1M5UA

Crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
123
structure length
113
Chain Sequence
b'TKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTAIRGGCEAYISKPISVVHFLETIKRLLERQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cell division response regulator DivK
publication title Crystallographic and biochemical studies of DivK reveal novel features of an essential response regulator in Caulobacter crescentus
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Signaling protein, cell cycle
total genus 35
structure length 113
sequence length 123
ec nomenclature
pdb deposition date 2002-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m5uA00
1Z15A 4F12A 2IPAB 2PUEA 3TD9A 1OXKB 1NATA 3LUKA 4N47A 3HM9A 3HJFA 4E7PA 4M88A 3KYJB 5KQLA 1Z17A 1NXPA 2PUAA 1DG9A 3KTOA 4Z4GA 3OQNA 3GBPA 1U2QA 2J48A 2JVIA 5IUKC 3CLKA 2IPMA 3I09A 3CG4A 4NQRA 3KS9A 9ABPA 3QK7A 2IKSA 3QLUA 5JNRA 4TLMB 3E3MA 4XASA 4FB4A 4G0ZA 4RZSA 1MAVA 2HQBA 3QELA 4KQCA 3MYYA 4LX8A 3LUJA 4Z4CA 3MIZA 1QO0D 5CHYA 4OLAA 4EVSA 4EY3A 4RSMA 1DBQA 2PE5A 2MSKA 4Z4EA 1AB6A 1Z13A 3C3KA 2ID9A 2JK1A 4RS3A 3C6QA 4ZMRA 1RPJA 4LE1A 1M5UA 1JYEA 1ZGGA 3LKBA 2H3HA 4RXTA 2GBPA 1YK1A 4TMYA 3TMYA 4RV5A 3IDOA 5GOTA 1YVUA 1DJMA 3LTEA 4MQEB 4RXUA 3CU5A 1YS7A 2GWRA 5IEJA 4HNQA 4OTZA 1TLFA 1JYFA 5TQJA 2FQYA 4XFKA 4W5NA 1NXTA 3SY8A 1SD5A 2E4YA 4RKRA 2FEPA 2H0AA 2QVGA 4S04A 2ZWMA 4KFCA 3QLVC 1Z12A 4JASB 3DLBA 1GCGA 4LDAA 1M2EA 3MMNA 2P9HA 2JVJA 2A9PA 2FQXA 2WJWA 3BRQA 3FFWA 2NZUG 3H5IA 3N0WA 4MRMA 4XLTA 4D6YA 1S8NA 1A04A 4RK6A 2FVYA 3KSMA 1B00A 1E6LA 3HDGA 1RZRD 1JWLA 1ZDMA 2HQRA 5FBHA 1WETA 2PUCA 1DC8A 2FN8A 3UKJA 3CKMA 3B2NA 2LBPA 3Q7TA 1GCAA 2A9OA 2FMFA 4KK4A 3OMWA 3FFTA 4FE4A 1QP7A 3F6CA 3DZDA 4ZMSA 3HCWA 1KRXA 4L4UA 3OO1A 2ID7A 1JFTA 5JS1A 2RJOA 3A0UA 3A3KA 3QLUC 3CZ5A 2E4WA 2MYNA 3MA0A 4XAQA 5KQGA 1VLZA 1L5ZA 3GYBA 1D2AA 3L6UA 4HNSA 4MYRA 3TX6A 2B4AA 4W5TA 4Z4IA 3OM1A 3RVMA 1PEYA 3JTEA 2GKGA 3RVLA 2NZVG 4ZPJA 3QEMB 2L18A 1XWWA 4IILA 1NXVA 4FE7A 1JFSA 4MQFB 5BRAA 3SM9A 1GUBA 4MPTA 3I42A 5DGCA 4EVRA 2E4ZA 2JVKA 5GQSA 3GT7A 2CD7A 3RVOA 5TE9A 4QICA 3LOPA 2QU7A 4KV7A 3RQIA 1Y1LA 3H5LA 2LUOA 1BAPA 2B1JA 3N0RA 2QVCA 4LDZA 2MSLA 3O1HB 2W42A 1MB0A 5IULC 2M1ZA 5D2CA 5EWJA 1ZN2A 3RVPA 3MF4A 1C4WA 1JBEA 1FFGA 5DLEA 4H3KB 4F06A 2PJUA 3W9SA 2GI4A 4YLEA 3EGCA 2R47A 4QYWA 2MYUA 4MAAA 1MB3A 2RJNA 1Z16A 2YHBA 1JX6A 3M9WA 2FN9A 1D1PA 3A10A 1YIOA 5EWJB 2FKAA 4Z4FA 3LFTA 5T7BA 3N6VA 3DLHA 4JP1A 3HUUA 2R25B 2FLWA 2VUHB 4O1IA 1Z18A 3HVRA 3OO0A 4MR7A 3F73A 2PL1A 3LUDA 1RNLA 3C97A 3HS3A 4RXMA 3RVKA 2VK2A 5CNMA 1YMUA 3FMVA 2E4UA 2M98A 1D1QA 3EQ2A 4IRXA 4RK5A 3HK2A 3GBVA 4IMIB 3A0RB 1NXSA 3K9CA 1JHZA 3SG0A 2E4VA 3FFXA 6ABPA 1VPWA 4Y9TA 1OXBB 4ZYLA 4WZZA 4W5RA 1R8JA 5EWLA 1SXGA 2FMKA 3O2QB 3KCNA 1VRVA 5KWSA 1EAYA 4IF4A 4MR8A 5DCLA 4UHKA 3Q7SA 4P1ZA 1ZESA 1QP0A 1CEYA 3HXMA 3LUGA 3N53A 3Q7RA 4OATA 4ETIA 4G0YA 1JF8A 5B3JA 3ROTA 1J56A 5I4CA 3EODA 1DP4A 3QELB 2CHEA 1MIHA 2WRZA 4MLDA 1BDJA 4PEVA 1BDIA 3LKVA 1JH9A 3N8IA 3QX8A 2PUGA 5TPZD 4DQDA 5BRJA 1PNTA 4MLCA 5FWXA 4WXEA 2FTKE 2TMYA 1EFAA 2PL9A 1RXEA 1ZH4A 3I45A 4EYQA 5KQMA 1ABEA 2IYNA 3G1WA 4JA2A 4RK0A 4YWHA 3LUCA 3HO1A 3OLWA 3UUGA 3O75A 4PYRA 1M2FA 2IOYA 2PKXA 3JS5A 2VYCA 3IP7A 1CYEA 1A0OA 1YMVA 3Q15C 1Z2EA 1JLKA 2QZJA 2ZAYA 3LUHA 1NY5A 1JL3A 2PMCA 3Q41A 4MGEA 2HPHA 1Z2DA 1P8AA 3HV2A 4PICA 3C3MA 5FWXB 2F8SA 4KREA 3RH0A 4ETNA 1RXIA 4XXHA 4DN6A 1KGSA 2JBAA 4G86A 5EWMA 3GL9A 3CG0A 4ZJPA 1QP4A 2WB4A 3TO5A 5KQPA 3ILYA 1EWVA 1SRRA 1ZH2A 5CNIA 1URPA 5TQ2A 3EQZA 3HZHA 3T95A 1F51E 3QEKA 1USKA 3CZCA 1U0SY 2IDMA 1A2OA 5FWYA 5FBKA 2CWDA 4Q6WA 3SAJA 3HSYA 4NICA 4Q6BA 1JFVA 3MM4A 4MRMB 5HKOA 1L5YA 3JPWA 2RDMA 3R0JA 5IEBA 3H6GA 1QO0A 1DRJA 1TM2A 2L19A 3CFYA 1PHRA 1GLGA 3DBIA 4KZKA 3OLYA 4PZ0A 4EYOA 1K68A 2LP4Y 5FWYB 1U04A 4RY9A 4LRQA 1YS6A 4LZLA 5CNJA 4YP9A 4G0QA 1DBWA 3HDVA 4H60A 2AYXA 2GX6A 4L85A 1T34A 3Q9SA 2DRIA 1NXOA 1TJYA 3IP9A 4OG2A 1CHNA 4OBBA 1E6KA 5B3JC 4KMRA 4IGAA 3EAFA 3CRNA 3EDCA 1D5WA 3L49A 4RWEA 4RU1A 4MS3A 3VNAA 1E2BA 4LE2A 1LBIA 4KVFA 3G85A 3URMA 4F11A 1SXHA 3I5AA 4IMJB 2R48A 4NCAA 1H9CA 2FLKA 4G0MA 4RY0A 5JNUA 4JAVC 3H1EA 2WMYA 5IUJC 3BILA 4PE5B 5IUNC 1Z26A 3KHTA 1TVMA 4MR9A 2VUIB 1DZ3A 1F4VA 3QX9A 5JS2A 3D8UA 3KKEA 3H1GA 4Z4HA 2PAFA 2CHFA 3UK0A 1FFWA 2FXIA 5C5CA 4NCBA 3EULA 3O74A 4TN5A 3N0XA 3LUFA 1DBPA 4YS6A 1PNRA 4XARA 4YO7A 1U2PA 2L17A 1NTRA 1W25A 2OENG 3O1IC 4Q7EA 4QPJC 5JNWA 2XDYA 1RZRA 4RY8A 2PLNA 4EYGA 6CHYA 1U8TA 4MS4A 4E7OA 2BGGA 4YGXB 3CS3A 1MVOA 4JB2A 1YK0A 3O2JA 3H5TA 3GA5A 4S05A 2YHAA 3ROFA 4F8JA 3F7NA 4KNYA 1ZITA 1ZAYA 3T38A 5HSGA 1IIBA 2PUBA 5IC5A 1ABFA 4UHJA 4HYEA 4RDCA 2L2QA 2V0NA 4D74A 2QXYA 1JDNA 5BQ3A 4N03A 4D6XA 1DCFA 1QNLA 4MR7B 1ZGZA 2LPMA 3OQMA 2NT4A 4HNRA 1AB5A 5T3YA 3JVIA 2NT3A 1XHEA 4YR7A 3OLZA 2QW1A 4G97A 2MYTA 1KMIY 3H6HA 4O5AA 4RKQA 4JOQA 3IPAA 3OMXA 4G0PA 3C3WA 1TMYA 3EJWA 3KLOA 4WXMA 5DKFA 3GRCA 5EWLB 1APBA 2KYRA 4F3TA 1FFSA 3IP6A 2FEKA 5ABPA 5IBQA 5KC9A 3OM0A 3QLTA 4MR8B 3H75A 3NBMA 1C0EA 2WJAA 4W5OA 1ISSA 3IPCA 2FSPA 5KI6A 2NUBA 2HSGA 