3UC9A

Crystal structure of yeast irc6p - a novel type of conserved clathrin accessory protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
184
structure length
180
Chain Sequence
VLQYPQNKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDSCKDIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVLVNVNEEVEQDEIDELNEIWSNAFTNVIEFVNWKTVNHNDYGEKLGLDRIQEIIDTHDWLNCEVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords Increased recombination centers protein 6
publication title Yeast Irc6p is a novel type of conserved clathrin coat accessory factor related to small G proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 66
structure length 180
sequence length 184
ec nomenclature
pdb deposition date 2011-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uc9A00
3UC9A
chains in the Genus database with same CATH superfamily
1W47A 2R1ZA 4BQIA 1ZVMA 1P80A 3C14C 1HEYA 4AB1A 4I4TA 2E87A 1PR4A 3L8EA 1TU4A 3W2HA 2IE0A 4G1EB 1FLDA 1Y63A 2AMFA 2EATA 1EVIA 5IDQA 1NR5A 2PXAA 3CLTC 3W5IA 3GD7A 4XWWA 3DAFA 2J7PD 1WP4A 5IASA 3VKHA 2WHEA 4IIEA 3K9NA 1E4VA 1KI7A 3KTAB 4L4RA 3T7JA 3USCS 3PVSA 4LC1A 5C81A 2XMCA 5AVTA 5JJIA 1Z6QA 3FR7A 2DBQA 3PD1A 4QKQA 5BUZA 1KAOA 1PJRA 2R8PA 1XVVA 1RS0A 3H16A 1ESMA 2ILTA 2DFPA 2IXGA 1XOIA 3DQQA 5BV8A 5JNUA 3VVCA 3NAQA 3B82A 3DMFA 3MQ2A 4JBHA 5CA0A 1YA6A 4UMEA 1BYUA 2GSWA 5G40A 1U0RA 1X0VA 3ZZ0A 2BTEA 2IC5A 2HX1A 2G72A 4BO5A 4ECEA 5JSHA 3R9WA 2ZI5A 3IIIA 3F3YA 5JZSA 2QN9A 2AJTA 3FVWA 2GZ2A 1QS0A 3PIDA 3OT1A 3UH0A 1A9YA 4A26A 1BD4A 3HE3A 4LY3A 3KUKA 2UZ4A 2B7BA 2BELA 3PQCA 3VSCA 4NNPA 1L0BA 4MCHA 3TQCA 2ATEA 2V0NA 3E81A 5B12A 4ZOLF 4BNJA 2QLBA 5U4XA 3OG9A 2IYRA 1I4DD 1UC5B 3IDQA 4M7PA 4X3OA 4EUHA 1Y9DA 2MYPA 3N5KA 3HYTA 3OZXA 3A27A 4OB7A 1U8EA 3ABIA 3JWJA 1N8TA 1JZSA 2ZR7A 4O63O 4P58A 2ZTSA 1PK7A 5KB3A 2ZUFA 1YR6A 2A9KA 2FMXA 1CZKA 1MH9A 3CM0A 1YZKA 4HH1A 4N40A 1MOZA 3G2MA 3DZHA 4M1ZA 3RVSA 2ZR8A 4PYRA 1N2BA 4KKXB 5C5CA 2DFTA 1M83A 4R7TA 2V6BA 4GO1A 4JI5B 2EYUA 3SVZA 1T0IA 2HXYA 5EHNA 3N2KB 3ORRA 4TTRA 2DT8A 4OKIA 5IJZA 4UTOA 2PMEA 1Y4UA 3ILVA 4DA6A 3NYWA 3C8DA 1YZNA 1RVV1 2BBSA 4LZPA 4XD2A 4XTRA 3V6MA 5AKXA 4WZBE 1H22A 1T5TA 3HSKA 1CERA 1HQCA 1QLWA 4JYAB 4LHYA 2H52A 4HB2A 4N5MA 1NVVR 1JB9A 1AS0A 1NTOA 2YJZA 1E4OA 1P0FA 3F3SA 4HDRA 4AJHA 2WWYA 5IVHA 3WJ7A 3H1AA 1KC1A 2C03A 1GSAA 2O05A 4M0DA 4OQNA 1ISPA 5F77A 3TCXB 2XZDA 3BERA 1V95A 1VGRA 4JKIA 1R6AA 3DAHA 1QR6A 1GRCA 3OY2A 1X3LA 4L9AA 3DFFA 5AH0A 1Y5IA 5KNBD 4QOGA 5AK0A 4GI5A 3SJCA 2IV7A 3HJFA 2CGEA 3PEUA 1IXKA 3E3AA 1B4DA 2PD6A 3NHWA 3V2GA 3E2IA 3NWPA 3W06A 1ACJA 4IDPA 1V8ZA 1C3XA 4I1VA 1NMQA 1ZMBA 3K0CA 1CB0A 4MUMA 4V24A 4PNEA 5MF6A 2JFBA 2XUAA 3GNLA 1R8JA 1FFWA 3W5UA 1XXHE 1YNSA 1PKEA 2ZTMA 3LOQA 4UBJA 4PRKA 2H63A 2OO3A 4WK2B 1MHTA 3L8HA 3ONVA 5AM3A 2CCKA 2HK6A 3O31A 1OBCA 4ZPJA 2DEUA 4QGBA 1G19A 4IMJB 3OOSA 4OBWA 1K7SN 4EO4A 1PNOA 1FRFS 3KXIA 3H1BA 3G85A 4TWBA 3DO8A 1N8NA 4WWHA 1C2YA 2XB8A 2Y1OA 2Q5JA 2X8AA 3Q11A 3HUUA 5JI2E 2P9BA 4O4HF 1IRIA 1XLTA 3G0CA 5TPWB 3TXAA 1UXKA 4KP7A 4PO3X 1XVTA 1RXWA 3WL5A 3ZCUA 3A9SA 2ZQ5A 4FGLA 4E12A 2OBXA 5FBQB 3TMAA 3X1YA 4RHFA 3EA5A 3IHLA 3OJEA 4INZA 5EKSA 4BQNA 2BGUA 4ZREA 3NT2A 3DL7A 1HQYE 4C43A 3H9CA 4LXXA 4F2DA 5FOSA 2X8WA 5KTKA 3SBXA 3IIJA 4Y2QA 2I4IA 3H2KA 3AUXA 2H7VA 1MZVA 4MCJA 1JXAA 3QXXA 4J9VA 1QIMA 4BGDA 4DNXA 3RSQA 3NRCA 3P26A 3J81A 4RD0A 1D1SA 4BNXA 4NYJR 1JHMA 1F8GA 2BDEA 1HDIA 4XVQA 5DRTA 4M89A 1F48A 1GR0A 3MILA 3U7JA 1KEUA 4W7HA 3ZVMA 4MR9B 3H0KA 1SXJC 4DRXA 1PJZA 3HFRA 4DJDC 3M0EA 2IEYA 3I04A 4ZAYA 2FH5B 3K35A 3NTRA 4J2OA 2FOLA 1Z75A 4IDOA 4KNWA 4U9HS 3G5TA 4F21A 3F5DA 1UIRA 2GN6A 2AG0A 2EKPA 3UMCA 4AMZA 2MDTA 3VHRA 2WWHA 1BJTA 1DRJA 4FSDA 3H05A 3EA4A 5ARBA 1CJTC 4L5AA 4D0LB 1MDBA 3QBDA 3KELA 1MNQA 1WLSA 4XYLA 1N77A 3RYCB 5KSWB 4S1PA 4D79A 2BUBA 3U7EB 3KUUA 1KO5A 2PRKA 4YGYA 2WICA 5FWYA 4Z8XA 1EFPA 2AQ8A 4MHTA 4IIJB 1EB8A 3DBVO 4K6OA 2I99A 4CZ2A 4GZ6A 5ALZA 2A1IA 2F2TA 3IT0A 4KXWA 3RANA 4GR9A 1QIIA 2PUWA 2ZBPA 5A0VA 4KJZA 4ZO7A 1PR5A 2IOHA 3ESYA 3HEBA 1ITZA 2KWIA 5YASA 1DAKA 4GBGA 3ZY4A 3D6UA 2DUJA 1MFPA 1Z3CA 1V5EA 2QSJA 1I14A 4PPQA 1GAEO 3EIUA 4S1VA 3FAZA 1CF9A 2GCNA 1M2WA 1THZA 2ZBGA 1LX7A 3NPAA 3TQRA 2JHCA 5E0KB 1V1RB 3Q40A 4MA0A 4A9AA 3RRJA 1JRLA 3R24A 1XRLA 3A58B 1TW2A 1HLFA 1R5OA 3BIJA 3SHVA 4NBTA 1YVEI 4P93A 5F98A 3BF8A 2DZDA 4NCKA 3DG9A 4H16A 1QDLB 3KKKA 4XYEA 5AO9A 4ZAGA 5KWJA 1SZDA 3SZRA 4GPIB 4WOJA 2MJLA 1XA3A 5DTQA 3V8EA 4F2PA 3PXEA 1T13A 4L08A 2DR0A 1XKQA 1FFXB 1UOPA 3RD5A 4FS8A 4Y6RA 5K8IA 1KY5A 5CDHA 3LLVA 2J3JA 2D6FA 2JCXA 4V0KA 4LHVA 3KKNA 3ETHA 1E1LA 2VBCA 4QUGA 4HDCA 2PFGA 2PX0A 1N6HA 1DGQA 4L9RA 5C1DA 5KPJA 4IQGA 1A0OA 3T54A 4M8IA 3U3RA 1EVQA 2C2WA 1Y7TA 3ELBA 2R751 3GLKA 3U4IA 5IM5A 2Q8NA 3VOTA 2XOKD 4X64B 1MABA 4EHNA 4DQUA 5FI5A 5I7SA 4C2BA 3KSMA 2ZRDA 3RBXA 1XTIA 1L7MA 2JJ1D 1G6Q1 5IBPA 4GWKA 4ZDWA 4DE5A 3L6BA 2PVPA 3B6EA 3E9RA 1S2OA 1S8NA 4LZAA 1W4BA 4TZKA 1MOQA 4Y9UA 1AHNA 1QSGA 3WHLA 4BU1A 4MQUA 2GEJA 3EVNA 2AVDA 2OZLA 1G42A 4N5LA 1NP7A 4Q9IA 3WK8A 5DSTA 3BGVA 3OIYA 1NJ5A 1T1EA 1UBRS 2I8LA 2M1XA 1YR1A 2QOEA 