4ROSA

Crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
318
Chain Sequence
ARSKIALIGAGQIGGTLAHLAGLKELGDVVLFDIVDGVPQGKALDIAESAPVDGFDAKYSGASDYSAIAGADVVIVTAGVPRKPGMSRDDLIGINLKVMEAVGAGIKEHAPDAFVICITNPLDAMVWALQKFSGLPTNKVVGMAGVLDSARFRHFLAEEFGVSVEDVTAFVLGGHGDDMVPLTRYSTVAGVPLTDLVKLGWTTQEKLDAMVERTRKGGGEIVNLLKTGSAFYAPAASAIAMAESYLRDKKRVLPCAAYLDGQYGIDGLYVGVPVVIGENGVERVLEVTFNDDEKAMFEKSVNSVKGLIEACKSVNDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Malate dehydrogenase
publication title Crystal structure of Methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose
rcsb
source organism Methylobacterium extorquens
total genus 112
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rosA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4rosA02
4XJSA 1ZNQO 1YQXA 2VTDA 4XB2A 3RUEA 4DTIA 1ZK3A 2VYVD 4CLDA 4ZA2A 5F1OA 4J49A 2HRZA 3QVTA 4PLWA 4E32A 4ILKA 2ZK7A 5HS6A 4ZQHA 3W4JA 1LDGA 2Q46A 4MVJM 1MX3A 2G76A 3OA0A 4LGVA 3UAGA 2ZB7A 3GMSA 3NJ4A 4JROA 4XZ3A 5JW6A 3H9QA 1UZLA 2VRCD 2HQ1A 3GMDA 1BXKA 5L4NA 4R5MA 2J8ZA 3NDRA 3WGGA 4E5KA 3RUDA 4IBOA 1Y8QB 2IZ0A 1DHTA 4BO9A 4DPKA 1MC5A 2O4UX 4LMRA 4NHEA 4PLCA 5BNIA 1LLUA 3DBRA 4H16A 4R1NA 2PKQP 3G3EA 4DLLA 2NU6A 4Z3DA 1EUCA 5BSGA 4B8ZA 5K6AC 1A72A 4BGIA 3EGOA 4DMMA 3DB2A 5A1TA 4BVAA 1JVBA 1CEQA 2NU7A 1R0SA 3ZU4A 2AW5A 4ALNA 1LQTA 2CDAA 3KYCB 3WYBA 4K26A 2EKLA 1TVEA 1SEVA 2CD9A 3WBBA 2C59A 3PZBA 1U3UA 3D1LA 3C7AA 1GAEO 4B3HA 1Z7BA 3L0DA 4II2A 4YXFA 4A5OA 1X7DA 2H1SA 2Y1EA 2DBQA 5U4QA 2ZTLA 3NX4A 3DONA 1GL3A 2LDBA 2CFCA 3WSWA 4I08A 3DTTA 2VT3A 3E1KA 1I01A 2PV7A 3LF1A 8LDHA 4GL4A 3C7DB 4GX1A 4ND2A 5F1PA 2VUTA 1W73A 5DBFA 2O3JA 3GDFA 4NFHA 4AJJA 1KVUA 3H5RA 1R0LA 2NACA 4LISA 3IUPA 1DFIA 4MKXA 3JYQA 3VTFA 4IM7A 4EJ0A 4WCFA 1PJCA 1G0OA 5H83A 3GEDA 3ICPA 1Z73A 2NU9A 3FTPA 4WLVA 5B4UA 1PS8A 4MVJG 1GY8A 3GLQA 1GCOA 1RYEA 1WPQA 1PSDA 2B4QA 2CVQA 4AJPA 2RAFA 4R1TA 4IY1A 1J49A 3W6ZA 1Y81A 1YRLA 3FCOA 2VCYA 2WSBA 3GGOA 3AI2A 5C37A 2BFAA 4AICA 3GZ4A 1SCUA 4CM9A 1K6JA 1T2AA 3PJDA 2EP7A 4Z0PA 3LT2A 3GNTA 3WS7A 3ZWVA 2IRWA 4FFLA 3TZCA 3ZWCA 5IJZA 5TT0A 1NFFA 2AEMA 1T2DA 1ZK1A 1I3LA 1DPGA 4DVJA 1BG6A 4PRKA 1PJLA 2ZKLA 4DREA 4Z6KA 4EGFA 3OECA 3FNHA 3M6IA 3AUUA 3LVFO 4FFRA 2W98A 1E3SA 3JYPA 1X15A 2DTEA 2EKPA 3DDNA 1V35A 4PG5A 3MCVA 1M67A 2E37A 3V1TC 1U4SA 2R00C 5IZ4A 3E9MA 2CY0A 2JAHA 3ZWBA 1ONPA 5KVSA 5A02A 4CLHA 2I67A 4LRTB 1UZMA 1GUYA 4NQZA 2X5OA 4QTZA 2YZ7A 2CVZA 2P9GA 3V8BA 3PPIA 3EVTA 3L4BA 2OGUA 1O0SA 2PKQO 1QXSA 3I9LA 4KTTE 1O5IA 1D1SA 4BQPA 3TOXA 1X1EA 1AXEA 3N58A 4ZICA 2VNAA 3CH6A 1P0FA 3D5QA 5A5EA 1O6ZA 2RBEA 2D3TA 1ZCJA 3GAZA 1I0ZA 1DSSG 5JMPA 1H6AA 2GERA 1HDZA 2PD6A 3FRJA 3INGA 3JQ7A 2IXAA 1Z6ZA 2GF2A 3CINA 3A9WA 4DPLA 3WLEA 4CLEA 4FGWA 3Q1LA 1PWXA 4ROSA 3QWFA 3ZWNA 2ZQZA 4WLNA 4GLOA 1QSGA 1YJ8A 4XQGA 3B1KA 3PWKA 4LRSB 5TJ9A 5TJHA 1NQAO 2CSUA 1QP8A 3DQPA 4XWYA 1QYWA 1X7HA 4RPGA 5ADHA 3SLGA 1DC5A 2QZZA 4CM8B 3TPCA 1E1LA 1KY5A 1E3JA 3S2GA 2NNLD 1TXGA 3BHMA 1ENZA 5TF4A 2CNBA 3V2UA 3UFXA 3FF4A 3F1LA 4LCEA 4YAKA 2VUSA 3DAPA 4IMRA 1C3VA 3MZ0A 2RIRA 4QECA 1I24A 4BGUA 1O9BA 1DIBA 3STHA 4DMLA 4CR8A 1PJ2A 1FMCA 1E3IA 1ULUA 4D3DA 3OH8A 1PZEA 1ZEMA 2J3KA 1CIVA 3RQSA 4NFYA 4BO2A 2PWZA 4KUGA 3TZQA 1FF9A 1LC3A 1EDOA 2FR1A 4C7KA 2I6TA 2CDBA 1X0XA 3B6ZA 1OI7A 1NWHA 1HDXA 1SBYA 2EF1A 2Y1FA 3AI3A 4BKQA 3BYZA 3OF2A 4AJIA 4KQWA 1YBVA 1HRDA 5JAMA 1E5QA 1IE3A 3QLJA 5JE8A 2QZ9A 4OXKA 4PIVA 4YQZA 2DFVA 2I99A 3WQRA 2B0JA 1BVRA 1K89A 4U5QA 5I7VA 2DKNA 3OFSA 3EUWA 3ENKA 3GNQA 3CE6A 2PKRA 1LBEA 5A9SA 3FD8A 2EWMA 1Q7GA 3VVBA 3FNEA 1ZBQA 3ZNPA 4NJOA 1JKFA 3GA0A 1DFHA 1LNQA 1N2SA 1N8KA 1DC6A 4N5NA 1ENOA 4FN4A 3RBZA 3KXDA 1QG6A 4R1UA 1R66A 4CM8A 1ULSA 1YB1A 2FSVA 2GLXA 3WICA 4IQ8A 3JD3A 3N7UA 3H9UA 4E31A 4DXHA 2DU8A 4O6VA 3D0OA 3G1TA 4EDFA 3O9ZA 5JPIA 4CLOB 4BMSA 4A2CA 1B2LA 3W8DA 4MVJP 4D41A 2HKIA 2Q2WA 2A4KA 1VJ1A 3QP9A 5JBIA 2HDHA 2QRKA 2A9FA 3RROA 5FWNA 1YKFA 2WE8A 1HDGO 3QWHA 1E7RA 4Y6PA 1YOVA 3JSAA 3I9JA 3ZWMA 1EZ4A 1MUUA 5CEFA 8ADHA 4OKIA 2OOSA 1A9ZA 3D3EA 4QEDA 3IIEA 3DWFA 3E48A 5CPBA 1LI4A 1JAYA 1PJ4A 4XYEA 1UAGA 1DC4A 2GO1A 1YDEA 4IZHA 2F1KA 3ZHZA 3L6EA 3UCEA 2FZEA 2JCVA 4Z0HO 1TB4A 1V6AA 2EG9A 1H2BA 2Q49A 2UUOA 1A71A 3BXXA 2I65A 4UEOA 3SXPA 2PZKA 1WNTA 2DBZA 2XPCA 2X86A 3ZHXA 1LLQA 3JD0A 3IS3A 3VPSA 3KYBA 1KVSA 4AJOA 5G0UA 2WM3A 1GZ4A 2X0IA 3KYDA 3H9JA 3K73O 2FZWA 4KWIA 5A3JA 4XYLA 4ZRMA 2D59A 4S3MA 5L3ZA 4CMEA 1BHSA 1VSVA 3PHLA 2HMUA 1R4NB 1VL6A 5T57A 1HE5A 1ZK4A 4FFOA 4BGEA 5JAZA 1QORA 2GZ1A 4YR9A 1XQ1A 4URFA 3DBHB 2UAGA 1DIAA 1T2FA 3AFMA 4D46A 2C20A 1FJHA 4HNGA 4IQ0A 1ZMTA 2VHZA 4CQLB 4MKZA 4BMVA 2O50A 4RPLA 1HZZA 2FOIA 2JD2A 4R69A 4R41A 4A0SA 3P7MA 2P4QA 2GGSA 1NYTA 4CLOA 3Q0EA 2VHXA 1JKJA 4CM5A 2GYYA 1PQUA 2O48X 3KTDA 2G0TA 3K2BA 2EW2A 1YH3A 9LDTA 3NTRA 5L4SA 1YS4A 2B69A 1YONA 3I9OA 3PJFA 3QQPA 4IGFA 4M1QA 4YBZA 4DWVA 5IN4A 4BQRA 1HDCA 3QJ5A 2XAAA 4E12A 1A27A 2B37A 2GN9A 4GLLA 4E5MA 1KVRA 3RC7A 2DUUA 3C7CB 2PR2A 1NFRA 2IDZA 2A94A 3H5NA 4EEZA 1I2CA 1CYDA 3EYWA 1HEUA 4J1NA 4GAEA 2X0JA 4EEXA 3OA2A 2X4GA 1UDCA 4ND3A 3ON5A 3KETA 3PHHA 2FPPA 