4LTNA

Crystal structures of nadh:fmn oxidoreductase (emob) - fmn, nadh complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
192
structure length
187
Chain Sequence
TYSIVAISGSPSRNSTTAKLAEYALAHVLARSDSQGRHIHVIDLDPKALLRGDLSNAKLKEAVDATCNADGLIVATPIYKASYTGLLKAFLDILPQFALAGKAALPLATGGSPAHVLALDYGLRPVLHSMGVRHVVQSFFMVQSQFSLAVEDDVASQLNNAIDHFRLSLSSEPSTRHLGHPRPSLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-dependent FMN reductase
publication title Crystal structures of NADH:FMN oxidoreductase (EmoB) at different stages of catalysis.
pubmed doi rcsb
source organism Edta-degrading bacterium bnc1
total genus 62
structure length 187
sequence length 192
ec nomenclature ec 1.5.1.42: FMN reductase (NADH).
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ltnA00
3O2NA 3B6KA 3ZHOA 2Z9CA 3F2VA 3L9WA 1JA1A 3HLYA 1BVYF 5FX2A 4GI5A 1H66A 1FUEA 1CZRA 3SVLA 1XYYA 4C0XA 1QRDA 1T0IA 2QX9A 2ARKA 1B1CA 2FOXA 1DXQA 3UXHA 2HPVA 3QFCA 4LA4A 3L9XA 3K1YA 5NLLA 2N1MA 3NHSA 1AKVA 4FGJA 1XT6A 4OXXA 5LJLA 1FLNA 5LBUA 2X2OA 2FZVA 4ZVNA 2BZSA 2FX2A 1AKUA 2FLVA 1YRHA 4YAUA 4YQEA 1NNI1 5EMNA 1CZKA 3B6IA 5TGZA 2ZKIA 3RPEA 1QBGA 1YKGA 1D04A 2OHJA 1AHNA 1V4BA 1FLAA 2X2PA 5EA2A 3ESYA 2V9CA 2RG1A 2V5VA 2KQUA 1AKRA 1AKQA 3ESXA 3OJWA 4LTDA 1C7FA 1OBOA 3N3BC 3QE2A 5F4BA 4XDGA 1SQSA 4DIKA 1FLVA 4U7GA 2R96A 5LMCA 3LT5A 4C0WA 2M6RA 1AMOA 1ZX1A 3U7RA 1WSWA 1RLJA 3NHRA 3NHPA 3EYWA 2MTBA 2QX6A 2Z9BA 2B3DA 3TE7A 1E5DA 2BPOA 2Z9DA 1CZOA 5LLDA 1DX9A 1YDGA 3NFRA 3F90A 2XODA 4N65A 2AMJA 3OX2A 3OJXA 3NLLA 2HNBA 4Y7CA 4NLLA 3NHJA 2XOEA 2MOKA 4FGLA 2MT9A 3OVMA 5B3LA 1YCFA 2FAXA 4Y9UA 3W77A 4U7FA 2OHIA 2MWMA 1FX1A 3NHWA 3W7AA 4Y9RA 4M0CA 2QMYA 4J8PA 5B3KA 3KLBA 2GSWA 2QR2A 3KAPA 1YOBA 3KAQA 1CZUA 4YALA 3OWXA 2BF4A 3W78A 3NHFA 2KLBA 2OHHA 2QMZA 4YAWA 1YCGA 1AKWA 4F8YA 1RLIA 2F1OA 2OYSA 3GFSA 4H6PA 5LVAA 1WSBA 3FX2A 1CZHA 4PTZA 2M6SA 4S24A 5FUQA 1T5BA 1FTGA 1KBQA 4CF6A 2HNAA 3D7NA 3FW1A 1BU5A 2W5UA 3NHYA 1C7EA 1XI2A 5EAIA 3F6SA 5ULLA 4QOFA 3B6JA 1JA0A 4QOEA 1ZWKA 4ZVMA 4ZVKA 1DXOA 5JROA 2Q9UA 3HA2A 3P0RA 1X77A 1XYVA 4R81A 4CETA 4FX2A 4LAFA 3FJOA 2QX4A 4ESEA 1RTTA 2BMVA 1OBVA 1RCFA 3NHKA 1F4PA 5FA6A 3U7IA 3LCMA 3ESZA 1J9ZA 4N9QA 4GR9A 1SG0A 3S2YA 4PU0A 3N3AC 2FVXA 5NULA 1QR2A 3R6WA 4DILA 4ICIA 1TIKA 3FVWA 4DY4A 1CZNA 3W79A 3GFQA 5F51A 4BMOB 3JSXA 4PTYA 4QOJA 1OFVA 1FLDA 2WC1A 3O73A 4FGKA 1D4AA 3ES9A 4C76A 5A4KA 1J9GA 2FDXA 3QFRA 1TLLA 4QOHA 3UXEA 5BUCA 4QOGA 4QOIA 1I1OA 2QWXA 2QX8A 4NULA 1D03A 3G5MA 1GG5A 3OWHA 2Q62A 5LBTA 2A5LA 3F6RA 5F12A 1J8QA 4GQIA 3TEMA 4YAOA 5LJIA 3NHLA 4QODA 1AZLA 3B6MA 1CZLA 1H69A 1FVXA 3TZBA 4D02A 6NULA 2V5UA 1QHEA 1KBOA 4BMPB 1YCHA 4XDHA 3FNIA 1ZWLA 4HEQA 3K20A 4ZVLA 1AG9A 2Z98A 3GAMA 3NHUA 2BN4A 4LTMA 4H2DA 1AKTA 4LTNA 2FCRA 2R97A 4U7HA 1J9EA 3EDOA 4C14A 3HR4A 3OX3A 4YAFA 3KEGA 2D5IA 3GFRA 3OX1A 4N82A 4HS4A 1VMEA 2FZ5A 3N39C
chains in the Genus database with same CATH superfamily
4PFKA 3MWEA 1V16B 3Q0TA 2PH7A 1Q1GA 1C3LA 4OTZA 1M33A 1OPRA 2ODTX 5EIAA 1QRAA 2Q6OA 1LPMA 3OTWA 3C39A 5J2UA 3KUKA 3LCRA 2HA3A 2J5RA 2B1JA 1T34A 1YZ3A 1VOTA 2IPXA 4HGOA 1G5RA 3SKYA 4URZR 2HCFA 4DDHA 3M4ZA 2YV5A 4PZPA 5JD6A 1W5AA 1MR3F 1QGYA 4DA4A 2N75A 4AQDA 3KKPA 2CYAA 5LM3A 3E9EA 3F46A 2WY2D 5DGIA 2Q5EA 4D82A 2C2HA 4TWBA 4AO7A 3ZBPA 1SPBS 1VSQA 3GAAA 3AONB 5FUMA 4Z3OA 2IPLA 2FI1A 5I47A 3DL0A 1GGKA 1QRDA 3GLGA 2ODBA 2BFCB 4CR6A 1ZGCA 3L1UA 2DFVA 1Z4PX 2QNIA 3RUFA 5A06A 1KOLA 4MZXA 3R5KA 4C3UA 2OSVA 3KQKA 3I0NA 3CISA 1HEYA 1W88A 2BE7A 2R8YA 3L9XA 4JLPA 4I50F 4OHCA 1FW6A 4KIGA 1E5XA 4TLLB 2ZZNA 1HX7A 1KVQA 2XWBF 4W5JA 3RS4A 2R2AA 2IT1A 1RWQA 4B6PA 4BFLA 4ER7A 5L3QB 1GGFA 1Z07A 3V5NA 2WVHA 2X1MA 3H2SA 2AFIB 2QTMA 4HB3A 4FGZA 4YNBA 2HUNA 4RZIA 1P31A 4MCHA 3JQ7A 1EBBA 1V5FA 3EG9B 1WDTA 5CX4A 5EERA 5FT9A 1T3SA 4YONB 3TQCA 4OIFA 2V59A 1UJNA 3ZEIA 3UMGA 1A8HA 4FIZA 1VI6A 5EP1A 4YV2A 4XEHA 1GG2A 2WYUA 3QEOA 1H0RA 1IIBA 1VLZA 4RFSA 3ZV5A 1GZDA 1XF1A 1VHDA 2VH1A 3OIYA 4KQHA 3NETA 1AKUA 4JU9A 4LN1A 2XI4A 3UNXA 4Z86A 3RF7A 4DNFA 3S6JA 3VZCA 3EHDA 1M6WA 2R1TB 2PKQO 1M83A 4H1UA 4EA9A 4EJ0A 4AMGA 5AVYA 3HYTA 2ZR0A 4I4IA 5JDCA 2ZKIA 2BELA 4FD3A 2Y3IA 5F76A 3N2ZB 1DTSA 2FWRA 1A0OA 1PN3A 2CVHA 2RHJA 3TBKA 1NJ1A 4UHCA 4B3GA 1PUIA 2QUHA 2FPXA 1IOLA 2C5HA 4UEOA 5CVEA 4XIFA 6PFKA 4QPJC 2B34A 4I6EA 2PWAA 3VR3D 5KQMA 2VK2A 4O4LA 4IP0A 3PV0A 4EHJA 3QUCA 3EZ6A 1V43A 4YT4A 3MGBA 1XNHA 1V8BA 5FRDA 1Z37A 4MLZA 5IDWA 4YUZA 1BW9B 2A9VA 2X0RA 5FPYA 3OFKA 3M6IA 5TMBA 2WU3A 3HWRA 5J47A 2JJMA 2JLXA 2BL4A 3Q7QA 5G0UA 4Z1MA 1HQDA 3RS8A 1WXXA 2G4VA 2PT5A 3I04M 4YFVA 4ZC8A 4ABYA 2FN9A 1CY8A 1G20E 4TKMA 2X7XA 3NUZA 1KDOA 2HCRA 3QY0A 1FDSA 2GM5A 1UODA 1NVMB 2Y1EA 1ZISA 3PSAA 1O95A 1Y4UA 4P3XA 4XDGA 3CO0S 4PYIA 3V55A 2P3OA 1JEYB 3A6HA 2VH2A 5DWQA 4ZYZA 1ZBDA 1S9HA 3OEED 1Y3BE 3JVUA 1SRRA 1TT5A 1U5AA 3AY3A 3HSSA 4ZOEA 4AKGA 5BW4A 721PA 2XW6A 3KKZA 2FP4B 5AESA 4W5NA 2IHKA 4EUSA 3JAWB 5I8ZA 3LT5A 4UM7A 2ZUBA 2C2KA 2PMBA 2XEDA 4I55A 4MA0A 2V0GA 4E1BA 4D0LB 4XPIA 3GUVA 1ANKA 5J1SB 2CSXA 3QKRA 5C7YA 4NU5A 3WQBA 1R5JA 2CFSA 1H2EA 3OUTA 3AR6A 4NESA 2O0LA 