2PBLA

Crystal structure of a putative thioesterase (tm1040_2492) from silicibacter sp. tm1040 at 1.79 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
262
structure length
262
Chain Sequence
GMELDDAYANGAYIEGAADYPPRWAASAEDFRNSLQDRARLNLSYGEGDRHKFDLFLPEGTPVGLFVFVHGGYWMAFDKSSWSHLAVGALSKGWAVAMPSYELCPEVRISEITQQISQAVTAAAKEIDGPIVLAGHSAGGHLVARMLDPEVLPEAVGARIRNVVPISPLSDLRPLLRTSMNEKFKMDADAAIAESPVEMQNRYDAKVTVWVGGAERPAFLDQAIWLVEAWDADHVIAFEKHHFNVIEPLADPESDLVAVITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative esterase/lipase/thioesterase
publication title Crystal structure of putative thioesterase (YP_614486.1) from Silicibacter sp. TM1040 at 1.79 A resolution
rcsb
source organism Silicibacter sp.
molecule tags Hydrolase
total genus 92
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pblA01
2D0DA 1LGYA 4H18A 1H23A 3PF9A 5ALTA 1CUCA 1C7JA 3VJLA 5KWIA 3BDVA 2ZJFA 2XQJA 1JJIA 1ZICA 2WM2A 1UOPA 1HL7A 2CEKA 3WWPA 5CXUA 1JI3A 1Q84A 1JFRA 3GBSA 4U2CA 4PSCA 1CUFA 2YH2A 1VXRA 5JAHA 5CW2A 4EY7A 5AM5A 2QM0A 3G0CA 1PV1A 5A6VA 4GW3A 3IA2A 3I6MA 2PU5A 2HU8A 1MX9A 3F96A 1QTIA 4BDTA 5AK5A 4DNOA 2WTNA 1QIFA 1C7IA 2FUKA 5C81A 3AIOA 2J3QA 2XLCA 4HS9A 5K3FB 3WK7A 4OCZA 4AO7A 5LZ2A 3R41A 3H17A 2RHWA 3WI7A 4AXBA 3V1LA 3NUZA 5K3DA 4BZZA 4X6XA 4DTCA 3C5VA 2JGEA 4Y2VA 5HKAA 3FOBA 1FFAA 2FJPA 5ALDA 4JYPA 3FAKA 3W9UA 4B7ZA 2O7VA 4KEAA 4HXFB 1M33A 3KSRA 2WFZA 4BAGA 1CEXA 2XUKA 1CUUA 2ACEA 1CUZA 2GBFA 2OGSA 3SK0A 4BTVA 1GKLA 3TEJA 4AX4A 1BCSA 4X6YA 4UHFA 4NZZA 2WHRA 1Q83A 1DWPA 3VKFA 3ED1A 1UK7A 2C5GA 1QFSA 3TJMA 4K6KA 2GYUA 5LZ4A 4YASA 3ZLVA 2VJBA 1YA4A 4MQLA 3H0CA 5C8XA 1HBJA 1PFQA 5EFZA 4MEBA 5K3AA 2D5LA 2G5TA 2GBGA 1YS1X 4MQMA 1E66A 5LKAA 5LIPA 3RKSA 1VA4A 3LCRA 1B41A 2HA4A 5LZ9A 3BDIA 3LIIA 1SOMA 4EZIA 4H7KA 4QWMA 3EQ8A 1E89A 3FYTA 2LIPA 4H7HA 3H1BA 5ALXA 5K3EA 1IZ7A 1DINA 3DL7A 1GT6A 3F98A 1P0PA 4I4CA 3PICA 1ZD4A 5AOCA 4QLOA 1XZLA 3ZLTA 3U0VA 2ZYIA 1ZIYA 4KE6A 1XZMA 3QYJA 2XMZA 3N0TA 1TCCA 4BRSA 2C7BA 3KXPA 2WG1A 3CN7A 5I9IA 3ANTA 2YXPX 1CUGA 4U2DA 1WM1A 3OG9A 4CI9A 3S2ZA 1G42A 5AI4A 2C4HA 4Y2UA 5CMLA 4B9EA 4YX9A 2Z8ZA 4A16A 4B84A 5DLPA 5EIHA 4DNPA 1YCDA 3WIOA 4J0IA 2ECFA 2I78A 5DYWA 2Z8XA 4UBMA 2XQFA 4JH0A 2PUHA 4WY5A 3VJKA 1RP1A 5YASA 2Y1KA 1WCYA 4GHWA 3WWDA 3PUIA 3R3WA 4DGQA 3B5EA 2BKLA 2HA7A 3C6YA 4C87A 1LPSA 3ANSA 1N5RA 1W1IA 3F97A 1FSSA 4F60A 1ZJ5A 3KD2A 4WY8A 2XI4A 4OYLA 5BWCA 2XQIA 4BC1A 2WIKA 5AKGA 5J3JA 1JU3A 4X3CA 5JD4A 2VA9A 2O2HA 1K63A 1LBSA 2JEZA 5IVIA 5FV4A 2Z3ZA 5ALQA 2QMQA 2RGUA 3HRHA 2OGZA 1CUEA 2B9VA 2HA6A 2WTMA 5EIEA 2BJHA 2RONA 4ZXFA 4QDUA 1LZKA 5HF9A 1O6GA 1CUBA 4OUKX 2XMBA 4OYYA 2XQGA 1EB9A 1CUAA 3IUJA 1MX5A 4C89A 1CUXA 1R50A 5FKJA 1S8OA 5AKYA 2QOEA 1VZ2A 3MVEA 1MAAA 2GBIA 5CBKA 1W76A 4RGYA 4X71A 1TCAA 5JZBA 1QONA 3WL7A 5EHQA 3QH4A 4F5ZA 1AMNA 5HK8A 1EI9A 3D5EA 1ZD5A 5FRDA 4JYMA 2B61A 3WWOA 3IVMA 4U2GA 3DD5A 3QMWA 1R88A 5CT5A 1LPAB 1DT3A 2WUGA 5ALOA 5KREA 4WFJA 4BYMA 4KJXA 4BVKA 1DT5A 3OPMA 3R0VA 4PQEA 3LP5A 3D0KA 4X97A 1QO9A 4H7JA 3QZUA 3KDAA 4EUSA 3W06A 3WQHA 4P9NA 3BJRA 5E4TA 4BB0A 3E4DA 1CV2A 2PSEA 4KAAA 3FVRA 3HACA 3L1IA 1XRQA 2RI6A 1U8EA 2W22A 4E11A 4BZWA 4E14A 3WK9A 3I2IA 2VAXA 2PPLA 4G1FA 4N5HX 4QDXA 4GWLA 1ORVA 4AZ3A 2IITA 5CT6A 4QWWA 4H7EA 2R8BA 4NMWA 3R3XA 1XZCA 1YA8A 2UZ0A 2XMQA 2XMRA 2X8BA 3DOHA 1ETHA 4FLMA 3U1TA 2AJBA 4M0FA 3NWOA 5C7YA 1VOTA 3WL6A 1R4ZA 4GLBA 1AC5A 3ILSA 2V9ZA 2OPHA 5IKXA 2HA0A 2ZJ6A 3I1YA 4CIAA 3H04A 4DMKA 2CJPA 2JF0A 2R11A 1TRHA 2QJRA 2WIGA 3O9VA 4PF1A 4QDOA 4DSZA 2OCGA 5CXXA 2H7YA 2WJ3A 1DTEA 2YYSA 5HF5A 2BUAA 1XLUA 4BRZA 4YK7A 4WJLA 4Q3OA 4WFKA 4MYSA 4IH9A 1UZAA 1XQYA 3D3NA 4G9EA 3JWEA 3MUNA 5JATA 4Y2XA 4AN0A 5FUMA 2JGJA 2PSFA 2PSDA 3HYSA 1BN6A 1OXMA 2Y2UA 1G66A 3IB3A 2VTVA 1T2NA 2XUGA 3FLEA 2WG0A 5ALJA 2BFNA 3D2CA 5EIAA 3HSSA 4Y2RA 2VATA 1USWA 4UPDA 5DTIA 3W05A 2HL6A 3FYUC 3G9UA 2FJ0A 5C8ZA 3DQZA 3ZLUA 5CRIA 2EDCA 4KE8A 2IIVA 3C43A 3WKBA 3WL5A 4WFIA 5HQ3B 2OQIA 1E3QA 4Q34A 4C88A 1H2WA 3M83A 1L7QA 2IX9A 1MO2A 2DQYA 3AILA 4E46A 1TK3A 1MNQA 4DSAA 3C5WP 2QXUA 1XRNA 3O4IA 2G4LA 5AK3A 3MUOA 1ZI9A 2OCKA 2DCMA 2RHTA 4UUQA 1IVYA 4LKOA 3LLCA 5AI9A 5ISMA 3WJ2A 4Y2YA 3QBJA 4TGLA 3AZPA 3K2IA 3C6XA 4N8SA 4L9AA 1LNSA 1GPKA 4IHAA 1DX6A 1W75A 5FLKA 1IUPA 2JGIA 4ZRDA 4HRYA 5LZ8A 3OTQA 1UWCA 4C4ZA 4G4IA 4DNFA 3DLTA 4UHEA 1CUHA 1JMYA 4OB6A 4XJVA 1Y7HA 3IUQA 4FWBA 4G9GA 5HZGA 3FCYA 5E4JA 3VVMA 2V97A 1FJ2A 3B12A 2XMGA 4K5QA 4P93A 3HC7A 4J0HA 4GECA 4BE4A 2PL5A 5AP9A 4LXGA 4ARBA 2WUEA 4AMYA 3WZLA 5ALWA 4B82A 1QLWA 2ZVDA 2FX5A 2X76A 4X00A 1YAJA 3I1IA 4CIBA 1X70A 1CUIA 5HQ3A 1SC9A 2VF2A 4UBIA 2EEPA 4DIUA 3FYUA 1JJFA 2XDWA 3LS2A 3R40A 1X2EA 1MN6A 5ALRA 1WB6A 3QPDA 3RM3A 4BBZA 2XUFA 4G8BA 4MYDA 1CRLA 5ALLA 1QIGA 1K5PA 5H3HA 1KU6A 5DNUA 5EHNA 1NX9A 3NOXA 5KWJA 1CUSA 2GYVA 2AJLI 3WKDA 1J1IA 3HI4A 3T52A 1SCQA 2AJ8A 3KWFA 3VISA 5AHXA 2O2GA 3NGMA 1U2EA 3X3HA 5CTAA 1SCKA 1U65A 2JGLA 5DTJA 4H77A 5ALFA 4UHDA 4MJ3A 3A2MA 4PO3X 1N5MA 3FCXA 1QIIA 5A62A 1QTRA 5JZ9A 3IDAA 1WOMA 3BE8A 2QS9A 1XZFA 1XZDA 1MAHA 3M82A 4PW0A 4EY4A 3V1NA 1WB5A 5FDFA 1AQLA 1BN7A 1X2BA 