1DAIA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
219
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 219
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1daiA00
1IXZA 2ZVPX 3B7GA 3CLVA 4M1TA 2VH5R 1YZGA 4B2PA 4MQBA 3ZD6A 1SXJD 3CKLA 2HT1A 2ZU0C 3GJ3A 3TH5A 1JPJA 4B6FA 3K0FA 1ELOA 4DHEA 1VG0B 4RZXA 3L0OA 3RAPR 1G7TA 4KO8A 2UKDA 2X1VA 3CPHA 4Q7LA 3EA0A 4BLRA 3BXZA 1TL7C 4M2LA 5CIWA 1ZRHA 1OF1A 5EUMA 1RW4A 4P3YA 4ARZA 2IS1A 3PUYA 4DSUA 2ZQ5A 4HDCA 2P65A 4TTPA 1OXXK 3MAAC 1SZPA 4L4UA 1ZD8A 2VBCA 4LYFA 1W0JD 2RGXA 5B30A 4XSHA 5SZIA 3L0PA 3B85A 4D4LA 2TMKA 2REXB 3KXIA 1KI9A 1Z29A 3A8TA 3KKOA 3TBKA 1RRPA 3AGQA 1Z5ZA 4W7SA 2JDID 3GJ5A 3W3ZB 4C0BA 1W47A 3Q3JB 1OW3B 1XD2A 3SI7A 3X1XA 2JLYA 4RVCA 2AXNA 2YJTD 3VU9B 1IOZA 2BMFA 4Q4AB 4LBZA 5JLJA 5JSZB 2ZE5A 3THYB 2IYUA 4PHTA 4BEJA 4NONA 3UG7A 1I4DD 1X86B 4TL6A 2IC5A 2ZUBA 4TQUS 4Q5IA 3T1OA 2ZUDA 3BIFA 4JL6A 5C2JB 4MDEA 5FOSA 4D25A 4P32A 5FBRB 1OKKD 2CDNA 1HTWA 1VG1A 2Q3MA 2V55B 1W5TA 3X1YA 2N42A 3HR8A 4LK2A 5G41A 2I1VB 3CUEF 1SVLA 4BLSA 2PMDA 1COWA 2PZFA 2WWGA 1SKYB 1W49A 1AA9A 1S0UA 3SOPA 2QBYA 1DS6A 4HUQA 5CYPA 3TVDA 1UADA 3RLFA 4HAVA 3BBPA 2OE2A 3CBQA 2AD1A 5FPKA 1P73A 1OLOA 4A4DA 3MUFA 3KTAB 4L9WA 3QXXA 5D3MA 3L43A 3DKPA 4M9QA 3ZS8A 2CE2X 5GJCA 1ZM9A 4V03A 5DI3B 1Z0AA 2A2ZA 1N5KA 1G3RA 4N3NA 2NG1A 2FFQA 2X8AA 1BOFA 3HYTA 2CJWA 2ATVA 3PENA 1XTIA 3UMSA 2ECKA 4IKEA 3T34A 4TL8A 3RNLA 3THOA 4D4JA 2MMGA 4TTQA 1GM5A 3SYKA 1XF9A 1R8SA 3UMFA 3U7GA 821PA 3B1VA 2X2FA 3NC0C 1F60A 5J4YA 4CYMA 3K53A 3QI2A 1E9DA 1SVMA 2FSHA 2R62A 5AJVB 3QSYA 1L4UA 2ZRNA 4CRWB 5J4VA 3DMNA 4E03A 1ESMA 3LBIA 2ZR0A 1P3JA 2W0MA 1RVDA 1GAJA 3CRRA 1OYYA 3CWQA 3AF1A 4HLUC 4LUCA 1E2EA 4B44A 3CH4B 1KHTA 5JCPA 1LB1B 2FJUA 3OIVA 1PLJA 4LHVA 3GEEA 3EWAA 4A9AA 5HTKA 4DRZA 1W4BA 3RHFA 3QE0A 1NF3A 1U9IA 3D3QA 4PC3A 4X8LA 1OV4A 3OEEA 1KNQA 3PV0A 1OB2A 1LTQA 1OXTA 2RB4A 4NYMQ 1PJRA 5LD2B 5JEDA 2BCJQ 3LDAA 2ZU6A 1CRQA 4A0GA 1UFQA 2XZPA 2EW1A 1KO5A 2BCGY 1W0KD 4P33A 3TSZA 3WBKA 1VCNA 3U6BA 5JCZA 5H8WA 3T1VA 4IXNA 3THXA 3NC1C 1RZ3A 5BN3A 2P6RA 5EE1A 3KQHA 3U60B 3QEOA 3K09C 3X2SA 1T3LA 2BOVA 5TDHA 1RJ9B 4DDTA 3B78A 4C7OA 4NCNA 1VDZA 2WIAA 4BEBA 3VNVA 1P2TA 5FUYA 3AVWA 4US1R 1XTSA 4NCHA 4OL0A 1Z6GA 3NDBB 2WWWA 2B7BA 4AURA 4IOKA 3FMPB 4DB2A 4GOJA 1Q1EA 2ZSFA 4EPTA 1A4RA 1II0A 5BXQC 1D5CA 1XP8A 3QIAA 4TMVA 1Z83A 3ZJYA 2XGJA 4V0ME 1Q21A 4QKQA 5DO9A 5DN6A 2EWVA 1KI4A 2ZRIA 4BFYA 3BB1A 4JVLA 1XTRA 2B92A 4KFUA 3RC8A 1TEVA 1M8PA 2J9RA 2FNAA 2OHFA 4Q9IA 3ZVMA 4ZIRA 3TGPA 4Q1FA 5JRJA 4FIDA 5SZKB 2Z0MA 3AVTA 3TQFA 1T9HA 1UBEA 3KKQA 2ZRKA 3A1TA 1SVWA 2GJSA 4JS0A 3LV8A 2GEUA 4JT2A 4DCUA 3H0KA 3RS5A 2ZAOA 4P31A 1ZIOA 4NE2A 4DT1B 2NO9A 1Z22A 2B8TA 2YYZA 5LBIA 5IK2D 1SKQA 1A82A 2WKRA 4BZQA 1Z3IX 4Q02A 3GJ0A 1OH7A 1KO4A 4M22A 1AS3A 3WBJA 2J1LA 5L3QB 5EE3A 1S1MA 4P4SA 5TMPA 4NL4H 3ZGXA 4TL9A 3N70A 3LVQE 3U3JA 4ITRC 3K8YA 4Q47A 4XWKA 3DKVA 4MGIR 1EFRA 3SJAA 4TMXA 5CLLA 1KAOA 1VTKA 1CBUA 2IUTA 2QP9X 2WSMA 1E94E 1SQ5A 2AHOA 4M9XA 1R6BX 3MG9A 4TMWA 1EWRA 2J46A 2QPTA 2GEDA 3A36A 1P72A 4NYIR 2R6CA 3QKSB 3U4QA 5E3HA 1S9HA 2J0VA 1BMFA 3I32A 1KI8A 2NPFA 3TAUA 3TMKA 5DSZA 1WXQA 1XNJA 2O8CA 1I2DA 4M9SA 4PANA 4RKFA 2YC2C 2O8FB 2X19A 4DIEA 5JWHA 4OHVA 2AFIE 1QDEA 5AWFC 2N46A 1TF2A 1E2KA 1YR9A 4IVRA 4KJZA 4A1FA 2FGKA 3AP1A 2QA5A 1VHLA 5J4HA 1NBMD 4DCSA 3M4YA 2D2FA 2ZRHA 3M6AA 4LBWA 3MD0A 1Q0UA 2B7CA 3SDZA 5JECA 2JLRA 2GXAA 1GKIA 3AVXA 2JLUA 3CPEA 1QHNA 2RH5A 2QSZA 5BYJA 4KXFB 1F6BA 3EIEA 4V0OA 1CR1A 4FMCB 1K8RA 5EP2A 2PJZA 3CR8A 1G8FA 5M04A 3VHLB 5FOUA 2XXAA 2KJQA 3TJZA 2RGBA 2YV5A 4ZDIA 5UKDA 3IBYA 5J4KA 4ZPXA 1WF3A 2WWHA 1FP7A 2XJ4A 4JLPA 2OLJA 3KZ1E 4A6PA 2QAGB 2VL7A 5F2EA 1SXJA 4GFDA 3CZQA 1EFUA 4BPBA 1RYHA 4DLVA 1VYTA 3A1WA 4C0AC 3EPJA 4BWYA 1NMXA 2EU8A 3KDSE 4OQNA 4TLEA 5CYOA 4EPXA 4MKIA 4PSKA 3X1WA 3WHKA 4EAQA 2ZITA 4AC9A 2LKCA 3AVYA 3EX7C 2IXFA 2UZIR 5G3ZA 5L3SB 1NVWQ 1KMHB 4KBGA 4PSAA 3I73A 1U0LA 4FCWA 3OE7A 2R9VA 4TWZA 4V0MA 1OXUA 2IYYA 3CO5A 1Z0IA 2NO7A 4PQRA 4QXAA 2GAOA 4M1WA 1NVVQ 1G5PA 3IHWA 4BE7B 2QORA 4CIDA 1JECA 2VP9A 2A78A 3LAWA 4KFSA 3BS4A 2JDIA 2V4ZA 1H8EA 3EARA 3ZQ6A 2JLQA 2FDCA 1NY6A 2C9YA 2D7CA 5CDFE 3BJIC 5JWOA 1ZUHA 5C46F 5KSZA 2RMKA 1JEDA 3IUYA 4CGZA 2VSOA 2WVJA 4Q18A 1KTVA 4C9BA 2VHUA 5DHFA 5CIQA 4LCBA 3TE6A 1AM4D 2IL1A 4I99A 1P75A 4PZZA 3WHLA 3FGNA 3ADBA 4ACBA 2C99A 2IHYA 1E79A 5LD2C 2JIZD 1AQUA 2DFKB 1W4CA 2DY1A 3LD9A 3R8CA 2A5JA 4ZDJA 2O0JA 1CJUC 2IWHA 2A5GA 1YRAA 4URWR 4GOKA 2BIFA 3GLGA 1E4VA 4NU0A 3C4JA 4LYJA 1JALA 1ANKA 4MKHA 2WJHA 1ZNWA 3OIUA 4Q7MB 1G64A 2PZEA 4LI0A 4CEJA 4FWIB 4NYJR 1G9XA 2OAP1 3F5FA 3B2EA 2ASEA 1LF5A 3QVVA 2ZRMA 3GCGA 1E9EA 3SU8A 2F3TA 2CEAA 3KJIA 4Q1EA 2VO1A 3U3MA 1AGPA 4LHWA 3RYTC 1M6NA 3W90A 1ZM2A 4M4SA 4IDOA 1K6MA 4J0QA 1W44A 4ZDWA 4DBLC 1XFAA 1Q44A 4HI0E 5IHPA 1CRPA 4PC7A 1T0HB 4BQSA 2QT1A 1W2GA 1GL7A 1GL6A 3TRFA 5B58C 4RD6A 2GDJA 3K0EA 2QP3A 3GLFA 3NH6A 2A5FA 2FPKA 4RZ2A 3ZVLA 4B6EA 2A3RA 1E0KA 2JA1A 3PUXA 2PL3A 3DOEA 5DGXA 4CEHB 4QBGB 3L0SA 2GK7A 