3UC9A

Crystal structure of yeast irc6p - a novel type of conserved clathrin accessory protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
184
structure length
180
Chain Sequence
b'VLQYPQNKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDSCKDIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVLVNVNEEVEQDEIDELNEIWSNAFTNVIEFVNWKTVNHNDYGEKLGLDRIQEIIDTHDWLNCEVQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Increased recombination centers protein 6
publication title Yeast Irc6p is a novel type of conserved clathrin coat accessory factor related to small G proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Recombination
total genus 66
structure length 180
sequence length 184
ec nomenclature
pdb deposition date 2011-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uc9A00
3UC9A
chains in the Genus database with same CATH superfamily
4KR3A 4Q3LA 2FLKA 1WTCA 2H3EA 3GRZA 1I0IA 1UIRA 4KO8A 5AW5A 3DAPA 2H29A 1V8PA 4EVIA 1WB5A 3KJFA 1CUXA 4C4XA 2FW7A 4DIDA 5I48A 3IKMB 3FLMA 4RSGA 5ITSA 5IP5A 1QE3A 2FZVA 4IGAA 4JP1A 4K26A 5CIQA 3FOFC 3RADC 4HXYA 3DL7A 1M6EX 4UATA 5J3JA 1K7SN 1L8LA 1W36D 2B1QA 3L05A 4D96A 4DQUA 4W9MC 2Y1KA 5CTAA 5B37A 1CPYA 3M34A 3PK0A 5IS2A 1T5TA 2AFIA 2GMWA 2R25B 3AUTA 4GUDA 4Q3NA 5CRIA 3W79A 4D0GA 1G8GA 4QLAA 2YVAA 5JQGB 5H4GA 1LZKA 4RHTA 4ASUA 1WXQA 3LWNA 3OZGA 2FSPA 3ML1A 4RWEA 4AJJA 4NE7A 4C5CA 1YUNA 3LIPA 4LSZA 1W9HA 3FHJA 3J81A 2I6FA 1FZQA 3R3ZA 3H4IA 1B8VA 1MX9A 3I23A 4MVJP 4CDGA 1UIMA 2ZI9A 5LMCA 1GO2A 4FN4A 2AJDA 3KXPA 3E9DA 2ZYHA 1L3CA 5KQGA 2FPIA 1MEOA 1EZ4A 2XTMA 3RRMA 1CNEA 4FJ2A 3WWPA 3L84A 1WA5A 4F5YA 4HH4A 4ZCPA 4ZQFA 2IE0A 3L0CA 3K2BA 4LVUA 4ZCRA 5GMOA 1Q15A 3TH5A 2XNSA 4ILKA 5D6OA 3R9WA 2O14A 2AD1A 2ZE5A 5FORA 3DOJA 2G82A 2RHJA 2PJDA 2BMJA 5JS8A 4UNSA 2I2DA 3BIJA 4MQ6A 1PT9A 3W2HA 3I2HA 1U81A 4BMSA 2YHBA 4C7MA 1PVVA 1Z18A 3ZV3A 4BIMA 4FFSA 4QYIA 4J76A 4I5GA 2OFFA 3QG5A 4WESB 4PLWA 3OPVA 5IANA 4BO6A 2PR2A 4WADA 3FCEA 4WINA 4XD7A 8MHTA 3HS3A 3WK4A 2NO7A 5JMTA 5ILOA 3T7IA 1Y7TA 4NFLA 1XF1A 3G8YA 4B6SA 4EYGA 1NASA 5DVZA 4WNAB 4BZWA 2E3JA 3D8SA 4AZ0A 1NP6A 4HFMA 4EK9A 4GOMD 3VOTA 1FXSA 4NU6A 5AVKA 1GD1O 3EA5A 3FYDA 4CM8B 5JATA 5KNDD 1NOJA 4LRSB 4TTJA 3M5DA 5DPMA 4CMCA 4D4HA 5CEFA 2X2OA 1A95A 1YZQA 1TAHA 3PL5A 1VI2A 4KXXA 4XA8A 4OHVA 1BYUA 5C2JB 5KIAA 4E15A 5DNYB 4P1ZA 1G41A 4BYMA 4BQRA 3FZYA 2XUKA 2IPMA 1MRZA 4NTZA 1NYTA 1R0ZA 2Z9BA 2YRWA 4IWYA 3V6LA 1QANA 1XCPA 4YASA 3IAXA 3ZWVA 1K7EB 2NU7A 1II8B 4ZC1A 4QM7A 3EPJA 2IYUA 4TTIA 2M1XA 4CCYB 1R64A 2O1EA 3WMEA 4MQEB 1MX3A 4M7PA 2VPIA 3BIWA 2BCGY 2O1SA 1E92A 4HHEA 4KMSA 1BKDR 4M98A 1G1MA 2FFHA 4MUJA 2D7JA 1Z4QA 1YH3A 5ALWA 3EA0A 2MINB 5EXXA 5TLSA 2Z2IA 2F1OA 3DD1A 2NW6A 4D0LB 2Q3LA 1E1QA 2ZSEA 3JD1A 2FV8A 1SQ6A 4N0PA 3CH4B 3H5NA 4I9GA 4KIWA 4L5JA 1NJ1A 3RV3A 3URKA 4DV1B 4L9WA 1FQJA 3KR2A 1P3Y1 5HQTA 1W87A 4BXOB 5EJ2A 3UH0A 3ETLA 1PZGA 3EDMA 1JLSA 4M37A 4A3SA 1HF3A 4CR8A 1SBQA 2PGDA 3H5OA 4NPAA 5KHAA 3T7CA 5HQ3A 1KDTA 1YDEA 1OSNA 1TF2A 1B1CA 1F8XA 2GUGA 1Y9EA 2YZ2A 3NWOA 1UDRA 2AMJA 3GRAA 4PHTA 4YGXB 5DXJA 5BMVA 1E1LA 2HA3A 4S2EA 2NADA 5J9FA 3GCGA 3JAMA 3G2KA 1BU8A 1NU6A 1B8UA 3EQ7A 1CKEA 3I9MA 4QUJA 5LP6C 2ES4A 4DV2B 1MTOA 3TB6A 1N8SA 4ILEA 2D0DA 4ALKA 1P2VA 2HQ1A 2Y1DA 3I6BA 5SZKB 1GZ6A 4CQLB 4EFNA 2E1RA 3OICA 1QQ5A 1RYHA 5DP2A 2WDPA 3UB4A 2Q5OA 4M7OA 2AOWA 2ZRBA 3PGKA 1RM0A 2PX5A 3W8RA 3KR1A 4LQDA 1ICIA 2X86A 2CNLA 2OCPA 3RBAA 3R0IA 4FCWA 2BEVA 1OBVA 1NXWA 2CCGA 4D9FA 1FJ2A 1W59A 4JLKA 1ORVA 4FHGA 3QA9A 2COKA 1F2VA 1N6OA 1TT5B 3LQ4A 4HX5A 4BCDA 5ALVA 3V2HA 1UFOA 1OXMA 3BXXA 1ESZA 2OSVA 3AOEA 2AT1A 2EW1A 3PUZA 4MIYA 1BMDA 4ZVMA 5C18A 4RMIA 2XKJE 3QKRA 1XXHE 4PAOA 5FB3A 4YCCA 2PGNA 4MP8A 2AYYA 1A9QA 2A0KA 1CUCA 3I34X 3V8PA 2Q1UA 4KQEA 4M4SA 1NVUQ 1QWOA 3O9VA 4EQ6B 2CV0A 4JLNA 4WXHA 1N7JA 2YZMA 2JGFA 5B57C 2G5CA 5A6SB 1ZKDA 2GJ4A 4BMZA 2YVQA 4L51A 2A86A 1E2FA 3OLYA 2NIPA 2JANA 5AQ1A 3OM9A 2IX3A 2C78A 1I4WA 3FUWA 3FYSA 1IRIA 2CHQA 3WRWA 5D00A 3CLKA 1RJ9B 3RQIA 2QL7A 1I5RA 4FYHA 2OQIA 3BA1A 1XNHA 4INPA 1U6IA 1I7LA 4BN5A 4UFOA 3VAZA 4FHFA 4LNUA 3DVAB 4F5ZA 4JJAA 2FPOA 1L1QA 3BDIA 1F3LA 4TKVA 2DSTA 5AOCA 1U8EA 1YKGA 3F4LA 1GPYA 1BWQA 3AUJB 4W5TA 1KQGA 1PK9A 4XM2A 1O95C 2HIHA 3ANNA 3Q72A 2PUHA 1UBHS 1ZESA 2XEDA 1WO8A 2P1ZA 3C70A 4LS3A 4RDXA 2AXEA 1JWBB 1GGVA 4MQFB 3WDLA 5ES3A 3WBFA 5IX8A 5DLQC 1IUKA 1ZM9A 1XMQB 4PR3A 3HLYA 3L4BA 1Z38A 1QTRA 3BERA 3H17A 4C7BA 2DB3A 4JYPA 1EHIA 1CHNA 1JXQA 2FA9A 3KFVA 3N05A 4P38A 3D81A 3EVNA 4E07A 2GPSA 1ZK2A 3R7WA 4B9AA 1P0MA 3RU7A 1JTEA 1X8XA 3BSYA 3DZIA 4UNNA 4US2R 1U3GA 4QBIA 4EO9A 4WBNB 5JBNA 4K40A 3RC1A 5JSFA 1S2LA 4RY9A 4ALLA 2XKKA 1C7QA 3FWHA 1YCDA 1YMUA 1MV5A 2R00A 4HQ6A 4IIXA 1MX5A 4Z86A 3BC1A 5KPDA 1JH9A 3U19A 5AW7A 5SY4A 2PL3A 2YZ7A 3PEUA 4FLEA 4MQLA 4O4JB 1CUSA 2Z98A 1FU8A 4BV9A 1Z06A 2XUJA 5ECWA 5KUTA 4DJAA 2WA1A 5AHOA 4G8BA 2AEJA 1QIFA 1QFSA 5DNWA 4LVNA 3C3BA 3CW9A 1A8HA 3IQGX 3I30X 4CHGA 5C37A 1XQ9A 1YS4A 4WK2B 1F38A 2AS0A 3QFRA 3PVCA 5I7VA 1NW3A 3O8NA 1XZDA 3RSQA 1Z25A 2H1FA 3RPEA 4I14A 2JLSA 2FOXA 2AA3A 1G8FA 1TYDE 5GJVC 1SVOA 2ALJA 