3UC9A

Crystal structure of yeast irc6p - a novel type of conserved clathrin accessory protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
184
structure length
180
Chain Sequence
b'VLQYPQNKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDSCKDIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVLVNVNEEVEQDEIDELNEIWSNAFTNVIEFVNWKTVNHNDYGEKLGLDRIQEIIDTHDWLNCEVQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Increased recombination centers protein 6
publication title Yeast Irc6p is a novel type of conserved clathrin coat accessory factor related to small G proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Recombination
total genus 66
structure length 180
sequence length 184
ec nomenclature
pdb deposition date 2011-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uc9A00
3UC9A
chains in the Genus database with same CATH superfamily
1F0NA 2OM6A 1EG2A 3GJTA 3MOIA 4LBWA 4S1VA 4UKDA 1KEUA 1M7HA 3PIRA 4YNBA 5D7BA 1KNXA 1P4SA 1YGYA 3X2FA 4F45A 4F84A 3WDKA 5EE1A 3IAM1 2ZI4A 3GFPA 2MU1A 1RCUA 2D00A 4HOYA 1B7GO 2QGNA 3JQBC 4DJJA 1NOIA 4H4CA 5C8YA 5HE8A 3DFZA 2DLCX 2UUCB 1Q0LA 2FRDA 2DLNA 2O7RA 2RK3A 4LI0A 3THXB 2MR6A 3STXA 2V6GA 2GNPA 2H9AA 1V9SA 4QPDA 1Z4KA 2AZTA 3KSMA 4PZEA 5L40A 3OQJA 4JOBA 1H2RS 1QPBA 5SICE 2OXFA 3ROEA 1R4ZA 2DUJA 1KOFA 1UODA 3OU2A 1REQA 4EABA 4J7AA 3DXZA 4A6PA 2SCUB 3VR5D 1SXJE 5COAA 2Q1YA 2BEWB 2CHQA 5K3SA 1CR0A 1P80A 1BU5A 1XYYA 3PKJA 5GTDA 5KCZA 4G5SA 2ZM5A 1QP4A 4FZJA 4KDRA 1J5EB 1I24A 3I9MA 1E5XA 4HNGA 2QROA 1WCV1 3ED5A 3A4IA 3G0BA 4ZT3A 4NG5A 1NC3A 1XG5A 1N2GA 3IXLA 4FMCB 4NZMA 1GGFA 4UAJA 1CVLA 2D0IA 1NXVA 4FS8A 4RAQA 4P8RA 1E79A 4U63A 1UT5A 2C29D 3JWJA 1QHHA 3OAAA 4CMCA 2Y0CA 5CLJA 4WUTA 1EVQA 1ML3A 3TK1A 4HQOA 2OHOA 4D99A 4L9SA 3O95A 4UD2A 1JNYA 3A9TA 3AFGA 3ADPA 5FBLB 4YAEA 3K9NA 2Z1NA 4BJHB 3KQPA 4TYNA 2C5AA 3P0JA 3BKWA 4IGAA 3E22A 4OBXA 4RF3A 5E9QA 4AKTA 1C3XA 3VPGA 4IHJF 1V2GA 4C7OA 1SC9A 1XLTA 2OK7A 3RC3A 1JR6A 3WI7A 2C5GA 3ORRA 4M7OA 2FWAA 4B8WA 4TTPA 3UAYA 2GAJA 4TZ0A 4KR3A 1W1IA 3GDFA 4E2XA 5KYVA 4GI1A 4B7AA 3FUXA 4M1KA 1W49A 2JGMA 3BAZA 4C20A 1G59A 4AF6A 4GOXA 3KUCA 3PQ8A 3I9JA 1I7QB 3HZRA 2AR9A 5HGXA 3PNPA 4W99A 2QN1A 3ELYA 1ZRNA 4RTKA 3V4PB 4M1ZA 4JMLA 1D2MA 1JJFA 4RGQA 1DBWA 5REQA 3CRMA 3ORYA 4MEAA 4B0PA 1VJCA 3O2QB 3EAQA 1LGYA 2LV8A 2QRKA 1YAJA 3AW9A 3GLSA 4HGYA 3PXDA 2UZ0A 4I7EA 3ZQKA 1CZHA 1JIJA 1D6MA 4YJ3A 1OWMA 3WGLA 2WJAA 3WAGA 4EHAA 1J8QA 1WTAA 5CVTA 1WZCA 4RV4A 3D7KA 3MTQA 4KLAA 5HKKA 4UCXA 5U4XA 1QTQA 4URFA 3U1TA 2FPPB 2XOKD 1ZBDA 3OM0A 1T1SA 5B3KA 3EEOA 2C4WA 2ZBDA 4DPLA 2KI5A 1VE7A 1ZICA 2WZCA 4H0NA 1T4BA 3IAFA 3QU5A 3K0BA 2QRVB 3D6AA 1C7EA 2JS7A 2VYCA 2YXLA 3OKAA 3ZY5A 4EHDA 3S55A 1GPLA 2ZE5A 4F6RB 3DXYA 1E6KA 4GIBA 3WK6A 2CZCA 2DM6A 4MQFA 1P2TA 4B7CA 2X9GA 1UDWA 1VCNA 4FW8A 4OQNA 1B15A 3AHEA 3IJ5A 3PHBE 1EXWA 3DZ8A 3U7HB 1G4HA 2Y0PA 2O5CA 1U8UA 1XN4A 2J0SA 1JHYA 1Q0QA 3GGOA 2Q9AA 4PFJA 1A95A 2AG0A 3RFFA 3ZLUA 3BFXA 1SM4A 4G9BA 2DUNA 5KI6A 1PLLA 2NACA 1LI4A 2PRYA 3E61A 3NM6B 5HJ2A 4IIEA 3RF7A 1JMYA 5HCNA 4N3AA 3E3LA 4KXQA 4E88A 1SCBA 1W0JD 3DDWA 2H18A 2G4CA 2W4MA 1EPUA 4D6YA 5AI5A 4G9EA 4TXLA 2P9HA 2HU8A 2P5TB 2WPDD 3F49S 4PW0A 5EERA 1DXQA 4LRQA 4TV8A 2WNSA 1ZD2P 1A88A 2OD9A 3PEEA 2J5QA 1L7DA 4Z3KA 1OZ0A 2D74A 5KNBH 1MHTA 4FGUA 1IWPB 4NP6A 5FAXA 2WAAA 1E3DA 2V0GA 1V8BA 3KR1A 1KJWA 1BW9B 1XWFA 3VU1A 4BU1A 1IUOA 3DEIA 3A3PA 3R75A 2H4YA 4KFSA 3ZV6A 1ZN9A 2R87A 1ID1A 1P0PA 3QVTA 4KPUB 1E0DA 1ZHFA 2SKCA 1KYWA 3COJA 3GEDA 3RSSA 3HJFA 4ZIRA 2IUSA 3LE8A 4HVAA 3ZCPA 1QQ6A 1U80A 5D6OA 1CY0A 4IXWA 4NTZA 1H6CA 1NOKA 3RROA 4YRKA 3D0QA 3MT8A 4TS1A 1M2FA 4ZVSA 4KK3A 3UJ9A 1K66A 1KQPA 2HMSA 4EIWA 3L7KA 1VKOA 1LBSA 4QPCA 4M49A 1ISPA 2TMYA 1FNDA 2YZ7A 3F1KA 4JU9A 1G8KA 2ZAMA 4IQ8A 3TRFA 4FSDA 1C7IA 2ZM6B 2UXCB 4QTXA 3TLGB 1RLUA 1I3MA 2ZVJA 2WBLC 1H1LA 2R44A 1PV1A 4TKUA 1HE4A 1V4NA 2IKSA 5ES3A 1II8A 3FDJA 1FY2A 1P91A 1DUVG 4INPA 3ROXA 3X1KA 1OBOA 1FW6A 3IUQA 3MS7A 3TOZA 4YR9A 1CJKC 3G2IA 1UXKA 4F38A 5K0BA 2ZIVB 4JLJA 4Q02A 4S1OA 5FPYA 5JSYA 4AF7A 1JB1A 2Q45A 3HI4A 4OHRA 5BVHB 3B5IA 3GBPA 3VTAA 1VBKA 1JLSA 2EW2A 3A7EA 4D81A 1MB4A 2WG2A 2QRUA 3C5HA 2QAGB 3ENVA 3U40A 4Z9AA 4CEIB 2PWZA 3T5DA 4X6YA 4Q4DA 1BVUA 1PYDA 1RQPA 2HGSA 2WJVA 2F1JA 1BMFD 2NT3A 3IT0A 2C92A 3GIWA 3LVQE 4Q7QA 3I61A 1W76A 3C6QA 1JILA 3PQCA 4YP5A 3RVLA 2AH5A 5B4TA 5C1DA 2AFIB 2VK8A 4PGMA 4ZVLA 1QVVA 2IX9A 1D0VA 1HFKA 1QC5A 4KPGA 4RHYA 1Y5LA 2IPNA 3I0MA 3UYLA 4EMTA 4YMTA 5CA0F 5HW0A 2J6IA 1GXSB 2WWFA 2I1QA 4ZQGA 2VQ3A 3BT7A 5IVIA 1Q17A 1UXGA 4D8VA 4HH3C 3E2MA 2CLMB 4XH9B 1G3IA 2BT4A 3DEKA 1J9ZA 2ZPTX 3PLNA 4OBWA 4QJ4A 4X41A 4XDGA 4ZTBA 1T29A 2FI1A 1L5YA 4QWWA 4WEQA 3K35A 5L3ZA 4EP1A 3DE1X 3MT7A 1KAEA 4RE5A 5ANRB 3FYHA 3CU5A 1Y3FE 1X7YA 1XRSB 4ITUA 3QFHA 3CZPA 4AJOA 2P77A 4C7MA 3QE4A 1R9JA 3MJ4A 1QKJA 2C3PA 3N5CA 1NFRA 2FZLA 4DM4A 1WHSA 1R5NA 1MB0A 1Q6YA 1NW8A 4AJ9A 1SC1A 1GG5A 3AESB 3DZDA 4I4IA 1BWPA 4WZAA 3PQEA 5I8ZA 4CFSA 1PVVA 5KSYA 2P2YA 5KHAA 4LRTB 1PD1A 3INGA 3IOBA 1F9EA 3D2BA 4Y6LA 4B8YA 1VLVA 1KMNA 3PZRA 1H05A 5LUAA 4P7FA 2PGJA 1V6CA 2YW2A 2QL6A 