2PBLA

Crystal structure of a putative thioesterase (tm1040_2492) from silicibacter sp. tm1040 at 1.79 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
262
structure length
262
Chain Sequence
b'GMELDDAYANGAYIEGAADYPPRWAASAEDFRNSLQDRARLNLSYGEGDRHKFDLFLPEGTPVGLFVFVHGGYWMAFDKSSWSHLAVGALSKGWAVAMPSYELCPEVRISEITQQISQAVTAAAKEIDGPIVLAGHSAGGHLVARMLDPEVLPEAVGARIRNVVPISPLSDLRPLLRTSMNEKFKMDADAAIAESPVEMQNRYDAKVTVWVGGAERPAFLDQAIWLVEAWDADHVIAFEKHHFNVIEPLADPESDLVAVITA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative esterase/lipase/thioesterase
publication title Crystal structure of putative thioesterase (YP_614486.1) from Silicibacter sp. TM1040 at 1.79 A resolution
rcsb
source organism Silicibacter sp.
molecule tags Hydrolase
total genus 92
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pblA01
3DYIA 1QIHA 1TCBA 2HADA 4O08A 5JZ9A 5BWCA 1PFQA 5BWBA 4OUKX 1F0NA 4QDUA 4X95A 3F97A 1RYYA 3A2LA 3QH4A 5SYMA 2HRQA 3HACA 2VT7A 4G8CA 2HL6A 3AUKA 1EDEA 4ZV7A 1XZKA 1E8DA 2RIPA 4TPKA 4W1PA 4DNQA 1ZIXA 4D9JA 5AI4A 3C45A 4RE6A 2QM0A 3VJLA 2PUHA 1RP1A 2RI6A 3F67A 4FWBA 3I28A 4NS4A 2VAXA 1A8QA 3KOOA 3VVMA 4B81A 2DCMA 1IUPA 1XQWA 3ANSA 1GXSA 5A71A 2PSEA 2WJ6A 1A8SA 1E89A 1LPPA 3BE8A 5ALHA 1MJ5A 4OB8A 2FJPA 5D3KA 1P0IA 4QZVA 4UFPA 5BV7A 1QFMA 5AI8A 1QJ4A 2P8SA 1P0PA 4J3JA 5ALZA 3E1GA 1C4XA 5AKJA 5LZ4A 4DLNA 1GPKA 3R3XA 1BRTA 1UT6A 3HLKA 3I2GA 4KAFA 2QUBA 3I6ZA 2G5PA 1CFJA 4Q3KA 2QKYA 2XE4A 1CUCA 3QPCA 3AIOA 1JU3A 5EHXA 2WIGA 2O2GA 4QDOA 1EDDA 5EHZA 2AJ8A 3H2JA 4UHBA 5FOQA 3WK6A 3I6YA 5BOVA 5AKEA 4H7KA 5JD5A 4Y2UA 3VKFA 1XLVA 1TCAA 2BKLA 5A7FA 4M0MA 3A70A 3O95A 3G8YA 5AI5A 2OG1A 4Y2JA 4N8EA 3BDIA 3I2IA 3OTQA 1IVYA 3O4JA 2JEZA 4OPMA 1BU8A 1YR2A 5C8ZA 5CXUA 4HXGA 2WU4A 1F8UA 2B4KA 4Y7DA 2H1IA 4NMWA 3FSGA 4CG3A 3FBWA 2VQ6A 5CT5A 4KAJA 3KSRA 2XUPA 5LZ8A 4UHHA 1QO7A 4B85A 2XI4A 2WIJA 4EZIA 1FSSA 5K3BA 4P93A 1IZ8A 1TKRA 1R9NA 5FDFA 3OOSA 3VJKA 1AUOA 3T52A 4PSDA 2YASA 1GKLA 4OD0A 4BB0A 5ALMA 5FRDA 5AM2A 4AX4A 2QXUA 3EQ8A 5ALUA 1IMJA 3RLIA 1WB4A 2XB6A 5HF6A 5ALVA 5A7HA 4EY4A 2I3ZA 3N0TA 1QIIA 2PX6A 2XUAA 1PJAA 1VZ3A 2Z3WA 1WB5A 4AB1A 1CPYA 4L9AA 3PUIA 5AM5A 1XFDA 5IVIA 4JNCA 4U2DA 1H2ZA 3O4HA 3HYSA 5EI5A 1QOZA 3PUHA 1ACLA 2X5XA 4G4JA 5AKXA 3WWCA 2GYWA 1VXOA 5CT4A 4U2EA 2XT0A 4H0CA 1LPSA 3TGLA 2QT9A 2Z8ZA 4BBZA 5JADA 1KU0A 3QVMA 1XKTA 1LGYA 2JGLA 4IHAA 4LXIA 3DD5A 4B82A 1QTIA 2WJ4A 3VISA 1SC9A 5HZGA 3FCXA 3NGMA 2DR0A 1A8UA 1K8QA 2VT6A 4UBOA 4UFOA 4FNGA 2O7VA 2WTMA 4PNZA 5ALLA 4X00A 5AOAA 3KXPA 4WCVA 2XMGA 4N8SA 4Q82A 2YH2A 5ALGA 2JGFA 1DTEA 2XQJA 4U2BA 1B41A 1FFCA 2JGEA 3WJ2A 1SCIA 3I1IA 3JYHA 2RGUA 2V98A 2XMZA 5ALJA 4K6KA 5JD6A 1EB8A 1U8EA 4WJLA 3IVMA 2BGNA 5ALEA 1CUEA 3GUUA 2AJLI 1FFAA 3GA7A 4C4XA 5CT6A 1NX9A 2AXEA 4ZXFA 3IULA 5LZ2A 1XLUA 3DOIA 1Q83A 5AO9A 4I19A 1Y7HA 4QWMA 3WWDA 3DL7A 4QEKA 3G9ZA 3ZLTA 3NOXA 1G42A 3OPMA 5C8XA 2VTVA 3NWOA 4DM7A 1JJFA 1A7UA 4B83A 2HA7A 2OCLA 4UHCA 1B6GA 2J4CA 2JGIA 2HDWA 4DMCA 4MYDA 2HA3A 2XMBA 3W9UA 1AMNA 4C4YA 3WKCA 3WZMA 1H2XA 4OYYA 3G7NA 2XUHA 1ORWA 1ZI8A 1JJIA 1XZMA 3W06A 3WK7A 5LKAA 2FJ0A 4BCCA 4G9EA 4CIAA 3H18A 1ZJ5A 2RAUA 1N8SA 1JT2A 3H17A 4B80A 1EXWA 4FBLA 1DX4A 4OU5A 3EBLA 3W9BA 3QMWA 4BDTA 2EEPA 1NU6A 1USWA 2Y2UA 4WY8A 5HF8A 2OQIA 2V97A 2WILA 1CUJA 4B9EA 1CUBA 1VE6A 1AURA 4CIBA 3AZOA 5AHXA 1LPBB 5E4JA 1VA4A 2PSHA 2GZRA 4RE5A 5JATA 3QMMA 1XZLA 4WY5A 3OM8A 1L7QA 1XKLA 3F96A 4ZGBA 3JWEA 4DMHA 1ODCA 5K3EA 1QZ3A 4J0IA 4ZV9A 1YA4A 1QO9A 3M82A 1UK7A 1CV2A 4E14A 5HK8A 1BCRA 5AM0A 4KE6A 4UBIA 3WIBA 3D2BA 3C6BA 3FLAA 1IUNA 3GELA 2XMQA 1AGYA 5D6OA 4BVJA 1YB7A 1H2WA 3FAKA 2DHEA 1J07A 3STVA 4F60A 3WA7A 2PPLA 1XZBA 3AZPA 4Z49A 2B61A 1ZD3A 2AJBA 1XZJA 2QMQA 5A6VA 5LP1A 5DNVA 2DSNA 4I4CA 4B7ZA 4JYPA 4QE3A 2Y6UA 5ALTA 1UK8A 4G9GA 5JZBA 1WHSA 1JJBA 4GW3A 4RNCA 2WIFA 1YAHA 2QTBA 5AM1A 5JAPA 5JZSA 3P2MA 2HM7A 3JW8A 5HFNA 1CQZA 3B12A 4HZGA 4FMPA 2PM8A 2ONCA 2XQFA 1W52X 1XRMA 1XZIA 3W2TA 4J7AA 4ROTA 1GGVA 5KWIA 2XUGA 1IUOA 4GBGA 1QIJA 1U4NA 5T4BA 4DNOA 2WIKA 2GBIA 3ZLUA 4MQLA 3ZWQA 5A2GA 4X6UA 1XZGA 2CB9A 4HS9A 3WMRA 3ESBA 4QA9A 1CLEA 2JGKA 3FSGD 3M3DA 3UUEA 2V96A 5CBKA 5ALQA 2HA0A 1XZDA 1EINA 5A62A 3K2IA 4KE8A 3AIMA 3D4LA 2ZVDA 3GFFA 3I2HA 4IH1A 4CI9A 2I78A 3I2FA 3WK8A 3V1LA 1U2EA 1EHYA 3DCNA 2XQIA 1FFEA 4FHZA 1WOMA 1G5FA 1SOMA 2C5GA 1UOQA 1OXMA 2OQVA 2BUBA 1XLWA 3ESCA 1ZOIA 3B5EA 4BRZA 3DNMA 4B0OA 2EDCA 2X8BA 2ES4A 4H18A 3LIPA 4BATA 1UWCA 3H1AA 4BAZA 5AI0A 1HKHA 2HU5A 1T4MA 2ORYA 1HBJA 3STWA 1XQXA 4AXBA 2XDWA 2WKWA 4Y2QA 2VJCA 1WCYA 4MYSA 3O4IA 4P9NA 3BWXA 4LYEA 2WUGA 4H77A 3R40A 4CCWA 2VA9A 5JD4A 1GPLA 1MTZA 2WQZA 4Y2VA 1WHTA 1T2NA 3H2GA 1A88A 4J0KA 1HDEA 1LPOA 1EA5A 3ICWA 2ZJ7A 5ALSA 3N2ZB 4DYHA 1ORVA 1P0MA 4BDSA 3LP5A 4BP8A 2QJRA 5IVDA 4AQDA 1WB6A 4CG1A 4EY8A 5AP9A 4RPCA 3U1TA 