1DAIA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
219
Chain Sequence
b'SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAAATGKYINLALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
molecule tags Ligase
source organism Escherichia coli
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
total genus 70
structure length 219
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1daiA00
1HE1C 1SXJA 1XEFA 2PL3A 4RZXA 3DZ8A 2NOAA 4TQ9A 4ABYA 4KU4A 4M1KA 1NLZA 1NJGA 4URWR 4GSYA 2JIZD 1FQJA 4QNMA 1B0UA 2F1RA 2VTKA 1U81A 1Z47A 3UMRA 1Q20A 1LNZA 2WWWA 4MYUA 2JLRA 4ACAA 5AUPB 2R6GA 2AWNA 2HCJB 4Q9HA 4P32A 1HA3A 5E7IA 1XXHA 2ZRDA 2ZRJA 3QG5A 1ONBA 2WSSD 4XJXA 2C04A 2B21A 1UBCA 4PO1A 3GLIA 4IFBA 4ERNA 4QL3A 3GLFE 1J8MF 4HLUC 3B1YA 4NCHA 2VRWA 2WOJA 4MRVA 4G5QA 1C9KA 1W1WA 2RGXA 2ZSAA 3GFTA 4TZ6A 4BFWA 3RANA 3U60B 3CRQA 2HT1A 4LYFA 4ZDJA 5A0FA 2BVNA 3N5CA 4CEHB 2FPMA 3FHOA 3CF6R 2O8BA 2C9OA 2IYLD 4P4TA 1KZGB 4JL5A 1KOFA 1OE0A 1E9SA 3QKRA 1M2OB 2IXEA 3QNUA 2FEMA 1ZNZA 3ADCA 4A36A 4F4JA 1UDXA 3QVVA 4GBMA 5K8UA 4HDCA 1EX7A 2BKUA 4IHQA 1OXVA 1VG8A 4QOSA 4DLSA 3LLMA 4Q19A 3AF4A 3AVPA 5L3RA 1N6PA 1IAQA 5EZ6B 3NH9A 3MWLA 4NHOA 1OF1A 1QHHA 3AKDA 1U9IC 2GRJA 1ZW6A 3W34A 1G20E 2YZ2A 4CIDA 4DDUA 4MH0R 2XNDA 2RGAA 2XZPA 3IQXA 2YOHA 3NBXX 4DRZA 2V7QD 1OFUX 2V4ZA 1KNXA 1OXSC 3RRMA 4QJ3A 4FWTA 2ZSEA 4D26A 4BFYA 2VHTA 1TTTA 3EXAA 2KI5A 1OHHA 3AF1A 3HWSA 1Z07A 1ZU4A 1NSFA 3DKPA 4EFLA 5CITA 2ZANA 1QRAA 3PUZA 2JLWA 3A1UA 1PLKA 1Z22A 3CUEF 4BRWA 2VHQA 1OFIA 2I1QA 4PZYA 1DPFA 4LJ5A 1KKMA 5CLQA 1G5PA 2HCBA 4KI0A 1SKQA 1JR3E 2J7PA 4YC7A 4DDTA 4PQRA 1ZUHA 4LBYA 4LX0A 1KI3A 3GJ0A 3LY5A 3OIUA 5IK2D 4JLVA 3TSWA 4ZCLA 5ELXA 4ZPXA 1GL6A 1E9RA 4ZI2A 1OH7A 2YWFA 1W0KD 1WRBA 4W9MC 1Z6GA 3ASZA 1G8GA 3CZQA 4A4DA 4NYIQ 1D8TA 1KI6B 1LS1A 1LFDB 1FUKA 4URZR 4YMTA 2WJVA 3PITA 2OZEA 4GPTA 4H1VA 1P73A 3SBEA 1SXJB 3P20A 2DPXA 1W4AA 5CK4A 5CYPA 2GBLA 5FI0B 3BH0A 3ZYCA 3RAPR 1WBDA 1TL7C 1AJEA 4B3XA 1DBSA 3A4NA 2FFQA 3BXZA 3DZDA 4QJ5A 3THWB 3NBYC 3I8SA 2XOKA 2JLVA 4YLGA 3OEEA 1YR6A 4JT2A 4LJ9A 2ZJBA 3LFUA 3I32A 1A2BA 1GNRA 3OEHA 2WM9B 3KQUA 4WZBE 1W0JD 2PZGA 3P26A 4P4SB 3FMIA 5FBRB 4LJAA 2YVUA 4HAWA 3TUIC 4HEJA 2N46A 1J70A 2D62A 2N42A 2YWHA 5EZ5A 2A78A 4Q7JB 3KXKA 1T6NA 2VP4A 2Q9AA 5TB5A 4CGZA 3L43A 1HUQA 5AJWA 2FSHA 1JXMA 4ZCIA 4TZ0A 1MRNA 3LV8A 2QNRA 4BLOA 1EK0A 5B58C 4D4JA 2AHOA 2IUTA 3LVQE 2HV8A 2V6IA 3OEED 2C5LA 2P65A 3W6PA 2ZRKA 3F5FA 3M0EA 3MWKA 1LY1A 1MH1A 2F6RA 4M2LA 3QVUA 1F48A 4TSFA 4XOIA 1ZU5A 4GNKA 1AKYA 1YHNA 5KNCA 2OM2A 5BQ5A 1TAGA 4TYPA 1T5LA 3LDAA 4Y0AA 5FTJA 3GLIB 3T15A 2A5DA 3QSYA 2BBTA 2XSZD 3KFVA 2W6ID 4KHZA 4PR0A 1N6IA 1H8HA 3QXSA 1E2IA 1G3QA 3VQTA 1E9DA 4WIAA 2REBA 2WIAA 4KVAA 1W46A 3C7KA 4NYIR 3X1YA 5L8VA 4CEJB 1XEWY 1FL9A 2F1IA 2J41A 2OO7A 2J46A 3BGWA 4Q47A 2WKRA 2J0UA 4IXNA 2RB4A 3EPHA 4OHVA 5BN4A 1P62B 1TPZA 3AF2A 1D2NA 3GMTA 3RSOA 1DEKA 1AGRA 3AP3A 5HZKA 2IYTA 1ZC3A 2GHIA 4ITRC 2E1RA 2Z43A 3FPAA 1O87A 1FP6A 2F3TA 4RZUA 3SYKA 3TBKA 4ZIRB 4G5SA 3L8YA 4POAA 4JVMA 2GAOA 4QFMA 4LJ4A 4TYQA 3WNCA 3EX7C 4BZQA 5BWMA 3X1DA 3X1WA 5KO2A 4UJ3A 4TL8A 2ORWA 1EFUA 1AS3A 2OBLA 3WYGA 2J1LA 4TTQA 4B74A 4W5JA 5ANRB 4BZPA 2ZRLA 4DLYA 3OEHD 4PHTA 1QHIA 2Q9BA 1ZYUA 1OXUA 3EWSA 4MITA 5L3QA 3BB3A 1EG7A 3PUWA 2ZRIA 3CX8A 1G4AE 4Q4HA 1Y3AA 3RHFA 2JJ1A 4EFMA 2CDNA 2YOGA 1RRCA 4FMCF 3KXIA 4PSAA 4OHZA 4LGMA 4GFDA 2CCKA 1NLFA 2WPDA 5FPKA 1E1RD 3BFXA 3B9PA 2MSEB 1DAIA 3OE7D 1D2MA 5HPYB 1E94E 1G7RA 4R2IA 3TAHA 1XF9A 3KFXA 3U44B 2FV8A 2OFOA 4B44A 1I4LD 3M4YA 3FHTA 2P5SA 3E1SA 1HE8B 3OAAA 1UF9A 2NMVA 2WKPA 2IXFA 2QAGC 1TMKA 2JJ2A 1TU4A 4Q7LA 3LD9A 4D0GA 5KSOA 3L8ZA 2UKDA 1JJ7A 2EWWA 1U90A 2NG1A 2JASA 1N6RA 4RJLA 5LD2B 1RE0A 1MKYA 2CL7X 1XZQA 1XD2B 2RGNC 1CEEA 3TSOA 3W5JA 3GLIE 3PEWA 1Z83A 3TQFA 3AH8A 4LRWA 1SQ5A 4QNRA 3VAAA 1IN5A 2X77A 1E2PA 2NGRA 1SVWA 2IK8A 1FZQA 4LC1A 3OF5A 4EPYA 3ZD6A 1YR7A 1OYYA 4JVLA 2QU8A 2R6DA 4XTCS 2WWIA 1TQ4A 2V55B 3R9WA 4V0KA 4KAXA 1T3HA 2OCYC 3AP1A 4V03A 3W8RA 2PZEA 1KI4A 1OIXA 2A30A 3H2YA 5JSZB 2WJYA 4BQSA 3ZVNA 2ZI6A 5JWRA 1VG9B 1ZM3A 4K81B 4C9BA 1XTQA 3IUYA 3HJNA 4NMMA 4F38A 1YZQA 2WJIA 4RVCA 1G5RA 1G3RA 4TMKA 4Q00A 1X1SA 3B85A 1P72A 3EZ9A 4AG5A 2ATVA 4B6EA 1Q1BA 4K8OA 4YMWA 4IOJA 4Z8YA 2WBLC 2ZYWX 1QHXA 4G5RA 2AXNA 1G6OA 3GJXC 3LW8A 1W36B 3TQCA 2FDCA 2ANBA 3MWYW 2CK3A 4JBXA 4LYJA 4U7DA 3QXHA 4AK9A 2QA5A 1R8SA 2OXRA 2GJKA 1QHSA 1LB1B 2FOLA 1QBKC 2CJWB 4Q03A 3SC3A 3DO6A 4G5OA 1P2SA 5K8LA 1XPOA 1FNNA 2HEIA 2WKQA 4DWJA 4UNNA 3FDIA 1E96A 2NO1A 3B13B 4JLNA 5DI9A 3R20A 2WSMA 3NDPA 2XGJA 1TQDA 4C0SA 3UG6A 5FBLB 4IFEA 3LVRE 2R2AA 1XTSA 1BYUA 4I81A 3A4LA 2QI9C 4LYHA 4TTRA 3FKSA 5B57C 3Q5EA 4IVQA 4HUQB 3B1WA 1G1MA 2PBRA 3F8TA 1CBUA 4IDQA 2RGCA 4M22A 3MWJA 5J47A 1VCMA 1US8B 3MLEA 4S2EA 1AK2A 1KGDA 2GAAA 1YZLA 1CXZA 2IA5A 1OT3A 4JLBA 4R7ZA 2H8KA 2FJUA 3LBHA 3SE0A 1SVLA 2QPOA 1CR1A 3A1VA 3QF4A 4MGYR 2KJQA 4KSCA 4LHXA 3RS2A 5EE3A 2DWQA 3ZS8A 3THXB 4Q5IA 4QGHA 2CHGA 3TH5A 2XXAB 3VKWA 4US1R 4OQLA 3SFZA 2HYIC 4Q4AB 4IDNA 1ZC4A 1Z0AA 2X8AA 5FFMA 