4OCZA 3GFBA 3WLEA 4DL9A 3HG7A 2JLCA 4INZA 1Q7GA 1PWXA 2PVSA 1TK3A 4YRDA 1CSEE 1A5ZA 2GBLC 4ND1A 1L4YA 3BHJA 2FW8A 3L82B 3LOUA 3VYRB 1IXYA 2Q99A 2XA1A 2GYYA 3QLVA 5DE3A 4KO2S 3V1NA 2Q50A 1KIFA 3C8DA 1JKIA 4HJXA 1S9DA 1W6RA 3COWA 1EFVB 4G4IA 4HN4B 5E9QA 2KHZA 4NG5A 5JS8A 1JDBB 1AXRA 3QFSA 5BSUA 4EF4A 3EFOA 4JYPA 3GD5A 4F2WA 2NTVA 3GJTA 3D81A 1CIJA 4RM3A 5EKXA 5ELMA 3A9WA 5JH7F 4IDHA 1J0CA 3HKDA 4JUDX 1EVZA 4A0RA 1RI3A 2IOHA 1DIOB 4NENB 2YYYA 4PW0A 2ZETA 3IPXA 4R2WA 1HR0B 4M1ZA 2C9OA 2W2KB 3G8DA 1XJQA 2VT3A 3KJGA 4OY3A 5AICA 2AMJA 4HXEB 1ZR4A 5K4HA 2X13A 1J20A 3V4PB 4MW1A 1DOAA 2E9SA 3FB1A 3DOCA 2WHXA 3MHTA 4NYIR 1SXJC 4R68A 1E32A 4TL6A 3WL4A 3OFNA 3ZXUB 1QG0A 4R0NA 4D9NA 3HB4X 4MTCA 1M8KA 2IELA 3KQYA 3QVSA 2QMQA 3VXKA 1DFGA 3IULA 2NUAB 3W2GA 1ZP6A 3QBVA 2PH5A 3I2GA 4MJ3A 3ZE8A 1U3GA 2XHZA 3RYIA 5EXSA 4OSPA 3CX6A 3E35A 2H85A 2NV0A 3JAKB 4ZQIA 4D9MA 4TLMB 3FTQA 4RLHA 3VR4D 1BX1A 1UBNA 3FNHA 1LRLA 4TQAA 2OOSA 1LI5A 4RSMA 4UHBA 3HL4A 4B09A 1EIWA 3ZW7A 4JI1B 3OVMA 4HS9A 4C87A 3DV2A 4E1VA 4QT4A 3IP6A 5JFTA 1VCIA 4U5XA 4FOOA 4KUEA 1NUTA 3QU9A 1M1XB 3UXYA 1CS0B 1KYIA 1RAGA 2FN7A 2QUAA 4TOIA 4U7FA 4EM6A 1VJRA 4Y8VA 4JMLA 2DKFA 4BNYA 4GVLA 3QQPA 3ZD7A 5FR1A 2NSDA 3CZPA 4PZEA 1OASA 5FHQA 3WXBA 4PANA 3EZ7A 3PENA 4L0QA 1TAUA 4M3NA 4DBLC 2VJOA 3O8RA 3L4JA 3HJFA 3N8KA 1MC4A 4RM2A 1XTBA 2WF9A 3VU9B 2FFBA 3CNEA 4LXHA 2YMLA 4Q18A 3LK7A 4CIVA 5BR4A 2QVYX 3R9XA 5JIBA 4BVBA 1QAOA 3OPYB 3X1DA 1GFSA 1C9JA 1Z35A 1LNZA 2BRUC 5CP8A 4KSYA 2SHKA 3GLHE 1H23A 4HGRA 1KHTA 2YRFA 3FMVA 4IO1A 4IIEA 1C0KA 2G72A 4QU9A 3VSEA 1X1QA 4FMDF 3KB8A 2HJWA 4NMHA 3LDHA 4WZBE 3TD2A 4G1FA 4DE5A 5B64A 2QBYA 2C5LA 2WTBA 3NIGB 4H4DA 3OOEA 4E22A 2IEIA 2W2NA 4OX9Y 4E3WA 1L8XA 1RYHA 1NVUQ 1QOPB 1ZHHA 2CUNA 1UDXA 3PZBA 1L4BA 1X80A 5A4MS 4DBZA 2AN3A 1QWSA 4KH0A 1KI2A 3DCNA 1BVUA 4IIYA 4RJLA 4B3CA 1KKLA 2G25A 2J41A 3EQ9A 3KOUA 4DEXA 2HSWA 2UVDA 3TIVA 1RVDA 2LIVA 5C8YF 4K9LA 3AFIA 4OREX 1O89A 4QO8A 4TTSA 2YZ7A 2RDMA 5JPIA 3LH5A 3N5CA 3SLKA 1GR1A 1JUDA 3EXG2 1A8QA 2R00C 3D3WB 2HADA 5K3OA 5GAJA 3ZJ4A 2CE7A 2ZQ5A 4X41A 2PU7A 3FCUB 1WDKA 1JLLB 4DIBA 1N1EA 1SFRA 3FW1A 5DHAA 1BU5A 1R4AA 2FPIB 2PX2A 2AEEA 2AR0A 2DTDA 2FZWA 2J7PA 2W5UA 3HJHA 1JYEA 4I81A 4LZNA 4RA6A 3AETB 4YLGA 5ALFA 2CNWD 4B47A 2O4UX 3REOA 4KXVA 4CM3A 2GLUA 4BZPA 4L9AA 4EMTA 3AF2A 5FLEX 3IBSA 3TSYA 4S2UA 3K72B 4M9SA 1XRNA 4QOFA 3V4VB 4CR8A 5BNIA 4XVQA 4R6XA 4F9FA 2ZR7A 3AH8A 5KINB 3BICA 4LYHA 4YP9A 3UJDA 3MB5A 4EPXA 2Y0EA 4Y0AA 5FBRB 1GTG1 1NVXQ 4NPHA 4EJ2A 1GFZA 1VLMA 3D7SA 4JBHA 2XX3A 3KYCB 3O21A 4D3YA 5JCPA 2ZB7A 4QJ5A 1L5ZA 3LY7A 3QW4B 4MPJA 5DFAA 1H4VB 2IPNA 4JL6A 2G63A 2RARA 4FX2A 1KRWA 4QWWA 4M89A 2CKMA 4K7JA 3IUMA 5AK5A 4B31A 1ZBQA 2W2XA 1EX9A 5KTRA 1B14A 2EJTA 1Z6PA 2CVOA 4BVGA 4QO7A 2AJLI 3KJHA 3H87A 3C5VA 4ACBA 3F3KA 2ZATA 4C2AA 1L5RA 1OI4A 2GO7A 4BO5A 1NATA 2Z3VA 3ANTA 2SCUA 3ZIUA 1P9NA 1YE3A 4JB8A 1YUNA 3SYRA 1U9CA 4DS3A 5A9SB 5FLXA 3NWBA 1S7GA 1UPTA 4ZVSA 2ZJ0A 4WECA 3T35A 5CXUA 1JILA 2P0YA 4CKWA 4AZ0A 2FWBA 2JIMA 1T3TA 2GBLA 3A1EA 1TM3E 5E3HA 2RGNC 3OQOA 3BWVA 2ZBVA 1NRXA 1NUSA 2H57A 3AHJA 3HI4A 4MVJF 4PU0A 2GGSA 5EIBC 5CCDA 1KJNA 1V45E 1UJ2A 1E20A 2VC2B 4LXYA 1OLOA 1VIMA 2CE2X 1W1IA 4JROA 3CH5A 4KPEC 3UJ8A 1B23P 1G20A 1N2ZA 1ZGAA 3DE5X 3FA2A 4R7ZA 3KDSE 5CFZA 3KWLA 1Z6GA 3NEJA 4TRNA 4CMAA 1XLUA 2YN4A 1GNLA 3GP8A 4YQZA 2DX7A 1GL6A 1FOEB 4OHMA 5AKHA 1EP3B 2PX3A 4QPZA 3GPBA 3M5DA 3BF8A 3V2IA 1UOQA 1ODKA 2WTUA 1VL2A 1O97C 4RDHA 4M1KA 2P9GA 4ZGWA 2OVFA 2FU5C 1DKPA 2VFAA 2JH3A 3EODA 3LZDA 3VH3A 5JQGA 3A4YA 4J0FA 4LXQA 5I4BA 2PMFA 1J09A 1IWPB 5T3YA 1DHRA 4DA0A 1QPGA 1Z4NA 5B7QA 4TV9A 4PC1A 5K3CA 5E6RA 2OK8A 1D6SA 2IOYA 2WT8A 1N8KA 4YASA 3AVUA 2JFVA 4QQKA 4WKOA 3OE7A 1IN1A 4Y98A 3EVBA 3ILHA 3GEPA 2KI5A 4IQ0A 3BD7A 4RDCA 3I64A 3PJDA 4UE3S 3RHSA 2Q3FA 3VR6A 4B8YA 1TLLA 3O74A 3IYLW 3HDGA 4JP5A 4PZYA 3SR3A 3TNJA 2HLDA 2I03A 1E0AA 3D7RA 5LZ8A 2P35A 3OTQA 1KWKA 3R7AA 1FP4A 2E4VA 2NAPA 4HO1X 4Y1RA 4AD8A 3G9TA 3BMXA 3H42B 4KGDA 2FXIA 1NC1A 4NCJA 4V0NA 2HIGA 4JASB 5IZ4A 3ETDA 1H2YA 3ONEA 1JE1A 1T9ZA 3T3PB 4BRZA 4DMGA 1QTQA 1KDRA 1D03A 5FI1B 3A2MA 1GG5A 3OWHA 4MQLA 1CU1A 2GERA 4RGVA 4TL9A 5F1PA 4C7OB 1GCGA 4D8YA 3EMDA 3H9BA 3RBVA 7REQB 5KC8A 4AU1A 3OU7A 4DABA 2ONZA 3PQDA 1E3LA 1TCBA 3GLKA 3L7MA 4X61A 2PUCA 1AQYA 2H9IA 5IN5A 4DA8A 4K1LA 4AZTA 4YJHB 2WT9A 4J6FA 4GQIA 4F86A 4Z49A 5KQGA 1E9EA 4QECA 4XH9B 2A1TR 2W0MA 3A9VA 1VL5A 3ILYA 2WFLB 1LF5A 5K3SA 4IV0A 1EUYA 3RUAA 2Y9PB 3P9XA 4KWHA 2GKSA 1AK2A 2BRUA 2D00A 2GD2A 2OGUA 1T5HX 4REMA 1NHGA 1YGYA 2V54A 4FBGA 1AZLA 2IF0A 3P0JA 4QJBA 4YLEA 4EVSA 2RHHA 1PZMA 1DRKA 1P2VA 4J7AA 3F47A 1G8GA 2E6UX 4MI6A 2YXDA 5AJHA 1H69A 1XRRA 4WNAB 1J5EB 4FMCB 4ID3A 4O6VA 3ESAA 2Y71A 4HAOA 5D6OA 1CT9A 1DQYA 3PE3A 2IE0A 3QE3A 4L6AA 3L43A 3LYAA 1MC5A 5BSRA 3O47A 4PSVA 3ZUPA 1TW3A 2BFEB 5FI5A 1FTYA 2HFJA 1ZMRA 4X8MA 2J9YB 2PLNA 1AH2A 1BDIA 1A8UA 1YULA 2I3DA 5JMTA 2LKDA 1I01A 3O7MA 1CQWA 1E4VA 3MJFA 4G5FA 4PQGA 1RR6A 1BMDA 4GS5A 4S05A 4FSHA 3QPDA 4B5KA 1PJBA 2JFPA 2FFJA 2BN4A 2R00A 3ENWA 4LTMA 5CIWA 4DV0B 3PR1A 6YASA 4WVLA 1IUPA 2YICA 4LYEA 