1HQDA 1DX6A 4J0JA 1YASA 1VE7A 3DLTA 2OGZA 3STUA 1JMKC 4W9RA 4JUIA 3DOHA 3RM3A 3EQ9A 4W63A 2C0PA 4UBLA 3VVLA 1THTA 5T4HA 4DNFA 5JALA 5F4ZA 1DWQA 2G4LA 2WJ3A 4U2FA 3PICA 4YX9A 4LYDA 4IO0A 3WQHA 1QTRA 3A2NA 1EDBA 3WL5A 2QR5A 5IKXA 5D3ZA 5AKZA 3DL4A 1UXOA 2FX5A 5FPQA 1WPXA 3C43A 2C4HA 3C6YA 3RK4A 2DFPA 1ISPA 2QXTA 4BRSA 4F0JA 3C6ZA 4UHEA 2QZPA 3WWPA 5AKKA 1DINA 1KEZA 2I3DA 4XJVA 3BF7A 4BAGA 4H7FA 5JAHA 3R3ZA 5ALWA 1QGED 5DYTA 2J4FA 4DSAA 2JF0A 4X71A 2RONA 2QS9A 1GPNA 1MU0A 4K2AA 5AKYA 4K6HA 5EGNA 4J0HA 1ZI9A 1D07A 1YS1X 3W05A 1N5MA 5T4FA 1RWQA 3HJUA 5C8VA 2V9ZA 2OAGA 1DT5A 2WUFA 4OYLA 4F5ZA 4BVLA 4E11A 4I3FA 5KBYA 5AKGA 3VDXA 1CUYA 2WG1A 1EX9A 1CUUA 1L7AA 2PBLA 3F98A 2GYVA 4FFWA 4QLOA 3WA6A 1GZ7A 2G63A 1CUWA 1EVQA 3E0XA 1YAJA 3E4DA 3D59A 4GI1A 4X3CA 4S0XA 3LLCA 2ZJ6A 3IBTA 2WG0A 2J3QA 3DKKA 1EB9A 1Z68A 4NZZA 4LKOA 4BZWA 5HK9A 3EF3A 4A5SA 3CN9A 3G9TA 3SK0A 5AK6A 1XZCA 2RHTA 2WUEA 2C5FA 5JAOA 4N5IX 4UBKA 4DNPA 1BROA 1VA5A 2ZYHA 5CT9A 4XVCA 5JYCA 1BEZA 3BF8A 3RKSA 4AZ0A 4TVKA 3HZOA 4E46A 1DWOA 3IUNA 5EHQA 3ED1A 3H2IA 3WKBA 1EK1A 4XWGA 1ZIYA 4FKBA 4KYVA 3FCYA 1VKHA 2XMSA 1UK9A 1HL7A 1XRLA 5CMLA 3KWJA 4P92A 1DWPA 3E3AA 2GZSA 3G9UA 4BZZA 4G4IA 2CEKA 2Z3ZA 1MO2A 3O4GA 3QPAA 1J1IA 4V2IA 4HAIA 1JKMA 5AJHA 2XLCA 3MGAA 1YB6A 2IITA 3QPDA 2PSJA 2CJPA 4WDQA 3OG9A 5DNUA 4FLMA 3D0KA 3STTA 1E8MA 5LZ5A 2OGSA 3DQZA 1MN6A 5LIPA 2HFKA 1SCQA 1G66A 2WTNA 2EDAA 4WFIA 4J03A 3GROA 4WFJA 2VF2A 4PSCA 1SFRA 4FFVA 1QONA 5CW2A 4J0GA 5AKIA 2ACKA 1VLQA 2OGTA 1R9MA 4L3WA 3DDUA 2ZYRA 3R41A 4H7DA 1YA8A 3D5EA 2I03A 5ALYA 1QLWA 2HA4A 1JFRA 4ZI5A 3AILA 1OILA 1WM1A 1DT3A 3H19A 5KWJA 4HRXA 4C87A 1ODSA 3R0VA 5ALXA 3QM1A 3C5VA 4XIIA 2HU7A 1XZFA 2B9VA 2WHQA 2BUAA 4FNMA 5DLPA 3C6XA 4AZ3A 1BN6A 2OCKA 4Q1VA 4DMFA 1CIJA 5C81A 5SYNA 4AMZA 3PI6A 4IH4A 5EFZA 1W76A 5E4YA 5EIEA 2XMCA 4KR0A 1K6EA 3LIIA 1XRRA 1LZLA 4FOLA 3ILSA 4QDXA 2GBFA 2WFZA 4Y2YA 5JIBA 2XUOA 1CRLA 2XUQA 3WK4A 3WLAA 3ZPXA 3WK5A 3OURA 1QIEA 1CUAA 3QMVA 5CH8A 3FYUC 4K6GA 1QIMA 1XQVA 3IB3A 3CCBA 2H7YA 4IQ4A 3SC2A 4QDZA 3W04A 2ZYSA 3O9VA 3OC0A 3FVRA 3WWEA 5T4EA 2WHRA 2WLSA 1P0QA 3K6KA 4X85A 3FYUA 4N8DA 3VXKA 1IZ7A 2G5TA 5AIBA 1HPLA 5FLKA 5ISMA 2UZ0A 2DHDA 5CXXA 5J3JA 4QWWA 2C58A 4H35A 1TAHA 2H7CA 5K3CA 3IUQA 4KACA 2W22A 3G02A 3ZV7A 5JAUA 4GLBA 4G1FA 1GQSA 1CEXA 3G0CA 3SWWA 4G8BA 1J06A 4HXEB 2OAEA 3BL8A 4OB6A 4C88A 4C01A 2DQYA 3L1HA 4ZWNA 3L1IA 1LNSA 3C87A 2VAVA 4BP9A 3TEJA 3HEAA 2JBWA 5FUMA 2ZSHA 3G0BA 4OCZA 2QJWA 4JYMA 1VJ5A 1CUHA 2DHCA 1AQLA 2IX9A 3WYDA 3Q0TA 4X92A 1ZGCA 1R4ZA 5AI9A 4DSZA 1JU4A 5HKBA 5LZ7A 4PQEA 5IVHA 3PE6A 2VSQA 5HKAA 4WFKA 1E3QA 2Z8XA 3DYVA 4PO3X 3G0GA 5HF5A 4FLFA 3X3HA 1G4HA 1TCCA 2JIDA 2HA5A 3BJMA 1BCSA 1XRNA 1ODTC 4ARBA 4BE4A 5AM3A 2HA2A 1H23A 4FLEA 2RHWA 4BTVA 1VZ2A 3F9CA 1E8NA 4EY6A 3S8YA 3FYUB 2XMDA 3G0DA 1EVEA 4N5HX 4ARAA 4DGQA 2D5LA 4X90A 3WL6A 5E4TA 5HFAA 4PF1A 3H2KA 1X2BA 4OU4A 1AKNA 1LBTA 4OB7A 3BXPA 3S2ZA 2LIPA 4KE7A 4AO7A 2BCEA 4YPVA 5AH0A 1FFDA 1XZEA 2OLEA 4FTWA 1UFOA 3WK9A 1LPNA 2HIHA 3WI7A 1BEEA 2H9YA 3NUZA 4B84A 5I9IA 3HXKA 4UFNA 4M0FA 7YASA 4A23A 1QIGA 2Z5GA 3AFIA 1BE0A 1MNQA 3WKAA 1K4YA 3PFBA 1QIDA 3AJAA 5CT8A 4LXGA 2PUJA 2AJCA 3CXUA 1R50A 3Q8WA 2WHPA 2CMFA 3YASA 4MQMA 1LPAB 3DKRA 4AO6A 2OCIA 3O0DA 1X2EA 4UUQA 1EI9A 3A2MA 1W6RA 2XUFA 1MX1A 4Y2SA 1Q0ZA 4UHFA 3AZQA 2WM2A 3R3WA 2C0QA 5KREA 1LPMA 2GBGA 1GKKA 2CUTA 1PV1A 3IIIA 2CBGA 1C7JA 4BCBA 4AN0A 4KAAA 1VOTA 5I7UA 1NU8A 4X91A 3IURA 2X76A 1CVLA 3D7RA 4EY5A 3QITA 1ZD5A 1Y37A 1O6GA 3HI4A 4CCYA 2VEOA 1TQHA 1ZGBA 4CFSA 2VJDA 2E3JA 4WDRA 4MXDA 2BAGA 4UBMA 3V1NA 2WFLA 3FVTA 3H1BA 5ALPA 5ALFA 2PSFA 4BTLA 3PFCA 4HRYA 5JARA 5HCUA 3LCRA 1X70A 3ANTA 3BIXA 4RGYA 3PF8A 3WJ1A 1E5TA 3WWOA 3ICVA 3KD2A 2JEYA 1UZAA 2XMRA 1DU4A 1KU6A 3V9AA 2PU7A 3GBSA 4KE9A 4QNNA 3V1MA 2VJBA 3DJYA 1EK2A 4KRXA 1DQZA 4G4GA 3C8HA 5ALNA 4FDMA 4X6XA 3WKDA 3WYNA 3IA2A 1CUVA 5AK5A 3MUNA 3HSSA 2XLBA 1C7IA 4BC1A 4BC0A 5DTIA 3R3YA 1LZKA 1BN7A 5HQ3A 1UOOA 2WG2A 5AI6A 5ESRA 5ALIA 2K2QB 4E15A 2WHPB 2ACEA 4J0DA 1H22A 3H04A 2B20A 2BFNA 2AJDA 4KJXA 1UOPA 3QBJA 3TJMA 4Y9SA 2XUKA 1UK6A 1UKCA 3FYTA 3VJMA 3F8SA 5YASA 2XQGA 3D2CA 3I1YA 3WL8A 3HABA 4K5QA 3FOBA 5LYYA 1CUDA 4EA6A 4AMYA 4EB0A 5JANA 1DQYA 1XQYA 3FNBA 2HU8A 2CZQA 4XX1A 4ZRDA 5IVKA 3M83A 4C4ZA 4H7EA 3SX4A 4MEBA 3V1KA 1JI3A 2Y6VA 4CCYB 3WKEA 3C5WP 4LIPD 1YCDA 4MWSA 2XUDA 1XZAA 2WFLB 3KWFA 1K63A 2ROQA 4W1RA 1TK3A 1TRHA 2HFJA 2GBCA 2JGMA 2GYUA 2QVBA 3BJRA 4X94A 3U0VA 5LKRA 2ZSIA 4KRYA 4QDTA 1S8OA 5K3DA 4ZREA 3I6MA 4LHEA 3HRHA 3UUFA 1ETHA 4OSEA 3I2JA 4B0PA 3CCCA 4UBJA 4YASA 1YSCA 1EH5A 4HVTA 4PW0A 3WIOA 4PSUA 5IH7A 1F6WA 2C7BA 5HQ3B 3DS8A 1MT3A 5AICA 5CH5A 5E2IA 4GHWA 3WZLA 2VATA 4X93A 3L1JA 1W75A 4Y2RA 3CN7A 3STYA 3KDAA 2WFMA 3ESDA 4GDMA 5K5EA 5FV4A 2O2IA 4B6GA 2BUCA 4G8DA 5FP0A 