3OOSA 2QRUA 2Q0XA 1CPYA 2VEOA 1THGA 3O4HA 5EGNA 3YASA 3BJMA 3GROA 5JAOA 3O9MA 2ACKA 4FTWA 4RE5A 3DEAA 1ZGBA 4CFSA 4Y2QA 1UT6A 4UBKA 4P08A 2XMCA 4FNMA 4V2IA 3STUA 5AKEA 4X93A 4F21A 3IUNA 2Y6VA 1QJ4A 3K6KA 5E2IA 4J0DA 1TIBA 2JIDA 3HEAA 2EDAA 4IO0A 4Q82A 4K6HA 4DYHA 2C0QA 1BEZA 5HFAA 1E8NA 5AKKA 1QO7A 3STXA 1CQZA 1XQWA 5ALHA 2JEYA 5LYYA 5F4ZA 3HXKA 3V9AA 2QUBA 2WQZA 1BS9A 1Q0RA 1ZOIA 1FFBA 4L3WA 2G63A 1Y37A 1AUOA 1JT2A 1CQWA 4BP8A 1FFCA 1ZIXA 3WWCA 3DNMA 3V1MA 3PDCA 4C01A 4CCYA 3W9BA 3DKRA 3WK4A 1H2ZA 5I8PA 4I3FA 3V1KA 1LZLA 1W6RA 1HQDA 1LPNA 3KWJA 5ALSA 1ORWA 1J07A 3FBWA 1XRRA 3JW8A 4B6GA 2J4CA 1Y7IA 1C4XA 1HPLA 2HFJA 3BIWA 1E8MA 3F8SA 5JD5A 3T4UA 1WHTA 1E5TA 2PVSA 5LKRA 2C58A 2WHPA 4HTAA 4J0KA 4BVLA 1XZGA 3C6BA 5LP1A 3L1JA 2CBGA 4JEIA 5BOVA 5FP0A 3ZV7A 3G02A 2B4KA 4KR0A 4X7BA 4AMZA 4DMCA 1CR6A 4X95A 2HADA 5IVKA 4B0OA 3G9XA 3IIIA 4KRYA 5JANA 5HKBA 3WK5A 1DWOA 1UOQA 4G8DA 3G9ZA 2PKYX 3ZWQA 2HIHA 5JZSA 4EY8A 3W04A 2HRRA 2DHEA 5EI5A 2OQVA 4QNNA 4QLAA 4WDQA 2OCLA 2XLBA 4QDTA 2WKWA 1LPPA 4BP9A 1F8UA 1F6WA 1JJBA 2X5XA 3STTA 1EDDA 3H19A 5T4EA 1GPLA 4U2EA 3I6ZA 5CH3A 4GDMA 3R3VA 4X94A 3D7RA 4IH1A 3VXKA 1LLFA 1VLQA 1MPXA 1UKCA 3BIXA 3SX4A 2QXTA 4BATA 2RAUA 1UOOA 4QZVA 1UKAA 4FHZA 1TCBA 3R3YA 4Y2SA 2ZJ7A 4FNGA 3EIOA 3O95A 4RPCA 1AX9A 2Y6UA 4KAJA 4ROTA 3IBTA 4BCDA 4BCCA 2ONCA 1QIDA 5AM2A 2CUTA 5DYTA 1LPMA 5AM4A 1HKHA 2ZSHA 4N8EA 1G5FA 1HLGA 4TVKA 5ALYA 2HM7A 4FFVA 3RK4A 3WKCA 4QE3A 1MNAA 3G0IA 4HXGA 2BUBA 1EHYA 2WJ4A 1ODSA 5AJHA 5ALGA 4BAZA 4UFOA 4P92A 5JARA 3EQ9A 3H18A 2VJCA 1WPXA 2PX6A 3N2ZB 3WKEA 4LYEA 1MX1A 1EH5A 4Y2TA 3E3AA 4AB1A 4HXEB 3AIMA 2ES4A 3PF8A 2XQKA 1N1MA 1F0PA 3WK6A 4FKBA 3GUUA 3IURA 5AICA 5A71A 4EY6A 1LBTA 2AXEA 3ESDA 1UKBA 1IUOA 4OPMA 3H1AA 2XUPA 2XUJA 3WA6A 2NW6A 1XZJA 1CUYA 1H2YA 1QGED 5ALMA 5LLSA 4PSDA 5C8VA 4BVJA 4OSEA 2WLSA 4IQ4A 1XQVA 1H22A 4DNQA 4J3JA 4LYDA 2WU4A 3DL4A 2O2IA 4BDSA 3W2TA 5IH7A 4H7FA 4J0GA 4WCVA 1QIHA 3IUMA 4B0PA 3AUKA 4W9RA 5DYYA 5DJ5A 1A88A 1J06A 3BF8A 4H0CA 1XRMA 1MTZA 1VA5A 3A6ZA 3GA7A 3WA7A 1GPNA 5AIAA 1R9MA 1ZJ4A 4ZGBA 3FNBA 3FSGA 1MU0A 1ACJA 1I6WA 3UUEA 3DYVA 4WDRA 3PI6A 1XLVA 3FWHA 1QZ3A 3AZQA 1P0MA 4I19A 2XMDA 1YAHA 4H7DA 1CVLA 5T4BA 4G5XA 4A23A 1EVQA 1YS2X 1DX4A 1ZI8A 5DNWA 4CG1A 1XKLA 4NS4A 2OG1A 4LXHA 1GXSA 5D3ZA 2VSQA 3I2HA 2HA2A 4NVRA 1BU8A 3FYUB 5IVDA 3DCNA 5A7HA 3ZI7A 1DQZA 2BGRA 3ESCA 4EY5A 1KEZA 1YB7A 2E3JA 1LPBB 4X6UA 3EBLA 1OCEA 4Y7DA 6YASA 4ZI5A 3FLBA 3G7NA 7YASA 5AKZA 2OAEA 3G0GA 1VE6A 5EHZA 4OB8A 4Q3LA 3H2GA 3HZOA 3P2MA 4X92A 4ZV7A 5AIBA 2HHAA 4U2FA 2PUJA 5HF8A 1AKNA 3BF7A 2QR5A 5K3BA 5AOAA 5JAPA 3M81A 2OAGA 4J0CA 3LIPA 1DU4A 2HFKA 4B81A 1MT3A 4PNZA 2AJDA 4KAFA 1EX9A 2XUDA 3C6ZA 2JGKA 2WUDA 4C6HA 1CUDA 1VZ3A 4DM7A 1VE7A 3AINA 4OB7A 4FFWA 1GQRA 3Q8WA 1UK9A 4J7AA 2BGNA 3H2JA 5CT4A 5HCUA 3Q0TA 5K5EA 1DQYA 1ZD3A 2H1IA 1XFDA 2ZYSA 4Q3KA 5HK9A 2C0PA 4S0XA 1XZAA 4MXDA 4M0EA 4Z49A 5KBYA 2OLEA 2H7CA 3STYA 2WHQA 3OM8A 2P8SA 4PSUA 4B80A 3SWWA 1BE0A 1BRTA 2PSHA 3BWXA 3C87A 1H2XA 2ZYRA 2HDWA 4CG3A 2JGMA 3FLAA 5CURA 3IULA 4HVTA 2DHCA 1J2EA 3WLAA 3I2KA 1XZEA 5AM1A 4MEAA 4KRXA 5ALIA 4XX1A 1HDEA 2WFLB 3AIKA 3CN9A 5ALKA 5JAUA 3SC2A 5EHXA 4ITVA 3AZOA 1ODCA 2I3ZA 1L7AA 1QIEA 1VKHA 3H2KA 4O08A 3PFCA 2CZQA 5LZ7A 1R3DA 4N8DA 2CB9A 4Y9SA 1SCIA 2DFPA 1EK1A 1ISPA 3GELA 1CLEA 5JALA 5IVHA 2XUOA 1GQSA 1JU4A 5AKXA 1IZ8A 3O4JA 5JASA 2DHDA 5AI0A 5FOQA 3OC0A 4LHEA 1D07A 4CCYB 4Y2JA 3V48A 3ZPXA 1K6EA 1FFDA 2GYWA 1XRLA 4GEGA 4INZA 3AFIA 3WWEA 1LPOA 1B6GA 4X91A 1T4MA 1QOZA 2QZPA 5DWDA 3O4GA 1TQHA 3HLKA 5BV7A 2XT0A 1THTA 1U4NA 4RE6A 5CH5A 1RWQA 2WHPB 3CCCA 4FBMA 2PU7A 3F67A 4EB0A 4UFNA 1SFRA 2DR0A 3I2FA 1ZI6A 3R3ZA 3JYHA 3EQ7A 3C45A 1TAHA 2OGTA 1EDEA 5AI8A 4FMPA 3K9BA 3AJAA 5K3FA 4D9JA 2I3DA 1K8QA 4MWTA 4HRXA 2QTBA 1JKMA 2ORYA 4X90A 3QMVA 3STWA 1E8DA 1XKTA 4KYVA 3I6YA 1CUJA 2WFLA 2ZSIA 5DNVA 2WU3A 4B83A 1KU0A 3DJYA 1UK6A 1EB8A 3S8YA 5AKLA 3QVMA 5AH0A 1A8QA 5AO9A 3VJMA 2AJCA 3ICWA 3G8YA 4FLFA 3O0DA 1R9NA 2K2QB 3R3UA 4Y2PA 3DKKA 2GZSA 5AM3A 5T4HA 1A8SA 5HF6A 1A7UA 3FSGD 4BC0A 4N5IX 4PV7A 5AK6A 2XB6A 2WILA 4QA9A 2BUCA 1QIKA 3E0XA 2JGFA 4BE9A 2VAVA 2OXEA 4LXIA 3A70A 4EBBA 1ACLA 3C70A 3M3DA 5AI6A 3B3QA 2VJAA 1FFEA 1YSCA 2W6CX 1YB6A 4W1SA 1EK2A 1WPRA 3QPAA 4LIPD 3ESBA 5CH8A 3RARA 1CUWA 1AGYA 1XRPA 3TGLA 5ESRA 2VT7A 2ROQA 5ALUA 4G4GA 1UFOA 1BCRA 1ZD2P 1G4HA 3WZMA 3H2HA 3I2GA 2B20A 4UBOA 3C8DA 3ICVA 4L0CA 4M0MA 4G8CA 3QMMA 4J03A 1IMJA 1ODTC 4DMFA 1Q0ZA 3KOOA 1F0NA 3C8HA 1BROA 1XLWA 4AN1A 4EA6A 5AM0A 4UHBA 2J3DA 1YR2A 3HJUA 1XROA 4UHCA 2I03A 2C5FA 3PFBA 5K3CA 1AURA 4BAUA 2GBCA 1QIJA 3D59A 1QIMA 1YASA 2CMFA 2VQ6A 1PJAA 1MJ5A 2VT6A 2XMSA 2QVBA 4K6GA 3RLIA 3WJ1A 4C4YA 4MWSA 4A5SA 4BTLA 2GZRA 1EVEA 4XWGA 3GZJA 2WIDA 3D4LA 5FPPA 5BWBA 4W63A 4F0JA 2WUFA 1JMKC 3WK8A 1XQXA 1P0IA 5AKJA 4JUIA 2QT9A 2BCEA 4FLEA 2Z5GA 3G9TA 5CT8A 3FVTA 2WG2A 4BCBA 4KE9A 2PM8A 1XZHA 2HU7A 1EINA 4UBLA 4W1QA 5D7BA 4ZREA 1NU6A 5LZ5A 2WFMA 4X85A 5FXMA 4B85A 4ARAA 4ETWA 4W1PA 3WKAA 3G0DA 1W4LA 4JNCA 1CIJA 4OU4A 3G0BA 1EXWA 2HA3A 3DOIA 5AKHA 3BXPA 3L1HA 5SYMA 2V98A 1CFJA 4K2AA 5AK4A 4UBNA 4CG2A 