1YZUA 3RFFA 3K6SA 1ZXBA 4PONA 1X7DA 2Z1NA 1LI7A 1QYWA 4CQMA 3EK2A 4GM0A 3QA9A 1ZUNA 2R97A 2VATA 2C0CA 4K3UA 1PFQA 4S04A 1A9RA 4PIVA 5IJXA 4DIOA 1NVGA 5CFQA 3OMWA 5AW4A 3TECE 3ZLJA 4EIWA 4CVNA 1YQTA 2FWAA 2FZLA 2HOQA 4Y9TA 2OQIA 4YAFA 4BAGA 2I71A 4LF6B 4PO1A 4EUFA 1NW4A 2A0FA 4LMBA 3GLHA 4X90A 2Z2JA 2ZANA 5CLHA 1YHYA 1BWPA 4JLOA 1IOVA 4Y7DA 1EHYA 3LO8A 1A9OA 1AGRA 1J21A 1JLRA 1I2ZA 3O82A 5DK6A 1FZTA 4QFBA 1SC9A 3GFFA 3U61B 3PWSA 4WZBA 3B6KA 4BKOA 1NYTA 3CSSA 2QN8A 3SXPA 3CTMA 2DTXA 2P6PA 5TT0A 4Y6RA 5EHXA 1ZW1A 3HTXA 1QONA 4FVTA 4HNAB 4CLOB 2UV8A 4C21A 2ZS9A 2AR9A 3FCSB 1HSZA 3Q1LA 4ZK6A 3HABA 3JD4A 2PBZA 3T61A 3ZZMA 2C07A 3C3BA 4ENWA 1OX4B 3HLKA 2AEFA 3SHWA 2ROQA 1I2DA 1AGYA 3CYFA 5JXWA 1L7BA 2ATEA 2J5XA 3NVAA 5HE9A 3ZZUA 4IDOA 3ADBA 3H11B 2AQIA 4HNRA 1ZYUA 4H77A 3GVCA 3L79A 2WZBA 4JMPA 4BQIA 4YMLA 1E77A 2HMVA 4YXWA 1IG3A 3WGMA 4RVNA 3R8CA 4P8RA 5CBPB 3IHLA 2IUUA 4E5UA 2JCXA 5DCUA 4J4BA 5DULA 5IAJA 4LI3X 5CCXA 2B8TA 3E22A 4PNPA 3O4FA 2JL1A 3JWJA 1JYFA 4YCAA 3CXRA 3N7TA 1JG1A 5NLLA 3SBOA 4JP2A 1EFRD 2RCYA 3BHNA 3IQGX 3QF4A 1KPGA 1RM4A 5BQXA 1SXPA 3FDXA 1BFKA 1EDOA 2RHMA 4O4JA 2GN6A 5JD5A 2B4AA 3EQ6A 4Q9IA 2AVNA 4FCWA 1JDSA 2BUAA 2XQJA 2EJBA 3LQ2A 3T7EA 4I3GA 1NG1A 1AMUA 1DWQA 4A16A 5BVGB 5HQJA 2B94A 3WC4A 2DLNA 3R76A 2FPOA 2BEUA 4OO3A 4IZHA 2ZDGA 4NV1A 2AN5A 5FV7A 3W6NA 5BPHA 1E98A 3TIXB 4E12A 1PJ3A 2PH1A 3BGWA 3G2PA 1F06A 3NDRA 4FP9A 5I9LA 1CULC 5DGCA 4ZARA 2YX1A 2DXIA 3ZGYA 1Y8RA 3CRVA 4NBRA 4WADA 4D3SA 4EGFA 2DECA 4GGPA 4K9KA 1BN6A 1C2YA 2GM9A 3OM8A 4AF6A 3TLBA 4DMLA 4E30A 2WD9A 1U7HA 5TGZA 5TJ9A 3UJCA 3U81A 5TB5A 4NYJQ 5IVDA 2PYZA 3HE3A 1EI9A 3WKCA 2O8EA 2PZBA 3NONA 3SFTA 3PDUA 4GDFA 2EQBA 2OG1A 4N39A 3EA4A 1P8AA 3KPVA 1YVDA 4A2WA 2O8BA 1YZQA 3OM9A 1YIDA 2FW9A 3WZMA 4WGFA 4LI0A 4Z8YA 2AW3A 3AU9A 1PL7A 3STXA 5AHRA 1BGVA 1N5RA 3GLQA 1BYUA 2AXQA 4QX6A 1O5OA 1KK2A 2XDQB 4PINA 3BCSA 1IBRA 4CR7A 4EB8A 2JGIA 1VG8A 1HA3A 1E0DA 2B2CA 2JI6A 4BS9A 1DGQA 4D44A 2PZLA 2XMQA 3WGQA 4KIWA 3BB3A 2J9FA 2C20A 5F9HA 4F97A 2OZKA 3RYHB 2JPDA 1IG0A 1VE6A 3HBLA 1YIOA 2Q4TA 1BQ3A 3FGNA 1ZCFA 3VC7A 1JJIA 3KXLA 3IUPA 4BEWA 2BKEA 3OJWA 5BQFA 1EGAA 3ZQKA 2ZE8A 3ZYCA 2JIZA 1F4LA 2XVZA 4GDMA 3HH8A 4E5KA 1DINA 1GSIA 5ALLA 5E1BA 1IN5A 3RRNA 1UKVY 4ZKEA 3QVLA 4RPHA 4L7QA 4TL8A 3CVWA 1QVRA 3LLUA 4IUCS 1KXZA 1OD6A 1QHYA 1FS5A 1JPNA 3NGLA 5COAA 4RE6A 2Z95A 4TWJA 2NVBA 2W6JD 4J0DA 5T3UA 1H5QA 2D4AA 2DWQA 1NQAO 4N41A 1SD1A 3GXOA 2CXPA 3S27A 4R2MA 2OYCA 2I2CA 3RLIA 1IXZA 4EUNA 2WFZA 3G2HA 4UOQA 3PXEA 1FDOA 3IPCA 1UC5B 3JZFA 4L5BA 5AW1A 1AS3A 2E4WA 1NAHA 1V8DA 4E88A 2UUCB 2BSXA 2O8NA 3KZVA 2NW6A 4CLHA 4ZCTA 4OV6B 3AIIA 4YWHA 3TNLA 3KLOA 2C9BA 2XMDA 5EPEA 1C4OA 1XTKA 3RFVA 3OEHD 2HRQA 1CB7A 2JGRA 5D87A 4YAUA 1VRCA 3DZFA 4EI9A 3GLVA 4D42A 4XLZA 3PL1A 1PAUA 5CTJA 4AWAA 3L0YA 5T6BA 2XCLA 2C1ZA 1NY6A 3K2IA 3W7VA 1V7CA 2B2NA 4NPAA 4YBZA 4MGKR 1CR2A 1Y0BA 3J7TA 2BKXA 1TA9A 5LQNA 1H0HA 1UK9A 3ECAA 1QZZA 3PDCA 4BBAA 1XJCA 3HRIA 2H07A 1ESDA 1VJTA 2PSHA 3QPAA 3EYWA 3KKOA 2IHYA 4Q4JB 4BNWA 3UV6A 5KYXB 1M0WA 1W46A 1E5DA 3WS7A 1PQ4A 2JLUA 2VXYA 4NJEB 2Z9DA 2M2IA 1C7RA 5B7NA 3A1WA 3RVOA 3QSGA 4XSHA 5ARDA 4DCOA 1YB7A 4CWAA 1MH9A 3A1FA 3DEIA 1V9LA 4KN9S 1HT1E 1U4OA 2FE4A 2XUGA 4WAUA 2XAUA 1V5EA 3DQZA 3VZSA 2ECQA 4B8ZA 2E1RA 3AIOA 4L72A 1I0ZA 1E69A 5BQ5A 1THTA 2RAUA 3QU4A 3CNBA 2VZ9A 5EE9A 1XJ5A 2E5LB 5JWHA 2BGTA 1I8TA 5K6RA 1BKDR 4O2BA 3O8BA 4XA8A 3ICWA 3UJAA 3WLMA 5JVDA 1Q44A 4M55A 4PAQA 2IHNA 4CE6A 4PG8A 4Z4GA 2JGAA 1JG6A 2YXPX 4WLFA 4UEWA 4EFLA 3DULA 1IQPA 4XQGA 3PLAE 1UF9A 4BX0A 1RJEA 2YRWA 4PPNA 1DX4A 5KYWA 3S81A 2IYLD 4BMXA 4R9UC 5A5FA 5DNAA 4JT2A 5AVUA 1K7YA 4NOMA 4ZD6A 3P0FA 1KAGA 2VA9A 4DNXA 1SUBA 4G67A 1YL7A 4QBIA 1L4MA 2OGSA 4MRMB 3K4QA 4Z9BA 1YCFA 3A3OA 2ZK7A 4P4SB 1OZFA 2CEKA 3UM9A 1E92A 4TWRA 1DS6A 1Q7RA 2MWMA 4KBYA 1ZKDA 2P77A 1HE3A 2XNKA 4K6GA 3ETHA 1V3TA 5AT1A 5LIRA 3GLIE 1QB7A 4BWFB 1KO8A 3LP5A 3FPKA 4Q7EA 4QFMA 5IVHA 2YDXA 2O7QA 3G9QA 1WPGA 5CVVA 1X1SA 5FJJA 4J7CA 1IZ0A 3G88A 1PJQA 3IQXA 3A7EA 3A06A 2ZIZA 1SHKA 4P35A 2QIOA 3NP9A 4WN3A 5JNRA 4N76A 1WW8A 3L0SA 4YYEA 4DA6A 2Z5VA 4RDIA 5HJEA 5CFNA 2OY0A 5IJ9A 1DJOA 2MMCA 3OWXA 2BF4A 3MCUA 1Y8CA 4QQ8A 4TQUS 1WXQA 2WJ4A 3NVKI 1YBMA 4HXFB 2CLHB 3UFXA 3DNMA 5HILA 2CXSA 1PBNA 2PKYX 2A9PA 3PVCA 4WACA 1Q74A 1X14A 2A67A 2AJCA 2FSSA 3TEFA 2QI9F 1Z0DA 1RIFA 4G24A 3PG5A 5C51B 2BF7A 4B3JA 4F8YA 3WLAA 3KQTA 1U2GA 4HX9A 1T3ZA 4PSCA 2X6RA 5GVRA 1LSJA 2ZIVB 2B6NA 2NQTA 3QV2A 3UGQA 2TMYA 1AS0A 1XXLA 3O3MB 4C9BA 3EVDA 2NSHA 3VKVA 2IY7A 4MYCA 3KEFA 2JFUA 1IHUA 5ADUS 2EX1A 1N2IA 1V4VA 3MMXA 1GAEO 1KEZA 1A7KA 2VDOB 2W2LD 4GQBA 1UKEA 2WTEA 3BAFA 1GN9A 1N4DA 4HH4A 2Q9BA 4KAAA 3G6KA 4PM4A 5DLYA 3TBHA 3UKDA 3JWHA 4E21A 5LBIA 1UBFA 4ZVRA 3GYGA 1VHLA 1USGA 3BRCA 3RW9A 4HEHA 5DNWA 4D56A 5JZBA 4U7DA 3AVVA 4LPKA 2O8CB 2DWUA 1DTEA 4KR9A 2VP3A 4QM6A 1OFIA 5AHKA 1M66A 5BO5A 1VLJA 1N2XA 1XFDA 3FIJA 3MCVA 2W83A 3FOCA 1MEOA 3TLYA 4DRZA 3EW9A 2J6HA 3OFSA 1SB9A 4BVLA 4Q7QA 2WKPA 3K9HA 5GIPE 3K35A 3B9QA 1G6Q1 1DUIA 3GROA 5B7GA 4IQ4A 5T7BA 2FFRA 2VXOA 2IHJA 1V7ZA 1U6JA 1D7OA 2PIDA 2VAPA 