4MVJA 3KIPA 3N2IA 2P2LA 2YYYA 3FWHA 3ZE1B 1EVZA 3IR6A 4HJRA 4LJSA 1JKXA 3TCKA 3SHVA 4Z51A 5JH7B 2HO5A 2G7ZA 5T4HA 1IK6A 4C07A 1URPA 5ALEA 4EG3A 2G17A 3PXXA 1XCGB 5DGXA 1GYRA 3B9BA 3KVOA 2F8TA 1H3NA 2KB0A 2PCJA 2Y2VA 4ZAVA 3DAHA 1YZTA 1AX9A 2OLKA 2GAFA 4B2YA 4R1SA 1PW5A 1XZJA 1M6EX 1QVAA 1U9JA 2YFKA 2ZPAA 3TL6A 1SUFA 2J46A 3V7WA 2G4LA 1PSZA 4N0PA 2G1UA 1UJ6A 4ASUA 5DCUA 2QPTA 1HY3A 4EAQA 4EGAA 2C7PA 1DMSA 1XZGA 2IHTA 1CQWA 4XRGA 3PZBA 2RIPA 2Q2WA 3R3JA 4UQPA 1GDTA 4E09A 3NOVA 5G1OA 1ISMA 3K32A 3UG7A 1TYBE 1WVMA 5ITVA 4FQ5A 1C9KA 3UUWA 4PNZA 1COZA 2XLBA 4PBTA 2ODPA 1YZYA 2CF5A 3WP0A 3M1YA 5K4HA 3EXIA 1XO1A 2GZ2A 4RENA 4CM3A 1JV2B 5CB4F 5JEDA 2NT4A 4TTSA 5DGCA 4EG0A 4Z7OB 2RKBA 3PA8A 1AS3A 3BRQA 1JKFA 1WLYA 2VYQA 4HXGA 2PJRA 1BWQA 2CXPA 3GEIA 4OK3A 1GAXA 2IE8A 3DFMA 4IIJB 4MXDA 1FP4A 1U7XA 4X71A 1KO8A 3B7PA 2Q0QA 4KVGA 4TLCA 4YRDA 1LEHA 1FYFA 2NUBA 2X19A 5GONB 1BKSB 5K8UA 1EWVA 4NVRA 5A7GA 4RPJA 2DF8A 2V03A 4QSHA 2H7YA 3TN7A 4JSTA 3C6ZA 2PKCA 5JQWA 5DM1A 4AU1A 2BTEA 3N0VA 3S1LA 3FAKA 2HT6A 1HTWA 3V9AA 5IM5A 2VNJA 4KK4A 4LHSA 4NBTA 1A5AB 2R84A 5I9SA 5JOQA 3A05A 2N42A 2J0UA 3A4TA 2C0CA 4KWIA 1RKUA 3L8ZA 4LOAA 2FPXA 4Q9KA 2Y67A 1CLUA 2M6LA 1HO3A 4A73A 4ZHQB 6REQB 1OREA 8GPBA 2R7KA 4BGDA 4ECEA 3UB3A 5KEIA 1P7YA 3PC8A 2CJPA 2NO6A 5LQRA 1VPTA 4JBYA 1UKYA 2CGEA 1F2UA 3ETJA 3QKTA 1OB2A 1S1MA 2Y92A 3KPYA 4L0CA 3MB5A 2IP1A 4MLPA 5CVCA 3A4YA 4AJ4A 3CO0S 5INTA 2IEDA 1MJNA 1UPXA 4YP1A 1LF0A 3VVBA 2JLUA 1GTRA 3NANA 4KYVA 1OLXA 2NV2B 1MX5A 1KK3A 2CMFA 2NZVG 2WYUA 2WT9A 3AHJA 3ZDRA 3NAMA 2Z5VA 3DR5A 4M36A 4NMMA 4DNOA 1XEXA 1IIRA 5AW7A 1K9VF 1ODCA 1V8PA 2JGAA 1SQGA 4M9QA 4PG8A 5BSVA 5JBQA 3WMEA 2VUHB 1G8JA 1Y4ZA 2VHTA 1J25A 1KSFX 1YS4A 6Q21A 4D0LB 3O4GA 3WLSA 1VJRA 4NPCA 4TYMA 5ALZA 3H11B 3D6JA 4YMLA 1AMOA 3R3VA 4FFBA 4G0XA 1M0SA 4F5WA 3N53A 4H7PA 1VL5A 1I7PA 1JKMA 5IKPA 3HBJA 4KSBA 1JBEA 2H63A 4KGXA 2OB2A 2XUKA 5CH8A 2CL5A 3ESBA 3U39A 5FUMA 3UH0A 4O4JB 3ZVLA 2PL1A 4E08A 1KR2A 2FG6C 2JCGA 4HPWA 4JGBA 1K6EA 1P44A 5T64A 4BTEA 5A7FA 4DZZA 4EKEA 4YMVA 1RPJA 5AVKA 2FW8A 1OOEA 2ZJ1A 4X6LA 4Y2SA 5TE9A 1CWUA 1LBEA 3FMVA 3EIQA 5E8JA 1KEEA 1I3CA 4TMKA 4BVKA 1UEIA 4WZZA 1OBFO 5JLAA 1UANA 4AG6A 4ZVRA 2CEAA 4QXQA 1TYZA 4HNVA 3D8RA 1U9IC 5FEMA 3AF1A 2KSQA 4BEWA 4ZGGA 1SG0A 2ERCA 3CUKA 4G8JA 1Q95A 5HUHA 2XGMA 2JIBA 2WA1A 1DXHA 1DINA 3D3WA 1YS6A 4X7MA 3VPAA 2PV7A 3QVSA 4IM7A 4N40A 2CLDX 2YNMA 4GXTA 5JCXA 2KLBA 3OJEA 3U80A 5GADl 2AMYA 1K7XB 2P9FA 3FVWA 4HNRA 6AT1A 5KVCA 3VU9B 3QVLA 3TAUA 3TQTA 5DNDA 3UJ3X 4DR7B 1CNEA 2HLNA 1TUGA 3GLQA 5G0WA 4BNVA 1CJVC 1LI5A 3C3WA 3K05A 1EB9A 4L9AA 4RMIA 4AY5A 2QP4A 2ALJA 3V2UA 1H0SA 5EIHA 5DN6A 3RSHA 3GAZA 121PA 1N3LA 4Y9TA 5JWHA 1JVBA 3GPLA 4CU2A 1U1EA 3PNBA 1UT8A 2VQEB 2ID8A 3KRTA 3BWBA 3FX2A 4Q18A 5E9AA 2NUTB 3WGIA 5IF9A 4IXMA 5JZMA 2AFHA 3WB2A 4I6EA 4LCJA 1ECLA 3CNBA 3HR4A 5IBPA 1FTSA 3D6UA 1PEYA 3IE1A 3NH6A 3KZ1E 3PYXA 3QXHA 4CIBA 1U8XX 1NMSA 5DBHX 2P78A 1M34E 1L5SA 1LVGA 4DLNA 3CLUC 1QYDA 2ZYSA 4H6VA 1AXRA 2WF9A 3R3UA 2VDMB 1OAOC 2YVUA 3FCCA 1NBMA 2YWDA 1RI3A 2FPWA 3QFFA 1DQRA 1W73A 3BSFA 1D03A 1V5FA 2HREA 2BEVB 2RHCA 4X44A 4LFBB 2Y1LA 1CRWG 2I34A 3IELA 4NIMA 1Y80A 1FRQA 5FHRA 5ELMA 3EPJA 1J6UA 1PL0A 4LDJA 1CUZA 4DV3B 1I2BA 2ZUUA 2E5LB 3AKDA 1DBRA 4MUKA 1YV9A 3DOOA 3H0KA 4FMDF 4IJ5A 5JW6A 3ZHSA 3C5EA 3NETA 4AUEA 1HX7A 2GBLA 1QSGA 5IFKA 1D6SA 4EO7A 3NASA 1N9GB 4LHYA 4BC0A 4F7WA 1POXA 3A6KA 4MO9A 1E94E 3GXOA 3HI6A 5F1PA 2N1MA 4I5FA 4PC7A 1GTG1 3U62A 3OPMA 1S6YA 3ZZNA 3WGNA 3CPEA 4BV9A 3V9PA 4DLTA 2HNKA 5JWRA 4EPWA 3NFRA 1PR9A 2FXIA 4TMVA 5FOUA 1DQYA 1R4MB 5EGSA 1KK0A 3HFJA 4EYGA 4MEJA 1FSGA 3QITA 3QJYA 4DLZA 3HKEB 4Z2AA 3IVMA 3LPCA 3RQIA 3NORA 1TTHA 5BW8A 2OBFA 4B31A 2V55B 3EGOA 4MPDA 5FOSA 3OPNA 3LKVA 1PGPA 2AOTA 2B6HA 1NY6A 3HUTA 1ACMA 2UUPA 3E9NA 5KWSA 2GLTA 1BHSA 2WUWE 4J0FA 2WSLA 2RCNA 1AQ6A 1YCHA 1N3IA 2QI9F 3L77A 2WU8A 3GHHA 4DYDA 3TVDA 1U0GA 4OHXA 4DMFA 5AI4A 2IOYA 3CISA 3W6NA 1DG1G 4YUYA 5HOEA 4EF5A 2KE5A 2PBRA 1J9EA 1XQ9A 1W46A 1W59A 3NCHA 5ITWA 2VBIA 1GKKA 3MGBA 4ON9A 4MCJA 4QG3A 4HDSA 3T3PB 1M83A 2F3UA 1TM2A 1UPTA 4KIJA 4YQFA 5B3JC 1C8KA 5JFTA 4X65B 2VSNA 4EA6A 5GZ6A 3PPXA 3ER8A 1E5LA 1GG2A 3QMWA 4MS4A 4S35A 4U2GA 1YL7A 3CSUA 3U9LA 3B1KA 2PUFA 1W75A 1PR2A 1EZZA 4K6FA 4M8KA 4QQKA 4R3NA 1TTTA 1M33A 1Q14A 3TQQA 1XXHB 3ZZMA 2H7VA 3M2TA 5AM3A 5A6SB 3HLYA 2PWYA 2NGRA 2HDOA 1F7VA 3ESRA 3JY6A 3DOJA 4UUNA 5BSGA 1JIKA 2BY4A 2N3ZA 4JITA 3HU2A 4BMVA 4WOCA 4PZYA 2CDNA 1PN3A 1U1IA 2I5PO 4RPLA 3V8VA 2RAPA 4KIGA 2EERA 3KWMA 1SXJA 5H16A 2P8JA 4DQKA 2QYTA 1VLMA 1BS9A 2XA9A 2SECE 2AG1A 4KDEA 4DCJA 1ZGCA 1P2DA 1UZUA 3PDCA 3WLHA 4A2WA 3PJEA 1D9ZA 2ODBA 3EVGA 4WOJA 2AUNA 4GBGA 3QFTA 1DXYA 5GIPE 3WIVA 1HEIA 2JFHA 2J3QA 4CM4A 1RDFA 4OY3A 2BDTA 4G1VA 1N6OA 4N8DA 1XRLA 4O4IB 2QL5A 3QVGB 4KODA 2IHZA 2J6BA 1ORTA 1V1MB 2AZ4A 3DPUA 5DLDA 4BMPB 3FUTA 5BSWA 5GVSA 2QJTA 2BPOA 2GNAA 2Y4NA 1SCAA 4J6EA 4BRSA 2GYVA 4WASA 3K73O 1AK1A 2VF2A 3EDRA 4I3HA 4D4GA 1UOPA 2JBAB 2ZP1A 2QT0A 2Y0BA 5A0VA 1SEPA 2DKNA 3BOSA 4FLMA 4OXQA 5B6PA 2ESRA 3OPVA 3RRZA 4M0PA 1EVYA 5FTWA 3LPLA 4DR2B 2VP0A 2I71A 