1DAIA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
219
Chain Sequence
b'SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAAATGKYINLALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 70
structure length 219
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1daiA00
3WNDA 4EKDA 3W3AA 3W6PA 5H68A 2AK2A 2EFDB 3MD0A 4KBGA 5FI0B 1NSFA 3R9XA 1E1QA 2QAJA 2QA5A 2ZRGA 1DAKA 1XXHA 1KI1A 1CR4A 2AXPA 5FL7A 1KY2A 3M0EA 3RRYA 1T8TA 4N0DA 2ZRLA 4XIGS 2MSEB 1G17A 1N6PA 3EPKA 1LB1B 3EC2A 2JLYA 3OEHA 3MLEA 2CNWA 5AWFC 2EFEB 1N5IA 1VYUA 2JEOA 4UXIA 3TW8B 3SJZA 5HCIA 1TADA 1ANKA 3AP1A 1IM2A 3LW7A 1CXZA 4A0RA 2HLDA 5JHHB 1QHXA 3KQUA 3EIEA 2ZJAA 3O8DA 4KHZA 2FFHA 2QAGB 4QHTA 4B48A 5KTYA 1XEXB 1KY3A 3LRPA 4S35A 2IT1A 1NN3A 4EIWA 4ZDJA 1DAEA 4IW3B 4URYR 3QXXA 3FMPB 2DWOA 1E0SA 3FE2A 2C96A 5FTJA 3ASZA 5G40A 2ZETA 2RH5A 4M1MA 5BYKA 2EYUA 2G1KA 2B8WA 3AP2A 1DBSA 4A8JA 3SBDA 5DO9A 3GFOA 1HT1E 3Q85A 2G6BA 1IHUA 3W6OA 4AYWA 1PVOA 1JEEA 2IYVA 4OHXA 3AF4A 3K70C 3P4XA 1ESMA 4PHHA 3BE4A 1Q1ZA 3U4QA 1QRAA 3B1ZA 2WWHA 1DE0A 2QE7A 4NYJR 821PA 2J0UB 5JBQA 4B3GA 4JBXA 4ON9A 5J4KA 2NO7A 2J0VA 2NO1A 4FWIB 1P72A 2IHYA 1PLLA 2WJGA 4HEJA 3TK1A 1A82A 2RCNA 4P32A 2ZUDA 4NYMR 3N2IA 4C0JA 2BM1A 1XZQA 4G01B 4DBLC 3VKHA 3DMDA 3EIQA 1XX6A 3UG6A 4QKQA 3UWKA 2OXRA 1DADA 3WP1B 4QRHA 4HAVA 5G3ZA 1AN0A 2A9KA 2AWOA 2GAAA 3AGQA 5CDFE 4BQSA 4Z1MD 3VU9B 4RKEA 1RRGA 2WKRA 5L3QB 2VP4A 1G5RA 2AFIE 2A5GA 5DE3A 4CEIA 1G8GA 2WICA 1G3RA 1S96A 3QVVA 4HSEA 3AKCA 5EZ5A 1NVXQ 1SXJE 1S1MA 1X6VA 2EFHB 1U9IA 1QF9A 2IHBA 5GJBA 4CGZA 5TVKA 4BASA 1D8TA 2Z4SA 4LWZA 4IOJA 1DAFA 3E1SA 4TYPA 1MKYA 4EPXA 1ZM9A 5L8VA 4C0QC 4WAUA 3EZ2A 4YMWA 1G8YA 3BB3A 4BLPA 4FMBB 5JLJA 2Q9AA 2J59A 4V0ME 3ASYA 3AGPA 1QG2A 1Q1EA 4TLCA 3VHLB 3GEIA 3TUIC 5LBIA 4YDSA 2A3RA 2VO1A 4HUQB 5G41A 5HE9A 1IN7A 3OAAD 1D2NA 5EJEA 5JEEA 2KB0A 4QFMA 4US1R 4DT1B 4Q4HA 2QRZA 1FP7A 3CO5A 5SZHB 3VFDA 4W5JA 4KLZA 4D26A 4I1OA 2FNAA 5JRZA 1CTQA 4YXWD 1U0JA 3L2OB 5AJYA 4LOAA 3IILA 3R8CA 4KSCA 3UMFA 2FFQA 1DAHA 3LWNA 5DYGA 4X8HA 5FTKA 1RE0A 4OJKA 2NO0A 2WTUA 1J8YF 1DTSA 2AR7A 5CITA 5KDLA 2W6JD 4A0FA 2ORIA 1X3SA 3OFND 1WE2A 2C99A 4QGFA 1W36C 2IXEA 4W5WA 1XJQA 4C0AC 1YRAA 4ACBA 1SKYB 1FMLA 3KXKA 4HLUC 4LRWA 3PG5A 4TL8A 4TMWA 4AG5A 2ZROA 1FW6A 2HUPA 2EVWX 3SNHA 4IDNA 3FHTA 3GPLA 5FUYA 5H70A 3UKDA 2GJKA 1OKKA 1TEVA 3AF1A 3B8HA 3RRMA 5HZHA 2YWGA 4ZI3A 3R7WA 3RRNA 4Q9IA 2O8DB 1FL9A 1MABA 3THOA 5KSYA 2H92A 4B2PA 2KJQA 4RD4A 1E9SA 2ZS7A 2XTZA 3KKQA 1J2JA 2CLSA 2F3RA 3DOFA 2XITA 5KNCA 3GJ5A 1K8RA 4B2IA 3WMEA 1P3JA 3DL0A 2KSQA 2G0TA 5JHGB 1S8FA 2NG1A 4PC3A 1QHHA 4HDQB 4EQ6A 1FTSA 2W6JA 5JCZA 2ZYTX 4Q1CA 5KSOA 2H17A 2V55B 5FUWA 4ABYA 3GFTA 3WHKA 3OE7D 1FX0B 1DS6A 4ESHA 3I5YA 3AEZA 4EPVA 5C46F 1BMFA 3K70B 3SI7A 4PO9A 1S3GA 2FGJA 2BEJA 2YOGA 4OI1A 4DB2A 5KDDA 1NJGA 4WZBE 2UZIR 2JGNA 2JDID 4F91B 5EXPA 1COWA 2ZI7A 4QG7A 5DI3B 1KK2A 3DPUA 4BZXA 1M8PA 4EFLA 4DLZA 1MO6A 2BJWA 5JWHA 3W90A 5EZ6B 3DKPA 3PCRB 3L0OA 3H84A 3R9IA 3ZVNA 4RD6A 4BRUA 3SHWA 2E87A 2BC9A 2VQSA 1AS0A 2QT1A 4EFMA 1ZM2A 1KI4A 3GJ0A 2I3BA 2IC5A 1MRSA 3B1VA 4PO1A 3TAHA 2RMKA 5E7IA 3ND8A 1KO5A 4G1UC 2BBOA 2C77A 2VHJA 4MQBA 4TZ6A 3OIYA 4I99A 3JVUA 4Q47A 1EFHA 3TE6A 5JI2E 2OFWA 3AVYA 5EE5B 2UVQA 5EE1A 1U8AA 4PHTA 3TR0A 2FFBA 2NOAA 2RGEA 5DN6A 3NBFA 5CK5A 1NKSA 2FH5B 3NWJA 4IJMA 4FI3C 4ZIRB 4NYIQ 1T4GA 5JS8A 1UM8A 4TT3A 1WRBA 3I8XA 1OFIA 3CONA 3SYLA 4GDFA 1FOEB 4LJ8A 1BIFA 4TL6A 1GSIA 2W2TA 3KL4A 1DAIA 4FCTA 5A5GA 2WJJA 5BQ5A 3GLGE 1XRJA 4LPSA 1NNEA 3T61A 2XOKA 2GZDA 2YHSA 4KBFA 5AJZA 3BB1A 2Z4RA 3K9NA 4W9MC 3RC8A 2VEDA 4HZIA 1WA5A 2ZI4A 3U6KA 1U0LA 4G5RA 2Q21A 1R0WA 2QBYB 3MG9A 1G5TA 4CT5A 4YONB 3CPJB 4K46A 2AK3A 1KSHA 4QHYA 1TQDA 3AF0A 3JZAA 4LCBA 2Q9BA 1GNPA 2XZOA 3KQNA 1Z28A 1W4RA 1NY5A 4IFBA 2DFTA 2ZSBA 2WIAA 3MGCA 1GDDA 3TW4A 4M21A 2QAGA 4LUCA 1BH2A 1NLZA 2NPFA 3AVVA 4IDHA 3TIFA 4V0KA 2E1RA 4TMVA 5J47A 1N6KA 3O47A 4Q18A 4AURA 2GBLC 2A5YB 1TNDA 2D3WA 2UZ3A 3A58B 3CM0A 2H5EA 2A5FA 3ECCA 4C0SA 1W36B 3KJHA 2NO6A 2D2EA 1ZINA 4UKDA 3FWYA 1YVDA 3Q8XB 4XD7D 4BFZA 2I1QA 5JEDA 4TYQA 2N1BA 1YU9A 2JLWA 4CRWB 1TUIA 1Q21A 2GESA 3S1AB 1HV8A 4FXPA 3W5JA 1G7CA 4DJTA 1ZIPA 2ZS8A 2ZRMA 4FN5A 1JXOA 1A2KC 2JLVA 2JJ1A 3QKRB 1QHNA 4BFXA 1TX4B 1F5NA 3IPYA 3QI2A 1PLKA 1V43A 4DSTA 2B7BA 2X8AA 4L9WA 2KWIA 3THWB 4GFDA 4Q4LA 2ZYWX 1P9WA 3K0AA 4AI6A 4A15A 1YRBA 5KO2A 4AY2A 1ZD8A 2CLCX 3EXAA 4QBGB 1VCNA 3DZDA 4DLXA 1F48A 2F6RA 2R6GA 3ADDA 3IIKA 4TQUS 2IL1A 3SBEA 2PX3A 1WQ1R 3EASA 3OIUA 2F9MA 2YNMA 2FFAA 4Q48A 1P9NA 4XVRA 4DZZA 5J4LA 1OIVA 1XNJA 2GAOA 2WZQA 2ZRCA 4YDHB 1YZLA 1Q44A 2BMDA 2FU5C 1R8SA 3ZVMA 1TQ2A 3C15C 1VG0B 2FF7A 3VU9A 2ZJ8A 3TJZA 2O52A 3PEWA 1OB5A 4XD7A 2BBWA 4WZ6A 1ZUHA 3RWMB 1YE8A 3SQXA 1VIYA 1D2MA 3F8TA 4Z8YA 4RZ3A 4DCTA 4RKFA 3U2QA 1R5BA 1UDXA 1OIXA 3ZZUA 3K0FB 1JQLB 4GNKA 5H1YA 3PUWA 3KJGA 2J5XA 2XX3A 1JALA 4QBIA 4WIAA 2VP9A 5CM9C 2CK3D 1BOFA 1AK2A 2N42A 3F0TA 3I8SA 4EFNA 2FX3A 2HT6A 2QPTA 3AUYA 4KJZA 4QBHA 3QXSA 1IJFA 1D9ZA 1N6NA 4PTLA 4NCHA 3K09C 3WP0A 1E9CA 