3HKBA 3N2GB 3N74A 3RAPR 3A10A 2X76A 2XOEA 4EEXA 4X1KA 4F60A 4EGSA 4E11A 2PWZA 1SCIA 4EJ0A 1GP2A 2BGLA 3ZDCA 3NG1A 4ND3A 2O6HA 2PWPA 1PTJC 1HYQA 3T3EA 1UJ5A 5I6DA 1IBLB 1UXGA 3I9V6 1K7XB 4JLUA 1HETA 1R00A 4KBFA 4E4YA 4V0ME 3KPJA 1AN9A 9LDTA 4B5KA 2PUAA 3FLEA 3JSAA 3I34X 4EKDA 1RC0A 3M4XA 3VSDA 3HRKA 1JG6A 2CXNA 2GZDA 2Q4DA 2Z5GA 1P91A 4JVLA 4XOUA 5EN4A 3D43A 2JAQA 4AX8A 3JX9A 2I7VA 4BWVA 4P3XA 1JKMA 3V2IA 1G8HA 1Z0UA 1E32A 4BBAA 1RQLA 2Q5EA 4K3UA 1HWYA 4M1TA 2RHBA 4K5QA 4X1IB 3RTBA 3RUEA 5J2UF 1RXSA 4QPZA 2BGTA 4FHDA 4YCJA 1O9HA 2FUG1 3EVBA 2QVYX 4UDXX 3A9WA 5DBEX 5ALYA 5H80A 2PUDA 3C3JA 2EF0A 2Y92A 2HIGA 3ZDYB 4COKA 2XA1A 1ZMXA 1FP7A 2MSLA 3MCVA 1LPBB 3O4VA 2B4RO 3OX4A 2MSNA 4YRAA 1C8BA 3FE2A 3F6EX 1A4XA 4QNRA 5A9TA 2PKEA 4DCJA 1WX1A 1AKQA 3O8DA 4WD3A 3ZTWA 2E4YA 1JDUA 1R6DA 2J45A 2ZWAA 1M6WA 1RT9A 3LX8A 4L74A 5IKPA 2OE2A 1YXMA 2QP3A 1L5QA 5FI0B 4ZXFA 3S4YA 2GOYA 3VQTA 4BLPA 1DARA 1TEHA 2XX3A 5IKXA 1QG2A 3CXRA 3OT4A 1P1JA 1UMKA 2HJVA 1U9IA 1YJXA 5DNVA 2YR0A 5JSKA 3K1YA 4RZUA 4UATA 4JR0A 1W9MA 4QWMA 3AXTA 2FRVA 4KITB 1QKJA 2J9YB 3L4SO 3ZJVA 1IDN1 2ZAYA 4GECA 4DC9A 2VHEA 1X9HA 4RZXA 3DO6A 1OTHA 2VZ9A 4B40A 3CE6A 2IOFA 1APBA 3RS4A 1ZJ6A 1ZUIA 4NCNA 3TVTA 4C4TA 6REQA 3D4NA 4RS4A 3KKMA 4JHXA 3VNVA 3IULA 3LXXA 2ISQA 4FBMA 4X7RA 3SEAA 2HLPA 1YZUA 1QQ6A 4K9MA 5K3FB 5KTNA 2NU7A 3C97A 3M1YA 4JSTA 1G5HA 1E8DA 2O1XA 3CINA 3U5TA 1B1CA 1AF7A 1OU4A 2WKQA 1F2DA 1EHYA 1E4EA 1ZH4A 2P41A 4A0HA 4XDGA 2GEBA 5JNRA 4ZGBA 4CIYA 5DGIA 2R8XA 1I32A 1X6VA 1NR1A 3KZNA 1AMNA 3FRIA 3OWXA 4KIWA 1N2JA 4B87A 4CIAA 2DAPA 3DO5A 1YCDA 4A0RA 5JARA 4A8HA 4QDTA 2ENWA 4DV5B 3AT1A 3GLUA 1MQ9A 1W4ZA 4OXNA 3ZCRA 2JFUA 2AXPA 4Q7MB 1DP4A 1FY2A 2OGSA 3RWBA 3WJ2A 4X66B 2CDAA 3MVEA 2M32A 4CL0A 2DR3A 4ZARA 3WGMA 1Z37A 2EDCA 4A2CA 3S40A 1JEDA 3ORQA 5REQA 1I7PA 4NULA 2JG3A 1S8OA 2HIAA 1KQ3A 3PEVA 4KUHA 5CHEA 2D54A 3TOVA 5IDWA 2YQ5A 1FMLA 2FDRA 4HCJA 5ED0A 2GBIA 1U8YA 3LO8A 1GZHB 4QEZA 1EH5A 1IN1A 1NQAO 1UM9A 2NSLA 1DFHA 2VS1A 2W6QA 2RAVA 3AR5A 5AOVA 4CIVA 3ZDAA 1JR6A 5CDUA 1EVEA 2Z3WA 3IJ5A 2OCLA 1E3JA 1Q0PA 3EDYA 1Y80A 1RYEA 3L1UA 4Y6QA 4PR0A 1LBHA 2V6IA 4LV5B 1KJZA 4WE3A 3W4KA 3OC0A 4LTNA 3QW4B 3C8HA 4M53A 1J8MF 3K1AB 4CEHB 3F7NA 4JY7A 2WIAA 3PIIA 4RHUA 1K4YA 4BO1A 1ISMA 4DANA 2GBCA 2CD9A 4D8VA 1JS1X 4QRIA 3G2NA 3QVKA 1ULZA 5IYZB 1IXZA 1LJUA 2FWPA 3A6JA 1AM4D 1ABBA 2IP1A 1T26A 4PQEA 4ATNA 4KXFB 1L7QA 4KVZA 2A88A 5E38A 3R4VA 3HN6A 1BWRA 4IX1A 1BAPA 2QYTA 3QRWA 2LVBA 4MS1A 1W88B 3H9UA 3HO8A 4IICA 4OX9Y 1Z88A 4GOMD 1L5FA 4GI1A 5EMHA 4ERXA 1EUYA 4MEJA 5CEEA 2Y9MB 3IC5A 4Y2SA 5FUMA 2DERA 2H2DA 3OEWA 4ZO9A 2OLKA 1Q17A 2WJ3A 2XT6A 1H2XA 4TLCA 3IAUA 4C3UA 1BHQ1 2W42A 4P83A 1LDBA 5GM1A 2Q5HA 3VH4A 1GKKA 3S7ZA 2PJUA 3C39A 1T36B 2JD0A 2PKQO 2YJ5A 4TVSA 5AK5A 4LNAA 5CAEB 2GF2A 1HBJA 2WF6A 2R6GA 3C16C 5IP5A 3D81A 2BAGA 2WFZA 4J7CA 5LBUA 1XNHA 4G9EA 4CKEA 4BNLA 2PLRA 4OB8A 4ENPA 2F48A 4ZTUB 3ZQ4A 5EJ2A 1JHQA 1KZ7B 1GKIA 2BSAA 4Y6LA 3U4QA 3PQ6A 4RLHA 5LDHA 4YP0A 2VP9A 4D3ZA 1KRXA 2ODNA 2PMDA 3M7IA 2VZ0A 2E1RA 1QVWA 2B82A 3UXEA 3DDCA 4KRYA 4EF4A 2XUJA 3VO1A 1BW9B 1T15A 5LQJA 1B26A 1IL0A 1XD2B 2H1HA 4IXNA 3ZGVA 3GQBB 4FPXA 3S8MA 5BPHA 3NV9A 4OQMA 1I7NA 4DIMA 4KE8A 4BC1A 3IIKA 5CB4F 3URKA 2VZLA 3QHQA 1SBYA 2X77A 3FW1A 5TQ2B 4TWZA 4MB0A 3ZI4A 1A4IA 3D8HA 1OB5A 1EP9A 2O0MA 5HFNA 4Z0TA 1DIOB 1EWYA 1YKFA 1MAHA 1R8QA 2H0AA 5DNEA 4TYWA 1DKPA 2HFKA 4ZZ3A 2IEBA 2P9JA 2R47A 1K66A 4RPCA 1QP7A 4UZFA 4C20A 2BGKA 4N54A 3EEYA 4E2FA 3RRBA 2Q2NA 3QM1A 1Z38A 3OPXA 2Z8ZA 5SICE 1DRKA 1OBOA 3HDJA 3NBUA 3ABSB 1VXRA 5ALWA 1AKUA 2WU1A 3RWOA 3WXBA 3FJYA 3EMBA 2YHSA 4FMPA 4TVKA 2FSPA 5AVYA 1UADA 1B74A 1T4CB 3PYLA 4M60A 4XTCS 1XDZA 1Z0IA 3QELA 3IAAA 4B7AA 3DTVA 5K3CA 2VQFB 2V59A 4EX7A 3GW8A 2HDOA 4HQKA 2X15A 3AETA 3QPCA 1W6RA 3QKRB 4CIWA 4L8YA 1N2OA 4KX3A 3WE7A 3ANTA 4JOSA 4BC0A 4G2NA 1Y7LA 5CPFA 4DB4A 1QZZA 1PUIA 4QSMA 5G1NA 5FTLA 3GRVA 3UXYA 3IE0A 5KQGA 4Y2JA 2K4MA 3MUOA 1P0QA 2Z58A 2ZYUX 4XCXA 3S8EA 2AJ8A 2PJRA 2GEFA 5KQPA 2L2QA 1YOVB 4PCVA 4MP8A 4PF1A 5CGZA 4WSOA 3FCXA 3KQWA 4LA4A 3A0RB 2JI6A 1YUMA 4GOXA 4MKZA 1ZIDA 3E53A 5IT4A 1BGXT 4N0EA 3SDZA 4WKPA 1UODA 5F2EA 4TMWA 1L7EA 3C3EA 3AKZA 2FMKA 4A5OA 1EFAA 2ZKLA 3DKPA 5CYFA 1N2CA 3LRPA 1D9XA 3EXFA 4OH1A 4FNMA 3CWQA 3CH6A 4E0BA 3L5KA 3ETDA 3OQVA 3WZLA 3ZKWB 3PE4A 1M73E 4IIJF 4KMMA 2P9TA 2WYWA 2PDAA 5EWLB 5C5DA 1TLFA 5IMSA 4CLEA 1IM2A 1HUQA 2HWXA 2KQUA 1G6OA 2YVKA 3JQBC 4M38A 1EIZA 1YIAA 2BFDA 4B76A 3LO5A 1ZGJA 2LXNA 2VATA 2C8VA 4FFSA 2QQGA 3RJMA 3SBDA 4H15A 1HDGO 1FMJA 2YWDA 3ACBA 3P7MA 4LOIA 3V1MA 1NBMD 5EHZA 5AUNB 2QS9A 3SMQA 3WSWA 2AHOA 2F62A 3LT0A 5TT1A 4TMZA 1KHTA 3ZWVA 4BUCA 4EEKA 4PX3A 2WAMA 6AT1A 5E6SA 1B0PA 2DH5A 5AK3A 1LC3A 3QSYA 5I45A 2ZDHA 1XMOB 3W8RA 1LW6E 5LIRA 2CFIA 2QRQA 4Q4AA 5JJCA 1MVOA 4TYPA 4UFOA 5AOCA 1K4MA 1TM4E 4G41A 5B1DA 1V7PC 2X8JB 4WXRA 1XELA 3U81A 2B8NA 1CQIA 1Q1GA 3QXHA 1MEEA 3OP1A 3KQVA 1CFJA 1ZD5A 4DA8A 4F6LA 3QU2A 2IEIA 2AOVA 2IPLA 2B35A 1NRWA 2PZJA 4NJMA 1MH1A 4BFVA 4E2ZA 3ABOB 3OO0A 1CUYA 4FX5A 4LXGA 1UJ4A 1QIFA 2NTNA 1LDEA 2PXCA 3LUDA 3K2IA 5EIBC 3KZOA 5L6LB 2BV3A 3HXOA 