4X0EA 3RASA 2OG1A 4ZU6X 1VM6A 1DBSA 2P3LA 1H8HD 2IXAA 3GH3A 4V24A 3IEUA 4AUNA 1F8UA 2W43A 3D4NA 2AEFA 3P20A 1C0LA 3WGOA 2VBCA 4DUZB 2F00A 2EWMA 4G36A 4Q9LA 2G04A 5A5FA 3TTXA 1C8VB 1W9HA 5KWIA 3MPUA 1UJ2A 1Q0ZA 1T6ZA 1HYBA 2QQ5A 1A7KA 4U9UA 3MCAA 4Y2UA 5A1TA 1HK7A 3MQ2A 3PE3A 1M67A 2YQ5A 3I8SA 2WD9A 4Q4HB 2NM0A 3CUYA 4AY4A 2YQ4A 3CEJA 4LV8B 2YH2A 1UKZA 3CZRA 2X3YA 3FNFA 1G8SA 3BD7A 3WY9A 1D0IA 2I67A 3L7IA 4WY2A 2AJBA 4YMIA 4RD4A 3QU9A 1T6BY 1E7QA 4D9BA 4FYJA 4KE8A 3CT6A 3BE4A 4GXNA 3SX4A 4Z4GA 1ZGHA 3PL5A 1I2MA 4D4MA 3PI6A 2ZDQA 4K05A 4BQOA 3PF9A 1YT5A 2XB4A 2B61A 2Y6VA 2N75A 2NG1A 3EGDA 3O6VA 4B8ZA 3L0OA 4XYBA 2RK4A 3U4QB 5CCBA 4HTAA 2AUTA 1P0QA 1UBUS 1IHDA 1AM4D 3AYXB 1VBFA 3K2EA 4MV1A 4C4TA 4BQIA 3DNMA 4ZK6A 2PS1A 2PNJA 3BDIA 2GF0A 2CFTA 4KIUA 1X92A 2YYSA 1FP1D 1NNUA 1WSDA 2EBUA 4PZPA 4TMFA 1OIWA 2PX8A 4TSKA 4TVOA 4REMA 4OGLA 5FAKA 2OILA 2R97A 1QR2A 1Z0ZA 3DTTA 4GKBA 5E95A 4L5IA 2X5NA 3TINA 3V2HA 1YB6A 4PPNA 5LXTB 3GI1A 2C59A 2GKSA 3BQ9A 4RA6B 3T9CA 4C3OB 4XJTA 4MWDA 2MHCA 4RY9A 4H4EA 4GOMD 5DHFA 1ZO8A 3DDOA 5JS6A 5A2QA 3OWOA 5L6MB 5E7JA 4B6EA 3K6RA 1NTRA 3ROMA 1JIQA 5EIBC 1ZMXA 3EDYA 2RAFA 4YB8A 1ELOA 1JR3E 5E0OA 2VJNA 2WIFA 1ODTC 1XRPA 2BKEA 4GLOA 1T6NA 1UIRA 1NR5A 2XCIA 3IP1A 3LXMA 4NYJR 2HXSA 1WMEA 4EFLA 2WIAA 3GLIA 3HDTA 3AGQA 4BYGA 3HKDA 3GVHA 3GRRA 3OE7A 2Y9MB 3ELUA 5LYJF 4TOIA 1R0YA 4LC9A 2CLIB 1STOA 2D5CA 3UCXA 1KWGA 5TX7A 1JEQB 3DOEA 3F5FA 4Z4FA 3KKEA 3R0IA 3W5VA 5ALGA 3ZWWA 3PG5A 3TQSA 1NBIA 2UZIR 3W05A 4KZPA 3I9V6 3MWDB 5EPOA 5TPWB 4YLGA 1XVTA 2XCOA 1U6IA 1B8OA 2BZGA 5PGMA 4RTQA 3R6WA 1U2GA 3S28A 5LJIA 2UVPA 4R7GA 4HWGA 5FPSA 2OBXA 5LNK6 2X5XA 2YJ6A 3FHCB 1JDPA 3FUVA 2VP9A 1XV5A 3SZMA 2A0UA 1YU9A 4U3JB 1WQ4A 3JQFC 3WV5A 3BWYA 3CTPA 3CXUA 3NP7A 4L6CA 3RVNA 4E5UA 1H5QA 2XV1A 4IEFB 4G26A 5ALUA 4BPRA 4F0JA 5GJBA 1QH1A 4Y18A 5FEUA 3S6JA 4YCNA 2D5BA 1A4IA 3AO0B 4FONA 3WWEA 3RAJA 1W85A 5IT9A 1Z5GA 5FLXA 3PGVA 3RKUA 3C1OA 2MYTA 2QTHA 3Q98A 5EZYA 4V1CI 5HVNA 1JJAA 2P9BA 1DRWA 4INJA 2W22A 1VBNA 4J4BA 2GXQA 4IDGA 3REOA 1UBJS 4CMAA 2H5JA 4GWKA 2RGAA 3H19A 1CW2B 2VUTA 4PZZA 5ES4B 4RF2A 3MGCA 1IPHA 4GX1A 3SYTA 1WMAA 2XDWA 3OT1B 4BFXA 1Z39A 3OTIA 3ABSB 1S8OA 4TKZA 2J3DA 4E5DA 2IS6A 3F71A 3EIEA 2IXGA 1E6CA 2XUHA 2WWXA 3K0EA 4H17A 4TV9F 3IP3A 1L9XA 3T34A 5LQDA 2PUDA 5KYUA 3LX5A 1J2JA 1U5BB 1SBTA 2GETA 3JSAA 3Q3HA 4IIFA 4X54A 3SSAA 5KS2A 1Q19A 4LXTA 1YI0A 4HGZA 4RD1A 2DH5A 5FWDA 1BHO1 1IU9A 3I73A 3V32A 6YASA 1ZU4A 5SV2A 5ICFA 4ZYLA 1FB5A 4OSEA 5ENVA 4YLYA 1BCSB 1KYZA 3NHFA 1H8EA 1XFAA 5KNBA 2HQOA 3BCUA 2QD4A 5FOXA 5JVDB 4QZVA 1Z16A 3HJAA 4U7FA 7MDHA 1WMSA 2O05A 1OFGA 3M5CA 4EFDA 2FN3A 4N48A 2VJBA 3ENZA 4GZ5A 4RK7A 4EW2A 5F78A 1IY2A 3N8KA 4KNWA 4TRNA 1SK9A 3REGA 2FN4A 1FTWA 1V11B 2QMUA 3UT6A 2HHAA 4JYZA 2VP5A 4KKXB 4G56A 1KDPA 3L05A 2ZSJA 2YRWA 4BMYA 3FKSD 4L7QA 5AYVA 5IANA 5AKGA 4JC8A 3HDGA 1AO3A 1G20E 1Q7TA 1UKEA 3CY6A 5K5EA 3A4VA 2HRBA 2QMOA 3DLTA 4IPTA 4XR9A 2V5AA 3UXHA 3HLKA 3CG4A 2A9FA 2XQVA 3C15C 3R7LA 2WG0A 4ZDIA 2PH3A 3ID6C 2BGNA 2QU8A 4K6CA 5ISMA 5EHIA 1GT6A 1QHSA 1RC8A 1JWLA 1T5SA 1J8MF 1PQ4A 2QZSA 4IDHA 4PC3A 4XCXA 3WB0A 5CLHA 4O63O 4FNMA 5B7NA 1W4LA 3V8QA 3L49A 4B09A 3CG0A 3W5SA 1M10A 2XODA 3GRCA 1G4AE 3INYA 3KHKA 4IJUA 4CM8A 2PUCA 3F3KA 1DKOA 1IHUA 1NFQA 2KBFA 3TLJA 3WGVA 3BS4A 4AS3A 1C9DB 1U2ZA 2HD4A 3DWIA 4LWOA 4CGYA 1N6LA 1WP9A 2CCGA 3FIUA 1FRFS 4RS3A 2IHJA 4XQGA 3VX4A 3P9YA 1DOAA 4FGJA 1CD5A 1JH8A 1G64A 4G67A 1OAKA 4MQEA 4KYIB 2FMIA 2FWPA 3N2NA 4JDPA 3R3XA 5KYYA 2X8WA 2A33A 2Q3DA 3GGDA 1GITA 2EXXA 1CZNA 2PTGA 3IV6A 3PT9A 4BAZA 5ELXA 1I7LA 3OAAD 4HDKA 4M76B 4XX0B 4CE6A 2EP5A 1XVVA 3IQXA 1GSOA 2J4DA 3MWLA 4URZR 2QLBA 5IS2A 4NMWA 1PS9A 1U3FA 1ZPDA 1UM8A 4HF7A 2MINB 3B1XA 1REQB 2PHZA 4K46A 1HLDA 5AUOB 2IBSA 3PRKE 5DGHA 3EAGA 3AOGA 5ICSA 1NP3A 4WNIA 1MFZA 4KLCA 1UWLA 1W6RA 3VH1A 3ZXXA 2HUPA 1G5PA 4O4HF 2VJMB 2WU3A 4MPRA 4RQUA 2JGDB 1PDVA 1IN7A 5FB3A 4EZBA 3ZVNA 4Y1GA 1PWYE 2Q28A 3BBLA 3H2JA 4L5AA 3MTEA 4DILA 3O0DA 1NI4A 5AESA 2FOIA 3D7NA 3U37A 3TR5A 2EYQA 4TKVA 4EUEA 2O07A 1ESDA 3KT8A 3LY5A 4RM3A 3VC2A 2DSNA 2H1FA 4NEGA 4RD0A 1EM8B 1CP3A 1QHHB 3HCBA 4NU0A 4TLDA 4EKGA 1J0BA 5LP6F 1GJRA 2QGZA 3WGKA 4MZDA 2EJUA 2ZCUA 5IEBA 2RKWA 3R76A 1JPVA 1DKNA 1P2FA 3UMFA 1ZIPA 2E37A 3O21A 3W2HA 4J1NA 2C5HA 2V7VA 1CZKA 3NR2A 4A1OA 3COSA 3IEMA 3C3AA 2OXCA 1HOXA 2Y76A 3NT4A 3VOAA 1XQWA 1N2JA 4C7OB 4H3HB 3SJ7A 2C9CA 3DE3X 2BE9A 3AR8A 4L8FA 2XDYA 3F7MA 3E53A 4RVCA 4ZYZA 5D00A 3K4QA 5ALDA 5TQJA 1M5RA 1CR2A 1QPZA 1CRZA 4YJFA 5ETJA 2XUIA 5J2TF 1MBZA 3WV4A 2PZMA 1DBVO 4GYWA 4KAXA 2WM3A 3E48A 4L72A 3RIGA 1MAUA 1FX0A 2IU0A 4UEWA 1J2UA 4EUHA 2ZUFA 3MJTA 4MVXA 2PPLA 1AV7A 1FYWA 1Z6ZA 1ZX1A 3PIDA 4BCBA 4J1SA 1P4RA 2H9YA 2JEOA 1VOTA 2O2EA 2XEDA 4HGNA 4BX8A 4HNHA 4E5YA 4BGVA 2PRKA 2K87A 1MJFA 3E81A 1DJLA 1P81A 1V7CA 3C7TA 1BN6A 4FW9A 1EK6A 2FPUA 3CLSD 2A1TR 3F8WA 4OLHA 4CDMA 2IU6A 4QGFA 1V8OA 5KDOA 1N7IA 2H4WA 1V47A 3FBTA 1R4AA 1XL1A 1DO0A 5JIBA 1OTYA 4QNMA 2K2WA 1SVSA 1DIRA 5KNCA 2J4FA 3RYIA 3MOSA 3IA7A 4TWIA 1GKIA 2J1LA 2B5WA 3OFNA 4HUQA 2F8LA 4O1HA 1QFMA 4XIIA 4D3DA 1TU4A 3F3SA 3KELA 3COVA 