WOJA 4TL9A 1F3OA 1KI9A 2BCGY 2XXAB 4CW7A 1QVAA 3AKCA 4BFYA 1KDOA 2P5TB 4Q9JA 1KO1A 2C78A 1W5TA 3U4QA 2YKGA 3LX8A 1OXXK 2B6HA 5LB4A 1GSIA 1UBGA 4D26A 1G8FA 4AI6A 2ZSEA 1X1SA 3GJ8A 3RS3A 1IHUA 1IY2A 1QHNA 3FMFA 2GK7A 4BPBA 5CIWA 2ODEA 4QNMA 2OT3B 4LJ5A 1RJ9B 2JA1A 3OIVA 1OH7A 1OYWA 3H84A 1T3SA 2ZRMA 4I1VA 2HT1A 3G0HA 2IX3A 2W58A 5JHHB 3UKDA 1ZAKA 2QNRA 2ZRKA 2ZTSA 2FSIA 1PVOA 1RKBA 2ZRFA 3DKVA 1CULC 1E4VA 4Q4JA 2J0UA 4HLUA 5CM8B 1Z8FA 4PC7A 1IN5A 2QAGC 3RC3A 1FTSA 1H65A 4TMKA 3CONA 3PEWA 1JR3A 2EQBA 3TH5A 3KKQA 4YXWD 4KITB 4JLBA 1RC8A 1HQCA 4X8OA 1SHKA 1XDBA 1GP2A 3THYA 1IN6A 2IUSA 1CLUA 1DADA 1OHHA 2XB4A 5FBQB 2ZS8A 3KZ1E 1ZU5A 4FMBB 3WBKA 4AKGA 4CT5A 2AK3A 2HJVA 5DGXA 3VR5A 4S35A 2YWFA 3X1XA 5H70A 3KB2A 1LNZA 4PAMA 3EPKA 4A0FA 4IHQA 3CUEF 2DFKB 1Z08A 4FWIB 1Z06A 3AKEA 4MYTA 1CJTC 2JJ2D 2Q9BA 4L5BA 3AP2A 5G3ZA 4B76A 1E2MA 3K09C 1W1WA 4P4UA 3FKSA 2QMOA 4D81A 4YMSA 5JWRA 1OLOA 2XZOA 2V55B 2NOAA 4O2LA 4OI4A 5IK2A 1AS3A 2QM7A 5KNCA 2GBLC 4EPYA 5KPJA 3LY5A 1HQYE 4TL6A 2VQSA 4PHFA 1NJGA 3FB4A 2QP9X 5L3VA 6Q21A 1P5ZB 3L0IB 5CYPA 2V9PA 2WOOA 3C8UA 3SJCA 1XCGB 4EJSA 1UAAA 4HI0E 2NO6A 3EIHA 3IQXA 4KFTA 2A5DA 2Q3HA 5AJYA 3W5JA 4D4MA 1GL6A 2ZRAA 1WBBA 3A36A 4M4SA 4B2PA 3EAQA 2JDID 1GIAA 3UMFA 4MGIR 5DE3A 3U7EB 2ZSDA 2P2LA 4IXNA 1XD2B 3GLFB 2ZE6A 2GXUA 3UXMA 4EPVA 1X1RA 4PQYA 3K70D 1VYUA 3EARA 2RHDA 5GJBA 4B43A 1H8ED 1FMLA 5JHGB 1E9SA 1KNXA 3SZRA 4WW0A 2EYQA 1BMFA 5DH9A 4EDHA 3TSWA 1OKKA 3U4QB 4IVRA 2NMVA 3S1AB 2NG1A 3WHLA 1SXJA 4Q7JB 4GDFA 1TX4B 5EP1A 4AWXA 1CJUC 1FP6A 2QAJA 5JEEA 1E0AA 2UZIR 2MSDB 2VL7A 4GOKA 3UATA 4ESHA 1Q1BA 5EXTA 5FTMA 4R71A 1NMZA 2QRNA 4W5HA 4A9AA 3D8BA 2JLYA 4MRVA 1HV8A 1VG8A 1Z83A 3B7GA 3MUFA 4QHTA 3TQFA 2BKEA 2CL0X 5IT5A 2KSQA 3CRRA 5DN6A 2PJZA 5DYIA 4CEJB 5JWOA 3MJHA 3ICQB 1A2BA 4HYYA 1SVSA 5FH9A 4CT4B 4KYIB 4DDVA 3WHKA 3VX3A 5CDFE 3B78A 1B0UA 4K46A 5EXPA 1EK0A 2WPDA 1RPZA 2WMNB 2SHKA 3EA0A 4KJZA 2QMEA 2FE4A 3THYB 4DCVA 4KSCA 3QEOA 2QTHA 4G01B 1E0JA 4LJ7A 1ZD8A 4M1WA 1Q21A 3B1XA 1DG3A 4RY2A 3TLXA 1GNPA 5JS7A 1K6MA 3AF3A 3WRXC 4CZ2A 1CTQA 2OXRA 2CNWD 4IOJA 1UBFA 2G1KA 2WWYA 1AS2A 2EU8A 2QI9C 4H9GA 4X8LA 1IAQA 3LBIA 2WKPA 3IHLA 1VMAA 1TL7C 4TMWA 3VKHA 3OFNA 2OXCA 4K81B 4MQBA 5SZHB 5KSYA 2VPPA 5FPKA 4ZV4A 2FSHA 1WQ1R 1LF0A 2VSOA 2BDTA 2NQ2C 3CH5A 3A58B 5FPSA 3QF7A 4PQFA 3AVTA 1XJCA 3BJIC 3OE7D 4KBFA 4FMDB 2IS1A 1KTVA 2YJTD 1Q44A 3QE0A 2YOHA 3P1JA 4OHVA 4E07A 2ZJYA 1PLJA 4GI7A 4ABYA 4L9SA 4BEBA 3RABA 2B8TA 1VTKA 2VP4A 2GXSA 1RRCA 4A6PA 1SVMA 4M9ZA 4G5GA 5H1YA 1R0WA 4RZUA 2J41A 3EA5A 1VKJA 4LBYA 4XJXA 4ZKDA 4B35A 3C5CA 2C96A 3X1DA 4HB2A 5FPYA 5HR5A 4EQ6B 2EFCB 2ZR9A 2XTMA 5J5CA 4KVAA 1Z0IA 4E09A 1W48A 3Q5DA 5E4FA 4NYMR 4DCSA 3VNUA 3QI2A 3ZH9B 1TF5A 2Z0MA 4OI1A 1E2KA 1VG1A 3CIOA 3O8RA 1CU1A 1IBRA 2VLIA 3B1YA 1QG2A 4BFSA 1OIXA 4Z1MD 2G6BA 1TMKA 2H92A 3AQ4A 1XZPA 1ZU4A 4TL7A 1WE2A 2DWQA 3CNLA 1A82A 1UEIA 5JJLA 3LW7A 2OE2A 3R9XA 2XB2A 1U99A 3TUZC 3HU3A 3TW4A 4Q9KA 4O25A 1RYHA 3SQWA 3D3QA 1XJ0A 1DAKA 3A6PC 2W83A 1QZXA 2NZJA 3OAAD 2NO1A 1MO4A 4JL8A 2ZRBA 1RIFA 2WAXA 4GMDA 4LC1A 1E2DA 1LFDB 4QBHA 1ZC3A 4MKFA 2O8DA 1R10A 3AF4A 5FTKA 1H8HA 1N6KA 2R62A 4HDCA 3ADBA 3CNNA 2ZAMA 3CX8A 2RMKA 3TR0A 3H2YA 2IYUA 4XD7D 1W0JA 2JASA 3PUYA 1COWA 1KIMA 1NMYA 1XEWY 4D4JA 4AKIA 2WVJA 4YQFA 4QG7A 4GMXA 2OBLA 2XITA 3C5HA 1XXHA 1EX7A 2AX4A 5LD2C 3OHMA 3ZVNA 2EYUA 4Y0AA 3BK7A 1IXSB 5F2EA 3K9GA 1ZP6A 3VU9A 3D6TB 2R6AA 1KYIA 3NBXX 5JWHA 4UNRA 2PEZA 2HYDA 2FEOA 1E1QA 3F8TA 3M4YA 1JBKA 3RS4A 3G82C 1S3SA 5EZ5A 1MOZA 3QPVA 3TVTA 1HYQA 4KBGA 1BH2A 1Z3IX 2J7PA 1KAGA 4Q66C 3CR7A 3PQCA 3HPQA 4KCGA 1IJEA 2GCOB 3MWKA 3UANA 2A5JA 1ZINA 5FI0B 4PX9A 2PZGA 4QXAA 2H16A 4D0GA 1A1VA 4JLVA 1R8SA 2QL6A 1GAJA 3QXJA 1OXSC 4URUR 1W2GA 4G1UC 5FPTA 4HLCA 2BVNA 1WMSA 4RVCA 3CF0A 3I72A 4Y0VA 2C99A 4MDEA 4DT1A 5B2ZA 3LD9A 4Q9IA 1R0YA 4M1TA 4W7SA 2F1JA 2ZJ2A 4NPHA 4LHZA 4OQXA 2G83A 3FGNA 2BBOA 1VIYA 2ZE5A 1DO0A 2GCNA 4HATA 4IW3B 4NZYA 1G7RA 3RHFA 3GLIB 3C15C 2WV9A 1W44A 3ZGXA 1RVDA 2IEZA 3PUWA 2CLDX 4OK5A 2PT5A 3H86A 4B2LA 4EUNA 1E4YA 1CXZA 1ONBA 1EGAA 1ZIPA 4GBMA 3U7FB 4DXAA 3VR1A 3RS2A 5JCPA 4ESVA 1VHTA 5G3YA 2BBTA 2OCPA 5CM9C 3CF6R 3WMFA 4M53A 1YVDA 3MWJA 2IHYA 4JVNA 2D62A 8OHMA 4DLWA 3ZLJA 1CJVC 4JMPA 4II7A 2CBZA 4OL0A 5EUQB 3QXXA 3NWJA 4O3MA 5F98A 2GXQA 3PG5A 3BIFA 4UXHA 3L82B 2YZ2A 4RKEA 3DZDA 2BKUA 1Q3HA 5FL7D 2O8DB 2YC2C 4B73A 2GRJA 3AVVA 3LBNA 4A0RA 1Z0FA 4PC2A 3WYGA 1XEFA 5DHFA 1D2NA 1NLZA 4RFSA 5CDFA 1GNQA 2G9NA 3KFXA 3BGWA 1KI7A 1FP7A 1PLLA 2IL1A 2RGBA 4XVQA 2YVUA 1GNRA 3OEHA 1XXHB 5FL3A 1O87A 2PCLA 4F4CA 3LLUA 4MYUA 4I4LA 4I1SA 3MLEA 2F9LA 2ZU6A 2BEKA 4CVNA 4RD3A 3VU9B 1OIWA 1JR6A 3B60A 1XPUA 1MV5A 3ADCA 2R6FA 1R4AA 3L0OA 1JXMA 3GJ6A 3NH6A 3RWMB 5L3QA 3LH5A 4UXIA 2BV3A 1W7AA 3EC1A 4RD0A 2VYFA 2CDNA 5BN3A 4V0ME 3QENA 3WNBA 3EPJA 3KXKA 2ATXA 5J47A 2PZEA 2DWPA 1I4DD 1QVRA 3EASA 5IF9A 4LY6A 3AEZA 1KMHA 