4LTNA

Crystal structures of nadh:fmn oxidoreductase (emob) - fmn, nadh complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
192
structure length
187
Chain Sequence
b'TYSIVAISGSPSRNSTTAKLAEYALAHVLARSDSQGRHIHVIDLDPKALLRGDLSNAKLKEAVDATCNADGLIVATPIYKASYTGLLKAFLDILPQFALAGKAALPLATGGSPAHVLALDYGLRPVLHSMGVRHVVQSFFMVQSQFSLAVEDDVASQLNNAIDHFRLSLSSEPSTRHLGHPRPSLDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-dependent FMN reductase
publication title Crystal structures of NADH:FMN oxidoreductase (EmoB) at different stages of catalysis.
pubmed doi rcsb
source organism Edta-degrading bacterium bnc1
molecule tags Oxidoreductase
total genus 62
structure length 187
sequence length 192
ec nomenclature ec 1.5.1.42: FMN reductase (NADH).
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ltnA00
1JA1A 2F1OA 4PU0A 2OHJA 2HNAA 4U7FA 4BMOB 3QFRA 2FX2A 2BPOA 1CZLA 3N3AC 4GR9A 1WSWA 2QX9A 5FX2A 1I1OA 1XI2A 1ZX1A 1J9ZA 5F51A 1AKQA 3ESYA 2MOKA 3NHJA 2BN4A 1C7EA 2WC1A 2M6RA 3ES9A 3F90A 2X2PA 3FJOA 3RPEA 3OX2A 4DY4A 5LLDA 1YCGA 4C0WA 2FVXA 1AHNA 6NULA 2Z98A 4QOJA 5BUCA 3W7AA 1SQSA 3TE7A 3HA2A 5F4BA 4FX2A 1CZUA 3KEGA 4YAWA 1FX1A 4YAOA 1GG5A 1RLIA 4QOEA 2D5IA 2Z9BA 3LCMA 3GFSA 3W78A 1QR2A 3FNIA 1OBVA 2MTBA 4NULA 4YALA 4ZVNA 5FA6A 4OXXA 2M6SA 4GQIA 2GSWA 1YDGA 4S24A 2FOXA 1YCFA 4R81A 3K1YA 1VMEA 1CZOA 1YCHA 2X2OA 4J8PA 3F6SA 5TGZA 3NHRA 4GI5A 4Y9RA 4LTMA 1BVYF 1J8QA 3ESXA 5LBUA 1CZHA 2HNBA 3GFQA 2BZSA 3GAMA 3W79A 3LT5A 5LJLA 3OJWA 2A5LA 1XYYA 2V9CA 3OJXA 4LAFA 2XODA 2FLVA 3K20A 1QHEA 4LTDA 2Z9CA 4H2DA 2KQUA 3S2YA 4ICIA 3NFRA 4FGKA 4U7GA 1CZKA 1QBGA 3HR4A 4Y9UA 3OX1A 2Q9UA 3W77A 4N82A 3L9WA 4NLLA 1KBOA 1H66A 3KAQA 3OX3A 1C7FA 2QMYA 3B6KA 1H69A 1D03A 1AZLA 1F4PA 5F12A 3NHFA 3FVWA 1WSBA 2QX8A 1B1CA 5NLLA 1DXQA 3B6IA 1RCFA 4YAFA 1FLAA 4U7HA 5B3LA 3GFRA 4PTZA 1DX9A 5LJIA 4M0CA 5NULA 3U7IA 4PTYA 4ZVMA 3NHUA 3QE2A 2HPVA 1D04A 3L9XA 2ARKA 3ZHOA 1OFVA 3NLLA 5LVAA 3O2NA 2MWMA 4QOIA 4YQEA 4DIKA 3JSXA 5EMNA 2XOEA 3FW1A 1KBQA 1J9EA 2MT9A 2R96A 3NHWA 4N9QA 2QWXA 1AKVA 1AG9A 4F8YA 1X77A 2BF4A 1NNI1 2QR2A 4XDGA 3OWHA 1E5DA 2Q62A 1OBOA 4C14A 1YKGA 2OHHA 4ZVKA 3KAPA 5EAIA 5EA2A 4Y7CA 3NHSA 4YAUA 1CZNA 1AKRA 3B6JA 2QX6A 3HLYA 3OVMA 1J9GA 5LMCA 4C76A 1JA0A 5ULLA 2FZVA 1FLNA 4D02A 1SG0A 3R6WA 3EDOA 2BMVA 4LA4A 5FUQA 2OHIA 5A4KA 3UXHA 3N39C 2W5UA 2Z9DA 4HEQA 4H6PA 1FVXA 3TEMA 2R97A 3B6MA 3G5MA 3O73A 1CZRA 2FCRA 3NHLA 4LTNA 1QRDA 3QFCA 2OYSA 1XT6A 5B3KA 3NHYA 1DXOA 4FGJA 4ESEA 4BMPB 1RLJA 2V5UA 1AKTA 3KLBA 5JROA 3P0RA 1AMOA 2B3DA 1ZWLA 3OWXA 2KLBA 1TLLA 3N3BC 2N1MA 4XDHA 2ZKIA 4QOFA 4C0XA 4CF6A 2FZ5A 1ZWKA 4HS4A 4QODA 3FX2A 1AKWA 1BU5A 1YOBA 3TZBA 2V5VA 1T0IA 2QMZA 2RG1A 1AKUA 3F2VA 1XYVA 3ESZA 1FLDA 5LBTA 3NHKA 4ZVLA 4QOGA 1RTTA 3U7RA 1D4AA 1V4BA 1FUEA 2FDXA 1FLVA 3NHPA 1T5BA 1YRHA 2QX4A 1FTGA 3F6RA 2FAXA 4N65A 4QOHA 4DILA 2AMJA 4FGLA 3UXEA 3D7NA 4CETA 1TIKA 3EYWA 3SVLA
chains in the Genus database with same CATH superfamily
4OBWA 1OJLA 1S01A 2OV1A 4PU0A 3JPWA 4BNLA 4J0KA 4BQFA 4MWTA 4ARZA 5JAIA 3UK6A 3B5JA 2VHXA 5HCUA 3AUTA 1QE5A 1PSWA 3KJEA 3PD1A 4CF5A 1WTCA 2XUJA 3TX6A 3OZFA 4IICA 4TSFA 4B6PA 3VZCA 2M98A 2VYVA 2QTMA 3JARA 1JV2B 4M1WA 2J3EA 4UQOA 3M5PA 3RWOA 4B6RA 1Q83A 2QTGA 3CX8A 3UKJA 2WTEA 4AG3A 2ZSDA 1MJGM 4QQ8A 4RIGA 3GT0A 3TW4A 1L5MA 1M0TA 2P75A 4RTJA 3MJDA 1E0SA 3RVSA 1DKOA 1VDZA 4UTPA 3D7MA 4JYAB 4RACA 5TMDA 3X1KA 1ES9A 1VSBA 2QX9A 2UKDA 1CRZA 1M6WA 2A9FA 3EGDA 3TOSA 1T0JB 3IDAA 4WRRA 1ZX1A 3DZGA 3FWKA 3HKEA 5DYGA 3STWA 3ICWA 3MJHA 1AO0A 2ENWA 2HU5A 2UYQA 4N7BA 3CLUC 1W36C 5TSDA 5AO9A 2P0EA 1WP4A 3Q9UA 1Y1RA 4V24A 4DUPA 1WZUA 2O0LA 4NARA 3KG2A 3RCBA 2FZLA 3NHJA 3F6BX 5JBQA 4UJ3A 3KWJA 4WT7A 3WG9A 1H0KA 3KQYA 3CLTC 3JQAD 2QN8A 1C1YA 5F3RA 1IVYA 5C3UA 5SZKB 5B4TA 3NC0C 4ZPJA 2G63A 3G2KA 1A96A 4PVCA 1N5JA 1FP4B 1MIOA 1E9DA 1MDFA 2NADA 3LDGA 4UDOA 1ACMA 1HLGA 1M2VB 2A5YB 1U65A 4PONA 5DW0A 2ZDQA 4OSPA 4Z1MD 5J1TB 4DY4A 2Q5CA 2ONJA 5JH7F 1E8NA 4OLFA 1YCGA 4LJAA 4EMSA 1Y7TA 4F5DA 5D85A 1C7JA 1WXWA 3GOHA 4HEHA 4X6LA 2VTVA 3WGJA 4JI7B 3A3PA 3NRBA 2R79A 1CUIA 3HL0A 4GPBA 2RH5A 3CW9A 3H0EA 1Y1TA 1ZK1A 4PYNA 1ELOA 3EUEA 4O33A 3N8DA 3GFPA 5EFOA 5HEKA 5K0TA 2YRWA 3QYFA 3HA2A 4JLMA 4NH4A 4EFDA 3PUJA 1E3WA 2I2XB 4WBNF 1YJ5A 5EZSA 3R0IA 1XN1A 2VLBA 1U2QA 2A2ZA 3N75A 4D9BA 4DZRA 2CV2A 1K9SA 2ZXEA 2JPDA 3DEKA 3AJEA 3OO0A 1YS2X 2P4UA 3HY3A 4H3HB 4RK4A 4KV7A 1CDZA 3NBKA 1ZRMA 3G85A 4AWXA 1PGQA 5LQUA 1QR2A 2RHHA 3V3TA 2OM2A 1Z37A 3G17A 1D2EA 1U2TA 4BPBA 1NXOA 1XMSA 3EN0A 4YACA 3CT4A 3S29A 3ZWVA 4MV7A 1E66A 2QMEA 4TVSA 1DC7A 1E5VA 2EKLA 4M55A 3HJNA 1UKBA 1XCGB 2GSWA 3GVHA 4NEHB 3RYTC 4IDQA 4MV0A 4AS3A 4D8XA 4DBVO 5EQJB 4LXUA 2BAGA 2YWJA 2QEQA 3Q7SA 4H7DA 4HK4A 4M7PA 2JI6A 3IXQA 1MN6A 3USZA 1GNRA 2FOXA 4R81A 3X1DA 4BO6A 4MW5A 4RJIA 2OE2A 4J43A 5K2MA 3S7ZA 1TIBA 1XRSB 2GS9A 3BAZA 4B8YA 3JQ7B 4JK3A 4EECA 3CZRA 4NAHA 5LP6C 1FP7A 1X3LA 4PCLA 5DCUA 1KI9A 1MABA 2YJTD 4HMOA 5J4LA 2R8PA 3K70B 3MWDA 4GWKA 2ZK7A 2BONA 5K45A 1N57A 2AR9A 4RCZA 4US1R 5K3CA 1JDBB 3CGWA 3DFUA 3ETEA 3TGPA 2JJ1D 3PG5A 5FHRA 3IDQA 3WHKA 1IUPA 4C3OB 