3LC7O 4WGGA 4NCBA 2PAAA 1IN6A 4YCMA 3PNLA 3ADCA 2OM6A 3CJQA 3WLHA 2JI9A 3DMHA 3K31A 4G4SO 2JGLA 2K87A 2XRYA 3LPDA 1M8PA 2HSEA 4QFDA 3T41A 4DJTA 1J2YA 3OZCA 4JQOA 3P52A 4EG3A 2REQA 1W25A 2CJYA 4Q34A 3V4SA 2O2YA 4CUJA 3DEAA 1CIVA 2P62A 3W2HA 4F2HA 4UBOA 2EEPA 1MNQA 1MD9A 3L41A 4LF8B 1C1DA 1ORTA 2J9GA 1M54A 3AVPA 3JWIA 1FRFS 3UICA 4UNQA 1XDWA 3CNHA 2VL7A 3K15A 5T4FA 2I91A 1SCBA 3JYLA 3LNCA 1OZAA 3MAGA 4M7RA 5IUNC 5CH8A 1F1BA 1L4NA 1EFDN 1FRQA 1NE2A 1WHTB 4O5AA 4YJFB 4L5CA 2VJYA 3STVA 4C5CA 1NNEA 4PLYA 2QN1A 4I19A 4O29A 4LFBB 3ORFA 4BQNA 4MS1B 4N9QA 5IAEA 1KJZA 3WGUA 2X14A 3KQOA 2B4YA 4RLFA 5D00A 1UM9B 4I50A 2ZOSA 4YJGA 4P93A 2CNNA 3QNWA 4MGYR 1DAIA 4V3CA 2QP3A 3V1MA 5KQRA 4UQLA 2Y1KA 3VA7A 1LB1B 4NY1A 1FNBA 1G8YA 1X9GA 4JX8A 1IMOA 1QZTA 3Q7PA 1DDGA 4JXXA 3MLEA 5EJ7A 1KQNA 2LRHA 1KEEB 1KMQA 4K87A 3O93A 1H85A 3OZ7A 1U1FA 1E1RA 4O25A 2BGGA 3AESB 4GD3Q 3HKCB 2A14A 3IXMA 4WZAE 1Z2CA 1U3FA 1NBIA 1Z4KA 4W8OA 1RXYA 3V4FA 4IGFA 3QE9Y 2B9VA 3NYIA 3Q5GA 3HBFA 5EHIA 1CDDA 2QL5A 4DDMA 2XYHA 2H1CA 1GJRA 2YOGA 1ZGHA 3R4VA 4G5RA 3VVCA 1ADBA 1U02A 3ES9A 3N58A 3PNOA 1XEWX 4GLFA 3M2TA 5AW5A 3VZBA 4BLOA 1I0IA 3D5QA 1CP3A 1TQDA 4KI0A 1H2WA 1FTNA 2GAAA 2ZYSA 3Q3JB 4ZQCB 5EINA 5A0FA 4Z1MD 4MCJA 2VEOA 4Z4CA 5CDGA 3NDIA 4IJWA 1LV7A 1C80A 4HDQB 2ZSKA 2EP7A 4BB5A 4DLZA 4BUCA 4U5QA 1M76A 2F43A 3ZBUA 2RE8A 3IAS1 5LZ9A 2F3UA 3GLIB 4QOIA 4RVCA 1ZL0A 5AM4A 1ISHA 3PXDA 3RV3A 3URKA 5HK9A 1O95D 2PZAA 2Z8YM 1I6WA 3WLQA 3IVMA 2WJWA 1CRPA 3BMNA 2Q3DA 2YIMA 1MAAA 1WEHA 5EPOA 3DOIA 3THYB 4WHMA 1WM1A 1QU3A 5HTOA 4EY5A 1L7NA 2XMCA 2H52A 2JHFA 3CU5A 1KZ1A 4LYGA 3BFXA 4RXMA 3INNA 1DFIA 2WE8A 2EG9A 2Z4SA 2NU8A 3TRIA 1VIVA 3IPAA 5A3JA 2QB5A 3H5IA 3M1AA 4HRXA 5BSWA 3GA7A 1P75A 1M6YA 4CT5A 2FKAA 4FSDA 1RHMA 1TKAA 2CUKA 4BQSA 1KSHA 2JATA 1PU2A 3IEIA 1O4WA 1J2RA 3L92A 4JOQA 5EJMA 4DDUA 5IKPA 1XXHB 1P9RA 4BNZA 3YASA 4DXHA 3F5DA 4UM5A 2GZAA 4WJLA 2OCDA 3KQSA 1TF5A 4DIUA 1K27A 3V42A 2ECFA 2UYYA 2BMFA 3W90A 4ZYVA 2C9MA 3B48A 4JKIA 3MG9A 3P2KA 1AURA 2BEVB 3HPQA 3S55A 5B5SA 3UFBA 1QHEA 4O8CA 3AR2A 3AHGA 3ZDCA 4MKZA 4Q3LA 4HQ6A 2F55A 3BS4A 1GAWA 2ZSDA 1XAJA 1LBSA 3T3GA 5I9MA 3RVPA 2HQSA 3E3AA 4HQFA 2R8PA 2PJRA 1E9RA 1L4KA 3OCWA 3H5OA 4HLQB 4EEZA 3FXAA 1OLUA 1K2VN 5H0IA 3DLBA 2ODNA 5IMSA 5ES3A 1G0OA 2QTLA 1D7AA 5E2BA 3SX0A 3WLOA 4OMUA 4AX4A 4P98A 5A3RA 1SCQA 2OFXA 2G76A 1AB5A 1OC4A 5BSHA 4LF7B 3GAMA 1BQ4A 1U0GA 4P5DA 4XSGA 1TCCA 4BP8A 1EFKA 4X5OA 3QE0A 2J6IA 4OJYA 4OI2A 4F45A 1Y1RA 1TADA 2OK7A 4GUAA 4X1KA 1JKJB 3L84A 4MRAA 1PFVA 4OVKA 2GZ3A 4PCVA 3VKFA 4L51A 1QE0A 1T29A 3CXUA 3OFND 1I3OA 1YA8A 4I2VA 1QYDA 3PXAA 3FZQA 4JUAA 5LDGA 1J9EA 2JJ1A 3AOGA 3CRQA 3ND9A 3MTAA 4ZI5A 4B3RB 4EA8A 5JH7A 4OI4A 1YV9A 3A6KA 3OX3A 5ALYA 3U7QB 4W99A 1O0BA 5AJZA 3G49A 3II6X 3WYEA 3R6GA 2EW1A 1RZVA 4ER0A 4N82A 4BZQA 2DKNA 1U8EA 2D5BA 2FZ5A 5K99A 4J4TA 4TWAA 4W1RA 1ZH6A 3U2QA 3ZGXA 3L04A 2O8CA 1I0LA 4IJUA 3C0KA 4Q1EA 5FTWA 3TZ6A 4DUPA 2XCUA 2JW5A 1R8JA 5DJ5A 5ELLA 3UG7A 4AJKA 4EEXA 1R6BX 1N2CE 2G04A 3L46A 4RE5A 1DBRA 3HRHA 2BJHA 3NBYC 2GHRA 4IXDA 3Q2OA 4Q9HA 2C5EA 5ALZA 5KCZA 2VJLA 3LC1O 5IHPA 1O77A 1A2OA 4MQFB 1GA4A 1XJ0A 3VR5A 2QD1A 1DEKA 2QG9A 2IY9A 3T6KA 1U3WA 1CUVA 3OESA 1Z18A 2EZ4A 3DE3X 4YCCA 1IPHA 5IC4A 3VPHA 4QARA 4GYJA 3VAAA 1O6BA 2P3SA 2WJJA 3H5VA 3M82A 4BYMA 2X9GA 5FL3A 1E62A 1XVAA 2E5WA 3L2OB 1TOAA 2W11A 4BJ1A 5GADl 3UAOA 1TVKA 1EXVA 3DTYA 1NP3A 2UKDA 2ZJ8A 1WCIA 1Y3DE 3DL2A 3FHJA 1ST2A 1PGJA 1IK6A 3IMFA 5EP4A 3S3TA 4WBNF 3L3BA 1ZC4A 4CKCA 2EJCA 3HVKA 2CCGA 4S1NA 2IDZA 3H65A 4MR7A 4RD6A 3PHJA 3RABA 2Q9CA 5IYZB 1KGSA 1BXKA 2FUNB 1KY5A 4YUYA 2F62A 4L2IB 4U0KA 4Y2VA 2AMLA 4Z3DA 4FGJA 4RHEA 5JWRA 1MTOA 2R6CA 1XVIA 2Q3CA 3JY6A 3TLGB 3M6AA 2FVYA 1K6JA 2JB9A 2VT6A 2R6GA 2NACA 5CA1B 2V58A 4H0FA 1PD0A 1QLJA 3BC1A 3GAFA 1FLNA 1HTWA 2X58A 3FZNA 4HDKA 4C20A 4OHYA 1HH4A 4I5GA 5T41A 4QUJA 4UHKA 1DCMA 5IJZA 4KRFA 1GZUA 1AM4D 4H3VA 4BE4A 4F7DA 1SBHA 2BZSA 2ETVA 3L0IB 1Q1NA 1TT7A 1IXRC 3R0QA 3I1JA 4UPVA 4XQ9A 3SDZA 1DL5A 1N6OA 1QYXA 3Q88A 1P4HA 4R1MA 4F2DA 1P61B 1JKMA 3DNPA 3S2IA 1KERA 1UMKA 1FYXA 4GUDA 2HQBA 4W7SA 2R9VA 3C6ZA 1NJGA 3U4DA 2J7PD 3VTFA 3H2KA 4BCDA 5KTSA 2B35A 4MVXA 1SIWA 3GPDG 4MWOA 4Y2XA 1YKGA 1T5TA 3CKMA 4E4RA 1U4SA 3DV0A 3DHNA 1UJ4A 4CNBA 1Y34E 2GFQA 5C8YA 1BE0A 3H5TA 2WSMA 3EEIA 2PYIA 3Q9LA 2WWGA 3LXXA 5EXPA 3M6UA 2NUPB 5BWOA 2M1ZA 4PLCA 5MF6A 2G1KA 2CV1A 3L8DA 2BI8A 3MINB 3D7MA 1OPXA 3WRXC 2O8DB 1DAKA 1P73A 4Z9AA 1FVFA 1XZ8A 3LC2O 5EJFA 1EFPA 4YJ2B 4M8LA 4F3YA 4K6MA 1X87A 3FBWA 5I7UA 1XBTA 2VYCA 4WZAA 3O8LA 1VL0A 5I9BA 4HBGA 5LQKA 3V8BA 4WVFA 5BOSB 2H4XA 3EMKA 3U40A 2J3KA 1VJDA 3H5AA 2WK1A 1UWKA 3QGMA 2IP2A 3D8TA 3QYAA 3SCZA 4YRKA 1KR2A 1YB6A 4G1VA 5FUVA 1KFKB 5ABPA 1DX6A 3FAKA 1ZHFA 4MMZB 4MYDA 1PUXA 3A2LA 4QM7A 1RQGA 1KHHA 3MWDA 1R88A 1UL1X 1X1RA 1SBNE 1MEJA 3DB1A 4GXRA 4Z0HO 1XWIA 2JJ2A 3EAFA 8AT1A 2FRXA 3IAHA 4KH1A 3UUWA 4RH1A 2NIPA 2I76A 1W1WA 3R5JA 1ADGA 4RESA 4LGCA 4M8SA 2X2EA 2AKEA 1VPVA 3PR2B 3HJGA 3OPXA 3SIPA 3ZVMA 2NXEA 1PJ2A 2IUEA 4RHFA 1QO0D 2PLWA 1MHTA 1J42A 2FSPA 3I1YA 3UK6A 1EFLA 4AUEA 1XZQA 4LS3A 2RHWA 2YJ5A 