1M5UA

Crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
123
structure length
113
Chain Sequence
TKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTAIRGGCEAYISKPISVVHFLETIKRLLERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, cell cycle
molecule keywords cell division response regulator DivK
publication title Crystallographic and biochemical studies of DivK reveal novel features of an essential response regulator in Caulobacter crescentus
pubmed doi rcsb
source organism Caulobacter vibrioides
total genus 35
structure length 113
sequence length 123
ec nomenclature
pdb deposition date 2002-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m5uA00
1DZ3A 3MF4A 1ISSA 2QVCA 3CLKA 4G0MA 2PE5A 1YMUA 1TVMA 1DBPA 2JVIA 2JVJA 4RU1A 1B00A 4G0XA 3EULA 2R47A 1QQAA 2FMFA 1YK1A 1BDHA 1TM2A 5BRAA 2CHEA 4HNRA 2MYPA 4HNQA 3SM9A 1EFAA 1YS6A 2WMYA 2HPHA 3RVOA 3HDGA 4KZKA 4MPTA 3OLYA 8ABPA 2OQRA 3OMXA 3MA0A 5TPWB 4FB4A 1NTRA 4XLTA 1YK0A 3H5VA 3QELB 2FLWA 2MSLA 1GUBA 1ABFA 1Z2DA 4RK0A 4Q6WA 3IP5A 3Q41A 3JY6A 1RXIA 4MS1B 3FGZA 2WRZA 3A0RB 5FWXA 4EYQA 1ZAYA 3RH0A 3RVPA 4Z4GA 4W5QA 5B3JC 1DC7A 1QP0A 5JNWA 1NXVA 3H1EA 5D2CA 5EWLB 1LJLA 1GCGA 4EY3A 4KREA 3QLVC 1C4WA 4N47A 4OTZA 1JFSA 4G97A 4LDAA 4IILA 4XAQA 5TQ2A 3C6QA 1FQWA 1YVUA 5KC8A 4EUKA 1ZGGA 3QLUA 1URPA 4OATA 4Z4CA 2MSKA 3CZCA 3N0RA 1SD5A 2PAFA 3KS9A 4KRFA 1HEYA 5FWXB 1UDRA 1AB6A 4YLEA 1PEAA 2FXIA 3TO5A 1MB3A 1Z18A 2E4YA 1T34A 3I09A 1ZVVA 2PJUA 4Q7EA 2PUGA 1U2QA 5TQJA 1YIOA 3ILHA 3P9YA 4E7OA 3FFWA 5C5EA 1BVHA 1OXKB 4F3TA 3GRCA 3JPYA 4PYRA 4XASA 3OO1A 2NZUG 4MRMB 7ABPA 3RVRA 3LOPA 1NXWA 3KLOA 3KKEA 2E4ZA 4N03A 4RK6A 2GWRA 5TQ2B 5BRJA 1M5UA 1I3CA 1RNLA 2J48A 2GI4A 5IULC 2B1JA 1EAYA 5JS1A 3ROFA 1ZN2A 3OQOA 1JX6A 1JBEA 3MYYA 3OM1A 3G85A 4KNYA 1EWTA 3LUJA 3N0XA 3NNDA 2YHAA 3A3KA 2PUDA 1QO0D 3HCWA 3OO0A 5JS2A 2NUBA 3N75A 5KQLA 1XHFA 2JVKA 3HXMA 1QP7A 3CRNA 1ZHHA 3LUFA 3O21A 3OLVA 4IMJB 1JFTA 3NHZA 5JNTA 3F6PA 3NHMA 1GUDA 1JH9A 1ZH2A 1NXSA 3H5WA 1D4ZA 3T6KA 2DRIA 1M2EA 2JBAA 2VUIB 3CNBA 3O2QB 2MYNA 4O5AA 3O74A 5JNSA 3F7NA 4ML3A 2LP4Y 3HVRA 4YS6A 3H5IA 4RXMA 4PZ0A 3A0UA 4MR7A 3HZHA 1RXEA 2CWDA 2FMKA 3JVIA 3C3KA 3KG2A 3QEMB 4JA2A 2R48A 3LUKA 9ABPA 5HQJA 4JOQA 4JAVC 1L5YA 1JFVA 4RZSA 4IRXA 1K68A 1W25A 3N0WA 4YCSA 2NT4A 2RGYA 2HQBA 2QZJA 4Y9TA 2QV0A 5DKFA 2P9HA 4QYMA 5TPWA 4MLCA 4RS3A 1DRJA 2FQYA 2H3HA 2JBAB 2LBPA 2XDYA 3QELA 4EVSA 1FFSA 4MLDA 2AYXA 2CHFA 4MR9B 3QK7A 1ABEA 2B4AA 1U0SY 1JDPA 3HSYA 3JVDA 4MS4B 1E6KA 3GYBA 4IMIB 4MR7B 4MS1A 5EWMB 3HM9A 2PUCA 2F8SA 1Z15A 4F11A 2PUFA 2FEPA 2H0AA 2PL1A 4W5RA 3N6VA 4MQFB 3BILA 3LKBA 4L85A 5TPZA 3SQNA 3OM0A 5TE9A 1USGA 1BDIA 1DCFA 3GT7A 4WXMA 3EJWA 5EWLA 4N0QA 5FBKA 1M2FA 1U2PA 1ISRA 3IDOA 4HNSA 4M88A 1E6MA 3K4HA 1QKKA 1SXGA 2RJOA 1KRXA 4EGSA 3F6CA 1Z26A 2ID9A 3LUHA 1NXPA 1Y1LA 3FFTA 2FEKA 4GNRA 2PUAA 4ZMRA 3EQ2A 2JB9A 5IEJA 4Q6BA 5HM6A 3SG0A 1GLGA 3OMWA 4H3KB 4DQDA 4MR8B 3DGFC 1CHNA 1DG9A 4KMRA 4LZLA 4LX8A 4Z9BA 4JP1A 4WWHA 5DLEA 4YV7A 1P8AA 3RVNA 1TLFA 3H5TA 4RV5A 1XHEA 1EWVA 1U04A 5EWJB 4G0ZA 5JNRA 3GBPA 5IUNC 4MRMA 4F8JA 1YS7A 4WXEA 1L5ZA 2LPMA 1FFGA 3LUGA 2NT3A 3BRSA 4S05A 4YP9A 3BBLA 2R4QA 1DBWA 3D8UA 1JLKA 2IPMA 3NNSA 2FTKE 3KHTA 3GL9A 3NBMA 5C5CA 1QP4A 4GPAA 2JK1A 5KQMA 3URMA 1R8JA 4KPYA 3HUUA 3M9XA 1KMIY 2V0NA 1JHZA 3I42A 4JB0A 3LUCA 1JDNA 4L4UA 3CU5A 1VLZA 2FQXA 4LE0A 2A9OA 4EVRA 1A0OA 4KFCA 1SRRA 2P4UA 4KVFA 5KQGA 3RVQA 2IDMA 3DLHA 4G86A 2FW0A 1Z16A 1JL3A 3T8YA 1P2FA 4OBBA 3LTEA 4Z9AA 4WT7A 4IGAA 3DBIA 4D6XA 4RWEA 5BQ3A 2A9RA 3FFXA 4G0YA 2PL9A 2RDMA 1FFWA 4WUTA 1NATA 3F73A 4ETMA 2OENG 2FVYA 5IX8A 3FMVA 1RZRD 4G0QA 1EHCA 3EAFA 5IEBA 4EVQA 1F51E 5GOTA 4KQ9A 2M1ZA 3OLZA 5T3YA 1C0EA 3UK0A 4YGXB 1ZESA 1USKA 2IPNA 2YHBA 4KK4A 4QYWA 3O75A 1ZY2A 3LUAA 2L18A 5TQ0B 4D6YA 3I45A 3CFYA 2WB4A 5FBHA 4KQCA 1MIHA 2A9PA 2R25B 3QEMA 5DCLA 3SNKA 1MAVA 2W42A 3GWGA 2O20A 2HQRA 4LRQA 1E6LA 3HDVA 4QPJC 2L2QA 5DTEA 4RY9A 4YO7A 3C3WA 2FN9A 3OQNA 3QX8A 4TMYA 1A04A 1ZDMA 2QW1A 2L17A 5I4CA 3JTEA 3E61A 4FE7A 2MYUA 2FSPA 4XXHA 4NICA 2FMHA 4O1HA 1S8NA 5JNVA 1NXXA 3SAJA 1A2OA 4MR9A 5B3JA 4TLMB 3JPWA 4MS4A 5EWMA 3RVLA 3OQMA 3HS3A 3EGCA 3MM4A 4RSMA 3QLVA 2QSJA 3CS3A 4MQFA 3O2SB 4NV3A 1W9HA 2WWVD 1TMYA 4ZPJA 3DLBA 3C97A 2JRLA 2PKXA 2LIVA 3D02A 4Z4EA 4F06A 1BA2A 4P1ZA 1QQBA 2FMIA 3EQZA 3H6HA 2GKGA 4LDZA 2PLNA 3QLUC 4RK5A 5KQPA 3CTPA 3GV0A 3GBVA 4QICA 4RK1A 5F64A 2KYRA 2VUHB 3B2NA 3QLTA 5JNUA 4EYGA 6ABPA 1NXTA 3M9WA 3HK2A 5FWYB 4MR8A 1VKRA 1NY5A 3KLNA 4RK4A 4YR7A 2ID7A 1P6QA 1QO0A 1Z13A 1P6UA 2A9QA 3L6UA 3HEBA 1JF8A 3CG4A 4CBVA 4Z0NA 1QNLA 4ZMSA 2HQOA 1PNTA 3H5LA 5EWJA 2E4WA 1KGSA 4WZZA 3HO1A 4RK7A 3EODA 1KRWA 3SY8A 3W9SA 4O1IA 3MMNA 4TN5A 4XARA 1PNRA 4S04A 3IPAA 1LBIA 3TMYA 5PNTA 4RY8A 3RVKA 3I5AA 5CNKA 3Q7RA 4XFKA 4H60A 4P98A 4OG2A 1BDJA 3GA5A 5E3JA 4UHJA 4UHKA 2CD7A 4MS3A 2FQWA 5DGCA 3Q7TA 1DCKA 3H1GA 3H6GA 3IP6A 2AYZA 4N0PA 2X7XA 1XWWA 4RXTA 1J56A 3RVJA 1M5TA 4MAAA 2PUBA 5CHYA 1VRVA 4W5NA 2QXYA 1LBHA 2JCGA 3BREA 4PE5B 1JYEA 1RPJA 1FSPA 1F4VA 1DC8A 1YMVA 4Z4FA 2TMYA 2IPLA 2QR3A 1DP4A 4H3HB 