5I8PA 1R7RA 4H27A 3SDBA 1EUQA 1HXHA 5LIRA 1IZ8A 1WO8A 2QLFA 3IHKA 1S3IA 1EP2B 1TK2A 2AWNA 2Q0SA 4Y6OA 4AS2A 1OREA 1GKIA 1IWOA 3A7DA 2B1RA 3LTNC 2CFIA 3NIGB 2YVAA 3EG9B 4KP7A 4CQMD 4D25A 2CLSA 1AC5A 4XVHA 2O7VA 2RJOA 5FWAA 1U2EA 2A5LA 4HP8A 4TQAA 4L6AA 5ES3A 5TDHA 1EI9A 3WLSA 3DMRA 4M22A 4CL0A 2WJYA 3RREA 5DLDA 2AC2A 2QXUA 3ETNA 3VOAA 1TLTA 3ZE8A 1UJ6A 4LDQA 3KR0A 2P67A 2FPUA 3DO8A 1NG9A 2ZANA 3B2NA 1T24A 2XY4A 3ZEAA 1DHTA 3GEBA 3O1LA 4ZPXA 1LJ8A 2CY0A 4EM6A 2X4DA 3QQPA 2C8VA 2DY0A 1P4GA 4IIJA 4W7HA 3RRNA 3WGUA 3ORRA 5IAKA 3DWEX 3NHMA 2P7IA 4AQYB 2AX4A 3HDTA 4M9XA 1HK7A 1XMVA 2HMSA 3L4SO 5KWIA 3WKCA 1JU9A 4JC8A 1UH5A 4X8LA 1WZEA 1ZP6A 2WV7A 4HCJA 1T8WA 2H4WA 1I33A 3CLHA 4ICIA 4OBBA 5M04A 2C9BA 3BICA 3H8JA 3NVMB 4HVAA 2ZUTA 4CM4A 4YIHA 2F00A 2H5IA 1E4VA 3LY9A 2E18A 4OI0A 3ZJVA 3BEDA 1NT4A 1J09A 1JEDA 5HZHA 3L9WA 3GAAA 1F2VA 4J1SA 2BGTA 1JG2A 1YZ3A 1WX1A 3AFGA 4U2CA 3MWYW 1Q21A 4Y7DA 4ALKA 5EQFA 4G4GA 3NZEA 4OL0A 3SQXA 1KJYA 2AWOA 2NG1A 1ZH4A 3QX9A 3L0ZA 1QMPA 3S2IA 2QMYA 5FNZA 1IEVA 2VRWA 3AV3A 2UXDB 5KYWB 4REQB 4AUMA 4YJGB 3BREA 3OOYA 3U3OA 1LDBA 2HJVA 2R1VA 1H3NA 4TMWA 1RHUA 1K3FA 1V8DA 3LFTA 2C7QA 3K0BA 5LYJA 1GUBA 1T6NA 5HTOA 3PF8A 1OZAA 1VBKA 2EDAA 2D1SA 1MQ8B 2G25A 5A7GA 2FZCA 3DZ8A 3USCS 4C4TA 1N2OA 3W7VA 3PEYA 2B7BA 3BL8A 3M6MD 1XF9A 4RANA 1QPGA 5FD8A 4EA9A 1I4TD 4YRIA 3BWVA 2BFDA 4B3DA 4OQQA 4ZGBA 1TPZA 4Z7QB 4GKVA 5TMBA 2R65A 3LVRE 4QLOA 4HVTA 2ZWMA 1GU1A 3MYYA 3OLYA 1JLRA 4V2IA 4W5JA 3UHFA 3ZDZB 4RTSA 1FLAA 4L0MA 1ZOPA 2ZWAA 3AR9A 3CONA 3EVTA 3QE3A 3VR1A 4BV9A 4ED9A 2IWHA 4RLQA 1DX9A 1AGYA 5FL7D 2JFFA 3P4XA 2W42A 1B00A 2PSHA 2VWHA 2YX1A 1QGYA 1ZUNA 2HCBA 2R7KA 3FDFA 5B1DA 5LB2A 4AZ0A 3QUAA 3EEOA 1FU8A 5CFLA 2P4HX 5BMVB 2RK4A 1XVTA 2X9VA 3RYFB 3VTZA 1RMTA 1U5BB 1VLHA 1ZGBA 2R1ZA 3W1WA 2RAUA 2ARKA 3GLTA 3DE0X 1S0UA 4IIGA 5CBPA 1GM5A 3LC0A 1W36B 3R74A 1CJSA 1TEVA 3QMWA 3GLGA 3R3YA 3UOWA 1OFVA 3ANYB 3TJZA 3DV9A 1MGOA 1IRIA 3HKEB 2WHYA 4YLGA 3SF8A 1T8YA 2PT9A 1NFFA 3VR2D 2CWWA 2A30A 1X3SA 1J22A 2FPIB 2FSIA 3HSSA 1X9IA 3DOHA 4G65A 4D44A 4DIKA 2VP6A 2LE0A 4DSTA 4DSNA 4E12A 4ZO8A 5FAKA 4BJ6A 5J2TF 1EDZA 3O82A 3ESQA 2K7ZA 3W5DA 1GQQA 1Y3IA 3R7NA 4LRTB 3SOZA 3IXMA 1ZI8A 4DJDC 3MJRA 3SQLA 4N9QA 3EZ6A 3O95A 4OU4A 1YOVA 4YYZA 2BGNA 3BA6A 1VMAA 4FHEA 3EZGA 4B48A 5A4DA 5DHRA 5JALA 1U8TA 5C46F 4TL6A 3VU9B 2HXYA 4B6JA 3SLGA 3QHPA 2XGOA 1P9OA 1ML3A 1AHHA 1ZJJA 3E2IA 3OT1A 5EGNA 1CR1A 1GCUA 4YT5A 2IEZA 3NVDA 3ZXSA 3HTXA 4F4IA 2JGNA 3F9RA 1E5DA 2RAFA 2D1QA 4NK5A 3T4XA 3WIVA 2OGSA 1WXIA 1OBOA 4TKMA 2GLUA 3ZLVA 2ECKA 1LFAA 4S2EA 1QPZA 4RQUA 4LQLA 1ZM9A 4BUJA 1C81A 1NOJA 2AZ4A 3P27A 2FN4A 2CXTA 4YCNA 1XQ1A 3H1EA 3DKKA 5CJPA 4W8HA 1Z15A 2J09A 3DHNA 3F49S 2ESRA 2OUKA 2JGLA 3JAKB 3KAPA 3KDAA 3OURA 4KJZA 3BDAA 3VR5A 1IWPB 1G2IA 1E3WB 3T1YB 4CCAA 4OHBA 5IPFA 621PA 3WOVA 3VKFA 2PBRA 1JEAA 1IYZA 2I66A 2FI1A 1O8BA 3FN4A 4AKGA 3TL6A 2Q9AA 2ZATA 3PIRA 2XJ4A 1QO0D 4IS3A 1H8HA 1XMXA 3HLYA 1JBQA 3E53A 2WE7A 5IUJC 1Z25A 3GPDG 3NBMA 2FSUA 2QUJA 4FBLA 1GQYA 4N40A 3WDKA 2P1ZA 4D6YA 1XMIA 3W2HA 3U61B 1KXZA 1KK2A 1OH5A 3ASVA 3FMFA 2ZUSA 1OYYA 5L9AA 2Q6LA 4P3NA 4MVJG 2B9VA 3EVZA 4KAJA 5EKTA 3FPAA 1Y8QA 3NT5A 3PF9A 5DNVA 3ZWOA 1KEEA 1USGA 3R6WA 4CLEA 4RPLA 3OLVA 3VV3A 4RHUA 1WBDA 4BJ1A 5LP6B 1FS6A 1E7QA 1QZUA 1W2HA 5AOCA 1NMZA 3SXUB 1Y5IA 1UKCA 1BH6A 3GEEA 4OA5A 1B8UA 5MN4A 2QAGC 1P1HA 4MVJI 5DSZA 5A4KA 1I1HA 1P5RA 5B3JA 2WZBA 4EHKA 3DOCA 3L8CA 3NJ8A 1XR3A 1C41A 1Z5UA 2AEMA 3RFTA 5CDHA 3SDSA 5BR8B 3OPYB 1YZNA 1DKMA 3MWDB 3N8HA 4KPGA 4IY1A 4M6WA 2JKZA 4RKQA 5DT9A 5K4AA 4BVBA 1W4RA 4DRYA 1RBZA 2Q3LA 4X95A 3B78A 4PZPA 5CA1A 1UAAA 4J4HA 4NZYA 2OCIA 2E6KA 3IBTA 2WAMA 2NVOA 1OYWA 5J4YA 4OYHA 2G06A 3EIFA 1XTJA 3BZBA 2ZTMA 1KMQA 2IUTA 3ZIAD 4JB2A 3TWOA 3F9CA 4LXIA 4AY6A 4KO8A 4RELA 4Q01A 4EA6A 2GBCA 3FZNA 4KTTE 3F8WA 1L9XA 1Y63A 4UMDA 3TDKA 3V00A 3A1SA 3UMRA 3W5SA 2ZIAA 3E3AA 2EX0A 5JISA 1QNFA 3F67A 2ZJYA 1K86A 4IW3B 4RKEA 1Z2CA 3LG2A 3AR2A 3GMTA 1TYCA 4DBLE 1GL6A 1XZEA 2OD2A 1A71A 2P9JA 4OATA 4A8PA 3L7YA 5BPFA 1HNXB 1K5DA 4LMRA 2G6BA 4H16A 2Q1SA 2VRCD 3L7MA 4IPTA 1KMMA 5T8KA 2OOSA 3LKVA 1R0KA 5DHFA 3UICA 7ABPA 2IK8A 3QUTA 4PYQA 5D2CA 3KQWA 5DLPA 3ISVA 4IIJB 1DG3A 2ANCA 6REQB 1Z73A 3Q9SA 4FYWA 4RVNA 4AJKA 5BSEA 1OX6A 1SBYA 1EPUA 1MX5A 1WDMA 4X85A 1EK6A 3LYUA 3KZVA 5EIOA 2ZYSA 2YVLA 4XE5A 4YMIA 4CM4B 1J2JA 3ZHRA 5FP0A 2RGNC 2X9QA 4KPUA 2ODEA 1LPSA 2AL7A 2IVFA 4XX1A 1SVUA 2UZIR 4OI1A 1L5OA 3H3FA 2K2WA 1U0OC 5D86A 5DGCA 1MJGA 4UU8A 3OT4A 1NVUQ 1RABA 4MWOA 1T25A 2NV0A 3PL1A 3PX7A 4L4YA 2RJNA 2H4ZA 4F4DA 5C2JB 3B1WA 1F6BA 1T1GA 4HWGA 3JQ9A 3D4OA 3HBNA 5BNTA 2GOYA 3INNA 1E0DA 2AC4A 2NU9A 2H2DA 1HV8A 4GVXA 4RTPA 3KSRA 5BVGA 3AGQA 4E2ZA 3JQ9C 3G2HA 1TGYA 4HKTA 2ILTA 3K2IA 3J80A 2ONYA 2FEXA 2Q29A 2RG1A 6Q21A 2JGEA 4RY0A 3S55A 2QBYB 1AKUA 1JP7A 2CWDA 1ZICA 4HNVA 3IQXA 5L3VA 3ROFA 5TMPA 4HEA6 3NPAA 3HKBB 5D3MA 2PRSA 4KUEA 4FS8A 3K9HA 5FPQA 1OFTA 3HNPA 5I9IA 5KVVA 3BXHA 4TM7A 2BDTA 3VI4B 3W1VA 3WR5A 1EWVA 2ZEJA 1GV1A 2R85A 4TRMA 1RQRA 2BFDB 4RK5A 5EHNA 2GILA 4X93A 1V9LA 2VHQA 1CD5A 2X2FA 4O4IB 3K71B 1Y1KE 3ET4A 