2WJYA 3FFBA 4MKIA 1X3SA 2XNDA 2PEYA 2GAOA 2J7KA 3GP8A 3AF1A 3GQBA 1DAIA 2ZI4A 5FOUA 2OCYC 4FXPA 4NCKA 1JI0A 4JIMA 3GEEA 4XSGA 2X19A 3V4FA 3NEYA 1NKSA 4DT1B 4DUGD 4ARZA 1K5GA 1ZNWA 1D5CA 2BMEA 2Z4RA 5DI9A 4BFZA 2CCKA 4YMUA 1KI8A 3QY0A 1XEXB 1GTVA 2GAAA 2WWGA 2IYYA 4URVR 3A4MA 5FTLA 5KSOA 1RE0A 3MMPA 5CLQA 4YONB 3B5JA 5UKDA 1EFRA 4BFUA 5K8UA 1CEEA 1X8JA 5BW8A 2VF7A 4DSOA 2C04A 4FMCB 1MO5A 3WXMA 1FUKA 3KX2A 3SEAA 4OK3A 4KV9A 1AZTA 1ZJ6A 4ITRC 2Z6VA 3CPHA 4BQSA 4PC1A 5HCNA 4DEXA 4HLQB 1G3UA 4TQ9A 4BZQA 2OAP1 1HEIA 2J46A 1VIAA 1R0XA 3IPYA 4ILEA 2VP6A 3PJRA 1E9FA 3DMNA 1P9RA 4P31A 3K53A 3BWDD 4Q9HA 1JEDA 1TTTA 1N0WA 5FUXA 2D3WA 3B9QA 3J81k 4XWAA 1EXMA 4RD6A 5DSZA 3X1ZA 2FGJA 4CEIA 3RS5A 3GJXC 4RD2A 1R0ZA 1D8TA 5HCIA 4ASUA 4DRZA 3PITA 2R6DA 1VCIA 1X6VA 1E2GA 3UWKA 4E5UA 1KSJA 4RFSB 1FL9A 2J1LA 3KUCA 3QF4B 3PUVA 2OILA 3A1VA 3ETLA 3RRYA 4ERNA 4L9WA 2VSFA 3QSYA 1YR6A 1WP9A 2F9MA 4DDWA 1E99A 3ICEA 1N5LA 2WICA 1KDPA 1JECA 1ZMXA 1G8PA 2BMJA 4KVGA 5DO9A 4DLVA 2HV8A 2WMOB 1U8YA 2RGNC 5DI3A 1YR7A 1YZNA 4B3XA 3VMFA 3W5IA 5KYKA 2VP5A 2WWHA 2ZUDA 1BYIA 4HAXA 3LWNA 2WJGA 4DKXA 1E2IA 2KWIA 4PHGA 4PR0A 1Z6XA 2A30A 2ZAOA 1IJFA 1OFIA 2R8RA 4IEIA 2Q21A 3Q8XB 3BORA 2F7SA 3QPUA 2QROA 4R9UC 3EW9A 3HU2A 4BLOA 1D9XA 4OK6A 3FMIA 2GHIA 5C4MA 1KMHB 5JSZA 4AK9A 5JJKA 2FA9A 1Z63A 3NDPA 1W4CA 3L43A 4F92B 3L2OB 2NPFA 1F60A 3NEJA 1ZRHA 3LBHA 1PUIA 2Q9CA 1E2JA 4TSFA 3I92A 1ZD9A 4C0KA 2W2XA 2IS4A 4US1R 1E1RA 5KDDA 2AD1A 2QSYA 4LYJA 1Z6GA 3T5DA 4RD4A 1NY6A 4ZIRB 4GFDA 3BFVA 2ZSBA 2VHTA 2QZ4A 2O52A 5FOXA 1WRBA 1OH6A 5GVSA 1C1YA 4PO8A 1FNMA 2C03A 3KJGA 4QM6A 1Z6YA 5IHPA 4IDNA 4LYAA 2ATVA 1G3MA 3BH6A 5JRZA 4TTPA 1T3LA 3NXSA 3WNCA 4C2TA 4NL4H 2QBYA 3DPUA 2VF8A 5EZ6B 1NVUQ 1II0A 5KTYA 2AL7A 4NP6A 1PV4A 1ETUA 3AVYA 1D2EA 2ZE8A 3W6NA 2LCFA 5BYKA 2O8CA 3U44A 1F5NA 1T9HA 1YU9A 2OV2A 4M9SA 1G6HA 5A0FA 4V02A 1JALA 3AKDA 4ZDWA 1Q1EA 5CLLA 4HB0A 2CXXA 3ZD6A 5FBRB 4DC9A 4MRRA 1U0JA 1PJRA 1XB2A 2X2FA 3FFAA 5TDHA 4M1SA 4DB4A 4QBFA 1CR0A 2QTFA 4TLAA 4WVFA 3GJ4A 4CEIB 1AIPA 1OFHA 2YINC 1U9IA 4C0BA 1GFIA 3KKMA 2D7CA 3P4YA 1DARA 3O8BA 3T34A 5AUNB 1W47A 4V0NA 5GVRA 2CCGA 3SS8A 4M1KA 1CJKC 2ZRDA 4QGAA 4PANA 3SR0A 1Q12A 4TMXA 1N6LA 1NBME 3ZJYA 3CX7A 2C98A 2B92A 2W6JA 2WKQA 3TSZA 4JLMA 4TZ6A 3U3OA 4FI3C 1G291 3W3ZB 1FOEB 1OT3A 2JEOA 3IDQA 4M1OA 2O5VA 1YZQA 3AUYA 5JFGA 4IDQA 4JSTA 4LV6A 3X1WA 4AG5A 3ZVMA 4JZKA 1E94E 1S9DA 5CJ2A 1AGRA 4OI2A 4FD2A 4KLZA 4Q1DA 1NN3A 4ZPXA 2JLQA 3UWOA 4D82A 2F3TA 4NYMQ 2OBMA 4Q4AA 3P20A 2YWEA 2ZRHA 1G6OA 3NHBA 2V8OA 1N6NA 4OQMA 2GESA 1S9HA 1F48A 5FOWA 4BFTA 2VIIA 1OE0A 2XAUA 2ORIA 3QNUA 4MKGA 2JLWA 4V0MA 3RRMA 2XOKA 1QHHA 4UNSA 1G17A 1U81A 4RCYA 1NSFA 2FU5C 3V4RA 1SVOA 1T91A 1TF7A 5F3WB 4LZZA 4S2EA 2R6CA 1XFAA 1ZVQA 3GLHA 5E3HA 2FJUA 3IO3A 3IKJA 5KNDA 1DO2A 4YDHB 4L8GA 1DAHA 4PPFA 3VX4A 1GRNA 1ODFA 3GPLA 2BJWA 3T61A 2I1QA 4A36A 3THOA 2QG6A 2ORWA 4Q5IA 1NMXA 1P2TA 3UMSA 1WDTA 2QN6A 3QIAA 4AYXA 1AQYA 3W90A 1U8ZA 3CX6A 1RZ3A 2XTZA 1G8HA 2GCPA 4LJAA 2QBYB 4G5SA 4ZDIA 1G5TA 2QQEA 1PUJA 5BXQC 1MR3F 2GZHA 2CL6X 5B58C 3R8FA 3N70A 2O8CB 3THXA 1IOZA 2OZEA 3U44B 4TWZA 3E2IA 1KK3A 4BE7B 4NH0A 2CK3A 3B13B 3LAWA 2ASEA 4JLJA 4ZCLA 3DOEA 2ZRNA 1KHTA 2E1RA 3NBZC 4LV8B 4C9BA 2JIZD 5EP4A 1SVWA 2XNSA 3TQCA 1Z0KA 3ND8A 4IDHA 4V03A 1Q3TA 3P27A 4M0LA 2ZI3A 4US2R 1DAEA 1L2TA 5KNBA 4Q7MB 3GFPA 2PCJA 4ZO4A 4C3ZA 3KDSE 4A82A 5FR2A 4DEYA 4B34A 3ZYCA 4NYJQ 4P0TA 2GJSA 3ZZUA 4F38A 3MWLA 1P4SA 2I1VB 2ZRPA 5JZVA 1US8B 2YNMA 1J7KA 3AGQA 4KFSA 3KTAA 5D3QA 2ZM5A 2KE5A 4IEEA 1SQ5A 3ZS9A 2E87A 3K9NA 2V1XA 1K8RA 1YR8A 1M74A 4TL8A 1E9EA 4ZCMA 2EFGA 1KO4A 4PO9A 5SZIA 3EIQA 2W6IA 3O8CA 2GF0A 4GOJA 4LJ6A 1RW4A 3BC1A 1TPZA 1U2RA 4EFMA 3SYKA 2AFIE 1L4UA 1EFCA 2ZYVX 5FOVA 1GWNA 1J90A 2RAPA 2HLDD 2BCJQ 5JCZA 4RJLA 2J0QA 1JAHA 4DJTA 1OB2A 1EFTA 1JJ7A 3CRW1 4MH0R 3KJEA 4IRUB 1ZUHA 3L8YA 2IXFA 4LDJA 3SOPA 5AK0A 5J4YA 3WNDA 1GOTA 1TQ2A 4O0MA 4GP7A 3THWA 3OZXA 2OM2A 4V0KA 2XX3A 4C2UA 3B85A 3ZD7A 2QPTA 3LLMA 1UBCA 5BYJA 5KPDA 1FW6A 2NO9A 2QGZA 1KJYA 2ZRCA 1XNJA 3GLHB 2J5XA 5B30A 3SHWA 2OG2A 1II8A 2J9RA 3A1SA 1C9KA 4NCHA 3I5XA 2VRWA 1IXZA 3KB1A 2R2AA 3BS4A 5AJZA 3NIBA 1P2UA 3TUIC 3BE4A 1KY3A 4A8JA 3DVLA 4JT4A 4Q1EA 1BOFA 3MFYA 4A2QA 1CJMA 2L0XA 1KO7A 4DLXA 4Q4JB 2J0UB 4HDOB 4QHSA 2P5SA 3UG7A 1XMIA 2Q9AA 4BFWA 1IM2A 4ZI2A 3BH0A 3GJ3A 5EE5B 1FZQA 3FPAA 3RRNA 2Z43A 2EWWA 3THXB 2IC5A 1JR3D 1P2VA 1J2JA 1NL3A 4BZXA 1CR2A 5AUOB 1UJ2A 2V3CC 4LPSA 4LBZA 5E7JA 1N0UA 3FHTA 1OHHD 2X2EA 3IPXA 2VO1A 3NG1A 1W2HA 3IUYA 5E7MA 2D06A 2A7QA 3W6PA 2D7DA 2W2VA 4V0LA 1JXOA 1SVKA 4MRNA 2N42A 3HDTA 3CBQA 3RC8A 1AK2A 3HP1A 1HT1E 4KFRA 1BKDR 1NSTA 2ODBA 1HUQA 5AJVB 1HY3A 1R5BA 3T1TA 4Q9LA 2QORA 5C18A 1SKYB 3LDAA 3M0EA 3NDBB 1P73A 3BOSA 1AM4D 1AA9A 1NLYA 2DWOA 3OEED 4KHZA 2IYTA 4OYHA 1EWQA 2QGNA 1UKEA 4DLUA 4TLBA 2QEQA 3MRSA 5IK2D 3NC0C 2Z5FA 4NONA 3W8NA 3TVDA 2HDNB 3K0CA 