1SVOA 2REOA 3BK7A 2F43B 3OEHD 3PEWA 1X1RA 1ZYUA 3QXHA 1UKVY 5FL3A 1Q12A 1VYVA 1YRBA 1ZUNB 1JAIA 4LBYA 4GDFA 1SVIA 1ZC3A 4KU4A 2F1HA 4PFSA 1F48A 3FYHA 4IOJA 4C0QC 1FP6A 2PCJA 2G0NA 3P26A 3PUWA 4ESVA 3U5ZB 3NIBA 1W0KA 1G20E 2ODEA 4M1KA 1MABA 1GIAA 4UNPA 1VIAA 3N2IA 4Z1MA 4PAMA 1KJZA 5KO2A 1FUKA 1AJEA 4Q7JB 5BQ5A 3QKRB 4HLUA 4O2LA 2GBLC 1KY3A 1W36D 1N6PA 2F1IA 2YNMA 2FFAA 4LDJA 2YKGA 3ZIAD 5TV2A 2PZGA 2OSBA 4E5UA 2ZI5A 2RCNA 3ECCA 3MSXA 2CMKA 3FFAA 2R2AA 3KJEA 4GNKA 4IHQA 3NBFA 3ADDA 2RGAA 3DVLA 3M1IA 3RSOA 3ZD7A 3GJ4A 3AVQA 2WBLC 3DHWC 1WBDA 4ACAA 1L4YA 1QZXA 4JLJA 1YR8A 1F2UA 1P2SA 1OXSC 2OM2A 1N25A 5EE9A 4DLWA 1XMSA 5KSOA 1E2IA 2QM8A 3BFKA 3GLIB 3FHOA 3GFTA 3S1AA 2W0SA 2ZRCA 2ZTSA 3IDQA 4NKRA 4IOMA 1N6OA 2BEKA 2QTHA 2R65A 4OQLA 5IK2A 1M7GA 3F0TA 2QAGC 3LBNA 2HYDA 1S4QA 2Q9AA 1TMKA 2WWXA 4EJSB 3THWA 4UXJA 2BV3A 1X8KA 1AZTA 4AIIA 4TLBA 1U0JA 2J5XA 3P4XA 3NDPA 1CR0A 3O47A 4EQ6A 2OBMA 2V9PA 4QRHA 2JLZA 2ZRJA 5TY0A 1BIFA 1G5TA 5FTJA 3W6PA 4C4PA 1G41A 5EE0A 5FL7A 5KPJA 3AKYA 4YMTA 3RS7A 2O8BA 1IY1A 1YQTA 5E7IA 2HV8A 2IYQA 3BD9A 5BYKA 1IHUA 2QGZA 3HWSA 1DEKA 4HZUB 5KDDA 5AUQA 1WCV1 4G5RA 3G0HA 1EESA 2FOLA 3REFA 1Z28A 4NDZA 1HE8B 2G88A 2QI9C 3K9HA 5DN6D 2QMUA 3RWOA 1FQJA 2SHKA 1OFIA 1KSGA 2PT7A 4DDVA 2D06A 1F5NA 2RGGA 3ND9A 1NBMA 1UPTA 1DG3A 4XD7D 1RKBA 3GFPA 3UWKA 4JLMA 3QBVA 1J90A 2G83A 4NYMR 5EQTA 2GEVA 1NG9A 4BLTA 4MRPA 1LS6A 1IONA 3CONA 1KI3A 2FGJA 5CJPA 2A30A 3SFZA 1W4AA 5FUXA 1TF5A 1IXSB 2XB4A 2Q9BA 3B1ZA 2OCPA 4JLKA 2ZI3A 4OHWA 4QGHA 1JI0A 2RGNC 4MGYR 2QU8A 4GP7A 4KYIB 5CLQA 4A36A 2RGCA 2ONKA 3B9PA 4Q01A 1Z6AA 1KK3A 1GP2A 2HDNB 4QGFA 2H92A 1KZGB 1YZKA 1BS1A 2FA9A 2WSSD 3CX8A 5FBVB 1CS4C 4Q4AA 5JSZA 3OHMA 4M1YA 3THYA 4JVNA 3SHFA 4TN1A 3H2YA 4OKSA 4P0TA 4RY2A 3ZS9A 4FMDB 2ZJ5A 4L9SA 2J7PA 2CL0X 2GJ9A 4JL5A 2EFHB 3PCRB 1NRJB 1G5RA 4K46A 4MDFA 4O3MA 3DM9B 4QJ4A 1T8UA 1G16A 1YVDA 4IFEA 2DCUA 5FOWA 1E2QA 4GOXA 1R4AA 1XDBA 1D2MA 2C78A 4ZV4A 1EWQA 2JJ2D 4MRVA 4B73A 2KSQA 1KI6B 1QHHB 5J40A 1IN4A 2OBLA 3E2IA 4M0LA 4CW7A 1G18A 4JLNA 1G7CA 2F9LA 2NPIA 1G4UR 4DDWA 1DAKA 5SZJA 1M2OB 1IBRA 1AQYA 2W58A 2ZE6A 4Q66C 4IFBA 3T1QA 3LBHA 4JLOA 3BE4A 4I1VA 1VIYA 2IYXA 2AWNA 4C0LA 2ZIAA 1TTTA 1XZQA 4W5JA 5DYIA 4AKGA 4D26A 1QHYA 2A7QA 4AKHA 1PV4A 1TNDA 3T5DA 1AK2A 2FH5B 5DI3A 3ZH9B 3CNLA 1IJFA 2HCBA 2WKPA 5EP4A 3LLUA 3UANA 3KJHA 1N0VC 1M7BA 4NMMA 1XTKA 4AY2A 4XVUA 3RS2A 3SFVA 4JT4A 4FXPA 4FN5A 4D0LB 2QMHA 4HB3A 1ODFA 2JIZA 5JJLA 2YZ2A 1E69A 1TQ6A 3RRZA 2WWYA 1KKMA 2IEZA 3FKQA 4JBWA 2O8DB 4LC1A 2CK3D 1T5LA 4S2EA 3GQBA 4R9UC 2F7SA 1PVOA 3UIEA 2WPDD 1E32A 2F3RA 1G4AE 2EFCB 1N6IA 4YC7A 2W83A 1N5LA 1CLUA 3P4YA 3GEIA 2FEOA 1IY0A 1Z06A 4HAYA 2ZXUA 5IF9A 4MUAA 1VHTA 5KSPA 2WIBA 1WRBA 1JXOA 3W6NA 1RIFA 3OE7D 1DVRA 4KAXA 2XX3A 3TUZC 1XZPA 4GZMA 4BFSA 4DCTA 3V4RA 4LC0A 4OJQA 1Z6YA 5JHGB 1BYUA 2C98A 1CEEA 1S9DA 3AF2A 4KITB 2F55A 1NVXQ 3K70D 1H8ED 3CRQA 1UKEA 2JLWA 4BRWA 3LRPA 4JMPA 4PC1A 2WV9A 4DSTA 2GF0A 3KX2A 4Z8XA 1AS0A 4C0KA 2CXXA 4B3BA 1GL9B 3Q5DA 4LJ5A 3R7WB 4YMUA 5F9HA 4TZ6A 3B6EA 1NVUQ 1D6JA 2JJ8A 3RWMB 4FW9A 1GSIA 4TTRA 5HE8A 1RRCA 3MJHA 4HAUA 4A15A 1ETUA 5KUTA 1RJ9A 2WWFA 3QEJA 1QG2A 2P6NA 4HDQB 2JEOA 1E79D 3OEHA 4MYCA 2A5YB 1DPFA 2H7VA 3FWYA 4OHXA 5D3QA 3VR1A 3KXLA 2J0UA 1JQJC 4DEYA 4EJSC 2B21A 3LFUA 2Q3FA 4Q21A 1XPUA 3M0EA 2BM0A 1R5BA 2GZAA 1QG4A 4NPHA 4V0LA 1RE0A 2P6UA 1E9BA 1TUEA 1KMQA 1Z2CA 3GLHE 2NO0A 4JBXA 4JZKA 1U8YA 2ZYTX 3D6TB 4DWJA 4F38A 2ZS8A 1WBBA 4PC2A 1D2EA 3DL0A 5JEEA 2BHRA 3C5CA 1VCIA 1K5GA 1NVVR 4B3CA 2WOJA 3UPUA 4RD2A 5IRCD 4C0HA 3HU3A 2IT1A 4GMDA 2QZ4A 4L16A 1TEXA 3BORA 5GVRA 2ZUCA 4Q1AA 1AIPA 1HE1C 4KCGA 3UMRA 4OJKA 4Q9LA 5FBWB 4DT1A 3ZIAA 5FTLA 1TUIA 2JLSA 4ZKEA 2ORIA 4B35A 1GVNB 2J59A 3PEUA 5L3QA 3AF0A 1YZQA 2BM1A 2H57A 3AGPA 4Z51A 3CWZA 4RZUA 2W2XA 3F8TA 4YLGA 3UATA 4DXAA 1ZM4A 4QHYA 1I4LD 1S3SA 4L15A 3MLEA 3RRYA 3ZVNA 2DFNA 4JLVA 4PHGA 2NGRA 1XWIA 1YZNA 3RDPA 2XB2A 1YKSA 5JS8A 4RFSB 2VQSA 4IOLA 1KK0A 2FSFA 2C77A 1WDTA 4IW3B 3LXRA 4JLBA 4Z54A 4XIGS 3Q8XB 2ZANA 4LWZA 1OE0A 2BKUA 4HB2A 2GBLA 3T1TA 2QQ0A 1E9CA 1JR3D 2O8FA 4M9ZA 1R0YA 3JZAA 5KU1A 1F2TA 1GILA 1NY5A 2YOFA 3BH6A 4WVFA 2V54A 2V8OA 2ATXA 2QP4A 5A5GA 4AD8A 4Y0AA 2EYUA 1QVRA 3CNNA 4IRUB 4ZI3A 3W34A 2Z4SA 1XB2A 1SVKA 1XJ0A 1YE8A 3HPRA 4QOSA 3U44A 3W8RA 4Z1MD 4GBMA 1NG1A 1DTSA 5K8UA 1SXJE 1A2BA 3NHBA 421PA 4CDGA 3Q7QA 3RS0A 4CT5A 2CCJA 2FPLA 2BBTA 1BKDR 4UXHA 1ZCBA 2DYKA 2GTPA 1N5IA 1ZM3A 1XD2B 1ZU4A 1Z0KA 3SYLA 3CIOA 4YMVA 1E3MA 2H16A 3GEHA 3LY5A 2AD5A 2EFEB 4ZI2A 3HP1A 4URVR 3VKGA 5DNYB 2GAAA 2ZETA 3W8NA 1JR6A 1II9A 2HUPA 3KKMA 1RYFA 1G3MA 4PO8A 1GRNA 2V3CC 1G291 2QT0A 3U7EB 5FBQB 2ZE7A 4XD7A 3ND8A 3KQNA 1CR2A 4YXWD 1W2HA 2NOAA 4GI7A 2GNOA 2ZS7A 4Y0VA 4PPNA 3I92A 1C9KA 1P9RA 1GUAA 3WP0A 5GADl 1VECA 3EZFA 4A2WA 4GRAA 5KDLA 2Y8EA 1OIVA 2QBYB 1QHGA 1KMHA 2QE7A 4URXR 1X8LA 2QUZA 3GLHA 1HT1E 3PVSA 2HXYA 1KAGA 2R44A 3OAAD 1N2CE 4WZBE 5CJ2A 1TPZA 2CLSA 4K8OA 4PC6A 1IQPA 1Q1QA 2C03A 3HYRA 3WP1B 5JJKA 5D3MB 4PZYA 1FPMA 6Q21A 3GP8A 3ZZ0A 3ICQB 