1HEYA 3IP5A 4ML3A 3O21A 4P98A 3M9XA 5PNTA 1KRWA 2FW0A 1Z25A 3H5VA 3RVRA 4YV7A 1USGA 2WWVD 3DGEC 1P6QA 4MQEA 1QKKA 1PEAA 4H3HB 1W9HA 4OLBA 3FGZA 4LE0A 2P4UA 5BR1A 4QYMA 2E4XA 4KRFA 4RK7A 3T8YA 5HQJA 1BDHA 4G0XA 1XHFA 3HUTA 4O1HA 2FQWA 2I6FA 3OQOA 3VNBA 3SNKA 4EUKA 4YCSA 4EGSA 2QSJA 4MS1A 4EYKA 4JB0A 2Q5CA 3SQNA 5IX8A 3NHMA 3KLNA 2FMIA 1YTUA 3BREA 1PUXA 1QQBA 5KC8A 3NNDA 4Z9BA 2JBAB 3CHYA 5EWMB 3GWGA 1D4ZA 1DRKA 2PUFA 1NXXA 4N76A 1USIA 4TLLB 3RVJA 1FSPA 4MS1B 3JY6A 1BA2A 3H1FA 2MYPA 2JCGA 3D02A 2O20A 5TQ2B 5C5EA 1BVHA 3BRSA 3NHZA 3RVSA 2QV0A 3P9YA 5CNKA 5ED4A 3KYIB 1QMPA 1ZVVA 4KQ9A 3M6MD 3JVDA 4RK1A 1ZHHA 1ISRA 3S99A 5JNSA 2HJ9A 2F8TA 1LJUA 3OLXA 1EWKA 1VKRA 4GNRA 1P6UA 3QEMA 4W5QA 1ZY2A 1P2FA 4YRZA 4MQFA 3O2SB 5TPZA 3CTPA 4ETMA 1EWTA 1K66A 4WT7A 4G0OA 5TPWA 5E3JA 3E61A 3JPYA 3NNSA 4NV3A 5DTEA 3TB6A 3O1JC 7ABPA 4N41A 1E6MA 3HEBA 4GPAA 2RGYA 4N0PA 4DADA 2N9UA 1NXWA 2OQRA 3KG2A 2FMHA 4WWHA 2LIVA 1QQAA 4MS3B 1GUDA 5TQ0A 3DGFC 4KPYA 2QR3A 5TPWB 1SXIA 3LUAA 2AYZA 3ILHA 3F6PA 4Z99A 4MR9B 3H5WA 3OLVA 4WUTA 5HM6A 2A9QA 4EVQA 3FDFA 2WY2D 4N0QA 1JDPA 4Z9AA 2A9RA 2FEWB 1QPZA 4KK3A 1I3CA 1DCKA 1UDRA 2JRLA 4RK4A 2R4QA 1FQWA 3NNNA 3K4HA 3LMKA 3MQ4A 5TQ0B 1EHCA 3RVQA 4B09A 5F64A 4CBVA 3GV0A 3N75A 3RVNA 2HQOA 2IPLA 3H5OA 5JNTA 5JNVA 3T6KA 1DCMA 8ABPA 1LJLA 3BBLA 2IPNA 1LBHA 2MSWA 1DC7A 3KJXA 3QLVA 1M5TA 4MS4B 4Z0NA 2JB9A 2PUDA 2X7XA 3CNBA 1LK0A
chains in the Genus database with same CATH superfamily
1P4AA 1HFKA 4NMHA 4O2BB 1EVLA 1QK5A 3MNFA 4X71A 2QKYA 2XT0A 3ZIAA 1SFRA 2PMKA 1SVLA 3DE4X 2CHGA 4ND7A 5SYAA 4JJ7A 4N47A 2RH5A 4NU0A 4MWTA 3DZGA 1G8SA 3HM9A 1PJ8A 1Y4AE 4LECA 4BO9A 1OBHA 2V3WA 1HO3A 1V3TA 3UJ8A 1WBJB 5G0UA 3ZD6A 2D5CA 1KAMA 3BJMA 2J48A 4QYXA 3A27A 2IELA 3M6VA 1AGNA 3L4SO 2AN5A 2GD1O 3ONFA 4J1NA 2R9VA 2YYYA 1Z5OA 4LXIA 2ERXA 4YK7A 1N5IA 4US2R 5L4NA 1T10A 3KS9A 3TI9A 1N6OA 2QTGA 5C8YF 2XUAA 4NE9A 4AWAA 3T99A 3E7WA 2OFXA 3G8BA 2YXDA 1CU1A 2H1WA 3OLCX 1KEEA 4WN3A 5A4AA 3HB1A 4OYLA 2VF4X 1NQOA 3K2BA 2ID8A 3W8NA 4BNMA 4DLXA 2MHCA 2R11A 3SSOA 4X94A 3USCS 3L40A 4OKIA 2Y0PA 4KBYA 1CK4A 2QTRA 3K9WA 4CM4B 1E0SA 4OQLA 1TEVA 2D62A 4JNCA 4HNGA 2IF0A 4WUVA 4A92A 2OCKA 1QDLB 2HPVA 1TC1A 2CMDA 2QY9A 2DWQA 3BZUA 4R40A 1VRWA 4WJZA 2FFBA 1NUAA 2DM6A 4EFNA 3X2FA 1UPTA 1ZOLA 1FVFA 4UNIA 1NWCA 3FKJA 3ZWQA 3GLGB 3LKBA 2PLRA 2IS6A 4FX5A 4DV7B 5L7WA 4WBNA 3KT0A 4ZZ3A 2W2MA 3FZEA 1VG8A 2D59A 2ZSBA 1DC4A 2W6ZA 1R6DA 3GEBA 5CM9C 3V1MA 4JSYA 1T36A 3K1AB 3U60B 3LCCA 2PWZA 2FPWA 5DCUA 1I6WA 1KFCB 4CIBA 5REQB 4CT0A 4I4TA 3JZFA 5FO1A 1JHAA 1TLFA 2WU8A 3TIVA 1IXYA 3RAEC 4XQCA 3VVMA 3ECAA 1CY7A 1Y8RB 2F7SA 2BW0A 3I2GA 1K86A 2HMUA 4JB8A 2EKQA 3V4LA 4QTUB 4R2JA 3NFRA 2O2GA 3FZNA 4UUPA 4EAAA 1CUHA 4NS4A 3RHTA 5LFAA 4KFCA 1QC5B 3C5EA 4JASB 4DT1B 2JBWA 4RTPA 4RTSA 3B1YA 2FRXA 4O4IF 3AR5A 4HHEA 2PL5A 2R8RA 2Q6IA 4INJA 4Q15A 3N0WA 4RY2A 2EG5A 4YLEA 4YP5A 4ZEXA 1CUJA 1S8NA 3ND9A 1ZW1A 2Y0BA 3Q2OA 4CLOA 3EUEA 3A58B 4CFYA 4EHNA 2I7DA 1ETUA 4MPDA 2W6JA 1T8YA 2ZI9A 4IIEA 4RZUA 5EJAA 5FBHA 4D81A 2H52A 1X94A 3DAGA 2Z6AA 1UBCA 4DLNA 5JCOA 1VIDA 3AU9A 1H2WA 2A9OA 1Z0KA 2EX1A 2FSUA 3FMGA 4MAFA 4ZP1A 4AXBA 1GV1A 4L4UA 3EPPA 2BYTA 3GFVA 4ZU1X 3TVTA 3ZDXB 1PS9A 5CH8A 2ICAA 5JS1A 3QLUC 1ODJA 1OLUA 1FFBA 2I65A 2QJRA 4MIEA 1D07A 1KJWA 2PA3A 5AIAA 5BSFA 1XN4A 3GYGA 5ALHA 1GZVA 1WUYA 4MYRA 2R8XA 1SQSA 4ZKEA 4CM9D 3I6IA 1I7PA 4M6WB 1ADCA 4OV6B 5A3SA 2JZOA 5JBIA 2C9BA 4RJLA 4RV4A 3HL4A 3KPYA 2JIOA 3LV8A 3WGOA 4ZOEA 3MWGA 1VHQA 4JKOA 4PU0A 4M7WA 1NJ5A 3V1NA 2XT6A 4B2YA 2OZEA 4E5YA 2GK7A 2AXQA 2O54A 4YUWA 5IK2D 2WTEA 2J31A 4QYTA 5BNTA 2MWMA 5B3LA 1L7AA 2H4HA 2WA2A 1ZNWA 1DG3A 2Q99A 4EJFA 2ZRDA 4U9HS 1G1MA 1ZMOA 2V6MA 4GD3Q 5DHFA 2GBGA 4QHTA 2W42A 2R6GA 3LXUX 1PFKA 1G41A 3QE0A 4QAJA 2YIMA 1C8BA 1NR7A 2IUYA 2LCIA 2XZTA 4NESA 2GI4A 2PT5A 1C8VB 3N7TA 3GQVA 5JANA 3LD9A 1RPNA 3MWFA 1F5SA 1WAMA 1L4YA 2AOVA 2HSZA 5D6OA 2AFRA 3AEUA 3RUIA 5FUMA 2NYVA 5MFPA 4UPEA 2R25B 3E3AA 1M2OA 4PHFA 4TV8F 4X8MA 1JB1A 3HJHA 3ZI0A 2O8FB 4KR9A 2PL1A 2OYSA 3LUDA 4CLHA 1YQQA 4RXMA 3SF0A 3GJ4A 2X1MA 1EFVB 1DQYA 1VSTA 1IQUA 2O7NA 4C0BA 1RBZA 4KQ2A 4NOMA 4GQAA 2GASA 3RG8A 2DBRA 1IE3A 4MVJG 1O94C 3EQ2A 4OFZA 4GOOD 2BSXA 4IV5A 1XFDA 4HKTA 3QXJA 4OP2A 3IUBA 4RA9B 2OV8A 3SDZA 3E22A 2ZBDA 4LZNA 4WNYA 3SYNA 3MMXA 1JQDA 5EJGA 1XTPA 2C4TA 5K03A 1SXGA 3VTAA 3WY9A 3BG5A 4FPXA 4M9XA 3RC2A 2Q5LA 3AR3A 5BV1A 3QLJA 2YW9A 4AK9A 4BC1A 4YUYA 2JZNA 3Q7SA 1HF3A 2IDKA 5COAA 5JD4A 1JKJB 2FGJA 5CXXA 1R4AA 1ND5A 2IZ5A 5LZ5A 1F2UA 1QLWA 2AXPA 2G63A 2GVNA 3FRHA 4B73A 2ZRFA 3C7DB 3CF4G 4JBNA 3VOAA 4G5FA 1RRPA 5JSFA 3BMXA 2CMHA 2H1CA 3GJYA 4WERA 2XMDA 1UCFA 5AM5A 3ZPXA 1E32A 3RTEA 1S8AA 1TTHA 3L1VA 4X8LA 1C7IA 5FTLA 3S2UA 2EWMA 5EMNA 4RLHA 3GG9A 4MH0R 4ALLA 2WC1A 1QHFA 3O84A 1PEDA 4JR1A 2CLHB 5EIFA 5DNUA 1I7NA 3RPEA 1UFOA 2FY8A 3BXPA 1KMHB 4J16A 3U1TA 1GPYA 3BL8A 5DX0A 3CRRA 2HEIA 4OIFA 3NANA 5B1HA 2GYVA 3O5AA 4AYXA 2VJDA 3S6JA 4YAFA 2WKQA 4C29A 3F6RA 4RFVA 1E98A 2QUZA 2YWJA 4J3JA 3RHSA 1ZUNA 4RDHA 1JL3A 3I1IA 2BFWA 2RE8A 2FETA 4FYVA 1CKEA 2W43A 5FLEX 3DZHA 4UNNA 4XM2A 1UKYA 