4YT2A 1U1IA 4X1KB 1JXAA 1JXOA 2Z8XA 5AYVA 3GCXA 3AZPA 3NXKA 4KQFA 2R6GA 2EAUA 3HJUA 4UTOA 1D9XA 3FPFA 5CBPA 1AKVA 1GQYA 1IIBA 1QQTA 3P0EA 1XP8A 5EGNA 3TL2A 2Q46A 2HB6A 3E22A 2K2WA 3EUFA 2E5WA 4CL0A 1VJGA 2FCRA 2ZPAA 2X7XA 4MLDA 5FJIA 2IBMA 3PTZA 4O2RA 1KJ9A 4EG1A 5EP4A 2BV3A 3Q0TA 4NMXB 3ZCTA 2FZLA 1UEIA 4EX6A 5ITVA 3X1DA 2HQOA 4UBNA 2IBSA 2VJDA 3BHMA 4RFSB 3EGVA 3B5EA 2BP7B 4TL7A 5LQSA 5TIIA 2WINI 1E0DA 1SVWA 2GYVA 4YCAA 2YWRA 3JVUA 2ZSAA 4QDZA 3AB3A 4HNGA 2X22A 1A5BB 1JHUA 1ZCZA 3FWZA 3B1ZA 3LFUA 4F9TA 4QUGA 1H93A 3PKZA 1JZQA 2NVOA 1DAPA 1TU0A 1XTZA 2DLDA 2M6RA 2DPXA 2ZVPX 3ICVA 3KV3O 4KKXB 3K30A 4MGYR 3AGQA 4RMHA 4XX0A 1GPDG 2HTEA 2I2WA 5DI3B 5LC1A 1SCQA 3F7OA 1QH0A 3VYTB 4AZ3B 1PL0A 4N9WA 1RR6A 3IR5A 3PRJA 4ZK2A 4B76A 4B17A 1F0YA 2X5JO 1N3BA 4FW9A 1WP4A 7ABPA 2ZUUA 2GEKA 4MW0A 3RB8A 3RTBA 5IULC 2D1TA 2F64A 1Y4SA 3U49A 3KQNA 4YQFA 1XNJA 4A6XA 4WECA 2R85A 2TMDA 1OX4B 1GGNA 5L3RA 2XQFA 1GUBA 1MAUA 5LUBA 3EC7A 1S2IA 1O94D 1FBNA 1V2HE 3IAFA 2FPWA 3NIFB 4M7WA 1QP4A 5HJ7A 2QE7D 4QOFA 4DCNA 4WK6A 4RTSA 2QA5A 3FYUA 1XN4A 4X1YA 5LA6B 1U8TA 4PW0A 3MBKA 3A31A 4LYYA 2FAXA 3DD5A 4XEUA 1XRQA 2QPAA 2I8CA 3RASA 4A0RA 4NG4A 4F8EA 2JBWA 3CWZA 2VAXA 2JFVA 1E32A 5ECGC 4EY5A 4ZYXA 5AVQA 4M8LA 4UEKA 5ENVA 1WPRA 4R1OA 4ZYLA 3FG9A 2HAEA 3HRHA 5TJ9A 2YWFA 5K0BA 4B2PA 4M9RA 2F3UA 3WJ2A 5AESA 5IDXA 1S5PA 4H3HB 5L45A 3DJFA 2GEJA 4G1MB 4F2GA 1F0KA 4YUAA 1KI6A 3SMVA 2C5LA 2OD7A 3KUUA 4Y18A 3AI3A 1NVKA 4A23A 1F8YA 1OXBB 3FIUA 3GDFA 3JQFC 4LJ4A 2AN3A 3VJLA 3BRWD 2WSSA 2VDWB 2QP3A 4P3XA 4JVOA 4UUMA 1BJTA 3UF0A 1WXFA 1Y9DA 3I0NA 3P45A 4DPMA 3I9LA 1LCIA 4KH1A 2HFJA 1UT6A 1LPBB 3ZGLA 4AB1A 1AQIA 2GETA 3GJTA 2QVLA 4U7WA 2I29A 3OKCA 4X64B 1TAUA 5EY5B 3W9BA 3NAQA 5MN6A 1RDFA 3CVJA 3LDUA 4DQVA 3LE8A 3GAAA 1EFCA 4OAQA 2A35A 3VFDA 2ECQA 5F98A 1M1XB 3AJDA 2CJPA 3H1BA 3E53A 3KKMA 2NUPB 5JSZA 1PL8A 1LK5A 3W8EA 1J24A 1D5WA 4G9BA 4AJEA 3HFGA 4BTVA 4XYLA 4M1YA 2WM9B 3G5LA 4HO1X 4IILA 3NBAA 2UDPA 1XQVA 3E1GA 4CT4B 4S04A 3ER9A 2PSDA 3CLSC 1Z7EA 2Z3VA 4AJOA 3OP1A 3Q8MA 2H1OA 1KXZA 5M5BA 5HBRA 3IP7A 3GLKA 4JVLA 2CV2A 1DT5A 1O08A 2PRJA 1G60A 3MWKA 3ZVNA 4U5QA 1MOQA 1MC8A 1BDMA 1Z2OX 5EXDA 4NARA 1MUUA 5TMPA 1QCCA 1YCGA 2BUCA 2VDPB 1AF7A 1Z45A 2CNKA 2WHRA 2YHIA 1UADA 2Z2XA 4GRIA 4ZQEA 5E9WA 2KQUA 3TW8A 3K1JA 4GOXA 2JD1A 1UKYA 2BBOA 4G67A 1UBTS 4HVAA 4DG9A 1D2RA 1UOOA 3TR5A 5K99A 2R1ZA 1E3JA 3KQOA 1NXPA 2A1UB 1NUQA 4JYCA 5I9BA 4IICA 2W90A 4HDKA 4LDRA 3GPLA 2A33A 1Q91A 5GV8A 2RC6A 1B8OA 3PFKA 3LLSA 3NOQA 4BX2A 1HNXB 2ERCA 4KLAA 4OMUA 4N48A 1GNRA 1RHKA 2PWZA 2WJVA 3LH5A 4G9GA 2FX3A 3TF5A 5AVVA 3CVWA 2IEIA 4HYQA 5P8WA 3BGOS 1SY7A 1YU9A 3MJTA 3ZIAD 4F9FA 2AMYA 2O8CA 3G7NA 1TVKB 4B32A 5IFKA 4GL4A 2QTFA 4FI3C 1E4YA 5AKHA 3EF0A 1DXQA 3QITA 1W5AA 2OZPA 4KEAA 4P4LA 3P9ZA 1OCEA 1GOTA 2OZVA 3ZW8A 3VDQA 1F51E 1YFZA 3UYLA 2FQQA 2X0FA 1K7YA 4LYHA 4YRGA 1VC2A 1KO7A 2IU4A 1NWCA 1NAHA 4WWHA 1P2GA 1E5DA 4NV3A 2FRXA 3B89A 3F3YA 4ESEA 1R6VA 4INZA 4Q7KA 2BEWA 3VSAA 9LDBA 1WR8A 2XQGA 3QP9A 4RK7A 4YP6A 2W6JA 2GLUA 1VZ2A 3BHJA 4Q4JB 2VJNA 3NT4A 4YWHA 3TRHA 1GCGA 4M8SA 2A92A 3EISA 4LYEA 4P33A 5LZ8A 5K0CA 1B0AA 4FFBA 4JCOA 4B8WA 2GFHA 5CLQA 4MB2A 5EKXA 4M1KA 1ZICA 5K2MA 1T5DX 1KE2A 1A96A 3ANSA 4NBWA 4NC9A 1LF5A 2ZB3A 4A10A 2DUJA 5AKLA 3AEZA 1VSBA 3NEJA 4KN6A 4WVLA 1ZGHA 4YRPA 1HDXA 2L42A 2B0CA 5CHYA 3Q7IA 1PNQA 1O6BA 5CX1A 3FZEA 3LPMA 5JJ5A 3DLPX 3V80A 4C0JA 1HYEA 1VCIA 1NOIA 4KGDA 1L3IA 3KT8A 4TUYA 3K7EA 4TSFD 3FCAA 2ECPA 3E15A 1YR7A 4R7ZA 3ZHQA 1EIWA 5LBTA 3MYYA 1VLLA 1SVNA 2I6QA 1NBEA 2V74B 3HU1A 5KTPA 4N03A 2X9LA 4DDHA 3LECA 3STTA 3EX7C 1XRNA 9ABPA 1FTQA 1NNI1 2PVSA 2ZRPA 3TPFA 5DRYA 4CTNA 4EMTA 2FR0A 1AIPA 4DMCA 1QC5B 2JPDA 2FPGA 3GU3A 5EXTA 1JTVA 4ZKDA 1X92A 3Q1LA 2GD6A 3IQHX 4ERNA 1N1MA 5H9VA 3UW3A 1T8PA 1BJKA 4ZAXA 3HYSA 1DDIA 2EHDA 3HADA 1PQYA 4C87A 5ES4B 5M29A 2NVUA 3WLLA 4IXWA 2Y71A 2I7TA 3BMNB 5HF8A 1OXSC 4Y2VA 3LC1O 1SHKA 3FPCA 4UNIA 2PUBA 1X7WB 2P6OA 4QQRA 4LOJA 4Z49A 4CLXA 2OLEA 1L5OA 2ZBQA 1SWVA 1SOWA 4H4CA 3FJYA 2ISSD 4FUTA 4YR7A 2IE8A 3ETDA 3TOXA 3X1KA 2J3MA 3KYIB 1AUOA 4BLVA 2FU5C 1ZJ4A 1Q11A 1KEWA 2WK1A 5C8YB 4C89A 3FFAA 2H6EA 1B15A 2HTFA 3H18A 4RS4A 5FNZA 5EJFA 4GSYA 3WGTA 3U3KA 1CVIA 5DU2A 5K0JA 1V7PC 4MV8A 5G1OA 4M55A 5MFZA 1BXKA 1CZNA 2H9AA 3DONA 5THKA 5LYJB 1NFRA 2WYOA 3EG9B 1DAFA 4LZZA 4RQUA 4AICA 1LPAB 1PQUA 2G0AA 2XE7A 3ROKA 1DC3A 4JELA 1DS6A 3BJMA 2DFTA 1I0ZA 3WWZA 4NY1A 3PQ7A 4PC6A 5K6AA 4N40A 5DYNA 4ZYZA 4LTNA 2ZRDA 1KMHB 1YZNA 5B7NA 3FWYA 3H0KA 3BHNA 4HX2A 2B20A 1C3VA 1J1ZA 2DVMA 2WICA 3FLEA 3Q6NA 4KUHA 2FFQA 4IYRA 3G6WA 4GLBA 4LGVA 3VC2A 3CINA 3L7AA 4DLZA 4IGKA 1RJEA 2ORWA 3GYGA 3KB8A 2BD0A 5DEOA 4YCLA 3HJAA 1TIBA 5HJ2A 1F9AA 3AUXA 3OHMA 4J16A 3DAYA 3HZRA 4BVKA 3R6GA 3EGIA 5JSUA 3HO1A 4OHKA 5EJAA 3PTAA 221PA 4FKBA 3QX3A 3ESXA 3WGOA 4LMRA 1JHMA 5TVGA 1YDHA 2H0AA 4QRDA 1RBYA 3MG9A 1IHUA 1JG2A 1ZRHA 1QP0A 1KU0A 3QLVC 1N5MA 1XXLA 3BMQB 3QELB 2GBGA 3BEOA 4PHCA 1BVRA 3R75A 3ZDZB 2WWIA 3VPGA 1WV1A 3BTUA 3TRKA 4B73A 3WRYC 3ENZA 1CYDA 4YJ2B 5JV5A 4ABYA 3LT4A 4Q03A 1RXCA 1VIVA 2IXFA 2WBLC 4UHJA 5BUZA 2O8FB 3DLAA 1RHUA 