2W2VA 3GQBA 2OT3B 2A78A 3FOZA 2DFLA 2RGCA 2C5LA 4PPQA 3Q3JB 4JT4A 4I1VA 2D7CA 3X1YA 1YZUA 3CLVA 1FQJA 5JJKA 1R5NA 1G4AE 2VL7A 3W6NA 2ORWA 2OSBA 1ELOA 3MRSA 4HUQA 4HAXA 3GLIB 1GG2A 2QROA 2Z0MA 3IQXA 1OXTA 3PIRA 5A4JA 4DT1A 3B1WA 2F43A 2YWEA 5HKKA 1Z0KA 1ZBDA 3B2EA 3I73A 1Z6GA 2DFKB 1N0VC 2CMKA 4XOIA 1WF3A 4A6PA 1E2DA 4L5BA 4M53A 2XNSA 1IN5A 1EFCA 3NC1C 4TLEA 5CK4A 4OK6A 4BEBA 4FIDA 2QN6A 3PUVA 2CK3A 2GILA 3ZH9B 1CRPA 2IYWA 2QM7A 2R2AA 1NRJB 4XSHA 1YZNA 1E9FA 1VYVA 4L15A 5JECA 2JLUA 4CEJB 4MDEA 1HURA 1NL3A 2O8BA 1H8ED 4LHZA 1E98A 1EGAA 2GK6A 3K53A 1Z0AA 2W83A 2GKSA 1E2MA 3DDCA 1KJYA 3FKSD 1R7RA 5AK0A 1GKIA 1MR3F 1SXJC 3I3SR 4MRVA 4OL0A 4C30A 2ZE8A 4YMVA 2JATA 5FPTA 2YC2C 8OHMA 4G5OA 3KQLA 3MFYA 2ZUCA 2I1VB 1R6BX 4LBZA 2OCYC 1G8PA 1JR3A 1ZNXA 2PBRA 4G0NA 1RJ9A 2WM9B 1IXSB 3I32A 3MWKA 3C5CA 3ZVRA 4LDJA 2FSFA 1Q1BA 3UXMA 4B71A 5FH9A 4LV8B 4B32A 1YR6A 3I62A 2HJVA 5HE8A 2QRNA 4M22A 4XWOA 2LWIA 2ODWA 5BXQC 1Z5ZA 2J3EA 3ND9A 1DVRA 3F5FA 5FPHA 4JBYA 1I4DD 4CIDA 2FPMA 2CHQA 4DSNA 2R8RA 1T0HB 1XU4A 4OHYA 3CWQA 2QPAA 4DLSA 3BRWD 3AVPA 1IN8A 1KSGA 3SJBA 1TL7C 2F1IA 1FX0A 2F1RA 3NC0C 4YMSA 1PUIA 1Z06A 3FKSA 1G41A 1R10A 3QKSB 4O2RA 2ERXA 4PQRA 3J81k 1XZPA 2B6HA 2HV8A 1XTKA 1N3BA 2IYTA 4OHVA 1CJMA 4MKGA 3GLFE 5JSZB 2AFHE 1Z6YA 1ESNA 1X8LA 4TN1A 1G6HA 2QTFA 521PA 5DI3A 3BB4A 3VKWA 2YWFA 1Z2AA 1KKMA 2N46A 1G64A 3TVTA 1DO0A 4GL2A 2BDTA 2ORVA 4O3MA 5CM8B 5C2JB 2XEXA 3D7MA 4C9BA 1ZM3A 2PEZA 4B73A 4HAUA 5EXXA 1XXHE 1KSJA 2ODEA 4M9ZA 5TB5A 3X1ZA 1GKUB 5AUOB 2FEOA 1QDEA 1E79A 5ANRB 3WHLA 3U3KA 5JRJA 3IEUA 4JKYA 4FWTA 3I4LA 2H18A 3PEYA 4URUR 5C18A 3K0SA 2ZS9A 4PC2A 3QE0A 3DM5A 1ZAKA 4LJ6A 1PV4A 3LXRA 1MT0A 5C1BA 2OBLA 3KJEA 1CU1A 2GK7A 1XMVA 3BOSA 2YOFA 4G3XA 4FCVA 4LHVA 4LY6A 3SQWA 2ZSAA 3FYHA 2P5SA 4IOMA 1J99A 4JLKA 3QXCA 4WW0A 1M7HA 4ZO4A 5AJVB 1L2TA 4V03A 2CVHA 1KI6B 1G3UA 4TL9A 1E9DA 4CEHB 2D62A 1N6IA 2GXQA 2IYLD 2XB2A 1SQ5A 2YJTD 5FOWA 2OLKA 3VR6A 1Z0IA 2EWVA 2YZ2A 2QBYA 1JR6A 1N2CE 5J40A 3A1TA 4HZUB 3LX8A 4TYWA 2Q9CA 5B57C 2FG5A 1NVVQ 4WVFA 5D3QA 1TF5A 2O8EB 2GWHA 3T1OA 2BKUA 2FMXA 1GNQA 3B7GA 1LFDB 1EXMA 1P6XA 1XD2A 1F60A 3K0CC 1NP6A 3AVXA 1F2UA 3NTUA 4ZPXA 4RZUA 2H8KA 2PCLA 4I1SA 2G9NA 4V0LA 1SVOA 4BRWA 4US2R 5LDDC 2NO9A 4LC1A 1E1QD 2ZTSA 5E4FA 5GVRA 3F3YA 4NONA 2B8TA 3QENA 3WRYC 1ETUA 2LCFA 2IYXA 1KOFA 1KI7A 4Q7KA 4NMMA 5FL7D 3RSOA 1NN5A 2VHQA 4LJAA 3UATA 4WBSA 1AA9A 2GJAA 3E70C 4YC7A 4D0GA 3EZ6A 1G6OA 3U44B 3OEHD 4Q21A 4MRPA 1XD8A 1SXJB 1QHSA 2HF9A 5CIWA 421PA 2ZEJA 3GLHE 2HLDD 4DEXA 2GJSA 1KMHA 3AF3A 2OEPA 3OIVA 3LLMA 4GMXA 1Z6TA 4LHWA 4QHSA 1KAOA 3Q7QA 4LGMA 1G5PA 1AS3A 3RRZA 3UK6A 3D31A 5TMPA 4O25A 3THWA 2WJIA 2GA8A 2JCSA 4F38A 2F7SA 2H16A 3G82C 3WY9A 4Q7MB 1T3LA 2R6AA 3K9GA 1OE0A 3QUSA 4W7SA 4UNRA 3HP1A 4QBFA 1KK3A 1H65A 4HB4A 4JSYA 4QNRA 4G5QA 2B7CA 3IEVA 2C98A 4BFUA 1XCGB 1G18A 4KO8A 4MITA 3ZQJA 1IXZA 4P4TA 1SVSA 4D2IA 1W5SA 1ONBA 2ZRPA 4BLSA 2ZR9A 2BIFA 1GZSA 2QE7D 1DOAA 2XXAB 4E09A 4A82A 1LF0A 4L8GA 2WWGA 3ONWA 3BGWA 121PA 1F2TA 1NY6A 4JJZA 3K0FA 2QEQA 4JYCA 4PC7A 2ZRNA 2J7PA 2QMUA 4OQNA 3PR1A 4N0EA 3I5XA 1W4AA 3X1DA 5FOVA 3QNUA 3DHWC 4URVR 3LVQE 1XJCA 1E94E 1N6OA 2FSIA 3CH5A 5SZKB 3SJAA 2OO7A 3SFVA 1P61B 3ADCA 3RNLA 3EA0A 4RD2A 2LKDA 1GTVA 3ADBA 2VBCA 3AP3A 4NKRA 2DPXA 4R9UC 4BFYA 4ZDIA 1NF3A 1P5ZB 2VP6A 4KFTA 1SULA 2NIPA 1BO6A 3Q9LA 3BJIC 1FMJA 2VLIA 2D74A 3LQRA 2OCPA 2GXSA 4V02A 2JAQA 2AD1A 4IDQA 1FZQA 1N6HA 1S1CA 3TAUA 4M8NE 1KO1A 3GCGA 1JAIA 2WWIA 4KVGA 1DEKA 3AVUA 1JQJC 2ONJA 3W34A 1FTNA 4AYXA 1UKEA 1YR8A 1NIPA 2B21A 3O8RA 4L4UA 2P0EA 2ZITA 3QJYA 1E2FA 4U5XA 3KDSE 1RPZA 4AC9A 5F98A 3PUZA 1D9XA 1JXMA 4CEJA 1W2HA 3T5DA 2FA9A 2DBYA 4TMZA 4UJ3A 3FMFA 3QKTA 1E6CA 3VHXA 5BW8A 1W5TA 1O87A 2ZSEA 4BPBA 1RVDA 2ZR7A 4BZQA 1RYFA 4MYHA 4Q9KA 2R6FA 1XTRA 3FB4A 3NG1A 2DB3A 2W2XA 2JJ8A 2IYQA 2BHRA 1EK0A 1VG9B 3LV8A 1W46A 5CB6A 5KPDA 3PJRA 4US0R 4X8LA 3GP8A 3LBHA 1RW4A 1LVGA 3ZD7A 5JI3E 3CB4A 2Z5FA 4L16A 2GBLA 4GOKA 4NZYA 4HB2A 3IHWA 4DLUA 1NN1A 1RIFA 2JLSA 2YC4C 3QPWA 4PSKA 4RZ2A 3LVRE 4DDVA 1P2VA 1E2GA 1QBKC 1PUJA 4MRNA 5EP3A 5DGXA 5B2ZA 2XTMA 3LAWA 1P4SA 4IRUB 1OKKD 3U5ZB 1US8B 2GDJA 2MSCB 2O0HA 2V8OA 3QKSA 4U7DA 1P62B 1G3IA 3AVOA 1QVRA 2V4ZA 2VPPA 4NH0A 1E2JA 1E2NA 4DDUA 1NG9A 2WHXA 5KSPA 4B3FX 2W58A 5JSZA 1IOZA 1KNQA 1MV5A 1EWRA 3SJCA 4JLDA 1NVVR 3N5CA 4Q66C 1GRNA 2MSDB 3RC3A 4PSVA 3WMGA 4LX0A 2JLQA 4ILEA 3CNLA 1XF9A 4PZYA 5BN3A 5AUQA 1XMJA 4KODA 5KNDA 3HU3A 1NLFA 2OESA 2VH5R 2X2FA 1GIAA 2QL6A 4JJKA 2FSHA 1LV7A 4ASUD 1VCIA 3VX3A 2WKPA 3EAQA 2X2EA 2FDCA 3QBTA 1XCPA 2IS2A 5A0FA 3QOFA 1JB1A 3NH6A 2GXUA 2J7KA 4QGHA 4U00A 4UXHA 3G0HA 1BMFD 3C4JA 3BFKA 2A5JA 3SZRA 3X1WA 1CR1A 2UKDA 5FBRB 4E07A 4R2HA 1TQ6A 1NSTA 1COWD 3SS8A 4AG6A 3LH5A 3C14C 1KDPA 2CE2X 3AB3A 4JYBA 3DMNA 2WSSA 3K1JA 3KFXA 4NCIA 3U60B 2IXGA 3IKJA 1HY3A 3AUXA 4PPFA 4JLOA 3K9LA 2X1VA 3O8CA 5EUMA 2ZQ5A 3AM1A 3U3RA 3WXMA 4GBMA 3K09A 2NPIA 4HDOB 3TKLA 3WBKA 5SZJA 2FWRA 4LJ9A 4KYUA 3CBQA 2QQEA 4ITRC 5L3SA 3SC3A 2RHDA 2ONKA 1W0JA 1G7TA 4NCNA 5BN5A 1RKBA 1F6BA 