1DAIA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
219
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 70
structure length 219
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1daiA00
4YMTA 2VIIA 2WWFA 4KSBA 2J46A 4PC6A 2HF8A 3VU9A 4BZPA 4ZDKA 3Q5DA 2P6RA 2ZS7A 4DZZA 4XH9B 3WP0A 4V03A 2BEJA 3KQKA 1B23P 3F3YA 3KJGA 3RANA 1Z0JA 2Z0MA 1E2JA 2CVFA 1KDPA 2FSGA 1HT1E 4BFUA 5JEDA 4IOKA 1TQ2A 4DCSA 2ZSEA 4A2QA 4GPTA 3K0AA 1U2RA 4DB2A 2Q3FA 2WAXA 3BBPA 3QSYA 1Q57A 3NEYA 1OXVA 1J8MF 5CB6A 3O8RA 2IYYA 3KJHA 3GJ5A 3B1XA 2KJQA 3SQWA 4NZYA 4HEJA 5J4KA 1W1WA 1Z3IX 4LJ8A 4URXR 5JS8A 2ZSFA 2ORVA 2D4HA 3FWYA 2V1XA 1F2TB 4QJ5A 5J47A 3AEZA 3GFTA 1XU4A 3U5ZB 3B7GA 1W0JD 3HR7A 4PZYA 1H8HA 4I81A 5DNYB 1DAHA 1OH6A 3CWQA 2ZETA 4Q9KA 3EZ6A 3RLFA 3W6OA 1Z29A 5EE5B 5LDDC 3EZ9A 4ACBA 2GAAA 3QNUA 1US8B 2DFLA 2J41A 1I4TD 2QTHA 1U81A 2V7QA 4XVUA 2IUUA 2C9CA 1P72A 4MGYR 2R44A 3DM5A 3CLVA 4LZZA 5AJXA 4DT1B 3AF4A 1MRNA 2RHMA 4X8MA 1KYIA 1E96A 1Q3HA 3WYAA 5EJEA 3U61B 4JL5A 2HUPA 1N6NA 4LJ7A 1G8HA 3BXZA 1HT2E 2Q9CA 2QUZA 4GI7A 3EPLA 3EX7C 5SZKB 1KSGA 2IYVA 3U3OA 3TVDA 3C41J 1DBSA 2WJYA 2ZE6A 3O47A 1DEKA 2XTZA 2CDNA 2HCBA 2LCFA 4Q03A 4DLVA 1PJRA 5FTKA 5AJVB 5SZIA 2KB0A 1XXHB 1AM4D 2VHQA 2OV2A 3CIOA 1NI3A 2ZUBA 4KLZA 1R0XA 1IOZA 1G6OA 1YRAA 4C4PA 2DR3A 4MRNA 1WB9A 2IS1A 1E6CA 3CZQA 4RFSA 5GJBA 4B47A 3MGCA 3LW7A 4M0LA 4PPQA 2QPAA 3LXXA 1NY6A 2QTFA 1HE1C 1SULA 3ICEA 5A5GA 2YC4C 4RD2A 4ESVA 4W9MC 1CJTC 1UADA 1E0AA 4DDUA 2BMFA 3A6PC 1ZUHA 4KV9A 4FIDA 1VHLA 2QTVB 3T15A 5GVRA 1WA5A 4QNMA 5FTJA 1GTVA 3ADDA 5DSZA 1Z0FA 1SKYB 2ONKA 3NBXX 1XEXB 1XTJA 4MA4A 4B73A 4PO8A 1DO2A 2QBYA 2NPIA 3VMFA 1SXJD 4NBSA 4NHOA 1HH4A 3NTUA 5EXTA 2N46A 1YZLA 4Q00A 3R7WB 2VP5A 1Z0AA 3C5HA 4DEYA 2ZRNA 4Q7MB 2XXAB 1FW6A 1E0SA 1XTSA 2GK7A 4TTRA 4D4MA 2VSXA 3BRWD 4TMKA 3UXMA 4TMTA 4R71A 1AKEA 4PC3A 2CJWA 3O8BA 4KHZA 3Q9LA 2ZJOA 1CR1A 2RGAA 2WKQA 1JPNA 5FOWA 2IK8A 1QVAA 1WP9A 3R8CA 2I1VB 1NP6A 3DZDA 4BFXA 2ZR7A 1UBFA 1QHSA 4JLPA 4BLPA 2BV3A 2QP4A 4ASUD 4MH0R 4Q02A 4UXJA 4P4TA 5FOTA 4BECA 4MGIR 1YZQA 4II7A 1TL7C 3U60B 3W34A 2O8EB 1TU4A 4KVGA 4PSVA 4G3XA 1Q22A 1W49A 3CKLA 4JVLA 3CF0A 4MRPA 4WXRA 3I5XA 3ZD7A 1Z08A 1EESA 2QAGC 2CK3D 3WNDA 2JLWA 1W48A 4OL0A 1N6LA 4KBGA 2NO7A 3SYKA 3T61A 4S2EA 4TMXA 4B74A 3OIWA 2DBYA 3WRXC 4LBYA 4Z54A 1E1QD 3AUXA 4W5JA 4A0FA 1NVXQ 3OEHD 3WMGA 1MO3A 4KYIB 3B13B 2VA8A 4PZZA 3EPHA 5FI1B 1RVDA 4FD2A 5L3QB 3I32A 2C5LA 3U4QA 1TF5A 4LX0A 4LWZA 2OE2A 4N1AA 3U7EB 1R0WA 4OI1A 2OCAA 4CZ2A 4K46A 1F5NA 2BMEA 1W4BA 4DRZA 1WRBA 3PVSA 2ZI5A 4H9GA 4NKRA 2PLRA 3ZLJA 4EIWA 4OQNA 4NCHA 3ZVRA 1MOZA 1QVRA 4HI0E 2KBFA 2YYZA 1ZM2A 3CR8A 1YKSA 4V0MA 2ZRAA 2WKRA 4DDVA 1UM8A 4P4UA 5HE9A 1Z63A 3D8BA 3ADCA 1P5ZB 1XZPA 3KDSE 1J90A 1DS6A 1OB5A 1IN7A 4D0GA 4EAQA 2GXQA 4FMCB 4B3BA 2JJ2D 2GCPA 3TRFA 2D06A 1SVSA 5LBIA 2W6IA 1L7VC 1UF9A 5EXXA 3DKPA 4OK6A 1KSJA 3MD0A 5FI0B 2VHJA 3OEED 5C18A 1PUJA 3KQHA 3FB4A 5KOYA 2F1IA 5JECA 4GNKA 2FN4A 3MUFA 2G77B 2VH5R 1OIVA 1ZUNB 1X1RA 3MJRA 2F55A 4DCVA 1E32A 1XTKA 2J7KA 2QPOA 1SXJA 3PUZA 3REFA 2IX3A 1J99A 4MGZR 5JWRA 1SVMA 3HPRA 2UZ3A 4HDCA 2YWHA 3EC1A 3GJ6A 4LBVA 4TT3A 3CX7A 4IEEA 4IKEA 2VP2A 4IOLA 2ZEJA 3SOPA 2J3EA 2R8RA 1Q1EA 1A82A 1NN3A 1KK3A 1NKTA 5D3QA 4QL3A 1AQYA 1X3SA 3I4LA 4C0JA 3ZS8A 4BEJA 3G5UA 3MJHA 1G7RA 2FSFA 2JLUA 4UNQA 5FPSA 1XNJA 2L0XA 4BZQA 1DE0A 1UEIA 1YZUA 4P4SA 2H18A 1NIPA 1UBCA 1XFAA 3U3JA 1D2NA 2IEYA 1IM2A 1I4DD 1OJLA 4ASUA 3K8YA 3BE4A 4RZUA 1TAGA 1Z5ZA 3NHAA 2QMHA 1HE8B 3RNLA 4UNNA 1N6RA 2GK6A 2CCKA 4OHZA 4BFSA 4V0NA 3C5CA 3DKVA 3A1TA 1TMKA 4AKGA 1KJYA 3BFKA 4TLDA 2FV8A 1GRQA 1TADA 1Q0UA 5EP1A 4W5HA 1JR3D 2DCUA 2DFKB 3THXB 2WJHA 1E1QA 4KU4A 4OJQA 1NN0A 4EQ6B 3S1AA 1GZSA 1U8YA 4CVNA 4BLSA 3HPQA 3M4YA 2P5TB 1YZNA 4M53A 3VR1A 1JALA 2WIBA 1NMXA 1TF2A 2ZSBA 5DI3B 3U3MA 4G1UC 3W6NA 3CB4A 3T1TA 1VHTA 3P27A 5B58C 2PH1A 2VHTA 3LNCA 3WP1B 3TSWA 4LBZA 1ODFA 3K70C 3KQNA 1TUIA 3RRYA 1N3BA 4EFNA 2REXB 4IOJA 4KFSA 1LNZA 3VU9B 1CBUA 1CJMA 3IIMA 3MWKA 2ZYVX 1PZNA 3OESA 3I8XA 1EWRA 3GFPA 1F3OA 1OW3B 2IYLD 4JLNA 3TR0A 4CRWB 3A37A 1XRJA 3QEOA 4LYFA 3LWNA 3BH0A 2WZQA 4P0TA 4D0NA 2NIPA 2UZIR 3K0AB 4NYMQ 1FQJA 4JLAA 4KI0A 5LB2A 4B6FA 1UAAA 2XSZA 4A1FA 1XCMA 1P3JA 1X8JA 2VP4A 2JJ2A 2JCSA 2ZRDA 1XPRA 1IN6A 1P6XA 2WJIA 1TPZA 4Q4JA 5EE3A 5H68A 4YDSA 1OYYA 4G5QA 2AXNA 1IN8A 2QAJA 1E9RA 3KTAA 3QXSA 2WBLC 5KDOA 4V0OA 4UNPA 4YDHB 4Q9HA 1KI3A 2CCJA 4DLXA 5FPKA 5TMPA 5JS7A 4DLZA 5CM8B 2QE7A 4US0R 1S9HA 5BQ5A 4YMUA 4BLOA 5C2JB 2ZE7A 2O8BA 1G3MA 4D4LA 2ZI7A 4V0ME 2ZXUA 1CULC 2A9KA 3EAQA 2ODNA 2QMEA 1YQTA 4YMSA 4TSFA 4NYIR 3VKGA 1F60A 1BO6A 3A1VA 4FN5A 1BKDR 4FWTA 2XGJA 1N6PA 2FSIA 3N2IA 2QGZA 3CRW1 1EGAA 4JSTA 4LK2A 3ZJYA 3IHLA 1IJFA 5CLLA 3EW9A 4AK9A 1UDWA 1JEEA 4A8JA 1RFLA 4YLGA 4LYAA 2JLXA 1KIMA 1R4AA 4PZLA 1OSNA 1M2OB 1RIFA 3VKWA 3PUVA 2CLDX 2JLYA 3OIVA 1CEEA 1NSTA 1FNNA 1UKYA 1OH5A 1IQPA 1GL9B 3RC8A 4DWJA 2A78A 1X6VA 1SXJE 2QY9A 4DSTA 4Z1MA 2QI9C 3CPHA 1GDDA 3CH4B 3AGPA 5CJ2A 3T12A 1T8UA 2OO7A 2DFNA 1AGPA 3UANA 4GMDA 