5LB4A 1E79A 2AD1A 4M0LA 3N2IA 2VIIA 1LF0A 5EE0A 3AVVA 1CU1A 4DLVA 3Q72A 4LSGA 3PQCA 1U0HC 4PC7A 4A2QA 3W6NA 2FN4A 1Q0UA 3K09C 2ZRHA 2BV3A 3H1TA 1Z06A 3ICQB 2FMXA 1RYHA 2CNWA 2L0XA 2W0MA 1S9DA 4EPXA 3I3SR 3ZZUA 2FF7A 4HLUA 3MG9A 4HUTA 2CE7A 4V0MA 1Q44A 3DVLA 2J0QA 1XB2A 4KLZA 2BHRA 2ZVPX 1GVNB 4NU0A 1P9RA 3T1VA 2GJSA 2HDNB 3EWAA 3EA5A 1XWIA 1KNQA 2BIFA 1L4UA 3VFDA 1KAOA 1Q3TA 2HF9A 3K0CA 1FTSA 4JBYA 4DDVA 3VMFA 3K0EA 3BB1A 4B3BA 3NH6A 2IYQA 5KPJA 3CPEA 4C2TA 1R0XA 1YZNA 1Z2CA 4KCGA 3GEEA 1MRSA 1T5IA 4RD6A 3RS7A 4PO9A 2C8VA 4C0BA 2GDJA 2V8OA 4UXHA 1E9EA 1MO3A 4AYWA 1C1YA 4NCJA 5DH9A 2J7PD 2PMKA 3TVDA 2DHRA 4C7OA 1GRNA 1IM2A 3OESA 1B23P 1ZM2A 2AR7A 3K53A 1A82A 4LJ6A 3ADKA 5FTNA 3A36A 1UKVY 3IEVA 2PJZA 2CLSA 1R8QA 2C78A 2G9NA 3BFKA 4PPQA 1OW3B 3MAAC 3KXLA 4CEIB 2ZUDA 2F7SA 2FNAA 1KZ7B 2OFWA 4DCNA 4OI0A 4U00A 4ASUD 1X3SA 4WBSA 5KYKA 1CRQA 3U44A 3RC8A 4ASUA 2YC2C 5F9FA 3PVSA 3T12A 1Y63A 3AVYA 5DI3B 2CE2X 4RFSB 2V7QA 3PR1A 3U3RA 4HATA 2IT1A 2QM7A 1GL9B 1SVOA 1G8HA 5JEEA 1TF5A 2AD5A 2WMOB 4TMWA 5G40A 4YQFA 2BMDA 1T0HB 3WYFA 4RD0A 5G3YA 4GDFA 1UBFA 4JIMA 5JCZA 1YR9A 4NONA 3HU2A 3SI7A 5M04A 4OYHA 4C0HA 5FL3A 2R6CA 1UBGA 1MO6A 3BH7A 2R65A 2NPFA 4JLDA 3ZIAA 4BUJA 3VKHA 2FFBA 2C9CA 4DB2A 1COWA 4L16A 1QVRA 4LPSA 3NTUA 2ZRMA 3H0KA 5F9HA 4PC6A 1M7GA 4LUCA 1G7TA 2AL7A 1Q21A 1DAHA 1S9HA 2WJJA 5JSZA 1HQYE 2JGNA 1NVWQ 3FVQA 4CF7A 3REGA 1XEWX 2F3RA 2RCNA 1ZAKA 2QMEA 2O0KA 1YKSA 3KDSE 3PCRB 1ZBDA 1IBRA 1XCMA 1JPNA 2WICA 4IW3B 1HEIA 1MV5A 3B6EA 5CK5A 2W6JA 5FL7D 2GXSA 1PVOA 3MJHA 4KO8A 2N1BA 1U8AA 3V4FA 3LBIA 5P21A 1VG0B 3SBDA 1TUIA 4DUGD 4JLJA 5KU1A 4JLAA 4C2UA 1RJ9A 1UFQA 1VG1A 2OAQ1 2XNSA 5SZIA 2JLUA 3B60A 3CNLA 3TVTA 1TX4B 3WHLA 3GJ6A 1VKJA 1BMFA 2R8RA 4IXMA 4TQAA 1WB9A 3QKTA 4ZCMA 1W0JA 2R6AA 5EXXA 4B3CA 3M6AA 1KK2A 3AKEA 1DELA 1RW4A 2JCSA 3EIHA 1G18A 3U6BA 1XPUA 3IHWA 3LH5A 2DYKA 1XEXB 2ZI7A 5TDHA 2EFCB 2Z5FA 2VSOA 3X2SA 5SZHB 3VR3A 1QVAA 5DLQC 1IY0A 1CKEA 1QHNA 3CRVA 1R0ZA 5G53C 2VF7A 2WHXA 1R0YA 2R9VA 3CRW1 4JVNA 1N2CE 4QBFA 4TYNA 4P3YA 1D6JA 4L5BA 5AUOB 2BC9A 1TEXA 4MRPA 3QPUA 3DKVA 2ZI4A 2FGJA 3TLXA 4GT1A 1II8B 3IDQA 3ASYA 1DADA 1TEVA 2P3SA 1OH6A 3AF3A 1KSGA 4CRWB 4V0NA 1H8ED 1P4SA 3QQ5A 1H8HD 1S0UA 1A5TA 2E87A 2QZ4A 2H18A 1SXJC 2ODNA 3SYLA 3THWA 4V02A 4KV9A 1DARA 2I1VB 1Z0JA 1SGWA 3T1QA 4IKEA 3U4QB 5JHHB 1OIWA 1DO2A 3KKQA 4EIWA 1G9XA 4FMBB 4L8GA 2O5VA 4PSKA 1X86B 1GKIA 5KOYA 3OFNA 1ZD9A 4HAUA 4LPKA 5HZHA 4PX9A 3FOZA 2YV5A 1GSIA 3TE6A 3W90A 1ZM9A 2FSFA 4XVRA 5EUQB 3U7GA 1KI6A 3RS5A 4Z1MA 1VCNA 5JHGB 1X8JA 2CLCX 1SHZA 1YZKA 2IUSA 4M4SA 3TAUA 5IHPA 4MDEA 1NJFA 2JDID 4D4LA 2FPKA 4LBWA 3LQQA 3Q5DA 3VU9A 3U4QA 3K9GA 3H86A 4A8JC 4US0R 4LYAA 2OE2A 1W4CA 4CT4B 1XZPA 1Z28A 4A15A 1KK1A 4A8JA 4NPHA 4AC9A 2QTFA 3CLVA 4Y0VA 1M6NA 4D82A 4TMVA 4R2HA 1Z3IX 1TUEA 1E2MA 2BJVA 2OSBA 1HH4A 2HLDA 3EG5A 4I4LA 2ANCA 2HLDD 3D8BA 2ZETA 1YE8A 1VYUA 2ODBA 3DOEA 3F0TA 1XEXA 4TLAA 4FMCB 4MDFA 2BMFA 4JS0A 2JJ2D 1ZINA 3M1IA 4F92B 4DLWA 3IGFA 1ZUNB 1RZ3A 3CR8A 3QXCA 1LTQA 1XJCA 1JALA 4D0LB 3B82A 1S1CA 3QPVA 4BLQA 2W2TA 3OE7A 3TRFA 2AK3A 4O2RA 4NH0A 4C0KA 3AM1A 2QT1A 5C2JB 1IXRC 4MA4A 1DAMA 2F9LA 4RFSA 4M1WA 1FMJA 4TLBA 3KQNA 3WMEA 1KI2A 1NVUQ 2NZJA 1IXSB 2ZR0A 4GMDA 3MSXA 1FNMA 3ZDQA 4E07A 3W5IA 2D7DA 3FMFA 4RD4A 2GETA 3BWDD 4QBHA 1QG2A 3CIOA 1XCPA 2D2EA 4E5UA 4AKGA 1LVGA 2NIPA 2WAXA 4OJKA 2O0HA 4XTRA 5AJZA 5KSPA 3W8NA 3WY9A 4Z51A 2GESA 4BPBA 3DOFA 1J7KA 1A1VA 2QMOA 4J0QA 1Z29A 2DFNA 2XZOA 1YJ5A 2ZI3A 3K0FB 1GITA 4H9GA 5JBQA 3CWQA 2A9KA 4JJZA 5DYIA 2GK7A 2PX3A 1IN8A 1KK0A 1PLLA 3P27A 2ZJZA 2IS2A 4A82A 3IIJA 1XD8A 3RWMB 3W6OA 2PH1A 5FBQB 5CIQA 4BEJA 3EARA 1OH8A 4XD7A 1KDRA 2PCLA 3ND9A 1EWQA 3FHCB 2CK3D 1FW6A 3I92A 3VNUA 2J0UB 5AUQA 5BYJA 3WRYC 4KFSA 3CX6A 5TMPA 2R62A 1N5KA 2RHDA 3BB4A 1II0A 3B8HA 3K9LA 2A5FA 3DMDA 3V9PA 4E09A 4LOAA 5FOTA 2X19A 5FR2A 3CPJB 2QP4A 1QHGA 3OIWA 4GOXA 3G0HA 2LWIA 5BN3A 1IY1A 4ZIRA 2IUUA 1ZRHA 3L0PA 1NBME 3KB2A 2OLJA 4NDZA 2Q3FA 1VHLA 2PEYA 4TL6A 4DKXA 2GTPA 4XWAA 4II7A 1Z8FA 3WMGA 3TW8B 3U3JA 1R0WA 4N0DA 3MD0A 4QGAA 2JAQA 4N1AA 4NCKA 4Q18A 3CBQA 1G8PA 3TGPA 5DHAA 3U3MA 1T3SA 2BMEA 3NC1C 1RKBA 2MMCA 1RRGA 5JJLA 4Q48A 3SOPA 1BO6A 3VKGA 1TF2A 2FZ4A 4FMDB 3SNHA 4MRRA 3QF7A 1N6NA 1XMJA 4FINA 4JL6A 2O8FA 3HPRA 1NN0A 1U0LA 2QT0A 3LQRA 4L15A 2ZJAA 4WXRA 5A5GA 2VF8A 4JSTA 2FSGA 2YWGA 2GILA 4Q4LA 1NY6A 4DDWA 5GVRA 2IF0A 2ZROA 5CJ2A 1E79D 1I2MA 4LZZA 3WNBA 5GADl 1AZSC 2CCJA 3P32A 5KNDA 4TYYA 1SVKA 2VO1A 6Q21A 4UJ5A 3K0SA 4AURA 1E9BA 4C30A 4EJSC 1TF7A 1N6HA 2ZYUX 3EZFA 3LLUA 4DJTA 2IYZA 2IXGA 1G8FA 3P4XA 1ZD1A 2ECKA 3W3AA 1AM4D 1JAIA 4DSTA 5TV2A 2BWJA 2ERYA 4E22A 4F4CA 1MO5A 1GOTA 5C4GB 3UWKA 3PEYA 1P7CA 1YU9A 2A3RA 2BOVA 2W6JD 1UKEA 2RGDA 2YJTD 2VP0A 5IRCD 1UAAA 2BBOA 3C16C 4QBIA 2ERXA 2LCFA 2QAJA 1KJZA 2NPIA 1YZTA 4M9QA 4Q4JB 3VX3A 4NL4H 1UJ2A 5F98A 5KPDA 1O3YA 4HDOB 3KKPA 2QUZA 1G6HA 4RKFA 5HCNA 2ZU0C 2O8CA 2G6BA 3KZ1E 3VU9B 3SN6A 3RYTC 5AR1A 1VHTA 2VPPA 1G4UR 2IBMA 4V0OA 4QHYA 1W36C 1XJQA 4B3FX 3WNDA 4ZDKA 1CR4A 4QKQA 4A92A 4JBWA 4TLEA 