2ZSAA 2WSSA 2QN6A 3IQXA 4Q9HA 3NBYC 4Q4HA 4DCVA 2ZPTX 1K5DA 2VF7A 5FL7D 1XBTA 3HU1A 2ZSDA 4G5SA 3GLGE 4OK5A 2CHGA 2ZRPA 2Q3HA 1PZNA 2P3SA 2VSFA 3FVQA 1P7CA 1OH8A 4B3FX 1AZSC 4RD4A 5FOTA 4AG6A 1FZQA 1UBFA 3AVPA 1FTNA 2F1RA 1KDOA 2JJ2A 2IYWA 2QMOA 4ZO4A 4WZAE 3CF2A 3AVUA 1CIPA 2H1LA 4C0SA 1GTVA 5KSYA 1FNMA 1X8JA 2VTKA 3PQCA 4O0MA 2C9CA 4XOIA 5DIFA 5KOYA 1GNRA 2X77A 2L0XA 3AP3A 4H1UA 2GJ8A 2ZM5A 2W00A 1XXHB 2OESA 4UKDA 4PPFA 2F6RA 1ZBDA 3GFOA 3QPVA 3QVUA 2FWRA 5FR2A 1ZINA 5G40A 3T15A 3GLFE 2WKQA 1P6XA 3I3SR 3SN6A 3AH8A 5C4GB 1G1MA 4LV6A 4MH0R 1WMSA 1D9ZA 4Q9KA 4ZCIA 1U0HC 3CX6A 4LGMA 4NZYA 2J7KA 2OAQ1 3VR6A 5CITA 3O8CA 4NCIA 4QJ5A 3EC1A 2C95A 2J0SA 2V7QA 3VR3A 4KBFA 1R2QA 2ANCA 1P61B 4TL7A 4NCKA 3PJRA 5IDVA 3PXGA 2FN4A 2CK3A 2QEQA 2RHDA 2BEJA 3QG1A 5FH9A 2OT3B 2R6DA 3VQTA 721PA 2QRNA 4DEXA 2WPDA 5GJWC 4A8JA 3R20A 4HAWA 2BBOA 4B47A 1Y63A 5CB8A 4C7OB 1DE0A 4HB4A 1OYWA 4MUBA 2IF0A 2J7PD 1P62B 3WRYC 2EWWA 2KE5A 2PT5A 2YHSA 3OIWA 3R8FA 5E4FA 3QF4A 5GJVC 4LJYA 3TW8B 1DAFA 4CEHA 2O8EA 1GNPA 2CHQA 3K0CC 4DUGA 1EXMA 2F43A 4JJZA 4LBVA 2D3WA 2WM9B 2ZJZA 4O2RA 5JWRA 2HJVA 1HQYE 1E9AA 4TYPA 4TZ0A 2FFBA 5AK0A 1P60A 5E7MA 4WW0A 2RHMA 2D74A 1GKUB 4XJXA 4DLTA 1QHSA 3BB3A 2NZJA 2J41A 1Q1BA 3T5GA 1TADA 3TR5A 1N6KA 2QTVB 4ZIRB 2QPOA 2IEYA 3GD7A 4OI1A 3IEVA 2XTZA 1G6OA 4M8NE 2DWOA 1XMVA 2WJJA 3HPQA 4ZCMA 4A92A 2VHQA 2VRWA 2AFHE 4R98A 1WP9A 4E07A 4URUR 5FFMA 1CJTC 4NCJA 1FNNA 2HLDD 3A4NA 2IYZA 1WB9A 2UVQA 4C2UA 2BJVA 4HYYA 5AJWA 4QHSA 1QHXA 1G21E 4V0NA 2XSZD 3QENA 1ZNZA 1Q57A 4MRNA 2WTUA 1DAMA 4JYCA 3K9GA 3FDIA 1U8ZA 5AUOB 2FMXA 1G3IA 5F98A 3OFND 4ZCLA 2ZEJA 2VHJA 5FPYA 3V4FA 2WMOB 3FKSD 4B32A 4YQFA 5CM9C 4YONB 1M34E 2IYLD 2VEDA 1E2NA 1M1YE 1ZU5A 1PUJA 2D2EA 3U4QB 1S3GA 2BMEA 3FHTA 4II7A 3AKEA 4TMKA 4F93B 1R10A 3SBEA 2IS2A 2O8CB 5EP3A 4TLAA 1J70A 3GLIA 1KOFA 2AR7A 4PAOA 4V0KA 3IPXA 4BFZA 1MKYA 1P4SA 1XEWX 3L8YA 5DISB 2BBSA 1ZMXA 2IYVA 2VF8A 1LY1A 1OSNA 1T91A 1TQ2A 2VPPA 3ADCA 1VPLA 4MKFA 5FOVA 1Z0JA 3K0AA 3QF7A 4KFRA 4R7ZA 1Z07A 3IQWA 4NH0A 1HY3A 4YMWA 3U6KA 3KB2A 4DLYA 1C1YA 1UJ2A 1NN0A 4G01B 4JIMA 4E09A 1QRAA 3ZVRA 5EE5B 5CK5A 1UM8A 3QKTA 2QNRA 2GCOB 2H8KA 3WNCA 1NBME 1EK0A 4HSEA 5HPYB 4EIWA 4BFXA 2IHBA 3IPYA 5JRZA 1KK2A 4I4LA 5FPHA 3ZZTA 1Z63A 1DOAA 4MGZR 5AR1A 4DSOA 2YVUA 5C1BA 1E9SA 3CX7A 3DO6A 3VR4A 4C2TA 3QNUA 5LB2A 2ZSEA 2G3YA 1JR3A 3WYFA 2JLVA 4NTZA 2ZJ8A 3VX4A 3WYAA 2H18A 4A82A 4KV9A 1US8B 1T0JB 2XEXA 3UXMA 5E95A 3MRSA 3CRVA 2G9NA 3TW4A 1R0WA 5EXPA 4BRUA 2CHVA 1D9XA 5EZ5A 2P2LA 3AVOA 3E1SA 3IHLA 3VHXA 4OYHA 5JI3E 1ESNA 3BH7A 1E1RD 2CL6X 2W6ID 4I1OA 2EQBA 4UNSA 4PO1A 3WYGA 2GESA 3EZ6A 3JVUA 4BFTA 4JL8A 2G0TA 5JMTA 1FX0A 1KY2A 1ZM7A 3SNHA 4KYUA 3FTQA 3W9YA 2WICA 1UBGA 1S96A 1GNQA 2ODBA 3ADKA 4GT1A 3TNFA 4I81A 4TQAA 1KZ7B 4POAA 4ZKDA 5DI9A 2ORVA 4PAQA 2R8RA 1MO3A 3NBZC 4FMCF 4RCYA 1AN0A 2ERYA 2FU5C 3G82C 1XX6A 3NH9A 1W4RA 3EIHA 4FCVA 1O87A 1G8YA 1XU4A 2C96A 4HB0A 3RRNA 4W5WA 1W5SA 2JJ1D 1SKYE 3LNCA 4TSFD 3LQRA 3PITA 1OH5A 1D8TA 1U9IC 4D4MA 5EP1A 4A0HA 2BWJA 3I1FA 4XWOA 1QHIA 3FFBA 4Q4JA 1ZVQA 4LY6A 4HEJA 1KIMA 4YXWA 1Q1ZA 2BBWA 4QC2A 4PZLA 5L3RA 2FE4A 3RRMA 3EXAA 3IBGA 2IS4A 3K09A 3TR0A 4H9GA 2B6HA 1Z2AA 1IN6A 5J47A 3BGWA 4B43A 4M1OA 2DFTA 4GL2A 3UKDA 3KQUA 4LJ6A 5F3WB 3SZRA 1FQKA 4JKIA 3OAAA 5FPSA 3LLMA 3TVTA 1KNXA 2DBYA 2JGNA 4D82A 3NEJA 1R0XA 4NP6A 1GOTA 1XRJA 1DBSA 2E87A 1JJ7A 2G1JA 2GCNA 2R6AA 4PX9A 4EPWA 4US2R 2F1JA 3IGFA 4OQXA 4DLZA 2VYFA 1HA3A 4JKYA 2CE7A 3VMFA 5K8IA 1KK1A 4A2QA 4KHZA 3T61A 4PO9A 2FF7A 4Q1BA 2VA8A 3EIQA 4PHFA 1EX6A 2KBFA 1OXVA 3V00A 5J4LA 2ZYVX 4UQOA 4R71A 3ETLA 4DIDA 4FI3C 1NLZA 2QM7A 5A0FA 2YC4C 121PA 4M21A 2C04A 2DB3A 2GVZC 1OT3A 4LJ9A 2QY9A 4URZR 3V9PA 5HZKA 3ASZA 3BH0A 1R8QA 3F3YA 1MO6A 4HLCA 2W2VA 3EZ7A 4US0R 4OK6A 2O8DA 2DWQA 4P4UA 4PXAA 1L8QA 1UEIA 3O8RA 1TF7A 4XH9B 4E22A 5JZVA 3VKHA 4Q00A 2EVWX 1JJVA 3IO3A 2G77B 3D31A 3DM5A 4DB4A 2ZVQX 4GZLA 1XJCA 1NN3A 2ZRFA 1NLYA 2O0KA 2Q9CA 5HCIA 2IXGA 2GCPA 2B8WA 2QE7D 1N0WA 5FR1A 5JI2E 4X8MA 2P0EA 2AK3A 1XCMA 3QG5A 1NI3A 2ZI4A 2D62A 1PLLA 3KFXA 3C15C 3CM0A 3IO5A 2D7DA 1N0UA 4TYWA 1MRSA 4XVQA 1IY2A 5EXSA 2GRJA 4HAZA 3RC3A 2DHRA 4F7WA 2PBRA 1IAQA 3BB4A 4MKGA 1Z47A 1LF0A 4U7DA 3EA5A 4Q19A 1CULC 3VKWA 1G8GA 2ZJ2A 1TX4B 4MRSA 3IIMA 3Q85A 1A1VA 4LHXA 3O8BA 1Z6XA 3VU9A 4OHYA 4KODA 2IUSA 2YWHA 3NEYA 4TT3A 1UDXA 3OF5A 4BFUA 2C8VA 3TUIC 3UWOA 1NJGA 4PPQA 1HEIA 4QM7A 4XTCS 3AB3A 2LWIA 1WA5A 3FMFA 4DLXA 3AKCA 4QBFA 1V43A 3SC3A 1XEXB 5B57C 3U3KA 3TUJC 4A2PA 3SEAA 4PQYA 3QXCA 4M1MA 4FMBB 2PCLA 1VG9B 3WRXC 1P2VA 621PA 3JVVA 3I8SA 1OHHA 1KSHA 1YR6A 2A5DA 5FTNA 3B13B 1G3QA 3AKDA 4CZ2A 1F2UB 4JSTA 4DLUA 4NBSA 5JS7A 4B2LA 4UJ3A 2ORWA 5BN4A 4TYNA 5A4JA 4GPTA 4IXMA 2DR3A 2VP4A 2GF9A 1T4GA 3KTAA 3RSLA 4DLRA 3A37A 1Z0FA 4I1UA 4BFWA 4DCNA 2ZRAA 5JFGA 1D2NA 1Q3TA 2W6JD 4DDUA 1II8B 1E4YA 3NWJA 4BECA 4NYJQ 1G17A 2GA8A 2HLDA 3R9IA 1SXJC 4H1VA 4PTLA 3K0CA 1OH6A 2QQEA 1R5NA 4OK3A 2V7QD 3B1YA 3GJ6A 2D4HA 1NSFA 3G5UA 2XSZA 3FMIA 5BN5A 4EFNA 5C4MA 1GRQA 4EQ6B 