2P5UA 4W99A 1Z75A 4ND4A 4ID9A 4R9SA 4F3YA 4PVDA 1SAYA 3NT4A 2PGLA 4GMFA 4FFMA 3VH4A 1LDEA 2C7VA 4RF4A 5A9TA 2GASA 3PRJA 5U1PA 3RSHA 1T25A 3BHJA 3IP1A 4P22A 4EW6A 2PA3A 2X9GA 2I3GA 1IULA 2E49A 3DMTA 3TN7A 4P4GA 3BMCB 1NQOA 4E2WA 3WGZA 4LSWA 1EVYA 2NSDA 4BO1A 4Z9YA 2HUNA 3DAGA 3T4EA 3JQBC 3T7EA 3DBHA 1E7SA 4B7CA 2GZ2A 2BKAA 4J1SA 4XDZA 5LDHA 4TMFA 4RVFA 5TSDA 2GSDA 3WB9A 2JHFA 4ZN6A 3GT0A 3I9NA 3KLMX 4CM3A 4DRYA 1VJTA 1NVGA 2PY6A 4MDHA 1K2WA 4YVFA 2WJPA 2O3UA 2VWGA 4GKBA 1HYEA 3CKYA 1Y6JA 1HE2A 5L7WA 4AJ4A 1BTOA 1BXZA 3GR6A 3GNSA 1H6DA 4IDEA 1BDBA 2A35A 3W1VA 5THKA 3DZFA 4WUVA 1RKXA 4MO2A 1I2ZA 2RHCA 3RUFA 3U4CA 4G5HA 4HFNA 4FDAA 5ENDA 3OM9A 3QIVA 5U9CA 3G17A 2QG4A 1EDZA 2Y68A 4I5EA 1LSJA 1Q7CA 3QE3A 3ULKA 2H9IA 4C4OA 1PQWA 4JN6B 3WR5A 1GEGA 1O89A 4XYBA 2BI7A 3ANLA 2QHXA 1DFGA 3TSCA 5TT1A 4NK4A 2GZ3A 1RM5A 3IUSA 3VC7A 4RZHA 3JTMA 1NQTA 1OZAA 1ADCA 1UXIA 3GAFA 2RH8A 3HFSA 4II3A 4WK6A 3QVWA 1ADBA 4HFMA 3RU7A 4ALMA 4UEJA 4Q3NA 2G1UA 3KRTA 2OBNA 3QHAA 4XQEA 2X5KO 1FXSA 1EBFA 3HDHA 3K30A 3VAZA 3A28A 3KHUA 1GU7A 4I8XA 4KP7A 1VKOA 4RVGA 4XIYA 5IXSA 4Y67A 2Y05A 2X22A 3M1AA 4CR7A 5CEJA 3CUKA 5TC4A 1A9YA 1DO8A 5JYEA 1HT0A 1CJCA 3VZSA 3ETEA 2HAEA 3K2EA 3TFQA 1W8DA 1B8UA 4IDAA 3W6UA 5I7SA 4CMGA 4DIFA 4BO5A 1IL0A 1VRWA 1XR3A 2ZQYA 4DLAA 1SOWA 2WYUA 3HQ4O 4FBGA 1HDRA 1H9AA 1UZNA 3ZI0A 1Y8RB 4GX5A 1LRJA 4INAA 2NQTA 1P1IA 4IZIA 3OQ6A 3OJFA 5AQ1A 3RASA 1HE4A 3ADPA 1U3VA 4CV0A 3F46A 4E5NA 1EFKA 4GQAA 1K6XA 3W8FA 2YY7A 1YDWA 4NG5A 1OOEA 3O8QA 1XA0A 5C7IO 3F3SA 1YWGO 1IPFA 1ARZA 1EVZA 3SX2A 3GHYA 3GVHA 4O5OA 4ZGWA 2JD1A 4D7AA 3H3FA 1HYHA 3I9KA 2AQHA 3CSDA 3G49A 4JP3A 5KJFA 1M66A 3C1AA 5T64A 4BNHA 1E7WA 3RWBA 1V9LA 1HDOA 2ZCUA 4UULA 4NIMA 2I9PA 2Y1CA 1RPNA 4PZCA 2CZCA 4N7RA 2X58A 2TMDA 4R9RA 5ILOA 1BXGB 4R68A 1ADGA 3MJEA 4EBFA 4CLRA 3I52A 3FNFA 4MKRA 4PLVA 3DBRB 2DQ4A 2WYVA 5L7TA 1R16A 1WDKA 5DNAA 1KEUA 4TKMA 1GUZA 2D5CA 2CDCA 3K8ZA 5ICSA 4MP3A 3WWZA 2J5QA 4PG7A 3RAJA 1QMGA 4IUYA 3MTJA 4ZHSA 3H4VA 1Q0QA 5G0WA 2FSSA 1U7TA 1SOVA 5EL0A 3T7CA 4DGSA 3T4XA 3JQFC 2FPIA 3CIFA 1BSVA 4E4YA 4TRJA 3WQQA 4RDHA 4QUKA 3ITDA 3O03A 1WAMA 1Y8RA 2NWQA 3HUDA 4D79A 5B37A 1NQ5A 1PL8A 1QYCA 2DAPA 2DPGA 4NU6A 2Z1NA 3WTCA 1PJQA 4P38A 2UYYA 3TQHA 3HDYA 1HYGA 1KEVA 1S7CA 1IZ9A 4YRAA 1HSZA 1MFZA 1ADFA 1PS9A 3VZPA 2PH5A 1OC4A 4WCFB 3ONFA 1XEAA 4CMCA 4YJDA 4AJ2A 3MEQA 2POQX 4IJKA 1ISHA 1BVUA 1XIVA 1PR3A 1RM4A 4FOSA 4PGFA 3ZDFA 4RPJA 3D5TA 1ORRA 4DC0A 4BNNA 1X1TA 3KSZO 2VN8A 3TRIA 3WJ7A 3INTA 5GZ6A 1BRMA 1ZEJA 2FHSA 3E9QA 4J3FA 1EE9A 2VYND 3GVIA 4JJFA 1QLHA 1BXGA 1C0PA 1H6CA 4CV2A 1G0NA 3E82A 3KEQA 3KSDO 2HO5A 4J7XA 4RVUA 2EXXA 3C8MA 4BMNA 1AHHA 3DFZA 3MJCA 4GH5A 3G1UA 3HSKA 4WGGA 1X14A 4TRMA 2AEFA 3LT4A 2Y93A 4YT4A 3U5TA 4Q3BA 3WIEA 1HDYA 1ONNA 3ASUA 2DPHA 4A73A 3QA9A 4CODB 3LDHA 4H15A 2PD3A 4B3JA 1MC4A 1RWBA 4PFJA 5DCUA 4NFSA 4W6ZA 3PK0A 4GI2A 3WJAA 1GQYA 5BNTA 1GPDG 1G6KA 2OBYA 4Y9DA 1A4UA 2Y0CA 1BDMA 4F6LA 1LSUA 3GF4A 2JJYA 3MWDB 4QT0A 3H2SA 4WCFC 5IF3A 3VKUA 3RJ9A 2EHDA 1KC3A 1ZJZA 3JQEA 1LSOA 1U3WA 2G5CA 4ONEA 2FPGA 5G0TA 3RKUA 4OQZA 5CDGA 2ILTA 4YJHA 1LTHR 4ZD6A 1ZSNA 1SB9A 5AYVA 2C29D 2DUWA 4QQRA 2VNSA 4IXWA 3D7LA 3NGXA 3KM0A 4R54A 3CEAA 4NBTA 3K31A 5F1KA 1PZGA 3ZU2A 1ENPA 5FEUA 4BO6A 2O7QA 2EKQA 1SNYA 4M49A 4PLTA 3SEFA 5I7EA 1ZMOA 2FMUA 3EK2A 5F21A 1MG0A 4TZKA 4MP8A 4WLEA 4BNZA 5I8WA 3JQ7B 1T26A 5DULA 2UVDA 1JTVA 4AJNA 3UGKA 4J4HA 2WD8A 4HFJA 3DXFA 2GN8A 4NBVA 1GUFA 2Q2VA 2BFPA 4LMPA 4ZQFA 4L4RA 4R3NA 1E6EA 3I23A 3GGPA 3K5PA 4FPXA 2AQ8A 4GGOA 3I5MA 1OAAA 3JQCA 1NASA 1NXQA 2J5RA 3OEWA 2GCGA 4BNLA 5JNLA 2YV1A 1GCUA 1PWZA 1U7HA 1LQUA 3PI7A 1UUFA 2WE7A 3PHJA 1DDOA 3ZW8A 1D1TA 4CMKA 2D4AA 3NT2A 4XJTA 5IDYA 2X9NA 3OJOA 3UN1A 3S2FA 4D44A 1B8PA 1OMOA 3EW7A 4UUOA 9LDBA 2C2YA 4R51A 1QYXA 2UV8A 3JQ9A 4BOYA 3TZKA 2VOEA 3JQDA 1N7HA 4YJGB 4CM7A 4BKOA 3IKTA 3L4BC 1L7EA 2YJZA 3H5AA 3FHLA 1WMBA 4LVCA 5CDSA 2QRLA 4GX2A 1K3TA 2JD0A 2X1HA 2O3RA 3NV9A 5JAQA 1DB3A 3JQAA 4I9HA 3FPLA 3DAFA 2VHYA 4HNHA 4P4LA 2D0IA 4IDGA 4NH4A 2DLDA 3W4IA 2YHIA 1PZFA 4BNGA 1BW9A 1LU9A 3AM5A 4N5LA 1DHRA 1OC2A 2LDXA 4BO8A 3ANMA 4JK3A 1GV1A 3GDGA 3FBGA 3PDJA 3U4IA 4JLWA 3HDQA 3E5RA 5A5FA 4BKRA 2JFGA 4ZQBA 2BMAA 4E6PA 4CQMA 1KEPA 3WWYA 1ZVMA 4IDCA 4L9RA 3FR7A 3VPFA 2PZMA 2HK7A 5J23A 4I5GA 1NBOA 3GUCA 4YAIA 1LLCA 3F6YA 5A9SB 2ZTMA 1T1SA 2VOJA 3P5SA 1A5ZA 1E92A 4E33A 1DIGA 4ZU3A 1B3RA 2YFHA 2B36A 2VT2A 5JC8A 2P91A 4R1SA 2YFQA 3UICA 5BQFA 1IHYA 2AXQA 4OAQA 2OMEA 3WLFA 1LXCA 4WEQA 3WBFA 5DOVA 4GGPA 3ETGA 2X0NA 4PZDA 3ZGYA 4EJMA 1U2GA 1RYDA 2P2SA 1HZJA 1XCBA 1P1HA 4GVXA 3LC7O 3SJUA 4CM9D 3ROMA 3H9GA 3FNGA 3CPSA 4MP6A 4UAGA 2Q4EA 4W9NC 2JL1A 1U1IA 1YQGA 3HB5X 4YJGA 3MJSA 3GVCA 3SJ7A 2Y1OA 3F5QA 4R16A 4Q39A 5L51A 1YOVB 2RH4A 3EC7A 3PFFA 4B7UA 3V2HA 3OIDA 3GPDG 1UXGA 4B3IA 5TRTA 2IODA 3AFNA 4Y6SA 2BHLA 2J3IA 2FWMX 3RI3A 1QV7A 5CG1A 1GTMA 3TZ6A 3LT0A 5T6BA 2C54A 3C3XA 3LC1O 2HJRA 4ZRNA 3IJRA 3AUAA 2P9EA 2RHRA 1E6UA 4PZEA 1VL8A 3PJGA 4WEOA 3RUHA 2C2XA 5HM8A 3H7AA 1MB4A 3O4RA 2Y0DA 1B0AA 3LLVA 4M54A 5DF1A 2XXJA 1CDOA 3ONDA 1UXHA 2VRBA 3UUWA 5MDHA 3GHHA 