3MGAA 1BEEA 4Q1VA 1UXOA 4AO8A 1A8UA 4B9AA 2CKMA 3DS8A 3H2IA 4C4XA 2DSNA 2V96A 3DDUA 3VVLA 2HRQA 3OURA 4W1RA 1TKRA 5AKIA 1QFMA 1GGVA 4H7IA 1AZWA 5AI5A 4DLNA 2QUAA 3A2NA 1Z68A 2XUHA 5E4YA 4AO6A 5D3KA 3GFFA 1K4YA 5FPQA 1OILA 2WIFA 3WYDA 3WIBA 3CXUA 5HFNA 1WHSA 4DMHA 2H7XA 3QPCA 3CCBA 1GKKA 1XZKA 4HAIA 4OU5A 3PE6A 2Z3WA 4UFPA 2WSLA 1WB4A 3VDXA 5JD6A 4AZ0A 3QITA 5A7FA 1N8SA 4H35A 4GBGA 5ALPA 3I28A 3QM1A 2ZYHA 4G4JA 1DWQA 4EHBA 2PSJA 2JBWA 2XUQA 3TRDA 4RNCA 2HU5A 2OCIA 2QJWA 4U2BA 3STVA 5ALZA 1EDBA 1EA5A 2VJDA 4L72A 1RYYA 4GI1A 1IUNA 4XIIA 2XE4A 2YASA 1XZBA 5SYNA 1GZ7A 3BL8A 3DYIA 2Y2VA 4ZV9A 4QEKA 5JADA 5JYCA 4IH4A 4KACA 4UBJA 2G5PA 5ALEA 3D2BA 2BAGA 4UHHA 4HZGA 2DQZA 4ZWNA 2PBLA 5I7UA 4CCWA 4J0JA 2WIJA 2XUAA 4FDMA 5CT9A 5ALNA 1R1DA 4KE7A 2O7RA 1QE3A 2WJ6A 1P0QA 4Q05A 4FBLA 5AOBA 4TPKA 4QDZA 1L7RA 1XZIA 4YPVA 1VJ5A 5D6OA 4XVCA 1W52X 3D2AA 2HA5A 4GXNA 3A2LA 3PUHA 3ESAA 4E15A 5ALVA 3WYNA 3WL8A 3UUFA 3F9CA 1NU8A 1UK8A 5T4FA 1CUVA 3E1GA 5JIBA 1VXOA 5A7GA 2J4FA 2XUIA 3UMJA 1O6FA 3HABA 3I2JA 2QKYA 4FOLA 4OD0A 5A2GA 3WMRA 3EF3A 2H9YA 4AQDA 1ZGCA 2RIPA
chains in the Genus database with same CATH superfamily
4H18A 2IE0A 4C7OB 1H23A 2CK3A 3AONB 4LOJA 2H4YA 5GPBA 3CZRA 1J39A 2YN2A 4I7EA 5ALTA 4A0FA 1KHTA 1B15A 5J40A 1M7GA 4G5SA 3CX4A 4UC0A 2ZJAA 1C7JA 3PSHA 3RSCA 1MOPA 4ZJYA 1D5CA 3D3QA 3IP1A 3PGMA 3OPYA 1S4QA 4QGGA 4XB2A 1JLSA 3GGDA 2XQJA 1Y7TA 3FI0A 1ODKA 1ZZGA 4JZYA 2UYOA 5A4MS 3GP5A 2CNWD 2C97A 3GGCA 3P8ZA 3UICA 4TYNA 4AN4A 3MOSA 2IYFA 5CXUA 4MZDA 2ZITA 5KVQA 1Z5OA 2OV1A 2QTRA 3ZDCA 1KFCB 1RR6A 3GBSA 1DCTA 1COWA 2WWFA 3P9PA 1K0UA 1F3LA 1V11B 1VXRA 4RD3A 2W2VA 3W6UA 3EEIA 3EGWA 4MR7A 5AM5A 3VZQA 2R8XA 4UDYX 1E1CA 2QM0A 1XK6A 3BA6A 4A1OA 1FW8A 1SXJB 4NCHA 4RPHA 5CXSA 1H2RS 3SX2A 3L6EA 4WKOA 1WZIA 1TQ2A 1ZSYA 1QG0A 1SZJG 2QTNA 1A9QA 3CVXA 3EIFA 4M9QA 2FDXA 3EFBA 4DCUA 3N3AC 3HWWA 3GLTA 3P9SA 1F8XA 2FLKA 3DEFA 2PU5A 4LVOA 2HIMA 4M0PA 2AYXA 1NNEA 1Q1AA 4NOJA 4PC6A 2Q5IA 1I5EA 2EFDB 5KJ1A 1OAAA 3WFJA 4U7HA 3K0BA 2PKWA 1OT3A 3FDFA 4MKZA 4PYOA 3PUKA 1VECA 3K71B 1OB5A 3TN7A 3LWZA 4A6XA 5THKA 2PS9A 5CA0B 4PIMA 3NHSA 1U8FO 4M1QA 2NU9A 4FSXA 3RYIB 3RWOA 2J3QA 1SU8A 4K6OA 4YRDA 2Q3DA 5K3FB 4AO7A 5AVZA 3TKAA 4JYCA 4URZR 1ZHOA 1C9MA 4MA0A 2NM0A 3NGLA 4WLOA 3PNQA 2VDPB 3RSFA 2CL7X 2I6UA 4YIKA 1A77A 1ZH4A 1Y1RA 1RHQA 2AYZA 3H5TA 1L5ZA 3UXMA 2VEDA 5DNYB 3DFZA 4DCSA 4KMMA 4CTJA 2N1MA 4AXBA 1KXZA 4L8YA 3RC1A 2G17A 5FWXA 3MW8A 3QX3A 1B8UA 3BB4A 1NXWA 2QRLA 3RCBA 4BZZA 1I7QB 2WABA 1HUQA 4HNQA 2UXDB 1UZUA 2JGEA 2GJSA 1E5LA 3CKMA 3H5NA 4ZVUA 2BMAA 4MQ5A 3TCKA 3AERA 4Y2VA 3DPUA 1ZMXA 4YLGA 5DZSA 3V46A 4DBLC 4JYPA 3FAKA 3DONA 1C7ZA 4IF4A 4LI0A 3EGDB 4B7ZA 3GP8A 1XTQA 2QTMA 1N0WA 3RK0A 4YNBA 1J2YA 2DHRA 3H11B 2PUWA 2FX2A 4MV5A 2G72A 3JYLA 4LTDA 3ZC3A 4DRXB 4PAWA 2RCYA 1M33A 1SVOA 1ZL0A 4WBNA 4C7OA 2ATCA 1ZSNA 1UINA 4C0QC 4TWAA 5CFLA 4BAGA 5TE9A 1WBJB 4K9MA 2C57A 2LBPA 2Q7OE 3NFRA 4HSEA 2XUKA 4IS3A 4RDHA 2EKBA 1OIWA 2O52A 3E7FA 2H92A 4JJ7A 4ZAWA 1X7DA 1I7SB 4D80A 1ZQ9A 5ARDA 3VBCA 1S7CA 1P7YA 3SFTA 4OX9B 2XRMA 2ZUVA 4RANA 1TM5E 2QY6A 5EZ5A 4AX4A 1D2MA 4GYKA 2AR0A 4X6YA 3K1ZA 4FXOA 4HWGA 1DBWA 4NZZA 3IKJA 1W0JD 2JFOA 3PPWA 1SIWA 3CZCA 4MPTA 1FW6A 3X1XA 1VL0A 5T67A 4GH5A 3A9TA 4EGAA 4AD8A 4ZO4A 1UK7A 1V11A 2VYQA 1ICIA 2D0PB 2O48X 1QFSA 5JTTA 2H57A 3TJMA 1XCBA 2IOHA 4JB0A 4K6KA 4QJ4A 1K1EA 1ZNXA 3OECA 2OO5C 2P9JA 3ET5A 2GYUA 1D1TA 3NXSA 5LZ4A 4GP6A 1E3IA 4O4JB 3LHFA 1V6SA 2O2CA 2QMOA 1FLVA 2X23A 4NH4A 4RH0A 3ZZ1A 2QYTA 1RXYA 2OCXA 3H5IA 1FU7A 1YA4A 3PIRA 4MQLA 3U62A 5JMTA 3H0CA 3PEEA 4UAJA 1DIOB 2SNIE 4K40A 4KXLA 4URYR 1PJ2A 2X1VA 3WRYA 1PFQA 2CN1A 1INLA 1WXHA 1FMFA 3E3NA 2Y9PB 4MEBA 4P33A 1NGSA 2RFLA 5K3AA 3P9IA 3MJ4A 2QLJA 3IHLA 4YMIA 3ZI4A 3N07A 3Q3VA 4N01A 2KM1A 3HXQA 2Q5LA 1V1JA 3W5CA 2R7MA 2V55B 1M54A 1E0SA 4XVQA 4CLDA 1P3Y1 2YX1A 3KCQA 4X8OA 1UAAA 2IDJA 5ER9A 5KDLA 4E5MA 1SB9A 1TIKA 1WD5A 4GICA 4OIMA 1OX6A 2C84A 4Y0AA 1SXIA 3W1WA 1JE1A 3T4EA 2MMCA 1KR2A 3LLVA 4CEHB 4UEQA 2QD4A 3AVQA 5LQDA 4OM8A 4WADA 5JSFA 5LZ9A 5BN5B 2OCPA 3A4YA 3BDIA 3HYCA 1OZ0A 1ZVJA 3ED5A 3LIIA 5ECDA 2HJHA 3LPLA 1QJCA 1TFUA 3P0HA 4HTFB 3PXGA 2PUFA 3USZA 1KXJA 1RKQA 3K1YA 4EI7A 5KX5F 3FYTA 1SPXA 3SX0A 4PGFA 1A69A 2JS7A 1LRJA 4L4XA 5ULLA 4LJKA 4UMVA 5JWRA 1N6NA 2MINB 3REQB 1KJ9A 4AJHA 4C6RA 4CKCB 3E8XA 1GT6A 3CLSD 4BFTA 3CUEF 4I4CA 1H1TA 5G4KA 2ZE6A 3RSHA 2PGXA 3G82C 1I2BA 1ZD4A 5EE5B 1Z2AA 1L6RA 2ODPA 3ZR4B 2J3KA 2CBZA 4OM7A 4XQGA 3Q2IA 3C3JA 1A5TA 2XY4A 4QLOA 1RPAA 3V7NA 3OKAA 4FMDF 4WOPA 3ZLTA 3C6MA 1GP2A 3FSEA 3NEJA 3R0JA 2WT8A 4BKPA 3OA0A 1MC8A 5HX7A 1O5TA 2DC1A 3NORA 4Z1OA 4OQFA 2JBHA 2GJAA 3L7YA 4NBWA 1OAOC 3ETNA 1TCCA 2NZ8A 2VPPA 3DT9A 2RK3A 3W9SA 1ETUA 3ECCA 3VTAA 3GCWA 3H11A 3GEBA 3PPXA 1EMDA 3PNPA 4QULA 5FA5A 1M9NA 3NVMB 5H70A 5KNBH 4O3FA 1UWVA 1CUGA 4U2DA 5EXSA 4EW6A 3IVRA 1G8PA 3RVDA 1T8YA 1G42A 1X1BA 3HBMA 3N5CA 3RAEC 4HX5A 1Q16A 2HC9A 5BSKA 2D1YA 5IAKA 4E4TA 1YWGO 3BJIC 4R8LA 4UVIA 4YX9A 1YNOA 2R6GA 3WSVA 5KYWB 2Z4TA 3THYB 1OXXK 3GT3A 3CR3C 1KEEA 4ENSA 1VJGA 1E2DA 1X42A 2JDIA 1YCDA 2VJPA 4B6EA 3DOEA 1MJGA 1H8ED 