1LS6A 2Y8EA 4PSKA 3SYNA 1IXRC 5F98A 2R2AA 1JAHA 3L2OB 3OE7D 5JWHA 4LHWA 3RWOA 3E70C 2RCNA 4MKHA 2ZANA 1KAGA 4GMXA 1NBMD 4D4JA 2F9MA 4Q1FA 5JHHB 4DLYA 2XEXA 5DISB 1GVNB 1E0KA 2Q9BA 5J4YA 1EWQA 5IF9A 2FU5C 2LKDA 1W36C 4LJAA 4PC2A 3ADBA 2HLDD 4XSGA 2RGEA 1CIPA 3CF6R 5FOUA 3LFUA 1NG9A 4B3FX 4M1TA 2NTYC 3C8UA 4UXIA 1ESNA 1G9XA 2KBEA 1WCV1 3C7KA 5CM9C 2A2ZA 4DSUA 3AKYA 4ZO4A 3FKQA 4XJXA 1DARA 5JFGA 4ITRC 3U7GA 1G7SA 4C0BA 2QBYB 1KO7A 2BWJA 3KKMA 2KWIA 4C0HA 4JL6A 1KAOA 2LKCA 1FP6A 2QSYA 4D81A 4A36A 4F93B 4MDEA 3EZFA 2CE2X 1XPOA 3QEJA 4TL7A 4DXAA 1J7KA 3EPJA 1VECA 4PQFA 4IOMA 4LBWA 4N0EA 1VYUA 1G5PA 4LRWA 3VR3A 4DHEA 4ERNA 2ZJZA 2C98A 4CGZA 4BGDA 5FOVA 4U7DA 3TBKA 3TW4A 2CJWB 4AY2A 4M9XA 1ZMXA 2GESA 1Z6XA 4UNRA 1T5IA 3V4RA 2IWHA 4TL8A 4QFMA 3AKCA 2ZUDA 4ZPXA 5A0FA 3PJRA 3PUWA 2CEAA 4X8HA 1Q1QA 2VPPA 4Q1AA 4RZ3A 3NVAA 1E99A 1JPJA 3CW2A 2X77A 4OHWA 5E95A 3IGFA 3T1OA 3ZVLA 2UVQA 4KVAA 3K70D 1E2KA 1MO4A 4JIMA 2F43A 2ZJAA 1F6BA 2Z5FA 4S35A 3VR2A 3ZQJA 3ND8A 1EX7A 1MABA 4ZKEA 1S9DA 1S8FA 1YZGA 2FG5A 2QRNA 2ZRHA 3H86A 5AWFC 1H8EA 4B35A 1T0HB 1II0A 3TUIC 5EP3A 2RB4A 2PBRA 3VQTA 5KNCA 3DVLA 1IHUA 2A7QA 3CBQA 1NRJB 3GQBA 4TN1A 1YZKA 1E2EA 1AN0A 1N6KA 1RW4A 1VPLA 3DMNA 4TQ9A 1WBBA 1ZCAA 3VX3A 4EPXA 3HR8A 5EXPA 2GKSA 4ZIRA 3B8HA 1E2DA 1G8GA 3REGA 5KTYA 1XZQA 2NMVA 4TZ6A 2XTMA 3SBDA 1GKUB 4NP6A 1GSIA 1JR6A 3KZ1E 3X1XA 3RRZA 3ASZA 3SJBA 1ZAKA 2BM0A 1G4AE 2CNWD 3U4QB 1W4AA 3I72A 1II9A 3CH5A 2PMDA 4DVGA 4AIIA 4MKIA 3R20A 3SEAA 4RD0A 4HLCA 2AN9A 1D6JA 1VMAA 4C0KA 4KXFB 1NBMA 4OI0A 1FMJA 1KO1A 2PJZA 3DL0A 1OXSC 1GOTA 4QHYA 4ABYA 2WSSA 2JATA 1GM5A 2Z4SA 1GNQA 1IONA 3OIUA 1EFUA 3OIYA 3K53A 4OQMA 5DYIA 5EP4A 3GJ4A 3IBYA 2BMDA 4IDHA 4A6XA 2XOKD 1VCIA 3J81k 5KYKA 3T5DA 4M1SA 1ZD1A 2WWXA 1JNYA 4KBFA 2ZUCA 4IDNA 2PCJA 3EC2A 2B7BA 3Q85A 1H65A 5HCIA 2ONJA 5KNBA 1S0UA 2CHVA 5DYGA 1NSFA 5CDFA 5AK0A 2QT1A 5EZ6B 3KFVA 1I2MA 3R9WA 2EW1A 3T34A 2F1RA 2VP9A 4AD8A 5IT5A 1XMJA 3AP3A 1DG1G 1E2LA 3NKVA 4RD3A 1NF3A 1TUEA 1XD2A 2GBLA 1N2CE 4FMDF 1SXJB 3VR4A 3THXA 1OPXA 4R2IA 5H1YA 1E79D 1HUQA 1P60A 2JLSA 2N42A 3FGNA 3WBKA 4JLDA 1KKMA 4LGMA 4PX9A 3PUYA 1DAEA 1S2MA 2AK2A 5K8TA 1R2QA 1FUKA 1W47A 5FBQB 3C14C 3RHFA 4WZBE 5FTMA 3QI2A 4F4JA 5BW8A 4OI2A 3EIEA 2O8CA 3VAAA 4AURA 5FL3A 2G6BA 3K09C 3MWYW 3TAUA 3CPJB 3PEVA 4PPNA 4FWIB 2RKOA 2NO0A 4DB4A 5FOXA 2PMKA 2ZYUX 5AR1A 5TXGA 5F9FA 2KE5A 2WSMA 1QBKC 5CYOA 2IA5A 2Z83A 2Q3HA 5C46F 3B1YA 1OYWA 4P4SB 2MMGA 1XWIA 4XOIA 3ZIAA 1TX4B 1CP2A 1W46A 2ZS8A 4HZUB 1W36D 2PZFA 4TMVA 3QF4A 2BBOA 3GCGA 3DZ8A 8OHMA 4R2HA 3AVUA 3TK1A 1G8PA 1Z0IA 3RSLA 4US2R 4L9WA 1AS0A 5JCPA 1SVKA 4Q7KA 1E2GA 3RYTC 5FUYA 1XTIA 3FMOB 2EYUA 1JEDA 2GILA 2NO9A 4A2PA 2QEQA 1Z0DA 2C8VA 3LVQE 5FUXA 3MSXA 2GCOA 3FKSA 2DWPA 1YHNA 3MRSA 1COWD 1NN1A 1Z07A 3AF3A 5TY0A 2NZ8A 1ZC4A 1MV5A 1CF4A 3EA5A 1RPZA 3S1AB 3SHFA 4ZCIA 5EE0A 5KSOA 2BM1A 4F38A 3GJ8A 2ZIAA 4TYQA 1Q12A 2R6DA 2FEOA 3SI7A 1J70A 1BMFD 4FW9A 1P7CA 4R7ZA 2C2HA 1OXXK 2CNWA 1GNRA 2H7VA 2GDJA 1ZNWA 1EX6A 4NU0A 3P32A 1M6NA 3QJYA 1QHYA 4DUGA 4I1OA 3U6BA 3K0EA 1C1YA 4D4KA 3ADKA 2GJAA 1BS1A 1CRQA 1VG8A 2J0SA 5P21A 3FFBA 5SZHB 3QY0A 3I8SA 4Y0AA 4DIDA 3LY5A 2P5SA 2ZYWX 3AF1A 4POAA 3IILA 5B2ZA 3BWDD 2GHIA 4BASA 1JB1A 2OBMA 2CHQA 4TMZA 821PA 1NL3A 2J5XA 1TQDA 1IN4A 4PPGA 5BN3A 1FP7A 1YE8A 3QG1A 3HYRA 2X19A 3MG9A 3LDAA 4Q4JB 3LA6A 3CR7A 1CJKC 2V9PA 3AF0A 4LV5B 2GJ9A 3TR5A 1M7BA 3KTAB 4I1VA 3W3AA 4BZXA 1CJUC 4A15A 4BLTA 1VDZA 4UJ3A 4F4CA 1Z83A 1SVLA 4UXHA 1ESMA 1GWNA 2FE4A 1EFCA 2Z4RA 3EA0A 5JZVA 1K8RA 1E9SA 1BYUA 1NBME 5FFMA 4KSCA 1PLLA 2NG1A 2ZS9A 2QL6A 3B82A 2RGCA 2VLIA 3HP1A 3RS3A 3R8FA 3NH6A 3AVTA 2O8BB 1LVGA 1XCGB 1ZYUA 4JT2A 2JIZA 1WDTA 4KYUA 4OK5A 4MUAA 1XPUA 1KMHA 4GRAA 4C30A 1GG2A 2O8DA 1NMZA 1XDBA 3JVUA 4OQXA 1M8PA 1KNXA 2QN6A 3HDTA 1YJ5A 1GRRA 2OFWA 4DCNA 1Q21A 3T5GA 4XD7D 2V6IA 4IRUB 2QROA 4IFBA 3LD9A 5JJIA 4OKSA 4A8JB 1Y3AA 5CDFE 5EE1A 2BHRA 2RHDA 3W5IA 3IEVA 4HATA 3H84A 3U7HB 3QBVA 4PQRA 3NDBB 4LPSA 1RJ9A 2MSDB 3PITA 4M1MA 1YVDA 2B6HA 3JZAA 4NONA 2VF7A 1ZIOA 4RZ2A 5HZHA 4M9ZA 2YZ2A 4QKQA 2ZJBA 3KFXA 3LV8A 2J87A 1AZTA 3T35A 2DPXA 4FXPA 2YWEA 3SJCA 4N0DA 1MO5A 3THOA 1GAJA 2RGXA 5FUVA 3ZDQA 2CLCX 1XX6A 1YRBA 3I73A 3KKPA 4M9SA 5G3YA 3T06B 2HT1A 4B75A 1Q44A 2OUKA 3IKJA 1OLOA 1D9ZA 2NQ2C 3CRQA 1NLZA 3I62A 1W0KD 4G01B 4JYCA 2WVJA 4TQUS 4Q48A 3X1ZA 1WQ1R 4Q4LA 4UKDA 1W0JA 5JWOA 1R5BA 4MYUA 3OZXA 3FVQA 3NIBA 4JBXA 3TGPA 1BMFA 2IS6A 3PQCA 2V6JA 2IYQA 3X1WA 2JLZA 1E4YA 3HJNA 1A7JA 4C2UA 3DOEA 2XZOA 4LC0A 2MSEB 2ZI3A 4E09A 3IPXA 1ELOA 5TB5A 5HTKA 4XTCS 1XJCA 1E2FA 1CS4C 4UQOA 1GP2A 4RJLA 4HAXA 4P31A 1XP8A 2OT3B 2FFBA 2WJJA 3MWJA 5KDLA 3PEWA 2IUSA 1J8YF 4YXWD 3BGWA 2XZPA 5AJYA 1FTSA 1VYVA 4JKYA 4M8NE 4XWKA 1RKBA 1FOEB 3BC1A 2XTNA 1E2PA 1G5TA 3H4MA 3NH9A 3WRYC 4MUBA 4L16A 1Y63A 4EFMA 5EUMA 2GEUA 1WF3A 2HV8A 4D25A 1G17A 1KI7A 3NC1C 2D2FA 1KO5A 3L43A 5H8WA 2ATVA 4I1UA 4LDJA 4RD1A 3NC0C 4LOAA 1ANKA 1WE2A 4FCVA 4AG6A 1FNMA 4BLQA 1DVRA 3BERA 2ZI6A 5BWMA 4LV6A 4HAUA 3W90A 3GPLA 3ICQB 1SHZA 2W6JD 