1V8OA 2VJLA 4HDNB 4DTIA 4EYQA 3NHLA 4BNVA 3AI2A 1RM5A 2FN7A 2GVZC 4GX5A 5BV1A 5MHTA 3OSZA 4Q00A 4DSOA 4DUGA 4LJLA 2WHPA 1EINA 1F6WA 4OI4A 4KE9A 1P8JA 1WB6A 1DDOA 5KYNA 1RRVA 2FZWA 4ZT2A 2O8EB 4YRMA 1ZCBA 2J3IA 1KEEA 4PYRA 4G0UA 2MR5A 5KYYA 1TUGA 1CCWA 2J6HA 3LNTA 3ZK9A 4Z4GA 4A73A 4MRSA 4TV9F 2WG0A 1ORWA 4RO0A 2BEUA 2PLAA 2ZWPA 3CKKA 4UU7A 3P2OA 3TSZA 2VK8A 1O95D 3O1LA 1GNTA 2FFAA 1V71A 4Q9LA 3A32A 3A6HA 3VNQA 3BQNB 5J2TF 5JWHA 5FULA 2IV7A 1V48A 1XA0A 4KQIA 1TQHA 5HW0A 4TVOA 1P72A 1XTIA 4F3CA 2C9OA 1B16A 5JZBA 4NWIA 3HNPA 3WGHA 4F04A 5F33A 3DFFA 1FSSA 1JR6A 3ULKA 3G2NA 4K9LA 2ONJA 1Q84A 4LHXA 3PA8A 1VYUA 5HIIA 4CI9A 5MF6A 1FIUA 1DRVA 2WB2A 5ALYA 3A70A 4NOLA 4BKUA 4GHWA 4BB9A 3FDZB 4KO3S 4K9KA 4MTLA 5TSDA 3ZZNA 1UPUA 2NAFA 2XAUA 3DFIA 5FWXA 3ZCSA 3RUAA 4D3DA 4EJSC 5HIKA 3WQBA 1PTJA 1WQ3A 2VF5X 3BKXA 4C21A 4PC1A 4QXQA 5DTMA 3TLZA 1OLUA 3ITKA 3RBXA 3UKOA 1Y8CA 4AX4A 2CB0A 1WDLA 3SK0A 4FNAA 4K6HA 1JXMA 1HLDA 3MB5A 3EGXB 4TZTA 1E2DA 4LK2A 3O82A 3MTJA 2G1KA 4GW3A 1D2EA 2VAMA 1W47A 3IEKA 5TS2A 4GI2A 4GYJA 4PZEA 3T7DA 3T3EA 3KDPA 3IE0A 2BM0A 2RG7A 5JMPA 3V6MA 4RF2A 4LCBA 5GVRA 1NMEA 3BWVA 3FTNA 2F67A 1JQAA 3O31A 2FOIA 2OXTA 1G8PA 4CV1A 5DV9A 1OD6A 3QSGA 2VBIA 2XSZA 3FIJA 1KJWA 1X7XB 2XUGA 5AW8A 1ZWLA 3LFHA 4PFJA 3B7WA 3T06B 1TJ4A 4RXUA 4CQMB 4DLLA 2QN6A 5F2OA 1PLJA 3PQ4A 1CC1S 2I1WA 2KM1A 2KX7A 2QTNA 4YRDA 4DG8A 3F2IA 3KPJA 1PAUA 2W42A 4ZOCA 3RVKA 4CM1A 2PL1A 1MTZA 3LC0A 2QEQA 1T0IA 3FTCA 3J80A 1UM9A 4DYDA 1Z0SA 2XH8A 4BNTA 3WGVA 1L7BA 3KT0A 4PLFA 2HL6A 4W5HA 2IU0A 5LMNB 1O96B 3L7NA 5CFMA 4IDNA 2J9YB 3LY7A 3PFNA 5BSMA 4RVCA 2VJCA 1QYWA 2B30A 1UXGA 4FN5A 4JT2A 4JI6B 1KY3A 2ID4A 5DTIA 3UYKA 3DO6A 3D1VA 4ER0A 4KXLA 2PAFA 3HI4A 4NR0A 2JBHA 2Z3WA 3HUUA 3L7JA 4JBHA 1OHHD 3TIIA 4XVUA 1D04A 5BW4A 2OT3B 3IP5A 1XPOA 2BHRA 4G0OA 2WHQA 1P18A 4LSWA 1GKLA 3P32A 5B58C 1O54A 3I53A 2YBEA 4NCHA 2E9SA 3L4EA 1AT1A 2B4TO 5A7GA 1VPDA 4ZPJA 4ZEXA 4XRGA 1WUYA 3RS4A 2G1AA 3RODA 5EJIA 4H7DA 4DGSA 2XGGA 1L1EA 4OQYA 3LYUA 2NTVA 3G9XA 4LVOA 3I9JA 3J81k 2HUNA 4TL9A 2CKMA 2P5YA 3FPKA 4EGAA 1HURA 2D0IA 3EVFA 5HPYB 2OLKA 1ZK3A 3KLBA 3DZKA 3TLYA 4C78A 5CHEA 2CF5A 1Y3FE 4N7MA 4DC1A 2OHIA 5FUMA 6ABPA 3IEXA 1Z5NA 4R54A 1V0JA 2P9QA 3NBKA 2Q8PA 3MXOA 3M83A 1ZH2A 5AK4A 2HR1A 3ZLJA 2C57A 3TS1A 3Q3VA 1EFVB 5ETJA 3WB9A 1CSEE 2OCAA 3KTDA 4CMKA 4DCUA 4E2WA 1U5BB 2ZSIA 1WTAA 3TNYA 2P9CA 5D01A 4MW5A 3RG2A 2JJ2A 4E2ZA 1SC9A 4TSKA 1P45A 3OH8A 2XBLA 3P9CA 4KW7A 5TQ2A 5CX4A 3ZCRA 3HWRA 1QP7A 3WNDA 2J4FA 1A9RA 1M2HA 4OP2A 4DSNA 3MGGA 4CKWA 4XLTA 5C31A 4JI5B 3PF8A 3QU9A 1DBWA 2WFLA 4DYVA 5HHTA 5D51S 5EC8A 4HB3A 1ADGA 5A2QA 1O9BA 4L73A 1RI4A 2G1UA 3DCJA 2HZBA 5BWNA 4FMDB 3EIEA 1VHTA 4HZUA 2PH1A 2GUWA 4YJGA 3DMRA 1GKIA 2R6FA 4X6UA 1ARZA 1V4NA 1VPVA 3L0ZA 1DG9A 2O1WA 2UYHA 1RLUA 2C1EA 1NN1A 3QA3E 2FMTA 4HR7A 4B44A 4WERA 5F9MA 3WISA 5JCJD 5K8TA 2FEPA 4PX3A 5BYJA 2VTDA 1J9EA 4C2TA 1O57A 4DR7B 1FTYA 1I2CA 2QXUA 3THSA 4F97A 3DPIA 2HNBA 2OCBA 3CEPB 1JQLB 2ODNA 3OMXA 1EX9A 1OIXA 2WD7B 1XEAA 2VWGA 5AKYA 1N2HA 1SBNE 2C20A 1RRMA 4PPQA 4XIGS 1ITZA 3S27A 4DWVA 1ZN7A 1UK7A 4G56A 1JIUA 2GS9A 2RK3A 4RVSA 3VPBA 3ZWMA 2ZAGA 1QO7A 5H5JA 5SYAA 1HL3A 2LW7A 3FCUB 3JATB 5JCZA 4H1WA 3SFVA 4AJLA 2G17A 2YX1A 4OXKA 5E8JA 3DEHA 4MS3B 1DKUA 1GDDA 1CQJB 2RHCA 3R7DA 2FETA 4MLPA 4RZ3A 1KO5A 1P61B 1T34A 3C5WP 5JDCC 4B3XA 1N2SA 5KNLA 1PNRA 2VDRB 4XIYA 5EE1A 4CUKA 4E5UA 1DAGA 2EW8A 4KE7A 2E6KA 1DIOB 3A4YA 2J5RA 3I6QA 3Q9LA 4PPNA 5F1YA 4M8NE 4H31A 1W75A 1G98A 2IP1A 1P77A 2AX4A 5I7AA 2I4RA 4IIUA 1IONA 1JG1A 4UUAA 1QF6A 1FNDA 2I3AA 3WZ2A 3LOQA 1PN3A 3GARA 2HBYA 3A26A 5HF6A 3FSJX 2NT4A 1FYEA 4MW1A 3TLCA 5KTYA 3TL6A 1Y9JA 2VDVE 1UMBA 2YCLA 4DYHA 3ZHYA 4GZMA 2V5VA 5CB4F 3W5CA 2YMMA 1ZIOA 3QVGB 1JDPA 3UMBA 4BJ5A 4EMUA 1E2PA 2B6NA 1QK3A 1TW2A 2YRFA 3K8OE 1H2YA 1EP1B 2FWIA 5FIUA 2YHAA 3SSAA 5BPHA 1IG0A 1R9NA 1XYGA 1K66A 3PZRA 3GLGE 1M2VA 1GFZA 3ANXA 2IJGX 1H1LA 4DDVA 2ISQA 1QQAA 2JLYA 4KPUB 2PE5A 3K53A 3TLGA 4KBFA 1WQ4A 1PD0A 3E7FA 1L5WA 2QRGA 3KXIA 4X9XA 4HFNA 5CAEB 2C2HA 1HLFA 4OAPA 5HZGA 4BLSA 2F48A 1ZMRA 1E3IA 2QTVA 1BXRB 2WOJA 3F0TA 3GDHA 5GONA 3GW8A 3VAYA 3MD9A 1GPBA 4L57A 4BTEA 1E3EA 1P7ZA 1RFGE 1WV0A 3E82A 3KZMA 1WHSB 3OFVA 1BS1A 1D2GA 2ZSUA 4PGAA 1PR4A 5DGTA 4MR9B 2EF0A 3B85A 5ALJA 4DY4A 2FI1A 4KR2A 1Z29A 3O47A 4Z6KA 1UXJA 1C7EA 4NE9A 4CEJA 4KRFA 2J3JA 1YR1A 1C9YA 3RUCA 2LXNA 2CDBA 5MN5A 4JI8B 4WH0A 1Y6RA 3HCPA 2IEBA 4KOAA 5CLIA 1JB1A 3ECSA 3P0RA 5CW1A 5FP0A 3W9YA 3K5IA 2XDQB 2QORA 4PIVA 2PFGA 3EWSA 1N6NA 2INGX 1AGPA 1I2BA 3P5SA 5DDIP 5BY2A 3K09A 1NBMA 1SC3A 2B35A 3OCYA 3U40A 1HYQA 1U6JA 1NRXA 1X7ZA 4B33A 1U7TA 5HIMA 2XNHA 3IE1A 2O2HA 2C94A 3G1UA 1ZMTA 2A8YA 2XDAA 3FCOA 1PHPA 3KTAB 5BYBA 4PBTA 3ZZTA 5FFFA 3LKVA 1OWLA 3IDZA 4HNAB 1Y8AA 2H1SA 3PIRA 1IZ0A 4OHPA 5EHNA 5JJIA 1B0ZA 5A03A 4L6IA 5EXEA 2ZIVB 1V26A 4PGFA 1K92A 3QBTA 4X97A 5JD3A 5K1ZA 3TBHA 4V24A 1VRCA 4KPFC 2QTMA 3PR2B 5FA6A 1Z7WA 4CDMA 5B6PA 2O8DB 3N07A 4JV5B 4OCZA 3WI7A 4S2UA 3O92A 5E1BA 4NZOA 3ED5A 2VYVA 1J25A 1JX6A 3DWFA 1EVYA 1QUFA 3ZWQA 3MWEA 3VYSB 4EFMA 4LMBA 2QPOA 3GLUA 4FU0A 4TQUS 4X84A 4ZGBA 1J97A 