1HURA 3MWYW 4B48A 1E2GA 4RD1A 3ZLJA 1TQDA 1XD9A 1HYQA 3WMFA 3W3AA 3RABA 1GG2A 3OFNA 1JAHA 2MSDB 3NHAA 4Q48A 3SYNA 3TAHA 2O8BB 1J8YF 1DAGA 2Z43A 3FKSA 1AGRA 1E0JA 3C14C 4BLQA 1EGAA 1DO0A 3QOFA 4CEIB 2FEMA 1S8FA 4IVQA 4C30A 2IA5A 3GJXC 4Q9JA 2YWEA 4LHYA 2WJVA 3QPUA 4DUGD 2HF8A 1NKTA 5DYGA 3Q7PA 1TAGA 3RANA 1CU1A 2WAXA 2IWRA 2ODWA 4BFVA 4R2IA 2P67A 1MT0A 3KUCA 3C16C 2BJWA 3PFIA 3TLXA 3EG5A 2PLFA 3SJZA 2QROA 5AJYA 1CP2A 2OG2A 2VP2A 1VMAA 4Q7KA 1P9NA 4RKEA 1J7KA 1LVGA 2BC9A 2MSCB 4U02A 4N1AA 5KDOA 4G5QA 5H68A 2OZEA 3BFVA 3N5CA 5DH9A 4BUJA 3AUXA 1R5OA 2YWFA 5FUWA 3NTUA 4RJLA 4PSVA 1UEJA 5J5CA 4UXIA 4NHOA 1OFUX 3C41J 3ZQJA 4B33A 3B8HA 5H1YA 1AKYA 4WXPA 2FX3A 2CVHA 2GZDA 2I1QA 1AS2A 1U2RA 3REGA 1E2JA 1Z6TA 4DC9A 2EFGA 2H5EA 3J81k 4ASUA 1KO8A 1YR7A 2XNSA 4MA4A 1R7RA 2DPXA 3PEVA 4Q4LA 3VR5A 3ONWA 1Q22A 3L2OB 1PLKA 1HV8A 1I2MA 4IDQA 4EUNA 1KDTA 3E5HA 2H17A 1ZD1A 4JYBA 3Q5EA 5FTMA 4BZXA 3QBTA 3C8UA 4MRRA 1E1RA 1JPNA 1OFHA 2W6IA 2WMNB 3LW7A 4AYWA 1HUQA 2VSXA 5FUVA 2JATA 4D81A 5LDDC 3SE0A 4P4TA 3OIYA 1UBCA 1W48A 2J87A 4DZZA 4XSGA 4JSYA 1DAHA 2A9KA 4ESHA 2ZE8A 3QPWA 2PJRA 1UKYA 4W9MC 5EUQB 2AKAB 2KI5A 4KLZA 3EASA 2JJ1A 2FV8A 3NVAA 2GJKA 4TSFA 3A1VA 3WNBA 2XITA 3BERA 3DOFA 3AQ4A 3I72A 2XNDD 3QJYA 1JB1A 1NLFA 2ZI6A 3KFVA 3NXSA 1N6LA 1RPZA 1HQCA 1VYUA 1ZP6A 3ZDQA 1E9FA 1F3OA 4FMDF 3RVBA 1YZTA 1E1QD 4RFVA 4RSGA 5AUNB 3QKSA 5BW8A 2GVDC 4JVSB 2ZJYA 3FPAA 5JBQA 4KSCA 2CNWD 2REBA 3BC1A 1E99A 2FSIA 221PA 2IW3A 4LZZA 1L7VC 2PEZA 5H70A 4TYYA 1OPXA 1DAEA 3K0FB 1CKEA 3T35A 2NQ2C 2CVFA 2HEIA 3P32A 2ZJAA 4B2IA 5K8TA 2ZS9A 1KI7A 3SS8A 2IF2A 4MGKR 1E2FA 3TSOA 1CF4A 1DELA 1FL9A 1Z08A 2OBNA 3BAFA 5G3YA 4ARZB 1XXHA 2OFOA 4XVRA 1U98A 4FWTA 1NP6A 4UNQA 4G1UC 5K8LA 3B82A 3AEZA 2ZYUX 4GSYA 4OQFA 2OO7A 1B23P 4YDHB 3AF3A 5GVSA 4RD0A 4GP6A 2WWIA 4JLDA 1CTQA 3LW8A 1MO4A 4KVAA 3PEYA 4LV5B 4AG5A 4D0NA 1KO1A 1Q3HA 2OXRA 2QAGA 4BLOA 2LKDA 3DPUA 4G5GA 4QGAA 1LV7A 3KQLA 4YMSA 3NG1A 4WOPA 2I3BA 1KKLA 2Z6VA 3IIJA 2IS6A 4CT4B 5TXGA 4M1SA 1XTJA 3D7MA 2J0UB 4F4CA 1OIXA 1E0AA 1I4TD 2WHXA 2J45A 3KKNA 3U2QA 3OZXA 2AK2A 5L3SA 4HUQB 5KHOC 3KUDA 4BLPA 1NIPA 2BMJA 2C5LA 2QRZA 4IEEA 1XMJA 4AYXA 3EPLA 3IEUA 1UF9A 1GZSA 1W46A 3K9LA 2CL7X 3PR1A 1IM2A 3K0SA 1W7AA 1CXZA 3KXKA 4I1SA 1S2MA 2VHCA 1U8AA 2C9OA 3N2EA 3BRWD 1VG8A 1CR4A 2VP0A 3VFDA 5FOXA 2CJWB 3TSWA 1W36B 3BWDD 3EZ9A 1MO5A 1YZUA 2JCSA 4R2HA 2EFDB 3CF0A 3MJRA 2WAYA 2W2TA 1GDDA 1ZIPA 4O25A 1EX7A 1RRFA 1EG7A 4L5BA 1NIJA 5AJXA 1LNZA 1MRNA 2GHIA 3FMOB 3W5IA 3GLIE 4QFMA 2XOKD 2CCKA 4BZPA 1KJWA 2VIIA 1ONBA 2CLCX 3A58B 2RGNA 3MCAA 5GJBA 2ZRGA 1N6HA 5IT5A 4L8GA 1U99A 3I4LA 2Q21A 2FZLA 5SZHB 4HZIA 2BMDA 5FI0B 2OFXA 5FI1B 4LYAA 2JAQA 4G0NA 4WXRA 4UJ5A 5B2ZA 1CJKC 3DEFA 3U61B 3EPKA 2WOOA 1E2HA 1E6CA 1LS1A 2E1RA 1XD8A 1E96A 2YWGA 3NBXX 2ZR7A 5F9FA 2PLRA 4EPYA 2W6JA 1F2TB 4RZ3A 4TMTA 2ZI9A 4MYUA 1GWNA 4JJKA 3AVVA 4WIAA 2Z83A 3B1WA 4BASA 4JLAA 4WA7A 4N0EA 1OB5A 2ANBA 2XTNA 1X1SA 4GMXA 3U44B 3THXB 2XTMA 4B75A 3B60A 3EWSA 3JZMA 4A0FA 1OFTA 2VP6A 1FFHA 4JBYA 4F92B 1JR3E 4EPVA 2R6GA 3VTKA 4YDSA 2QPAA 4TT3D 1U94A 2IUUA 1T3SA 3GJ7A 1T6NA 3LX8A 1ZJ6A 2KBEA 2V6IA 5E7JA 1KI1A 2DFLA 3K9NA 2DWPA 4QGGA 1J99A 2GCOA 3AV0B 5L3VA 4UNNA 4ERNA 3MFYA 3SJBA 1JQLB 4HLDA 3E70C 2AWOA 2GK6A 3L0IB 4WZ6A 2BDTA 3A1SA 3A1UA 2Z5FA 1IJEA 3LWNA 4G5OA 3I8XA 3RS3A 5AUPB 1FW6A 1OHHD 4OI0A 4M53A 1DG1G 4XTRA 4D6PA 2CBZA 2G1KA 3MMPA 4WAUA 1DO2A 1FUUA 4IDNA 2KB0A 2Z4RA 1V5WA 2GJAA 1US8A 5HKKD 1N5JA 2QMEA 3BOSA 1E9RA 3WNDA 1LW7A 3WXMA 1IN8A 1FMJA 4D80A 1G8PA 2ERXA 4U00A 2V6JA 2GWHA 4KLNA 1H8HD 3RS4A 2IX3A 1H65A 2NIPA 4G3XA 1J8MF 1IN5A 2QG6A 3Q9LA 4QBIA 1IXRC 4D0GA 2NO6A 3GLHB 3MGCA 1UDWA 1BYIA 1W0JA 1MR3F 3PUVA 2RAPA 1X3SA 2JASA 3QKRA 1G7SA 3PIRA 3ASYA 4K81B 3T06B 2HT6A 4A0RA 4QHTA 4HDOB 5TARA 2PEYA 4P4SB 4B71A 3LH5A 5TVKA 2ONJA 2ZRBA 3I5YA 4OI4A 2XZLA 4V02A 1MH1A 2WJGA 3HDTA 1YU9A 2WZQA 4LJ8A 1QF9A 4Q4HB 2GILA 4KSBA 3TK1A 4BGDA 3KL4A 2YOHA 4MITA 4QJ3A 4LPKA 1SHZA 4MYHA 1M7HA 4IDHA 2ZR9A 1A2KC 2ZRLA 3U3RA 2IXEA 1OKKA 4B3XA 4LHZA 1NL3A 5FPTA 1ZAKA 1P2UA 1W1WA 2IYRA 4EPRA 4FINA 3EPHA 5C18A 4TMZA 1BO6A 1OIWA 4LJAA 2WJIA 1QVAA 2PMKA 2N1BA 3B5JA 3DDCA 4LV8B 1N6RA 3TQCA 2GXUA 2QENA 2YINC 3WMGA 1CJMA 1X6VA 1P5ZB 1ZNXA 1G7RA 2KWIA 4QBHA 2HXSA 1VKJA 3KB1A 4PQFA 1UKZA 2XAUA 3FOZA 5CB6A 1XJQA 2K5UA 4EJSA 3SBDA 2ZROA 2XZOA 1YJ5A 4PR0A 1TQ4A 4B3GA 1KDPA 2MSEB 2Q0HA 1G8HA 2O52A 1E2DA 2ODNA 1UAAA 2NTYC 4AKIA 4B74A 3ZYCA 4N0DA 2QGNA 3LXXA 2FPMA 2LCFA 4RCZA 5HE9A 4Q1CA 1WQ1R 2XNDA 3B1XA 3AP2A 1N3BA 4LPSA 3PUZA 3EZ2A 2IK8A 4DVGA 2XXAB 1NJFA 1OJLA 5LPNA 3HU2A 4OBEA 4LOAA 1E1QA 4ASUD 3AUYA 2P5SA 3K1JA 2CNWA 2FG5A 3P1JA 4HZUA 4IJMA 3CNOA 1IN7A 4B3DA 1SXJB 3EW9A 1NMZA 2O5VA 5KNCA 4A8JB 3I5XA 2RGEA 2ZAMA 4HATA 1J2JA 1KGDA 4ON9A 4ABYA 3HR7A 1E2LA 4QL3A 2YOGA 2FFHA 2E9SA 1XPOA 3QF4B 1W36C 2O8EB 4LJ7A 3MWJA 2O0HA 5CM8B 3QXSA 1RFLA 1FOEB 1YHNA 4AYTA 4HUTA 4EKDA 2AKYA 2C2HA 5HZHA 1T5IA 1A5TA 1COWD 1NMYA 3OESA 5EXTA 2X2EA 2J3EA 2AL7A 1EFTA 2ZJBA 5KNBA 2JLXA 4Z8YA 3T12A 