4IEIA 1U2DC 1RXWA 5K6AA 3AFHA 1RR6A 1P1JA 3DTVD 4J8PA 4TTAA 1J56A 3E82A 4P3NA 5UKDA 2X5JO 2XE7A 3A9SA 2OG2A 3OZFA 4CODB 1MRSA 1USUA 1JEDA 4WCDA 5CW2A 3EFOA 1CUBA 3FPAA 5BVGA 1K3UB 4NQRA 2BGTA 2EHJA 3A36A 1E2GA 3PJGA 3NKVA 3KOYA 3F5DA 2R6JA 3T06B 3TDKA 4P3KA 1FBTA 2A5LA 2WWWA 3HCDA 1SZDA 5DHAA 2WVAA 2IW3A 2O06A 1WVGA 3DBHB 1F51E 1KOJA 1J21A 3ZYZA 1LKZA 2HQRA 5IVDA 1XZAA 3KOMA 2WJ3A 3MTAA 3C3YA 3R5TA 2GGSA 3EG9A 2EV9A 4CG0A 3EXG2 4DDHA 5BOSB 3HXOA 3U5ZB 4W5WA 3DTVB 4F4FA 2OHIA 4G4SO 5EG5A 4CGZA 5IKOA 2PD6A 3ELWA 2ZJ8A 4GOKA 1A9SA 4NECA 4RELA 4U6QA 3W6PA 2EGGA 2QTNA 2A1UB 5AK4A 2FW9A 1SZJG 3N8GA 1GY8A 1WD7A 1ESCA 2XY4A 4BXOA 2B3DA 3ZHCA 4LA4A 1UZMA 1M34A 3T7CA 2JJ2A 4BLQA 1WZ2A 1ORRA 4J3FA 5KSZA 1YZ3A 2A9PA 2IL1A 3WGUA 2FWIA 1J07A 3L2OB 3IVRA 3LKDA 4XEUA 3IP6A 2HX1A 1H1LB 4PTZA 4MUNA 4TKUB 2O7VA 2XRMA 4S05A 2NSJA 2QL7A 3FGZA 1II8B 2FWNA 2HCFA 2JKYA 3B2EA 3GFFA 3EUFA 3JQ8A 4CUZA 2GXAA 3KDPA 2YKGA 1YUBA 2WJWA 4OHZA 1QKIA 1G19A 3ILYA 3JVVA 4ED9A 2GX6A 4D8YA 1JXOA 2OENG 4G4IA 4HXYA 4OLJA 2J6HA 3VMFA 5C4IA 4NI5A 3QEAZ 2GJ8A 3RFXA 1S9DA 1CEQA 4B79A 3GJ6A 4QC2A 1WCIA 2EFJA 4C76A 4REOA 2PRJA 4E5NA 7REQB 2PAAA 1PX0A 3K1TA 3CWCA 2VZLA 2FPIB 3GP5A 4L4RA 1NF2A 1SEVA 2CLSA 1UAYA 2ISQA 2F3SA 3ZJTA 3HEAA 4RPCA 1T4DA 3G7SA 1W35A 2A9JA 3HABA 2IH2A 3K9GA 1C3LA 2O5RA 1DZIA 1PFKA 1HDIA 4OYYA 4FI3C 1BGXT 3CNOA 1DJOA 1N92A 1YNOA 3TNYA 3CEPB 3LU1A 4YXFA 1VB5A 3KCNA 3JU3A 2IYOA 1NIJA 4OM8A 3EVFA 1J8YF 3ICEA 4Z1MD 1E92A 2RE8A 5EWLB 3GXBA 3HUFA 3UFBA 3QXSA 5P8WA 4QJ3A 2ASVA 5K3CA 2CCKA 1S02A 4GDMA 3ONVA 3TQCA 3B1YA 1OZFA 1DNPA 1S9HA 3HQ4O 1Z6PA 2QSUA 1V9CA 1USWA 5HTKA 1C9EA 4BBZA 2VSOA 1NNEA 5G2OA 2CW5A 1Y6JA 5HM8A 3E9CA 3MRXA 4UTOA 3PYLA 3FCSB 1N75A 2R11A 4D80A 5KUTA 1RAHA 2PZEA 3HCNA 3BWMA 1ZJYA 3ET5A 1WHSB 2HYDA 2VRBA 4HLCA 4L16A 5G4LA 4LKOA 5F77A 2JLZA 1Y48E 3HH8A 2IYUA 521PA 3WIEA 3EPKA 1G66A 3EYAA 4Q4JA 4EG1A 4MGIR 1X74A 3FHTA 1LLUA 2AK3A 4UHBA 2GK6A 4MWZA 4KLZA 3FJ1A 2WG1A 2QIPA 3DUFA 3LWNA 4P3XA 1K4KA 4U00A 1PFQA 1ZIYA 2O8FB 1V1JA 1VSQA 1Q91A 3Q1LA 3EMDA 1BOOA 2WVJA 2YV4A 3BJEA 4IJVA 3OY2A 2WKPA 4JLOA 4BJ3A 2NYAA 3EXHA 5DGDA 3WBKA 3ZVKA 4O4LF 1O08A 1CUSA 1H2BA 1D4OA 2VO1A 1RRFA 3H9GA 4XUCA 3ZV3A 5EVCA 2Y1FA 2JFPA 3ZW9A 1JA9A 1LVHA 3AP3A 1S2IA 3FI0A 2ZI7A 3WLMA 5BUQA 1Y1RA 4OQFA 5E6SA 3THWA 2F8SA 3R6GA 2XF2A 5FUQA 1YVRA 4C3VA 4ZRMA 1GWNA 2QG9A 3RS5A 5EJ9A 1I6MA 4E5KA 3H65A 4LWZA 3Q3GE 1TK3A 4QOJA 5CNMA 1L7PA 2YWGA 3RYTC 1F0KA 1FDSA 1S8AA 1P5HA 3M6IA 4YAGA 4PR3A 2HMAA 3ZNPA 5F5LA 1V16A 5JHHB 2I55A 1L0BA 3EZLA 1EH5A 2JA2A 4KVFA 4Q00A 2G72A 2OPBA 2QE6A 2PH5A 2DQSA 3QJ5A 4CYMA 3NDJA 4B4UA 5AVJA 3HCFA 3IAUA 4NC9A 3GJ5A 1ZDMA 2HBZA 4FDTA 1Y8RA 1SOMA 4ETMA 1OPRA 4IHAA 3K0AB 2GOYA 3AZPA 1RRKA 1IPFA 3PQ2A 4O5OA 2OTCA 3VOBA 1U99A 2J9XB 3HU5A 2Q5IA 1VSUA 4H15A 1AXGA 4KPYA 1U0EA 3IAXA 3Q5DA 4A0RA 3E18A 4QPPA 4HLQB 3S2EA 1QCYA 3ZZ1A 1G5RA 3QBVA 3FMFA 4EK9A 5AMXA 1E3SA 1NQTA 1X19A 5HCIA 4YAWA 3I5YA 1UOEA 3JYQA 2ZSBA 3AJAA 3N6RA 5LQSA 1J39A 1QU2A 1O87A 1TJYA 3QXJA 4FSXA 2PZJA 4IGEA 3RVDA 4CV1A 2K2QB 2NW6A 2G88A 4RACA 4PSDA 2WTEA 3MCUA 4MYHA 1JH9A 3KVVA 3QHAA 4W9MC 2NXCA 2D4AA 1D04A 1B0ZA 1MTZA 1EHCA 2HSDA 3MRTA 3ZDAA 3WRYC 3MWGA 2D1FA 3GMIA 3I52A 4ZVNA 2I2XB 1S2NA 2PQMA 5HUJA 3JD3A 2VH2A 1QE0A 4MV8A 3WO1A 4IRUB 4IWYA 3VYUB 4PSAA 1L4EA 3MQ4A 5FWYB 4KO3S 3AVUA 2YBEA 3NDRA 4EYSA 2WC1A 4HJXA 4GXRA 3LTEA 4PNHA 3T99A 5IYZA 3FYCA 5I7RA 5ERGB 2DFKB 1RXYA 2JPDA 1GPMA 1JHPA 3HWRA 4CLXA 4WKGA 3RU2A 5EJGA 2XGGA 3F7TA 3D8BA 1UC4B 2IY9A 4PCAA 1E2HA 4QULA 1A9ZA 3KR9A 1F14A 2HK7A 4UC0A 4D4KA 4R9UC 2HRRA 1TZBA 4N7BA 3TDNA 4PLPA 1PNOA 1MW8X 5LKAA 5LM3A 1E3IA 3THYA 2JGJA 1E1RA 1O9HA 2HK9A 1IY9A 1HYHA 1YS9A 1KWKA 1U3GA 5CMLA 1JR3A 3AXTA 3CF2A 1ZOSA 2FW7A 3QLEA 1C0IA 1NNI1 1Q3TA 2QX6A 1XMIA 4HBZA 1C3OB 2C3MA 3ZW8A 3VGPA 3R3WA 1AUPA 3BYZA 1UKVY 2VHUA 4HWKA 5KTMA 1BVHA 2HLPA 5LOVA 4QYMA 4Z4EA 1U2TA 2ENUA 3H2YA 2PXHA 2Y05A 1J0EA 1YCDA 4CLDA 4N3NA 3S2YA 3O8RA 1AKTA 2EQBA 4MR7A 5IG2A 3OD1A 4FOLA 5FYQA 4CLRA 1SD5A 2C7BA 2GYYA 3EC1A 3UUEA 1HDYA 4X66B 3DBVO 2LR0A 3ODPA 4O0MA 3SHQA 2GYWA 2PS3A 4X90A 5EUQB 1UQTA 2H4XA 4J7CA 4Z9FA 3WKCA 5DBOA 3ADCA 3H5NA 3M49A 4F5ZA 1XLTC 3NT2A 1SCQA 3I53A 2O0MA 4II2A 2XIJA 4DCVA 4OB8A 2VNAA 4RESA 3RK1A 5I7VA 3GR6A 3RTBA 5H4HA 4EY7A 1Z6GA 1P1HA 2V9PA 2XCSB 1I0ZA 2XNJA 5LZ2A 5FT9A 2EW8A 1FMFA 3C39A 1AHNA 1XQYA 3GA0A 2D6FA 1Z3IX 1FFWA 1CDZA 2VN8A 2WK1A 1XD9A 5K3EA 5KYKA 1ZJ5A 1NNSA 1RQ7A 2GHRA 4MARA 3MCZA 3CRZA 3MQFA 1UMBA 4Y2TA 1QDUA 4FMCF 4P84A 3ZV4A 4XQ0A 4OGFA 2OESA 4PANA 1UWCA 3TW6A 3W3AH 3N1UA 2IZZA 3L3BA 4MR9B 3G5UA 4KXMA 3W34A 4C6SA 2AX4A 4XQEA 4QL3A 4R0MA 1QKKA 4G24A 4Y2JA 4EB6B 5LMNB 4JLUA 3D81A 4IL5A 3ZWQA 4PQRA 1LBQA 3SDSA 1P6UA 2P5SA 1J5XA 8ADHA 2ZRAA 2E82A 3KALA 4LG1A 4J2TA 4TKMA 2QR3A 2Z6VA 1JE0A 3E9ZA 3KKKA 5HEKA 5CFZA 2VCEA 1ITZA 1TM5E 1Z0UA 2EFDB 3H1BA 3G1TA 4G0NA 4JP2A 3KX2A 2QN9A 4D82A 3HG7A 1KYQA 2KS6A 3OCVA 3LAWA 4RNDB 4XPIA 3NXKA 9LDTA 4IV0A 3ESCA 3PGMA 3TLBA 5C81A 1T8RA 3DZKA 3IMFA 2WSYB 3NWOA 4HX2A 4AJNA 1ZSVA 3G2PA 4J7XA 1L7AA 5LR6A 3E27A 2V98A 1ZGJA 3QE9Y 1Y9EA 4WV3A 4Y9SA 