2ZTSA 1GRNA 1G19A 1ZM7A 2B21A 3BH7A 2FEMA 4LHZA 1KI9A 2P67A 2ZR0A 2ZJYA 5AUPB 1JQJC 4Q4AB 3CPEA 4TL6A 3SR0A 3KX2A 2NO1A 4H1UA 2DHRA 2C96A 1ZRHA 2VSOA 2ZROA 3X1YA 1GILA 1P2VA 2O52A 2F43B 3QXCA 5G41A 1MABB 3A58B 4CEJA 4AKIA 4DIEA 1A4RA 1EFHA 2YNMA 3PG5A 4XD7A 4PO1A 3ZZUA 4DDTA 4B3GA 4DKXA 1OKKD 1Q1BA 3X2SA 2RGBA 2VL7A 2WOJA 3P20A 4N3NA 5BXQC 4NCJA 1U99A 3RS0A 4OQFA 5HPYB 2WTUA 5J4VA 4HB3A 1KDTA 3EIQA 1OV4A 3GLGA 1M7HA 4ZIRB 1KHTA 2OESA 4EJSC 2C03A 5F2EA 4D6PA 3VFDA 5CIWA 2BKUA 1WXQA 2WWWA 2ZI4A 4RD6A 3VHXA 3PCRB 1KDOA 4KO8A 4IDPA 4EPYA 2ERYA 4HLUA 2DB3A 3DDCA 1G3IA 2WHXA 2GF9A 1JBKA 1U0LA 3L82B 2G83A 3LAWA 4Q1EA 2BJVA 4QJ3A 1XJQA 3KUCA 5JEEA 3DHWC 1NY5A 3B1VA 3B78A 2CL6X 4Z51A 4Q7LA 4I1SA 4KODA 5KO2A 3HU2A 1NKSA 1W0KA 2YVUA 4AYWA 1RC8A 4ILEA 3OFND 3IUYA 5EE9A 1ZUIA 5FPTA 4DCTA 3AVXA 2BBTA 2E87A 1R8SA 2QQEA 4NYJQ 5B30A 1TU3A 3HWSA 4MRRA 1KJZA 4FCTA 5KSZA 4HZUA 4MITA 2OAP1 1GNPA 2HDNB 4M2LA 4B34A 3K09A 4MQBA 3RWMB 4MYHA 3K0FA 4RCYA 3FYHA 2IXGA 4BFWA 3SC3A 2PT5A 1E1RD 1JXMA 3CRRA 4JLMA 1N0WA 4RKFA 1F2UA 3QOFA 1W7AA 2FNAA 1GKYA 1P62B 1QF9A 4A9AA 2H8KA 4YQFA 4OHYA 3A4NA 3CF2A 4FMCF 2CK3A 4DLTA 3V00A 2PEYA 2CCGA 3RRNA 2P2LA 3SN6A 3WHLA 1XD2B 1GUAA 4HZIA 1G8FA 1DPFA 4QGGA 1SGWA 3AF2A 1G16A 2OXRA 4PR0A 2IW3A 1G3RA 2H1LA 3OEHA 2JEOA 4LPKA 2ATXA 4JS0A 2WKPA 2EWVA 3F0TA 2HJVA 2FGKA 2WIAA 2ZRBA 1N25A 5SZJA 3VR6A 4EPWA 5C1BA 3TIFA 4JT4A 2O8CB 4EDHA 2VQSA 4MYTA 1M7GA 2FSHA 3T1QA 3EZ2A 4E5UA 1VTKA 4AI6A 1VG0B 2ORIA 1DELA 4WOPA 5JSZA 2W6JA 1N6HA 1IAQA 2IS2A 3LH5A 1DAIA 2WM9B 4PANA 3QF4B 5HCNA 4GFDA 4LYHA 3CO5A 5DLQC 1OIWA 4O0MA 1OF1A 1E9AA 2OFXA 5BYKA 1NVVQ 2YHSA 3DM9B 1AS2A 4C0AC 3MLEA 1JAIA 2ANBA 1FQKA 4HLDA 4C2TA 3TE6A 3SU8A 1NLYA 2KSQA 1E3MA 3FDIA 2GRJA 3TW8B 4M1OA 4BUJA 5JJLA 1CKEA 3K9HA 2NPFA 3OEEA 3RS4A 4HB0A 2GCOB 4BE7B 3BB1A 4MRSA 4PAMA 2QPTA 5EZ5A 1LTQA 4URWR 3K0CC 3IPYA 3AQ4A 2BJWA 4KAXA 3DPUA 3GJ0A 5H70A 4ZI3A 5DHFA 1JECA 3ZYCA 5K8UA 4BFYA 4QGAA 3QXXA 1U90A 1NJFA 1KI1A 2HEIA 1KI6A 4ESHA 3SJAA 2REBA 5DO9A 4Q9IA 2BDTA 5KSYA 1KMQA 2JDID 4HB4A 3W6PA 3KB1A 3AKEA 5GJWC 4O3MA 4Q5IA 1Z0KA 4BRUA 3ONWA 3W8NA 2IYTA 3I1FA 1PLKA 4E22A 3RABA 2HCJB 1N5IA 4AKEA 4D82A 3P4YA 1KNQA 4PAQA 5BYJA 3GLGE 3GMTA 5HKKD 2D74A 4LUCA 5HE8A 2GTPA 1JI0A 3FPAA 4FCWA 3WNBA 5FPHA 1NMYA 4E07A 1FX0A 1QHNA 2OEPA 2YOFA 3KB2A 3NG1A 1G41A 4WAUA 2OCYC 2WWYA 2OM2A 5AUNB 5LD2C 2VHCA 4JLKA 4IEIA 1XMVA 1XEFA 2A30A 1E2IA 4JJKA 2R9VA 2IBMA 3SFZA 1KJWA 2C9YA 3ZH9B 2IF0A 1P61B 3NDPA 4ACAA 1JR3A 1XB2A 2VRWA 2GVDC 2ZSDA 3GLFE 2JASA 1A2BA 1UBGA 3QXHA 2R62A 5G53C 2BIFA 4TZ0A 2YJTD 4A0RA 3M1IA 1KMHB 3EWSA 2O8DB 2N1BA 3WHKA 3FOZA 1GL7A 1E9BA 3TKLA 4W7SA 5FR1A 2EFGA 5CYPA 2ZE8A 2G1KA 4Q18A 5F9HA 2BEKA 2J1LA 1AGRA 1I4LD 4L8GA 3UPUA 2EWWA 5IRCD 2BCGY 3QKSA 4JMPA 5UKDA 3WYFA 1U0HC 3KJEA 4TLEA 5DGXA 1OB2A 1W36B 2FMXA 1RJ9B 4XVQA 4QBGB 2Q21A 5E7JA 1G64A 3TUZC 1B0UA 1Z6TA 2AKYA 2BVNA 3LQQA 4OHXA 3TAHA 1T3LA 1R8QA 2W0MA 2I4IA 1FMLA 4Q9JA 2G1JA 3LX5A 4DBLC 2W00A 3K9NA 4E03A 2EFDB 1IXSB 4HAYA 1UKVY 2HXSA 1GKIA 2PEZA 3HU3A 3IQWA 4PHTA 3GEIA 2WJGA 4Q4HA 2QAGA 1J2JA 1OFTA 2AWNA 4TWZA 3SDZA 2GXUA 3QE0A 4QM6A 3O8DA 3B2EA 3SS8A 3W9YA 5DE3A 2UKDA 4WZAE 3W8RA 4BFZA 4F4IA 1D8TA 5KHOC 1VG9B 2FJUA 1YR7A 5E7IA 4HUTA 2AX4A 2OLJA 2QGNA 4C7OA 3BB4A 3W5JA 1ZJ6A 4LJYA 1YR9A 3CZPA 5GJCA 4JVSB 4TL9A 5DN6D 1II8A 1KK2A 3C16C 1P9NA 3PENA 4JJZA 2XNDD 1TTTA 3GFOA 4Q4AA 1G8YA 2OG2A 2W2XA 3PV0A 3TMKA 4GDFA 4D0LB 3AH8A 4L9SA 2H92A 5KSPA 3ZQ6A 3UIEA 2JA1A 1LF5A 3FTQA 4JYBA 2GXAA 5A4JA 4NYMR 4JSYA 3E2IA 1OT3A 4RD4A 1LW7A 1ZNXA 2FZ4A 3Q72A 1E0JA 4LJ9A 3FHOA 2IYWA 4X8LA 1RZ3A 3KKOA 3LRPA 4D26A 4BWYA 3R9IA 2XJ9A 4NCNA 3RVBA 4LJ6A 2J0VA 2OILA 3DOFA 3FMIA 3LBHA 5B57C 5CB8A 5J4HA 2ODEA 1DAFA 1C9KA 4PAOA 1P73A 3VHLB 1KZ7B 4QOSA 4QXAA 3QVUA 1KO8A 1M34E 2HJGA 3U3KA 1R6BX 1SHKA 1QZXA 4G5SA 3LVRE 2I1QA 2B8WA 3OE7A 4EJSA 4O25A 1GITA 3QVVA 5KU1A 521PA 4BLRA 2Z43A 4BPBA 2F7SA 1P2TA 3A4LA 1T6NA 2P3SA 2H16A 2ZRFA 4RZXA 4WW0A 1H8HD 2O5VA 3BIFA 3QPWA 3ETLA 2HLDA 4GT1A 1AS3A 3MFYA 3QG5A 2I3BA 4JLJA 2DWOA 4CEJB 2J7PD 3I92A 2OAQ1 2R6AA 2XJ4A 2W58A 4L5BA 4P32A 2JAQA 3B5JA 3AP2A 4B43A 221PA 2IHYA 2ZAOA 2PZEA 1IBRA 4B33A 4Y0VA 2RH5A 3BFXA 3QKUA 2ORWA 4FINA 3GLGB 3DMDA 1OFUX 1OXTA 5GADl 4B71A 1ZINA 3UWKA 4IXMA 5CLQA 1JR3E 1ZBDA 4YMVA 4G5GA 1KO4A 1RRCA 2V3CC 3AVVA 2HF9A 2OSBA 2ZJ5A 1KI8A 3CWZA 3IQXA 5FPYA 1GIAA 2NOAA 2VP6A 1SXJC 1PVOA 2JLRA 1W4CA 2WWGA 1HV8A 3BOSA 2ODWA 5ANRB 2WWIA 1KI2A 1XF9A 4DCUA 1P9RA 2RGDA 2YV5A 4V0LA 2BMJA 1CRPA 1P9WA 2VTKA 4HAWA 4PHGA 2CMKA 4PSAA 5L3VA 2O0HA 2DWQA 3ND9A 1NIJA 2IYUA 2R6CA 2VHUA 4GOXA 3CX8A 4PHFA 5DN6A 2YWFA 1ETUA 2FA9A 2H57A 2XNDA 5EUQB 2ZRJA 1O87A 4QG7A 2O8FA 1SVIA 3T1VA 2MMCA 1UEJA 3IO5A 4GZMA 2F1HA 1QHGA 3QPVA 2V55B 3EIHA 1HY3A 3K0FB 2FPKA 1EXMA 2DYKA 1DOAA 2X1VA 3SJZA 1HQYE 3SZRA 3B60A 4US1R 3OHMA 1F2UB 5LPNA 2ZJ2A 3O8CA 2A5JA 3A1UA 4IDOA 2WWHA 4LHXA 2JLVA 2TMKA 3IIJA 4QJ4A 2QORA 1Z2CA 2WV9A 3E5HA 4AG5A 1LY1A 1D9XA 1R7RA 3MAAC 4C0SA 1AK2A 3THYA 2AHOA 2J59A 5B64A 1G6HA 