3KYDB 2IXBA 1QRRA 1E6WA 2HSDA 2PZLA 1NVTA 3BMOB 2YV2A 3E9NA 2EERA 5T8KA 3EVNA 2GUGA 4OQYA 1B3BA 4BO0A 5EQDA 1L1FA 3UXYA 3ZV6A 1WP4A 3AY7A 4HWKA 4L76A 3UCFA 2DVMA 4Y98A 1ZSYA 5H82A 4GWGA 4B4OA 4BNIA 3S1LA 3I6IA 3KLPX 4O0LA 4N5MA 4OSOA 1DLIA 3DFUA 3DEYX 3JYNA 3PLRA 3TL2A 4IIVA 1F0YA 1ML3A 2AA3A 2JCYA 4UVDA 4NBWA 3AWDA 4EUEA 1RJWA 4AG3A 3SC6A 4E30A 2G82A 1NFQA 3EDMA 3GN2A 4K28A 3OIFA 3PP8A 3D64A 4XRRA 3WYCA 2YDXA 2HRBA 1UJMA 1ZK2A 4HP8A 4WNIA 3ABIA 1YJQA 1VL0A 3L4SO 3UH1A 4AJHA 2OUIA 4YJFB 1CETA 1E7MA 2FN7A 3BMQA 2CF6A 3DOOA 5G4KA 2AE2A 2V65A 1PJ3A 1R37A 1AXGA 3L6OO 4CMBA 1XQ6A 3VDRA 5GZ1A 4CMEC 3VPXA 5ENVA 5JY1A 1PEDA 4L4SA 1AN9A 2Y0EA 3GEMA 3ZNQA 5JDIC 4YTEA 4KQXA 3DZGA 3AK4A 4ESOA 5EIOA 2EIHA 5BR7A 1I33A 4MIEA 3BMOA 4F46A 3OQBA 1CERA 2E48A 2C7GA 3F4LA 1D4FA 3UOGA 1XLTA 1DBVO 3TL3A 2P4HX 2VTEA 4BL5A 5JDCA 1U8FO 5I9NA 5G0SA 4E13A 2X5JO 3V2GA 4JX8A 5JLAA 7MDHA 4IGEA 1H93A 3WGTA 7ADHA 1I36A 1SC6A 3TF5A 3JQ8A 4IDDA 3ZHYA 4U6QA 3IC5A 3U4DA 3DR3A 4HKTA 2ZYDA 2Q2QA 4DIOA 3G0OA 3X2FA 3UHAA 1ZXBA 2Q1UA 2JFHA 3OIGA 3ZU5A 1ISMA 4Z0TA 3L07A 4DC1A 3LU1A 3SBOA 2GDZA 2RCYA 4UUPA 4CJXA 5JYDA 1XYGA 5KKCA 5JO9A 5LCXA 3AY6A 2CF5A 3NDIA 1LUAA 2D2IA 5EINA 4JJIA 4OKNA 3F5SA 1U8XX 3B1JA 3HG7A 1PR9A 4HXYA 2HMWA 1NNUA 3I9MA 2FR8A 5KJ6A 4XGKA 2C07A 2H5LA 4XR4A 3VH3A 2IZ1A 3RFVA 5GZ3A 1I32A 1U28A 3PQDA 4PG8A 2J3HA 3NYWA 3ZWAA 3E03A 1XSEA 3CMMA 4YRBA 4DQVA 4DBVO 4YJFA 4B79A 1ZXLA 2AQKA 3KUXA 4JBHA 3WNVA 4CL3A 2PH3A 2ZB3A 4CMJA 1NPYA 3DMTC 1WDMA 3X2EA 4A03A 5IZCA 4M86A 4G81A 4HUJA 4A10A 3DZIA 2Q1WA 4IJVA 3OJEA 4J0FA 1XDWA 3L77A 3JD1A 1GYQA 4J1QA 1YL6A 3NJ8A 4YAJA 4Y8VA 1V3UA 1O8CA 2NLOA 1MXHA 3IJPA 4OHUA 3RC2A 3QVSA 4KDEA 3P19A 3RBXA 2C5EA 2O4CA 4Q3AA 3D4OA 4B4UA 3DBVO 4O59O 3ROKA 2DT5A 2ZB8A 3GVPA 1DJNA 3VOSA 4DQUA 1I5RA 3VH1A 4BNTA 1P9LA 1V3VA 2DTDA 2NADA 4MVJF 3EHEA 1ISGA 2JKVA 1PJTA 4GWKA 4M87A 2Y1DA 2X23A 3WOHA 1TT7A 3A06A 4BO7A 3FR8A 2G17A 1NHWA 4OJNA 3ZNOA 3SVTA 4AJ1A 4PLPA 1FDVA 4L0QA 3BTSA 4FIZA 1J6UA 2Z5LA 2PZJA 1ONOA 1DXYA 2P9CA 1VJ0A 4U0JA 4YAGA 1QR6A 1W6UA 2IYPA 4AFNA 4BNUA 1JW9B 4F45A 3HB4X 3FPCA 4MVJA 5EPOA 3K92A 5A3VA 3ZHBA 4BNWA 4D0SA 1Y5MA 1P31A 3DHNA 2FRDA 2JCXA 1E5LA 3UKOA 4EYEA 1ZIDA 4CV1A 2PNFA 1OFGA 4ND5A 5ER6A 3ROQA 3GVXA 4NJMA 5EMHA 4BNJA 1N7GA 1JQBA 1IY8A 4EUHA 3O8QB 4UVEA 3JYOA 1WZIA 2BELA 2VZ9A 1GR0A 3PEFA 4AVYA 1NM5A 2WWRA 3VPHA 4RORA 4KTVE 1Q7BA 2V7PA 3ZN2A 3EZLA 5JSFA 3WGOA 1Z74A 4BO4A 4PLFA 3DOCA 3DZKA 5COAA 4UVHA 5F5LA 4DUPA 3VTZA 5TQVA 1AGNA 1E3EA 1PS0A 3DBLA 1KY4A 4J1TA 1J4AA 2HJSA 3PVZA 4JXKA 3DZHA 5IDQA 3PGJA 4OYRA 3ROPA 1MLDA 5KJ1A 4EJ6A 3HE3A 4CLRB 4XYGA 4UUNA 4CUJA 1VI2A 4OGWA 1PGPA 2GNAA 1LA2A 5FF9A 4WASA 3HJAA 3KVOA 1CQIA 4I5FA 5EJ2A 1P1RA 4WLUA 3VHRA 2FP4A 5JS6A 1YBMA 2BFMA 4QFCA 2NV6A 4CL8A 4FJ2A 5BNFA 5L7YA 1GPJA 1O95A 3B70A 3WDSA 3HN7A 3WGQA 4PRLA 1O94A 2AE1A 4I1IA 4MJLA 3AUTA 3ZWYA 2HK9A 4BKPA 2ZCVA 4FC6A 3ZNNA 4JJGA 3ZW9A 3MWEB 4DQXA 2XOXA 3A1NA 1R12A 4LCJA 3S55A 1NPDA 1UXKA 4Q3EA 3OMLA 1DAPA 1F8GA 1IHXA 4OH1A 4XGNA 3UW3A 4IDBA 2QRJA 1GD1O 5BSFA 2D5AA 3VZRA 4TSKA 1XGKA 1AE1A 5GMOA 3RBVA 5KOIA 2C82A 3C85A 3K96A 5KVCA 2ZIZA 1TEHA 2NVUB 4DYDA 1Y9EA 1GFSA 3LSYA 1WDLA 3S2IA 3RVDA 2ZB4A 1UAYA 2X9VA 3GPIA 3AOEA 3U62A 2VYVA 3NEPX 2NTVA 4D3SA 3O26A 3PZRA 5I8ZA 3RUCA 5KNLA 1JDJA 5CPFA 5KJEA 2OZPA 2J3JA 4MVJD 3ICCA 4O1MA 4RGBA 3FWZA 3BMNB 1T24A 2VHVA 4R3WA 1ISJA 1HTBA 1QLJA 1SZJG 2PGJA 4YACA 5DCYA 2YV3A 3U3XA 2VHWA 4OO3A 3NRCA 3AI1A 4C7JA 3D4NA 3EZYA 1P77A 1PJSA 1C0LA 3D3WB 3JV7A 4QO7A 4TKLA 3QVXA 1KOLA 3WMXA 2GN4A 1N92A 1LDBA 2HMSA 3M2TA 4K9DA 4M89A 4R5HA 5HRUA 1HKUA 3IOYA 1FDWA 3FSRA 4ALJA 3FWNA 2JFFA 2DBRA 3BA1A 4HV4A 1A7AA 4XEHA 3I83A 1YXMA 5F5NA 1GADO 4EZBA 3TNLA 2Q4BA 1W4ZA 3ZZNA 3B20A 3WG9A 3I1JA 2BI8A 4R01A 1F12A 3F4BA 4A27A 2I76A 3ANNA 4FC7A 2Q3EA 2AMFA 2IEBA 5EN4A 3PHGA 1NR7A 5ILGA 4BUCA 3QWIA 4W4TA 1C1XB 1F8FA 4E21A 3HN2A 4CUZA 2NVUA 4RCVA 3PXXA 4IINA 1M2WA 1V0JA 1T2EA 1ZUD1 1VC2A 2B5VA 4QFDA 2XF8A 3GEGA 4PLZA 4NR0A 5JXWA 4YJHB 3E5MA 3GQVA 5TNXA 3E18A 5C5IA 3OICA 1GYRA 1IOLA 4CPDA 1XWFA 1TI7A 1MA0A 1KVTA 2CUKA 2W90A 2QX7A 3KSUA 4BV9A 4CM4A 3JQFA 3LF2A 4XIJA 3ZWOA 4ALIA 3BMNA 3QSGA 3BZUA 1KIFA 3D4PA 4KMSA 3ZV5A 3E8XA 3DTYA 4NK5A 2NTNA 4J2OA 1E3WA 4K6FA 1DIRA 4PLYA 4BIIA 2EGHA 2ZYGA 3K9QO 2BGKA 1J0XO 1QKIA 3D3WA 5ICMA 2PTGA 4FFPA 1P44A 1ZW1A 4B4WA 2VQ3A 2R2GA 4FGSA 2I3AA 5JC1A 2PD4A 4L73A 2VWHA 1ZJYA 4DYVA 3NT5A 3N74A 5C3MA 1GQQA 2R6JA 3LZ6A 4FSHA 4Q3DA 1C0IA 1QYVA 2NM0A 4OXNA 3Q9NA 3K6JA 3V1YA 5JY6A 3U09A 4GX0A 1GQ2A 1PGQA 2HLPA 3AM4A 3GG9A 4MVJI 3H65A 4J6FA 1ZK0A 3JQGA 1EVJA 3WIDA 4D45A 5CFZA 5A06A 2H6EA 4XYMA 2Z1MA 1DOHA 4NZ9A 1PTJA 5JAIA 4U8GA 4A26A 4RVDA 1B7GO 1NAIA 3VDQA 3WSVA 5CAEA 2DBVO 2SCUA 5EESA 4B8WA 4DLBA 1C1XA 2Y66A 1UP7A 4FJ1A 4J90A 5K6AA 2PLAA 2HCTA 2IZZA 2V6BA 2ZTVA 3JQAB 4O63O 3OEYA 5KVQA 3NDJA 1K5HA 1C0KA 4JNKA 3MJ4A 4N54A 3ONEA 3PWSA 4L74A 4MIYA 3GRKA 2YHIB 4W7IA 3CXRA 1BW9B 5H81A 4NBUA 4WE3A 1SPXA 5A9RA 3FTNA 4BV8A 4RVSA 1M6WA 1UP6A 4AJEA 1T4DA 5COQA 1H2HA 4YQYA 4E2XA 3RCBA 2V6GA 1X13A 1M6HA 1P3DA 3FN4A 1LRLA 1SB8A 