4GP6A 2VP2A 2AFIE 1NKSA 3LXRA 3IO3A 3RRZA 4RCYA 1BKDR 3RSLA 5AUNB 1E9CA 3AUXA 1UADA 1KDOA 3B1XA 5LB2A 1EGAA 4OHWA 1W49A 3D3QA 3K09A 3CNNA 5FOVA 3U7HB 2P67A 1GRQA 3BJIC 2ZAOA 1US8A 4XIGS 5FBVB 1D9XA 2DCUA 3L82B 2A5JA 5LBIA 1JQJC 4LV8B 3I4LA 1OIVA 121PA 2B7CA 2DY1A 3KX2A 1P61B 2D2FA 3VHXA 1F3OA 4DIDA 3FB4A 3D6TB 1HQCA 3GCGA 4TWZA 2XJ4A 5JLJA 3NIBA 3OZXA 1L7VC 1OXXK 2YHSA 2WJGA 2GEVA 3O8CA 3NDBB 4PO8A 2MSCB 4V0LA 1PZNA 2ZYVX 1E4YA 2FFAA 3QKUA 4ON9A 2FE4A 3KUDA 4DC9A 1UDWA 3AP2A 2QTHA 2ZEJA 2GVDC 1NMYA 1NLYA 4C0JA 5KSZA 4PPFA 1FOEB 1X1RA 3QE0A 1XPRA 1X8LA 3DM5A 4TT3A 4AD8A 3ZGXA 5L3QB 2GVZC 1LS6A 1QDEA 2VP9A 3JZMA 2QGZA 1ZCBA 1OYWA 2B8TA 3Q85A 1KSJA 3SR0A 2D3WA 2OEPA 1IY2A 1W48A 2P6NA 3LXXA 1CR0A 2QPTA 5SZKB 2ZJ2A 3O8DA 4LBZA 2V54A 1WQ1R 2O8DA 3DEFA 3SEAA 2EFDB 4B2IA 1KJYA 1NRJB 3QEOA 2Q21A 1Z6AA 4AG6A 2RKOA 2RAPA 5GJBA 1N25A 1EXMA 3CF0A 3K0AB 1PLJA 3UMFA 2IS1A 1EESA 1XTJA 1SULA 4V0ME 5E95A 1RIFA 3H84A 1UEIA 1DAFA 3MCAA 3G5UA 4I1SA 3SQXA 2OBMA 3OIYA 3I8XA 4PHFA 1F2UA 1ZNXA 2RHMA 4A9AA 1ETUA 721PA 3AUYA 4BECA 2GCNA 3IQWA 1F6BA 2AKYA 3RDPA 3GEHA 2KB0A 3MGCA 3T1OA 5L3SA 4WAUA 5CJPA 4S35A 8OHMA 5FUYA 1KY3A 5K8TA 3NBZC 2Q6TA 3FFAA 4D80A 2WWXA 5HTKA 5EE9A 4WA7A 4JVSB 1KK3A 1BYIA 4IEIA 1GKUB 3B1ZA 2OCAA 4KYUA 2DWPA 3QUSA 4BLPA 5BYKA 1NIPA 3C4JA 2CVFA 4DVGA 5K8IA 2XITA 4OHXA 4B33A 1ZVQA 2CMKA 3KJIA 1WCV1 2EQBA 1OSNA 1JR3D 4G01B 3HYTA 1CTQA 5HE8A 4F7WA 1LF5A 1ODFA 4DEXA 1KI9A 2XTMA 2VA8A 3DHWC 2EWVA 3VR2A 2QMUA 1KMHB 1E2HA 1SVSA 4F4IA 1R4AA 4YMUA 3BOSA 4Z8XA 3EASA 1W0KA 3LRPA 5F3WB 1J90A 3SJBA 2ZJ5A 4UNRA 4FCTA 1QHHB 1NVVQ 1J99A 3GEIA 2ZI5A 2VH5R 5FPTA 2ZTSA 3EZ2A 3FYHA 3LW7A 4Q02A 5F2EA 3NVAA 2ZUCA 3TIFA 2Z4SA 2JDIA 1FFHA 1N6LA 2UZIR 3JVUA 4GZLA 3UATA 1COWD 3I72A 4IEEA 4LJ7A 4QGGA 2QSYA 1Q1ZA 4Q9LA 2XTZA 1UPTA 3T35A 5J4YA 2XOKD 1W7AA 2ZI9A 4OI1A 2ZE5A 4L9SA 2JLZA 4IOMA 3QBVA 4QBGB 5KDDA 5B2ZA 1E9AA 1I4TD 4DIEA 4KITB 3ZS9A 2FA9A 4XVUA 5DGXA 1GAJA 2FU5C 1E2JA 2AWOA 3K0AA 2BBWA 2ZSDA 3PXGA 1D9ZA 1GUAA 4W5HA 1EFTA 1Q1EA 3B1VA 2GCOA 421PA 1JAHA 2A2ZA 1F2UB 4JT4A 2C98A 3FMOB 4JL8A 1E2FA 2NQ2C 3QKSA 1Q12A 1JEEA 1VPLA 3K0FA 3SZRA 1H65A 3CH4B 4LDJA 4MUAA 4XVQA 3ZD7A 3QI2A 4RZ2A 4TSFD 1DS6A 3NHAA 1Z0DA 2QP3A 4A2WA 1AKEA 3GPLA 3R9IA 1N3BA 3B9QA 3UIEA 1KIMA 1OXTA 2WV9A 1YZGA 2KBEA 3B5JA 1ZJ6A 2FX3A 1KAGA 1AGPA 2H7VA 1E2NA 2VSFA 1P60A 3BE4A 5FTMA 1HV8A 4G0NA 3CM0A 4C7OB 1E3MA 3I5XA 1FX0A 5CDFE 2GNOA 2ZQ5A 1U8ZA 4B71A 2H16A 3RNLA 4DSNA 3UPUA 4L4UA 1JJVA 3PEVA 4IRUB 4KLNA 4B76A 2J0VA 4EPWA 4GMXA 3EC1A 3GJ8A 1ZP6A 1PUJA 3VR4A 2CEAA 1N6KA 2QENA 4LY6A 4AKHA 4FMDF 1CJVC 3IIMA 3TMKA 2V1XA 1BIFA 1E2EA 1JQLB 1T9HA 4ILEA 2QBYA 4KXFB 5GVSA 1FTNA 2ZRNA 5LPNA 1U94A 1XX6A 3QXJA 2WWGA 4PC2A 2ZREA 4RZ3A 2QMHA 2XX3A 3KB1A 1S8FA 4HLQB 3PIRA 1QHYA 4NKRA 1WXQA 4LHZA 1SZPA 4LK2A 3A37A 5DE3A 4EPRA 1D5CA 1NY5A 1G291 3BORA 2IYXA 3HP1A 4DBLC 2CJWA 4JKIA 2JLYA 4UKDA 3EC2A 2QBYB 3NBFA 4GI7A 1U99A 4N0EA 4IJMA 4PZZA 4Q1FA 2F55A 4ZKEA 5J5CA 1K5GA 1XMSA 1EX6A 1Q1QA 4NYMR 5BN5A 3A1TA 4TMXA 1EFHA 1CS4C 5B64A 1JXOA 2RH5A 1C4OA 2QQ0A 4BWYA 3WP0A 1G3UA 2O8DB 4IOKA 4X8LA 1JEDA 3PFIA 1N0VC 1E0SA 1ELOA 2VHJA 2HJVA 2G1KA 1KDPA 1NKTA 1XTIA 5LDDC 1JECA 1M7BA 4JSYA 5JMTA 4NE2A 1QG4A 1KSHA 2QP9X 2O0JA 1KI7A 3GLHE 1SKYE 5DISB 3QG1A 4A0RA 3TW4A 3U2QA 4TL7A 4YDHB 3EPJA 4HZUB 5KDOA 3SHWA 3VR1A 3GFPA 3T5DA 1OKKA 4HB3A 1GNPA 4D4MA 2ZRFA 2FWRA 3GD7A 2DBYA 5L3SB 4BFXA 2VQSA 1D2EA 1FX0B 2D7CA 1XD9A 2HUPA 3MJRA 4B2LA 2GKSA 3QIAA 4TQUS 1A7JA 4OQXA 1Z6YA 5JRJA 5A4JA 5EUMA 3NG1A 3LA6A 3Q8XB 2IHYA 3FE2A 3I1FA 3QF4B 4KSBA 4PSVA 4EFNA 1Z63A 3EZ7A 3PENA 3IO5A 5H1YA 2D06A 3LAWA 4AIIA 2IEZA 5FOUA 4BFTA 2OILA 1E2GA 1ZD8A 2WOOA 3O8BA 3CZPA 5DO9A 4B35A 3HU1A 3NKVA 3RLFA 4FWIB 2G3YA 1KY2A 2HJGA 3GP8A 3QKRB 3ZLJA 1N0WA 2UZ3A 2WMNB 3RC3A 5FH9A 5JS8A 2BDTA 1M8PA 1N5IA 1VIAA 4D0NA 3CRMA 3JVVA 2OCPA 5B30A 2P6UA 3K9HA 5KUTA 4HLCA 2ZJYA 4MKHA 1IOZA 1CP2A 1R5BA 1KI8A 2AXPA 3QXXA 2G0NA 1E1QD 2KBFA 4US2R 1GILA 1U98A 1NNEA 4XWKA 3UKDA 3LX8A 2XEXA 4IDOA 3GLHA 2LKCA 4LV5B 2Z0MA 4X8MA 4BFVA 3U7FB 1K8RA 2J45A 5EP1A 4AKIA 4B47A 2J87A 3C15C 3DL0A 4B48A 2ZE8A 5FI1B 1DAGA 4DZZA 1IXZA 2CBZA 3FWYA 3AQ4A 1VTKA 1XRJA 3Q7QA 2P5TB 2CL6X 2VSXA 1PJRA 1S2MA 1XMVA 4FXPA 2ZIAA 4JZKA 5FTKA 4DCSA 4YXWD 5CYOA 1G7CA 3ZJYA 2YC4C 4ZKDA 1G41A 2X2EA 1S1MA 3FMPB 2ZR9A 2BCGY 1Q22A 3CF2A 4UNQA 1T8TA 2OXCA 3K0CC 3THOA 1W5SA 3WBKA 3VNVA 1SXJD 5E3HA 4GRAA 2W00A 4C0QC 3RRYA 2J59A 4BRUA 2V9PA 1W47A 2Q3HA 2AK2A 4TMZA 1OFTA 5CDFA 2BJWA 1IONA 3IPXA 3IILA 3GLHB 2JLQA 4G3XA 1SKYB 2EFHB 4G1UC 2FH5B 2AKAB 4YXWA 4D25A 2WWYA 4F93B 2ZRAA 1LW7A 4ZO4A 1XFAA 4R71A 2E9SA 1KMHA 1GL7A 1T91A 3AB3A 3EW9A 4OJQA 1WBBA 4PANA 5E7MA 4AYXA 5CM8B 3VR6A 1FP7A 3SQWA 1W4BA 4D6PA 4BLSA 621PA 2G0TA 2XB4A 3RWOA 3REFA 2B6HA 2K5UA 5UKDA 3ONWA 1E0AA 4GZMA 2NTYC 2BEJA 1JPJA 3S1AB 1EWRA 4DUGA 4O3MA 4M1TA 2ZE6A 2G88A 4FI3C 4NZYA 4PXAA 5FUXA 4EJSB 3QKSB 5EXPA 1UM8A 5JZVA 3R7WB 4QM6A 4PPGA 3WMFA 3V4RA 1DOAA 4PAOA 2VP6A 4MGKR 4D4KA 2FZLA 2ZJ8A 1OH5A 3C5HA 2ZRGA 1CLUA 1NF3A 4NYJQ 4Q21A 