4ITRC 1NW6A 2QYHA 2R1UA 1VMEA 5HA5A 4E31A 1RJFA 3VVLA 4NBUA 4TUYB 4IZOA 5FUQA 3QZUA 4U2BA 4C06A 4KXXA 2GETA 1TUBA 4EPRA 1M8KA 2H5JA 4HDNB 5KYTA 2UUCB 2R84A 3DMPA 1PZMA 3FXAA 1P72A 3KHUA 4A03A 5FOWA 3P71T 5JC8A 1Z0ZA 1F7UA 4IS2A 3LLUA 1XWIA 4DF3A 4D57A 3TTWA 1E9VA 1QRAA 1YQWA 3OIWA 5IT5A 1I2DA 4M7RA 4ZOLA 5HILA 3FPGA 3ROPA 4ER6A 4HYQA 1W29A 2VRNA 4YAKA 4ZT3A 4WLVA 4DCPA 3DD5A 4KE6A 3VDXA 2PPLA 1GA1A 1XPUA 2VF4X 3EMKA 1MC1A 2Y0EA 4GP7A 3Q85A 3ENVA 1BXRA 5GJWC 1OMOA 1TO6A 5C4IA 2AHRA 2ZE6A 3PFIA 4HTFB 2F8MA 5JEDA 3WGIA 2JIMA 2JGNA 4HQNA 1EVJA 1OIVA 2Q1WA 3C1AA 3G9UA 3IVXA 3AUUA 3PF8A 4RETA 2AG5A 3PC6A 4C7XA 1EDDA 3FZQA 2IHYA 4PHGA 4ARUA 5LVAA 2YNMC 2XYHA 3GV0A 1XV5A 1NDHA 1NXXA 4OHRA 4RJJA 3SX0A 4C05A 4LOAA 3O8QA 3GLIB 2HF2A 4TKMA 4NXMB 5DIZA 9GPBA 3U31A 4RYLA 1WE2A 4Q9LA 6LDHA 4WBXC 5TF4A 5JSZA 3B38A 3IESA 4MPJA 2HWKA 3EGWA 1VJDA 1XDSA 5G4LA 2O1WA 2ZRGA 4OIFA 1JLMA 1OUMA 2EGGA 5I7OA 3FPEA 1XMSA 1JHAA 4QHTA 4RPLA 3UK0A 1YOBA 1QK4A 4CI0B 5CU7A 1USKA 2P1ZA 3ESXA 4JGGA 4YUZA 1S2NA 3ICQB 4MW0A 1WO8A 2CNDA 2WQ6A 2FZEA 3PA8A 4JT8A 3PQ7A 2XUFA 3OFKA 5FPYA 4BHTA 4DGSA 2DJIA 3LY7A 3NH6A 1JUDA 4GC9A 4BBZA 2IL1A 4HYTA 3RFFA 4D9BA 2I78A 2IU6A 5BN4B 1W0JD 2WILA 4FQ8A 1IMJA 1QX3A 3M1AA 2UZ1B 3TLJA 1HDEA 1TMYA 1Q20A 1VZ2A 3HUTA 4FJ1A 4JA0A 4QBFA 4UM8B 3T5BA 2DULA 4EPVA 4A5SA 3KB6A 4B4UA 4EYSA 1RQGA 1M7GA 4QO7A 3SXPA 3AQIA 2GB4A 4BZPA 1S2DA 4OGLA 4UHHA 2OHHA 5ECGC 2NYUA 4QDKA 5C9ZA 2IVZA 3I9JA 4EFMA 4LMRA 2A14A 4YRGA 2GFHA 3B70A 3A6DA 2WV7A 4D3FA 3Q3VA 2ZSIA 2C82A 1GTL1 1S4MA 1AKWA 1DIBA 1J8DA 1X80B 1JA1A 2GZHA 4ZVNA 5JZOA 3ROXA 3HNRA 3KNZA 2PBLA 5JRZA 4IV0A 1UBCA 2C2ZA 4E88A 5BSKA 4MS3A 5F5NA 1JZTA 3H4IA 4TYQA 1IQRA 1EWTA 5AKKA 2CLFB 2FE4A 4KVFA 4CM7A 4NMXB 1VJCA 3QPWA 1Y6FA 4JQOA 4EW3A 4GXQA 2G77B 4O4HA 3EZFA 2B92A 2IWRA 5ITZA 1IY0A 3QA9A 2WTUA 1X1CA 3OF5A 3WAGA 4EUKA 2CLLB 4BGUA 4HRXA 2ZAIA 1FQJA 1KP2A 1QHNA 2F17A 4L8GA 4LKOA 3C6ZA 4FWTA 1JKIA 2Y3IA 3LVBA 2VJKA 1HV8A 4L16A 5AP9A 1QC5A 4KSCA 1KE2A 3S28A 3UKJA 1UR5A 2JL1A 1L8XA 1M2OA 3W9YA 1EUDB 1XZDA 2SHKA 1LWOA 1BE0A 4YX9A 5E1BA 4RJKA 4BQPA 4BVHA 2Z56A 2OZKA 2OOSA 3E9MA 4C01A 1KIFA 2ZATA 3AJ9A 4H3HB 1P4AA 1WKVA 4HLUC 4B43A 3OQBA 3IXLA 3SC2A 5JBNA 3MTQA 3RVMA 2Z3ZA 1T5LA 3S5JA 4GW3A 2VPQA 1TM2A 1OI3A 3ADBA 1TA9A 2HPHA 3DHVA 4WNAB 2PH3A 3DFIA 3MAGA 1BHO1 2OILA 1P1KA 3TAXA 1GXSA 3ABZA 2HJRA 1WLYA 3A6KA 1BDJA 3HCWA 1DIAA 2C9BA 5AUQA 5CDFA 1H2ZA 1GRVA 2VTKA 2CUNA 4MUXA 4JLOA 3R7FA 4AY3A 4C4AA 3LCVB 1C0PA 4YGXB 3L6DA 3QSGA 1UBLS 5COQA 3TWOA 1XDUA 3LWBA 4TKZA 3BA6A 3CX6A 3PDJA 5IYZF 2ZSEA 6YASA 4N7BA 5IK2A 1U1DA 1RP7A 2CLCX 3EULA 3T0GA 2Y0CA 2PGLA 3WB1A 4YCBA 3H04A 3WB0A 1BH2A 1W87A 2WUGA 5IVPA 2X8BA 4KRGA 3JR3A 1G63A 1YQEA 3FOWA 2REQB 2J6IA 2QN3A 1M0EA 3FDFA 2IZ7A 3G82C 3H1PA 4B6JA 3D7KA 1OXXK 2YJ6A 1DKQA 2JJ2A 3WQSB 1UJ2A 3O9ZA 2PXHA 4N18A 5H0IA 3QLEA 4G24A 5EUBA 1L5KA 1VPVA 3BICA 3GGSA 1NM5C 1I2CA 1ZH2A 4GGOA 5AIBA 1XMXA 2BHNA 1OT3A 3DYBA 1W0KA 2IYFA 2J9FA 3ZY6A 4B8WA 4DV6B 2J4CA 4R40A 1EWVA 2Z30A 4JX9A 1JHXA 3DT9A 3HY4A 1FC0A 3RIYA 5AVXA 3D59A 3RF6A 5I8PA 5KQSA 3P2MA 2N42A 2QTFA 3ZE8A 1Z82A 1B8VA 2HJGA 4MQMA 5CFQA 2JLZA 9MHTA 2JLVA 3FFTA 7MHTA 1P33A 1PJAA 3Q88A 4MRRA 3CS3A 2Q45A 4JEHA 2FPLA 3OTQA 4L15A 4FBGA 1Z83A 2NO7A 5EYPB 3H9GA 4G4IA 2OBNA 1ODFA 2PEZA 1U2ZA 5DHPA 3TO5A 2XSZD 1H8ED 4IKEA 1OXMA 1OI4A 2GH1A 2ZBRA 3VZCA 3JVDA 4P4SA 2ID7A 1VLHA 3QJYA 4DC1A 1R9JA 2DY0A 1R0SA 3JWPA 5EKTA 2CV2A 2BGJA 4X6YA 4CMIA 4UUNA 1F8FA 1SJ9A 1JMKC 1R6UA 3AG6A 4B44A 2FW6A 3OLCX 4MVJH 4BFXA 1N5IA 4M0KA 5LQDA 4HK4A 4CEJB 1FTWA 2V3VA 3UV6A 4OGWA 4H2DA 4LDRA 2CMFA 2FPGA 2R1TB 1VLLA 4X41A 1P5RA 1WCWA 1P19A 2C83A 3P0RA 2HSWA 2O23A 5EKDA 4UQOA 3CNEA 4B2LA 2PTHA 5LYJF 1IVYA 4L1KA 2RH4A 1JKJA 4LXYA 4S1OA 4Q5IA 3JPWA 2HK9A 5F7JA 4JK3A 3ZWCA 4CKBB 3LQYA 2FMIA 3S1AB 3WBBA 4US0R 4WCFA 5AM4A 4DCMA 1A2KC 2FHPA 1K3UB 3D0QA 4MW4A 4XLLA 1P6QA 2Q46A 2ACWA 5A62A 3MIZA 4UNNA 4UAVA 3SIXA 3W9SA 1KY2A 1N2CE 2WJYA 3OQ6A 4YMGA 1A9XA 2JGKA 3UMGA 1JSCA 2V1UA 6Q21A 2KHZA 1PBNA 4GZ3A 1QGOA 4UUPA 1J0EA 1CUEA 3GRUA 1E8NA 1QOPB 1XCOA 2HI0A 3ML1A 1XEWY 2V5AA 3CH7A 2ECPA 4O1HA 3WAJA 2GVDC 4ZEXA 5H8WA 4ZU1X 4UEJA 1JQDA 3EBPA 3GGGA 4JHLA 1ZESA 4DTIA 2FGJA 1DAMA 5A3QA 3I12A 1XZHA 5IXSA 3N75A 2P35A 4MX8A 4ZVLA 3WJ1A 5AWFC 1C1XA 3MMSA 5DXJA 1AU9A 3R3SA 4ZIRB 1FPMA 1ZJYA 4QBKA 4AX4A 5J2UA 5JXWA 3GI1A 1AC5A 2XQFA 1ZD9A 4DR5B 2CBZA 5JD5A 2XE8A 3B48A 3K31A 3SM9A 2G9QA 4TKUA 5HJEA 3K05A 5FL7D 3TZLA 1EA5A 3X1DA 4BP9A 3KR9A 4RO0A 4YRNA 1D2CA 1UWCA 4ZEWA 1T9BA 1S6YA 1RU3A 2W8ZA 4XCVA 4JA2A 3V6LA 2JLSA 2C7RA 3Q7TA 4Y0VA 4JVMA 1M76A 4C6RA 2MT9A 2F90A 3HUEA 2NQTA 2IHZA 5G4KA 1X2BA 3TTUA 4R8SA 3GT4A 1MA0A 3W4JA 1RP1A 4JP5A 1XKTA 1QIJA 4OQ4A 1V26A 2CXOA 3PTZA 4AYWA 1A3CA 1FK8A 3F5FA 1KY4A 4B4WA 3S81A 3EXEA 1G7CA 4UMDA 1U1IA 1J6UA 2NT3A 3DFKA 4QYTA 4L5IA 3QF7A 4R8RA 2VOJA 3P4XA 5JZVA 4UBIA 3CXUA 1UQTA 3CTMA 2EL9A 4WCDA 3ZUGA 1JV2B 2PS1A 2UUOA 1EE1A 5AK4A 2VXYA 3AKDA 1KI4A 2ZIUB 3OQIB 2DUUA 4J07A 2OGWA 5CXSA 2QT0A 3ROGA 1M8JA 3VR6H 1EM8B 3BMQB 3DL4A 4MMYB 4C6HA 3FX2A 1HE3A 5JFOA 1Q3TA 2AI3A 1CIJA 5DM1A 