3RTAA 1GSOA 3N1UA 4Q4LA 1UADA 2ZI6A 1M2GA 1KDRA 4Y1GA 1NLYA 4RETA 3UGTA 4Z53A 2I78A 2ODQA 3B48A 3VR4A 1DKUA 2ZJYA 4P54A 3VC7A 1Y6GA 3EIEA 2WZBA 4PZDA 1VLHA 1S8FA 2PUHA 4OAQA 2EGUA 3WQBA 4U7JA 1XWWA 2X0DA 4I9UA 4F3NA 5CVEA 1M75A 2EBUA 1L7NA 2D00A 2FEPA 3DKIA 3GFQA 2A0UA 2GN8A 4FZVA 4HYTA 4R2IA 3V2GA 4HB2A 5I8WA 4W5TA 3WB1A 1YB4A 2Q3CA 2Q8QA 3ZV5A 3REOA 4YYEA 1ZK1A 4DWOA 2VVTA 2V59A 2R6HA 2BISA 3JQ7A 1DHTA 4LOKA 2JRCA 1CQJA 3UMFA 1KI8A 2WZCA 3B5EA 3DBRB 3I5UA 4QPZA 1WUKS 5CLQA 3DVLA 4B4VA 3QI2A 3OZVA 1O77A 2VPIA 3C6YA 2B99A 4PPNA 3FKQA 1OFUA 4IY1A 4TMXA 1SXPA 3F97A 2Z57A 3EGIA 3DFMA 2IOFK 4RK6A 4F60A 4YCMA 3DUWA 1CJBA 1SXJE 1YHYA 2AVDA 2ZE7A 3IP7A 4IUDS 4LYFA 5FBWB 2FWPA 4ALNA 2JLAA 1KK2A 3WBKA 1C8KA 2QVXX 3VDRA 2R5NA 2PGIA 4G0VA 1KTVA 2YZKA 4E2WA 2WIKA 1TVKA 5BN4B 1SHJA 1OWMA 1IIBA 5KMGB 3HJGA 2RB4A 3AR7A 3ER6A 1H9CA 3SF8A 5DXAA 4TKUA 2JEZA 3BSFA 1YVPA 1QYVA 1PS9A 1OLUB 3OPXA 2Z3ZA 4FONA 5ALQA 5DW0A 4CKCA 5FV4A 2UU9B 3I62A 1JDZA 5CNKA 2D1SA 1SN7A 1Y5RA 2RGUA 3HRHA 4OQLA 4ISCA 4QUEA 1BMFA 2QX8A 2CK3D 3AIIA 4TT3A 3UWMA 2B9VA 3PQDA 3OQIA 5PGMA 3L79A 4M1TA 5EIEA 1IY8A 5DYNA 2RONA 4O25A 4WW0A 1WBDA 4XPIB 3U6BA 1LZKA 4TX1A 1N5LA 4OHZA 4AQYB 4OA5A 1MDFA 1O6GA 4U4AA 4OA8A 4JCOA 3AHDA 4RACA 2H1VA 2WNHA 4MW1A 1ZOPA 2Y9MB 2FYTA 1E1NA 4LCBA 4EEZA 2GUGA 2XMBA 3O73A 3PTLA 1UJ4A 2XQGA 1Q74A 1ZY2A 2HMVA 2IYQA 3NYWA 4JXKA 1KI4A 4P7BA 4O4LA 1X7HA 1QDEA 1U2ZA 4C89A 1WP4A 4HSGA 3SS9X 2O8CA 3JQEA 3NIWA 1T5OA 1JYFA 2NO9A 1VL2A 2R4UA 3SHTA 1AKUA 5E7QA 4RXMA 1S6YA 3T7DA 1PL6A 5MDHA 2H4FA 2O3RA 2I54A 3PNVA 2GHRA 1COWD 5FKJA 3W77A 2NTJA 3GGSA 5CDHA 3DFFA 1N2ZA 3HCPA 4YJ2A 2YZGA 2NXCA 3HUEA 4WUVA 3IDFA 4RUKA 1VZ2A 2BHSA 1HR0B 4LRSB 3RFUA 1NXTA 1PR2A 1PG5A 1HFEL 3CVVA 4CG0A 4N6NA 1PG0A 3WGOA 4L5CA 2GBIA 1U5CA 2V7TA 3IBCA 3O3NB 1I1HA 1J2UA 1XXLA 4FDTA 3THYA 1XDUA 1V8ZA 1DAOA 1TU0A 2VN8A 3UJ8A 4GMGA 4LI3X 3N8GA 2GLXA 5CU7A 4RGYA 5KTOA 1TI7A 3VAZA 4MKHA 1NPDA 3W3AA 1PT5A 2FY8A 2DFDA 5EHQA 3WL7A 2OM6A 3NHAA 1AUPA 4QHTA 3HZHA 2AOXA 3LUDA 4NOLA 3TRKA 4LJYA 4FE7A 1EI9A 2X42A 3DAYA 3MB8A 3NJ8A 4AT1A 3BWCA 4M1MA 3O8BA 3TW0A 2VH5R 2JAWA 4ARUA 4EG4A 2BLLA 2ZU6A 1LWOA 3U19A 3DGFC 2RH4A 2K87A 3LT4A 2ZXUA 5FTKA 5F1OA 2ZM6B 4O4IB 1N7IA 3RIMA 1Q21A 1IEQA 1T5BA 4DIDA 2VTBB 3DD5A 3SBDA 5HA5A 4JT8A 3KETA 2UZ3A 3T38A 3CUUA 2AWNA 1M67A 4F4FA 5CT5A 4I5DA 4M60A 5FR2A 4ZEVA 4G1VA 3OBIA 2J9YB 2EQBA 4EG3A 4WFJA 3DB2A 5KREA 3I45A 1SK9A 2WJVA 1HQYE 1DOAA 1KKMA 2HV9A 3KSMA 2Q0HA 1B76A 1KR5A 3CF6R 4B73A 2AN9A 1DKRA 1MXFA 5B4VA 1RRVA 4OMFG 1H4TA 5DI9A 3HYNA 3L41A 4Q3EA 4YHBA 2OK8A 3O6VA 4C0KA 1QHNA 3CW9A 3ZTTA 6ABPA 2GEJA 4PQEA 2FFBA 3LP5A 3QUSA 1QO9A 5ERXA 4B3RB 1G20B 1GZVA 1ULUA 1WMDA 1TFRA 2HSGA 2O50A 3BH6A 3INNA 3KDAA 5EL0A 4WL0A 2C61A 4Q15A 1SCNE 2M98A 3QEKA 1M5RA 3KOWA 3WQHA 1WXXA 1QMGA 1NY5A 2Y99A 1S2MA 2DUJA 3E18A 4NDZA 1ZCBA 1TM4E 4Q4HB 4CTOA 4TL6A 2O8BB 3NYQA 4QYXA 3VRHA 3GV0A 1VIDA 5B2ZA 5DFAA 1E1RD 3FVRA 1OLUA 1Q7CA 1ZMBA 1CZKA 5IM4A 3T7CA 2RI6A 1YRQA 4NAVA 5K2MA 3AUUA 4IIBA 4W9NC 2B8EA 4F9TA 3CE9A 5I7RA 5H83A 1GGHA 1RXVA 2F90A 1GG8A 1VFPA 2W22A 4R1LA 4E11A 1W36D 5FEUA 4QYMA 3FR8A 3IPAA 5B64A 1F5SA 4ZTUB 2HD4A 4KHPB 3FHCB 3I2IA 3QNMA 3I92A 1N6KA 5D84A 3QOFA 3EJ6A 3VR2A 4FWTA 2PPLA 1D1PA 4JD5A 4NJEA 4G4SO 4RMGA 3BSWA 2Y0EA 4U6SA 4N5HX 1JPJA 1NI3A 4GWLA 1DTWB 1KKUA 3GF4A 4EAAA 2QZZA 3RVRA 2J0EA 1PG2A 5K8VA 4NY1A 1L5GB 4FJ2A 3EPLA 2VQEB 4NMWA 4FU0A 4RPJA 1DG9A 1IJEA 1QH9A 2HW8A 1SUDA 4Y6SA 3OZTA 3TVTA 4BX0A 2X1HA 3U09A 5JRDS 2OFPA 3EK2A 1SXJD 1SXQA 3A58B 3OMWA 2W2KB 1OXKB 1P72A 3ELWA 2GZ1A 1T8RA 2P5TB 4UKDA 1JIVA 1SQGA 2V7PA 3FDZA 4GYYA 4XDZA 5A4IS 3QFHA 3PQ7A 3B6EA 3RFCA 3BGWA 1KY2A 4N54A 4JVLA 2BP7B 2C4NA 2I91A 2PLAA 3CGGA 1U7OA 1VL1A 4YLYA 3B51X 3FYHA 4ZOEA 2AZTA 3B1XA 4V1CI 1HDXA 3ILSA 1J8VA 3KZCA 4JASB 2X3YA 1G9XA 1OGYA 4TLDA 4TUYF 1XELA 1P29A 4NRDA 2OPHA 4DMUB 2O6LA 3MHPA 1J2JA 1SUPA 2O3SA 1E60A 1OSNA 2FCRA 1TUBB 2PGJA 4Y9UA 3A6FA 4DMKA 2CJPA 3GT0A 4OSOA 4D44A 5IWAB 2O5CA 1TRHA 4RVNA 4AVYA 4OGFA 4AK9A 1SKYB 2QM8A 3C1UA 1CVIA 2ZRQA 3CCFA 1PZFA 4X3PA 5CXXA 4BNNA 3U2QA 1U0BB 2H7YA 5DISB 1OXVA 3GFGA 3TOVA 1I80A 1SBTA 3K9GA 5I7OA 4CKWB 4D9BA 4S35A 2BUAA 2Z5LA 4EKEA 4JI0B 3CEAA 1KFKB 2QQGA 1XLUA 3FD8A 3UT5A 1L4BA 1G59A 4YK7A 2P67A 4LV8B 1HTTA 2A59A 2B2XA 4WFKA 3ZCXA 3KQPA 4ZYUA 4LFCB 2CJXA 4YT2A 4HQLA 4KL8S 3SPXA 4L2IA 2DFLA 1M83A 3L8HA 4DR3B 3UMCA 3MSCA 5GADl 1BFKA 3DXYA 5F7ZA 5EP4A 1E2FA 1KRHA 3CXRA 2N47A 3D3NA 2LKCA 2DPGA 2RHMA 3FSRA 4RYLA 4BQRA 4RA9A 2FSGA 4RK1A 1UXIA 3MIIA 1J9ZA 2PXXA 4FI3C 4R1PA 4OXQA 2QM7A 2AE1A 2B6NA 4PZLA 4AN0A 3I32A 2GVZC 2R2GA 1VPDA 4M87A 1LV8A 2CNNA 1KQPA 1BOOA 2OB2A 5AWFC 4YI5A 1Y3AA 1M8PA 4O1HA 3C7KA 4URWR 3KK0A 3HYSA 3HN2A 1JDPA 4PRZA 2Y2UA 1G66A 2ZRLA 4DWJA 2OV2A 2G1PA 2HF2A 4JBWA 4ZODA 4GOMD 4GU5A 3GO4A 3I05A 2OESA 3F47A 3CH5A 1OTXA 5E9QA 3T06B 4I1PA 1MXHA 3C6QA 2OUKA 1TTTA 4QBGB 1WCV1 2OBFA 2HHLA 2VPWA 2V5UA 3NYRA 5FYDA 1KVSA 2XUZA 4YRTA 2HPAA 1T8WA 4PLPA 2BFNA 3RKUA 2GI4A 1PGJA 3WNBA 1QH8B 4GX2A 3TJZA 3RYTC 3Q3CA 2VATA 4ZEXA 5E6RB 3X1YA 2JDID 1TMOA 5EFOA 4OIFA 1Z0DA 3G2NA 3H4MA 