5FI3A 5IN5A 4CQMB 1HXHA 2C5AA 5AVOA 1PGOA 3HFGA 4XRGA 2PFGA 2EGGA 2VZ0A 3EAGA 4RV9A 4ND1A 4EITA 3PYLA 1B26A 3AJRA 4Z9XA 4Z9FA 4PVCA 4RVHA 1EQUA 4ZQEA 1UH5A 4N18A 3WGHA 5KTKA 2EP5A 4JQCA 1FK8A 1E77A 4OOFA 1YGYA 2P5YA 1EEHA 1JLLA 5DCWA 3P2YA 5KVVA 3KB6A 4YDRA 1DRVA 3Q6IA 3JQ9C 1XHLA 5TIIA 3AY3A 1Y8QA 4CMIB 1U5AA 3M1LA 1UXJA 1VE9A 1VM6A 1AUPA 2E82A 3GZNB 3HWRA 4KWHA 1IYZA 3PIDA 2Q50A 3Q2IA 4TRNA 1JWAB 3WQSB 3WGYA 2V6FA 3PDUA 2B35A 4TVBA 4E2YA 3GN1A 4NDNE 1K6IA 3PHIA 2NU8A 5HBRA 1U4OA 1V3TA 2DTXA 3KYCA 5KKAA 4BHTA 4YYZA 1TA4A 1T2CA 2QIOA 4R4JA 4D0RA 2FR0A 5C7LO 4FR5A 1JN0A 1PL7A 1SEPA 3WGIA 3AU9A 5AXAA 3ADOA 1H9BA 3IQDB 1DAOA 4FOOA 2NVBA 1MG5A 2BGLA 2EW8A 5G2OA 3V5NA 4YT8A 3RJ5A 1LDMA 1IZ0A 3GDOA 3JQ6A 3KV3O 4BNXA 2EV9A 4KDFA 4OM8A 2R00A 3Q11A 2QW8A 1Z82A 3FBTA 3VPGA 1A7KA 4BNFA 1F17A 3IKVA 1GYPA 1G1AA 3OBBA 3RIHA 1YL5A 1WWKA 1EVIA 4HBGA 2B5WA 1D3AA 4S1VA 4J4TA 5DOZA 2YYYA 4OL9A 4CMAA 4WCDA 2O2SA 1JKIA 2BRUA 4KUEA 4L8VA 4L75A 3LC2O 2EEZA 2IYOA 1EMDA 2FY8A 2TMGA 3R3SA 3KEOA 2HU2A 3L9WA 3I4FA 1CWUA 3ST7A 3B1FA 4BNVA 1NTOA 3SC4A 1R15A 4E5PA 3KZVA 4I5DA 1D8AA 2I5PO 1DC3A 1CF2O 1PU2A 1V8BA 1T4BA 2AG8A 1DRUA 4XR9A 4M55A 3I4CA 1GV0A 1JWBB 3FI9A 5A05A 3RD5A 3ZV3A 3UF0A 4CMIA 3GZNA 3IDSA 3GH3A 1SO8A 2JHGA 1L7DA 2Y1GA 1UP4A 3M2PA 3PFWO 2JAPA 3ETDA 5AOVA 2OP1A 1R4MB 4XA8A 3GY0A 5LDGA 1NPTO 2D1YA 3V1UA 2AQIA 1DIHA 1MFPA 3QY9A 5CHEA 3F9IA 1FDSA 3Q9UA 4UEKA 4WLOA 3AOGA 4IS3A 3EMKA 4FS3A 1ZFNA 3VVCA 4I9NA 2WTBA 3F47A 4KUHA 3DOJA 2WYWA 3RUAA 1HWYA 2GRAA 4J9VA 1LDYA 1BMDA 3PJEA 4PCVA 3Q2KA 3H9EO 3PIIA 2Y99A 1VPDA 3OJLA 4YT2A 5C7OO 5THQA 3BMQB 3GK3A 3WTBA 2UUPA 5G4KB 1H94A 4MVJH 1LEHA 1U3TA 2BD0A 4W9NA 5LC1A 5L95A 3L9XA 5FI5A 5L45A 1ZZEA 2OP0A 3U0BA 4ZJUA 1I3NA 2PK3A 5T8KC 3GOHA 1TLTA 5EQFA 6ADHA 5DP1A 4B7XA 1ZH8A 4ITUA 1ID1A 3JQAD 3TWOA 2DC1A 4XCVA 1IB6A 2P68A 4D3FA 1EBUA 3UVEA 1ZSVA 2ZTUA 4NI5A 2YW9A 4CM1A 1HETA 5DBIA 3LQFA 4BGVA 1NR1A 1PX0A 4HADA 4TRRA 1KS9A 5DT9A 4BNYA 1F14A 3NUGA 4IQGA 4FQ8A 1GEEA 4LK3A 4MIOA 3KBOA 5B4TA 4YB8A 4RF3A 3WXBA 3IAHA 4E5YA 3JQ8B 1U9JA 4J2HA 3H2ZA 4RO0A 5A04A 5L9AA 1LSSA 4J43A 4CQMD 1EFLA 1YVEI 4JBGA 3CTMA 3HHPA 1P45A 1RM0A 5JO0A 1H6BA 1Y7TA 2X8LA 4GMGA 3OSUA 1P74A 1Z7EA 3NKLA 4OSPA 4BNMA 4DBZA 1XELA 1B15A 4G2NA 5B4VA 4H3VA 4GSKA 2D8AA 2NVWA 4G65A 4BO3A 1Z45A 5JMWA 5HTOA 4W7HA 4QX6A 3UCXA 1OBFO 1J5PA 1R4MA 3INRA 1ISFA 2AG5A 1CQJA 2HMVA 1EUDA 3QV1A 4U6SA 5TX7A 5IFLA 2E4AA 3G79A 3HADA 3JCZA 1LDNA 5JFOA 2Q45A 1S6YA 4KOAA 4ZQGA 3A4VA 2VZ8A 1E7QA 1N1GA 2O3SA 4A7PA 4WJZA 3JD4A 2CVOA 4WECA 2VWPA 3ENNA 4K1LA 6LDHA 3VKVA 2J5KA 3IP3A 3BTOA 4YT5A 4W82A 1I3MA 1EK5A 4FJ0A 1GZ6A 5DN9A 4QSMA 4ZVVA 4CLXA 5CG2A 1EUZA 3RUIA 4UVGA 5JDCC 2XXBA 3EY4A 4D43A 2BLLA 2AEJA 2H63A 4GSLA 4IDFA 4P8RA 4J9UE 5G4LA 4YEDA 3H6KA 4OXYA 3ORFA 5TLSA 1NX6A 2O3QA 2EJWA 1AHIA 3C1TA 4XKJA 2O23A 5GY7A 5IG2A 1N1EA 3R0IA 4IIUA 4IPTA 1PJBA 4CUKA 4EI2A 4HFRA 4XQCA 3P2OA 4D42A 3DHYA 4YRDA 3DZJA 3WFJA 1P1FA 3LLSA 4AJLA 2NUAA 5ER9A 4X54A 1KEWA 1T1RA 5HA5A 3GC6A 4RPKA 3DHEA 4XDYA 4FW8A 2GD1O 4WLFA 5JDIA 5K9ZA 1HF3A 1N5DA 1P33A 1E1NA 2ET6A 3CZMA 4FCCA 3HDJA 1PZHA 3HZZA 1M76A 3TDKA 4MINA 3ZWWA 1DRWA 3AU8A 2QYTA 2GR9A 4IJWA 4IS2A 2OO5A 4XB1A 4YAEA 3A14A 1U5CA 4RF5A 1YB4A 1ZO8A 4RLHA 2W2KB 3VZQA 3MJTA 3KOUA 1WVGA 5DBGA 2WD7B 2QYSA 4XX0A 2F00A 2O7SA 3R6DA 4CMHA 3JYLA 4M8SA 3AW9A 3HNPA 4F6CA 3GG2A 1X0VA 4NJMB 4HY3A 5IZCC 4Y6RA 1WZEA 5ITVA 4BS9A 3MTGA 2B83A 1N9GB 2X6TA 5BT9A 2Q1SA 2I66A 1LX6A 2DFDA 3GRPA 2NTJA 3MOIA 2J6IA 5TS3A 3ASVA 4RQTA 3H3JA 1XKQA 4LSMA 4OMUA 5T5QA 1XG5A 2YHUA 4OIMA 2GPTA 1WW8A 1VLLA 3E6AA 2EJVA 1RM3A 1UR5A 3GFBA 1KERA 1H0KA 3PYMA 4JGBA 3U9LA 4BKUA 3IL2A 3PTZA 1D7OA 5CDYA 5I7FA 4JBIA 1NHGA 3DBLB 3ZCXA 3RC1A 3C24A 3WYEA 4UUMA 4YPOA 5CDUA 3O38A 1DEHA 1PGJA 2NQ8A 3PGXA 4DA9A 5JCXA 1FDUA 5KWEA 4YWJA 4L4XA 1HLPA 4FD3A 1MP0A 5AXCA 3QWAA 4JCOA 1MXFA 3JD2A 5DP2A 5CEEA 5COBA 1Y5RA 1E7YA 2ZJ1A 3I6QA 1B14A 1R4NA 1PL6A 4BNKA 3ZV4A 1KVQA 4E3ZA 2CMDA 1E3LA 1VKNA 5IXYA 3WMWA 3QRWA 2IEDA 3VH2A 2BF7A 2X0RA 1NP3A 3OJ0A 5G0VA 5AXDA 3RU9A 1GZ3A 4WOKA 5A03A 1C14A 2O3TA 3RFXA 1QV6A 2OXIA 4WKGA 2V6MA 2BGMA 4U0KA 1UDAA 1KYQA 3F1KA 4CQLA 3BIOA 3JQBA 2W2KA 4NU5A 4RL6A 4AL4A 5MGBA 3QW2A 2W8ZA 2WD7A 1ISIA 4CM6A 4E2ZA 1YO6A 1A4IA 2WMDA 3DO5A 4QXMA 1HL3A 5JCJA 3DC2A 4PLGA 3NGLA 5L40A 4H7PA 1N9GA 3IMFA 3PYXA 1I10A 1YQDA 2Q99A 1NWCA 3I3OA 5L4LA 3BHIA 1IUKA 1LRKA 4GVLA 4ALLA 4IMPA 4UREA 4QO8A 2Y67A 2W2LA 5IDXA 5IDWA 4XQ9A 3L6DA 5T67A 1I8TA 2BFOA 1I2BA 3WNQA 1JU9A 1PGNA 4BB5A 1EK6A 4TWRA 3AM3A 1EQ2A 1PQPA 3LT1A 1P1JA 5B1YA 1W0CA 1TT5B 1SMKA 1LJ8A 3NTOA 5BSEA 3PQEA 4RZIA 1WXDA 3Q3CA 5KJCA 1FDTA 1XU9A 1EE2A 4TQGA 1NAHA 4J0EA 1C1DB 1LLDA 3OQ1A 2ZATA 5ES3A 2QQ5A 2HMTA 2YUTA 3ZWXA 3BMCA 2DM6A 1PIWA 4U7WA 1ENYA 3NTQA 4JIGA 4J4BA 4Q3CA 4NPCA 4XD2A 4TROA 1KETA 5BSHA 2VUUA 1I30A 2OFPA 4DIBA 4CV3A 4JP2A 2WDZA 4BB6A 2YDYA 4GPD1 4TZTA 1DLJA 3U4HA 1YL7A 4FB5A 2GN6A 3COSA 1CRWG 4LN1A 4YCAA 3PWZA 3WFIA 1B16A 1JAXA 3W8EA 1Q0HA 2B4TO 3AOEC 4NNJA 1HSOA 4EUFA 4Q9NA 4RF2A 3BTVA 1WMAA 5B12A 1QYDA 2PGDA 1XU7A 5IAAA 4K6CA 3CZRA 1VSUA 