1Q1ZA 2PCLA 2YWGA 3L0SA 5L3SA 3KQUA 1HA3A 2H17A 2GVZC 4KFTA 4M9QA 4URZR 1QG2A 2GJ8A 2E9SA 1G7TA 5LB4A 1R0ZA 4TYYA 1TEXA 5FOSA 2OBNA 3K0CA 4B2PA 2V1UA 1ZM9A 1RE0A 4KFUA 5JSZB 3IHWA 2QT0A 3B1WA 2Q9AA 1X8KA 3VR5A 3QF7A 1S4QA 5EP2A 2NGRA 4RVCA 2PT7A 2VSFA 3CNLA 1HTWA 4QM7A 1HYQA 3BJIC 2AFIE 3IO3A 4HAZA 4D80A 5KNDA 3NEJA 2ZRGA 4I99A 2GJKA 4ZCMA 1NNEA 2XOKA 3Q3JB 2J7PA 3KQLA 4A2WA 2ANCA 4Q7JB 1SZPA 1E2HA 1E98A 4JVNA 4DJTA 4EPRA 5CK5A 3ZVMA 1Q3TA 2WAYA 3EG5A 2B7CA 5EQTA 4B6EA 3SQXA 1G3UA 2ZQ5A 5D3MA 1DAKA 1DADA 2NZJA 4OK3A 3IIKA 4Q1CA 1D5CA 4NDZA 2ZPTX 3BFVA 4XTRA 2FH5B 3WYGA 2AKAB 4B76A 3EASA 3UG6A 1K5GA 1V43A 1VCNA 2KI5A 1M1YE 2ZRLA 4WBSA 4HLQB 2ZR9A 4TMWA 1E79A 1S3SA 3A4MA 2ZU0C 1N0VC 5FL7D 2ZITA 4GOJA 3TJZA 1T9HA 1KI6B 2E1RA 2A5GA 2DY1A 3FHTA 3BK7A 1XBTA 3GLHA 4K81B 4RSGA 3A1SA 4Q47A 3BB3A 4QBHA 4YC7A 4BFTA 4F91B 4TYNA 2FFQA 1LB1B 1Z06A 3RRMA 3PXGA 1S1CA 2QENA 4QHTA 3B6EA 3CONA 1RRGA 3ZZTA 1QDEA 3U44A 2F9LA 2ECKA 2YOGA 1UKEA 3THWA 1FPMA 1N6IA 3P4XA 1XEWX 4X8OA 4CF7A 2YKGA 3L0PA 3AUYA 4LV8B 3V4FA 3V9PA 4A8JC 2YINC 3CM0A 5ELXA 4M1WA 5FTNA 2IC5A 4G0NA 4BFVA 2A3RA 1JJ7A 4Q1DA 1FX0B 1T8TA 2QQ0A 3KKQA 4LJ4A 3VKHA 3ASYA 1E9CA 4A0GA 1NVWQ 2QU8A 4MDFA 4A0HA 1JXOA 1NJGA 2Q6TA 4B44A 3GEEA 1XTQA 4ZDIA 5JMTA 4AKHA 2F1JA 4D2IA 2G0NA 2F3RA 2XITA 2ZE5A 4TYWA 4XIGS 2W6ID 3Q7QA 4HDOB 3LX8A 1G5RA 1W5TA 1A1VA 5KUTA 4HYYA 1COWA 3D31A 4HB2A 1OFHA 1XJ0A 4JKIA 4QNRA 4DC9A 621PA 4PQYA 3A1WA 3TLXA 5K8IA 1SVOA 3BH6A 2IT1A 2HYDA 3LW8A 2X8AA 2X2FA 1NN5A 3GLIA 3GD7A 1ZVQA 2IYRA 2IYXA 3M0EA 4WIAA 5J40A 2VF8A 4FMBB 2J0UB 4B2IA 721PA 3I5YA 3IDQA 3UKDA 3ZD6A 2QA5A 1MR3F 4Q21A 1ZNZA 2QMUA 3L0IB 3QIAA 4I4LA 4TT3D 4AWXA 3NBYC 5CITA 3UMRA 2OHFA 1UBEA 1FTNA 1C4OA 4DLWA 1U98A 4MKFA 4DLSA 2D7CA 3AVOA 421PA 3QKSB 1EG7A 1OHHD 2EVWX 2IXEA 3B9PA 3P26A 3GP8A 2J45A 2GZAA 2R6GA 5JCZA 2WJVA 2ZVQX 3AVPA 1CR4A 3QUSA 5JI3E 4JLOA 1Z8FA 1P75A 4NE2A 4OJKA 4PXAA 4AYTA 2FDCA 2PJRA 1Z6GA 2J9RA 1U8AA 1XD9A 3CRVA 4V02A 3W3ZB 4Q01A 2ZYTX 2Q0HA 1OIXA 1G291 4ARZA 5FBWB 4RKEA 4QBFA 3QBTA 4Q4HB 4B3XA 1AKYA 1IY0A 1F48A 2QAGB 1Z47A 4R98A 3H0KA 3TSZA 1BIFA 1G21E 1IN5A 3WMFA 5FH9A 2GF0A 1E94E 2GEDA 3MMPA 1KKLA 3K1JA 1CR0A 4PC7A 5CJPA 3UG7A 4CIDA 1T4GA 4PPFA 5HR5A 2AXPA 4C7OB 3NHBA 2C77A 1CU1A 3NBFA 4A92A 4NCIA 3LLUA 1KY2A 1X8LA 4M22A 4QBIA 5G40A 3UWOA 5FL7A 2C95A 1II8B 5GVSA 1V5WA 1XTRA 2W0SA 4ZKDA 1E9FA 3KKNA 2F3TA 2HT6A 1L8QA 3RAPR 4CEIA 3RSOA 4TQAA 2ZRKA 4A6PA 1KSFX 2YOHA 4TLAA 4RY2A 4Q1BA 2FGJA 4U5XA 2G9NA 3U2QA 4BRWA 1U94A 5KPDA 1KDRA 2XAUA 4EPTA 1YU9A 2FPLA 3VNUA 4IVRA 2RMKA 5FBVB 2OFOA 1CXZA 1ZM4A 1E9DA 2GZDA 3PIRA 1W2HA 5M04A 5AUOB 4NYIQ 4WXPA 4JBYA 1XCPA 3UMFA 2P65A 3OF5A 1WMSA 1T5LA 4HDQB 5FBLB 3LBIA 1TQ6A 1OH8A 4ZI2A 3SE0A 2CL0X 2XSZD 3GJXC 2FPMA 3CUEF 1EFRD 3EXAA 3L0OA 3ZS9A 1KGDA 1AA9A 2FF7A 3GLHE 3AP1A 3WXMA 3U3RA 3KXIA 4EJSB 2WPDD 3Q5EA 5JLJA 2RGNC 4CEHA 2WOOA 2EFHB 2EYQA 3CNNA 1VCOA 1KOFA 5AJZA 2GETA 2IL1A 3N2EA 3D3QA 3GLFA 3RS2A 1ZW6A 4HUQA 1E2MA 4JBWA 2VO1A 2ZVPX 2QE7D 3PEYA 5TV2A 2D3WA 3QKRA 4XSHA 1U9IC 2YC2C 1R10A 3U6KA 1E9EA 1UKZA 1OXUA 1YR6A 1ZU4A 2EFCB 2FFHA 3AVQA 3P1JA 5EXSA 2OCBA 1GFIA 5K8LA 2AL7A 1TEVA 3TQCA 1KI4A 4TSFD 5AJWA 3EZ7A 4O2LA 4AC9A 1E4VA 2IYSA 2ZREA 1MKYA 2EQBA 1OHHA 1T3HA 3G82C 3I3SR 1AJEA 2QM7A 1P2SA 2OLKA 1VG1A 3SNHA 1KK1A 3GJ3A 4WZ6A 1G3QA 1G4UR 2V8OA 4YXWA 6Q21A 4GZLA 5E3HA 1BH2A 1FL9A 3SBEA 1SVWA 5E4FA 3MWLA 3UK6A 4URVR 5JI2E 2QRZA 1W4RA 3LQRA 1A5TA 4TLBA 2IWRA 3AVYA 2GXSA 4LCBA 1DAMA 2IEZA 3GLIE 2XZLA 1UFQA 4Z1MD 2GBLC 3DEFA 4ON9A 1L4UA 2GZHA 3EPKA 4F7WA 1QHHB 1EFTA 4A82A 3K9GA 3ZVNA 2D2EA 3GEHA 3B85A 4HAVA 4OI4A 4PTLA 1T91A 4M1KA 4Q66C 1OFIA 2QP9X 4MGKR 4Z8YA 3WNCA 4EKDA 1F2TA 1DAGA 2ZM5A 1RRFA 2ZSAA 1Z6YA 4KFRA 4URUR 1GL6A 2XB4A 4LJ5A 4QGHA 4CDGA 2MSCB 1R5NA 4NH0A 4Q19A 3VTKA 2O8FB 4BQSA 2CVHA 3K70B 4Q9LA 5E7MA 4MKGA 5TARA 2PX0A 3MCAA 5FBRB 3EARA 4B32A 4GSYA 4AYXA 3SHWA 1UJ2A 1HQCA 2C78A 3OAAD 5C4GB 4NL4H 4JZKA 2LWIA 3QQ5A 1KSHA 1OKKA 1LFDB 1ZD8A 4PFSA 3HYTA 4XWOA 2AR7A 1US8A 2GNOA 3B9QA 4H1VA 1KK0A 1PUIA 4OQLA 2BCJQ 2ZRPA 2V4ZA 2AD5A 4NPHA 2FX3A 3D7MA 4DT1A 4UJ5A 1UPTA 2JJ1D 1I2DA 1Z2AA 3THYB 4IW3B 4PHHA 3UATA 3FFAA 1PLJA 1VIYA 2IXFA 2AWOA 1CLUA 5L3SB 5JJKA 1EFRA 3FHCB 1ONBA 4OHVA 3TH5A 1E2QA 1Q20A 2WPDA 1XD8A 2VBCA 2CHGA 2PZGA 4CYMA 2QMOA 3SYLA 1E69A 1MRSA 1YR8A 3B1ZA 1PV4A 2IHBA 4DEXA 1XXHA 3RS5A 1EK0A 3OFNA 3DO6A 1ZC3A 1CR2A 1KY3A 4LC1A 3R9XA 4RFVA 1N0UA 4GBMA 1DG3A 2G0TA 1K5DA 1JQLB 2IYZA 5HZKA 3G0HA 2JJ8A 3FMFA 3IEUA 1VIAA 4KLNA 4XWAA 4M21A 2D62A 3AVWA 3A36A 4B3DA 1QG4A 3A8TA 4QHSA 2C9OA 4M1YA 4LHYA 1SKQA 2IS4A 2BBSA 3U7FB 4V0KA 3VNVA 1A2KC 4R9UC 1VYTA 1YZTA 2FZLA 1E1RA 2ZAMA 2CBZA 1H8ED 3I61A 1NG1A 3K9LA 3ECCA 2CLSA 3HU1A 1XMIA 5D3MB 3KJIA 5KDDA 1CTQA 3LO5A 4IVPA 1X1SA 1WBDA 2P6UA 4GP6A 1MH1A 4JL8A 3H2YA 1T0JB 2FWRA 1DTSA 1D2MA 1XEXA 3TNFA 4A4DA 3BD9A 5F3WB 5LD2B 4PO9A 1JJVA 2J0UA 4UNSA 3JVVA 3D6TB 1LF0A 3GLHB 1KTVA 2QNRA 3E1SA 4NYJR 3R7WA 3TVTA 2CL7X 2XXAA 4C9BA 4MRVA 2OBLA 1OE0A 4CT4B 1W5SA 1L4YA 2V54A 