2PBLA

Crystal structure of a putative thioesterase (tm1040_2492) from silicibacter sp. tm1040 at 1.79 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
262
structure length
262
Chain Sequence
GMELDDAYANGAYIEGAADYPPRWAASAEDFRNSLQDRARLNLSYGEGDRHKFDLFLPEGTPVGLFVFVHGGYWMAFDKSSWSHLAVGALSKGWAVAMPSYELCPEVRISEITQQISQAVTAAAKEIDGPIVLAGHSAGGHLVARMLDPEVLPEAVGARIRNVVPISPLSDLRPLLRTSMNEKFKMDADAAIAESPVEMQNRYDAKVTVWVGGAERPAFLDQAIWLVEAWDADHVIAFEKHHFNVIEPLADPESDLVAVITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative thioesterase (YP_614486.1) from Silicibacter sp. TM1040 at 1.79 A resolution
rcsb
source organism Silicibacter sp.
molecule tags Hydrolase
molecule keywords Putative esterase/lipase/thioesterase
total genus 92
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pblA01
4L72A 2RHTA 3IA2A 1B6GA 3IUNA 5FP0A 5KWJA 3IURA 5ALFA 1MN6A 5LZ7A 1B41A 3STXA 4H35A 2XMDA 3STTA 5AOBA 4Y2JA 5AM1A 4ZWNA 4X94A 3C6YA 2G4LA 3NOXA 4DNOA 2XQFA 4BC1A 4K6KA 1RP1A 3QYJA 2PBLA 2HDWA 5AKZA 3QITA 2HA3A 2O2GA 2WKWA 3NUZA 5SYNA 4EY6A 4IH1A 3PFBA 1UWCA 3MGAA 4AO7A 1HDEA 4WY8A 2C5FA 2LIPA 3WK7A 5HZGA 1BEZA 5CXXA 1YA8A 4GI1A 1GKKA 5LLSA 3R3XA 4C6HA 3I2KA 1VE6A 5AIBA 3ZLUA 2HFKA 4H18A 4W1QA 3R40A 5AICA 1BROA 1GXSA 5JYCA 5IKXA 2QOEA 5JZ9A 5AK6A 1LPSA 3A6ZA 4UHEA 4J0JA 3K2IA 2QXUA 1BRTA 1GQRA 1QIFA 2I03A 4QDTA 4AB1A 4BDSA 2ZJFA 5CT6A 5HK8A 4KACA 2DHEA 5ALRA 3BJRA 4EY5A 1EDBA 1XZGA 5LZ8A 2OXEA 3C8DA 3ESCA 3FLEA 4AMZA 3CCBA 5AM2A 5HF8A 3BF7A 1ZD5A 2VA9A 5FRDA 3ILSA 1W1IA 3ZLVA 4I19A 1MNAA 1THTA 2BKLA 5HF5A 1E8DA 4J3JA 3D7RA 5DYWA 3STVA 2BGRA 1WHSA 3C5VA 5JAUA 1AGYA 2J3DA 1LPMA 4CG3A 3WL7A 3WQHA 2XMBA 2XMCA 3B12A 3WA6A 4B84A 2WHRA 3I2IA 4P9NA 2WHQA 1QIMA 2OLEA 5AKEA 5LYYA 1CUDA 4GLBA 2PSJA 5ESRA 1MAAA 2OCLA 4MWTA 1XQWA 1VOTA 2OGTA 2PSEA 1E5TA 2QKYA 4OPMA 5DYTA 2PX6A 4K5QA 1Y7HA 3QMMA 2JEZA 2K2QB 3IUQA 3D2BA 4JUIA 4J0CA 3I1YA 4I3FA 3HEAA 3O4IA 3N0TA 1QO9A 4ZRDA 2ECFA 3U0VA 2O2IA 1XKLA 4DNPA 2IIVA 3DL4A 4AZ0A 1LPAB 3GROA 3W9BA 3I6ZA 1FFAA 4W1SA 3ZI7A 2DHDA 4BAGA 4HS9A 2UZ0A 3VVMA 1XZJA 4F0JA 4H7JA 2DCMA 4H7DA 3QPDA 3A2NA 1XZFA 2WTNA 1ZD2P 1UK7A 4G9GA 2HM7A 4HRXA 3DYVA 4BRZA 2JGJA 4X3CA 1A8SA 4KRYA 3WJ1A 1JJBA 3WKAA 3FYUB 2WM2A 1IMJA 5ALXA 2VSQA 3WKEA 4H77A 4JNCA 5ALKA 1XLWA 3FCYA 2WJ6A 4RGYA 3Q0TA 1O6GA 2HRQA 3OPMA 2VJAA 4OU5A 4A5SA 3R41A 5FPPA 4ITVA 4ARAA 4UUQA 2PUJA 2GZRA 1TRHA 1XRRA 5LZ5A 1R50A 2PL5A 5AKIA 3UUEA 1QIJA 1N5MA 5JZBA 2XQJA 4G8BA 2CEKA 3G02A 1XZEA 1G66A 2VJCA 3E0XA 4OB8A 1CUIA 4FWBA 2WHPB 1FFEA 1YB7A 3H1AA 2DFPA 3E4DA 1IUPA 3JWEA 3I2GA 3ANTA 1K5PA 3FBWA 2GYWA 1CUAA 4DTCA 4EY4A 1CLEA 4ZGBA 1QLWA 5AM3A 3QH4A 1AURA 4IHAA 1W75A 1HKHA 4LXGA 2VAXA 2Z5GA 2PKYX 1E89A 3I28A 4OCZA 3VJLA 4Y2XA 2J3QA 1SOMA 1QE3A 4QWWA 4X95A 5IVKA 1E3QA 2OAEA 1CUEA 3W2TA 2WFLA 4BVLA 3WIBA 4OYYA 4J0IA 4BB0A 5ALUA 3AINA 4Q1VA 4W1PA 1YR2A 1TIBA 5E4TA 1XZCA 1P0PA 4UBMA 5ALGA 4FHZA 2WG2A 5AI6A 4CIBA 4HXEB 4X6YA 3G9TA 3BWXA 1IUNA 4ARBA 4DM7A 4KJXA 4E15A 4U2DA 1QFSA 1W6RA 1AUOA 2WU3A 1ZI9A 4PNZA 1MJ5A 1L7AA 4NS4A 3FSGA 4BTLA 3VKFA 3DLTA 4W1RA 2VT6A 3C5WP 1XZIA 3E1GA 1UT6A 4BRSA 3ZLTA 1UZAA 5AKXA 4QE3A 1X2BA 3WYDA 3FYUA 2O7RA 3FOBA 3DKRA 2QTBA 4C01A 5CT9A 4DYHA 5JD6A 5FPQA 2OG1A 1PV1A 2YH2A 4ZV9A 1UK8A 1CQZA 4B7ZA 3PE6A 4A23A 4X93A 2H1IA 4O08A 1QO7A 5AOAA 4H7HA 5BWCA 3PF9A 4G8DA 4X97A 2CKMA 1Y7IA 5AI9A 5A6VA 3GBSA 1IZ7A 2V97A 2BUAA 1TAHA 1NX9A 3VJMA 4BC0A 1N8SA 3X3HA 4WFIA 1A8UA 2WSLA 5KWIA 3IVMA 5HF9A 1EHYA 4PSCA 5ALHA 3Q8WA 2H7YA 2XQIA 4P08A 5AHXA 5AJHA 2YXPX 2HA6A 1BCSA 4UHCA 3JYHA 3BXPA 3R3ZA 4X00A 4MQMA 1AX9A 4WFKA 4P92A 1EVQA 3KWJA 2B4KA 3H0CA 4ZI5A 5HQ3A 2OCKA 1NU6A 3W04A 5ALTA 4UBIA 4DSZA 5LKRA 2D5LA 3IUJA 3L1HA 1IZ8A 4QWMA 4Y7DA 3OTQA 3AUKA 4F21A 4FNMA 3HSSA 1JKMA 4X6UA 5AIAA 5K3FB 3CN9A 1K63A 4RPCA 1G4HA 3QZUA 1DX4A 1FFDA 3FYUC 3OOSA 4Q05A 2XI4A 5T4BA 2B61A 3HABA 3M81A 3SX4A 3D0KA 3WWOA 1ODSA 5C8XA 5A7GA 2HU5A 4MQLA 2DQYA 2JGEA 5KBYA 3K6KA 3UUFA 2WUEA 5JIBA 2WIKA 1HL7A 4FFWA 5DNVA 1CUWA 1WOMA 2CJPA 1MO2A 5CH3A 3WZMA 4W9RA 1E66A 4DMCA 2Z3ZA 2Z3WA 3IIIA 1XLUA 4FTWA 4DNFA 1XRPA 1P0IA 2J4CA 2JGIA 1ODTC 3CXUA 3AZOA 5ALZA 1YAHA 1HBJA 3WYNA 5ALJA 2FJ0A 1CFJA 2HA2A 4X7BA 5EFZA 2QS9A 2VQ6A 3DDUA 4EA6A 1G5FA 1ZOIA 2WFMA 2DQZA 3RK4A 4EY8A 1GPNA 1VKHA 4U2BA 2XDWA 3GELA 4H7KA 1ZGBA 1CUHA 3QPAA 2ZVDA 5C8VA 1ORVA 3H2KA 3KWFA 5AM4A 5LIPA 1T4MA 1W4LA 2XMRA 1PFQA 1JJFA 2VT7A 2BJHA 3D59A 5JZSA 3I2FA 1WB5A 4F60A 3QMWA 3WZLA 5AKYA 4U2FA 4KR0A 2WJ3A 5K3DA 3V1LA 2WU4A 1MX5A 1LPNA 3MVEA 2PSHA 5E4JA 4BBZA 5ALNA 3FLBA 2FUKA 5DNWA 3B5EA 3C87A 3EQ8A 2WIJA 4AQDA 5A7FA 1QIKA 2HADA 5ALMA 4DLNA 5ISMA 4B82A 1E8MA 1CUUA 2XUDA 4AN1A 1CUVA 5ALIA 4HTAA 1CRLA 5ALOA 1H22A 1EB9A 4B9EA 5BV7A 3CN7A 1FJ2A 1DQZA 3O4HA 1EXWA 2V98A 4MXDA 1CPYA 4UFNA 1KU0A 2JBWA 4Q3LA 4EY7A 3BJMA 3QM1A 2BAGA 3FVTA 1ETHA 1ZIXA 2JF0A 4OU4A 4K2AA 2BFNA 4X92A 3DCNA 5H3HA 3V1NA 4BYMA 4C87A 3C45A 3HXKA 5K3FA 1KU6A 2ZYSA 4GWLA 5IVHA 1JU4A 1P0QA 5AKGA 1K8QA 2WQZA 4LYDA 3TGLA 1AQLA 3V1KA 4DMFA 1XQVA 5LZ4A 3WL8A 3DKKA 4BE4A 4WDQA 3E3AA 4Y2VA 4KAFA 4H7IA 4TGLA 2QMQA 1E8NA 5CT5A 