1YE3A 2W4QA 3AUSA 1Q0LA 5CDTA 4PLHA 3GFGA 3ZH2A 5KIAA 3RC9A 2Q1TA 2B4RO 3W4KA 3DZBA 2BH9A 2UDPA 3GGGA 4DL9A 4CM4B 3C1OA 3MOGA 1E1MA 1HLDA 1DJQA 1I3KA 3PQFA 2Z95A 1B8VA 2ZYAA 1E3WB 4XGIA 1R6DA 4P4NA 2VRCA 1K0UA 2VYNA 3DL2A 1JA9A 3BTUA 1R0KA 2AHRA 3TZHA 2YQ4A 3OHSX 5JCJD 1TT5A 4RLSA 3TFOA 5ITWA 3WX0A 4E0BA 3RFTA 3GUYA 1NVMB 2OL4A 3DMYA 3ZWPA 4HX5A 4RDIA 5EERA 1Y9AA 3QWBA 4WPGA 1BGVA 1C1DA 1KBZA 5CP8A 4KZPA 1WLYA 2W2LD 4IXTA 1E1KA 1MGOA 3MJVA 5L53A 4ALKA 3QVOA 3OETA 1Q1NA 1ZKMA 4YA6A 5AXBA 3RKRA 4DPMA 3NAQA 4UVIA 1GDHA 4CR6A 2E6UX 1E0DA 3JQGB 3PLNA 4PN3A 1MV8A 4AJKA 5HWSA 3OP4A 4J91A 1HE3A 4PG6A 3U49A 3ZU3A 5HS4A 1H5QA 4LVUA 3LK7A 2ZJ0A 4J16A 4LW8A 3CMCO 4NMHA 1YBAA 1X7GA 5A4DA 4RPHA 4FFNA 2O2YA 4IJUA 1BWSA 2X7HA 1M75A 5I9MA 1YB5A 2VWQA 4TVOA 5FFFA 3S8MA 3R1IA 5KCZA 4WNCA 3H8VA 1P0CA 5DZSA 2OHXA 1LC0A 4MPDA 4MOWA 4GBJA 4J7CA 1F06A 3TJRA 1JVSA 4NBRA 1P1KA 1UDBA 1IPEA 2C0CA 3LYLA 3SLKA 1Y1PA 2YQ5A 5FYDA 1U2DA 4RQUA 3S2EA 3R3JA 4J7UA 1KC1A 4WOJA 2A92A 4I9UA 2IE0A 4B4VA 4OOEA 3KO8A 5TGDA 5K0ZA 2OORA 2HK8A 4PG4A 5F3RA 2WEKA 3TOZA 5DDIP 3ITKA 4RJTA 5I9LA 1Q2XA 4MVJE 3BAZA 4Z3KA 4GKVA
chains in the Genus database with same CATH superfamily
4L85A 5DHUA 5IKPA 2ZVPX 3HLKA 3OX1A 2YZKA 1ZNQO 4XJSA 2XW6A 2KS6A 2ZIWB 1ZK3A 3BORA 3BX1A 4JLJA 5ULLA 4Q3LA 2RONA 3LQ2A 2J6CA 3MILA 5ALEA 4E32A 3T3MB 3L7KA 3ORHA 5B30A 4L27A 3C7TA 3DP7A 1LDGA 2Q46A 3HYLA 3LHSA 3YASA 1G17A 3SQXA 2YYZA 3BD6A 1MX3A 1RQXA 2G76A 3NBQA 2ZB7A 3GMSA 5IBCA 4JROA 4XZ3A 1U7DA 1B76A 2WV9A 1EHCA 4ENRA 2Z3ZA 4QAQA 5L4NA 1UZLA 2QM7A 2VRCD 3KJIA 4DR1B 4M1YA 4QTXA 2IP1A 4E5KA 4DZZA 2OTCA 4IBOA 4LYFA 2H1CA 2BFCB 4PINA 1DQYA 3S44A 4BO9A 3GEPA 1MC5A 4QXAA 5BNIA 1O6BA 5FDFA 1LLUA 4H16A 2D3WA 1UOOA 1KY2A 1TU0A 2FQQA 1XTIA 2NU6A 2R7AA 1EUCA 4QG7A 5BSGA 4B8ZA 1UOQA 3U37A 3U9TA 2A1TR 4Q7EA 4O2AB 3EGOA 4B73A 1TEXA 1U80A 5A1TA 4BVAA 1GHTA 1ZD9A 1VHQA 2REQB 1R0SA 5IW8A 3A11A 4WCVA 5LMNB 2AW5A 4ALNA 1KK1A 2QG6A 2YZ2A 3KYCB 1SKBA 2JIZA 4HUQA 4JODA 3ZKWB 2XF2A 1V48A 1XAJA 4K26A 1UPTA 1JSRA 3C97A 3I0NA 4EUNA 3UVEA 2ZIUB 4MUMA 2C59A 1G8FA 1Y4ZA 3NETA 3PZBA 3C8UA 2ETXA 1FL9A 2W2PA 2V1UA 3OQJA 1UC8A 4A5OA 3D0KA 1JB9A 5A2GA 1DTSA 2AI1A 3VNRA 1UADA 1CB0A 3BQNB 3EOAI 1YI0A 3C16C 3DONA 1RI4A 2GJSA 2EWWA 2QJOA 1C7JA 1JEYA 3WB2A 4LOLA 3GXBA 2ZROA 4I08A 3DTTA 3GWGA 1PFVA 1N3YA 2TS1A 3W3AD 2PSEA 4GL4A 4GX1A 2XV1A 2F9MA 1JHMA 2O3JA 3H0EA 4MCAA 5C8ZA 3GDFA 1SJ9A 4KXFB 4AJJA 2V4ZA 3BRWD 4LISA 3IUPA 2W2XA 4MKXA 3OFND 1TIKA 3JYQA 3VTFA 1QQ7A 4EO9A 1Q1AA 3P97A 5HDQA 1IIBA 2QTVB 3T99A 3M1YA 4CKZA 4KK4A 2Y1XA 1E1CA 2B99A 3FTPA 1FPQA 2QVYX 2I9KA 3GLGE 3DO8A 4UUQA 2WLTA 1LF5A 2H48A 4H6PA 1A5BB 1WPQA 4QU5A 1UC9A 4YJ2F 1QRTA 3WK9A 4QSHA 1KK3A 2VBCA 4XGRA 1I4EB 1AJEA 2QA5A 2JGAA 3Q2OA 2R48A 3C2QA 3KCQA 4Y2PA 1IEVA 1G59A 4DR2B 3FCOA 3TBHA 3GGOA 1XVVA 3K0BA 2O2ZA 1SQ5A 3CNEA 2BFDA 3E8SA 2CXOA 1JQLB 1C50A 3H4IA 4CM9A 3H6HA 4WFJA 3OJWA 3P4XA 2MR6A 4D9NA 2B25A 3GNTA 1TK2A 3ZWVA 1XK6A 1TM2A 4QOGA 2J09A 4YJ2A 5GWXA 4ADSG 2H1OA 1IN1A 1AHNA 2A5YB 2ZRIA 5HKBA 5IJZA 5TT0A 1NFFA 2AEMA 1T2DA 1NOIA 1ZK1A 4JC4A 3QEAZ 1QYRA 4EGAA 3JALA 1XYVA 1BG6A 2F64A 4DDUA 1JG6A 2ZKLA 4OHRA 3FTDA 5CR9A 2I3BA 4R8LA 3TRKA 2V4MA 1QBKC 3FNHA 4BE7B 1BOFA 3H4TA 1XKXA 3BRSA 4HDMB 3Q85A 1FUEA 3L1IA 1Z62A 1XNGA 1CR6A 3MS7A 5HFAA 3ZK9A 1SUWA 2GMWA 3OM8A 4FFBB 3KV1A 4RKQA 1H23A 3ZVLA 1BHQ1 2E37A 5IRCD 1E2IA 5DXFA 3O74A 1EXVA 4RW0A 5GJCA 4PONA 3BIWA 5CLQA 4NECA 4UHKA 3UPTA 4EUSA 1TUIA 4JLAA 5A02A 3VSBA 5IK2A 4LRTB 5CNKA 3SHQA 4M38A 5ALYA 4QTZA 3R5SA 1GOTA 2FG5A 3UBMA 4F4FA 3V8BA 5KEIA 2JIZD 3UBTA 3L4BA 2OGUA 3I9LA 1QXSA 4NU8X 4BV3A 1XT6A 1AB6A 1TCBA 1TQHA 2YRXA 3GEHA 4AP5A 2QTBA 3EZ9A 5J1SB 4INZA 3TKLA 1VBNA 5JADA 4F1JA 4EYSA 2W70A 4ZICA 4A15A 4YP6A 4OQFA 2ZJ2A 4R1PA 3ELYA 2X8WA 1Y5LA 1HMPA 13PKA 1WXQA 3SG0A 2XNHA 3D02A 3IVMA 3C3YA 5JMPA 4EENA 4YCSA 2V7QD 2GERA 1HDZA 1PV1A 2HD4A 4K6GA 1QRSA 2HV9A 3EN0A 1KKMA 3JASB 2J30A 2YFYA 3OIYA 5JWRA 3JQ7A 2QBYA 2R1VA 3HGMA 1E3DA 3CINA 3ZVKA 3WLLA 4OKSA 1ULHA 2RG1A 1FTQA 2G80A 1H5UA 3H1BA 1PP4A 4A0HA 4FGWA 3ILHA 4BQOA 2HYDA 4QTYA 4JYZA 5CGQB 4WLNA 4N5IX 1WABA 1CT9A 4XQGA 1EG7A 3AJ8A 2D2FA 2IUYA 5AI0A 2CHUA 2EFGA 1EU1A 3SZGA 1QYWA 3QF4B 1AGYA 1P8JA 2HGSA 3JU3A 3V33A 2R8RA 4O3FA 1I7QB 3FCCA 4KIFA 2IH5A 1FNSA 2A0FA 1X3LA 1IWPB 4RK1A 1E94E 1TXGA 2BE9A 2K2QB 2YHAA 4ZHQA 1Q95A 1ENZA 3EQ9A 3T7KA 4KITB 3UFXA 3LHIA 1Z08A 2YV4A 4LF9B 4LCEA 2DYKA 2I2AA 4REMA 4ETMA 4YAKA 1BE0A 2QT0A 3F97A 1F60A 1QGED 3ISTA 1WRBA 1XFDA 3HXQA 1BZYA 2RIRA 2B2NA 1I24A 2XHZA 3MZ0A 3PUYA 4Q4AA 1DIBA 1YS6A 3STHA 3AL3A 1E3IA 1NUQA 5CVTA 4KQEA 3TSZA 2JK0A 1P7ZA 2W43A 3X2SA 1G60A 1QTIA 3JAWA 3UM9A 3BC1A 4X7MA 5KCMA 5I48A 3RRJA 4I8IA 1K8RA 3RQSA 3SBDA 2PUCA 2UXDB 2PWZA 3S4YA 3ADDA 1CBUA 1Y8AA 1QDUA 1II9A 2VPZA 3DDOA 2YN2A 2AXNA 1QHSA 1WEKA 4L5AA 4KQ1A 1HKHA 4LTMA 1NT2A 4MLPA 3DYIA 1N32B 2CDBA 1IQRA 1UK9A 1Z4JA 1OI7A 1EGHA 1VHLA 1Z39A 1NWHA 2EF1A 3B6ZA 3KJHA 4G24A 5E4YA 4PO1A 3RYCA 4F60A 3BYZA 2EFDB 3MELA 1HRDA 1WLSA 1RLIA 1DUVG 3LUBA 1N2JA 5FOUA 1TQ8A 2GS9A 3DE5X 3PICA 5JE8A 2QZ9A 5THXA 