2OPHA 4X97A 1E66A 1VXRA 4PV7A 3MUOA 2NW6A 4ETWA 2HRRA 2WIDA 4M0EA 1XZHA 5CH3A 1CUXA 1J2EA 4AO8A 1FFBA 1XRQA 1ZD4A 2HA6A 3AINA 3FLEA 4EY7A 5AK3A 1OCEA 3QYJA 3DEAA 2IIVA 4MWTA 1ZICA 2ZJFA 1CR6A 4Q05A 1THGA 4F21A 3M81A 1AZWA 4BAUA 3MVEA 6YASA 5LLSA 3TRDA 5DYYA 1Q84A 3O9MA 1QFSA 3R3UA 5AKHA 2QRUA 5JASA 2ZYIA 2Q0XA 5AM4A 3IUJA 2YYSA 5DJ5A 4C89A 5ALKA 1L7RA 1N1MA 1ACJA 4DIUA 2R11A 1JMYA 2HHAA 1WPRA 4Y2XA 3FLBA 5ALDA 2QUAA 1FJ2A 3ZLVA 3HC7A 4UPDA 4W1QA 2PSDA 1I6WA 1CUZA 1ZI6A 3A6ZA 3LS2A 4Q34A 2JGJA 4DMKA 1H2YA 5K3FA 4W1SA 3QZUA 3ESAA 5ALRA 3C70A 5FKJA 4B9AA 3EQ7A 5CTAA 1N5RA 2WSLA 4C6HA 3T4UA 4J0CA 3R3VA 5CRIA 3IDAA 3ZI7A 4BVKA 2DQZA 3H2HA 5D7BA 1UKAA 4Q3LA 5EIAA 4MEAA 4ITVA 4MJ3A 1CQWA 1U65A 4NVRA 3G9XA 4X6YA 3WL7A 2O2HA 5A7GA 3EIOA 4EBBA 1MAAA 4EUSA 2OXEA 3PF9A 1GQRA 1LLFA 4GXNA 2CKMA 5LZ9A 1R3DA 4UHDA 3FWHA 5DYWA 2W6CX 4G5XA 3RARA 4LXHA 4GEGA 4CG2A 3BDVA 1GT6A 1MNAA 1XROA 4YK7A 4GWLA 4GECA 2WU3A 4P08A 4BCDA 2H7XA 2WUDA 4A16A 3D2AA 1LBSA 5AOBA 3G0IA 2XUJA 5DTJA 5K3AA 4DTCA 2YXPX 1W1IA 3PDCA 1M33A 1Q0RA 1QIKA 1R1DA 2ECFA 4Y2PA 4BE9A 1F0PA 4INZA 1TIBA 1O6FA 2PU5A 4Q3OA 2Y2VA 5FPPA 4U2GA 1K5PA 2PVSA 1QE3A 5K3FB 5HF9A 3V48A 5H3HA 2BJHA 3I2KA 5AKLA 2Y1KA 2D0DA 3IUMA 1MX9A 4EHBA 1UKBA 5ALOA 3STXA 4UBNA 2BGRA 4IH9A 2VJAA 5DNWA 1CUSA 1Y7IA 3K9BA 5AIAA 1ZD2P 5CURA 5EHNA 1SCKA 4HXFB 1YS2X 5DWDA 1HLGA 3C8DA 5AOCA 4Y2TA 2FUKA 1XRPA 4L0CA 1AX9A 1AC5A 4BYMA 1QIFA 5C7YA 2PL5A 4QLAA 5EIHA 4KEAA 1CUFA 1BS9A 4H7JA 4JH0A 3AIKA 2QOEA 1MX5A 4L72A 1W4LA 1R88A 4X7BA 2R8BA 2XUIA 2O7RA 4JEIA 1CUGA 3BIWA 3D3NA 4TGLA 1CUIA 2J3DA 3UMJA 5FXMA 1ZJ4A 3H0CA 3B3QA 4HTAA 5AK4A 1MAHA 3GZJA 5I8PA 4AN1A 1MPXA 2OCGA 4U2CA 4H7IA 4H7HA 2XQKA 2PKYX 4FBMA
chains in the Genus database with same CATH superfamily
2W6QA 2BHNA 3ZJVA 1V11B 4I6EA 1SVWA 2XJ4A 4ARCA 2YWDA 1DJMA 3WMGA 4N6OA 3V2HA 1DEOA 3RROA 3OP1A 3ZY5A 1U3WA 2HADA 2PQMA 2VNHA 1XVVA 4ZAVA 2N75A 4PGMA 3ANLA 5KKCA 1W34A 3PDHA 1P9RA 2ZR8A 4QEDA 2IIBA 5BWBA 3C74A 4OUKX 3ZJ4A 5GADl 3M6FA 5T57A 4RQUA 2YKGA 1N78A 2F3QA 2VSFA 1JW9B 4GFDA 4MVJG 3A2LA 4UTOA 5SYMA 2RGBA 1KSHA 1N2CE 2BFCA 1ZPDA 2VP0A 1E9FA 3JALB 2VT7A 3LCCA 3WBFA 4G8CA 3ZE1B 1D2EA 4YCNA 4TYQA 2A6PA 3KAJA 5JNUA 1E8DA 2RIPA 3G6KA 3GB9A 1BA2A 2JLCA 3P19A 2PRIA 4WL0A 1I1HA 2DCUA 3FNGA 4MUYA 2VN8A 1ZIXA 2QV0A 3NGXA 1LEHA 5EXTA 2ZBVA 2PWPA 2A1IA 5JR3A 1HTTA 1TNDA 3D1VA 5EL0A 3S7TA 4RPLA 2JDID 3DUFB 4RVOA 4A8JC 2QM0A 2DP4E 2JPDA 5DM2A 4QU5A 5EGSA 1BHSA 1O94D 2LWIA 2PL9A 1KHHA 2ASEA 3LX8A 4HGYA 2VAXA 1A8QA 3O8DA 3DCJA 2NUAA 4XUDA 4GVXA 5EZQA 3VVMA 3ZG6A 4Q7QA 3LDAA 6ADHA 1ZQ1A 1XQWA 2O1XA 1EM8A 1BZYA 1XK6A 1ZGGA 2QPLA 3ANSA 1GZ3A 4MV9A 3V1TC 3VNQA 3S44A 4BGEA 1KJ9A 1QFJA 3B6ZA 1P2UA 4O2AB 4TMFA 1IATA 4IOLA 3AR8A 5IG2A 4DDMA 2B3TA 4I5GA 4UPVA 3Q2IA 5KQLA 9ABPA 3LUPA 1FXSA 1TZMA 1P0IA 3DT8A 4L8GA 1YVRA 4TVSA 4A8JA 1J21A 3V8MA 5BV7A 2PGOA 1QJ4A 1QHHB 2C8LA 2WD7B 1NVTA 3AETB 5L3QA 4IG9A 3T0IA 3DMFA 2P27A 4RETA 1AHHA 2CVOA 2PH7A 4PG6A 4YP6A 3TTSA 3AI3A 4M1WA 4NESA 3TIGA 3W77A 4F12A 1F0KA 3O03A 1Q3HA 2OAP1 3JY6A 4MWZA 5EIFA 1GPKA 2Q1TA 4HO1X 2ZI5A 3H5LA 3RD5A 4ASUD 4KO3S 1YZYA 4UOEA 4B3RB 3R3HA 1UP6A 2DJ5A 4KAFA 1P29A 2FWIA 1AQNA 2QUBA 2CVZA 2F8LA 3ZHYA 4NYJR 1HEIA 2DUUA 4ALMA 2ZIUB 2PWBA 4X7RA 4Q3KA 4LJRA 1KIMA 2DUMA 3F49S 4IICA 3R0IA 2AFIE 1JFFA 3CUEF 1ADYA 4R1LA 3L5KA 1ORHA 3MTDA 2K4MA 4L28A 1CEYA 1EA7A 2MSLA 3QPCA 3SEZA 1JA9A 1MABA 1Y9ZA 2VPPA 4Y9TA 5BOSB 2JFOA 2PO5A 3AF6A 1W8IA 5ES3A 4FMDB 1FYWA 5K45A 5BWMA 4MUJA 2C9CA 2O1WA 4F9FA 5SY9A 5FBWB 1TIKA 3HVUA 5DNCA 5KWSA 2O8CB 5CCXA 2J5QA 4EARA 1YNSA 3QLUC 2H59A 2JIZA 2FZCA 3I5UA 4JFRA 2XVAA 4GWKA 4R1NA 3UB3A 5TMDA 3ZU4A 2IS6A 3ZBPA 3OJXA 1NVDA 1PEYA 4MO9A 2ZSJA 1M6NA 4OJNA 3V42A 2WPDA 5KYYB 4QSMA 3F4BA 3UAVA 3CLSC 2Z6UA 1ZXLA 1FU8A 1N2SA 2FAXA 5FTMA 3TD9A 4ECAA 1YR3A 3GLVA 4A6EA 1XLVA 5ADUS 5JQGB 3QXHA 1DIOB 3K0HA 3RC9A 1Y8ZA 4L57A 3BPSA 1L6RA 3O95A 3OE4A 3G8YA 3I6IA 3QLUA 4JVMA 3TOZA 5BW8A 3PX3A 5AI5A 4FEAA 3G2QA 4RBNA 2R4TA 4YDHB 2ZSKA 5REQB 2QP9X 4YI5A 3PITA 4FHDA 1F8FA 1NVWQ 1WMBA 1ZNWA 3IQIX 2HTFA 4NABA 4E94A 1SVLA 2PA0A 1XTQA 2IOHA 4FYVA 1MB3A 1EP9A 3ICOA 5FB3A 3R44A 3K9FC 2I6QA 2OK7A 1SCBA 4EKEA 5FF9A 4CDRA 3K5IA 3OZUA 3H5OA 1IVYA 2WZCA 4M99A 2ORVA 2JGRA 4UAJA 1P7VA 1A5AB 3TOCA 3I42A 1IBRA 2OSVA 4F4HA 4YUZA 4HNTA 1OB5A 1NR7A 1UXIA 4G1MB 2DPLA 2HSZA 1KAOA 3E2PA 4L8FA 1ZD8A 2AKAB 3VSBA 1RC8A 4NJOA 1DXHA 2I7XA 5AW9A 1PZNA 4JJZA 4TTAA 2VBGA 1BXGB 2B4KA 4O02B 2XUZA 4Y7DA 4H1VA 3IO3A 4R7GA 4BNMA 4H6XA 3ZE2B 3ETJA 3KT6A 4L95C 4NMWA 3FSGA 5BV0A 3KJIA 4R51A 3CIFA 5CT5A 3KSRA 2ILVA 5JWHA 1ULUA 3G89A 2WF5A 3PPXA 4K6MA 4TXNA 4AL4A 4NF2A 2HKIA 5E7JA 1TLTA 2W70A 2BD0A 2H1OA 1G7RA 3NGLA 4EZIA 1AQ6A 4GO1A 3L0CA 1NOJA 2Z2XA 2WE7A 4P93A 4DOMA 4M8NE 3VKGA 2OXRA 1LSSA 4JJFA 5FWYA 3AUTA 1NXPA 