3WLFA 3I58A 3RRFA 5JZVA 5CLIA 1LI5A 1R4MA 1UZMA 1JXMA 2J7PA 1X74A 4FIZA 4E22A 4R40A 1V3UA 4KIGA 5FBKA 2XYHA 3VR4D 5C8ZA 3QFFA 3HVKA 5CRIA 1RWPA 4LNAA 3TXXA 4J3NA 1HKUA 4KE8A 1N0UA 3L9WA 1DAHA 3B6IA 1T25A 2CUKA 4INPA 2IIVA 3C43A 4I3GA 2EZUA 5HDBB 3Q8LA 1YBAA 2H1LA 3N3BC 3FPEA 1VIYA 2IQIA 3HR4A 1OC4A 3G79A 4MWDA 3WL5A 1U5BB 1N77A 4JBLA 2YWCA 3ELUA 2I4LA 1M1YA 4PXYA 2OQIA 2W2KA 3GDFA 2DWOA 5K6AA 1BC5A 1Z7YA 1X8JA 3U7JA 2Z2XA 4OJYA 3M83A 3NPMA 3C15C 3LC2O 4LA4A 2QTTA 2QR3A 3QWAA 3T3MB 3AKCA 4XR9A 3VPHA 1W2HA 1LH0A 3QIAA 2VNKA 2W98A 3JZMA 2IX9A 2A1TS 3IVGA 4TS1A 3THXA 2DQYA 4JLAA 1P45A 2BP7A 5CIYA 3LQ1A 3SDZA 1EK6A 1PZNA 4KXVA 2HYIC 4BVGA 3M9LA 2AW3A 4XB1A 2QWXA 3CVJA 3OTIA 5COQA 3TQRA 2WUVA 2QTLA 3JY6A 2NTYC 4FHGA 3O4IA 2ZXEA 1TUBA 3LGAA 4IXNA 4P2GA 1TE2A 4XA8A 3KXLA 5C35A 2Q2NA 5DHSA 4KQ6A 3MUOA 1ZI9A 2OCKA 4TQUS 1CE8B 1K7EB 2PYDA 4M8KA 1II0A 1H6CA 1MH1A 4YC7A 1W59A 1EP1B 4KN5A 2YRFA 3ZHXA 3V8QA 5BSRA 2I9PA 3L2OB 1ZK3A 2INGX 3H3JA 3CUYA 4JGIA 4EG8A 1XDZA 4EATA 4X62B 1LDGA 1N0HA 3LLCA 3GRCA 2XYRA 4PANA 3ONDA 4QXQA 4E12A 1YZKA 4BHTA 4MYRA 5E6UA 3WJ2A 2ZUSA 3TMYA 1PJRA 4JS0A 3VO9A 5MN4A 5DW3A 1Q12A 2REBA 5F1YA 4DN6A 2C2ZA 3B9RA 3C41J 3NC0C 2G9UA 3GCZA 2H4ZA 1BMFD 3QWBA 1QQBA 2X9QA 4L9AA 2WMYA 4XUGB 4BLWA 1HZZC 3LA8A 4Y1RB 1Z0UA 1E3LA 1SXGA 1X7YA 1P7PA 2VYVA 2YQZA 1K8XB 5FUYA 5LFAA 1DX6A 2YVKA 3HVIA 1Y6FA 1AF4A 5JQWA 1KZ9A 4GWGA 3RNLA 4HRYA 2R00A 2QV0A 1FYXA 2OKGA 4RZ2A 4C5AA 3CSSA 4KQ2A 4HLQB 4LGYA 5DP1A 3DLTA 4IG4A 1GEEA 1WEHA 5C4IA 1UBRS 2BT4A 1UBSB 2R6AA 3N2LA 4UHEA 4XSHA 4YMSA 1JMYA 3P52A 4LW8A 3Q10A 4Q03A 1DEXA 3WJ7A 4XJVA 1TKAA 1Y7HA 5I3ZA 4DCGA 3EAQA 1L3BA 2EP7A 3N6XA 1GIAA 2B8WA 4L76A 3ER8A 4X9XA 2Q3EA 3IMKA 1KI3A 2E5LB 3FCYA 1H1LB 5COAA 2PL3A 3A4IA 3TL3A 3OQ6A 3MWYW 4P83A 1E0KA 4PSKA 2QN6A 1FMJA 2FZ5A 2PZAA 4OJKA 4B3HA 1OXSC 2MYTA 3MM4A 3QUTA 4J7XA 3RVSA 3VVMA 2ODBA 1G20E 4ZICA 4CKZA 5KHLB 3ONEA 4RA6B 4UOQA 3JPWA 3ERCA 2C1EA 1V8FA 2VHEA 5JVDA 4I6JA 1GR0A 3B12A 3PNBA 2ZATA 1T1JA 4FB4A 5JNVA 3DGEC 3FNRA 3P97A 4P93A 4X20A 2VPXA 3WL6A 4J0HA 3SCZA 4GECA 4DJFC 3ND7A 3SAJA 3W3AD 5HXAA 1J5EB 1C7QA 1FNCA 5JJKA 4NECA 1M2NA 1N1GA 1XMVA 4K6MA 1NSTA 4LXGA 2RKOA 2SBTA 4ZAFA 4Z5XA 5ALWA 3WDSA 1WX1A 1NF2A 4TTRA 1QLWA 3AI1A 4GT1A 3AHGA 1WXWA 5TQ0B 3GJ6A 1XCMA 3I2YX 3PTAA 3V42A 5F5LA 3ER9A 3TDNA 2LRHA 3K32A 3T5TA 1SC9A 2KI5A 4AUNA 6REQA 2WU1A 3GCXA 4AJ2A 4ALKA 4AUMA 3O8QB 1MABA 2QPLA 4LVNA 4XDGA 1KSJA 2XDWA 2AN5A 2W7TA 3P0FA 4ZOAA 1EX1A 5KTMA 2PA0A 3QPBA 3ZJ4A 4JXZA 1VYVA 5KNCA 3IBYA 2PR2A 1FYEA 4QO7A 4POAA 4XWYA 2FG5A 1F3OA 3B36A 3A06A 3MCTA 3RF6A 3RM3A 4MUBA 2FOIA 2DWUA 2RCNA 3GLSA 4TLLB 4ZOLF 3HU5A 4I9GA 2B4RO 4MAMA 1RPZA 3LWBA 1F8GA 4KODA 3IP6A 1NW6A 2DFVA 4R69A 2FSFA 3UT0A 4BO8A 1JQDA 1QKIA 2CL0X 5IUNC 2ON6A 2FK7A 1L4MA 4GMDA 3OEYA 1QIGA 1RBYA 1S9HA 1V5EA 4BNHA 1J0EA 3ZUPA 4QJIA 4TYMA 4EHAA 1U9ZA 3VNUA 4B3BA 4CIWA 5H3HA 3MMPA 1OBVA 2YV1A 5I01A 1U0RA 3SJCA 1NX9A 4PZZA 1MGPA 3NOXA 1YNSA 2EVWX 5C4MA 2NUAB 2Q4RA 1JBQA 4IHJB 2IS2A 1J1IA 4YS6A 3UAZA 4DLVA 3NAQA 1AK2A 4YRPA 3RRYA 3SBEA 3UJHA 4LJ7A 2YXNA 4R3WA 2AC2A 3KYDB 2A92A 4LJAA 3CU5A 4MW2A 4TV9B 3MC1A 5AHXA 4M55A 4XCVA 5FQOA 2FW0A 1S4MA 2VDVE 2O8VA 3CMCO 1W30A 2AIRA 3A26A 3IP3A 4G23A 4E5SA 4H3SA 2GTIA 4UHDA 4I08A 3BAFA 4TTVA 1F2UB 3BSSA 4R7ZA 3VR2D 5KKAA 4AURA 5CVTA 1EK0A 4K0KB 2Z5VA 1QIIA 4QYSA 1WY7A 3DFUA 3PT5A 4Q4AA 4L73A 2Y05A 3IDAA 3S0JA 2HDNB 1VCIA 2JFQA 3OT4A 4XCQA 3RTCA 5JZMA 3BRCA 3UJNA 1TU4A 2QS9A 1M6VA 2QTZA 4NC9A 1EJ2A 5IM5A 2H51A 3WDLA 2RE8A 3UPUA 1Z12A 5LXTF 5G02A 1E2BA 1RXCA 4FI3F 1MAHA 2C4WA 3EA5A 3F74A 5JS1A 1RI5A 1II9A 3HCAA 4OHXA 1JR2A 1NBOA 3BWYA 4EY4A 2FMHA 3AESA 5HKKD 1KQGA 4L6CA 2PANA 1KF0A 3SQDA 3EWNA 3WBBA 1FYFA 1AQLA 4ZD6A 3Q8KA 3QJYA 4ME6A 3QA9A 1XEWX 4P3KA 4Q93A 4B4DA 1F12A 4MUKA 2GWHA 3T1QA 1WDTA 2PFKA 4Z3KA 1XDWA 5COBA 3EH2A 5JAMA 1A98A 2OXCA 3GROA 3WLEA 3YASA 1KI7A 3O9MA 3KBBA 4I81A 2IV2X 3KKLA 4NHEA 1F4VA 4GYJA 5TQ2A 1E4OA 4O2RA 4AY3A 3DEZA 3MWJA 3ZDYB 4PYIA 3GDOA 3VNBA 5A0VA 3PGVA 1B1AA 1UT6A 4Y2QA 1YUNA 3HJAA 4KAXA 3GDGA 1SPBS 3SG0A 4DR6B 2EJCA 1MIHA 4FNMA 3R3SA 4B6RA 1WV0A 5DXJA 1YMQA 4B75A 1B93A 4YV1A 5CFQA 3T4PA 4X65B 1GZ6A 2WBLC 5NLLA 1OZFA 3DG9A 4J9UE 2IYUA 3LBHA 2AN1A 2VR1A 1E4YA 2Q6TA 3NCTA 5TF4A 3WLIA 4X93A 2QZ9A 5JDCA 1GILA 3EVDA 2Y6VA 5HOEA 3PBKA 1N5DA 2WOOA 3WQRA 4J0DA 4NBRA 3DZDA 1NN1A 2VDWA 1OH8A 2BEVB 1UEIA 1QR6A 2Q4DA 2EDAA 1CB7A 2J59A 3TIVA 4OAPA 1NW9B 4MR8A 4ZYWA 8ADHA 3IO5A 2EZ8A 3I6IA 1V5FA 1JKFA 4ITRC 4QGFA 8AT1A 4DYHA 5GM2A 1PV2A 2OD2A 4YGXB 1JXAA 3V4RA 2WJHA 1UFQA 3GGOA 1TO6A 1QPBA 1Z2OX 3DAHA 2B82A 3DF7A 3LY8A 4HNAA 4JEUA 3RK1A 3W90A 2A2ZA 4BMZA 2X77A 4EYQA 2PTHA 5ALHA 1XCOA 4CF3A 3LUHA 5ESXA 5SZIA 3ZZ0A 3PQ4A 1P80A 3IR7A 4M22A 4CL0A 1O94A 4KN9S 2A9JA 4MOWA 3E8MA 4ZZ1A 1TF5A 2AOUA 3VV2A 5LMUB 2WQZA 4C05A 3DZ8A 1B8PA 2FR8C 3GJSA 1DRUA 1H8HA 3AV0B 4B09A 4KXYA 3RUEA 3VFDA 4EP1A 3GJ8A 4F5WA 4FDAA 1DXOA 5A4DA 2ZWVA 3ITEA 2XE7A 2HBYA 1TXGA 1HK7A 3ORHA 2XAUA 1Y3FE 3IP5A 4JLKA 1Q15A 1GAJA 4C2AA 4WECA 1MOZA 1XXHA 2CD7A 4C1BA 1JT2A 3LY9A 2HGZA 3LK7A 4YP1A 3KPJA 3KYDA 5CM9C 1JDVA 