2KI5A 4EJSB 4LUCA 1ZW6A 1NNEA 3Q72A 2ZXUA 4C0QC 1NBMA 3CPJB 4JS0A 2WWIA 1ZNZA 4D0LB 2WWFA 3T1VA 3JZMA 1GKUB 4ON9A 2F6RA 3EG5A 3WMGA 4QC2A 1U90A 2REXB 1NP6A 5JLJA 3E70C 2FFBA 5FTJA 5DISB 1FUUA 2BBSA 1QF9A 3THWB 1LTQA 3M1IA 1SXJB 4G5QA 1BMFD 5F9HA 4MYHA 1OKKD 3SYNA 4DSNA 4DVGA 1OB5A 4CGZA 1DBSA 1SXJD 2HJGA 2PLRA 2QUZA 1LW7A 5P21A 3CLVA 3QKRA 2IXEA 1IQPA 1CR1A 3SJZA 4DZZA 1G18A 2MMCA 1XTKA 4LJYA 4A8JB 1GRRA 1Q57A 5HZHA 1CS4C 1UKVY 3RVBA 2ZREA 5DN6D 2HEIA 3NHAA 1EFUA 2J87A 5DIFA 4BLPA 4DB2A 3QOFA 2VHJA 1MO3A 3T1QA 1VPLA 4I81A 4TLCA 4TYYA 5F9FA 1XZQA 4JL5A 4EPTA 2WKRA 1KSFX 3DHWC 2IYZA 2CMKA 1W0KA 2O8EA 3ADKA 4PSAA 1R2QA 1JQJC 2ECKA 5JBQA 1TF2A 4LBWA 1E2HA 4AG6A 1OF1A 4LWZA 3LNCA 5AJXA 3RNLA 1I2DA 2HCJB 2ODWA 2BM0A 5FFMA 1Z6AA 2W0MA 4XWOA 3TAUA 3W3AA 4G3XA 2IF0A 1MO6A 4KODA 2WSSA 4UNNA 5EQTA 3WYFA 3LO5A 1ZD1A 2WJHA 4Z8YA 1FFHA 4B47A 1U94A 1VHLA 2QAGA 2XJ4A 2QE7D 2ZRGA 3LRPA 2VHCA 2ZUCA 3E5HA 4DSUA 2VH5R 4BLRA 3DO6A 4QGFA 1N0VC 2ORVA 3KKOA 3OFND 4NYJR 2AR7A 2ZROA 1F2TA 2DFNA 1W5SA 3KKPA 1YE8A 3A4LA 1U8AA 4LGMA 2FSFA 3FHOA 3BERA 4B3BA 3GLGE 4PPNA 2PJRA 2LWIA 4QJ3A 4WXPA 2JLXA 4QFMA 2W2TA 2FPKA 1E3MA 2V54A 4LI0A 1NVXQ 2OFWA 4TQUS 1W36B 1QHIA 2NGRA 2ZI7A 4PPGA 3GJ0A 5TXGA 2DY1A 5GJCA 2Z83A 4HZIA 2D2FA 3SFVA 1QRAA 3HYRA 4AYWA 4BWYA 4OHWA 1AKEA 5HE8A 4BLSA 5LPNA 3Q7QA 2VA8A 3AH8A 4BEJA 4DSTA 1BIFA 5C2JB 4BRWA 5L8VA 3AVUA 1R5OA 2AWNA 4HAUA 3CWQA 1HT2E 2ZVPX 4QBGB 4Q1BA 1FX0A 3EXAA 3OIWA 2GBLA 1DE0A 1JNYA 1P6XA 4GOXA 5D3MA 3GCGA 3SC3A 2DHRA 2AHOA 4RZXA 4QRHA 2IUTA 1AKYA 1F6BA 4D6PA 3B82A 4JSYA 1KI4A 1JPNA 2GZAA 1OSNA 2RH5A 3Q5EA 3SDZA 1EX6A 4B2IA 2OCBA 4HSEA 1JEEA 1YZKA 3TMKA 1MABA 3CW2A 3PR1A 2DFLA 4Q48A 4C0LA 4IFEA 3QKRB 4I1UA 5KDLA 3TAHA 3H1TA 5AJWA 1E69A 1OXTA 2ZS9A 3OIYA 1ELOA 3U3JA 4HUQA 3W34A 2ZJ5A 4YMWA 5AUQA 5HKKA 4GZMA 4QKQA 3U5ZB 3CH4B 3I32A 1P60A 5C4GB 1IN8A 1A5TA 1G1MA 3Q9LA 5BQ5A 2JLRA 1OXVA 4XVUA 1XPRA 5H8WA 1X8KA 3KXIA 4LHXA 1BYUA 2JLZA 1XMJA 1HH4A 2IBMA 2O8EB 3U6KA 3T15A 1H8HD 1VG9B 1K5DA 2F1RA 2GEUA 2GDJA 1G4AE 4IVQA 1VECA 2HCBA 4JLNA 5FR1A 1IN4A 1G8YA 1KZ7B 1OV4A 1UADA 1Z22A 2HUPA 3L0SA 4XH9B 2ZS7A 3WRYC 2NO0A 4M1MA 3N2IA 1COWD 2A9KA 4JVLA 5EP3A 5A4JA 2ZYWX 4BASA 2ONJA 1DAMA 2FOLA 2ZU0C 3KL4A 2IYXA 3FYHA 3RANA 3QJYA 4JLDA 1ZYUA 4AIIA 2J3EA 3VR4A 2FN4A 4BRUA 2GEDA 1XD9A 1KI1A 1E9BA 1YZLA 2IYWA 1RRPA 2LKCA 2OUKA 1Q1ZA 1E1QD 5SZJA 4MKHA 2ERYA 1XRJA 2V7QA 2CLCX 2C2HA 2FG5A 4YLGA 1Y3AA 3GLFE 1E2PA 4JYBA 3DEFA 1W4BA 1SULA 4GPTA 2H8KA 2O0KA 3RYTC 4RSGA 3LXXA 1NN1A 3WMEA 1E79A 2FZLA 3TNFA 1Z5ZA 3QG5A 4Q19A 2QRZA 3RDPA 2FPMA 5KOYA 3O8DA 3RS0A 3K0EA 4HLUC 3JVVA 4B6FA 1BO6A 4MRSA 4FW9A 1G16A 1YZGA 3NKVA 2FX3A 4WA7A 4WZAE 1CIPA 3RRZA 5AUPB 3KQKA 3R9WA 4IFBA 3T06B 5C1BA 4URXR 4IDPA 1NG9A 1Z2CA 4LC0A 2FDCA 1F2UA 3FE2A 3MD0A 2P6NA 5D3MB 3R9IA 4HLDA 2IK8A 2DYKA 2V6IA 3EZ9A 4YMVA 1XEWX 2QP4A 1KAOA 2AXNA 4FCVA 1VCNA 4U02A 5KU1A 5JS8A 2IUUA 4Q4HA 4RD1A 3FKQA 3KJHA 2JJ1A 2XSZA 4C0JA 2BM1A 4DDTA 1XMSA 3X1YA 5FI1B 4DIEA 4A6XA 2P65A 3KXLA 3N5CA 2OFOA 1ANKA 5J4HA 1TAGA 5JI3E 1A2KC 3HR8A 2VP9A 4KXFB 1N5KA 1T8UA 1NVWQ 4G5RA 1GL7A 2CVFA 5L3SA 2FV8A 2AWOA 2FFHA 1ESNA 2FF7A 2REBA 3KKNA 4GSYA 1KJWA 3CKLA 4EJSC 1G64A 1LF5A 2ZJ8A 3FTQA 1N6HA 4EPRA 1KZGB 2ANCA 3AVQA 2FH5B 2ZR7A 3VNVA 3SU8A 1FMJA 1IY1A 1S3GA 1CF4A 2C8VA 2C9CA 4TYNA 5KHOC 2D74A 1YJ5A 2TMKA 3KUDA 4PXAA 1HE8B 2FEMA 3F0TA 4G5OA 2RGGA 4IOLA 1NN5A 3PFIA 4N0EA 4NTZA 3LX5A 1LB1B 2X1VA 3UPUA 2JLVA 4XWKA 3FMPB 1P9WA 4M2LA 5L3QB 2GETA 3DZ8A 1OW3B 2YWGA 2QQ0A 4NBSA 5A5GA 4C7OA 2IS6A 4KAXA 4Q1AA 2QM8A 5E7IA 4DIDA 1MRSA 3D31A 4B44A 1SXJC 1V5WA 3VR6A 1II9A 1RYFA 1QHSA 3EWSA 4IDOA 4TQAA 3ZIAA 4CEHA 1JB1A 1MT0A 3AP1A 5DLQC 4A4DA 2F1IA 1SVIA 3K1JA 4C4PA 3REGA 1BS1A 2G77B 2YWHA 3M6AA 2GTPA 3EPHA 1XTRA 2BEJA 4UQOA 3KQLA 2A5YB 1M1YE 2JAQA 4BFVA 1GM5A 4Q4LA 4MDFA 2PZFA 5J4KA 2IYRA 4JL6A 3GLGA 5B57C 2C9YA 1E98A 1NIPA 721PA 2XXAA 3RAPR 5EP2A 4L15A 1TU3A 4HAZA 4JLOA 4ARZB 1FNNA 1C4OA 2AD5A 1UPTA 2BOVA 3UIEA 1MKYA 2ZJZA 1YRBA 4YDSA 1N6IA 5H68A 1XU4A 4MGYR 4URWR 3R8CA 1S4QA 3CWZA 3LA6A 4ACAA 3AGPA 5TB5A 4BLQA 5CYOA 3SFZA 3NVAA 4FCTA 2QU8A 2CVHA 1VCOA 2X77A 1M34E 4B48A 4OBEA 4AKHA 1E2FA 4TT3D 5EUMA 3TSOA 1N6RA 4F91B 1Z47A 2GXAA 2YOGA 3ND9A 2GKSA 3C14C 3WBJA 1G41A 1M6NA 3FMOB 4JBXA 1RJ9A 4Q7LA 5CK5A 2EWVA 1G3IA 4Q21A 1UBEA 4QJ4A 3RSLA 3QUSA 3HWSA 2ZJOA 2IEYA 1RRGA 4LJ8A 4FCWA 3ECCA 1NVVQ 3HPRA 2VTKA 4Q4HB 3PEUA 5FUWA 2FZ4A 2ZRJA 4JJKA 4YXWA 3SN6A 3GD7A 3REFA 4QHYA 1JPJA 3PEVA 1WXQA 3QVUA 3I1FA 2ODNA 2GEVA 3L0PA 3BB4A 1ZM7A 3E1SA 521PA 3TIFA 5LDDC 4TN1A 3TR5A 1EESA 3LW8A 1KGDA 1P7CA 2IYVA 5SZKB 4TMZA 1ZIOA 3EZFA 3QXHA 4KSBA 3KFVA 2FFAA 1J8MF 2F1HA 4QGHA 4B3DA 3LQQA 1A7JA 1W4RA 2JJ2A 1M7BA 2WZQA 2NTYC 5CIQA 3B6EA 1N3BA 4H1UA 4ASUD 5FOTA 3FHCB 4C0HA 4FWTA 3U61B 1CR4A 1W36C 2D2EA 5J4LA 3VKGA 3VQTA 5KO2A 2GK6A 3I8SA 4HUTA 5G53C 5FBVB 2AK2A 5L3RA 5DI3B 2VHQA 