1ZUIA 3CB4A 4RD3A 2OV2A 1ZCAA 1JNYA 2QAJA 1CJVC 3K70B 1Y3AA 2NO1A 3FHCB 3GPLA 3IKJA 5ANRB 2QL6A 1JXMA 2ZYWX 3GMTA 2AXPA 3H4MA 2AX4A 2OILA 2CLDX 2FSGA 3A4MA 3HJNA 1NN5A 2GZHA 3MWKA 1AKEA 2GKSA 1VCOA 2V1XA 1XCGB 1KYIA 3C7KA 2OCBA 4QG7A 3A6PC 1RC8A 1VCMA 4B76A 3VR2A 1ZC4A 4FCTA 8OHMA 3LX5A 3QXJA 3WY9A 4FD2A 1PUIA 4UNRA 3P27A 4IEIA 5TB5A 521PA 5L8VA 1GFIA 4S35A 4LX0A 5JHHB 2R6FA 2IYSA 2NZ8A 2HCJB 1MOZA 1N6NA 1XEXA 4ILEA 3W6OA 4C0JA 4IVPA 5AJZA 3SJCA 5CDFA 1NN1A 3LO5A 2PH1A 4NYIQ 1JBKA 1KI6A 2GETA 1QHHA 3VX3A 1XPRA 5KNDA 2OFWA 1SVSA 1O3YA 3GLGB 4TYQA 2OLKA 4DSNA 2QSYA 2VP5A 1JEEA 3U3OA 2IBMA 2ZI7A 1ZW6A 2FZ4A 3WMEA 4AWXA 1S1CA 4CEJB 3QQ5A 3X1DA 4EFMA 5KTYA 3R9XA 5HR5A 1DAIA 2HJGA 1ZNYA 3CZPA 1MV5A 4OQMA 3OEED 4KVGA 5DLQC 5LB4A 1II8A 1XEFA 3LVRE 5FTKA 3TKLA 4DJTA 3NKVA 2RKOA 3KJGA 3AM1A 1E0SA 1SGWA 5BWMA 3K0AB 5CK4A 2OEPA 1G6HA 3CW2A 3LQQA 2J0QA 4AKEA 1KI2A 3KQKA 4CVNA 1SHKA 1U81A 5DHAA 5JJIA 4D4KA 2BVNA 2BKEA 2XOKA 3GLFB 2HYIC 3H86A 4X8HA 2ZRDA 4URYR 4B34A 2Q6TA 1U90A 1A7JA 3O8DA 2OUKA 3W5JA 3GJ8A 3CRW1 1R0ZA 1SULA 1KSFX 2UZ3A 3A4LA 1WE2A 1T3HA 4CEIA 3KKPA 2P5TB 1LFDB 4Q1DA 1KDRA 3R9WA 3FE2A 1GRRA 4OI2A 4KFTA 5EZ6B 4QNRA 3TIFA 3L82B 3L8ZA 5HCNA 1G3UA 1NNEA 1XEWY 2EYQA 4MYTA 2OCAA 1HT2E 3DMDA 4CF7A 1HH4A 3SQWA 4U5XA 3U7FB 1MABB 1NSTA 5KPDA 1P9WA 3FB4A 4Q03A 5EXXA 2ZSBA 2PX0A 3QY0A 4PHHA 3UG6A 4KI0A 4QM6A 1GKYA 1FX0B 1C4OA 3R7WA 4LYHA 5G53C 4OHZA 4JVMA 4ZDKA 2MMCA 1KJYA 1B0UA 3MWLA 4PPGA 3D8BA 1XMIA 3EAQA 1NKSA 5KYKA 1QBKC 4LSGA 4F4IA 1L2TA 2GXSA 2IYTA 3CH5A 3LA6A 1YZLA 3B9QA 3PG5A 4IDPA 3AF4A 2WJYA 2ZREA 4AI6A 3CR7A 1T8TA 1KO7A 1EFRD 3DZ8A 5ELXA 1G19A 4TLCA 4W5HA 1FTSA 5DE3A 4LRWA 5FBLB 4Q4JB 1DADA 3BFXA 5HKKA 4HAXA 1XTQA 3SQXA 1M74A 3QKUA 3H1TA 4HLQB 3I62A 1H8HA 2CCGA 2G6BA 3H84A 1BMFD 3S1AB 1FMLA 3CPJB 3I61A 2OXCA 1GITA 3SR0A 3VNUA 3EC2A 4X8OA 4F91B 2AN9A 1TU3A 5EJEA 2I4IA 3DZDA 1E2MA 2HF9A 2PX3A 1TU4A 4DLSA 3THWB 3Q72A 2QTFA 4A8JC 1KSJA 4A6XA 2VLIA 1Z8FA 3CRMA 5B64A 1Q20A 2OCYC 4DKXA 4TQ9A 3ICEA 2ZJOA 4QNMA 3QUSA 4D2IA 1RRGA 3P20A 4XWAA 3ZZUA 2GXQA 1XCPA 3U7HB 2F9MA 1EFCA 3C5HA 3CF6R 1Z0DA 4TLDA 4EDHA 3UK6A 2RGDA 1E2PA 4F4JA 1DARA 2XJ9A 1EFHA 4LJ4A 2V1UA 4C3ZA 1E98A 3IILA 1BH2A 1ZD9A 4WBSA 3VAAA 4RFSA 3SHWA 2VHTA 3IIKA 5P21A 4AK9A 4EFLA 2NMVA 1XXHE 3K70C 3X1ZA
chains in the Genus database with same CATH superfamily
4P5PA 1SJ9A 2ZVPX 1XN1A 3B7GA 2YWCA 4YRLA 4PIVA 3K15A 2GPWA 4MQBA 3ZD6A 1VA5A 1F3LA 5CA0B 1ZG3A 1NW7A 2HT1A 4B6FA 1JPJA 1KZYC 4DHEA 5JAQA 4D26A 1GPBA 1C0IA 4Q7EA 1CY1A 2NXCA 1WSAA 4HNTA 2OUIA 1ZIXA 1ADBA 2ZDGA 1XZKA 5T57A 3CPHA 3BAZA 4UTRA 1PZFA 3MTJA 1I1OA 4WXYB 3EXEB 5TMEA 1E7SA 1LI7A 5CIWA 5K0BA 4A8TA 4J0CA 1NA5A 4P3YA 2I7TA 3KPVA 1BQ4A 2K2QB 3IR7A 4NF2A 4ARZA 3T1NA 5SICE 5EUBA 1OXXK 1SZPA 1ZD8A 3DP7A 4LYFA 1OLXB 1W0JD 1XNQB 5B30A 4XSHA 3L0PA 4D4LA 3I34X 1MIOB 1PRYA 2OCGA 1IUKA 2PWAA 1M3SA 2HY7A 3EUEA 4B6GA 1ULUA 3A6EA 4HP8A 1CHNA 4WERA 3VKVA 5LNK1 1X1CA 2VPTA 3TBKA 4W7SA 4IWXA 3B2QA 4C0BA 1AUPA 3JQBA 3Q15C 3GMDA 3ZH2A 2JFNA 2FG7C 4ZOEA 4L72A 4NFLA 4BXOA 2UXBB 2ZB4A 1ZEMA 1PYGA 5JFTA 3GGCA 1CQJA 3CMMA 4L8LA 3GJZA 5AW8A 1J2UA 2ZBPA 2H4JA 4LBZA 3X0DA 1GRCA 1XMOB 1FXWF 5C4IA 2Z8XA 4EY7A 1GGNA 3S68A 2IYUA 1ISFA 4NONA 3UG7A 2CV2A 4A27A 1VBNA 5DNEA 2XECA 3ESDA 3MPUA 2IC5A 4Q5IA 2M2IA 2ZUDA 1UIMA 4JL6A 4R2WA 5AVJA 4UE3S 4CMIA 4MDEA 4C87A 4P32A 5FBRB 1WPGA 1HTWA 5ES4B 1RXIA 2PTHA 3JAMA 5G41A 1DAOA 1NMQA 2JZCA 1MB9A 2O2CA 3PFKA 5H3LA 2GPYA 2WWGA 3U49A 1AA9A 1S0UA 2I8LA 3O8QA 3SOPA 3P9ZA 1S5PA 2Z57A 4HUQA 3CEAA 5T3UA 3WLOA 1OZHA 4JI5B 3MTAA 3EBPA 1UPUA 1EVKA 2CYBA 2DLDA 2QJRA 5DGCA 5T6MA 3CLTD 4WBNB 2ZT6A 3CKKA 5ENDA 2YCBA 3HUDA 3OJCA 4B3MB 1DC8A 1A4IA 3FRHA 2ZBQA 4X6YA 1Y80A 3BXEA 3C70A 1QO0D 1VGVA 4M9QA 5GJCA 2PKRA 3NIWA 4UHJA 4ZEWA 2QUJA 2F3SA 3Q3VA 5IH7A 2C0CA 4NBRA 4Q3KA 4N3NA 2A9FA 4ND5A 1BOFA 3HYTA 5E8RA 1QO7A 5KYWA 4XKJA 3T34A 3ZY5A 3QSGA 4KO1S 1C2TA 1J0DA 1LDMA 4G5FA 4S12A 5EWLA 4G67A 4DR3B 1MFPA 3GRVA 5IAGA 3V4PB 1B0ZA 2FRDA 1GM5A 3BBLA 4BQOA 2X2FA 2Y1OA 3BWCA 3QEMB 4CYMA 1E9DA 1MDFA 2R62A 3Q7SA 2WIGA 4HZGA 3KT3A 5AJVB 4BPRA 5BPFA 3GP3A 4ZRNA 3AY6A 3HVHA 2BEWB 1SMKA 2R6HA 1RVDA 1FYWA 3CZ5A 3CEMA 1OYYA 3V8PA 4ZI7F 5KX5F 5CB4F 3CWQA 4L0MA 4LE0A 4V0QA 1E2EA 3KR1A 2EZ8A 2ZIEA 5JCPA 1LB1B 2ZVDA 3AOEA 3K9QO 4HD8A 1RLOA 5HGJA 1NF3A 3ZW8A 1RQRA 4ZYZA 3VPSA 4PGHA 3D3QA 4TVBA 3S81A 5E6SB 3OEEA 4L4SA 3JAWB 1OB2A 3LOQA 1LTQA 4KN5A 4QOJA 3WLLA 3WYNA 1PJRA 2WU8A 5JEDA 3ZXYA 2VFAA 1GTSA 1KH1A 5HOEA 2XE8A 3F3SA 2XZPA 3JQ9A 1DBWA 3LQ1A 1W0KD 2MR6A 4ENRA 3RUHA 5EHNA 3WBKA 2FQWA 3MWEB 3B6KA 1K4KA 2YUIA 2C3YA 2X8JB 4A16A 4EYQA 4O4LB 3WLPA 3THXA 2ZPUA 1F2DA 1A9RA 1RZ3A 1WTCA 1SH7A 3OD1A 3EDCA 5IH3A 4DV2B 4MR7A 3U60B 3X2SA 3WWOA 4KPGA 2BOVA 1NQUA 2VYND 3DDUA 4DDTA 4C7OA 3I9KA 1Q7BA 4YDRA 4BEBA 3P71T 3CF4A 2QUIA 3SP1A 2A1TR 3MRXA 3BCUA 1RHQA 4L8WB 4M0DA 2VDQB 1H0RA 4NCHA 4OL0A 4RPJA 1CY7A 2HGSA 1D6MA 2VXYA 1FSZA 2B7BA 3EFEA 4IOKA 3A1CA 3EGOA 4EPTA 4CQNA 1P1HA 3OT5A 4Q3CA 5I7SA 1NF2A 2HRZA 1AUVA 2RHGB 