4TT3D 4KJZA 4OHYA 2XB2A 3DM9B 4X8HA 2EFGA 4KFTA 1OHHD 4DB4A 3KJGA 2BM1A 2CL0X 1V43A 3KJHA 2QE7D 4M9SA 1G19A 4P31A 1MABB 4CW7A 1KO1A 4ARZA 3QBTA 3CW2A 1XP8A 4BEBA 3P4YA 1P2VA 1J8YF 2A7QA 3OHMA 4PFSA 2WWHA 1XMIA 1SXJE 3K70D 2RGNA 1VCOA 4O25A 4DCVA 4H1UA 4RSGA 3KKMA 5J40A 2F1JA 3EA0A 5IK2A 4HZUA 4OI4A 2Q9CA 3E5HA 5DI3A 1M74A 5FBWB 1II9A 2OHFA 4I1OA 4Q66C 3HR8A 5BXQC 1CF4A 4DCUA 3PEUA 4E03A 2PLRA 4FW9A 2QRNA 4UNPA 5FR1A 3E70C 4PHHA 3HR7A 1M34E 1QZXA 2IS4A 2WVJA 2YYZA 2AX4A 1AS2A 4JYBA 1H8EA 4DLRA 4URVR 1ZIPA 1HY3A 1NN3A 3THXA 2J7KA 3QENA 2ZS7A 4IDPA 5FOSA 5DIFA 4PQFA 2O8FB 1Z6XA 4P4UA 2NZ8A 4DXAA 4GL2A 4IVRA 4YONB 1JB1A 2ZXUA 5JEDA 1RRFA 3U3KA 2W0SA 1N6OA 2D4HA 2F43A 2IF2A 4GOKA 4HZIA 4NYJR 4PC1A 3OFND 3VTKA 5JJIA 1FMLA 4MYCA 1LV7A 1GP2A 2XTNA 4P4SA 4O0MA 4LV6A 3PJRA 3MFYA 2NO0A 4RY2A 5TARA 3WP1B 5CB8A 1ESNA 2JJ1D 1ZM7A 3UK6A 2PT7A 4OK6A 2O8EA 3Q9LA 1G3IA 4DHEA 5CB6A 2AFHE 2V3CC 3AVOA 3CONA 3ND8A 1EFRA 4QHSA 1G5TA 2CHVA 3KTAA 2G83A 4LCBA 3U3OA 3X1XA 5GJVC 1GTVA 3S1AA 4QHTA 1E0KA 2DWOA 2Z6VA 4W7SA 5C4MA 5FUWA 3QPWA 1AQYA 2WIBA 2C77A 2ZYTX 3FGNA 4Q7KA 4MYHA 1W5TA 4BGDA 4A1FA 5G41A 4FCVA 3W9YA 1ZIOA 2OESA 3AGQA 2ODWA 1NIJA 2PMDA 4HB2A 5FL7A 3AGPA 3CRRA 1XDBA 4Z54A 1EFRD 3N2EA 2GZHA 1KMQA 1AN0A 2VBCA 1TU3A 4KODA 3U7EB 1AZTA 5JI2E 3IHLA 4I1UA 2GF9A 3THYB 3BFVA 1Z0FA 4QC2A 5HKKA 1RYFA 3VHLB 3KQLA 5J4KA 5DN6D 2YWEA 2GF0A 3C41J 1CULC 1GKYA 4WZ6A 2V6JA 4RD1A 1GG2A 3I62A 4QRHA 2WWFA 2XAUA 4D81A 3C5CA 5D3MB 4M8NE 3U5ZB 3ADDA 2ZSFA 5IT5A 5C1BA 2J5XA 1SVMA 1ZNYA 1N5JA 4MKFA 4PAMA 1YRBA 2DFKB 3A58B 2FG5A 3VX4A 4HAZA 2VEDA 4DT1A 2GCOB 1S3GA 5DN6A 2ZJOA 4RCZA 1YR8A 2EW1A 4M21A 4KFRA 1KHTA 2EYUA 1QF9A 4TMTA 2W2VA 1VCIA 3A4MA 3GFOA 5SZJA 2P0EA 3R8CA 1G7SA 4DLXA 4EJSA 2CCGA 2OT3B 1T8UA 4QGFA 2BMJA 3WRXC 5DYGA 1NG1A 2GXAA 3HPQA 1TADA 1NG9A 2X1VA 2CHQA 3HU3A 4AYTA 1XXHB 1N5LA 3BC1A 4BFUA 4JMPA 1CIPA 3TUJC 1MR3F 5J4VA 2OG2A 1F5NA 3GLFA 1E0JA 3ADBA 2WZQA 4A8JB 3IKJA 4GP7A 4IOLA 3IPYA 5IF9A 2ZR7A 4PHGA 1AS0A 4MYTA 2GXUA 4YMVA 1YQTA 4ESVA 3N70A 1VIYA 2JA1A 3CPHA 2VP5A 3PUXA 4DCTA 3DMNA 2C9YA 1YZUA 4O2LA 2Z83A 3ZVMA 1RPZA 1CJKC 2A5YB 4GOJA 4RFVA 1R10A 4Z1MD 3K8YA 4P33A 3ZVLA 5JRZA 4A2PA 2IYSA 2QN6A 3GLGA 4A6PA 2GZDA 5D3QA 3ZH9B 1E6CA 4HSEA 4UXIA 1GDDA 4XWOA 2QQEA 2O8EB 3GJ4A 1WF3A 4HB4A 1NMXA 3AKCA 2PLFA 1S96A 4EKDA 4AY2A 2WPDD 4A0FA 1KSFX 4ARZB 5EP4A 1Z0IA 2IS6A 3EPKA 1GNQA 2KSQA 2GBLC 1E32A 1IJEA 1NN1A 3ECCA 3QOFA 4PQYA 1KTVA 2XJ9A 4KBFA 3U61B 1T3LA 4U5XA 4WVFA 2GJ8A 3UMSA 1V5WA 2JATA 5KTYA 4QM7A 2R6FA 3IIKA 2XXAA 3TR5A 4TYWA 2PEZA 2GA8A 1R5OA 3EAQA 3HDTA 4LWZA 2DR3A 4YDSA 4B6FA 4PPNA 1Z0KA 1FQKA 3SHFA 4JLPA 3LO5A 5G3ZA 4DLUA 2YOFA 4LHVA 5AWFC 4ZDWA 4Q1EA 3KQHA 5FPYA 1J2JA 5CLLA 1E69A 2SHKA 4FN5A 1N0UA 2OBNA 1PV4A 1L2TA 3FFBA 3ZQJA 2WTUA 3WYAA 3PUVA 4URUR 4ESHA 1VYVA 1ZMXA 2ZE7A 4XD7D 2ONJA 5DNYB 1P6XA 1RVDA 5FOWA 4DSOA 2BM0A 1RRPA 1I2DA 2CNWD 2HF8A 5EP3A 3RS0A 4B2PA 2G1JA 3BBPA 3T5GA 1ANKA 1OB2A 1JR6A 4AI6A 1XXHE 1XBTA 2ZS8A 1CJUC 2QTVB 2VHCA 2VL7A 4HLDA 1E98A 1IHUA 4MQBA 4X8OA 4XSGA 4EAQA 2C96A 1RJ9B 3WBJA 1U9IA 2I4IA 3ZZTA 3L0SA 1DVRA 4HYYA 1OV4A 1E1QA 2B7BA 3KJEA 4HB0A 4URXR 5EXSA 1DAEA 2X2FA 4JLMA 4QG7A 5DHFA 4LHYA 521PA 2VLIA 2BBSA 2H57A 1BS1A 3FKSD 2OLKA 4P0TA 2XNDD 1VYTA 3W3ZB 5KSYA 4EUNA 3AF0A 2ORIA 5GJCA 4DSUA 4OK3A 2BEKA 4Q9JA 2HXYA 1OJLA 2J3EA 1OLOA 4EPVA 3K9NA 1OFHA 5HR5A 1UEJA 3A6PC 4Q1CA 4HAXA 1PUIA 1W44A 1YRAA 4MUBA 4M1MA 4DT1B 3LNCA 5L3VA 3TKLA 4TLDA 1P5ZB 1DTSA 2V1UA 3NEYA 5FUVA 4AKEA 5LD2C 1JI0A 4TL9A 4G5GA 1II8A 221PA 2IEYA 2O52A 3LWNA 2JIZA 1HT1E 2QAGB 3BRWD 1S3SA 1OKKD 3T06B 2NO6A 2QM8A 1XD2A 3R9XA 2RGBA 1KO8A 1Z08A 5JWOA 3FKQA 3A1SA 3MUFA 2IYYA 1UBEA 3UWOA 2FSIA 2CXXA 1KKLA 3BS4A 5D3MA 2ZUBA 4MRSA 4B34A 2PZFA 3RS4A 1XTRA 1T0JB 4M53A 2PCJA 3R8FA 4Q1DA 1TQ6A 1W36D 3T61A 3QY0A 1P75A 1U2RA 3NXSA 1DO0A 4EPTA 3I73A 3ZQ6A 3J81k 1RFLA 3OIVA 1GWNA 1NP6A 3AKYA 4NCNA 1E2QA 1EFCA 2ATXA 4OKSA 2OUKA 2W2XA 1L4YA 1VMAA 2GJAA 3QEJA 4OL0A 4Q4JA 2BKEA 2VHUA 1KO5A 4M1OA 5TVKA 3JZAA 3K70B 3C8UA 2NO7A 2GEDA 3GLGB 3L2OB 2IWRA 1UKZA 1K6MA 3GLFB 4LHWA 1XJ0A 5AJXA 1DAKA 2Q3MA 1DG1G 1CR2A 4B32A 3H4MA 5JS7A 5FOXA 2H92A 3ZVRA 3EIQA 3BAFA 1G64A 3F3YA 4CEIA 2DFLA 4PZLA 1TQ2A 2JLSA 2OAP1 4ZI3A 1IN7A 1R6BX 5JWHA 4BFSA 2H1LA 1AIPA 2GXQA 3GJ5A 3U6KA 5JECA 5EE1A 2GJ9A 1IJFA 1KI1A 2JLXA 2HXSA 2KE5A 2RGEA 5JI3E 4CEJA 2O8BB 1BMFD 2WJHA 5E4FA 3THYA 3TK1A 3K1JA 1AQUA 1WE2A 3CWZA 1A2KC 1IQPA 4HI0E 1AA9A 1GM5A 1Q3HA 1NVVR 3TR0A 4EQ6B 1X6VA 1ZNWA 2RGGA 3SJAA 2IWHA 3NWJA 2ONKA 3FTQA 4C0LA 3L0OA 5H8WA 1X8KA 1DG3A 4XSHA 3AV0B 3AVTA 1GRRA 3V00A 2IL1A 2MSDB 3CX7A 1CJTC 3AVWA 2J0SA 2ZRBA 1R5NA 1JR3A 3BH6A 4OQFA 3WXMA 4M1YA 2QRZA 2TMKA 3L0IB 4ZDIA 3TUZC 4HDQB 1E2KA 4UNSA 1G16A 3BK7A 1F60A 2J9RA 2QGNA 4WXPA 3DDCA 1VDZA 2EU8A 1T4GA 3C14C 3SDZA 2NO9A 4CZ2A 1JNYA 3Q3JB 4C3ZA 1FPMA 1W4RA 2GEUA 1FUUA 2PX0A 3MRSA 5JFGA 3D7MA 3K70C 3NC0C 4LBVA 5EQTA 3ZIAD 4RD3A 2A5GA 2EFEB 5AJYA 1RC8A 5C18A 3SJZA 3A8TA 2JEOA 5FPSA 4FIDA 5EXTA 3SJCA 1KO7A 3CNOA 2WAYA 2ORVA 1WDTA 3PG5A 4W5WA 