1X8LA 2VJOA 3NBYC 2HCFA 3KHUA 4C0XA 4TZTA 1LPOA 5FNZA 4X7BA 4XB6B 5TR9A 1J8DA 2YFQA 4CFSA 2A1TS 1QBKC 1QH1A 1DWPA 2W0SA 1C9EA 3V48A 3WWYA 1W52X 1HDIA 3T95A 2R8OA 4QVIA 4FKMA 1N5RA 4YASA 3NYRA 4INOA 3CZCA 2E1RA 4UBNA 3SR3A 4HQFA 2I6TA 2DPXA 1TGVA 5HCUA 2IZZA 4NICA 4QA9A 3TSOA 4J0KA 2PU5A 3I37X 2QZZA 1T1EA 1L5YA 2QT9A 3DKIA 2CLLB 3HE3A 3AIIA 4BXOA 3KYDB 3CKLA 1JECA 1XLTA 4CMEA 2QOEA 2G9UA 3AOGA 2O4UX 4OAPA 4EBBA 1ONSA 5A9TA 1OFGA 4L07A 4BEVA 1UMDB 2QROA 4ITUA 2ZJ8A 4A0FA 1KMCA 1S2OA 5D51S 1N5DA 2RI6A 4YP9A 3LBNA 2PWYA 1LFAA 1YR6A 4ZQEA 3QTLA 4CR6A 4ENWA 2YJ6A 3JQPA 2OHVA 4IUDS 1XCGB 1GQYA 1AKTA 3QTTA 4OG2A 4RETA 2ETVA 2GXUA 3L0ZA 5B3JC 5CD9A 4CIYA 4HFJA 2H1RA 3N0TA 4Y2YA 1ACLA 4EKEA 4L8GA 3VSBA 1C30A 2RGEA 5JDIA 4CEJB 4EPYA 3GLFE 1SXQA 2J0UB 5AKLA 4EG5A 3IUQA 5C8YB 4D26A 2BE7A 1RBMA 3V42A 2R48A 4MYTA 4UZFA 1MLDA 5DGTA 1Q5PA 4YRNA 3G8DA 2QG4A 4ZT2A 4QPPA 3CH5A 4EEXA 2CXPA 1TB4A 1G8MA 1BWQA 4NENB 3W7AA 1M1YA 3C5CA 4WJKB 1N2CE 3CLSD 4X97A 5IJXA 3RHZA 1DJOA 1NBOA 2I3DA 1N5JA 3C87A 2YMMA 4KIFA 3NGXA 1TO1E 1YXMA 3D7LA 2FJ0A 4TWIA 2FXVA 2XI4A 1RIIA 4D4HA 1EFPB 3TVYA 4YPVA 2I5PO 1HKHA 4GF5A 3MK31 4GP7A 4X85A 3SHFA 4H4DA 3A4VA 1U2PA 2B30A 3PUHA 1SCUB 4ALKA 4R9VA 1H5QA 1J5EB 2ZR8A 4IICA 1ISGA 4RLQA 1KWKA 1I30A 3ZH9B 5D7BA 3KTFA 2VT6A 4BE7B 2GQ0A 2JLCA 3LVQE 1M1UA 3O0DA 1XF9A 2H1OA 4K46A 5FUXA 2PX4A 1PT9A 3WMXA 3C4QA 3BDIA 3QXSA 3DF9A 2BEWB 2YHAA 5D1NA 4CF6A 4RSGA 5A9SB 3E3LA 1SA0B 1PL8A 4G56A 4YCDA 4PX3A 2HV9A 1M6YA 1Y1SA 1YB7A 2XR1A 2YJ5A 5ECGC 1YBHA 3H3XA 5IC5A 1XA4A 1DBSA 1XXHE 3KB6A 4AY4A 3Q6IA 4X92A 2J3KA 8AT1A 5KNDD 5FI3A 3C6XA 1CIVA 2CE7A 4EO4A 2GNPA 2NAFA 1RBQA 3TCNA 3FOZA 5DBIA 3CRQA 4L22A 5IM4F 3GRKA 2Y67A 4CM9A 3RKRA 3ZY3A 1NHGA 1WPXA 1KAGA 1U6IA 4O4IB 1U8AA 3ZU3A 3K8ZA 3EPJA 2RARA 2ZRLA 2FSSA 3IMCA 4CLEA 3PA8A 1FFXA 4G23A 4KR0A 4K3VA 1G64A 1YB6A 3F71A 1GY8A 4L5YA 4LDQA 2A58A 2P8JA 1C14A 3EZ9A 3KDAA 3JWGA 1N2XA 4ZOLF 3NTVA 2WIAA 3LM8A 3DFUA 5AQ1A 1XPRA 1EKXA 1LPAB 3JYPA 3P9ZA 4J0QA 5IK2A 1PVDA 3TRFA 3DZKA 1FX1A 2I7VA 4E2FA 1ZEMA 5A0FA 2HYDA 3VHXB 4X1YB 3OP4A 4WA7A 1WD5A 1SXJE 3D6TB 2DR3A 4FP9A 5K3CA 3WLTA 4JOCA 3WTBA 2XGMA 3IPCA 2A57A 1E9EA 3INGA 2OGZA 3GJ8A 3ML1A 3OWXA 4IDGA 2WEKA 4Y1EA 5AHKA 5FNVA 4WVFA 3SR0A 2JGKA 2QM8A 2XF2A 3JRNA 3NHPA 5TF4A 4DAEA 3KP1A 3O3OB 3G2JA 2PJDA 1NUQA 3HY3A 3O4IA 3WKCA 2EHJA 3WK8A 4B48A 3DGEC 3PT9A 4NULA 4D5GA 1PR1A 1HOTA 4TYPA 5LQCA 1FP2A 1W9HA 3RT9A 2ZYAA 1Q7RA 1WU8A 2ZJ2A 2GERA 4FBMA 1X7YB 2CK3D 3DMFA 2IYFA 5K8UA 2FFAA 2JHFA 4L7VA 5JPDA 3H3FA 3QI2A 5AM0A 2LKDA 1W35A 3EDMA 4DNFA 4BNVA 5AKHA 1VQ1A 3FR7A 2QTVA 2ZPUA 3B6IA 5LA6F 4XDYA 2DY0A 2HU2A 2QYHA 2NVOA 4B6EA 1AOXA 1XA3A 4Q9IA 4FXPA 4MWSA 1E9DA 2FMIA 1UPUA 2JIZD 2UDPA 2Y0EA 1JR3D 2R7LA 1WXQA 1GGNA 1O97C 4R31A 4S24A 2XIJA 5FKJA 1D8AA 2QJFA 1OCEA 1U0OC 3G0BA 2EDAA 1HG1A 2Y1LA 3EF0A 1XZIA 3QVWA 4YJDA 4OXXA 1EAMA 1USIA 2PX0A 3RVJA 2GKOA 5C9ZA 3U31A 4EW6A 1MTOA 1XRJA 4OI2A 1SHKA 5IJZA 4X54A 5KOJA 1GZ7A 2C2YA 3OZSA 3LK6A 1CETA 1DIAA 1ICEA 2D0IA 4LMRA 1MGOA 4MJLA 5EKXA 1H2YA 3R7SA 4DA6A 5LNK1 1ENYA 1QF9A 4IVRA 4N01A 1F38A 2A14A 3M6MD 4R83A 1B42A 1R12A 4RO0A 4CKCA 4TV8B 1LJUA 2VO1A 1EB8A 3CPHA 2JFOA 3RFVA 2DBYA 1D5CA 2NVWA 4FONA 1PN3A 3T9AA 2UXDB 1E0AA 2BDTA 2Z08A 1DEKA 3BJZA 4A03A 3UWKA 2R3SA 2PN1A 5JFTA 2NTNA 2XH8A 2W2TA 3NVAA 2VT2A 4EQ6B 2X0EA 1E77A 1FQKA 4OGLA 2YY5A 1JTEA 2G3YA 2Q9BA 5DXJA 2J0EA 4D4MA 4Z1MD 3JW8A 5EPOA 4AP9A 7ABPA 1QF6A 2WJIA 1E3JA 4GPAA 3X2SA 1NVXQ 5AW6A 4BX9A 4QPCA 1G17A 1KARA 2X5JO 4ENUA 4OLFA 3BAFA 5I8ZA 4KN8A 2OK7A 3OJWA 3FBWA 1PQYA 4FR5A 4B3SB 1WB9A 4WNAB 2Q49A 5LP1A 4AVYA 4DKXA 2ZT5A 1EINA 3JD1A 4EJ0A 3KLPX 4FFLA 1TI7A 5K09A 5CD1A 2VK8A 3PEWA 3G68A 5BPFA 2JJ2D 4YT8A 3X44A 2ST1A 2J3MA 4BTLA 1Q44A 3CE9A 5KCMA 5K4HA 1IUOA 3IDQA 5HZMA 4WUTA 1P7WA 2VOJA 4D9MA 5JCPA 3EGXB 4HVLA 4NDNE 4G0UA 1ZCBA 2QZPA 3THYB 1NSFA 3UAYA 4URXR 5LUBA 5K9ZA 1WUJS 4LOHA 5IMSA 1FQWA 1XTZA 3GLHA 3VFDA 3RVQA 3ADCA 5DM1A 2B37A 1RXUA 3SIPA 3WYGA 1YOBA 1F48A 4PZZA 3ESAA 3GK3A 3TTSA 3GV0A 3NTXA 1B41A 5ALKA 2CKDA 2DECA 5LC1A 4ZAZA 1AA9A 3BMQA 1IULA 1XZPA 8ABPA 1R6AA 2WDZA 4DRYA 3EZYA 1AQYA 1E9RA 2JH8A 1Y8CA 1TX4B 2QN7A 4HUJA 3KQYA 1P2VA 621PA 3CIOA 2Y99A 4G26A 4GX2A 2IPAB 2OBLA 1I3LA 4MYSA 4PAOA 2XKKA 2N47A 4IV0A 4JVLA 5L51A 2D4AA 2FZCA 3E5NA 4CQMB 2DOKA 3SF8B 1K97A 4FMPA 5A3VA 1OHHD 3ZKWA 1N6PA 1M2WA 1NSYA 2Q9AA 2PL3A 1JR2A 2YTZA 3ZR4B 4AB1A 1YA4A 1AT1A 1UM9A 4LYGA 1CUUA 3ZWCA 1Q1QA 1D6MA 3JQGA 2FZKA 2OHXA 3EA4A 4HNHA 3WA6A 1VLVA 5LJLA 5B1SA 3TPCA 4CHTA 3AL2A 3CY6A 3UC9A 5ICGA 1L5SA 1W85A 1CQWA 2C2GA 1VCHA 2GDJA 2Q9UA 2IT1A 3PHCA 3WB0A 3RYCA 2ECQA 1L6IA 3W5SA 5DHRA 3ZU5A 2ZXEA 4OA8A 3BHIA 1E5DA 5BR4A 3GJ7A 4PRZA 4DY6A 1CZRA 3FE2A 2CNBA 3VVCA 1JKFA 1DAFA 1Y8QB 3SE0A 4R6XA 4HUTA 1AQNA 1GEGA 1RPJA 1P2UA 1UEJA 1TA0A 2VQ3A 3ANYB 4WZ6A 4QKQA 1DKLA 1DKRA 2PWBA 1TCAA 2YRFA 5D6NA 1XRRA 2BF4A 3F5SA 3DP7A 4R1LA 1K6XA 2Q5QA 3OOWA 1Z33A 2P5SA 2ZYUX 3I2IA 2B8NA 3G9QA 1EVYA 3OICA 3R0XA 3V8EA 2BGNA 3A05A 2CBGA 1P0FA 2J6BA 3ZBTA 3DL7A 1DZIA 3FW1A 1TQ4A 2YC2C 3PDUA 4UXHA 1Y3BE 5BXQC 2NO7A 5HUJA 