4QUHA 5FBVB 2ZXUA 5JYDA 3A14A 4M9RA 2EP8A 1J42A 2IYVA 2CZCA 2ZI9A 5AUOB 1JDJA 1UZAA 1RLMA 1R12A 2B99A 5LQRA 2Q9AA 1KE1A 2BZ0A 4M0LA 3QFSA 4LN1A 1N6OA 1H85A 1IATA 1KJWA 1W94A 2R68A 3AJ8A 4PW0A 4TUYF 4UTXA 2J7KA 3D3EA 4X61A 2J7PA 3CIOA 3RTCA 1NY5A 3A6HA 2ZS7A 2IOFK 3M1LA 3QVJA 4OATA 5KOHB 1UT8A 4ZMRA 2C3PA 1NLZA 1YDGA 3L43A 3D7LA 3FFWA 1GPBA 3P0JA 3VHXB 1JPVA 1UJMA 3OJ0A 1NQUA 2I7XA 5GONB 3RRXA 3FPFA 3VZBA 4QJ3A 2BEWB 4M0CA 3TI7A 5ADVA 4DCSA 4IDDA 2DFDA 1XPJA 2PTGA 3IV9A 5LDGA 1PRYA 3I64A 3THXB 1ECGA 2XMPA 2Z6UA 3SQNA 3TLMA 3FLAA 1U0OC 1ETHA 1RPZA 2ZI7A 5ICSA 3E4DA 3BFJA 4AP6A 3F5SA 5JU6A 2BE7A 5INTA 1NUHA 2FPWA 3RYHB 2UU9B 5FUVA 2WUVA 4MZDA 5BV7A 2QZ4A 2B36A 1N78A 2IVFA 4IGEA 1OR8A 3M34A 3L7DA 3M4JA 5IULC 1Z26A 3PUIA 4GVXA 2FAXA 2KLBA 3O8LA 3JQGB 3UJ6A 1OTXA 5J59A 4R9SA 4F9FA 2GO1A 5GV7A 3FI9A 1VL2A 4GPBA 2VG8A 4JLPA 1SQFA 2G0AA 3EXIB 1T2UA 2XF2A 3PUVA 1RZRD 1MJFA 3PJEA 3TW0A 1X38A 1TKBA 2HXSA 3FYCA 3PQ8A 2VYFA 1LLDA 5A7FA 1GG2A 1NHGA 3GGOA 3LZDA 5FWXB 1I94B 5FJIA 1EIWA 3CWZA 2HQRA 3S8YA 5IX8A 4GBED 3MS4A 1W49A 1QX4A 5L3RA 1RC1A 4PLVA 4RW0A 4WKBA 4COOA 1HK7A 1K4KA 3N6VA 4OMDA 5G41A 1DC7A 3PT5A 2D2EA 3SHQA 4IYJA 1ABEA 1XTPA 4WNIA 2CE7A 3HM9A 3BTVA 1T9KA 4A4DA 4KTVE 1ILEA 1R3DA 3BE5A 2A2ZA 5CCXA 2F1HA 1I2AA 3DWIA 2P65A 4ZQIA 1JQLB 1SBIA 2JCYA 1UBSB 1YBFA 4YWHA 1YQQA 1SKYE 4LBWA 1U2EA 5F76A 3QJGA 1IH8A 1FTNA 1Y3CE 1QHXA 3L8CA 1JEYB 4UBNA 3HXPA 1JIXA 4HY3A 1P7WA 4BMNA 5A2QA 1VRCA 2G6BA 1IUOA 1M8FA 2E4AA 2HRZA 1LBSA 3CSSA 1PWXA 2PA0A 4G5HA 4KYIB 4HNHA 2B2NA 1DXYA 1Z68A 2NPIA 3JAKB 3JQ9A 1HG0A 3K0BA 1LC0A 2FZCA 2LP4Y 3VZDA 2G83A 2EEPA 1MQ8B 1VIDA 5CB4A 4NENB 3V9AA 4Z3OA 5DTEA 2B20A 4EHBA 4JSYA 3UF0A 1Y6QA 1J2JA 2YJNA 2N75A 5KNBA 2P5UA 1M2GA 4GMXA 2F3TA 2J9XB 4KB5A 1YRLA 3GUYA 4K6FA 4I8XA 2JAXA 5D5PA 3PXGA 2EXXA 4W7SA 2E5WA 4CTJA 4AZ3A 1Z4LA 4G0UA 1LZKA 1V39A 5FWNA 4B45A 4ONEA 1MGPA 3W3AH 2P77A 4DNPA 5HKAA 1JFSA 1QH8B 2GLUA 4I08A 4G85A 3ZY3A 5JBIA 3U6KA 3TLYA 1NA5A 2KPOA 2DUNA 2X0EA 4JCCA 5DI9A 3B2EA 3ITKA 1Y4ZA 2VJDA 2X0JA 4Z99A 3AJRA 5JCXA 2A57A 3L4EA 3NYRA 3OCVA 4GVPA 3DHYA 4IJ5A 1OC2A 1PFYA 2YWRA 4MB6A 5CDFE 3NX4A 1L5ZA 3GWGA 2HO4A 2ZTHA 4I66A 4EB3A 1HE4A 1CR0A 2IW3A 3L7BA 3MJSA 5NULA 2HT1A 3Q6MA 1CYDA 2EQAA 2JFQA 2IFTA 5CCDA 4DXHA 2FVYA 1WDMA 2HNBA 4OKSA 4YT2A 4UUMA 1WOMA 3AFHA 3W2IA 1YI0A 3UA3A 1U6IA 2QJOA 2OCPA 4MKRA 1M8GA 2N47A 3L18A 5DGXA 4G56A 1E2KA 3HXKA 5FO0A 5K0NA 4CDRA 1KQNA 3WDLA 4L9WA 1UBUS 2EGUA 3IO5A 4AWAA 4B3FX 3QVUA 1ZJWA 5JRDS 2G08A 1TEXA 4BPRA 2DJ5A 4P3OA 2QQ0A 4R2HA 3V48A 3A31A 4IW3B 4CCYB 1SOAA 3VVBA 5DX1A 5KAMA 2A3NA 3LH5A 4WN9B 1GTRA 3RW9A 1VCNA 3RT7A 5EFZA 4KLCA 1K63A 3WK7A 1G8YA 1DX4A 1YJCA 1VCHA 2E9SA 1L5NA 3GFQA 2FUEA 1S1MA 2PZBA 3RYCA 2Q3JA 1ZIXA 4IPTA 3B78A 1PZFA 3KQTA 4KEAA 1YE8A 5DNAA 5K6TA 1L7DA 3TOXA 2ZIAA 3LZ6A 4KGVA 3SS8A 1OAAA 2YJ3A 1Q57A 4HWKA 2RI1A 4YPFA 3WICA 4JCOA 4IIJA 2VHQA 3D4PA 3L7AA 1IHDA 3N7UA 2HU7A 1M1UA 4GRDA 4TYYA 4I2VA 3OQPA 1ZMTA 3FYTA 2YYSA 4RORA 5HOQA 1I8TA 1VCOA 4HUTA 1GA4A 3WIEA 3GH3A 3BSFA 4LSMA 3E7PA 5DM4A 1LBTA 3I6BA 2CDBA 3W2TA 1STOA 2QY6A 1Z07A 2UKDA 3NYQA 3PQ4A 4RCVA 4ZV9A 1SVOA 1PS9A 1HSZA 2C1EA 2EAUA 4YJFB 1XUOA 3WIUA 4YS6A 1B14A 3FGPA 4KL8S 2G80A 1VMAA 4JIMA 4WAUA 3UJHA 3CVWA 1VL1A 1KYQA 1G41A 1TMOA 2BONA 1I7SB 1OREA 1V1RA 1C4WA 1PFWA 1V45E 3F4KA 4LYAA 2I3GA 4G1UC 5LB2A 4N48A 2F64A 2Q2QA 3EVGA 4EFDA 2QTVB 3KVNA 4M0UA 3RYIB 3ZXXA 4CQMB 4DYDA 5JATA 4D02A 4JZYA 2W0SA 4ZDIA 2VF8A 2HH9A 2B5WA 1H2FA 5LNK6 3AUAA 2M6LA 1FFXA 4MWBA 1OJLA 3N07A 1EQ2A 3B3GA 1WP9A 4R0MA 3P9QA 2JK0A 1SVSA 4WUVA 1NMEA 3SFVA 2CEKA 4LOHA 3VO9A 4OF4A 1UFKA 3S2FA 5JYEA 3BIXA 1U7XA 5BUSA 4Z4EA 3DNMA 5IN5A 4BVFA 2FPMA 3GEMA 3GMSA 4RCYA 2W2QA 1V3TA 2P8SA 2CVZA 5CDSA 1I1OA 4PX5A 4MHOA 5DF1A 3G6KA 1C9DB 2I7CA 1Z39A 3JQFA 2QVCA 2P6PA 3WYAA 4BO8A 4LCJA 4LTMA 1UEJA 3IV7A 2F7SA 3HL4A 4OFBA 5WRFA 3HI6A 2GGSA 5AUPB 4WMLA 2VTEA 4OYYA 3LUGA 1RWVA 1U1EA 1UWLA 1XQ6A 2QMOA 3AF4A 2X3FA 3BH0A 1O97D 1BU5A 1HMYA 2XWPA 2DKFA 1NUAA 3D54D 3K5IA 3SS9X 5KSYA 4PC1A 5KYXB 2J3IA 5ALOA 1GY8A 1UZLA 2EIHA 3T61A 4I4IA 3T9CA 3D1VA 3RS9A 4D97A 4DYVA 3BSSA 4CTNA 3S2EA 2A5LA 2VSXA 3U2QA 1ODSA 2WU0A 4DT1B 2ZCUA 3H0EA 3N2GA 3FROA 2XOKA 4EAAA 1GARA 1JR3D 4ND4A 4WXHA 1JPUA 1A04A 3SPXA 1T5OA 3G0BA 4WT7A 2PUFA 4YV1A 2JJ1A 4OBEA 2IPOA 2VK8A 2WWIA 4G36A 3F9RA 1GLVA 4GICA 4IZIA 4TTQA 3A37A 4AYXA 2NXNA 2QRZA 2XGSA 5H4HA 4DDUA 1AY0A 2GAAA 2JF0A 5AJXA 5AYVA 5L7WA 1PL6A 2CJFA 4F56A 2WUEA 2Z2JA 3KJFA 4IV5A 2VXBA 2P3LA 3UWOA 4OLHA 2M9MA 1IAQA 3V32A 2D5AA 3E61A 3OZTA 4BMSA 2WE8A 3Q3CA 3X1XA 4BB9A 3HBFA 4RIFA 5CJPA 5AI0A 4X1IA 3LGSA 4ASUD 1P29A 2HTFA 3GOQA 4JEMA 3UMMA 2XJ4A 1GNQA 2IYYA 3PFFA 3EEOA 1MB3A 1YQGA 4U5XA 3ZWBA 1C7JA 2FN8A 1KJIA 2V65A 1F60A 4LBVA 5DIFA 4EENA 1US8B 4ZDJA 3C3WA 1P2DA 2ONCA 2R5WA 2A7XA 1FFCA 3BRQA 1DJPA 4RMNA 3V1NA 1FTGA 7ABPA 5IT0A 1YVDA 2BY4A 3C3KA 4V0RA 5E4JA 3NT4A 2ZYTX 3RYTC 5KU1A 1AA9A 2YVLA 4G5FA 4QFDA 3FG9A 1ESDA 1SWWA 1KDTA 4M37A 3TFQA 2VWPA 1YWGO 2Q41A 4N01A 2CB9A 2IIPA 3O03A 2QR2A 1DCTA 3UMSA 2PE5A 1MFZA 4R3WA 5F33A 2HADA 3PR2B 4JIGA 1CBUA 2WM9B 4A1FA 2XZTA 