1V1MB 4JJ4A 4QPJC 5FA5A 3TTUA 1QCCA 3QW2A 5DE3A 2YHSA 1JKXA 1QVVA 2AJCA 1M34B 2QJFA 1R2QA 4OHRA 4ZEWA 1X8KA 1XDGA 4OGWA 1LLQA 4R9SA 1UKVY 1N8NA 3FYTA 1ZUNB 2JKYA 3CX3A 3FY4A 4HWOA 2E2WA 4KIWA 3S2ZA 1PK8A 3MQFA 2QZ4A 2ZVDA 2H2WA 4G37A 3ZH9B 3LL4A 1P61B 1SIWA 5FPKA 4UVIA 3LCRA 2W2LA 4KKXB 4RENA 3LQRA 3H16A 4KXMA 1ZK4A 1M2EA 2AOUA 2I62A 3RVDA 5JFGA 2HXSA 1H4TA 3GLGB 2R8BA 1E79D 2WAOA 4U9UA 3OZIA 3WGVA 1TIKA 5AW5A 5L45A 1Y81A 3IVAA 5A71A 2UAGA 5C52B 1KFEB 3OY2A 1JA1A 1YK0A 2R00A 4MMYB 4KJXA 4CMIA 3DTVA 4I55A 1TYEB 1TA4A 1XZCA 5I7OA 2EW1A 4MR9A 1VYVA 5MDHA 4ER6A 1A4UA 3M70A 3VPBA 2V7QA 4O5AA 2QSUA 4PF1A 3EBLA 3RLIA 1C4OA 4QLAA 4ERNA 4DIUA 4ZHQA 2FWNA 1EVJA 2GZAA 1S2OA 3CR3C 5EKSA 4FFLA 4AZTA 5JYCA 4NYMR 1E9AA 1Q1BA 1ZM7A 1MQSA 3REQA 3B85A 1SVOA 3AOGA 3CLVA 2IW3A 3KJGA 3ZXXA 2RH8A 1P44A 4DC0A 4QKQA 4LN1A 3WJ2A 4HZGA 1U7OA 3K09A 4FMCB 1U9YA 2QLBA 1N2GA 2Q3FA 4MVJP 5IRCD 3MXOA 1KOJA 3LOUA 3N0RA 2H59A 4M9RA 4UE6A 2QW0X 3RSQA 5LZ4A 3L02A 3JQEA 3WQHA 3MT7A 4RVDA 1LZLA 1PJQA 1OOEA 1TZMA 4KXVA 5JJKA 1SPBS 4MW1A 1URPA 3N8KA 4O4LF 1Q6ZA 5D1HA 3MS7A 1LRLA 4RTLA 2MOKA 2KI5A 1DKUA 4QEKA 4F04A 3H4VA 3TL3A 3BGSA 4P54A 2F48A 4YR9A 1JBKA 1MO4A 1ONSA 2DSTA 3OOWA 4CPDA 2AJLI 4LG1A 5CG1A 4XWTA 1OTXA 2J4DA 4QBGB 4MROA 2PYIA 4D4JA 1XTIA 2VL7A 2ZI7A 1HY3A 2PL9A 1SU8A 3RS9A 1MTOA 2C2WA 3A9VA 3JPYA 3OX2A 5DO9A 4CEHA 5AW0A 1U0FA 3TLBA 5ICCA 2EFGA 5ED0A 4N0QA 3CU5A 4PXSA 5K03A 1YZFA 1TAHA 1IPFA 4G67A 2GWHA 1CF9A 3V34A 2D62A 3V55A 3ID6C 4DE5A 2CE2X 2HYIC 3I8SA 1D4OA 1XIVA 2ZSAA 3GT4A 3EPHA 2YICA 3CPSA 2WJPA 2G07A 4FN5A 5GV7A 3WXBA 4B3IA 1LPAB 1M66A 3HFRA 4D43A 3BHJA 1YGYA 3D4IA 4D9HA 2QGFA 1Y8QB 2DB3A 2HA2A 2QAGB 1B14A 2PCLA 3RK1A 4ZYUA 2UDPA 5EXEA 4BFTA 3PQ5A 4C30A 3U80A 2V59A 3MTGA 1CY0A 2X5NA 3DM9B 3D0OA 1A4XA 5H5JA 3OCVA 3RSHA 1HOXA 4ZQIA 3TR0A 3U40A 1ULZA 4BNYA 5A5DA 1O77A 5K0NA 4ZHSA 5ABPA 3EGCA 4MQUA 3D6VA 2VYNA 2ZJ2A 3I1IA 4B3MB 1CY1A 1QDLB 5FNVB 3LX5A 4D3XA 1IN8A 5M2QA 5DULA 1P1JA 4JEHA 5JLJA 5H1YA 1LDMA 4BNTA 4E5NA 2GO1A 3AP1A 5EWMB 2ODNA 1II0A 4ACAA 1A8PA 1CIJA 1FVHA 1R15A 3GPBA 4YP1A 4TMFA 5AJZA 4K81B 4OHUA 3WP1B 1IUOA 2WDPA 3WL8A 1UT5A 3I9V1 1V26A 5FQNA 2JKVA 4HN4B 4UM8B 3K35A 1N0UA 3L7JA 5JSQA 2QDXA 5EZ5A 2A9QA 2C5LA 4RFSB 1QQBA 3LT2A 2YJZA 3E48A 3LT4A 1HLDA 3A1CA 1ZH8A 3FRHA 5K0CA 3OLQA 4QEZA 3OKCA 1MB0A 1DKQA 1JU4A 3A9SA 3QVJA 3DCIA 2IH2A 3AVWA 3TZHA 3I92A 1FP6A 3IEIA 1I36A 1WLSA 4L5IA 2EJBA 2B0CA 3SZOA 3OIGA 2VT6A 4R1LA 2H5LA 2WSSD 3SYLA 3ILSA 4NNPA 3INTA 3SZGA 2FMUA 2YZ7A 4FHZA 1GCIA 1YQTA 3Q7IA 2D0DA 2W8BA 2BI8A 2PFSA 4K2HA 4R31A 5TQ2A 3T35A 4AMZA 4YUWA 1ZL0A 4IWYA 1CZHA 2P79A 1ADCA 3P2KA 4KV9A 3R0ZA 4KSBA 1UJ5A 4WLUA 4R2MA 4DLRA 1DX4A 4MVJA 2W6PA 2BZSA 3ITEA 2EYQA 1AUVA 4HAZA 1VKRA 1S1MA 2AN3A 2NTNA 1RAAA 4AO8A 4NBWA 1M5RA 2AMYA 2QD3A 2XKJE 4W9MC 3A2KA 3IALA 2H06A 4C7BA 2AXNA 4OHYA 4QREA 5EIHA 4TKVB 2FZ4A 4M9SA 4YB8A 4YEDA 1BOFA 3ZE1B 4D9GA 2GPYA 3NAMA 5AVSA 1NQTA 1Y7PA 2RC5A 2Y8EA 4H0NA 5BV0A 4LTDA 4J6FA 1UKYA 3M49A 2WG0A 3CY6A 1XAHA 4IIFA 1NQWA 4LYDA 4M4SA 4Q1BA 1W6UA 1V4NA 3OI7A 5EERA 3KUXA 1H1LB 2W7TA 3EH1A 3KUUA 3L04A 4WXRA 3G5UA 3X1WA 3DDZX 3TTXA 5BVGB 1Y9AA 3ZI7A 3D6HA 4E5PA 5IT9A 3LAWA 2PIDA 1SBNE 4BC0A 1ZCAA 1DT5A 3O4IA 4GECA 3O8CA 2VVTA 4KITB 2H7VA 4BU0A 3H2JA 4TKZA 2JK1A 4G4SP 3LLMA 1HDIA 1Y0BA 1EXVA 4PG7A 3R7DA 1U9ZA 3IUPA 3LC7O 3WWZA 4RHCA 4DVJA 3JCZA 1UKEA 1ZN7A 2H4FA 4MGYR 2F9LA 4LX0A 4RKFA 5FF9A 4QBTA 2XF2A 3SQWA 9ATCA 4ZYWA 2VP2A 2EATA 1K8XB 4IV5A 3CLSD 1S5PA 1NXTA 5AR1A 1YI1A 2HJHA 3OTWA 5AVUA 1W4CA 4U6SA 2XDQA 4EA8A 3AUJB 4P83A 2AW3A 3H9UA 3R5FA 4IV8A 4G0OA 2FPRA 1P77A 4PNEA 3K8ZA 1AE1A 1HSZA 1HSOA 2NZ2A 2PAFA 4ND3A 1Q95A 4AZ3A 2A35A 2ISCA 2GF2A 1U2DC 1GFIA 3G13A 2HEGA 2WKSA 3E8MA 4IQFA 3MGBA 4JOSA 1XA0A 2PZGA 1MP0A 3QKSA 5AVRA 4EZIA 2ERYA 2NP6A 4KE9A 2R6DA 4JQCA 2NXWA 1JNXX 3HO6A 1JIXA 4OB7A 5AK0A 3V2IA 3FVTA 4XQ9A 2PU5A 1KO7A 3N0WA 4CMIB 1CFJA 3HN7A 3Q11A 1NP3A 3WMRA 1RXVA 4QTZA 2PLFA 1M1XB 3ENNA 1S02A 3HJHA 4KLNA 1Z88A 2MINB 2WA1A 3T7AA 5CCEA 4H9GA 4L5AA 3KXPA 4P7KA 2VP3A 1S7CA 1PJ4A 1PO7A 2A8YA 2P3SA 3ETHA 4JYBA 5ECGC 1IXYA 3I09A 2UVPB 2V9PA 3I0ZA 4QUHA 2I34A 4GGMX 2ZAOA 4IL5A 2OA0A 3T7KA 1YXMA 3IMCA 4IJWA 1YB1A 3CTPA 1QX4A 1AKMA 3W9BA 3RRXA 3TRHA 2HX1A 1ORRA 2PD4A 3PCTA 4F38A 1KU6A 4X00A 2ZYVX 1D4FA 3IUYA 1BWRA 1PEKE 1RRVA 3JR3A 3PJDA 4HSEA 2XT9A 3D3NA 4IQ8A 4X6YA 5IG2A 3G8BA 4TLMB 3LQYA 1GPH1 3KELA 4K7JA 3NTXA 1ETUA 4WXPA 5LSAA 3PFNA 1EGQA 4AD8A 2C4MA 2WIAA 3CISA 1HNWB 1B3RA 1V95A 3DPIA 3A3OA 5EMNA 4Q18A 3STYA 4ITRC 2P3OA 1CEQA 4CKBB 2H57A 2D2EA 3K0EA 4I2NA 2X1HA 3UH0A 5C80A 1PT8A 1J9EA 1XTRA 3NW9A 4OGKA 2HL6A 4I5GA 2BD0A 5ILQA 3ROGA 3G2PA 4EI2A 4PN7A 2F17A 2G3YA 1TZ2A 3EARA 1DQRA 5BW5A 3O4GA 3CTMA 4HXYA 5BW6B 4UUQA 3QWAA 1PHRA 2GAAA 3P97A 1JE0A 3FPBA 4MZDA 4BKRA 2Y4NA 2BJWA 2ZJ5A 4EABA 2B94A 2BR3A 4AI6A 3AGPA 2O2IA 1AQLA 3N0VA 3PX2A 3TRJA 1N2HA 2C5SA 4LEIA 4WLOA 3RE1A 1QYXA 1Y80A 1YIDA 3FYUA 1Q3HA 3N2ZB 5IUKC 1Z7WA 2ZIFA 4RIFA 4UM5A 4E3WA 1KY3A 1D2RA 4AMVA 1VPLA 4YJKA 1KWGA 2ISSD 1A5BB 2Q3MA 5IHPA 4XIIA 4YCAA 4ALIA 4P34A 2ZRLA 4RSGA 1Y3BE 1UPBA 2FMFA 