2CMFA 2J4FA 2AXEA 1VXOA 2VAVA 3N2ZB 1YB6A 2Z8XA 2HA5A 1QONA 5C7YA 5T4FA 1LZLA 2ACEA 5EIEA 1XZMA 2WIDA 5HKBA 2XB6A 2QR5A 4EUSA 3I6YA 3VDXA 3I1IA 3I2HA 4RE6A 1ZGCA 3A2LA 4HAIA 5IVDA 2OQIA 3AJAA 2C4HA 4MYSA 2JEYA 4EZIA 3RM3A 1L7RA 1W76A 3WK9A 4OD0A 1YASA 3DNMA 4N8SA 2BUBA 1C7IA 1YAJA 4L9AA 4BAUA 4B6GA 5D6OA 3STUA 1UXOA 4QDUA 1BN6A 1DTEA 2HFJA 2JGKA 4QNNA 2OQVA 5AK5A 2Y6VA 2WUDA 2WUGA 3PF8A 1YS2X 5CBKA 1MX1A 1USWA 1PJAA 1TKRA 3IB3A 2ZSIA 1AC5A 3PUHA 3R3YA 3F67A 1GT6A 2XLBA 3M82A 1ZJ5A 4UBLA 3PFCA 3R3WA 2VEOA 4H7FA 4KE9A 1ZI8A 3G0DA 4C4YA 3WWPA 2G5TA 4FLMA 2RONA 4BCDA 4A16A 2DR0A 1LPOA 4MJ3A 2O7VA 4L3WA 2PM8A 3KD2A 1QIGA 3YASA 1ZJ4A 4N8DA 4XJVA 3WI7A 3G0BA 3SWWA 1DT5A 2DHCA 4OB6A 2NW6A 1HQDA 3FCXA 1ODCA 1CEXA 5FXMA 1ISPA 4UBKA 4PSDA 1JMKC 1H2XA 4IH4A 3EQ7A 1ACLA 1XRNA 4NVRA 3OM8A 1R1DA 1SCKA 2WLSA 1YS1X 1C7JA 1EX9A 5FLKA 1DWPA 1XZLA 4DMHA 3LP5A 4M0EA 3WLAA 3WK5A 1MAHA 2PU5A 2Y6UA 1X2EA 4QDZA 2EDAA 4B83A 3H19A 4ZREA 1JT2A 1VE7A 4KAJA 1DWQA 2PU7A 5DLPA 5JD4A 2G63A 1JI3A 2XUOA 3G0GA 1F0NA 4S0XA 1XROA 4E46A 3AIOA 2FJPA 5CT8A 4HZGA 3C43A 4N5IX 4G4JA 3RKSA 4C89A 2R11A 5K3CA 3QBJA 2GZSA 4M0FA 1C4XA 2HIHA 5HQ3B 5AH0A 4B80A 5CW2A 4EHBA 3HACA 3VISA 5JASA 4J0HA 4B85A 4U2EA 1CUCA 4XIIA 3WKDA 4E11A 3KXPA 1A88A 4UFOA 3HJUA 1EB8A 2WUFA 4WDRA 5D3KA 3IUMA 4G8CA 2XMZA 3F97A 4AXBA 3LLCA 2PVSA 3G9ZA 3D4LA 4CG1A 1CUXA 4CIAA 2HRRA 2Y1KA 1BN7A 1TQHA 4BVJA 1J2EA 3DOHA 2ZJ7A 3WWCA 3W9UA 5AO9A 2QXTA 2HA7A 1K4YA 5LKAA 2W6CX 2CBGA 2DSNA 5DWDA 1XLVA 5JD5A 5AM0A 4X85A 1JJIA 4J0KA 5JARA 4J03A 4FFVA 1CQWA 1QIIA 3C70A 5ALQA 5IH7A 1GQSA 2QRUA 2JGMA 4FOLA 3HC7A 1VZ2A 2W22A 4BTVA 3KDAA 2WILA 1UK6A 1ZI6A 5A7HA 3BF8A 3OURA 3MUOA 1CV2A 5J3JA 5AK4A 5EHNA 2VATA 3D2AA 1XZKA 3DQZA 1DQYA 4Z49A 4NZZA 4G9EA 3H2JA 3V48A 5ALSA 1GGVA 4WJLA 3L1JA 5I9IA 4UBOA 1LZKA 4RNCA 2O2HA 3IDAA 3MUNA 3WKBA 1JMYA 2QUAA 1ZD4A 2XUHA 3BIWA 1EK2A 1CUBA 2D0DA 4OSEA 3VJKA 2QZPA 3WJ2A 5AM5A 3WL5A 2ACKA 2BGNA 3LS2A 1KEZA 2ZYIA 4H0CA 4QA9A 4QDXA 4WY5A 2GYVA 4AZ3A 3SK0A 1EDEA 2FX5A 1A8QA 4N5HX 4QZVA 1UFOA 5D7BA 4UPDA 5C8ZA 4LXIA 4LYEA 1XZAA 2RHWA 4PF1A 1W52X 5CT4A 2QT9A 3S8YA 3AILA 4U2CA 2BCEA 3IBTA 4PSUA 3HYSA 3PDCA 1CUYA 1S8OA 4G4GA 2C5GA 2VJBA 1GKLA 1FSSA 4J7AA 4G5XA 5CTAA 4LIPD 5JAPA 1MX9A 4Q3KA 3S2ZA 3SC2A 1VXRA 4QDOA 3PI6A 1TCCA 4B0PA 3ESAA 3I2JA 2YYSA 3D3NA 4Q3OA 4TPKA 4BZWA 1EA5A 1TK3A 1U65A 2ZYRA 4EBBA 4B9AA 5JANA 3VVLA 5KREA 3H18A 2C0QA 5ALYA 4FNGA 1OCEA 1Q0RA 2C58A 3AFIA 2XUIA 2CZQA 1EI9A 1N5RA 1Z68A 7YASA 5DYYA 1WCYA 5BWBA 1XRLA 1O6FA 6YASA 1XQXA 5K3EA 1U4NA 3O95A 1EH5A 2XUQA 4BP8A 1BCRA 1RYYA 4UHHA 2HA4A 4J0GA 5EGNA 3H17A 4IH9A 5D3ZA 5K3BA 1H2WA 4RE5A 2R8BA 3LCRA 5ALWA 3STWA 3D2CA 3ZPXA 2CB9A 5AI4A 2XQGA 2AJDA 4QLOA 1U8EA 2QVBA 1FFCA 4Y2SA 4GECA 2HU7A 5AK3A 2VJDA 2HA0A 3H2IA 1UKCA 2ONCA 3TJMA 1HPLA 4CCWA 3L1IA 1Q0ZA 1ZIYA 4OUKX 1MNQA 4PO3X 4X6XA 5A2GA 5CH5A 1CUJA 1R3DA 4MEBA 4KE7A 3JW8A 2AJLI 1VLQA 4UHBA 2C0PA 5DTJA 4FLEA 2JGFA 2QJRA 3P2MA 4MYDA 2EDCA 3GFFA 1SCQA 5AP9A 4BATA 1BS9A 1YCDA 2X5XA 1TCBA 4XVCA 1WM1A 4YASA 1U2EA 2Q0XA 3R0VA 5JAOA 1ZD3A 3BIXA 1IVYA 2HHAA 5AOCA 1XZDA 1Y37A 5SYMA 3WKCA 4B0OA 2XUKA 5T4HA 2PUHA 1UK9A 4X71A 1JFRA 4YX9A 1UKBA 2ES4A 4WCVA 3ED1A 5AI0A 3DJYA 5E2IA 4TVKA 1CUSA 1EVEA 5CXUA 2BUCA 5DTIA 4N8EA 3ZWQA 4HRYA 5JAHA 5EHXA 1EK1A 4G1FA 1SFRA 5FDFA 4JYMA 5JALA 2WFZA 2H7XA 2JGLA 3O4GA 3R3VA 3AZPA 4QLAA 4X90A 1M33A 4UHFA 3PUIA 2ZSHA 4K6GA 4LHEA 4GHWA 4FDMA 3WK8A 1MU0A 2XUGA 1A7UA 1XRQA 2ORYA 2P8SA 4AO6A 5AKJA 2XUJA 5FOQA 3T4UA 2V9ZA 5AI5A 2HL6A 3QMVA 4BE9A 4QEKA 3OG9A 1Q83A 3D5EA 3EF3A 3O4JA 2OGZA 1BE0A 3ANSA 4FBMA 3WK4A 2XT0A 1DU4A 1MT3A 5AI8A 4W63A 1LBSA 2WG1A 4DMKA 1MTZA 1TCAA 3ICVA 4GW3A 3GA7A 2OGSA 1CVLA 3DYIA 1AMNA 2VTVA 3DL7A 4U2GA 3KOOA 3FAKA 1BEEA 5T4EA 1UOOA 5CURA 3H2HA 1XKTA 5ALVA 1AZWA 1VA4A 2XE4A 1X70A 3ZV7A 5LZ9A 2XQKA 1XZBA 2PPLA 4UBNA 2OCGA 4L0CA 3F98A 4Q82A 3ESBA 3EQ9A 3BDIA 5YASA 4Y2PA 1T2NA 1GZ7A 1VA5A 4INZA 2WTMA 4UFPA 3R3UA 4HVTA 3H04A 4HXGA 5JADA 4ZXFA 5AKLA 4BZZA 1MPXA 1CR6A 1H23A 3TEJA 2Z8ZA 1WB4A 2XMSA 4CG2A 1XRMA 1J06A 4GDMA 1BU8A 1QGED 3BL8A 5A71A 2B20A 3A2MA 3M3DA 2I3ZA 1YA4A 4BCBA 2ZYHA 5EIAA 4C4XA 3HRHA 4BCCA 4C88A 4AN0A 5CH8A 4AO8A 5BOVA 2B9VA 3GUUA 4WFJA 2H7CA 4AMYA 3C6BA 4GXNA 2AJCA 1R9MA 2WIGA 1R4ZA 4I4CA 3RLIA 4BAZA 2H9YA 4CCYA 5HKAA 3WWEA 5E4YA 4CCYB 3EIOA 3WK6A 4KE6A 4M0MA 1K6EA 2I3DA 2RGUA 5HCUA 5CMLA 2GBGA 2PSFA 1H2ZA 3F9CA 5HFAA 2Y2VA 1DX6A 4JEIA 1GPLA 3FVRA 1P0MA 4J0DA 3HLKA 4F5ZA 2ZJ6A 3G9UA 4PQEA 4FBLA 2JIDA 1LNSA 5LZ2A 1LPBB 3UMJA 3DD5A 1J1IA 1SCIA 4MWSA 4X91A 1IUOA 1CUZA 1R9NA 5EIHA 1HLGA 3ICWA 5ALLA 3NGMA 2C7BA 3WMRA 5C81A 1H2YA 3WIOA 2HU8A 3STYA 4UHDA 5LP1A 1WPXA 2GBCA 1I6WA 1CUFA 4DIUA 2QUBA 2X76A 3FNBA 1XQYA 2XMQA 4DSAA 5I7UA 3WA7A 1JU3A 1XFDA 2E3JA 3ESDA 3U1TA 3A70A 2WHPA 3C6XA 2PSDA 4ROTA 3DS8A 3W05A 5FKJA 5HF6A 4D9JA 4IO0A 4OB7A 5ALDA 3KSRA 2RIPA 3LIPA 1R88A 1QZ3A 3HZOA 3WWDA 5AKHA 3DEAA 2OCIA 5CRIA 5EI5A 2XMGA 3DOIA 4GBGA 1DWOA 3G0CA 3FWHA 3F8SA 1VZ3A 4JYPA 3GZJA 1F6WA 1EINA 2Y2UA 4XX1A 4NMWA 2WG0A 1LBTA 2WFLB 3TRDA 1LPPA 2GYUA 5JATA 1OXMA 4Q34A 1DT3A 