3SYLA 2CJWA 1WBDA 4DDUA 2AFHE 2ZRIA 4OHXA 3AM1A 2DR3A 2ZUBA 3JVUA 4AD8A 2GVDC 1S8FA 4F4JA 5JMTA 1U98A 3U6BA 5GJVC 4ZDKA 2IW3A 4N3NA 1HTWA 3UMRA 2HF8A 1GKIA 3RSOA 1TUEA 1XD8A 1NY5A 2N1BA 1T4GA 3GJ7A 3MJRA 4RZ2A 4TYPA 1E0SA 3JZAA 2JDIA 2ZYTX 4N0DA 2CE2X 5HTKA 3VFDA 2G3YA 5FOSA 2XEXA 5FTNA 3OIUA 1G3RA 1Z0JA 3IBGA 4DLZA 3DM5A 3GLIE 3K0SA 3TW8B 5LD2B 3EZ6A 1D9ZA 1H8EA 3DMDA 1SZPA 4UJ5A 3GLFA 1XD2A 4KFUA 2QP3A 4EKDA 3GLGB 3NBFA 1AJEA 1E2QA 1ZM4A 4TSFD 1O3YA 2QY9A 1AS0A 3C41J 4L16A 2JLUA 1KY2A 4OQLA 1NI3A 1E1RD 2ZVQX 4AYTA 2GF9A 221PA 2GZDA 2PH1A 1GZSA 4MUBA 5FBWB 2J45A 3W9YA 1YRAA 2RGCA 3R20A 3S1AA 4NCJA 3AV0B 4D80A 3B2EA 2MSCB 4CRWB 1NIJA 1DVRA 2OAQ1 4Q18A 5DYGA 3CO5A 5G40A 4BLTA 1OH5A 3U3KA 3U3RA 2N46A 2H1LA 4JT2A 4I99A 4N1AA 5CJPA 1M8PA 4CEJA 4W5WA 3IEVA 2ZI5A 1UM8A 3BRWD 3IBYA 4A0HA 1IONA 2D4HA 2RGAA 1PZNA 1T0HB 1IY0A 4EIWA 5FBLB 2B8WA 2EFDB 2CHGA 1GG2A 1OIVA 2P67A 2ZE7A 1CRPA 2ZSFA 1YHNA 1S1CA 4Z54A 1AZSC 1M7HA 1QDEA 1TQ4A 2O0HA 2OEPA 2UVQA 4ZDJA 1XXHE 4B3GA 1UDXA 1EFHA 4LJ9A 3FVQA 3SJAA 4AC9A 3EIEA 4FINA 2AKAB 3UG6A 2PX0A 4LYHA 4ZKEA 2CNWA 3IIMA 4WXRA 3UK6A 2OCAA 3KQUA 2P6RA 2E9SA 2CCJA 5GJWC 1GUAA 3PCRB 1UDWA 4A2PA 1W49A 1XJQA 3OESA 4URZR 1TADA 3AVOA 4HAYA 2A78A 4LCBA 3SJBA 4Z51A 5M04A 4HAVA 4QM7A 4UKDA 5JSZB 2W6JD 2CJWB 1R5NA 1TEXA 3I73A 1N5IA 4OHYA 3OEEA 1Y63A 2CLSA 3CRQA 3OE7A 3CRVA 2WAYA 2RGEA 5HZKA 4Q4AB 3QBTA 1XPOA 3PVSA 2W0SA 4HZUA 4A92A 2QT1A 4OQNA 3WP0A 4WZ6A 2WSMA 4NYIQ 1M2OB 1GL9B 1YZTA 3C7KA 2C77A 4Q02A 3CF2A 1G4UR 2OLKA 2ONKA 1QHHB 4WZBE 3SE0A 3P26A 4QNRA 2DCUA 4NHOA 3A8TA 2ZR0A 3MAAC 3K70B 2FGKA 1XF9A 3DM9B 4UXJA 2WJIA 2XOKD 3AF2A 5CK4A 4R2IA 2HXSA 2RGDA 4EQ6A 2RGNA 1R6BX 3VAAA 1HE1C 1KDRA 4PFSA 1OJLA 3PENA 1J99A 2A2ZA 1ZM2A 3GEHA 3OF5A 3PIRA 4Z1MA 4DBLC 5JI2E 2NO7A 1FQKA 2GA8A 4MGKR 1FQJA 4PQRA 2BWJA 2OHFA 2PMDA 1E9RA 2OSBA 2QMHA 1VCMA 3HR7A 3LVRE 821PA 5BN4A 2Q3FA 5AWFC 1U0HC 4U00A 2FFQA 3K0AA 1LV7A 4P32A 2ZI6A 3K9LA 4PHHA 3TKLA 3AVXA 5EJEA 1XCPA 3OAAA 4B3FX 4L4UA 3T35A 3HU1A 2KBEA 1NVVR 2H17A 1LS6A 1P62B 4KU4A 5G41A 3ZQJA 2ZI9A 3HYTA 2CK3D 5C46F 1OXUA 2G0NA 1KI3A 1ZNXA 2NIPA 4XD7A 3TJZA 4DLYA 3Q85A 4Q1CA 2VEDA 5B64A 1T0JB 1VYTA 2O8BA 2AKYA 2B7CA 4FMDF 1XTQA 2OO7A 2KJQA 4NDZA 4XOIA 3FKSD 5TV2A 3VHXA 3WP1B 3KTAB 2VP0A 3IQWA 3K0FA 2C95A 3KQHA 1A4RA 1GRQA 2P0EA 1WCV1 1PLKA 2WIBA 3MG9A 3BXZA 1YKSA 4WAUA 2DPXA 1Z0AA 1SKQA 2QE7A 1E2NA 2GNOA 3RWOA 2XTNA 2HF9A 4TYQA 5EE9A 3IILA 3IIJA 4DCUA 4D25A 2GILA 1IXRC 3AB3A 2HXYA 1Z2AA 4LSGA 3LFUA 2W6ID 2Q0HA 2WIAA 2YHSA 4RKFA 2H5EA 4RCZA 2XJ9A 3ADDA 3ZQ6A 1G19A 1KK0A 2GCOA 1AN0A 3VR3A 4F93B 4RZ3A 3A1TA 1KI2A 3QVVA 4Q01A 1CP2A 3QPWA 4HZUB 2MSEB 4AY2A 4MUAA 4EFNA 1DAGA 4JJZA 2C9OA 2YYZA 2ZQ5A 3B1ZA 4W5JA 2B21A 4IXMA 3EX7C 3A4NA 1S0UA 2IWRA 1DEKA 3SI7A 4I1OA 3R7WA 4D4KA 4OHZA 1JJVA 4HAWA 5BWMA 1UEJA 2K5UA 2PT7A 2WWXA 4M9QA 4PO1A 4US0R 4MGZR 4GNKA 3KQNA 3TGPA 4Z8XA 4BFXA 4KI0A 4LOAA 1II8B 3B9PA 5EXSA 5J4VA 1RFLA 4BUJA 2R9VA 4P3YA 1DOAA 3GLIA 3MWYW 2R6GA 3LXRA 2FWRA 2OBNA 3C4JA 2PLFA 5K8IA 1ZNYA 4JBYA 4F7WA 1WB9A 2QSZA 3PV0A 1L7VC 5HE9A 4LPKA 3LQRA 4WIAA 5JRJA 3I3SR 621PA 1QBKC 3CPEA 1L8QA 1OFUX 4DLTA 3TK1A 3DL0A 3K0AB 5CITA 3QQ5A 3ZVLA 1KDTA 2OESA 2WPDD 2QPAA 1V43A 4B75A 3X2SA 2ANBA 4EPWA 3SBDA 2F43A 3B1WA 2EFHB 3H4MA 5IDVA 5ELXA 2V1UA 5FL7A 1B23P 1LY1A 3EZ7A 2IXGA 4ZCIA 4D0NA 1Z07A 2JLSA 4IOMA 1P72A 4B32A 3U7GA 3LV8A 3P32A 1KSHA 2G88A 1W46A 1S2MA 2BJVA 2O8BB 1UKYA 1P9NA 4MITA 3I8XA 1TU4A 4NCNA 121PA 4DWJA 4A0GA 1KO5A 4X8HA 4NMMA 3AVWA 3H0KA 1G7CA 1TEVA 3K0FB 4LHVA 4O2RA 1ESMA 2B7BA 5EE3A 3T1OA 4PAQA 4DHEA 4Q1FA 1ZUNB 2CEAA 3DKPA 1KOFA 2GJKA 5DNYB 1KKLA 2CL7X 1ZCBA 4PAOA 1KKMA 3PUXA 4AKEA 3T12A 2WBLC 4PHTA 1XCMA 3QKSA 4LYFA 3CB4A 3ZDQA 1Q20A 5FUVA 3PUZA 4P4SA 4G0NA 4BECA 5K8TA 2RKOA 5E95A 4OJQA 1D2MA 2ZSAA 3A1WA 1VG0B 1U0LA 3K09A 4NKRA 4Q47A 1UF9A 2IHBA 1NBMD 3ZVRA 4W9MC 1W36D 4TMVA 2NPIA 4IJMA 3RLFA 4C0AC 4EAQA 4R7ZA 2G0TA 2UKDA 2IWHA 5FUYA 4B3CA 1LS1A 2O8FA 2Y8EA 4MA4A 1GKYA 3G5UA 4R2HA 1SHZA 1ZBDA 4NYIR 1E0KA 2ZEJA 2VBCA 4JLPA 4PZLA 4WOPA 2AN9A 4FN5A 3FWYA 2QTVB 3WY9A 3A37A 3R7WB 4DUGA 1NN0A 3IGFA 4JVSB 1VDZA 1N5JA 2CE7A 4XTRA 3VTKA 4ACBA 1DTSA 1TNDA 2C5LA 4UNQA 3EC2A 4Q00A 3VKWA 3PEYA 2NZ8A 1XEXA 2G1JA 3AVPA 1VYVA 4M9XA 1KI6A 1U9IC 2ERXA 2ZANA 2H7VA 4K8OA 4M1YA 5FPHA 3RS7A 2PBRA 4XIGS 1E9CA 2IYQA 3QBVA 4GT1A 3EZ2A 2XZLA 1DS6A 1IN7A 2JATA 2PMKA 1MH1A 5CB8A 1E96A 4NCIA 1NG1A 3VHLB 1DELA 1EG7A 4NE2A 1E2LA 5TVKA 4JKIA 1RRFA 2JGNA 3SQXA 4FIDA 4OQFA 1E2EA 1NLFA 1S1MA 1N2CE 1P75A 5KSZA 4M22A 4MYCA 3ZS8A 4A2WA 3TRFA 2WJJA 3NTUA 1T5LA 1M7GA 4C30A 2F43B 1E9AA 4C0SA 2P3SA 4QGGA 4EPXA 1W0KD 4BGDA 1XBTA 4IVPA 2IYLD 3EWAA 4POAA 1W0JD 1G7SA 4CIDA 1DAFA 3NH9A 4E03A 5EE1A 5CB6A 2Z4SA 1XTJA 1Z0DA 4PC3A 1GDDA 2FMXA 4TTRA 1WF3A 3T5GA 2REOA 3U2QA 2UZ3A 3CR8A 2X8AA 4KO8A 2YV5A 1N6PA 1YQTA 2VSXA 2YC4C 1ZUIA 4LHWA 5K8LA 4LJ4A 1KK1A 3CNOA 