1R9NA 2VNSA 4WTOA 3KZKA 3WO0A 2PJDA 5FDFA 1VL1A 2NUPB 1N8NA 121PA 2AEFA 5F3DA 1PDWA 2AWOA 1T9ZA 3KO8A 4FXOA 4MLZA 4ZHQA 2JKVA 3L0YA 4I08A 5THXA 2J30A 1EVZA 3OZTA 3KR1A 3T52A 4HSEA 3U56A 1ZMTA 1ZRSA 4E70A 5B4TA 2V74B 3TNFA 2UDPA 4OD0A 2PLRA 1QYRA 1P1FA 1Z08A 2J5BA 3R9XA 1MFPA 3OJEA 1VKNA 4X61A 5K8UA 1JHAA 1NFQA 3L8ZA 3ENKA 1V3VA 5ALMA 2OFFA 4BB0A 4AX4A 4FMBB 3EPKA 1NP3A 4PX3A 5CXSA 3ZTTA 4C21A 1MZVA 2AFHB 4BBPA 2AUTA 3A14A 3EQ8A 8OHMA 1PG5A 4TM7A 1Z75A 2Q2VA 3EHEA 2JHGA 1UPXA 5G1NA 4M6WB 4QPJC 1YS7A 1YU9A 3VPFA 2G83A 3GT7A 3MS7A 5H68A 4Z86A 4CV1A 3MSCA 3SSNA 2F1IA 4QHSA 5FQOA 2JCBA 1TPZA 3KQWA 1TAGA 4GPIB 5JCJA 1TO6A 3PRJA 4UUBA 5BSWA 3UMGA 3H11B 1US8B 2KLHA 4B4KA 3PEYA 1DKOA 1YDHA 3IAAA 2DFLA 4EPTA 2XUAA 2NPFA 2UUOA 2LR0A 1HDOA 5IXYA 2P9CA 2Q1SA 3ELYA 3ZWCA 2QTCA 4C2AA 3PWZA 1O0SA 2Z3WA 3ZCRA 1L7XA 4GNKA 1LQTA 1ZMRA 4C7MA 2FHPA 1YZHA 2H4HA 5GQSA 4D46A 4AB1A 2FWBA 4G56A 4FFDA 4DWVA 1A72A 4Z0NA 1RHMA 2J9XB 3UK0A 3U4IA 1XFDA 1CETA 5IVIA 1H6CA 1TMKA 1DBRA 2OY0A 4ZYLA 3LL4A 3IB6A 1YOVB 3WGHA 4C0HA 2LNDA 3UOWA 4DG9A 4XGIA 1GOTA 2AFIB 4OP3A 2CDRA 4TKZA 4C78A 1BE6A 3PPVA 3PHJA 3W0LB 4QOFA 1VXOA 4KAXA 3T7SA 3GA0A 3TR0A 3H2BA 2M32A 3W3AD 3ZV3A 3ZWNA 2R7KA 2JLBA 1KI7A 1WXXA 2VZ0A 3PVSA 4KQIA 1N7JA 4N5LA 5CT4A 5E1MA 2FPKA 4LVOA 3ZZNA 4BKPA 3TKLA 2WNIA 2IIQA 4BGVA 3AFOA 5EVJA 1N6PA 4YRQA 1XTZA 3KAKA 5ED4A 1KZ1A 1TUBB 2RI0A 1EK5A 4HAWA 5CVCA 3SHFA 3HVRA 4C14A 4S1VA 3V4LA 3H9EO 2FGJA 4WT7A 2I8LA 2I8AA 5FNVF 2XGGA 3IHWA 1LGYA 1I3LA 4IHAA 1B42A 2BH9A 3MAJA 5FUWA 3DD5A 1XZNA 1WP4A 4G4SP 2AQHA 2WJ4A 3L01A 2QAGC 1BHO1 3OOEA 5E6UA 3ZN2A 4F4DA 4UD2A 5LQJA 3KL4A 1SHUX 1KYQA 2BGGA 1L5SA 2HF2A 5FL3A 1FDTA 2ZBPA 3NGMA 3INYA 4C0BA 4CM1A 5DX0A 2DY1A 2WY2D 1IZYA 3F90A 4PIMA 1PJSA 1ECJA 2DY0A 1K8QA 1JQ5A 3QBVA 4UBOA 4UFOA 4EW2A 3TLMA 1SCUB 3AESA 1R0ZA 3FTDA 1ZKDA 1S4MA 4FNGA 2J6BA 3NOOA 4KWTA 3W8DA 4X00A 5JLJA 1R66A 4IG4A 2Q3EA 2A84A 1S9DA 1HDCA 2AE1A 3KXPA 3O82A 4Q1BA 4C7JA 4QULA 4HWGA 3UXYA 3EEFA 2JFWA 3RIGA 4E3ZA 1KZ9A 2QAGA 2W8ZA 4N8SA 821PA 3BK7A 3TK1A 1KSFX 2Y67A 3FUVA 3HGMA 4FMCF 2B7CA 3JV7A 2DFNA 3LP8A 1J33A 4JLSA 5DASA 1UUFA 4HR7A 3WRVA 3EN0A 1PJTA 3WJ2A 3HO8A 2VH1A 3T5AA 2WTBA 1NY5A 1VLZA 3E4CA 4JJIA 1MF7A 4Y67A 4Z6KA 1HYBA 3EODA 1XD2B 4GOMD 5FFNA 4F04A 4IM7A 1L2TA 2WJWA 3IP3A 4U9IS 4BFSA 5HHTA 4K9DA 1SD5A 2AOWA 3GGCA 4YIHA 4B75A 4G0WA 5DFAA 1R6BX 3C3AA 5ALJA 2ZRLA 1L8XA 1MA3A 2MU1A 5IFLA 4PXSA 1EB8A 4ZAZA 4UNRA 1I3MA 1U2QA 3VR4A 1KARA 4WJLA 4YR7A 5K09A 3D3EA 5IK2D 3CG0A 2YJNA 3IVMA 5JMPA 5BUZA 5IAGA 2OXTA 5ALEA 1XZQA 5FOWA 3V7WA 2UZ3A 2G25A 3AEKA 5C8YA 5D3MB 3PWSA 1Z8HA 3A7EA 3EC7A 1A2BA 4NSNA 1XMXA 4CBVA 4GPZA 1TKBA 3Q3CA 3V6MA 5DRTA 1KK1A 2JZCA 2O3TA 2ZW9A 5DTQA 4KHZA 4C4XA 4D3SA 3WC4A 2J0UB 3FBTA 3Q1KA 3BZBA 4WESA 2YWJA 1Z2OX 1EUDB 2R1TB 1N5LA 5DDIP 2YUIA 1I80A 4HAXA 4XX0A 3U0BA 3SXPA 5KEIA 2ZVQX 3AJEA 3IPXA 2R87A 1COWD 2P6OA 3DHVA 3N53A 3WICA 3CZ5A 5CXQA 4BP1A 4GSKA 5ENZA 1TAUA 3C2QA 1KJYA 2DPYA 2QQGA 4N12A 5AO9A 3J81A 5DLQC 5TEWA 2XEXA 2I2WA 4IIJF 2B2CA 1L8LA 4WNCA 4A8PA 2PGJA 3LY5A 4UNPA 2JIRA 1ESCA 1LRLA 2VJLA 5BNIA 3ASYA 4Q93A 1EX1A 3IELA 1WUKS 1Y8QB 4QEKA 3G9ZA 2COKA 2XHZA 3D0OA 1EFUA 3RIEA 3UJ9A 3NOXA 3MQ4A 4PX2A 3MFYA 5C8XA 3C5CA 1USVA 1FUKA 1UPFA 3EWIA 3LJKA 3R7SA 5A3QA 2X4IA 1MV8A 3ZWMA 1JJFA 1Q0TA 2Y8EA 4KL8S 1XMVA 3L93A 4KQ1A 4L2IB 3RAPR 3F2IA 2CCGA 1FDUA 3R77A 3ZDQA 3U40A 5KYGA 3E3LA 5CJ2A 2BV3A 3EZGA 2DTXA 4FHEA 2RHCA 4UHCA 4W4TA 4YGXB 3SFTA 4LHYA 2BOVA 2QZ9A 3G2IA 1GCAA 1IQ0A 3KOXA 3WSWA 2GR9A 1DAKA 3DE3X 2PMFA 3LSTA 4YN3A 4DMCA 1KVQA 4Y6SA 1FFYA 2XOXA 1X14A 3HRKA 3JYQA 1A82A 3KTAA 2XMBA 3BMQA 3NHLA 4WMLA 1YCFA 5FTKA 1AMNA 3RS5A 5LR6A 2X2OA 2FG5A 1NBMD 3EWAA 4D9GA 1H4SA 1KEUA 3OWOA 4KQ2A 3L8DA 4XEHA 5J4VA 3N2YA 3QLTA 4CTMA 4RF2A 1MORA 2AN5A 5BO5A 1LD3A 1U0FA 1FTWA 2QXYA 2V7VA 4MW1A 3VYRB 4GZ3A 2P9FA 1NQWA 4JC5A 3H18A 4C7XA 4PPNA 5DOVA 2D0OB 2W71A 3BMXA 4IMRA 3O94A 4JSYA 1IIBA 4Q4DA 3UGJA 2WI8A 1JT2A 1FNNA 1PIWA 3O6VA 4MQFA 1J9GA 3CVXA 4GLLA 1QE0A 4RYLA 2J87A 4HZUA 3NHSA 4CKCB 1FNMA 3MAAC 1M5RA 4N7BA 4C2UA 1Q1NA 4OU5A 4PX9A 1GTVA 4JI8B 3W9BA 3V34A 2EEPA 2GTHA 2GASA 1BMFA 1G5PA 3DAYA 2QTHA 3EW9A 1AQIA 5AVXA 3NM4A 1YIOA 5HF8A 3N5CA 3TSZA 3OT1A 4Q9IA 3UWDA 3BMCB 4FDAA 3NAGA 1YR1A 4AT1A 5BNZA 3FCOA 4OMFG 1IIRA 4OSOA 3BBLA 5EZYA 4NCBA 5BMVF 3E7FA 2EP8A 1JAXA 2OHOA 1VE6A 9LDTA 4TYMA 4KXUA 4PC6A 1FP2A 3K0FA 4HFMA 3V4OA 3EIQA 1ICIA 3A4VA 3IE0A 3COVA 4YAFA 3GLQA 1ODLA 4MINA 5KU7A 1ITZA 2ZE6A 1EIZA 5AVSA 1PGOA 2VNIA 3CA8A 4Y6LA 1XWFA 3GUZA 4J90A 2IXBA 3ZCSA 3T7EA 3RU2A 3O84A 3RHTA 2AKEA 1XXHA 4MUGA 5JATA 3KQQA 4P3XA 3PXBA 3HB4X 4GICA 1NW3A 3OM8A 3A1VA 3FTNA 4K9OA 1PWXA 1RJWA 2OLJA 4HUQB 4BMCA 4MS4A 4WWHA 3JWEA 4JCOA 5IP5A 4CIWA 4PFQA 4UVGA 1GTSA 2IH4A 3DTVD 4JKYA 3T3DA 4ZV9A 5FO1A 1YA4A 4NG4A 