1NBMA 5EP2A 4FCWA 2C99A 1A4RA 1P9WA 5GJWC 2IYWA 3BERA 2YINC 1E1RA 4NCIA 1NI3A 3R7WA 1MOZA 3GLGE 1KDTA 2QL6A 5C46F 4JLKA 1ZUIA 2EVWX 3KL4A 1E4VA 1KO4A 2QROA 5HE9A 2QEQA 2QG6A 4Q9IA 4TN1A 2YKGA 1E2LA 1YVDA 2W83A 3AVQA 3UANA 4OBEA 2QE7A 4KBGA 3AVXA 2ZITA 3HYRA 3KTAB 1NBMD 4R9UC 5BW8A 3T34A 4URYR 2XSZA 1Z2AA 4FD2A 4KVGA 3KKNA 4BZXA 3CB4A 4OI2A 1R7RA 1E2DA 5H68A 4LJYA 5TY0A 5DSZA 3VR5A 3RVBA 4A0HA 4JLOA 2LKDA 3LBNA 5J4HA 1IN4A 3T1TA 4JJKA 3B78A 4KYIB 4Q9KA 3SYNA 3SFVA 2PJRA 2CVHA 3E2IA 4Q7MB 5KNBA 3ETLA 2P6RA 5KDLA 3IEUA 4UXJA 4M9ZA 3X1ZA 4Q4AA 1P3JA 4LC0A 1R2QA 1MT0A 4LJ8A 4JYCA 2ZRPA 1ZM4A 4A6XA 2C03A 4B3DA 3D31A 2YNMA 1I4DD 4TLCA 4I99A 3I5YA 5HKKD 4AWXA 2F1HA 2IX3A 1MO4A 2AN9A 5EE5B 1G17A 2PT5A 2R44A 3CR7A 4CT5A 2D74A 1TNDA 2P2LA 3IBYA 3EIEA 2ZRCA 4NP6A 2CLDX 4YMSA 1GFIA 1CRPA 1U8YA 2C2HA 4JKYA 1ZCAA 2QAGA 1WP9A 2MMGA 4UQOA 3EPLA 4CYMA 2B92A 3ZZ0A 4NTZA 2ZSBA 2OCBA 4BFZA 2QPAA 4B43A 4BLTA 4RD2A 4C4PA 4NBSA 2W6IA 2OFXA 1NSTA 4XH9B 1P2UA 4Q01A 4CDGA 4L9WA 2QORA 1WMSA 1E9FA 4WOPA 1F2TA 3SU8A 4QXAA 4ZV4A 4I1VA 4WZAE 2ZVQX 1K5DA 4ACBA 4TTPA 4OK5A 1GZSA 4OQMA 1ESMA 821PA 4A0GA 3O8RA 4HAYA 4HUQA 3PV0A 4B3GA 3EZ6A 3SS8A 4K46A 4MKGA 1NN5A 2UVQA 1XNJA 4BLRA 2XZLA 1HURA 2JJ8A 2Z4RA 4D2IA 3UG7A 4DEYA 2GK6A 2RMKA 3CH5A 1M7HA 3CKLA 3KUCA 3NHBA 1Z6TA 1P9NA 5J4LA 2G77B 4OQNA 2OV2A 3GJ7A 2IYUA 1OPXA 2Q0HA 3GJ3A 3BIFA 4B75A 4Q1BA 1NVXQ 2HT6A 1OB5A 1SVIA 3IBGA 1BH2A 2IYVA 4PTLA 4BASA 3A1WA 3BD9A 4PC3A 2REOA 1XCGB 3G82C 2DFTA 2IC5A 3GQBA 4MGZR 2BCJQ 1UKYA 1BOFA 5JCPA 2QSZA 3TNFA 4IVPA 2QY9A 2HYDA 2FFHA 3B2EA 3AVUA 2GCPA 1G3MA 4HAVA 3B7GA 1Z5ZA 4MKIA 2ZPTX 2FGKA 4R98A 2ZU6A 5JJKA 2C95A 2VYFA 3KKOA 3P1JA 4B73A 3AEZA 4IDHA 1WA5A 5E7JA 5KHOC 2KWIA 3ICEA 1NMZA 3PUYA 4EDHA 3MMPA 4N3NA 1GIAA 4Q4HB 4WW0A 4Q1AA 2WSSA 5FTLA 4KFUA 2H5EA 3NEJA 4QJ4A 1DE0A 1W2GA 1S4QA 3OAAD 3RS3A 2GWHA 4C0AC 3WHKA 4BE7B 5CM9C 5EJEA 1MABA 1VECA 1U0JA 1XTKA 1M1YE 5AJVB 1IN6A 4CVNA 1KJWA 2B8WA 3DPUA 1L8QA 5IDVA 1NL3A 4RKEA 3O47A 1G8YA 1E99A 2F9MA 2IW3A 4CEHA 4DLTA 2F43B 4LI0A 1HYQA 3CO5A 4EQ6A 5FPHA 2ODEA 1G21E 2DB3A 1JBKA 3I61A 3Q7PA 3RRNA 1W2HA 4M9XA 3LX5A 1CJMA 3TSZA 1KYIA 2FEOA 2IHBA 4MRNA 1SHKA 2ASEA 4MGIR 1Q57A 1HTWA 2FPLA 4DLZA 2GZAA 4F91B 4PAQA 4M1SA 2H17A 2ZM5A 2O8CB 5HCIA 2ZAMA 5AK0A 3UXMA 2REXB 3KQKA 5H70A 1HT2E 1F2TB 2I3BA 2Y8EA 5CIWA 3QJYA 3TJZA 1P2TA 1XU4A 2ZS9A 4U02A 2IYRA 5TXGA 2EYQA 3RABA 4NYMQ 2W58A
chains in the Genus database with same CATH superfamily
1SXJA 5JAIA 2P9EA 4G81A 3N2YA 5I7HA 4YJDA 4TQ9A 2DWCA 4CV1A 3O90A 2B0CA 1AN9A 3K0BA 1NMEA 1NJGA 4URWR 5EG5A 5EIBC 1RXUA 3ND6A 1R88A 2LCQA 4AL4A 3A6GA 4C08A 4JC0A 4FGZA 1GY8A 1CETA 3T9EA 3UMRA 5ELMA 3OQNA 4MVCA 3JZFA 3LPCA 5K45A 4ACAA 4HN9A 5CAEB 2AWNA 5ALKA 3Q1LA 2GN8A 1T3ZA 4JC4A 3N8HA 1GGFA 3E7WA 3L4EA 3QG5A 3Q6IA 1CQXA 4YO7A 1M6HA 4UAVA 1L5ZA 4GM1A 4CLRB 4Z9BA 1OV6A 2C04A 2B21A 1RAAA 1YU6A 4KWHA 4ERNA 4J7AA 4QL3A 1TJ4A 5KOJB 1QIIA 1G2PA 1MX5A 1Q7EA 2HO5A 2O2CA 1NXTA 3CSUA 1PGOA 4PRKA 5E4JA 1W1WA 2RGXA 4TZ6A 4ZVUA 3U60B 1I0IA 1O5TA 2QGFA 3PUKA 5AOAA 3IDAA 1RCFA 3TZHA 1VA4A 3H11A 9LDBA 4HC4A 5CW1A 5A0FA 4J90A 5P8WA 2MSWA 3GAFA 4CUKA 5KWJA 1MFPA 3CX4A 4H08A 1ML3A 4OP1A 1BFUA 1KOFA 1OE0A 1ZGHA 4K3VA 2O9JA 5F7OA 4KXVA 3JSXA 2YWJA 3GNTA 2PGAA 4IO1A 4KEAA 5K8VA 4FQ7A 3ADCA 1XZNA 1VJ5A 1Z73A 3GQVA 4HWGA 4B4OA 3DFZA 2J4CA 4B17A 1OXVA 1VG8A 4QOSA 2QLTA 4CQMA 4Q19A 4YTEA 3AVPA 1H2RS 5CX4A 4ARSA 2G9QA 4AMVA 4AW9A 2PD4A 2ZWAA 2O6HA 5IFKA 2IY7A 2EX4A 3R4CA 5FUQA 1R4ZA 2GRJA 1ZW6A 2PWAA 2YZ2A 3ZBTA 4CIDA 1D2GA 2P9CA 2W2LD 3WZ2A 3NBXX 4DRZA 1IZYA 1SD2A 2V4ZA 3RRMA 2VJQA 2C2GA 3QY9A 4JHXA 4QJ3A 3M2PA 2UV8A 1SO8A 2X8WA 3DLIA 3I52A 2YHAA 4C29A 2GM3A 3UF0A 3LUJA 3PGJA 4OHOA 1TTTA 3EXAA 2PV0A 5TQVA 3ES9A 3RSSA 1VL2A 2HNBA 2UUCB 1CUDA 2TMYA 3D3WB 3IJ5A 4P8RA 3ZWXA 4EFLA 5CITA 3HSYA 1PLKA 2FPUA 4ZFNA 1F38A 3OZAA 4V0RA 2B4QA 1OFIA 1E3DA 2I1QA 2VHQA 2AC7A 4AZWA 2CXUA 5CLQA 1P4RA 1U2ZA 2HCBA 4MVJA 4KI0A 4DM3A 1L7QA 3QA9A 3H0EA 5I4CA 2PUJA 3DG9A 5DLYA 3Q41A 4OQ4A 2Z56A 3Q3EA 4LBYA 3HJBA 1KI3A 2IYAA 3GJ0A 3C2QA 3GGPA 1S8NA 4ZCLA 2RGRA 1BKYA 2AOTA 4XIYA 1AURA 3NIDB 3RYFB 4FLEA 3OQIA 1G8GA 3CZQA 3M89A 3PQ4A 3UT6A 4A4DA 1GYPA 2EX0A 2GH1A 4PHCA 4TVOA 1LFDB 4YMTA 5IC4A 1KAEA 4EWLA 5HS4A 1BEZA 2EP8A 2QQFA 3BWYA 4BNIA 1ECCA 2NQ8A 3NHPA 3IUSA 1YBFA 1NURA 3FUWA 1RWQA 1DINA 2YUTA 3UWDA 4E7PA 4DV1B 4NZPA 4FJ2A 5CYPA 1P3Y1 4ZT4A 4EJ0A 5K6AA 1J33A 4NU6A 1A71A 1SZCA 4TPKA 4J1SA 5B7QA 1VI5A 2I6TA 4EB8A 4R1MA 4XM1A 1CDZA 3TPZA 4B3XA 4E6EA 1Z36A 5AOVA 1CY2A 2FRDC 2G4VA 4QJ5A 3HZHA 4XR9A 5K0LA 4HBZA 2XOKA 5FWAA 5AVVA 1EVIA 1BNCA 1H5QA 2YV1A 5D5QA 5LQCA 2X8LA 1EUQA 2NUBA 4P36A 4JT2A 3LFUA 3D4IA 1LQ2A 4RXTA 5IT0A 4D9BA 2BGIA 5JQGF 4FHFA 2V58A 4X7PA 5DM2A 1Z13A 4HAWA 2LD4A 1C0LA 3GMSA 5EWLB 4KR9A 3TUIC 3RKUA 2D62A 3KSBC 2N42A 4TXNA 4U9HS 5GINE 3M6MD 3N8IA 3BCSA 5BNTA 1PNRA 5DGCA 5TB5A 4CGZA 4W5NA 1KZ4A 3KR9A 2CV1A 3I01A 3DWFA 3L43A 3KAQA 2FSHA 3KKLA 1X7DA 2R96A 1C0PA 3FSGD 1MRNA 3LV8A 4DJEC 1YJBA 5HR5A 3L40A 1BX3A 2R47A 4D4JA 2H4HA 2XCQA 3PL5A 