4OJKA 3SIRA 4Z4HA 3HVUA 3FVVA 1CUEA 4GI7A 2OZVA 3GT3A 2C92A 1V5GA 2D54A 3LP8A 2OUIA 4WLNA 1QJ4A 4Q4CA 1VG0B 2IS6A 4UU0A 1N36B 4DQDA 5DCYA 5EZ5A 1N78A 3MMSA 3TXXA 1J0XO 4MVJA 3WOVA 1JLHA 1WSWA 3PDJA 4YROA 5DMHA 3KJEA 3G7UA 1GPH1 4YAGA 5C7OO 5FEUA 5IFKA 1SULA 2ZU0C 3AXSA 1PTKA 2YVKA 2FPSA 2I9PA 3PC8C 4QYIA 1QQAA 4F1KA 4G09A 4DDKA 1I4DD 4YBRA 4AFNA 3OE7D 2M32A 1US8A 1V2GA 4KVGA 4A2CA 4YR7A 4XGIA 4EQZA 3OA2A 3VR6D 3Q7TA 2H1HA 3TM5A 3HNPA 1QB8A 4MA5A 3TE7A 1FBTA 1E6UA 2HLDD 4GOND 3UT5B 1D2RA 3A1TA 4DLWA 1OTHA 1Z3IX 3K6RA 4EP1A 4TN5A 3OT4A 4EHDA 3I2KA 3TPFA 4UXIA 3UAWA 2QRKA 3B9RA 4C04A 3WV5A 1L9XA 1KEUA 2AG1A 2Q5JA 1DX9A 2O5VA 5A62A 5K5EA 2HQRA 1IJBA 1VRVA 1X7HA 2J3JA 2WI8A 3FNRA 1OIVA 4RY9A 4D45A 1ZJ6A 2HRBA 1KYZA 1Z2AA 1DKMA 2NYAA 3NBXX 4HZUB 3RVMA 5BUZA 3LTNC 1YJAA 1XROA 4EYGA 1SB8A 1KJQA 3NDBB 2NZ2A 2I2FA 3HXKA 4FTWA 4M38A 4ND8A 4E1AA 5ITZA 1PX0A 1DP4A 2VBFA 3OX2A 1OZHA 5CNKA 3OF5A 1I1NA 3WGVA 4ENUA 5KKNB 1N1MA 2PZKA 3LXRA 3BMCA 2QUBA 1DXYA 3HDHA 5AKLA 3U3DA 2B83A 5DTMA 3BQ9A 4FEYA 1U2RA 3KM0A 4IFTA 4GIBA 1FFWA 1Q0LA 3LQRA 4G8JA 3CVOA 3NWOA 2A78A 5CHYA 3ZK7A 1BVHA 2WG2A 1F12A 2PL9A 3EQ7A 3F74A 4P86A 3ROQA 1FDRA 4YRMA 3IV6A 1QYIA 3JQBC 2XT0A 4EY6A 5BYAA 5B6PA 2NUBA 4K9NA 1E2QA 4DRYA 2NXJA 1ZEJA 5FWAA 3NHWA 4PN7A 2BGKA 1UPUA 3OT1B 4IVPA 2CSUA 5DGTA 2DCUA 5F52A 4X0EA 4A3SA 3FTNA 2CLKB 4QGSA 4ZEWA 3AEKB 4QPNA 4GRDA 2VSFA 4OJNA 4JB2A 4FNAA 2MYUA 1YS4A 1PJRA 5KUTA 2R5NA 2GSWA 1U6KA 3ETGA 1YCDA 4YPVA 1ATZA 4P7FA 1C30B 2VHYA 2VZ8A 1N2CA 1HQKA 3KWFA 1JIIA 2D0IA 4F0JA 2XCTB 1YOVB 1L5HA 4A0SA 4F4IA 3TGWA 3RS7A 3SDSA 4F85A 1CUAA 3WY9A 2DT5A 4LY9A 4O4IF 2VJKA 4G5SA 1O08A 4CQMD 1N34B 4ANFA 4HWRA 3SXJA 2EHJA 2F1OA 3GFSA 3F3MA 1XMXA 2HCTA 2FA9A 1ZVQA 2OBXA 3K3PA 5KX5B 5DN9A 1RI2A 3HN2A 2Q45A 3HA5A 4PX9A 4IOJA 4TUYF 2RHTA 3BCUA 2EWWA 2WVAA 1W47A 3NBQA 2J3IA 1Q2XA 1OLSB 1ZN2A 3DPIA 3K09C 3T9BA 1LVHA 3LYLA 4K9DA 1E3MA 4R1LA 1FTGA 3K1AB 5FV4A 4FMBB 1FMJA 2YW9A 3WJAA 3ENVA 1KRHA 2TS1A 2PQMA 3DLTA 1XFAA 1PI3A 1E9AA 4MUNA 3U3OA 4B6JA 2Q6KA 1XA4A 4TN1A 1JTFA 3TH5A 4CM6A 3CH7A 4GNKA 5LDDC 1USVA 2ZQZA 3SZGA 4L4SA 5ALNA 4C6TA 5THKA 3ZWOA 1QLWA 4AZWA 2JCYA 1K5DA 5HR5A 1ESMA 4X6LA 1ENPA 1TVMA 2FSVA 2KS6A 2Q5FA 1F6WA 5DT2A 2C00A 3ZI7A 3LWBA 1CVLA 4KMRA 1VFPA 1UDRA 3H2JA 2OO5A 3Q98A 3TK1A 2IYFA 1PYGA 4FFOA 1KKUA 3PKJA 2DSTA 2INGX 2BE9A 1YR8A 3EOAI 4YXWD 3RUEA 3Q12A 2C4TA 3BK7A 3ZX5A 3TQQA 1XZBA 1LX7A 1C3JA 4Y0VA 5LQMA 4IDNA 1GG9A 1PG5A 3KWMA 3OPVA 4H7EA 2XKKA 3TMAA 2VDWA 3OZBA 2EAUA 2Q1TA 4YRNA 1R3DA 4FC7A 3FDZB 3AJEA 1P39A 2OP0A 3ICCA 3RUPA 3KQNA 2IS1A 4LSZA 3R5SA 4C0HA 4JAVC 4FYJA 1JG2A 1JDJA 1RTTA 5KOJB 2BMVA 4EGAA 4G5QA 4GSYA 3E7XA 3NIDB 4G1EB 4R1PA 3JQAA 2J3HA 2AOUA 1QDEA 2IYXA 2K6GA 1XP5A 2EERA 3LDFA 1BX3A 4KWCA 3SZMA 3I0MA 3CPHA 1ZD5A 4J4HA 1ZI8A 2PU5A 3H86A 4QPDA 5G40A 3VYUB 3ZU4A 3HU5A 3ZKWB 3PC8A 3TZKA 1QHSA 2ZG6A 4OQFA 4Q01A 2KX7A 4V38A 4CZ2A 1IK4A 1IOWA 3ZBTA 1G21A 3CWZA 3C4QA 1G2QA 1FJGB 3EZFA 4MPRA 4N54A 5TQ2B 3STTA 1TM2A 1ORDA 4PV7A 3UZUA 3ULKA 3QEJA 4N7BA 1FNDA 3TN7A 2YBEA 4Q4AA 1QYRA 1N2EA 5AW3A 5IEBA 4JHXA 3KKNA 1LBHA 4M87A 1W52X 4XM2A 4A8JB 1WB6A 3F5FA 1QIIA 2B30A 3NTVA 4YJ3B 4Y6OA 2PUWA 4WPGA 1REQA 2BONA 2O2GA 2VQ3A 1SZCA 4MQEA 4KB5A 4AJEA 3T7JA 3E1GA 4N0PA 4P4LA 3BGVA 3K0FA 3QELA 1KZ6A 5EKSA 4A73A 3R3WA 1PFGA 1OH5A 1KDPA 3V8EA 3CBGA 1WXHA 3JZIA 3FH0A 2BDUA 1ATIA 3E5MA 1VPLA 5A3VA 2QI9C 2N3ZA 3W3AA 1ULZA 4TMFA 1TECE 4C76A 4ZYYA 3WRYA 1VKHA 2VI5A 4IWXA 4II3A 1E3WA 5CDFE 4K0RA 1GGVA 3QIAA 1PJTA 1S2NA 3HZOA 4U2EA 4TV8B 4ENQA 3LVBA 5HF8A 4J0IA 4DR7B 1ADYA 2YNMC 1NIJA 2X0DA 4CU5A 1DV1A 3N2LA 3COPA 2JIZD 5ESDA 4GZ3A 5A9RA 4MO2A 5C34B 2EC5A 1PWZA 2GNAA 1KJYA 2AJDA 5AVXA 2RGAA 2OAQ1 5LQRA 1FQOA 1JZTA 1MU0A 2I3ZA 1EG2A 3TI9A 3IQHX 3K9FC 3S70A 3DFFA 5J4VA 3JQBA 2QRHA 4DSNA 1JDUA 3M9WA 3PITA 2ISCA 4OP3A 3RS0A 2UUBB 4CEHB 2OWEA 4HNHA 4UU7A 4JSYA 1LLFA 3LIPA 4TMWA 3WSWA 4PLZA 3L6BA 3N7AA 5E8JA 3VUFA 2UXDB 2EBUA 2X1VA 4B83A 5CCBA 2WU4A 3M6MD 5GPBA 1NAIA 3A6LA 3LS2A 3OOSA 4CMHA 5B12A 1S02A 5FUYA 6REQB 1HL3A 2HK9A 2DH5A 3FPGA 4LHWA 2HFKA 4JH0A 4M8KA 4IAOA 4CU2A 2HEGA 1SBTA 3TR6A 3WLTA 3BWCA 1L5KA 4AG5A 5KOHB 3ZIDA 1L7EA 1LDMA 2FHSA 4MUBA 4ENRA 1Z0AA 1KI7A 4IOKA 3IIKA 1JU3A 5CEJA 1DKLA 2FZCA 3E03A 1G42A 1G6OA 4LOLA 2IUSA 4BFXA 2DBVO 4QXAA 2XVMA 4J90A 5KTYA 1XRMA 1KK3A 3EEOA 1C2TA 1I4WA 4B85A 1SKUA 4D02A 1TU0A 3KFXA 5BV1A 1WNFA 4TVOA 2YN0A 1AK1A 2ZRDA 3PGA1 1FS4A 4HTFA 4QBKA 3SG0A 1W581 2RHLA 3QXGA 4JBNA 2IYQA 1E2IA 2GJ9A 3OICA 1THMA 1PE0A 4LRUA 2WM9B 3NTUA 4U7JA 3EPHA 2BLLA 1ZOLA 3K09A 1PD1A 1U7OA 4RWZA 3UAVA 5JU6A 4JYAB 2ZUTA 3QOWA 2C42A 5FBHA 3NMUF 1G5PA 1ONBA 3WAGA 2D0DA 1C0EA 2R7MA 5DXAA 3J80A 2C4VA 1JAHA 1GPKA 1AC5A 1NY5A 1GNPA 1A9SA 4QD3A 3ZE0B 1J0BA 1G55A 1C1YA 1EDDA 5DLEA 1R6DA 2JIRA 1Z17A 2ADMA 1SQ5A 4YA6A 2GNPA 1E6KA 3RU3A 2QNBA 1Y80A 4AP9A 4XWOA 5FWYA 4GLBA 2ODWA 4C5AA 5HIAA 3LKZA 5EEHA 3PJRA 1XVUA 3JR7A 4C4XA 1RXUA 4LTNA 1FXSA 4QT0A 1RCTE 2NQ8A 1OI2A 2EGHA 2X9VA 3CG4A 2YFYA 4MI1A 4MGIR 1NVAA 1Q0ZA 1P17A 1X1AA 1JJVA 3GG9A 3Q7SA 5B58T 5BYKA 1AA9A 1R6TA 4DNPA 3GJ4A 4OA8A 2UZAA 