1X8LA 1XP8A 2QAGB 2YOFA 2R44A 1GVNB 2WSSD 3QF4A 3TUJC 5JJIA 1KK2A 3ASYA 4IOKA 5GADl 1D6JA 3BH7A 2QMUA 3LVQE 1F2TB 3IIKA 1QHXA 1KMQA 3K70C 4WBSA 1SVLA 2RB4A 4QOSA 4DCTA 2J59A 2J7PD 3TE6A 3VR2A 1NJFA 1XTIA 3KJIA 2ZITA 1UKZA 1R8QA 3B8HA 1T8TA 4B74A 3QG1A 3QKSB 1XWIA 1Q22A 3GFOA 3QXSA 1R7RA 2QT0A 4R98A 4P4SB 3QKTA 2AXPA 2R65A 1L4YA 3HJNA 2JCSA 4FMCF 1E6CA 2VP2A 4HEJA 3CZPA 1I2MA 2MMGA 2ZYUX 3U60B 1FTNA 1AGPA 3GLHE 1TQDA 4EFLA 2O8FB 1OH8A 1ZCAA 1HURA 1JQLB 1FX0B 1NKTA 2GWHA 2KB0A 5HPYB 1AQUA 3NC1C 2J0VA 1E32A 1QHGA 3WYAA 2V4ZA 4PSVA 3AKYA 4J0QA 4GRAA 4ZIRA 4A1FA 4CYMA 2HT6A 4V0OA 4DLSA 4TTQA 3DOFA 3FOZA 4M21A 2QPOA 4RFVA 1SGWA 1MABB 1JR3E 2GJ8A 1S96A 1J8YF 1YZUA 2H57A 3A1UA 4LV5B 3BB3A 4OJKA 4TT3A 1KI6B 2GVZC 4HUQB 3SHFA 4P33A 4XSHA 2CHVA 3GJ5A 2FPLA 4XVRA 3CRMA 2OLJA 3ZZTA 1KNQA 4OI0A 1QHYA 3CM0A 4PZZA 2IT1A 5HKKD 4MRPA 4JVMA 5J40A 4D2IA 1Q1QA 4Q7KA 2CHQA 1NF3A 1KJZA 4Q03A 2DB3A 5TY0A 1G3QA 3GEIA 4B71A 2J0SA 2BMFA 1G9XA 1Z29A 3BD9A 3F5FA 1QG4A 1SKYE 2LKDA 2BHRA 3BAFA 5BN5A 5DHAA 3OEHD 2RGXA 3GMTA 4LHYA 3C16C 421PA 3I4LA 1OPXA 4HB4A 4HB3A 2RHMA 3IHWA 4JYCA 4GL2A 5EXXA 4PPQA 1N6OA 1G5PA 4JLAA 4A15A 1I4TD 1GITA 3B1VA 2QENA 2PL3A 3SNHA 1OFTA 4LRWA 3ASZA 1P3JA 5KUTA 3MCAA 4YC7A 2QA5A 3MSXA 2EFEB 1T5IA 2A5GA 2V7QD 2RCNA 3QEJA 2IYSA 3L8ZA 2XNDD 4A8JC 5TMPA 5IRCD 3U7HB 4BZPA 4TLDA 1E79D 3TBKA 2BIFA 2V6JA 3QXCA 4XTCS 1SXJE 4ZI3A 3W6OA 1UFQA 4QBIA 1ZM9A 5LB2A 4H1VA 3V9PA 1W4AA 3Q3JB 1Q0UA 1LVGA 4QL3A 3AUXA 4B6EA 3GFTA 2BMDA 2XZPA 2GJAA 3W8RA 4X8MA 1FPMA 3EPLA 4M8NE 5KDOA 1KO8A 1F2UB 4IKEA 2ZPTX 1TQ6A 3V00A 1MRNA 4HDQB 3O47A 1JAIA 1EFRD 3IO5A 2ZRLA 2EVWX 1G20E 3ONWA 4KLNA 4UJ3A 4D4LA 1HA3A 3AP3A 4UNPA 2F55A 1XMVA 4JLKA 2IF2A 2P6UA 4P4TA 1Z6TA 1WA5A 1G8GA 3BBPA 1ZC4A 2I3BA 2I4IA 2H18A 3D7MA 4PTLA
chains in the Genus database with same CATH superfamily
4E7PA 4PZUA 1PT8A 4FHGA 3IBTA 4O8CA 3L3BA 4UPVA 1N2BA 1NRJB 3CZQA 4KV7A 3T9AA 4B80A 2GHRA 3AEXA 2V5AA 3MCVA 1RYEA 1QIKA 1U7PA 2FN3A 1NXVA 3ZE7A 1JSRA 4JUAA 2HO4A 2GBFA 3VC1A 3EZLA 3HCBA 1OYYA 2IU4A 5HJ2A 4OGKA 2DFTA 2HM7A 3T1HB 4CLEA 5JEDA 5HWSA 3G9UA 1Y98A 2PSFA 4LQ4A 4AB1A 4KXWA 3EGOA 3K0CC 2JIZA 4LYEA 2VT7A 1ZM3A 2K87A 4RVOA 1JWAB 3ISTA 3MWDA 3NDRA 4Z4QA 2EV9A 1YGYA 4YJ2A 2I1LA 4PO3X 4P54A 2O2CA 4ILKA 3QW2A 4RPJA 4JI2B 2PX3A 3DLBA 2PKEA 2QRHA 1I4LD 2FN8A 1WD5A 2HV9A 4PX2A 4KXYA 5LJLA 1UMCB 2XUIA 3VV2A 1DIRA 1QFYA 4QQ8A 4MKRA 3TBHA 3BFXA 3JATA 1P2SA 5H82A 3LQFA 2GM9A 3ZZMA 3MWEA 4WESA 4Z1OA 1ZL0A 3HO6A 2JZOA 3EVCA 3HXQA 1EWRA 1XX6A 3DWFA 4HP8A 4IRMA 2O19A 4WDRA 2P2YA 4OBBA 4U5XA 3ZI0A 1RZUA 2ECQA 2OFFA 1US8A 2FE1A 5LQDA 3NCHA 1TKRA 2VCHA 4X5OA 4Z4IA 2QN7A 4FGKA 1R6XA 4QNNA 5AVOA 2QY6A 2RJ3A 4QRIA 4CF7A 2I54A 4EI7A 3JSXA 1NDUA 2IEAA 2FSGA 2X2PA 5J2TA 1FK8A 1PRYA 3C6QA 4WQMA 3BQ9A 2HXGA 4H27A 1DPFA 4O2AA 4QUHA 2AXQA 2NZUG 5EQJB 3OI7A 4R9SA 3R76A 1DX4A 4C2AA 4EQZA 4TLEA 4PSKA 5IXJA 2ZBPA 5CXQA 5JZOA 4MP8A 2RB5A 4TYWA 3PWSA 3PUKA 4PRYA 4AQ7A 1DT3A 1PZXA 1WD7A 1TRHA 2JIRA 3LHFA 5EL0A 3BMOA 4DPLA 3CA8A 3BL6A 3ZX4A 2Y2VA 4KNWA 2BMWA 4W63A 4TUYA 1YQDA 3JR7A 4Y6PA 1NT4A 4DLRA 4EW1A 2XXAB 3WLFA 3AC0A 3K2IA 3Q2KA 1IEVA 1SBIA 3ORFA 3QTTA 4UHHA 1ZI8A 2H1CA 3AKCA 2I67A 1KDOA 2W6MA 2P5TB 4Q9JA 1YCHA 1TJ4A 3NDJA 4RABA 3LOPA 5KMGB 2O5CA 3HFJA 2VK4A 3VKFA 2BHNA 3KHKA 2CJXA 3AKZA 2OPBA 2REQB 2FEAA 1A5SB 3TB4A 3DDUA 5LB4A 5CXSA 4BO1A 2QRPA 3HUFA 1SZJG 3WQSB 3CG0A 1XQYA 4NEQA 3GJ8A 2ZYGA 4FP9A 4UVDA 5HXAA 2CXQA 4BPBA 1N9ZA 4JP1A 4C7KA 1P3DA 1M6EX 4LJ5A 3LT0A 5DWVA 4OMCA 3DBLB 1POWA 1Z62A 2XZDA 1T3SA 4PWYA 3I6MA 3LDUA 4NCAA 1KPIA 2LGJA 4H4EA 3SLKA 2C88A 1EJ6A 2XUOA 3KB6A 3FSRA 1W88B 3TD6A 1MFZA 4HTFB 4UDOA 2X9LA 2FSIA 1PVOA 1RKBA 1LTHR 2H85A 1WXGA 3TRHA 3TL2A 3D5EA 4M98A 4CMEA 2ZQZA 5LBUA 1E4VA 2J0UA 4TWRA 1WHTB 4PC7A 3F9RA 1T0UA 1FX1A 4E5MA 2HWWA 2DLNA 1XMXA 3PEWA 2JH3A 3UB2A 2PU5A 3ZE2B 5I4KA 1RC8A 3KKQA 2P0AA 1Y1KE 4F04A 1N34B 3OZBA 3U56A 4K9OA 1CLUA 1DADA 1YB6A 4O08A 4EG7A 4UEWA 2XB4A 4ETMA 2YJZA 4WH0A 3QWBA 4JXXA 5DWDA 2W2KA 3BICA 4BJHB 4AKGA 1AO3A 4CT5A 2AK3A 3FROA 3L7OA 5DGXA 4IZOA 3VR5A 3RAJA 3X1XA 5H70A 3CRZA 2HDHA 4PN7A 4HFNA 4UCFA 1LLDA 3NU1A 1U2DA 3MRTA 3SIPA 2DFKB 1XDGA 5IUKC 3UENA 4UTPA 2PN1A 3G0IA 4OEHA 3RJZA 4L5IA 3AP2A 1D4FA 4B76A 2ZCUA 3G8AA 3LBYA 4MUHA 3SQLA 1XCOA 3ZCVA 4J7UA 4P4UA 3EEYA 2AN4A 1M2FA 2QMOA 2YWJA 2UUPA 5EHGA 3COJA 1X7YB 2ID4A 3WMRA 1CUFA 2V55B 3KOOA 2C9DA 2IOHA 2QTMA 3G79A 4IP0A 4YAWA 1FLDA 1ZVJA 3EVEA 3IKLA 5EINA 2GBLC 2CJYA 1CT9A 3IH5A 5KIAA 3LY5A 1VP9A 3OE5A 4KO1S 3PL5A 4YA6A 4F2GA 4A0QA 1YE5A 1EA7A 1UAAA 4MQ4A 2Z9CA 4HI0E 4KFTA 4B4UA 4V0QA 4D4MA 4OMUA 3VDXA 1JB9A 1FSZA 3MQFA 1Z82A 4M4SA 5ISMA 3LDGA 4OF4A 4MS1B 3UMFA 4ZPJA 4IXNA 5DCLA 2HNAA 2ZE6A 1B2RA 2GXUA 3AUTA 3AUUA 4EPVA 1X1RA 1Y5NA 4MGHA 3ECSA 1GKLA 2OCLA 1VYUA 3WNVA 2VYVA 4J0JA 4EM6A 2GLXA 1H8ED 1AH2A 4Y0NA 4ZXPA 3EF0A 1VBNA 3DHEA 3F6YA 3WIDA 4F60A 4FONA 