4HH0A 3RUPA 4HNQA 4OTZA 2QTBA 4QHYA 5ICFA 1BXGA 1ZD2P 3DV0A 5EJMA 5KOHB 5KNDA 1MX9A 3TQIA 2QLNA 5AHXA 5H1YA 4QX6A 4GUDA 3NATA 4RVSA 2GTIA 3LY8A 4DQXA 1JU9A 3W5DA 2J9RA 1KOGA 1K5PA 4LVOA 4POOA 3DLBA 3VKHA 2AWNA 1RYFA 3VR0A 3PHIA 4HXYA 2OBNA 3NNDA 5HKKD 1QFMA 2CDBA 2IZ0A 2Z1MA 4HNAA 5F7ZA 5TS3A 4JBHA 2V1UA 5F3WB 5CLFA 1E1RD 1RWMA 3ICQB 4BNTA 5A0TA 3IJPA 3BSSA 1UH5A 4H4EA 3T5TA 1GR0A 1K0FA 2W2PA 5GPBA 3V8BA 3UKJA 3K5HA 1DL5A 4UUMA 5DV9A 5IT4A 3WGIA 3KX2A 1DJLA 2XMCA 4G0VA 3NAZA 2F59A 4WY5A 4F0JA 1N77A 1MX5A 1IJFA 3F46A 4KQXA 4BLOA 5K8VA 4M1WA 1JXQA 4AZVA 2IPOA 1VCIA 3D4LA 3EZ7A 4QUJA 4UARA 3UXHA 1U65A 1Q19A 3EVEA 1NJ6A 5GZ6A 3KZCA 3AYZB 2WABA 3VVBA 4NZYA 2XCQA 3GJ0A 3JTEA 2GKGA 2AN4A 3SSMA 4EEZA 4LGYA 1DKUA 1W5EA 3QKSA 1Z5VA 4BN5A 5DASA 3EW7A 1UK9A 4HNTA 1OH5A 3H9CA 4YJGB 2QT1A 4XUGB 1WO8A 1PL7A 2CK3A 3DCYA 4Z5XA 3G0DA 4P31A 3G8AA 2QU7A 5AW9A 1VL2A 3D9QX 4KSYA 2FE1A 2YXNA 4KNWA 1N4DA 2HO4A 4LSZA 4J4BA 4L6AA 1ZCFA 3G8YA 1AKNA 2B92A 3JQQA 1VP9A 1Q7TA 2XHEA 2ZIWB 5HGJA 3JD3A 1XTRA 3NDIA 1MPTA 1IG0A 1FNSA 1X0XA 2JIZA 3BC1A 3S2IA 1JR3A 4B75A 1POXA 5D2CA 3EFHA 5JD3A 2V8BA 4ECAA 2XSZD 3IUEA 4XIYA 4JT4A 3PF8A 1L9KA 1T6NA 3ELUA 1SZCA 1VE5A 2HTFA 2VTVA 1CR2A 2GD2A 1WWKA 2WMOB 4GT1A 4RFSA 4Q3CA 1GYRA 2IYUA 2J09A 3O94A 1BE1A 2VK1A 4JROA 4IJKA 2J9FB 1RS0A 2QVBA 4UEOA 5AVOA 1K6IA 3WICA 2B36A 1Z6ZA 3CV3A 3I9FA 2DHQA 4ZYYA 1F8GA 1H66A 1D1TA 2FKAA 1VJTA 1YE5A 4QFMA 4I99A 4A16A 1KU6A 4DMFA 5B7GA 4YEDA 4OX9B 5TT0A 2QJTA 1A7AA 4IGKA 1YI1A 4YMLA 1SCIA 5MDHA 5BNIA 2CB0A 1ZJ5A 3VNQA 2OP1A 3HWRA 2EKZA 2FQ1A 1OB5A 4PLWA 2YQ4A 3UANA 2RH4A 1NFRA 5LDGA 3FTFA 1I9GA 1XXLA 4YMSA 4OAOA 5HOEA 4JN6B 2E4UA 1MHTA 1YZKA 3PNQA 3WRXA 3DM5A 3F5QA 5CDFA 2AFIA 2GN0A 3KETA 4Z1MA 4H3SA 4A2PA 1SVMA 5C5DA 1PQWA 5AYVA 2G67A 4YRBA 3VPDA 4BOYA 5JQGF 1UL1X 3H0KA 4IZHA 3TLXA 4D3ZA 2QV7A 3UFBA 1PJ4A 1T6BY 2IYVA 1PJZA 1RT9A 3U3OA 2H9IA 5M34A 5DT2A 3KZMA 2DAPA 3HXKA 2QEQA 3MN1A 3D5QA 4D8TA 4D8UA 3P9CA 2CXUA 3M6LA 2JJ2A 4I9NA 4BUJA 4DMUB 3Q7RA 2LD4A 3EFOA 4IM7A 5AXDA 2VJQA 1HSZA 2Y77A 1KOFA 2ZBUA 1GQ2A 4GICA 1UXGA 5HF6A 4HJXA 3I0NA 1ARZA 1KVQA 4E5NA 4X61A 1X2EA 2IJGX 3ADOA 1PNTA 3GXBA 3JVUA 3W8FA 4YVFA 3U5TA 4WCFC 1FTSA 1YOVA 3IAXA 2KJQA 3I2JA 4DCPA 3HUFA 1SOMA 1DOZA 1MAWA 3GJ3A 5DHPA 1OBVA 3GROA 1S2LA 1SVNA 1W93A 2GAAA 3KHSA 1Y82A 3Q11A 2WAMA 2XWQA 3TQSA 2C3YA 1LX7A 1QIDA 3D6VA 2IOYA 4OHXA 4M4SA 2VHTA 2GOYA 2H8GA 3WKBA 1OWLA 4AJKA 2IZOA 2Q4DA 3FYUA 4MJXA 1AU9A 2GTPA 1VHLA 1NOKA 4MGEA 5EP2A 2BFDB 4Y9RA 3S40A 4PICA 3ZHXA 1X9GA 4DA7A 4CLRA 2EFHB 2JLAA 1HOXA 2GTHA 2ZSIA 1Z2CA 1CTQA 4G86A 2R5NA 1B0UA 4O29A 3IP3A 2PD4A 1N7IA 2MTBA 4A2WA 2HZBA 2ISQA 4F4CA 1OHHA 3KXLA 1GL9B 2GAFA 4A91A 4OMUA 5BXYA 3PLAE 3PPWA 4YRDA 3EZLA 1C4KA 1JSXA 4TQGA 1P44A 4AI6A 4J3FA 1F51E 3SGLA 1GGJA 4KMMA 1XELA 4HTFB 1A2OA 1GTVA 3RK0A 2ASVA 3PEUA 2XE8A 3EPKA 1GM5A 3Q1KA 8LDHA 4OAQA 4MWCA 4QGAA 3SS7X 1SG6A 1IJEA 1JB9A 1UT5A 2BVNA 5KJEA 3PC6A 2KHZA 3HCAA 3UGTA 5CW1A 4D43A 1N7GA 4QDJA 3VSEA 4KW7A 5BYBA 3AG6A 3TOXA 1Q1AA 2Y3IA 3DZCA 3R0ZA 5WRFA 4ZV7A 3PNOA 3QQ5A 3UJ7A 2XTNA 1TE2A 1NPTO 4HWSA 3COVA 4OXIA 4E12A 4QASA 2C5HA 3SJAA 2OGSA 2P3LA 4OBWA 4Q19A 2BD0A 3F6EX 1ESMA 3FOWA 1XIVA 1AHPA 3OZUA 3M4ZA 1TJYA 2OZPA 1RKQA 5BNFA 4MI3A 5I7EA 4LS3A 1G1AA 3EC7A 1FTGA 3DPIA 2Q5JA 3EAFA 3IHLA 1CQIA 1YQGA 3G0CA 3IMFA 4M8SA 4MIKA 2YHIA 1RZ3A 3DBLB 3G89A 3PICA 3EVZA 3LCUA 4J7CA 1PT8A 4FMCF 1P61B 1V3UA 2CNOA 2Q2WA 3URMA 1KAEA 2ZTVA 5JHHB 5KYXB 1O2DA 3KBOA 4G0MA 3DWGA 2OBXA 3BWEA 2PT6A 3LTNC 2F2TA 1B8NA 1LCIA 1TFUA 2CSUA 4D82A 1D2NA 4AJ9A 2Z3VA 4WKBA 5E6UB 3ULKA 4K9NA 4NP6A 5IDQA 4JELA 2VUIB 5BSGA 2FK7A 4QDOA 3L0IB 2V58A 1NF9A 3GC6A 4IIXA 1NY6A 4MUJA 3KB8A 2NSJA 5KQRA 4YP7A 3EXEB 3GGOA 4I50A 2H8KA 1JQ5A 4NEHB 3UK0A 3VKWA 4YYZA 4TN5A 3GOQA 4LVUA 1SN7A 5HKKA 1KWGA 1H65A 3PNYA 1HY3A 4OJTA 1PNRA 4ZCMA 4QEZA 1KEWA 1UWCA 4WCFB 5TVGA 4BNFA 1M66A 2WAXA 1E1RA 3E4CA 3GNTA 4F86A 5AVWA 2WF6A 3KR2A 2D7CA 5HRAA 3P0RA 4GOJA 4EB0A 1U2EA 2Y1OA 3L06A 2PWAA 3F3YA 3KQSA 5CK4A 3V00A 3H5TA 3WIDA 1XPUA 1H6DA 2OV4A 4FTWA 4IJQA 5A5DA 1T9HA 2BDUA 2OHOA 1CVLA 2ONKA 2YCBA 3F49S 3OM9A 2PMFA 4V3BA 5B57C 4FZRA 2I4MA 3RAJA 1JDSA 1ABFA 2FPOA 3UJ9A 4B85A 4BO7A 3BCSA 2AQHA 1AXEA 4P5EA 3WGYA 2C7QA 1JR4A 1E2PA 1HQCA 3AP3A 1NUUA 4JLBA 3VO9A 1DCFA 2BZ0A 3WLHA 4OHKA 4QPDA 8MHTA 4HNRA 1RFGE 3CO5A 4FUQA 1NIJA 4TLBA 3H2BA 4RKWA 3I52A 4BZQA 3EW9A 1G2QA 1G8PA 1J8MF 1K5GA 2NSLA 3W34A 4LNAA 2R79A 2DPLA 1D0SA 1FLNA 2YZNA 3C3XA 3M89A 4EYEA 3IIKA 1I7SB 5BQOA 1XOIA 4AO8A 3RG2A 2CV0A 4YJ2F 3U44A 3KAPA 4R3WA 3CR8A 1T8PA 3KLOA 4KDRA 1NRXA 2EWVA 4FFPA 1ICIA 1M0SA 3Q3JB 1E61A 4DJJA 2XZLA 3QU9A 1Y1TA 3MW8A 3OM0A 1N0VC 3DE3X 3F78A 4LJAA 2G9RA 4EELA 4F4FA 1WSAA 2A1IA 2I8LA 3K8YA 4CEIB 5HZKA 1KKUA 4H1VA 3GIWA 2AN1A 2W2KB 1SBQA 3AVXA 3M6XA 1IDOA 1KRWA 2GZ1A 4PFQA 3A14A 1O54A 1MFPA 1RQGA 2IOQA 1XX6A 4HYTA 1JNXX 1G3UA 3OQBA 4P0TA 5JROA 2BZ1A 2WWVD 1DDIA 3I5YA 3N5CA 2E3JA 2VCEA 4BU1A 1SM4A 2X5NA 1NU6A 4L8FA 3A11A 4NFYA 5BR1A 4U1RA 4CQNA 4RK7A 4HRVA 5AW8A 2Q21A 2POCA 3B6KA 1VIAA 4M8IA 5G0VA 4EB3A 1XTKA 3CWCA 1BROA 3ZVMA 