1AGRA 1TQHA 4L2IB 1XTSA 5EAIA 1NI4A 2DFDA 2HGSA 3VPHA 2ODWA 1Q0LA 2ZI4A 5EA2A 5BSUA 5IAAA 1Z36A 4F3RA 4HH4A 1UDCA 2Q3BA 5A5GA 4H0CA 3MJ4A 2P4EA 2CSXA 2J33A 3C3CA 3KBOA 1RQGA 3Q3VA 5E1MA 4K46A 3NWEA 4DLVA 3W5HA 2VQ3A 5DYYA 2LP4Y 1Z5OA 1B0UA 3ER6A 3ZE9A 1A77A 2CNBA 5JPCA 2RHDA 4Q3CA 3COPA 3WGYA 2BTEA 3D3EA 4C76A 1VMKA 1VKZA 3PCRB 2WD7A 3ZHYA 3D2LA 4CW7A 1LF0A 1HDGO 4P31A 3IUBA 3QLTA 1IQPA 4TTVA 5JVDF 2DULA 4HAOA 3WMGA 5BOSB 3TCXB 4I8DA 3LUGA 3E7XA 3PRYA 4L7QA 2CD9A 4PGFA 3RAPR 2I99A 1U4NA 2XCOA 5BSGA 1SCJA 1L4BA 1NGSA 3FETA 3UBTA 3QLUA 1I6MA 4YRQA 3R41A 1XJWA 5AKEA 2Q9BA 3K6SA 2V7XA 3QZUA 1JLHA 1CNMA 1O5OA 4X20A 4Z51A 2C82A 1KMIY 4JBHA 3M1YA 4NR0A 2YUTA 3C3AA 1CS0A 3WQRA 2ZIVB 3HB5X 4XM2A 3QLUC 4FHGA 3U7EB 3BD9A 3NIDB 4XPIB 2IELA 1XVAA 3HV0A 3G5MA 3NH6A 3O73A 4P92A 5FOXA 5IHXA 1M6YA 4AIIA 3QFFA 1GZUA 3W8FA 2HWUA 1V5FA 3MHPA 3HWSA 5EIBD 4HRAA 3DR5A 2ZJ1A 4GI1A 3AYXB 2IUYA 3S0JA 3IKJA 4ACBA 4NYIQ 1TD1A 4QNMA 1XT6A 1YB2A 2PGIA 3M5CA 2OB1A 5JUWA 3W2TA 1GT6A 2J45A 2WZQA 3KQKA 3TJMA 1I5RA 1NRWA 1DINA 4KIGA 4ZXFA 1JILA 2WVGA 4X1KA 5KSOA 2BHSA 1JQ5A 2VP0A 4EQ6B 5I7FA 5K3OA 4DPLA 4HRXA 4MVYA 1Z47A 2PXCA 4KN9S 2N42A 2ZT7A 4GSLA 3G8CA 4XWYA 3AQ4A 4B2PA 1FEZA 2VIIA 3C1OA 1A5TA 3OOJA 5DMHA 4WLFA 2C96A 2I54A 5GVRA 2R8EA 3GK3A 3MN1A 3O4HA 1QS0A 4OY3A 2NU8B 2AD1A 4N3NA 4NOLA 1PQUA 2J7KA 2GEDA 2GGSA 2HLDD 3IO3A 3K53A 3BE6A 3NHAA 4L08A 1ZMOA 4IF6A 3LQ1A 4TMZA 3VUEA 4LYHA 1MX9A 1U28A 1QIEA 1Z5GA 3IVXA 1G3MA 3NRJA 4LQCA 1JPVA 4A8TA 5C5CA 3M1IA 3U62A 1YHZA 4TX1A 3OCZA 4HI0E 2HK8A 3UANA 4DQLA 2FZ5A 2OFPA 1P73A 4HC4A 4DCNA 1SUFA 3WLQA 4Q1AA 2JFVA 4JDPA 1GTJ1 5FBKA 4EFLA 2GJ8A 1WU7A 2E9SA 2PV7A 3AF2A 4LV5B 3VC1A 2E82A 3HYCA 4MMZB 1GRCA 1OCEA 1NXWA 3UV7A 5F64A 4MA4A 4F85A 3M4YA 3PXAA 4ZAWA 5IBPA 1CVIA 4F4FA 2ZOSA 4NS4A 4H6XA 4AO6A 5KQLA 4INPA 4I5DA 1CUFA 4JBNA 2ZREA 2W70A 4B2LA 2JGMA 3PSAA 2R66A 4CIVA 5EHQA 4WUTA 3I30X 5ANRB 2QMZA 4BNZA 4HMPA 5KAPA 3PTAA 3GX1A 2TMYA 5AJXA 2GNOA 3TQTA 3ZVLA 1NKSA 1UDRA 2PGNA 4ABYA 1DGQA 5LBTA 1QGUA 1NM5A 4QFDA 2JFOA 4R69A 2NLOA 1R6BX 4HNAB 4IGIA 4IJMA 1I3CA 3E22A 1YZTA 1BU8A 1AKYA 2VSNA 3OZEA 4A27A 4D8WA 1RI3A 4L07A 3I2FA 4QRDA 1E6UA 2QI9C 3M83A 3RS3A 2OKCA 4DCCA 5C9ZA 1NM5C 2QTFA 3CNNA 3U1BA 1DBQA 1ODLA 3FGOA 1W0JD 1J4AA 2DQKA 3NHPA 3DBHA 3QF4B 2D0OB 4F12A 4Z9XA 2CXHA 1CX9B 1XXLA 2WIGA 3U4QA 4GKJB 3A06A 3P20A 3OY7A 3D1VA 2D4AA 2PLAA 1J7KA 3E7FA 1HC7A 4H1UA 2PVSA 5KX5F 4FKBA 4I50F 3DT8A 3HWX1 3SEQA 1I7LA 1IMJA 1XFAA 5T67A 3KQOA 2X9GA 4UNIA 3L5KA 1UXOA 4JJEA 4QWMA 4XSVA 1N2CB 1EGAA 3LYAA 1X1TA 3UXEA 5B57C 1W4AA 3AIKA 1ZGJA 4B32A 3HCPA 4DCTA 2F4NA 3AM1A 3DC7A 1THTA 5JZOA 4NE2A 2H3HA 2YHUA 3D8RA 4PPQA 4OQYA 4M1YA 1NZDA 3R3SA 1ZU4A 3F0TA 1FDSA 3KHUA 3QQ5A 3A11A 3CLRD 3G8AA 4ZXPA 1M2OB 2V0CA 3R0XA 1Z5NA 4J0FA 2EKZA 2MSDB 1U8YA 2G72A 2IQIA 1RJ9B 2NO7A 3CNHA 1R66A 2QVGA 4FFVA 3T7IA 4BO7A 2B1IA 3UFBA 2G88A 1F1BA 4LJKA 4Y2QA 2EARA 3LLCA 3DW1X 1ENOA 3DE4X 1N5MA 3QFTA 4KZKA 1EFVA 2OBMA 3GU3A 4KW7A 4YCCA 2C4UA 4G26A 2XUAA 4BIIA 3OIWA 3RG8A 3MCZA 1WSWA 1ZJZA 1YZGA 4LY3A 3THRA 3VR0A 4D4KA 1CKEA 1K0UA 3NAGA 4MUHA 4Y0AA 4F4CA 1JHDA 5FEUA 1TUEA 1W1IA 1WCYA 3R7LA 2SKEA 2PX0A 5K2OA 3S1SA 1D1SA 1XP8A 1YR7A 3LWDA 3P9XA 1C9DB 4ENUA 2X22A 5HUHA 1SCQA 1U1GA 3EVNA 4K1LA 3BCSA 3RRJA 3HKCA 3TSWA 3TOZA 3D4LA 1S2LA 4A15A 2X13A 4ALMA 1SG9A 1OXBB 2I4IA 2IHVA 4XQGA 5CX4A 3JD4A 2HC9A 3ZHSA 2ISQA 1CQIB 1PDOA 2D2VA 1GHTA 2HF9A 2XSZA 4G5HA 4EDFA 3N07A 2IBTA 4P33A 1CUDA 5AHXA 1EE9A 1YNOA 2H1VA 2Y1EA 4C0SA 2V6GA 3E5RA 5HKKD 2INGX 5CHEA 2AK3A 3BTSA 4UQPA 2IHKA 2I0FA 3L07A 1X2EA 5K05A 3OE4A 1RKQA 4IHAA 4OHXA 4KGDA 1AQIA 5FBHA 2CDAA 2CJYA 3FROA 2CNWD 2JEZA 1RZUA 2PAAA 3NP9A 2IEIA 2Z2YA 3DWIA 4ZZ1A 3IB3A 1W47A 2YW2A 3DSRA 2BI4A 4CMCA 2AUMA 1RVDA 1UL1X 3DV2A 4U2GA 1NWHA 3TZCA 5JWRA 2H8GA 3S6JA 1PVDA 3AERB 4AYXA 4UMVA 3W5JA 3GZJA 1Y5NA 3AFNA 1PI3A 3KB2A 2AZMA 5JSZA 1IY8A 3PVCA 3GDFA 1WY7A 4FXPA 3C6QA 1RJWA 2J46A 3ZWKA 1FX1A 4BKUA 2W4IA 3OQIB 3DMHA 3RF7A 5C8YA 4BY9E 2Z9BA 4JASB 1JT2A 3LQ2A 3ZCPA 4EG5A 1YS9A 3GGPA 3IVCA 1ESNA 2ZTSA 4KXFB 3G7UA 1C3JA 2CDRA 1S6YA 1N5IA 5ESWA 3F46A 4L3WA 1YIOA 4QBIA 1Q44A 1M8GA 5BY2A 5K0ZA 3IEVA 4MJ3A 3RS0A 3PUXA 1RI4A 2TS1A 3GEDA 4PICA 3SU8A 2D2XA 4A73A 1TJPB 3IUMA 1GR0A 2XPCA 5CT6A 2QQ0A 3HL4A 5K3AA 1C8VB 4QUGA 3BVPA 3CZCA 4B2YA 3WICA 3C8DA 2YINC 1KHTA 3RLFA 2HFJA 1L2TA 1UPFA 1VMEA 1FNMA 3N2GA 1CZOA 3QE4A 4INOA 3BE5A 4LZNA 2WV9A 3Q98A 4II3A 3E1SA 2HPZA 2QRGA 3EZLA 1YCHA 4W5HA 3STVA 1GDHA 1KQNA 4NFHA 4Z4EA 1AQUA 1BCRA 4OVKA 4D9KA 3GRVA 1PJLA 4L22A 3K73O 3JYNA 1ZC4A 4TZ0A 3H0CA 2XEDA 1T0BA 3AUUA 3Q6NA 4V39A 1J8MF 2Q07A 2P3LA 3C74A 3EAQA 5DCWA 1F1JA 2VTEA 3A9TA 2OV2A 4KRXA 4Y8VA 3GRYA 4ZYVA 4DZTA 3F3YA 5EJ7A 5MN6A 3S81A 2BM1A 4EPRA 5CA0B 3C3EA 3GT7A 1YJAA 4YJ2F 1FMCA 3HGTA 5DBEX 2VUTA 1RPZA 2XXAB 4TZ6A 1QIKA 2NP7A 3A0UA 1Q1NA 421PA 2IHZA 4UTVA 3VH1A 1TU3A 3P71T 3M0EA 1O9HA 2GCGA 2NZVG 2FWJA 4M0KA 3PHJA 4E88A 5K6AA 5FEMA 2B4QA 4E15A 4AY2A 3O47A 3B9RA 1GT91 5HR5A 1NLUA 1ORVA 4JUBA 3H7AA 1G6Q1 1C30A 3OF3A 5F1OA 1Z2EA 4J4BA 1R9NA 3B1ZA 4KQEA 2XODA 1V11A 1E99A 4O2BA 2FLVA 