5GM2A 2R6R1 2FJPA 5T4EA 4CFSA 3OX1A 1GSAA 3EZXA 2QQ0A 1RRMA 2RGDA 2ZIFA 1P62B 3NP7A 4MR8B 3PFWO 4FI3C 5JEEA 1VMEA 4NYMQ 1OVGA 4YRSA 3HDYA 1XTUA 4FX5A 2X19A 2P2LA 4FFVA 1DEAA 4GKVA 3P2MA 4OATA 5FOXA 3RYCA 4BLPA 2FK7A 3LBIA 4OG2A 4V0RA 5EWMA 2ZIUB 1G5TA 2WV7A 2X5NA 3HPRA 2OC4A 4JKYA 2YC2C 1K97A 4UNIA 4Q7MB 2ZB2A 4CGZA 3BKXA 4GBJA 3QLUC 3M4YA 4HAZA 3Q2IA 1U8YA 1WTCA 1YJQA 4KG7A 4KKXB 4W6ZA 3C5WP 3X44A 4X7RA 3PYLA 3V7YA 4IDEA 4X66B 1QG6A 1F2DA 1Z8FA 1WOMA 2JI4A 2UYOA 4EW2A 2Q3EA 1R4MB 1OKKA 3GK3A 4PPFA 5P8WA 3PVSA 4YRCA 5EUQB 3NU1A 1IWBB 3RYFA 1NOJA 2WF8A 3JYOA 4XFKA 3SC2A 2RB4A 3H8JA 3VVMA 1GZ4A 2OLEA 3CB4A 3PC3A 4CKYA 3ZCVA 4YLYA 2G07A 3O90A 4YGXB 2WPDA 4G0MA 1Y48E 4EG4A 1YWGO 5I51A 3OEWA 4FNOA 1AQNA 1JB1A 1YZTA 2B36A 4LDAA 2G9QA 2LUOA 4TZ0A 3L49A 2RGEA 4K2AA 5AM3A 3AEQB 5IF3A 2HYIC 4EVQA 3ZDXB 4M1EA 3OZWA 5LMNB 4H17A 5J59A 3L7NA 2NO9A 1P4JA 4RDXA 4XM0A 4OI0A 2IGTA 3GWGA 5I7RA 1JSZA 2PUJA 4ER5A 3TD9A 3R09A 3KD3A 1R8YA 2B8NA 2GPSA 4HWKA 4ZQFA 3LUAA 3QVMA 5JADA 3OIWA 1TO2E 1YDHA 3EIFA 1E6EA 2GARA 2VK8A 3IOYA 4LQCA 5REQA 1YDFA 3O1HB 3R44A 3RVKA 5CB4F 5A0VA 3NOVA 1BJTA 2ECKA 1DVRA 1VLVA 2ZPAA 3M3HA 4HUJA 1LS1A 4MVJM 4CIAA 3CH4B 5JNTA 2ETXA 4XE5A 1Z63A 1SMKA 4CDRA 3CIOA 3MMNA 3LGXA 2PIAA 2YNMA 3WYBA 3A0RB 3IAEA 1JEAA 3EULA 3O3OB 4GXQA 4E51A 1AHNA 3W8RA 3W2TA 2X0FA 4AKHA 1ISMA 3UAGA 5IVKA 2JARA 5IHXA 4LBWA 4W5TA 3L0PA 5FEMA 4H0CA 1KE2A 3MBKA 4CTJA 3RSCA 5DHFA 3O03A 3QOYA 5BSMA 2QSZA 1W5BA 3LZ6A 3BVPA 4E70A 3PRHA 3ZE7A 4M76B 1GZ7A 1AUPA 3E53A 5DX8A 1JHOA 2OFPA 3FNQA 2XBMA 4PZCA 3D8HA 1IUKA 4AI6A 1B26A 4NBNA 2VP6A 9ATCA 2YWFA 2ZDQA 4HLCA 1DO0A 5HFAA 2J8ZA 3AHHA 1WMEA 3GR6A 3LY9A 5EMJA 4IMJB 2CLEB 3LBYA 1OX5A 1F8XA 2BR3A 1ISIA 3ZCUA 4PLFA 3PVZA 1AKRA 1ODTC 2JFOA 3TLZA 5JBNA 5CH3A 1K8ZB 2HA0A 3H0EA 1M0EA 4UNRA 4D25A 4TTVA 5MHTA 2QL7A 1C7FA 2D7CA 3GFGA 3RSZA 1FX0A 1SBIA 2HHJA 2JCBA 4YT8A 3GCWA 4W9NC 4RK5A 3FCCA 1G2IA 1P7VA 4Y1EA 5E2IA 5CDFA 2BR4A 4LX8A 1FMTA 1DAHA 1QS0B 4DADA 3CZCA 2NUTB 3B9PA 3OZAA 3WNVA 4GOOD 1T2VA 1CXZA 2ZRBA 2ZS7A 3CEPB 4MK4A 2HW8A 2CLIB 2J4CA 3CLUC 3N0VA 4RD2A 3HACA 2A5FA 3HY4A 1O6ZA 3ABOB 1WAMA 1Z6ZA 3KHSA 4RF2A 4F06A 1E1RD 1N7HA 1PQWA 1TVCA 3H0KA 4PRKA 4RA9B 1AF4A 2GDZA 5CVDA 4DLPA 4MKHA 1JXAA 3P2OA 1SGWA 1N6NA 2D13A 4XR4A 5AW0A 4JB0A 1DARA 5D3QA 2BHLA 3OTHA 1D2CA 3DHYA 1U7UA 3WMWA 4WFJA 4KXYA 4WK4B 1E6LA 3OIDA 1IL0A 1DUVG 4R3WA 2CY0A 4RSGA 1JMVA 1OU4A 3C1TA 2Z4TA 5JNWA 1ULAA 4ZT4A 4BVEA 3X1ZA 4UUPA 1TQHA 2H2DA 2K7FA 2C31A 4CEIA 1VM6A 4FE7A 1JJAA 5KYYB 3O95A 2Z9BA 1EJ0A 5AMXA 3BH6A 4LYAA 3ZDAA 3HU3A 1GNSA 2JKYA 4IY1A 1MKYA 3K0AB 4BGDA 3AR3A 4LSGA 4OQ4A 1E94E 2AFIA 2QYHA 4C2BA 1T36B 1P1FA 1CY4A 3FSJX 3RG8A 3I5XA 1TGYA 3QBTA 1WP9A 4L57A 2EW2A 2FSFA 3VR0A 3JQQA 5EQDA 2XNJA 3T4UA 1KK0A 1UWCA 1GSHA 3UEOA 5BR7A 3BQMB 4NJMB 1QNLA 2A57A 1GXSB 2RJ3A 3R9IA 2QM0A 3DMYA 2WA1A 1RW4A 2FPGB 3FYTA 2WM2A 1IZ8A 4DVGA 3ZPXA 2N42A 3QLUA 2PL1A 1QHIA 3ZE1B 2GI4A 4XX0A 2Y6UA 2GLTA 3NEAA 1ABEA 3WL6A 2FEXA 2OCLA 2CDRA 5J4KA 3UQZA 2NTYC 4YP5A 4WSOA 4R16A 3O4JA 3IBYA 3ILXA 3WAKA 3MWEB 3P71T 3PGMA 3I58A 3AB8A 1G64A 5JRJA 2XBUA 3KZNA 2V7EA 2RSLA 1PVOA 5KKAA 5J2UB 2R7AA 1FMCA 1Z0ZA 2XVXA 4PCAA 1GT91 1ZOIA 3PFNA 3T1HB 1EXDA 4G0VA 4PHHA 2MT9A 4LZWA 3ZDDA 2AI3A 1XKQA 2KYRA 3EIHA 3GH1A 3OHSX 4FKZA 1V5IA 3FIUA 5HJ7A 3AFHA 1ID8A 1KGDA 2IDKA 3D8NA 1CUJA 3G68A 1AUQA 4JJFA 3E23A 4DLXA 2HA4A 1RKQA 4EVIA 2AT1A 2H4ZA 4JLDA 1SPXA 3KEQA 3X3HA 4PY2A 3U80A 4JOCA 1MQAA 2IA5A 2OT3B 2PKXA 4NABA 3GLGB 3AUSA 4A7PA 2ZW9A 1EE9A 1H9AA 3IJPA 2O2DA 3D6JA 4ZV7A 3PUJA 3TRFA 2QJFA 4BEVA 2BH2A 1ZMXA 4CT4B 4RD3A 2ZUFA 5IZCC 1ADCA 4KDFA 1Z0IA 5C5CA 3CB2A 2H8GA 3ND7A 3PT9A 4ZANA 5I7OA 5G02A 3R7BA 5I8WA 3OE5A 1FRZA 1W88B 2W98A 2XUDA 1N75A 3GH3A 1QTRA 4Z9YA 3S8YA 5CVTA 2WABA 3GRKA 3W78A 1SKYE 4IDCA 1ZEMA 2N46A 3OI7A 3FPJA 5DP2A 3UCFA 2O7NA 3KYDA 4AUKA 4G2NA 5JANA 2FMIA 5JD4A 1UK6A 4BRUA 3P94A 4MQUA 4OBWA 1QZ3A 4QUGA 3SAJA 3SY8A 3TRDA 4CNQA 1OCEA 4ZJZA 4JIGA 1MVOA 1PUJA 2JJ1D 3HO8A 3JQ7B 2F3RA 3NS7A 4F7WA 1Y33E 1EM8A 1J8DA 4HPXB 4RIHA 4YP0A 5AM5A 1JIQA 5ICGA 2IPMA 4H6PA 1UAGA 1L5NA 1W5EA 4CM4A 3FX2A 3EJ6A 4BGUA 1Q22A 3UWMA 2BDEA 1QRTA 3E3LA 1JV2B 4RFSB 3NHZA 1LDBA 2ZAYA 3FVTA 5FUQA 3ZDEA 1VHWA 3HGMA 2YASA 4KGXA 3K2EA 3D3KA 3OLXA 1DKQA 4BKUA 2JD0A 4YJHA 3RDPA 5IUJC 4PGAA 3E3MA 1UDBA 2HU2A 3LHIA 4GSLA 2YV1A 3R7WA 1WPXA 2C94A 2QUZA 2VZ0A 5I5EA 2G4CA 3V00A 1Z6TA 2BIFA 1V11A 4PX3A 3GDFA 1CF2O 3IA2A 3HCEA 4WINA 3REQA 2O07A 2IP4A 2H1VA 2Y05A 3OLZA 4DG5A 3E9CA 1Z5VA 1N5IA 3VR5D 4KPFC 2FEAA 3QKIA 1Y9ZA 1XPJA 2E3JA 2H7YA 3E8MA 3H4VA 4KIJA 1VE5A 4LNHA 4O4LB 2I6QA 3HY6A 4I9UA 4OK3A 3BEOA 3TW8A 5TT1A 2XMBA 1Z39A 1JA0A 1QCYA 4B33A 2CXXA 5HOQA 3OOJA 1A8PA 4W9NA 4GBMA 2PX4A 4P0TA 3Q8MA 1SXQA 2IUFA 2CMKA 2YS6A 4G4JA 3V1UA 1TTTA 5EIOA 3KQWA 1R7RA 1ZZEA 4X92A 2GFIA 1E7WA 1U4NA 1TJ4A 1CYDA 3JQPA 3H6KA 1BC5A 2CFRA 2VT2A 2F8LA 1LDYA 3HEMA 2XADA 2WSYB 1KAQA 2Z2YA 1YB4A 4CG1A 3PUXA 4US2R 2PFSA 1NBOA 4EYOA 3VO2A 2RAVA 1XCBA 3RVJA 3IUEA 4GZMA 1J8VA 1FDWA 4B0OA 1Z74A 1UBMS 3K94A 1T0UA 3A9SA 5EGSA 3C3DA 1GILA 5JD3A 4UM9D 3LFUA 1Z5UA 