5E9JA 1CJBA 1RYYA 5C8XA 4X1IB 3FVRA 5KS2A 3UWDA 3L5KA 4EI9A 2I55A 1ILEA 3HABA 1KAEA 3EEBA 4TKLA 4R2HA 2Y1EA 3PITA 4J91A 4QFMA 2NXJA 3N3BC 4P35A 5ADHA 1MO2A 2BHSA 2Y6UA 2Q6LA 3PYXA 4B7ZA 1LS1A 2VCYA 1MJ5A 3MM4A 3X1ZA 4BP8A 3U9LA 2ZPTX 1RTKA 4JH0A 4PS1A 3U7IA 4ZFNA 5JBIA 5KYWB 3HM9A 1YI8A 4ZXFA 3R7NA 3R3VA 1HLGA 4G8JA 4M21A 2ZUFA 4F85A 2P75A 3FD8A 4LJ5A 1DO2A 3OX4A 4LC0A 1G7CA 3L7KA 1UODA 2HV8A 1D5CA 3PEFA 1DHTA 3RYCB 1BEUB 4R0NA 5FEUA 4IWXA 3RABA 1PR1A 1FNNA 2WD9A 5L7TA 4LOKA 1SK8A 3FETA 2XUQA 5LCXA 2C4MA 1EXWA 3JD4A 2QMOA 1H0RA 5EMMA 3TDMA 4KZPA 2J0VA 1X39A 3V48A 3H9CA 3UV3A 1IB6A 3HYTA 4D9EA 2B7CA 1FDIA 2PAAA 3I3SR 1TXGA 2E4YA 1WL8A 1TECE 1BD4A 1Z6PA 2OCDA 4QDKA 5JOQA 1GXSA 4LF9B 1FS6A 2O7SA 1HDZA 1HE4A 2HN9A 5AVWA 3QZUA 1KYWA 1R6BX 3KVVA 4WPGA 5TMDA 2D7CA 1CULC 1JDJA 3EXHB 2OBXA 3BFJA 1FTNA 4GMGA 3ZOZA 5CLJA 3FHTA 3QMMA 2UZ4A 1J22A 1CV2A 4I9NA 4ON9A 4LF5B 1WVMA 2GPNA 1IEQA 2QNBA 4Z4CA 3I0ZA 3ZYZA 4OHXA 2AG5A 2XYQA 5TJHA 4ZIRA 1ZM4A 1U94A 1XO1A 1ZWKA 2J8ZA 3AHGA 4G0ZA 4AMBA 4BNMA 1CDOA 2QGZA 2R1UA 3DJYA 2G3YA 1E0KA 1JEJA 2P0YA 4HAVA 2ZUEA 3QOYA 2AI3A 1T4BA 4UDNA 4BNGA 2XZLA 1GUFA 4A9AA 4P32A 2WDZA 4OK6A 1YZUA 1PR9A 1KIFA 5K3DA 3DXXA 5LB4A 3SYRA 2HA0A 2PX4A 1KTIA 3SS7X 4TYWA 3LLUA 3FAKA 2I1VB 3F7TA 4AJ4A 2ZQZA 1NR1A 2WF7A 1BROA 5K09A 3G85A 3E2MA 2A0UA 4UMEA 2AJLI 2FSHA 3OAAA 4ZOLB 1B6SA 4QARA 5H0IA 1OROA 3WJ1A 1BE6A 3HXLA 2W22A 2OHGA 4XGNA 3DL2A 3KAQA 1XEWX 1Z3CA 1P7PA 3FHOA 1P3JA 2IYAA 2ZJ0A 3P9SA 2X8JB 3FVVA 3DYVA 1AA6A 3BT7A 5TPZA 3WKAA 1JGTA 2XODA 3UJ9A 5LWQA 1JLLB 1WY5A 2ZIUB 2ZREA 3WL6A 2FN4A 4XYBA 1GTVA 1Q1QA 1F5NA 1YI1A 3D7LA 4RY0A 3C8MA 3UT5A 3UY4A 5L4SA 1URPA 3EIHA 1GG2A 2FQYA 3LUAA 3PGMA 4CR6A 2YBDA 1N2CE 3KEMA 3QUTA 3Q3GE 2KYRA 1VFPA 3RK4A 2HZ7A 2C4NA 1HZZC 2P9FA 1XALA 1XL0A 1X7YA 2JFOA 2Q1XA 2XXAB 1ELOA 1RP7A 3ZS8A 2O7VA 2HCBA 3UK1A 1KJYA 1ZH4A 2GCIA 1YRYE 2H7VA 2LGJA 3W6ZA 4LPKA 4X3OA 3PFBA 4FOSA 4EHDA 3RSOA 2RI6A 5FCDA 3H04A 4ZD6A 3U09A 5AXAA 2TRSB 1VSUA 2B4YA 1P5HA 1WY7A 1PGNA 1OFGA 1SNYA 1Q16A 2O8NA 3UTDA 4UVIA 1EAMA 1U98A 4MRMB 4KI0A 3UWSA 4J2OA 1XMPA 4XVCA 2QRKA 5ICMA 3VNUA 1KIMA 1NVFA 3JU3A 4IM7A 4XUGB 3KQWA 3FVWA 2QAIA 4RW0A 1U7UA 5J47A 1NVBA 1EZZA 4MJ3A 1YVUA 1UJMA 1NN3A 4XEHA 5A4FS 3IGFA 4PTYA 4CPDA 3R20A 4JBNA 4GBJA 4M36A 4TV9A 4W99A 2ZVDA 4BB6A 5C8VA 1LQUA 3T9CA 4EF5A 3CXUA 4XUCA 1DDGA 1BGVA 3WGJA 4DG5A 3OUZA 1GQSA 2CUNA 3O6VA 4KU4A 2G9RA 5CBKA 1LSJA 5J2TA 1EUCB 5D5PA 4DGQA 1GQOA 5SICE 3AEKB 1O5IA 1QFJA 4J3FA 1SXQA 1NR5A 2IT1A 1REQB 2ZJ8A 1TU4A 3DFZA 3FUXA 4JBLA 2H1IA 3UOWA 1KXJA 1XXHB 2I2FA 3H5LA 4NAHA 5KTNA 3HRIA 3W5JA 4MAFA 2Q5QA 3LT5A 1BNCA 2UYGA 2C29D 2Y27A 3DBHB 1ZI8A 2W6ZA 3MWFA 4TKUB 3WJAA 5CA1F 1OV6A 1ZSNA 3H05A 5BW5A 5KTMA 2I9KA 5LLDA 1E5XA 4PAQA 2CWWA 2CDAA 4YV7A 2VP3A 2J3QA 4V38A 1P2FA 4K3UA 3GFFA 4MNTA 2QT1A 4PSCA 3AP3A 1JEDA 4FFRA 1AXEA 4WXYB 4M87A 3OQ1A 3W6UA 2Z2KA 4CGZA 1GGMA 3A1UA 3IS3A 3ONWA 1GUAA 5LQUA 5LVAA 3DZDA 4KVFA 5KYGA 1WD7A 4WFIA 1QOZA 1ZS9A 2EKDA 4B2IA 2DLCX 3JRWA 1M33A 2YW2A 5EKSA 4CKBB 2F6RA 1Z5ZA 1XC7A 1G7TA 2EBFX 1VE6A 3KVYA 4I1OA 3EBPA 1XV5A 1EQ2A 1EWTA 1CXZA 2IOHA 3AOGA 5K4GA 1AS2A 1CQIB 1E2BA 1HFJA 2BKXA 2ARKA 1A8PA 4GWGA 4L5IA 1S6YA 4MVCA 1QB7A 4HWSA 1GJRA 4Q5IA 5B1EA 3C3AA 1J8QA 1ONOA 1JHRA 3U7RA 3PSHA 4CLRB 2ZANA 3WWYA 3ZHTA 3I2KA 3WAJA 1WMFA 1QV9A 1V6SA 4B84A 3F46A 3RRNA 2IEZA 4M6WB 2WM8A 1AK1A 4P80A 3NIBA 1VHJA 2Y3IA 1KVUA 3FMOB 4NENA 3A14A 4RK4A 5K8LA 1C3XA 2FFBA 5BV0A 1AQYA 5AIBA 2VDNB 1EHCA 3UK7A 1C3JA 2AZXA 2EJCA 1L5GB 3NOVA 3ZXSA 4YALA 3MS7A 3W3AH 3A36A 1I6LA 2A59A 3JSXA 1ZHHA 1YJAA 2EBHX 3HCAA 4D99A 2WWWA 2YUIA 3DH0A 2IYLD 1JW9B 1P9LA 3E3OA 3KM0A 3RQSA 3LUGA 1XPUA 5DGIA 4CKXA 2FX5A 1EM6A 3PQCA 4KSBA 1PS8A 1DEKA 2QRQA 1IOVA 1GL9B 4F86A 4AZVA 2BH2A 2VDLB 4JROA 4EB8A 1YB1A 1LBIA 2W93A 4KKVA 4UUQA 5AOBA 3VA7A 2NXNA 4NG5A 1VI5A 3T7TA 2D1QA 1RC1A 3A2LA 4DXDA 2R44A 1XJWA 1UDCA 1S3IA 2V97A 3KYCA 3LG2A 5F77A 3SHVA 3ZGYA 1BFKA 5IWCA 2QBYA 2FK7A 3NWJA 2GM5A 3GH1A 1T2FA 2I1QA 2LBPA 3MAGA 2PWAA 4S1PA 1D4OA 3IIIA 4FGWA 5HZMA 3LM8A 3ZU5A 3IL2A 2A7XA 1J0BA 2AN1A 2ZIXA 3L0BA 3QEAZ 1M9NA 3L1KA 2YOGA 2OXFA 3BZBA 5AW9A 3GRFA 3O4GA 4EPVA 2YZGA 3C5CA 3O74A 5DYGA 5JFOA 3PPIA 1C29B 1QQ7A 2REQA 3A1CA 4OFBA 1GSOA 1LLUA 1ORRA 1YB2A 2WVJA 1NX9A 3EMKA 4OHMA 4WTOA 4DARA 2TMYA 4U7DA 3HP4A 5E7MA 1JG3A 4HF7A 4D4MA 4ED9A 2F3QA 5C5EA 4EI8A 1Y8RA 2OAGA 3S28A 3CF2A 4J29A 2I2XB 2I87A 3UXHA 3WHIA 2GO7A 3FE2A 4PZAA 2W00A 2ZATA 1P19A 3IVXA 4HN4B 3KUCA 2PNJA 1K8ZB 3WVNA 1OMOA 2LE0A 3SR4A 1NF2A 3OCJA 5JC1A 5JXGA 1XGKA 3NCHA 2QL5A 3HJCA 3HHPA 4NBKA 1NUTA 3I1YA 4QNRA 4TTQA 1E2LA 1WOYA 3I5MA 3VVLA 1OUMA 3BVPA 5J4VA 4XM1A 3O90A 4FCTA 4OVKA 2HU2A 3OIYA 3RC7A 3I5XA 2QN9A 1MB9A 1W0JD 2QJFA 3B9BA 3H5AA 4OI1A 5ALDA 4EX7A 1V11A 5E6UB 1LSUA 1SOMA 4MUIA 3KZNA 5BR1A 3RFFA 1AUVA 1E1RA 3UXYA 3H0CA 3O21A 4CF6A 4TMYA 1XZKA 2XTZA 3ICCA 5CT9A 1MB0A 3U7GA 1O87A 4AQ7A 1AJEA 1F5SA 2ZYTX 3U80A 3OJXA 4DJTA 3KKOA 3QIAA 4AMZA 1G2OA 1JG4A 4QELA 2E1PA 5IF9A 1T36B 4J0EA 1O58A 1SHUX 2X9QA 3FUUA 4QX6A 5JRJA 3EWIA 2XUPA 4NYMQ 3KETA 3H5RA 5EOVA 2JGNA 2QMQA 1XZ8A 2DTEA 