2R5WA 1PS0A 4JBWA 2H92A 1ZRHA 4ZK6A 4ETMA 2V6BA 5HK8A 1VMIA 4YXFA 1RPNA 3DFZA 4C2TA 4R2LA 5JMWA 4YDSA 1TEVA 2NLOA 2RH8A 1P2GA 1PR2A 3OPYB 5JBIA 4KV7A 4B40A 1JLRA 2H54A 2NZXA 1KMCA 2QAIA 1MQSA 3TQQA 4H4DA 4OUDA 3C6BA 2QA5A 4M1SA 3TLCA 2D2XA 3H4MA 1UQUA 4LXXA 3E9ZA 2XMQA 3VTKA 1AGYA 1RCUA 1PJQA 2FPUA 4NE2A 5IMBA 4HOYA 4EHJA 4KITB 1ND6A 4FZRA 3FAKA 4YALA 1IHDA 3AYZB 2XNDA 2UUPA 4FGSA 2O3JA 1N4DA 2DHEA 3ZU2A 5KINB 2HSDA 1NQ5A 3TI9A 1I0IA 1NUQA 2PPLA 5JNVA 2WOJA 3V8EA 3AZPA 2O8NA 1W4RA 2EEZA 2GRJA 2B61A 2EQAA 4IDOA 2OL4A 2ZIFA 3M9XA 4A0GA 1G6Q1 1ZD3A 2AJBA 2I4RA 1XZJA 1OX5A 3CRVA 3KZOA 4RS3A 2IU0A 5ITZA 4S04A 1ZZEA 5I7EA 1JDZA 2ZCJA 2EGGA 3P97A 3KTDA 4IEEA 2PUGA 4I4CA 1JLLB 4R98A 5TY0A 1KXJA 1U81A 3P71T 3SCZA 1FDVA 5K0ZA 1Z5GA 2VHZA 4TV8F 5BWLA 2CHFA 4LY3A 4A6DA 5KQRA 2IYLD 3IR5A 2Y6UA 4QE3A 5ELLA 3R20A 3CLTC 1JG4A 3JZAA 3UATA 4B3IA 4JUCA 1ATIA 2BZ0A 3KKQA 3NW9A 1A7AA 1N0HA 4YUYA 3GZNA 4R8LA 1V35A 2IGBA 1JJBA 2VHVA 1GWNA 1I4DD 2PA3A 2P3QA 5DHAA 4EIWA 1Z06A 4XVUA 4F7WA 1EUCB 1TVKB 2XD9A 3ISTA 4JOQA 5C3MA 1SBZA 1M75A 1W46A 3B89A 5KTOA 4KG7A 1K7CA 1YAHA 4CKBA 1BWPA 2IHKA 4DLBA 4JLMA 4YMLA 5EWMB 1U0RA 3KLMX 2N1BA 5BQOA 5JZSA 1KS9A 5F2EA 4LX8A 5F33A 4ILKA 1XTTA 2HM7A 2VP6A 4LY0A 4BWYA 3A1SA 4P33A 1CQZA 1Y63A 4PNPA 1P75A 4S3MA 4UOQA 4FMPA 2B5VA 1DQPA 2PM8A 3F8WA 3H8JA 3TPCA 4JEMA 4BO8A 2JVKA 3THSA 2GUGA 2ID8A 2XQFA 4QGFA 3GQVA 2IYZA 4ZTUB 1BXKA 1SRRA 3TAHA 1XRMA 1I5EA 4MUKA 1CZUA 1OASA 2FJUA 3O3OB 4L51A 2QRJA 4WCFB 1XRSB 4EYEA 3EOZA 2B4QA 2NYAA 4RPJA 5KWIA 4GBGA 2P1ZA 1TJYA 2ZS9A 3IEUA 5J4LA 3GFOA 5J40A 4D4IA 3C16C 2WJHA 4QG3A 4HNRA 1YK1A 4O59O 1QYXA 4GSYA 1R15A 3EWSA 3ZX5A 1W59A 4XJSA 4DNOA 1ZW1A 2AC4A 4HAZA 5GZ6A 5LNK1 4O4IB 4B34A 1JJ7A 3O7WA 3WRYC 1W5BA 1P9LA 3P0RA 3NFYA 2X3UA 5CTJA 3KZMA 2ZYUX 2X77A 2XT9A 4HQNA 2AV6A 4MGZR 1KRXA 3VPDA 3ESBA 4JMLA 3GG9A 5KSZA 5LQRA 2YN0A 1QGDA 1L5NA 3VO2A 1CLEA 2IEYA 2DFVA 2O1SA 1E32A 1VP9A 4J4TA 4O1MA 2DOKA 1ZC3A 1IL0A 3DVLA 3OFNA 2WVAA 2R8OA 3FUWA 3UTCA 1YIDA 1PEDA 3I3SR 3WRYA 2WT9A 1XP5A 1LY1A 1XZDA 4NLLA 3TW0A 1JUDA 1UP4A 1SU6A 4Q7MB 4C6TA 2MJLA 2HOQA 5AWFC 4ETIA 1AGPA 2FEWB 4ZYUA 1WIWA 3WLLA 4FI3C 4BMZA 1E6LA 5HE9A 2ONYA 3FOWA 5B53A 3D4LA 1Z28A 2EG9A 3GFFA 3ZYCA 4AI6A 3I2HA 2YOHA 3QWHA 1ZOLA 3Q6IA 3B1JA 1VLLA 1C3VA 3I2FA 3F6PA 1VSUA 1J5PA 3CX8A 3PZBA 4C0JA 1JHMA 3P5SA 5L53A 2PSSA 3NDJA 4LNAA 2BKAA 3FIJA 1CRQA 1LLCA 1L4NA 3C6MA 4NNJA 4QXQA 3ZXUB 4YLEA 4RM2A 2JCYA 2VZ9A 3SHWA 4RKQA 3UJCA 4AECA 2J3LA 2R3SA 3I01M 1MV5A 1WOMA 1YQGA 4X7PA 5JY1A 3CVUA 2PRKA 2QMYA 3CNQS 4Y98A 1GPYA 1A9XA 1UOQA 1JG6A 1OXMA 2ZQ5A 4WCDA 2M1XA 3L6RA 1DEHA 2XXBA 3OCUA 4JXJA 1ZOIA 3ADKA 3CIOA 1Q57A 1JIIA 1LSUA 2HQOA 2XW6A 2EDCA 4BQIA 3FSEA 5HEKA 3AR3A 1GNQA 2V45A 2QLLA 2HEGA 4GF5A 3EYAA 4BATA 1P72A 1UWCA 3H1AA 4MCHA 1KSJA 2JJ8A 3SJZA 4ZICA 1VRVA 5KNBD 1F1BA 3CCFA 3I9V6 2A57A 4CL2A 2BM1A 5CM2Z 3RNLA 2Z04A 5A3JA 2AK2A 3STWA 2ODWA 1V9LA 1PR3A 2OO3A 2XDWA 3OE7A 3ZNOA 2D8MA 5KYXA 2CV1A 3NUQA 3K70B 3TD6A 5JJKA 2N46A 3UPUA 1U6KA 3NQ41 1G3MA 1YZNA 4TUYB 2JLQA 2BMFA 3B1XA 4MYSA 1MH1A 3BIJA 2WAOA 2C8VA 4L5JA 1JL3A 4MPDA 2JEOA 3H9GA 3WL3A 2P5TB 4DG8A 5FORA 3IOCA 3GQBA 3WAKA 2WUGA 3OQBA 1SOAA 3R40A 5A3VA 5DX1A 2F48A 1GGJA 3RS0A 1XPOA 3R6LA 2GAIA 2R8ZA 5JD4A 4DR6B 1MTZA 3ZOZA 4YCBA 3O8LA 4J49A 4LXQA 4C6SA 5LNK6 2F3UA 5TRTA 5KNCD 1E1NA 3LO5A 4MKHA 4P22A 4AN4A 4G26A 4RZHA 4XGKA 3RU7A 1WHTA 1TF2A 3AX6A 1XHEA 2D4HA 3R9KA 5KZMB 3GV0A 1HMPA 1R8SA 5F5XA 5A5GA 4DV7B 5CM8B 4AVYA 3P9ZA 3RBVA 1A88A 1CC1S 1I51A 3RTBA 4C4OA 2QRVB 5DI3B 4B6QA 5FI1B 4ENQA 5BSVA 3N2ZB 1YCHA 2R96A 4LE2A 4EQ6B 1U5BA 1ZCBA 5I6DA 3E81A 1LDBA 3BH0A 3N3AC 3EDYA 4FNAA 1K0UA 1REQB 1R0BA 2FQ1A 2I54A 4BDSA 1T13A 3UA3A 3UMCA 2NZ2A 4BP8A 5LMCA 4FT4A 1JLHA 4IYRA 3SBDA 2PIDA 1W25A 2W98A 5IVDA 4AQDA 2NSDA 5FPHA 3OVMA 1SZCA 1Q5PA 4LX0A 3AQ4A 5F1YA 3VYWA 1ICEA 4AMBA 4CG1A 3A3PA 2C3UA 4LJLA 1MW9X 5T7BA 1SB8A 3DL2A 4L02A 1HQDA 4ZVKA 4MQUA 4YRJA 3PFIA 2GILA 2YZGA 1DX6A 3R8XA 4GL2A 3V3TA 1XLTC 3BC1A 1YKSA 3JS5A 4N65A 4UMVA 1MEOA 3F46A 1II8A 3G8AA 5AK0A 1LDGA 4O33A 1OYWA 4ZZ1A 3EQ9A 3WISA 2V7GA 5YASA 4B3BA 4N5DA 4P2GA 4IAOA 4U7TB 4XE5A 2ZYAA 1OGIA 4MDEA 2QL9A 1CZKA 4D9IA 1I6MA 2CEAA 3CRNA 3DB2A 1L5FA 3T7KA 3H5NA 1LTKA 3TGWA 1M9NA 5F2NA 1RQXA 5H8WA 1YQXA 1DKPA 5T4HA 2OVFA 6REQB 1JAHA 4K03A 4BX8A 1OH6A 1NSFA 3JQFC 4QFDA 1V16A 3LBNA 2YXLA 3AUJB 1QORA 4UARA 3IO5A 4BO9A 2DU8A 2GK7A 3P0EA 2H4YA 3UMFA 3HUDA 3GWGA 2G4LA 1ONSA 5DT9A 2IWRA 2XOEA 3OLVA 2B83A 4IDQA 1SU7A 3GD5A 4NH4A 4IO0A 6ABPA 2BTOA 2W2QA 2OPBA 1T8UA 3WQHA 2YCLA 4OOEA 1QTRA 4CM4A 3A2NA 4ESHA 3DWFA 3PQ6A 5CFPA 2XE8A 5IKXA 3JQFA 2I7TA 2VQSA 3VR5H 3RVNA 2WF9A 2XE6A 1J23A 2FX5A 5FPQA 1VG9B 4AJNA 5B3KA 2AC7A 2FKAA 5H70A 2C4HA 4CQMB 3WFZA 5HUJA 1OI3A 3IOYA 2DFPA 1IVNA 3EZNA 4IJVA 3RK4A 1Y1PA 2ST1A 