1BWQA 1M67A 1ZOLA 2P65A 3ORHA 2ZM6B 1VLMA 4EDFA 3FDZB 4QO7A 1SOWA 2GNPA 1E2UA 4P0PB 1XNQB 3KD3A 1SOAA 2AMFA 2ONCA 2E1PA 2YWBA 3BL5A 2IYEA 4I50B 3R3JA 5BRNA 4AJ9A 4CM8B 5CFMA 2O4UX 2XVZA 1HF3A 1O4WA 3LDUA 2Y1EA 5BORA 4NENA 3O3MB 4XOIA 5THXA 5ESDA 4GNKA 1FFAA 1XLTC 2QYSA 1KWGA 1TAGA 2E4WA 1DX6A 4FSDA 2VF4X 5AM0A 4FVTA 3GZJA 5LQKA 4XQCA 4LX8A 4PLZA 1D4AA 3QSYA 4LXHA 4A03A 4COOA 4RTOA 3K71B 2EBWA 5BR8B 4KHZA 5LC1A 3TLGA 2A9RA 1N6IA 1H8HA 4CCSA 1AF7A 3LQYA 3GBPA 2I7CA 5EJ6A 1E9DA 1X1DA 5JXWA 2G28A 3KWJA 2R25B 3IAS6 3X1YA 2R8ZA 5JT1A 1XEWY 4HL6A 2WUWE 1GKLA 3H5OA 3BGWA 4WFJA 4DREA 2Y4NA 4B5KA 2AI3A 2J0UA 3B38A 2OZLA 2RB4A 2WIDA 4H7IA 3OZBA 1Y8RA 3OY7A 3G0IA 1D1QA 4P82A 1IEVA 4CM4A 1I30A 4HDRA 2VDWA 2XCRB 1H4QA 3PNYA 4MJ7A 4NZMA 3UV6A 4PR3A 3FCEA 2IYTA 5HZKA 3I04A 5A1TA 2J6CA 2JFYA 1B8NA 3EF3A 4DA9A 3I6BA 4S3MA 1O87A 4L0MA 2W2QA 1P2BA 1JEYA 3RU3A 4BP8A 1EHCA 3ZWQA 1Q6YA 2GPBA 3SYKA 5HRCA 3TBKA 1P1KA 5JNWA 1QFMA 3IE2A 4D43A 2JJYA 5IW8A 4POAA 2BFCA 3TG8A 1ULAA 5IUJC 4LJ4A 1UP6A 2L18A 3IIIA 4P5EA 4TYQA 1YJAA 3WNCA 4X64B 3ZD8A 2W71A 2CFCA 5EEHA 3RUEA 1RQRA 4YLEA 3D4BA 3LSTA 3DBRA 1RT9A 3HCWA 1K7YA 1SCIA 4NFSA 5KO2A 3DGEC 2ZYSA 2J1LA 5JJBA 4RJTA 5IF3A 3EYAA 4BBZA 2QL5A 4XM2A 3CG0A 4BO2A 2UYQA 1XJ5A 1M2WA 1ZYUA 2EQ5A 3S7TA 3IAM1 3BB3A 2I0FA 3AETB 3MPOA 3IBTA 4MVJM 1AMNA 4Q4HA 4JWKA 1PFYA 5EJAA 1MAUA 4QFCA 4MS4B 4PYNA 5AVOA 1AV6A 1I3LA 1NXVA 1VBNA 3EUFA 4FMCF 2JFGA 4FGSA 1O03A 3PIDA 3O03A 4OHZA 1W9MA 1XZAA 3EXHC 4IUBS 1X7WA 6GPBA 4M0DA 1TQ8A 4RIIA 5TJHA 2QMQA 3LPMA 4GR5A 4BQEA 2RFLA 2W6MA 4WLNA 2D0DA 4WXYB 5K20A 3GP5A 1K27A 2B4KA 2QVGA 3TSCA 3TLAA 1W5FA 5HPYB 1XF9A 2VAXA 2F67A 2FVXA 4XFDA 3E1SA 1ABFA 1DCMA 3N07A 2NMVA 4YJ2B 3QEBZ 4LZOA 5I4KA 3VOBA 2V5UA 1KYTA 3GJQA 1TU4A 1L5MA 3LC7O 4QEKA 5DW3A 1IYZA 4D0GA 5KSOA 1JJ7A 3OQ6A 4HQNA 2ABWA 4RJLA 4BOYA 5CGQB 2WFMA 2CL7X 1XZQA 3T52A 3BRQA 4AECA 5IZ4A 3IPAA 3DTTA 3L02A 5A5VA 4FD3A 3PEWA 3CN7A 1ZRNA 2WSBA 1GN9A 1NBIA 1PS8A 1SOVA 1UWKA 3R1IA 2GZ3A 2JIRA 4BDSA 1WVMA 4UOEA 2X77A 1Y3CE 3BUSA 5BURA 4JMLA 3WIBA 5JO0A 4BMDA 1FZQA 2R6ZA 3OWXA 4LC1A 1Y4UA 3RREA 2XQFA 1JPVA 1ULTA 3D0KA 3ZD6A 1OYYA 3WL7A 1MO2A 4J29A 3HSKA 2CW5A 2VF5X 3N53A 1L8OA 2AG5A 2R6DA 4HH3C 4JVLA 3VYUB 1AKVA 4RANA 1TQ4A 3PCTA 4OGFA 4PN7A 3ED1A 2BZGA 2D5LA 4P5DA 5GONA 2HJRA 2JFXA 2QD5A 3GEGA 1U1IA 4MLPA 5IH7A 1H93A 1SC6A 1TLTA 1QIHA 3VKUA 1WPXA 2OTCA 2DPMA 1U0OC 4O4IF 2X4DA 1LWOA 1ZM3A 5HEKA 3ZV3A 5A3JA 1XTQA 4INZA 1EU1A 1YBAA 3CRZA 4NMMA 1YZQA 4H60A 4F38A 3HVRA 1KQ3A 4NXMB 3E9NA 1G3RA 1DJPA 3LC0A 4C87A 1P5RA 2WNHA 4AG5A 1J0EA 3VR6H 4O2AF 5DNAA 2ATVA 2R48A 2W6QA 3ZNQA 4B6EA 4K8OA 1NYTA 2JFVA 3UK2A 4YMWA 1I4OA 2F48A 1R74A 2HSDA 4DY4A 4MR7A 3I6IA 3U3DA 1F9AA 5HS6A 3K3PA 3PF9A 1L4LA 4JP5A 1C30A 1YS9A 4JYPA 3WS7A 1GQOA 2YFKA 2E5WA 3E05A 4KUHA 1QHSA 2FW0A 2NV2B 2FOLA 3CMMA 3DO6A 4TSRA 1P2SA 1UJCA 2JGLA 3RRJA 5K8LA 4MW4A 2DQYA 4EO9A 1XPOA 5ER6A 3ZWYA 2DMRA 3FDIA 1E96A 1WPRA 2XKAA 5DI9A 2NSLA 4QYIB 3L79A 3QE3A 2PVCA 1XTZA 3BQNB 1RQNA 3UG6A 3C43A 3NDIA 2B69A 3C3EA 3MOGA 2R2AA 1MGPA 1Q11A 3UK0A 1BYUA 5EKTA 3JRXA 4IGFA 5FUMA 3KR2A 2BGJA 4IZ6A 2B2NA 4Q12A 1Y89A 2AFVA 2HCFA 5AVZA 4CM3A 4BLWA 1UP4A 3BA6A 2RGCA 3MWJA 3HWRA 4HDKB 4OXYA 1IJBA 5KHLB 1Y3HA 3MLEA 3ZQ4A 2Q6KA 2LUOA 5IFLA 2IA5A 4JLBA 3RYHB 3WL5A 4IDGA 4TX1A 2AN5A 4DJDC 1SVLA 1OLXA 1I13A 1QWSA 3A1VA 3BWEA 3GFQA 4MGYR 3FLAA 1IEQA 4KSCA 3VUEA 2HRRA 4QXRA 4AY5A 3THXB 4YRFA 2CHGA 4XWYA 1C8LA 3ABZA 4G0ZA 5DFAA 4RNCA 1IWBB 3SFZA 4EKIA 3DS8A 4B4VA 2HYIC 3EA4A 4ZOLA 3K15A 4Q4AB 4IDNA 5EHZA 2X8AA 4GMKA 5FFMA 3DB2A 2XQGA 5LB4A 2BZ1A 3JD4A 5EE0A 4ISCA 4LSGA 3F2VA 4R8RA 4A2QA 2PQ6A 8LDHA 3IAXA 3IV9A 2ZRHA 3I1JA 1Z68A 3G0GA 5A4KA 1LH0A 3ICQB 2PIAA 4ESOA 4O5OA 2X9NA 4C3VA 3OM0A 3LP5A 1JLMA 4OQPA 3ZZUA 4ZAFA 3GG2A 5EGSA 4HLUA 3MG9A 5BOSA 4LKOA 3RBVA 1T1RA 4EZBA 2CE7A 5BMVF 2J0QA 3DVLA 3GLKA 3DZKA 5IDQA 4I50F 4M37A 1JDBB 2JH8A 4B46A 5AM2A 1IPFA 1P9RA 2Y05A 3GEDA 2VHWA 2Y1WA 3A3YA 3NW9A 2ZP1A 3EA5A 3PTZA 3PR3A 1T36A 4K2AA 4N8EA 1KAOA 5T64A 1SCUA 1Y9ZA 1JI3A 3IULA 5KYYA 5DM1A 2AKEA 2EOAA 5AOBA 3K0EA 3FVTA 1WVIA 3WSTA 1I4WA 3IQIX 1FSZA 1I6LA 3NH6A 3PEEA 4FKMA 4NDNE 3V2HA 4B3BA 3OU2A 1TIBA 4FX2A 5TQ2B 1ZR4A 5DBFA 4JSRA 1MRSA 3KU1A 3O31A 1VHWA 4NX2A 5FNVB 4EHJA 4YRMA 1G2QA 5EWMA 1E7MA 1E9EA 4ZXPA 1C1YA 3LVFO 3WMWA 1P7YA 3OESA 5FWNA 2PO5A 1AQNA 4O4JB 5JPIA 1JHPA 4YRPA 5FTNA 3G0DA 4JJ6A 1WZUA 1G9SA 3IEVA 1SCUB 4XLTA 5FO1A 4L0DA 5KJ6A 1R8QA 4HQ6A 2C78A 3L4JA 2CXPA 1M8JA 1NZFA 3BFKA 5KINB 5K5EA 3PPVA 4YY3B 1GZVA 2ZUDA 2QUKA 2XV1A 3SSOA 4P2BA 3HVUA 1MXFA 2YICA 3PYXA 3G9TA 3IXQA 1KYWA 4W9RA 2EJCA 1J8QA 4WBSA 4F6LA 2ZBUA 1E3EA 3QVWA 4M38A 5IM4A 5DKFA 3TXYA 3QE9Y 3PGLA 5JSYA 4BNGA 4KQ2A 1R12A 4N5MA 3AVYA 1Y7LA 4RFSB 1KPHA 3Q6MA 2ADMA 4HXGA 2P68A 1UOPA 2CD7A 2YJZA 2IGBA 1T43A 2JA2A 1U31A 2HHJA 2JF0A 3BMQA 5HFJA 2QI9F 5E8RA 2RARA 4PG5A 5LWQA 4XUGB 2WMOB 3T38A 2A0FA 4HGNA 2GUGA 1T0HB 1ITZA 2VBFA 4RD0A 2G76A 3NTQA 4U5QA 5G3YA 3WYFA 3C3YA 1YR2A 3RQIA 1UBFA 4GDFA 4XDYA 1WW3A 3CA8A 4CJXA 1Q19A 5GP1A 3SSMA 3E3NA 