2VK2A 2E4VA 3RVSA 3M6MD 3O1JC 4OLBA 1U8TA 1YTUA 1OXBB 3O1HB 5IUJC 3CKMA 1DBQA 2I6FA 3BRQA 4MQEA 5KC9A 2M98A 1D1PA 3FDFA 2IPAB 4RKQA 3T38A 3IPCA 3N8IA 2ZAYA 5ABPA 5CNIA 4MS3B 2QU7A 1MB0A 1ZH4A 4JASB 5KWSA 1Z12A 5TQ0A 1GCAA 2HSGA 2GX6A 4G0OA 1PHRA 2N9UA 4N76A 1PEYA 2RJNA 3E3MA 3A10A 2VYCA 4HYEA 2IYNA 3TX6A 3G1WA 1E2BA 3OLWA 4DN6A 5HKOA 4RDCA 4KV7A 3VNBA 1JWLA 4OLAA 2ZWMA 2E4XA 3JS5A 1QPZA 5IUKC 6CHYA 4MQEB 3DZDA 4NQRA 1D2AA 5CNJA 5GQSA 4W5OA 5ED4A 4D74A 3H1FA 1D5WA 1LJUA 4ZYLA 3TB6A 2FN8A 1NXOA 1D1QA 1PUXA 2WJWA 4F12A 3QX9A 5CNMA 1DJMA 3CZ5A 2LUOA 4MYRA 4ZJPA 3DGEC 4W5TA 2PUEA 4YRZA 2FLKA 3UUGA 1Z2EA 1TJYA 4NCBA 3KCNA 3LFTA 2WJAA 3HUTA 3IP7A 3TD9A 4N41A 3KSMA 1JYFA 2GBPA 3C3MA 5BR1A 1APBA 3R0JA 1CYEA 4RKRA 4RXUA 4PEVA 3H75A 3EDCA 3H5OA 5IBQA 3Q9SA 5KI6A 2NZVG 3LKVA 4MGEA 3Q15C 3LUDA 3NNNA 5TPZD 3OLXA 4EYKA 4EYOA 1VPWA 2Q5CA 3RVMA 1SXIA 2BGGA 4DADA 3L49A 5FWYA 2FKAA 1Z17A 1CEYA 1DCMA 1SXHA 1AB5A 4Z4IA 2FEWB 4IF4A 1IIBA 3QEKA 3N53A 3O2JA 4G0PA 1K66A 4PICA 2WY2D 3HV2A 2E4UA 3S99A 3UKJA 1MVOA 4Z99A 1WETA 3MQ4A 4YWHA 2L19A 3IP9A 3KJXA 4LE2A 4B09A 1H9CA 4TLLB 3LMKA 2IKSA 5IC5A 4NCAA 1QMPA 3ILYA 4RY0A 3ROTA 3HJFA 4Z4HA 5HSGA 1EWKA 3KYJB 4E7PA 3CG0A 3VNAA 1RZRA 3Q7SA 2MSWA 3T95A 1Z25A 5T7BA 2HJ9A 2QVGA 1USIA 3K9CA 1LK0A 3KTOA 4ETNA 3KYIB 2F8TA 4JB2A 4ETIA 2MYTA 3CHYA 4KK3A 1DRKA 1ZITA 2PMCA 3MIZA 4FE4A 3O1IC 3RQIA 1ZGZA 2IOYA 4LE1A 1BAPA
chains in the Genus database with same CATH superfamily
2BUBA 4YB8A 4PHHA 4I9UA 5GY7A 4ZI7A 1W47A 3NS7A 1ND5A 1SM4A 5DSZA 2C9CA 3U40A 5B7QA 1P39A 1PWEA 2WILA 4B6GA 5LU9A 4UBJA 3MSXA 4KYUA 1YB5A 4KOAA 4RENA 3N1UA 3QFHA 1Q3TA 3CCCA 1X7ZA 2WUGA 3I32A 2YNMA 1E1YA 1KVTA 3GVIA 5TX7A 1OFUA 2C3OA 2B3TA 1JLSA 3LBAA 5JCPA 2KBEA 2XNJA 2PH7A 1FJXA 2VJBA 4FSDA 2WE7A 1S9HA 2ZAIA 2Y1FA 3D6FA 1ZMRA 1JXOA 3H9EO 4AKSA 4J4BA 2RMKA 2ZR9A 4BN0A 2BP7A 1QHFA 4N1AA 3W8EA 1WO8A 4Y18A 2GESA 4BMXA 1NBME 1A9SA 1FY2A 3H2YA 2GBGA 4FILA 5CEJA 3EC2A 4JITA 4OXNA 8ABPA 5AVQA 4DE5A 1VBFA 2ACWA 4QYTA 5ISMA 2JKZA 4N4AA 5KTTA 1Z6XA 3QELB 5CVCA 1SUWA 1N4AA 1NAIA 2E85A 3KFVA 1HDGO 1G4UR 3L84A 4FMDF 2X1HA 1DJOA 3IP5A 4XDHA 4ZJUA 1DIOB 1GFWA 2ZRNA 421PA 2B7LA 1W29A 1RYEA 1G6HA 2C78A 2H2DA 1P7YA 2KLHA 3DDHA 1NUPA 2QY6A 4YMGA 2C8LA 1XTIA 1LDYA 1A9ZA 1U3WA 3KU4A 1Z6GA 4NBRA 4V02A 5AJWA 2VJNA 3BTVA 3DEIA 4HN4B 2VCYA 4UM9D 1S7GA 3UPDA 3L77A 5CXXA 3HVKA 3UICA 4AS3A 2R751 1G3MA 1Y5LA 2XGGA 3A2MA 5AUPB 4N3GA 4NCHA 4KTTE 5F76A 5LM3A 1RI2A 1NF2A 2A0KA 4P35A 1JFSA 4XX1A 4BQNA 3FOCA 5JO0A 3IEUA 5TQ2A 1SG6A 2FQQA 3C6QA 1SEVA 3DE7X 3VX4A 1VRCA 1BDMA 3AVPA 1SB9A 2BAGA 3QBVA 4MKFA 1Q3KA 1PO7A 2DM6A 3MW8A 3OZBA 4TS4A 3GLTA 4EO7A 1QU2A 2OYSA 3H4TA 4ZT6A 4UW9A 4V0NA 4KDCA 1OZFA 1WD7A 1DZIA 3GOQA 3UAZA 4F3YA 1H6BA 4RD0A 2E6UX 1NN3A 1OYYA 4FLMA 5HK9A 1UXJA 2E5LB 1E2EA 4F04A 1CUVA 3QU4A 4KOEC 5KO2A 3Q5DA 1MEOA 3VNVA 5G0WA 4KJXA 1IB6A 1TC2A 3JPYA 4ENRA 4PG8A 4MVJI 1ORDA 1W1WA 3FYCA 3N8NA 3OO1A 3AZOA 3IEPA 1M8PA 3OCUA 3IB6A 2GTPA 4MIKA 1G8MA 3AV3A 3KSRA 4BUJA 5TQ2B 1ODLA 5ALRA 4ZVNA 1KJYA 1O5IA 3OOHA 1ZC3A 3Q8LA 1M74A 2Z58A 1A7KA 1UJMA 1V5IA 3EVNA 5EHIA 2W4QA 1MC8A 4E2XA 2QLFA 1SC4A 3PXUA 4C0XA 5IU6A 1J70A 4C3OB 3FPHA 1Y3AA 2RC6A 1JJBA 4LDQA 2HYIC 2HXSA 1I9GA 1YAHA 3HY4A 2RGBA 3PPIA 2IVFA 2CC2A 3D2CA 3FHOA 2QG4A 1LLCA 4NHEA 2OBNA 1FUYB 1QGUA 4LMPA 2IZOA 3DZ8A 3GY0A 3RQSA 3RUFA 5EJ6A 2GXQA 3REFA 3W7BA 2VRCD 4O4HA 1WWKA 3IEIA 3JWEA 3BCUA 3NHMA 1T36B 4RNCA 1GUDA 5TJHA 1Z75A 4QRHA 3HDHA 3QXCA 1V5WA 1UWCA 4RHXA 3VGPA 1N7JA 5A2QA 1V1MA 2P9BA 2QRLA 4UOEA 3CF0A 3WX0A 4QRDA 3OQIA 2Q9BA 2WSMA 3EZNA 3HCEA 5GONA 3V7YA 4F9GA 2P67A 5AYVA 3UJCA 2ZQ5A 4TWBA 4PZ0A 4ZDWA 2QMOA 2OGSA 4IL5A 4RAOA 3GJ5A 4CQNA 3ZDXB 4V0MA 3GDHA 5K7SA 2Z8YM 2EXXA 2ZRGA 2Q7OE 3QEMB 2WJ4A 5H0IA 2OO5A 3JQBA 4MH0R 4FX5A 3MT9A 5DOZA 2D5AA 4BQPA 3DBLB 5K6TA 1L4UA 4ZO4A 3FHTA 3FUXA 4BJHB 4ZHSA 3G5UA 1DKNA 1IPFA 1ZD8A 1J2EA 1PFGA 2QTNA 5GJWC 3V8MA 2Z5VA 4YRNA 2ZXEA 1L3CA 1T5HX 1I3MA 1VP3A 1Y9DA 2A7XA 3QH4A 1X2BA 2O1EA 3CINA 2FQYA 4WSOA 2IZ5A 3DZJA 5AW9A 2Q8PA 5A3JA 1ZXLA 1OZGA 1DV2A 3TK1A 1Z6TA 3S2YA 3THSA 1J6UA 4L78A 2C4VA 5BNFA 5IVHA 1ORHA 5COBA 1IOWA 1IMOA 2OECA 3NP9A 2W6QA 1A5AB 4GLJA 5AUOB 2PUCA 4EHIA 1IXRC 3HKEB 2H0AA 5LKAA 3RBZA 1J9GA 4DA4A 1TQ4A 1U8UA 1H3FA 3DDCA 5M04A 3O4FA 3S2UA 4EDFA 3MHTA 1T43A 2VJMA 3HYLA 3RUPA 4HDMA 1R6UA 5D01A 3A05A 2B7CA 1T4GA 3SX2A 1EQUA 1PD0A 3IL2A 2BI4A 2P6UA 4LHZA 1F2TB 2R7AA 3FVWA 4LJAA 5AOAA 4KO3S 1K7YA 3R77A 5FFNA 2Q4OA 3S1LA 2RJOA 3ERCA 4C88A 2ID9A 4G5OA 3L0OA 3KR9A 2AI2A 1OLUA 4BTLA 2HZBA 5TQVA 1VHDA 3ER6A 3RT9A 4JBHA 1BDBA 4AS2A 4JKOA 1IYZA 4HWKA 2HW8A 5HM6A 3CRMA 4MPRA 2BMAA 1VGVA 5LB2A 3E2IA 2X8WA 3LCVB 4L8GA 3ZY6A 1CHNA 1H8HA 1I3OA 2OORA 4XYMA 4Z1MD 1RYFA 4Q4LA 2PU5A 4GMKA 5H70A 3SCZA 1U4OA 3L7NA 1ISJA 2P2NA 2Q5HA 2RIRA 3TDKA 2I4TA 1ZOOA 2X8JA 1WZNA 3FUTA 1KAHA 1XCOA 2ZJZA 3F7OA 1RJ9A 3NRCA 2NU7A 3F4BA 5IUNC 4X1YA 2J0EA 1C3EA 4WXEA 3T1QA 1P4RA 1Y9ZA 1XKXA 2IHZA 3FF4A 4IHJB 3B1WA 4TTRA 2RI6A 4DEYA 3LUGA 5L45A 2OBBA 2NZWA 5AI9A 3UYLA 1YFLA 1Y42X 4K6FA 3D2AA 1J8YF 3LIPA 1Y3BE 2V1XA 4W8GA 4M37A 