4KUEA 4BU0A 2NUAB 4II2A 5H3LA 1JHZA 4YHBA 1TO1E 4WLNA 3NNDA 1KA9H 2A5LA 5SICE 3SY8A 3VX4A 5HP4A 5JT1A 3D8TA 3LUGA 1C9NA 2R6ZA 1DINA 1BFKA 3IP6A 3IQWA 4BV2A 2SBTA 5HKKD 1RCFA 1YRBA 5FA8A 3EVAA 3ILXA 4IKEA 1T9GS 4BAGA 2AG8A 3F6BX 1RXEA 3LOQA 1Z2NX 4I50F 4RJ2A 1FOEB 4WZZA 4CHGA 5JH7B 3ADOA 5DCWA 1WRBA 4DNXA 5IDVA 4BMDA 1HNXB 4H7FA 3TIIA 1PJ8A 3BAZA 2E21A 3L77A 5M7EA 1CYEA 3BWEA 3QUAA 2EP7A 4DSAA 1QGED 5HILA 2D5CA 2I6TA 2AOTB 4TX1A 4X71A 2RONA 4MH0R 4IXDA 3QWFA 4QT0A 5P8WA 2XYRA 1G9XA 1MU0A 1N5OX 2OBBA 1U2TA 2WJIA 2PS3A 3H9UA 5IC4A 1GRRA 1Y9EA 4OI1A 3LMKA 3N07A 1E2PA 4K6HA 5EGNA 2HWXA 4J0HA 4XWAA 3UWOA 4C7BA 1ZI9A 3IDSA 3W05A 1N5MA 2GHRA 4L16A 1XTUA 5FWAA 4JC0A 1UBTS 4KMMA 2XZTA 3GW8A 4IVQA 3HJUA 3PJGA 3CRRA 4MPJA 2JI6A 1DAFA 3QVGB 4MUBA 2HLNA 1WP9A 1VYUA 4NONA 2LPMA 4RXUA 3WG9A 1OXXK 4B2LA 5LDDC 1U63A 5AFSA 5IBRA 5HDQA 1DT5A 4AYXA 3HK2A 2EKPA 4EUFA 3VTAA 4KRFA 3COSA 4LJSA 1QDLB 4HGZA 4F3CA 3B1FA 4BVLA 4F5ZA 5JCPA 2AW5A 3IVCA 5KOYA 3C8UA 5AVJA 4K9RA 3FHLA 2AR9A 5AKGA 3REGA 3ZE9A 1DUIA 4M7OA 5GTDA 5A9TA 1CUYA 3HMQA 4LNUB 1Z22A 2WABA 2WG1A 5E7QA 4CYMA 1L7AA 2PBLA 2HK9A 2GYVA 4FFWA 2HRDA 3B9BA 4HTFA 3WA6A 1A5BB 3KYCA 1JEJA 1GZ7A 2IT1A 1L4UA 1T8YA 3LM8A 1HEYA 4CLRB 4HVCA 4AY6A 3E0XA 1MAUA 4HS4A 1S3SA 3WJ7A 1LWNA 3D59A 4GI1A 3Q7PA 2IYEA 4M0CA 3Q8XB 3W79A 4S0XA 4YRCA 3ZDFA 4BB6A 2YIVX 5BMVB 2GKSA 3LLCA 4HEHA 2YJ5A 4WK6A 2ZJ6A 3BG5A 3IBTA 5K0NA 3SDBA 2QLBA 2RKWA 3FLMA 3K4HA 2N1MA 3CB2A 1VLHA 3BWCA 3MMZA 2PVPA 4KLAA 4MR7B 5HK9A 2WMOB 2ZJYA 4JXZA 3PX7A 3CR7A 1ZOPA 1L5OA 3FNEA 4A5SA 4C08A 1Z35A 3WTBA 1N2IA 2X4GA 1F3LA 2W2OA 5C35A 5JOQA 1D8AA 4NCKA 1KF0A 5IJ0A 2A33A 4FFRA 4WXHA 3KFVA 4WBNF 2GEUA 1O0BA 5CT9A 5D8DA 4RTRA 1YDEA 1NUUA 3GLFB 4XQCA 4XXHA 2IV3A 1Y5LA 4HB4A 3K9LA 3N1UA 2BM8A 4F5WA 5CCEA 1SKQA 3GT3A 3AUSA 4Q12A 1T0IA 4TVKA 1I24A 1IBSA 1HE8B 1VGVA 2SHKA 3H2YA 1DI0A 3TIXB 4YJ2A 1E5DA 1NURA 1IM8A 3NKFA 4TQUS 5EHQA 3H2IA 1U99A 4O1IA 1ENPA 1Q7CA 2WIBA 3KWMA 1CS0B 2GAAA 1E0KA 3M34A 1F4PA 3ZHRA 5E38A 1WW3A 3AU9A 3C0KA 5CVJA 1CVRA 3BCHA 4MSUA 2H2IA 3FHJA 1JS1X 4WA8A 3ZWYA 3FZEA 4KYVA 5CDTA 5AXBA 4ARZB 3L7IA 1ML4A 1UK9A 2H1CA 2IE8A 4YV7A 3ZDCA 1XWWA 1HL7A 2Q2QA 5KNLA 4RTLA 1XRLA 5E3HA 2XE7A 1Q2UA 1I01A 7REQA 4FSXA 3PEVA 1LNZA 5J1TB 3VNSA 4BO5A 1NG1A 3ADCA 3NORA 2QV7A 2I1VB 4NG5A 4V0QA 1FBTA 1NDQA 1RFGE 2J7KA 5L40A 5IN4A 3E3AA 1PE0A 3IRVA 4YJDA 3ME5A 3R7NA 3RK0A 1N75A 4I14A 3NKVA 2FP4B 3UZUA 3WVNA 4G4IA 1PAUA 3TEMA 3C1UA 4URHA 2Z3ZA 1AGRA 1S2IA 3LBIA 4MWEA 4EGSA 3AR2A 5BWNA 1GEEA 5LPNA 4KQJA 1UJCA 1WU8A 3O4GA 1GEGA 1SEVA 4CMAA 4GR4A 1E4EB 3M4NA 4V2IA 4DKJA 1GDDA 1GFZA 3NWPA 3BWVA 4YYEA 1Q44A 5GONF 2BH2A 1KE1A 3QPDA 4FBGA 3ITKA 4IIFA 5G53C 1UKZA 1A5TA 4I1IA 2ZBQA 3IPRA 1L5MA 1QHSA 5MF6A 4FLMA 3D0KA 4WVLA 3DHYA 1GPWB 4KQEA 2ONZA 5B7PA 1E8MA 1U2DC 2REQB 3Q3HA 4HAOA 4J0FA 1Z8NA 1YONA 1W0KA 2OGSA 2PH5A 2ZRJA 3GPIA 4V1CA 3DQZA 1MN6A 4TSFA 1RJ9B 5DF1A 5ICMA 2HFKA 2MDTA 1RXCA 3RSCA 1E1YA 1SCQA 2IXGA 3CONA 1HFWA 4JEHA 1KDYA 3AU8A 3KE8A 4WFIA 2XGOA 3VNBA 2AQIA 1KQOA 3GROA 4XVHA 2G88A 4JGBA 1PVVA 1ONPA 2TS1A 3KHTA 2BL4A 1ENZA 5K0BA 5CW1A 2H5EA 5TMBA 3LYAA 3TG8A 2HUNA 3VSDA 1KTVA 3CT4A 3K70D 1U2DA 3IBYA 1N34B 2AB0A 3O8NA 4DB2A 4DT1B 3GRAA 3HA7A 1UM9B 1CCWA 3H8SA 4ZVUA 3EEQA 3K0CC 1U6JA 9LDBA 3H7AA 3T9FA 3GLKA 1JSLA 1HLDA 3DEHA 3DDUA 3DOEA 2DQSA 2ZYRA 4O29A 2E4YA 2OHXA 1YA8A 1FTNA 1Q77A 2O2DA 1GAXA 9GPBA 3HL0A 2O2YA 1E4VA 1A4XA 1DAHA 2JI9A 3DBLA 1NAHA 5CLFA 2XBMA 2B7BA 4BFVA 1QLWA 1JFRA 1Y0BA 3PNSA 1VJTA 1LH0A 2OB2A 4EJSC 2QNRA 3LHFA 3WHKA 4HRXA 3DCYA 3AHDA 4WVFA 3RR2A 3FPAA 4MKGA 3K0CA 5A02A 1VG0B 1E59A 1NFFA 2O7QA 3V1YA 1RRKA 3RSZA 2ORWA 1WVMA 4KIJA 1E92A 4TN5A 1NULA 2HU7A 1MB9A 1NRJB 1BIFA 2B9VA 2RHLA 3DF9A 1Z0DA 2Q49A 3V7NA 4G41A 4Z7NB 4X44A 1L7VC 2BUAA 4EHDA 5AUPB 5HX7A 3JQ8B 3VGPA 4FNMA 5DLPA 1ZP6A 3FB1A 4LTNA 4RDIA 5DI9A 1NXSA 1BN6A 5J5VA 4HX2A 4EJSA 5F9MA 5DM70 3JTEA 4LW8A 4Q1VA 2AN4A 2X22A 4US1R 3GFPA 4FKZA 1SUSA 3ZH9B 4I4TA 2J0QA 3CR8A 3PG5A 1YMQA 1JYFA 1H0SA 4QECA 2DRIA 4TL7A 3QENA 5EMHA 3VYSB 1J8MF 2BZ1A 3N2EA 2QZJA 2H4FA 3AHEA 4J6FA 1E3SA 3KB8A 1SC3A 1N92A 2JCSA 4G84A 4INJA 1IY1A 1CJBA 3LIIA 3KS9A 3PC8A 2BEUA 2GS9A 2COEA 4GM4A 1R0LA 4PXAA 1W87A 3GAFA 4Y1GA 5BSGA 4A0QA 2ZIXA 1RQGA 2VNKA 1P39A 2AMJA 1L4HA 2JD2A 4WNYA 3PD0A 5ERXA 3IQGX 5IN5A 2YN4A 3SJAA 4QVKA 1ILWA 4EYQA 3GXBA 3LC2O 1CUAA 1YACA 5L45A 4IIVA 1T1EA 1G64A 1GL9B 4R81A 2FN3A 4DLPA 1VGQA 5C8YB 2BFDB 1GADO 3M1YA 1CIPA 2ZIEA 3L9XA 5ICEA 2R8YA 4MJXA 1QIMA 1TK2A 1HYGA 1XQVA 3OCVA 1GU1A 1HT0A 2PZ8A 1BH6A 1QLHA 3MIZA 4II3A 2H7YA 4MRMB 3S2FA 1DTSA 1DCTA 1K97A 3W6OA 3I4CA 4QDZA 5CFZA 2WKRA 1WSDA 3W04A 1C0IA 5BV1A 2HIMA 1M0SA 3H0KA 4XGQA 1YDFA 4MVJH 4TMKA 5F2KA 3ZHOA 3GLGE 4XOUA 1BDBA 1KEPA 3I04A 5JQWA 3F73A 3DBRB 4YXWD 5A0FA 1N1GA 1ISJA 4RCVA 