4KR2A 1JZSA 4JQSA 2IELA 3K92A 3B3JA 4ZV7A 4KE9A 4MDYA 2PUAA 1ECJA 1XCJA 2WFZA 5SYMA 4BAGA 3EVEA 2YUTA 3DOFA 4NCIA 1C4KA 4L8YA 2XADA 4CQJA 2I4TA 1EJ2A 3U3RA 2NXWA 1IMJA 2BCGY 3EEFA 1VMEA 1MF7A 2HOQA 2YJTD 2YS7A 3LD9A 2CDBA 4GM4A 2N0SA 3SHFA 1G20A 4F91B 2FX3A 1AIPA 5LQUA 4AQ7A 1EXDA 1LV8A 1DT5A 4BP3A 5LU9A 2H0QA 2XPCA 4TLBA 4E21A 1U4OA 2BDEA 3GO4A 2G07A 1M76A 1MOQA 2JANA 1FVOA 3C6KA 3E7PA 4OI4A 2WSSD 1Y1KE 3K9QO 4MI9A 5K3OA 1TA4A 1ESMA 1KVUA 2XHZA 2EFYA 4UHDA 2P7IA 1CXZA 2AOTB 3JZAA 5BN3A 3GRAA 2JLYA 2NP7A 4QYXA 3F9IA 2B98A 3CONA 4DLPA 2DR2A 4WESB 3T7KA 1HTTA 2PX0A 4NV1A 1E5DA 3IKTA 5H0IA 3U3JA 1COWA 4R0NA 2F1KA 1N5IA 1VDZA 4O5AA 4TXMA 2FOLA 5A0FA 3FCOA 4P80A 3ZLBA 4GP6A 4GC5A 5DE3A 2PLNA 3MMZA 4AN1A 3HC7A 4XD7A 1CKEA 3ZKAA 5CT6A 5BSUA 1XJ0A 3W5HA 4EW6A 4JJ4A 3LVRE 4HDOB 1LK0A 5TMBA 3VXKA 2AG8A 3I01M 4CMGA 4E0BA 1HC7A 3LC7O 4MS4B 4X1YA 1HURA 2Y9PB 1EQ2A 1NBHA 1DCFA 4NOKA 2O6LA 2HA3A 4QUEA 3RSGA 2BHNA 1K63A 3PKIA 4D4LA 3V34A 1E1CA 5L3QB 1F6WA 3H3FA 2P2GA 3KB1A 3B3AA 3EFHA 1PL6A 4MB0A 1GUZA 5IH7A 2G9NA 3L01A 2QUZA 4OBEA 4WKNA 4HMPA 5FYDA 1V96A 3D9QX 1DHTA 2IXDA 1BE0A 2W2TA 1R18A 3IQHX 4QLOA 3BRCA 4QTTB 4AULA 4M9ZA 2WJGA 4M98A 4PPYA 4BFLA 5BNFA 5B1EA 4FEAA 2QMZA 3SS9X 2OV1A 5T7BA 4UW9A 3V3TA 3IOMA 4X20A 1KQGA 1DAOA 1XZLA 1RM5A 1QG2A 3ASVA 3QKRA 3UK7A 5JD5A 3NTRA 3ZKWA 2D1QA 3MCTA 1NI3A 1Y1SA 5HMMA 2GEKA 3NONA 4FVTA 1RKBA 3HL4A 3R7SA 1KI8A 5AJXA 4QYSA 2FE1A 4CT0A 4JLKA 5BUSA 3D43A 4YP0A 1U65A 4ME6A 4W9RA 4YRAA 3CLUD 3DL7A 3OCUA 1I4WA 3I6ZA 4B3RB 2W98A 3CFYA 1KDZA 5CFLA 3F6RA 1GTZA 4JXJA 4UNNA 2P75A 4IHJA 2DPGA 2XVXA 3P8ZA 1MIOB 4HRYA 4I4NA 4LNAA 5E7IA 4KN8A 3KHTA 3P0EA 2NVUA 4D9KA 1RFGE 3O26A 4CDNA 4DABA 2JJYA 1Z9BA 2ZEJA 1YNSA 3B9QA 4UULA 3JWIA 5DEOA 1BS2A 1KJJA 2BV3A 2NNWB 1SELA 3B20A 3EQ9A 1R6AA 3KYBA 3OMLA 4FTWA 4HADA 1GTSA 5IMBA 5JPIA 4EA7A 2OZLB 1KYVA 4LYFA 3RWOA 2BAGA 2YWXA 3RS7A 5CCEA 3ASZA 5EQJB 2A5DA 5A3RA 5CFMA 3KV1A 4FBLA 2PWAA 4DAEA 1PR5A 2AQKA 3IB6A 3KPJA 4WOPA 4DV1B 2MSEB 4PYIA 4WK4B 1Q20A 5B64A 1WMBA 1JDBC 1R5JA 5C31A 2AN3A 3OLZA 5SZJA 5ECDA 1UL1X 4PM4A 4KQCA 4L3VA 2RB4A 2FB9A 3IDQA 5JECA 1W93A 2BFCA 1T4CA 1XNHA 1XU7A 3UAVA 4F4HA 3ABRB 1YMQA 3MELA 5KYGA 2YV5A 4EMSA 1WUIS 1O0SA 2AK2A 4ETNA 1M1YE 1XMVA 1UBSB 2R86A 3A4MA 3MTBA 1TGVA 2ZS8A 3RC8A 2CNKA 2YL2A 4ND2A 3BORA 2XDAA 1AGPA 1XD2A 3ZDXB 4V2IA 2R85A 3ND6A 3D4PA 1P9NA 1K8RA 2EL9A 4ID9A 3RI3A 4QD3A 5CRIA 1I7SB 5DNYB 1YRQA 1WMFA 2Y2UA 3T1QA 5JH7F 5CK5A 4Q1FA 4CJXA 5AJYA 4DZTA 4ALNA 4GMDA 1HDRA 3GJQA 4QM6A 1ZS9A 1SHZA 1T0PA 3VV2A 1DFIA 5JAHA 2ACKA 1H4QA 4WZBB 2F4VB 1KAHA 3KNZA 5L8VA 1YR6A 1RAGA 1NP6A 3L9WA 2AJDA 1ISFA 2HQSA 4WKCA 2OFXA 4KWHA 2TRSB 4W7SA 1YULA 1TM1E 3F9CA 1RWWA 4PSKA 4HVCA 2C83A 5JJCA 5EIEA 2DFLA 2J32A 4ENUA 3HO1A 1XELA 1V7PC 1FFAA 3D0RA 5HF9A 5JNRA 2VTEA 1TTQB 3LRTA 3GNQA 4CXMA 2WWIA 3GCWA 5DB4A 5TRTA 2BMEA 5HSGA 4YGXB 2JNWA 2AEMA 3A2KA 5ADVA 4PVDA 3ZE7A 5JYCA 1N5KA 1KEPA 3FF4A 1JMVA 2VDQB 3PJRA 4ZYTA 3PC8C 3R3YA 1YZUA 1R4NA 5B58C 5C1OA 1J0XO 1YA6A 1O6BA 4YUWA 1XAGA 3Q7EA 4DIMA 1XDZA 1PF7E 1YHNA 2AMFA 1NJ6A 5EQTA 2CUZA 3SZUA 4BLRA 3J81A 4JBXA 3K0FB 4HLDA 1KMIY 1E1NA 2WT4A 2X0IA 3RYHA 4BVAA 2C4TA 3CH6A 3JQRA 1LXCA 5E1DA 4Q5IA 5GONF 2GRUA 4MUAA 5L7TA 2RGUA 5CJ2A 2QX9A 1K5PA 2PUBA 3B6EA 5H5JA 3TUIC 3JWGA 3TZ6A 5DCYA 5F1OA 3WL8A 2R8RA 4BE4A 1CUHA 1Z25A 5H80A 3A3KA 3DYIA 3O8QA 2A9OA 2XXJA 3OHMA 4KUHA 3Q88A 4F72A 4HTFB 4ZTUB 4HWRA 1UBOS 1WE2A 3PVSA 3VPSA 1PNTA 2RGCA 1QIIA 4GPAA 2BGLA 3T5BA 4M0CA 5IJZA 6LDHA 5JCOC 2WZBA 3LHSA 4IF4A 1Q16A 4ZT7A 3UKJA 4GWLA 1NOJA 1YL6A 1JDTA 1SU6A 3CH7A 1IOLA 3WLTA 5LQNA 1DDOA 4RJTA 3UQZA 4ZHQF 2FPRA 2JVIA 4HQ6A 2ON6A 2ODAA 2W6JA 3LBIA 3T3IA 4CNBA 1U7WA 2QUAA 3LYUA 2BGJA 4WFQA 1V71A 3V7FA 5J4LA 4DV4B 4FHFA 1DZ3A 1LW7A 4UCWA 3P2EA 2I3ZA 4DEXA 1F8XA 1ZY2A 1TZMA 2HJRA 3BK2A 1AKWA 3CXRA 3PRHA 1G0NA 4GI5A 5CA0A 4DUPA 2C9YA 2AGVA 1L7VC 4E4RA 5KYUB 5AXCA 5CAEB 4FHEA 1RWVA 1BO6A 2A2ZA 1U02A 4OM7A 1L4BA 1TCUA 2QW1A 1ZOPA 5F21A 4RJJA 1Q21A 1SBNE 2FHSA 2LBPA 4DANA 5B30A 1JTEA 2IY7A 2Z9DA 3FDFA 1MA0A 13PKA 4C2TA 2OYSA 1ZR2A 4QTYA 4L8GA 2A1IA 4DMLA 2DWOA 1R8YA 1E58A 3OO1A 3UV6A 3K0SA 1PQWA 1NLZA 2EG5A 4JEIA 4MOWA 4Q1CA 5DT2A 5FDFA 4F4CA 1CJMA 3ROGA 4XR4A 3S2UA 3LF2A 5HQ3A 1SG9A 1Q3KA 4RXUA 3AUFA 4AX8A 1BS1A 1OI7A 3O84A 5JTUA 3TCXB 3TECE 2C4NA 4UTVA 1T1EA 4DVJA 5BT8A 2G4VA 1MH1A 1FLDA 1PK9A 2P2DA 1IE3A 1K8XB 4ZANA 4MPJA 2BGIA 4MVYA 2J7PD 4O4JF 1ZOIA 2QD3A 5ARCA 5G4KB 2A94A 4X8MA 3S2IA 4CR6A 2WFAA 4FN5A 3LGAA 1NXSA 2WVHA 4KQMA 4URYR 4K0RA 1V4VA 3VTZA 3WFZA 3DL2A 5KOIA 3DO5A 2VCYA 4Y98A 2WFMA 1BDBA 1LZKA 1KZ9A 2W71A 1P2BA 4G97A 1FU8A 1Z0AA 2LDBA 5HF6A 3PV0A 4NBNA 1ECFA 3IT3A 3P0RA 2XMSA 4MHOA 3TKYA 2BM9A 5HHTA 3WQQA 2VUUA 2YICA 3KTAB 4M6WA 2HLDA 5J2UB 3PENA 4RSRA 2W2VA 1IXSB 2O54A 1VI6A 3CRQA 5EIBD 2X3FA 3A0UA 4B2PA 4O08A 4AJIA 4YRGA 3P2JA 3ZE9A 3ML1A 4DCGA 1MKYA 3U7QB 3I2JA 3Q6IA 3QE0A 4E13A 1N1GA 1YOBA 3NBMA 2P9CA 1SQ5A 2QTVA 4PG5A 3KXPA 4X3CA 2P2SA 4CKCB 1KI9A 5KSWB 3SF0A 4WQMA 3EK2A 1LWOA 2C7QA 2JFBA 5D3MA 4OHWA 3V1LA 2PJUA 2W90A 1A2BA 3ZV5A 4Z1OA 4OPMA 4OMFG 2PYDA 3DPSA 4EITA 4JI8B 