2QRQA 3V46A 4EKYA 4YAUA 1T1EA 4MO9A 2R8ZA 3HKDA 2YXPX 4ALNA 2NWQA 1UPUA 3C8DA 4EHAA 4BLWA 2XA2A 3CURA 3X3HA 3CXUA 1QAOA 4XE5A 2PQMA 5DBIA 5BOSA 1C7EA 1ENOA 3IEKA 2G08A 1WHTA 4ED9A 4LSWA 1G17A 3QVTA 3AKDA 3K5HA 1F0PA 4JBIA 4PTYA 2PH5A 4W63A 2CVPA 2X8JB 3KKLA 4AJ9A 5CBPA 5JNSA 2Y1CA 5C4GB 2EFHB 1SXPA 3EVBA 3PT5A 3IBTA 1JLLA 4ZI5A 1JSZA 3RAPR 3ADDA 1JL3A 1EUQA 3CSDA 4IZHA 1WW3A 3OA2A 2XLCA 2W0MA 2PA0A 3DDWA 4W7HA 5KX5B 1J9EA 2AFVA 3OE1A 3D7MA 2NUAB 5J5VA 3CH5A 2ERYA 3HKDB 3MGCA 4OH7A 4WGGA 1RZRD 2X5OA 3MYRA 1PTJC 3GDOA 4CCYB 5BSVA 3Q8WA 2WAXA 1N6IA 4PQEA 3C1UA 4NLLA 1J0DA 3EG5A 1JE0A 4X00A 4AF7A 4S35A 5CBPB 3NDPA 1FNBA 1WY7A 2Z6AA 3C1OA 1E1MA 2A4MA 1MIHA 4WJKB 4ZAFA 3DMHA 3UJ8A 3HJTA 2PK3A 4BCCA 5JXJA 1R5OA 3R0XA 4Z7JA 1JLLB 1A2KC 4IG4A 3FKJA 1XWFA 3B1JA 2Q7XA 2ZIAA 4YJHB 2G06A 2WWRA 1NVEA 3DFFA 3FZYA 4YJ2B 1QOZA 2PWPA 3BQ9A 2FN9A 2C77A 2QUJA 4ND7A 1IUOA 1V39A 1RADA 3ZJVA 1FX0B 1WZUA 2OCYC 1Z2OX 2CFTA 2Q3CA 3G9XA 3PJGA 4AO8A 5JNLA 1FTSA 1LZKA 1GR0A 1MDBA 3WQBA 5HXAA 1Z8HA 1L4LA 2OK7A 1XXHA 4KBYA 3K1JA 2YY6A 1Y4SA 1CUFA 3LFUA 2XECA 3EXHA 3ILXA 4MKXA 4MUNA 4XYLA 4AXBA 1B8NA 3NVMB 5CJPA 4MS4A 3RVLA 1VYHA 1XRQA 1E1LA 2Y6UA 3CPEA 5DRYA 5B1DA 3SMVA 5K5EA 4EI2A 3FCAA 1NN5A 1G9SA 3IQGX 1DFHA 1Q22A 2ZITA 3DULA 1AZLA 1AZTA 1W5SA 4NV3A 4Y3UA 1XLTA 2HZ7A 5DI3A 2H2WA 1N1GA 1UDWA 3AEQB 2VP6A 2YY7A 3C97A 2F9FA 1ZVJA 4GDFA 1GQRA 1KYWA 3PC8C 3U4CA 1EXVA 4Z3OA 5ELMA 2OAQ1 1KPHA 1TIPA 4DWWA 1YT5A 1CWUA 1XELA 2G70A 4OMCA 4XZ3A 1NAHA 1C41A 3C3JA 2O3QA 3GLSA 4NCIA 1XXHB 3PT9A 4GP9A 1J8DA 3NDJA 5CCBA 5K2MA 1U7PA 5KHOC 1HLFA 4M9CA 1H23A 2CFIA 4XPZA 4KVAA 4HNTA 2QAGB 4QREA 3M9WA 4FDLA 2NU6A 1SBCA 1USUA 4ZAVA 1R6XA 4L3OA 2J3MA 1P73A 3Q3IA 3GZNA 4KNVA 3PNBA 4A0FA 4KTVE 1ADJA 4LXXA 1R50A 4W6QA 3Q6MA 3L6UA 4RF3A 5F51A 1KI9A 2WSLA 3ZWDA 4CM8B 4JYAB 4EKEA 2Q8NA 3H5LA 2PPLA 1II8B 1P29A 1ZUNB 4NOKA 2IXBA 1P0IA 4RK7A 4H7IA 2FPWA 4JVMA 4X24A 1L7DA 3A1WA 4JUAA 4BATA 2IYQA 5K05A 1KY2A 3GHHA 3FNFA 4U2EA 1PNRA 2JI7A 4DBVO 4LOAA 2BR5A 3CH6A 1EK1A 1LY1A 1PE0A 3RRNA 1OI7A 4I0WB 4K9KA 4IWXA 3DZGA 3L82B 2R44A 3Q3GE 1CHDA 3ZD6A 2Y3IA 3THRA 3OA0A 2E6KA 5KJCA 4M98A 3WGJA 1EI9A 4NOLA 1PT7A 3QX7A 4ITRC 5TS2A 3OF2A 3TMYA 1XNHA 4W5NA 5KVAA 5D3KA 2AMYA 3R9WA 4X3OA 4EKNB 2WAOA 1NDUA 1X7XA 1GG5A 1KK0A 2W48A 2YWEA 1KY3A 3IKJA 3E6AA 2ZRQA 4JJEA 3MJDA 4JH0A 1DC8A 5K3SA 4G25A 3UK2A 2TMYA 3QHPA 1YZKA 4OMDA 3TIVA 1NOJA 1J0AA 5DN9A 4XKJA 4ENPA 3DTVB 3O1JC 1VPTA 3SFZA 2HA4A 2RGRA 1POXA 1JIIA 5IG2A 3V1MA 5FB3A 2QTRA 4PLVA 4BVJA 2GM9A 1KO4A 2YRFA 3T38A 1SUPA 4AD8A 1J20A 4TSRA 2V3VA 1L2TA 1WCYA 2GMWA 3AUKA 1KVQA 1TM5E 1Z12A 1EP2B 3AJEA 2QRVB 3IR7A 3NHUA 5G1NA 1XZDA 2VHCA 2VT7A 1CUBA 1M0WA 1XDBA 1XLTC 2VKQA 1TCBA 3OPNA 3CLRD 2IC5A 4XFDA 5DGDA 4Z9FA 1Q20A 1L4MA 5AM2A 1M73E 4P22A 2HX1A 1OCEA 4KPFC 1XZPA 3T1TA 4EG3A 5BWCA 3EMBA 1AKMA 1PS9A 3G1WA 4JR1A 4KKXB 4QBFA 1E2BA 1Y0BA 4S3MA 3I2FA 1RQ7A 1ZFNA 2N47A 3O8LA 4L51A 2FQ1A 4OHFA 4ZZ3A 2EW1A 2I2WA 1P0CA 4AVYA 5IVKA 2FF5A 3OP4A 4BFXA 2IH4A 2OSVA 4QO7A 1WCV1 2VPXA 2GRUA 2VDKB 4IG9A 5G1PA 1QG2A 3HBFA 3RTBA 3HO6A 1NXOA 3NFYA 4NAUA 3WSWA 1QFMA 3QE3A 2P5TB 3G1UA 5FR2A 1EVZA 1XAJA 2OXFA 3A3NA 3UJAA 4A36A 1S8AA 5GV7A 3TPFA 1FMLA 4H18A 2QD4A 2VNIA 1G2OA 4WXYB 3AIKA 1NI5A 3NEYA 3L0YA 4B46A 2PXXA 3QPBA 2RBGA 1JEAA 1RQGA 2GSWA 2WD7B 3P45A 3SXJA 2H2IA 5AI4A 5BWOA 1YHZA 1OVGA 4DJFC 5JCXA 4B3GA 1OV4A 2PNFA 4RXUA 3E27A 3CNHA 2GYWA 3JQEA 3ZX4A 2UYQA 4A10A 2O0LA 3E18A 4XQEA 1UZUA 4BV2A 2RHRA 2B8NA 4DANA 4KUGA 1NW7A 4RPCA 1V4VA 3QVSA 4CF5A 4IDBA 1N36B 4RKWA 2VDOB 4KQWA 4G5SA 3G9ZA 4AMVA 1CQXA 1U7WA 1Z17A 1WTAA 2FV8A 2HHJA 5HFJA 4EJFA 3UUFA 3N6XA 4FNOA 2NP6A 3HNPA 1ZL2A 2FFJA 1IIBA 1XEXB 4JLBA 4M9ZA 4OQPA 3MOSA 5D3MB 4W8OA 2E4UA 3BWMA 4WN9A 5A7HA 5KNCA 3AVUA 4PGGA 4GM4A 1A7UA 3K9LA 1FFAA 4ESEA 1QMPA 1XQ9A 1KK2A 4OOEA 3R7DA 3UATA 3UT5B 2OZLA 1DS6A 4II2A 3ZQKA 5G41A 4E7PA 2QI9C 4ZQBA 5MN4A 4HBGA 4N01A 2G1JA 2I8AA 4GVPA 4EYSA 1Q92A 2CYBA 4O5OA 5TVGA 4HEHA 4L9SA 1CQJA 4CL8A 1ZXBA 3CHYA 4IIXA 4KFUA 3WZ2A 2ODAA 1DC3A 1SVUA 1Z6QA 5EJGA 4N9WA 2VOEA 3U7RA 3V4FA 1ZITA 1BRMA 2PMCA 2B9VA 2RI1A 3KR1A 4GZ5A 3ICEA 1GOTA 4WN9B 1BA3A 2NXJA 3L8HA 1ID8A 4KR9A 4D8WA 2WR8A 1KR2A 3V8NA 1DGQA 4AO6A 2ZYUX 5L7YA 4D6PA 2VSQA 2H48A 5GADl 4W7IA 1TF5A 5IDQA 2LKDA 4H2DA 3IR6A 4IVPA 2H65A 3L04A 5CXSA 4CEHA 1E1DA 2W2QA 2OZLB 2DLDA 4HATA 2FMFA 3I6YA 4TZ0A 4R0NA 1BDHA 1I3NA 1JTVA 2OHJA 2JFZA 2NYUA 3G23A 4BP1A 4XEUA 3GH3A 1M34A 1ECLA 4RFVA 4ZOQI 3EMDA 3JX9A 3S2FA 3EVGA 2O1XA 1D4AA 3DMNA 1SOVA 2Z9CA 3ZIDA 2RAUA 3B2EA 3EE6A 3FPFA 3OLYA 2P7HA 1X7YA 2VHUA 5AKKA 1E69A 3U9TA 3UK1A 2GAFA 2IW1A 1YQ9A 4BGUA 3H5VA 3MJFA 1L7OA 5CMLA 4DSUA 2X86A 4PONA 4KO4S 1T6NA 5C0OE 1FTYA 1YJBA 1I4DD 3N58A 4BKQA 4QPDA 4JJAA 2FRVA 4LOKA 4WTOA 5TR9A 2HFJA 3DKRA 1ZAYA 1QHSA 4BNLA 4EITA 1GWNA 2CBXA 5D8DA 5B3JC 2B82A 3L3BA 1NUHA 5E9QA 1NV9A 2QQGA 3N5KA 1DHRA 2BFEA 4GNKA 4GGPA 4MW5A 4Y2YA 4M9UA 5EWLB 1G3IA 5CB8A 1LU9A 3BGWA 3AEKA 3IMFA 5D6OA 3T7EA 3TKYA 5DN6D 5KJ6A 1YF3A 1KVSA 3GJ7A 2ST1A 3NWEA 1TA0A 3ZVRA 2PX8A 2ET6A 4MI1A 1FQWA 5DMHA 4YFYA 1A5TA 4EY6A 