3ZE9A 4G1MB 2WIDA 1OLSB 4C3ZA 3DHEA 2BOVA 3EF3A 1EZ1A 3HB0A 1EX9A 4R5HA 3KWFA 4JB0A 3TR5A 1KE1A 1JLMA 4ZYVA 3CE6A 4TUYA 1SU8A 1JT9A 1XU4A 2O0LA 3HZRA 1NE7A 4XPIA 3ZD8A 4QOHA 3MEQA 3A9CA 4DR7B 3NDRA 2IEIA 1WMSA 5ALFA 1W0KD 3A1UA 4L3VA 4OBXA 1ECCA 3EQ6A 5DHAA 3TJRA 1L5HA 2C4NA 2Q5FA 1L4EA 2EX4A 3MOGA 1XZCA 1T9CA 1V3QE 2WM3A 1G9TA 2ZQYA 3JY6A 3LYUA 1Y3DE 2RHTA 3AZQA 3OESA 2I2AA 4TL6A 4DIDA 5C5EA 4DB2A 1PJQA 1VE7A 1UFQA 2QTMA 2JZCA 5CIYA 1GP2A 2C58A 1ZR2A 1DFGA 1SBHA 2XUIA 4M8NE 4Q4AB 3BCRA 1V8OA 2FP3A 4G2NA 1IBKB 4TMWA 3SFTA 2O8BB 1D6NA 4F60A 4Q02A 3KLBA 3QEMA 5FRDA 3FWYA 3L7CA 2Q1XA 4TMTA 4U7PB 1GFIA 1XDZA 3O2SB 3AU8A 4L9AA 2VBCA 4JKYA 3HFSA 2XHZA 4O4JA 5CCDA 3KOUA 3SMVA 4AM8A 4BO4A 4F84A 3I9V6 3FJ1A 5LZ4A 3H11B 2PTGA 1AV7A 2R00A 3HCBA 4OHOA 5ERXA 4YCMA 1CUAA 1FP4A 3QOFA 1J9GA 1WVIA 1X3SA 3KKOA 4WBXC 5KNDH 3WRVA 5E95A 5EEHA 1CUIA 2VTBA 1OT5A 4J0IA 2VDVE 2ZJFA 3EIEA 3ICCA 1NT2A 3O3MB 4DC9A 2QWXA 1EGAA 1PGPA 2XCIA 2P6UA 2Y6UA 1SVIA 3ICPA 5TPWB 1SG0A 4R5MA 5CX1A 4KN6A 3RS0A 3VH2A 4DEVA 4F2DA 2WPNA 2Q3EA 2QX4A 5AW5A 4EKNB 4KVGA 3O9VA 4TKVA 1CERA 1W4RA 3TMYA 3OLVA 4Z7QB 4JMLA 1A4UA 1RWWA 4AJPA 1ADGA 1WMFA 4BGVA 4EVQA 2LE0A 2WY2D 1VIVA 2AJTA 2PNJA 1CRWG 2AT1A 4Z9AA 2BUAA 5C3UA 4OHYA 1AKVA 3EFEA 3NIBA 1R0RE 4G65A 4P82A 4TKUB 4OCZA 1WUKS 5E1OA 1RWPA 1QU2A 5DLDA 5TQ0B 4EATA 3BKWA 1KYYA 4UULA 3VBEA 4QODA 1U7DA 2NZWA 4LJ4A 5F64A 4DUGD 2PKCA 1E96A 2HQOA 4MP8A 2QVXX 1U6JA 4WEQA 4YJFA 3V8VA 3UT5A 4BAUA 2GEDA 1Z5WA 2QSZA 3BBLA 4C2UA 3S1AA 4NMLA 1ZW6A 2H2WA 4JA0A 5JH7A 1M5TA 1DKOA 1NLUA 2UZIR 3FYCA 3THRA 3CUUA 3QPBA 3KKQA 4KPUB 3NDJA 1EXDA 1RRGA 3UTCA 1P75A 1VCMA 2JC3A 3AZOA 3BE6A 3OECA 4OB7A 5DYIA 1OB2A 3GP3A 4PIMA 3L8MA 3A36A 1JH8A 3KYJB 3A1WA 5D00A 1Q0LA 1NXPA 1GZ5A 2C3MA 1BHSA 1DG9A 2ERYA 2HSEA 3L1UA 3CLHA 4ZVRA 3NBUA 3N74A 2D2FA 1PF7E 3FNIA 3R5JA 4QPNA 5DYWA 1FJGB 1GRQA 2GA8A 5DE3A 2BEKA 3SCZA 4K0KB 3GRFA 1KQPA 3S70A 4F9GA 1UFKA 3TI7A 1YCGA 1AG9A 2QRLA 9ABPA 1LK5A 3AF6A 3VPGA 4CMBA 3O4RA 3O91A 4JS0A 4ZOAA 4COKA 3OPXA 5K2OA 3MERA 2YW2A 3J80A 3R0IA 4BVBA 4QG7A 4BO6A 3SBOA 3WLLA 7YASA 4MWOA 2YOGA 4FFOA 2OQIA 3ZCVA 1PD1A 4IIJF 2ATVA 4UEKA 5D3QA 5CHYA 3DE6X 1RWQA 2Z95A 4IQ8A 2E6UX 2IEYA 1B8UA 3W2EA 1HQYE 1B6RA 3TTUA 3ZGXA 4BX8A 3VGJA 4DR3B 1DV2A 4URFA 2VUTA 1EX1A 1FK8A 1VG1A 3K8QA 3V4SA 1XYYA 4C20A 2AG0A 4DIEA 2DLNA 2FJUA 4R6WA 4DRXA 1D7AA 1V6SA 3IMEA 1R2QA 4K6GA 3ABIA 2RD2A 4DIUA 3FMPB 5ETJA 4IKPA 3CH7A 4MULA 2X3YA 2QTLA 1Z28A 2PR2A 1CFJA 2AQKA 4FMCB 4P0PB 3I62A 3UV7A 1Y3AA 3VA7A 4X6YA 3LW8A 3TNFA 1W2WB 2FOLA 1WY7A 5LZ2A 4HAVA 5IT5A 3KPUA 3HKBA 4RXUA 3EYAA 1D7OA 1WXGA 5AI9A 2WSIA 4PPQA 2ZRKA 2DPHA 4HLNA 4UBIA 3I4CA 5ER9A 4DHWA 2VNHA 3EG5A 3TTYA 4FC7A 1CRPA 4WBNB 1YR2A 2C7BA 3AH8A 1Z07A 2C29D 1TL7C 4D98A 3MFQA 2XDAA 1VI2A 1RAHA 1E6WA 3BRQA 4U02A 2NZUG 5C7IO 2Z2XA 4G2TA 2O57A 2RCNA 3N07A 4IXMA 5FUWA 1EDDA 2BHTA 3LX5A 1TW3A 2JHAA 3UOWA 1IHOA 4PX9A 1W49A 1RW4A 1T1GA 2EXXA 1DAEA 4NPAA 4HF7A 4X3CA 4ENPA 3RFFA 1VA4A 4K6MA 3D1JA 3PXAA 4NCXA 5DK6A 1XLWA 1ZIDA 3B82A 2XXAB 2QTCA 3WWPA 5EXXA 4MUFA 4RTLA 4MUBA 1WW2A 2OBBA 3ZDFA 3OHPA 1Z88A 1KEKA 2GZDA 4XAQA 1M8KA 1LDGA 4Z4IA 3L6UA 2AOXA 3RARA 4N5MA 3AUSA 3UF0A 1GPLA 3IJ5A 3U7FB 1VFNA 1PAUA 1JLHA 4POAA 4RGBA 1OFUA 3K3PA 2XQKA 2CDRA 4WN9B 5CFOA 1MU0A 3PIRA 4QUDA 3MC1A 4FE7A 2XRZA 1G6HA 5JJKA 2HT1A 5FUQA 5JEEA 5GADl 4V38A 1OLUB 3K15A 1ULTA 3EOAI 3V7FA 4YJ2B 3QVTA 5AVZA 3EDQA 5JMWA 4QICA 4C08A 3LOPA 1MB9A 4IFEA 1Y1LA 2R6R1 2P27A 3E5MA 4QO8A 3B7GA 2M9MA 4EFKA 5BN4A 4BLQA 1H23A 1P8JA 1EHIA 2ZB8A 1M6VA 1TADA 1BKYA 3EBOA 3FN4A 5A71A 3ZZ0A 1FBTA 3HH8A 2ILTA 1STOA 2H2DA 3MF4A 5CPFA 4B3HA 2BHRA 4D9CA 4DR5B 3WLAA 3DMTA 2DF8A 5L45A 1W0KA 2VFAA 1L7RA 3KYCA 3KR1A 4O4LA 3SU8A 2B61A 2E5FA 2ZUCA 3E2IA 2ZOSA 3QSYA 3BD6A 2GLXA 1CD5A 3D8RA 4BQRA 4JMPA 4EMTA 1N6IA 2FN9A 3A10A 1I4DD 2D0DA 5J59A 2GN6A 1W4AA 3WG9A 3MWJA 4DV2B 3VH3A 1YQ9A 2QNRA 5LL6P 4YRTA 1PEKE 1KP9A 3GVHA 4UAVA 5GGXA 3WB1A 4INPA 3RK1A 4WZBB 1DAMA 3ABOB 5DNAA 1D1SA 3KQOA 3T12A 2A86A 1EUYA 1EJBA 4R9UC 3A6GA 1QZTA 3DE1X 3ORSA 1QO7A 2PXHA 1RHJA 2P9CA 3KJFA 3QPCA 5FTNA 4D9FA 1R6UA 1C1XB 3M5CA 4DR1B 1X14A 1BE8A 2X3UA 3AFIA 3KC2A 4YMGA 5K3FB 3NUQA 3ON5A 5DOVA 4Z4QA 2B1QA 3LC7O 5D3KA 1S1MA 4BN4A 1JXAA 2B99A 3CX6A 4DCJA 1IZZA 2QL7A 4CMEC 2ODEA 5H3CA 3SX0A 4FYIA 1GR1A 1LNSA 1VLHA 4WZZA 1KEUA 4O2AB 4CE6A 4IY1A 4P4UA 1CEEA 4B3MB 3CH6A 3R20A 2HJSA 4PPGA 1JHVA 4MR8A 4TXNA 2X8BA 3VRHA 4NAHA 3EGEA 4WX2B 1FDRA 1IEXA 2YINC 4Q4HA 4C22A 1V96A 1XALA 3BWDD 4UHBA 1CEYA 3N53A 1WEKA 1EU1A 1RAAA 2Z5LA 4NZZA 5AP9A 2PZJA 1DQRA 4WBSA 3N2GB 1NFFA 4KLAA 3QYJA 1FP6A 4G24A 3OFKA 5JAIA 5FLXA 1DLJA 4TKLA 2CJPA 1EK2A 2JAPA 3GEGA 3JYLA 1U28C 2A2ZA 3M1LA 4Q00A 1Z82A 2FEXA 2ZIGA 4ILEA 4Z0PA 2CXRA 2CNDA 3NBXX 13PKA 1MIOA 3FCXA 4AQ7A 4JGIA 3RSGA 1MR3F 4PSKA 1CNEA 3AT1A 1RLOA 1B3BA 4DUGA 2IODA 1Z39A 3IR5A 2SKEA 3HPQA 1YZQA 3B1VA 4IUYA 3UJPA 3PXCX 2DBZA 3I39X 3M1IA 4MGIR 2QZ4A 4V0QA 4BN0A 3BDAA 3IP7A 2ENWA 3I58A 3KEMA 4PYQA 1GXSA 1EXMA 4BNUA 4W1SA 3SDBA 1RJDA 1JLKA 4LOLA 3PLNA 4OMCA 4H08A 3SQMA 3VH1A 3KDSE 1P0CA 1DBRA 1Y8AA 