2FWMX 3VJRA 4YRIA 2IODA 4EG5A 5KQSA 4M0FA 4W8HA 1DAEA 4BO0A 4HH4A 3AEQA 3AOEC 4EY4A 1LPAB 5CNJA 5DYGA 3RVKA 4AQDA 5CB4A 3RU7A 2VJCA 1Y4DE 5AKZA 4DDKA 4O29A 3NRBA 4A2CA 1G6Q1 3HEBA 2RONA 4UHKA 4AKSA 4QKQA 2LKDA 1AZLA 2H2AA 3P94A 5FXMA 4IG4A 2FNAA 1EX1A 3MBKA 3NTQA 4FWBA 4A23A 4BLVA 5C37A 5CFNA 1SKBA 1O6CA 3H1EA 3OZDA 4JUBA 4F93B 1T25A 1ZXLA 3ZD7A 4PLZA 2CFSA 1IEWA 2E5FA 1EUCB 3ESDA 1PEDA 1FFEA 3NYRA 4FYVA 4OHFA 5ECWA 1SXGA 5TS3A 1ESZA 4KV9A 1VSVA 4MRPA 4PZCA 2QZZA 1DC3A 1APBA 3DE4X 1CULC 1OA0A 5JDCA 2WI8A 2A86A 1XMJA 2UYGA 2O0KA 2GF2A 4KGVA 2XKBA 5FTLA 3T5TA 1IZYA 5KSPA 4Q34A 4FZ3A 3A27A 3FMOB 3TM4A 2PKEA 5JY6A 1KVSA 1NHGA 3F0TA 2OGZA 3DMTA 4ZVUA 1GU0A 3LYLA 2NO9A 5KYXA 4IVPA 1FVHA 1YQQA 3NP9A 4YI3A 3L7NA 1KDOA 1MORA 5JZBA 3SE7A 4DBLE 3A70A 4D5EA 4PN3A 1SFRA 2XB9A 1JFTA 1XRNA 2P90A 4GXQA 1DIGA 4J4HA 1T0JB 4QX6A 2X14A 4MIKA 4DJ5X 2YOFA 3VV3A 4NXNB 1K7SN 2ZROA 2WP8J 4HYEA 4RFSA 3RBVA 2G0AA 3QH4A 4EY8A 5ERYA 3TTTA 1EAMA 4LJYA 1UC9A 3EWIA 4FFPA 3ZIAD 5A0TA 5KNCD 4JXKA 4KIFA 1C3JA 4AN4A 4DLXA 4WE3A 3G6WA 5C7IO 2J9YB 5F9HA 3W1WA 1T6YA 2W6MA 2A58A 2XD4A 4IDDA 1Y3IA 4KR6A 4W7IA 1PQYA 3AR7A 5JSZA 3W2EA 2HK6A 4TUYA 3R20A 3ZDYB 1DC5A 3LT4A 4YBZA 2J33A 4HEQA 3Q4GA 1RHJA 2EKBA 2XKJE 1DCTA 1GLGA 2GSWA 2OAGA 1CB7A 4MH0R 1UKAA 4NSNA 4PPFA 5C3MA 2QT1A 2BEKA 2YUIA 1RZRD 4LQLA 5A4AA 3MJEA 4FFOA 4KPEC 1KQNA 1WKCA 3ANYB 1M2OA 4DUGD 1C7QA 1DJQA 3SE0A 4BN0A 3VNVA 3C7DB 2O8DB 3QK7A 1BEZA 4WBSA 1HUQA 2R2GA 3AJRA 4OTZA 3AETA 2OYCA 2QYOA 1A7UA 2V59A 3MINB 1UZLA 4MZXA 5I9MA 3WSWA 4BNYA 2YDYA 3K5WA 4OJKA 2QZPA 3RYIB 9ABPA 4AZ3A 1CQJB 4A0HA 4BTLA 1PEAA 4MVJI 1Y5MA 1YR1A 1KP2A 1KI2A 1DIAA 1E98A 3I9V1 4LHEA 2DTDA 5I6DA 2CLLB 2PGXA 3ND9A 4F96A 4L5JA 2BHTA 3X2EA 2CFRA 1HR0B 1OSNA 1O94A 1UJNA 1IMOA 1X1AA 2C4HA 1I1HA 2FQWA 1KI7A 1N8KA 1R6TA 1XDWA 2GBCA 2WHRA 2ZJZA 1XK6A 4H35A 3KR0A 4MAAA 1UBNA 4YRLA 5DIZA 5LNK1 4RTMA 4QUDA 4A8JA 3NBUA 1JG3A 2P4SA 2CWWA 4PONA 3DLBA 4LFAB 2XA2A 1JEEA 1V1RB 1A2OA 3CS3A 1P77A 1DV2A 1KBZA 2XQGA 1VI2A 2ZSUA 5IDYA 5IAGA 4EKDA 4D96A 5CEJA 3U16A 2WQ7A 4WA8A 5AVSA 1L4GA 3NKLA 5DX0A 1ZHHA 3F98A 2OD2A 4HLNA 1KZHA 4DIDA 2BEUB 2HJWA 2OECA 5EQDA 4P2BA 1TB4A 4R40A 3QPWA 4O4IF 2ID9A 4BWGA 1SBZA 1TZJA 3B5EA 3NFYA 1R9NA 3HVIA 4RSHA 4B3BA 4KBFA 5B6IA 2JZCA 4UVDA 4F1KA 2BMFA 3SVZA 3K1AB 4UTPA 3SZLA 2D54A 2JDID 1JTVA 3AONB 2PEYA 4WCFC 4JR0A 4PINA 1N0UA 4U02A 3T7AA 4FOSA 1NUQA 4UAGA 4Y0AA 2I4OA 4K6HA 3VH3A 1OLUB 1QGAA 4N3CA 4ENVA 2XTJA 5CHEA 1UBFA 2IOFK 1PJRA 3NI2A 4I8XA 3QUTA 1PG2A 5KTTA 2ADFA 3DM9B 1WP4A 3FR8A 4PLHA 3AR6A 2Z8ZA 1V41E 2C96A 7ADHA 3HDYA 3FFAA 4UBMA 4K86A 4EWLA 5IZCC 1GCIA 1Z07A 2R48A 4EMUA 1KBQA 5MFZA 4I46A 2ZRGA 3ZDEA 2JJ8A 1J7JA 1JF8A 1N6HA 2W4IA 1NMZA 2EQ5A 2PU7A 3ICVA 3F97A 3LUCA 3UCEA 4YYZA 1SKAA 4WK2B 2X0KA 1C0EA 2QM3A 3LBFA 4A9AA 3BF8A 1RCTE 4HZIA 5FTMA 3E1GA 1UMCB 3MERA 4N7RA 4K1XA 2Z2YA 1TAGA 3GF4A 2Q4TA 3MFYA 1H4TA 1LH0A 3CLTC 2A0FA 4HNUA 5JMTA 1K5GA 2IPMA 1EA5A 2FP3A 1P75A 3A1TA 3KSUA 1GRRA 4G1BA 5AW5A 2PSFA 2Y6UA 1DOHA 3AV0B 3EZYA 3FZGA 3O5AA 3B7WA 1GG9A 1XZ8A 2H1LA 2ZQYA 2ZT6A 4NK5A 2C2WA 5FUXA 5TT0A 4CTJA 4DSUA 4MS3B 4N5HX 4P82A 4ZU3A 4UXJA 1LD3A 1VKRA 4TLAA 2GERA 2EKQA 1Z37A 3FSEA 1IRXA 5JYDA 2VTKA 2DJIA 4WFJA 4C0LA 2ECQA 4YAJA 3B6JA 3O8CA 1GUAA 2YHBA 4LY0A 4ARBA 1EM6A 1RHKA 4Z4QA 4RHCA 3DBLB 2AOUA 4G5FA 5EMNA 2B1GA 2CXOA 3BTUA 4JR2A 4GVPA 3TBFA 3W7BA 1VIMA 1A96A 4LXHA 2P5YA 3I2GA 3C48A 1X8JA 3BSSA 3QENA 3I37X 4HS4A 4OP2A 2ZYAA 2FLWA 2GN4A 4FHCA 4YRFA 2VPTA 2Z3ZA 4MPPA 1IBSA 3LH5A 5F7JA 5LXTF 2GN8A 1I4LD 5AHOA 1U2GC 2CEKA 2WYOA 1OV6A 4KG7A 1KSGA 3HP7A 1DWPA 1JG4A 2PRZA 3AW8A 3DMRA 5AH0A 2QYSA 3NRCA 3UMVA 4DWOA 4QJBA 1WDMA 4C7VA 1XU9A 1PJ2A 1ZW6A 2OWEA 3CCBA 2R7AA 3W3AA 1BHQ1 2ZIFA 4FYXA 4RXTA 4RA9B 4Y6QA 3RV3A 4EB3A 2ZZMA 1Z18A 3DMFA 1FEZA 1KF0A 2HU2A 3EBPA 2R4TA 3LNCA 2RJ3A 4KCGA 4U6SA 4WBNB 4R1PA 1Z4MA 3GA7A 4HDNB 4HFJA 4EQ6A 3FSGD 4OX9B 4RAOA 3QOXA 1GZ3A 3DUFB 4F2PA 1E64A 3DEJA 4ZKEA 5KU1A 2J3JA 5KYNA 2QVYX 3LJKA 3KJIA 4ZAYA 1U0FA 1Y8AA 4IVNA 4GL2A 3DW3X 3GYBA 2BBWA 1ORWA 2YRXA 1L5HA 3RBXA 1PG5A 1SXIA 4TM8A 2ARKA 4GYKA 1PZXA 5M29A 1QIHA 1QQ7A 1GNSA 1RIFA 2FP4A 2WUGA 2CXSA 2ES4A 5D3ZA 4DL9A 2MSWA 2C77A 4YO7A 2WV9A 3CTMA 4RIIA 3GFQA 1P2SA 1U4NA 1JSLA 4NESA 1E2JA 3E1KA 3HBNA 3ORSA 4K5QA 5BORA 2XCQA 1ORIA 3GUYA 2UZAA 4MYCA 5IC5A 3A2MA 3D5TA 4UMVA 5CT9A 3P5SA 4ZVQA 3T7RA 2OCAA 4A92A 4D97A 4DS3A 2ZBGA 1TX4B 3STVA 2UYCA 3DUWA 2D7JA 3O1JC 1V16B 1SUEA 1JXQA 5CCXA 2W7TA 1FS6A 4RV9A 4E31A 1Z4JA 2FPGA 2VHQA 1XTTA 2W6NA 4XJVA 4UQLA 3X1JA 1Z75A 2OWDA 2YWBA 4JI5B 3E2IA 1N1MA 4OHVA 3EYWA 1ZIOA 3GRUA 2P6PA 3ISVA 4H7EA 1DQZA 4K3VA 3MLBA 2AB0A 1L4MA 2GD6A 4OMUA 5DNWA 5F1KA 1YI8A 3OIDA 4Q3BA 4U7HA 1PL7A 2YN0A 1SY7A 5AI0A 4BP9A 4YJGA 4UBKA 1P1IA 2VYVD 3B6MA 1UMDB 4JX9A 5E1BA 3R0ZA 5DMHA 4MYTA 3UJAA 5A04A 2CFIA 2CY0A 2QZJA 1E66A 2VBFA 2L42A 3TIVA 1OXVA 3DNFA 2FUKA 3T54A 4B2IA 1KK1A 1SCUA 1AUVA 3GFSA 3MHTA 1GN9A 3TX6A 4YCJA 2JHFA 3UJ7A 1H6BA 2B21A 2IHNA 2VPIA 2R5WA 2FCRA 5EJ5A 1B8NA 4KQFA 1UJBA 4AJJA 4M87A 3W6OA 3Q8LA 1WSWA 1QIGA 2ZZKA 1Y6RA 1EMDA 2ZBEA 3KPWA 4IH4A 4LC1A 5AKHA 