3ZDQA 3TW8A 5K6AC 3ROXA 1U9IA 1XSEA 2G6TA 3KYJB 4LWQA 3FLEA 1IXSB 1Z6TA 1YQEA 5ITZB 4WQMA 2YWXA 1KI7A 1VRWA 1NVGA 4P1ZA 3G2OA 3S2GA 3IKMB 3GLKA 2EBHX 2EZ8A 3O7MA 4L28A 4C20A 1RMYA 3KTAB 5JSZB 3TLYA 2O1XA 3GLSA 1MB3A 5DXAA 1Z62A 3DUFA 4U7GA 3T1VA 3GG9A 3VYTB 2WG1A 5GMOA 1HG1A 1MC8A 4HRYA 4EB8A 3PFCA 4Y6QA 4UE2A 5AXBA 2E87A 1L5HB 1J56A 4MLPA 4DNFA 3Q1KA 3ESCA 1S2IA 4QIHA 5ADWA 4AJJA 3KL2A 4TTIA 4D99A 3EFOA 3GRUA 1I5OA 1I4LD 4EJ2A 3PXUA 3GPCA 1R6TA 1AXRA 1F8XA 1JVBA 1GYQA 1I1QB 3KAQA 4LDNA 1ZVVA 2IH5A 3EDRA 4M1EA 1N0WA 1ZEJA 3WHLA 2AV6A 2GAJA 4ILKA 4BNJA 1P75A 3BTVA 1TI7A 4WDQA 4C6SA 1ORDA 5EP4A 1W88B 4R7GA 1SXHA 3MSXA 1YBMA 5DWVA 3S8YA 4DMGA 3FGZA 3VPSA 4PWZA 2YY7A 1DOHA 4BVKA 1XU7A 2XQJA 2KMLA 3GGDA 3AKDA 4Q1DA 2Z43A 2H7XA 5T4HA 2UUAB 3U1VA 1XZKA 2C42A 3GUZA 1H6BA 4KQ6A 8ATCA 2D8MA 4ZQFA 1MAWA 2BT4A 5F12A 3SR0A 2GT1A 2ZAIA 1MRNA 2EFHB 3NVAA 4WKPA 1VCIA 1UDBA 2W6JD 3AR7A 4RSHA 4Q7MB 4Z2YA 3VHQA 4B3FX 4E1AA 3FFTA 4EAQA 2RCNA 2QT0A 1O89A 3FNRA 3WGQA 4OJTA 4RD1A 3SZRA 2XW6A 1TC1A 1XLVA 2C20A 3BJZA 2W6CX 3Q72A 2C99A 1D3AA 4MVXA 1M2WA 4OXKA 1ND6A 5ERXA 4G0NA 3UKDA 1X13A 3Q3IA 3GFRA 1T0UA 1WXXA 5C81A 4AMUA 2HI0A 2G36A 4EYEA 2VDRB 4TQ9A 3TIFA 1GN8A 5A02A 1YVUA 4WOCA 2UZ4A 5DK4A 1IN6A 2G04A 3NGLA 4LDRA 4LYAA 3BH6A 3GJ0A 4PIPA 5AUNB 5CVEA 3D3KA 2ZR0A 3OEHD 1JTEA 2FKNA 2IHTA 1RCTE 5EE9A 4LDPA 1EP9A 1RHKA 2HWWA 1GCAA 4E0BA 3NYQA 3PKZA 4OU5A 4RO0A 1T43A 2VDPB 3EVDA 1YR6A 3EXFB 1TQ8A 4KI7A 1Z5ZA 1GPYA 1RLUA 4FMPA 4QPZA 4V1CA 3OEED 3R77A 1XNJA 4AUEA 2NX2A 3RYHA 1FB5A 2C8KA 5EVCA 3DMTC 4YI3A 2FU5C 2FPSA 3ORSA 1MB2A 4LBYA 1XJCA 4B4VA 1L5NA 3PUYA 4ZU3A 4Z3DA 1U7UA 2JJ1A 1D09A 3DL7A 1IVSA 1RYFA 2O1EA 4CHGA 4IF4A 2O8CB 4E51A 3EULA 4MO9A 5BOVA 5KWSA 1SBCA 2QWXA 1BHJA 1F2TA 5BQ3A 2EHDA 2OBNA 4FKMA 4ONEA 4B81A 1YKFA 4CQMA 3SWWA 5TJ9A 4DHEA 2BHRA 1BE0A 5FOSA 4FWTA 2NU6B 1NA5A 2XUIA 1AKVA 4RMJA 4BCBA 2Y1XA 4Q24A 2NYVA 3WGHA 4RDHA 3C87A 4KQXA 2QR2A 2O59A 1G9SA 1CK4A 2FWPA 2OB2A 1VPTA 1SCDA 1YRWA 2YY5A 4UAUA 3U9TA 5C1DA 4Q4AB 1NTRA 2ADOA 5JV5A 2BJVA 1QGOA 4I6EA 2CHFA 3SZLA 1ABFA 3WGOA 1TZBA 1XWIA 1Z5VA 2F1IA 2R8YA 3OZGA 2GLXA 4WKBA 1TJNA 3ABIA 1JDVA 2L0XA 1IY1A 1E1QA 1I32A 2P2ZA 2VXBA 4LYEA 4X90A 1YRQA 4L75A 3VGPA 4QM6A 2H1CA 3DLAA 2XDWA 3E9DA 1Y9DA 5K0BA 1WUKS 2WAXA 2WTAA 3NBFA 5LWHA 5EPEA 4IEFB 3VTKA 1N33B 2UZ0A 4I8IA 1KE2A 1KI6A 3WYFA 5I48A 3BD8A 1O0SA 1RRPA 5FR1A 4NZMA 3TAUA 1E6KA 4DREA 3KOYA 4PLZA 4JUDX 3G1WA 2VSXA 1XEXB 2X8AA 3K7EA 5E1DA 2PKQP 3R8FA 3TPCA 1EM6A 3I9FA 2VTBA 1WY5A 1M1YB 4YUAA 1LA2A 3BSSA 3N0TA 2Y71A 5CX1A 4D42A 5HVNA 3PR1A 2V6MA 2FX3A 4IIYA 1X1CA 1T2UA 1E2JA 4N48A 3GQBA 1TMOA 1UXHA 3FPEA 4C21A 1O96A 5DTIA 2XKBA 2FGKA 4ZT6A 1EEXB 1X92A 2ZSUA 4WVLA 4Y1GA 5GV8A 5E4JA 3GH3A 1PZXA 1KS2A 4F8JA 2W0MA 1KOFA 1SQ5A 2YWFA 3LE8A 1HT3A 4MWEA 3EYAA 2JH9A 4A0HA 1XNQB 1SJ9A 4NOKA 1M76A 5DHTA 3J7TA 1CB0A 1XAIA 3SX0A 3WDMA 2OBBA 1TPYA 2CXSA 2XWPA 3K31A 1A7KA 3N2GB 2II6A 3SNHA 1P4AA 2OHIA 4Y67A 3SHWA 1Q7EA 3UXHA 4B43A 1Z8FA 2MYNA 5E9AA 5AJTA 5B4UA 1VL1A 1TM2A 3DE2X 4P5EA 1W0CA 2BMFA 2K2QB 1F7UA 1BCRB 1Y9JA 2JFXA 2P0YA 3GG2A 5EGSA 5KWJA 1IN1A 2FPGB 4DXAA 1EFPA 1VKNA 3AEKB 4I08A 5H68A 1CF2O 5LNK1 1JHQA 3PE4A 4KQJA 5IF9A 5THQA 1YZYA 1JAHA 1TIPA 1KK1A 5AH0A 5C5IA 5TPWA 1VE7A 4V0SA 3KYCA 3UMGA 4B47A 2IY9A 4NFLA 1UCFA 4XYEA 3NNNA 2EX4A 3HJCA 1C8KA 3NKVA 5E4TA 3TVYA 3FOZA 2OQIA 1ZRHA 4Z4CA 4RX1A 5HTKA 3SJ7A 1J39A 2FEKA 4H3SA 3AZOA 4EY3A 1TX4B 2HAEA 3DL2A 4L51A 2J9ZB 1RIIA 4OIFA 2IOHA 4B40A 3I6YA 1PSZA 3C5EA 2HCTA 2LDXA 4MQEB 4O4JF 2PZFA 5JAQA 2HTFA 4ZU6X 3WL4A 2I67A 4EPVA 2VT3A 4QT4A 4K6OA 4DC9A 3AM5A 1UFQA 1EIZA 4RHFA 2PJZA 4DLYA 4O2BB 5F76A 2X5JO 3TW8B 1ONBA 2E4WA 2DFLA 3BERA 3BSWA 3UUEA 1YR2A 3VR2A 5IABA 2EBFX 4JYPA 5K0GA 2O5EA 4TT3D 4F6RB 5CTAA 3AW8A 3L84A 3IIMA 4YUXA 2BFBB 3GLQA 4Z9FA 3HLTA 5HF9A 3WA6A 5BSHA 1I0ZA 4XDHA 3A4NA 2OYRA 5BYKA 1L4GA 1D6SA 2DY1A 4GOND 2HN9A 4NTZA 4L74A 3JQAB 3ADBA 4MOWA 3IUJA 5JAUA 3HJRA 5F2OA 2I91A 4CMEA 4XKJA 4CF6A 1HYHA 3DWFA 5KMGB 3KQPA 1E2IA 1H23A 4TV8F 1OFUX 1C3OA 5HCNA 2NXCA 3UJNA 5J43A 1I8TA 4G4SO 3EFOB 3F47A 2FE1A 3FTQA 3IERA 2HJGA 4RLHA 1DAGA 2WJZB 1SUPA 2HHJA 5I8ZA 1AKWA 1KYIA 3ECSA 1DOZA 2D2IA 3QWFA 4AJ9A 5HZMA 4WECA 4F71A 2P4QA 3LRTA 1F60A 1BZYA 1T9AA 1OGIA 3EB9A 4QQNA 5ERGB 1HKUA 1UBNA 4XJTA 2QN3A 2O8FB 1R8QA 2R68A 3ZJTA 1QP8A 2YCBA 1BXRB 1FZQA 3W6UA 5HHTA 2VWPA 4FFRA 5JANA 3G0HA 1ZXLA 4DLBA 1BFUA 1GZ7A 1G5FA 2I7XA 1U7TA 3FHOA 4BNNA 4MUBA 1G5TA 2HMYB 1O0CA 1EE2A 4CIXA 4ZT3A 5LXTB 1JHMA 3AILA 2ABWA 3E9NA 4KBFA 1U8XX 1QE0A 5AVOA 4Z9AA 3HH8A 5HSGA 1R9JA 4UNRA 3UY4A 1YIAA 1JEYA 2GAIA 1M8KA 5IJ9B 9LDTA 5MFZA 1D4AA 2P78A 1N2SA 1QO0A 1R0YA 3O8QA 3VAAA 3L4BA 4QU5A 2LD4A 2PXHA 2XMQA 3SFZA 3AUSA 1LDNA 5LQCA 3CRQA 4FX5A 3DBLB 5LC1A 3AEZA 4WXMA 1XXHE 3LP8A 4YJ3B 3WZMA 1FLVA 4M89A 4GDFA 1DMRA 2APJA 4RUKA 4NHEA 4UNSA 2DQ4A 3WSWA 3DC2A 5I4KA 2P77A 2FMKA 3BYZA 2O7RA 4TTPA 3L1IA 3SX4A 1V16B 3K16A 2PGXA 4CM9A 3L4KA 3NB0A 3E7WA 3SQNA 4F8EA 4QOHA 1N2EA 1P1RA 2NYUA 2GXUA 1VG0B 3PNSA 3G0OA 3AY0A 2BFFB 3SPXA 3K5WA 4PVDA 1U9JA 3LPAA 3O21A 2C58A 1E7WA 3E27A 4TLCA 4EUFA 1XDWA 