2X8BA 4UBJA 4Y2RA 3O9MA 5AKKA 5FV4A 4C4ZA 3AIKA 2XLCA 4PW0A 4Y2UA 3M83A 5IVIA 2WJ4A 1FFBA 5EHZA 4E14A 1QTIA 2AJBA 4GEGA 2G5PA 3AZQA 5HFNA 2IITA 2V96A 5A62A 1ACJA 4FLFA 4KEAA 1VJ5A 4BP9A 1EDDA 3OC0A 4V2IA 2IX9A 2GBIA 2EEPA 4CFSA 4KE8A 2VF2A 1WB6A 4FKBA 3RARA 1SC9A 4LKOA 2OPHA 4P93A 3C6ZA 3O0DA 4B81A 3V9AA 1Q84A 4H7EA 4Y2YA 5HK9A 1LLFA 2XUFA 2QM0A 1UOPA 1GPKA 1F8UA 3V1MA 1G42A 1AKNA 3WL6A 3I6MA 3C8HA 2AJ8A 4FMPA 1QIEA 5F4ZA 4G4IA 4YK7A 4MEAA 4DGQA 4HXFB 1DINA 3T52A 4CI9A 3FLAA 4DNQA 5I8PA 1QIDA 1YSCA 3K9BA 1L7QA 1J07A 3EBLA 5K3AA 3VXKA 1QOZA 5EHQA 5DJ5A 3G0IA 2YASA 1QTRA 4Y2TA 1F0PA 3PICA 4AX4A 5K5EA 5DNUA 1QJ4A 3HI4A 3H1BA 1CIJA 2GBFA 2I78A 4KRXA 1XZHA 4ZV7A 4Y9SA 3BE8A 1OILA 3LIIA 2RI6A 3FSGD 3H2GA 4BVKA 1CUGA 5FUMA 2XUPA 4Y2QA 4PV7A 1WHTA 1RWQA 2QJWA 2XUAA 1LGYA 4IQ4A 1UOQA 3QVMA 3G7NA 3BDVA 5ALEA 3NWOA 4K6HA 2CUTA 3W06A 4XWGA 1QIHA 3IULA 1UKAA 1D07A 5ALPA 1N1MA 1THGA 3FYTA 4ETWA 1QFMA 2WIFA 2OAGA 2ROQA 4OYLA 4YPVA 4KAAA 4KYVA 4LXHA 1NU8A 3AIMA 3QPCA 3CCCA 3F96A 1WPRA 3G9XA 4JH0A 4BDTA 3O9VA 1ZICA 3B3QA 2RAUA 3G8YA 1ORWA 4EB0A
chains in the Genus database with same CATH superfamily
4L72A 1W2GA 1C3VA 3OOWA 1CY4A 3OFVA 4HB3A 4MRVA 3LP6A 3PUXA 3FWNA 3NX4A 3RTEA 2W6OA 1H2FA 1O95C 5FP0A 3IRVA 1Z7YA 5IBCA 1KH1A 4IINA 5JC1A 1WSAA 5JJLA 3TRIA 3IILA 3K30A 4DQXA 3IURA 2EFJA 4MZXA 5D87A 1L8XA 5ALFA 4B6FA 1MN6A 2P9GA 3JD2A 3GRVA 1B41A 2ZRNA 1ISHA 5BSTA 3STXA 2IHUA 4H35A 3AMVA 1RADA 4JBGA 3STTA 5C5CA 1DC8A 4BMNA 1EFLA 4Q9JA 4DZTA 1G6Q1 1RLOA 3UAGA 1ZCZA 4E5KA 4DWVA 2CK3D 4N40A 1LQTA 4KYTA 4QC2A 3RNLA 4BX8A 3EIQA 4IV0A 4KC0A 2DYKA 2RH5A 3IR7A 1MDBA 4EELA 2Y0CA 4HN2A 4N7MA 3ILXA 2HJRA 1RSZA 2VT2A 4IHJF 4UNNA 3W8NA 3NOXA 4DNOA 1ZMBA 2O6LA 1NJ2A 2SBTA 1SQFA 1V9LA 3T1VA 1WF6A 3PYMA 5HKKA 4MYHA 3KLPX 3O8BA 5B7NA 1P8AA 1CFZA 5DN6D 1T5SA 2FPWA 2YIVX 1MF7A 4JP5A 5DBEX 1P7CA 1W1UA 2O8VA 3D3WA 4IH1A 2AEFA 3PFBA 3URMA 3QEBZ 1RM4A 3S68A 1UPTA 4DG9A 1ULZA 2VJMA 4UTXA 2G0AA 3AHFA 1XK7A 4B3DA 2DJIA 4O2AA 1YDWA 4NFYA 3VR5D 3CVOA 4JSTA 1VYHA 4XGNA 4PC3A 4WY8A 5JMPA 2XSZD 3REGA 2C5FA 3OLXA 4ZVOA 2LIPA 2EJTA 3R5XA 1U7WA 4HF7A 4N65A 4IVPA 4C7MA 3JRWA 3VGJA 3UO8B 1YA8A 2CBZA 5DCWA 2E89A 3HVIA 3QYPA 5FA8A 3W2GA 4DBLE 3K0FB 5LLSA 3EYAA 3ZH9B 1Q0SA 4EP1A 1XTZA 4ND2A 2M2IA 3R3XA 2ZM6B 1ZMXA 1LVUA 4X54A 3I2KA 3NM4A 3KSUA 1VE6A 2TMYA 1PZFA 4PIPA 4DZZA 4H18A 3BTOA 4W1QA 5AICA 4BJ5A 4IZHA 1ZH8A 1GDDA 2X6TA 1W59A 3HP7A 3W3AA 1GP2A 1DKLA 3VMFA 5JYCA 3PPWA 2YV5A 4DCPA 2NOAA 4GD3Q 3VAZA 4TLAA 2ATXA 2AE1A 3VAAA 1IM2A 2Q28A 3DHVA 3KVRA 3ZXXA 8ATCA 3N7UA 1C8VB 2A5GA 4KPYA 3RVQA 1BRTA 2O06A 1R4MB 3FPBA 1GQRA 4FR5A 4CEHA 3MJFA 4BDSA 1I2CA 3TGPA 4G1CA 3RS7A 2HD4A 4WESA 5GOZA 3N1UA 3JARA 4MO9A 4Q1AA 1GD1O 1ZCBA 3BJRA 3QE0A 1BOOA 4G84A 1BYUA 4DLUA 1RQPA 2JHFA 5FYDA 1JJ7A 4DR2B 2RK6A 3R8CA 2BJWA 4QOSA 4XQGA 4HB4A 4K9KA 4BJ6A 4AMZA 5I01A 4QELA 2AS0A 4MP8A 2NO4A 5KOJB 3CCBA 3TPZA 1E1RA 5F4BA 2GPYA 2EYQA 3K9GA 3LBHA 5HF8A 4M1SA 4YRBA 4G63A 2B8TA 3ZK8A 4H31A 1I32A 4UPVA 2I2XB 2JZCA 3IHKA 4HUJA 4IV8A 1WG8A 5FJIA 2ATVA 3SVZA 1E9BA 1G8AA 1U3WA 1VL6A 4Z3DA 3BPSA 4I8DA 1DXHA 2OCXA 5HIAA 3BORA 1K7CA 4AWBA 3HGMA 5H83A 4XZ3A 4YRAA 3GH1A 3G2NA 1ENZA 3K6SA 4UMDA 4EPYA 3SMQA 5HF5A 1E8DA 2H1VA 1AK9A 3QHPA 4BWVA 3B3AA 1ZU5A 3U4DA 5EWMB 1L7XA 4NJMA 3AM3A 1QNLA 3D6FA 4IMIB 5CDGA 5CFOA 3PE3A 5I7VA 5DGXA 1X8XA 3OX3A 3TQSA 2I6SA 4Q16A 2VJQA 4AMGA 4IJVA 4Y67A 4R1OA 4PTLA 1F8XA 1DTWA 5B12A 4J4HA 2FMXA 3BD7A 4LJ9A 1YBVA 1YUNA 2BKXA 3HU1A 2A14A 4B84A 4WACA 5LQRA 3I2IA 4LMAA 1ZITA 2IWRA 4YJGB 4B3IA 1RWPA 4HN4B 5TS2A 2OCBA 4ZAFA 2ZB8A 5B6JA 4XPIA 4HNSA 2QPLA 4OG2A 4XB1A 2PSJA 3EF0A 5ESRA 4DBVO 1MAAA 3P5SA 4XPIB 4AUNA 4RH0A 3UAVA 1Y5NA 1RD4A 1HTTA 3GLFA 5L3SB 2R8XA 3SVLA 2OGTA 5DULA 5JT1A 1PZNA 2QIPA 3GQVA 3IGFA 2PSEA 4OLJA 1GFSA 1TTHA 4BO1A 1II8A 3G89A 4CNQA 3V33A 1RTKA 3VO8A 5FBVB 4KWHA 1HV8A 3USES 5PGMA 2YV3A 4I55F 2JH9A 3NWJA 2J41A 1JHOA 4HY3A 4ZOLF 1K98A 3KEOA 4OPMA 1JFLA 1Y4SA 2ORED 5JXGA 1WU7A 4RELA 3N39C 1R0CA 1NMSA 1TFRA 5TT1A 3VKUA 3S70A 4MOWA 1L5HB 4L5BA 3D2BA 1YDMA 3FE2A 3O1JC 4R2KA 3VR3A 1VBNA 4LXUA 5E6UB 1IB6A 1O4WA 1JLRA 3I1YA 4IIGA 3RC1A 3N0TA 1A8IA 3JVEA 4LHVA 4W6ZA 2PX3A 4K9PA 2IIVA 4DNPA 4KNYA 3HVJA 3JPYA 3I6BA 5J5VA 4CQLA 3DL4A 1M2HA 4NBSA 4WUTA 1EQAA 1G60A 1XAHA 2Q4TA 1KJJA 3NDRA 4CQMB 5F73A 1C81A 3UPDA 1JDBB 3GROA 3B1FA 1J2JA 1SZDA 1YA6A 3KJIA 1WTAA 5JNTA 2WDPA 3OETA 4U7TB 2C2OA 1KY2A 3LQQA 2VHTA 3O2QB 1UMCB 2QYHA 3OZRA 1N4DA 3WNDA 2D5IA 1OFHA 1ENOA 1GRVA 1P4GA 1SAYA 1PLJA 2AG1A 2DHDA 3K9NA 1CZNA 4IGAA 4JUDX 4BAGA 3I9LA 1VLJA 4EI7A 1AGNA 3EIHA 1Z5UA 5CGZA 4DLAA 5CDHA 2VP9A 1SXGA 4DC9A 5J2TF 5JDCA 1Z6PA 1QYIA 3ZGLA 3AOEC 4GNRA 1H6BA 3NVKI 1R6VA 1F51E 1NONA 2DCMA 3WRXC 1E3JA 3BMCB 4H7PA 2WJAA 5KJ6A 4HQ0A 4BFZA 2HK6A 5L4LA 2MSNA 1LQUA 3A2NA 4X8OA 1RIFA 1XTKA 2WTNA 2J87A 1NMZA 3N3BC 5BV1A 1HYQA 2P2DA 4NBVA 1JTEA 1AGRA 1T9BA 1D2HA 3BEOA 2R1UA 4JNKA 2HM7A 1B6TA 2LTAA 3NG1A 2D4AA 4XWWA 4UEQA 1EVIA 4BRZA 2JGJA 2ODAA 2I4MA 1HRDA 3S2YA 1XP8A 3ZE7A 2ZKIA 2O0MA 2O54A 3CMCO 3WKAA 2WM2A 4JBNA 1O8CA 4QPDA 4WLEA 1G7TA 1MB3A 1LK0A 3KC2A 