4ASUA 4UNPA 2PH1A 2QGNA 1XPUA 4HZUA 4HATA 4NP6A 3GMTA 1C9KA 3KUDA 4CW7A 2CEAA 3HR8A 5DN6D 4OQXA 4YMTA 4AK9A 2GXAA 2PT7A 2QNRA 2PL3A 4TQ9A 4TT3D 2PZFA 4D4KA 4FMDF 3H4MA 3NHAA 4P31A 4A1FA 4GT1A 1II9A 1S9HA 2ERYA 1UJ2A 1N6RA 3IDQA 1XEWY 2RGAA 2RHMA 3HU1A 1TF7A 1KNXA 3R20A 3EG5A 3A4LA 1S3SA 4Q1DA 2XOKD 4D81A 4CVNA 5BN4A 2QP9X 2BV3A 4OK3A 3KJIA 1GL6A 3OF5A 4BE7B 1T8UA 2MMGA 3QBVA 3UWOA 2IYRA 2XAUA 3KTAA 1E3MA 2YVUA 5EP2A 3U44A 1UADA 3SN6A 1Z47A 3NEJA 4NCJA 4Q7JB 3TMKA 1SXJA 3OIWA 4BFTA 2YV5A 3U3JA 1Z07A 1KO4A 2EYQA 1VCOA 1KI9A 1OYYA 2C9CA 4NHOA 2J1LA 1Z8FA 3FVQA 5F3WB 5FBQB 2KI5A 3AV0B 1OHHA 4FMCF 2LKCA 1Z0FA 2YINC 3VR4A 1TU3A 2PZGA 1E4YA 1VTKA 4DWJA 4QJ3A 1CJKC 1OSNA 2O8CA 1HE1C 1CJUC 1N5JA 4JVLA 3CR8A 4A8JC 4LV5B 2BBSA 1Z3IX 2IA5A 1JI0A 2CBZA 2Y8EA 3B9PA 2O8FB 2QMEA 3ADKA 3CF0A 3B85A 1KK0A 2O0KA 4UNQA 3VX4A 2OAP1 4CDGA 1Q3HA 5EE0A 3T12A 4KV9A 2JJ2A 2HJGA 1LNZA 4LBVA 3RAPR 2FE4A 4MKIA 1RRCA 3GJXC 3QXJA 2VA8A 1NVWQ 2JJ1D 2XNDA 3A37A 3T06B 3FHOA 3M1IA 1YQTA 3C7KA 1XP8A 1UBGA 1EFTA 2XXAA 1A5TA 1IY1A 2ASEA 2HEIA 1NI3A 2Q3FA 3V4RA 1DAGA 2IEZA 1ZU5A 3D6TB 3GJ4A 5TDHA 4M1TA 4G5GA 1R4AA 4UXJA 5KNBA 1DAMA 3THYB 1X8JA 3LX5A 1XEXA 3KKOA 1XMIA 1VECA 1G1MA 2PMKA 1UKYA 4E03A 3CWZA 3C41J 4HAZA 2G83A 3TSWA 4HLQB 1H8HA 1XFAA 4Q1AA 4MRRA 3Q5DA 4N1AA 1A2BA 2OILA 4M2LA 1SKYE 5LB2A 2WOOA 1QHGA 3A1WA 1W7AA 4WOPA 5HTKA 1CBUA 3SDZA 4FMDB 1G3QA 4Q9LA 3KQKA 4XVQA 2ZJ5A 2ZJZA 3IBGA 4D4JA 4TLAA 4OI0A 4QJ5A 2PJRA 1JPJA 3A6PC 3FTQA 1GL7A 2GJ9A 4K81B 3IQWA 3QPUA 1IXRC 3PFIA 1AIPA 5D3MB 4MGKR 4IXNA 1I2MA 1Z29A 4M9QA 5FUVA 2J0UA 2J46A 1WBDA 3EW9A 1GITA 3KKNA 3K9HA 3ZD6A 1UEJA 4GP7A 3TVDA 4R7ZA 2GEUA 3QF4B 2CL6X 4V0OA 1IJEA 1EX7A 5IF9A 3ZS8A 4NL4H 3X2SA 1PJRA 3NBYC 2Z83A 2EWWA 3AKEA 5TY0A 3FGNA 3O8BA 2FN4A 3D8BA 1OB2A 2VIIA 4D6PA 5JJIA 3EZ9A 4XVUA 2QUZA 1FNMA 4PPNA 4QC2A 5AR1A 4M1WA 3RLFA 5DSZA 4GSYA 5E95A 4DDWA 3IO5A 5DI9A 2VP2A 3GJ3A 4FMCB 4MUAA 5L3QA 1MH1A 1JNYA 5CLQA 3LW8A 5HKKD 3KQHA 2ZJYA 2GCPA 1M74A 4PR0A 3WNBA 4XH9B 1YJ5A 3A4NA 2CE7A 2GCNA 1E4VA 1OIWA 3L82B 1WB9A 3RABA 4B3BA 4EDHA 5GJVC 1TF2A 2BMJA 2ZSFA 3K0CA 2OFXA 3QG1A 4DKXA 2V7QD 4KVAA 3MUFA 3RANA 2RGNC 1N25A 2BEKA 2VHTA 1R0ZA 4IVRA 2ZIAA 4GRAA 4Q4JB 1XXHB 3BERA 2R6CA 3TQCA 2QP4A 3WRXC 4AKHA 2EW1A 1KMQA 3CRW1 3ZZTA 4B74A 3Q72A 5EE9A 4Q03A 2VF8A 1T6NA 4WXPA 4Z51A 2BMEA 4ZKDA 2CCGA 2V1XA 2C2HA 3SYNA 1XDBA 4EPWA 1M34E 1XPRA 1LTQA 2OV2A 1VIAA 4R98A 3RSLA 4B34A 4Z54A 2A30A 2ZYVX 3NHBA 5FTMA 3V4FA 5F9HA 1JR3D 3CX7A 2PLFA 3CZQA 1ZMXA 4TMXA 5FFMA 2HCBA 3FMIA 1XTIA 3VR5A 1KZ7B 1Z08A 3TH5A 1Q22A 4MKHA 3U61B 1W47A 1OT3A 3HR7A 1SHKA 1ZJ6A 2FOLA 1AKYA 4BLRA 3LDAA 1UKZA 2ZJOA 3T34A 3KKMA 2A2ZA 4IKEA 2IF0A 2O0JA 2IYZA 4HLDA 1D5CA 1S0UA 2BBTA 3EPJA 1P2SA 1E1RD 2V7QA 3AKYA 2ZPTX 4A8JB 4ESVA 2ZRDA 4X8OA 5AJXA 3A1VA 3B5JA 2IUTA 1P9RA 4A92A 3B82A 3VR2A 3HYTA 3VKGA 2EFGA 4B47A 4M9XA 3U4QB 2V6JA 4D80A 3K70D 4KLNA 3BWDD 4MRSA 2C9YA 2O5VA 4F4IA 2WMOB 1DELA 4RFVA 4QOSA 4NU0A 1ZM7A 2IK8A 3V9PA 4TWZA 1AS2A 1E2KA 2C78A 2A7QA 2WV9A 2YYZA 1YKSA 3EA5A 3LBNA 1GNRA 3BIFA 3VMFA 1QVAA 1W2GA 4RD3A 2IF2A 3KB2A 2ZAMA 4BFVA 1JPNA 1MO4A 2XZPA 2O8DA 3L8ZA 5CYPA 2ZI6A 2ZRKA 1SGWA 4JLAA 2P6UA 2C95A 1E32A 2ZRFA 3QY0A 1W49A 4K8OA 4NYIR 1J7KA 1II8B 1ZC4A 1TMKA 3TSOA 1E69A 4DCVA 4IOKA 2IYUA 1E1RA 1EFRA 1E79D 4KFUA 2H7VA 1FNNA 4KAXA 2NMVA 5BWMA 5LD2C 3GLHB 3CX8A 2QSYA 3KXLA 4B3CA 2GCOB 1UDWA 2H1LA 2CDNA 1E96A 2CJWB 2VF7A 1ZNWA 4TZ0A 1TPZA 2WJVA 3B6EA 1OXVA 1MO5A 1VKJA 4FD2A 2OG2A 1KJWA 4JKIA 4UQOA 3W9YA 3ZVLA 2C8VA 1QG4A 4RZXA 1CS4C 4AYTA 4II7A 4AD8A 1RFLA 4MA4A 4JT2A 1U98A 2X19A 4LJYA 5EUQB 2ZAOA 2WIBA 2ANCA 2MMCA 1X1SA 3FMOB 1I4LD 4JL6A 1XPOA 2ZVPX 3W3ZB 2EU8A 4ARZB 1SZPA 4HB3A 4YLGA 1AZTA 4QGGA 3B78A 2ZRBA 2DR3A 2QORA 1TUEA 1T3HA 1II0A 3QIAA 1HQCA 4ZI2A 2J0SA 1LS1A 4GZMA 1SHZA 3ICEA 3IGFA 2ZM5A 2G3YA 5FOUA 2YKGA 1E2EA 4P3YA 1CR2A 4BZPA 1XTSA 4A4DA 3RS7A 2VP5A 4Q4HB 5DISB 1P73A 5FTNA 5FBLB 1TU4A 3H0KA 3LO5A 4Q01A 4H1UA 1G4UR 4BLQA 2SHKA 2HYIC 2CVFA 4ZCLA 3BH0A 4MYTA 4LHYA 1OW3B 2QY9A 1P60A 3GJ8A 1G291 1X86B 4ZIRA 2RKOA 4EPRA 1LS6A 3LY5A 2F55A 4XJXA 1WCV1 2FEMA 3CW2A 3MAAC 4M1YA 4TYYA 3G5UA 4PZZA 4QGAA 1GKYA 4JBWA 2ZSDA 2FJUA 2WWXA 1OV4A 2WWFA 1TQ4A 1W36D 2NGRA 4NCKA 3UANA 1OFTA 4IHQA 4TSFA 4MDFA 1T5LA 2QP3A 1G8FA 4Q1FA 4QM7A 4JLVA 1SVIA 2RGXA 3VNUA 1QZXA 4M0LA 4WXRA 1HTWA 4DLYA 3VQTA 5KU1A 5TARA 2IX3A 4RCZA 4JLNA 1TAGA 2IUSA 5FI1B 2QI9C 2AD5A 4IEIA 1CKEA 1Q57A 3FFBA 1MABB 4ZDKA 5GADl 2CHGA 3KB1A 1KSFX 3U7FB 1W4BA 1HUQA 4BFWA 4OKSA 1ZD1A 2C03A 3W8RA 2F1JA 3ZIAA 3BFXA 1Q3TA 4J0QA 4ZDWA 4DLVA 4OBEA 2Z6VA 3I92A 4M9SA 1U2RA 2C04A 4KI0A 4CF7A 3R9WA 2IWRA 1KTVA 3QEOA 1QHHB 3AVQA 3GJ7A 2RAPA 4EQ6B 4Z8XA 4XSGA 5J4HA 3EARA 1SVLA 4LYFA 5FOTA 4TYNA 1E9RA 2PZEA 2ZYUX 3DZ8A 4LYHA 3THXB 2W0MA 3A8TA 1EFUA 3W5IA 1E9BA 1A7JA 2ZUBA 1KYIA 3DEFA 3IUYA 2F1HA 2IBMA 3H1TA 3OZXA 5G3YA 2XGJA 4HI0E 1ZCBA 3I72A 3PXGA 3S1AA 4HLUA 1BYUA 1MOZA 3BC1A 4QL3A 4TLBA 5FBWB 4Q02A 4B35A 4BWYA 4JL8A 4BECA 4DLWA 3QKRA 4C7OB 2J7PD 2CHVA 2WSMA 3T1VA 1B0UA 