4JUCA 5T7BA 5M04A 1DXYA 3OETA 4RMJA 4DQLA 3AG6A 4FILA 1MA3A 4PLFA 2Z3WA 2L69A 3VKHA 2DR2A 4F5WA 4FFOA 4QTUB 2JLBA 4LF5B 3DUWA 2I22A 3M9XA 5HIMA 4JOSA 3X1JA 4DB2A 2PRYA 4LPSA 3T1HB 4RZQA 5F9HA 4TQGA 3ZG6A 3DMTA 5IVPA 2IOFK 4LUCA 3MHTA 1DRUA 1G7TA 2QN1A 1Z35A 3BBLA 1HDIA 1HQYE 3H05A 3JATB 4DAEA 4LF4B 2BEUB 3CX3A 3C6YA 4CF7A 1HETA 5D1NA 3U1VA 1B41A 4RMIA 5FYDA 4FM9A 2OYSA 2F3RA 2RCNA 4YS6A 2O0KA 1YKSA 3KDSE 3PCRB 1HFJA 1X0VA 1ZBDA 1A88A 5ALZA 4A91A 1WCWA 4E5MA 8ABPA 5EI5A 1NX9A 1O94D 3RFXA 2WW8A 2EEPA 4MXDA 5FL7D 1MOQA 1JWLA 2DSTA 1XIVA 3V4FA 1U8AA 3LTEA 3DXZA 3SBDA 4DUGD 3WKAA 2F62A 5JARA 1Q2UA 2QLJA 2VZEA 4K86A 3T7KA 3GPIA 3RJMA 4ZEMA 3IFSA 3IEIA 1L5NA 3GT4A 3FJOA 2XUHA 3MN1A 4EHLA 1FP4A 1DQZA 1DXQA 1BMFA 4Q39A 1WXGA 3OC0A 1H6BA 1W0JA 2R6AA 4R1PA 5EXXA 1VLHA 1KK2A 5E3IA 1DELA 2HRCA 3KPYA 3EIHA 3FPKA 1UIMA 5BWCA 4ENUA 2R4UA 3MC1A 3LH5A 2PH7A 2DYKA 5TDHA 9ATCA 3BULA 3S2GA 4ZYLA 2PKWA 5BRJA 3CGGA 3QSGA 4X20A 3UNXA 3NX4A 1DIHA 4TV8F 4CLOA 3CURA 3DP7A 2GEKA 1RM3A 2QX7A 3X2SA 2HO4A 4MHOA 4CHTA 1RXEA 2QUJA 4M9RA 2CT8A 5JZBA 3UJ8A 1BXGB 2GB4A 5ICGA 1IY0A 1YE5A 3OVMA 3HJRA 4JAVC 4EGAA 2KPOA 2ZT8A 4MR8B 3VKVA 4QDJA 3NHSA 1R0YA 1P18A 3E9ZA 1NBAA 2OHJA 1ZSYA 1TZCA 4ZMSA 2BC9A 1TEXA 1XK6A 2V97A 4RC9A 2FGJA 2PQMA 2Y0PA 4CMIB 4PCAA 1XZHA 2PS0A 4LFCB 1MQ9A 3ASYA 2Z5GA 4ZQBA 5IKMA 1KSGA 3L3BA 3M9WA 3JWHA 4FBLA 4CL8A 4V0NA 3QQ5A 4GYJA 1P5HA 2X1HA 3HJCA 4ZOBA 1AT1A 3TGWA 2E87A 1XTPA 2NZYA 3KPVA 3SYLA 1O9BA 3RFFA 3AHCA 1HNZB 4M89A 4DMLA 1Z0JA 2A33A 2QV0A 3HDYA 3DE6X 3GFSA 1FXWA 3GNLA 4LC9A 2ES4A 1G9XA 3A1DA 4PSKA 1JEAA 1X86B 2BUBA 2VI5A 4GKKB 1W4ZA 5BW6B 2GZSA 4C4ZA 1SFRA 4RHFA 1ZD9A 4CM7A 4PX9A 4WE3A 1JHQA 3TPCA 1PJSA 1S8OA 2FSFA 5CW2A 4QDTA 3W7VA 3U7GA 1RXVA 5JXIA 1C8VB 4L08A 4MQMA 4Q93A 4Z1MA 2X0DA 4E4TA 1X8JA 1Z74A 1SHZA 4X3CA 1TYZA 5BUQA 4D4LA 2XQJA 2FPKA 4K6MA 3Q5DA 4OHMA 1FUEA 4RW0A 2E5FA 1EVKA 2XGSA 3QZUA 4B9EA 1KP9A 4LTMA 4M36A 1XL1A 3VI4B 1X3LA 1XZPA 1YACA 2RHBA 1MU0A 3QHPA 4NPHA 3E22B 4YEDA 3ZUGA 4R2HA 5AI4A 5TLSA 1Z3IX 4UPVA 1E2MA 4ZZ1A 1S2LA 2BJVA 5JW6A 3CUUA 1HH4A 2JEZA 2XHZA 1VE9A 3EG5A 5D3KA 3UMGA 4E5NA 4X24A 3PWSA 2DM6A 5FUBA 3D4NA 3QV2A 5IJXA 3BE5A 3F0TA 1L4NA 1NWHA 2OP0A 3HCBA 1FJXA 3W9UA 3EZXA 4FMCB 3FNQA 1E1NA 1MDBA 4K2HA 5ICFA 4EUEA 1WXHA 1LWNA 3A6LA 4QVGA 3SX0A 2INGX 3T6KA 1A5BB 4TV9F 3CUTA 3G13A 3CR8A 1AA6A 1DJNA 4IHKA 2PUWA 1DKRA 1S1CA 2B99A 4BLQA 4P98A 3PT9A 4C0KA 4YV7A 2QT1A 2ZIXA 2PGLA 2GN4A 3ESZA 2UAGA 4RFSA 2XE8A 4D3DA 4MVJE 3HXMA 3KQNA 4A8HA 3WMEA 1KI2A 1NVUQ 1QVVA 3I6YA 4QYMA 3MSXA 2BT4A 3ZDQA 1XP5A 2D7DA 1F8FA 3AYXB 2QRUA 2BY4A 2BTOA 3FMFA 3L9WA 5LLTA 3JR3A 4U2GA 2BM9A 4QBHA 5ALEA 4YCSA 5JUWA 4AKGA 2NIPA 2WAXA 3G9XA 1EBFA 4IJWA 5LYJA 5AJZA 1E63A 2W2NA 2EP7A 4IWNA 3DAPA 4Y6OA 1EXDA 4GW3A 3ZI4A 1J7KA 3VR4H 3RYFA 4I2NA 1LK7A 4JJ4A 1PW5A 4YJ3B 3WR5A 2XZOA 1DC6A 4HFRA 1U9CA 2GEBA 3CWQA 1UZAA 3W5AA 5DHUA 4OKNA 3V4ZA 1QK4A 5L4SA 1OTHA 1UWVA 1KK0A 4NFHA 3CJRA 1V8BA 2ZJZA 4ZEWA 2IS2A 2QTZA 3L8GA 4A82A 4M1ZA 3DULA 1IEWA 3REOA 4BNFA 1OH8A 3D1VA 3DDUA 2PCLA 4YO8A 4A5OA 2Y0BA 3L93A 4MPJA 3FHCB 2FW8A 1XZJA 4YCMA 3KT8A 4LOJA 5KTRA 1YS4A 1KWKA 4OQDA 4HFNA 4XB1A 4XX0A 2NZVG 1DEXA 2R62A 3MNFA 2YHUA 2PRIA 1N5KA 5E6SB 2RHDA 3EMBA 3UEOA 3K9LA 4LISA 4C14A 5MHTA 1A9TA 1CQJA 4R68A 5IAEA 3U4AA 2X19A 5IDYA 4IJQA 3NS7A 3W3AH 2QP4A 2HDHA 4L9RA 3G0HA 4Y2RA 5EPOA 1E92A 1M6VB 5T8KA 3ZJ5A 2YYSA 2VPQA 1VHJA 3IR7A 3E1KA 5U9CA 3HXQA 3F6YA 4BV2A 1CEXA 1VP9A 2BUCA 1ZRHA 3L01A 3NXKA 4X7BA 3DMRA 4MR7B 2PEYA 4TVKA 4RTLA 5ILQA 4I08A 3GDOA 4MWGA 4XWAA 2I99A 3SC4A 4V3BA 5KNBH 1SU7A 2I7XA 3FPCA 1E64A 1R6UA 3MD0A 4QGAA 1NQ5A 4JCCA 3MJFA 4N1AA 3OQMA 4UMEA 1RAEA 2Q2WA 2XB6A 1WO8A 3TGPA 2QIPA 1FNDA 3LL4A 1T2FA 4ZD6A 1ACLA 2BMEA 4L22A 1H6AA 1SU6A 2MMCA 4RYDA 4DBZA 1DRJA 1RBQA 1BO6A 1U6IA 1USIA 1XWWA 4J6EA 4XYMA 1RHRA 4U2CA 4U2KA 4EHNA 4EO7A 2QDKA 2FY8A 2VTBB 1PVVA 1OILA 2LCIA 1UT8A 2JH3A 1N6NA 2V98A 3JYQA 1N8TA 4EMBA 4DABA 1SBHA 2QT0A 4R2KA 4YP1A 5A5GA 2ZJAA 5C8ZA 5D86A 4WFKA 4EL0A 2IHNA 3ZGOA 4YCAA 1E5DA 1NY6A 3SXUB 5K0ZA 2FEXA 3TMYA 2R7KA 2B7LA 2ZROA 5HKAA 1NXQA 1E79D 5GADl 2ZT6A 3PLRA 3R6DA 2GDZA 3O2NA 3OFVA 2PMEA 4TYYA 3CINA 2VO1A 1KZYC 2BFPA 3ZCVA 2VTEA 2DXIA 2ZYHA 3VC2A 1TF7A 1A72A 2WSIA 4XD2A 2WINI 1CWUA 1OVMA 2IXGA 1G8FA 1U7OA 3P4XA 3GMDA 4XB6B 5ERXA 3VU0A 5CAEA 4BNXA 3W3AA 2JFWA 3C39A 3OZWA 1RBZA 4WK4B 1JAIA 1N1EA 4BCCA 3I0ZA 4FHEA 2BWJA 1U2GA 2GZ1A 2WZBA 3WV4A 4EEZA 5AD1A 2C7QA 3FPSA 2ZZMA 2FEAA 4PQGA 5DW0A 5EMKA 4EYSA 1AKNA 1U2SA 1PT8A 3GUZA 1YU9A 2BOVA 4BWGA 2AC2A 1PJTA 2VHZA 2W6JD 3MTQA 3BX1A 2FP4B 3FZEA 1A3CA 2WJZB 2RGDA 4HNAA 2G82A 5IRCD 4EG5A 5BSVA 3BMOB 2DULA 5HUHA 4FYKA 1L5QA 2ERXA 1C4WA 2OV4A 2QAJA 2A7XA 2VH2A 4WV3A 1KJZA 4QATA 4XDZA 3V8EA 1Q1AA 3GOHA 2QW0X 4N7RA 3UK7A 1SCQA 4KXXA 2W90A 2VHXA 2LP4Y 2ZSHA 3VX3A 5M34A 4CETA 5KPDA 4EY7A 1O3YA 3I30X 3EN0A 2QUZA 3ZEAA 1G6HA 1OBFO 2O06A 2Y1OA 1WBJB 3EDMA 2ZU0C 2J4FA 3F46A 1IFXA 4JXKA 4D9EA 4PGFA 3KZ1E 4DV6B 2O8CA 2GN2A 2OHIA 3ICPA 3KHSA 4N12A 1VHTA 2WK1A 3CUSA 2R85A 3EUWA 4JJFA 1VLQA 