3AEYA 4LSGA 4YQZA 4C0QC 1T5SA 3HVKA 1ZGCA 4X45A 1X7YB 4N01A 2Q0QA 1BVRA 5IK2D 5ESDA 3NHLA 1GVNB 3GNQA 4KMMA 3AR7A 4MJ3A 3NIDB 4PO9A 3FETA 1SD2A 1TJ5A 2GBGA 3P4UA 3V8NA 3KQTA 3FD8A 3L4JA 3VVBA 3FNEA 2FLKA 3ZNPA 4NJOA 4DMFA 1A8IA 5DFAA 4YROA 1ZLYA 1N8KA 1OPXA 2A8YA 3EGXA 3D3NA 4G01B 4N5NA 2JLQA 1ENOA 2C9DA 1BCRB 2GVDC 2I2CA 2YOHA 3ISVA 3MWJA 4KXUA 1LV7A 3KXDA 4N4AA 4Q4JA 3RBZA 4HTAA 5DIFA 4CM8A 3RRYA 1VHDA 5FADA 3ZHOA 3OT4A 2E5WA 3ZJUA 4P0TA 1NVBA 3ZXIA 1E6LA 1W88A 2DU8A 3WGMA 1P2GA 3RWMB 4F9GA 4QUGA 3D0OA 3G1TA 3KYJB 1QFXA 1V9CA 1Z7YA 5JPIA 4KFRA 3HRIA 2RH5A 1JKJB 3UHFA 1LPMA 1ZZGA 3FGOA 1TZKA 2RK4A 3M8KA 1PBTA 1Y3CE 3QOYA 5JBIA 1Y7LA 2HDHA 4O08A 2HBZA 2PWPA 2A9FA 5F64A 5KBYA 4HN9A 1YKFA 1J8DA 3BRCA 3Q98A 3QWHA 4C5CA 1WB4A 1KEEA 4Y6PA 1YOVA 3JSAA 2QSZA 4MEBA 1YQ9A 5AI9A 5AUNB 2NO6A 1EZ4A 2JVIA 1EGAA 2VEDA 5EIAA 8ADHA 3NTXA 1A9ZA 2G08A 4HH3C 1MJGM 3IIEA 4U4AA 1W29A 4Q00A 4MGHA 4Y2HA 5CPBA 5AW7A 3QTTA 3DQQA 2X2OA 5LU9A 1A8QA 1C2YA 3OZDA 4P86A 3U17A 1EE1A 1D0VA 3L6EA 3SI7A 2O14A 2J0QA 5JJBA 4V3BA 2JCVA 4PGHA 1T43A 2CCJA 2QU7A 4BP3A 2PBFA 3SJCA 2I2FA 1NBHA 3KFLA 5I7WA 1CUZA 1PT7A 5AMXA 3SXPA 2J9ZB 4G8CA 4V0RA 3TW4A 1J8VA 4EHKA 2JGNA 1N8NA 2OCKA 3WGKA 1O5TA 3G5MA 4B6JA 1UEIA 2ZSKA 2PSDA 2DBZA 3CNQS 5A0VA 3ZHXA 3SOZA 3I73A 4IH1A 2JC3A 3JD0A 3IS3A 1KQNA 4BMPB 5IJ0B 5KREA 2RH9B 2R8ZA 2PSSA 1QAMA 4ZMBA 1APBA 4XYLA 1NDQA 4GE0A 4PZZA 1C4WA 1JBQA 1DAEA 1L5QA 1VSVA 1SUSA 4FZ3A 4D4GA 5EQJB 2PLNA 2VATA 2XQVA 1HE5A 3PQ4A 4FFOA 3RRMA 4DSTA 4GSYA 2HB6A 1J70A 1QORA 5DHQA 2WILA 4YR9A 4Z1MA 1G21E 2VDLB 4FMCF 4URFA 1IHPA 1RADA 1G5HA 5FPKA 1T2FA 3AFMA 1AGPA 1YFZA 4MRPA 4AWBA 1JVNA 2WKRA 2GEJA 4D46A 2C20A 2OAP1 4FXPA 4HNGA 1ZMTA 5GONB 5KTPA 2GWRA 5IVIA 4YRSA 4C20A 1ISSA 2P8JA 4RPLA 3V48A 4R41A 1SRQA 2Q8QA 3P7MA 4FHCA 2GGSA 4HXGA 4LOHA 4UAJA 3LY5A 2GPWA 3H1AA 2OYCA 3SP1A 1O08A 1S3IA 1NR5A 2AX4A 2QRQA 2G0TA 2N3ZA 1F20A 2FK8A 3NTRA 1R9GA 4HGZA 5BMVB 2B69A 4I66A 4IGFA 4DWVA 7ABPA 3EWNA 2E85A 1AA6A 5IN4A 1G6Q1 3QJ5A 3L1VA 1RSZA 1A27A 1MJHA 4GLLA 4HAZA 3VU1A 4E12A 1EIWA 2FW8A 4C3OB 3KE8A 3KQOA 1U2RA 3K0HA 3QU5A 2A94A 3H5NA 1QGYA 1CYDA 1WTAA 3Q7QA 4OATA 3W3AH 4AUNA 2ZDHA 2Y1LA 4J1NA 4GAEA 1NLMA 3D2BA 3O75A 4QU0A 4ARVA 1M1UA 5A5DA 1PNTA 2EX1A 3WRXA 4NTZA 2ZJOA 5KSWB 4C2BA 2VP4A 2X4GA 2YZNA 1W5EA 2DUMA 1EJ6A 3ON5A 2G70A 3PHHA 4QU9A 3KETA 2XGMA 2FPPA 2YMPA 3F2VA 1Z75A 3NYIA 4HRXA 3S2SA 4Y7DA 3UYKA 4R9SA 3QKRB 3WMEA 2QX4A 3IQZA 3CQ9A 4HQFA 5FI0B 4F3YA 5K0GA 4DN6A 1ESMA 2AC4A 2IYYA 3CURA 3RGGA 3VH4A 3FTCA 3OZXA 1A5SB 2C7VA 5AVQA 2XYRA 3PRJA 1R6TA 3OPYB 1DWOA 3VHQA 1T25A 2XNCA 3SS8A 2XMZA 2PA3A 2E49A 2W6MA 3LS2A 3TN7A 2XUAA 1FBTA 3K0EA 3E3MA 2ENWA 3LVBA 4G1VA 4WW0A 4ZT6A 3RUPA 2BSQA 1S4QA 1K4YA 3ECAA 4B3TB 5KQPA 2A5JA 4WZ6A 2GZSA 1G5PA 5CJJA 4Z9YA 1NI4A 1UMDB 2FFAA 4OHFA 2VKTA 3O4GA 3CZQA 1A2OA 3B36A 2QAJA 2IK8A 3QOXA 1IJFA 3QY0A 1XRLA 2GKGA 5LDHA 2HOQA 3NHZA 3GJRA 1CW2B 5HFNA 1RAIA 3RREA 4IXDA 3UPDA 2JHFA 5P21A 3LXRA 5DM70 1U04A 1TZ2A 3KLMX 2HU8A 4WESB 4CM3A 5EP2A 3BH0A 3CF4G 1EX7A 4MLZA 1K2WA 4PYJA 3NG1A 2BFBA 4IH4A 4M0FA 4U2GA 3W7AA 4GKBA 1HE2A 2P8SA 1MEEA 2O1WA 4FNOA 4G8DA 1EFDN 4OHWA 721PA 1H6DA 5JV5A 2PPVA 1LBHA 2ZBUA 5HGJA 3W1VA 3WHIA 4TWAA 2XOEA 1RKXA 2GB4A 3U4CA 2VQ6A 2W8BA 5ALNA 1EWRA 4G63A 1CY8A 1D2EA 3OM9A 4LDZA 1PQYA 2LBPA 5K8JB 3D8UA 2JB9A 5AM4A 5KPJA 4M6WA 3NB0A 7MHTA 3WAJA 2XOKA 5DLDA 4KEAA 4C5AA 1AKTA 4ZVNA 1TVKA 1VYVA 1Y4UA 3RG8A 2QLNA 3FNBA 1FXUA 4LFAB 4IVNA 4KW7A 4K9QA 4JN6B 3PEWA 4MGKR 2WQ6A 3HPRA 1JXQA 2CXUA 3ANLA 5BXYA 1LW6E 3IAAA 5GPBA 1WXEA 3TSCA 1G20A 3R77A 3UJ6A 2GZ3A 2IYUA 1O95C 4RZHA 3U7GA 3AF0A 4M1SA 1ACMA 2FVYA 3W9SA 2RH8A 4LF7B 3K94A 1M8JA 1TVCA 4RDIA 3ROZA 1KH3A 1SQSA 3RU7A 3ZZUA 1VP9A 3H13A 4Q3NA 1UWLA 2FZCA 4LI0A 3T4UA 1S0UA 4XQEA 3OZRA 4EB8A 5G1OA 3SE0A 1CF4A 1DC7A 1JHPA 2R7NA 3K30A 4AN1A 2EWVA 3A28A 1USUA 1D6NA 2QU8A 3BB4A 1M34A 4G23A 4I8XA 4KP7A 4L15A 4HT3B 3KQSA 1KO5A 2PX4A 3AR3A 3M1AA 5LUBA 3CUKA 3AHJA 1C7ZA 4PXSA 1DO8A 4K0RA 2TMYA 1C2TA 3H86A 4C87A 1HT0A 1VLJA 3LJKA 2HAEA 3K2EA 3F6PA 3Q3JB 4S2UA 4RKWA 3ZY2A 5C51B 4G0VA 3V8QA 3NBUA 4C6TB 4CL0A 5C5DA 1Z0UA 1KQPA 2P9YA 3JRNA 3LKBA 5E6UA 4AYXA 4JP5A 3CUVA 4JOSA 1OH5A 1OBHA 2CLHB 2ZQYA 2MYPA 2KJQA 2ZJ5A 2WYUA 3O92A 4J2TA 4YCJA 4DLAA 4ZYZA 1E0KA 4FBGA 1H9AA 3R8XA 5M34A 4MRNA 3A58B 4YO7A 2PMKA 3ONVA 2TMKA 1N77A 2NQTA 4M4SA 4IZIA 2IHUA 3OQ6A 3TI7A 5LR6A 2FSPA 5TF0A 4M8NE 3DVQX 3L5KA 1U3VA 1UJ4A 1Z0JA 2FP3A 3N0TA 1XV5A 4MUIA 4E5NA 1G9TA 1EVQA 2Z8YA 5FTWA 4QJ4A 4AP9A 3IQHX 3OJCA 4DARA 1ZESA 2RD2A 2OAGA 2YY7A 3W79A 1CFZA 4PU0A 1H22A 1IHUA 1QWSA 2JLAA 5EKTA 5BSTA 3S1SA 2CFSA 1IPFA 1PR4A 1EVZA 3SX2A 4ZGWA 2A7XA 3NORA 4MV1A 2B61A 1KH2A 4IH9A 3UUEA 3MOSA 2EJBA 4UU1A 5C8DA 1HYHA 1W2GA 4FHFA 2AQHA 1ZHFA 4UFOA 3CSDA 2GCIA 4LXYA 5BWBA 5DW0A 5B53A 3EZ6A 3FUUA 2EF0A 5T64A 3LX8A 1E7WA 2O06A 3LHKA 1H4VB 1UBHS 3KTFA 3O93A 2X4LA 2V8OA 3L1HA 1BE1A 2YWCA 4MWSA 4NIMA 2XVZA 3AB7A 3KQWA 4M8KA 3TIFA 4CG2A 4PZCA 5BVGA 2CZCA 4KQKA 3RAEC 3R3WA 3ETCA 3AO0B 2XOKD 4H7EA 1QOPB 4I6GA 2CNKA 1BXGB 1QH1B 2WAAA 4ZT3A 1WCWA 2YOFA 2PE5A 2GX6A 