2AI2A 2V7QD 3BA1A 2P35A 4TLCA 4UBMA 4WHMA 4Z3DA 5BVGA 3K0KA 3I8OA 1VLQA 2AEFA 4LJYA 4RZIA 3FUCA 4B76A 3D8BA 3FOCA 3PXXA 4U00A 4XOUA 4Z8YA 1E58A 2XNJA 3CG0A 4ENRA 2W71A 3UMMA 3SHOA 1KYTA 3EXFB 4JSTA 3TO5A 4E5VA 2HMTA 4WY8A 6PFKA 2QG9A 1NNI1 1NG1A 3DVRX 1BJRE 1E7QA 2OWEA 5TQVA 5CDTA 5EQDA 4NEGA 4RTKA 4DUYB 1A1VA 1J8VA 1UBEA 2IDMA 5IPFA 4JLWA 5FBKA 2Z5GA 4DQVA 1KHTA 1KJIA 1E0DA 3PE3A 1V71A 2FUG1 1E3SA 4QDXA 3T3DA 5AK3A 3RS9A 4TWRA 4XX1A 3NVKI 3SIWA 1P62B 2DHCA 3KB1A 3ZE7A 1DRJA 1QH1B 3P2KA 4MA4A 1UT6A 4MQ6A 4E22A 1JEYA 1B4DA 2UV8A 5KHAA 1TT7A 1U0FA 2E89A 4S2EA 4J3NA 3V33A 4M2LA 1Y81A 4F6LA 3K0SA 2G25A 4KGDA 1RWVA 5CNJA 4D25A 4NJEB 1QHNA 4FSHA 3LUBA 2G28A 2RCYA 1J2EA 4OGWA 4L85A 2AYXA 3LBIA 5TB5A 4HS4A 4EB8A 3Q9SA 1MC1A 4HB3A 4MOWA 5AVXA 1YS9A 4BXOB 3KL4A 3JQAD 1QWSA 3OD5A 4HGOA 4XIGS 1RIFA 2GUGA 1D5WA 1Z0UA 2B98A 2H4ZA 2PMDA 3HFRA 3QWIA 4MS3A 4BAZA 3B12A 4F2PA 2AIRA 3LP6A 4KQKA 2JAUA 4CKYA 2UXCB 1SXHA 3S8EA 2KX7A 3TFOA 3P9SA 1K4MA 3VJMA 1NC3A 4IUCS 3T4PA 4BZXA 5KU1A 1GGMA 3QW2A 4L4RA 2X6RA 1Z26A 4YRQA 5DXFA 4ZDWA 4BTVA 4HAWA 4HO1X 4P6VF 3URKA 2XLCA 3D3NA 2GCOA 4FT2A 2VNSA 1QKJA 1RJFA 5AKXA 3Q6NA 2PZFA 1TYEB 2RB4A 3X0DA 3UCXA 2A78A 4DBZA 2E87A 2VQEB 2INGX 2CB9A 2NOAA 4E5UA 1DBPA 5HM8A 1CQXA 2AE1A 4MVJF 4TROA 4EBFA 4Q3AA 4R9SA 1J0EA 4YHHB 2HLHA 2R1ZA 2IH2A 2YZMA 2ZI3A 1XP8A 2DKOA 4LYHA 4BRUA 2ZATA 2A0KA 2YJ4A 1T8SA 3JQCA 3R5XA 4EEKA 3T9FA 5H82A 5JDCA 4RTJA 4L78A 1MXHA 1A9YA 3D2BA 3IOEA 2C5BA 2PSHA 4GFDA 3ROFA 4RPJA 2G83A 3UGKA 2CVHA 4URVR 4QXQA 3AFMA 4BWFB 2NV0A 5EEGA 4BVHA 3K72B 2VYQA 2G1JA 3B3GA 5TGZA 2ZJZA 3A7EA 4OB8A 4TZ0A 1DADA 1C3OB 2WHYA 2L2QA 2ZBGA 3LGXA 2VLIA 3I73A 4AKHA 1T6ZA 1HE3A 4J0HA 1VPDA 2FPMA 3RYHA 4D80A 1W73A 5HKAA 5I7RA 1E1CA 1XJ5A 4RL6A 5BWOA 2ZUFA 1FYDA 3B1JA 1IXKA 1AB5A 1R18A 4BZWA 1MRSA 1BEZA 2RIPA 1I33A 4TQ9A 4J4HA 3AMVA 4HD8A 1EFTA 1THZA 4N49A 5EUBA 1EP3B 2X9VA 5F4BA 3I8SA 1EXVA 4HDOB 5A4FS 2G08A 3THXB 4PG7A 3KPJA 1NRWA 1TKRA 3IB6A 1YR7A 3LF2A 3IO3A 1JIXA 4LXXA 4UDOA 4Y6OA 3ZXXA 2BMEA 4U3JA 2ZCJA 2FWIA 4NYMR 3QEJA 3FLBA 4BB6A 5JIBA 2HUPA 1EUCB 3UT0A 3TR0A 3NU1A 4RIFA 4RPCA 3DQPA 1NOJA 3C24A 3LC0A 3NBMA 1UQRA 3QJ5A 4OHCA 5ICMA 5ITVA 4IIBA 2F4VB 1ZP6A 1DMRA 1SHUX 1SHTX 3NP9A 4N7JA 1NVWQ 1KZ6A 3HXTA 4P98A 3OCZA 4PNHA 3NI2A 5ULLA 3UOGA 4JCCA 3ZV7A 4DMHA 2FR1A 3OZXA 2EBWA 3QV2A 1H2RS 1GCIA 2OG2A 4PGMA 5AI4A 1K8XB 2PS0A 3TRIA 3NRBA 3LGAA 3V34A 1CUFA 1LF5A 3RLFA 3WYEA 4QSHA 1NW4A 3GPCA 1A7UA 4MQLA 3NKLA 4IDEA 4OHFA 1J2RA 1XF1A 2XQIA 3UCFA 5FNVB 3QF4B 5C81A 3E05A 3JZIA 4RZ3A 5AUQA 4C4OA 3KTDA 3VU0A 1U9IA 2FU5C 1G6Q1 4JGGA 4U7HA 4B8WA 1KERA 3ZUGA 3F0TA 3OURA 3C3DA 4G4JA 1CUSA 3FOEC 5IX8A 4L0QA 3HDQA 1VPTA 3DOOA 2BELA 3IQZA 3FCUB 1AUOA 2HFKA 4PLCA 2JBAB 5SY9A 1YB4A 3K6RA 4P2BA 3DAOA 4Q9JA 2YVLA 5DTQA 3T5GA 2DXIA 1H5NA 3IAAA 1XQWA 2C9YA 4A6DA 5EIBD 2QTVB 1VECA 4MYDA 4J0EA 4OXYA 1M1YE 4ZJUA 5BWBA 4UD6A 3CIFA 1JPNA 2NTVA 1TA9A 3BRSA 4MRNA 4NBSA 1LB1B 2H4YA 1E2JA 2ZJ6A 4OKSA 1P45A 5AJHA 4A0SA 2JJYA 5CFQA 1CDOA 4TPKA 3EZGA 2VF8A 1R0LA 3DHWC 3JASB 3JVDA 1NNUA 1IVNA 1L1QA 2F48A 2JJ8A 2VZLA 2R7MA 2QX7A 5CYPA 5D8DA 5FR2A 3EARA 4L5CA 1E2KA 2Y68A 5CIWA 4EFDA 1HRDA 3PTZA 4G41A 4L50A 4WH0A 3S8YA 4DYVA 1G63A 2H31A 4BKPA 5LXTA 1KK2A 1BGVA 1V8BA 5CB4A 1H94A 4HWKA 2QN3A 3PC7A 1BW9B 1JU3A 1VL0A 1EG2A 2WFMA 2OB1A 2XGOA 2HMWA 4IH9A 3SC2A 1VSUA 4LZOA 3PJDA 1UWVA 3OF5A 4PQFA 2CJXA 5GV7A 3CLSC 4Q7JB 4TTAA 4EA6A 4CKCB 1IMOA 3BH7A 4ZO7A 2I2XB 2N46A 3DZFA 4HBZA 4Z8XA 5FO0A 5GJWC 1GADO 1LWNA 5EKUA 1VYUA 5HKLA 4I9GA 4OQPA 4FNGA 1JA9A 1TT5B 1GUDA 2BFAA 2V7QA 4C43A 3MTBA 4BWGA 1HMYA 3D1LA 2JIRA 2FV8A 4EFLA 2HWYA 2YJZA 1R3DA 3VI4B 2L42A 1ZIPA 3GPDG 4AY2A 3SKXA 3QMMA 1UMBB 2F1IA 4LMBA 4JT2A 2XMZA 3C6BA 4PHCA 1L4FA 4XWOA 2X4DA 3OPQA 2P75A 3Q88A 5JE8A 5AI8A 4XZ3A 5B3AA 1ILWA 2C4HA 2OM2A 4XGKA 1Y3FE 1EHCA 2QUBA 1YC5A 2OVFA 1ATIA 4KB5A 3QVGB 4AJLA 1PFUA 1WZUA 4ZTUB 4BJ1A 1CR4A 2JASA 4GVLA 3QF7A 3LCMA 2X8JA 1GZSA 3A28A 1OI4A 2WZQA 1KDZA 5CUQA 1O0BA 4Y6PA 2VJMA 3PC8A 4MV4A 2HDOA 2EZ8A 4GR5A 4IOLA 1B74A 3ZWOA 1AO3A 2HJWA 5HDBB 5EZQA 5K6AC 1DC7A 3KJXA 4MS4B 2AR0A 2VDJA 5E2AA 4BCDA 2IZ1A 5JAPA 2AF4C 1HGXA 2Y05A 3RUCA 3IXLA 2V5VA 3CCCA 3DM9B 1TJ4A 3HP1A 1KMNA 1PFVA 2HO5A 1F6BA 3BYZA 1M54A 1WM1A 5M3BA 1PWXA 3C5VA 2AK2A 2OXEA 5ELMA 2FZ5A 2H08A 3G59A 3JQAA 5CDUA 4Z4GA 3KQVA 2RMKA 4C6SA 4ZGGA 3IC5A 3BICA 1T3HA 1K6EA 5FPYA 2BCEA 3CLKA 1XU7A 5IUKC 3I09A 4LJ8A 1JHDA 3UICA 3B52X 4JSRA 4HN9A 4MW2A 3WL8A 3ZQ6A 4A8HA 5LU9A 3INRA 3BQMB 3WKAA 9LDTA 1GG8A 4LJSA 1I0ZA 3K20A 4XOIA 4G0ZA 4NU5A 1OXMA 2AJBA 3FYSA 1CV2A 3GGSA 4ND4A 4QRDA 1MOQA 5G4LA 2I33A 4A82A 4D46A 2UU9B 1L5RA 4MJ3A 1CXZA 4JUDX 3E03A 1Z6PA 4LX8A 5EZYF 3TMKA 3V4OA 1X7XA 1KO8A 4LV8B 4GOKA 1BX1A 4Y2QA 2JNWA 1GQRA 1PJLA 2VEDA 3MAAC 2HTEA 4Y2UA 1C9JA 3JQGB 4X7PA 3FIJA 3QNWA 5JS8A 4G5YA 4JYAB 4GMXA 2JGLA 3HDJA 3Q3CA 5A6VA 5JFGA 4EHBA 2FMXA 1E3IA 3NWBA 4PF1A 1W85B 5A4JA 5DHTA 3T0IA 1U9CA 2MMCA 1Y4UA 3QUTA 3Q1LA 4CTMA 5L53A 3RYCB 3R7FA 3IS3A 4RXTA 5CJ2A 3AIMA 4RDIA 4W9RA 4X93A 3V80A 4KQ1A 1YMQA 2XRFA 521PA 3U7EB 4K2HA 3ZEIA 2A59A 3KSDO 