1IQ0A 4AP5A 1WY7A 3L5KA 3Q3IA 2PA0A 2Y0DA 3GW8A 3U7IA 4FNMA 4I66A 2X8BA 1ZH0A 2Q3JA 1VZ3A 3LFHA 1I6MA 5D1NA 2YY7A 2ZIGA 3WYCA 2WNHA 4WBNA 2JLZA 4GPBA 1EESA 2X23A 5LFAA 1DLIA 2P2YA 2Q1XA 2XIJA 3H1GA 3VZRA 3W6PA 3O8OA 3W1EA 2HJ9A 1TT5B 4F11A 1XVLA 2DFLA 4N18A 1CLEA 4UQOA 4AYXA 1VSUA 5K0BA 1U1DA 1EWRA 1OYYA 2VXCA 3TLAA 4M1QA 4BNHA 4MTLA 4RMIA 1EWVA 4KZPA 1P5ZB 3EZ9A 4I55B 1BKYA 5HVNA 4XPIB 3VNBA 4ZODA 4DC9A 2DY0A 2JJQA 4NDAA 4KO4S 1RLMA 4F5EA 5HZHA 3LOPA 5K6AC 3QKRB 4KP7A 1BA2A 1DQZA 1WZNA 2CDCA 1CZNA 1SCNE 2BGRA 3EAQA 4UOEA 4HLNA 3VYWA 3GRYA 2R48A 1V3VA 3E9QA 2BYTA 4H7FA 3QMMA 4PNEA 5B3JA 1ILEA 4RTNA 3C97A 1EQUA 3CE6A 3KG2A 5GJWC 2GAOA 5JDIA 1W44A 1Y5MA 2X15A 4FGKA 4Q00A 3D6NB 1HDYA 1Y4DE 3DZDA 4Q03A 1GUFA 2Z5FA 4LHVA 5D7BA 3VGPA 3WR5A 4KREA 2W2PA 4TSFA 5BRJA 3DGEC 3EFOB 3GGPA 1XTSA 4F9EA 5JECA 5DSZA 3G2IA 4P5EA 2R8ZA 1SCAA 1CR6A 2I6SA 1NNUA 1GRVA 2BFBA 2ORIA 1V1MA 2ZRMA 3G23A 3FGZA 3MVEA 2A9KA 4H1VA 3ZTWA 5B4TA 3KQHA 2L17A 1ELOA 2HJRA 4PIMA 4DR4B 2JAWA 3ZGLA 4TLBA 1W19A 1JHUA 4IXMA 5EJ8A 1EUCA 3AF4A 4OKNA 2O1SA 2BM0A 1SKBA 3C8MA 2AN9A 1HMPA 3EXIA 1X1CA 3IPLA 3RSQA 2JJ2D 4DLUA 2NTNA 2ZI6A 4R1UA 1BCRA 2AXNA 5LUBA 5IJ0A 3EX7C 2Y9MB 4DC1A 1YQXA 3OT5A 5JNVA 3VSBA 2C2ZA 5BSKA 1XJWA 2Q62A 2VTKA 2VWQA 1O57A 2VSQA 1D4ZA 4O33A 5F1KA 2JVIA 4ZAWA 4IYRA 2OGWA 1IN8A 3WA6A 3U62A 3RYIB 3F6RA 1Q6ZA 3Q0IA 3QUBA 3FKSA 4NK5A 4PYLA 5F9MA 4CHTA 5JXGA 3MYRA 1KDVA 1M2WA 4JC5A 3AHDA 4ISBA 4C89A 4ZZIA 3OP1A 1UC9A 2DG2A 1LF0A 2P7HA 4NBKA 3OJOA 2B7CA 4FHZA 1QK4A 2IYEA 3CRZA 1ZU5A 3LO5A 4Q05A 4FYPA 4IDDA 3KXIA 5CDUA 3Q8WA 4MVJD 3HEAA 3SIWA 3JPWA 2BLNA 5HEKA 1QZUA 1R12A 3I32A 3QG5A 4HNGA 1NQ5A 2O3RA 4XXHA 1G3UA 4DCUA 4DCMA 1G5QA 1R0KA 4MAMA 2P3QA 4CG2A 4EATA 8LDHA 4W8GA 4F4CA 1I7QB 9LDTA 4HAIA 1I3LA 4OLHA 1NVBA 4E2ZA 4G01B 4U8GA 4UHDA 3L77A 4WLOA 3AUXA 2QRNA 3E05A 4RQBA 2CHVA 3R9XB 2PMKA 2QK4A 1WG8A 1Y8QA 2F6RA 4G9EA 4LQLA 3T1VA 3L6UA 3MB8A 4RK7A 4UE2A 2R84A 3UT0A 1WCV1 3TD6A 2Q3MA 1JDNA 1E2LA 3H9EO 4FFRA 2E37A 5AXCA 1BAPA 1Z5WA 2AG8A 2RGCA 2PV0A 1KU0A 3FWYA 3GEGA 3KTAA 4GXNA 4KOAA 1GNTA 4GR5A 2DKOA 4PWZA 1DRJA 1UJ5A 1W75A 3FMFA 3GCGA 2DETA 3MTJA 3RHZA 4AJ2A 4TT8A 3B2EA 4IKEA 4WRRA 1FSSA 3LWZA 1QGED 4PHGA 2EFGA 4YXFA 2QBYB 4R5MA 3TLCA 3N53A 5LKRA 4CCAA 4EG8A 5LWHA 2VHXA 2GKOA 4AO6A 4DQ0A 3CZQA 1X80B 4Y6SA 4DQLA 4EKDA 5L95A 1RRKA 2AQ8A 1KSFX 1J07A 2H0QA 1SEPA 3HZRA 3FFTA 4D41A 5JISA 1W4ZA 4A1OA 3PFCA 3ZHUA 3QY9A 1QVAA 5EXDA 3UMJA 5HNKA 4QREA 2CXQA 1TQ2A 2EBWA 4PYNA 1LRJA 2C2GA 4HS4A 2Q1YA 3CLHA 4JEHA 1YT5A 3WK5A 1YQGA 3UK0A 3AUAA 5ALPA 4IRXA 4RYDA 3I9V6 2R1UA 4JVNA 4KSCA 3EZLA 2P41A 5KBYA 3AEZA 4O4HB 3U4QA 4RA6B 4GO1A 4Y18A 5LQCA 1LNQA 1QGAA 4RJKA 5KJFA 4JR0A 5TPZA 3HKEA 3Q41A 2JEOA 5E7IA 1X74A 1WLSA 2Q5QA 4GOLD 1E9CA 3AZOA 4M8NE 3VTZA 4DJEC 2A9FA 1FUEA 2HN9A 1L7OA 2Y92A 4M46A 5EKTA 5ITVA 3EDRA 5DEOA 4ZQEA 2YR0A 2Q5IA 3THSA 1XYYA 2M6LA 4KVAA 1YNOA 5ITSA 1G38A 4Q0MA 4ITRC 4ZK2A 3DVSX 4KQGA 4N47A 1UKBA 2GCNA 3D6HA 3ESDA 4KXLA 4D8UA 2XGGA 4D9CA 2HZ7A 3K4HA 4ZAGA 3ZQ4A 5J5CA 4ZHQF 2WFAA 1YR9A 1GQFA 1RM0A 4YRJA 3TI7A 3VDXA 5JUWA 2E4XA 2B4RO 1I7NA 1NKTA 2VRNA 1B1CA 3Q5EA 4M49A 1DCKA 2FOXA 2IPAB 1CY1A 1FRVA 1UBEA 1WKBA 2V0CA 3CV3A 2HPVA 3QFCA 2EJVA 4UNPA 4PN3A 3PJGA 2HC9A 3PGLA 3VKHA 4QPPA 3JARB 3A14A 4NAVA 1PT8A 2GPJA 3QW2A 4HYQA 2SCUB 4UZEA 1E0SA 5HFNA 3NWEA 5G53C 5K6AA 1WIWA 2XVAA 5CXSA 1X86B 2WAXA 4LYDA 1N25A 3K2QA 3OA0A 4LJLA 4ZV9A 3HJBA 2R4UA 3LLVA 3PI7A 3DLAA 4CKWB 3U56A 4AZ0B 4G0QA 4RV5A 5M04A 1IHDA 2V03A 4AY3A 1ABFA 1JMKC 2KLHA 1PNQA 4L78A 2RJNA 2WIBA 3NGXA 4P38A 4JLVA 1LQ2A 4ND6A 5T4HA 4EY3A 5CD9A 4DREA 5DNCA 1ZN7A 3N76A 4JB3A 4B71A 4OHFA 3WOHA 5A02A 4D26A 3WLRA 4RMGA 4RTPA 2VLBA 4EABA 4O4IA 3IJEB 2Y0PA 3IE1A 1H4SA 1G20B 1W8IA 4Q48A 1Q17A 3I42A 4DM3A 3FHOA 3C6XA 2Q46A 3TCXB 3WMXA 1OXUA 2Q28A 2IYRA 2RKBA 1QP4A 3DPUA 3PE4A 2QVZX 2ZPTX 2FY8A 2P9JA 2JNWA 4TUYA 4MIKA 5E6UA 4A27A 4UDYX 2Y1LA 2ICAA 3H9QA 5J23A 1CUCA 2VCYA 2QU7A 2X4IA 4U2FA 1QQ6A 1LK7A 2QN2A 3AB3A 4RK0A 2C7PA 4RIFA 2JFBA 3PLNA 1E7YA 1LS6A 2EP5A 2OO3A 3THXB 2BFEA 3ESCA 4TV9B 3I9MA 5F3RA 4XWKA 1N57A 2ZCUA 1K98A 4Q5IA 2QG6A 3KJFA 5E6RB 5AI8A 5ALSA 3RWBA 1JQAA 4EYQA 2Q9AA 2ADOA 1C9NA 3IQDB 3WO0A 4BMDA 2EGUA 3BXOA 1N7GA 3MQFA 1K5PA 3IESA 1I4LD 5HCNA 5JFOA 1G7TA 4CQJA 1UBSB 4OAQA 2BGWA 4MB6A 1DO8A 3SEQA 3W5VA 3HCCA 1DUSA 2FG7C 1H6DA 4QHSA 3VR4H 1N7IA 4PFSA 5FO1A 5JOQA 1FP4B 3WGJA 3EIQA 4MDEA 1WZUA 1MA3A 2QLJA 4Y1RB 1RWXA 3F8WA 4BQOA 1ZNXA 2K2QB 1A27A 4RANA 3JQAD 4X45A 3BYZA 4B0PA 4WZ6A 2R62A 5HIJA 3ZEAA 3GAZA 2FTKE 5T6MA 2Z3ZA 4O2AF 4J0HA 2QZJA 3NC4A 3MJHA 5FOTA 3S5JA 3DFMA 1X15A 1XZCA 2XXBA 1DC3A 3BXFA 1AUXA 2OQRA 4I8IA 421PA 1WVGA 3L8CA 5JCZA 4GZLA 2WM8A 3O4VA 2AN1A 2ZJ2A 4B3XA 3FZYA 2AZDA 3AKYA 5EQFA 1YR3A 3LLCA 1GPYA 4L16A 3GNTA 4P2BA 5SZHB 4OGWA 1I30A 2G5GX 2FSHA 3QHAA 4FZ3A 1OBCA 1FYVA 4IS3A 3GF4A 5DDIP 2QGNA 2FUG6 2G1AA 3HZZA 3I8SA 4KPGA 4UTPA 4D3ZA 1FY2A 1GG8A 3DC7A 4HAWA 3GVIA 4P92A 1XD2A 2PLAA 4CIXA 1IZ9A 3ND8A 4PR0A 2BUBA 3R77A 3THWA 1DT5A 3G2NA 5BV7A 1XZJA 1YI1A 1VKNA 4ZZ1A 5A4AA 5LU8A 1KPIA 1U80A 5KJ6A 1NW8A 3JYHA 1R1DA 