3NNNA 3KQKA 4CLRA 3I52A 3FNFA 4MKRA 5AHRA 5DM1A 5AH0A 5JSKA 5MN5A 2WYVA 5L7TA 2NU6B 3EF3A 1EUCB 3JAKB 3NUQA 4BFXA 5HJEA 1BYIA 3RYIB 2OG1A 1KEUA 1QIEA 1NJFA 2FSIA 1KFBB 4C76A 2CDCA 5ICSA 5IH7A 4WADA 3IAFA 2J5QA 4PG7A 2JASA 2YZMA 3P9PA 3BWCA 4HUQB 4BAUA 1Q0QA 1D0SA 2DFNA 2JFUA 3NVKI 1CQZA 2FSSA 2H4YA 1SOVA 2P30A 4DGSA 2CW5A 3I32A 3QVMA 5BP7A 1RABA 2FPIA 2QMZA 4IMJB 3IESA 3MERA 2HL6A 2O8NA 2JLWA 4URUR 4TLLB 4CE6A 2O6LA 3NXSA 2H5JA 1Y8RA 2NWQA 1OSNA 2IYTA 1AKQA 2Q9UA 3HUDA 3WL4A 4K8RB 4O4JF 4HS4A 1JEYB 2FEMA 3MTEA 1PL8A 1QIGA 2DAPA 4NU6A 3EG9B 4BMOB 4TS4A 2OCYC 1JRLA 1GZHB 3KVYA 1FLAA 2DCMA 2GH1A 3TTWA 3HCAA 4I1SA 2UYYA 1DKLA 4TMXA 3TQHA 3AONB 3HDYA 5BQ3A 1KEVA 1L7BA 3FKJA 3S40A 3AGQA 4RFLA 4PFKA 2XUGA 1IZ9A 1JXOA 2AZ4A 2HK6A 3EHDA 5AI5A 3SXUB 1ADFA 2FPGB 4U6NA 3V4OA 1BIFA 4CMCA 1GG5A 1NRXA 4YJDA 3BT7A 1Q6YA 4O4JA 3OZAA 3O2QB 4X6LA 5SY6A 4KQMA 4IJKA 1GZ5A 1ISHA 3P0IA 4BN4A 1OF1A 4LWPA 1RXEA 3LY8A 2X3FA 4AB1A 2JFZA 4O29A 4REQB 3VOTA 4ER3A 4PGFA 3HJUA 4IDQA 3U7HB 2C9YA 5IKMA 2A2ZA 4MQEA 1SXGA 1JLHA 3LI2A 3DXYA 4FONA 1VBFA 4DC0A 5LQCA 2RGGA 5HP4A 3W8NA 5DSZA 3INTA 1ZEJA 2JGJA 3UAXA 5GJVC 1KDVA 2EZTA 2F3PA 3A4NA 2ERYA 3Q87B 4P36A 1G4UR 4B87A 1SQ0A 3S1AB 1PR1A 3R7DA 3FFTA 4ZJYA 3DDWA 3MLBA 1H6CA 1T8UA 3O6VA 4WERA 3RVLA 2Q5LA 4HDAA 5LA6A 5TVGA 4P81A 1SVNA 1YNSA 2GPBA 3V4LA 3A9SA 3EGEA 4I3GA 2IOFA 1E8NA 5KWIA 3C8MA 3DGFC 1AHHA 5EIEA 3AC0A 3G0IA 4G1UC 2AEFA 4LJ5A 3K4PA 3MTAA 3P45A 4YT4A 2WAMA 3JALB 4H18A 2HSEA 5DTIA 2FE1A 2JJ1A 1KYIA 4Q3BA 4RXUA 2LTAA 3M6FA 1HDYA 3ASUA 5JTTA 4A6DA 2CJWB 2CHEA 1L4BA 3M6WA 4CODB 4H15A 2PD3A 4B3JA 1UMKA 5AJUA 3K6SB 4WK0B 3U3DA 1S3SA 5E3JA 5DCUA 4NFSA 5TXGA 1MJFA 4L6CA 4DG8A 3H18A 2WJAA 5A0TA 3SZLA 3KK0A 4GI2A 4UOQA 5SYNA 3KUDA 1GPDG 2BKUA 4R71A 4A1OA 4UPVA 1A4UA 4FOPA 3N0RA 3EISA 4AS2A 2I7DA 1SK8A 4F2DA 4HMPA 1AKYA 1P5ZB 2DWPA 3BKWA 3A6EA 5FWXB 1N8TA 4CNBA 3VKUA 2IPOA 2WR8A 1CEXA 3KZOA 4MW4A 4ENVA 1U3WA 1LD3A 1PUXA 1SKQA 2IHTA 2APJA 1EJBA 2XY4A 3CO5A 3DEHA 3KPJA 3UJAA 5IDVA 4YJHA 1KYYA 4OX9Y 3F3YA 2P90A 1ZSNA 2QTGA 1SB9A 1SIOA 4HJXA 1K5DA 5DKFA 1M6NA 5AYVA 1HRKA 1G8YA 5SZIA 4TTQA 2HYIC 1CUFA 3FTQA 1QK3A 3KHTA 5EIFA 1C8LA 1JHQA 3KM0A 3QXHA 1DOAA 4R54A 3BZWA 5ERYA 3U1BA 1L8XA 4BWYA 3ZD7A 4AXBA 5DX0A 1TQ4A 2ZJ6A 4PFSA 3LPMA 2PN1A 1PZGA 1TYAE 1ENPA 3GT3A 4M49A 3SEFA 2ZAGA 4LCBA 1ZMOA 3C15C 4G0ZA 5F21A 4I4CA 2COUA 1G21B 4GPAA 1CNEA 4P6VF 3PVCA 5I8WA 1HLFA 1XZBA 2OD2A 1QQ5A 3JQ7B 3SYRA 4ARSA 2R1VB 3OIUA 1ZITA 2UYCA 1NA5A 2K7ZA 2NUPA 1Z5NA 5IEJA 1GSOA 3RVPA 1QQ6A 1TKRA 3Q72A 4PY2A 4N03A 3K32A 1KSJA 3PC7A 2BGWA 4W7SA 2I1LA 2IZ5A 3R5TA 3RSSA 4NARA 1E6EA 1MABB 5DN6A 1HE8B 3I23A 1Q6ZA 5JD3A 1PLLA 2I1QA 2HIMA 5TB5A 3ZXSA 3G89A 3BF8A 4DLSA 4F4JA 4A82A 4G5SA 3EEQA 2YV1A 1LQUA 4HATA 1I7PA 1QOQB 4I50A 2XZOA 1L5GB 4ZHQB 4XIIA 1DAMA 2D4AA 2QN6A 4XJTA 1NE2A 1ITZA 3TB4A 2IYVA 3UN1A 2JAXA 1XDUA 3CT6A 4BX8A 1NE7A 1XAIA 5ARDA 3ZGVA 2WFZA 4XWGA 2CSXA 3EW7A 4N39A 5E7MA 9LDBA 3JZMA 4CEHB 4KN9S 1GQOA 2C2YA 1O9GA 4JVSB 2UV8A 4UZEA 3DCNA 1Z83A 1XPJA 4C29A 1M2KA 3F5FA 4G0PA 5HRCA 2B1IA 3MTQA 1N7HA 2VDOB 1RCFA 4BQSA 3RS2A 3AF2A 1RBQA 1L7EA 3WLMA 3MWDA 1U0HC 2CV2A 1DBIA 3JAWB 1RE1A 1WQ3A 4ZYLA 1COZA 1DX4A 1RCUA 2PZ8A 2XRFA 5DB4A 1WMBA 3CLRD 4JGIA 2QRLA 2VS1A 5LD2B 4Y1RB 2FFBA 2C3UA 2JJ1D 3JQAA 3KVRA 4RESA 2GVNA 4WL0A 1SOMA 5DNWA 3ZHQA 3DAFA 1WPRA 4QPZA 2D0IA 1CY7A 1H3FA 3LKZA 4NMXB 3W4IA 4JR0A 3THWA 1PW7A 3RYCB 2YHIA 4DM4A 4KDCA 3HO1A 1BW9A 2YXNA 3IILA 3HL0A 2OO3A 4W8HA 4HZIA 4PXAA 3ANMA 1AQYA 4JK3A 4M21A 1UPCA 5FLEX 3G2KA 4JLWA 3P2KA 3E5RA 3LUJA 1Z28A 1YR9A 6ABPA 1EFPA 4FT2A 1FJGB 2BWJA 4E6PA 1IRXA 5EKXA 1P2DA 3WWYA 4I1VA 1IXSB 4RQAA 5ARCA 2WM2A 4ZZ2A 1KFKB 2C2GA 1ZI8A 5CLLA 4I5GA 1DL5A 2OLKA 4M1OA 3OQVA 4FUTA 4YAIA 5EMLA 1J8FA 1VI6A 4OXRA 5T41A 2QTCA 1NOJA 4INOA 4CEJA 3AHDA 4JLUA 2AOTA 2DPLA 4E5UA 4BIMA 1Q77A 3U3JA 4AN4A 1G2PA 1TM7E 2CLOB 1ICEA 3A2MA 3A9CA 2FOLA 5HZGA 1XZPA 2YFHA 3UMFA 2B36A 3WLOA 4XOUA 4Q4JB 1BQ3A 1Y33E 3IPRA 1AQ6A 2P91A 4QVKA 3E7WA 5ALWA 2HJ9A 4C9BA 2LZ0A 2OM6A 4DSUA 3FKSA 1I4TD 4OAQA 4U7TB 1U4NA 4C7VA 4WEQA 1MB0A 5IAGA 3GLFA 2CV1A 5F78A 5DOVA 4ETWA 1W88B 5JZSA 1XDDA 3V4RA 1HZJA 4OQLA 4GVXA 3SJUA 3EF1A 4RIEA 4WHMA 5TGTA 3CPSA 2ZQ5A 4EO4A 2BM1A 2NV0A 4DDMA 1EM6A 3V8MA 4KKVA 3JXEA 3LBHA 1L5RA 2BONA 4M0LA 5DYIA 3E0QA 3MT0A 1P1BA 2NO0A 3AHCA 4L8FA 4ENSA 2Y1OA 1K8QA 1OU4A 2N1BA 1JKMA 3NFYA 1TMYA 1YOVB 1JMYA 1ZM4A 4YV7A 4I46A 4L8WB 3GPDG 5DTQA 2VK4A 2BKEA 1VOTA 4B3MB 2CUZA 1T8YA 2Z0MA 3IMGA 4RADA 4V39A 3II6X 3TQOA 4PCAA 2WUWE 1CEEA 1XAGA 3M9LA 5KOHA 1QQAA 2J33A 3HKCB 3KLOA 3F78A 1FE8A 1QQTA 4RA6B 5CG1A 5LKRA 2C54A 3AUJB 3LC1O 1RXIA 1ZD2P 3N0WA 4UD6A 5MHTA 3ZOZA 2Q4OA 1VL8A 3KQYA 4WEOA 3IELA 5B3AA 2AKEA 3SJBA 5IT9A 4AQYB 2Y0DA 3CX8A 4KLNA 4G5RA 3QU9A 3UMJA 1JEEA 3MCAA 5EYPA 1CDOA 1ZGBA 1ULZA 4FFSA 1UXHA 4IMIB 1PF7E 3C70A 3DNFA 2H16A 5D1HA 3NBYC 5ECGC 4GRIA 4RGYA 3BMOB 2ZR9A 1E2EA 3PNLA 4NZYA 1KP9A 5AK5A 3HKEA 2JLBA 2JDID 3I9V1 3Q10A 5T8KA 3EVNA 4OQYA 1B3BA 1CDDA 1RQRA 2FSVC 4MGZR 1HBJA 2QSUA 4RC9A 4BO0A 1C8VB 1ZUWA 1VBMA 2GFHA 3W5CA 5NULA 1T1GA 3MCZA 