2G77B 1D2EA 3IO3A 2ZJBA 2V54A 3BAFA 3Q7PA 4KU4A 5ELXA 5EXTA 2OCAA 4TTRA 3CZPA 2K5UA 5DLQC 1G20E 1YR9A 3KKPA 2WPDA 3HPQA 1G21E 4LJ4A 3L0SA 2ZR0A 2REOA 1AJEA 2IYYA 2VP0A 5JCPA 4P4SB 4A36A 5J5CA 2FGKA 2GJ8A 4XTCS 1YR7A 1XJ0A 2EFCB 2JA1A 4LJ7A 2OXCA 4PHFA 4HLCA 2RGDA 4IDPA 3GEEA 3LNCA 5IRCD 5LD2B 2RGBA 3P20A 4MGIR 4JVMA 5FOSA 4R71A 2D7DA 1NMYA 1KDOA 1IAQA 1T91A 2VYFA 5GVSA 1GAJA 1ZRHA 5G53C 3KUCA 2AKYA 4KSBA 5FOXA 2VHUA 4B33A 1AM4D 1I4TD 1C4OA 1NIJA 4OQLA 2P5TB 1E2LA 1KAGA 1M2OB 2R62A 4C0BA 5EP4A 2OBMA 3QXHA 3U7EB 2QU8A 1YZKA 2P6NA 3MSXA 4GOJA 4Q4JA 1GILA 3ZS9A 1OLOA 1UEIA 4DSUA 3EX7C 3QKUA 3REFA 5JFGA 3P32A 4PPGA 4PHGA 3BFVA 5M04A 3FPAA 1OXSC 2V3CC 2XSZA 5B64A 1YZQA 2W0SA 2ZJ2A 3HU2A 5DHFA 3UMSA 1IY0A 3RDPA 4XWAA 5JS7A 2GF9A 1Z2CA 4C4PA 2WMNB 3T5GA 2W6IA 3GLIA 1Y63A 3UG7A 1C1YA 1OYWA 4I1UA 1OH6A 2OCBA 3MWJA 2HF8A 4DRZA 5IK2A 3CNOA 4HDCA 1VPLA 4DXAA 3SFZA 4PXAA 4ZCMA 4LI0A 3B9QA 1KDRA 4JLBA 5JMTA 2BMFA 1NMXA 4LYAA 2CXXA 3MJRA 4JLJA 3SEAA 4P33A 5FL3A 3CNNA 2BVNA 2PX0A 3AVTA 1ZUNB 2QQ0A 1NBMD 3NKVA 2PMDA 1S4QA 1U8ZA 4A9AA 4MUBA 5CJPA 2BKEA 3EZ7A 1EG7A 4Y0AA 4KFRA 3KZ1E 4KFSA 1R5OA 1OXXK 3K8YA 3NBXX 3X1XA 3LBIA 4D0NA 3A4MA 3BH6A 1D6JA 2D4HA 3QG5A 1NKTA 1OH5A 3BH7A 1FFHA 2L0XA 5FPYA 4B3DA 4D25A 2PJZA 3UMRA 4DDTA 4PZLA 3CF2A 4NDZA 1IQPA 5FTLA 3QSYA 1DO2A 2R65A 3AQ4A 3K0AB 3W8NA 1G9XA 1N6LA 4DCUA 4X8MA 5AUPB 3IPXA 2Q6TA 2EQBA 1LW7A 3LQQA 1U94A 2IS1A 3CH4B 5IHPA 3EWSA 1AGPA 4CYMA 3EPLA 2ZI3A 1E2HA 2I4IA 3ZLJA 2F9LA 1II8A 1KI2A 1OF1A 5K8IA 2FV8A 1X8KA 1NBMA 2ZI5A 5DNYB 3PEUA 4JLPA 2DWQA 4Q00A 5SZIA 2ODBA 1CP2A 3HDTA 5DH9A 3EIHA 3GLHA 4V0NA 2ANBA 3NH9A 4FW9A 1E0JA 2GCOA 2OLJA 3WBJA 4DB4A 5L3RA 1QHYA 4QXAA 2CJWA 1T5IA 1BYIA 2DHRA 4GI7A 1Q0UA 1WBBA 2WSSD 3VR3A 2PCJA 5DHAA 3VNVA 2HDNB 1Z0JA 1CIPA 1FPMA 3TGPA 3PUYA 4B44A 3VAAA 2V6IA 2QGZA 3GLGB 5F9FA 4GP6A 4MKFA 1G16A 1FUUA 4ARZA 1XTQA 1KO8A 3A36A 2DCUA 2D06A 1TEXA 4QNMA 3DO6A 1VYTA 5KOYA 1GOTA 4LBWA 4LV6A 1XCMA 4RCYA 3BS4A 2FPLA 1VG1A 3C8UA 4PFSA 4WA7A 4EAQA 1UBFA 1W0JD 4JIMA 3HYRA 4Z1MA 3TRFA 1G19A 3WYFA 4F4JA 5IDVA 1CF4A 1BS1A 1HEIA 4URXR 2JIZD 4AKIA 2AXNA 5DIFA 2F43B 2ZU0C 3LXXA 3CPHA 4KCGA 4TMKA 4DIEA 5LB4A 4W5HA 2TMKA 4HAWA 3RWOA 2GETA 3Q5EA 3K0EA 4BFSA 1GL9B 1P2TA 2REBA 4O2LA 2JLRA 5P21A 1UPTA 1E2QA 3CF6R 3KFVA 1E0KA 4MGZR 5B58C 2O8BB 2RGNA 4LC0A 4NPHA 3AF2A 4XWKA 2VTKA 1KI6A 1YHNA 1N0WA 2G1JA 3ZDQA 3T1TA 1A1VA 3HPRA 3L8YA 4CEHA 1AZSC 3JVVA 1JJ7A 4OYHA 1U81A 3MJHA 1GVNB 1L4UA 1SXJD 4DHEA 1EESA 4EJSC 3OAAA 3FFAA 4KXFB 4PC6A 1KKLA 4M1SA 4PQYA 2ZANA 1RJ9B 2ATXA 2JIZA 4NTZA 2CCKA 2WVJA 3GJ6A 2O8EA 1OHHD 3OEED 3CRVA 1GP2A 1OXUA 1W48A 4YXWA 3WYGA 2FSGA 4L9SA 1U0HC 2WAYA 4GZLA 1G3MA 2C9OA 2QZ4A 4NBSA 5UKDA 3H2YA 2KBEA 3RVBA 4RD1A 1DARA 1R0XA 3P26A 1M7GA 1WXQA 2E9SA 3OFNA 2QMOA 5KPJA 1JBKA 1EWQA 3FHCB 3GEHA 3QQ5A 4A2WA 2OAQ1 5CDFA 1DG3A 2PLRA 4TL7A 5F2EA 1UFQA 2JJ2D 4IFEA 1JJVA 3THXA 5AUNB 3T35A 4U02A 4KYIB 2XNDD 2XZLA 5FPKA 1W0KD 3BORA 2J0QA 4BGDA 1VHLA 3EWAA 5CYOA 3DKVA 1O3YA 1T0JB 4C7OA 4TTPA 5K8TA 2ZRHA 5TXGA 1N5LA 3MMPA 3QEJA 2D2FA 3LLUA 1KDTA 2P65A 1AQUA 3OEEA 4OI4A 3MWYW 3RHFA 4QM6A 1GM5A 3FKQA 4LHXA 3PVSA 1ZNZA 1WDTA 3U6BA 4JLMA 2AKAB 3DVLA 4HAYA 1E99A 4OHZA 1H8HD 1NG1A 1WP9A 2AL7A 2ZRAA 3RS3A 3PENA 4ZCIA 4P4SA 5J4YA 3TLXA 4DVGA 1E2PA 1VHTA 3CR7A 4V0MA 3FDIA 4CT4B 2JLXA 1JECA 2WJYA 5EXSA 3L43A 1DG1G 1XWIA 1VMAA 2FZLA 2Z43A 3SHFA 1KJZA 1R0YA 1GUAA 3DM9B 1NVUQ 1Y3AA 2CL7X 4P0TA 3OE7A 4MYUA 4LYJA 2ZXUA 4B75A 1NN0A 2V9PA 3ZYCA 4B6FA 4BLTA 4A2PA 4RFSB 1OFUX 2P67A 4DCSA 3ZGXA 2JDIA 3LD9A 4AIIA 4B6EA 1W0KA 3OHMA 4D0LB 4OK5A 5FR1A 4EPTA 4RJLA 1K5GA 2ODNA 4OI2A 2DY1A 3N70A 1HE8B 2QPOA 621PA 4AKGA 1P2UA 3CX6A 4DLRA 4DSOA 1G7RA 4IVPA 4BUJA 3NDBB 1AKEA 1J8MF 3NDPA 3I61A 4PAOA 4BLOA 4D4MA 2IYSA 3TUJC 3BK7A 4C2TA 4RSGA 5GJCA 2BM0A 5HCNA 3P4YA 4DIDA 1M6NA 2AX4A 1XD2B 2QG6A 3NEYA 4JSTA 4DUGD 4F4CA 4R2IA 4A0HA 5J4VA 1U9IC 1F2UB 1MO3A 2RGGA 3SR0A 2HT1A 3P27A 1AGRA 4Y0VA 1N0UA 2HYDA 2VHCA 2ZVQX 1JR3E 4TMTA 1OH8A 4PSAA 2VSFA 4UJ5A 2CCJA 3TUZC 3I1FA 1T9HA 1HYQA 1KZGB 5JWRA 2DWPA 4URWR 4LJ5A 1IN4A 5FR2A 2G0NA 5HZKA 1J70A 5FPSA 4LZZA 1T3SA 4F93B 2PT5A 3HWSA 4Q4AB 1P7CA 1ZW6A 2Q3MA 2QTHA 1HQYE 3JZMA 4D4LA 4GOXA 1KMHB 1R8QA 3B1YA 4TLDA 4LBYA 2IW3A 1WMSA 1OFHA 4PANA 4EJSB 1Z0DA 3GLFB 1CR0A 4OJQA 5LPNA 2QMHA 4DUGA 2BWJA 721PA 3A1UA 4EUNA 3AKDA 2J41A 3LFUA 3T15A 2DFNA 4JS0A 3CUEF 1E0AA 1IONA 3R8FA 1PLJA 3B60A 3SOPA 4HUTA 2REXB 1FQKA 1MRNA 4C0KA 5FUXA 4WZAE 4IDOA 2OBNA 4YQFA 1SKQA 1RRFA 1GFIA 1UBCA 2OZEA 3ETLA 2P2LA 4GPTA 1FP6A 4PC1A 2WWYA 1E9AA 3SU8A 2QM8A 4PX9A 4UNNA 2OE2A 2QT0A 2F3TA 221PA 3PITA 1XEFA 1ZNYA 3VTKA 1QHIA 5FBVB 3N2EA 3QVUA 1G7SA 1F2TB 1M1YE 2QSZA 4P4UA 4DLTA 4ERNA 2ATVA 2X77A 1DPFA 1NJFA 4C3ZA 2DYKA 2AHOA 1US8A 2VSOA 3DOEA 3REGA 2BOVA 4Q5IA 4JL5A 1JEDA 3L0IB 3M6AA 3IHLA 1KGDA 2NTYC 1RC8A 5CLLA 3B13B 3TSZA 4QJ4A 1FUKA 2NQ2C 4TTQA 5EP1A 4ACAA 3SE0A 2IXFA 3GLGA 2VRWA 1IBRA 2GHIA 3C5HA 3NVAA 3QPVA 2IUUA 1XEWX 4IEEA 1HH4A 4YMUA 3RS4A 2V1UA 4JMPA 1CRQA 1W44A 2ZE5A 1EFRD 1L4YA 