4TRJA 3D6MA 1FFCA 4N76A 4DQVA 1EZZA 1UDAA 4EG1A 1M6YA 3MLBA 3D3WB 1JQ5A 2PUVA 3DNMA 3HP4A 3N87A 4DC1A 2ZOSA 2AG0A 2ZBEA 3A0UA 1G8FA 3NWEA 4UZFA 1GDTA 2OSVA 1F2UA 1DXYA 4JLBA 4CMHA 2LDBA 4LGCA 3VPBA 1JVNA 1X7ZB 1XVVA 2X9LA 3VOAA 1C3OB 1O87A 2BRUA 2CNKA 3F2VA 4AX8A 3A14A 5DM60 1D6NA 2F62A 3A1NA 3DKRA 1OFHA 5KI6A 3WK4A 4C3VA 3EWAA 5L4NA 2J7PD 2AG1A 3V1KA 5HRCA 1DJQA 2WZDA 3AKDA 1P9WA 4IOMA 3R7WB 3ROXA 1DAGA 4R6XA 3W0LB 1NBHA 4PXAA 5BWOA 4F96A 3BK2A 3PJDA 3TTWA 1W6RA 3KWJA 4EHNA 4XFKA 3F49S 4WY2A 1J07A 3DE2X 4L85A 5ALSA 1IQUA 1I36A 1WUYA 3PC8A 1KH3A 1RYNA 2F17A 3PFWO 4RDXA 3OFJA 1WU8A 4LK2A 1ZWKA 3BIWA 1E8MA 3IE0A 4CM9D 4YJ3F 3JQCA 4ESEA 1WHTA 3SYRA 5C8YB 2H3EA 1KQFA 5LKRA 2W42A 4FBGA 5KOHA 1LNZA 4M88A 2PT9A 1ZKDA 1VGRA 2UKDA 4YRSA 1K6JA 1BGWA 2J09A 2P90A 3N0WA 4R9UC 4RAOA 4EKYA 4GOXA 1AZSC 1RAAA 2R1TA 4RTJA 4PCVA 1WP9A 4BN5A 4D9GA 2CBGA 1ONOA 4RULA 1U8ZA 4MCIA 2H18A 4MLZA 4UXHA 3ZV7A 4IDOA 4OBXA 4UMDA 1Z8DA 2E21A 3M70A 4KR9A 3E7DA 3NJRA 1XD2A 2GRAA 3I30X 4RVUA 2BKXA 1AKTA 1L4YA 3BEOA 1NVAA 4CIDA 2Q07A 3H5OA 4ZTBA 3ENKA 3BFPA 4X95A 5T64A 4EB3A 3QE9Y 3U7QA 1QGUB 1C3EA 3EMKA 1AKEA 1VSQA 1U28C 1QYDA 4BXOA 3U49A 3L4SO 3KZKA 4U9IS 3HDVA 3K70C 4ZZ3A 1SHKA 2FW7A 2NUPA 3WZ2A 2XJ9A 3DDCA 3HR8A 1EEHA 4NICA 2OZEA 4PX5A 4BFZA 4EQ6B 4LFBB 5DRYA 1Y8RB 3CUVA 1XMSA 1JV2B 2OVBA 3IPRA 3VNVA 2IW1A 2YHSA 2RSLA 4HZIA 3CVOA 4RMNA 2HWKA 4HPWA 1YL6A 1FNNA 3FFWA 4IEFB 2IC5A 3N2KB 4G8DA 3W8RA 3QWHA 2XR1A 2AL7A 4Z0HO 4P53A 5IG2A 1Q1BA 3B7PA 2EKPA 1KA9H 4DIEA 3JQBC 2A7XA 3VTZA 4C9BA 2VYVD 1NURA 5JZSA 1VMEA 3IYLW 3UCEA 2BH2A 2M9MA 1GUBA 4ZIRB 5IPFA 5JS7A 1E7WA 4DDKA 1FRVA 2RC6A 2XRFA 3NEAA 8GPBA 5K09A 4R3UC 2RGCA 3TLKA 2JLVA 1L1RA 2AKEA 3ADCA 4IXDA 4X7PA 1DJLA 2EFYA 4GNKA 4D56A 4QDTA 5KVSA 2R0QC 1Z0ZA 3DP9A 1PP4A 2QBYA 3CPSA 2QORA 1F8UA 1R3UA 3HWX1 1GUDA 3L6BA 4R0NA 5J23A 2HJGA 2OHJA 1JJBA 1JQBA 1RWOA 3BC1A 3FM9A 4QDKA 1Z33A 3CLSC 1WF3A 1UBTS 2BTQB 4P4LA 1YXMA 4QYIA 1KDVA 1PR3A 1B3RA 1XQ9A 3BQNB 3FVQA 2ZYGA 4XQ9A 2UYCA 1H94A 4PZUA 1EDDA 3H19A 3GLQA 3PHGA 4BMSA 2ZJZA 3SHQA 1BWSA 1KGDA 3T5GA 3HJBA 3GFSA 4IEIA 3WJAA 4IH1A 3A1VA 1BOFA 1D4AA 3E8SA 4LHSA 1JGTA 4GOJA 2IU0A 4BPRA 4LV5B 2FRXA 4NYJR 4ID9A 1U0EA 1VLQA 3NHJA 4Z99A 1HORA 1UKCA 3BIXA 3FDIA 3BERA 3SJ7A 2QXTA 4CCSA 5B55A 2UUAB 2J5XA 1HDZA 5JU6A 4P84A 5CCDA 2W00A 1O9GA 4HNHA 4PTLA 3FPBA 4IOKA 2BMJA 2ZJ3A 1TCBA 2ZZMA 3NBMA 2QYOA 2R25B 3CLHA 2ZXFA 4HNGA 1XXHE 3V2UA 4ACAA 3U44B 1P75A 3FHOA 1QVAA 2PZEA 3AB7A 1JH8A 3IQWA 3EIOA 3O95A 3UWKA 2GN1A 1EEXB 1YFKA 3DNFA 4UPVA 4WOBA 1VRWA 2OEPA 5F9MA 1USGA 2VAWA 3N2NA 3PD0A 5HILA 1W19A 4IVRA 1OV6A 5ED4A 2PD3A 1C8LA 3TNYA 2NVBA 4WD3A 2ONCA 4Y30A 4UUAA 1JEAA 3I0ZA 2V65A 1MW8X 1GZ5A 2QRZA 2VS1A 1LPMA 3AVPA 5F7JA 5AM4A 3RVBA 4MHTA 4U7FA 1SGWA 1TRKA 1XALA 5EAIA 4N5NA 4GE3A 5KNCD 2NZUG 3ESXA 3IAXA 1PSZA 1HLGA 3RV3A 5TJ9A 2HR1A 5B5SA 2HM7A 2PZBA 4KTTE 4XTCS 3EAGA 3LE8A 3RK4A 1XP8A 1QHGA 4LDQA 3ZW8A 1RLJA 1RXSA 1KYXA 2M6KA 3VSCA 4AS2A 4G85A 5BOSA 1BHO1 2VNAA 3PYMA 4DY4A 4QFBA 2BKUA 5IXYA 4HXGA 2Q4BA 4GUAA 3L4KA 4G41A 2ZQZA 3U4CA 2WYIA 1R0SA 4C0XA 1TYCA 1ODSA 3R77A 1UBCA 2NO7A 4GVXA 4YXWA 2ZUTA 1YKFA 2YTZA 3ZLBA 4BAZA 1GQQA 2FU5C 3A8TA 5FBVB 5L4LA 5JARA 1CEYA 2N46A 3VOSA 1EA7A 1EIZA 3IOCA 3EQ9A 2XZLA 1VMKA 2JBAB 2E18A 2HMWA 4BE7B 3B9BA 1PT8A 4QBKA 1GUYA 4AG6A 5FWDA 4X64B 2B1RA 2RHRA 1YR1A 3A1UA 4FGZA 4N40A 4KQWA 4WCDA 5C0OE 2QUIA 4A4DA 2R66A 3WNCA 3N2ZB 3WIEA 3WKEA 4EUFA 1A2OA 4UM7A 1MX1A 2O8FB 1EH5A 4CTMA 1D1SA 5J2UA 4C0LA 4IFEA 1A82A 1XJ5A 3H2YA 4MGHA 3DZCA 1GTJ1 4R2MA 2IPAB 2A0WA 4B35A 4ICIA 3Q11A 5KVVA 4K9RA 3OZUA 4F4HA 1C7FA 4RH3A 4TMKA 4PPFA 1G8KA 3WK6A 4FKBA 3TZ6A 3IURA 3C3BA 2JL1A 3WNVA 5E6SB 3ANNA 1LBTA 1JQEA 4LC0A 4YAJA 2GXSA 3W5AA 4P36A 2H5IA 4NABA 4JC0A 4LS3A 1IVNA 1UP7A 1GNSA 5CHEA 2ZIUB 3H1AA 5JRJA 1L9KA 1FP1D 2H0QA 1C7RA 2HSEA 2XUJA 2DT5A 1RYFA 2ZB7A 3BBPA 5I3CA 3CPJB 3WV4A 3G2MA 4NENB 5C3MA 3TQFA 1XZJA 4QT4A 1IWOA 4KU4A 3DV2A 2CMGA 1CEEA 1CLUA 4UNSA 1BYUA 4DLTA 4LF8B 1DQRA 1QP4A 1JTEA 4L51A 2FPPB 4US0R 3VR5H 2Q3LA 4IQ4A 4DIKA 2LTAA 5FTNA 4M76B 2C77A 1BWPA 2AF4C 3GJ5A 1IFXA 2Q21A 1H22A 3V1YA 3K0FA 2QTGA 1E61A 2B6HA 4GZ6A 1E5DA 4LYDA 1TEVA 4L8WB 2GCOB 3L0YA 4YUAA 4ZT2A 3UXEA 1ZGAA 3B6KA 1YULA 2WU4A 3II6X 5EXTA 2H2FA 5TEVA 5J47A 4RIGA 1NQOA 1UXKA 3BHNA 2YR0A 4WCVA 5C7LO 1PFGA 1T5SA 3ZV4A 4ROSA 5FWYB 4R2XA 4ZYVA 5JISA 3IUMA 4D25A 3NIBA 3U7HB 3DV0B 2O7SA 3T6KA 1FFXA 3UHFA 2AOVA 2RJ3A 4RHXA 4H17A 5F7XA 1I30A 2NU6A 1P9OA 3AUKA 3AY0A 1CB0A 3AY6A 2ZT8A 3KIPA 4W9RA 5FTWA 5CA1B 2WV7A 5K0TA 3LTEA 5DJ5A 5BYJA 3P9XA 2I4NA 2R4TA 4H0CA 3OWOA 3RJZA 2XH8A 5KUTA 1YUMA 4RKEA 3WICA 3DAFA 2H0RA 1PFUA 1JZQA 3S40A 5ELMA 1E2GA 1GARA 1SUAA 4FGLA 2CJFA 5BMVA 4LNUB 5GIOE 1C8VB 1GPNA 5CX1A 5AIAA 5BWNA 3ZKWB 4GR4A 1O0SA 5JFGA 5LBTA 1GA6A 4M86A 4CDMA 2QMYA 1MU0A 1LBEA 1RQNA 1HOXA 1F14A 3ZBTA 2B1GA 1I4WA 1PWHA 2PGLA 4Z0NA 2ZYVX 1NUQA 1NOJA 1VBKA 3FZYA 1A8PA 4HWOA 5TSDA 1FFYA 3UC9A 4WDRA 3ZZUA 2DJIA 2FP4B 2PX3A 4HQKA 4ONEA 3VNSA 4LPSA 3PI6A 5JC1A 3RVKA 1ZC3A 5G0SA 1A9OA 1SZPA 2RGXA 3GB9A 1QZ3A 3I23A 1O94D 4ZO9A 1K6IA 2H11A 2L2QA 