1W59A 4DA4A 3IKLA 4H0NA 4JASB 1S3FA 3ZV6A 3KFXA 3EEIA 1RXWA 4YIKA 3WZ2A 3Q7IA 1F8UA 1M0WA 3ZZ1A 3S1LA 3NANA 2IEZA 3KLPX 5TY0A 3EEOA 4QL3A 2ZSAA 3PCXA 1Z47A 4MMZB 1QH0A 4DEXA 1DCTA 3N1UA 2WZDA 5AVWA 2HZ7A 4RA9A 1VE5A 1RI2A 3DEYX 3JYNA 1MC8A 1MAHA 4ZOBA 3O8OA 3TL2A 5HMMA 1X94A 2AMYA 2AUNA 1ML3A 2ARKA 2P41A 4PPGA 5FQOA 2XUJA 3K8QA 2F8LA 4MQ5A 1CY6A 3ZUGA 3OQIA 4EUEA 3VR3A 4BLOA 2VF7A 3QOFA 5CURA 3T5AA 4EG4A 4YP5A 5KZMB 1ZJ6A 3PP8A 2O8BA 3FKSD 3D64A 3VM6A 5I47A 4Q4LA 1VIDA 1GRQA 1FMTA 1MW9X 4WZZA 4CTNA 1CUJA 2XCOA 2CZQA 2Q6IA 2NIPA 4WNIA 5FJJA 1NUTA 2QX9A 1FYVA 3L4SO 4CRWB 8MHTA 2OUIA 3GIDA 3O8BA 2NMVA 3QVGA 4QUJA 3PVSA 3MHPA 1ND6A 2FUNB 3N53A 4NCBA 2VA8A 5JHGB 2N0SA 1FDIA 3TJZA 5F77A 2BJWA 3DOOA 2QUAA 4PX9A 5B1HA 2C5GA 5EJ5A 3K9LA 3M4JA 4CMBA 5K3OA 3VDRA 5GZ1A 1A9SA 2JZOA 1MN6A 3GRRA 1AN9A 3IE0A 4KQXA 1RU3A 1AS2A 3B53X 4U2BA 3R76A 4ESOA 5BR7A 2IOFK 4F46A 3OQBA 1CERA 2C9OA 2C7GA 2Q41A 3F4LA 2P3OA 1A4RA 4OYLA 4IKEA 1Q91A 4HAOA 5IFKA 1VJGA 2HRCA 3QLUA 1XD8A 1OXXK 2IYZA 3C3KA 3LUDA 2WB2A 1JE1A 3USCS 3OG9A 2XQJA 1JHZA 4FKMA 4RZUA 1NVVQ 4JFRA 3TEFA 5HJ7A 3WGTA 1IXRC 3BUSA 2V3VA 4ZOLA 4FEGA 5LDDC 2J07A 3I1FA 4IDDA 4R83A 1HQYE 3AG5A 1S2MA 3RWOA 2GBLA 2QYHA 1OI2A 3DR3A 3ABZA 2DEUA 1G3MA 1MO2A 1GNRA 4IHJA 4C7OA 3LO5A 2AXPA 4DV1B 2Q1UA 2JFHA 2QD4A 2GKSA 3DVLA 3RYFA 4YCDA 4Z0TA 1VHWA 5I7OA 4DZTA 1KDRA 3GXOA 3BDVA 4KIJA 3TQRA 2I62A 3K7EA 2I7CA 3E53A 3EZGA 1VGVA 1XYGA 4C0BA 1XA3A 4YP1A 2KLBA 2VVTA 1NXTA 1OFIA 1UKVY 1NXWA 2CF5A 2D2IA 4JJIA 5EIBD 1U8XX 2PH7A 1IRIA 1TM3E 4HPJB 3B1JA 4M9QA 2PRYA 3UMRA 4B76A 3L7DA 4GZ5A 1IEXA 1L4HA 4P84A 2CC2A 4XVUA 2FR8A 2LIVA 1H1LA 3PA8A 2XTJA 3SZRA 3ZWDA 1I32A 3PQDA 3F5DA 1VFNA 1S5PA 2J3HA 1E4OA 2Y2VA 4PG8A 1KZ7B 2ZIXB 2C7QA 1XSEA 2YXPX 2GNOA 1FPMA 1KI1A 3CJTA 2WSYB 2CLFB 4LHXA 4QE3A 3IRUA 1C7RA 2HPZA 3BCRA 5IHXA 2CWDA 2ZYTX 5KNCA 3UAVA 4FSDA 2V98A 3SCZA 4CMJA 2GZRA 3WLTA 2VI5A 1WDMA 4OHPA 4KYUA 2C4UA 1G7CA 2GT1A 3ISJA 4D02A 3REQB 1YRYE 1M7HA 2RGUA 3INNA 4G25A 3RRNA 4HUJA 4A10A 3DZIA 1ULBA 2CHFA 4CYMA 1XMOB 3NW9A 3I6ZA 1B74A 1GYQA 3FVVA 3I39X 4Y8VA 1C9MA 1OV6A 3RODA 2W0SA 2DF8A 1O8CA 3GRUA 1RYHA 1TM4E 3KFVA 4WKOA 3U26A 3UMSA 3P19A 4G4GA 4NAHA 2C5EA 3S0JA 1H42A 3T34A 2NSYA 4ZVUA 3IAXA 1JDNA 3T9DA 2BEKA 2ZOSA 3K5HA 4W8OA 2H00A 2JH9A 3BGWA 3D4OA 3DBVO 1FB5A 4GKAA 5A7FA 2VDWA 3ICQB 2Z08A 5CJPA 3ROKA 2DT5A 2ZB8A 4DQUA 3R2JA 3WKEA 4BNTA 1P9LA 1V3VA 5ED0A 2NADA 3AQ4A 3AR8A 3W77A 2O57A 2HXYA 2VXCA 3BWVA 1GRCA 3TTXA 3IP9A 3KZ1E 1M8KA 1TT7A 2ECPA 1T9KA 3FR8A 3OKFA 1QS0A 1NHWA 2X2EA 3HUFA 3MJDA 3GA7A 3SVTA 3KZKA 3IBSA 4PLPA 1FDVA 3LIIA 4Z0NA 1RQNA 5CD1A 4Y6QA 1WDWB 1QWOA 2ZBRA 3EXAA 3ZY5A 4EY8A 3E9CA 4O4HF 2PZJA 4HYYA 2XUHA 1SRRA 3ZHVA 3R5HA 4ZCRA 1GA4A 1QR6A 1W6UA 3OT1A 1T1IA 3ETJA 1IVYA 4RMIA 3P96A 3MMPA 2ZIEA 1XI2A 3L43A 3PNYA 3UYLA 1VKHA 5A3VA 3R3YA 5GM1A 4B6SA 1R5JA 4RH1A 2JCXA 4BU1A 1ZR2A 1NDUA 3SMVA 3TDNA 2WINI 3OM1A 1YMQA 1OFGA 5YASA 3W5JA 1RBYA 3C4QA 2REOA 5ER6A 3KYIB 4O4HA 1Y98A 3T9BA 1DDGA 1PFQA 4Q1EA 1ZUNA 3LBAA 2HW8A 1U0OC 4QDTA 1WZIA 2BELA 4WZAA 1W5AA 5ERGB 1GR0A 3X0DA 3B1WA 3ESDA 4AKSA 2PHZA 2YJ6A 3U0VA 4MK4A 4MVCA 3G5LA 4TZ0A 4G6ZA 3EC2A 4AVYA 2HREA 2WWRA 3VPHA 5LOVA 2DR0A 1QYIA 2NAFA 3ZQ6A 1Q7BA 4MV7A 3DV0B 3ZN2A 1XDGA 4FFVA 4TS9A 3BILA 1RI3A 5EKUA 3T3OA 1YGPA 1JT9A 2P6NA 1OROA 4BO4A 1PDWA 3DZKA 1Z8DA 1XOIA 3MMSA 1I5OA 4XLZA 5COAA 4DVGA 1PUIA 1ZS9A 4DUPA 1DMRA 1VYHA 1OAKA 1XD9A 4YUVA 1E3EA 5BVGB 2XTMA 1KQ3A 2GZMA 1QOZA 2QL7A 1V6CA 3DBLA 1F2DA 3SM9A 3UFBA 2HJSA 3V4FA 5IDQA 2ZEJA 2H08A 3PGJA 5HK8A 2BZ1A 5KS2A 4QM6A 2B30A 3RIXA 4R05A 4IIGA 4CLRB 2PXAA 5KNCD 3C5EA 3TNJA 4MWGA 4B6PA 2XE4A 1GPMA 2VF5X 2QN1A 1CQIA 4I5FA 1UCFA 4WLUA 2C57A 5E9QA 1CDEA 2FP4A 2YWXA 2F7SA 4DWWA 3CPJB 4TTRA 3DAOA 3G7NA 4FJ2A 5TQ0A 2PL9A 5L7YA 1GPJA 1O95A 3CN9A 4KRGA 1IJKA 1H2YA 4I1IA 1X77A 3CLTD 4L72A 3AUTA 2UUCB 4DM7A 4AMVA 2PRKA 4CKEA 2PSFA 4KQHA 2J0SA 1Y9JA 1CUHA 3I53A 3CV3A 1EFUA 1A88A 1ORDA 4JJGA 5FCDA 3SGLA 2P2GA 5TV2A 2F1HA 1CC1S 2CNWA 2DH6A 3A1NA 4LCJA 1NPDA 4PPNA 3DLPX 3OMLA 5DGCA 4BE9A 1IHXA 3Q9LA 4G85A 3N2NA 4X1YB 3VBCA 1GD1O 2JGEA 3D43A 1XEWX 3LY9A 3M49A 2IV3A 4C2AA 5GMOA 1AE1A 5C1BA 1YC5A 2GLUA 1JLKA 2FQ1A 5KOIA 2C82A 4E03A 3TAUA 2WJGA 3TMAA 1JIJA 4EJSA 5BSUA 3IUNA 2ANBA 2OSBA 3HLYA 4PYKA 4RV4A 1XN4A 2QXTA 4ZWNA 5IMBA 3UV6A 2VJKA 3T5PA 4ZV7A 4P31A 3I64A 2E4XA 5GJWC 1YV9A 1KMNA 3RVDA 3UT0A 4JB2A 2SECE 2BY4A 1N6PA 2PWAA 4TWJA 4KACA 1L6IA 2DWCA 3ZJ5A 3G2IA 3O26A 2NO9A 3PZRA 3QBJA 5KNLA 5FNVA 2BEUA 5KJEA 4Q9LA 1G3QA 3UGTA 4D1YA 3ICCA 1UM9B 4O1MA 1POXA 1VSBA 3AJDA 3N8HA 3OC0A 3RG2A 3LP6A 4CCAA 4MQEB 2DULA 1T24A 1UBRS 2VHVA 5ALRA 3OEEA 1ISJA 2X1LA 1AZTA 4E1BA 3VPDA 4AS1A 2VHWA 5AFSA 5EXEA 2JCSA 1JEAA 1MAWA 4MGEA 4BCBA 3EZYA 3WICA 1WMDA 1KOLA 3S2YA 2JRCA 4WY2A 3O94A 1N92A 3TKAA 1PI3A 4IILA 3M2TA 5KHAA 4M60A 5EHNA 4KAXA 2HLNA 5LA6B 1J06A 3IOYA 2EU8A 1N3BA 2XKAA 4N7MA 1PFYA 1OQAA 1V9SA 2RMKA 4MI1A 3ZDAA 1MW8X 5AVSA 2DBRA 2G8LA 3CBGA 3BA1A 4AD8A 1A7AA 3RAFC 1YXMA 4YREA 1E2HA 3WYDA 2CLIB 4Q18A 4X84A 2EDCA 1UBFA 4EZBA 4O02B 4X90A 3IHLA 3DYBA 4YRGA 1I3CA 5EZ5A