2DXIA 1Y6FA 4FUQA 3WBKA 3M34A 4QXMA 1EBUA 2EJCA 1BO6A 1CW2B 1VHWA 4OJKA 1HM5A 1TFRA 1MNQA 5FTWA 3UAVA 4K1XA 4PIVA 4HNSA 4J0QA 3TI9A 2OV4A 3ZZNA 5A3QA 3E61A 2WHPB 4Y1RA 3B70A 1RC1A 1C4XA 2QE7A 1CVRA 2GCOA 5JH7A 4V0MA 1NI5A 1QTIA 5HE8A 2JG3A 3V7UA 5CIWA 3ZIAA 2GPBA 2FSFA 2B5OA 3CC8A 4Q1CA 2QN1A 1RM5A 4B0PA 2XYQA 3QFRA 4WFIA 3SJUA 4IO0A 4WX2B 4WL0A 3WFJA 2XHZA 4RVOA 3W4KA 4Q9NA 3AVTA 1W19A 3NNDA 2JFZA 1BJTA 1OYVA 2P9BA 1EVEA 1H65A 3HO8A 2CDCA 1E1KA 2BKEA 2B20A 2EV9A 1NDQA 4RPCA 4ZC8A 1H0RA 3UW3A 2AB0A 1SG6A 1WCV1 4J49A 4NABA 1W5TA 1QOZA 4XGIA 3ZK7A 2WM8A 1VKJA 3GWGA 2QRNA 4XJXA 3UHOA 4GVPA 4TUYA 3BMOB 4KTVE 4IIHA 5REQA 4KR3A 4KHPB 2C2OA 3LIPA 2XRFA 1GV0A 4XYMA 5EXTA 2PNJA 4I1PA 5AM3A 3MTQA 1IHOA 3MJVA 4K9QA 4XWWA 3SM9A 1JBEA 3KOZA 4W8OA 3RWBA 3H3XA 3H5WA 4BFWA 4WCFA 2GRJA 1K88A 1FPQA 2MR6A 1YBVA 4MYRA 3ZHCA 5BRAA 5FHQA 4WA8A 4JODA 1V7ZA 4BQOA 1U3WA 2G8LA 4FK8A 4JVOA 2IXTA 1THGA 4WCFC 4G0QA 5BR7A 2Q0HA 3KKZA 5ALFA 4CMHA 1VECA 4GGPA 2OCDA 3DQZA 2UZ1A 2OO5A 5DBOA 3ELBA 4ID3A 3UG7A 2OXEA 2DHQA 1IFXA 2J6BA 3M89A 3JZMA 3J7AC 3S3TA 1YC2A 3DD5A 2GYYA 3U0VA 5HOQA 1D0SA 1KJIA 2JHAA 4RA9B 4F3YA 1EFRD 1UOQA 2C5GA 2O57A 2QJOA 2HEIA 2VJQA 5CLHA 4MITA 4TXLA 5DT2A 3B12A 3HJUA 3N2LA 2RGBA 3V6LA 3VRHA 4DQVA 5BNZA 5JBNA 1NVDA 1ZR2A 3GJYA 3OLZA 2R7MA 2AHRA 3AFOA 4G86A 5KKCA 2BIFA 2HO4A 3A9UA 3DDCA 4UPDA 1UZLA 2IGTA 2ZVJA 5BYBA 1SQGA 2WOJA 3AKCA 3GJ4A 4ZCQA 4ATNA 4OLAA 2A5DA 1IZ9A 1JW9B 3I37X 4BAZA 4BNIA 1PAUA 3KKPA 4YAOA 4O4HB 4RORA 4Y30A 4K87A 3K1ZA 1TQDA 1SK8A 1EX6A 1VMIA 2N75A 1GLVA 3GFSA 3LUPA 5CHYA 2IX3A 4IG4A 2QZSA 1K7FB 1Q2XA 1U6JA 3FKSD 2I2WA 1EFPB 4YXWD 4G6ZA 4MQ6A 3TUJC 4JB8A 4AQ7A 1UXKA 5AOAA 4U1RA 1PBTA 3PWZA 3FBWA 4FFMA 1XDBA 4F6LA 5LMCA 1E0AA 4FZRA 2RH4A 2CFTA 1SOUA 5P21A 4EENA 1K5HA 4ZAYA 3DZJA 1D7AA 1CPYA 4Q21A 2CUZA 4FFPA 2XWJI 2YIJA 3DHEA 4IDHA 1GFWA 3NANA 5LQKA 5DM4A 5K09A 2D13A 1KKLA 2H1SA 3QU7A 4CV2A 4E09A 2W2PA 3D2CA 2PJRA 4QYIB 4GL2A 5FBVB 3RAJA 4M8NE 1Z8HA 4CTKA 4XDZA 3CEAA 1FYWA 4GUAA 1RXYA 2HDWA 1XHEA 1CQZA 3HVJA 2AUTA 1Y3FE 3DMPA 1B41A 2I8CA 5JHGB 2DKNA 1ISMA 2PBLA 3IA7A 3ABOB 4LIPD 3R4CA 4N03A 4ZDJA 5IC4A 5LU9A 2B0JA 1LI7A 3KYIB 4MUEA 4EK9A 5KJ6A 3K5IA 1U3VA 4EHNA 1I2BA 1US8A 5FLEX 1KQGA 5D7BA 2DR2A 5J40A 2VUUA 1HF3A 5CAEA 2WWYA 1JUDA 1KI3A 3O0TA 3U60B 3OCCA 1E69A 2RHJA 1KFJB 5D1NA 3N74A 2DBQA 1E1CA 3GAMA 2HGZA 2IEDA 3GHYA 2FMIA 2I3BA 5TT1A 3LT5A 4PW0A 5D8DA 3T0FA 1JKIA 1OV4A 3T3DA 4XUGB 1ZVMA 2ZRAA 3A6DA 3NMUF 4J7AA 4QQFA 4UUNA 4L85A 5IN5A 2JW5A 4KBGA 4MEAA 5TVGA 2Y0EA 1P0QA 3HU5A 3Q8WA 1HEIA 3M6LA 4X6XA 4XH9B 5A5FA 5LQNA 1OVMA 1XRMA 5ADVA 4X66B 3KD2A 1WUYA 4YDQA 2F3QA 1E58A 1HKHA 1RE0A 2PKCA 5TNXA 3SE0A 1W0KD 1YNSA 4D4GA 4BYMA 2JFGA 5AVWA 4P3KA 1WMAA 1PWEA 1KZ7B 1J2RA 4YPVA 2OFOA 1HFJA 1P7YA 3L46A 3SDZA 5A9SA 4WJZA 3B3AA 4J9VA 3ZBUA 2Q2VA 1DAIA 1RC0A 3M9LA 4XJVA 3ONVA 1G5QA 1JG7A 1ZUWA 3A1VA 4Q15A 3TJRA 4JI2B 1EAMA 1XTPA 2GPTA 2NU7A 3Q6MA 4JLWA 1QRUA 2HSDA 4N76A 1FL9A 1DUSA 1D2HA 2Q9UA 5JC8A 1EDOA 1JEYB 2P30A 1MZVA 3UGJA 5FBLB 1GKLA 3IL2A 2A4MA 5IJZA 1U1EA 2PT5A 2PMBA 1AV7A 5E7IA 1NXXA 4BNMA 5BV1A 4DIOA 1LFDB 2GN6A 2O4CA 4QDTA 1DJMA 4ZTUB 1K98A 2PUDA 1CHDA 1DBIA 4XGQA 3T7SA 1O5TA 1XCLA 2PV0A 2WFZA 3TW6A 4H4CA 3QBTA 4PQGA 1CJVC 4R3NA 4TYQA 5DHQA 4KGZA 5T41A 4RDXA 3FMPB 1H0SA 5I3ZA 2GYUA 5J4HA 1PNRA 3OKFA 4MZXA 2AX3A 2D06A 3ZCTA 4E33A 3QV1A 2P5UA 4Q4HA 1RJFA 4FJ1A 4UHFA 1F17A 2AFHB 1E2FA 2ZYAA 4DEVA 3JAMA 1D2AA 5FI0B 1HX7A 2D59A 3U7QA 1JDUA 3OZWA 1I2DA 1JHZA 2EJUA 3LZDA 5DNAA 4IWNA 1YUBA 4MRSA 1LLDA 1P2SA 4J0GA 4GR5A 3WSVA 4LZAA 3ADOA 3IE2A 1RWBA 3VMFA 1DT3A 3WJ7A 4NIMA 4AIRA 3ET5A 4MQ5A 2HDHA 3ZX4A 3HPRA 4A8JA 1BDHA 3AF6A 4O6VA 2ZU0C 1W76A 3VPDA 5A4AA 3MSCA 2GKGA 2Z4SA 4OQXA 4D9CA 1RWWA 4BVAA 5K01A 1E3JA 3FDIA 1WMBA 1ZNYA 1I0IA 2DP4E 3B3JA 3OFVA 3ZY4A 4A8JC 3U37A 4C0JA 2YZKA 1EUDB 3MFYA 2BM9A 1X7DA 1ZSNA 4Y9TA 1UPUA 2GCOB 2ZR8A 5CDUA 1BMQA 1X7YB 2DVMA 2WIKA 3NHBA 4IDOA 2X9LA 1DELA 1U0GA 2EGHA 1YK1A 3LZ6A 3K0HA 1W8IA 3EF0A 3TQHA 4B4WA 2EKPA 4S1WA 1DDIA 4C4OA 3ON5A 5AIBA 2UU9B 4EG7A 1SU6A 3EIUA 4BVEA 3QLEA 1IG3A 4IDAA 1O7JA 3TYXA 1DG1G 3CB4A 3WV5A 1MXFA 2VWQA 5F33A 1M1UA 1SD5A 3X44A 3TECE 4MCHA 3M6VA 4I46A 1SN7A 1Y33E 3PC8C 3UJAA 2NMVA 1X1BA 1VE3A 3ZD7A 2PBFA 4FD2A 4P8RA 4BFVA 1JKFA 5C1IA 1NR1A 5BVHA 2J3LA 1Q3KA 3WIUA 5L3SA 2GEKA 2E4UA 1MV8A 1O9GA 2JGDB 3V8QA 1JEQB 4OOEA 1TU0A 3C7DB 3AP3A 2FSVA 4J91A 3G9ZA 4CM1A 4GLOA 1U2RA 4RPJA 4V0QA 5J2UA 4LHSA 2PMKA 3OCJA 4IWXA 3DBIA 1IU9A 9LDBA 4FKZA 2IZ7A 1ZS9A 2FSVC 2QYSA 3ZZ0A 1Q50A 3L7IA 2Y0PA 3KEMA 3JQPA 1YBAA 2R87A 1LWOA 2C2XA 3QU2A 5JS7A 4YY3B 1B23P 1OTYA 4GUDA 4JFAA 2QAIA 4LW8A 3WNVA 4TT8A 5GTDA 1DG9A 4DAOA 4HGQA 2VHYA 4AJ2A 1Q92A 2SCUA 5CB6A 2EP5A 2NO5A 4S12A 4BEJA 3KU4A 1IY2A 3H2KA 4ZOBA 3SBXA 3C45A 4LK2A 1DOAA 2XA9A 5EUBA 4S1VA 4DB4A 1RADA 3O4RA 4DNXA 4ZVKA 4BTLA 5F7OA 3WL6A 1KZHA 2CYBA 4PG6A 1VJ0A 3W8EA 1SKMA 2ZWPA 3I5AA 4N12A 3RUEA 4F3NA 1QIMA 2HIAA 1G21E 4RVUA 1E5LA 3BS4A 4JLBA 1I51A 2EZUA 4P84A 2CL0X 3QVKA 1DLJA 3FCAA 3VOBA 2G9QA 2FRVA 4FE7A 5E6SB 3FI0A 1P29A 4LVUA 3T3NA 1I94B 2JCSA 1QCZA 1XZNA 1JVSA 