1Q95A 2DECA 3DE4X 1I3CA 3COYA 5ENDA 2BTEA 1N33B 1Y48E 2OKCA 2Z2IA 3JS5A 2P1ZA 4P3PA 5AJVB 5CFRA 4ZQGA 4JNKA 1JT9A 3RE1A 5B7NA 2GZ3A 5T4BA 1DMRA 3LVQE 3P94A 4CGYA 2ZRDA 4QFMA 1EVQA 2J5KA 1DX4A 3S99A 4RK5A 3GD7A 4TTJA 4WLUA 3OZIA 1QHXA 4MPDA 4NF2A 1ZI8A 4KFRA 4NS4A 1UANA 2OG1A 3O8CA 3NAMA 3NM5A 3B1JA 4I4TB 1PQWA 2DUWA 5A1JA 4CV2A 1SVMA 2EW1A 2VDKB 4FR5A 4JR2A 4PWYA 3D6NB 3RT7A 4BO0A 1OLXA 2Y0BA 2VSQA 3AYXB 3I2HA 3OZXA 3T1YB 2JLWA 4UD6A 3BE5A 4X7MA 5ECYA 1NV8A 2Z83A 3K30A 3FYUB 4QRDA 5IVDA 5C32A 4OXNA 3NUGA 5E6SA 3X1ZA 4BKRA 1DQZA 1ND5A 2BGRA 4KQ9A 2BE9A 1E7SA 4YV0A 1Q22A 1AHPA 1JH9A 2E3JA 4X6UA 1JFSA 1KOFA 1V9CA 2XT6A 5GJBA 4RF3A 4NENA 4OBEA 1XMOB 2FSUA 6YASA 2RI0A 3FLBA 1RAGA 3U3XA 1APBA 1KP2A 2AW5A 2DEUA 2YDXA 4D8UA 4WHMA 4FZ3A 4PS0A 1W36C 4EF6A 1VE6A 2J41A 4LV6A 3G13A 3OJEA 4G1MB 2I7XA 4BJ1A 1KAMA 3JVEA 3RJ9A 2VHXA 1FP6A 3P2MA 1YZFA 4I1SA 3TGPA 3V55A 2VK4A 1RQRA 2ECKA 3FDJA 1P2DA 3JQGA 3O93A 4RHFA 3TBHA 4CKEB 3UOAB 4DA6A 1AKNA 5JC8A 4D6YA 1DBQA 5FB3A 3I9MA 1LRKA 4F2HA 4H3KB 4HNSA 2YFKA 1LFAA 4MTLA 5LA6A 3WZLA 1EE1A 4R81A 3TLGB 4HV4A 3EZ6A 2K2WA 2P0YA 3U3KA 1RI3A 5KTNA 1Y9EA 2RHGB 3KKMA 1DU4A 2HFKA 1X6VA 2X7JA 1ZD8A 4YMLA 1V47A 2D8MA 4BY9E 4E4RA 1WPGA 2IVZA 4A7PA 3EXEB 3WLLA 1HYHA 2P6MA 2ZS7A 1E9CA 4Q02A 3UC5A 5FWYA 5DK6A 2JGKA 2NNWB 1VJ0A 3OT1B 4L5JA 2IS6A 1Y4ZA 2W2NA 1MRSA 3E81A 4JI5B 2X7HA 5CA1A 1NJGA 1SXJC 1AUXA 4LRWA 1VE7A 2H4WA 4POOA 3ADDA 5G0WA 3U56A 2IPNA 1JG1A 2I4RA 1P61B 4GM4A 4FX5A 3C1AA 3WRYC 1GQRA 4ODIA 3ZJ5A 3ETCA 3BBLA 3OKPA 3G23A 3OLQA 5EXDA 1P60A 4AMVA 4BO9A 2C9MA 2X0IA 4OKNA 3PKJA 4OH1A 1FMTA 3I5MA 3Q0TA 1MTOA 3AF4A 3EE6A 3O74A 1F6BA 4D4JA 1TOAA 4OQQA 2REOA 1Z6ZA 4EFKA 1BDBA 2J07A 3UAYA 1J0DA 4UVDA 1DV2A 1SD1A 3SVLA 1VIAA 2JAXA 1P39A 4V1CB 2C0PA 1NVEA 3ECSA 2H48A 5IDQA 4MXDA 1JEQB 3MCVA 4JT2A 1K06A 4M0EA 1QQ7A 1RPTA 3OKFA 5CW1A 4Z49A 1T5TA 2PUGA 2BR5A 2HQOA 2W6NA 5HZHA 4TM7A 4LY6A 3RODA 1NMYA 2Q4EA 3OLWA 5KBYA 1OWLA 3LG2A 1L5RA 2Q9AA 1YQEA 4R7TA 1NC1A 4GPIB 4LE0A 2FSVA 4R5MA 1HYBA 3V4PB 5KQLA 4RHCA 4RHUA 5IYZA 5K9ZA 4QBTA 1RAIA 2G3YA 2JJ8A 2XDQB 1CZLA 1P62B 1YBVA 2PSHA 3L8GA 4PBSA 2HMAA 1JPUA 2FG7C 1YJAA 3K0CC 4RJ2A 1H2XA 2B78A 2ZYRA 1Q6ZA 4I4TA 3RHFA 1FXWA 3U4GA 5D1NA 4MUHA 1Z7BA 1W46A 2JASA 1X77A 3GLHB 2R85A 3IULA 5LB4A 3OCWA 1PX2A 3OETA 4EG0A 5JLJA 1VE1A 2V9CA 3WLAA 3B1ZA 1XZEA 4JJ4A 2XHEA 4CLOB 4AU1A 3SVTA 2JD0A 2OHFA 3GHHA 4C5BA 1F4LA 2JLSA 4HQFA 9GPBA 1G60A 3FWZA 1G7CA 4KK4A 1C1YA 1J8QA 1KYQA 5A03A 1IIRA 1AK9A 4RX1A 2F6RA 2WFLB 4XX1A 3DE3X 2G06A 2XSZA 1EBFA 1MF7A 2Y71A 4R1NA 4V03A 1PR4A 5AJYA 5EMKA 5FTJA 3SC2A 4D3FA 4IYJA 4ITVA 3G68A 1JDTA 1L7AA 4FYJA 3T7IA 3VKVA 1J0AA 3M1IA 3ZE8A 1VKHA 4JBGA 3LXMA 1WW2A 4GSLA 4LVCA 2BZ0A 4MB2A 1COZA 2PD4A 2XYQA 3PFCA 4PQRA 1JKJA 4U8HA 3B52X 1AKRA 2CZQA 3HGTA 2ICAA 3LW8A 3P2OA 3KQTA 4U2KA 4JI1B 3D43A 3TRIA 3PJGA 3U61B 3C16C 4PSVA 4Y1RA 5L3ZA 4V2UA 1T8TA 3EG9B 2P1RA 4N8DA 4QJ5A 5EWMB 1SCIA 1FDRA 2QHXA 2XW6A 5E0OA 4AQ7A 2V03A 4EO9A 5HJEA 2GD2A 4L74A 3FGPA 4RHEA 1JJVA 4NKRA 3BGOS 4A6EA 4OHCA 4HAUA 1B8VA 2B5OA 3RSLA 4BNZA 1Z35A 1FSFA 1T26A 1T2VA 3ND5A 3MT9A 5EGSA 3TNJA 2XGJA 1P2FA 4ZZ0A 1JU4A 3HSKA 1X1AA 3SIWA 4P7GA 1TJNA 3EXEA 4ZA2A 1K66A 4QSHA 4JLMA 3TI9A 3TXYA 3WL4A 3D6VA 4G0XA 5CEEA 3KAKA 2PKEA 4RORA 3C7CB 1SWVA 3GJXC 3GWZA 4MGZR 2GN0A 4P35A 4QXAA 4WNIA 5FOQA 2ZVJA 2EZTA 4UMEA 4WNYA 3ET4A 3T4XA 1FNSA 4YXWD 5DBOA 4GXRA 1V95A 1KZ1A 4CCYB 1YKGA 2QTHA 4ZTZB 2KQUA 1IAQA 1M34B 3FOWA 3OHPA 1VJDA 1K6EA 4ND2A 1RAHA 2LKDA 3DW3X 4JJZA 3IIMA 1UBOS 3HN7A 3ELYA 5IDVA 3R9KA 3KAPA 4KWEA 1ONNA 3ME5A 3MRXA 1FUUA 3SBOA 1QRUA 1NATA 2BZ1A 2PXHA 5HBRA 1B6GA 1TYEB 2WIAA 3H5AA 3AUXA 4HDMB 4MKXA 4WE3A 4X91A 3LFUA 5M5BA 4DV6B 1U7ZA 3HCOA 2QZPA 3PPVA 3HKBB 2CLDX 4Q7KA 1JBEA 1U1GA 2J45A 1IBCA 2JATA 2JVKA 3HLKA 4YRMA 4BJHB 5BV7A 3TPCA 2XT0A 1T2CA 3CTPA 1ADBA 1VFNA 2GN2A 1THTA 3EW7A 3GCGA 4U6QA 1M8KA 3SZOA 1JHXA 4N7JA 4OJQA 1WNTA 3OIDA 2TYSB 3V3TA 4D8VA 3TNLA 4QUJA 1SZDA 2JHFA 1NN3A 1W47A 3WG9A 4BNTA 4C2TA 3ENWA 3F67A 4FFRA 2IA5A 4EB0A 4HNUA 5M04A 2FPKA 1NVGA 3O3OB 5GJVC 5SV2A 4UARA 3IHWA 5KS2A 5AJXA 1J0XO 2IUSA 1GZUA 1U0FA 3EQ7A 4BMOB 1TAHA 3QUQA 4KNYA 5AVUA 1THMA 5JCPA 5BRAA 1XO1A 2OMEA 4EUNA 3FUCA 2D1QA 4WBXC 3P45A 4YLEA 5AI8A 3SHOA 4DR4B 5BV1A 2QDKA 2BFBA 3VC2A 1Q0PA 4BLPA 4J1TA 3MSXA 4HVLA 3S1AB 4I9NA 1IOWA 3WRWA 1DVRA 2G1KA 3G88A 3TE7A 1C9DB 4F06A 5KZMB 1K68A 2G9VA 4CLOA 2AN4A 1J99A 1DRWA 2JPDA 3L0DA 4LCEA 4EG6A 2YMLA 4Q48A 5JNLA 5CCXA 4W7SA 4IFTA 2Q6KA 1UF9A 4WZBB 1JB1A 5JJCA 4KYVA 2C8VA 3S70A 2WPDA 1CUJA 5F64A 2WFLA 4CMEA 2WQ6A 1KU0A 3MWLA 2ID4A 2PRSA 1BE1A 4GOLD 1CWUA 1GL7A 4KXMA 1YJQA 4CQNA 3UOGA 4EPXA 1LRLA 2P65A 4V3CA 2DH6A 4L7VA 3S8YA 3ZBPA 1T5DX 3Q9LA 4CMIA 1OA1A 2AUNA 3EX7C 3K8OE 5AO9A 2J6HA 3JYPA 3VJMA 1YHNA 4NCBA 4B3CA 2HLHA 4BMPB 4HQOA 1AM4D 5CEFA 1U6IA 1DQPA 1RWKA 2D7CA 1Z47A 3ICWA 3LUFA 1VGVA 4N03A 4U39A 1UKYA 1SRRA 3P2JA 2MYPA 3G5MA 4XH9B 2H0AA 3V8BA 1QRDA 1QAQA 3EG9A 4Z9BA 1K6MA 4KLZA 2O2ZA 3L06A 3O0DA 1R9NA 4MS4B 1U3VA 3T15A 4YCJA 1U4SA 1EFLA 4WBNF 4EGFA 3B2EA 1E2IA 1MOQA 4RXTA 4K2HA 3RNOA 2WYWA 4E51A 4UVGA 4ZHQB 