1BTOA 2EQAA 3QBEA 4NZMA 3P2JA 5KSWB 2EFJA 3OLXA 5DN6A 5EGSA 2EWVA 3UCEA 1T9BA 2G04A 4IDFA 1ZI9A 4MJ3A 4OIFA 3DYVA 3N2NA 4Y9TA 3K9WA 4BO9A 3LKDA 1N5MA 5FOQA 3EIUA 4DYHA 2I4LA 3ZVMA 3KHKA 1T9DA 3KVRA 5CTAA 5TJ9A 4FIDA 4KX3A 3QP9A 2C84A 1BJKA 1T9HA 5FEMA 2YBEA 3LI2A 4JB0A 2ZRKA 2G9QA 3A1TA 1SVWA 4ETIA 4JS0A 3ZZ1A 3COPA 3RS5A 3WGTA 4YMLA 2ZAOA 1WUKS 4P31A 1N2EA 1HLFA 3VM6A 2HRDA 4DT1B 1Z22A 1XQ6A 5IK2D 1N8TA 2H4ZA 1Y1KE 1SKQA 1A82A 2WKRA 4R51A 3K1YA 4ZQHA 1AVTA 1U1IA 5AHXA 3WBJA 5L3QB 1F38A 5EE3A 2WM8A 4KXMA 3AYZB 5I7EA 1YTUA 3IUNA 2WF9A 1XAHA 4TL9A 4IMPA 3LVQE 2YYAA 5DCUA 1W5AA 1E1YA 1GCIA 5HJ7A 2IZ6A 4GGMX 3D5EA 1GEGA 1UBRS 1BHSA 2RHBA 3CYFA 5GIOE 3DMHA 4XWKA 3CVYA 3OJLA 1OC2A 5FBZA 5TGDA 5KNCH 3FTPA 2ASVA 5AW9A 2PIDA 5AM3A 2YDYA 3DMPA 4RGQA 1A9XB 1Z35A 2DWUA 2AHOA 2VAPA 2ZJ4A 4M9XA 1R6BX 1E6MA 1QB7A 5HDQA 1Q1NA 1QYWA 2QPTA 3DZFA 4L22A 2AX3A 3A36A 3QLUA 1NHGA 4NYIR 3ZKAA 2C4KA 3UH1A 2FCRA 5LLDA 3QKSB 2D59A 3O73A 3AUKA 3QA3E 2ZOSA 4S1WA 3RTAA 1S9HA 2J0VA 4F9GA 2VJMA 1I2DA 2GM3A 4M9SA 2PH3A 2YC2C 2O8FB 3CRZA 3EQZA 3DOHA 3KNZA 1ZZGA 1Y0BA 3FSGA 4JX9A 1CY0A 4INAA 1YNSA 4CL8A 4RJJA 5A62A 2O7VA 1ZVJA 3KS9A 4B4DA 3QU2A 4CQLB 3WL5A 3AP1A 5J4HA 3RK1A 1WAMA 1S2NA 4JYPA 4UBNA 1CR6A 1Y3BE 2GBFA 2WIDA 4H6PA 4XJVA 4Y2JA 2ZRHA 2P2YA 3M6AA 1QAQA 4ARBA 2IHTA 2ZT7A 2PV7A 2JLRA 4FX2A 2GXAA 4X1KB 4KPFC 4DL9A 3CS3A 3ZNNA 1QHNA 2PZLA 1ULZA 4OFXA 4KXFB 1F6BA 2GEFA 3EIEA 1RMYA 2GJ4A 3CG4A 2ATIA 4V0OA 4WADA 4MMZB 3RUPA 4AS2A 5DP2A 4B0OA 2WF8A 1PF7E 1K8RA 1BE8A 5EP2A 2XT9A 5KQRA 1HNZB 4W8GA 2PJZA 4K9RA 5EQDA 1GZ3A 5IAJA 3UWDA 5M04A 4OOFA 1C81A 4LTMA 2KJQA 3LQKA 4R1TA 1V7ZA 4XQCA 4CCYA 2XXAA 1T10A 3CUUA 2GAFA 4B81A 3SM3A 4EJ0A 3IBYA 2YICA 4ZPXA 1WF3A 2DP4E 4AU1A 2NAFA 5BORA 1JR4A 2OLJA 1ZOPA 2VL7A 5JMWA 4P0PB 3M81A 1SXJA 3LHFA 2CVOA 3CZQA 4MS1B 1C4KA 1CWUA 4DLVA 3EPJA 2R7LA 1TVKA 4HDSB 3U09A 4HCJA 4WLEA 4X64B 2V7TA 4AT1A 1RS0A 4REQB 1N9KA 3I01A 3X1WA 1T9KA 1OGIA 3OP4A 5JAPA 4AWAA 4BQFA 2PUTA 4O4IB 3TOVA 3O4RA 2WJZB 4Y2GA 4WE3A 5G3ZA 4HTFB 1NVWQ 3WTBA 4PSAA 1IC6A 4JWTA 5FKJA 3OE7A 4JBGA 1JG1A 1Q50A 1HT0A 1OXUA 1V71A 2EEZA 3ICPA 3NWBA 4RGYA 2JBHA 3LT1A 4M1WA 4RKRA 3IHWA 4OJYA 4YLEA 1L7OA 2VPWA 4CIDA 5C31A 1JECA 3AJEA 3NCTA 2B34A 5FWDA 3J80A 3M34A 4COKA 5JROA 3WWCA 4H08A 5BQ3A 1JEOA 2WG2A 3VMMA 3DZBA 1A97A 2DMRA 4FIZA 4QIHA 2FLWA 2H1HA 1WW2A 2MYPA 4KQ6A 4XLZA 2YJZA 5IUJC 1YFLA 2JG3A 2C9YA 2QDXA 2UYYA 3LK6A 1UKAA 1SUSA 3SIRA 5JWOA 4R6WA 1AGXA 1ZUHA 4B5KA 5C46F 3SQMA 1H2XA 2RGYA 1KF0A 1U9ZA 1JEDA 4GQIA 2Y1FA 2VSOA 2WVJA 4CGZA 3H97A 1XRPA 1KTVA 3A6HA 4LHEA 4MB6A 4M98A 4C9BA 1IVSA 1TA4A 2JFZA 3IODA 4B6OA 4LCBA 1XA4A 4H27A 4HNQA 1VGQA 1TU0A 4GIBA 4XX1A 4WZBA 3HYCA 1PEDA 5EVJA 2Q5CA 3FGNA 4ACBA 1RWNA 2PRKA 2C99A 3ZLTA 1E79A 2CXOA 1K86A 1NQVA 4WCFB 2ZYRA 1YBFA 3R8CA 1RZRA 3U3XA 4BLWA 1IQRA 3E7WA 4LZJA 2VPQA 5D6OA 1UXJA 2JFFA 2PKQP 3H5NA 2CFOA 1WXHA 5A1TA 1MB2A 5A7FA 4WGGA 2BIFA 3BGVA 1JHMA 1RQ7A 1E4VA 2MT9A 3GLGA 1D03A 1OJ7A 2Z56A 4HRYA 2O0LA 1NBHA 4LYJA 4OHRA 4YT5A 1OFUA 3C1OA 1Y7TA 4L4XA 3RFUA 1G64A 3TTUA 4NYJR 1CYEA 1GCAA 4FJ0A 4C5CA 2G80A 1YOVB 3KUXA 5IAOA 3K9FC 4C07A 1MFZA 1SVNA 3MIIA 1SBIA 2O19A 1AV7A 1OTYA 1VP9A 5IFLA 2CEAA 3KJIA 1G2QA 4LJRA 1KU0A 3AL2A 1AGPA 1M6NA 3K8OE 4EB6B 4R3WA 4M4SA 5CFRA 1AKWA 1K6MA 1W44A 4DBLC 4PFQA 3UGKA 4D4GA 4BIMA 4HI0E 4N01A 4JR2A 3TOXA 1S8OA 3H18A 4LXGA 1CS0A 2A5LA 2D5CA 3V7WA 1KE2A 1CRPA 4PC7A 2QT1A 1E1LA 1YZHA 5EMHA 3TRFA 4CMEA 4RD6A 1TA0A 2PAFA 2BE7A 2H2FA 3MTDA 3VVLA 2FPKA 4RZ2A 3WICA 3PYLA 2ODTX 1GU7A 3PZRA 5B1SA 3AM3A 3IDZA 3PCXA 4G2TA 2VJBA 2NXWA 2PL3A 4P4NA 5E9QA 1HEUA 3L0SA 5AI8A 1TTHA 2V45A 3AHEA 1P5HA 2C8LA 3AR8A 4QQ8A 5FWYA 5IN4A 4L4YA 3N6VA 4R7GA 1NASA 4G1CA 3D6UA 5JH7B 3ZJVA 4DGQA 1VYVA 4TVOA 6ABPA 1YRBA 4UU7A 4NECA 4CKBB 2C42A 4GEGA 8MHTA 4FYMA 5HIKA 4YQEA 5ITZB 2P5YA 3BQMB 3R6LA 1CX9B 4LVOA 4X6LA 1C29B 4N5HX 3GUCA 2G0NA 4IZIA 2OV8A 3UT5B 2IS4A 3QVWA 5GY7A 3H87A 4JASB 1G20E 2EGGA 4H6XA 3EG9A 3FTNA 2N9UA 5EERA 2CVPA 3RBAA 3NV7A 1X7DA 4UNPA 1PZGA 4Z1MA 4MPTA 4WINA 3Q9NA 1F8XA 1U28A 4YP7A 1O6GA 1QHEA 1VHQA 3ZXSA 2JD0A 5I6DA 1AHIA 4CTMA 2QJFA 5FJJA 2VJAA 4G4JA 2GBLC 3TDKA 4Y1GA 1AQ6A 1N6PA 2DEUA 4YRPA 2BSAA 3S7TA 2YNMA 1ZH4A 3ROFA 1IQ0A 2DFPA 2WNSA 4UU1A 4LE1A 4ZYUA 1YF3A 4Q3NA 1IRIA 1TT5A 1UAYA 4R2KA 3ECCA 4TTVA 3U7IA 1TW3A 3ZHYA 4BNGA 1VMDA 2C3UA 3KJEA 4I3GA 1KL7A 1PQ4A 1FRVA 3BGSA 4P7FA 2C58A 3R3UA 4MAFA 3BMNB 3EGIA 3TNJA 2GUWA 3DVLA 5DM0A 3HUTA 2OG1A 4KO2S 2FSVA 3FNBA 2P4HX 2VSYA 3GJ4A 1C2YA 1C0PA 1U5BA 2D5AA 2WBLC 1I0IA 3LPNA 4RIHA 1ZKDA 3L1HA 3UCFA 1ARZA 4ALKA 4HMOA 4MTCA 1QZXA 4JLJA 4D3FA 5ALEA 2QTRA 2CDBA 4JELA 2AGVA 2RC6A 1J9GA 5AVXA 4X9XA 5EE9A 4LZPA 1GZVA 2COEA 5CAEB 1QIDA 3UUWA 2QLBA 3TEMA 2AN4A 1GQ2A 2APJA 4FFDA 4FSXA 3OM0A 1WNFA 5D85A 4D9JA 3PGKA 1E1MA 4MW6A 3STHA 3GLIB 2RHCA 3L02A 1Z25A 2UZ0A 3SDSA 2PSDA 2V8BA 2W0SA 3OTIA 5AK3A 3WFZA 4B7UA 4F11A 3SVLA 4UHCA 2JANA 3O3NB 3WGNA 4IOMA 1LSSA 2QTHA 4CKXA 3I6BA 3QVKA 1HX7A 1Z0ZA 4YLYA 3BEOA 4RV4A 1DO8A 1L8LA 1JQ3A 