3WMFA 3PUXA 4PAQA 4BEJA 4A6XA 4M1OA 1ZC3A 1KI3A 3UPUA 1PZNA 2OM2A 2GEVA 1KI8A 4HYYA 1AQYA 1UBEA 4JVSB 5H8WA 3EPHA 3OESA 4B3XA 1VDZA 2GRJA 2ZI9A 2GZAA 1IY2A 2NZ8A 1ZP6A 2YWHA 3IIMA 4S2EA 3RS0A 2WAXA 1VCMA 1CJVC 2JASA 4UNSA 3MCAA 4URZR 4EPYA 3M4YA 5KHOC 1UAAA 5GJWC 1YZGA 2WJHA 3RS5A 4LPKA 4DEYA 1VG8A 2R9VA 2ZRJA 1Q1QA 1LF5A 2QENA 1U90A 3QF7A 1U8YA 3TBKA 1I2DA 1ZVQA 3CPEA 2PEYA 3IIJA 3D3QA 5E7MA 3ZJYA 4OQFA 4MGYR 4C0HA 1TTTA 4GMDA 1XB2A 2IEYA 1F3OA 5K8LA 3TNFA 5KUTA 5HR5A 4CEIB 1L8QA 4M1KA 2GTPA 3P1JA 2GVZC 2AWNA 1JAHA 3BD9A 3KXIA 1GRQA 3NXSA 3CRMA 4IOLA 2OHFA 1U99A 4FINA 5HPYB 4E5UA 2BCJQ 1K5DA 3T1QA 3IBYA 5KDOA 1B23P 1J90A 5E7JA 1KO7A 2KBFA 2XTNA 4I81A 5C4MA 2FZ4A 1ZD9A 3U7GA 4G5SA 1RZ3A 1R2QA 5KYKA 3EZFA 4PAMA 1OPXA 2BCGY 5K8UA 3GD7A 1P75A 2B92A 1CEEA 3UIEA 1W4CA 2ZE7A 4ZV4A 5TV2A 4TSFD 1Z83A 5AJWA 3WNCA 5JWOA 4TQAA 3CKLA 1HA3A 1H8EA 1ZYUA 4M4SA 4NYJQ 4IVQA 2R44A 3H86A 5L3VA 4Q1EA 4N3NA 3ICQB 1S2MA 3PQCA 4H9GA 4JVNA 2GZHA 1Z22A 5EQTA 2IWHA 5IT5A 1GRRA 3ZZ0A 1ODFA 4FCWA 4NYMQ 2G88A 2QAGC 4Q9JA 1N5KA 3ZIAD 1OH7A 2HCJB 3E2IA 4E22A 1RYHA 4B2LA 4LSGA 2A5DA 4Q19A 2VSXA 3E5HA 4C0LA 3PV0A 1Z6AA 3WYAA 3MWLA 2WKQA 2GVDC 4I4LA 5CJ2A 2WBLC 1Q20A 4DCNA 1XD9A 3NIBA 2CL0X 2J87A 3PEVA 2O8FA 3AH8A 2J9RA 2WWWA 2KE5A 5DYIA 2IS6A 1IN6A 2ECKA 1SVWA 2XJ4A 4PQFA 1RRPA 4XTRA 2GF0A 1KK1A 1NLYA 1OJLA 1KIMA 2P3SA 1CJTC 2ZREA 2ZRIA 3GFPA 4Q7LA 4RVCA 5EE3A 5KSZA 1LY1A 2XJ9A 2OUKA 4DC9A 5CB8A 3GLIE 1XTJA 1UKVY 2W00A 3R7WB 2AN9A 1A4RA 2QTVB 4RFSA 1SVKA 1ZU4A 2OFOA 4OHWA 1W1WA 1E2IA 3KX2A 1SVMA 4NE2A 3B1XA 4LK2A 2WPDD 2BJVA 2XB4A 3BXZA 4IXMA 3VR1A 3CRQA 4B43A 5L3SB 3THYA 2ZU6A 4Q1BA 2Q0HA 2ZE6A 4A2QA 2P6RA 4H1VA 4C2UA 1Q12A 2J45A 1E9EA 1K6MA 1M7BA 1Z6XA 1ZCAA 1HT2E 1X1RA 4MYCA 5B30A 1UF9A 2GNOA 4RY2A 5JJLA 2H57A 1GWNA 3NBZC 1XMSA 5CIQA 3U3OA 2RB4A 3HJNA 4AKEA 1XBTA 1ZIOA 2HXSA 4O0MA 4F92B 4POAA 5E3HA 1G8HA 2FPKA 3L0PA 3TR5A 5JZVA 3TQFA 3U3MA 5D3MA 4KITB 3RS2A 4F7WA 4ZKEA 4Q9HA 4HB0A 2YOHA 3U7HB 1V5WA 2HXYA 4MH0R 4RD0A 4CZ2A 1BKDR 4AWXA 5BYJA 2GEDA 5C4GB 2R6DA 2IS4A 4PO8A 1Z63A 1ZUIA 1S9DA 3KTAB 3AVWA 3BBPA 3QF4A 1ZM4A 1NMZA 2XSZD 4OQMA 3LA6A 2CNWD 1NBME 3C16C 4B76A 3RYTC 4Q4AA 1YZTA 2CLDX 4D82A 3CRRA 1EX6A 3CIOA 2W6ID 1CULC 3EC1A 4A0GA 2WOJA 3SYKA 3V00A 4EJSA 1KHTA 2Q3HA 3GLFA 5IK2D 1CLUA 1L7VC 3ZQ6A 6Q21A 2O8CB 2NZJA 2JLZA 3A1SA 4JZKA
chains in the Genus database with same CATH superfamily
4C43A 3IA2A 3HVIA 1OUMA 4W8HA 1PR0A 1EEXB 1FDRA 3W6PA 4E5YA 4XXHA 4EKDA 1YBHA 5IDWA 3QX7A 2ZJ0A 2EFDB 3S1SA 3R9XA 5H3CA 4J91A 1JLRA 3O3OB 2QAJA 2QA5A 1CJSA 1JHVA 4BBPA 1XXHA 3DR3A 1UUFA 3L8EA 4FE7A 4ZHQB 5FL7A 5EEHA 1DHRA 1PEDA 1T8TA 3A6KA 1NI5A 2MSEB 1SU6A 1LC3A 1E63A 1N1MA 2BRUC 1MQSA 1EP2B 2G9QA 2XBLA 1JBQA 3DT6A 3EC2A 3MLEA 4OHCA 1HEYA 1N5IA 4G84A 4AJIA 4BGEA 5JNVA 1XTUA 3MBOA 3S8EA 2C2BA 3WQRA 1ANKA 3KEMA 2EAUA 2Z5GA 4MTLA 1QHXA 5C1OA 1AUVA 5BV8A 2QD4A 5C8XA 3CGWA 4QHTA 3GHYA 1XEXB 2MR6A 1MG0A 4S35A 2XODA 2VNHA 3FMGA 4MB2A 1NN3A 3KPWA 3MQ2A 2FY8A 3QXXA 3CZ9A 1XRSB 4N5HX 3DEIA 1V8PA 1Y37A 1BEZA 1UC8A 1JILA 3B70A 1YH3A 1OI2A 3GRPA 4IDDA 4CXMA 1IUNA 4IBOA 3M9XA 4EJMA 3FKJA 4C06A 4RJ2A 3ZHSA 1SK9A 2IZ5A 1DBSA 2A7XA 3G9XA 3Q7RA 2Y1WA 1T8WA 4OREX 4A8JA 3FNEA 5DO9A 1D1SA 1E1CA 3GFOA 3PGA1 4YIKA 2G6BA 4QU9A 4XARA 1W5BA 4YB8A 3NX4A 1FUIA 1YB6A 4G09A 4R1TA 5LCXA 1TDJA 1AGYA 5JCXA 3P4XA 1ESMA 8MHTA 4N5DA 4IWYA 3MTAA 4L7VA 3PBKA 4XM0A 1R16A 3QOWA 1J20A 5TEVA 4KQFA 5HUQA 821PA 3TRKA 1IMJA 4KL8S 3VR3D 4B3GA 4MCIA 1PGNA 1X42A 2PXXA 4OCZA 5J4KA 1WU7A 2NO7A 4FXOA 2RG7A 1RZVA 2YZ7A 4UMEA 2R00C 1P72A 1Y9EA 2IHYA 1VL1A 1PFVA 2WJAA 2WHPB 3TK1A 4P32A 1C8LA 4RTKA 1K4KA 1E20A 1D4OA 3N2IA 4M99A 2HTFA 2BM1A 4CUZA 5C51B 3KE9A 3GT3A 4GPBA 3VKHA 2JCYA 3EIQA 4DM4A 1XX6A 2R0QC 1IATA 1HC7A 5FJJA 3WSTA 4C89A 5IVKA 3G9UA 4HAVA 5H4HA 2ZSKA 3L4KA 1Q14A 2AWOA 2VF2A 3IA7A 4LEIA 1EDDA 1X8XA 2OV8A 2ZIZA 3JYPA 3PPVA 3ROXA 4EA6A 4RKEA 1RRGA 5LYJA 2VP4A 5FUBA 1GA1A 2I2AA 2WICA 2QX8A 2PKXA 1S96A 4FFBA 4MWEA 3AQIA 3SQMA 3IUJA 2E4ZA 3NW9A 5CW2A 4DWVA 1H2FA 4QDZA 1H66A 4O59O 2FW9A 1DBPA 4MUXA 4M9RA 1KVQA 3VC2A 2EFHB 2YVLA 1JSRA 2WD7A 3SSAA 4L72A 3ZHXA 1L5GB 4GBJA 4IZOA 3WWOA 1U2GC 2CXSA 4CGZA 2WYIA 1C2TA 2EQAA 2P9TA 2Z4SA 2WG2A 3HJGA 1DAFA 1U0TA 3JD0A 3IVGA 3LKBA 4QIHA 1PJLA 4WXYB 1LVHA 2PD3A 2FPUA 3KE8A 2DFDA 4XLTA 3TSCA 5A06A 2CZCA 5MF6A 1Q0ZA 1ZM9A 1CQIA 2FPSA 3FLMA 4DSZA 4R0MA 2Q7XA 1GUZA 5K6AC 1G8YA 3EMKA 3M8KA 3NP7A 4FMBB 1RLMA 3NZEA 4G0VA 2Q9AA 4HDMA 2GM9A 2B1GA 3MWEB 2X5NA 4ZGWA 5LQMA 1EH5A 1A5SB 6ABPA 3AGPA 1W88A 4MCJA 1KJ9A 4QBTA 3GEIA 4B9AA 4FZVA 1E6UA 4MLDA 3BPSA 4MRMB 1SBHA 3IOBA 5EMHA 4HUQB 2VO1A 5G41A 4IF4A 3RJTA 2FQXA 2NUPA 2XGSA 4AN1A 1IN7A 3QNMA 4AMGA 2NVWA 1D2NA 4H4DA 5EJEA 1CDZA 2KB0A 4QFMA 2AA3A 3GARA 4G07A 2I7VA 2YQ5A 4Q4HA 5DXJA 2VQFB 1EQAA 3LBAA 4G63A 3WVNA 1L8XA 2ZB2A 4BO8A 3QTTA 1VJ5A 2VJCA 4YXWD 1U0JA 4F0JA 3T1NA 4CM5A 4HGOA 2X4LA 3F47A 2R4TA 4LOAA 5J58A 2X7XA 4MMZB 3R8CA 4KSCA 3L7IA 3G2PA 3E3AA 3UMFA 4FONA 5DYGA 5A0TA 5CD1A 4JUIA 3FUUA 2XA2A 5A5FA 3YASA 