5GIPE 1EUDB 1PKEA 2KMLA 3DYBA 5DM60 4E6PA 4YT2A 3WHLA 3NJ8A 4DG9A 3STWA 3N8DA 1A9TA 3MN1A 5EP1A 5TEVA 3EUFA 4OFBA 5LL6P 3RSGA 1VSVA 1VIMA 5IVKA 1E0AA 1GUZA 1YA6A 4RSMA 2VXBA 4HADA 2QRNA 4W5HA 4WA8A 1M1NB 3E3LA 3D8BA 3M81A 1HSOA 1EFVB 1QCCA 1HV8A 1U3CA 2WHYA 3FUXA 4MRVA 3U3DA 2BKEA 2KSQA 4DV4B 5DN6A 4JOSA 3WLSA 4HXGA 1V3VA 3HB5X 1JAZA 4JOCA 4CEJB 1SY7A 3AIMA 2PQ6A 1ENZA 4LMPA 4W8OA 5BVHA 5JWOA 1QJ4A 4HYYA 1GPBA 2ZR8A 1WB6A 4L6CA 3G2LA 2G40A 2XE6A 5EXPA 2B25A 2O07A 3FI9A 3IV6A 3A1EA 3CZ5A 4GP9A 1PQWA 4QO7A 4AG3A 3DEKA 1SUPA 1QBGA 2FE4A 2XQGA 4N9WA 3ZBQA 1NV8A 4GLBA 3QEOA 1W73A 1E0JA 2IITA 2PMBA 2XLCA 4XCVA 2HBZA 3ST7A 3SC2A 3D4BA 3GP3A 3KCNA 5LA6A 3T1NA 1G21A 4K9DA 2OCKA 4ZQCB 3TLXA 3FD8A 5LN1A 1XHEA 2HIAA 3AF3A 3WRXC 2C00A 4F3YA 4IJ5A 4ZZ3A 5A5EA 3RU7A 3ZDZB 1K92A 1Q15A 1M6YA 1RZRD 2EU8A 2QI9C 4H9GA 4KXQA 1WXFA 1OAOA 4M7RA 4X8LA 3LBIA 2X0DA 4L7VA 2NXCA 3KPYA 1PV2A 1NU6A 2VNIA 3H83A 3VZBA 3I45A 1E7RA 3OFNA 3NQ41 3QFHA 1ZQ9A 4B85A 1O6BA 1I1NA 4TTIA 3AEUB 3RFTA 5LNK6 4MUGA 1PNOA 4QUDA 1LF0A 5KKCA 1ECPA 3CH5A 5B4TA 3GBVA 5DNWA 5JSHA 3QF7A 1EFAA 4PQFA 5EXEA 2QIPA 1AZLA 3H2ZA 4CR8A 1A76A 5M2QA 2YJTD 2WP8J 2R85A 4N6OA 2OV8A 5JXWA 2Q6IA 3U4IA 4OHVA 3ZHTA 5HJ5A 2XODA 1GYPA 2P90A 3O4IA 4AWBA 1Q11A 4Y6GB 5KTSA 1L6IA 1RWPA 2ECOA 3L6OO 2L42A 4MVJD 4UU0A 4Z49A 4CM7A 1SPXA 1SVMA 5IDYA 5H1YA 1MC8A 4PYOA 3SWWA 2V03A 3FNQA 4LBYA 4XJXA 4BWFB 5DP1A 4GXQA 1XLTA 4HB2A 2R68A 1Q1AA 2EFCB 2ZR9A 1V1MB 4JBLA 2OO5C 3GVIA 1W48A 3GW8A 3NO4A 1RBZA 1E5QA 1E5LA 4JLSA 1LSOA 2Q2NA 2EBFX 2ACVA 2Z0MA 4R16A 4ZAFA 4OI1A 3CIOA 4D8TA 4K2HA 1QG2A 1B6RA 4BBJA 3FPSA 2FXVA 2P2DA 1OIXA 2JARA 2QRLA 3AR2A 3QYJA 4Z1MD 3Q7EA 5C9ZA 2G6BA 2H92A 4Q3KA 4RKQA 1NURA 5BN4B 5K8VA 5AVJA 1TKBA 4OJMX 4Z0HO 3UKOA 4ZO8A 1YO6A 1IN1A 2DWQA 3QY9A 4OFZA 1CZKA 2YXLA 4NZNA 2IH5A 1NW4A 3LLVA 4RXTA 1MD9A 2W2LD 2OE2A 4F5YA 2GDZA 3L6EA 3V97A 3TRDA 4XPZA 3V7NA 3U31A 3OKFA 4NBNA 4A2CA 3F9CA 3C8HA 3LPDA 3I09A 4O25A 4M7WA 1JFVA 3G0CA 5G0VA 3SQWA 1JKJB 1DAKA 1OYOA 1ZR2A 1V39A 1QZXA 5DYNA 5HOQA 4QPZA 3DDOA 3OX3A 3UEOA 4E4TA 3I2KA 1ZK2A 2A8YA 3MJEA 3NGLA 2D4AA 4A9AA 1LFDB 4QBHA 1Q0HA 4X66B 1CUIA 1R10A 3AR6A 1H8HA 4DR1B 2BLLA 4JA2A 1CY6A 1XYGA 2Z4TA 1ORIA 4I55B 2ZIVB 3WRWA 2CV2A 2F1OA 2VK1A 1TQ8A 3FRHA 4CTNA 1N5DA 1UPBA 3DT9A 3DE1X 3ZU5A 2XWPA 1KIMA 3KAKA 2EG9A 4KREA 4AKIA 4O2BF 4QG7A 4D9IA 1ODKA 3SS7X 2M98A 1XN1A 1XXHA 1GPH1 1JXQA 2P8SA 5E6RB 2F3QA 1NE7A 2BFBA 1IXSB 1F8FA 4GPAA 3ZBUA 1P81A 2J8ZA 4DLNA 3VU9A 3NVKI 3D81A 1YIOA 1K9VF 1GTMA 4NNPA 1N7GA 5JWHA 4UNRA 5BY2A 2C31A 3P2EA 1JAXA 2QD2A 4CM8A 5FNVA 2BSXA 3OCWA 3HYSA 5IEJA 4CLOA 1X80B 1WEKA 2HU2A 5BSEA 1I7QB 1QGDA 5B7PA 5EZ5A 3AW9A 4YPVA 2J7PA 1KAGA 1I32A 4XFDA 3ONVA 3PQCA 3HPQA 5LLSA 2MU1A 3ZZ1A 4HH3C 3OCCA 1AUOA 2A5JA 4HV4A 4DJEC 3GLKA 2XDWA 4N6NA 5IHXA 2V6MA 1QRDA 1M54A 2C94A 3PLRA 2H16A 1ND5A 1V8FA 4K6CA 1A1VA 4UMEA 1NVMB 3AESB 3TKAA 4C29A 1AQJA 2PDAA 2QL6A 4U7JA 1SD2A 2ZPAA 1L5LA 4E5VA 4AO6A 4FFPA 1ZAYA 5CU7A 3R44A 1AMNA 1VZ3A 3CCFA 1Z88A 5BSVA 1CZLA 2PT9A 4EHIA 3OZUA 4RVCA 2HC9A 4PONA 1D5WA 1P45A 3CGGA 3IB6A 4Y0VA 1HTTA 1ZFNA 5JCXA 1UUFA 4BP9A 4Y18A 3TL3A 1EB8A 2WNIA 3LHSA 5H4GA 2ZJ2A 4EA8A 1Q74A 3ZHVA 1IM5A 3PC6A 4L3OA 1BQ3A 1JJAA 3DOUA 4PCLA 3WL8A 1Z4MA 2J3JA 3HHPA 4IW3B 1J8QA 1G7RA 4JBNA 3IC5A 3C15C 2CKMA 2WV9A 4OB6A 1YL6A 1W44A 5HGXA 1HX7A 2IEZA 1SKMA 3PUWA 1X0XA 4OK5A 4RYLA 4B2LA 3BKWA 4IIBA 4HS9A 2XYHA 2AMVA 3U7FB 3KHUA 4DXAA 4MQEB 2FUCA 3ILXA 3UUWA 4X1IB 3AR5A 3RS2A 2NVBA 3O92A 4P81A 1AHPA 3CF6R 4F3CA 4M53A 1M2WA 3MWJA 3COVA 5LKAA 4ZCSA 1STOA 3SQOA 8OHMA 3V46A 4ADSG 3KU1A 1CJVC 3DP7A 3NTLA 1KFCB 4HGRA 4B7ZA 4R51A 5ALUA 5J23A 2CBZA 4L5AA 4OGGA 1B0AA 2R8YA 4L2IA 4OL0A 1U3GA 5CW2A 5EUQB 3BJEA 2YN2A 3FTPA 3A4TA 4NEGA 1QIIA 3SZLA 1I7LA 1ORTA 1DQNA 3UV6A 3ZKAA 2YWRA 3ANXA 5KNCH 5L4SA 2DF8A 1T35A 4GC5A 3RREA 3CJRA 1KXJA 5DEIA 3DZDA 3QLUC 1NBWB 5CVDA 2O8DB 4BE4A 4NNOA 3SVTA 3ECAA 1EU1A 4HRVA 2ONCA 2W22A 3LBNA 4O1MA 1Z0FA 3RIGA 3T3EA 3BTOA 5T4FA 4F9FA 4LMRA 6REQB 2O5EA 3B7PA 4UVHA 3O4JA 4RIIA 5REQA 4UCXA 4E1VA 4G9GA 1TCVA 2AG8A 1GNQA 1PTKA 4R1TA 2G9NA 3GQVA 3UYLA 5ABPA 5JQGB 2RGBA 2WF5A 5DM0A 1L4LA 1GR0A 1R0KA 2I87A 1J9ZA 5FL3A 3LLUA 1HORA 2Z3VA 3IFSA 1AUVA 4TTJA 4MYUA 1Z5WA 2JAXA 3R7DA 4I4LA 2B1RA 4G1EB 2F9LA 4MKXA 3RUEA 4CVNA 4RD3A 1KU0A 2C8KA 1NHWA 4QU5A 5JPCA 5HQ3A 2X9VA 3MXTA 4KZPA 1MV5A 4KR7A 5JD4A 5LP6C 2C2BA 3RWMB 1T6BY 4GX2A 1G8JA 1HO3A 4E5NA 3EC1A 5L45A 1N78A 3PQFA 4PVCA 3ZDCA 3QENA 4NAHA 4ZICA 4W5NA 3PX2A 3MJDA 2XYVA 3F6RA 5DTMA 1DB3A 1SB9A 4U6NA 3IUMA 2Z1DA 1KS9A 2JBHA 1KGSA 5A06A 5J47A 1ESEA 1QVRA 4TS4A 4XQEA 3HR4A 1KMHA 5LP1A 1M8GA 1UXGA 2RHHA 3HBAA 1ST2A 2PEYA 3MCTA 4ZQEA 4ZJYA 4DADA 4CG1A 5EMKA 4FWBA 5ITWA 3KSBC 2OB2A 5AQEA 3DOOA 2Q49A 2ZI4A 1T5HX 5FOUA 2OCYC 5G02A 1N2IA 1M2VA 2LIVA 2B35A 2ZIGA 2ZP1A 4FXPA 4KB5A 3GEEA 3KAJA 3SR4A 2XRZA 1CY1A 3O93A 4M7OA 4JWKA 3S68A 4ZK6A 