4MQFA 5EJ2A 2FAXA 5ED0A 5A3VA 4YR9A 2JARA 1C81A 2QU7A 3CSDA 2XYGA 2J85A 4WEQA 2QM0A 1J00A 1YJ8A 3VHXB 3DPSA 3WNDA 2FZVA 1B73A 2MYNA 4NZNA 4MRAA 4K3UA 3RJ9A 2E6UX 2ZSUA 3OPMA 5IC5A 10MHA 3LC2O 1AV7A 1T8WA 3CLHA 2VP2A 4ZO9A 2YMMA 4J4HA 1ECPA 1NKSA 4F97A 4BN5A 1CUUA 4GWLA 1OU0A 4PX2A 1E9CA 3OM1A 4Q37A 4Y67A 5DTIA 2NU8A 1KDOA 3B1XA 4YV2A 4WGGA 1K4MA 3TL2A 4BNHA 3CNNA 4CKEB 3I5UA 5FOVA 3HADA 4LK3A 1V1RB 3BK1A 2MCFA 1B0AA 1D9XA 7YASA 3UWSA 1FY2A 1CW2B 1H66A 1S2NA 3L82B 4KG7A 5LBIA 4LV8B 1VM6A 5HF5A 1W5EA 3U1BA 3PQEA 1OIVA 2DY1A 2B7CA 4QDZA 3K4PA 1G98A 1F3OA 1RLMA 2H06A 5FEMA 5I4IA 3A4IA 3FB4A 3INRA 4I14A 3D6TB 1LDEA 5AVJA 5EHNA 4TWZA 3GFBA 5LMCA 2IOHA 3A7DA 4JQYA 4UTZA 7GPBA 2FEPA 4J0GA 3ESRA 2GEVA 3GH1A 5CXQA 3UW1A 1AQJA 1YL7A 4N0QA 5DGDA 3DDNA 4MKRA 3WLSA 2ZYVX 4DG9A 3O8OB 3PVCA 5SICE 3ZXYA 2FE4A 1DG9A 4MKXA 5GZ1A 1YFKA 1FU4A 3KWLA 5DRTA 4J03A 3UMJA 2QZ9A 2E7ZA 4V39A 1XMQB 2VCHA 4G0VA 5KSZA 3KSMA 1X1RA 1QBGA 4R16A 5DX0A 3TDMA 3WG9A 4AY6A 5IULC 1RYNA 3AJAA 1N2OA 5FPPA 3ZCPA 3ZGXA 5L3QB 3FYSA 3FLBA 5A03A 5JYDA 4EGCB 3HS3A 4ZALA 4BN0A 1ZCBA 5LQMA 4HWTA 4Z0NA 3Q85A 4G67A 1KSJA 1M2VB 2YZ7A 2XZTA 1Q50A 3FIJA 3HDHA 4MCHA 2D3WA 3PSAA 5H83A 4UAGA 4D5EA 5SZKB 1CR0A 2JI8A 2HADA 4D8YA 2X4LA 1QE5A 2APJA 2AE1A 3OKFA 3R3YA 3DWEX 4M8KA 2AOWA 3B3QA 3K0HA 4XARA 3WA7A 3QVGB 3QE4A 4UU8A 3DEFA 3SEAA 4B2IA 5BY2A 3KYJB 4LG1A 4AG6A 1IUPA 3DBIA 1KBOA 1ZA1A 4F4UA 4RELA 1EXMA 3K0AB 2EJWA 1JT2A 3UMFA 5B7PA 5LMUB 3LX6A 4MW9A 2E4UA 1B15A 2XY4A 1RIFA 4NVRA 1DAFA 1PNVA 3GN2A 3ZLBA 5HUJA 4DM7A 1F9EA 1GAQA 2XCLA 3OIGA 3I8XA 4PHFA 1SZJG 4FDMA 3HXPA 2B4TO 3W04A 4DIOA 5G4LA 1EWYA 4BL5A 2VHYA 1WETA 1H1LA 1DMRA 1L5FA 3A26A 4G56A 5H81A 3W06A 5LIPA 4KVZA 3GEHA 4RA9A 1Z2EA 1PSWA 1SUPA 4WAUA 3N87A 4DAOA 1MORA 1O54A 1V6SA 1SEPA 2XE4A 3NBZC 2Q6TA 2O2HA 1COZA 3ET5A 3RVPA 1WXEA 1SXIA 2A9OA 1KK3A 4F2DA 1GKUB 3B1ZA 2XRYA 5JQWA 1QS0B 3DOJA 4XPIB 4JUAA 5T41A 4GI2A 5AIAA 3MTJA 3KTDA 3A1CA 4ZOCA 2L82A 4EB3A 5K8IA 1FFYA 1Y82A 4WTOA 4O0LA 4AQDA 4GUAA 3WTBA 4KIFA 4YASA 4MPTA 3D6UA 1PWEA 1LTKA 4G01B 1TAHA 3ET4A 5K0CA 1V95A 1ODFA 2R5WA 4JFRA 3T1NA 3DMPA 1OYVA 2EWVA 3G9QA 1XFDA 5HA5A 4MQUA 1DQNA 1XYVA 3DEYX 1F2VA 1KMHB 4GVPA 1JWBB 4H77A 5JOQA 4NOJA 1FE8A 1R4AA 3GROA 3EASA 1W0KA 3LRPA 3VO2A 1H9AA 5CEFA 1CUZA 3BMOA 2B34A 5HDQA 3T0FA 5AXAA 1J06A 1N9GA 5FPTA 4ZAZA 3LW7A 1PFVA 3ESYA 3DD5A 4D8UA 1SJ9A 3HUEA 3KU4A 2ZUCA 3TIFA 5KNCD 1ADJA 3R23A 1U2PA 4IEEA 4MLDA 1E6UA 1FYDA 3DZHA 4QEDA 3GFGA 1ZUNA 3PNVA 3JW8A 2XOKD 1B1AA 4IDDA 5CHEA 2YYYA 3MJDA 2JLZA 1W7AA 4IOMA 1N2EA 1B6TA 1UJ6A 5JRDS 1C0KA 1F12A 4IDFA 1UXGA 2B8JA 3HKDA 1XLVA 5EJFA 2H4ZA 2OCDA 3EOBI 1CRZA 1X39A 1ISSA 1JL3A 4L75A 3N2ZB 4P92A 4V38A 3VM6A 4XVUA 2AEMA 1MJ5A 4XXHA 2GPTA 1GAJA 4KXWA 5HKBA 1K8YB 2FU5C 3WAKA 5JIBA 2ZRQA 2P2CA 3PXGA 2C9ZA 5EESA 1GUAA 5AVSA 5DLEA 4LN1A 2Q45A 421PA 1Z62A 2MSLA 3HRKA 1JA1A 3KYIB 3SSNA 3MHPA 4CTMA 3EMVA 2X0FA 1N2BA 1CDEA 2QRHA 3H99A 4Q16A 4YAGA 4FFSA 2FUNB 1Z8NA 3FWKA 3LCVB 1Q12A 1VPLA 2ONZA 1PK8A 1R0LA 3SZRA 5LZ4A 1QGUB 5KOHA 1H65A 3KDAA 3OX1A 4JI0B 2MYPA 4XVQA 2QTTA 1QB7A 3QI2A 1GV1A 4TSFD 1ZICA 1Z0DA 3T7TA 3ZTTA 1UH5A 5CH5A 3KLNA 2WV7A 1N3BA 4EW3A 1N5MA 1KIMA 4XOUA 5D8DA 2QLMA 5F7ZA 4XGNA 4B31A 7REQB 5LSAA 5I5GA 2D1YA 3L7AA 3FROA 1A0OA 3DW3X 3IDSA 3A3KA 4ZAXA 2H7VA 3UHJA 4R0VA 3FPFA 5K6AC 1GFSA 3LKBA 3E6AA 1RWWA 1E3MA 3CLTC 2FMKA 5GGXA 2Q62A 2K7FA 5HYVA 3UA4A 3WIUA 2ZQ5A 3A9TA 4P4LA 1IOWA 2H16A 2I87A 1SBNE 3KK0A 4QYXA 1SXGA 3KTOA 1LDYA 2HRBA 2HHHB 3PEVA 4RIHA 4KLNA 3U7IA 4MWCA 4U6QA 5JSUA 1PUJA 1SUAA 3VR4A 1OXMA 1OTYA 4ZI7A 3T95A 1I7SB 1YK1A 3TMKA 2IODA 3U80A 1MJGM 1AK1A 2XVXA 2WM3A 5AVQA 2Q0QA 4RDCA 4F3TA 4YMGA 4UMDA 1IN1A 2O1WA 2ZRNA 4MIKA 5LPNA 1NFRA 1U94A 1NW7A 4ZT5A 1ZEJA 2SCUA 3EFOA 1CY1A 3O2QB 1U02A 4PC2A 2QMHA 2BRUC 3CYFA 1QTQA 1S8FA 4AN0A 4L8LA 2PS3A 1ZDMA 2I55A 4BFLA 2P2DA 1ZMTA 4CMGA 5BP7A 3C24A 4I5GA 3HMQA 2IZ6A 3HXKA 4YP7A 3ROZA 3E2PA 3HP1A 1OX5A 1IUOA 2NUPA 3N8GA 4MVJF 4BVKA 2Q4OA 3B9RA 1NA5A 2BHLA 4F86A 4GI7A 5JNRA 1KEEB 3RE1A 3HCFA 1M2OA 2C2MA 4FYHA 3WYCA 1FS6A 4RA9B 1RPTA 4UTNA 1H4SA 4J91A 4QBTA 1NNLA 1OC4A 1M1ZA 1L1EA 2RH5A 3HBMA 4JUFA 2WIFA 3SCZA 3N0VA 5ICMA 3AHJA 1P7PA 4H27A 4QUJA 2O8DB 4YWJA 1N0VC 3R7DA 2GFIA 3EGXA 4HWPA 5BQ3A 5HGXA 3F2IA 4D0RA 5LDDC 1JECA 4CIXA 4IQ8A 4JSYA 2DP4E 2OD2A 1RYDA 1UBHS 1IY9A 2J48A 5C7OO 1M0EA 3RAJA 2VT7A 2YNMC 2QP9X 1SY7A 5A3RA 1CUSA 1GPJA 2QZJA 4OY3A 5AKEA 3QG1A 5ALDA 3JQDA 2HWXA 3KRTA 5L6LB 1KAQA 3DBRB 3EPJA 1HZZC 3IOEA 4XASA 3ABIA 3I1IA 5KDOA 2DBRA 5LOVA 1DBWA 4D8WA 1OKKA 3VAZA 1K92A 5JXGA 1PF7E 2C58A 3G68A 4M7PA 3ER6A 1GXSB 4PN3A 2ZRFA 3KO8A 2FFRA 3SM3A 4H1HA 1POWA 4BFXA 5BT8A 1QVWA 1FX0B 1NXWA 2PX8A 2DEUA 4P3KA 1QNFA 1W30A 4JDUA 3MTGA 3WGYA 3QIAA 3GRYA 4PLCA 5K3FA 5IM4F 3NG1A 2IHYA 3DNFA 3IMGA 3ZX4A 3VNAA 4E1VA 4EFNA 5IT9A 2IDZA 2QRMA 4JJEA 3JQBA 3WK6A 3WYNA 4BKMA 2PN1A 5H1YA 1UP7A 2D06A 5F76A 3RF6A 2IEZA 1AKTA 3QWFA 4ZWNA 4HVLA 1P9OA 1ESDA 2E82A 3W5SA 5ICSA 1QRUA 1E2GA 1ZD8A 3KYBA 3P7MA 3PC7A 4R8KA 5DO9A 1UDBA 2XVAA 5T4HA 1ZS9A 4W8GA <