1MC5A 4BNDB 5GAJA 1EGAA 1M72A 2ECOA 2IPAB 4DCNA 4LDQA 3KJQA 4NZOA 3RUIA 4NLLA 4OCZA 1H6BA 3TS1A 1WXHA 2AA3A 1KXJA 3D6MA 4BBPA 5JD4A 2XY4A 4PRLA 4Q01A 1YE5A 4G0ZA 4F3NA 1VE3A 1ZCBA 3NHRA 2LDXA 2W93A 4EL0A 3MCZA 2G76A 1ZPDA 1PL7A 2PSJA 2Q1XA 3ZTTA 4KQ6A 4HFRA 4ZOEA 2O8CB 3CTPA 4CCSA 3DZFA 3V8NA 2WG2A 5CLLA 3GG9A 1GYPA 2KLHA 3DKVA 1XYGA 2A5YB 2WZQA 4GE3A 5K3FA 4BN0A 5LJLA 4YAWA 1SBTA 1Q44A 2VNSA 1MRZA 3QFTA 3UGJA 3RIHA 3LY9A 4RTQA 1DOAA 1SD5A 5EXXA 2O7QA 3IKMB 5LPNA 3QMMA 1JEOA 4FR2A 3W5JA 4JS0A 4EDHA 1L4MA 4BX2A 1FOEB 4XIIA 2JIOA 1D8TA 3EMVA 2O3UA 5AW9A 2BH2A 4ZANA 1DX9A 1NQOA 1YCHA 3ZE6A 1U0EA 1EFLA 4PVCA 4FW8A 2HYDA 2CNLA 2VBGA 4D4JA 1T2DA 4WX2B 3I2JA 3E18A 2FQ1A 2GEKA 1L4EA 3HG7A 1EWQA 4M1QA 3FH0A 2XKKA 4QYSA 3IPXA 1YAJA 2HPAA 4P81A 1YZ3A 5CBPB 3T1OA 1UANA 5GONF 5AKZA 4JJEA 1OX6A 2G88A 5DGTA 2C20A 1P7YA 3I01M 5KC8A 2AYXA 3VPSA 5FOXA 2WYIA 1TD9A 1QYVA 3IEKA 4HGOA 2IHKA 1XZKA 1SUBA 1MIOB 2DTDA 2Z4SA 2X0FA 4BNGA 3S2GA 4QFMA 3K1AA 3MB8A 1RRKA 2KB0A 2YFQA 5HMMA 3DDWA 1FDVA 3KOOA 1RKBA 3WWEA 2FF5A 1RD4A 3MG9A 1YB5A 5C1BA 1N92A 4OH7A 5CVTA 1EEHA 1U7HA 3LW7A 5IYZA 3HYNA 1W0CA 1FLVA 1U1FA 3I32A 3KYBA 4URUR 2NUPB 3PWZA 4EY3A 4CI9A 2AN3A 4P0TA 3LHIA 1LNSA 5D3KA 3VV2A 2LR0A 1W88A 4PLYA 3I62A 3F2IA 5GINE 4NBLA 2IELA 1CY7A 5CLIA 2JASA 1DKMA 4AM8A 3G9ZA 3L8MA 3IQZA 5HS4A 1PWZA 3SSMA 4CLOB 3U26A 2FW7A 2H5LA 1W59A 2QTHA 4KNVA 5LQCA 1UT5A 3TL2A 3EIHA 4A92A 3D3WB 4EM6A 1PR6A 1IZ7A 4QTZA 1GPUA 1F2UB 1SKAA 1T36A 5CJ2A 4RM2A 2ZJZA 3D5TA 2E5FA 3K9LA 4BMXA 4YP9A 4DLLA 1WBDA 1Q0RA 1TT5B 3O1IC 5DSZA 4ARCA 3T3NA 2P4QA 1EB9A 1XN1A 1RNLA 3MTGA 4HB3A 3LSYA 2EBWA 5LYYA 4UU0A 1U63A 1EZ4A 1W35A 3SLGA 1KOFA 1H4QA 1U5BB 3LWDA 3VDMA 2HIMA 5E7IA 5DH9A 3T15A 4BJ5A 3AR9A 2XOXA 4M6WB 1BW9A 4BMDA 4I1RA 2JLXA 1PEKE 4N3NA 1W7AA 1XD2A 4RANA 4BLOA 3GQBA 4CF3A 3U3KA 4WK6A 1CY2A 1XZPA 1W4LA 4DV1B 4G9GA 2DQ4A 1DNPA 2DTXA 4PSVA 3F78A 3UBMA 1SBQA 1V41E 2JZNA 3SQMA 2G71A 2W90A 3PRKE 5HF8A 1N1DA 2VK2A 4BNZA 5AW2A 2J46A 4G23A 3OT5A 4FEAA 5BT8A 3ROEA 1UBKS 2G67A 3AI3A 2PXXA 2VHUA 4Z9AA 1KBZA 5TQ2A 4C0XA 1ZCJA 2QTGA 4N5IX 3D6AA 1AHPA 3PB3A 1U8UA 1ZICA 4L73A 3EPKA 3U4CA 3WLTA 3MQFA 1ID8A 2C5HA 3LZCA 3JYPA 4WACA 2XB2A 5DHRA 3W2EA 4LY6A 2ECKA 1JAXA 4Q3OA 5IC4A 4J1SA 1H9BA 5LYJA 1CF2O 2Y71A 2QWXA 4R1PA 1MG5A 1FDIA 4RSRA 2RH5A 3RWMB 4CG0A 4EIWA 1WOYA 5K8TA 3QUTA 4B2IA 3LBIA 5J1SB 4LHXA 1Q2UA 1Y8QB 5C46F 1W96A 1T4CA 5JAUA 2DSTA 3ELWA 3QE3A 4V0SA 4U39A 1H3NA 2VDVE 5HKLA 1NAHA 3GYBA 3AI2A 2Z09A 1I4LD 4M9UA 1GFSA 3HYCA 5U1PA 4E09A 5KDOA 2JHFA 3JQDA 4Z7QB 3QKRA 2HLNA 4ZK6A 1SUCA 2Z2XA 1K68A 1RWPA 4LVNA 2IEGA 1N3IA 2ZSDA 3HJTA 2GVZC 4UCQA 3SR0A 4YAGA 1GTVA 4KX5A 5M04A 4MS4B 4KMSA 4DLWA 1IJKA 2FN9A 2Z9DA 1H42A 1EUQA 2TMGA 4Q3NA 5IC5A 2Q62A 1YOVA 4LE2A 1ULSA 3K71B 2FFAA 2QJTA 1RRMA 3BJEA 3OU6A 1YA4A 3JVIA 3LD9A 1PT9A 4FHGA 5DISB 2G9VA 4W8GA 5JAMA 5JYCA 2V7GA 1P5HA 3CB2A 2PKYX 4QLAA 2CFOA 1DINA 4Y6GB 4DG5A 1XDWA 5M29A 4TKLA 2UYQA 4DLSA 4AO6A 1YC5A 3IO3A 1H23A 3KOWA 1QVZA 5TB5A 5JYBA 3U7RA 2ZJFA 3CEMA 5M3BA 3TPZA 3UN1A 4DZZA 1N5RA 3CX4A 4GOLD 4Y6OA 3M9LA 4C08A 3WGKA 2BMDA 3ZKWA 3MINB 5K3EA 2BTQB 5EWLA 2IBMA 2VAMA 1U1GA 3EZLA 3FMGA 3LI2A 1J5EB 1XJCA 2M2IA 1I1NA 1Z16A 1F17A 3INYA 3NDJA 2Q3FA 3KS9A 3CZ4A 4MGKR 5CLGA 4D56A 1V3UA 1SGWA 4Q24A 4O0MA 5CX1B 3Q8MA 4HEA1 5CT4A 4A0QA 3IBFA 4BFCA 1GFIA 3WSTA 4DUYB 1SRQA 4LHEA 2SICE 4FCCA 4MV1A 4R31A 2Y4OA 3SU8A 4DQ0A 3GDHA 2XUHA 3M3HA 3IOBA 1Z2OX 2NXEA 4KQGA 1IHOA 2J3LA 2DPGA 1WS6A 2PL5A 5HCNA 3FTFA 3CEPB 3JQQA 1II8A 1XT6A 3NXKA 5BP7A 1M2VB 4OG2A 3ZK7A 3GEBA 1FYFA 1ECJA 2AZ4A 2X8JA 2VYVD 3SD7A 1UKYA 5L51A 2A30A 1SULA 3AMVA 3C6BA 4NCHA 4H7IA 2WPNA 1WTCA 1PD1A 2N1MA 4PC3A 4KNYA 1NBMA 3CPSA 3FPSA 5LL6P 3GAAA 1GVNB 4Y1EA 2AIRA 1UP7A 1BVYF 1NQWA 1XJWA 4HUJA 3IVRA 4R2IA 3RRYA 5F9FA 5BQ5A 3I5UA 1KS9A 3D7NA 1DEHA 1HE5A 2K5UA 3I92A 4JU9A 5BV2P 5GWXA 2P27A 1V47A 2W2LD 3L05A 5TT0A 3ZK8A 3BAZA 1RJWA 4TUYA 4Q15A 1RYZA 3OPVA 1TQ4A 2XBUA 1W25A 4GL4A 4IAOA 2DTEA 3MQ4A 4FP9A 1K89A 1TI7A 3WK6A 3VKGA 4H0FA 4HDNA 4G8BA 1KDVA 2FX5A 3KEOA 2Z8XA 1M6HA 3CRRA 4LHSA 4I99A 5FI3A 2H07A 5H1YA 3MJ4A 4INAA 1ATZA 1RHUA 1P1RA 1T5HX 5HNKA 5KREA 5LXTB 2O8DB 1DZIA 1X39A 3OJWA 2KS6A 2AOTA 4H6VA 4UCXA 3ZHRA 4YREA 5JUWA 1LS6A 2Z83A 1XA4A 4LRQA 4ZT2A 1DMRA 1DCFA 2OQIA 1ACMA 2PA3A 4O8ZA 3V4OA 2HJWA 2RDMA 2UXBB 3ZWKA 4MKXA 2ZRFA 1DOHA 1JQAA 1AKMA 1XAHA 2YVUA 3CPEA 3N53A 2Q4BA 421PA 2CL6X 1HSOA 4QU5A 2HHHB 4L72A 1XZ8A 3KLBA 3QHPA 1P74A 1RR6A 4HTFA 2CHGA 4BKUA 3MHTA 2IZ6A 3N59A 2XDAA 3ZZMA 2Z0MA 3NIGB 4N5DA 5EERA 4YRJA 5JTUA 3RVBA 1E9AA 1UM8A 2JLRA 3UHOA 2PQMA 2FW0A 3WGZA 2WKWA 4NFHA 3PFWO 4B5LA 4MVYA 1O4WA 3HGQA 1FNNA 2RKWA 3K9BA 4HVLA 2AG8A 3GLIA 2O1EA 4GPEA 3K92A 4K26A 4HHEA 4DLAA 3E3NA 4G1MB 4JX8A 5LLTA 1VPTA 3JRXA 1W1IA 5FTJA 2WF5A 4ZQBA 3PPYA 3ZWOA 2QM3A 3SBEA 4GQIA 5BN1A 2O0HA 2QYOA 1SC3A 3F9CA 2B6HA 3QX3A 2IW1A 1FXUA 3SIPA 1L5OA 3ZHBA 3D02A 3ZXIA 4W9MC 2ZBEA 2CJWB 4KIUA 1ZS9A 4U0JA 4V3CA 3AZOA 4AJOA 4RPHA 4PX2A 5JPCA 1HDXA 1KIMA 1TQ8A 1X1AA 1OI7A 3NM4A 2C9CA 4QBHA 5E7MA 3RADC 1VKZA 2H1FA 5I9IA 4H9GA 3CRZA 3ONDA 3IH5A 4P3YA 5BN4A 