2O0JA 3TQFA 3U44B 1T3SA 1HEIA 2WICA 3QXJA 4B3CA 3THWB 3GJ7A 1S96A 4FI3C 2AFHE 4EPVA 4EUNA 3AKDA 2W2TA 2WSSD 1Z22A 2OCPA 4RFSB 3KL4A 5JBQA 5FR2A 4JVMA 4IJMA 1IY1A 3CX6A 4EFLA 3FE2A 1CJVC 2WMOB 2H5EA 3Q8XB 1TNDA 1TF7A 2ZRIA 1N6OA 2ZJ8A 3OAAA 5DH9A 1OH7A 4DSOA 121PA 2PLFA 3BORA 3FMPB 4ZCLA 4DSNA 5IK2D 4F92B 2SHKA 2GAOA 2GWHA 4DLUA 5L8VA 3PUXA 2OXCA 1G1MA 1RYFA 3WMEA 2O8EA 1RYHA 5J4LA 1M74A 4C3ZA 1KZGB 1TQ4A 1ZP6A 1G20E 3KXLA 2RGGA 3EWAA 4LSGA 5CK4A 2JJ1A 1QHIA 2Q3MA 1ZIPA 3X1DA 2EFEB 4WA7A 4IXNA 1X86B 2A5YB 1ZD9A 3NXSA 3GLIB 1E2NA 3ZZ0A 3TUJC 2W83A 3LXRA 5JRZA 4P3YA 1R5OA 1XEWY 3TSOA 3AM1A 1G7CA 2ODBA 3WY9A 2DFTA 2G3YA 2JLQA 4HSEA 4CT5A 2EU8A 3L8YA 2JDIA 4G5RA 5L3QA 1W44A 3BS4A 4G5OA 2BBWA 3F8TA 3F5FA 1N5JA 3PFIA 3QENA 4KJZA 4ZV4A 2XX3A 1NVVR 5L3RA 5DHAA 2W2VA 5FUWA 3RS7A 2XB2A 2P6NA 4J0QA 5HKKA 4KITB 3ZIAD 1QRAA 4LYJA 1D2EA 2NO6A 2AK3A 2ZI9A 1AQUA 4TYPA 4ZDWA 2XNSA 2VP0A 4L15A 1N5LA 4IFEA 3VX4A 4PC1A 3CNOA 3QKTA 1G18A 1ZCBA 4U02A 4ARZB 3PR1A 1ZM3A 4NCKA 2IUTA 1U0JA 3AV0B 5KPJA 3CRMA 3ZGXA 2GEVA 2K5UA 2R6FA 4KCGA 4LI0A 1NVUQ 4P33A 2D7DA 2A5DA 2ZRCA 3AGQA 3KXKA 1R0YA 3RC3A 2P0EA 4FMDB 4C0LA 4TTQA 2F6RA 2O0KA 1LV7A 3NBZC 2B92A 1FZQA 2QZ4A 3FKSD 1XXHE 1K6MA 4BEBA 1S3GA 4JLVA 2CXXA 2VEDA 2Z6VA 2CE7A 1IXZA 1L2TA 3M6AA 5TDHA 4TLCA 1S1MA 2FOLA 2ZRMA 1ZU5A 2A5FA 5DI9A 4QGFA 3Q7PA 4IDQA 2JGNA 1QHXA 4CEIB 2RGNA 4W5WA 2REOA 1UDXA 1DO0A 5AUQA 3KUDA 4L4UA 4CW7A 5BN4A 2IF2A 3LLMA 3RDPA 1MO6A 2GCNA 1BOFA 3QPUA 1FFHA 2OZEA 1P2UA 2R65A 4K8OA 5CIQA 3N5CA 1IJEA 4GOKA 5TVKA 4DUGD 4TTPA 4U00A 3K0SA 2V7QD 1U9IA 5J5CA 2X2EA 4LHVA 1SQ5A 3PEUA 1VCMA 4M4SA 2ERXA 4GP7A 2BC9A 4NMMA 1AZSC 2HXYA 2QM8A 5DIFA 3SFVA 1SKYE 4YONB 2GA8A 4B48A 5FTLA 2J0QA 1AIPA 1XMSA 3NWJA 1N5KA 4B2LA 4IHQA 2QG6A 3UMSA 5GJVC 3JZMA 1VKJA 1Z6AA 2VYFA 2QP3A 4IVQA 5IK2A 5IHPA 4ZDJA 4DDWA 1NLFA 3H1TA 3AB3A 4JLBA 4HLUC 1P4SA 2B8TA 4MYCA 2GJSA 2WMNB 1ZNYA 4Z8XA 4CEHB 5JHGB 1QHHA 4RCZA 5C4MA 4YMWA 4DLRA 2PL3A 2ASEA 5BN5A 4QC2A 1RRPA 2G88A 3GLFB 2RAPA 4WVFA 3L8ZA 4HUQB 4O2RA 5IDVA 5G3ZA 3QKRB 4XVRA 3IBGA 2HYIC 4EQ6A 1U8ZA 2BOVA 1O3YA 1MT0A 4C0QC 2AD1A 1LS1A 4OBEA 1HURA 2JIZD 1Z28A 1IY2A 3BAFA 3C15C 5DI3A 2QSZA 1BYIA 3WBJA 4GL2A 1W2GA 1FUUA 4OYHA 3N70A 4URYR 2C99A 2BKEA 2FFAA 2ZU6A 4NTZA 4LY6A 4QRHA 3LBNA 5JRJA 2PX3A 2C04A 3C4JA
chains in the Genus database with same CATH superfamily
1V6SA 4BV9A 3S8EA 3HCFA 4PC6A 5GONA 3VU9A 1CY6A 4ZDKA 2AFHB 1YJXA 1YONA 3V8EA 3I1JA 3WP0A 4V03A 2BEJA 3UC9A 3KQKA 4L6IA 3V2HA 2MJLA 3F3YA 5BV0A 5GIPE 4C7MA 2Z0MA 3I6IA 1JEJA 1HT1E 2HMYB 2I2DA 3OZIA 4IOKA 4ZEOA 5JEDA 3FRIA 4DCSA 1FDRA 4GBGA 5LOVF 4GPTA 3LRTA 4V24A 1EB9A 1DC6A 2X5XA 3N75A 2QQGA 1Y48E 1UM9B 4DB2A 2Q3FA 5CFLA 1EFKA 1DDIA 3RTGA 4KJXA 2XOEA 1HPLA 3O8RA 1G55A 3NNDA 2B9VA 1XU9A 2IYYA 3ETGA 4IYJA 5JXIA 3FHJA 3KJHA 3L6DA 4FC6A 2IUYA 1Y6QA 3DKKA 4NICA 1V3QE 2PVSA 3EGDB 5IKOA 1W1WA 2DBRA 2PRZA 5I9MA 5TEWA 1HDXA 1SCJA 2ORVA 2Q50A 3F6BX 3FWHA 1WIWA 2D4HA 3M6UA 4G8BA 3RAGA 1UP4A 5DEIA 4IUBS 2A92A 4F3YA 2PN1A 5B37A 1XU4A 1WY5A 3B7GA 1W0JD 3U5ZB 2W5UA 1H8HA 4F5WA 2HBYA 4ZTBA 1DAHA 2BGNA 3C3JA 4IICA 5BNZA 1IWPB 3WG9A 2F48A 1DIAA 1G8JA 1Y7LA 2LDXA 3N39C 4UAJA 5M2QA 4KDRA 1Q95A 1B1AA 1Z29A 2ETVA 3PQEA 4YCDA 4NPAA 4NG4A 1LK0A 3EDCA 3QNUA 1SZDA 2EDAA 2I4RA 1U81A 1XCBA 2HWKA 3C8ZA 4X45A 2IUUA 5I4IA 4UEQA 3Q7SA 3DM5A 1W5EA 5AJXA 2H06A 4M83A 2YJ5A 4XJTA 1MRNA 1OLSB 2MYNA 3ITDA 2IOHA 2NZWA 1QVVA 2UV8A 3QXGA 5CEFA 5BQOA 3NEAA 3R3XA 4MVJA 4G1BA 1UPBA 1QK5A 4C87A 4K03A 3RUIA 3N2NA 3LNTA 2FR0A 1I3OA 3TZHA 3IL2A 1VXOA 4B9EA 1M2VA 2OB1A 2Q9CA 4GPAA 3OPMA 2NPOA 4IMJB 1B43A 3BWXA 2C2WA 2AMJA 4GO1A 2IYVA 4EHDA 3BKWA 3KYDB 3O47A 4UCFA 3QW2A 4HQLA 2NYAA 1WOMA 1LBSA 4KPFC 3FTDA 4IZHA 4X84A 2PUCA 3AEQB 1N7GA 4K8RB 1MN6A 4OP3A 5SZIA 1H1LB 4YRFA 1C4XA 2MWMA 3T0GA 1EDBA 1NI3A 1JU3A 5F1KA 4EW1A 1T6XA 2GHQA 1VMDA 3CUYA 3PRJA 4AO6A 3ELBA 2BW0A 1R0XA 3I2GA 1IOZA 1C9EA 1NV8A 2XBLA 3H4IA 2IOFK 3IPLA 5D51S 1AO3A 1L7RA 2FHPA 3AHFA 3LCVB 2Q4OA 4KDFA 2I4TA 1E6CA 3CZQA 4LYGA 1WB9A 2W6OA 5L7TA 2OP1A 4FGKA 4J16A 3WQBA 2QPAA 3LXXA 3WIOA 2IYEA 3A3KA 2QTFA 1SULA 2YN0A 1D09A 5A5GA 1SIOA 5HRCA 3EYWA 4NARA 4RD2A 5JH7B 2CLFB 4ESVA 4FJ1A 1CJTC 4JJ7A 4AJ1A 2J6HA 3MCZA 4FT4A 3OJXA 1UADA 3HCCA 1FTGA 2NUAA 1D1TA 3A6PC 3IV7A 4DYHA 3R8XA 5LP1A 4X60A 2AJLI 3DR3A 3BSSA 4EEZA 5IARA 1EE2A 1I3LA 2ZIWB 3PC4A 4KGVA 4MV0A 5CXXA 4EG6A 4YO8A 1GQFA 1TIPA 2I2FA 4S2UA 4M7OA 3ZHXA 5HGJA 5JY6A 3BJEA 5LA6F 4DR4B 2ONKA 5PGMA 3UHJA 4BPRA 3NBXX 1OFVA 1H0RA 2OVBA 4G9BA 3WLOA 2BFFB 5G4KA 4CR8A 5CVDA 1NOJA 1QO0D 1S8NA 4P53A 5CIYA 1NLUA 3GOHA 4X62B 2QBYA 1K86A 5CDHA 2XB6A 1NUPA 4Q00A 4WGFA 3Q40A 3R7WB 2GTIA 3UK7A 3ZOZA 1FFYA 1ZK3A 1U3WA 1RAHA 1Z4IA 3GL9A 1EVKA 3IT2A 3K30A 3ULKA 5F5XA 2I6FA 1XHLA 2PSJA 4HX2A 1KYVA 4KUGA 5B6JA 4JX9A 1KBOA 2W8BA 4TMTA 4FDVA 1SC9A 1AKEA 1DX9A 3I01A 2GN8A 2JPDA 2VCHA 2DQKA 1FVFA 1U65A 2CJWA 1FU8A 5DSXA 4RX1A 2WT8A 1X80A 2IXAA 4L8VA 2ZJOA 3LCMA 2PLAA 5NULA 2RGAA 2JJYA 1SCIA 2IK8A 3AOEC 3R8CA 5AW5A 2MINA 5JPCA 4KMMA 