1UKZA 1YVUA 4QDTA 1HR0B 4MQEB 5JECA 4OI4A 3PL5A 2W00A 3ND6A 2AR9A 3L0PA 3ZXSA 2OY0A 5DW0A 1P5HA 5TQJA 1QIIA 4C03A 1V39A 1JWBB 2X4IA 2Y1KA 2GHTA 4PZ9A 1FRVA 2WNHA 6REQB 2O3JA 3BB3A 1A9QA 1Z12A 2XWSA 3HVIA 1GCGA 4JWKA 4P32A 4LDAA 5ALNA 5FBWB 3CLTC 5EMHA 3RYFA 1W6UA 1MFZA 2C59A 3H87A 1E7YA 3LC1O 1OI2A 2D13A 4L02A 5FQOA 4PC1A 4ESHA 2QE6A 1HZZC 1BXGB 3DV0B 3UB3A 1UJ2A 3AESB 4MHTA 1I3MA 2W6PA 4K9SA 3JD4A 4B34A 1WETA 1IBCA 1M2NA 2ACVA 1K08A 1PFWA 3CPJB 5IAGA 3UAGA 3P9XA 4B71A 1VB3A 5BQFA 2LNDA 1Z56C 3F6CA 4LYFA 3O83A 3PR2B 1TEHA 1YQEA 4XWKA 1MOZA 1TLTA 5KPJA 1GNTA 3ETGA 5EXDA 1OX5A 2BN4A 3O03A 3QIVA 3ZGLA 2XMGA 1W8DA 2YQZA 3GLHE 3SXJA 3GCDA 4BAGA 1EUDB 2KI5A 5JWRA 1PLLA 1WOMA 3GYBA 4MA0A 4FGWA 1N9KA 4X45A 1Q21A 3JQBA 3UK2A 3RVLA 2B8TA 1XWWA 2FSIA 1EGVB 1GUBA 3MPOA 2Z9BA 2Z1NA 3I42A 4MKRA 3KJIA 2R60A 4FYHA 4JBGA 1EZZA 2O6LA 3H8WA 5GQSA 3VO8A 3ZCXA 4E94A 4ND8A 3ODGA 4P4LA 3LRPA 1KR2A 2QT0A 2VHXA 1TC2A 1ZEJA 3QFTA 4PGGA 2BRUA 2B1JA 1PVVA 1YE3A 4UMVA 2ODBA 4KU4A 4QT0A 1WABA 1I7QB 1ISIA 4UDNA 3QKSB 5MGBA 1SCDA 2ROQA 1HLGA 4Q4CA 4HAZA 2GM3A 1Y9AA 5GM1A 1AKMA 4NXMB 2WVJA 3LX4A 1T25A 3T94A 4C0HA 3I12A 3IAHA 5DLEA 2BGJA 3IHTA 3ID6C 3DVAA 2W6CX 2Y9PB 4AL4A 4DPLA 5CGQB 5AJZA 2QX6A 5IKPA 2IYXA 2CMGA 3FYUC 1R00A 1REQB 3AERA 4FWBA 3B2EA 4QTXA 2GPTA 4Q82A 1HDCA 1W5AA 2GJKA 1E1YA 3NHAA 1PS0A 3VU9B 5C1DA 3JWHA 3QWBA 5DWQA 1BD4A 2XNCA 3OKCA 4P4SB 5CB6A 2ZS8A 2JCVA 3IMGA 5H5JA 3MUNA 4M1TA 4K81B 2C9ZA 3HCOA 2DWPA 2FWPA 3KFXA 4OGFA 4R7TA 1N2OA 5G3ZA 4M22A 4LRTB 4HWGA 2OCXA 4PC7A 3ZDEA 3LLCA 4PX2A 4ZQIA 4ZK6A 1Z4PX 1RNLA 4UBJA 3OZTA 2I7TA 4DDKA 2Z8YA 3GAZA 4QOFA 3SVZA 3W1EA 3UHOA 2A67A 3FMVA 5AR1A 1L5OA 2VWHA 1ZJWA 2NPOA 5HPYB 2PJRA 3BXEA 4MEBA 1NBHA 2BONA 3WNQA 4BBAA 1NQTA 4IMIB 4MP3A 1QUFA 1C0KA 2HJHA 3P20A 2GJAA 1IBRA 4C6TB 2BM9A 1UPAA 2OO5A 2IW3A 4K9RA 4W1PA 3ZLJA 3CRVA 5EWLA 1VLLA 1P2GA 4LVNA 1N8TA 2ONYA 3BBPA 2QSUA 3KR0A 4JKIA 1UJ5A 2C5EA 3D3KA 3INNA 3VR2D 3MBIA 3PNBA 4P35A 3SNHA 1QP0A 4V03A 2BTOA 1ZU5A 3S29A 2RG1A 1AK2A 2QMQA 4HAOA 4D97A 4AKGA 1J56A 2ZJAA 3EODA 4HEA6 1DP4A 4AS3A 2X7HA 3S28A 5T8KA 1DVRA 2WU1A 3HACA 4U8HA 1WHTA 5NULA 4RQAA 3O9MA 1JH9A 1UBOS 4IDPA 5G4KA 4F4DA 1E60A 5IG2A 4KR3A 3J81A 5BRJA 9GPBA 3SZRA 2JFBA 3ZK8A 2FB9A 1Y5RA 2DU8A 2HA5A 1NVVR 2TMYA 4KWCA 3ZI4A 4BFSA 5C7LO 3COZA 1EFAA 3I45A 5K0GA 3L4KA 2KQUA 4L0CA 4MYCA 5CLIA 2CCKA 3LBFA 4FFNA 1W5TA 2I1QA 4PINA 1O08A 1RTKA 1YFKA 1KTIA 3I83A 1CYDA 1FX0B 3LUHA 2GN9A 3H7IA 1NY5A 4RHYA 3Q41A 1UQTA 2GN8A 3IOMA 1P8AA 3NC1C 4G37A 1YOVB 1EE2A 2XBUA 4JODA 3EH1A 3RYIA 5IXJA 3V7WA 2QRQA 3GCZA 1WDKA 5ADHA 3D2AA 3O8LA 2XKJE 4TYMA 1CSEE 1R3UA 2HA6A 1AM4D 4V0LA 5CEEA 3CLVA 5EE9A 1R6XA 3U48A 1N1DA 1X7ZA 3ESXA 3ILYA 5KQPA 3WKEA 2UZ1B 2WVGA 3FYUB 4D6PA 1UJMA 2YXEA 1CF2O 3QEKA 2CF5A 2IHYA 1JDTA 4B3TB 4CLRB 5E9AA 2BV3A 1UBNA 3UMBA 5JAZA 1XMOB 1F5NA 1RKXA 2AH5A 2XGGA 5F1KA 1YZHA 4US1R 4IS3A 3RF6A 3PFIA 4MRMB 2F3TA 4IG9A 2ZJ3A 3ZQ4A 4WLVA 9MHTA 3L0BA 1JR3E 1PK9A 3OPMA 2ZUBA 3PRKE 1IUNA 2GB4A 1A9XA 3HB7A 1NW9B 1ITZA 3Q5GA 2X2PA 4H1UA 3LOUA 4FYPA 2K2WA 4FYYA 4WDQA 2GBFA 1VRCA 4ARIA 2H6EA 3CX7A 4ZDKA 3UV6A 3ZK7A 1N9GB 1XTBA 4BO8A 4R8MA 2EJVA 5JXJA 3QKIA 1PYDA 1RXSA 1V8FA 2VLBA 2TSYB 4EO7A 1GQSA 4C2TA 2RI1A 3NYIA 2PZEA 3WAJA 2HMAA 1X8JA 3CT6A 1E92A 4W4TA 1KBQA 1COZA 1DEXA 1ML3A 3ASVA 4PC3A 4BASA 4F11A 2D0OB 3K6SA 3TKYA 2FPPB 1MN6A 2EFCB 2QAGA 5H68A 2VQFB 1OX4A 5IUJC 3Q87B 4AF8A 1U3UA 4Q24A 2CXNA 2ZBQA 2I4LA 5T57A 2BI7A 2VF7A 1N1GA 1DS6A 1DZ3A 1WS6A 2GLUA 3M4YA 3R2JA 5FA8A 1CQIB 3LC2O 5CDFE 2AFIE 3OFSA 4DDVA 1GN8A 4HNUA 2GKSA 2V4ZA 2JGDA 4PO8A 4B43A 5DDIP 3IUNA 3R0QA 3EULA 3NFYA 2XYHA 4FS8A 3USES 2GA9A 2Q41A 3PDIA 4RD6A 1UR5A 1BTOA 3LCRA 1CDDA 4PY2A 4CKBB 5EFZA 2Z58A 1AHHA 2C5GA 3LLVA 3QXGA 4ODIA 1SNYA 4HS9A 5CPBA 5ALLA 3QXCA 4I81A 1UXHA 5F5NA 3EUWA 1ADFA 3P0JA 1U8TA 3CR7A 5DF1A 2JFXA 4WFJA 1TLLA 2VSYA 2BF7A 2QDXA 3EXHC 5CVVA 4ZVQA 3D6JA 1J24A 3GA5A 2YRXA 5DHSA 3FSGD 3E18A 3PUXA 2V7UA 2LTAA 1E2FA 3IULA 2E4AA 5KX5F 3WBKA 1L4NA 1R4MB 1PJ2A 2RAPA 3A6KA 4B8ZA 3FD8A 3GELA 2B3TA 3V2IA 4HI0E 3I6BA 4FYKA 1YDWA 3MRVA 1P0IA 2H16A 1S8OA 1TUGA 4JX9A 4ZAFA 2JAWA 4ZI5A 4U2DA 3WKDA 2I1WA 3NUZA 1T15A 5G3YA 3T9BA 4AZTA 3UMVA 3ZV4A 5IJ9B 1VKZA 2IIPA 3NM5A 1ULHA 1R4ZA 2G70A 4J2TA 1VL8A 5L6LB 1TNDA 1GPBA 2W2OA 1HTBA 2IUSA 5IKOA 5E8JA 3CO0S 1VDMA 5HE8A 3S3TA 5KAMA 5AFSA 4G97A 1CQJA 3ZDYB 1SHZA 1R6VA 2PFKA 2NU6B 3FTQA 1Z0FA 2H51A 4UM9D 1Y4SA 5DM4A 5DYGA 1JJ7A 4AIRA 3UB4A 5EJIA 3A1DA 1APBA 5JI3E 1FFSA 2Y0DA 3UMRA 1XDUA 1XRPA 5JVDA 4EENA 1Z37A 4F2HA 2R00C 3AB3A 2O50A 2BDEA 2IYQA 2W9XA 3GCGA 3PFBA 5E7JA 3U4GA 3KXIA 1ZNZA 4EJMA 4DIOA 5LP6F 1XNRB 4DYDA 1T1IA 2B8EA 2QI9C 4IJVA 3GH1A 3I9LA 2O8CA 3QUBA 2AEEA 2XUKA 1U1DA 2R66A 1PR3A 2FW0A 4G67A 1A3CA 4Q4JB 3RVRA 4YV7A 1IY2A 2QN2A 1QTQA 4YLGA 2JI6A 1U6KA 2AG5A 3FG9A 4FOPA 3AL3A 4YRIA 1P6QA 2BHSA 1EP9A 2Q3LA 2XUHA 1E99A 4Z6KA 5K4AA 1SGWA 4B9AA 4CN9A 1V4VA 2P4UA 4ZEOA 4BJ5A 4CM3A 2A0FA 2B0JA 1T5SA 3BTOA 3FXAA 2R8EA 3K0BA 3NOOA 2CC2A 2ZQ5A 3PZBA 4H4CA 3NEYA 1YVDA 3O4VA 4S1VA 3JRXA 2M6SA 3ETDA 5CYFA 4CKEA 4HAXA 1KZ9A 