3MCTA 2QZJA 3ETNA 2F64A 4FWBA 4Z9FA 4E6EA 1C3JA 4KWCA 3QK7A 2JFUA 5F1KA 2BV3A 2RDMA 4PSDA 3FZNA 1B1AA 4TLBA 1U0JA 1EM8B 2J5XA 2VZLA 2WW8A 4FUQA 3MOGA 4HJRA 1IPHA 1PCXA 1CR0A 4JJIA 3E0XA 4DANA 3PNOA 1R6AA 2V9PA 4EQ6A 3KCQA 1MGOA 4TMFA 2YV2A 2OFPA 3V2IA 2NUPB 3W6PA 1TYBE 4X44A 2WMDA 3WGJA 4J0GA 4MWZA 2OECA 5EE0A 2ZM6B 5FL7A 5H16A 2D5LA 5KOJA 4AICA 4YMTA 3PSHA 4MQEA 2VNJA 1MQAA 1G8MA 1YQTA 3W5VA 1Q92A 4P54A 2IYQA 3ZWMA 1TI7A 2ZYGA 4CM7A 4KIUA 4QWWA 3N2ZB 2QGZA 5CT6A 3SEFA 5EYPB 1PW5A 3GL9A 5DK4A 1SWVA 3INYA 2WHRA 4HZUB 5WRFA 3ETEA 4MYSA 1EFKA 2HBRA 1MTOA 1NTRA 3W1EA 3G0HA 3REFA 4AJPA 1L5VA 1V2HE 2QI9C 1JF8A 3NYWA 1ZL2A 3LC7O 2BFBA 5DTJA 2O3TA 1EGQA 4DDVA 2VJCA 2CKDA 4E4YA 2RGGA 3NO4A 3ND9A 1NBMA 2KYRA 5BYAA 3ETCA 3PNQA 4GHWA 5A3VA 3U81A 5LQRA 2A84A 1J90A 2G83A 1G66A 4AJNA 3BRQA 1JIIA 4DJFC 4LWPA 3CVUA 2JH8A 4L27A 1L4FA 3WWZA 1ZL0A 4LYEA 2Q49A 1D0VA 4I46A 3PICA 5ALRA 4NZZA 4DWWA 5KYXB 1W4AA 2IEAA 4WCFC 1TF5A 2HSJA 4RZQA 5GP1A 5JIBA 3B1ZA 2NU8A 4JLKA 2ZI3A 1NBWB 4OHWA 4ALLA 1JI0A 1A9TA 3PPXA 1CEXA 2P9HA 3OEYA 1JLSA 4G5HA 4KYIB 4D02A 2ONKA 3WOVA 5I7WA 2Y99A 1Z6AA 3INTA 1KK3A 2OO5A 3PDHA 1GP2A 4ZOCA 4Z9AA 2XQIA 4GYWA 3RYFA 3WBFA 2CD7A 2H07A 1RZVA 2VHWA 4EY4A 5BV1A 5K7SA 1YUNA 1KZGB 2A0UA 4BMNA 4CMHA 1AQLA 2D5BA 4OG2A 2NV6A 1LLUA 1JMKC 4FNOA 2PTGA 5FBVB 3GQVA 1O97C 1ENOA 4HRAA 4M1YA 1H0KA 4JVNA 4FDVA 2PL1A 3SHFA 4TN1A 4P0TA 3FWHA 1B14A 2CXRA 2J7PA 4EHIA 4BJ5A 3HO1A 1L4KA 3NM4A 2ISCA 4B84A 1QIGA 1K6EA 3O4HA 4QPPA 2W2LD 1IEWA 2ZLBA 1K3FA 3GEMA 1EWQA 3LC0A 4MRVA 4B73A 5ALVA 1TLLA 4I14A 4C4YA 4CW7A 1GT6A 3CR3C 3DKIA 3VPBA 2F9LA 2NPIA 4J3FA 2VDWB 4BFCA 4DDWA 3TTTA 1IBRA 1WY7A 1WULS 2W58A 2H52A 2WTNA 3BE4A 2DECA 5HFAA 3IP1A 3NORA 3AFIA 4XUCA 3SFTA 1U63A 4Q9AA 5LVAA 1TTTA 4PYRA 1XZQA 4FFMA 1RM3A 5DYIA 4AKGA 5K0CA 2A7QA 2IZ7A 4JOBA 1TNDA 1CUZA 4J91A 3T5DA 4CCWA 1Z68A 2FH5B 2XUZA 1LDYA 3AXSA 3E9ZA 2AEMA 2M9MA 1IJFA 2HCBA 2OZLB 3UANA 3LLUA 1XT6A 1L4MA 4EW6A 3RVLA 2NNWB 2VRBA 1BAPA 3VR6D 1OWPA 4XVUA 3MF4A 4G0YA 3KTDA 3U1BA 1S2LA 4FN5A 4JQZA 2QMHA 2HW8A 4HB3A 3FSRA 3VR3D 2BGTA 3E9NA 5BMVB 1E69A 3D3WA 1I2BA 5B4TA 2WWYA 3WRVA 2FKAA 2CK3D 4R9UC 4EFDA 4YRRA 1IHYA 5G02A 2DQYA 2LIPA 1I10A 4QPCA 2HPZA 3HSKA 4ZT5A 2WPDD 1EUDA 5IU6A 3NANA 1V35A 4DIFA 1VSTA 2PA3A 3TM4A 3L5KA 2RHOA 2WYOA 3ZQUA 2XT0A 1EX9A 2M98A 1I33A 4IIJB 4BRZA 2J3IA 3HV0A 1Y6FA 3VSEA 3ZE0B 4OU4A 3P4YA 1GLVA 1OA0A 5CVUA 3GA7A 3L4SO 2H0AA 1F7UA 3B6MA 2W8ZA 2B8JA 2WE8A 3IVGA 2BP7A 2YZGA 4PIMA 4Y2XA 2Q5QA 4J1TA 5TE9A 2Q7DA 1DVRA 4KAXA 1M1NA 1SZJG 1A9YA 2YX1A 4RGVA 4DCTA 4E2YA 1G8KA 1H3EA 1QSGA 3DT9A 3HCRA 3IH5A 3MJCA 1JYSA 1QIMA 3P9XA 3GUZA 1O5TA 3RVQA 3W5CA 2Z6UA 2C98A 3G2MA 3S2UA 1CPYA 1S9DA 1WZNA 2F55A 4WFJA 1NVXQ 2HO4A 1H8ED 2X5NA 4NV3A 3K70D 4BDTA 3R40A 1FMFA 5GTDA 3QLTA 3FGOA 3GPCA 2GCEA 1UPFA 4Z8XA 3I42A 3ECSA 2IQIA 3WDMA 4OBBA 4BVAA 5CTJA 2CXXA 3CH7A 2QD4A 4JNKA 1FSFA 1SBHA 4QAJA 1IXYA 3JALA 1HG0A 3CJTA 3SIPA 3F8SA 4TZ6A 1J23A 2XHZA 1SU6A 2YY5A 2JA2A 5SY6A 2ZZMA 3MJHA 3PHIA 4CUKA 1XMPA 3BYZA 3QEJA 1OBOA 1QG2A 2P6NA 3HEBA 2CWWA 2FW6A 3FLAA 4G07A 1Y4ZA 2ODPA 3Q6MA 1AZWA 3EVAA 4RPIA 4ZALA 4AKSA 3VTAA 1DCMA 4DEYA 1NQWA 1U3WA 4J16A 3BIXA 2W2KA 3V32A 4F86A 3BA6A 4LXYA 1XPUA 4ENQA 3GRYA 3AHFA 1JU3A 3DFUA 3M0EA 3M82A 3VO2A 4CLXA 1QG4A 4AMZA 4IYJA 5C8YA 2P6UA 1A98A 1E9BA 1LJ8A 1TUEA 2WWRA 2NO0A 3T7DA 4JZKA 4HEHA 3RIGA 4LY9A 3PC8C 3A2KA 3USES 3V34A 5JEEA 1CQXA 3VNBA 1QUEA 1VCIA 3C5CA 1PFQA 1M10A 1NVVR 4JHXA 5J1SB 3RVJA 4F46A 2WOJA 4E2FA 5BNWA 5KS2A 4ZJUA 1ZMOA 1JG6A 3TR5A 1JBEA 5F7OA 1SC1A 3HYNA 3OPNA 4U8HA 5GQSA 4GGOA 4X62B 2G07A 3DHVA 2JHAA 1MLDA 4I55F 2ZUCA 4JDPA 3SMQA 5C8DA 1HE1C 2RARA 1DUSA 3FRIA 3C43A 4K86A 3PXUA 4RLHA 4D8WA 4AW9A 4K40A 2VRCD 3ZIAA 3UUGA 5J2UB 4ZKEA 5HWSA 1TMYA 3STVA 5IJWA 4RVGA 1GVNB 2RHTA 4H3HB 5F12A 2OHVA 1YAHA 3AF0A 2BM1A 2PNJA 4CHGA 3AUJB 3TS1A 4Z51A 4UTPA 5T8KC 2PGIA 3CWZA 2C2BA 2JGJA 2QJWA 1ZK0A 4BNVA 1LZLA 4LVNA 4D6YA 1IK6A 3G0DA 5EJMA 3H2SA 4G26A 2LD4A 5CVDA 4QHYA 3WNQA 4DXAA 5A06A 2ZWPA 3AFHA 3RRYA 1DTEA 2BONA 5B3LA 2AOUB 3G2KA 4JLVA 4PHGA 5MFZA 1FXSA 2G06A 2AEEA 5KJCA 3B9BA 1XCOA 5INTA 1CJSA 2VQSA 3AOGA 2Q4RA 4C4AA 1T3TA 5JE8A 4CGYA 4B4WA 1X3LA 3GLUA 3PL5A 4JLBA 4Z54A 5IF3A 2EF1A 2ZANA 4ROSA 1OE0A 2PUAA 3V1UA 3VR4D 1ZA1A 4R8VA 3AONB 2IBSA 1R8YA 4M99A 4HNHA 5HILA 3HVRA 4EG3A 3E8SA 1J97A 4ND4A 4OM8A 1U1DA 3RVPA 1WVIA 1JDVA 4QFBA 4HDRB 1GILA 3BH6A 3TB6A 4EWLA 1CUFA 1M0SA 2BI8A 3U4DA 5A5GA 3F9CA 2WNHA 5H4HA 2EYUA 3WO0A 2RI6A 1QVRA 4IRUB 4ZI3A 4QTXA 2LZ0A 3AHHA 3PUHA 4XARA 3AJAA 3W34A 2NQ8A 3ZLBA 4EF4A 1SVKA 1XJ0A 2BH2A 4LE2A 3FF1A 2WE7A 4JI8B 4IZ6A 3F5DA 4EL5A 3AETB 4OB8A 1DTSA 1BFKA 5K8UA 1H1LB 4MZXA 1OFVA 3NHBA 2WUDA 1E2UA 3RR2A 2HA0A 3ESQA 4BC0A 2OBXA 1Q0RA 2GSDA 2VPIA 3LBYA 1CT9A 4QA9A 3WSVA 4DJDC 4B3TB 2UXCB 4JI1B 1RHJA 4LMRA 3AW9A 2QM0A 1N1DA 1SC6A 4HDAA 5EZYA 3SYLA 4E5MA 1JDTA 3OX4A 4CQJA 3ZGOA 4E0BA 5AXBA 3LY5A 2AD5A 4FCCA 2EFEB 4HDKB 3O4VA 4N7JA 1VM6A 4Z6KA 4M55A 4RJIA 3HP1A 4URVR 2Z2YA 4OLAA 3ZWOA 3W8NA 3CC8A 