3DZDA 4L3OA 3KETA 2BFOA 1X13A 2ZR7A 3OFKA 3U3XA 2YFQA 4YRSA 3CUVA 4BO2A 4X65B 2Z6UA 2BV3A 2QP4A 3USES 4IMRA 1KF0A 2FRVA 3ICOA 4JROA 3HV0A 3INRA 1CB7A 1X1TA 4P4TA 3LC7O 5ER6A 5FOTA 5BO5A 2JLCA 4H0NA 2P1ZA 3FVRA 3WJ7A 3U80A 1JU4A 2Z8XA 4XCVA 1U7UA 1U1EA 3U5TA 2BPOA 3AEUA 4FGLA 3C43A 4G3XA 4HRXA 3A28A 2M6SA 4L78A 1MAVA 1Q7GA 3TM5A 1POXA 3I5XA 3ZD7A 1FUYB 1WZEA 3WNDA 4GXTA 1CZKA 2Q3BA 1BHO1 2EZ9A 4OL0A 3U62A 3KWFA 2BFAA 3VYSB 5IYZB 1R0BA 4R83A 2UVDA 4LBYA 3DC2A 2CLMB 1IHXA 4BX8A 3MQ2A 1SC1A 5DM1A 1O8BA 1OYOA 3WMGA 3ZY6A 1MO3A 2GN4A 1N9GA 4U7FA 2L19A 3ONDA 1BCRA 5CDSA 4KYIB 4O4IA 2C84A 3DT8A 4PZZA 4ZAGA 2Y93A 3NWEA 4LW8A 4MUFA 4NNJA 1PZGA 2VT2A 3I32A 1T2VA 4RYLA 1JEOA 4NJEA 4KE6A 2OE2A 3SFTA 4CV3A 4A6DA 1O8CA 2Z95A 4UDOA 5BW4A 2ZYIA 4K46A 4Z99A 1W4BA 1ZO8A 1A9SA 1YV9A 4LZNA 1IEWA 4I50A 2PGAA 1DTWA 2OD7A 4ZN6A 3ZVRA 1MOZA 5C5DA 1QVRA 1NZFA 1CZHA 2JD1A 3CR8A 2UZ4A 1LNQA 1HORA 1W9HA 1YKSA 3KKEA 4DBVO 3FJYA 1ZVMA 5A05A 4GQAA 4MVJE 2E48A 4DDVA 1UM8A 1RHQA 1U8CB 4GQBA 4DMGA 1XZPA 2RBGA 1ODLA 1Q7BA 3Q5GA 1OB5A 5B1DA 1KEZA 4LA4A 4B3BA 2GO7A 1XZAA 4G1MB 4Q37A 1C7IA 4QQFA 1SVSA 2VDRB 2VNIA 1FF9A 2W6IA 1XVTA 1UF9A 3DWIA 3WLSA 2HDOA 2O7VA 1JT9A 5EXXA 3EVNA 3UJ6A 1B6TA 4J0CA 4ER0A 1B42A 1C7RA 1XYGA 2IEGA 3FYUA 1ZUNB 1VFNA 1WD7A 1XG5A 2WZBA 4M9CA 5EJGA 1XTKA 1SXJA 2P2NA 1SB8A 3CLRD 3ID6C 4WNCA 3NTLA 1J99A 1SVMA 1TZCA 1QYVA 4OYRA 2YWHA 3CX7A 1JEQB 1YNOA 1FYEA 1Z13A 4IKEA 3IDSA 3H5LA 3GLVA 4HGQA 2YXBA 1Z5OA 3WMRA 5LLDA 3ZWKA 3B5IA 3HB1A 3BRWA 1SBTA 1IIBA 1NMQA 4GWGA 3ZKAA 2C0CA 3E7XA 3SDSA 4D6XA 3I9JA 4BEJA 2FPGB 4FYJA 4RPIA 5CX1A 1A9RA 1U6JA 1UWCA 2JLUA 1XNJA 2L0XA 2XHEA 3PEFA 3P2KA 4OBWA 1MNQA 1DE0A 1YZUA 1UEIA 3ED5A 3GUUA 1NWHA 1OOEA 2H18A 2HK8A 3EISA 1UJCA 1ZGJA 1D2NA 1TAHA 4WA8A 4XARA 1U1CA 1DX4A 4C76A 2WP0A 4J91A 1JPVA 1YRHA 4NSNA 2UAGA 3IP7A 1Z2DA 4RZUA 2NUTA 4X71A 1EH5A 1Z5ZA 1HMYA 2QJFA 3N6XA 4YAFA 4YT5A 4P9NA 4Z2AA 4DR3B 1HE8B 1DOZA 4RXTA 4TTIA 1EXDA 1P45A 4MQFA 5I5EA 1RNLA 3WIBA 1NKVA 4Z49A 2X86A 2EXXA 3D7LA 4BFSA 3MCWA 3W1EA 4QPCA 1H2ZA 2COUA 3LYHA 3FOAA 1L7DA 2HPVA 3LUBA 1YRYE 3OLXA 2HHJA 3MTBA 3DKVA 4J0DA 4YDRA 3WNQA 3A1TA 4R7TA 4ZJUA 4XQGA 3OPYB 2A9JA 3AETB 4HYQA 2VAXA 4JR0A 3SJUA 1JR3D 3UJDA 4AL4A 1DKNA 1YTLA 3QLUC 3COPA 1E1QA 4UM8B 3UBTA 3CMMA 4OJQA 3QOXA 2YMPA 3HPQA 1YZNA 5DVZA 2XD9A 1PWXA 2PV0A 1I1OA 5DI3B 5JXWA 2OXEA 3CB4A 1VHTA 1DBPA 3P27A 1OU0A 4E70A 4WLNA 5B58C 2PH1A 4KWEA 3WP1B 1DBIA 4L07A 4IJUA 3TSWA 2NZXA 3JSXA 4Y7CA 1FFBA 4I8DA 4EL5A 4MR8B 5EKXA 5A71A 1YJBA 1NYQA 1D0VA 1S8OA 2REXB 4Q4DA 1VC2A 4WH0A 3QWBA 1W75A 3NM6B 5AMXA 4KFSA 5GONB 3DEIA 4IIDA 3VU9B 3WB1A 3GJRA 2OPBA 3OTHA 4AMZA 4CFYA 4AP6A 3ABZA 5FDFA 3MWKA 2H4JA 2ZYVX 5IASA 4CN9A 4M7PA 1EWRA 3C3MA 2FFRA 1JRLA 2B8JA 1CE8A 2R8BA 4CRWB 5JAMA 1X3LA 2JBHA 1JHRA 1NBHA 3W77A 3BH0A 3SC2A 2NIPA 1C3EA 2NVBA 1UAAA 4JLAA 2FZVA 4TZTA 1AQ6A 1A3CA 2XSZA 4A1FA 3K1AA 2JCSA 3CTMA 3RVNA 3DDWA 3LQFA 3ROTA 3NCTA 5LQNA 2Q6VA 3NYQA 1USUA 2Q4TA 3HFJA 4R2XA 5IVHA 3VV3A 4QREA 2RJNA 4G5QA 2AXNA 4YJFA 3EVAA 3AKZA 3IX7A 1A50B 4IV0A 2ZYAA 3M9XA 3KTAA 3EEOA 4NBVA 1HGXA 4V0OA 4QUEA 4XGIA 2OZLB 3JAKA 4JN6B 1KI3A 5FPKA 5LFAA 2V0NA 4OUDA 3HVRA 1XXLA 4RTMA 4ENRA 4IIHA 2PH7A 2I29A 2G08A 3ZD6A 3F4LA 1Z45A 3MGBA 1O9HA 4MV5A 4Y2TA 5EL0A 5GZ1A 2EKDA 2JZCA 2X5JO 3PD1A 4O33A 2HBZA 1YVUA 1JA1A 2WHQA 1Z2OX 1P6UA 5CX4A 2O8BA 5MDHA 2CXTA 1DBWA 2ZI7A 3JR3A 3P9CA 2ODNA 3VO1A 2ATCA 2QMEA 4YMSA 2OZKA 4TSFA 4HDAA 3ETJA 4IJKA 2NP7A 3VKGA 4WXMA 1H4VB 2ZUTA 9ATCA 4WNIA 4FWTA 1NUTA 5E8RA 4KP7A 4G5FA 4YRRA 2BSXA 3ZJYA 4RC9A 3WNZA 3GHYA 3QLVC 1E4OA 1N92A 1M0SA 1RU3A 2HCFA 2XGMA 1JEEA 1V16A 4U7HA 4WCDA 1YTUA 1RFLA 2JLXA 2VF4X 1KIMA 3GRVA 1ONSA 5FULA 3T9DA 4LDRA 4PZLA 1PF7E 1ZAYA 1EVQA 4YA6A 4KI7A 2CLDX 2ZSUA 4X6XA 3OIVA 2JLYA 1CEEA 4BDSA 2GD6A 2I99A 4FFSA 2PGLA 5FUMA 3VV2A 3JZFA 1GL9B 4LE0A 2IKSA 4P81A 2M1XA 3BDVA 4NABA 3TLJA 1SXJE 1M2VB 4J9VA 1IEXA 4MCJA 4R81A 2BCEA 4TSKA 4WGGA 2IDKA 4DQVA 5I7FA 1KVUA 1XKLA 4XIIA 1XYVA 5B3JC 1NOIA 4PIMA 3ZTWA 5F98A 4FYKA 2R2AA 1HWYA 2AI3A 3K2BA 5FV7A 3VH4A 3VZQA 4DY4A 4FZ3A 4LHWA 5ES3A 5I01A 1VIMA 2RCNA 2QLLA 4LXYA 2BM8A 4EA9A 4OB7A 1VLHA 4JB0A 4C03A 1P7YA 4U4AA 3WRVA 1FLVA 1D7OA 5IJWA 3P5SA 4DFDA 2C9DA 2VQ6A 1XL1A 3H65A 2G5GX 1YE5A 3HM9A 2XEXA 3RU2A 5FT9A 1EWQA 5IF9A 1W36C 1E8NA 1QP8A 4HXYA 4PC2A 3NIGB 4DQ0A 3ADBA 5HRAA 4K05A 3NB0A 5GPBA 5KYVA 4DQDA 1Y4ZA 4JFRA 4EATA 6AT1A 1LTKA 4R4JA 2ODTX 5FYDA 3KPUA 1L1QA 4MGEA 2NUAB 4IEFB 4AN0A 1WCWA 3PDJA 2R60A 1MAAA 4B3FX 4ZO9A 5T6MA 1HDIA 3FX2A 4NBTA 2B3TA 1PJ4A 1YE3A 1G9XA 1XK7A 3K35A 2F67A 4EAAA 1E77A 1MF7A 2H3HA 1N2OA 2A2ZA 2WG0A 3AOEA 3GGSA 3HKEA 1P1BA 3TI9A 4MVJP 4XJXA 1BHSA 3ZZNA 3DLAA 1DEOA 4LF4B 5JFGA 1LXCA 4IXDA 1C81A 3U7GA 3B9BA 3CZ5A 1VI2A 3LM8A 5G4KB 5JE8A 2ZAYA 1OX6A 2JHPA 2JAUA 1JQKA 4C0BA 4CG1A 2QBYB 4N8SA 4UMEA 1RMQA 3P9KA 1KO7A 2BWJA 2AN4A 2KWIA 1BRMA 2VHWA 3DONA 4PCVA 4EB3A 1J21A 4QXQA 2OAEA 4L9RA 5F7ZA 1OGYA 3C3PA 3QEJA 2YVQA 4DXAA 4PQFA 1UT8A 4AAYA 3GZTB 4IDFA 4B6GA 1Y7HA 3K5IA 4FT2A 2C4MA 