2H29A 1YVEI 2HCTA 3DGFC 3OFND 3RBVA 2BEWA 1G9TA 1W36C 4ZEWA 3OVMA 3C0KA 2A8YA 5HBRA 1XJQA 2OOKA 5AW9A 2OM6A 1J0CA 4GSLA 1TGVA 4ZA2A 4XWTA 5LQJA 4DUYB 1FMLA 4YJDA 3WRXA 4Q12A 2QLBA 3EXHA 2ZROA 4AG5A 5EY5B 1FYEA 2EVWX 2WMDA 2Y93A 1VGRA 2HMSA 3NUGA 4FHEA 2XKJE 5FUYA 4X7MA 3SNHA 1L5LA 4E5SA 2AVDA 2E82A 1VKNA 1WQ3A 2E5LB 3TOSA 1RS0A 3KALA 3TD6A 3B8HA 1NQAO 1QG6A 1Z88A 2EBUA 1X9HA 4EZEA 3DZCA 3VBEA 4LZAA 2QTVA 2NU8B 3RRNA 5BOSA 3MCVA 4R4JA 5LA6F 3TFWA 3Q0EA 1L7QA 2RKWA 4FDLA 4B2PA 1U6JA 4CETA 1UK9A 3FCAA 3Q3HA 2KJQA 2HBYA 2QRQA 2XTZA 3DOFA 3UAWA 1WMFA 4YJKA 5ALKA 1I36A 1XDWA 1T5TA 2R5WA 1Y7PA 1A7KA 4PC3A 5J1SB 3WBFA 1QHHA 3NWOA 2JIDA 2RHLA 4JQZA 4JP8A 2PSSA 3R44A 5FT9A 2F67A 2FSPA 2BN4A 2V55B 1X74A 1H9CA 1EXVA 2GT1A 5CMLA 4DYDA 4AULA 3I5YA 4ESHA 1I24A 2PFKA 3KVVA 4DYHA 2BH2A 4EPVA 2F3PA 1SQ6A 4PO9A 3ZWXA 4CMBA 3SKXA 2K2QB 4WZBE 2UZIR 2JDID 4F91B 1HDGO 1ORDA 5LR6A 2PO5A 4TWJA 3BDVA 3OIFA 4QG7A 3ZJVA 1FDTA 4RS3A 5DI3B 3IP1A 3U3XA 3PRHA 2IITA 4FYYA 1NFRA 2REQB 3F7MA 4B7CA 1MO6A 2BJWA 1SKBA 4B84A 4DLZA 4EHBA 3DKPA 1U5BA 4AJPA 3PCRB 1H4QA 3G13A 3GLSA 3ZVNA 3T4UA 4V2IA 5DJ5A 2MTBA 2J6HA 1WY5A 5BRNA 2QT1A 3EVCA 3REQA 3SHOA 2EP7A 1RAIA 5E7IA 16PKA 3RFUA 4D8YA 4RAOA 2HPVA 4G1UC 2BFFB 2Z08A 5B12A 5CDTA 3OIYA 3H16A 1ECGA 2XOEA 2OP0A 3K4HA 2ZDQA 2QDKA 4JOQA 4E5DA 3I2YX 1CUXA 2XPCA 1HWYA 3O1LA 5ADWA 2XYPA 3PFHA 4LNHA 4WACA 1QFXA 1Y5RA 4WASA 3TZLA 4M7OA 5CK5A 3NWJA 4ZIRB 2PLNA 1T4GA 1EJ0A 1UM8A 2IIPA 3R6LA 1ECLA 3RJMA 4A3SA 3NDIA 1OFIA 3CONA 1EWYA 4LF5B 4K9NA 3IUSA 3KR0A 4DUZB 2GUWA 2IXAA 2Q5QA 3NS7A 1BIFA 1EAYA 4LJ8A 1BWSA 3BHIA 2AQKA 2P11A 3H19A 4QFCA 5AHXA 1N2OA 4JI3B 3KL4A 3WLEA 4FCTA 4DLAA 2WJJA 1GZ6A 3K4PA 5BQ5A 5KYNA 3GLGE 2AUTA 4LPSA 4YCDA 3RVRA 4B46A 1DC3A 3T61A 5IBQA 2XOKA 3TJMA 1PUXA 4M54A 4EENA 3BB1A 2HC9A 1DB3A 2QTGA 3RAJA 8GPBA 1WA5A 4Y67A 1ZK4A 3TKYA 3DBOB 3U6KA 1R0WA 3U4IA 2OFPA 5KTRA 2QJWA 2FEXA 4ZHQA 3RYFA 1P5JA 1YASA 1V39A 4RHFA 3L6EA 4E2FA 1WF6A 3FCSB 4K46A 1KSHA 3GPBA 1TQDA 3AF0A 3JZAA 2YJGA 2Q9BA 3NUQA 4H1HA 5J5AA 3UW1A 1Z28A 5HYVA 4INZA 1K7CA 5G2OA 1KEPA 2FVYA 2BR5A 1QRDA 2DBRA 2JFGA 5KHLB 2V58A 2MYPA 2HWUA 5L9AA 2YRFA 3V6LA 1T6BY 4DA4A 1SB9A 2MWMA 1MFZA 1JKXA 1MOSA 4LUCA 1GCGA 3GNLA 3UBTA 2BMVA 4U7PB 1NLZA 4J90A 2X4DA 2H4HA 4EKIA 3T3NA 2ROQA 3OA0A 1IJBA 1GRVA 3QITA 4FI3F 4EGSA 1N6KA 2D5CA 4GQBA 4K6GA 5I6DA 5CDYA 1L4NA 4AURA 2A5YB 5BN1A 2AE1A 1TNDA 4BO5A 1JDTA 3SPXA 1CQXA 1NVGA 1E3WA 2VDUE 3CM0A 1NAIA 3DMTC 1VI2A 2C0PA 2A5FA 1A3CA 1T3ZA 1JQ5A 1YL5A 4C0SA 1C3EA 1ZINA 2D2EA 1E66A 2IYEA 3FPJA 3FWYA 3LDHA 3LWDA 4IRMA 1JHPA 2CWDA 3NHUA 5AKLA 3H0EA 1HKHA 3FLEA 2GESA 3AC0A 3EAGA 1QOQB 3W5JA 1MDFA 3RSZA 2B1JA 4BJ6A 1DDGA 1TCUA 4FIZA 4A03A 5C3UA 3C3YA 3PYXA 3RJ9A 1SC3A 1XLUA 2W2KB 5IJ9B 4RESA 2ZT6A 1IVNA 1F5NA 1Z7EA 3IPYA 3U31A 1FS6A 1ZDMA 1PLKA 4Z7QB 3OCJA 2B7BA 1IEWA 4L9WA 4DSTA 4JXXA 1MUUA 1PX0A 1Q0HA 1UP7A 3NEAA 3A6EA 4ZXPA 4K03A 2WHPA 2A35A 1RPNA 4EOGA 4GX5A 1KFKB 1YRBA 4EJFA 4A15A 4HFMA 1KH1A 5KVCA 1IY8A 2YZNA 3IMEA 3OJOA 3ADDA 1ADFA 3IIKA 1NF8A 2IL1A 4X44A 3WWDA 2E55A 3AHJA 2ODTX 1PWXA 1QHFA 4Q16A 3ZE9A 1WQ1R 3EASA 3OIUA 5BUCA 3V97A 2IDZA 2EZ4A 1P74A 1P9NA 5J4LA 1U8EA 4R84A 4YDHB 4E2ZA 3Q12A 4ARVA 4BKQA 3OCZA 4FFDA 4WFKA 1TQ2A 1L5FA 1F6DA 4J16A 1YXMA 1XRLA 2BBWA 4GDMA 1NOJA 4WZ6A 3WK5A 1E7YA 4XDZA 2H0QA 1L5OA 1PNTA 4Z9XA 4EABA 4PXSA 3PD7A 1R5BA 3IJPA 3U2QA 1WMBA 1OIXA 3K2BA 1J25A 3DEKA 3OKPA 3VO2A 3UJBA 3R24A 2VP9A 4AX4A 1Z6QA 4Q24A 3SEQA 3G68A 2IHVA 1E3TA 1D9ZA 2HA4A 2JGMA 3EW7A 1X9GA 1IG0A 4O2BF 5IYZB 1IB0A 3C3KA 1TTQB 4P86A 4EYKA 2DY0A 2PWAA 5EIBC 2W2VA 2HQOA 5E7QA 3RUHA 4AJHA 4XD2A 4DR7B 2DFLA 2FZGA 4GSKA 2C5LA 3HHEA 4RVOA 2GN4A 4RZSA 4JT4A 2I91A 4J0KA 3ZLBA 1ZZGA 2E48A 5FEUA 2OSBA 1BN6A 1ELOA 3MRSA 4HUQA 4R0VA 4YIHA 3WOVA 1A96A 3RBXA 1RR6A 1UZUA 2R5FA 4C20A 4C7JA 2IUEA 3IQXA 5T8KC 4NK5A 3VAYA 4NCBA 1WW3A 3KZMA 4J4HA 3N6VA 4CTKA 4EHNA 4DV6B 3B1WA 1BEEA 1M8FA 1MG5A 1SCUB 2CJXA 2F43A 2FLWA 2V7GA 1MTOA 2YWEA 3SM3A 3VZDA 5HKKA 2FRDC 2I9KA 2CMKA 2X7HA 1ILWA 4L5BA 5LBUA 4M53A 3IUNA 4LY9A 1E5VA 1IN5A 4Q3KA 2BFMA 3FUCA 4BB5A 1EFCA 2OP1A 4TLEA 3TTVA 4GVXA 3SIPA 1PYOA 2GILA 2VYCA 5FAXA 3V8PA 3IEMA 5C8ZA 5I7UA 3IJ5A 1I3NA 1DRWA 3H1PA 4P3OA 4TVBA 3D8NA 5JECA 4M0DA 3EEOA 3SYMA 2O8BA 1JZSA 4U7HA 1H8ED 1QIIA 3G79A 1KFEB 3WSWA 4AJLA 2Z3WA 1EGAA 3CW9A 5HFAA 3TSAA 3ZWMA 4DCGA 2AJCA 3W1WA 2GKSA 3I0ZA 1KJYA 1UJCA 4RIHA 4BKOA 3R1IA 1MR3F 4OL0A 2G70A 4MRVA 3S55A 5FPTA 2Q3BA 4WL0A 1QE0A 3A2LA 2AJ8A 4JJGA 2BRUA 3II6X 4UHJA 5IJ9A 3K0HA 3HFJA 4LBZA 4ALIA 1XFDA 1JXAA 3BF7A 2NU8A 4OBXA 5FWXB 3JZIA 1IXSB 4EMTA 4C1NA 3KQOA 1C5KA 3C5CA 4HPWA 1RWPA 1XZJA 4LS3A 3VR0A 4ZVMA 3ZVRA 5B1YA 2XUZA 1Q1BA 5IH3A 4B71A 5KKCA 1GNSA 1G20B 3ET4A 4KAJA 3ENZA 4XWOA 2HRDA 3FPFA 4I46A 3OKAA 1ML4A 2ODWA 3VC1A 2O54A 1U04A 1NBIA 3FHJA 4RLQA 4CQLB 2P27A 1PJCA 1UINA 2J3EA 4C7KA 3F5FA 5FPHA 5FPPA 4JBYA 2FPMA 1G66A 1RT9A 1T0HB 2R8RA 3CLTC 3TL6A 2QRMA 4DDKA 4EYEA 5J1TB 3VNSA 3FVVA 3PI7A 3OM8A 4P4LA 1E61A 2EKBA 1ZK2A 4RVNA 2C58A 2Q4EA 3UCFA 3VTAA 4BO1A 