4UZSA 1TF7A 2X5XA 4BNNA 3RIMA 5FPPA 1BH6A 3N0RA 5ITWA 1U5BB 2Z1NA 5CT8A 4ZVOA 1XHLA 1K7EB 3EXFA 4YLEA 2C5LA 1MR3F 5FWAA 1RQRA 1TQHA 4OVKA 2CE7A 3D3EA 1UWLA 2WWHA 5B6JA 2OE2A 5I48A 2XCIA 1L4EA 1U3UA 3MLEA 4U9IS 5JIBA 2BFEB 4C06A 3PV0A 4UDYX 3ZQ6A 3ECCA 4OHCA 3RUDA 1UQUA 4HDKB 2QHXA 5B2FA 3K0KA 1T9GR 2JGIA 4QUEA 3RJMA 4A2WA 4UUPA 4E12A 4YV0A 1W0KA 3QW4B 4A7PA 3DOFA 1JHYA 4N03A 4P3PA 4RK6A 1U8ZA 1QE3A 2NTYC 3X1DA 4D0GA 2PZBA 1JNYA 4RELA 2WSBA 1D3AA 2ECFA 1EU1A 2Z95A 4UNPA 4D0NA 3OECA 4B33A 3WZMA 3KB2A 4G0WA 3K70C 4J1NA 1CY2A 1YHNA 2C84A 4MMYB 1N2EA 2W5UA 1MT3A 2IIQA 1OH7A 3GDWA 1D0IA 4DLUA 3SKVA 3WLSA 4HQNA 1WV0A 4YDQA 3A6LA 3FDZA 5K0BA 5LQSA 2G5TA 2C5AA 1T3LA 2PFKA 4IHJF 4JUIA 2V8BA 1B3BA 3D3WA 5I4IA 1B0UA 3JXEA 1O4WA 4P81A 4K6MA 2V65A 5KWVA 1DBIA 3THYA 1GADO 4X5OA 1XROA 3KPUA 4KACA 4KO8A 3ZNPA 1E0AA 3R20A 3A1TA 1JHXA 3EBPA 4YP6A 2QNRA 1HG1A 4CU5A 2GTIA 3BGOS 2O2DA 2RARA 3CISA 3I4LA 1SBNE 1PUJA 3AMVA 4UCQA 3RIYA 3RVBA 3SBEA 1TLTA 4O4IA 4EG4A 2NSDA 2XMCA 2Q1XA 2UDPA 1USWA 4MR7A 3C0KA 5INTA 4JK3A 3LUKA 1W5AA 1IY9A 2R8EA 5C80A 2YJ3A 1Z4KA 1UBRS 1VMKA 3FVQA 5FF9A 3VDRA 1I8TA 3G7NA 3TZLA 1FMCA 4BASA 4YCSA 2WZDA 2YJ6A 4YBZA 3KQOA 4EGJA 5KX5F 3THYB 1WSDA 5DHPA 4C7KA 1NN1A 1RRCA 3ELYA 3GYGA 3I83A 4HWTA 1A9TA 3AEXA 3B36A 3LO8A 4MUHA 3E3OA 1LEHA 1FRNA 1O7JA 2XJ9A 3JQ7B 2XMDA 5IM4A 2PRKA 2VRWA 4NPCA 1W59A 4PLHA 1U99A 2ALJA 3K0AB 3CRW1 2AFIB 2QYSA 3N2KB 4R98A 3KQYA 2O7QA 5CA0B 1WPGA 4ZRMA 2GVNA 3QKSA 2QZ9A 4DR3B 1HV8A 4MR7B 4IMIB 2BF4A 2ZU0C 3LM8A 4B3XA 4DR2B 3ZHOA 2F43B 3B5IA 4V0ME 3OSUA 1N0VC 3B6EA 3RLFA 4AIRA 4YJ2F 3GVPA 3M33A 3U4DA 2DR3A 4HXEB 2XB2A 1YZQA 2OCPA 3PFBA 4RL4A 3ZU4A 3ZWVA 3F2IA 2NVOA 3T5AA 4DC0A 3PDUA 2PRIA 3VSDA 5HVNA 2GAIA 2WIKA 4OLHA 4EMSA 3LXXA 2QG6A 3U5ZB 3I8SA 1OGJA 4N5DA 5DLYA 2XUIA 5ALWA 4RA6A 3L8EA 4IIHA 3S70A 4L7VA 4YGYA 2H2FA 2MTBA 4W9NA 4AS1A 1H0RA 3CPSA 2O2ZA 3M3PA 3MINB 3TZ6A 1X1BA 3BWXA 4LYEA 4DQDA 1QANA 1UKEA 3YASA 2IY7A 4OGKA 2AWNA 3QEJA 4Q3CA 5DO9A 4HYYA 4MP3A 3H7AA 3M4NA 5F2NA 3UPTA 3D7LA 3O92A 3JRNA 1A95A 1TGYA 2ZJOA 3MS7A 3SEFA 4BUZA 4YMLA 4IJWA 2VXBA 1Q3HA 1WDLA 4C5BA 1W88B 2PX0A 5BSKA 3BBLA 3AHDA 4QGBA 3G8AA 4RM3A 5EXPA 2BY4A 4FJ2A 2HJGA 2YHUA 4FEGA 1R1DA 4IUDS 2PMFA 3RWBA 3I9JA 4MYTA 1HDIA 4DEVA 3FMGA 1O3YA 5HF6A 4QWMA 3UH1A 1ZM7A 4I1PA 2AZXA 3B85A 2R8PA 2ZB8A 3M9XA 3O83A 3UAWA 3CEJA 4E32A 3S4YA 4MQMA 5EVCA 3DQZA 1HQCA 5JY6A 3U60B 3ZD9A 3OQJA 1P2GA 5HCIA 2RAPA 2RONA 3WY9A 3GLIA 2A9OA 3LBNA 4LK3A 1TMOA 5FOTA 4K9MA 2VHWA 4WY8A 1QQTA 2YN4A 4LFAB 3TNJA 4MCHA 3CB4A 4ZVTA 4G1VA 2D7DA 2XNHA 3TJZA 2CJPA 4DXHA 3LDAA 4HTAA 2CVQA 1GCUA 1MC1A 2EATA 2SICE 3D54D 4NJEB 4KH0A 3WNCA 4YQYA 1VG9B 4ZN6A 4B3MB 4X63A 3TLKA 2H1OA 5DM60 3KU1A 1VE3A 5IEBA 3KK0A 2QJRA 3AR6A 4I81A 3TRKA 2L42A 1BTOA 5FORA 1JQ5A 3DVSX 3WWZA 1MTZA 1OUMA 3AR4A 1ESDA 3SX0A 3HSKA 2OKCA 1MAVA 3HDTA 1XN1A 3K5PA 2X0NA 1SKQA 3U7IA 2HQRA 1C30B 2B1RA 1GPKA 1Q7EA 2NZJA 2QSZA 3ESQA 4CIVA 5J4YA 2DUNA 4FNAA 4RF2A 1XE3A 4LRYA 1FUEA 2FH5B 3R23A 3B9BA 3UGTA 4N54A 1N5DA 5M3BA 4DA6A 4YH1A 2NUPA 3EG9B 2FSPA 1T9KA 2GCOB 3L0SA 1TZCA 5CVJA 2HF8A 3A9UA 1VPLA 2FDCA 3TW4A 1SCNE 4JI0B 1K9SA 1A27A 1M76A 1N0IA 1X14A 5CLHA 2HNAA 4JVSB 3U7EB 2G36A 4FOLA 3RC9A 1SVNA 1MCZA 2G82A 3GEDA 2A5DA 1MX5A 2G04A 4GOMD 5AP9A 2O8CB 4UUMA 3ANTA 4C08A 1VBKA 4KLNA 5FUXA 1OHHA 2IRWA 1H5UA 2I6XA 2VRBA 2HSZA 3EN0A 3TTXA 4F71A 3U1BA 2O0KA 3LQ1A 1P4AA 1ZD3A 1K3UB 3IHTA 2GN2A 3USZA 3I62A 3BEDA 1YE8A 1ZI8A 3BTUA 3EZ7A 4N8DA 3CUTA 5BV2P 4G3XA 3MS2A 1YR1A 3NUGA 1V8BA 4G36A 1R12A 2WG2A 4CMKA 3NONA 3FWNA 1XXHE 3SXUA 1LPAB 1SU8A 4V38A 4EY8A 1IBLB 4EYGA 2J3QA 3HK2A 2OVBA 4YYZA 4BVKA 3TLMA 4GPBA 5FWYB 3F97A 3GMDA 3KLNA 4MR8A 4EHLA 1Z62A 3QVLA 1P6QA 2BTQA 1HEIA 2A9QA 4HX9A 3N2GA 3NV7A 2GM5A 3WJ1A 521PA 3K8QA 5D87A 3VNQA 3IXQA 2XNDD 3HPRA 3TB4A 1RWQA 1ZIPA 4TMXA 2IZ0A 1YRLA 3V2HA 1ST3A 2BGNA 1JQKA 4H15A 2FZKA 4Q5IA 4JLJA 2IWRA 3RRJA 4AUMA 1WF3A 4X93A 2XYHA 1XCBA 2GN9A 3ZXSA 3TDMA 3L0CA 4N12A 3LU1A 5FOUA 2LGJA 3OQ1A 5ICCA 3ZWYA 2PT9A 4M1ZA 2Q4BA 3KR0A 2IUUA 7YASA 4GW3A 4CL2A 2WOOA 4MV5A 4Q15A 2VUTA 4Q9IA 1Z2PX 3H2ZA 2O48X 3GARA 4OG2A 3AJAA 1NNUA 2H5IA 3LT2A 3ND7A 5ALXA 2XPCA 3NC4A 1PRYA 3QBTA 4TGLA 4WDQA 5A0FA 4KQGA 3RODA 3TVTA 4E11A 2UUOA 2AYZA 2F3SA 1RJEA 2PGOA 4BDSA 1ZK2A 2WV9A 2WTUA 2CJYA 4ZIRB 2ZJYA 3T7RA 1Z0KA 4KUEA 4PHFA 2D2VA 1JYEA 2B37A 3GG9A 4O4JF 2YW9A 5K0TA 3KVVA 3L0BA 3W7AA 1KKLA 1NWCA 4NYMR 4RPIA 1W6RA 4CEIA 2WYVA 1QCDA 1KZ9A 1U7ZA 2KE5A 2QY9A 2LTAA 3DC7A 4GR5A 2X1LA 4H3HB 1T5DX 2Y1WA 3FCXA 4FXPA 2ZB2A 5FKJA 2ZBDA 2C07A 1KC1A 3K0FB 3NZEA 2XUGA 3DUFA 3FDFA 2PU7A 2EKQA 4F21A 2E49A 3T7CA 3B5JA 1H6AA 2W00A 3PA6A 4PC2A 4F2DA 4NH0A 4UTRA 5AW8A 5H9WA 5KEIA 2D2FA 2WT9A 4I9GA 1YOBA 1FDRA 2BKXA 5IJWA 3TMKA 3NI2A 3DVAB 4IDGA 4JY7A 4K03A 4XPIA 1YA4A 4BN4A 2KX7A 3KWFA 1OY1A 3L0ZA 1ZIYA 4HEQA 5ITZB 2HY7A 3T5DA 4E2FA 2BMWA 3AYZB 1FXUA 1KGDA 3ZHVA 1AQUA 2IYAA 2VF5X 4QTXA 4HJXA 3M4JA 6CHYA 2WM8A 4MAMA 2NV2B 2KWIA 2YYSA 3RF6A 3WADA 4DARA 1HDCA 5JBNA 4D74A 1U2RA 3C3DA 4MJLA 2PGJA 1NVVQ 2W58A 3NEPX 4HNGA 3RC2A 2VP4A 4F12A 5AVJA 2DP4E 