5LNK1 3L0ZA 4RWEA 5DYTA 4OI0A 1V4NA 2UZ1A 1IOLA 5LSAA 2O8EB 2QTAA 3VBCA 1P0PA 1UJBA 5AXBA 2L69A 3RUPA 5KJCA 3IP8A 2C4WA 1O58A 4EKNB 3IILA 4WKOA 4Y2RA 1BXGB 5HKKD 3L04A 3C1UA 4D4LA 4H3VA 3CR3C 3QE4A 4DA0A 3EDCA 4EMUA 2BM0A 2ZRCA 4EG7A 1KEWA 1SRRA 1CR6A 2QG4A 4Y1FA 2R6CA 3HABA 1ZYUA 5FLKA 1G4HA 5HTKA 5TY0A 2HRDA 4C2UA 2RB5A 3ETGA 1X80A 4HUQB 3O8CA 1W0JA 2JZCA 2QM8A 3AM5A 2IDKA 2P7HA 3L40A 5CH3A 3GO4A 2CE2X 1DE0A 4ZVRA 4Y67A 3OM0A 1C4OA 1DAEA 1OKKD 3JYQA 1RZUA 1L4KA 4WOKA 3RK1A 3PGXA 2HA3A 3E48A 1B0AA 2VIIA 3CZPA 3NALA 2J3EA 2J6CA 3O73A 1QNLA 1P7ZA 3NCHA 3HGMA 3L1JA 3UVEA 1U28C 1WW2A 4AMBA 4Z7NB 2JJMA 3SFTA 4OKNA 1PT6A 4L0CA 1IN7A 2H1CA 1V7CA 3TD9A 3HCOA 3I53A 1WSDA 2OA0A 4OBBA 1NVXQ 1FDUA 2YX1A 5BRNA 1XJ0A 4L4UA 1XMQB 5CXXA 2A9JA 4U63A 1K3FA 3DVSX 2YICA 5TGZA 4RDXA 1YL5A 2LW7A 3VKWA 4EYKA 5JCOA 1EUDA 4CTKA 3SYNA 4IEEA 4CU5A 3H3FA 1WRBA 4IJ6A 1JJVA 4QGHA 2CYBA 1X77A 4EOGA 2DX7A 4GZ5A 4ZMSA 2VH2A 3ADCA 3ZE0B 2C2BA 5IAOA 4AS1A 1F8YA 3SYTA 3K94A 3KPUA 1AIPA 1HNXB 1UCFA 1AO3A 3EJWA 4R9NA 4BZWA 1QGYA 1Q2XA 2ZSAA 3JD1A 3DEKA 3Q41A 1EFVB 1X0XA 3UB3A 2OSBA 4CR6A 4DZTA 2ZM6B 4WNAA 5EXPA 2RHCA 2B78A 4RY2A 2VVTA 2COUA 1Z5OA 1R6TA 5DYWA 5HQJA 3H42B 1OH7A 1KMQA 3KEMA 1K8ZB 4AY2A 1C81A 4BAUA 1U3UA 2XCIA 2WI8A 2OWDA 2X14A 4MHSA 2H0QA 2FEMA 2CWDA 1TO2E 1MB2A 4G8JA 2ZWMA 4KOEC 3K9WA 2IU4A 4JGIA 3P52A 1FS6A 4MSUA 2H54A 1GAXA 4IG4A 2Q28A 2C97A 2I6UA 5EPOA 3ZE7A 4BEWA 4ID9A 4JUFA 3BGDA 1D09A 2D1FA 5AJTA 1X1TA 5B5SA 2JIQA 1LDYA 3MFYA 2GHTA 4PFQA 4TMVA 3UGKA 3L4JA 1S1CA 2FXVA 5LD2B 1CJUC 1PF7E 1A7AA 2CNKA 2REQA 4U7JA 1KFBB 4HXFB 4B2YA 5TLSA 3UFBA 4HRAA 2P68A 4AJ1A 2O2JA 4S05A 3FTEA 4R3NA 4CW7A 3WC4A 3KSZO 1A8IA 1SR8A 1TM5E 1C14A 3I8SA 4RAOA 3TJRA 4CODB 4HPJB 5JMWA 4LDJA 1EDBA 1T3HA 5LZ7A 1QWOA 1YJBA 4RSMA 2FPIB 3CURA 3T0IA 1V8BA 3KHKA 3OKAA 4JLVA 2ZUEA 3F2VA 1TJPB 4FD3A 2DHRA 4NBKA 1XD9A 5IMBA 4FLEA 2FEKA 4DR1B 3F97A 1RRCA 3RTDA 4O29A 6CHYA 4LMPA 1HFWA 5KTTA 1TIKA 2YN4A 3LQQA 3GJXC 2I4TA 3GLVA 1O0BA 1JIQA 3P2JA 3HBLA 2H1OA 3KD2A 5JEEA 3RNOA 4AZ0B 4BNIA 2GBLA 4EJSC 1GYQA 3P4YA 4HQLA 5JSUA 1IM5A 4UVHA 5EYPA 4K3VA 3ZGLA 1PEDA 3AR2A 5FUYA 3RM3A 5TIIA 2ZPTX 3NOOA 3AEKB 4RTMA 4B7XA 2I6SA 1HC7A 3FWNA 5DEIA 4DMCA 5FULA 4IWNA 1S02A 5ALVA 5LZ4A 3OJCA 4F46A 4X90A 5AW4A 5BWOA 4NE9A 1S9HA 1YKGA 2G82A 3TTYA 4NECA 5EJIA 1QG4A 3GA0A 3IUJA 2AEJA 4FXPA 5CA1B 1SZJG 4CEJA 4PSAA 1G8GA 2NU6B 4UZEA 4NSNA 3TIVA 2X6QA 3AUTA 3UQYS 4A0GA 4G5QA 1JKFA 3L4BC 5CVUA 2R1TA 3T1HB 3M6MD 4UU7A 6NULA 2P0YA 4B6OA 2YTZA 2XSZA 2VTBB 3TLKA 3G5UA 3ZBPA 4FMCB 3V7WA 1ZVKA 3FVRA 1B16A 2P2ZA 1CUWA 1R1DA 3IT1A 5DN6D 4AROA 4YRPA 2RGXA 1JPNA 4K6CA 4Q7LA 2C7QA 4XAQA 3DZCA 1N1MA 3AVUA 1L7RA 2PO7A 3DHWC 3PPIA 1PKXA 2HWWA 5EXDA 4CKBA 4KXNA 4JENA 4S1WA 2DRIA 3S1AA 4BMVA 3EXHC 3PG5A 2PCJA 3B8EA 4D9CA 4F9EA 1BFDA 1P0CA 3H19A 1XO1A 4XIFA 3NNNA 2QU8A 1A97A 2E89A 2XKBA 2HGZA 2VJLA 3QW2A 1GN8A 4IXWA 4MRVA 5J5AA 3E8SA 4ED9A 1QV9A 3P9IA 3PF9A 5B3AA 3B8HA 3PHGA 1PJ4A 1GCOA 4CM9D 2NO5A 4RKRA 1UK6A 4O2LA 1IUPA 1YR2A 4OJTA 1A9SA 1EGVB 1F0PA 2B0CA 1JVBA 2ATIA 5F52A 1CUAA 3C4QA 4UNRA 3WLNA 3WGUA 4KR7A 4BQRA 2C95A 1F9EA 4BWYA 5JJ5A 1G8KA 2OKCA 1ZGZA 2JGRA 1YHNA 2EFJA 2BF4A 4L50A 4LISA 5K0SA 4LJ6A 1YIDA 2IYWA 3A36A 5ADWA 5KTMA 1ZD3A 4CETA 5IFLA 4Q48A 2EQ5A 1EAMA 1LGYA 4FHZA 2FEXA 3KVOA 3ESCA 2GM5A 4YCMA 1YTLA 3PNMA 3VSAA 1QYIA 4JI1B 3PUXA 1JLLB 5LP1A 4R84A 1Z15A 4LDNA 1K86A 2QRUA 2P0EA 4JELA 5ALUA 3FCAA 1X7HA 2LRHA 3SYRA 1GTJ1 2GJSA 4LXIA 4L78A 3OX3A 4RZ3A 4XJSA 5CNMA 1HLDA 4P32A 1NBME 2GZSA 3H8SA 3QU4A 1ESNA 4RQAA 5K3OA 3A3OA 4E08A 1NX6A 4K1XA 1DAIA 4NXNB 5JJKA 3BD7A 4TRJA 1ZL2A 4IO1A 1NPTO 2NVOA 3EVDA 2RGEA 4K9KA 4MIEA 4Q1AA 5D7BA 5FL7A 3RS2A 2Q8PA 3FY4A 4GX2A 4J29A 2JRCA 4OI4A 4PTLA 2WU3A 1DUSA 1ZBQA 2V97A 5JOQA 5JWOA 2WIGA 5CYPA 1R4ZA 2OFXA 2BFEB 5EEHA 3MFQA 1X1EA 3VU8A 2Y2UA 4HBZA 1SD2A 3DMTC 3K0FB 5B7NA 1BE6A 5AXCA 2C3OA 1X7DA 1GUFA 5F1PA 5JMTA 2DWQA 1HYEA 4UU1A 4Z4GA 5BNIA 2BHSA 1UPTA 3OQIA 1TX4B 3C7TA 3CHYA 2EKZA 3M49A 3OIUA 1EM8A 3BMQA 1YL6A 2BFAA 2V7PA 1YQXA 3FCOA 1RXCA 1J99A 1ZEMA 4AG6A 4FZ5A 5JLAA 4Y9TA 3OCUA 1YVPA 1U0SY 2ZT8A 3DL2A 2OC4A 4OK5A 1G66A 3U9SA 2ADMA 1ZGHA 1R2QA 4MTCA 2LIPA 3LXUX 3R2JA 2C0CA 3WADA 3B7PA 2H11A 4HQ6A 1V8PA 2XVAA 4OD0A 1D2HA 1EQUA 1K3TA 2P9QA 3INRA 3O21A 3RE1A 1YL7A 2XT0A 4PNHA 5KOHA 2QD4A 1ZN8A 3DLBA 1P9OA 3VM6A 2HU8A 3AGPA 4HXYA 4GYKA 3PRJA 4JBIA 3ASVA 1ZHHA 4NMWA 2FG6C 1IPFA 3I23A 4ZQEA 4AQ7A 3PC8C 4II3A 3KQYA 2W98A 2WIDA 4UASA 5LXTF 5GONA 2O19A 2BEWA 1UIMA 3RU7A 3OQMA 3GLIE 1SC4A 1D03A 1M6YA 3THXA 1M2NA 5J4HA 1K6IA 3MUFA 1IN8A 5BQXA 4DAOA 4YDQA 3P0EA 3FZEA 3KRTA 4P6VF 3JASB 3QVGB 4P7FA 2GKOA 2VNIA 2Z1NA 2BJVA 3RYHA 1P39A 4FMBB 5LA6B 3RC9A 2EFYA 4JJFA 5JALA 1N0UA 4BNFA 1NXSA 4ISCA 1NVVQ 1S2IA 4P8RA 2JH8A 5CM2Z 3WYEA 1PV2A 1E96A 3O0TA 2RHJA 4DVJA 4QZVA 3FNIA 3TPFA 1MRSA 3PWTA 2HNAA 2CB0A 1LSJA 1T2EA 2ODTX 3JQGA 4HOYA 4ZP1A 1H2AS 3QTLA 2JFNA 3ELDA 3VDRA 4CDGA 2HSDA 2HWYA 4US2R 1VLQA 2ZSBA 3F8WA 3U16A 1QLHA 1PJ3A 1SCUB 3PT9A 3V3KA 2K2QB 3EXIA 3ZR4B 1O9BA 1IZ9A 4FGJA 1KRWA 4N7JA 4XSGA 1D1PA 1GQQA 4HRYA 1OZGA 1H5UA 4XYGA 