1P1JA 1JEJA 1II9A 1QV9A 3KKMA 1CZNA 2P4SA 5IFKA 4PO8A 1M2WA 1QQTA 1C3EA 4RDHA 2RAFA 4MI9A 4X84A 1XNHA 1OAKA 1FMCA 3ND8A 4RFLA 1FU4A 1LBQA 4FP9A 1USVA 3R5TA 4LZNA 1U8TA 2ZS7A 3BM5A 4CT0A 4ZO9A 3UBMA 1GUAA 1VFNA 4KFCA 2BFCA 3B6JA 2FW7A 1N2HA 1C4WA 1OIVA 3ZE2B 1KMHA 5J43A 4URXR 1ICIA 2ACEA 5KB3A 3MBIA 1J22A 2Q62A 5JAMA 3GLHA 4MA0A 4YJFA 4GDMA 4G6ZA 3T3NA 1N2JA 4QECA 5AM1A 2R1UA 3H5IA 4OHMA 4MQ5A 4IS3A 3S44A 5F33A 4PC6A 1R0BA 4JFRA 3WP1B 4CMKA 3PYXA 1XTZA 3NW9A 3PFNA 1ZOOA 2G70A 3AR6A 1B2RA 1P2GA 3KB8A 5CD9A 3A4VA 3MS7A 1S7CA 4J1NA 2HJRA 4L3VA 4Q9HA 4FW8A 5GPBA 3UC9A 4HKTA 1W5FA 4QDKA 3OOHA 1NDHA 4G0QA 4K6KA 3HU1A 3GAMA 2Q50A 3KHTA 4GI5A 3EEYA 2GH1A 4FHFA 4FEEA 3AZQA 4H7FA 2C94A 1LK7A 1YS6A 3BCHA 4DS3A 3PUJA 4RD4A 1SN7A 4IWNA 4RMGA 2QW1A 5IWCA 1OZAA 4AJKA 4YNBA 4ENVA 1UBFA 5HJEA 2Z5GA 3ZDZB 2WFLB 2JJ2A 1TVMA 4MJ7A 4ZARA 1KU6A 3EMBA 2C8KA 4QGBA 2I4OA 4JSRA 3M4ZA 4BMXA 2JHGA 1FNMA 3ZU4A 5L6MB 1X8JA 4ZVOA 3TZCA 4LF8B 4IGFA 2EKDA 1ODLA 2VYVD 1V4BA 3A9RA 4O0MA 2WZBA 1Y8QA 2C9CA 3EEIA 1UC9A 3D9QX 5KOYA 3HKDA 3RJTA 3E3AA 4HQNA 2WVGA 2GJ8A 3R7FA 5CD1A 1XXHB 3L46A 4XUDA 4Y1RA 3ZJ5A 4UKDA 4UDXX 1DRKA 1QHFA 2CUTA 3DTVB 1UFOA 1ZBDA 3U3DA 1ULBA 4RKYA 4KLRA 5IJ0B 3IDFA 4X60A 1ZINA 1L5FA 1KPGA 1R0CA 1XA3A 1U7OA 5FAXA 5G40A 3T7SA 4AO8A 1UM9A 5C4GB 2E1PA 4I8DA 4F8YA 3NLLA 2VK1A 5KOHA 3GDGA 4R1SA 1FDRA 2XH8A 4FOSA 4BVKA 1PT6A 1WDLA 2V7QA 1GU0A 4J2TA 2V96A 4IP0A 1R2QA 4ZREA 1TC2A 1DX9A 2H0QA 1P6UA 2NO5A 2PZJA 2QTZA 2V0CA 4GL4A 2FN4A 3VC1A 5CA1A 4MR7B 4RVDA 3QG1A 3VQTA 5DHPA 3ABSB 4ARSA 2P9BA 3CRNA 2OHJA 2QLNA 2Y0CA 3UAVA 1T0IA 4A8JA 4NE9A 4DEXA 5KTKA 2PGXA 4C7OB 5CB8A 3MGBA 3U31A 2NXEA 1OYWA 2QN2A 4MUBA 3U4MA 4MDFA 3WRYC 3R8FA 1RYDA 2KE5A 3EK2A 4ZAXA 3V8BA 3IVCA 5AW1A 3AL0C 3M2TA 2VTEA 3QF4A 1OV6A 4K28A 3WKCA 3H05A 4CEHA 2VF4X 1ZVVA 2O8EA 3IAS6 3LVBA 4DUGA 4O2RA 5DHUA 5TT1A 4TZ0A 1WLSA 1P0MA 3TTWA 3I9V6 4CN9A 5J2TB 4H1WA 4MMXB 3DFKA 5AK0A 1ZUNA 3VA7A 1CV2A 1P60A 2GPNA 3DEYX 3Q0TA 2FPGA 4FKMA 2RHMA 2D74A 1Q7GA 3RARA 5KVQA 4XGNA 3TFOA 1QHSA 1RDFA 1CIJA 1NVEA 4OXXA 3HSSA 3HB9A 4PZPA 4CLEA 1DC4A 5JAIA 1VJGA 1Q1BA 4PIPA 3T5GA 4LDPA 2HRQA 1N6KA 2I3GA 2OYSA 2QTVB 3D2CA 4FHZA 4UTOA 4ZA2A 4OI1A 2VZEA 4CM8A 2DWOA 2IZOA 1W8DA 1X2BA 4GH5A 1OOEA 4IDGA 4H16A 3PKIA 1RQGA 4A92A 1E92A 4RH1A 4UMDA 3PFFA 2VRWA 2FR0A 4R98A 1WP9A 2I6SA 4PINA 5FPPA 1FNCA 5HMMA 2F8LA 1LV8A 1N2CA 2Q6LA 4DF3A 5IKXA 4UOEA 5I8WA 3EVGA 5C32A 3UBTA 5AJWA 2RG7A 4F4HA 3HKEA 4KAAA 4V0NA 4CTNA 1T9GR 2V74B 4IQGA 1ZNZA 5JY6A 3DB2A 4S1NA 3PFWO 4Q3BA 1ONSA 4JYCA 5C3MA 1MOPA 1M0WA 5AUOB 1NQOA 5F98A 4ZGWA 1ESZA 1Y9DA 3OU7A 4C4ZA 5LP6A 1DDGA 4N3BA 4ZCLA 4ESEA 2IY8A 2BI4A 2C07A 3V4FA 4BQEA 1SCJA 3EUFA 4B32A 3H13A 2WF5A 4YQFA 5CBKA 5CM9C 1KMCA 4I4CA 1GZUA 3OVMA 1USUA 4PN3A 1L3CA 2IIQA 2VEDA 3M6LA 3F5QA 2XCTB 2D2EA 4UQLA 2BMEA 4ZXPA 3FHTA 1GAEO 4II7A 5GAJA 2R4QA 1NZDA 1JV2B 4F93B 2VJMB 4X6XA 3JQBC 2QQGA 3IV9A 2GUGA 2VJPA 4V0KA 2CV0A 2G76A 3IPXA 1WDMA 3C7DB 3DUFA 4DXHA 5JVDA 2XI4A 1XEWX 3L8YA 3LT4A 1Y3HA 4PXYA 3LWBA 5C1DA 5KREA 2VF8A 2ZT5A 1ZGGA 3PC2A 4MUXA 1I6LA 3KZOA 2IX9A 4WV3A 3LHSA 3GF4A 1BHQ1 3DNFA 4MWCA 5K3CA 1VPLA 1W8IA 3FUUA 1PR6A 3NP7A 1Z0JA 3QF7A 4MKFA 1QGUA 1BOOA 1EGVB 1WCXA 3M9XA 1CUYA 3KB2A 3LIPA 1T2FA 1C1YA 5TSDA 4DLYA 5KKCA 4DNQA 2YDXA 5MDHA 2VRNA 1T5TA 4QOEA 1GQSA 1TXGA 3BWEA 4ID3A 1GSOA 3ZVRA 1PTKA 1PR3A 5EE5B 3FCOA 4BNHA 4H4CA 4KN6A 3T9BA 3IUMA 4C3OB 2AMVA 4MV0A 1QFZA 4P92A 3WNCA 1PSWA 2IH5A 1V3TA 4Y18A 4L9RA 3ZVKA 4HBZA 1TJ5A 4I6JA 4MICA 4C7MA 5DTIA 5AR1A 1J5PA 2PY6A 2YVUA 4S1TA 8LDHA 3DO6A 1BDIA 4GG1A 3WIBA 1UK7A 3V97A 2ZSEA 3WYFA 3KXPA 2JLVA 4NTZA 3WYAA 3QOWA 4JROA 1TVKB 3HJBA 2OVFA 1PL7A 1WO8A 1JAXA 4U39A 5MGBA 4RTKA 1VKZA 5E95A 1QH0A 2DWCA 4K6FA 3CRVA 3MW8A 1BE1A 1RWOA 1D9XA 1T36B 3LA8A 3OLCX 4YECA 2IOHA 5F4ZA 4OYHA 2PGDA 2G1PA 9GPBA 1PSZA 2W6ID 1IOVA 1T13A 1TJNA 2QJOA 1FP1D 4UNSA 4BN4A 1LRJA 2FRDC 4EUSA 2GESA 3EZ6A 1Y6QA 3JVUA 3Q0IA 4BFTA 4JL8A 1VYHA 1ZM7A 2GNAA 4WEQA 4OB7A 3SNHA 3D8SA 5IUNC 4ZU3A 1HRDA 4GT1A 3HN6A 4TRNA 4I81A 3TNFA 4TQAA 4POAA 3AKZA 4KXXA 4H59A 2C5FA 2W4QA 4AJ9A 2EHDA 1MO3A 3KVYA 3NBZC 4FMCF 4RCYA 5D7BA 4MQ4A 1XX6A 3VZQA 4EW2A 3GU3A 4EFKA 1RU3A 3EIHA 3F8WA 2HUNA 4QGSA 1XU4A 3N8HA 2SCUA 4PVDA 1W59A 5ILOA 1W5SA 1ZA2A 3G0OA 4A5SA 3LNCA 1P7ZA 4DMUB 1FFGA 4HNSA 1RYYA 1SQGA 1TMGE 3PITA 1OH5A 3W3AH 1QORA 1WUHS 2FEWB 1JG3A 3M4NA 2G0AA 2IPLA 1C9JA 3I1FA 1M2KA 3KG2A 1QHIA 3FFBA 4NU5A 3DOUA 3TEJA 4LY6A 3I9OA 3PQ8A 1XFDA 4YXWA 1YOBA 2BBWA 4GBED 2XBMA 5L3RA 4EECA 3HYSA 3EXAA 3IBGA 3JQ9C 5F73A 3MMNA 4X63A 3O4IA 2AI1A 1O95A 3TR0A 4H9GA 1BKYA 1RD4A 4KMSA 1PR0A 2QMYA 3FM9A 3LE8A 4B43A 5JZMA 1T9GS 4M1OA 2DFTA 1I14A 4HNVA 1PJ2A 3CUWA 3C6XA 4ZCPA 3UKDA 3VVMA 3KQUA 3E2MA 3OD5A 4JKIA 3L9WA 4Q82A 4OPMA 2EARA 4D82A 1MAUA 2WJWA 3ED5A 2E87A 1DBSA 1E5LA 1EVEA 1JJ7A 2R6AA 4PX9A 3SBOA 3QE2A 3BKWA 2P2ZA 4FZVA 2F1JA 2YFYA 2A33A 2PSSA 3IGFA 1GPKA 2ISSD 5G1NA 3HE3A 2NU7A 2PMEA 3VDNB 5I47A 1HA3A 5IXJA 1J2RA 1HQKA 3DLTA 1U8EA 1WABA 2IPMA 4PO9A 2FF7A 3BD8A 2VA8A