1GTVA 2H7VA 1V9CA 4MYRA 1C0LA 1N32B 4YRZA 2X5NA 4AUNA 1Q5PA 4YCMA 4GZLA 4FFBB 4XPIB 3K32A 3IP7A 3JQGB 4WLEA 4OHPA 1UINA 4DM7A 4B47A 4FWIB 3EGXB 4B6JA 1LGYA 1JQBA 1ZIXA 2ZYSA 3C87A 3H99A 4IJ6A 4NSNA 1Y8RA 3KJNA 1WCIA 4BO3A 1WMDA 1XMXA 3G88A 4P9NA 4QQKA 2IV2X 3I3OA 4CM4B 5B4UA 1ESMA 4C2TA 5HCUA 4RHCA 3SLRA 2WJVA 4ACBA 1SHLA 4I4TB 1JHVA 5FUMA 4Z6KA 2FPKA 4HZUA 4O2RA 2XSZA 3P4UA 2G1PA 1XA4A 1BFDA 1M2VB 2UU9B 1T9BA 1ECJA 3Q3EA 1G3QA 1SU4A 2BSXA 4RX1A 5ECYA 4Y9RA 3WGLA 2R86A 1STOA 3UAVA 4AAYA 5G53C 1EX6A 1EE9A 4PXSA 1DUVG 3RG8A 3SIPA 5ALDA 3HV2A 3K2EA 2GHRA 2PVPA 4CT0A 1Z0IA 5K01A 2VNAA 1DQZA 4J1TA 4DIUA 4H77A 3T52A 1N2HA 1PJCA 3QHAA 1RRVA 1P62B 5T4FA 2C4KA 5KSZA 4MKRA 3G2LA 1XDUA 2QOEA 3TLJA 4F4DA 4PNZA 1NQTA 1PG0A 2WSSA 3CNNA 4P8RA 2QYHA 1BD4A 1EWKA 1E2QA 2ODBA 3KVYA 4MXDA 3SHTA 5IRCD 1J8FA 2V59A 4UU0A 3M3DA 4HZUB 1CUYA 4E5DA 4F2HA 3RUHA 5EIHA 1D2EA 4CT5A 4QOEA 1IQPA 1FMFA 3GHYA 4FINA 4CM7A 4ETIA 1SELA 2UVDA 1VCNA 5MGNA 1D6SA 1YDFA 3GI1A 3IVRA 1NVKA 2QJWA 1ZGZA 5A4AA 4WZAA 1H2YA 4TYYA 1IQUA 4GD3Q 2P6NA 1AX9A 3CR8A 3T4UA 4P84A 4XWTA 2GLTA 3OTWA 4MV1A 4AG3A 2Z1DA 1B00A 1I36A 4AN0A 5FO0A 3GJ4A 4R1TA 2B25A 1DIAA 7GPBA 1TT5A 5AJHA 3GEEA 2IS4A 1SKUA 4UHFA 3GFSA 3LC7O 3F2VA 2HT6A 1MG0A 3FBGA 4JI4B 3NIBA 3MTEA 1FDUA 2JCXA 3SM9A 2ISCA 2F67A 2R1ZA 2QNBA 3OFND 4CFYA 4EG7A 4L28A 1IY8A 1JXAA 3CW9A 4IVRA 5C7YA 3NT2A 4RLSA 3N0VA 4DGSA 1W1UA 4D81A 721PA 1OREA 3GMSA 4MRRA 1XO1A 1V7CA 2Q5EA 5JVDA 4P0PB 5E6SA 3AVTA 2I4MA 4XM1A 5EKDA 4EZBA 2UUBB 3RWOA 1ABFA 2CB9A 2PGXA 3ZV7A 4OH1A 1GT6A 3DLCA 5ALQA 4DLZA 1PBNA 2YV4A 1TT5B 4IWNA 4GEKA 1UKBA 1TJPB 2ZAOA 1JU4A 1COWA 3A4TA 4EYQA 1I4TD 4QPPA 3MCAA 2UYCA 2PANA 5BMVA 3FYUC 1PGJA 3BZUA 3PFHA 1WUHS 4QEZA 2IU3A 1CUAA 3TXAA 3VDQA 3ZWKA 2HB6A 1DC7A 3QPWA 1U0BB 2X9NA 5GIPE 3CIFA 1WXFA 2XBUA 1M34E 3H1EA 3W5JA 3G9UA 1WY5A 4QOGA 3NAMA 2VZ9A 5FYQA 2NO9A 4YI5A 5AXCA 2GZMA 4FVTA 4BGDA 1XB2A 2FEAA 1H8EA 1GSAA 2EQ5A 2PBLA 1Q50A 1PQWA 2MIIA 3DP7A 1NPYA 4GC5A 4MMZB 3UJDA 5CA0F 5I7SA 4E1VA 2FFBA 1I51A 2YICA 4AU1A 3AWDA 3E8MA 1QS0B 2A67A 1RFLA 2GILA 2ILTA 3CZRA 2CL6X 3I9MA 4AUKA 1PGOA 5CB6A 1ZK1A 2PAFA 1EAMA 1Z56C 3ABQB 2H63A 3EEOA 2GSDA 1AF7A 1AB6A 3FPGA 3PC7A 2MMCA 5AUQA 3SDZA 2IEAA 1Z18A 3PGKA 3ICWA 4JVLA 2R6AA 3ZGLA 1KKMA 2F8LA 4BKUA 3ZZMA 3TZBA 5TQJA 5AJZA 1ZM2A 1TYEB 2WQ7A 1YS2X 4PCLA 2RH9B 1T1JA 4E7OA 4UPVA 3GLFB 4RJIA 3HBLA 5IAAA 4HWSA 2PIDA 3AI7A 5KTNA 7ABPA 5LVAA 3VI4B 1NJ2A 5IM4F 3L7YA 4IHKA 4YRKA 4QXMA 3O8DA 2JH8A 4UREA 3SQLA 1RKQA 1XYYA 3FB4A 1SCUB 1AMOA 1TOAA 4MUIA 1GILA 1SCJA 2P2DA 1HNXB 2X0EA 5BW4A 4WNAA 1FNDA 2BBTA 3IS3A 4FBGA 5I5GA 4DIBA 2ZM6B 1JX6A 2G72A 1KVRA 4TXHA 3G85A 3LUJA 4DPMA 3E9ZA 3N0XA 1LW6E 4JFRA 3FWHA 2DQZA 1SIWA 1CEQA 2VH1A 3OO0A 2VHXA 2C54A 4E15A 3OOEA 2CLSA 5DLPA 1FP6A 2B21A 5ALJA 4ER6A 5JJLA 1JFTA 1VYUA 3LT4A 2TMDA 1CDZA 3F6PA 3HCDA 4DIKA 4CEJB 2I8CA 2X8LA 2OP0A 2OYCA 1JDVA 4KDRA 5GVSA 1BE0A 3K70D 2YMQA 2ENUA 2DQYA 4IAOA 2Z6QA 1SUSA 1L7QA 2BRUC 5JD6A 1IBRA 2H2HA 4YT4A 3DAYA 3BB3A 1RXEA 4UBOA 1MHPA 3OCCA 5I9IA 1UR5A 3ORYA 4DZTA 4RH0A 5B1HA 1FXWA 3AI2A 3KXPA 4BNKA 3A06A 3GH1A 4L74A 1NYQA 1K68A 1D7OA 4AY6A 4PX5A 3BA1A 1HQKA 3FLMA 2NT4A 3DPIA 5C34B 3VPSA 4NJMA 2F17A 4M0EA 1CZLA 5DSXA 4AY3A 3COWA 4C43A 4GLOA 5CFOA 1EVYA 1M7GA 2CBGA 2BEKA 4OLJA 3ZVMA 3LHFA 4C6TB 1XVLA 2AFIE 2AK3A 4YCLA 4JI2B 3G0OA 5CEFA 4P5PA 4D9KA 2CLFB 3D8BA 3JQAA 3CVVA 4FJ0A 2I66A 5AM3A 2BM0A 1RZ3A 4MDYA 3VU1A 2DPHA 4P54A 2D1RA 2WB2A 4V0SA 5TF4A 4C4YA 2IHKA 1W44A 3OC0A 1OFGA 1DCFA 4BKOA 4ND8A 4YRGA 1O57A 2D1YA 1J8MF 2RK6A 2VOJA 3VU9B 1R37A 1Q83A 4K86A 1ORWA 1SQ6A 1SKYB 2I55A 2RC5A 3EA5A 3EGWA 1YR3A 3PDIA 3R7AA 4DVGA 2UUPA 3ROPA 3S81A 4MYDA 2FW8A 5LZ2A 3ZY3A 4BZZA 2QUIA 4R84A 1PWXA 3TGWA 2C0CA 2ZCVA 4A8JA 4BFLA 1DOAA 2PLRA 4UBKA 3E9CA 2BGLA 3BKXA 3EGDA 3EQ2A 4WIAA 1PKXA 1NW3A 3I3SR 3A6JA 4Q6BA 2P9EA 4HWOA 4B8YA 2M6SA 3KZVA 3K9BA 4URHA 1GLGA 1RAGA 5AWFC 4UEQA 4DG5A 2WC1A 4HAUA 5JTUA 2QPTA 2W6ID 2ZI9A 4ECEA 3PD0A 2I99A 3FLBA 4BHTA 1R16A 5LD2C 1F1BA 4XSHA 3V4OA 3CUSA 3HVJA 4FT4A 2P2SA 4RV5A 3ZZNA 1JGTA 3BJMA 3D8TA 3QYJA 2ZI3A 3W90A 4MKHA 1E5TA 2H0RA 4BOYA 4HDSB 1DC4A 1II9A 2C04A 4Q37A 1DT5A 1NP6A 4ZT3A 4A8JB 3BXFA 1G5TA 1JLKA 5CVEA 3EGDB 2CXOA 4YUAA 1CZOA 4GR9A 5CH3A 3OEHA 3WNDA 5A06A 3NHYA 2X2EA 2QGZA 3OT1B 5HP4A 4CMGA 3L7LA 3AFGA 4CQMD 2J7PA 4KQ1A 1EVLA 3P9NA 4G0NA 1DIBA 1ZBDA 4RQAA 4U5XA 3UWMA 3P2KA 3VYUB 2XQJA 3FYTA 4MWOA 3S2IA 1GTJ1 2IZZA 3Q9UA 4V3CA 3JAKB 1C7IA 4B74A 4NENA 1X74A 4EVRA 1VI6A 3STTA 1VSBA 1GITA 2VDUE 3BHIA 4BB5A 3LKZA 5AT1A 2H1HA 4TX1A 5DNUA 5CH5A 9ATCA 2D5CA 1O4VA 4A0HA 4QJ3A 1O87A 4Z9AA 4CTKA 3RWMB 1E8MA 1U1CA 3N7AA 3O47A 3PE6A 1XQYA 2WWFA 4X3CA 3JAWB 2CKDA 4C05A 4PAQA 4ZCTA 2EX4A 3C7TA 3L93A 1GZ5A 2EJVA 3TE6A 4AKEA 2B4YA 3JQ8B 2R5FA 4R1OA 5GM2A 2WP0A 1F51E 3AHGA 2PSSA 5J59A 4U4AA 1YJAA 5G4KB 4V1CI 1VL6A 3EZ9A 2Q6KA 1X70A 3NYWA 3DVLA 3PUIA 4ZT4A 1DIGA 4MIOA 5E7JA 2Y76A 4URZR 1V26A 2NUTA 5GAJA 3NOXA 2JEZA 3CNOA 3HDVA 4MWDA 1ZI6A 4ZCIA 2XE8A 2PUFA 1O03A 4TLCA 4RVOA 3SC3A 4MWSA 4ESHA 1HH4A 2A9KA 4KWEA 4TSFA 5IXSA 4FGZA 1K8ZB 4DLTA 