4IEEA 4JNCA 4RMJA 1RHKA 1R66A 1ZD8A 4RZQA 5E7MA 3T38A 3TECE 1NSYA 1YMVA 3ACCA 1QQ7A 4O3FA 3OM9A 3SLRA 4EG6A 1L5YA 1VPLA 2VL7A 4RABA 4RKYA 5DSZA 3GRCA 5BSFA 1P4JA 3A14A 4B32A 1DRWA 2CLOB 1ODKA 1SR8A 4QT4A 3FRJA 1JA0A 3FMFA 4LRQA 1WW3A 3BDAA 4YROA 1OW3B 4W7SA 1XRJA 1HZZA 4YAFA 4TTIA 3MCAA 4C22A 3QEOA 2QY9A 1E1MA 1V7QA 3RSHA 2HSGA 4ISCA 1ZZEA 3D4BA 4I6EA 3TIIA 4C5AA 5L6MB 1FFYA 2CNBA 2V6FA 1G5IA 3ABRB 4UUQA 1C2TA 3A37A 2PZAA 1N8NA 2GZRA 1TRHA 5LZ5A 3EXEB 5JCJD 1DIAA 3EFEA 2V58A 5FUYA 5AW5A 2CXUA 1PWZA 3UUEA 3V9PA 3B5IA 1TM1E 1PR0A 3IP3A 1EX6A 1RDFA 1C9EA 2PGAA 3MWEA 2PTHA 3NOOA 4GQAA 1CEYA 1LBIA 1NVEA 4YB8A 1MJNA 4EW1A 5FHQA 4HEJA 2QJFA 3MW8A 3G02A 3N8NA 3WJ7A 1E1KA 4BU0A 2HJHA 4AKGA 2KPOA 1P0FA 2F1IA 2Z09A 3DCJA 3MLEA 5HRUA 1UKVY 5KTMA 2ZQ5A 5U9CA 4FS3A 4KNWA 1PJQA 1RXUA 2WHPB 3JASA 5CYPA 1FFEA 3BK7A 4UE6A 4DAEA 1YB7A 3H1AA 4UJ3A 2DFPA 1T8SA 2H5IA 5FFNA 1W8DA 3E4DA 4NJEA 1T9KA 2TMDA 3OJFA 3TTVA 3OQNA 1GLGA 3BFVA 4YV1A 3LLSA 2ZRBA 1ATIA 3W5AA 3WXMA 4WNAA 1K5PA 4LJAA 3S2IA 3FBWA 4ZJPA 1XK6A 3QLTA 4WIAA 4X8HA 2CJFA 2H4XA 4QRDA 4YCNA 1IZ9A 2RGRA 4X62B 1ZONA 1FDSA 2GPWA 5DB4A 4EY4A 3FPGA 2V8OA 5IM4F 3TSCA 3GEEA 2I66A 1QLWA 2NUBA 4FW9A 5AM3A 1QQBA 1AURA 3KLOA 1GNSA 5AVOA 3UBTA 2XUZA 1MO6A 1GFWA 2X4LA 1MRNA 3K5HA 2ONJA 3DOJA 2VYVA 4U7FA 5TS3A 3W4JA 1POWA 5E9QA 1AOXA 4HWRA 5A0VA 1ADYA 4OLAA 2FEMA 4O4HF 5ER9A 3BRWA 2ZDGA 3HCEA 3MXTA 4LJ5A 2VDUE 4E2XA 1TZMA 4HQOA 5IN4A 1Q5PA 1YZQA 2R79A 2Z5GA 3AV0B 1EAYA 4I1VA 1E89A 2A5YB 5CEFA 1AO3A 3I28A 3RIXA 2XTZA 1PL0A 4ZYTA 5A3QA 4JUBA 1SKMA 3B6MA 3NJRA 1X77A 3VJLA 4A9AA 5JSYA 1MG5A 2IEGA 3HJBA 1CZOA 3L40A 2ET6A 3P0FA 5B5SA 2J3QA 3ED5A 4ZEVA 1W0CA 3G49A 2CXQA 4RL6A 2D54A 2VHEA 3GLQA 4JODA 4OP2A 4WLOA 4TSFA 4QWWA 4X95A 1YQ9A 4QXPA 3DOCA 1X0VA 1I6LA 2XD9A 3F5SA 3OX4A 4CM4A 3W5VA 2R97A 1DAIA 3W2TA 2WFLA 4M36A 3Q9LA 2CL5A 3UPTA 2COUA 4OYYA 3WIBA 4HLDA 4KXNA 2QMEA 3EG9B 1SIBE 3GCWA 2OHGA 2ZR0A 3OJXA 3VDQA 3RS5A 4RACA 3ABQB 1UPUA 1UBUS 2WWGA 4DSOA 3UMMA 4AQYB 5HCIA 4FM9A 3H1EA 2JI4A 1J2YA 1JHVA 3UFXA 3INNA 1R18A 4KHPB 1TIBA 1HFJA 4M7WA 1P19A 4A6PA 4CUKA 1D2AA 3NRJA 1SXJA 2HPZA 1T3HA 4YYEA 4QGSA 2R44A 3OUTA 1IUNA 5DMXA 4XYEA 4ARBA 3VJRA 2XX3A 1DBRA 2F8MA 3LKBA 3AF3A 3N3AC 3VO9A 1AUOA 4EIWA 4JLBA 3F9IA 1Z26A 4DPKA 4UCWA 5LWHA 2VP3A 3ISJA 2DB3A 2MR5A 1DAOA 1KGSA 3VYRB 3ITKA 5TQ0A 3NETA 3SM9A 4CIDA 1PR5A 3GFTA 5E1DA 3D6HA 3FSGA 2GZ2A 3L8DA 2W48A 2F3TA 3LSYA 1ZQ9A 4Z7JA 1KQFA 1G8KA 2O59A 2YJ5A 3ZWXA 2PIAA 4BVHA 2CHEA 1ZM3A 2FZLA 4F38A 3GDFA 4YJ3F 3I4CA 3K71B 1Z2EA 4AKEA 5KWEA 1HYBA 1Y5IA 2IBMA 3FOCA 4XEHA 4L2IB 3MQFA 1C3LA 1UT6A 2I3GA 3JQ6A 5BQFA 2NAFA 3KU1A 3LM8A 3LKVA 4PZ9A 2X7XA 4M1KA 1GA4A 3EPJA 2CW5A 3AVWA 2BVNA 1UZAA 5AKXA 1VCIA 1T36B 1X2BA 4QE3A 5M34A 2YN4A 2VPIA 4PAMA 2NTVA 3B6IA 1U6KA 1AKYA 3H1GA 1BS1A 3FOBA 3MJEA 3ZZMA 3RC3A 3DKRA 5J9FA 1VGQA 5LPNA 2JFHA 3AX6A 3U17A 2PUFA 5BSMA 4CF3A 4HNRA 3WGZA 1GSIA 3FJOA 5FHRA 3V7UA 4AAYA 3GLFE 4ZTBA 3OZSA 1V5FA 1ID1A 3LO5A 1KO4A 1OLXB 3R2JA 1CDOA 3BSFA 1E0JA 1JG4A 1UF9A 1UK8A 3HKBB 3KEQA 3E3NA 4GM0A 4NRDA 5U4QA 1VSBA 3D5TA 4UVDA 3C5HA 3FBGA 2G9VA 3FUWA 3A31A 1O6ZA 3AI2A 4JZKA 3ZDCA 3ODGA 1Z2NX 4UMVA 4HMQA 2CNDA 4MH0R 4XI9A 4JDUA 1S2IA 2H1IA 2XEXA 3DZ8A 4P4TA 4RVCA 3FA2A 9LDBA 1JFVA 1Z18A 2NPOA 1N5IA 2WIBA 3PJEA 4OQZA 4KLRA 4MQFA 3GAMA 2C2GA 1YFKA 2E5FA 1NJFA 3PF9A 4LOKA 5KDLA 4KFSA 1IXSB 1ZD1A 4G8DA 2DBQA 1A76A 4K9RA 3RIEA 3H2SA 1EIWA 2BBOA 5EMKA 4AZSA 3GLGA 3RFFA 1KAOA 3JX9A 4LCEA 3THRA 4GQIA 2E6UX 1XDSA 3OECA 3MJSA 1P74A 1Z13A 1MT0A 3CLVA 4I1RA 2XNDD 1SOWA 3D43A 4EEKA 5AI9A 3RFUA 2H0RA 2Y66A 4GR4A 3D3EA 3D8SA 1CY0A 2QR2A 1XGKA 3H5LA 1A9OA 1KO5A 1CIPA 1NDUA 1JHYA 1QUFA 3K1TA 3VJMA 4BC0A 5CX4A 4DMUB 4IVRA 5CXQA 5CB4B 1MHTA 3R9WA 3P0JA 3FJYA 4IIDA 3AL2A 3TOZA 2VAPA 4X1KA 1UBGA 3L84A 1RJGA 2VN8A 5BSKA 1A8UA 4CDRA 3KP1A 2WSLA 1TO2E 3IVMA 4JKIA 5A6SB 1EHYA 4PSCA 5JNSA 3Q8WA 2REBA 4QAJA 3A6JA 4JDPA 4LBVA 3UJPA 2P2LA 2C3PA 5EZYA 4P08A 4BNMA 2EC5A 3T5MA 2C7VA 1RZ3A 1C3OB 2IU6A 2W6JD 5AHXA 1E5VA 2OYRA 4EW3A 3RUDA 4URXR 5A5GA 4NQZA 1RMQA 1AQUA 4QOJA 1YC5A 2WF6A 4UVGA 4WWHA 3CURA 3JYHA 3GJTA 3PVCA 3TUZC 4IGIA 3VV3A 1P6XA 3C5EA 4AY5A 5FI1B 3SY8A 4PNHA 4PPQA 2HJVA 1FXUA 2O8BB 4HDOB 4P83A 1T2UA 1QUEA 3R77A 4R2XA 4ZI5A 4B31A 1LD3A 2CUZA 3QLUA 2PD3A 3URKA 1OGJA 1WMSA 3GIDA 3II6X 1PWXA 5L40A 4K40A 4ZFNA 4DJFC 4FOPA 3S1AB 4RY9A 4F6RA 2NZXA 4JKYA 5LKRA 1XLTC 5CK5A 1V8PA 1M76A 4Y7DA 3EEIA 1PV4A 4AJ4A 3QYAA 3C6QA 1QHGA 1P1RA 3BZBA 8ADHA 4R6WA 3PJFA 3UHPA 1EFRA 1SRRA 4X6UA 1E6CA 1SHKA 1E2LA 2XTAA 5EZSA 3U31A 5LMUB 1KMIY 1SKUA 1V96A 4FHCA 1Y1QA 2GZHA 2SCUB 3C3BA 3N7TA 3T15A 2AHRA 4C1NA 5AVQA 1G2IA 2J48A 4HNGA 3QZUA 1AVTA 1GPMA 1FFDA 2AXQA 4M7PA 4MULA 4FZ5A 4EYQA 2HMVA 1QJCA 3FYUC 3OOSA 1KFBB 3R6GA 4MVJI 2NZYA 4OVKA 3MT0A 4RZUA 1T6XA 2R8EA 3SX4A 1YS9A 4PTZA 4DCNA 3D0KA 2QPOA 1J0DA 3IQWA 5FCDA 3MTJA 4QDKA 4TXMA 2YMQA 1XDBA 1L7VC 5IP5A 1VLMA 1YRLA 3RG2A 1NW6A 5IH3A 1L5SA 5DP2A 3B20A 1I01A 5JCZA 1U63A 2IPXA 1HEIA 2G08A 1MH9A 3KLBA 4Q6WA 1MORA 2PIDA 2XZTA 4PFQA 1F4LA 3NPAA 1KIAA 3SFTA 1CUWA 1Y7LA 2E6KA 4R0VA 1WOMA 1JL3A 2OG2A 