2ZWPA 2F1RA 3AEKB 3NC0C 4WOBA 2Q5FA 1FCJA 3QKSB 4O2RA 2ERXA 4PQRA 4QQKA 4AKSA 3J81k 2HV8A 2ZRQA 1DBQA 4Z99A 4MKGA 1BGXT 2YXBA 3GRAA 1KEEB 1AKMA 5LYYA 3URKA 1GUFA 1G6HA 3UT0A 3CN7A 5DI3A 1I13A 4EUEA 3UWSA 3KIPA 4OQDA 2REQA 2B5OA 1MVLA 2ZBRA 4MSUA 2R00A 1HPLA 1YMQA 5JSKA 4X65B 2ZT7A 3KEGA 2ORVA 5E2IA 5CM8B 3U26A 3AI2A 4Z4HA 4A5SA 1PF7E 3D7MA 1H42A 4C9BA 3QU2A 2I29A 5C32A 5KJ1A 1JIVA 3GUZA 3I6ZA 4L4RA 4DADA 1O1YA 4C4OA 3TKAA 4JFRA 4M9ZA 2EW2A 5AT1A 4N54A 3AG6A 2AE2A 1AF7A 1KZ4A 3IEUA 1XAJA 4ZQCB 5F3RA 5F52A 4FWTA 2JRLA 2H18A 1X7XA 1L8LA 1W8DA 2VPZA 2ZWVA 2JI8A 3O9ZA 3ORQA 3QE0A 4H7EA 3UV7A 3ZE0B 2OBLA 3CIFA 5D87A 4OPMA 3KJEA 3GN1A 1WDWB 3WC4A 4G3XA 2O7NA 3J7AC 5H82A 3CISA 3A2KA 2WZDA 4G0UA 1I6KA 3FYHA 4OB6A 1PJSA 3HS3A 4U5QA 3DDOA 4H16A 3B6JA 3T7SA 4OL9A 4RPCA 4KK3A 2NAPA 3DLTA 4Q34A 1R4MB 1U2GA 4ZO4A 5AJVB 1UT8A 4N0QA 5EMKA 1NVTA 4NNPA 4YPOA 3NCHA 1X2BA 1G3UA 2YQZA 3V48A 1C50A 2RAUA 4TL9A 3UWPA 1J0XO 3ZGOA 1ONSA 1T26A 3CJTA 3NIFB 1OWMA 1QTNA 3AI1A 1O97C 4D8TA 5K6AA 1JDSA 2P35A 1J1UA 2C4UA 3DG9A 3R4VA 3TTUA 3F8SA 4KEAA 3U80A 1N2CE 5BSMA 4HZUB 4TYWA 3JAWA 4OKNA 3WK8A 4K0RA 2Q9CA 4RV9A 4HFJA 3ZOZA 5K0CA 3FXAA 2FW6A 1TF5A 3H5OA 4GWLA 4OFXA 1B2RA 2GYWA 4U3JB 1RJGA 1UZAA 2GWHA 1WV1A 5EJGA 1N5MA 3T1OA 2O8VA 1ZAYA 3MMNA 1GNQA 1LFDB 2IV7A 4Z9YA 1EBUA 4GECA 4OXRA 4L5AA 4KPYA 1P8JA 4BE9A 3K0CC 2FEAA 2QLFA 1F2UA 2A58A 2G6TA 4DV4B 3FYUC 2H8KA 2PCLA 3LQKA 4I1SA 1UFRA 2CXUA 2DQ4A 2PMBA 2Y2UA 3CWCA 2G9NA 1PI3A 3EVBA 5H59A 2ETVA 4US2R 1G98A 3ROZA 2NO9A 1W96A 3SLRA 4AZ0B 3F3YA 1R00A 3PIIA 4CTJA 2D1RA 1R15A 1V6CA 2A33A 2OCXA 1KI7A 3VPCA 4PPYA 2LZ0A 1B43A 5EZQA 4X7PA 2DRIA 2IU4A 1CZNA 1M2HA 1PG5A 3CZRA 3PK0A 3MJFA 5JCJD 4BNKA 2FPOA 1GCIA 2PZAA 3EZ6A 1TUGA 1O94D 3T6KA 3V7UA 4DWOA 1NVBA 5KVSA 3U44B 2DTEA 3MTIA 2J30A 4RL4A 4UUNA 3DWFA 5KOJA 2WT9A 421PA 3LCCA 1T10A 1DRVA 3TPZA 3LA8A 4KIWA 1EG2A 2PRJA 2YWCA 2W2KA 1KMHA 3AF3A 4I8IA 4I6EA 4GMXA 4GPZA 1Z6TA 3HG7A 3GA7A 1Q92A 4G4SP 4I9UA 1KAOA 4JR0A 4MP6A 3HRIA 2F9FA 1HM5A 3L8MA 3Q7QA 3EA4A 4P8RA 4R3UC 2ZUVA 1PKEA 2R4QA 5EXEA 5AXBA 5C7YA 3GGCA 4OYLA 1ZW1A 2JCSA 2V6BA 4F38A 1V4NA 3GEPA 5CA0B 3WY9A 1ZX1A 4C4RA 1T3LA 1OI7A 2X3FA 2ZAIA 2NO5A 3QUSA 4XX1A 3HP1A 1K27A 3ZHVA 4BQFA 3B1FA 3KJXA 3QRWA 3HVKA 4IQFA 4JSYA 1WAMA 2I1LA 2ZUTA 3SC2B 4G5QA 2B7CA 3IEVA 3OM1A 4BFUA 2R5NA 1O5IA 2HAEA 3KTDA 2FOIA 1OOEA 3FYCA 1IXZA 1TKCA 3C45A 3UUWA 4EELA 2EZUA 4MS3A 4HDRA 5ARDA 3LPNA 1M6VB 2OD7A 2ZRPA 3ZG6A 2XUOA 2PXHA 4DY4A 1CLEA 1GZSA 2BIFA 2QE7D 5ALIA 4ER3A 2OYCA 4RHEA 4XASA 2XBUA 3T9DA 3ONWA 3BGWA 1L9XA 5BR1A 5CDSA 5JOQA 5L51A 3IBTA 4JJZA 3E5RA 1MJHA 2E2WA 2QEQA 4JUFA 3F5SA 4PC7A 4DQXA 1YFLA 3VI4B 4JB2A 3UT6A 5KREA 4QWMA 3PR1A 1W4AA 2YS6A 3B6MA 3X1DA 1H94A 3TG2A 1UODA 3LVQE 4G5YA 1O6ZA 1N6OA 2FSIA 3CH5A 4XZ3A 5SZKB 2OO7A 3SFVA 2FP4B 3EQ9A 1B7GO 2AQIA 3EA0A 1GTVA 1KY5A 1PL8A 4OAOA 2VWPA 1JG4A 2DPXA 2AYXA 4R9UC 1QYCA 1XHFA 1NF3A 1CUYA 1XZEA 3FR8A 3NBQA 4DR4B 3FOBA 1MJFA 4KFTA 1SULA 1FP1D 1KYQA 2HMAA 2Q2NA 3HA5A 4LRYA 3Q9LA 1ENYA 3D43A 2O2YA 2VLBA 5F7OA 1SB8A 2D74A 1DO8A 1OYVA 2OCPA 1U7ZA 3F7TA 4S0XA 4V02A 2AF4C 1JHAA 2AD1A 2M6LA 4YGYA 4EO9A 1F2VA 1WDLA 1W29A 1B41A 1KQNA 3MWDB 3L7CA 3KPJA 1SCUA 4UUOA 1JAIA 5D5QA 3W5DA 1XVIA 1RPAA 4ED9A 2G1PA 5A02A 1VB5A 4AYXA 3COJA 1M67A 1BKYA 1UKEA 3NNSA 1YR8A 4MJXA 3RQSA 1NIPA 1X19A 1PR5A 1BWQA 3G23A 3ZGVA 1JKFA 4L4UA 1J0EA 1SIUA 2B9VA 2R6ZA 1DZ3A 5AM3A 1KFJB 1ID8A 1XVUA 1E2FA 1RPZA 2B8EA 2P75A 3PUZA 4UMDA 2X8JB 2BPOA 4CI9A 2AX3A 2CXOA 4L4ZA 2VJNA 2ISQA 2HHCA 4MPTA 1JXMA 1QX3A 3AHDA 1DJQA 1ISSA 1SQGA 4P92A 1FFDA 5ERYA 2FA9A 1ESZA 2DBYA 1JRLA 5BQXA 1NUSA 4UJ3A 5A3QA 3IAM6 3FMFA 2N9UA 3RVSA 4B6PA 3JQGB 3PNPA 2CJPA 2OOSA 4K26A 4TV8A 2LXNA 3QUBA 2A4KA 4B7XA 5IHXA 4G4SO 3DEJA 3ZNPA 4F85A 1OFGA 1RVDA 3WNQA 4PTYA 1DFGA 1FX1A 2ZXEA 3CGGA 3OMLA 4MYHA 4PCAA 4R9RA 4Q9KA 4WEOA 3RH0A 2OQIA 1BEUB 2RHCA 4MR8A 3NKLA 3NG1A 4UPDA 4AJKA 5FWXA 4EW2A 2L18A 1AHHA 1USGA 4BO0A 3WAGA 3DE3X 4O4IA 1RYMA 3JTMA 1KXZA 2GPNA 1RRMA 5LP6F 3E18A 3SVTA 1G20A 1OCEA 4JBLA 3LBHA 4L75A 3GP8A 1RW4A 4B0PA 1SZCA 4IIGA 3O31A 2J33A 1JAZA 1G21A 1O9BA 2P3OA 5GP1A 2HRZA 1CERA 4L16A 3FNRA 4NZYA 3BHJA 4HB2A 5CG2A 2JFPA 5KOHB 2YHUA 3EODA 4NOLA 5HS4A 3DMTA 4YYEA 1XZFA 3HKDB 3KEOA 3CVVA 3B3JA 5AIAA 4DDVA 2FCAA 1QBKC 1SU8A 2FE1A 2J5BA 5AVVA 3CLRC 2F8LA 2ZQYA 3HB5X 5AH0A 5DGXA 5B2ZA 4IRUB 3OJCA 4O4LB 4EHIA 4A0QA 2PRYA 1US8B 1ULSA 3AEKA 3QKSA 4U7DA 4QVGA 4C4AA 2OHXA 2VPPA 1KAQA 3IQFA 1EWVA 4W8OA 1EVJA 1FP2A 2WHXA 4OSEA 1NG9A 3RUDA 1Y1RA 1KNQA 3UXHA 1EWRA 1KEEA 3SJCA 5BXYA 1H1LB 1MC5A 1NVVR 3N5CA 2R86A 3VGJA 5FFFA 4G41A 5FX2A 1T9CA 5IFLA 2VXBA 5TPZA 1S01A 1I94B 2C84A 3FPLA 4KODA 4EYQA 2H2IA 2GKGA 1UWVA 1MT3A 1OBCA 4YV7A 3P9XA 3ITDA 2OESA 4PGHA 4JJKA 5I9IA 1GIAA 3EJ6A 4PRKA 4LYEA 2E4UA 4HT3B 3C3BA 5AI9A 5E1MA 3VX3A 1VJCA 3EAQA 1RZUA 5ILGA 3U39A 4N7MA 2H1RA 3TZ6A 3RCBA 2I76A 3F8WA 1RWOA 3G0BA 3QOFA 1QYRA 2C2OA 2IOYA 3NH6A 1CYEA 2BTQB 4WMLA 3VSBA 3WDSA 2UKDA 3GHHA 3N58A 4KACA 5FBRB 1PGOA 4PZDA 5HA5A 2Y9PB 4Q93A 4ENWA 1NSTA 