1FVHA 4HN2A 4RXUA 4EUHA 5CDYA 5HZKA 1TFUA 4JC4A 1EU1A 2Q8PA 3NHPA 1INLA 2Y76A 1MFZA 3AFOA 4YCLA 2NO5A 3W3AD 4OMFG 2WJGA 2JFXA 4MAFA 5CFRA 3VX4A 2F8SA 1WDWB 1JE0A 5I9IA 3BXXA 1G19A 2IVZA 4DWVA 1TPYA 2QUKA 2E4ZA 3LF1A 1MB4A 1CQIA 1UBRS 2EBFX 2P67A 3A8TA 5KWVA 1XE3A 1F48A 1Y37A 3LMKA 4G0XA 2XCSB 5CDSA 1WCXA 3ILVA 4IIBA 2AG5A 4MDYA 3HVRA 5GOTA 2EVWX 3UKJA 2V6GA 1JHYA 3QX3A 1OFUX 3KYJB 1P1IA 5LP6F 1EXWA 3OE1A 3K6KA 1O5TA 1WXFA 3K6SB 1NLFA 4XB6B 3H2HA 3V32A 4CQMB 1EH5A 5BVGA 2ODEA 3QUQA 1ZUNB 4K1XA 5K09A 4I3FA 3MGAA 1IATA 5A2GA 2ANBA 3AG6A 1R64A 4GWLA 1V3QE 5KQSA 5JE8A 1SC6A 2AQKA 2NO0A 2QG4A 2E2WA 3EVAA 3X1WA 4AY4A 2PGDA 1C0PA 2B8WA 3GLHB 4PYQA 4GX1A 4HC4A 4DGQA 3LT1A 3R9KA 4Q3KA 3Q11A 3GVXA 1YNSA 1WKCA 2OL4A 3ZXXA 4WZBB 2GBGA 1TRHA 2CVFA 1L9KA 4CMCA 2YHUA 2X5KO 2EP8A 3GBVA 1EK5A 4FGLA 2DOKA 4TMXA 1OXMA 2A0KA 5B1SA 3LY5A 3P7MA 5IBRA 2WYWA 4AO8A 2A5GA 1MOPA 3DOFA 3IP8A 3JAMA 2OAP1 4DV7B 3ZWWA 3WVNA 2FPKA 2XYGA 4QYSA 4IMRA 4MX8A 2XECA 4I6JA 4TV8F 3TZQA 1IBKB 4NXMB 3ZNOA 2Z1DA 5JI3E 1BFUA 4TXJA 4HH1A 3BA6A 3UJ3X 3VU1A 2FAXA 3W77A 2P5SA 4CQLA 3FYHA 3HBMA 3B5JA 4BFCA 5AI5A 2E1PA 2YJGA 5D7NA 3N28A 3KJQA 1J24A 1QDUA 1EJ6A 4R6WA 2O1XA 5BN1A 1N32B 4A1FA 3W7AA 4A6PA 1JFRA 3A4VA 1B16A 1JMYA 3HI6A 3TIGA 4BKRA 3CLKA 2CCJA 2ZVPX 2VP0A 3EUAA 4H7IA 3PCTA 4C4TA 3FROA 4RH0A 4Z1OA 3ZHRA 4Q7LA 4WA8A 4DPLA 1FSFA 1P1CA 2GVNA 4MB0A 3F71A 5D5QA 4G0YA 3L0BA 1M8GA 2IHUA 2H7VA 3B3JA 3E22B 3FPEA 4K8RB 1Z4QA 2VJAA 3KX2A 4AKTA 5BWNA 1EAMA 4UW9A 4BGIA 3HBJA 1WX1A 2ZE7A 1S0UA 3O1IC 3ME5A 2FOLA 1B6SA 4O4JB 3G3EA 4WKBA 2UU9B 4NV3A 1VB3A 4DHWA 3SN6A 2H7XA 2CL5A 3DV9A 3G17A 4ZV4A 1S2DA 3OQJA 3F2IA 3BWBA 3HP4A 2YOHA 3L4BC 3MSCA 4HYEA 4UARA 5DYYA 2XXJA 4G86A 1YONA 1AX9A 3A58B 2BEUB 3LTEA 2WJVA 1CERA 2HV9A 3ZD8A 1WB5A 1DEXA 4BX2A 2HTEA 1KZ4A 2D1TA 4W5RA 2ZRKA 1TCAA 4OMCA 5LSAA 2BBSA 1TC1A 5GINE 1JEOA 3QPWA 1QFJA 3ZWXA 4BASA 3NUQA 2G5CA 4NL4H 1Y8RB 4CF6A 3PSHA 1ZW6A 1Y8ZA 2X3FA 4KIUA 3PWZA 5EE3A 1MGPA 3VR1A 3QBJA 2J3QA 4KDCA 3NAQA 4RVFA 4I4TF 3T9DA 3KSUA 2IE8A 3TNYA 1LY1A 3KTOA 3GFPA 4GEKA 1F60A 5CJJA 3R6DA 1D1SA 2O8EB 2V7GA 3B3FA 2OKCA 1CUUA 2JRLA 3IJRA 2XNCA 1C7EA 5LKAA 2O8BB 3PC4A 4Q9DA 1EGQA 2ZR8A 4FSXA 4BX3A 4EGJA 2OESA 3QU5A 1E60A 3L8MA 4RLQA 1HYEA 1Z12A 4FT4A 3TQOA 2CMDA 3I52A 4EG1A 2ON6A 3QZUA 5DH9A 4RQAA 1A2BA 1G0NA 4N8DA 4QQRA 4MV4A 3U5TA 1RAFA 2VHZA 5DU2A 2XIQA 3M49A 2J9FB 4ZREA 2Z5GA 4ILEA 5DTIA 1IE3A 4D0RA 5CDTA 1X8JA 1Q0RA 1NG9A 2WPDD 1O8BA 4DLKA 2R85A 5TEVA 2J4FA 4QDKA 3CC8A 3W5CA 3DF9A 1WMSA 1Z83A 3MWFA 5TGTA 1B6TA 5FOUA 3LHDA 5K9ZA 1BS1A 5KWSA 1N6HA 1A5TA 2GMWA 2GF9A 1BDMA 1ZJZA 3GY0A 1NFQA 3Q9NA 2LZ0A 2QRQA 3OLQA 4HQRA 3NHKA 3SFVA 5JAOA 1TQ4A 4OXRA 2QYOA 3KE9A 2GD0A 4QAJA 2YJZA 3X2EA 1TL7C 4AQ7A 2AW5A 1OBFO 2E85A 3FHTA 1C81A 1OT3A 3RANA 3WK8A 2XJ9A 1GOTA 4B1FA 3CQ9A 5U9CA 2HWUA 1UK7A 4C4AA 3UMRA 1L7QA 2Y1WA 1PWHA 1RWOA 2CW5A 4LOJA 3UHPA 3AOEC 4X44A 3OZXA 3WHPA 2O4CA 5K0CA 4M37A 4ZT7A 5DM1A 3J81k 4BKPA 4HT3B 1ES9A 1CRWG 2C8VA 3V9AA 1P7YA 5HBGA 1TIBA 4TWIA 1J97A 3ID6C 1BU8A 4PG7A 1W7AA 4IH9A 4W1SA 1GTSA 4M4SA 4II2A 1S2GA 2ZIXA 2XH8A 1G8PA 2YNMD 5GV8A 2OD7A 4URXR 2B21A 3QYFA 2HAEA 7AT1A 1EXNA 1GPMA 2XE7A 1XZLA 5H68A 5KS2A 1QAMA 2BHRA 4QUDA 5DNUA 1K92A 1ZNZA 3EWIA 3GC6A 4NFLA 2E4UA 1H2ZA 5M29A 4J07A 3LV8A 4FT2A 5AVQA 5CB4A 3CEJA 1S6YA 2NZUG 3OECA 2XA9A 5FA5A 1G5IA 4W8HA 5MN5A 1X19A 4ZGBA 1S01A 4OI1A 2YXLA 5DNYB 2QE6A 2R6AA 4JVLA 4DNQA 3IA7A 4UMEA 3LBNA 1K88A 1V25A 2WTXA 2RD2A 1W4AA 2RH8A 3KLPX 1C14A 3ZCQA 1NXSA 1CDEA 2CNLA 1UBTS 3OF2A 3VSCA 3LCVB 1B1AA 3CRMA 4MKFA 5EUMA 1R6UA 1N0HA 5KZMB 5IBPA 5AYVA 3RD5A 3QKSA 1RIIA 2JVJA 2OPBA 3M33A 2BC9A 2Q8QA 2IQIA 2O9JA 2ZJ4A 4AXXA 5D01A 3TAHA 1T43A 1E2NA 4YMIA 5DHPA 3QPCA 5EHGA 1G41A 2GA9A 2R68A 4JFRA 4UU1A 1JSCA 2BBOA 3EMBA 4HDCA 4O2BB 5CYFA 5DBOA 3WO1A 2J5KA 2H0AA 3QHPA 5COQA 5JVDB 2IF2A 4MPTA 3BCRA 1CX9B 3U39A 1KQ3A 4P33A 2UDPA 1AQ6A 1JFVA 3EB9A 3G5MA 4MDHA 1X7XA 1G17A 2ORYA 2ZYIA 4RCVA 2Q29A 5FBLB 4M6WA 5HIMA 2C5BA 3H83A 4EJSA 4NX2A 1ZJ4A 4MA4A 2CF6A 3ZU3A 5I7SA 1JB9A 5H8WA 4N6NA 1YR7A 5KYWB 4WEQA 4MHOA 5LJIA 4URWR 4MQBA 4TRRA 5KTPA 1WZ2A 5IC5A 1AS2A 1LSUA 3ZW9A 2GUGA 2ZBEA 1J1IA 1XMPA 1T1RA 2KWIA 3HJTA 4FYVA 1NXTA 3W9SA 1FVOA 8ABPA 3JQGA 4DEVA 3C3WA 2VZEA 1N2SA 4U7TB 4XWGA 3AT1A 4E15A 1K0UA 2AH5A 1FYDA 4LWQA 2A3RA 2GAFA 4A2QA 4MIEA 2C0PA 3MJEA 4DAOA 2I65A 1VYHA 1WMFA 2R8EA 3GJXC 5EJGA 5HS6A 1PHRA 2H92A 2ENWA 2WIKA 1GFIA 3FJYA 4LF9B 3UJ6A 3A70A 2IWRA 4J7UA 3ZZ1A 1F2VA 2OAGA 3L4BA 1XQ9A 1YQUA 3LRXA 1E6WA 4YS6A 1LW7A 4OHZA 4DMUB 4RL4A 4CMBA 5C7IO 1DHTA 2V4UA 1HNXB 2RKWA 1PJCA 2RGRA 4C4OA 4F46A 1E3DA 3VC3A 2GVZC 5MGBA 1YJ5A 2NVWA 3GA0A 5IJ9B 1RZRA 4E7PA 3DAHA 4NBWA 4H1WA 2A5YB 1XPRA 3R7LA 3UFXB 4QNRA 5CLLA 5K8IA 4KJXA 2YMQA 3EPPA 4QLAA 5KQPA 1GQ2A 4ZTZB 8MHTA 3FFWA 5ALTA 3EBOA 4RJJA 3V80A 4U9UA 2WWHA 5E0KB 1JYSA 4F71A 1HDIA 4D98A 1AKTA 3ABSB 3VH2A 2ACKA 5C2JB 2YUTA 4IXNA 2FCRA 2QTAA 1GWNA 2CYBA 3HDQA 1CEEA 1ZLXA 4C14A 4BIMA 5A71A 6GPBA 1U81A 2J30A 5JHGB 3MJ4A 1EUDB 2PNFA 4BP1A 4Q3OA 3STUA 4G6ZA 1P2GA 1XQ6A 5G1PA 2XUPA 2ZRJA 2W93A 1BOFA 3ABRB 4CT0A