3KAJA 3QXCA 3WNVA 4E51A 1PZNA 2J9GA 3VO1A 2YTZA 1R27A 3K0CC 1CF4A 2QRPA 1GL7A 2IXGA 1FSZA 4LVCA 3SR0A 2HDNB 5H3LA 5HQJA 2ZOSA 3LBNA 4U4AA 4MVJE 4JLAA 2H1LA 4QDXA 2QBYB 2AMFA 2DHDA 2C3OA 4KGXA 5CCDA 3GUHA 3IPYA 4FHEA 3JQQA 1DMSA 2P41A 4KQXA 3N8DA 2GYWA 4B6EA 1CWUA 1L5SA 3RU9A 1YZKA 5EPUA 4QREA 7MHTA 3CPJB 1NW4A 2RHBA 3IMGA 2CJXA 2I0FA 2VDJA 3I58A 1SXJA 3JQBC 2JRCA 4GF5A 1QE0A 4OJMX 4RMGA 4HLDA 1SOUA 5IVIA 3PX3A 2HA4A 2YIVX 4DCTA 4EJSB 4OUKX 1KWGA 4COOA 2HNAA 3TI9A 4XIFA 1XCBA 1TVMA 2POCA 2VSQA 1KK2A 3KEFA 1U3WA 5K05A 3AWIA 3ZDEA 1GA1A 4NQRA 1EVKA 1VSVA 3B53X 3N5KA 1PFYA 3D02A 4OQLA 2H4JA 3D8TA 1W94A 4N0EA 1LGYA 4U9UA 5EAIA 2R5FA 2WHYA 1J2YA 4IUBS 1TCVA 2FPUA 1RLIA 1LVHA 4YLEA 5FRDA 1C0IA 3FNBA 3C45A 5JY1A 4FIZA 1SU7A 1R0SA 2CLKB 4L6CA 4A27A 2WABA 5H8WA 5F7OA 1EX7A 1F7VA 3LUKA 4WLUA 4B82A 5K0LA 1GTJ1 2DQ4A 1SCAA 1SULA 3LF2A 1TEZA 2R8YA 2OD2A 1P74A 2D5IA 3DCIA 3SDSA 1KMIY 3OD1A 3LWBA 3CF4A 5LFAA 2OMKA 1Y9ZA 2WSIA 3HM2A 1LQ2A 4V0OA 5DX0A 1R0LA 2ZZKA 4TTTS 2UUCB 1RZ3A 4EG6A 2IYWA 1US8B 4PC2A 5JYBA 2WUWE 4WZBE 5IBRA 3G9TA 1SCJA 5I3CA 1ZGAA 1YU6A 3O8OA 3QXXA 5FLKA 1N2XA 4QL3A 2E0IA 1BSVA 4N54A 3TTVA 4MTCA 1DJPA 1O0BA 2AJTA 4IHJB 1AB6A 1NM5A 4M1ZA 4HDSA 3VNBA 4F6RA 3QNUA 1E2HA 2XZPA 3R3SA 1OY1A 4CMGA 4NNOA 4DSAA 3CH7A 3ILSA 3U3ZA 2FY8A 3A6PC 2D13A 4G1VA 3KYBA 4R1PA 3V9PA 3X1MA 4DDUA 5AHXA 5KJFA 2BFFA 3IPLA 2YQ4A 2YDYA 4A2PA 4DAEA 5A5GA 5THQA 2HWWA 1QHYA 3LUCA 4PG6A 4C4PA 3LQFA 4EJFA 5KSZA 2EKBA 1FCJA 2JFYA 4B79A 4DA9A 3I2YX 3RVMA 1O0CA 2EKQA 4WI1A 4AULA 1FUIA 1XG5A 1G19A 3AEQB 5LD2B 3A6LA 4C14A 3HK2A 2ANBA 1JBQA 3WYFA 1ZA1A 4O4HF 2B36A 4X93A 4XQ9A 3WL7A 3EZ6A 3W6OA 4L07A 2ZXEA 1B00A 4LDNA 2HHCA 1DTSA 3L6EA 2ZRNA 1VPTA 1LXCA 4GYWA 1QDLB 4FC6A 2CXRA 4QSMA 2NTJA 3AX6A 3LPLA 2WWVD 4D4GA 4G85A 1W4CA 3T38A 1NYRA 2B78A 3QE9Y 3NHPA 5F21A 2IA5A 2YV4A 2FRVA 2OGUA 1SN7A 1OI3A 4RHYA 1S2MA 5B2FA 4BX0A 3REOA 5JWRA 5I9MA 1JFFA 3REQB 2R6JA 2V54A 1H85A 2QIOA 4HCJA 5DHFA 5IAKA 4EI2A 1L4LA 4U5XA 4YUZA 2O57A 2K4MA 1J70A 3EW7A 4Q3EA 3ZXXA 1E1NA 2G70A 3JRNA 5EUQB 2CBXA 4HEHA 1XMSA 2IEAA 4WCFA 4Y9UA 4CLOA 4DUYB 1Z34A 4PAGA 3OTHA 2A0YA 1XZLA 1F0PA 1UDWA 1CLUA 2AFHE 2QZZA 2XTJA 3MUEA 4JIMA 4LIPD 4UUOA 5D8DA 1CY7A 1VLZA 4A0QA 5C4GB 1NE2A 4JGGA 4ADSG 2GOYA 2QJOA 1QIMA 2VP6A 3CT6A 3E3MA 3D4LA 1ZGGA 4GM0A 3V8BA 2L69A 4A0HA 5K0ZA 1GZUA 1AKTA 1F2UB 1LVUA 2JGDB 2ZXFA 3SE7A 1IBLB 2P68A 2A1TR 2ODEA 2V0NA 2BJVA 3IQIX 3JTEA 1XZIA 1I1NA 2ORIA 3K6RA 3MD0A 1H6CA 3QJGA 4OB6A 5EYPA 5LJLA 3G5MA 1IK6A 2IOQA 2PEYA 3AIIA 1IOWA 1MZVA 3DBRB 3DL4A 4PYNA 4WN9A 5EEGA 5MFPA 2C92A 4JLOA 4DANA 2PJUA 4QUEA 2OO3A 3OZAA 1MJGM 1DJLA 1U1EA 2I80A 4PZ0A 3U3OA 2YNMC 3X44A 5CDYA 3HVRA 2A3RA 1SBCA 1Z6GA 3W0LB 3SVTA 1SCBA 2Q2NA 3AYZB 1RAGA 2EERA 2NVWA 3JYHA 3OLXA 3EMBA 2L18A 4BO2A 4CEIB 5IC5A 1M8KA 5SY9A 2GM3A 1V8ZA 5AVOA 1PJ2A 1Y8QA 2ATCA 3DMDA 4NFSA 5D87A 1EGHA 4P5DA 3AIOA 4MKZA 2CYAA 5DSZA 5EWJB 1TA4A 4RESA 4KR0A 1KY5A 4LYGA 2NV0A 2PYIA 4H7PA 4K6GA 2V0GA 1U8ZA 3HO6A 4Q9IA 3OM1A 1XCGB 1NVGA 4DZTA 4WLOA 4QPPA 1A7UA 1ESEA 3ODGA 5AI9A 3CNLA 2VSXA 5KMGA 3IIJA 1M83A 1OOEA 1X7DA 2OHHA 3KJGA 3MWYW 4PHFA 4V3BA 1R4AA 2BMDA 5T57A 4PXSA 2ZUVA 3ONNA 2VWPA 3GXBA 2R1VA 3DGFC 3Q88A 2WR8A 1UKCA 3F78A 4E11A 1TD1A 2I4OA 4G0WA 3RJ9A 4WXMA 1CUHA 3FM9A 1QKIA 1KNXA 3ZHZA 2IQ5A 4EUNA 2CZGA 3C3WA 3FZQA 3GEDA 4OK5A 1J2EA 1L5RA 2QD5A 2A7QA 3INRA 3LJKA 4J0HA 1W49A 1RHJA 1L4FA 2FRDC 1PR5A 2JKZA 3GWGA 4ZZIA 5D6NA 3WNQA 2RHTA 1POXA 4MDEA 2XKAA 1G5IA 4HS4A 1ENOA 2O1XA 3RJTA 4BJ3A 2PZBA 3G2OA 1N9GA 4OSEA 4RUKA 3CN7A 3WA7A 3RUPA 4Q3OA 1ZAYA 2VFAA 2CFTA 2C4KA 3TX2A 1GDHA 4WV3A 1ND6A 2E49A 5FXMA 2FMUA 2AC2A 1ADFA 3FSRA 4LOIA 3WZLA 1UXKA 1ZR4A 4AMYA 2WZDA 2CLSA 1E8NA 5AI8A 1GPUA 1IDN1 1R4NA 2FPMA 1JIIA 2SKCA 3F6PA 2XZDA 4DA8A 4L8GA 1XZNA 1HDYA 3QYAA 1Y34E 3I4LA 4GYYA 4C7OA 5CFNA 3N59A 3A1WA 3EIOA 16PKA 4I55B 3RGWS 1H0SA 3BILA 2O2EA 3A9SA 1M1NB 2WAYA 1WCIB 1NVTA 3ETJA 4LZOA 5BT9A 2C7QA 1IJFA 4IUYA 3RRZA 1AXGA 4GC5A 4S35A 5BURA 1QK4A 4Q48A 4WOJA 1OXTA 2AQ8A 4IXTA 3AXSA 1F7UA 2BGUA 1P5RA 4ZALA 2Q8QA 4DADA 3OM8A 2ZBFA 2VZEA 3QFCA 1WU7A 4RKFA 5JC8A 1WZUA 1C7FA 1JFTA 5DMXA 2WFAA 4RC9A 1WCXA 5IAEA 3QY9A 2GN9A 4D9CA 1Y6FA 4FGUA 3CZQA 2HADA 5EIOA 5HK9A 4LNHA 2J6BA 3VC7A 3DXFA 4DC9A 4EG3A 4JI7B 3BB1A 4YCNA 4M9UA 3Q3CA 2C0CA 3OSUA 1IVYA 4ARZB 3LUDA 1H2XA 4INOA 4B3IA 4D56A 2ZXUA 4M60A 1T13A 2A5FA 2Z5GA 4YFYA 1HBJA 3OBBA 3S0JA 1P1FA 3FNGA 3LYHA 2R5WA 4ER7A 4F7DA 5DGCA 3L43A 1TZMA 5ECYA 1C81A 4QPNA 3RVRA 1J1IA 4QSHA 4H6PA 1NY5A 1ZW1A 4H7KA 1OQAA 4NYIR 3UA4A 2VR1A 3B52X 4QBKA 2OAEA 2MIIA 3E6AA 3NXSA 4QUIA 3W3AD 4AO6A 1J00A 3KEGA 5IAOA 1H2AS 2J6CA 5JQGA 2P2CA 3OE4A 3IJRA 1GPKA 3G2QA 4GMXA 4L3OA 4U63A 3DWIA 2R11A 2YYZA 4GOJA 5COAA 3RTAA 1QHNA 3W6NA 5K0FA 3O8CA 4GQIA 4XLLA 3ADCA 2EARA 3HA7A 5TC4A 1C3OA 3DE0X 2FB9A 1G8AA 4XR9A 3O1JC 3AR9A 3EVAA 3TNDA 2V1XA 2Y1CA 1RWOA 5J43A 1N7HA 3GRVA 2CCKA 3I45A 4G0MA 1VL0A 1GKKA 4KIFA 4G5YA 4L9SA 1O2DA 1S89A 2CEAA 4Q9KA 5DBEX 4QGHA 4UMDA 3TJMA 3PPVA 4ASUD 2J4DA 4EFDA 1NV9A 1YS6A 2VQDA 4S0ZA 1JSCA 3JQGB 4CCWA 1IEVA 3VPCA 2FPKA 1U9IA 3SJ7A 4YMIA 3Q9NA 5GADl 