2Q45A 4MV5A 1JG1A 1MO2A 2GM4A 1CKEA 2OORA 2PZFA 2GB4A 2VHZA 3IMEA 4CM1A 2Z3ZA 4BMDA 5JSQA 1K92A 4MCJA 4L8FA 2IPOA 4L7VA 5FA5A 4DILA 4UXIA 2C95A 2C3UA 1ZXLA 4FTWA 5B2ZA 3V1TC 3VHLB 4BGIA 5HJ7A 3OE7D 1YXMA 1R8SA 5GY7A 3A4VA 2B30A 2H2HA 1GAXA 2DFVA 3P9ZA 3OU7A 2IEAA 4GOMD 4PRZA 3TCKA 4DUPA 1Q44A 4EYEA 2JLQA 4GX1A 4C7VA 4KQ6A 4ZPJA 1O8BA 1NJSA 5TT0A 4D41A 4ML3A 3C3DA 1HZJA 1YE5A 3VZCA 3CX7A 1E0AA 4ZC1A 3AU8A 1ZSNA 1R5JA 2X41A 3QP9A 3ASZA 4WASA 2DETA 4H15A 4R69A 2ZRMA 4FGKA 5KMGB 1Y5RA 4ND7A 3WYNA 3E05A 1NRWA 3SEFA 2M9MA 1DBSA 4L0QA 1M34B 2WZBA 4M49A 3ZHVA 3LTNC 2EGUA 2HA2A 3B7PA 4EUNA 3M1LA 4HD8A 2H4FA 3J80A 2P41A 1RAAA 3EDMA 2FLVA 2OOSA 1HI9A 1F2TA 1H3NA 2V7PA 3OCZA 4ACAA 2WD9A 2D8AA 5CLHA 5TARA 2DQZA 3KT6A 5JYBA 3DFKA 2Y0BA 2Q5FA 4EY8A 1E20A 2P9YA 1GPNA 3DV0A 2GWHA 3OFND 1ZMRA 1NWHA 1JDZA 2WMOB 4TKMA 3RYFA 5GIOE 5ED4A 2Y67A 1PEKE 5LP6C 4RTNA 4ZP1A 1ZGBA 3JPWA 3K0EA 4M3NA 4ZTUB 4DIBA 2QL7A 1PL7A 3B13B 1QPZA 2ZVDA 3H65A 4PLTA 4Y0AA 1EE2A 2C8VA 3BCSA 4R8MA 5JY6A 1SUIA 5J2UB 2GJAA 3WGKA 4Z3OA 4EF4A 3EXIB 1M8PA 4Q66C 4Q4LA 3RUIA 2A57A 3UTCA 1SGWA 4GP9A 4ND3A 1PG2A 3GW8A 4IXDA 1W4LA 5TPWA 3S7TA 4QL3A 3BQMB 1T1RA 3MS7A 2ZATA 1GTZA 4ZU1X 4TZKA 4F6RB 5EXSA 2BJHA 1OBFO 1PSWA 5DHRA 4P3NA 5JZSA 3CS3A 2J0VA 4MW2A 4N7RA 3PIIA 1XHFA 1W34A 4KU4A 1TQ2A 3QU7A 1VJRA 1Q91A 3E22A 1ZBDA 2D1RA 3GZNA 5FNVA 1Y8QB 1WVGA 5K0CA 4RZHA 4LGMA 4UATA 5K3DA 2QVXX 1Z73A 1C9YA 3CVYA 3CUUA 1MX5A 1Z7WA 2ZB2A 5U4XA 3EXHC 1Q1AA 2IYYA 2ZYVX 1VE1A 1KAMA 4YP1A 1X42A 2X22A 2V54A 1WQ3A 2DQKA 3HR8A 2Z43A 4KVAA 1M2WA 5F1PA 1KQNA 1NBMA 2C9DA 4LV5B 3WMWA 1L7MA 4HDKB 4LQLA 4JXJA 2YBEA 2D1FA 3C87A 3F7OA 2CXPA 1RE1A 2X0JA 3M5PA 3MNFA 1KC3A 5EE9A 5A7FA 3FOEC 2AF4C 1T2EA 1JR3A 1DJLA 4KDRA 4UJ5A 1U2DC 2YMMA 2GCOA 5CVUA 5ISMA 1KZ9A 1RQGA 2Z98A 4I1IA 4WVLA 4Y2HA 3ROKA 3LC7O 4RZ3A 4J1QA 1L5LA 2BDEA 5ALIA 2NYAA 2P4QA 1P2UA 4FGLA 1YS4A 4N5DA 1DKUA 4P4LA 4F92B 3SZ3A 3I34X 4HTAA 3S8MA 4BMPB 3TRFA 2W58A 5ALOA 3UMSA 4D2IA 3K5PA 3C3JA 9ATCA 3QYFA 2X8AA 4J90A 5DISB 2G80A 3HA5A 4DV4B 2A1UA 1HM5A 2XBUA 4RKRA 4W8HA 4R84A 4B48A 5JBQA 3T0GA 1CF9A 4DB2A 1AKQA 4DUZB 1A5TA 1FJ2A 3NUGA 5AXAA 3OICA 2CVPA 4ZOAA 1XIVA 5L51A 2DBVO 5EIXA 5LQAA 3KELA 1PD1A 4OQDA 1JPNA 2C7GA 4M55A 1HDOA 4UFNA 3RSLA 2AMYA 3QKSB 4WBNA 4P34A 4J2OA 1EVJA 2YXBA 2J8ZA 3W8RA 5B58T 3ZIUA 2H5LA 5B1YA 2BAGA 2QZSA 1JG2A 4OU4A 2BTOA 2AEMA 2P27A 4MLCA 4Y18A 1WV1A 2BFNA 3NHFA 4F5YA 4TVSA 3AHCA 5KNCA 2AN9A 2VUSA 1US8B 3V1NA 3ZE9A 1BS2A 3DEZA 2PZLA 1FZTA 4MW1A 1NVUQ 4MWGA 1EJ2A 3CBGA 4H3HB 3VM6A 2X13A 3EAQA 4KXMA 2BIFA 4G5GA 1WO8A 3TYXA 1S89A 5AKGA 8MHTA 1PJBA 4LJ6A 3BMNB 3NKVA 1NVBA 4E2YA 2DKOA 5BOSA 1K8QA 3EZLA 3PCXA 3HXMA 3AR3A 3TGLA 4WOPA 4Y9UA 2I67A 4LJRA 3BWVA 1AQLA 4LWQA 1GCIA 3IAM1 4Y2GA 3SZLA 1CZRA 1NJ8A 5BYBA 4ND8B 2IZ7A 2QTZA 3BA1A 2QQFA 1AT1A 5K8JB 3E58A 5LZ4A 2C4KA 1P1CA 2P6UA 2ZT6A 1XNRB 1SKAA 6Q21A 1X1TA 4R83A 3B2NA 3ZXSA 4Y2VA 3QOFA 4LUCA 3SJBA 4CQNA 4H7IA 2FSUA 1RHQA 2RGEA 5H80A 3PJGA 1R4NB 2DBRA 2B7CA 5DKFA 3RF6A 1O1YA 4Q9NA 1CY1A 1T15A 2P6MA 4KI7A 3RRXA 5CFQA 3SVTA 1E5QA 1U0FA 2AXEA 5ECYA 4E4TA 1VXOA 1NATA 3BA6A 1NF8A 2DPYA 2NZWA 3NIFB 4IOMA 4OTZA 3FDXA 4YJFA 4MW9A 3PX7A 4YRSA 2WQ7A 3NO4A 3PKJA 3NTQA 2EP8A 2ZIVB 1WMFA 2FUCA 2WPDD 3CR7A 3T95A 3UK0A 4CDNA 5A03A 5MHTA 1QZZA 5C7YA 5T4FA 4ZGGA 3KZMA 2IF2A 3M3PA 1UPAA 1NZDA 4X66B 4KLNA 1W4ZA 2ACEA 3W4KA 3WV4A 2O3RA 3AL3A 1II9A 2GDJA 3U61B 3U4AA 1J1ZA 5AOVA 7ADHA 5LUAA 1XZMA 2WIDA 1E4OA 3HL4A 3WLKX 4US1R 4JBLA 1L6IA 2F00A 2QR5A 4FZJA 4I4TB 4DXAA 4EUSA 2GPJA 2J3JA 2WV9A 3B1VA 3M6FA 1U28A 3ECCA 5HE8A 5AUNB 3LQFA 3I1IA 3Q5DA 2M32A 1BDIA 3WYBA 1M72A 1ZGCA 1XVUA 1YZNA 4J1SA 4R16A 3UCXA 4DCTA 1KFCB 4J0QA 1QO0D 2BEUB 3FNGA 2O3UA 4HLQB 4MYCA 3AY7A 3WC4A 2YCLA 3LYLA 2J0QA 4CGYA 4MTCA 4WK6A 1Y6GA 2NN3C 3U3RA 2C4HA 4MYSA 3V7WA 3NAQA 4WLUA 2JEYA 4QFBA 4RMNA 4EZIA 1GY8A 3RM3A 1DLIA 4WERA 3H83A 3QENA 5MGNA 5CDUA 2BPOA 1L7RA 1B6RA 2NNWB 4R8KA 1W76A 2BFEA 1I30A 1MIHA 3OTOB 4OD0A 5EJ7A 2WKRA 1E2KA 5I9TA 4N8SA 1PZGA 3EVCA 1B6SA 1CDEA 3F6RA 3HBJA 3F4BA 1N6NA 4FNOA 4WJKB 1PDOA 1JTFA 3B1WA 4KVGA 1JFSA 4B8YA 2R87A 3QLVA 5ECWA 1H4VB 2Y0PA 2XH8A 1EG2A 3ASYA 4PIMA 2QORA 3DBHB 3MB8A 4J16A 4UQPA 3STUA 2IYZA 3ECSA 4OI2A 4TUYF 2CCKA 1CYDA 5A5FA 1WXHA 2BGLA 1PJ4A 2DZDA 3QLEA 1ZN8A 2WVHA 1UXOA 4QDUA 3IAXA 4G8JA 1YCFA 3DPSA 1RM3A 2HFJA 3VOBA 4I3HA 4PC7A 4QNNA 4UM9D 2VYNA 5DRTA 2WAOA 4ZK2A 2NXCA 1T2AA 3EBOA 4BX3A 4Q4DA 4F2WA 1QHNA 2Q1TA 4RJLA 4JBYA 4Y6GB 5K0LA 3B2EA 1TEVA 3PF8A 1YS2X 5DEIA 5JFOA 3FPSA 1MX1A 5CBKA 1T9ZA 2YNMA 5C0OE 3IAHA 3PGA1 1IY1A 1Q14A 1TKRA 5CCXA 3IB3A 3U44B 2K5UA 3GRPA 1Y0BA 4GI2A 3KCQA 3SZMA 2FH5B 2ZZKA 3E9RA 3MT8A 1XA4A 3L7LA 1CY7A 5L4NA 2GUWA 1DBPA 3TB4A 2ORIA 4L07A 1S0UA 3X1ZA 3RLFA 5EIBD 1DAFA 3G3EA 3LUCA 3OPYA 4HAVA 4QT0A 4YMSA 4GT1A 4UBLA 3T4PA 5CFNA 1M8FA 5FOUA 2P9HA 2RK4A 3E48A 1NVKA 1VPTA 3G2OA 2ZIWB 4FMDF 4JT9A 3R8XA 3VFDA 2WE8A 2D7JA 3BB1A 3SZOA 3WWPA 5IKMA 2E4YA 4C0HA 4ER5A 2P3LA 5C35A 4GP7A 3M9WA 1G3MA 1K7FB 4HPXB 4BCDA 4K0KB 3MIZA 4F3YA 1EFTA 4K87A 4TTTS 5KYGA 3R75A 2O7VA 1DJOA 1VMEA 3IODA 2O2DA 4L3WA 3VC7A 