3TFQA 4J7AA 3RC7A 3JZAA 4DV0B 2QPOA 3MZ0A 4X54A 2EP8A 1CE8A 4RANA 1JJFA 3GP5A 1Q2UA 5EZ5A 4YRMA 4B8WA 1EQ2A 1WL8A 2ADOA 2ZSJA 3NIDB 2PXAA 2VAXA 3C70A 4BJ5A 3HL0A 3WYAA 5LDHA 3TOVA 5LUAA 1P1IA 1PNQA 4K9RA 5KMGA 3KT0A 5IARA 4FX2A 4I5FA 1TYCA 1W0CA 4L72A 3VOBA 3DLBA 1MNQA 2VTEA 2K87A 4FYJA 4Q7JB 2Z08A 3O91A 4F06A 1JMVA 1Y33E 1NE2A 3TW6A 4N8SA 4GL2A 3A31A 3VVCA 1L7VC 2MINA 1UP7A 4JP2A 3BK2A 5EOVA 4WVFA 3IGFA 4PN3A 4ZK6A 3QLUC 2ISSD 2XOKD 3RV4A 4DF3A 1XKTA 2WJPA 3VUEA 1CC1S 1L1RA 3TKAA 4B7XA 1ZJZA 3Q72A 3R4CA 1SCBA 5F64A 3VOSA 4RSRA 3CY6A 4NK4A 2B92A 3DEHA 1XQWA 4LI0A 1N34B 2IYWA 4JSRA 4X1IB 2WQ6A 2XA1A 3O0TA 3NVDA 5G0TA 4JLNA 1OI2A 4R5HA 3IVMA 3U4QB 1MV8A 2I0FA 4PWYA 3FG9A 1QO0A 4Q21A 4WKBA 4BEBA 3KXIA 4I1SA 3D59A 1S1CA 3ET5A 2QX6A 3CG4A 3HZOA 4MARA 1GPUA 1U3GA 5DGTA 3ZCTA 5H82A 9GPBA 1FMJA 1TYAE 3D4PA 3OJEA 3OZSA 4BC0A 1MC5A 1H0SA 2Q1TA 4YUVA 1JDUA 2MINB 3L7BA 3RUAA 1M66A 4OHUA 4OXKA 2JFPA 2GHQA 3HN6A 4CHGA 4R1PA 4M4SA 3UJHA 5JXHA 4J43A 4I4TF 2HR1A 3P9QA 4HEA6 5AJTA 4F5WA 3CF2A 3J7TA 3EW9A 3ZU2A 3G79A 1OTYA 3PD1A 1MU0A 2ZGVA 1AK2A 4KQMA 4UBNA 2WHQA 1A7JA 3P32A 4P98A 3ZLVA 1UK9A 3INYA 4LMBA 5FUWA 3UXHA 3AIIA 1K6JA 2TSYB 4PG4A 1HQDA 3T3GA 2BHRA 4LHVA 1XTPA 4MWGA 4JHXA 3T9DA 4M2LA 1JLRA 1L4KA 4JNCA 1XWWA 2HHCA 2B69A 3N3BC 4Z86A 4FB5A 3NJ4A 4WD3A 2QXYA 1KQPA 5EXDA 3ZWQA 2CVZA 1F8GA 2WMNB 3N2IA 1JIXA 4AP9A 2W6NA 4BO0A 2G67A 2P2CA 4MVJA 1B7GO 3MPOA 3P2OA 5K4GA 2CHGA 1P75A 3ESYA 1XLWA 3O03A 5JU6A 4C0KA 2IBSA 2ADFA 1ECBA 1OFUX 1CJVC 1HT0A 4C0HA 1E96A 1UJ5A 1GIAA 2GEUA 4AQ7A 3DG9A 4XTCS 3RS5A 4UE6A 4BNMA 1UKYA 1G9XA 1ZH4A 1VPVA 1KI7A 1DVRA 4HAVA 3I1YA 4ZCRA 5DCWA 3SVLA 1VHJA 3LOQA 1MO5A 4Q4HA 2E21A 3TNYA 4DCOA 4GVXA 4X44A 5AFSA 1Q16A 3ZV4A 3BXXA 3B9QA 3CZMA 3LVRE 2XT9A 5EPOA 4ZCSA 5DPMA 3NKVA 1NSYA 2EKPA 4PVCA 1GQFA 4KO1S 1Z7GA 3CZAA 1BMFD 3FZQA 4R81A 3WGGA 2Q3HA 1TU0A 4DN6A 5J23A 3ZK8A 2Z04A 2AI3A 4V0LA 5CX4A 1P2SA 3T7IA 2QN6A 3AG6A 4Q3LA 4ZZ0A 2CNDA 4WFQA 2Y1DA 3T5GA 4ZJYA 3GLKA 4TZKA 3THWA 3WLNA 1QIJA 2R6ZA 4GX2A 2QWXA 4E4RA 4EG1A 2XKKA 1DEAA 5KDLA 4EKIA 2SKDA 5E0OA 2R11A 2V4ZA 2XTMA 4BMOB 4LF5B 1DV1A 1E2MA 3I5MA 2I4OA 4YN3A 1C9DB 3RSQA 3TB6A 3IAAA 1NBMD 3D9QX 2SHKA 3VR5A 3ZCSA 2QE7A 4KXYA 3W3AA 1Q6ZA 3QE9Y 3IAFA 1U81A 2ZDQA 5BNWA 2HWYA 2FLKA 5J4KA 3EK2A 2B1GA 2O23A 4BNXA 4EEZA 2X0IA 2I3GA 5F7JA 1GXSB 4OLFA 1UDAA 5ELLA 3U26A 5JASA 1TM7E 1ZD9A 2GBLC 1PJBA 3HFRA 1J21A 4M1KA 3CXRA 3K71B 4B0PA 3KSMA 5KB3A 4D26A 4YI3A 1PQPA 2IYLD 2OHOA 1CYEA 4YFVA 2DFLA 3THWB 1I7QB 2HA6A 3EWSA 1WLSA 3DM9B 2O8VA 4X85A 3LKVA 2RGNC 4B32A 2FI1A 2ZW9A 2NSHA 1NKTA 3PPXA 4NPAA 2H6EA 2NSYA 3BFKA 3WWOA 2WMOB 4KIJA 3H9BA 4XRRA 4YLGA 4DMHA 2WYHA 3BE6A 1UXGA 3MTAA 3WMWA 1T2DA 1R64A 1V6AA 3MUFA 5LN1A 1WULS 3BS4A 4XQ0A 1V3UA 2AXQA 2SNIE 3CPJB 4J03A 5DW3A 2WICA 3RFCA 1HE2A 3X1YA 4BMVA 1GPDG 1YCFA 5B2EA 5J9FA 1V37A 4TLLB 5H3HA 2EFJA 3CSSA 3NR2A 5C51B 4LWOA 3ZU6A 2HV9A 3GF4A 1RVV1 3P0RA 4TKZA 4RABA 3E1SA 3ROTA 5LSAA 2JNWA 3CG0A 1KSGA 5BT9A 1QAMA 2J9YB 5KVVA 5T7BA 1TYDE 3JQ9A 3R0VA 3EW7A 2Q41A 4BVBA 3TZCA 1HPLA 3U3ZA 1QFXA 2MYTA 1OTXA 5HDQA 4BJ6A 4Y6PA 1Q91A 1LVUA 4F46A 2JLVA 5EHGA 3AG5A 5E95A 3WAGA 2XVMA 3LGAA 5FH9A 1R4AA 2JVJA 1HG0A 2ATEA 2AR9A 2XNCA 4KDFA 3H4IA 1KFEB 1BWQA 3AP3A 4QM7A 4ENVA 3QSGA 5IJ9B 2I2BA 1ZW6A 1NI3A 2H5EA 4K6GA 3GJYA 4OJTA 3F1LA 4FONA 4QELA 2N46A 3ASVA 1TM2A 1NVAA 2ZYWX 1FVFA 3DYVA 5K4AA 4CV2A 1C3OB 4KDEA 4DCSA 3H1BA 4ENUA 1WXGA 3CCBA 1NQ5A 1CUHA 3LGXA 1LWOA 5IT5A 1V3TA 4IXWA 3SF8A 1NNSA 1VKJA 1KA9H 2Q99A 4U2KA 3S5UA 2B78A 621PA 3KJQA 2IF0A 1EFPB 4NYMQ 4EGCB 2EEPA 2Q4DA 2VYQA 4WZAE 2V5VA 4MULA 1CTQA 2QD1A 2V55B 1V16A 3L7OA 2BMFA 3P5SA 2D54A 4KO2S 5TY0A 3U6BA 4KRYA 3PHGA 4K9SA 1R4ZA 2UYYA 3Q41A 4U8GA 5BWMA 1MB9A 4RVUA 3GA0A 4BAGA 4RV4A 4W1SA 3GLGA 1YRYE 4W82A 1K8QA 3DTTA 1DX4A 4Z4GA 2WTBA 2DVMA 1YAJA 2P41A 4M54A 2PX3A 1QP0A 3VNUA 3AR2A 3NWJA 4J29A 3U2QA 1M1YA 3FDXA 4R9VA 5JD4A 4IGFA 1H0KA 1PL7A 1AUPA 4FOTA 4KREA 4B85A 3NBQA 1RQLA 2VZEA 1QP8A 1G4AE 1RJGA 3D8SA 2YV3A 1XYVA 4BNIA 3A4IA 1HLPA 1YJCA 2LW7A 2W8BB 3AU8A 4XAQA 4FS8A 1GGFA 5C8YF 1OC2A 3H19A 1RCFA 1DMRA 3STHA 3OEED 4DPLA 4KITB 2ZE7A 1MNAA 2C3UA 2P7IA 2FN3A 3ETLA 1L8XA 4GKAA 2H4YA 4IGEA 1CY0A 5KYNA 1SA0B 1UEIA 2EJUA 2GD6A 7AT1A 4WV3A 2H17A 4JBGA 4CT4B 1HDRA 3VZBA 4XLZA 3Q9LA 1AT1A 1T0PA 5F5LA 3HC7A 3STUA 4AF6A 4TQGA 1LJ8A 4QG7A 1PDWA 2GGSA 4BNGA 4PYRA 2Z3ZA 1O08A 4KGDA 4RCZA 1DWPA 2HAEA 1ZPDA 2NZUG 3O4JA 1LWNA 3ORSA 2Q4EA 4LBYA 4YMWA 5KCMA 3OFSA 5DHQA 4EPYA 5BN5A 4PLZA 4L4RA 2PZKA 5HJ2A 2HGSA 1BJTA 2ZAMA 4X65B 2RHHA 4TWJA 1JDBB 1XC7A 1JBQA 1Z7YA 8OHMA 2QR2A 2GUGA 3P71T 2ZJBA 4HQ6A 4AUEA 4PCVA 3UAOA 3EASA 2A5JA 4L6IA 4RMNA 2E82A 2O8FB 5K8LA 3H11B 5E7QA 1L5RA 3JZFA 4I3FA 2YHAA 3VZPA 2ZIZA 2EQBA 2GZRA 4K05A 3SQXA 2ASVA 4KWHA 3X2FA 3NQ41 2XD4A 1INLA 3N75A 4U9HS 2JVKA 1W48A 4IEIA 1BXGA 1AXRA 3MRTA 1LFAA 2MOKA 4E4TA 3TF5A 3KOYA 2I7VA 3KR2A 2BCJQ 4DLBA 1LNQA 4MHOA 3NHZA 3R7BA 3OUZA 1U3DA 4BB0A 2AJ8A 2YL2A 2JHPA 4NCNA 3FDJA 3KZ1E 5EQTA 2VJCA 1YI0A 3IJPA 1R3UA 3DD1A 4DJJA 2CJWB 3GMIA 1N2ZA 4F4UA 3E82A 3UK6A 1XTQA 5JHHB 2JBAA 