1LRJA 1GZSA 2ZJ2A 1UC4B 5GAJA 2O2YA 2PG3A 4JI3B 3DOFA 1YUMA 1FP6A 2HT1A 4PG7A 5ALLA 2IYNA 1GCAA 3RDPA 4MVJH 3IESA 1CEEA 2AOUB 2R87A 2YASA 2J0SA 3C3YA 3DUFB 1ZSVA 2F62A 1ZK4A 4TX1A 3W1VA 4TLBA 3ZY6A 5BPFA 5L3QB 3F5MA 4EKGA 2EQ5A 1XD2B 4WESA 5C8DA 2IIPA 4N0MA 4RA9A 3V34A 2NZWA 3KVOA 4F1JA 1WUJS 5CA1A 5JAOA 1U1DA 2X7JA 1BWPA 1IAVA 2H5LA 2NZXA 2OFXA 5IZCA 4Q4AB 3EE6A 4YXFA 3IAS1 4ZZ3A 4UVEA 1FJGB 1NC3A 5CYFA 3ELWA 4NOJA 5FLXA 2JH3A 4XB1A 3PUKA 2IOFA 3MLEA 3C16C 3F1KA 4RCYA 1QOQB 1XQ1A 2JI8A 3GZJA 1TZKA 2O50A 3H2KA 5ALKA 3I76A 5AJWA 5DHSA 4ZREA 1AKNA 3GG9A 3P9XA 5FUYA 3SOPA 2GK6A 4DIFA 1OX5A 3OOEA 5A3RA 2BE9A 1Z7GA 1IXSB 1D8AA 2XUHA 3FBWA 3IHWA 3NAGA 1K5PA 3PDCA 4MI9A 4YO7A 4ZDJA 1ZHOA 2PBZA 3ZU6A 4H27A 4PM4A 3I61A 4GL2A 4P5EA 4F3KA 4A03A 4MAAA 4E4RA 3OQNA 4AKHA 4EY4A 1PZXA 4K2AA 4KYTA 4WA7A 1T3SA 2BTQB 4QU0A 3H3JA 2ZGVA 3WYCA 2RH9B 1ZH8A 1ZNXA 4CCYA 4JMPA 4JSYA 1PK8A 4MQEA 2Q0QA 3IEUA 3E3NA 4G0PA 2A5JA 3OTQA 4PRLA 1MAVA 1J8DA 2BSXA 2FZGA 1X38A 3L8GA 4N47A 1NDQA 2MINA 1SIOA 3AKDA 4HFJA 2DCMA 2QTWB 1EEXB 1RYDA 3BMCB 1UPTA 3BMXA 4OKNA 4UU1A 1ZKMA 4AY5A 2IY8A 4F2WA 3KAKA 4DT1B 3Q7RA 3LCJA 1TLTA 3LCUA 4NCKA 1ZUD1 4TTPA 4URZR 4BXOA 1Q0TA 3P27A 3D3JA 2VPTA 1KPIA 3VZQA 4EW3A 3DTVB 4R05A 1GARA 1MR3F 2ZJ3A 3L6UA 2DLNA 2R6HA 4M1WA 1UJNA 3IAUA 5FNVF 3IJ5A 3TQHA 4YRIA 1IZZA 2AYZA 1E1QD 1Y5NA 1M3SA 2O7RA 1RAHA 1I9CA 2OM2A 3NAZA 4IIBA 4A15A 2C5BA 3NNNA 4C7XA 2FW9A 4FD3A 3OX3A 1GADO 3FTPA 1OA0A 2IHKA 3A6EA 1I8TA 3QMWA 4X7RA 3WL5A 4BUJA 1RPJA 1S96A 1QX3A 5BUSA 4R98A 3MJSA 1E1KA 2IPNA 1YJBA 4TVBA 4UBKA 5JISA 1E94E 4NNJA 3NM5A 4G23A 4GVPA 1Z4OA 1IJKA 3AF2A 1K7XB 2JBAB 4ZARA 5A9RA 3H5WA 1JLMA 1RU3A 3T7SA 4JJEA 4F9GA 3FCCA 1OLXB 2E37A 2QX9A 2YMQA 3KPUA 3VR6H 3X43A 1WMDA 4TVSA 3UJAA 2OHFA 1A04A 1KBZA 2OUKA 2QJTA 3NEPX 4UBJA 4BO7A 3FRJA 1PBTA 2EQBA 2F1JA 2GDZA 3OZRA 4P08A 3FRHA 3TRFA 3D6MA 1T0JB 1GDTA 2QN2A 2Q3MA 2OQ2A 3FKQA 4YMWA 3VO8A 4KQGA 2W2KB 4CV3A 3AFHA 5A6SA 2B94A 4JZKA 1C2YA 1P4SA 4TXHA 3DV2A 4A6PA 1G1AA 1PJTA 4DDKA 1E58A 1TQ2A 4L28A 3U7EB 1DO8A 2VF4X 5BR4A 1RJ9A 1FSGA 3OCCA 4BMDA 4GZ6A 4JC0A 2ZTLA 5CT6A 2VK2A 2C99A 4EUKA 1TLLA 4IJKA 4MV6A 2VOJA 3SYKA 1A50B 2P11A 2Z4SA 3DF7A 1ESMA 4LTMA 1CDZA 3SZUA 1KQ3A 1PJ3A 3NJRA 3PXBA 3TTXA 2ZULA 1QDUA 4U8GA 1ZH6A 3U1TA 1VDZA 4N5HX 4WT7A 1ODFA 4CTOA 3PGA1 3O3CA 4MQFA 1BKYA 2ATEA 3ABIA 3DOEA 1K7CA 4JT9A 4BO3A 4YMLA 2ZP1A 1EWYA 5IFLA 4Q7MB 1TDJA 4E7PA 1PYGA 2HREA 4D2IA 3HWX1 2EZUA 2FG5A 1KC1A 3UTCA 1KI1A 2MDTA 2IYPA 1NXXA 3N2GB 3O3MB 1ODSA 3PYLA 1LS6A 4C04A 3B3JA 1TCAA 1QVVA 3GLIE 2EWWA 1N0IA 2WF6A 5JYEA 1S02A 4LWPA 2K7ZA 2Q7DA 3WIEA 4I3FA 1Q5PA 2JI4A 1ZONA 4F72A 1E5TA 2OV4A 3OZXA 2EG5A 3VRHA 1M7HA 3P94A 1DL5A 4O4JA 5BSTA 3VMFA 3N28A 2HMTA 4FGLA 5DN9A 4AS2A 1VQ1A 3IERA 1CP2A 1AZWA 2VK4A 4FLFA 4HGQA 1ECLA 1K8QA 2N9UA 1IFXA 3WBBA 1Z5GA 4IIJB 4DCSA 1FDRA 5KQSA 1ZISA 1N77A 2OV2A 5DULA 4DLRA 5LL6P 3A3YA 1JPNA 3F2VA 2IQIA 2W2QA 4NL4H 2ZRCA 3GLGB 2WYWA 2FN8A 3GZTB 2W8ZA 4GO1A 2ACVA 3BULA 3K70C 1LH0A 1R74A 2C2ZA 3AESB 1SKAA 2GBPA 3R5FA 2ONCA 4G4GA 5JCXA 4MV1A 3R5KA 3MFQA 3IQFA 5KAPA 1KZGB 4ZI7F 3S44A 1W44A 5KWVA 2D7DA 3HSKA 2NXEA 2TECE 4O4LA 2OV6A 4GNKA 2G9VA 2GBLC 1E9RA 3OLCX 3LVBA 1JAHA 3EARA 1YJQA 4CL3A 4G5GA 4EVQA 2P2ZA 2WTNA 2ZWVA 3QE2A 2VH1A 3AW8A 1UBNA 1EP3B 1EG2A 3GEEA 3NEAA 4O1HA 4KHZA 2NU8B 3L04A 1XDWA 1ZCJA 2H5EA 2V3WA 1C1HA 2JGMA 5KYUA 2P4QA 2X5KO 3IX7A 3A3NA 1COZA 4DMRA 2C7PA 1UJ6A 2YH2A 2XWBF 1YRLA 2DQYA 3E9MA 4L4ZA 3TRDA 1HG0A 2NP7A 3P2JA 2FSVA 4YRFA 3AVXA 1UK6A 1S8FA 2P0EA 1H5UA 3BSWA 3GA7A 4CMHA 1BEEA 2NPFA 4Z2YA 4R40A 3PDWA 2ZYGA 4FFDA 1JEEA 3M1YA 4LWOA 4IP0A 1DXYA 3TZCA 2MYPA 3O2QB 4BFLA 5JNWA 5I6DA 3CSUA 5C51B 2GYUA 2IVZA 2YNMD 5CIYA 4BKRA 4H6VA 1RWPA 4DTCA 5LP6F 1U5CA 1WWKA 1Z4JA 3K9HA 2BTOA 1AXRA 1YIAA 2DQKA 2TSYB 2XLBA 4FFOA 5E1MA 3VOAA 2W70A 4D9GA 5EHXA 4I4TB 1K68A 4UREA 3T0GA 5JANA 4EJ0A 2QZ4A 5IYZB 1NBAA 4FEEA 2X5XA 4U7FA 5B3JA 3BSFA 4XVHA 4OP1A 4P34A 3TDNA 1J09A 2P6MA 2O3QA 5HOQA 2IHTA 2WF8A 3PQDA 5IM5A 3SEAA 2OGSA 3N1UA 3IOMA 4TL8A 5KNDA 2IXTA 2O5EA 3HBNA 2MMGA 1IH8A 4NXMB 1Q44A 3EWNA 4BEWA 3GJSA 2BRUA 4JR1A 4TV8F 3TZBA 1QXSA 4G5XA 2V7GA 2AG6A 3S3TA 2WWRA 1QV7A 4Y2YA 3IKLA 3BM5A 3C6YA 3MCZA 4ZN6A 4QGAA 5I4CA 2CNDA 1UPXA 2JCYA 3G7SA 1MRNA 3SX4A 3LT2A 4QGSA 3QEBZ 4MEAA 2O59A 2ZIGA 5E1DA 4E32A 4W6QA 1QK5A 5A4DA 2DSNA 3BEDA 1ZG3A 5BSUA 3CE6A 2FPLA 3EHDA 4TWZA 4UNRA 4K6KA 1AM4D 1DKLA 4NU8X 4MQMA 3ZGNA 5KYXB 4ES6A 2HJ9A 1G8KA 3ICEA 2VDWA 1HYHA 2C96A 1SHJA 1ODLA 5EKUA 4GWLA 3VQTA 4F1WA 1FFAA 3OEHA 3K8ZA 2JLAA 3GR6A 4UEOA 3TLMA 4EARA 5CH3A 4NATA 2OXEA 2FGJA 1MQSA 3IP8A 4Y2RA 1KSFX 5F7JA 3BXHA 5CT5A 3WY9A 3ZG6A 5ICCA 3KDAA 4D9JA 4N9QA 1Y3CE 5B5SA 1YE5A 2PWPA 4CG0A 4UOZA 1XFDA 4LZLA 1LI5A 2HWXA 3VH4A 5I4KA 1HXHA 2NUPA 3A1VA 2E21A 1E69A 3CWCA 2AD5A 1JLHA 1SIUA 3ZJTA 4Q3CA 5K8IA 5BUQA 3D7SA 3T5CA 1QPZA 1K8RA 3T41A 1ZQ1A 1A8SA 4P81A 4Q24A 4EYKA 1TL7C 3A9VA 2N0SA 4E12A 4UOQA 1LI4A 5T7BA 3KCNA 3IVCA 1ZBDA 2VP4A 4MYRA 2ZCVA 3ZLUA 5J4YA 3WWDA 3LVQE 2ZUWA 3HCCA 5A6VA 3NATA 4DJFC 2QLJA 1I4OA 2JASA 4OHFA 1YL6A 1RIIA 621PA 1T91A 3BGWA 1B8PA 1MORA 