5DLQC 1Q6YA 2HO4A 3C7AA 4TMKA 1DE0A 2IODA 1I1OA 2JFFA 1KNXA 2VRNA 2XJ9A 2YJ6A 3PNLA 4Z9AA 3GJ4A 4IJQA 421PA 4EVIA 1FLVA 4W6QA 4XFKA 2FPIB 3KJQA 4B3FX 3S55A 3TZHA 3OF3A 1RYBA 1FQOA 1ZJ4A 4AULA 5BV0A 4PPYA 1V9SA 3AUTA 4QXAA 2AOWA 2EJWA 3DXYA 3A9UA 4MUXA 3B7GA 4DLTA 1I3NA 3LV8A 3T3EA 1EZ1A 3R6DA 4DIEA 3DEJA 3SSNA 5KMGA 3IE0A 3NH9A 1QG6A 2JI8A 6REQA 2Q3JA 1K6MA 3UJHA 2AX3A 5TV2A 4G0VA 3UT6A 4CM5A 5K05A 4M22A 5K0JA 3PUKA 3H3XA 1WU8A 2C8LA 4FX5A 3FTEA 1HURA 1B4DA 2ZPTX 1GKIA 3V1YA 3OLVA 5B37A 3A3OA 5FXMA 1Q1NA 4HI0E 4O4JF 3DTVA 4A0RA 1ISPA 2A2ZA 1EJ6A 2CZCA 4D3DA 4QVIA 3GIWA 3NFRA 4F2GA 1CJMA 1H2XA 3R76A 2X3UA 4C0BA 2G1PA 1XRNA 2OB1A 3K4PA 5BPHA 2X7JA 2PRSA 4RXMA 1IRIA 2ZRQA 3S7ZA 4BVEA 2BMJA 4JI7B 1SCKA 3SC4A 1EXDA 3V4FA 1J24A 1Q1QA 3A3KA 2NAPA 3E9NA 1UMKA 2PAAA 2F59A 1YS1X 5HZMA 2VH5R 4C43A 1C7JA 5ELXA 2PLWA 1EX9A 3DW3X 5HVNA 1KIMA 1XZLA 1BWQA 4UUOA 3ZS9A 4DMHA 4AS1A 2Y0EA 3BZWA 1N9ZA 1QYVA 2NU8A 4GMXA 3RHTA 2W8ZA 4K46A 4FIDA 3FOZA 2Y6UA 1OPXA 1X2EA 4FZVA 2X77A 2IYEA 3HZHA 2P9FA 3EGXB 3HRIA 4B83A 4G6ZA 3H19A 3SGLA 1D2GA 4HH1A 3G2PA 1RZVA 4KAJA 2ATIA 3L3BA 2H06A 1NFRA 3VZQA 2HY7A 4KMSA 2GD2A 3CYFA 3ICOA 4XUEA 1U5AA 1PL6A 3E53A 2G63A 1JI3A 2FWAA 1I4WA 1XHLA 1OYOA 2A84A 2I7XA 2QNBA 2VOEA 3EK2A 1K66A 4J1TC 4MV3A 3R5KA 3EZFA 2BFMA 4LY3A 3K31A 4HGYA 4CUZA 4INJA 4A0GA 3U4IA 2RG1A 4E46A 5CNMA 3DGEC 3C43A 2VF5X 4N5IX 4G4JA 4ZVPA 4RKFA 4BX2A 3RKSA 1DG1G 2PRYA 2C4MA 4I1PA 4OREX 2JKZA 4D4MA 3RSFA 3EHEA 2JBHA 3OZWA 4O0MA 3Q2OA 1XA0A 3HI6A 3OPVA 3DHYA 1TPYA 2Z9BA 4PVDA 2OE2A 2YS7A 3IUBA 3E3MA 2C2HA 3W9YA 4DA9A 1NXXA 3ZV4A 2QVZX 4JC0A 3E35A 5CW2A 2VDOB 2A58A 2V3CC 1J9ZA 3EZ2A 4C06A 2QX8A 1KQGA 5BWBA 5CLFA 3HACA 2G83A 2V7BA 1MOSA 2FNAA 2HK7A 4U2EA 2C04A 1D2EA 2YV1A 5KYNA 4Q4JA 4NCHA 2IEDA 4MWCA 3MJVA 3CVXA 5AW7A 3Q3EA 1IPFA 2ARKA 3TO5A 4V0ME 4WBNB 3KM0A 2P3QA 1FQWA 1EWTA 2I87A 3E15A 3GC6A 3FPCA 3EGXA 3DMTA 3L6UA 4OGGA 3SICE 5EZ6B 5E9AA 4CODB 2N1BA 3FNHA 5HA5A 1Q7CA 1A88A 2X8WA 4O33A 5J4KA 4G0WA 3OQPA 1M75A 2VHCA 2FUEA 1WDMA 3V1UA 4RV9A 3KV1A 5D3KA 4RHEA 3IUMA 4G8CA 4G2NA 4HB0A 2XMZA 2QN7A 3LHKA 3OTGA 1RT9A 4YRIA 3BGVA 2JCXA 4AXBA 2FEPA 5KSPA 2FPKA 3JALA 3LLCA 2PVSA 1KDRA 3NNNA 3D4LA 2QRJA 2IPNA 3CNEA 4HX5A 5FF9A 4EO9A 4CIAA 3W2FA 1WNTA 2JD2A 1L5HA 3OUUA 4I6GA 2I2CA 2DLCX 2F1OA 4QNMA 2FN9A 4D44A 4BNVA 3U7RA 4FBGA 2Y1KA 4OSPA 4B6OA 1L7BA 2C1ZA 3A04A 4TXJA 1WMAA 3DOHA 4TS1A 3RRJA 1Z6AA 3HU2A 2ZUCA 2EKDA 3HNPA 4FZRA 1BDBA 1K4YA 1KRHA 1WE2A 1Z6QA 3D8RA 4P7FA 4GXRA 3R5FA 1SKBA 2W6CX 3D6UA 1OROA 2GZMA 2WP0A 2XWJI 4G4SO 2DSNA 4M8KA 4NMHA 1SXJB 3DLPX 2XCQA 4QEZA 5BRNA 1XLVA 3JU3A 3GLIB 4J0KA 2Z6AA 5GPBA 4OAQA 5CB0A 3UW1A 2IUUA 3K0AA 2QTWB 5DP1A 2GJKA 1M2VA 1BW9B 1ZCAA 1R4MA 3L0PA 4NYJQ 1L4YA 1TM4E 3AHJA 2ZSDA 5GADl 2ECQA 1G2PA 3D1VA 4DA0A 4RUKA 3MLAA 2A9FA 2EBHX 3G5LA 1IN8A 1W93A 3FTPA 3U7QB 1AZTA 1MZVA 2PH1A 3FFTA 1AKTA 4RAQA 2YXDA 3C97A 5K8UA 1EMDA 4AG3A 2B8NA 3EFHA 3ETCA 1E79D 1N1EA 1SPXA 2G0TA 2R00A 2JIRA 3M1AA 5A3SA 1U1DA 2G7MC 2YXNA 5FEMA 3MRSA 3K53A 1LNZA 1LB1B 3NWPA 2GCGA 4G0PA 3WRYC 4QJ3A 1YJXA 2VA8A 3T5GA 3Q7SA 3DTTA 4JMLA 1E2MA 1T2CA 3NI2A 5A7HA 2FXVA 3PKZA 3DB1A 4MGKR 3DBIA 1EVZA 1Q3TA 2PK3A 3Q1LA 1DCKA 2BHLA 3P2EA 4ZVVA 3Q3CA 1LK5A 4U00A 1LDNA 1C2YA 2KBEA 3GJ6A 1XJ0A 1GO2A 5CDFE 1H1LA 5EJIA 1ESEA 2D5CA 3DV0B 2CDNA 4ESEA 2VATA 4MS3B 1HO3A 1XMXA 4RBNA 3TPCA 1XU9A 3OZAA 1CS0B 3UXMA 5AVVA 6ADHA 3DNFA 4EHAA 1MXHA 5DBFA 2JFBA 1DQYA 3GRYA 4P5PA 2BEUA 3KYCA 5T64A 3SS8A 2GKSA 3LKDA 1QHFA 2OTCA 2PZJA 2AQHA 3AG6A 3AF0A 1SA0A 3QBEA 4LHSA 3IQEA 1NM5C 2RE8A 4YDRA 1MENA 1I4TD 3TKAA 3MTQA 1S8FA 4AMUA 4OFBA 3KOUA 3REQA 1Z17A 3B9RA 1XXHA 2CGEA 4MDHA 2Z58A 2JH8A 5I9IA 3IC5A 3MUNA 2YY7A 3T99A 5LR6A 4UQLA 3CLUC 1VE9A 3DXXA 2Q3BA 4GO1A 1G0NA 2YHAA 3A6HA 1A9PA 2AVNA 2EKQA 4J3NA 5IT0A 2RGXA 1CUBA 5H3LA 3WLOA 4WZAE 1Q0QA 3FTCA 5AXCA 3PA8A 1Z4NA 1C1DA 2XODA 1WMDA 1U98A 3KQMA 4D02A 4WCFC 2BP7B 4F9EA 5AM5A 1AGPA 5EP2A 1I5EA 3B6EA 1JLMA 1C9DB 2BGNA 2H4WA 2H54A 2O1SA 3LS2A 4OGWA 2GBLA 4V0LA 1KEZA 4XJXA 4D4HA 2D6FA 3AKEA 4KPGA 1HT1E 4QDXA 5TPZD 3ILYA 4Z9XA 3K72B 4WY5A 1KK0A 1SD5A 3FPEA 4I5EA 1P31A 3PIDA 6REQB 2XAAA 2HRCA 2A9OA 1H1LB 4J43A 4Q1FA 4KGXA 3IR6A 2LCQA 4NI5A 3BGOS 3ILVA 4A8JC 3NCTA 3WBBA 1JQEA 3PFGA 4A0FA 1G8HA 2EJBA 3PYLA 3ZUPA 1Z06A 2BFCB 1C8KA 2ZLBA 3EXFB 3QVTA 1XP5A 4LXIA 3TTSA 3ZGOA 2YC4C 4LYEA 1BVRA 2BTQA 1XZAA 1J49A 3UB4A 4XQ9A 1YB2A 4PYQA 4L9RA 4UZEA 3RUCA 1JYSA 4PF1A 1ECGA 3R3JA 1NOJA 1HMPA 4IEIA 3RS9A 1KZ1A 1W44A 5DM4A 3HM9A 5JU6A 4ZXPA 2IP4A 3AILA 4U2CA 4DVJA 2BCEA 2DHQA 3GCDA 5JXHA 3VNRA 2IH5A 2VC2B 1GL9B 1UQTA 4MP6A 1YHNA 4DEVA 5BVHA 2BWJA 3IJEB 1M6VB 1MFZA 2ODWA 3PDCA 3QBTA 4HUQB 5AJWA 4B4KA 4YCSA 3EEFA 4CXMA 4DV5B 4GLLA 3MWGA 3ZDYB 2PV7A 1BFKA 1U1EA 2QMOA 3U6KA 3K0CC 1UM8A 2V8BA 1OVMA 2DTDA 4QQKA 2GHRA 3UCEA 2GKGA 1GUAA 1PZXA 2WNIA 4IHJA 1Y8RA 3FF4A 1FSSA 1ULSA 4I1OA 3HJRA 3H6GA 4G5XA 1QFYA 2JCYA 1B3BA 2ZIEA 3E61A 4MWBA 1A4XA 3CB4A 5JAPA 1MX9A 2O0HA 5A6SA 1EWKA 1JYFA 1IUKA 3MLBA 4N3GA 3HO6A 1DL5A 1UPFA 1OFTA 1ZH0A 3AWIA 3DM9B 2Y8EA 4LKRA 5ERGB 5B3JC 1SOAA 3IBSA 4R7ZA 4RLQA 4B0PA 