1COWD 4M8LA 4AG6A 4XGQA 1WP4A 4JYBA 2NXNA 3K1JA 5IG2A 5LQCA 1G38A 4BPRA 2P62A 4PLPA 4PPFA 1ZIXA 3L0BA 2R8ZA 1KQ3A 3A26A 4JLOA 4LZJA 1E3LA 1T8PA 1OTXA 2X1VA 1J2RA 3HWWA 4IL5A 3ORHA 3ZX5A 1R4MA 4XGRA 5ALRA 5FEMA 1M83A 5I9TA 3AM1A 4XEHA 3QVTA 1G1AA 3VZCA 3NBUA 1NYLA 1TYEB 3EVNA 1DI0A 2HPHA 2UZAA 4INJA 4NXMB 4LJ9A 4W9NC 4KYUA 3ZY3A 2G71A 2QQEA 3SOZA 5L3SA 1WEKA 3OLVA 3S0JA 1KRHA 2IIVA 1KYXA 2Q99A 5CFNA 5BNZA 1OFUA 2ONKA 4NCNA 3A9VA 3EXIB 2P91A 2R1TB 1BVYF 4HZUA 3WGMA 5CB4B 2AQ8A 2WTUA 4FYVA 3D4NA 2I0FA 5CX1B 3UJ3X 4YY3B 2CEAA 3PTAA 4D3FA 2GA9A 1IIBA 2EJBA 2II6A 4U3JA 4YH1A 3VBCA 1Z5OA 4TT3D 2PL3A 3HVJA 3RC2A 4PAGA 3E23A 5T8KA 3VR4D 3DB1A 3NHAA 3KPVA 4KV7A 5SYNA 4A1FA 4OH1A 3IDFA 1LLDA 3PS9A 3G5AA 1II9A 3EHEA 3M6XA 1C7RA 4CQMD 3JRWA 1QORA 1V4VA 4NSNA 5JZOA 3GEGA 2FRDA 4AZWA 4DYVA 1KNXA 5HF9A 4PIVA 3A3NA 4EGFA 1AMUA 3N2NA 2Z6AA 2H0AA 3A4LA 3KJFA 1BVRA 3K05A 4UEKA 1C0EA 1PRYA 4D81A 3RVNA 5KTKA 4TROA 1YS7A 4TQGA 4AZ0A 3ZHRA 2QP9X 3GLVA 1ZN7A 1KMNA 4CVNA 4D79A 3KJIA 2F1OA 4MMYB 4D8UA 5HJEA 2K4MA 3OF5A 2GKOA 4K6OA 5D3KA 4BE7B 2P9GA 3H99A 3QBEA 3RVLA 2Z6UA 3I1JA 3SIRA 4XVCA 2XAUA 1E3MA 1THGA 4OGWA 2PGOA 3T0FA 1D09A 4B40A 1DWQA 5DM4A 4JJEA 1YJQA 3U44A 2R7KA 3WBBA 1NXTA 1ZOIA 4NCJA 4J2TA 2WSBA 3ZWOA 4AUMA 3OIWA 4MGHA 4CN8A 4ZI7F 4GRIA 5B37A 5BOVA 4LOJA 1KO4A 4YT5A 4QOHA 1VCOA 4MS4A 4G0MA 2QM3A 3E05A 3VYTB 3LC7O 1Z8FA 4G1CA 2PTGA 4BV8A 1RAGA 4H60A 4IGFA 2YINC 4GD3Q 5CLFA 3JX9A 3HEBA 1ZI8A 2QTCA 3NB0A 1TU3A 2ZCUA 3VR4A 4MV7A 3GAZA 4OHOA 4DAOA 4AFNA 3LUGA 1A5AB 1GUYA 5ISMA 2CNOA 3KXDA 1N1GA 3Q0IA 4N9WA 4F2WA 1RWXA 5DM2A 3CR8A 4FOTA 4LV5B 5F4BA 3KSAC 1JI0A 1JKJA 2CBZA 1QBGA 3R7BA 1LV8A 1PT5A 3AXSA 1EGMB 2ORYA 1VKZA 1R74A 3B85A 4MV0A 4UNQA 3RVJA 2EARA 3FPSA 3OQIA 3VX4A 3UA4A 3K8ZA 4CDGA 1RKVA 1I30A 3QWIA 1RBYA 2HJSA 4NJOA 4KIFA 3HCNA 3T12A 1V16B 2F3SA 4ZMRA 1WW2A 2HJGA 1JKMA 4L4XA 5AVYA 2FE4A 1AXGA 1LK0A 1ISMA 2R6HA 3BZBA 4HNQA 5K0FA 2XNDA 1M6VA 4S04A 1TU0A 3M6UA 3TZQA 2XQGA 2IQIA 3M1IA 4M0FA 1XP8A 4HXEB 1EFTA 4J7UA 1IXYA 2BFDB 1U1CA 4AF8A 4F4FA 2C1XA 4QPJC 2IEZA 2JJQA 4RWEA 3GJ4A 1WZEA 5TDHA 4G5GA 2J5QA 4JX9A 2PMEA 1DKLA 3EGXB 3AR9A 5JQGB 3BWMA 3KKOA 4ESOA 2QZSA 4Q6WA 1T15A 2FP4A 4N65A 3C41J 3N0WA 5CHYA 1NASA 4PGMA 2ZYSA 2PMWB 1H8HA 4Q1AA 4B80A 1Z74A 1H69A 1ZK3A 2VRBA 3QV2A 5DM70 4A10A 4YJ2B 2YMQA 4GMHA 3SY8A 1SKYE 1QLHA 2DGDA 5IKEA 1QHGA 4WERA 1AQJA 1IPEA 3GEBA 5F4ZA 4IGAA 4I0WB 5HTKA 4EMSA 2Q6VA 3PC2A 4Q9LA 1DINA 3KQKA 3HBFA 3P2JA 4CL0A 4XVQA 1YO6A 2ZJ5A 4EW3A 4ZEVA 2H1OA 4UVDA 1CUEA 3KQMA 1OQAA 4TXJA 1YJ8A 1LSJA 1MV8A 4HJRA 3DEAA 3EOAI 3MWDA 1SUWA 3PFIA 1VGQA 1HOXA 5AVZA 4IXNA 1HSOA 1RHUA 1X7YB 2W70A 4M9QA 3K72B 2JBAA 4OOEA 2BJHA 5JZMA 1LJUA 2IFTA 2EF1A 4CLDA 1XA0A 3EW9A 3ERCA 1JPUA 4X7RA 5AKXA 2PSJA 3K9HA 3ZD6A 2Z1NA 4NEGA 1KPIA 3DW3X 3TVDA 2WA2A 2GEUA 3F5DA 4BHTA 1MFPA 1A8PA 2DKFA 1IM8A 1CUFA 2Z2JA 4V0OA 5IJWA 3LLCA 2X8JA 3AUAA 4NL4H 1IHOA 1YA4A 1SBYA 3DBRB 3R6DA 3NBYC 3QTLA 3TX6A 3VYVA 1JFRA 4G0XA 1ID1A 2VUUA 3G89A 3H1FA 3JAKB 4KZKA 1FBNA 3ET5A 3T7DA 4AECA 4D6PA 2DE0X 3EZ9A 1DX4A 3D1JA 5GM2A 3V8MA 1M1NB 1FNMA 4QC2A 4U0KA 3JQGA 4W1QA 3CZ5A 1XCLA 2I87A 3SHTA 3DVAB 2DH6A 4DDWA 5L3QA 3GJ3A 2OC4A 3HACA 5CLQA 3STVA 3LW8A 3OQOA 1MXFA 3SICE 3VOBA 3DZHA 3T1HB 2F3UA 2GCPA 2Z8YA 3ETDA 1X1AA 3P9YA 3GT0A 3EIXA 2JCBA 3ADPA 1XQYA 3RABA 3HUUA 2Y68A 3IXMA 3V8BA 1F0KA 2CJYA 3K0CA 4C3OB 3PXXA 4LKOA 3L0DA 4GC9A 1CUBA 1N25A 2VHTA 1MCZA 3FYUA 4LW8A 4HGQA 2DQSA 1FSZA 3A31A 1SH7A 3R3WA 4Q4JB 5CGZA 2R6CA 5AI5A 2XIJA 4KXYA 4DBLE 4RVUA 3QY9A 4L9AA 3CRW1 3M4XA 4EEXA 5BMVA 5TGDA 2VFAA 3IHKA 4JN6B 5KOHA 1GQYA 2O2GA 2VF8A 3MMZA 4F60A 1H6CA 1XIVA 4WXPA 1BU5A 3WLLA 3HKDA 4Z51A 2V1XA 3N2YA 4UBJA 3N75A 1XPRA 2W90A 3RSLA 4B34A 4O4LA 4IF6A 5FTMA 3ZU6A 2UZ4A 4FE3A 3H83A 5GOTA 4LYDA 1SHJA 1APBA 5F9HA 2VNIA 2PLFA 1IBLB 1E2BA 2HCBA 4I3HA 1KC1A 4F8YA 2WFZA 3V80A 1HRKA 1KZ7B 1EK1A 1YZHA 2VK1A 4GLFA 3TFQA 2WAAA 2XTJA 3HR7A 4XJSA 1JF8A 3JYLA 2FOLA 4D9BA 5IUJC 1LLQA 1H1LA 1NJ1A 2ACWA 2B4QA 2VAPA 4Y2XA 1NVKA 3VV3A 4CF6A 4D9GA 1QQ5A 1ZCJA 2A2ZA 1Q6ZA 3H8VA 1OI3A 4G0WA 4Y6QA 4BO2A 4HLDA 3I2JA 4KX5A 1J49A 5ALFA 2JBWA 1E1RD 2NADA 2J32A 2H1VA 4BMPB 1ZXBA 1N2CB 4WKCA 4RDXA 1NT4A 1HQDA 2X5KO 3OA2A 4KKXB 4MJLA 3GNSA 4A92A 4BX0A 1SRRA 5G1PA 4QBKA 4EL0A 4CIXA 5E9JA 3ZQUA 3KTFA 1KH3A 4UW9A 4Z7OB 3U4QB 3LZCA 3WGYA 1E7QA 4CCYB 1MX1A 2BTQA 4OMUA 3KDAA 2VF4X 3BWDD 2R8PA 4MRSA 5EN4A 1R64A 5FYQA 2CF6A 2RGWA 4KQWA 2Z58A 1KQFA 5CVCA 2ESRA 3F6RA 5I4IA 4NU0A 5DMXA 2Q4BA 3DV0B 1YJCA 1NE7A 1WS6A 2A7QA 2WNIA 2WV9A 3ABZA 1KDVA 3BGIA 3JVIA 3T0GA 2B82A 4ZRMA 4RD3A 2DPGA 1MO2A 2IF2A 2XUJA 2HMYB 3LHSA 2BHTA 3CINA 1JPNA 4L0QA 1L7XA 3LRXA 5FI3A 4F9GA 4FLMA 2O8DA 3OLCX 3VSAA 3N1UA 5KZMB 2ZI6A 2H1CA 4YUZA 2C95A 4IO1A 4D92A 2W22A 4K8OA 3QY0A 3JYHA 4MOWA 1ZC4A 4PWYA 1TMKA 1IC6A 5AXDA 3VKFA 1C1HA 1TKAA 1PNQA 5IXSA 5JYDA 3T5MA 1E1RA 2DPYA 3C3MA 4Z1OA 2HY7A 4OU4A 5FCDA 1FNNA 5BWMA 3H75A 3DMRA 2LE0A 1ZJ5A 1T36B 2GCOB 1UDWA 2R1TA 2H1LA 2WABA 3AIKA 3EXIA 3P9KA 4QU5A 1W8IA 5CB4A 2ZIXB 3ZXIA <