3PJFA 2ASEA 3I2GA 4LUCA 2FW8A 3GQBA 3G2IA 3IURA 3LZCA 3HXPA 4A2WA 2EKZA 2Q4TA 3EUAA 5EIFA 5K3BA 1VLJA 3O9MA 4QYTA 3M5WA 4K9OA 2CBZA 4MUHA 3KQHA 4DSZA 4Y3UA 4ZMBA 2ZM5A 2A1UA 1I3MA 1U4SA 2F3RA 1Y1TA 2P91A 3AL3A 2MU1A 1H2BA 2AH5A 1PZMA 3SEZA 5TF0A 3KFXA 4EA8A 1QYRA 2Y2UA 1WXGA 3WOVA 3I6ZA 1DJMA 1R8SA 4ZO6A 2YJ6A 5KJ1A 3R5SA 1ES9A 3A2MA 4QBHA 1A9XB 4MOWA 2G9ZA 2MJLA 3K9CA 5E2AA 2ON6A 3JCZA 5ERXA 2H1HA 3OBIA 3WYEA 4HBZA 3M81A 4XAQA 3GLSA 1IHOA 1W2HA 4YTEA 4BNJA 2X9VA 4D5EA 3AF5A 1OASA 3GB9A 2O05A 4Z9XA 4KFRA 4X94A 5CA0B 5KDDA 1CF9A 5NLLA 1FJHA 3ST7A 3FPLA 2CC2A 2V6GA 3BIOA 3A0RB 3K1AB 3QF7A 3VR3A 3WB1A 3GFOA 3ETHA 1R8XA 4OLHA 3GDGA 2JFHA 3F67A 3O03A 1QRSA 4N6NA 1YUBA 2N1BA 3O8LA 3CPEA 4GMDA 3UGQA 4NMWA 5F1OA 5I9NA 3WG9A 1J20A 3SNHA 2WILA 3UAOA 2A9PA 2WLTA 2B8WA 5D3MB 3VMMA 1FDTA 5ALGA 3GNQA 3CIFA 3DFMA 3JYNA 1N2CB 5E8RA 4X41A 1I5EA 1C0KA 5HFNA 2R86A 4G3XA 1XA4A 2AWNA 1RI3A 3TCNA 3FGNA 1NVWQ 3MCTA 3UQZA 2QLMA 4TRNA 4Z3DA 1FYVA 2PA3A 1L4HA 1OX6A 4MUKA 4R2XA 1XK6A 2D2IA 2E18A 2RHHA 1Z7YA 1GLNA 4JKOA 2E4ZA 3X0DA 1NQXA 4E5VA 3K2QA 1PDOA 4HQLA 1WPGA 4RTPA 3ZY5A 4YFVA 3W05A 3SBDA 4PLCA 1C8KA 5MGNA 3LUFA 1VL1A 3DVRX 2XB8A 1E20A 1CR2A 1L7MA 3NRJA 2II6A 4N76A 3QLJA 1JIKA 1M1YE 2X0IA 4GECA 1FBTA 3ZU2A 4ND3A 4Q19A 3F5DA 4NYJQ 5ALTA 5H82A 3R0ZA 1WUIS 4CJXA 3ABRB 3EPHA 1QS0A 2D2XA 3MGBA 1UP6A 1PG5A 4RNDB 2RHLA 5CT4A 4ZTBA 3E9QA 2W48A 3RC9A 1XKLA 4BATA 1RAAA 2FMXA 1QC5A 2O52A 2QG9A 3IQDB 1KEVA 3V97A 2K7FA 5H83A 4TKZA 3WK8A 3AC0A 3COYA 5GY7A 3IJPA 4CWAA 2AE1A 1D6JA 3GRYA 3SF0A 2VNKA 3V1UA 3PNYA 1RJFA 5DHAA 5FOUA 3UMFA 2VJMA 1YRWA 3F9RA 3AR3A 1H1DA 2RBKA 3DLHA 3LL4A 4NESA 3T5GA 1SOVA 1X7WA 1U2RA 4KJZA 3MNFA 5AM5A 4YV1A 3N76A 5IUNC 1TFRA 5JAMA 1RRCA 3B7PA 1ZEJA 3NTXA 3I6IA 1DB3A 4G0YA 4KIJA 4QXMA 4Y2HA 3I04A 2BFCA 3O4HA 1TUBB 4IIDA 3VTAA 3VZRA 5F2NA 5CH8A 4MUYA 4UAJA 4HMPA 4BV3A 2J07A 1UOEA 3IV7A 1T0UA 4FNOA 2GN8A 4DV5B 1U7ZA 3MFYA 1JHOA 3IDQA 1IUPA 3JAWA 1E7RA 1O6CA 4TLAA 1JQEA 4C4RA 5JTTA 3EG9A 2D74A 1EJ6A 4CKEB 4R3UC 3QEOA 4YK7A 4TPKA 5F3WB 2Y68A 3NFRA 1NC1A 4QLOA 3OF5A 4MRAA 2BF7A 3KSAC 1Z0IA 3QMVA 4ITUA 3RTEA 2KB0A 5C34B 1CVRA 5TB5A 2A5GA 1MBZA 2JC3A 3EBOA 3VR6D 1KMHA 4ZOLF 3X1JA 3N75A 2A84A 1ECFA 2DWPA 3H6GA 3H5TA 4IHKA 4RABA 5G3YA 3ABQB 2W8BB 3NHFA 1T4CB 1QTIA 4M1QA 1S8AA 1M34A 2PSJA 4WZZA 2X77A 1RZVA 2AJBA 3CEJA 3SYNA 4UKDA 3RHSA 3MTAA 2QM8A 5D84A 1ZNZA 3JSAA 3BTSA 5FO1A 2IXBA 5DX1A 3TQQA 5BORA 4LJRA 3NUGA 1FNBA 1DV2A 4KE6A 4NABA 2ZDHA 4GDFA 4LYAA 1J0AA 4HXEB 2EIHA 1O94A 4ENUA 4NEQA 3H2ZA 1VB5A 3DYIA 4X44A 3EAFA 2QE7A 3CVYA 3C24A 3NPMA 4LQ4A 5BVGB 2XA1A 3BMQA 3QELA 3GA5A 1XNQB 2NV2B 3HVHA 2I67A 4G5SA 4W1RA 2W6MA 2QZJA 2QF7A 4UBIA 5DXFA 3W2GA 2FDCA 2O54A 1AQUA 4DBZA 2OAQ1 3PI6A 3C43A 1ML4A 1ANKA 3HU2A 4URUR 1ST3A 4NMLA 2O8FA 4F2PA 5JFTA 4RNCA 5ESRA 1HLPA 2AQIA 2CHEA 3CR7A 3TUJC 3C3EA 2ZB7A 4HH3C 3PDIB 3RLFA 2CHVA 3UCXA 1M2OA 1NSFA 2AR7A 2QVXX 1HMYA 3LUJA 1W8DA 4OQPA 3ZBQA 1KI4A 5GWXA 3BK7A 2HEGA 3UH1A 1QKKA 4B8YA 1E99A 4LBWA 4FI3F 5FTKA 5K2OA 2F43B 4TXJA 5D1HA 1D3AA 2AGVA 1YXMA 2PN1A 4I8DA 5KAMA 5LQDA 4IGEA 4WACA 3BRWA 4OQZA 1ZGBA 3KC2A 3T35A 4D0SA 1HDEA 4H1TA 5LQKA 3THXB 2RGNC 3QEKA 2GZAA 4NV1A 1LFAA 3QPCA 3V4VB 1APBA 3OC6A 3ZNOA 7REQB 3A8TA 1RAEA 4DUGD 2JHAA 4XPZA 4YBZA 3TK1A 4OL9A 4OQQA 1VFNA 4YAFA 2XYPA 1VJTA 5JASA 2Z04A 3F90A 4FSDA 3GGOA 4ZO7A 3K5HA 5FFNA 3JZMA 4EENA 4D9BA 1X87A 2FWAA 3EZYA 3UB2A 2CBGA 1AUXA 1NDHA 1ZRMA 2K87A 1D0VA 4POAA 4W7SA 3JZFA 2VYCA 2A9JA 1XDBA 4H7JA 1V1RB 4TKMA 5A2GA 4OKIA 3LHDA 1ZOLA 1YB4A 2GZ2A 3HZZA 1K6JA 4LMAA 4IKEA 4PF1A 1U0RA 2ZE7A 1QLJA 2VRBA 2WM3A 3TBFA 3V7WA 4YO8A 2PSHA 4X45A 3VI4B 3DBOB 3BB3A 1CJMA 1LF0A 4DCJA 1Y0BA 3I4CA 4R51A 4RZIA 5ABPA 3AT1A 4BN4A 1WU8A 5CXXA 2CLMB 4Q05A 1E89A 5ALMA 1BN6A 1USVA 1A5SB 3EASA 2V7UA 2Q0SA 2AQHA 4E0BA 2AL7A 5EJ8A 4KUGA 4WIAA 5A5DA 2FQ1A 1HL7A 2MWMA 1SXPA 1YCHA 1HK7A 5FOVA 5K3AA 2ECFA 4KXYA 4R6WA 4XARA 3CX7A 2C00A 3BFPA 3K0BA 1D8TA 1EX6A 3NH6A 4B1FA 1M5RA 3MERA 2AFIE 3HMKA 1RKQA 3CRZA 3RYIB 3WYBA 1JEYB 2PPVA 1I36A 1N2GA 1Q20A 4FD2A 1E3LA 2H4ZA 1TQ4A 2E87A 2JK1A 3NDRA 3TUIC 3W90A 2YVUA 4B47A 4ECEA 1CJSA 1D07A 4M0DA 4NK4A 3RVOA 1E3SA 1JDBB 4D57A 3QNMA 4EITA 4Q3DA 1GTZA 3IBYA 5ELMA 1EK5A 5FV7A 3SJCA 2B5OA 4F4HA 2W2XA 2CVZA 4V02A 1X7XA 3A1SA 4UJ5A 4BO9A 4DXHA 1UXOA 4JVNA 4O2BF 1T8WA 3T3MB 2OK7A 1FLNA 4CQMA 3AUYA 4ENPA 3KBBA 3CU5A 3G2LA 5IXYA 1TADA 2JIZA 4BX9A 2A9FA 1N5RA 1SUCA 3ICWA 4G1CA 4LNAA 1EFKA 2GF0A 3RS0A 1F2TB 3U1VA 3HBJA 4OBWA 2AUMA 3AUUA 3S68A 3TCXB 1BH6A 3QSYA 1UQUA 4OHUA 5DNUA 1JKJB 4ARUA 1LK7A 2XUZA 4NECA 2E4VA 1M5UA 1XYVA 1O96A 3NHUA 1KH2A 4FGSA 2HMUA 5DT9A 1GSHA 1QAMA 2JA2A 4MWEA 2W4IA 3S8MA 2ODPA 4PICA 1DTWB 2WTMA 4KNYA 1RMYA 3C7CB 3FOAA 4XYEA 4P84A 5HUJA 3NUZA 1A5ZA 1KHHA 5L53A 1KK0A 3H9UA 1QRUA 3F8SA 1JQDA 3NBMA 1OVGA 2ZAIA 4HDMB 1E3WB 3R3HA 1GYQA 4TMWA 1WF6A 5GQSA 3JPWA 5F1KA 4EY3A 4PCVA 3HEMA 3P2IA 1JJIA 1YMVA 1UKBA 2J9RA 5ICSA 3NGLA 5LU8A 4UUPA 1NMSA 1DRWA 4Z8YA 4Q4HA 5KNBA 1GLGA 3WBKA 3O1HB 3OG9A 1TA9A 1PZFA 1IN8A 3HCFA 4C4YA 1N4DA 2HLHA 4TSFA 1DQYA 4G25A 3CPSA 4OXXA 5IHPA 4KYUA 4IOLA 1SBIA 