3G5TA 2BLNA 3VFDA 5JVDF 3NWPA 1THGA 3QA9A 1TF7A 1C3VA 3NHLA 2O2ZA 1ISHA 2IIVA 2DLDA 4N03A 3I5MA 1OVMA 3OM9A 1WF6A 4E1BA 3OX2A 2HZBA 2JIPA 4EFMA 1USIA 3WHIA 1M1YA 1O95A 3IODA 3LLVA 3NGMA 5CDSA 2QQEA 5DIFA 3WYAA 4WAUA 2R0QC 1SHKA 2EU8A 4H6PA 2CDCA 3R7WB 1JR3D 4G5RA 4LVUA 4MR8A 1S3GA 3JWHA 3SOZA 4DQLA 1AQJA 2B36A 2O8BB 4G23A 3BILA 2HWYA 3DYBA 1CP2A 4REQA 2BUAA 4L0DA 5K3BA 4R41A 1LDMA 3OZWA 2BZSA 3KQSA 2O1SA 3VR5H 4HPXB 4KX3A 3QU2A 2FRXA 5KOHA 3ZE6A 4NS4A 5DU2A 2GPSA 4PAOA 1LSUA 4TWAA 1DJPA 3GDWA 4FCTA 1WA5A 3LL4A 3JQAA 4Q03A 2I54A 3QGMA 1KS9A 1UC5B 2W0SA 4YN3A 1S4QA 1GAWA 3SYLA 3ZWCA 4BKRA 2NXEA 2XWBF 2JCSA 2V5UA 3CZ5A 4BO2A 4D26A 1K86A 2CMHA 1ISSA 1YHZA 3D6MA 5TSDA 5K2MA 1GPKA 4LKRA 1UP4A 4E03A 1WUJS 1BA2A 1B76A 3AX6A 3F6EX 3P0IA 4HAIA 4S2EA 3VYSB 2R8ZA 1RADA 2VOJA 2BMVA 2Z1MA 4FQ7A 5DOVA 2FJ0A 2PZGA 1PJQA 4UEJA 3DE2X 2H4FA 1RWQA 1Y1TA 1I30A 1JRLA 1Z4PX 3WA6A 3H2BA 1E2KA 1KIMA 2F3PA 5LYJA 4MR7B 1N78A 2D1SA 4CLRB 2QMEA 5EMJA 1RAFA 3AKEA 1E4YA 3V7NA 1GPUA 2EBHX 4X1KA 4OD0A 4Q7KA 2XXAA 1G2OA 4NFYA 1M8JA 1X3LA 4WY5A 3O4IA 2ONJA 3WLNA 1NMQA 1FQOA 1KXZA 1NRXA 1QX3A 3W4KA 2PVPA 3L6BA 3DE7X 3S4YA 3SIWA 5F9MA 4MI3A 3EVBA 4NL4H 4ZEMA 2BM1A 3U4DA 1X3SA 5BV1A 1FK8A 1MUUA 3K5IA 2P4EA 1JA1A 3I6YA 1SCDA 5ITSA 3IVAA 1QANA 1PIWA 3HA5A 3L46A 1JIXA 1YB4A 2QWXA 1OROA 1NGSA 2H5EA 3CCCA 4GD3Q 4RDIA 1PJLA 2QTWB 2GM4A 2YHIA 3FW1A 2REOA 1BQEA 2OB1A 3R5FA 2NZ2A 1T1GA 5EE5B 3WTBA 2B92A 5F7OA 1ADGA 2UYOA 3PGJA 3EX7C 1TO6A 1HKUA 4LTNA 5CITA 2OHGA 3DGEC 4RYLA 3WICA 1Q2XA 3D6NB 4URHA 2H85A 2XRFA 5EJ6A 1YVEI 2ZRFA 2JZNA 1A4RA 1KJNA 3STHA 1FL9A 4AWAA 1H2ZA 3HCAA 1FXSA 3LOQA 1PSDA 1Q3HA 3BTVA 4PE5B 1WM1A 1RXCA 3DONA 4BKPA 5BPHA 1ETHA 1ONNA 1WXXA 1FUYB 4QA9A 5KB3A 1YD7A 3KU4A 2EARA 1W36B 2FEMA 1IBRA 4EB8A 2CUNA 3LUBA 2OMKA 3MWEB 4QICA 4TV9A 3OIWA 4IUBS 4RFLA 1YMVA 3BF7A 3AU9A 3HACA 3TW8B 4AXXA 1QR6A 1K7FB 2C7GA 4QVIA 4YAKA 1ZU5A 3FNQA 4IIXA 4JIMA 2ONYA 3CVJA 4QOFA 3NT5A 3WWDA 1PV2A 4BUZA 1GA4A 1A9XA 2JI7A 3I6QA 3ZHRA 5ITZB 5JZVA 3HYRA 2GZRA 2X4GA 4BV8A 2APJA 4ISCA 4M1SA 3AMVA 2ETXA 1T9HA 4AD8A 4URUR 3FYSA 3JRWA 2HL6A 4A8TA 5IBCA 5B2FA 4YRMA 1S2MA 3TI9A 2RD2A 1J09A 3NS7A 1RPNA 3RHTA 4BNMA 3K1YA 4LHZA 4MS1A 4PHFA 4QFBA 1P61B 2NP6A 3D8NA 4F04A 2IPXA 3KL4A 4WADA 4FXPA 1JAXA 1E7WA 1OX4A 2AN9A 1T0HB 2DBRA 1WZUA 2GEBA 2JLSA 4G86A 4HR7A 5DDIP 3LY7A 3VR2A 3WE7A 2XT9A 3ZV7A 2ZWPA 2JFWA 1E7MA 1HDGO 1FUKA 1B2LA 1WWKA 2CVPA 3E9EA 1TNDA 4RANA 2UYQA 1XVIA 3T4XA 2VWHA 3VX3A 1P4GA 1QIJA 5J3JA 4PX2A 1EGAA 1YZVA 4I5DA 3M6FA 4BLTA 1Z68A 3H05A 3WL6A 5DWDA 4AJLA 4Z7JA 2OZVA 4J0HA 4P4TA 3JQGB 5EJ7A 2BISA 1K27A 1U28C 4K6KA 2ECPA 5E2AA 2HPAA 2W2XA 2JW5A 4I1RA 2H65A 1FMJA 1NE2A 1W4ZA 1DO2A 1F4VA 3LKBA 3VJLA 4WIAA 3FR7A 1JBQA 3GAAA 3ZY6A 3MBOA 3J7TA 3T4UA 4LQDA 4N01A 4N0EA 4DXAA 1BTOA 4IQ4A 3A14A 4HVLA 3H5LA 5BW6B 4LJ6A 4QUJA 1I2AA 4KR7A 2VDLB 2JIDA 4BZQA 4CQMA 2VRNA 1JWBB 4LI3X 1X1QA 3I2IA 4E5VA 1HE3A 3VVCA 3ABIA 4MRRA 4RTJA 1JLMA 2E18A 2JGRA 1SB8A 4B47A 1TU3A 2TMDA 1Y1QA 3CJQA 3PQ5A 1Z6XA 4NMLA 4ZREA 4MVWA 5JS8A 1PJAA 2IITA 1WR8A 3OTGA 3R9WA 5DV9A 4RZIA 2IZ0A 1VJGA 5D5QA 5HK8A 1GDHA 4Y1RB 4AW9A 1IONA 4BNFA 5DLEA 4BCDA 1QNLA 2WJYA 5CDGA 2VDWB 1M8PA 4TT3D 1Q0HA 1ZJJA 3GPBA 1L5QA 4LGYA 5ALQA 2GZDA 3KZNA 4DR1B 3KTDA 3OECA 2O2SA 3BD8A 4NBWA 3AEKA 2E2WA 5ILGA 2X42A 4J4TA 4Q93A 1DEAA 2GR9A 3IR5A 4QHTA 3JTEA 3ZY4A 3GT7A 2LZ0A 2DT8A 2A8YA 2A88A 4FP9A 3V33A 3HDQA 3WFIA 2GZSA 2C7VA 3P2OA 1IXYA 3KUUA 4O4HA 1V6SA 2FUNB 2E85A 3JQEA 2ORVA 3JD1A 4G9GA 4DJAA 3EPLA 4MQ5A 3VR3A 2R1TA 2IT1A 4QBHA 4G01B 2UUAB 3ABOB 2WAYA 5TXGA 3ZDCA 5LZ9A 5EJFA 1SA0B 2E55A 2I9PA 5I9TA 3JAMA 3HVJA 2GCPA 4QLAA 4FPXA 1WXGA 1QAQA 3DV0A 1N5RA 4K8OA 4KE7A 4MQ4A 2BSAA 5LP6A 4CMHA 4RK4A 2OCGA 1I3OA 3C5WP 4JXZA 5DGIA 1GGKA 2GXUA 4G41A 1XQ6A 2OT3B 3TOSA 3R23A 2DGDA 3AHHA 1RSZA 2VPWA 4MQUA 4RD3A 5EUCA 4ZZ1A 5ALLA 4M1MA 1CUGA 3H2ZA 4HZUA 3BEDA 1LF5A 4HD8A 2CXXA 2HEGA 1OPXA 2R7MA 3TB4A 1TEXA 3L7CA 2Q3LA 4M86A 2QJWA 3U44B 5BN4A 5K0GA 5J2TA 3CRVA 2JIMA 3NHBA 1DKUA 5TPZA 2Q46A 2IDJA 4IKEA 3KQUA 4ZFNA 4BUCA 4J29A 4OYLA 5DO9A 2AFIE 4MW6A 1Z2CA 3R5JA 5DI3B 3V6MA 3M81A 3N2LA 5GAJA 4BNXA 3HCEA 5JCPA 1IN8A 1L5WA 2A78A 3EXHC 5IJXA 4NJMB 2KWIA 1XGKA 3RG8A 4OI0A 4B43A 1CJSA 3PNOA 4N7JA 4AG3A 3OQIA 1VE5A 2ZDGA 4KQ2A 2WUDA 1WPQA 4XGIA 4ZCMA 2HV9A 4TRMA 1D3AA 2RGWA 1NJFA 1TYCA 3BN3A 2RI6A 1BYUA 1DX4A 3COPA 3SPXA 3QHPA 2DQKA 3IKVA 3TLCA 2G80A 1VLQA 3OCCA 4ARVA 1LK7A 1AMUA 2HW8A 2P9ZA 4XGQA 4ABYA 2C2ZA 2D13A 3STWA 1LQUA 3LHKA 3ICOA 1XR3A 1PZHA 3I01A 1AMNA 4KFUA 2BFBB 3HZOA 1AH2A 2RJOA 3DCNA 3TRJA 1Y6ZA 3DDSA 4AUMA 3P4XA 2HF7A 3F8TA 1F4PA 1KPIA 4PN7A 4FLEA 4J91A 2OFWA 1W52X 1TCAA 2SNIE 5E6UA 4IOKA 5CA1B 2Z30A 2IUUA 2QX7A 1QFXA 1GSAA 1Z28A 1WO8A 3TUJC 2FETA 3KQNA 2HPHA 1BDHA 1FMTA 2ANCA 3W78A 1T8TA 4RIEA 1T34A 1WB6A 2PGIA 1S3SA 5ICMA 2Z2IA 3UMCA 3GLIE 3UT5A 2D3WA 2C2KA 4KOAA 3OM8A 1Z8FA 3EZ2A 1P4AA 1EFVB 1E18A 1QGED 1XPOA 1MU0A 4S0XA 2Y1XA 5DHPA 3ICPA 3VBEA 1L9KA 3CLHA 3TVTA 1CZOA 1PR3A 2EX1A 2WD7B 3HO8A 2IPOA 5DRYA 5HP4A 1D1QA 2V5VA 2ZTHA 1FFHA 3HDVA 2XE8A 3UBMA 3I09A 4Y6RA 2Y66A 4YAUA 1U3UA 