3O4FA 3PUXA 5ELMA 2WHRA 3M33A 2PZBA 3KIPA 5C7OO 2X9LA 4HPXB 3IAS1 3LZDA 3ED5A 3DZIA 4NZNA 4R41A 2O2CA 1ISSA 2EIXA 1W93A 5JNSA 4P7KA 1U2GC 1YBMA 3GHYA 2FSFA 1KDTA 5ISMA 2UZ0A 1KDPA 1RBZA 4FDLA 2WMYA 3IQHX 3KXIA 3H84A 1XJQA 1BXRB 3MELA 4P7FA 2CLOB 3HJHA 2I3AA 1UMBA 5F23A 2XECA 4XFJA 5TF4A 2B0CA 2H7CA 1MJNA 1V5WA 3GUCA 2P5SA 1A4IA 2O0MA 1L8OA 3TMYA 4FE7A 2YL2A 1G8SA 1QTNA 4TXLA 4IFBA 3JQ9C 3KYJB 1YZKA 2QLJA 4PAGA 4BN5A 1IM2A 1A5ZA 3ESQA 1FTSA 1CEXA 3G0CA 3U7JA 4C29A 3SWWA 1U2GA 1PZMA 4MWOA 5G4KA 3HEBA 3RRZA 1FTGA 1NA5A 2JI7A 3FZGA 3K31A 4PXYA 1D2RA 1DBIA 4GI3A 3ZHCA 2XXAA 1GITA 1OXBB 3AKDA 3ES9A 4JBXA 4W99A 1WU7A 3ZEIA 4RVHA 1L4GA 4PC2A 3WMEA 3M6UA 4GL4A 4D45A 4ZU6X 4BP9A 1JQDA 3CSUA 4HMPA 1IOVA 1QCZA 3D7SA 4HKTA 3T95A 2H00A 9ATCA 2CDNA 3JQ9A 3MJHA 3VZQA 4R8RA 4BKRA 2AOXA 3S2UA 3UMVA 4K0KB 2ZANA 4ZEMA 2D5BA 2H2GA 5CVUA 2CXQA 5JVDA 3BXGA 1PJ4A 1QAOA 4ZDWA 3CVWA 1YCGA 2E4XA 1T2AA 3H6GA 3G0BA 3FNQA 3QEKA 3VHQA 1JQLB 1P6XA 1VC2A 2FMHA 2QJWA 2P30A 4TZTA 1VJ5A 2GGSA 2VJPA 1D6JA 1TKAA 2XB4A 2WHXA 3FF4A 3GJXC 5G4LA 1NONA 3QELB 1Y42X 1JQAA 2O6LA 1FZQA 1RVV1 3PGVA 5C46F 4CKEA 4UUPA 1TCVA 5L3SA 1XTSA 1Z4PX 2IHJA 3PQ3A 3AFNA 4FYWA 5B6PA 2GXSA 2JIZD 2WP8J 3MMXA 5FULA 4XB6B 4JC8A 1XN4A 1J42A 3V33A 3PGA1 2QN6A 4EF6A 1GT91 2TECE 4UDNA 1TADA 2WYIA 3KM0A 3MC1A 5EP4A 1H9CA 4Z3DA 2CJXA 4Z4EA 3B78A 4C03A 5SYAA 4KDFA 3S0JA 5IHPA 1MH9A 1CZHA 4PQEA 4Q9DA 4WIAA 4ZMRA 3U48A 3NBXX 1RWPA 2IP2A 2J46A 4FGUA 3UJ8A 5HSGA 3DFUA 3S4YA 4ZDKA 4CM5A 5E7IA 2R6DA 4TKVA 4F38A 4PLPA 3GP5A 4FQ8A 2QBYB 4FLFA 2C97A 1RACA 1G4HA 1I32A 3UBMA 1CK4A 1E62A 5BT8A 1QF9A 1P1HA 5G1PA 3JQQA 4DLZA 3CLSD 2W2PA 3HUFA 4B48A 5HIJA 4HN9A 1Q0PA 3OZAA 1XRNA 4AY5A 3Q2KA 3RG8A 2HA2A 1LI5A 1LTQA 5CJJA 1X7YA 3L4JA 2X58A 3LSYA 4P5PA 3AVVA 4YBRA 4R71A 3U6BA 1NN3A 3VR2A 1WZIA 2WM9B 1XD9A 4KWHA 4NFSA 4JGGA 1VZ2A 3PE3A 1XEXA 3OZBA 3TS1A 4DM3A 4EY6A 1E2HA 4TKLA 3AERA 2XMDA 1N7IA 2CMHA 3JAKB 4HGQA 3U3MA 1OBOA 4YHHB 1NNEA 1VE1A 2CXHA 3KEMA 4BECA 3CUTA 3T3NA 1M2GA 4ARAA 3H9QA 4BV8A 1KIAA 2PLWA 4NRDA 3DF7A 2C5EA 2WLTA 4AQ7A 1IH8A 1JWBB 1ZNXA 3AEZA 4KVFA 4X90A 5HFAA 1HT2E 4IUYA 1BMQA 1YS9A 5L4NA 1X2BA 3F1KA 1C1DB 3ZCPA 4EUNA 2FSSA 4Z4FA 3GLGB 2C78A 3BL5A 4G8JA 1LBTA 5JO0A 3A6DA 4RO0A 1SJ9A 1V3TA 2LIPA 3HJNA 4NIMA 2NU7B 1EFPB 3UWKA 3VUEA 3ZGVA 2KW5A 1PNVA 3DMDA 1YE8A 2BCEA 2H51A 4MTCA 4K05A 3H5TA 5EHGA 3HJFA 2UV8A 2KMLA 3D9QX 3TIVA 4GMXA 5G2OA 1B0AA 3BMOB 3AHGA 1ESEA 2VQEB 3K92A 5G1OA 1FFDA 1XZEA 1RXUA 3K5WA 3UH1A 3W6UA 3MK31 4WADA 1KK0A 2XY4A 5EJ6A 1JQBA 1YZVA 4W9NC 2R7NA 4WASA 1HL3A 2DUNA 2B7LA 2GJ9A 2VTDA 3KL2A 2Q46A 1MQ9A 3WLFA 3WTCA 3ZC3A 1ESNA 2QVGA 1O2DA 1B1CA 5EMJA 2CN1A 2GNOA 5KJFA 3HBLA 3KJNA 5FOXA 2HIHA 1U28C 4U9HS 2GETA 4XM0A 1DC7A 1NW5A 2XDQB 5F76A 4OXYA 3U4DA 3WI7A 1GQYA 1XB2A 3HDQA 3LF1A 3MBIA 4N18A 5FO0A 4AUEA 1O5IA 2GOYA 5JCJD 3OZFA 3R1IA 3NUZA 5ER6A 4GI2A 4MA4A 1VHTA 5E9JA 1XTJA 2XCQA 5DW0A 3EGXA 2J9GA 3SOPA 4R05A 4FOTA 1ADFA 1P2FA 2AFRA 4W9NA 4ZQEA 1I2BA 3OCJA 3USZA 2P9JA 3ID6C 1TQDA 2BDUA 3OM9A 3A4TA 3DMGA 3EA5A 3HY4A 3N2IA 3PUWA 4A23A 4ZMBA 1FW6A 4OP1A 1E1QA 3P2KA 3P96A 4OQYA 4TRMA 3ZKWA 1U9ZA 3AFIA 1BE0A 1UPTA 3WKAA 1K4YA 5IMSA 1NXXA 2IUFA 4Z9AA 1UJNA 1YI1A 3GJYA 2SCUA 1E63A 1D2MA 2JANA 4H17A 1E9SA 2H29A 2ZSUA 4MW2A 5TMPA 3R7BA 1G17A 3A1WA 2VR1A 1FX1A 3RS7A 3ZCVA 1RQNA 2CL7X 2KJQA 4L5AA 3WB0A 2C2YA 2V7UA 4F5EA 2VC2B 3PFHA 4LMRA 1V5IA 1O97C 3A9WA 4CKZA 1GPBA 3DKRA 2OCIA 4TMYA 4P80A 4DA7A 3AG6A 1KJZA 5ADWA 2CMKA 3HYNA 3OHMA 5HYVA 3KZCA 2VAMA 3SC6A 1DO2A 3EXIB 1NVMB 1W4CA 5H83A 3NRJA 3L6DA 5IASA 1TM1E 3DT6A 2LXNA 3A2MA 3H6HA 5KCMA 3GGPA 1EVLA 2VP3A 4FSDA 3I45A 1Q0ZA 1KPHA 4C7OB 1U04A 2WM2A 4YRSA 4AUMA 2DFDA 4YQZA 1G9TA 1M1ZA 4OHXA 4E4TA 5HQTA 4MWDA 2AX4A 3UPDA 5BW5A 1GZSA 1M76A 3JQCA 1I4OA 1XDDA 3IPAA 5HKLA 5KREA 5KX5B 2Z9DA 1GKKA 1MHPA 2CUTA 2H1SA 5CYGA 3IMEA 2H5JA 3IIIA 2CBGA 3JARA 5E6SB 3ROKA 1YB1A 3UG6A 1IMOA 4X64B 4A1FA 4B4VA 4CMIA 1NN1A 4KAAA 2OZKA 1VOTA 4UTRA 1P61B 5I7UA 3SVLA 1O4VA 4QU0A 1V2HE 4XOIA 1JR6A 1NU8A 1ZU5A 4XWOA 2O5EA 2R8EA 3N87A 3LQKA 3GC6A 3TB6A 1ZR4A 3NIWA 2V5VA 3ZHTA 3D7RA 3WLTA 1UBKS 2M2IA 3QITA 1QO0A 3VNVA 2XF8A 3FWKA 1KR5A 2NYUA 1FBNA 1CXZA 4MV0A 3D81A 4IFIA 3UA4A 3PUVA 2ZDGA 1F2TB 3OZXA 1ZGBA 2D59A 2JB9A 1NJ5A 3K9HA 3UMYA 1UM8A 4CEIB 3EFHA 1SU8A 2ASVA 3EZLA 2A9OA 3FR8A 4O2RA 4UVHA 4EATA 5DX8A 4ZI7B 4ZVLA 2HSJA 2A5YB 4RJLA 4V0LA 5ALPA 2CZGA 3L3BA 3I0NA 3CEHA 2O54A 4JQSA 2HZBA 4RIEA 1ZM7A 5JD3A 2GLTA 3TXAA 2VYNA 3T1TA 1KI8A 1Y6ZA 4P4SB 1UJ6A 2QRHA 4ZAXA 1X70A 3UG7A 2RARA 3CZ4A 1VQ1A 4RAQA 3JVVA 4QRIA 3BIXA 1T4CB 5HBGA 3U44B 1YL5A 3PWKA 1D4OA 3BB1A 3PF8A 5EXSA 2WMDA 4Z4QA 5I47A 1Q19A 2P2LA 3V4FA 5KYWA 3TR6A 4DDUA 3D1JA 3B6JA 1RKBA 4XSVA 4RLFA 1IBMB 1TM5E 1KO7A 1UINA 2NTJA 2XMRA 4BPBA 4LV5B 1DU4A 3H2SA 1BA3A 1Y7LA 1KU6A 