1MC4A 1A8SA 1DLJA 2VRNA 3GUVA 2VNIA 2GNPA 3NHFA 4WN3A 4PV7A 4YROA 3VNAA 1HDRA 1W1WA 4PG4A 3PHHA 3HG7A 4F85A 3C8UA 5FPYA 1ODFA 5KOYA 2AOTA 1QG2A 3FNIA 5I47A 2JGFA 4FQ5A 1ZKMA 4MV3A 1FLDA 3R6LA 2FHSA 2FPGA 4LZLA 4R9NA 3L8DA 3KL4A 2QSZA 4RHTA 1KFJB 1N0IA 4XOIA 3A70A 4Q7QA 2FMXA 3K70D 2LNDA 1JLHA 3QPWA 4IFBA 2JIMA 1A9RA 1UBLS 1RRPA 2OUIA 3VR6H 2BGKA 4BASA 1YSCA 1YB6A 5EKDA 2JHGA 1FXSA 3L02A 2GSDA 5I4KA 1EK2A 4NK4A 1TYZA 1IJKA 2D7DA 3JWGA 2I2CA 4ARZA 4KIJA 3RARA 2GEVA 2YXDA 4H7PA 3ZI0A 2QU8A 1FTQA 2DBZA 2CXSA 2VIIA 2XNKA 3HKBA 2BDEA 2VT7A 1IJFA 2ROQA 3TE6A 3G1TA 4FEAA 4G4GA 3B1WA 5BV8A 2C99A 5DM4A 2TMDA 4V0NA 4YRCA 4LQ4A 2IYZA 4UU1A 4KOEC 2IK8A 1T9GR 3MJVA 1YT5A 4WIAA 3DLBA 2YV4A 3NBAA 3HO6A 2XKAA 1SVUA 3DQPA 4BJ6A 3AF2A 2QL7A 2AK3A 1XZQA 4YMWA 3ICVA 2J6CA 4M0MA 3E27A 2XB9A 2QI9F 3AV3A 5IDXA 3DE1X 1KFEB 1RJ9A 1ODTC 4J03A 4OH7A 3OCZA 4DV0B 3BH0A 1NVBA 1NC3A 4DAOA 3A1DA 1XLWA 2HY7A 2P0AA 1ZPDA 1E98A 1X87A 5CK5A 1RQXA 2QT1A 2J31A 3QF4A 1IDN1 1D2HA 1NP3A 2FW9A 4WV3A 4BX3A 1G3QA 3FOEC 3IR5A 2YWXA 4EL0A 2BFFA 4TSFA 5K3CA 1E9SA 3NRJA 4LRQA 4Q16A 1QIJA 5EOVA 5IBQA 2D8AA 4BAUA 1ULTA 4CHTA 1DKPA 3D59A 3PNKA 2O19A 4JVOA 1YASA 1B14A 2IXFA 4QGBA 3NTQA 3TIFA 3RASA 1PJAA 2P41A 4LISA 2VT6A 5TPWB 4ISBA 2QVBA 2ZRMA 4FYWA 4QBIA 3HP1A 1NQUA 3EZXA 4G3XA 5CYOA 1NAIA 5P8WA 4BEVA 4C4YA 1ECJA 3ITNA 1GZHB 2JK0A 3LRPA 3GVIA 2ZBDA 3LAWA 3PC7A 4A5SA 3HJTA 3ESZA 5BURA 5BR1A 2GZRA 4XWGA 3CPEA 5DSZA 2H00A 2WIDA 4R2JA 3GLHE 4UCWA 5JCOA 4EUKA 1MX3A 2HXSA 4B1FA 3WNZA 1ZZEA 3QKSA 1EESA 2FH5B 4YGYA 4KPUA 3KE8A 1HT2E 1KNQA 5FJIA 4D3SA 2AXPA 1CEQA 5F3RA 3ZW7A 2FFHA 3T35A 4X1YA 1NVMB 3G8BA 1P0IA 5AKJA 1JHUA 2QT9A 3UHAA 2BCEA 4X5OA 1ZA1A 1IK6A 2GM9A 1JW9B 3G9TA 1OMOA 3I4CA 2F4VB 1ZINA 2IVFA 1WXQA 4MYTA 2Y1LA 2XB8A 3CT6A 1M2WA 3U1BA 1RKXA 4A0QA 2EJVA 5KHOC 4PPYA 3KZXA 2W83A 3BVPA 4KE9A 1JLLB 5F1KA 3UG6A 1Z34A 4L5BA 3O8OB 4G0NA 1IE3A 1Z82A 1XLTA 2PM8A 1XZHA 1MB3A 1BMTA 1T3GA 2BJVA 2IZ1A 3KQQA 5C4GB 3RUPA 4DLSA 1YZHA 2JI8A 3OLZA 4J91A 3ETDA 3W78A 4R2WA 4UBLA 4EHDA 4JQOA 3GL9A 5C1BA 1BWRA 5DHQA 5KJFA 4RTNA 3JPYA 1LI7A 4KREA 1JDUA 5A05A 1KO1A 2WFMA 3DDHA 4X1IB 4XW2A 4B85A 4EMBA 4ARAA 4W1PA 2Q46A 2G6TA 1EP9A 2E37A 3D8UA 1TAUA 4TXLA 2FN3A 1D9ZA 2CUNA 4NV0A 1YVDA 4JNCA 3OLXA 5BR4A 4OU4A 4Z3OA 3G0BA 4HDCA 1EXWA 2RBKA 5DGTA 4PYJA 2ANBA 1VLLA 1U0HC 3CS3A 4JR0A 1WQ4A 3BXPA 1Q3HA 3L1HA 4RY8A 4BJ3A 4L07A 4OGKA 1CFJA 1NI4B 3EXHA 3W2FA 4IDEA 4K2AA 5FCDA 5BQ5A 1KE1A 5HM6A 4UBNA 1HFWA 1NASA 2BN4A 4KR2A 1VPEA 1T91A 4HMPA 1Y89A 3LWDA 3W1EA 5JV5A 4ZVNA 3ZDXB 5KU1A 3VA7A 4YHHB 1KORA 5LNK1 4CV1A 4MJLA 1YR3A 1Z0IA 3LXXA 4JEMA 1H66A 5CEJA 1O5IA 2QB5A 5IF9A 5ECWA 4AO8A 4B9AA 3KSAC 1HNZB 3C3MA 3HXPA 3VU3A 5I7WA 1FIUA 2NZWA 3DS8A 1AH2A 4MX8A 2OB1A 4B4WA 3CRQA 1LLQA 1M5TA 4FS3A 1J42A 2C00A 2Q5QA 4KWTA 3CUTA 1ZVQA 8LDHA 1RTTA 4DR7B 2WF7A 5B7QA 2RGNC 4KXNA 3E6AA 2XGSA 3P32A 4QAJA 4CQMB 4EPRA 1DBVO 1AT1A 1VI6A 2HJVA 1QFMA 1RJFA 2IIPA 4TT8A 2K7FA 5ADHA 3EC7A 1YJCA 2GTHA 4F04A 1Q1QA 5KQRA 4NH0A 5EE1A 4K1XA 5AI5A 3DMRA 1OJ7A 4TL9A 5DGDA 5EHGA 5IBPA 2Z30A 1HY3A 1KMHB 2ZR7A 4AP5A 3A2NA 4D9NA 4Z2YA 1RLUA 1H9BA 2I99A 4MQEA 5E4YA 5DEIA 4AO6A 2ARKA 5EVCA 3VH3A 5A06A 3DE6X 3O1IC 4OHFA 4RLSA 3G8DA 1Y9ZA 4HGYA 3WTCA 3E22A 5JNSA 1DOHA 1ECPA 2V3WA 3TOCA 2WT9A 4FX2A 3LOUA 3WIBA 3D7SA 4AECA 2BHLA 2J33A 2FN8A 1GXSB 3GARA 3UMBA 3QPCA 1V45E 2A78A 1NV9A 3W6NA 4BS9A 2EF0A 3ORQA 1GNLA 1D4ZA 2AC4A 3EUFA 1M7HA 1XCGB 1N9KA 1XJWA 4OQMA 3RW9A 3JASA 3NB0A 4HAIA 1WULS 4O4LF 4U7GA 2H5LA 5FUWA 4B6FA 4EDHA 5K6AC 1DTSA 4TMVA 4QVKA 4Q37A 4HDRB 2AF3C 4TV8B 4RQAA 3F3KA 3BN3A 4INOA 1A5AB 1M1XB 3AB8A 3KLPX 1V43A 3JR7A 1G5QA 2WSLA 4ZAGA 4IWXA 4Q1AA 2HHCA 1K08A 3HJCA 4AY4A 3PVCA 3T99A 3UK7A 4YEDA 3QITA 4YJ2F 3RRNA 4AZ0A 2Q9UA 3T3NA 5BQFA 3F5QA 3COPA 3R20A 4J7UA 1SIUA 1YRWA 1T8PA 1QCYA 1SCAA 2H1SA 3DAOA 3JD2A 4H35A 4LF5B 3QM1A 2PRKA 3BGDA 3PQ6A 3KP1A 2OP0A 4JUCA 4R9VA 3W34A 2WJWA 1FFGA 1JLLA 1X86B 1E63A 2EWVA 2JBWA 2PSJA 2C3PA 2XUQA 3FUXA 3O8OA 2JA1A 2AZ4A 1Y1TA 3SGLA 2Z9DA 3MWDB 4AS3A 4DCPA 5BW6B 4JHXA 4A8PA 3MELA 4CMJA 2FQWA 2ZAGA 3RI3A 3OCUA 3TQHA 4QZVA 1ULHA 1H5QA 2O8EB 2QJWA 2ADMA 2IOYA 4ND3A 1F0KA 5ALZA 5HOQA 5H7XA 1A3CA 1ZGGA 1I1QB 3Q7PA 3I5YA 5HDQA 2YC2C 3VKHA 2MU1A 5IN5A 5DT2A 3V8EA 4XQ0A 1GDHA 2E5FA 4Z0PA 1WB9A 2HCJB 1YQGA 4NCAA 4GLFA 2QAGA 3GG9A 5DN6A 1X7WA 3CX6A 2WTUA 3KHTA 5LQSA 1K2WA 2OR3A 2YASA 3ASVA 1DKQA 1MIOA 1B6RA 2RKWA 1BX0A 3E7PA 3NBUA 1LVUA 3KJHA 4LZOA 4B79A 3O8RA 2C5AA 3GLGB 5INTA 4HR7A 2EGGA 3BL8A 3A05A 4OI2A 2JKVA 3VNQA 3MPOA 4CF5A 3MUEA 5I4CA 4TZTA 4XASA 5JADA 1WXEA 3BXEA 2OO7A 1WS6A 1F9EA 3NBYC 3G9QA 2HPVA 2I4TA 3GG2A 1SAYA 2R00C 4FFDA 4UBJA 5DNCA 2PL1A 1ZNWA 2O2XA 4PO8A 1CRWG 1QVZA 3DP7A 1Y9AA 4Z4IA 3KAQA 4Q1DA 2WPDD 3OD5A 4YDHB 3BD9A 4CN8A 2NPIA 4H4DA 2B83A 2O23A 3MBIA 4PU0A 3I01A 2QTWB 2CYAA 5FF9A 1FTSA 4CV3A 1P5FA 1R5JA 1T6XA 2BAGA 4RK7A 4HAOA 3DTVA 2GYYA 3IE1A 2CJWB 1M0WA 2DLNA 5DMHA 1BYIA 2IW3A 1TA4A 2CDRA 2DQZA 2P3SA 4HD8A 5ES3A 3K2BA 4C20A 4ITUA 5HIJA 3MMSA 2WJGA 2R5FA 4UULA 2FK8A 1EWQA 1SUEA 1GGNA 3DZJA 5FHRA 1RYHA 3IAUA 3R8XA 2GHTA 4ABTA 4KPYA