4GMFA 5KZMB 2X8BA 4JUDX 1K7YA 2J0VA 4BLWA 4W1SA 2WU4A 3LCJA 2GARA 3EEBA 3MF4A 1X7GA 2MSLA 3TQRA 4RX1A 5LWQA 1TW2A 1M8GA 1JT9A 1JG1A 1K2VN 1RQGA 1SQ0A 4JBIA 4R8RA 1WPRA 2IYPA 2JD1A 4F1WA 5AKEA 5C8XA 1R0SA 1CB0A 2GCGA 3EARA 3GG2A 3MWJA 1MJGM 2AN5A 3N59A 1ZUD1 4Q9AA 2X9VA 1FDVA 4N7MA 3E5RA 4GBED 4ENTA 1NC1A 3IVCA 5BQPA 5PNTA 3VU8A 3RW9A 4F9FA 1EGMB 1O8CA 3U7FB 2OGTA 1ODJA 1JNXX 2SKDA 3FNGA 2C1ZA 1RKQA 3N70A 5THQA 2R5NA 4Z0PA 4C7JA 1FRVA 3ED1A 2JLWA 3EF3A 1Y7LA 5K2OA 3PE6A 4GPZA 1AKVA 3D6HA 2WWHA 4MKFA 5GJCA 2FWJA 1GKUB 2B25A 4GS5A 5L4SA 4BNIA 2FRVA 4N6NA 1IJBA 4PZLA 2XRZA 1X1EA 1F3OA 2NN3C 3NIWA 3JARA 3HVRA 3ZDDA 3WQHA 1OCEA 1PTJA 4QTZA 2XNHA 4XQCA 1SZPA 4YMSA 1U8FO 4NV3A 5BO5A 1FPMA 1PYOA 5BQ5A 1OFIA 1X80B 3KB8A 3PUVA 4LDPA 4D9MA 4QRIA 1TO1E 3AUSA 3R4CA 3RRJA 1XZCA 2ZIZA 2QM8A 3C3DA 4I99A 3FFWA 3RBAA 3K16A 3O74A 1Z6AA 2YYAA 5CIYA 1V3QE 3CVWA 3R9XA 4EENA 1AT1A 4DG8A 4U7GA 3MZ0A 5DTMA 3BFPA 4DDWA 1HG1A 2VDNB 5SZKB 3HKBA 5A3JA 3T1VA 1HSZA 1HLFA 4P54A 1KDTA 5CLGA 5CT5A 2I62A 1Z82A 3ZHUA 2P3SA 2VK2A 4HV4A 1WXHA 4A91A 2PX4A 3TSCA 1NN5A 2X0EA 1DGQA 4K9SA 3R1IA 5DCWA 5FLKA 2BKVA 1AQLA 1Y33E 3H04A 3LRXA 3VPHA 3UJNA 1Y8CA 3V3KA 3H9CA 3T94A 3TZEA 1G3RA 4AP9A 4PRKA 3UC5A 1W5AA 3OU7A 3R0VA 4EUSA 2ZRMA 2WIBA 2QQGA 4IRXA 5CYPA 3TNDA 1KOLA 3O4JA 3WNQA 2JCBA 5TMPA 4G0MA 3PQDA 3T41A 1KQFA 2H51A 1VCIA 1V39A 4PHGA 2W6IA 5IK2A 3UW1A 2OQ2A 4MP3A 1WW8A 4PG6A 3VAAA 4CL3A 3H5OA 1DIOB 5J9FA 3O03A 3CO5A 3RAGA 5DWQA 5J4VA 5ENZA 3NJRA 4HI0E 3TGPA 1QE3A 4XAQA 5I01A 1GPJA 2F9MA 3D8HA 1EWRA 2O1XA 2WTBA 1DG9A 1CRPA 1FS4A 2X23A 3JQ9A 1JDBB 1U7ZA 2M98A 4OFWA 4B74A 3TUZC 4KFCA 3ANSA 3KTOA 1QFSA 1I2CA 2X2PA 3KE8A 4AKIA 1DL5A 2Q4DA 3FHLA 1PDOA 3C6XA 3UHJA 2XQKA 1NUAA 4GSLA 4PYNA 4QUKA 3SQNA 1J1ZA 3TIXB 4L0QA 3ZHZA 1X7ZA 4JBWA 4O4LA 2K4MA 2X22A 4KREA 4XWWA 3F8SA 2BF7A 4GRIA 2WYHA 1EFTA 1RYNA 2O57A 3KJZA 5LZ4A 5JNUA 3GVIA 5GV8A 2CKDA 3BMOA 2ERYA 2A3NA 1JIIA 1QB8A 1D9XA 4QM7A 2HCJB 1ZONA 2VXOA 2GVZC 4EHKA 5TGDA 1TFUA 5EA2A 1AA6A 2H1IA 3UGKA 1H69A 3P2IA 3M9XA 1H2FA 5M04A 3HP1A 2OXRA 4UD6A 5DP2A 2B7CA 1MOPA 2EJTA 2EYUA 2O4CA 1FSSA 3TSZA 1IAQA 3FOFC 4LYHA 3O9MA 1A50B 1GEEA 5EJAA 4CCWA 4KOEC 5ESDA 1VJ0A 4A10A 3OQHA 1AGRA 2IS4A 2X6RA 1NURA 3CM0A 5FJIA 2AMVA 1D2AA 3FOCA 3PITA 1YIAA 2NLOA 1H94A 3BERA 2TSYB 4YT4A 1QRTA 1FP7A 5AOBA 4IGKA 2DPXA 1ISIA 3IDAA 4D79A 2C8VA 4H3KB 1RYZA 2FQXA 1Y7TA 3KZKA 4L51A 5E9JA 2XKKA 3DP7A 3QLVA 1JN0A 5B7QA 3FM9A 4C06A 3PPIA 3ZD9A 2Q6KA 3NNSA 3RWBA 4KJXA 4XSGA 4I9HA 5EEHA 4OXXA 2FMHA 4IIUA 1J9GA 1GL9B 2PMKA 4JKOA 1P73A 2VP6A 3QU7A 3BCSA 4Z49A 1MC1A 3CPHA 2FAXA 4JP1A 4HDMA 3SD7A 4BKOA 3FYUA 3TFQA 1Z35A 2VTVA 4L2IB 2GCOA 4MUYA 3M6XA 2PZFA 4O8CA 5DF1A 1F2VA 3MIIA 5JAPA 1LUAA 3AG6A 3G0OA 4MHSA 2IUYA 4MLCA 1CJUC 3GDOA 1TJPB 3WSVA 2BGGA 1LTHR 3WX0A 3AH8A 3D2AA 3ZVMA 5I5GA 2WJZB 3QPDA 1HYQA 4CLEA 4UZFA 4DWVA 3BFJA 2P9GA 3D8TA 2JLQA 4A3SA 3G9XA 1R5BA 2BLLA 2DJ5A 3DT9A 1RW4A 3G2HA 4RY0A 3ZJYA 1BMDA 4Z3OA 4DR4B 3P0HA 1D4ZA 4OP1A 4RFVA 5HNKA 2JAXA 4BE7B 3S8EA 3Q9NA 1W25A 1X94A 3PLAE 1DWUA 1C1HA 3E9YA 4ZYWA 4AMZA 4DR3B 4DV2B 4ZVTA 4AJ1A 1XE3A 4GRAA 3IXQA 3SJZA 4L5YA 3QJGA 3TOXA 1ZCAA 2I6UA 1GZ4A 1U3VA 1VKNA 1Y9DA 3BTSA 3ONNA 3ZWBA 1KAOA 4B87A 4E4TA 4ITRC 2JI9A 4ZT2A 4IWNA 4NEQA 4TUYB 1P9WA 2OXIA 3EIHA 5CBPB 3EXEA 3OFKA 4LVOA 3LXUX 1YI1A 4ZC8A 4JN6B 5F4BA 4RU1A 3GNSA 4YUXA 5C5DA 2WKSA 2P0YA 4RK5A 5I7WA 2XZOA 3ETGA 1U2PA 2L82A 3NQ41 1TYEB 1JYFA 4KNVA 5THKA 4DMRA 3RTGA 2AI3A 3VSDA 1VIYA 5IXYA 5LZ8A 3ZBUA 1WOMA 5IDVA 3RO7A 3DWEX 4S1PA 4V0LA 3AM1A 5C51B 1M72A 1S2DA 1TAQA 3INNA 3E8MA 2A5GA 3LLUA 4S1WA 5I9NA 4PTLA 1EFUA 4JYAB 4C0XA 2W4QA 4OVKA 1C3EA 1V35A 3KD3A 2WUVA 2BUCA 5HFJA 3EGXB 2WB4A 2QB5A 3LUHA 5EIOA 4LF9B 4MRMB 3TL2A 3HM9A 1HNWB 1J2TA 4BU0A 2XE6A 1MO5A 4O59O 4JEUA 4XOIA 5SY9A 1QIMA 2V7UA 3QE2A 4DRYA 1IEXA 4ZJUA 2PANA 1Z2EA 4NCKA 1H42A 1LY1A 4GYJA 1QU3A 4B40A 1XXHE 4CF7A 1P8JA 2OV8A 2C2GA 3MILA 3O92A 4BC1A 4TLEA 1OBCA 1EZ4A 4U5QA 2QR5A 2VEDA 3HRHA 1JDZA 2C0PA 5CVJA 3N86A 1JYEA 1DQNA 2SCUA 1TT5B 2I7CA 2ODNA 5EGNA 2RJNA 3AI1A 5LA6B 3USCS 2BEWA 2ILVA 4JDUA 4OH1A 3T7IA 3TIFA 1ZJWA 3PXEA 4B6GA 3GFBA 3A6JA 3N0WA 3P9KA 1E2PA 3LPDA 4QARA 5F2EA 1HNXB 3KT3A 2P6OA 1JLKA 3FNHA 4PG4A 5D6NA 1FQJA 3BD9A 2XUAA 3COZA 1Q0PA 5HKOA 2C2OA 3NGXA 3BEOA 3ACBA 2FZWA 1UM9B 1HORA 1IDOA 3G3EA 2OP1A 2ZUTA 3ANTA 1HLPA 1QM5A 3PFHA 4BNDA 3E05A 4IFEA 4MDEA 3VR0A 1MGOA 5FULA 3L6DA 5AUQA 1L7MA 3SF8B 1E9SA 4D5GA 16PKA 1WV0A 2HBRA 1PJ3A 4M53A 3RVBA 3PR1A 3D7LA 4QHYA 3VR5A 5IVKA 2ODQA 2ZB2A 2B6NA 1NQAO 1PT6A 3M4ZA 3LDUA 3TQFA 3U3OA 5D84A 5DCLA 5DPMA 3NXSA 2IWRA 1SKYB 1UH5A 2ZJ3A 5IJ0B 3CVXA 5KVQA 3KQTA 1XJWA 2YASA 3H4TA 3WO0A 1WZNA 2NUPA 3DCYA 1RQ2A 2NO1A 4NULA 2JH8A 3KLOA 1D5WA 3NX4A 4OQEA 2E1RA 3TEJA 1FP6A 4M9RA 1TXGA 2X1LA 3WYEA 1OH5A 2E48A 2ZK7A 1NPYA 3R5HA 5JWOA 2JKZA 2Q9BA 3DMNA 4GQBA 3G5AA 4JGGA 4UTNA 1AB5A 1E5TA 3LLCA 3ZBQA 3RKSA 3WQSB 3D5QA 2OO5A 2ZAIA 4BFTA 2ZB3A 1A1SA 3BZWA 2FPPA 3ZWAA 3AY3A 5DH9A 1MXFA 1ZOLA 4R2MA 3UICA 3VZQA 3RADC 4G07A 2B83A 4LC0A 1RYFA 1Q7BA 2FSGA 3FKJA 4OQQA 1KE1A 5KBYA 1IB6A 3JRXA 5DW3A 4DQ0A 2PEZA 1VJ1A