1IN4A 1W7AA 3RW9A 1Z8NA 1T9DA 4NSNA 1YBHA 1CY8A 4I36A 4UM5A 3M1IA 2G1KA 4GXTA 1B0PA 1XWFA 3D5QA 3T1TA 4C2UA 5LQKA 1SH7A 1EA5A 1QFZA 5TSDA 4IUDS 2Q50A 1TK3A 3N6RA 1UQRA 1U65A 3NBMA 5EJ5A 3FUUA 1UEXC 2F64A 2E2WA 3WXBA 2R66A 2PFSA 1PT5A 4H60A 4LMRA 4NENA 3O82A 3WMXA 2B5VA 3BWBA 5JANA 1WBDA 1XMJA 2QJTA 3SDSA 1DV2A 3NHRA 3HO1A 1OBCA 3AONB 3KEFA 4FNGA 4PZDA 3LW7A 4ZAGA 4WV3A 2RIRA 1JQJC 4HOYA 4KH1A 5TVGA 2IIPA 3RSQA 1IPEA 4U6SA 3X0DA 3I01M 1ADCA 2IJGX 2R84A 5TX7A 1Z0AA 2W2KA 4RVDA 1IK4A 3E84A 3NASA 1XRLA 2PKXA 1O6FA 2PBFA 2ZBVA 3I0MA 3ZE8A 4TQAA 6YASA 5IAKA 2D13A 2OAP1 3A1VA 3BK2A 3PPVA 1OTHA 2PBZA 2DY1A 3IT2A 3O95A 1TAGA 2X40A 2DH6A 2ATCA 4NEGA 4JENA 2F6RA 3HPRA 4GOJA 4TTAA 1BWRA 4IJUA 3ZBUA 2NTNA 3QVKA 4L08A 4UHHA 4IFEA 1X74A 3OMLA 4J0GA 1A5SB 1XCLA 5EGNA 2WVJA 1OXKB 1X7WA 4GUAA 4XWTA 5D3ZA 3IOCA 1ZNWA 3DV2A 5K3BA 2AFVA 1LTKA 1YGPA 1LJ8A 4JLNA 4M7RA 2QBYB 4RMGA 1DARA 2XV1A 1L3BA 4B44A 2O8NA 3HM2A 4O2RA 5JJKA 2J5RA 3O8NA 3STWA 4CKCB 3EVBA 2VSFA 4FT2A 2CB9A 1ZGAA 3L5OA 3RT7A 2H3HA 3ZY4A 4F9GA 1YRBA 4BFTA 4YVFA 4PG5A 1UINA 3HNOA 1DJPA 3ZDRA 5AQEA 4V0MA 4LRUA 1PHPA 1BDMA 5C9ZA 3BE4A 1U8EA 4ENUA 2QVBA 3D6TB 3IAUA 4RPJA 4JWTA 1QYDA 4YGYA 4EMTA 2RH4A 2XECA 3JVVA 4BLQA 1CQIB 2VJDA 5CITA 3QQ5A 5KOIA 2I54A 2HA0A 4HFMA 3L6BA 3T1NA 1X92A 3UAXA 2ONCA 2ZRAA 1X15A 1G7SA 1PE0A 3BKWA 3N8HA 2XKKA 5DASA 1MNQA 1KETA 3I0NA 1TF5A 3GWZA 2HWUA 5EYPA 5TXGA 3KAQA 3OT1B 3V5NA 4G41A 1CUJA 2ORVA 3DD1A 1R3DA 2H4HA 2IE8A 3LUHA 1TAQA 3QBVA 5F5LA 4P0QB 2IIBA 3OLCX 2RAFA 2FQXA 3H9CA 3C6KA 2ZEJA 4M0UA 5HRCA 4UHBA 3D3WB 2Y4NA 2J0UB 4B6RA 3BX1A 3DE2X 1W8IA 1N78A 1RKBA 1JEJA 4G1BA 5K3OA 1N57A 3V4ZA 1GYQA 3OQBA 3ODPA 1X1QA 2FWPA 1Y8QA 4AJHA 3WL3A 2ZJ4A 4CF4A 4HAZA 4L8GA 3L4JA 1RZRD 1QG4A 3WL4A 2NO6A 1E1LA 4FFLA 3WTBA 2NXJA 1RXVA 1A9ZA 2EDCA 4LJLA 5FPTA 3G85A 1RXIA 5DNAA 5AP9A 5TMDA 4KITB 4Q9KA 3DZBA 2V9CA 3GLHA 2HX1A 2ODNA 4LJYA 4QOEA 3H5VA 5CP8A 2WF9A 4CLRB 1UZMA 5C2JB 3B60A 4QQRA 2W8BB 2UYYA 3UJAA 4H1WA 4W7HA 2WJWA 1T0UA 5A02A 3UH1A 4QREA 4LMPA 4MKGA 4BUZA 1WM1A 4EGSA 4YASA 1JDVA 2Q0XA 5BV2P 4Z86A 5JAOA 1IVYA 4B73A 4QYXA 5JLAA 3NATA 2JFGA 3OEHD 1HYHA 3M6AA 3LBNA 1GAQA 3NEAA 4UUBA 3HB0A 4R1TA 2EOAA 5J4HA 2PUHA 2F3UA 4LC9A 5EL0A 4C0SA 3OIDA 3AUJB 2QTVA 2RD2A 1U8TA 2WYIA 4LJSA 5G2OA 3KSZO 3NHYA 1YL5A 5CW1A 2HZBA 3T3OA 5K2OA 3ZWQA 1XJWA 5ITVA 2G17A 5EHXA 4BMYA 1DC7A 1GGEA 1QXSA 1SFRA 2OOKA 3IXMA 4U7JA 4B4DA 4URVR 5JYEA 3AETA 2CJWA 3P20A 5EERA 2CVZA 3QJGA 5SZKB 1PS8A 2I4TA 3IEUA 3ZK7A 5KPJA 5C52B 2OXRA 2QTCA 3VYVA 3EUAA 3EH2A 2P1DA 3LT0A 4QSMA 1BWSA 3QRWA 1FIUA 3R3VA 1QORA 1PVOA 4YJDA 2WJJA 4RL4A 5C7IO 4Z0HO 1NW3A 4TRJA 3LMKA 2WKQA 4I9FA 1YJ8A 2ZRCA 1QGAA 4N4AA 3IT0A 4R3UC 3I12A 1J0AA 3JXEA 4X90A 5IYZB 2IX3A 4UAUA 5AVSA 1RJ9B 4UHFA 5IMSA 4RLSA 2XA1A 1U0HC 3GJ5A 1A0OA 5J2TA 3A58B 4PN7A 2VP0A 4Y0VA 4EFDA 4K6GA 4KV7A 1DC4A 2WYUA 2QTMA 4YUZA 5IDXA 1XRSB 3W77A 3G17A 1A7UA 5F77A 2H9AA 1JH9A 4DANA 4DLLA 3K0BA 3I64A 3NRBA 4NATA 4AUEA 5CG2A 1K0FA 1CJSA 5BO5A 4DT1A 1PFGA 3DYBA 4F04A 6LDHA 1Z74A 2ZU0C 3TIFA 2NNLD 4OHZA 1ADBA 3EGIA 3T4UA 2BOVA 4DCUA 1A50B 1L5FA 2Z08A 2YJTD 1J2UA 1I6MA 1USUA 2IHKA 3C3EA 3GT7A 1FNDA 1MKYA 3QMVA 4BE9A 1OFGA 1WUKS 4QEKA 2DOKA 2WWYA 2R9VA 3GVHA 3EF3A 4L4YA 3H11A 4XM2A 3TI9A 2IUSA 3ZV3A 2ZJOA 4NYMR 5TQ2B 1BE0A 3MGKA 1A9QA 3PGMA 1Y1SA 4IQ8A 3ZGYA 2QPAA 1KKLA 1XG5A 4FBMA 5DWQA 4EF5A 3ESQA 4HUQA 1JE1A 5KVSA 2BRUA 1LDMA 3WK4A 1NW4A 2DWPA 1TU0A 1IOWA 3C16C 1DKQA 1OWNA 1GTSA 1WBJB 3MHPA 3ZZ0A 3LI2A 4ERXA 3BRQA 3KR2A 5HUQA 2BGIA 4WVFA 4YJ2F 3ZUGA 4RD6A 2R6HA 4UC0A 4ZQCB 4E7OA 3L43A 1PSDA 1PT7A 3MD9A 1RMYA 4OOFA 4P58A 1XMOB 2OGSA 1OHHA 1CVLA 2BCGY 3DYIA 5CIYA 1VL5A 3AB7A 4R68A 1CE8A 1QS0B 1T0JB 2GNOA 3IEKA 2QN3A 3KOOA 1BEEA 4U2GA 1JLKA 3W5JA 4YJ2A 2VUHB 4HRAA 3ZS8A 1OI4A 1OZGA 1UOOA 3FI0A 4FFOA 5CURA 2VP2A 3TKYA 5ALVA 2XDQB 3JR7A 1X70A 3ZV7A 2CVHA 4F4FA 2XQKA 3I30X 1RRMA 1YH3A 2ENWA 2PPLA 2QTAA 3NHZA 4TSRA 4QODA 5B30A 3JQAD 4L0CA 5CCDA 3MXOA 3F98A 2ID4A 1N3YA 2CSUA 3FPJA 1YCHA 3PR1A 5FBLB 2QHXA 1LVGA 1KIFA 4GSYA 4XIYA 1SIUA 2YKGA 2ONKA 1R16A 1H5UA 5B3LA 4Y2PA 1YNSA 1GARA 1NHWA 2QVGA 1GZ7A 3L9WA 3O4FA 4U7WA 4NBUA 2IV2X 5JBIA 1YNOA 2W6QA 2ZW9A 3FZEA 4IRUB 3REQB 2VYQA 2WTMA 3G6KA 3HYLA 1N34B 3KL4A 2NP6A 1RXSA 2RBEA 1J22A 1CCWA 1W4AA 5JADA 5EMMA 2DMRA 3GFVA 3O21A 2QSJA 4BZZA 2IL1A 1XYVA 4JYCA 5K0BA 2EX4A 4X8LA 4HPJB 4KXLA 2WJVA 1O95A 3LT2A 2EG5A 2ZSBA 3BG5A 4K9OA 1I2AA 1SQSA 2GVNA 4BOYA 1YK0A 3O38A 3OIYA 1EJ0A 4AG6A 1GTRA 5A9RA 5FEUA 2YIMA 1BGWA 1XAIA 1YU6A 4GDMA 4ARZA 1B23P 1OI2A 1T8YA 1BU8A 1QGED 3JALB 2WWVD 3S40A 5IKEA 3U60B 1U1IA 2ZTLA 1J56A 3KB8A 3ZWBA 1NY5A 3LY5A 2F1RA 2I34A 3DVAB 3NXKA 4P7KA 2I3ZA 1A3CA 3R7DA 1Q50A 4MR8B 4JUCA 3WLFA 2JFWA 3K9QO 2JIZA 3LPMA 4IPTA 3UK2A 4MS3A 3HXPA 4C4XA 3QMPA 4GMFA 4YA6A 3HRHA 5B3KA 2GTHA 3F3KA 1JEQA 4BCCA 5E38A 4YRMA 3KQSA 1E98A 4NAVA 1CZLA 4F96A 3EC7A 3A0UA 4JLSA 2E82A 1U7TA 3OP1A 2PS9A 3GUUA 2GK4A 4MKIA 5AWFC 4XR9A 3HUEA 4O4IA 3JVUA 2H7CA 1AUPA 1F06A 4QUDA 5C31A 1LWNA 3AGQA 4GXNA 5HUHA 5M29A 1UJ6A 1VL0A 3C3XA 1RKQA 3Q11A 2WIGA 2VTDA 1ZEMA 3RLIA 4QUHA 1KK3A 2GZ1A 