5FWXA 4K2AA 4M86A 1W2HA 4H27A 5HIJA 4JQYA 3UWPA 3OQ1A 1NQXA 2J4DA 4EVIA 4UTPA 1J9GA 1TZ2A 3DE1X 1SUWA 2DWCA 3UAWA 4ME6A 5FBRB 1PHPA 2BFMA 4FD2A 3SF8B 1E7QA 1G7RA 3X3HA 5KHLB 4C76A 5LMCA 1D9ZA 2QIOA 3HEAA 3QWBA 2R9VA 1JKXA 3WWCA 1UMCA 4CIXA 8ABPA 1UT6A 3AVVA 4AKSA 3H5IA 3O82A 1U99A 2JJYA 1SMKA 4EAQA 4WNCA 1RZRA 2VT7A 4X54A 1LX6A 1A1SA 2C88A 3R9KA 4X85A 3VC1A 3KKPA 3WDSA 5AVSA 2BMWA 3CBGA 1JGTA 4AZVA 5DNUA 3INGA 1L4GA 3AEXA 4IJUA 1HYHA 3TI9A 1AK9A 3TB6A 3TUJC 1ISIA 4RJTA 1EYZA 3WB9A 2JLWA 1JEYA 2I9PA 3ITDA 2A5FA 2DHQA 1JSXA 2EHDA 2QLLA 2OBBA 2FB9A 2VPIA 4PHTA 3FPLA 3QEBZ 3DR5A 1FCJA 3MTIA 2EG5A 1VLVA 3JAKA 4OO3A 4B8ZA 1O57A 3QVTA 1FYEA 1S96A 4ND2A 4JP2A 3ELUA 5KU7A 1GPJA 4FHEA 3B6KA 4N3BA 4NENA 4OJYA 4Z2YA 2DQSA 2Q49A 3EW7A 3PI6A 4BXOA 4YRQA 2X1LA 1VJ1A 3OU7A 4L3OA 4RL4A 3RUDA 2PUTA 2ZIVB 4JNKA 1T9GR 3RR2A 3ZHYA 4EPXA 4RTLA 1QPBA 3TQQA 5DW0A 4C6SA 3P2EA 1C2TA 4D4GA 1SCDA 3OX1A 2ZBFA 2MHCA 1QVRA 3ZGNA 1UMDB 3ACDA 3SQXA 4C88A 1KKMA 4RA9B 2YMQA 1CFZA 2GAFA 3WY9A 1GG5A 1Q7CA 3OHMA 4I9FA 3LHFA 2J0VA 4KFCA 1NW7A 5IZ4A 2AFIB 3BCHA 4RLFA 1MEOA 1NVBA 3QXGA 1RAGA 4O0LA 5IJAA 5EIAA 3AP3A 3O1LA 1J1IA 3KXLA 4TWRA 1MENA 1E0JA 2WJZB 1V2HE 3RFCA 4QBGB 1A8PA 1UAAA 1XYVA 2QAIA 2E6UX 2IQ5A 2RIPA 1AE1A 4Q9DA 3RVQA 4ER5A 2J9RA 4AUNA 4UD2A 2COKA 1O9GA 1NVKA 2PCLA 2QAGA 4PQYA 5GQSA 3T5MA 3VYRB 1QH1B 1WCIB 2XZOA 2ZT6A 3BULA 3GUCA 3DOOA 5KSZA 4RDIA 1KI8A 1IQPA 4GLFA 4YP7A 3UKOA 4DLRA 1TYEB 5FPPA 5KCZA 1E63A 3OUZA 2KJQA 3LQ2A 1BD3A 5JDCC 3PLRA 3B1JA 1ZCZA 2RCNA 4UEWA 4XR4A 3KZKA 2PGIA 4W63A 4CCYA 2Z9BA 4IJMA 4PR3A 3GG2A 4B80A 1IJBA 1RPAA 2VRBA 3HR4A 1BE8A 4U6QA 2QQEA 2IH4A 3PHBE 3G17A 1CQPA 2H00A 4FM9A 5FYDA 1MGOA 1SH7A 2HCJB 2QJWA 3AYXB 1WTAA 2NADA 4FSXA 3RSLA 2ZDGA 2ICAA 2QXUA 4WQMA 3VAAA 4F85A 5KZMB 3PNQA 4I9UA 4AS3A 4EFLA 2G63A 4F4FA 2IODA 4Z7OB 4LF5B 3O94A 4MUIA 1HEIA 3MJTA 3ITEA 3ISJA 3N7TA 5AM5A 1NN5A 2ZUTA 1YBAA 5F23A 5M34A 3SE7A 2GQ0A 3P0HA 2WF8A 1RPJA 1U0LA 2R86A 3NVDA 3NDRA 3CPJB 3WLIA 3HKCB 4PCAA 3OAAD 1UJCA 4ESEA 2I2DA 2NQ2C 2Z4RA 1T9AA 3KB8A 3PGKA 1Q1ZA 3GN2A 1NN3A 5A3SA 3ETEA 5HYVA 4ECAA 3GCGA 1ZP6A 2XTZA 4PZ9A 1JSRA 2AEFA 3U0VA 4DV2B 1JB1A 1U2TA 2G28A 2LCIA 5THXA 5K01A 4YJFA 3IOYA 4MPDA 3WYCA 4AMYA 3MW8A 4BEVA 3N8KA 4YJ2B 3HO6A 1LUAA 3X2SA 9LDBA 5DE3A 3KZ1E 3EDRA 1OYVA 2ORWA 2PZMA 2F4VB 2BOVA 2Y76A 2GKGA 5E2AA 2DWUA 4D74A 1YFLA 2H29A 1E94E 3IUYA 4IFIA 5L45A 1TJ3A 3PGVA 5TMEA 3RYIA 2W11A 1TPYA 4BKQA 1G3RA 1QWSA 2I71A 2CJYA 4EW6A 5ELXA 4ZQGA 3QQPA 2VT2A 4INJA 1W8IA 3IUMA 3LF2A 1SXGA 4W5JA 1RQNA 5KHOC 1PZHA 3KKEA 1Q0HA 3MELA 3QNMA 4ZYVA 1H9CA 4M8KA 4D8TA 4P38A 3Q7QA 3PXDA 2IXAA 4YIHA 2IXTA 3T5CA 1Q91A 3C2QA 1NZDA 3OKPA 4B33A 2C7GA 1TDJA 4UM5A 3W0LB 2GTHA 1XP8A 5DNYB 1KR5A 4PBSA 4IL5A 4K0KB 5AJWA 4WERA 2WU8A 5KS2A 1Y82A 3R3JA 3UAXA 1G3IA 3HMKA 5CA1F 1VMKA 2A5JA 4JJ7A 4QXRA 3CNHA 1V11B 2CNWA 4MMXB 3GHYA 5IAKA 3V2HA 4QAQA 5FHRA 4FFMA 3WLFA 2BM1A 3UT5A 1KERA 121PA 2I3AA 4M1KA 4X1YB 4KQFA 1W4AA 1KMNA 2Z2KA 4FMCF 4BV3A 3KXDA 3ZGZA 4UTZA 1K0UA 3A7DA 3KLOA 2ACEA 2GKSA 3CGGA 4ARAA 1H6CA 721PA 2NZWA 2UYYA 3W8NA 5KYXA 1NBOA 4RABA 3J7AC 1UBJS 2Q3DA 2R7LA 3IALA 3P2KA 3TMYA 3WZMA 1C8KA 1G8JA 4C03A 3M3PA 4QX6A 1F6DA 2HMAA 3R0VA 4DT1A 2R85A 2Q1SA 4B71A 5I7HA 4BS9A 4IDNA 2B4KA 2QN2A 4URFA 3DNFA 4MR7B 1YBMA 2PWBA 4H77A 4KSYA 3PXXA 3WGGA 2ZVPX 1Y9AA 1SO8A 4F38A 5CT6A 1TKRA 4S2EA 1OH5A 1B6SA 3DPIA 3F96A 4Z9YA 1QHIA 3H99A 2PX6A 3LSTA 3TDKA 2ZYRA 1PUXA 2PVSA 4Q7JB 4O08A 3PEWA 1MN6A 1N5KA 1U3WA 3E4CA 3JZIA 1Z0KA 2WF9A 4JI0B 4UE6A 3CLSC 3ZLBA 5JXGA 2JGMA 2ZB8A 3HP4A 3SEQA 3HQ4O 1WR8A 4NNOA 4O2AB 5HX7A 3NETA 3MTAA 1JR3A 1NJGA 1ZH8A 2G3YA 2TMYA 4URYR 4JI2B 1MA3A 2YOGA 3IHWA 4AN0A 3O84A 2XR1A 3L49A 3WK4A 5AVUA 1Z4KA 1BX0A 2RJOA 3D7SA 3PEEA 2PRJA 4J1TA 4N5HX 1GG8A 1J8FA 1VKNA 4J0JA 1S8AA 3G9TA 4KIFA 4MRAA 5AM1A 4AD8A 4BX9A 1YULA 1ZGGA 5SZHB 2RKOA 1RBZA 2OYSA 4KQ1A 2GHRA 1US8A 3VAZA 3COWA 4EKIA 5ES4B 3WDMA 2V4ZA 3FYDA 5BMVB 1YQDA 1BGWA 3D4IA 3KTDA 5ECDA 3MWFA 4WGGA 4F7WA 3AY0A 5FV7A 3NI2A 4EP1A 1PK9A 2A33A 3SSNA 4AU1A 4ZYXA 4F9GA 4YUAA 1SZCA 3GT0A 2WY2D 4RHYA 5KQMA 2GJ9A 4EY4A 2I3DA 2ERXA 2VCHA 4LF6B 4ASUA 4ZU3A 2XNDD 4C0BA 1Q15A 1NKSA 1QB7A 3E3OA 2FP4B 4KXVA 5AHWA 1YB6A 3TCNA 1NUSA 4CIDA 4BNDA 1ILWA 1Q1AA 5IJWA 4YCNA 1SD1A 4NDZA 2OV1A 4GM0A 3PS9A 5EHIA 4BNWA 2JS7A 4UD6A 1N2IA 3FRHA 1A5ZA 4G3XA 5B3KA 1FVOA 3MWYW 1S7CA 5KVAA 3B1VA 1AKTA 4BIIA 1M0SA 1BHSA 2GZ3A 3CR8A 1KI1A 3OA2A 4FDTA 3ZTYA 3DV9A 4BNHA 1G6KA 2D4AA 3LCUA 1EG7A 4LGCA 1B6RA 3EE6A 3JS5A 1M5UA 3KPVA 4U7HA 1KDZA 4AJJA 4YMTA 2IH5A 5IAEA 3C45A 4GMGA 3VPXA 5EJ8A 1T4BA 4TVOA 2O8CA 4C7BA 3OESA 4OHUA 2EC5A 5DLEA 3SEFA 1YU9A 1JTVA 3QUCA 4GKJB 1JSLA 2BZ1A 1E7SA 1KMHB 4DQXA 3VMFA 2GPAA 2VYND 1XDDA 2H5EA 3HXQA 1DKLA 2IBSA 4M8NE 2XQVA 4AIIA 2HB6A 5C7LO 5CFNA 2UUBB 3PIRA 2ASEA 4KN8A 3L4KA 1QRDA 1YJ8A 1PZEA 3F5QA 2FXIA 3JD0A 3VSEA 4JLWA 4F6CA 5JDIA 3CLRD 1FFHA 3KALA 5ALIA 4N8EA 3UJ9A 1K97A 2QEQA 4J0IA 4RIIA 2C7BA 4RGVA 3HYRA 3GFTA 4YN3A 3FSRA 1RRVA 2WJGA 1LLQA 2J0UB 4IZ6A 4MI3A 2IKQA 1QGUB 4NTZA 4D9GA 3MCUA 1JALA 1RKXA 4HZUB 3RU9A 4LFBB 3NHAA 4BCDA 4UAUA 1J1UA 