3GV0A 4DUGD 2Z8ZA 2XA2A 4ARZA 4BP8A 1ENPA 1ZNWA 1DLIA 2Z4RA 3OZGA 3TNLA 4BFZA 1KI8A 4BGEA 5AW3A 5KWJA 3CEPB 2Q29A 1QQ5A 2EP5A 2I3DA 5HBRA 4ED9A 4MWZA 3LWZA 1EFRA 4G84A 4CXMA 5K8UA 2BTEA 1C1DA 2OP0A 4ZXFA 1CEEA 2Z95A 2VF7A 4FKMA 4XGNA 3UGQA 4FMCB 4PWZA 3T7KA 2CXNA 2JFNA 3VHQA 2XADA 3G7SA 1PGNA 2G1AA 4C22A 2IHKA 4HRYA 1DEHA 2P4QA 2VCEA 3GDWA 1AZTA 3L1UA 4KV9A 1ZJ6A 4KYTA 2NPOA 3LPLA 4BQSA 1U1DA 1KRXA 4AJOA 5KOJB 1BROA 2ODAA 1W30A 1SA0A 1HEIA 2OAP1 3OTWA 4UCQA 1R9NA 4FNGA 3OO0A 2N0SA 1XZJA 4XLZA 2YYAA 3PIDA 1L4GA 3M82A 3J7TA 4ILEA 1LWNA 3PJRA 2D1QA 1JRLA 2I66A 1P9RA 1W2WB 2ZSIA 4RS3A 3SDSA 3BWDD 1V1JA 1CDZA 4S1NA 3VR6H 2PYIA 4FPXA 4Q9AA 3UJ7A 5C7OO 2B30A 4HCJA 2K4MA 5FUXA 5LU8A 2D3WA 2YRWA 3TCXB 5MN5A 1EXMA 4F8YA 4CEIA 4L4RA 4V1CB 5JDCC 3GJXC 1ZD3A 4G2TA 3UHOA 4C1BA 5HCIA 5ADHA 3X3HA 1VCIA 5J63A 3S2SA 4DAOA 5L3ZA 3ONFA 2RKBA 1M0WA 3AONB 5I8WA 4J0GA 1QM5A 1BRMA 3VPCA 2ZSKA 1CYDA 3A06A 5A1JA 1IQRA 3GROA 3LWDA 2HSJA 3R6GA 2NSYA 4FDVA 1U0EA 2F9MA 5TF0A 3ZJ4A 4DDWA 2E5WA 2B3DA 4BMCA 2WICA 5DGHA 1SIWA 1ZMXA 1G8PA 3P4UA 2BMJA 2NXNA 3OM1A 1VL0A 1SZCA 2HV8A 4GL4A 1HR0B 4BCBA 2Q8PA 4B3XA 2O8NA 1U4SA 3U4AA 1I13A 5DCYA 2B34A 4NFLA 3LHKA 1S2NA 4R8RA 5HKOA 2WJGA 4WK0B 1UBKS 4DKXA 5JNUA 1X1CA 2CB9A 1O6ZA 1ZD4A 4I2NA 1E4OA 2AMYA 4PHGA 4PR0A 2ZAOA 1MNQA 2P41A 5H4HA 5AW6A 1JH9A 2N1MA 3PVCA 4J9UE 3L7DA 4F3KA 1M5RA 3KXDA 4IEIA 5IYZF 1VJDA 3BORA 4DMMA 1FDIA 1JKMA 3IDZA 5B1YA 3HU2A 2ZCJA 2RHLA 4CM4A 1TZ2A 2CFSA 3GRZA 4OK6A 4EG5A 5DBIA 4ZZ0A 2J3LA 4N5LA 1QRRA 1CLEA 1GCIA 3MIZA 4CF6A 5C5DA 2VDWB 4ZA2A 3MJTA 3HLTA 5JJKA 4JVOA 5EIAA 5JYBA 2NPFA 3VVLA 4NZPA 3PU6A 1F60A 2A86A 2VTEA 2Y0DA 1PUIA 3IP5A 4FHZA 2Q9CA 4MRAA 7MDHA 4RF2A 1ZD9A 2PXAA 4DOMA 3W9SA 1RYDA 4PNHA 4C0KA 3V5NA 4KC0A 4YRLA 4LYJA 1Z6GA 1WVGA 2C57A 4ZOLA 3WK8A 4DV7B 1R74A 1CNFA 4ZIRB 2CDRA 2RAFA 4N4AA 5FOXA 5HMLA 1ZK3A 1RRMA 2YZMA 1SXHA 3EXHB 3D5QA 3HV2A 4PO8A 2C03A 2D59A 5CFPA 5KYXA 2Q1XA 4UD6A 1UOOA 1LVUA 3F98A 2RSLA 3KJGA 4MV1A 3ESYA 4X85A 5AM4A 4E31A 5IHPA 1LPOA 3MBKA 4BQRA 3ZR4B 1VJTA 1U02A 2VYNA 2OR3A 1KPGA 1U8UA 3C5EA 5TS3A 1BX3A 4Y6QA 3ICOA 4WFKA 5JPDA 4TTPA 1T3LA 2FY8A 2RH4A 4NE9A 4HUJA 4NL4H 4XZ3A 4LFCB 3DPUA 4C2TA 2PVCA 4O4HB 4UUAA 2MSNA 3R7SA 2ECPA 3AVYA 1D2EA 1LQ2A 1Y7HA 4LNAA 4MVJM 4OLHA 5HF5A 2HHJA 2VHVA 3NATA 1YU9A 2NYRA 3HCAA 1SOUA 4BNDB 4RDXA 1G6HA 1KP2A 2ZJ0A 4GU5A 5A0FA 1KDYA 1JIXA 2W90A 4XWTA 4XYEA 1Q1EA 5JC1A 4DL9A 4YVFA 3ZD6A 1Q7RA 2R2GA 1QFSA 2QB5A 4WBNF 1NHGA 1PUXA 1U0JA 3EIUA 1D6MA 1TAQA 4MRRA 1PJRA 1GG9A 2X2FA 3FFAA 5TDHA 1O94C 3Q1LA 4Z0NA 4QBFA 3RW9A 1XG5A 1PR3A 3KXPA 2JI9A 4YLEA 1A9RA 2EJBA 1ECLA 2DUJA 1HDYA 4Y9RA 2QW1A 3S2ZA 3MJCA 1AIPA 5MGBA 1DOHA 4JOQA 4JN6B 3QE9Y 2HQBA 5KTMA 3PFCA 1T5OA 1YDEA 4GF5A 4YX9A 4ZYYA 5AUNB 1W47A 1CEQA 2R96A 4V0NA 5GVRA 4JGBA 1ADBA 5A9SB 3K1AB 4ND7A 4MHOA 1S6YA 3ELUA 5J5AA 3RC9A 3SR0A 3EBLA 3DV0B 1CY8A 4B6SA 5BWCA 3OT1B 4F4HA 1G55A 5ARDA 4QG3A 3CX7A 2BELA 2C98A 1QE5A 1T9GS 1QO0D 3U3OA 1G291 2X7JA 3TS1A 2ZZKA 2YS6A 4JC8A 2JEOA 2XVXA 1ZSYA 3IDQA 3NAQA 1ZOLA 3BK2A 3GD5A 1VGRA 3CZ4A 4M1OA 3F2IA 4JSTA 5ALSA 3SVZA 5I9LA 1X7ZA 5JFGA 4UCWA 1E94E 3VNAA 5JH7B 5K0GA 3DBIA 4GYJA 1R16A 3FGPA 4Q1DA 3ROMA 3UWOA 3WRYA 2YHIA 3A9SA 4DXHA 4QYIB 1EZZA 3AG5A 4NYMQ 5IT9A 3O90A 2YWEA 5KX5A 1SQ6A 4NG5A 3RRJA 4EO7A 2V8OA 4OAPA 4ZHQB 2JAWA 1YDHA 2E6UX 2R7AA 4ZPXA 1CQPA 3OJWA 5JNTA 1PR9A 4IIJB 4KE7A 2VIIA 3BF7A 3DZCA 3ZCRA 5BOVA 4MKGA 5ILQA 3LX4A 3HXMA 4CI9A 4NSNA 2JHAA 2HA6A 1RQNA 2O05A 3RRMA 1A5ZA 5CFOA 2QG9A 3A4VA 2O7NA 1A7KA 1G17A 1U81A 1BA2A 4RCYA 2FU5C 1HYBA 3NP7A 1BGWA 3GMIA 1NXWA 4HDKB 4U7GA 3QWIA 1ISGA 2FJUA 3IO3A 3IKJA 3BSYA 4K03A 4H0FA 4YDHB 1DAHA 2I34A 4HT3B 3DF9A 5JLAA 5KYWB 1GRNA 2GNPA 1XQ9A 2JKZA 5E9WA 4HYEA 4YRTA 1YVUA 2QG6A 2P3QA 2PS1A 4ABTA 2I7CA 5K3BA 3UMSA 1TFUA 3Q41A 4HD8A 3COWA 4D8YA 2D6FA 5L3QB 1PDOA 3ANMA 4AYXA 1AQYA 3W90A 1U8ZA 3C45A 3KPUA 4YMIA 3LMKA 4Y6OA 4G5SA 3RM3A 1GAWA 2CKDA 3P19A 4MR9B 2WU1A 3RASA 2GZHA 3EMBA 4S0ZA 3SD7A 1WLSA 2GR9A 1ULSA 4WEOA 1IOZA 3PNKA 3O8NA 3M6VA 4PG7A 3RQSA 3U44B 3DZJA 5HJ7A 3A6KA 1I6MA 4TS3A 3FYTA 5IVPA 1T5SA 2ABWA 1SBCA 2CK3A 1TM7E 3DQZA 1YCFA 1T9ZA 3NAGA 2D1TA 3VSAA 4TLMB 2P6MA 1W6UA 3C85A 3DOEA 1XNQB 5BPFA 4C9BA 3G0OA 1N75A 1SVWA 2XNSA 1JTFA 2AB0A 1ODCA 3WB1A 4IDHA 4JI5B 4YV7A 1Q3TA 2WUGA 3P27A 3TDKA 1N2CB 4D9KA 4DMCA 2ZI3A 1Z8NA 3QFTA 2BD0A 4HVTA 1SMKA 3T9DA 1RPJA 3T95A 1AV7A 2RG1A 1GFSA 3NTVA 4Q7MB 1N57A 1Z6QA 2P6OA 3JATB 3UWPA 2UUAB 3MWEB 4OHOA 4WESB 5FR2A 1U0GA 3GHHA 4BX3A 4AF6A 4CKBB 1PFUA 3ZYCA 1JH8A 4NYJQ 2QAIA 3AIKA 3ANLA 5DBFA 1JWLA 3AHIA 1XZIA 1LDGA 1WPRA 2ZRPA 1US8B 3AGQA 5D3QA 4LF7B 3LCMA 2EIHA 4F7DA 1CRZA 4IEEA 3EQ6A 1RXYA 1UJMA 4N5MA 2XF2A 3K9NA 1XNHA 3TTYA 2A9JA 1B16A 3IMKA 1XA0A 4OMDA 4LYGA 5J2TB 3AHJA 3VOSA 2EFGA 1O96A 4O2AB 1ULAA 2GK3A 3EIQA 3JAKB 3K30A 2OHVA 3OOWA 5ER6A 4QT4A 3H13A 3IT3A 2DRIA 1U2RA 4FGUA 5FIUA 2A9PA 