4AX4A 1W75A 3C8ZA 3HBJA 3I12A 3LA6A 1TQ6A 4O5AA 3AUAA 1CQIB 1PFWA 2D59A 3UVEA 2YDYA 4EPRA 3EGEA 1X80A 3VOTA 4B48A 3DWIA 3E7XA 4RXMA 5F9FA 3JZDA 2DQ4A 4YRBA 4DVJA 3PEUA 1T2NA 1KK3A 2FMKA 3HGTA 1TE2A 2GFQA 1D0SA 1E32A 2PL3A 1J07A 1HF3A 3C3KA 3AJRA 4WJZA 1L5HB 4YQFA 1QKJA 4IRXA 1CV2A 4DLRA 2VDNB 3FGOA 1ISHA 2XVXA 3FOAA 4FKBA 1YWGO 3TR0A 2J0VA 4RTOA 5EYPA 4A0SA 1VRWA 2Y66A 4XRGA 3QRWA 3ZH2A 3BG5A 3R0QA 1QQ5A 3KZOA 4DDVA 3HLTA 2P9TA 2WI8A 1M6EX 4DCMA 1QBGA 5JAQA 3D7NA 3QJ5A 4DSTA 3QKRA 4R2HA 3EVFA 1SVIA 2HMAA 2JBAB 4UVEA 4H7PA 1E1CB 3QXGA 4BAUA 3TTWA 4TV9A 1M8FA 2JLCA 4LV8B 1X80B 1ABEA 3GEBA 4P2BA 5EWMB 1ETUA 3HU2A 4MSUA 1PDOA 4UTVA 3NHFA 4OAPA 1QK4A 1XEWX 1FFBA 3EBLA 4MQFB 1RQ2A 1AQ6A 3OM0A 3PC4A 1T0JB 3ZWOA 4FC7A 4K0KB 1JSLA 3N2LA 1OZ0A 4WXMA 4US1R 5EYPB 1Z8DA 4RFSB 4DLYA 5KWJA 3KOXA 2MT9A 3OQPA 4E03A 1WG8A 1JQ3A 1B6GA 1AKVA 3NJ8A 1OU0A 2J41A 1DKLA 1T4CB 2EBUA 4U5QA 1SXGA 1KRXA 2O2HA 1SKYE 3G6KA 5IJXA 2HXYA 1BKYA 1CPYA 3A27A 4TV9B 5HUHA 3HA3A 3FB1A 2DTDA 4NFLA 4QVGA 4Q18A 4GZ6A 2XCQA 3WP0A 4V24A 5L6LB 2C4NA 3Q2OA 4TT3D 5IEJA 2DEUA 5L3QA 3ZVLA 3WLPA 5BQFA 2P6OA 2PLWA 1USVA 1VHTA 5LA6B 2A0XA 2FW6A 1IUNA 4QUHA 4HXGA 1OIWA 2ABWA 2QAGC 3MQFA 4GMDA 2ID8A 3WO1A 2XWBF 1TLFA 3H5TA 1B0PA 1ZMXA 4ZPXA 4D42A 3DPSA 1C29B 3ACCA 1UQTA 1C7QA 1JSRA 2CN1A 1KYYA 4PPQA 4S0ZA 3KDAA 3W4JA 2BEUA 3R7WB 3IALA 1L5MA 1RJWA 2BFOA 3A1FA 1X15A 2ZE8A 1IZ0A 3U3JA 1GNTA 3OIYA 5KNDH 1OH6A 3IAS6 4OB7A 3W79A 1CR6A 2JK1A 3AX6A 4XB2A 4CVNA 3QMMA 2BEJA 4I5GA 4LXQA 3URMA 3HUUA 4BNZA 4B2YA 5BR4A 1TM3E 2C7PA 2CL7X 1UBKS 2WFLB 5I7EA 1JDNA 1MRNA 2WNSA 1H6DA 5CDFE 1D2HA 3TSYA 3CEMA 1L7XA 1VG0B 4KFCA 4HQLA 3K6RA 5CT5A 3GJRA 5F2OA 4KMSA 4UDXX 3GUHA 1XQ1A 3SJ7A 4DDKA 1PJQA 3L7IA 5JXGA 1VKHA 4C29A 1DAOA 3I0MA 4D2IA 3HWSA 3NM5A 4OY3A 3TIIA 3TWOA 5DIZA 2JJ8A 4J0EA 2JFVA 1KPGA 1NL3A 4O4LA 5AK5A 4DCUA 4C0SA 3WISA 4ESOA 5JDIA 4IUCS 5LUBA 4ZOLB 4AMBA 1U7HA 1EFVA 2DX7A 3GAZA 4UHEA 3I34X 3PWSA 3PXGA 2ZBRA 2RGXA 5FA6A 5BSWA 3TEMA 2JAQA 4G85A 1DAEA 4M87A 3ETGA 5H1YA 3WL6A 4ZZIA 4M53A 3K0CC 1CDDA 3H2KA 4IVNA 4I8DA 2AIRA 5U4XA 4YGXB 4B84A 4C7BA 5KOJA 2IPNA 2ZJ7A 4YJ3B 2YFYA 1U1GA 3ESZA 3SBDA 3L1IA 1H6CA 3VJKA 4D6YA 1JPJA 4CDMA 3B3AA 4NKRA 5IDXA 1FXSA 4BE7B 2XKBA 4NZPA 1ZKDA 2WIGA 5JZ9A 2H00A 1D2CA 1G3UA 4NU5A 4L9RA 1VFPA 1N5MA 2C5GA 2BEWA 1S96A 2H4XA 3FPSA 3IBCA 4IIVA 3C1TA 4CWAA 1OQAA 1UAAA 4I1IA 4TMYA 4BBAA 5AOVA 4P4LA 2FX2A 3EGIA 4P83A 1KETA 2WZQA 3ENZA 4FDMA 4UFOA 4CL3A 4DLAA 3ZKWB 5B1IA 1PFUA 2DUMA 4O1HA 5AXDA 4KI0A 3EMKA 5ELXA 4FMPA 5BW8A 2DT8A 1BJRE 4M1SA 4GOLD 4B6EA 2CLLB 3E3LA 5EIOA 3SGLA 2G5PA 4LX0A 2Z83A 1JG1A 1FMTA 4UVIA 3HS3A 3SHOA 2HPVA 2CXSA 3QLVA 1W9HA 1SCIA 4P3XA 1ZNXA 2QT9A 2K7ZA 2O1SA 1GRVA 1EESA 4MVYA 5E8RA 4B81A 2VQDA 2D2IA 5E1MA 5CCXA 3RBXA 1XZQA 2VT6A 4R54A 4TWAA 2FWJA 3GFVA 4DQ0A 4AZ3B 3FTNA 1FW6A 5HM8A 2OCAA 5KJEA 2O8BB 2XB6A 2CZGA 2FFHA 3OBBA 4YP5A 3EXIA 4CQLB 4CKWA 4RK1A 1XZCA 2DETA 2KLBA 1KJ8A 1LF0A 1OT3A 3KDPA 1P1RA 4WXPA 1EA7A 1K4KA 2FSGA 2EGGA 3SEQA 4DWJA 2BKAA 5F2KA 3T7SA 1RYZA 4AN1A 3K72B 2VWPA 3OJLA 2ZUEA 4CKYA 4XGKA 1M6WA 1NY6A 4F86A 4JXZA 3NHSA 3JZIA 3QLJA 2I2XB 4L4SA 3RTGA 3K9GA 1CJSA 1UKAA 4LSZA 3UQZA 1AN9A 3SDSA 2HMWA 1ZGHA 2YVKA 3OIWA 2E4WA 1MD9A 5EMNA 5EI5A 1Z7BA 3BZWA 4YWJA 1PFKA 4FYVA 3W9SA 4W99A 2FG5A 1DAKA 4TMVA 1RWMA 4Y7CA 4DLLA 2JFWA 2WV7A 3KQSA 1HK7A 5D3QA 4CKWB 4YREA 1KR5A 2J7KA 1QJ4A 2C8KA 3RJZA 3DVQX 3RE1A 1HLGA 4E51A 4BNVA 5CNKA 3PR1A 4CLXA 1PN3A 5DTMA 2BLNA 2D7CA 2AKAB 2D4AA 3WIEA 2HA7A 1V3VA 3BRWD 3VPXA 2R5NA 4HLQB 2BI8A 2JGKA 2AJCA 2OLEA 3IP6A 1KZ6A 5IT4A 4OX9B 1QRDA 2NADA 3UMGA 3ZY5A 4RGQA 2GM4A 4F3RA 1XMQB 1RJFA 4FFNA 4E1AA 4QXPA 1RPJA 2YXLA 5A5VA 4WA8A 1Y5RA 3HR4A 4ITUA 2I9KA 3OQHA 4U3JA 3ZI4A 3RYFB 4B43A 2PTHA 2VK2A 2FJ0A 3DNFA 4O08A 3R0IA 5HK8A 3RVSA 1BU5A 4ABYA 5AKXA 4X95A 2HCJB 2GPJA 5DYTA 3B13B 4OQFA 2HK8A 4RACA 3ZNNA 4ZYZA 2G76A 2YIMA 1NMZA 2RG7A 1CRLA 4MWEA 2ZAYA 5EQFA 3ISJA 5LBUA 5ABPA 5LFAA 5JROA 1X86B 1CJTC 1SHTX 3EPJA 2IBTA 1B6RA 1OGIA 1VCOA 4JASB 1AMNA 2BBSA 4ZVKA 4XVCA 4N76A 2GD2A 2X77A 1FUIA 3QOXA 2RJNA 5FPYA 4MKGA 2RGGA 2XDWA 4K26A 5AKZA 1QWSA 2WFMA 3IJ5A 4A8HA 3ECAA 4ZARA 4G4SO 4KPUA 4BO2A 1H5NA 1UM9A 3HUFA 4AIIA 3NASA 4BO6A 1OWNA 4HDNB 4MVJE 3VNBA 3C3XA 4P86A 2H4WA 1ZJYA 1ITZA 1XKQA 4PBSA 1WMSA 4RDHA 1WHSA 1LLDA 4J7XA 4DIFA 3TW0A 4OFBA 4J0KA 2O7NA 4UHDA 5AUNB 3THXB 4PRKA 4U7PB 3F90A 1B15A 2AVDA 5B6IA 4ZYLA 3ZWNA 2FN8A 2FPIB 4ESVA 4YRFA 4ZAZA 3SC4A 4XIYA 4B7ZA 1G21A 2HWKA 1MJ5A 5T41A 3PNLA 4BEWA 4O3MA 1JR3A 1EVJA 5C1DA 1X8JA 4JLUA 3UWKA 4F60A 5IJ0A 3FHJA 3OZTA 1TJNA 3UUGA 1E7YA 5H02A 2IX9A 4NE9A 2JLRA 1YMQA 5EN4A 3O8QA 4AYWA 4MNTA 2GRAA 2AC2A 1EFKA 2R4UA 3PP8A 4S2UA 1EGVB 2CDAA 4DDTA 4UXHA 3I1FA 2Q5JA 3C15C 1WW8A 2WPNA 1T8TA 1G5RA 4WE3A 5FTNA 2GA9A 1JPUA 4XH9B 1FE8A 1ZCFA 2ZIGA 3AL0C 3BCRA 4TOIA 3P19A 2JGAA 3M6UA 3WBKA 3MC1A 4J16C 1SXJA 1K08A 2XWQA 3KEOA 3NBAA 2G40A 1NBEA 3U19A 1CIJA 1G21B 2VUSA 4M9SA 4UU7A 5FL3A 4ZA2A 1ECGA 5H81A 1FQOA 2ZJ2A 1XZMA 3RNOA 5CFRA 3MCVA 4CTMA 3CJTA 4JYCA 3UB4A 3I5YA 1Q95A 4DT1A 4ITVA 4MKIA 4G0PA 2WY2D 1M2GA 