3NG1A 4GX5A 4QFMA 5AW8A 4QJ5A 3F97A 3OTHA 5DW3A 2FE4A 2ECOA 2I4OA 3DAYA 1Q3TA 3IP7A 3NX4A 2FSPA 2J3MA 3QBJA 4LE0A 5KC8A 3NYIA 2VFAA 3H13A 3PFFA 4IIVA 5F73A 4NPCA 2IYXA 1CY4A 1ECGA 1HQCA 1QK4A 2FFQA 4GDMA 4BCDA 4HDNA 1E6CA 3CLSC 4GOLD 4AKTA 1ZK3A 4C6TA 1YJBA 3Q12A 1JB9A 1AIPA 1EBFA 2AT1A 4FGZA 2C07A 1SQFA 3V48A 2HBRA 3LDHA 3VX3A 1RSZA 1YMQA 2WHRA 3OQVA 1KVRA 1UFRA 3RVMA 5EINA 3QX3A 4R8RA 4Z4IA 1PR5A 1ZR4A 2DCUA 3KT3A 4BHTA 1MT3A 4M1KA 5ARCA 5M3BA 3PNQA 1Z56C 4QARA 3TZ6A 3VVBA 4A6PA 4DG5A 2BKLA 1TKAA 1L7PA 1QFJA 4J16A 4I6JA 4YRJA 4PPGA 1NC1A 1EDBA 2B2XA 1QKJA 5D00A 2PXAA 5P8WA 3V7NA 5CAEB 3UWMA 2OXRA 3TQOA 1HDXA 1W48A 3CUWA 3M81A 2IXEA 5TEVA 2V1XA 4NJEA 5AQ1A 2PX8A 2QROA 2XUGA 3VNAA 1WCIA 2QVCA 1EMDA 3B1XA 2FFJA 3SG0A 3K32A 4JH0A 1DCTA 3U3DA 1W49A 4FD3A 4QG7A 5I7AA 1B26A 1SUEA 1JXMA 1XJ5A 1CU1A 3DP7A 2F9MA 2CXNA 2JEOA 2PS1A 2OBYA 5KSZA 4C03A 5LUAA 3OE7A 4CCYB 1QM5A 3P0IA 4YI5A 5JECA 2PHZA 3N2NA 4WY8A 1JIIA 3UJ7A 2F90A 5AJUA 3GAFA 4HDKA 1WABA 4P36A 5AI9A 5K0JA 5PNTA 1SULA 2CBGA 2UZ3A 2XB9A 3AR6A 3MBIA 2I1VB 3P9ZA 2WTMA 4QYWA 4DIFA 4DWWA 3PXGA 2EWVA 3CLKA 5KTYA 4D4LA 4E2FA 4BP8A 2RIPA 3ZX5A 4YRFA 2IDKA 4ZYYA 3YASA 4IIXA 1V7PC 4JQZA 1QHGA 3E9YA 1ARZA 2WJJA 1OR8A 2XJ9A 3S28A 4PZ9A 1B6RA 1IBLB 4KO3S 2Y77A 4QPCA 4B7AA 2XCIA 1UMBA 2B1GA 3VOSA 3ABSB 3AIMA 1NBHA 3KRTA 3HN6A 1G19A 3GB9A 4HB4A 1H05A 3B38A 1QIIA 3EMBA 1SAYA 2CXQA 4QYXA 4KXXA 4Q3EA 1U90A 4QWWA 1W4ZA 2BBOA 1YOBA 1E9RA 3PC4A 2WIFA 4O2RA 3V1NA 2ANBA 2VJDA 2YDYA 4KAAA 3ZDAA 1NP6A 2PVPA 4Z4FA 1R0BA 2Z2ZA 3ZE6A 4U2KA 4G5OA 1PT6A 1RLTA 2GN4A 2Z57A 4KQFA 4PLFA 4WKCA 4D9FA 3OA2A 2FP4A 1PG0A 1RYYA 3B1FA 1RKUA 3U7QB 1XF1A 2R8ZA 3ESZA 2WWXA 2UXCB 2HF7A 3C48A 4F6CA 5J2TB 3WI7A 3CZQA 2KE5A 2OZPA 1MRSA 4NCJA 2AFIA 2PH5A 1E62A 3UNXA 2D7CA 5ITVA 1Y9EA 2MHCA 5JEDA 2QQEA 4A8JB 1A4RA 4CG0A 1NQUA 2XCUA 3BILA 2QPTA 4CF3A 5IBCA 2ACEA 4ZZIA 4BO0A 2QRHA 2YZ2A 1XZFA 3O5AA 1RYBA 4GP9A 3ER9A 2IOFK 5KYYB 5BN1A 3ZIUA 5JNUA 1N75A 3C8MA 4NMMA 1Y3DE 4UCQA 2YIDA 5AVZA 1HQYE 3RUCA 1NKVA 4JOQA 1VP3A 1DJLA 3DMFA 2QZPA 3F6RA 4N65A 4GMHA 3QEKA 5GAJA 1UR5A 1U94A 1IULA 1E7YA 2EIHA 1IZYA 2H1RA 3I5UA 2ZAYA 4RKYA 2FEOA 4DPKA 4KREA 5AKYA 1CHNA 1CUUA 1NVVQ 4OF4A 4QDXA 2HK9A 4U2EA 3K05A 4UEQA 3D4BA 3EF1A 2A88A 1T6BY 3RODA 10MHA 2GD1O 1R6XA 4BLSA 3AUYA 4P32A 4NNJA 1TM5E 3X0DA 5TRTA 3CX6A 3S2EA 1J7JA 4G01B 4KZPA 1EHCA 4DRZA 2O2GA 5KYNA 3NCHA 1BYIA 4WZAE 3MMZA 3MAAC 4N8DA 5ALUA 4L8GA 4MP8A 5HIMA 3ZW7A 2CLMB 3DL4A 2YWDA 2NVUA 3JZDA 3QKRB 3ZOZA 2OT3B 5EG5A 4ZI7F 1XTUA 3Q40A 5LQSA 5TVKA 3F3SA 1WU8A 3Q10A 3V5NA 1U8FO 5EYPA 4AECA 1U63A 1XELA 5EWLA 5HM6A 2ZPAA 3L6EA 3KWMA 4JVLA 4XUEA 4QSMA 4RULA 3D5TA 1FC0A 3IODA 3IYLW 2CKDA 1F06A 1G8HA 2B4TO 4KH1A 4URVR 3IP1A 2A3NA 3UZUA 2YVQA 1N7HA 2SNIE 4MGZR 3S99A 1T5HX 2FHPA 2ZU6A 3IT1A 4F21A 1WS6A 4EP1A 4ODIA 4WASA 4X7PA 1POXA 1KC1A 3SSAA 4BBAA 4GP7A 1YQDA 3EZYA 1N9KA 3HXQA 2HCRA 5BQFA 3KSDO 4QICA 3AI3A 4BV8A 3PKIA 4KWTA 4Q9AA 5AI5A 1GPKA 1DX6A 1L3BA 1M9NA 1E6EA 3A1TA 3I8XA 3SIWA 4A6XA 1AUOA 3AB8A 3I6QA 4QYMA 4ND2A 4CR6A 3GROA 3FNGA 3MT8A 4BO1A 3MEQA 3LUKA 1GUYA 1Y7LA 3L2OB 1VBNA 1CUAA 2QRPA 4MRPA 1YMUA 5DIZA 3W2EA 4AG5A 3ACBA 1VG9B 4ZKDA 2PVCA 2ZJBA 4EJ0A 3KYDA 2QJWA 2JLWA 1TMYA 1MG0A 1TVEA 3BB1A 1U8CB 5BR1A 1KJWA 1SC4A 3ZXUB 3GW8A 4P2BA 5F7XA 3ZE7A 2PKQO 4HXFB 4JYCA 4OLJA 2BUAA 2G1JA 3TQSA 3THYA 1L8QA 4UHKA 1CUXA 1FMLA 3DL0A 1OBFO 1E2PA 1E2MA 1GGKA 1NATA 2JC3A 2PQ6A 3FTPA 4AY5A 1FTSA 4EPWA 4XVCA 4YAIA 5TARA 2OWDA 1QORA 3U81A 2XQIA 4B45A 3A6HA 1WQ3A 2LIVA 2ATEA 3H1GA 1DFIA 1GKYA 2CLDX 2GAOA 3DE3X 3L05A 3RC7A 3VVCA 3M6IA 4KLZA 4YASA 1WLYA 2CMDA 3BSYA 4ITUA 4MS1B 3UUGA 5B58T 3KIPA 2GPJA 2Q5HA 4G8DA 1U2GC 4NU8X 1YS1X 4GD3Q 1QH8A 4NAUA 4YJHA 4CKCA 4YDSA 3VR3D 3DEIA 4FOOA 2XUOA 5JXHA 3UGQA 3W78A 1C0PA 2HIMA 3DEAA 1IOVA 5JDIC 1PUJA 1TDJA 2QN7A 2Q2WA 1BW9A 5EP1A 3VQTA 3HNRA 4LFAB 1G9TA 1ZK2A 5KVSA 1A9XA 4Q3OA 2RHMA 3EX7C 1U80A 1W0JA 2I4RA 3AY3A 3T1QA 1M8PA 2RBGA 3K15A 1OE0A 3JQGA 3RS4A 4TM8A 1FX0A 5CNMA 1JGTA 1SUCA 3Q8MA 3H1FA 2C95A 2C3YA 2WJ6A 4NJEB 3BMQB 2AK2A 3FOFC 2P9EA 2B2NA 3HLKA 1UBMS 3OCYA 4P81A 2HSGA 1TUBB 3AL2A 4WFQA 3FTDA 1W29A 5IVHA 1CBUA 2GHRA 2HWKA 3K9QO 2GPNA 4O4IF 2A1UA 3JALB 3ZXYA 4JKOA 5DYIA 1B6GA 1Q6YA 1NUQA 2EFJA 1QRRA 2N47A 4FONA 4DM4A 4O8ZA 1XQWA 3E8XA 1PNOA 3BWMA 4Y9RA 4B8ZA 1JHRA 1USVA 2ZI5A 3CVUA 3NEPX 1JHOA 1TO1E 5KVAA 1EB8A 2FZWA 2DBRA 3G7SA 5G41A 5JWHA 3GCDA 1VHQA 2WKPA 3OJLA 1C29B 1P7VA 5I9MA 5LBUA 5SYAA 3CINA 4HFRA 5TT0A 3KE8A 4F5EA 3WYBA 2XWQA 3CLRC 3OQPA 4RNCA 1FVFA 4RL4A 3L0OA 4L0DA 4XOIA 4NG4A 4BUZA 2QPOA 3IPLA 1XLTA 2D74A 4BRUA 1KNXA 2OFXA 2OFWA 3WJAA 2HRBA 2V9CA 3FE2A 4RQAA 1QDUA 3RHZA 4INAA 1WW2A 4K9SA 3COSA 4KNVA 3OM8A 3NTRA 1P5HA 4S0XA 4X3PA 4TLDA 4MTCA 1VPWA 4NOJA 3PHIA 3OPNA 2G5GX 3A2MA 3T7DA 3D3WA 3HC7A 2QKYA 1CB7A 1Z7BA 4NPAA 4QUEA 3U0BA 3DB1A 4G56A 5FB3A 3Q9NA 1V71A 3T5CA 4I1IA 2EEZA 4AZWA 5FUMA 3E9EA 3KZOA 1FUKA 2Z6VA 2VYFA 3GCZA 3TL2A 1F0YA 2BISA 2LRHA 4NFSA 3WNDA 2D7DA 1B7GO 2Y1WA 1TF7A 1KJZA 4Q39A 1NN0A 2AHOA 2O14A 3LNCA 3Q3CA 3OX1A 2AFIB 4M3NA 3EA4A 4F60A 5DX1A 1G5RA 4QGSA 4R1QA 