1E5VA 1JIKA 5CBPA 1M1XB 4UXHA 1CTQA 3OLVA 4TSKA 5DCYA 5B30A 2W43A 3L07A 1KYVA 2BGMA 3DE4X 1DQZA 1FUKA 2PBFA 3GK3A 3R1IA 5BSRA 1E3IA 2QKYA 2I5PO 4J7XA 1DO2A 3TMKA 2OV8A 1WMEA 3ZHUA 2YCBA 5JXJA 1CE8B 2ZYIA 1MIOA 1LVGA 3ULKA 3TR6A 1MV8A 1WMAA 3AR4A 5C1OA 5TVKA 5LA6F 3E23A 3E22B 5DT2A 2P8JA 5J5CA 3VXKA 5L3SB 2K2WA 1CS0B 4BTVA 1B42A 2QRPA 3MPOA 5E1DA 4CNQA 2MYTA 4CV1A 2ZJ5A 3JZFA 3UBTA 2FSVA 2JATA 2JD2A 1G6HA 2X4DA 5AXDA 1DC5A 3B9QA 3BEDA 1ZU5A 5HJ5A 3ISTA 1WW8A 2NUPA 2Q21A 1SBHA 3UJNA 3O92A 4OP2A 3G68A 2RHDA 4UHKA 2IV3A 3TJZA 3FPJA 1IB6A 3HL0A 3MT0A 3HDGA 4FI3C 1T6ZA 3IOEA 4A6PA 3U1BA 3GGCA 4NEQA 4DR4B 5ALLA 1WHTB 3EFEA 2B94A 4CLOA 3KDAA 4R8MA 5HGJA 3MGBA 3T9FA 2JAWA 4E4TA 1Z8FA 5ENZA 4ABYA 1E64A 1OXBB 2AYYA 2G04A 4WY2A 1A27A 2BFFB 3D3WA 2MOKA 1GWNA 4HQRA 1K7EB 1Q1QA 1W8DA 2IUFA 1RWOA 1F2UA 3OZDA 4Q47A 5LP6C 3UG7A 1QIHA 1AJEA 2UVQA 2Y05A 1Q0LA 2GCGA 2A0FA 2ZIWB 3OKFA 4IKOA 5DLDA 5HOEA 1TT5A 3KL4A 1KEZA 3AW9A 3VFDA 4FKBA 1TIBA 4LJ9A 1IB0A 3GNQA 3L0DA 1PG0A 3JQAD 1YFZA 2ZW9A 1XCJA 2DB3A 4IIXA 4N8SA 3JQ7B 3CNNA 1NI4B 4UHDA 3ER6A 3PA6A 4D3YA 3QLUA 1GUZA 2J87A 3PJRA 4RK0A 5JADA 2OO5C 1U5BA 4YHHB 4UXJA 4IM7A 2OHVA 2GK7A 2YXEA 4FZRA 2N9UA 1ELOA 1ZA2A 3R7BA 4Y2XA 2FN4A 4M6WA 2KX7A 3G5LA 4Q6WA 1TO1E 4R7ZA 1V25A 1CUZA 3QUBA 3HB1A 3FYUC 5AW5A 1KYXA 1XLWA 4QTYA 2AI2A 2VDOB 3KG2A 3RAFC 3BE4A 3DCYA 2OHGA 2ZGVA 3JQAB 3CW2A 3LCMA 4HD8A 1LRJA 2NZVG 1JU4A 2QD1A 1D5CA 1KFEB 3E27A 2R6DA 3H1FA 1OWOA 3EY4A 3K6JA 3NFYA 1KH3A 4I6GA 4UQLA 2FDXA 3L7NA 4AP9A 4I1UA 4F8EA 4B3CA 1TD1A 1QOZA 3BGSA 2KE5A 4BMZA 5A9SB 5HRCA 1B41A 1R37A 2XDQB 5DMXA 3GBPA 4IY1A 4BLRA 1EFCA 1DTSA 4DG8A 1Y1QA 2SNIE 1Q1BA 5EMJA 1I2BA 4BRUA 4ZZIA 2B21A 1RI4A 2B3DA 4GOKA 1SCQA 4FFWA 1TRKA 2VJBA 1P5FA 4DBLC 3T0FA 4Q19A 2GN8A 1IBMB 3E9YA 3MJRA 2BD0A 3QFHA 3WOHA 3PFKA 2ATVA 4YECA 3HA3A 5CEFA 1H9AA 1C5KA 1Y8QA 4OLAA 1HOTA 2J09A 2WYVA 3HYLA 4AAYA 3WKAA 1FTQA 1PAUA 2GILA 5A5EA 5FV4A 1WXWA 1HY3A 3PUJA 5D1HA 2H2HA 4B9EA 2JFVA 3M70A 1WMDA 3W2GA 1QG0A 1K9SA 3L92A 3EFBA 5I5GA 3F6RA 3VU3A 1VDMA 5CLQA 2ZE5A 1Y4SA 2Q2VA 1QANA 4IGIA 4MGHA 3BWEA 3IP9A 4KYTA 3KYCA 4X71A 3AWIA 3H5TA 1UJ6A 3X1KA 4MS4A 4B09A 3D2LA 1HFJA 4OP3A 3MOSA 4PS1A 5EIFA 3Q2KA 3L7KA 2I33A 2XYPA 2DP4E 1RI3A 2ROQA 1Y5RA 4CMJA 3RBZA 2C57A 1SVKA 1SB9A 3TZ6A 1LF5A 3K09C 1EK5A 3KXPA 5LBTA 4BMCA 4DLTA 1AO0A 1A8QA 4Q05A 3DBHB 3ZK9A 1F9AA 2C9YA 4GZLA 5CFZA 3FOCA 1RM0A 3MERA 2P9CA 2R5FA 1PVOA 5JQWA 3QU9A 4NZ9A 1NNUA 3WISA 2HAEA 1ISHA 2JVIA 4H7KA 4P4UA 3W1VA 5L3VA 1T3SA 4L6IA 3K8QA 1J0BA 1E5XA 4G0NA 5BSFA 3MINA 4MWSA 3R6LA 4CEIB 2BTQA 4CWAA 1F7VA 3CW8X 1JFFB 2H2AA 2KSQA 1EUCB 1VE7A 1OQAA 1Y8AA 3DLPX 3PICA 5B1EA 4AIRA 1JXOA 5CX1A 2VO1A 2YWCA 5MN4A 3TXXA 3NOXA 4YAIA 1YTUA 1X7YA 3PDWA 1IJEA 2SCUB 3RARA 1RACA 2LGJA 4MCAA 3SJBA 3W77A 1DG3A 1A5TA 1N0WA 2JGLA 1CR4A 1KSFX 4PYKA 1Q1NA 1QZTA 1YMUA 2I65A 4E6EA 5KTRA 4U7WA 1JEEA 4EITA 3QPDA 4KCGA 4YMIA 2O5RA 3QEMB 2OQVA 5KINB 4YJ2F 4IEIA 4LYJA 3OTHA 2NW6A 4KYUA 4W5TA 2DSNA 4WADA 3R6TA 1KYWA 2YYAA 5A71A 5CLJA 1M2VA 1E3TA 1YFKA 3LOUA 2QIPA 4G25A 5B6PA 3FVTA 2O2YA 1WULS 2FPUA 1AMOA 1FDSA 3K70C 5GV8A 5CB0A 4EVSA 3QMVA 5JD3A 2WWRA 1PSDA 1QE0A 2UVPB 4NC9A 1CUVA 3WYNA 3G6WA 1HNNA 3GAFA 1FNMA 2PR7A 4RZ2A 4CXMA 4KUGA 1FRZA 3ZW8A 1IWBB 3AKYA 1JFVA 4JB2A 4JROA 4AJIA 1E2BA 3OQOA 1Y8CA 4S35A 3FFXA 3SQLA 3T7SA 1H1LB 4II7A 4JQCA 1K1EA 1I1QB 3WYFA 2ZRHA 1RYYA 1DELA 2VYVA 4QUBA 3ZU3A 1IONA 1ORVA 1ZUWA 2WDZA 3WMEA 4B79A 1T4DA 3U6BA 4AQYB 5F9HA 4AZSA 1E2FA 1NXOA 5CFRA 1LK7A 1OFUA 5LCXA 3HO1A 1VMIA 3T5PA 4XGRA 4HQOA 3AOEC 4FDUA 1Q7GA 2DETA 3BF7A 3U48A 1BNCA 3INTA 3QLTA 4UKDA 3O7MA 5LXTA 2PBRA 5A5FA 2O8DA 4QU0A 2WSBA 3CZAA 4O1IA 2YS7A 3K6KA 4G0MA 2OECA 1RBQA 2W2LA 3KEFA 2R00A 3HBNA 1BOFA 2YV4A 1MZPA 1N33B 1BSVA 1JR3E 3HRHA 3SZ3A 4JV5B 1OW3B 3KUCA 3NPMA 4Q9NA 3LDAA 2I7TA 1W76A 1RABA 1T9HA 2H17A 3GCWA 3H6HA 3NTXA 4TX1A 2CK3D 3MT8A 2VT3A 1C9NA 4ZRMA 3THSA 3AG5A 1Z6XA 2HDWA 5KOIA 1XCMA 2VUUA 3MPUA 1JWAB 1CZOA 1GITA 1N1GA 4RXTA 1IOWA 1VHLA 3RSOA 2Y27A 3CY6A 1KWGA 1DQSA 2OZVA 1LLUA 2HRQA 3NEPX 4KODA 2CNOA 1IIRA 5PGMA 3QG5A 3VZRA 2J41A 3PTAA 4DLZA 3FSEA 1L8OA 4F4IA 1C9MA 1Y1RA 4R6WA 2H1RA 5ALJA 1JLHA 3E9ZA 1GZ3A 1N0IA 1Y89A 1Z4IA 4GMHA 5B1HA 2C2GA 2C61A 3EPRA 5T3UA 3K8YA 4QSHA 1O87A 2BIFA 4O2AF 1N5LA 1MV5A 2A35A 1NW4A 3G9XA 2WJ4A 2BKEA 1HL3A 2DCUA 4IRMA 2Q7XA 4NS4A 3OPQA 3I01A 4IUBS 1N5OX 4ZD6A 3ZDDA 2C04A 2PG3A 2J0QA 3EGDB 1B6GA 4IDHA 4JWTA 3A1FA 2XCTB 3KAKA 1AB5A 5IDXA 1F4PA 5C7YA 4PZPA 2CJWA 4MVWA 4B4VA 3MBIA 4MROA 1ZN9A 1IEVA 4P08A 3UUGA 3G0HA 3MXTA 3P96A 1PX2A 4RU1A 4H3KB 3BGOS 2BZSA 1FU8A 3OH8A 5FJJA 5B3JA 1SM4A 1UXOA 5JO9A 3WLMA 5EHQA 1DTEA 3GEPA 4QEDA 1HT2E 1PJLA 1CVLA 1NX9A 4MKIA 5BWLA 2G0TA 2P6MA 2GPBA 5CIWA 3I2KA 2O8EA 1X87A 1KJNA 4IV8A 5E95A 4F11A 3COYA 1QHHB 2B3TA 1ZITA 4KKVA 1BXGA 4G81A 1BC5A 3R5KA 1YZVA 1MC8A 3B9RA 2QL6A 2R3SA 5CW1A 3CZMA 4NG5A 4PG5A 4RH1A 4D42A 1FJ2A 1J8VA 1RJGA 1J0DA 1M8PA 1W52X 4TXLA 1WA5A 4CM4B 1O6GA 3OIDA 1MOPA 4AWXA 1GSOA 4XUDA 3N5CA 1DX6A 3FUXA 4M0FA 3NKLA 4HUQA 4RPGA 3KQQA 2X0KA 3BXFA 1JR4A 4JR2A 4RHCA 1NG1A 3FHLA 3P27A 3E84A 4HJRA