2C2YA 1Z12A 2DY1A 3N8KA 5A4AA 1EPUA 3TIXB 1ZJYA 4F6LA 2WIJA 5TPWB 4ECAA 3O4RA 1MAHA 3R0QA 1EXMA 1T2DA 2O3TA 3G2MA 5JVDF 2O3UA 4WZBB 4BCCA 5JSQA 3ZGVA 1P0IA 1NQTA 4ZAYA 3NRBA 1YB5A 1U5BA 4NJEA 4Q3KA 3AVPA 2I2BA 5IJAA 2HPHA 4C88A 5JYDA 4IV0A 3BL8A 3I6MA 3DOHA 3HBFA 3U4DA 2WJZB 4AZTA 3ZVKA 1WBBA 1LUAA 4F21A 1YHZA 1NVVQ 5JG7A 2ZB4A 1E2NA 1QFXA 5EZYB 4EB6B 1OFUA 4LE2A 4PIPA 4QBGB 3RVNA 4HVTA 2G5GX 2NMVA 4D0RA 2O8BB 1KDRA 4FEAA 2ONKA 2DY0A 1MJHA 3DEAA 2WMDA 2JJ2D 2R7LA 4I4IA 5FPSA 3CHYA 1MNAA 4QDJA 5B64A 4N41A 5LZ5A 4FZ5A 2FZCA 2BTEA 2PMWB 3L7DA 4JU8A 2VKQA 2IUUA 1FNSA 4RA6A 4WXPA 3LK6A 4B3HA 2QUIA 2Z1MA 4D80A 3D8BA 2WV7A 3TUZC 1NVDA 4I46A 5F9HA 5TQ0B 1W581 1X13A 2JAHA 3SX2A 2DERA 3AVUA 4FXOA 4F2DA 2R6AA 1YDGA 1XNGA 5I5EA 1S4QA 3NT2A 4NH0A 5EE5B 3I5UA 3NLLA 2QUKA 5E3HA 3GPDG 3ROGA 4MDFA 5LP6A 2K5UA 3H65A 3C5HA 3NQ41 1RWBA 4S24A 4BDSA 2VYFA 4OV6B 3KIPA 5FPPA 3FOZA 3F3KA 2ZETA 4PFKA 1E2MA 2XVZA 2PTGA 1ZH0A 4UBMA 2OCYC 3QK7A 1LDBA 1U65A 4B7AA 2A2ZA 2OXRA 4ZDIA 3N0XA 2PLNA 4Y6GB 2B2XA 3JATA 1KEKA 1AVTA 4ARIA 3H9GA 3W5SA 2DMRA 1EKXA 1KJQA 5A5EA 1E3MA 2CL0X 3L4JA 3K5WA 3N2ZB 4MS3A 4G4SO 1RW4A 1CQJA 2RB5A 4OU4A 5K0SA 1KC3A 2AFHB 4R1MA 2OCLA 4LYJA 5LYYA 1RWKA 4HNUA 4XFKA 5ADUS 4ESVA 3H11B 3H5IA 3N87A 3OKFA 2WIAA 3GN2A 3R3JA 3V1KA 4IQ4A 3AETB 4TV8A 1I7QB 3A3PA 1TUEA 2JZOA 4LRTB 1W5FA 3Q0IA 3AJ8A 1EQUA 1ZYUA 1KAGA 3GJ7A 3QPWA 4K6FA 4DV7B 5EJGA 4Q02A 4HDCA 3HJGA 4MI3A 4MINA 1NQ5A 5ALNA 1I10A 2DWQA 3CV3A 1AN0A 3DZHA 5HJ5A 1XSEA 1QH9A 3EY9A 4GBED 3QVGA 4XSVA 1THGA 1UMDB 4QDUA 1ZGZA 2DUNA 1OWPA 3AB7A 3KOZA 3UHFA 3EFOB 2HOQA 4BE7B 1LV8A 2IZ1A 2WT8A 1XU9A 1ZSYA 3D3QA 2A30A 1BCRA 2YINC 4AJ1A 5CITA 1EUYA 1HV8A 1ST2A 4DMHA 1L4UA 3WLSA 3HJRA 4F8YA 3CVOA 4L50A 3IUJA 2P4SA 2VP2A 2AOXA 1Q50A 2BHTA 3NZEA 4ITVA 2JLZA 1VECA 3UJ3X 1E66A 3E8XA 5DXAA 1IM2A 5HFJA 3FMVA 3FOEC 1JP7A 2W0SA 4LX8A 3PHBE 1I30A 2VZ8A 1IMJA 3V00A 4DF3A 2GXSA 5KWIA 2ZRKA 2WJHA 1BXRA 4PG5A 3ZZ0A 2EF1A 3HV0A 1N8TA 2Y0BA 1RRGA 3KD3A 4XJXA 3W3ZB 1JTFA 4CLEA 1GA4A 4EG8A 5JI3E 2VQFB 3PEYA 4Q6WA 2RSLA 1KRHA 2ZUSA 4U1RA 4Q18A 3MWDB 3ZWCA 1HDCA 2OWDA 3ZS9A 2QTLA 4MR9A 1J2TA 2X6QA 2FE1A 4P93A 1I7SB 1EUQA 5COBA 3TL3A 2J41A 2EFEB 2OPBA 3IIMA 2ZWIA 2YJ3A 3OTGA 3DKVA 1Q0RA 3VU1A 1T1RA 2F1KA 2QW8A 3BXFA 1J5EB 3Q3IA 4RAQA 3TJRA 3QMPA 5EIEA 2X6RA 2YXDA 4IIHA 4UHDA 4O2AF 2QR3A 1B42A 1E79D 1IBRA 2KMLA 4TM7A 4BNWA 2QP4A 2HJSA 3U6KA 2HXSA 4RQAA 1TQDA 3JRXA 2OMEA 3RF6A 3VZPA 1SUFA 1W48A 5DB4A 4ZOBA 4G09A 4JL6A 3UAGA 5JQGF 4BVEA 5B2ZA 2A0WA 2NTNA 1BXZA 3HDVA 1G0NA 2W43A 1D7AA 1KVRA 1SM4A 1WKVA 1X70A 2E6UX 2QTHA 3ESRA 4OJNA 3K70B 2PT5A 3TIGA 4HNAA 1DBIA 3H1PA 1UBSB 5ALIA 3TAUA 5CTJA 4IHQA 4C6HA 1XFAA 4IKOA 2FHPA 1XQ6A 1ISHA 2FPPB 4I9HA 2P3OA 1B4DA 3H2SA 4QGFA 1USIA 1MIOB 3QV2A 3KZ1E 1X77A 2HRZA 2RGDA 4DLKA 3AM3A 2A9KA 4HVCA 4Z7QB 1B43A 4MCJA 3IEPA 4HWKA 2BMWA 2FDXA 2CJWA 4C29A 4FGJA 1XRSB 3BJRA 4RZUA 3SEQA 3MXTA 3FR8A 4FYIA 4IIGA 3GI1A 1QGUA 4DNPA 1FPMA 1ULAA 3AFMA 3WKCA 1Z35A 1P17A 4UEJA 4MEJA 4ZVUA 3ZEAA 2AOVA 4JR0A 3BPSA 4Q1BA 4G1EB 4X1IA 1ZD3A 5FUBA 3JX9A 1H23A 4AZSA 2WJPA 2LV8A 1DUSA 3THWB 1IXRC 2NWQA 3FBTA 4HZGA 1G42A 2VYVD 1QMGA 2RGEA 3Q8XB 4MKFA 1E4VA 4OQFA 2XDWA 3VNVA 3UAVA 2WU3A 1ISRA 1X42A 1Z6AA 5ITZB 1T1SA 4WXRA 1O03A 1HOTA 2QMYA 4MGKR 4R81A 3CX8A 3UFBA 4DW8A 2H51A 5TE9A 3PV0A 4D79A 2GAIA 1CUWA 2QPTA 1DJOA 4KUEA 1WD5A 4PYIA 4G86A 3R7FA 4JMLA 2XVMA 5JAIA 3EZ7A 4MKHA 1G5PA 3JYOA 1T6YA 1MJGA 1TYZA 5T41A 3UXMA 1GGHA 1P3DA 1MPTA 1MT3A 1V47A 4IFTA 5CM8B 5BNFA 4BO4A 2WB4A 2ISCA 4YT4A 2JS7A 2ONYA 1GPH1 5IEBA 4XWAA 4QT4A 1AMUA 3GEIA 3IPAA 3FFBA 2H7CA 3G49A 3QXGA 4ZMRA 4K9MA 5AVUA 3BJEA 1QZZA 3P2MA 4ZTUB 3AK4A 2AKEA 4C4SA 2LWIA 3FW1A 3RS5A 2Q9BA 5F3RA 1JT9A 1IBMB 4QOGA 4ZANA 2F9LA 4RS3A 1CJVC 3KWLA 4L15A 4YB8A 3MSXA 3D4NA 1GZDA 1LBEA 2BZ0A 2X4LA 2NO4A 3QFSA 4IAOA 1DAKA 4ZCIA 4XJSA 2LDXA 1IUOA 1SUEA 4UNPA 2ZSJA 2AC4A 2WWGA 4IQ8A 1K6MA 1FUEA 3HRKA 3E03A 1CEXA 5TXGA 3KSDO 4B6OA 1DXHA 5B4VA 3SR3A 2IS4A 5B1SA 1P1RA 2VCHA 2QQ5A 1L5YA 3R23A 2ZVJA 5JZOA 5HRCA 3JQFA 1XZBA 3QPDA 1HTWA 3H0EA 1VLMA 3MPOA 5FQOA 4HYYA 5JTUA 3GLHE 4MV0A 1X2EA 4NCBA 3WLKX 2VJYA 3D3NA 2FLVA 1QHXA 3RK1A 4I50F 5CB0A 1MC4A 1ZY2A 3A6FA 1CIJA 2AJCA 3N0TA 4MZDA 2AEMA 5I9TA 4AJHA 1BX0A 1T2UA 2F1IA 3LSTA 3RYFB 8OHMA 3K71B 4Z3OA 2GHRA 3QU4A 4P8RA 2MYNA 5KYTA 1L7RA 3N8NA 4G41A 5HKBA 1B8NA 1M72A 3C5EA 1A8UA 5DCUA 4EL5A 2GZSA 1SD5A 4B3CA 1RPNA 2J0UB 1M2EA 4JSRA 1E0SA 1L7DA 4ZOLA 4L2IA 1KAOA 4NZNA 1N5JA 2OZEA 1L5HA 1P1JA 1HM5A 5AK5A 1WLSA 2BFWA 2WU0A 5EIAA 3GVPA 1FVOA 3UPTA 3F9IA 1JMVA 3WZMA 4F56A 2G7ZA 1JLLA 1N7IA 3DMPA 1K4KA 4CM5A 1UBRS 5EE3A 4EL0A 3PC8C 1MW9X 3VVCA 5AP9A 4XWOA 1II0A 2JAWA 1DLJA 5DOVA 4CFYA 1JIXA 3GFBA 1Y1SA 4TT3A 5CVVA 3ZY3A 5YASA 1O97C 1HE8B 4LZJA 2XXAA 3AVWA 3Q5EA 4LJ8A 2WRZA 3ANYB 4FE7A 3IAAA 5TPZD 1YKSA 4DNQA 4J0DA 4LYDA 3TIVA 2VQ6A 3FFTA 4W5WA 1A88A 2MSDB 3U7JA 3ZHRA 3VBEA 1U2DC 1IEWA 5FFMA 1UMCB 2C4UA 1IPFA 4L4RA 5K3FB 2FVXA 1TGYA 1AZSC 1EMDA 2KSQA 3L1VA 2WU4A 4DIMA 3ZLTA 4WE3A 4Z99A 5K0NA 2FG6C 4A8TA 1QNLA 3CUWA 4D4LA 3NASA 2NT3A 3WNZA 5KSYA 5FTJA 1EJBA 3SF8B 1I5OA 4RIFA