2AT1A 5EGNA 3GMDA 3NOXA 1YH3A 3PFFA 3ND7A 4L6AA 3F5QA 4F3NA 5LP6F 1HNZB 2HLDD 2P1RA 3BMOB 3GRYA 4D3ZA 4KRFA 2OOKA 2IEGA 3OLCX 1JAHA 5T4BA 3VOBA 2WIJA 3PXBA 4KXUA 4C08A 1EFTA 1PEAA 2OXEA 4ZV9A 1RM5A 3M4NA 2HR1A 1OBVA 1BWSA 2CUKA 3IHTA 2IZ0A 4U8GA 1QV6A 3RF7A 5AK0A 4JJ8A 1C8BA 1BWRA 1ZQ1A 1L6RA 3QVXA 1ISMA 4AJ1A 3PD0A 4GP7A 3PC7A 1MXFA 3WNZA 3U4HA 5IFLA 3DG9A 3K71B 1FDWA 4LDQA 4RVDA 1UK8A 3DE5X 2O2ZA 1HNNA 1QK5A 1RZVA 3B85A 5DT9A 3ZWMA 4LEIA 2PGLA 3UJNA 2QPTA 3PFHA 1RJGA 1B73A 2ZRCA 1XNJA 3HYNA 2BSQA 4L8VA 3SHWA 1HZJA 3ZNQA 4RTNA 3A1SA 2B2XA 2Q3DA 1ACMA 1IXZA 2XCIA 4D9EA 1THZA 4UM9B 2OYRA 4YRMA 1I7PA 1UMDB 4TTSA 5F76A 3NIBA 3GAFA 2GB4A 3TLGA 4D9GA 2FWPA 1ORDA 3F7MA 4M0KA 3RO7A 2Q6KA 4TRRA 1PI3A 4Q1EA 1BOFA 1J0AA 4PQEA 3D4NA 3VPGA 4F6LA 1R0CA 4RNDB 2L0XA 4R0NA 4DLXA 1K4YA 1X9IA 1Y8AA 2W93A 2J0UB 4HDOB 2JGFA 4YJFA 5AM3A 2ZM6B 2W43A 2W2LA 3PDHA 1IZZA 1GNLA 5A3SA 3GYGA 1UZUA 3BH0A 4Y9UA 5EE5B 2D5BA 1FZQA 4FFDA 4FKBA 1GJRA 5IC6A 4XWGA 1PW7A 3QUAA 3ZV6A 2H2AA 2WW8A 1GXSA 5AQ1A 3GLRA 2PKCA 2C2GA 4ZCRA 3QP9A 1P2VA 2XYQA 4FHFA 3V4VB 4MEJA 2BZSA 2W2KB 4E5KA 4HFMA 5JY6A 2HWUA 1NJ5A 1O9HA 2W4QA 4LPSA 2Z6UA 3A1NA 3WWYA 2H3HA 1N0UA 2W71A 3FHTA 3IPXA 4D8XA 1TUBB 3HB7A 3NG1A 3W5DA 1A8PA 1PS8A 2O7QA 5E7MA 5LXTF 3BJMA 1BE0A 3BWCA 4GOND 1Y0BA 3NV7A 2H0AA 4C6TA 2D7DA 4MV7A 1I24A 3L49A 2W2VA 4IIFA 2QX9A 4V0LA 4MRNA 5AP9A 4BNZA 1C41A 3HDTA 4CMHA 4EECA 3AOEA 3KLNA 4NBKA 4HXYA 1HT1E 3IUEA 5CCDA 5JS2A 1BKDR 1IG3A 1KVSA 3B12A 5ECYA 4ZV7A 2H9AA 3R9KA 3RC2A 2NN3C 1CDOA 1WEHA 5AJVB 1WUIS 1R5BA 1DOZA 3EDQA 4Q9LA 3VH4A 5DHRA 2Z3WA 4WOKA 4BNVA 4IJWA 1X7WB 4IGEA 1BJRE 1T1GA 4OYHA 4Q24A 1RXSA 3GHYA 1ONNA 4L3VA 3AFGA 3EQZA 4TLBA 4C89A 3MRSA 3D3NA 5IK2D 2Z5FA 3GMSA 4OH1A 3SOZA 5I8ZA 5KNCD 1HDOA 2FCAA 3RRXA 3A9WA 4MVJI 2VQ3A 1FJ2A 4I5FA 5DNCA 3OLVA 1ZW6A 2YWBA 5JS1A 2GNAA 1NNEA 4IS2A 2QLFA 3Q10A 2FZWA 4XGKA 4C0QC 4K88A 4LVOA 4YBZA 5AI0A 3RV4A 5JANA 2G9QA 4D0LB 3T1VA 1NLMA 3CLSD 3KR1A 5HRAA 1GKUB 5JY1A 2F6RA 3TE7A 5GOTA 4AF8A 4FT2A 4W5QA 3EG5A 2QVBA 3ZHCA 4V39A 4UVGA 4DIOA 2Y99A 1F9AA 1JMKC 1S7CA 3E70C 5INTA 10MHA 1YVRA 1WSDA 3KR0A 4AZ3B 5K0CA 1FUUA 2CDAA 4ANFA 3M1IA 4D9JA 5CFQA 5K0SA 1IWBB 1J2TA 3DOIA 5KC9A 3QIVA 5IANA 3G5AA 1BMFD 1Q0RA 4BOYA 4LF4B 5F9HA 3OU6A 1RWMA 2QYHA 2GUWA 4DSNA 1OB5A 4CGZA 3OPMA 4ZRNA 2V7GA 2WF6A 2AOWA 4U2CA 1RLUA 1SXJD 3AJEA 3JRWA 3QZUA 4J2HA 2QUZA 3VH3A 5P21A 4ICIA 3O3CA 3K2EA 1PYDA 1YAHA 4N3GA 3VHRA 2VNSA 2IPNA 3R7NA 2C7RA 4R8SA 1XTKA 2MMCA 4LJYA 4A8JB 3H5WA 2XCQA 1Q57A 2QUBA 3WX0A 5HZHA 1CS4C 2YY5A 5BSUA 2I5PO 2CBXA 2EKPA 2QR5A 2ZREA 3P96A 2FWJA 2I4TA 4OBWA 1K6XA 2J87A 4K86A 3TR6A 4DB2A 4DIKA 3QOFA 4QPDA 3ZHRA 4LMBA 3JWHA 5GV7A 4KIFA 2VF5X 4BV8A 3U9LA 5GOZA 2FW8A 2GERA 4P7FA 4O4IA 1L4BA 2WVHA 2DHDA 1XUOA 3ADKA 4PSAA 3HB0A 4MW6A 3ESCA 5FEUA 3G8DA 5HSGA 1P1JA 3SC2B 4LWPA 2OV4A 4ISBA 1G21B 5LA6B 5JBQA 5JO9A 3V8VA 4X7RA 1TOAA 1L4MA 4H7DA 1TEZA 4LWZA 3NHMA 4K2AA 5CFNA 3Q9SA 2ODWA 3R4CA 2NUAA 4BVAA 4XWOA 5DNUA 2AFRA 4W99A 2CC2A 1XMQB 3H7AA 1NX9A 2AOUA 5I48A 4JR2A 3NWOA 3T4PA 3HXTA 3R6WA 3GLVA 4E2WA 2ROQA 3EISA 3FNHA 1FFHA 1H3FA 1TLLA 1CS0A 2EBHX 3WHPA 2QU7A 3RE1A 2QAGA 2XJ4A 1OU4A 4OUDB 2DJIA 4X20A 4DSUA 1E2BA 4CKXA 4A8TA 4XDHA 1GQYA 4IDFA 1PDVA 1W4LA 3KKOA 2AJ8A 2RC6A 3SZUA 2FDRA 2DFNA 2VJLA 4TRMA 3KKPA 1YE8A 4YGYA 4JUDX 4BB9A 1L5WA 2EJTA 2YL2A 3U40A 3GLGE 5LZ4A 3EGDA 3MTQA 5A3JA 2XCUA 5BMVA 4KUHA 1Y6GA 3RG8A 4JELA 2GPSA 3PFBA 4LI0A 1S01A 1I80A 1NVXQ 4UREA 4ZI7B 2JCXA 4Y2PA 2V45A 3DMTA 1F06A 2XVYA 3A3YA 4A26A 3SM9A 1M2EA 5F1OA 5C7LO 3KPJA 4RH3A 1A2OA 3GJ0A 2YXPX 3T9CA 4BIIA 1A9YA 3MGAA 4FZVA 2R97A 1W1UA 1Z3CA 2PUWA 3ROZA 4AYWA 4PG5A 4BWYA 1XCLA 1AKEA 3L8FA 5J2UA 4S04A 2G82A 1KAEA 3C7CB 4J0FA 3WWDA 5LPNA 3ZVKA 3AH8A 2MHCA 4QUKA 9ABPA 3GLUA 4BRWA 5L8VA 5KWIA 1R5OA 2AWNA 3OOHA 4Y2JA 2ZJ3A 3Q9UA 1X1EA 2O1SA 2Y1CA 1XE3A 3PE4A 3TW6A 1RBQA 2IYPA 4GOXA 2LR0A 3NORA 4D9NA 4EGQA 3SC3A 2HRRA 5H16A 3JQ6A 1SU6A 2AHOA 4RA9A 4OBXA 5DGIA 4D6PA 3DKKA 2BR4A 4HNSA 1RI4A 2I29A 3LCCA 3LM8A 3K2BA 3HDGA 4N49A 1U7WA 2IHUA 4F46A 3LECA 2OCBA 5CLIA 3TMKA 1HNWB 3K35A 5KNBH 2O4CA 2JIBA 3GAMA 5LMZA 3FUCA 1Y1RA 4YN3A 4NR0A 1E69A 3PQ5A 1ELOA 4B3TB 4HUQA 1DGQA 4BU1A 1BFKA 1YHZA 1E6LA 1G2IA 2WM8A 4YMWA 5AUQA 3WQQA 4Z7QB 1WABA 1NVKA 3WJ2A 3I32A 5C4GB 1P60A 2ZTHA 1MQAA 1PT5A 2ZCVA 5CG2A 5KJFA 3N0RA 1IN8A 1Z4OA 4WOCA 2FUEA 4FGZA 3KCQA 1OXVA 1MX3A 2PSEA 3DOCA 2M9MA 3GG2A 3KOUA 2YVLA 4GWLA 3SX4A 3WOVA 2I91A 1U9JA 4BQQA 2IBMA 2ZIXA 3U6KA 2PO5A 5COQA 3UA3A 4BGUA 4TTVA 1DX9A 2HA0A 2X5KO 3DC2A 3N8IA 4TSKA 4UU1A 1VECA 3P2IA 5D51S 3RBAA 5A71A 1IRIA 3D4OA 1IN4A 1KZ7B 3MOSA 3P9NA 4P7JA 5FR1A 3WY9A 4EUSA 3WRYC 2BFBB 3CY6A 3NYRA 1COWD 2A9KA 3J80A 3LF2A 1FMCA 4BASA 2ONJA 1CG6A 3NDBB 4CIXA 2BRUA 3KL4A 1KZHA 3FYHA 4QAJA 5BR4A 1J2YA 4CM8B 3QJYA 5FNVB 2HSZA 4JLDA 5DGTA 3H6GA 4CLOB 1GAEO 1UP4A 2J3EA 2VOEA 4BRUA 2UZ0A 1E9BA 1YZLA 4H16A