4N0EA 2ZBUA 2LIVA 3ILXA 1G5PA 3EGEA 3MWDA 4LRWA 3VR3A 2DTDA 2MSNA 2W8BB 4ND8A 3VNAA 4ZI7A 2BYTA 1ZRMA 2RK4A 2CMFA 4BGDA 1CZOA 5FOVA 4MQ5A 2FRDC 4JBIA 1Q7CA 3LVBA 1GN9A 2AOVA 3ESAA 2CJWB 2VDWA 2RGRA 4AY2A 3LK7A 1Z6XA 4UNRA 1X80B 1ZONA 3A6DA 1MBZA 2DKFA 3AKCA 4TL8A 2IWHA 1U3FA 1XO1A 2Y1OA 1T5HX 5A0FA 3PUWA 4UMDA 3EVTA 2JFZA 3W4KA 2MINB 3TDMA 5ITSA 2VPPA 4RZ3A 2V4MA 3NVAA 1E99A 2PQ2A 1JPJA 2Z98A 4OHWA 4KVAA 2RG1A 5IULC 1E2KA 1MO4A 3IQFA 4M89A 3RCBA 3K70D 2X9GA 3NQ41 1RWWA 1PL8A 1G38A 4ZKEA 1S9DA 1S8FA 1YZGA 2QRNA 2ZRHA 5K0LA 4QEZA 5KX5A 1H8EA 1BQEA 2BL4A 2CLEB 3JYQA 4TS4A 5HIIA 4R3NA 4B35A 1SBNE 4B31A 5KNCA 4AN1A 2ACKA 5TNXA 3AUJB 1CY4A 1IYZA 1IHUA 2A7QA 3AEUB 3GUHA 3M81A 3D6JA 1Z7YA 5HFNA 4I6GA 1N6KA 1RW4A 3DMNA 5I9LA 3E5MA 4BL5A 4DV0B 4KRXA 1WBBA 1ZMRA 4EPXA 3HR8A 2DG2A 5DF1A 2DBVO 3B8HA 4X7MA 1E2DA 4IDBA 2IP4A 1HTBA 3CCBA 1GUFA 4G1CA 4UOEA 2VF2A 4IH4A 3KHUA 1HFKA 4YV7A 3GRFA 1XZQA 1WXXA 2XTMA 4F97A 1GKUB 3P2JA 3G9UA 1NQWA 1RXIA 1ZOIA 3EUEA 3OBBA 2C4WA 2Y66A 1N9GB 5H7XA 1BCRB 1NW3A 4YJKA 1HE5A 5JNWA 3SJBA 1NNUA 4HPXB 5D86A 4XR9A 2VAMA 2V3VA 4J0EA 1B1CA 1E5VA 1OBVA 1ISHA 1RMTA 4D74A 4NJEB 1II9A 3A3OA 3Q7IA 4N5HX 4OHMA 5K3BA 4DVGA 4LQCA 3IEIA 1KPHA 4F9TA 3I5AA 1FX1A 4RF3A 2NSHA 3P0EA 2GCGA 5DGCA 1Q1GA 4HLCA 3SEAA 4DL9A 1WULS 1D6JA 2ZR8A 3K6SB 5A7GA 4I50B 1THTA 5DFAA 2PUJA 1NBMA 3RKRA 4OI0A 1E18A 1DTWB 1FMJA 2P7HA 2WG2A 3ER9A 4HXFB 4ABYA 3NVKI 3MXOA 3QVSA 2WSSA 2JATA 1GM5A 5B6PA 4OQMA 3OIUA 1UZNA 1V9SA 3K53A 3HCNA 4Z4GA 3IKVA 2Y1EA 3GJ4A 1PO7A 5TLSA 1ISFA 2XQGA 4MMZB 5TT0A 2O14A 4OGLA 3RWBA 4CKWA 1E6LA 4O4JF 4A6XA 3G68A 1I30A 4EGAA 1ZGGA 3IAM6 3RROA 2BZGA 3FVVA 3BHJA 3WLHA 3SM9A 4J1TA 2FZ5A 4M1SA 2IIQA 1EJBA 4NECA 5HG0A 3ZIUA 2HPAA 2B7BA 3FW1A 4BKQA 1P3DA 1CDOA 1C3XA 1ZMBA 2CHVA 2NZVG 3HJTA 2YMQA 4GPBA 5CDFA 1AKUA 3W2FA 1DWPA 1ADJA 3FSGD 4GOLD 4ZARA 3GP5A 3AIMA 2XVAA 3W3AD 3KR2A 2D2VA 4MR9B 4M0UA 4EJ2A 5CCBA 2VP9A 2C4UA 2JHGA 3FYUB 5BV1A 1XMJA 1NBOA 2J3HA 3ER8A 4KQGA 3LP5A 4F56A 3O95A 1PT7A 1XD2A 3KO8A 3PT9A 4XDHA 5I7OA 2AJ8A 1SXJB 4IP0A 2G9QA 1RXCA 4RQUA 3TTUA 3ZNNA 4MVWA 2VPTA 3L6CA 2JA2A 4UU8A 4CKCA 1ZHFA 3I4FA 2OQIA 1Q15A 3PUYA 4W1RA 1S2MA 1R2QA 1FUKA 4HNUA 3G0HA 1H2WA 3QI2A 3OZCA 1WVMA 2AV6A 3KTOA 4OSEA 1FU4A 3SZ3A 3VAAA 3SR3A 1ZCJA 3VPFA 4PPNA 1GLVA 3A4IA 3TQRA 1LJ8A 1G8MA 2DR0A 1PQUA 2P62A 3MJFA 3RF7A 4D43A 2JIBA 2AEFA 3QLUA 3ZY3A 2KE5A 2BE7A 2WSMA 5KJ6A 4IMPA 1FSFA 1NQVA 1ML4A 4QYXA 3BF8A 5CX1B 3V1MA 5HP4A 2QTCA 3DT9A 1LRJA 5LJLA 2R4UA 3VNRA 1ZJ4A 2GFQA 1ZN2A 2MMGA 1XWIA 3PFBA 4P4SB 3RU3A 1TX4B 1CP2A 4CL8A 2GJ4A 5CT6A 3HBJA 3D1JA 5EN4A 3U4HA 2W42A 1QCYA 3QF4A 4QUDA 1JBEA 3DWEX 1OZFA 3TPFA 3RIMA 2CV0A 2ZIVB 4RTLA 4LE1A 3GCGA 1HFJA 3DZ8A 3WICA 4CODB 3GEMA 4OFZA 3DF9A 4R2HA 3K2EA 2NUTB 4GW3A 5GGXA 2JGKA 2P9QA 1ILEA 1Z0IA 2OCGA 2QTBA 3E9ZA 4KLCA 3PXBA 4L76A 4K9NA 3RSLA 1TGVA 3RW9A 4US2R 4L9WA 1B6RA 1NSYA 4PNPA 1IN1A 4Q7KA 4MQFB 3ISVA 3RYTC 1D1QA 1K6JA 4ZVQA 1K7XB 1DU4A 4XYGA 3T52A 4KTVE 1VI6A 3NX4A 2H07A 3QWIA 1I3NA 3FMOB 3NJ4A 4QTXA 5LP6C 1EZ1A 4AW9A 1Y4AE 5B1YA 3MSXA 3A05A 2NNWB 3E35A 3FKSA 5KCZA 4HWOA 1L5SA 4JI1B 3GW8A 3HVJA 3AF3A 2YQ5A 1MV5A 5IM4A 1CF4A 3I52A 4I4TA 4MW7A 3BE5A 2GAJA 2GYYA 2VKTA 4ZCIA 1GRCA 1IB6A 5F4ZA 3TSYA 4FDLA 3DDOA 4NE7A 1Q12A 3CUTA 1RPAA 2FEOA 3OU2A 1BMFD 2QD2A 2IYNA 3R4CA 3BWBA 4FMPA 1O9BA 1P7CA 4IGKA 1OXXK 4J3JA 4UD2A 5AK6A 3TNDA 4BMNA 2BKLA 3HGMA 3ZNPA 4UBJA 1ZFNA 1EX6A 2B20A 1PN3A 2QD3A 2W6MA 5GP1A 1XLVA 3S2GA 3CVWA 4ARBA 3QJYA 4B4OA 3O91A 3I9KA 2O6HA 2A8YA 4KR3A 1C1YA 3M6IA 2AI1A 5CNIA 4ID9A 4H7JA 5FYQA 5EESA 3G49A 5P21A 5SZHB 3I8SA 1ZDMA 1CE8B 3C1AA 4LWPA 2P4QA 1SU6A 3BWDD 2GHIA 1JDZA 1C50A 1JB1A 4X93A 5CH8A 5B2ZA 4BASA 5GTDA 5LMCA 4CG2A 4FR2A 3RR2A 2O54A 4TMZA 3GGOA 1MXHA 1SBHA 2Y68A 3SC2B 4NMLA 1KARA 2VRCD 3FPKA 3I42A 2GQ0A 1TAQA 1A97A 2XD4A 4PPGA 5HBRA 4ZK2A 3K1AB 1YE8A 1JQEA 3T1NA 2X19A 5EUBA 4KQMA 5BSGA 2TRSB 5DYNA 4YS6A 2WKWA 4LV5B 4YJFB 5CCEA 3ZY4A 5KYGA 2A0XA 2POCA 3U4MA 1SD2A 4L0CA 3ZH2A 3KTAB 5KTMA 5HX7A 2PL9A 1G66A 2Q1UA 4BLTA 1GG9A 4UJ3A 1ZOOA 3JAKB 2DP4E 4GBED 4MQLA 1JG6A 1WS6A 1YMUA 2E6KA 2VFAA 1E58A 3EA0A 3BRCA 3MTQA 1UCFA 1RAGA 4OUDB 4PS1A 3RO7A 3SYMA 3TBHA 1NBME 1I7LA 1G2OA 2ZB8A 3N2LA 4FBLA 2ECOA 5FFMA 1C2YA 4AZVA 2A3NA 2ZS9A 3B82A 3AG6A 2RGCA 2XMRA 3AVTA 1I4EB 3FAZA 1LEHA 3M3HA 4EO9A 1XCGB 4EUFA 2O8BB 2O2JA 3EC7A 1F51E 1KMHA 4GRAA 5A7FA 3KLBA 1PR5A 5KEIA 3S29A 1ZD5A 2O48X 2E55A 1JFFA 4OQXA 4W6ZA 5TMBA 4AS1A 3FOWA 3HDTA 3KLNA 1JWLA 4DCNA 1FZTA 3WE7A 2YNMD 4UFOA 3ZY2A 1YI1A 2OXIA 3OQJA 2JHAA 2CYCA 1ICEA 5IKMA 1VA5A 3SPXA 5IVKA 4G81A 3L04A 3C7TA 4MV6A 1NW7A 1V16B 2GZ1A 1Y3AA 3PNLA 1Z4LA 5CDFE 5JJIA 5CGZA 5JSYA 4X9XA 3LPCA 3QBVA 3SQDA 3DCIA 3RS9A 8AT1A 3JZAA 1HQKA 4LQDA 4M9ZA 3W04A 4CNQA 2PM8A 2F3SA 2QMYA 3LV8A 1V3VA 2LW7A 2VG8A 3H8JA 2B61A 5IF3A 3DDSA 4RUKA 2XRYA 4N0DA 1MO5A 3VH3A 3GPCA 1A98A 1KS2A 5T41A 2HN9A 1SD5A 3SVLA 4AJHA 1I9CA 4O29A 1CUWA 3ZDQA 4ATNA 3H1BA 1UXJA 3I5UA 3KKPA 4GZ5A 2FN7A 4UBMA 4A27A 3QU5A 3GNTA 5JTTA 3OCCA 2OUKA 4DCOA 