2VEDA 2ZI4A 4TTJA 4B8ZA 4Q7JB 1SHLA 2C8KA 3C48A 3LA6A 1WXDA 4BLUA 1JAIA 1PT9A 1FK8A 1Y1KE 3EIOA 2QUZA 1F8GA 3CLSC 4D4GA 4WY2A 2HTEA 5EZQA 1HOTA 5H0IA 2I3DA 4OMDA 5I3ZA 1NHGA 3P2YA 2CXRA 4XD7D 2PSFA 1Z8FA 4K3VA 3HJGA 3OFSA 4N18A 3RYIB 4DQUA 1YE3A 4OYRA 5GWXA 2GYYA 2RGAA 2Y2VA 3NM5A 1GPLA 2MU1A 4JEIA 2BM8A 2CJYA 3UGJA 3SR3A 3EA5A 2W6NA 1QLJA 3HQ4O 4AZTA 5B4VA 3P9QA 1WHTB 4TUYA 2J3MA 1XEXA 3FN4A 4I8IA 3VYUB 4J0DA 2ZPUA 2ZSFA 3D6MA 3GEGA 1DHRA 1QE0A 4FFMA 3WGTA 3AHDA 4F5ZA 5CA1B 3HO8A 5E2AA 4PQEA 3FDJA 2I6TA 1R0SA 2JIDA 4MR8A 3RQSA 2XTMA 1AN9A 3ZVKA 3I52A 2O23A 1LPBB 1Q17A 3AFHA 1MRSA 3ZGZA 3LDFA 1WZIA 5IN5A 4LHXA 2X86A 2LD4A 3K73O 3NHSA 1RVV1 4NJMB 4Z51A 5EE1A 5IAAA 4NOLA 4Q03A 1KTIA 5TF4A 1WMEA 2BFCA 3C8MA 4KBFA 2Y1XA 5EIHA 3KFLA 4TM7A 1ZZGA 3K2EA 4YT5A 2ZZMA 1W5AA 1E3WA 4NKRA 1RVDA 2OKCA 2P9BA 4HJRA 4TOIA 2C2KA 5C81A 1OY1A 2EZ8A 1D04A 3NTOA 5EMLA 1E6WA 3WIOA 5JS6A 4ESVA 2OESA 1VMAA 4UEWA 5CVDA 1I5RA 4TLLB 4JQCA 5CLLA 3TQIA 1WPXA 2GBCA 2IY8A 4JI5B 1FDRA 4B87A 3KSBC 1NL3A 1GVNB 1CTQA 3LTEA 1WDTA 1N7JA 1ZK0A 3OPYI 3S5UA 1LXCA 2VNSA 4ANFA 3K70B 4MKZA 3KFXA 5DTMA 3DFFA 4WXMA 4C2AA 1UBCA 2JLXA 2O8FA 1EGQA 2ZE8A 1NR5A 3VZBA 5C1PA 2R3SA 4KX5A 2OV8A 4MUMA 4C29A 3CF2A 3SHFA 1QVAA 4QUJA 3A2KA 3P52A 4NH4A 4B35A 1R5BA 3VR5H 1NXVA 1XQYA 5ENVA 5LBIA 4PQRA 4DHEA 4E1VA 4IF6A 3LZ6A 3RB8A 4KK4A 3PC7A 1SWWA 2YWFA 1VBMA 4V38A 4O8CA 1DCTA 2UZ1B 1X7GA 4LAFA 4HVLA 2D74A 2GN8A 2PJZA 3DEYX 3KV3O 1N2JA 3L8MA 2PSSA 3L79A 1NXPA 4TMWA 1KR5A 3QWAA 2D2FA 2YRFA 1RWVA 4RD0A 1AKVA 1GXSB 1I4OA 3DS8A 3W05A 4OXNA 3WGVA 5F7OA 3BT7A 5FKJA 5F9HA 1XTSA 3M2TA 5HBGA 3DVQX 4D9JA 1KOGA 2FOIA 2P2SA 5DGTA 5KYYA 3F73A 4HDCA 3SJUA 5G02A 1ZRNA 4LA4A 4LHZA 1K1EA 5EE5B 1P2BA 2ZB3A 3KK0A 5F9MA 2FFHA 3ASUA 3LIPA 1DP4A 1VJTA 5AUPB 3RWMB 3D8BA 1U8AA 4DFDA 5IDVA 1VBFA 3OI7A 3KWLA 1IXKA 5AKHA 1T4CB 1USVA 2OCIA 1JQDA 3OT1A 4I14A 1GQFA 2VWPA 2WEKA 2CJXA 4GBGA 4KXXA 5EZYF 1DWOA 1TADA 4F84A 1FOEB 1KEEB 3GJZA 3O03A 5MFPA 1TCVA 4B46A 4PSKA 2HRZA 3KZXA 3KQHA 2HNBA 2PWYA 1Z7BA 1W46A 1N2GA 4ZT4A 4QUKA 5KCMA 1VZ3A 1Z47A 1KVUA 2HJWA 3AL0C 2Y1EA 5P8WA 1ZN9A 2WB2A 3NGLA 1NW7A 2O20A 2I99A 2HB6A 3JS5A 4FGZA 5ELLA 1BOFA 1C4WA 4BLPA 1HA3A 3KB2A 1R8QA 1EINA 3LW8A 4RVOA 4WA8A 1ZG3A 3UTDA 2OXCA 3GLGE 1YQEA 1RRKA 1JAHA 4L9SA 4XVUA 1L1RA 3CUTA 3SHTA 2QIOA 1UXJA 2SKEA 2VHWA 3PIRA 1X7XA 5LWQA 2X5OA 5CIQA 3U4HA 1ADJA 3NBAA 2WFLB 2B35A 4K05A 1HL3A 4D56A 1A5AB 2PRIA 4TL9A 5IUKC 3VR0A 2VSOA 3LT5A 3OKFA 4YJ2B 1D0VA 4IFBA 2ZZNA 3GA0A 3T9BA 1IHOA 2FMHA 3R5JA 2NUTA 5K6TA 2X8BA 3OLWA 4UBJA 3O9MA 1OAKA 4Y2RA 3EPHA 5FV4A 3LT1A 3KZOA 2ZT7A 4NDAA 3AUUA 5IAOA 4UEKA 4CTNA 1CB7A 4I8XA 2XLCA 4C0KA 3LNCA 1B1AA 4NCXA 3LPNA 4RDXA 4LF6B 2XIQA 4O0LA 4P82A 4PW0A 5FBHA 4JJKA 1YQUA 4RTLA 2GFHA 2XXAA 1E9FA 1SCUA 1IEXA 3T1YB 1QTIA 4CV0A 2KLHA 1KH3A 2DM6A 2M6SA 1RI5A 2QTVB 2RHLA 3AZQA 3EIXA 3NJ4A 4D3YA 5BNWA 2HEGA 3TSWA 1CF2O 2I80A 3H5IA 2IITA 3R7FA 2QP9X 1D6NA 4EKNB 3EW7A 1ACJA 3OP4A 3ER8A 1BKSB 4KEAA 2Q0QA 3H05A 2BT4A 5BYJA 4O59O 3OM0A 2BSQA 2A5DA 2YJ3A 1L0BA 1T1JA 4U7HA 1HE1C 2JA2A 1MW9X 3P4YA 1O94A 4G0QA 1ORHA 3DEFA 3Q40A 2GBIA 1SULA 4OQLA 4CU5A 4NAUA 3OJWA 3WYFA 2G0NA 5F51A 4TSKA 1ECCA 1IN6A 1EP3B 2DEUA 1WDKA 2H65A 1I94B 3PHGA 4DADA 4KE8A 3SEAA 2OZLA 4JEHA 3WYEA 2V7WA 4B3GA 2AXNA 4C20A 3F2VA 3TSYA 2W6PA 3GLHB 2VVTA 4TKLA 4IQGA 1FW8A 3HWWA 5I8WA 1ZKMA 4PS0A 5DWVA 1EPUA 3LHIA 1L5NA 4GR9A 2CLCX 3FFWA 4RJKA 2OPBA 2QAGB 3RVOA 3TL3A 1GTJ1 2ZS8A 3VTKA 1P0CA 2FFBA 4B6PA 2X4IA 4EPWA 3PQCA 2OPHA 4P93A 3EEQA 4D45A 2FZ4A 5AFSA 4DR4B 3L7YA 2A5FA 2XT9A 5KNBH 4JQSA 1D0IA 2WTUA 1B3RA 1JKFA 1HZZC 2J07A 4UDOA 2IZ1A 4CIVA 3LSTA 1OH5A 4QPNA 1Q84A 5LCXA 3ROQA 3A4IA 1BMTA 4IUCS 4Y2YA 3K4QA 1G5RA 3EYWA 3ND7A 2WR8A 5HKOA 1M66A 2BGTA 2PKCA 2PX4A 1UMBB 1FL9A 1BVUA 3GGJA 1LFDB 3TX2A 2P1RA 2XUFA 3L7AA 5AYVA 3V1MA 1G42A 5EYPB 1JJVA 2H08A 2VHYA 2TYSB 3C8HA 2PXAA 4FDVA 3E7PA 5ABPA 2UZAA 1S4QA 1JHQA 2EFGA 5EXPA 4MUGA 4F3TA 1YT5A 5FQNA 2RKWA 4C0AC 4P22A 3R7SA 2V59A 1REQB 1QYXA 4HXFB 4Q1EA 3TSOA 5MGBA 3FPKA 4JUAA 1M54A 2PX0A 4BNKA 2BI4A 3A1NA 4CI9A 1P9NA 1T25A 1IPHA 4DNQA 1TUBA 4KO4S 2H2GA 2ASVA 4K81B 2JCVA 1GR1A 3C3MA 4J49A 1YKGA 4KSCA 5KTKA 3SBDA 1VG0B 4Z53A 4HO1X 1BG6A 1HYGA 1HETA 3TQTA 1JDSA 1NXWA 2ZRJA 4QHTA 1WUIS 4F5WA 4W5QA 1DNPA 3M3HA 1OJ7A 3WDSA 1U4SA 5KYUA 3NYIA 4QXRA 2JK0A 4H6VA 3PV0A 3TCNA 4M88A 3O83A 1XPOA 1XVTA 3EOZA 4CL3A 2Q6IA 4UDNA 1WIWA 3EBLA 3OH8A 5E95A 1FNNA 1L4NA 4BNFA 3GQBB 4DQLA 4YCMA 4RJTA 5LU9A 4ZCMA 2W4MA 2GARA 1JV2B 4Y6RA 5GMOA 1PZHA 3DF7A 1QK3A 3DAOA 3I1JA 5JAIA 4YCLA 5DJ5A 3TLEA 4CTJA 1YULA 4BO8A 4Y2TA 1TUGA 4QTTB 5G0WA 4YIKA 3H2YA 3UATA 2HMTA 5I5GA 1LY1A 2YVLA 4GYYA 1COZA 3OIGA 4QNRA 4E3ZA 2PUBA 2IYOA 3IT3A 1X3SA 3H1BA 2BYTA 2BTEA 2JBAA 2LKCA 1N9GA 2J9YB 2Q4RA 4D92A 4PE5B 4EA8A 3RVBA 1NF9A 2EP7A 4V3CA 3U3KA 3NBFA 4EH1A 4FILA 4ZV7A 2PBRA 3HFSA 3EAFA 5D1HA 2CSXA 2FPOA 3BULA 1LW7A 1OB5A 4UARA 4A2QA 2E48A 2QN6A 5K6AC 3CC8A 3TLXA 1QK4A 4JS0A 1U9IA 2H31A 4QHYA 4PAQA 2DU8A 3H1TA 4PICA 3BXEA 4YP7A 4KJZA 4ZEOA 4OLFA 4K6CA 5F1KA 3RAGA 4D43A 5BXYA 1L8AA 3DLBA 4NMXB 4MDFA 1XDUA