3KQHA 1KEPA 4C3VA 3R9XA 4BNWA 4DLZA 4CLRA 5HKKA 3HDHA 4K8OA 2FZKA 5AVYA 5HILA 4F93B 2IT1A 3K92A 2O8EA 1SZCA 3T15A 4RWEA 1G7RA 5F5LA 1RXUA 4FFSA 2A78A 3F98A 5K8JB 4UM7A 5DGDA 3HA7A 5GJWC 4WZZA 2FN3A 3ZGZA 3SZMA 1FPMA 2G17A 5FFFA 2C57A 1WPQA 4M87A 3MM4A 2UUBB 3I5MA 4N5NA 4P86A 1VA4A 1Y4UA 3HCEA 3V8BA 4AY3A 3AVVA 5EESA 4R6WA 4MW9A 1R5NA 2B8WA 1CJCA 4RXUA 1HR0B 5KREA 1K7YA 2VDOB 4O4LB 2XVYA 3VV2A 5D3ZA 4D0NA 2ZRJA 4ETIA 1SXJD 4O1MA 1X9GA 1IOLA 1QIGA 2J9RA 5IYZF 4XQ0A 1P3Y1 3IBSA 2RHGB 4UHBA 3A1EA 4GXQA 3W5VA 1AV6A 1O6FA 4MK4A 1PTKA 1EQUA 3A28A 3IAEA 3ELDA 3KJNA 5E6UA 3L0BA 4NBUA 5WRFA 1Z2OX 3A36A 4IBOA 5LWQA 4MCIA 4XX0B 2Q4RA 1NVEA 1XKXA 3E81A 5A6SB 3PEVA 2HF2A 3OZXA 3HVRA 2BMAA 1BKYA 1JLLA 5C7LO 2RBEA 4BLWA 1WZIA 3VGJA 1NG1A 2QRKA 3ZV6A 1PTJA 4WJLA 4J1TC 4BKQA 2NO4A 4II2A 2BTOA 3P52A 4C4XA 1F5SA 1MC1A 4WCVA 4P0PB 3WB9A 2RJ3A 3OPMA 4TWZA 1VIVA 1DTWB 2NUAA 4ENSA 2HU7A 4EW1A 5FXMA 3HYTA 2N9UA 1NUAA 5DNDA 5FT9A 3U4DA 2LNDA 1Q0HA 3AR8A 3ANMA 3KJZA 2Q5LA 3BH0A 5KTSA 3O2NA 3PGKA 2ZRMA 3MBKA 2FRXA 1TK3A 3DAHA 1OLUB 2NUBA 4JX9A 5LZ8A 3RR2A 1A5AB 1T9HA 2E4VA 4EF4A 5DM70 2BOVA 4K6MA 4QX6A 5FPTA 4DA4A 1BSVA 2ZQZA 4A91A 3T5PA 5L4LA 2XOEA 4R1MA 5HRCA 2BGMA 2O2JA 4Q1FA 1O0BA 3P5BA 4XWKA 3HDJA 3KEFA 5DDIP 1NJ5A 2WD8A 5GGYA 3BWDD 4IUYA 5ADUS 1G8KA 1L5QA 1U0JA 1E9SA 2ZULA 4KUHA 1XTTA 1J2EA 1SIOA 3NJ4A 1P1KA 1TUGA 2J0UA 3HI4A 4N5DA 1CDOA 4MUIA 4P38A 3ZI4A 4FYPA 2ATVA 4Z3OA 3MMPA 1O6CA 1IN7A 4HQNA 4E13A 3X1YA 5JVDA 2JCBA 1LPMA 2JI4A 5KNLA 4MWZA 2W6NA 5ALLA 1YTLA 5JBIA 1RQXA 3WK4A 1QK3A 4W1QA 5HWSA 1MVNA 3A4MA 2RD2A 3UHPA 2PSSA 5CBKA 2IX9A 2NNLD 3O26A 4J4TA 5K3BA 3N70A 2Y68A 1K5PA 2QUIA 1KETA 1Q77A 2B4KA 2GXQA 4S1OA 1QG6A 5EEGA 2Y4OA 1JDJA 1YR1A 3I23A 3WYAA 4BGIA 4YBZA 3ZDRA 2C94A 3RFCA 3H9QA 1JEEA 3P2OA 3UYKA 3EG5A 1GRQA 1K2WA 1QFYA 4WERA 2HLHA 3NUGA 1A95A 4LHZA 5HKLA 4DQ0A 2VAXA 3K9WA 4JITA 2BP7A 3WQBA 2R4TA 2KPOA 2WSIA 4YJHB 1Z0SA 3O3OB 4LDJA 3UHJA 2DKOA 3P2JA 4AO7A 2IS2A 4E3ZA 5EZQA 2DX7A 3T3OA 3E3LA 4DEXA 4UHEA 2OZVA 2WF6A 1NJ2A 2X15A 1WXGA 4GKBA 1XOIA 2ATXA 1W5SA 4W7IA 1QHSA 5GOTA 4KN6A 3ZW8A 1WF3A 5IVIA 3UT5B 2DHCA 2YC4C 3PPXA 3QVXA 3D4NA 4Q12A 3G2NA 2C7BA 2EP8A 1XLWA 1G5HA 1QTRA 2RKWA 2ZSEA 3R3WA 1NUTA 4Z49A 1CIVA 1Y82A 5DLYA 5L53A 1P2VA 3GFOA 2BMVA 4ZARA 2FPLA 4V3CA 3RABA 3L8GA 1ZOOA 4ZO4A 1FA9A 1TZJA 3GNTA 5G1OA 4WAUA 3R6GA 5JO0A 1QG2A 3ABRB 3QIAA 4OQLA 4DR1B 4M7WA 1E0JA 5C18A 4EB3A 2RB5A 1T3LA 2N3ZA 1GPAA 3H86A 2W6JA 2QD2A 2Q7XA 2XTMA 1VZ3A 5LKAA 1GQOA 4DUZB 3H9CA 1RAEA 1JB1A 3E5MA 1N9GB 3RJZA 1PZNA 1WHSA 2CLKB 2GTHA 2Y99A 1FVXA 1I3OA 1PFKA 1Y6ZA 2X0JA 4FNAA 4XGKA 1Z26A 1UM9B 3U4IA 3K9FC 3RS7A 5A4IS 4OFBA 2PZBA 4ML3A 4BEWA 2CKMA 1IL0A 2FTKE 3PT5A 4QRHA 4AT1A 4P7FA 2O2SA 1K4MA 1UOPA 1OZHA 1KSGA 3FZYA 2QQFA 2IWRA 3ZC3A 3BXEA 1JHXA 3I3SR 3MQ2A 4JWTA 4MINA 2OECA 4PCUA 2H7CA 3Q8LA 4N7JA 4YCLA 3PNMA 1P5FA 3EXEA 3QFSA 4UKDA 3IMFA 3MLBA 4CM3A 1SXQA 2Q5IA 3E3NA 2O48X 2XBLA 1AMOA 1UXIA 3EQZA 1XKLA 2OHVA 3OEEA 4JEUA 1N78A 4KQGA 2I5PO 2YHIB 2WU8A 4RQTA 1Q16A 3F74A 5DP2A 4WEOA 3WWDA 4Z7JA 4Y9DA 2FMTA 3TLKA 4EPYA 2N1MA 2ZUUA 2O8DB 2FK8A 3RKRA 5TQVA 3OZAA 5AW3A 5K3SA 4JI8B 4K9OA 3V2GA 4QOFA 4W5WA 2EJTA 1LX6A 1R37A 4PYKA 3R75A 1IY9A 4OXQA 1T2FA 2J3IA 1DU4A 3DH0A 1PZFA 1G6HA 3MAGA 2X5OA 2WSYB 5U9CA 2XH8A 1YI0A 3V9PA 1ORTA 3H6GA 3IUQA 4I14A 3QFHA 2ALJA 1GAJA 1BIFA 1CQJB 1YZKA 2W6OA 4MHTA 1WMDA 3A70A 3FX2A 5EJIA 4CLRB 4N9WA 1V8PA 2ZR9A 2ZBFA 4UFNA 4EPXA 2XZOA 1E2DA 1FNBA 1RKVA 4WADA 1FP2A 3QYPA 1GKUB 1J0DA 2QT1A 4EITA 2A94A 4URUR 3LOPA 1ZNWA 3IILA 3IMEA 4A0SA 4B1FA 5A9RA 2BEVA 4X64B 1KO1A 3DBVO 3H11B 3IBGA 4X62B 3NTQA 2IHJA 5FYQA 4ALNA 2J85A 3A25A 3KDPA 3P45A 2IPNA 3PCXA 7REQA 2ODPA 1C2YA 2YJGA 3OFJA 3EWIA 1G4UR 4KDFA 4MKFA 4RZHA 4EZEA 3V2HA 3PGLA 2NW6A 3L8EA 3LMKA 4CODB 1GJRA 4XQCA 5K5EA 2J0QA 2PJUA 4HDSB 2PKRA 1BXZA 4QOGA 2W0SA 3C5WP 2GBLA 2GN0A 3LCCA 4KUGA 1WUHS 2QTTA 3KS9A 3MWEA 4N0MA 4MRMB 1USKA 3WAKA 4EW3A 5BMOA 1YI8A 4HX5A 2G40A 2POQX 4H1TA 3E0XA 3NHZA 8LDHA 5I9NA 4GIBA 4EJMA 1H2ZA 1ITZA 1O95D 2REQB 3IBYA 4DR5B 3E1KA 4U3JA 4HGRA 3WXMA 1ZUHA 2FEMA 3C7KA 4FZ5A 4NV3A 3O9ZA 4R41A 2PX5A 1K8QA 1M72A 3TSCA 2BGJA 2W6IA 4KYIB 4DCSA 3HU3A 5K20A 1FUUA 1HDYA 4V03A 5KYTA 3HXLA 4TKUA 1YJXA 4FYKA 4GNRA 1VL2A 3ICVA 4N39A 3DBRB 1U6KA 3W04A 3ZKAA 1UP7A 2NUAB 1KFKB 2GTPA 1Q1GA 5FBWB 4MUYA 3W05A 3FPSA 5D5QA 3DLHA 2XGSA 1YL5A 3CNBA 1QPBA 4W9RA 4F4UA 1EWQA 1FTWA 1BWQA 4WTOA 4TV9B 3VNVA 3TIVA 4YJFA 3WNCA 2OO3A 3V4FA 2GCNA 3FWNA 5E1OA 1R10A 3CGGA 3FYSA 4MV5A 5JD3A 1SK9A 4N41A 4L5CA 1FJHA 3HKDB 1T4MA 2G71A 4ZC1A 2OAP1 4QPNA 3DKRA 3RS5A 1GLNA 2YZMA 2B78A 3HQ4O 4U7TB 3T3EA 2YN2A 1EGMB 1SA0A 1F0PA 2R60A 2WP0A 4QUAA 3K1AA 4IHJF 2HSWA 6CHYA 3IV7A 5DOZA 3MFQA 1U1DA 4RVHA 4BLOA 3IR6A 2X3YA 1CZLA 1B4DA 2DTDA 2R1UA 4MQLA 1U31A 2J0UB 1QQ5A 3IOEA 3P9IA 3N3AC 5AK6A 3UO8B 1M8JA 4WFKA 5FX2A 4UNPA 4IDBA 5AKKA 1I1OA 2A9OA 3ILXA 1GZVA 2CUNA 1N8SA 3EY4A 4Z54A 1TKCA 2AJBA 2VXYA 1G66A 2PY6A 3V4LA 4DQUA 4ZIRB 3UGTA 2A5GA 1M7HA 2JA2A 4KMMA 2LCIA 4BMNA 5BW4A 5CG2A 1KRHA 1X2BA 3JATB 1IJEA 2YKGA 5K8TA 5FOWA 4NCAA 4LJ8A 5EE1A 2QUHA 2H9IA