1MFPA 2Q3EA 3VISA 4RW0A 1KR5A 4PRKA 3D0QA 3EVBA 2R86A 1JKFA 1KQ3A 4JB8A 4MKXA 1B2RA 5E1BA 2OBBA 2X2PA 4Q4LA 1W0JA 2V3WA 4UKDA 3HL4A 4A73A 5K6TA 1JG1A 1IMOA 3FDZA 4JBXA 3R75A 2X1MA 3TGPA 4K6KA 1N57A 2AFVA 3EJWA 3GUCA 4ZAWA 2IYQA 2VYCA 1DCTA 3C5WP 3OETA 1QZTA 3A3PA 3H9BA 4ZGWA 2NZ2A 4C2UA 1K6XA 1SUEA 2ZI3A 4AN4A 3IPXA 4PZCA 1WSAA 3PVCA 3B1JA 1Z5UA 3C2QA 4L08A 5TB5A 1DX6A 4EG1A 2QVGA 5CFMA 5K4GA 2BEVA 2XVZA 5J5VA 1U8XX 1UJ5A 4PIPA 3HKEB 1Z88A 1QQTA 4NY1A 5HFJA 1EWTA 2W2OA 3OM9A 3T94A 5KDLA 3OPNA 2SCUA 3F5MA 2OYCA 1E5QA 2IYPA 3ABQB 4IJWA 2B4KA 1FTSA 1VYVA 4JKYA 5KOJA 1AMNA 1RBZA 4IINA 4LWOA 2XNKA 1PKEA 3H4MA 3N0TA 2XTNA 3UV3A 3QM1A 1BSVA 4TTJA 3NH9A 4GRDA 3LHKA 4XI9A 4F1WA 1FS6A 3OIDA 4EFMA 1QC5A 5H0IA 1KI7A 1BA2A 3NC1C 3V6LA 3SIWA 3WI7A 1TJNA 3VR6D 3C4VA 1GKKA 5K0ZA 1YZVA 10MHA 3MWDB 2GK4A 4AG6A 1FNMA 4BLQA 4ND8B 3HA5A 4ZJZA 3U48A 5BWMA 3RUDA 5JDIA 2Y92A 1ZN8A 2PYIA 1YA6A 1G9TA 2VDWB 3UW3A 1W73A 1GRNA 1KXZA 3U4AA 2B21A 3H5WA 1T15A 2PKYX 3MMXA 3R44A 2P67A 1CZLA 2ZJYA 1T43A 4M1EA 1R0CA 3LC0A 4NQRA 3P5BA 3HCPA 3CPEA 4OHKA 2XLBA 1R9GA 2RGUA 4L9AA 1SM4A 2JHFA 3SLGA 3TG8A 2VSOA 1ZRHA 1NR1A 2ZROA 1T3TA 4IQFA 1NJ2A 4Q3DA 3U19A 2O52A 2APJA 3E9YA 4KR6A 3LUAA 3COVA 1TZ2A 4CEJA 1A4RA 4IGFA 3PG5A 5KX5B 1IL0A 3EB9A 4QYIA 4PO1A 4DDTA 4JOBA 2CLLB 4B3GA 1OKKD 4JD5A 3X2SA 2GZRA 2RGBA 2YBDA 4CTOA 5BXQC 1AQIA 2P3OA 4EOGA 1Y3HA 2QN1A 4REMA 5CDUA 2FEPA 2O1EA 3COYA 1TLFA 2GBGA 3WFIA 4HB3A 2VQDA 4II2A 2IU6A 1GSHA 3DZFA 1M7HA 3E3OA 1JFSA 2ZCJA 1KHTA 4HDMB 5F2EA 4QUHA 1VJTA 1X1BA 1D2RA 2OCLA 1QO0A 2ZI4A 5T3YA 1NX9A 3BXGA 4KO8A 4QDTA 2JIOA 5EIBD 2AVDA 4HLUA 1GGNA 3HB9A 2PO5A 3EA4A 4ITUA 2WHXA 3UCXA 3A27A 5K5EA 3LI2A 2G82A 2H2IA 3DB2A 3HM2A 1NWCA 1ICIA 1BFKA 3LAWA 1YUNA 4Q1EA 4BKRA 1QS0B 2W70A 3AR2A 3D5EA 1OLUA 5CNJA 3V55A 3QFSA 4HFNA 5HKOA 5BR8B 1OUMA 4KODA 2VNJA 1FBNA 5D85A 4AYWA 4CMIA 5K8CA 4GPEA 4CMCA 1K8QA 5AKYA 2R7KA 3PDWA 5ECWA 3P2EA 1AV7A 1ZUIA 5FPQA 3W4IA 4AX4A 4YRKA 2G6TA 2AZXA 1R8SA 1B8PA 1C2TA 1KJZA 4MULA 1PBNA 4DSZA 1GNPA 2HDNB 3OFJA 4L7QA 4F3RA 2YJNA 3VJKA 4Z2YA 1U0SY 4ENSA 2B7LA 4IG4A 1WB5A 4MYHA 3L4SO 2J32A 3K0FA 4LF8B 2IXGA 2DBQA 4BFWA 3A1NA 4NENA 4YX9A 1TM5E 2ZWAA 3F7TA 1KC1A 2PT5A 1JLMA 2QJTA 3MBOA 1H6BA 1X2BA 2HRZA 1J24A 1N0WA 1F4PA 2GNAA 2FNAA 5FWDA 1GKYA 3RASA 1MO2A 4YY3B 4YQFA 4Y30A 3CF2A 1CQIA 4LHEA 4DLTA 4M6WA 4YJHA 5HF9A 3TPZA 4F5ZA 1HLPA 3PL5A 2G40A 2YZNA 1QE5A 4YAUA 1XD2B 4ZV7A 1OTYA 1QTNA 3TOXA 1G8FA 2V5UA 5IZ4A 3K0SA 3KHTA 4PYLA 1G16A 2IW3A 1G3RA 4LZOA 2FZGA 4N12A 3VYVA 4CKCB 2A35A 2BDUA 2JEOA 2XCUA 1TMOA 2ATXA 3BPSA 1HOXA 3DV0A 4JS0A 4AJJA 5LP6A 4RELA 4EPWA 5SZJA 3TW6A 4HGRA 4NZPA 1LQ2A 5DEOA 1MA3A 2I9PA 2HSJA 3BAZA 1N1DA 3I28A 5JNLA 4TM8A 4DCGA 1M7GA 1JFVA 3EZ2A 3AJEA 5ER9A 1ZEMA 2NP6A 2AH5A 3H5OA 1GTJ1 2ARKA 3NXKA 3L3BA 1W5BA 1MJHA 4XJVA 2AOUA 3EYAA 1GAQA 4MVJM 1IAQA 2CEKA 2DZDA 4EY4A 4YAWA 1N4AA 3LH5A 1K0UA 2PIAA 1DAIA 1FDIA 2WM9B 1AO0A 3QF4B 2D2XA 4MIKA 3ZCUA 4J9UE 5F2OA 1RE1A 3B6MA 2VQ3A 3O7MA 5EKDA 1OIWA 1OF1A 1QK3A 4NFLA 4LSWA 5BYKA 3ST7A 3D2CA 1EJ6A 5D6NA 1PQ4A 1A9ZA 4G23A 4UUPA 4K6FA 4R84A 4XX0A 4JP1A 1HYEA 1N5MA 1FQKA 4HLDA 1PWZA 1EA5A 4GMFA 4C2TA 3KTFA 3G5LA 3E9QA 3RV4A 1E3MA 3FDIA 4JA2A 2HK7A 2V4UA 2NPFA 1ZKMA 4ETNA 4HB0A 1HRDA 3IBFA 4IWNA 3BB1A 4LGCA 2RI0A 2ISQA 2YN4A 1U28A 1LTQA 4BOYA 3IA7A 3VHQA 2BJWA 3MJEA 4I4TB 1JJFA 3GJ0A 3SBXA 4ZI3A 3WJAA 1JECA 4Y6LA 4MRMA 4TKUA 2HJ9A 1YHYA 5A4DA 2CL5A 4QGAA 5JISA 1U90A 1ZKDA 2XXJA 1I9GA 2YRFA 3KUKA 4QYTA 1U0OC 3GFBA 3N07A 2C5GA 4M38A 2DUUA 4F0JA 3NYWA 3KB1A 3AKEA 4KX5A 3DOOA 2GBIA 4AMUA 1W87A 4MJLA 4QOIA 4D3ZA 3ILVA 1CUXA 2A67A 4RK6A 4A7PA 5JYBA 4BXOA 2B37A 3W78A 3WNVA 2JIQA 4AKEA 1N5IA 3W1WA 1QGZA 5KC9A 2UYQA 3FUVA 3OMWA 1PFKA 4Q7EA 2D74A 4BNVA 3R3VA 5HE8A 3PGA1 4B3JA 5HKKD 1NATA 3EG9A 1JI0A 1V4VA 2H65A 1I0LA 4K6OA 2C9BA 1UZLA 3R24A 4FE4A 3F46A 1LRKA 2FJ0A 5JASA 1E5LA 4E07A 1FX0A 5IJZA 3FPEA 1FFAA 3KB6A 1Q1AA 1HT0A 3G1TA 3SEQA 4G07A 1SMKA 3AXTA 5AKGA 1SK8A 3BT7A 3TTVA 2OM2A 3NBAA 3I01M 4CTMA 4E15A 1RHMA 3KVNA 4MOWA 4IEIA 2CB9A 4M9UA 4YREA 1U1DA 2WUFA 4JJKA 4BDTA 4YIHA 3TM4A 1P17A 3OQ1A 4ACAA 3NRCA 3QFHA 1JR3A 3O3OB 2ZSDA 2GVDC 4L0DA 4IS2A 1PGJA 2ON6A 2PR7A 4C3VA 3FYTA 2VJKA 5KQPA 1C5KA 2BIFA 2IE0A 2DWUA 2HFKA 3PHJA 1YBVA 1KMHB 1EK1A 2RH8A 3ZHQA 2N1BA 2ATEA 3AHJA 1Q50A 2BEUA 5FOQA 2IITA 1JFFB 1E9BA 2HA5A 4W7SA 1QRRA 5A2GA 5LNK6 2EFGA 4B0OA 3PLNA 1BQ4A 2DOKA 2G1KA 1O5TA 4HQKA 5FNVF 1EA7A 2BEKA 2J1LA 1UOOA 1ZVKA 2JFBA 2RAVA 1AGRA 1I4LD 2I8CA 3AFNA 3JQDA 4BNXA 4IH1A 5JCXA 1SHUX 1E1MA 1PJSA 2BCGY 4XUCA 3HUTA 4H3HB 5IRCD 2P3LA 4RWEA 2UXBB 5UKDA 3WYFA 5DGXA 3DR5A 1W36B 4G0VA 3VTZA 4BU0A 5EQJB 4DIMA 2GRUA 2QY6A 4QBGB 2XVMA 2I3AA 5A03A 1E61A 1M0WA 2WD8A 3BTSA 2HO5A 3CX3A 1C7ZA 1SQ0A 1HDCA 4H1HA 4WLEA 4YMIA 2R8ZA 1R3DA 5AVJA 2PK3A 5TVGA 4G6ZA 1MB4A 2PGXA 2RHWA 3E2MA 4YASA 3IUEA 1S5PA 2ZIXA 3EXHC 3O8NA 1TVEA 5I45A 2EFDB 3IE1A 3AOGA 3NGLA 5JSQA 3IJ5A 2JGFA 4IIBA 4AZWA 3FIUA 4L57A 2CSXA 2PEZA 3G17A 3I12A 1CX9B 4KO3S 2I54A 4ZYTA 4BRSA 4WESA 2VPYA