2G5GX 5JUWA 4BNHA 1I2AA 5ALOA 3GJ8A 1NM5C 5EQDA 3SJCA 3UJ9A 4Z4QA 1FUKA 4X90A 1C7RA 2A7QA 3MTGA 1IEVA 1N3IA 3FGPA 1Z37A 2IX3A 2XIQA 2Y93A 4AZVA 3GGJA 4FKMA 4B09A 2EJCA 3DHWC 4AJEA 1PZXA 5E38A 5IXYA 2XWPA 4QQFA 3W2GA 4Z4HA 2NXCA 3KYJB 4CM1A 4JLPA 1N2GA 5I7UA 1CUGA 2P0AA 4R2MA 3H86A 1XTZA 3EZYA 1O96A 2CMDA 3CLSD 4E13A 2PMEA 3A1NA 4DT1B 5JG7A 1E9SA 3A1CA 1HYGA 3CLTC 3B3QA 1A69A 4RVCA 3G5MA 2EHJA 4AKGA 3E03A 2P4QA 2YZ7A 4LE1A 1BAPA 3DHVA 4C5AA 3DAPA 4G0MA 3TI9A 5DRTA 4Z2YA 3JQQA 2I1WA 1FFYA 3BXEA 3E9QA 3T7KA 2W2OA 3IXLA 1I2MA 2NM0A 1ACJA 1NW5A 3EULA 4PBTA 1TIKA 3DTNA 3RS9A 4DW8A 4BXOB 5J43A 1R9JA 3LE8A 1PFVA 4UUNA 3WGQA 3JVEA 1EFDN 5A9SA 4D0RA 3W5AA 3W5SA 3ELWA 2YCBA 1X3SA 4K1LA 1Z08A 3DNMA 3QE4A 3R8XA 3LECA 1RBMA 4YAOA 1YI1A 4D5GA 2PYDA 1FFDA 2ZT5A 2UV8A 3PQ6A 3C41J 2SCUB 3P4XA 3V32A 5EJIA 4CXMA 1X92A 1Y5MA 3TQOA 5T6BA 5EMHA 3D31A 1UBNA 3BHJA 2JLQA 1GKKA 4YRTA 1GUBA 4Q4JA 5HFAA 2DXIA 1U80A 4FN5A 3EWAA 1RE1A 3FD8A 4MHSA 1ZL0A 1ZJ5A 2PS1A 3IUQA 4KAJA 5JC8A 3MGBA 4MS1B 2H1RA 1W4ZA 2WRZA 3NOQA 5E6RA 5JOQA 3B6MA 3QVOA 1SQGA 3ZGVA 3OU6A 4HVAA 2OHFA 3SJBA 2V7QD 1KYXA 4UFNA 4O2LA 2EZUA 5DWQA 3NPMA 4TRRA 1NW9B 3DE5X 1G66A 1Q1BA 1IVYA 4OOFA 2VQ3A 4X7MA 1BSVA 1WXIA 1EYZA 2CSUA 3ILSA 2GZ3A 4G97A 3M1YA 4LDAA 3I2YX 4AZ0B 3UHAA 3DFIA 4DJ5X 4YRAA 1EUDB 5LZ4A 1H4SA 2ZUVA 2WBLC 4J9VA 5HA5A 8LDHA 3CBGA 5I7RA 5KYTA 1NW4A 2YH2A 1JEYA 3F47A 5CURA 5HMMA 1IUPA 4N5MA 1G64A 2RHJA 3HCAA 5AOCA 3W9BA 3WR5A 1N5JA 2BF7A 3A9VA 3ENWA 4J2TA 4NZYA 1G20B 4DILA 1X0VA 1FDIA 1YA6A 3HL4A 1AQNA 3DLAA 4Q4AA 4UTOA 5KVQA 1ZVVA 2JHCA 3FFWA 1U9IA 5C5EA 1OXKB 1LDGA 3ST7A 1R18A 2OESA 4S1WA 1O0SA 2QRUA 1M1YE 1RYYA 1J06A 2IZ7A 4BRUA 2W6MA 5G4LA 3WDLA 4RD6A 5DXAA 4TV9F 1Y63A 4EFLA 2X40A 3M4XA 3M34A 5DYWA 4L5AA 3RAJA 2O54A 4DQLA 2ID4A 2BZSA 2HTEA 5IULC 2CLDX 1JA0A 2B1JA 4D7AA 5BN3A 1W4AA 2Z9DA 3SZUA 5JS1A 3PQ2A 5LA6F 1B1AA 2H9IA 2PS3A 4G9BA 5E1BA 2ZB7A 2JH9A 4LVUA 4IJVA 3EVTA 1R5JA 4OIMA 1MX1A 2QGFA 1EWTA 4Q1BA 4UD6A 1FVHA 2HMSA 1S2LA 1Y1QA 2ZSUA 3NNDA 2R1TB 4Q4AB 1UOQA 3CRQA 4MZDA 3V8QA 5JRDS 5KTPA 2PUDA 3KTFA 1F8YA 3WE7A 5KQLA 5JYEA 2F3UA 3HU3A 3UCEA 2CV2A 3L4BA 4YBRA 1Z33A 2CHUA 3FNGA 3O21A 1YB6A 1IEWA 3G7SA 5TC4A 4QYIA 4LGVA 3OWXA 2IEYA 3N07A 5FJJA 3U7JA 3VZCA 5GTDA 1NVFA 3GFBA 4MITA 4GECA 2I8LA 1E62A 2DRIA 3DDSA 3H4MA 4LC9A 2R8YA 3LKDA 1JEQB 1T2FA 2BZGA 2GJAA 1GPLA 1CS0B 1LBTA 1T1IA 1YR9A 3OE7D 4H0FA 1E0KA 2H2GA 2EFYA 2V7TA 2VIIA 4Z0PA 1W87A 3UY4A 3A0UA 3K96A 4C3UA 3NYRA 1ZVKA 4Q93A 5D3ZA 1KO7A 1RXUA 3EAGA 3EOZA 3BTSA 3PE4A 2G83A 4HQFA 1L5YA 1Q74A 4RZSA 5LCXA 3BWVA 1GFSA 3MB5A 1BX3A 2NNLD 3HCBA 1QXSA 1NVMB 3KXKA 3RYCB 2JDID 3IUJA 4ZOLF 2C2ZA 4MGZR 5D1NA 1FQJA 1UKZA 3HDJA 3HFGA 2Z1MA 3W8RA 3G59A 5DM2A 2A1TR 2G1AA 3TSZA 3LJKA 4MI3A 1EP1B 4TM7A 2VLIA 3ROXA 4CKXA 1IONA 4L1KA 2YFKA 1LV8A 4LRWA 4YJ3F 5HE9A 1NVWQ 4UUAA 2E1RA 1GCIA 1U0GA 2EU8A 2G5CA 3OU7A 1ZD4A 5B1YA 2WM2A 3V4LA 1EGHA 3D5EA 4HX2A 4ND5A 3HADA 1J25A 1YVDA 4FLFA 4HLUA 4R2KA 3KIPA 4OQ4A 1PX2A 2OP1A 3L05A 1QFYA 3H0EA 1UT6A 2EG9A 4HDRB 5BWNA 5L3SB 1O5TA 4CIXA 1SZDA 3ZH9B 3EF0A 1EPUA 1PI3A 1U6IA 1U0HC 3GT7A 2C7QA 1FTQA 2VHJA 1S5PA 1TZ2A 4JGBA 1NG1A 2VF7A 2W6CX 3UAYA 1CZNA 1F0YA 2R9VA 1E5DA 2ODEA 2WF7A 4YAEA 2EFEB 5AW7A 2X13A 4A6XA 3HYRA 1IPHA 4YV2A 5CT4A 4IDAA 4X8LA 4OK6A 1XF9A 2JB9A 5I9SA 2VCEA 3U7HB 5FR1A 4TV8B 5SZHB 5AW4A 5JANA 1A3CA 2XUAA 1RPNA 4YUWA 1ZIDA 2NN3C 4CR7A 2MJLA 3VSAA 2XRMA 4LX8A 4LVOA 1WZCA 2Y2VA 1FFHA 1QGOA 1UDXA 4QUBA 5DGIA 3TLAA 1PZEA 2BD0A 2FRDC 4IZOA 4RIHA 1ZHOA 1I5OA 1WM1A 3QPVA 4MRMA 1XXLA 4NV0A 4B4VA 3R8FA 4ZVUA 4G9EA 1WRBA 3Q12A 3QYPA 1U2EA 4JQCA 4LSGA 4EP1A 1AJEA 1QG4A 2ARKA 5IS2A 1UXKA 3HZRA 1RE0A 2BHLA 3O8OB 3H83A 2WJYA 3IJEB 2BC9A 3D8UA 3I6IA 1SG9A 3KAKA 4G2NA 1GPWB 4GBMA 4H4EA 3TVDA 3U17A 2Q3EA 2EKZA 3U0VA 2GZHA 2WHPB 1NMYA 1SD2A 3V2UA 3QWFA 3T1OA 3H17A 1C7ZA 2YX1A 4NESA 1DTEA 3RHTA 2WHRA 1YV9A 3A36A 1ESZA 2VJKA 1AHIA 2X0FA 4MDEA 1EGAA 4QXOA 4YCAA 4FYKA 5FQOA 4O2BF 3CT6A 1DRVA 4OX9Y 3A4NA 2VBFA 3ZX5A 3DR5A 3DZHA 4WZBB 5ALHA 3E9NA 1ZH0A 1H4QA 5KQGA 3B6JA 1IATA 5LXTA 2JGLA 4LA4A 2XT0A 1ICIA 3W5DA 5H8WA 1XNJA 3R3VA 4ER7A 1XAIA 3ZTTA 4EGAA 4IZIA 2OPHA 4LN1A 2O3UA 1G19A 2RK4A 4KIWA 2OV8A 1XNRB 1E9AA 4RETA 1JA1A 2V8OA 3P2MA 2PZMA 2RDMA 4YUXA 2RAFA 1N33B 1NNLA 3WV4A 1TB4A 4JBLA 1L7EA 4G0QA 4F45A 1EHCA 1AV6A 3LW8A 2X23A 3FTPA 2UXBB 3OLZA 2FJPA 2ZYHA 1NNEA 1PSWA 1REQA 1R27A 1ZESA 4X1KA 1DIHA 4HLUC 2ZI6A 1QHIA 5TQ0B 3VH3A 2BM1A 2ODTX 1LQUA 3VYWA 1XQVA 2WAMA 4XGRA 2JA1A 5B57C 4R1NA 5AW0A 4N39A 2A9PA 4JXXA 3C7AA 4XCQA 4B9AA 2W42A 4B4UA 1B8UA 1SUIA 2ZTVA 2INGX 1CIVA 3VBCA 4BPRA 1XNQB 2JIOA 3M6VA 5AK3A 2YDXA 1KQFA 3IKTA 2QIOA 5KYKA 3I76A 4GI5A 3C3WA 4HNAB 3OQNA 4GKJB 1NI4A 2VZLA 4IIFA 4FKZA 5FFMA 5E7MA 3IOBA 1KZ4A 2QW1A 1UJNA 1JR4A 5HF9A 1PGNA 2ZBUA 4FE3A 1JHPA 3DTVD 1V5EA 1J8QA 2H18A 4IDCA 1XD2B 4TL8A 1BHJA 3TQTA 2CK3A 4UEWA 4XLLA 2ZK7A 4B6RA 5TIIA 2L69A 2VPTA 2CE2X 4YMSA 3WJ2A 3BGDA 4BWFB 1R88A 1P3JA 4X1KB 5IJAA 4TUYA 1QVVA 1LXCA 3LLSA 2B5OA 2EZ4A 2EKBA 1KAOA 3B3JA 4G4JA 4HLDA 2QRMA 1M8KA 4GBGA 4LZOA 1T10A 2N1MA 3QOWA 1EEHA