1W2HA 2AOUA 4JOSA 3S44A 1HYHA 4K05A 4YAKA 1LQTA 1L7DA 4F91B 1SD2A 4MS1A 4H18A 1RRVA 4LQLA 1OXXK 3QKRA 1B76A 4BGIA 1A88A 3CN7A 1SEVA 3WK5A 3QYAA 5DSTA 2ZE6A 5TRTA 4MDEA 4PWYA 1XNHA 4P84A 3AHJA 2A9JA 4XWAA 2ZDQA 3SX4A 2NO4A 3VPCA 2RKWA 2HWUA 3WE7A 1G20B 2OL4A 3EXHB 3G5AA 4PQGA 1HDXA 4HK4A 4D9IA 5F5LA 4AZ3A 4UATA 1BA2A 1QCZA 3VR2A 3O9ZA 3D02A 1G8AA 3QVKA 1HNNA 3LY7A 1F06A 3VTZA 3GF4A 3RVSA 3ZHVA 4OJMX 4CF7A 1ZIYA 5ALWA 1PNVA 5A3QA 2CT8A 3LQ2A 2RK3A 3OIGA 1DBIA 3DTVD 3MAJA 4RF5A 3IT3A 4EMBA 4JXXA 1EWKA 1KJZA 1P6UA 2F43A 5BSRA 3QBEA 1V43A 1XTTA 3R3UA 5GJCA 1SOAA 2JFZA 2CUTA 3T7JA 4EG1A 1S96A 2AN3A 3RT7A 2JGFA 3RSCA 1K66A 4FQ5A 1E1KA 3RC8A 3GD5A 5K0LA 3Q8LA 3GFGA 2YICA 1XPJA 3LDGA 3NNSA 5DTEA 4AWXA 4YRJA 3NCHA 1JG7A 3L0DA 1GL7A 4DAOA 4HVTA 3VNUA 3B5IA 4NV1A 5JY1A 1DUSA 3VVLA 3ZWBA 5IYZA 3RAGA 1LPPA 2H18A 1FQJA 1NXWA 2V6GA 3LWDA 1GL6A 2H7CA 3CZMA 2NO6A 1E5QA 4GVPA 3NRJA 3TCKA 3QXXA 4YFVA 1U7OA 3DMGA 1TJ3A 5ALMA 3UMJA 5A5VA 1N6KA 4ZYXA 5C8XA 3BH6A 1KI9A 3V2HA 3UMFA 2VTEA 3BHMA 1CP3A 3DKKA 3SD7A 1EE9A 3LT2A 5ALJA 2VKQA 1UQUA 1KZ1A 2P40A 3O4GA 1Y6FA 2NU7A 4RLSA 1K7XB 3KV1A 4S3MA 4EKYA 5F23A 3PJRA 3FDFA 3WIEA 1SIBE 3AF2A 2GXSA 1VZ3A 3MS4A 1R9NA 2FUEA 3N1UA 4QBIA 3LMKA 1ZL2A 1EM8A 5IN4A 2I9KA 3C7AA 1LDYA 4IIFA 1J2JA 2VL7A 4JCOA 3DNFA 3LA8A 3TTXA 4B80A 2EJTA 4F3NA 4LA4A 1XZMA 4E0BA 2IBTA 1Z0ZA 2MSNA 4JLDA 4KYIB 1RXYA 4XPZA 5FIUA 3T6KA 3W0LB 1CZHA 1UEIA 4H0NA 3E9QA 3KWMA 5AW2A 4Y2TA 1L4UA 4F3RA 4KFSA 4Z2YA 3DD1A 3CNBA 4X24A 1UBHS 4DXDA 3RC7A 2VBGA 1J7JA 2Q2OA 2FFHA 3UIEA 3E58A 1XRNA 2GAIA 4M1QA 5HZHA 1CHDA 4D9NA 2KLHA 3AKYA 1GA6A 1NP7A 4BFZA 3UYLA 2GS9A 2QJOA 4RAOA 2PRKA 3K30A 2WD7A 4WEOA 5CHEA 4LFBB 2FPLA 1XVUA 5T5QA 2GBLC 3TOZA 5J58A 5AVKA 4GDMA 1O9HA 2WJGA 3NMUF 3B78A 3KVNA 4TXHA 1AZSC 1PJ3A 2HBYA 4DLKA 5A4MS 4QUEA 3JWIA 5I9MA 4ZKDA 2O48X 2FR8A 4PZPA 4E07A 5JNRA 2IHZA 1GNLA 3Q40A 1I8TA 4FB4A 1INLA 1YJ8A 3EG9B 3CNQS 3G13A 4HGRA 1GN9A 3WLSA 1Q57A 4WV3A 5G53C 1EVQA 5HYVA 4KQCA 1NQVA 3BZWA 1RDFA 4L3OA 1JR6A 2R84A 3DTNA 3MCZA 4KG7A 2PJZA 1JWAB 4OLAA 1W0JD 4A8TA 3KHKA 3FVQA 3CCFA 4WGGA 1W6RA 1N57A 1XNJA 1ZK4A 1U0HC 2A3RA 1GRRA 2C92A 2C8KA 1BXRB 2XW6A 3NT4A 1LBQA 4JH0A 4RS3A 5LP6C 1G3RA 3WR5A 3O82A 1MJFA 5K01A 3WK9A 3ESRA 4W8GA 4HUQA 1M34A 3RTDA 3ZWMA 1P7ZA 4EA9A 2Y66A 4B7UA 2A5DA 4WFIA 2H3HA 3N76A 3OKFA 4BO1A 2AI3A 1Z83A 1Y7HA 1DQPA 3PI7A 2Q9CA 4Q12A 4UPVA 4BO5A 1N3LA 2PY6A 2VWGA 3X3HA 3FSGA 1ZSYA 5DBOA 3FDXA 2P5TB 5IARA 1VIMA 2Z30A 3AFNA 3ZTYA 4DLYA 4M7PA 4I4CA 4DRXB 4INZA 1VMIA 4ZZIA 4WINA 3SJBA 2HHJA 2XCRB 5LLSA 1FY2A 1L5NA 3ANNA 2OXFA 2P6PA 3H13A 1OGIA 3OTQA 4IFIA 2D0PB 1HT2E 4YRLA 4E1BA 1M7BA 3R5SA 3FHOA 3C6YA 1F4LA 3T1HB 1JSZA 2WJWA 4NOLA 4U7JA 3R3XA 3HFGA 5K5EA 4E3WA 1NKTA 1O96A 3RJ9A 2WTAA 3AV3A 1HUQA 3RU2A 1K1EA 2QNBA 1ZX1A 5FBRB 2C98A 4IP0A 4ZAWA 1GTJ1 1Y37A 2B8WA 2JEOA 1U4OA 4WTOA 5DXAA 5CBPB 1XTUA 4RORA 4Y1RB 3E8XA 4YREA 4NMMA 1GFZA 3L6DA 5FR1A 1ZUHA 2ZANA 4P33A 1G4AE 3Q7TA 3QH4A 1X6VA 1YDGA 3QHQA 3HCWA 3UJHA 5KX5B 4B47A 3HRHA 3INTA 1M75A 1BWPA 2AX4A 1XK6A 4DCSA 1Z5GA 1SK9A 4FMDF 2E4WA 1NW7A 2YXLA 3D3WA 3QKUA 2ZAOA 2K7ZA 4L0MA 1FXUA 1BKDR 2BJVA 2C54A 3KXKA 4FOTA 4PGAA 4QEDA 4F3CA 2H1LA 3VBCA 2VI5A 3B9BA 3TW8A 5DULA 4IHAA 3G9XA 4Z51A 3D0OA 1X9IA 1LTKA 4KXUA 5FQNA 5E4JA 3TW0A 1P3Y1 4ZALA 4MPTA 3PQCA 2LR0A 4AZ0A 4DEXA 2JKZA 2E4ZA 1S2NA 3CURA 1BFUA 3GT7A 5M2QA 4GMKA 4U2FA 3B38A 3D2CA 2EP7A 4KVZA 1EA5A 4RZHA 5AJTA 1CC1S 3ACDA 4OU5A 1ZJ6A 3RQIA 3U6KA 4BV3A 2G1PA 1AKRA 3A6JA 3IE0A 4MCJA 2XIQA 1LLQA 2Q6OA 3T3HA 3GVCA 3RSQA 2WG1A 4O8CA 4A0RA 3GX1A 5M7EA 3AUKA 1VYVA 2XTZA 3ZWPA 4E5KA 5JSZB 1YL7A 4TZ6A 1BXZA 3OEWA 3EXIA 3CKYA 3FNFA 5LP6B 4YHBA 3IOCA 4N0EA 1QDEA 3BGDA 2QD4A 5E0OA 1A98A 3R3WA 2CEAA 3B3FA 1GNRA 3KPWA 1PK7A 4KGZA 1XGKA 2F1OA 5DW3A 5J4KA 4IO1A 3GUYA 4HLCA 2PJUA 1H2BA 2XV1A 3NHLA 3PEFA 4JUCA 2VRNA 1PWYE 4ME6A 4OEHA 5JO9A 1GPH1 3H1BA 1SIOA 3O38A 1YGYA 2W2QA 3E23A 2VP5A 3F5DA 3IAS6 1N5OX 3IT0A 3AEQB 2CUZA 4IIGA 1E2DA 3EGOA 1M6VB 5A6SA 4ND5A 4DDMA 5F9FA 4KODA 1N3IA 4XSVA 3CEHA 2W8ZA 3VV2A 3N6VA 1SQFA 1N2IA 3DTVA 4TS3A 4CUJA 4Y7DA 2GZ3A 3Q9UA 1KI6A 5LMNB 4O4LB 2WTNA 2H2HA 5JRJA 1WZCA 2AFHA 2VQDA 4RPLA 1F6WA 3ESCA 1VBKA 3AETB 3WXBA 4DBLC 2C3UA 1D1QA 1WUIS 2Y76A 2QP3A 4R2WA 2OZVA 1ZSVA 1NXSA 5L3RA 3U09A 1MW9X 4Y2RA 3CT4A 4CG2A 3ZDCA 1VPWA 3IPYA 5JT1A 3RS7A 4B0OA 3K9GA 4R1PA 2I22A 1SBTA 1SIWA 1HKUA 1T8RA 1Y98A 4UUAA 4HVCA 1XUOA 2PS9A 3RVBA 4DV3B 1KHHA 2IK8A 4EGFA 5BWNA 2B7LA 2B94A 3MGGA 1IZ0A 1XQ1A 2XUGA 4GI3A 4PHHA 4HC4A 4LXHA 5L3QB 3QFHA 1WY5A 4ZFNA 4OATA 3T41A 2WOOA 5BSMA 3RS8A 5HF8A 1JF8A 2UXBB 4BFYA 5CJJA 3ILVA 1PR6A 1WA5A 2AC7A 4CMKA 3KQQA 5L40A 2P2DA 2JANA 2OCDA 4C76A 1TM1E 2A30A 1ZI8A 1WP9A 4HLQB 2X1HA 4FCCA 4BMNA 4Q47A 1J0BA 3BK1A 3WGQA 2R87A 4WXEA 1PW5A 4NARA 2J33A 5ADVA 1A5BB 2HRCA 4KL8S 4QGSA 4BQPA 3V4ZA 3HO1A 2BKLA 4PYRA 2E18A 1U9ZA 1IRXA 4CODB 1VMAA 2O6HA 4JU8A 4X63A 3N9IA 5KTMA 4C7OA 1R8XA 2FSHA 3FBTA 2EGHA 3I72A 2QQ0A 4EUNA 4MNTA 1CE8A 3OX2A 5C1OA 4B17A 3IKMB 3JWJA 3K96A 5IAAA 1EA7A 3A3NA 3OBBA 2Y6VA 2ZE8A 2NU9B 3ZC3A 1H4SA 3LFHA 3LSTA 1CJBA