4GX0A 4KNVA 4HLDA 4ZU3A 3ANMA 3QNUA 2E0IA 4EJ2A 3PK0A 1RAFA 3CRZA 3LPMA 4K6CA 2VJBA 2VK8A 5DV9A 4DV5B 3ZLJA 4W6QA 4FNOA 5J2TB 1RDFA 4MEJA 1DQZA 4G4GA 2D1RA 4DCCA 3DVRX 4BLVA 1G1MA 2PRYA 1N3IA 4FDMA 4CN8A 3TUJC 1V1MA 3ZQ6A 1SWVA 3WYNA 1WSBA 3MUNA 4ZIRA 2QPAA 2MTBA 3KEFA 3AFMA 5I8WA 1DMSA 4I55B 4BC1A 4BC0A 1PLLA 1ZWKA 1LDNA 1K06A 2NTNA 2GZMA 3D4OA 3L7JA 5EVCA 1E3WA 2VJMB 3R3YA 1ZGJA 4RLSA 4YAIA 5ALIA 4EEKA 3REOA 1C5KA 1TJNA 3K16A 9MHTA 1HOTA 3FRHA 2A9PA 1W36C 2C3OA 3KQHA 1EFAA 2GK3A 3RVPA 5CEFA 1M72A 1D2CA 1J09A 3GPBA 3H04A 4ACBA 1KI6B 4FYIA 3THYB 1DS6A 2VPXA 3QWAA 5BN3B 5CDYA 1E4YA 1EGAA 3B52X 4H6WA 1IULA 4QGGA 3RVSA 5JTUA 5EUBA 1O03A 4JLDA 4M9XA 5DHFA 3BEDA 4EB3A 2GZ3A 2IZOA 3HL4A 4KQGA 5FADA 1DVRA 3AMVA 4D5GA 3SR4A 3W7AA 1TU0A 4FZ5A 4LQCA 3VJMA 4KDEA 1VI6A 4A0HA 4MKXA 2GWHA 4AWXA 1M67A 3HM9A 3HFGA 5I9TA 1T9DA 3GJZA 4J0QA 2P75A 2AQ8A 3D2CA 4NC9A 1BQ3A 3FPSA 3QE3A 3WL8A 1VPWA 2W83A 3PCRB 1MIOA 3UF0A 4BJ5A 5IAAA 3FOBA 3SVTA 4BLUA 2R48A 1YZTA 1E2KA 2WICA 2JLYA 5D2CA 1H9AA 1CUDA 4KZKA 4EA6A 3HHEA 5HS4A 3FPFA 4MKZA 5JANA 1XQYA 1IVSA 1TYDE 1VB5A 3FNBA 5K3SA 3U09A 2HU8A 2ZWIA 3E61A 3FFBA 4UTVA 1QFXA 2Z43A 1KZ4A 3Q5DA 1WZEA 3VR3A 5KWVA 1IN7A 3RGGA 3WHLA 2IXDA 1PLJA 2AR0A 1KMIY 1Q1BA 4MUFA 4BZPA 3R2JA 1FU4A 1HUQA 2PPVA 1Q7BA 3O8CA 4ZODA 2ODEA 1OFGA 3GJ6A 2RB4A 5EE1A 2BLNA 4CTNA 5IVKA 5I48A 4B3MB 2XTNA 3FE2A 2FUEA 3SX4A 5HIIA 3D6HA 4LBWA 5EMNA 4I3GA 5BYKA 3EISA 4OQFA 2V7WA 4YAKA 3P9QA 1NSYA 3I3OA 1D7AA 4RIIA 3USES 5F4BA 3RJZA 2MINA 5AHOA 3WS7A 2ZS7A 1CR2A 1HC7A 4ZU1X 1N5DA 3P5BA 3O8OA 2Q7XA 3CUYA 3FPJA 3I5MA 3G1TA 3MLBA 2BZSA 1XTBA 2V9CA 1XZAA 3PQ2A 3KWFA 2Q9BA 1MOZA 1VKRA 1G0NA 2A88A 3DWGA 3W5VA 5T6BA 1L5HA 4JYAB 4E2YA 1C1YA 1IOZA 1BMFD 1ISRA 3GRVA 3OF3A 2IU3A 2VDOB 4I0WB 1HSZA 2R6GA 1Q95A 4LSZA 4A0RA 3LTNC 5KTKA 2WKPA 3KSZO 2MCFA 4RK1A 2JGMA 3PR1A 1UBHS 2QVBA 2WWIA 4X94A 4ZMSA 7MDHA 2CUNA 1ZM2A 2YHIB 4PCUA 1H2RS 2D2FA 3AF5A 2VHJA 2IA5A 4BNTA 1CNEA 4KK3A 4WOBA 3U0VA 5KU1A 1NHGA 4GD3Q 3DYBA 5C4MA 4IDHA 5EC8A 2YHBA 2NXJA 2XYHA 3MWGA 4RZ3A 4YRFA 1B15A 4XDYA 4Q4AA 4MP3A 3C1TA 2YOFA 3W78A 5M04A 2AD1A 4ID9A 5BN4A 1T26A 3K1JA 2GARA 1BGWA 1CU1A 1WMDA 3O73A 4G07A 4D9EA 1R4AA 5I01A 1CQJB 4N0MA 5DGHA 4NWIA 1Z7YA 2AI1A 3O8BA 2V03A 5CPFA 2WWVD 2HO5A 3ROFA 2W2KA 5A06A 3FRJA 1GAWA 3KU4A 4JP3A 4EHNA 2OXFA 3BS4A 4REMA 2FI1A 3OX1A 4M87A 3I2JA 1PR5A 1A8HA 3ENVA 4OSEA 3RAGA 2ZG6A 3D6FA 4EF4A 2JKZA 4D02A 1T24A 1ZFNA 4FYJA 2C8KA 1X39A 1EH5A 5BNTA 1Z3IX 4XIYA 2O3RA 5CLIA 1BJRE 2Z5VA 2QG6A 3TZKA 5FOSA 2RHGB 4MVXA 5IH7A 1EWQA 2OYSA 3RS4A 3T5DA 4MVJA 1KVTA 3A10A 4WXMA 1MT3A 2CNDA 1N2OA 4D74A 1XJWA 3CE6A 2BMJA 3MTBA 4FJ1A 3THXA 1FLDA 3HV2A 4BNHA 1PKXA 4IGIA 3DO6A 5LOVB 4MAMA 3DDHA 3R5JA 3OM0A 3RFVA 4X93A 1W75A 1HLFA 3BN3A 3FVQA 1LJUA 1FRFS 4Y2RA 3R5HA 4DCSA 4YUVA 3CN7A 3STYA 4IILA 3OKFA 4DUGA 3QU2A 4D0RA 4GDMA 3RYIA 1XEWX 3U13A 5K5EA 2IQIA 1PK8A 1LA2A 2EIHA 2O2IA 4JUBA 2Y0PA 1LU9A 2BUCA 2NUTB 2DH6A 4X97A 2XNDD 1NTRA 1NI4B 2AYZA 5KUTA 4MLCA 4LKRA 5IWCA 3CEPB 3MINA 1E66A 3C3BA 3KHKA 4GSLA 4EHFA 1XZ8A 3AR5A 3D64A 4R16A 5EQTA 1RADA 3GLTA 2VFAA 3QVVA 3SIWA 5HZHA 1E98A 4N0EA 4BVBA 3D3QA 3OY7A 4CF6A 2W90A 2FTKE 2QP4A 1FPMA 1XZHA 2CFCA 4P34A 1NUTA 2AKYA 2XYQA 5JS7A 1P60A 1VMKA 4XR9A 4O3MA 3DCIA 4BLOA 4O5OA 3W4JA 3E70C 4M7WA 3NO4A 2C9MA 3QKUA 4AO8A 1FFBA 3GLSA 1XAJA 5BXYA 4FGWA 4HQ6A 4IDDA 4MW4A 4XSHA 2OHIA 3CNNA 4K2HA 4OQXA 1IYZA 1AJEA 4EY7A 5E0OA 3OQVA 1L4MA 3S2YA 1UJ5A 4KN5A 1VLMA 3H65A 3DM9B 3HP7A 4NX2A 5E9WA 2WB4A 2UXCB 2H4WA 4YAWA 1E3LA 3L6CA 2R7LA 5F9HA 3F7MA 4NAVA 4ZAFA 1FEZA 1THGA 1CIVA 4TZ0A 4Y1RB 1AGNA 3LNTA 4RKWA 1NW7A 4G0YA 1M8JA 3AY7A 3WLMA 2VQ3A 4DLAA 3SJCA 2FPPB 1D6NA 2ZTHA 1PL7A 1Q84A 3N2GA 4LJ6A 4NOLA 5DYYA 5JO9A 4OXIA 2F2TA 1J0AA 1RU3A 3CLTD 1SULA 2IKSA 4Q1DA 1NTOA 3N28A 2NU9A 1R4MB 3O9MA 2E85A 3GI1A 4M1OA 3C98A 2ZIVB 4Z5XA 2VI5A 2X5OA 2GPBA 4RVDA 5BP7A 1JIJA 1V37A 2Q0XA 4ZO4A 4A6PA 4YMUA 1P31A 1M6YA 5DJ5A 2J67A 2PFSA 4C89A 3BMNA 3DM5A 4MQ5A 4Q47A 2RGDA 1N1MA 5JAMA 1NVFA 3SLRA 1HDGO 4DIUA 5BURA 4LHXA 4QOIA 4JJ8A 4BWFB 3E58A 1QDEA 1DARA 1U7OA 3B1KA 2HHAA 3KOYA 4CLOA 1FJGB 3ZE6A 4EMTA 2UYGA 2OGUA 4P7JA 3VHXA 3WGUA 3IHKA 2R6AA 3COYA 3ZHBA 5JEEA 1O5TA 3HC7A 5CHEA 1JLMA 3DPUA 3PD7A 1YK0A 5C1IA 4CF3A 1OXVA 2FPGB 4IV8A 5BV8A 1U1CA 1ADJA 1QHXA 1QK5A 2FX2A 1K6XA 4JUDX 5K4AA 1WKCA 2J6CA 3FTFA 1VL0A 3KP1A 3ZDXB 1ZINA 4HLNA 1RPAA 1K2WA 1XDBA 3COWA 1W5TA 2HREA 2IODA 5JG7A 4Q18A 1JTEA 5TB5A 2EAUA 5K3FA 1XF1A 1EGMB 3KVVA 4KCGA 4PHTA 2HV9A 1O89A 4CM8A 2OD2A 4JJEA 4W1SA 1QFYA 3OX2A 1C1XB 3GUYA 3QZUA 1GG9A 3ESAA 4URZR 4DS3A 4EI8A 1M0EA 5AVRA 5FKJA 3PB3A 1C4WA 3CF0A 3RC3A 2GEDA 3OFND 1Q11A 2WSLA 3T4UA 4P8RA 4IVPA 1U7TA 4AG3A 4WX2B 4W5WA 3I53A 3HDVA 4GBMA 3ZQUA 4OY3A 1Y34E 3IDAA 5JAZA 2AEMA 4BVKA 4CW7A 1VL5A 2CK3D 5BVHA 2FOIA 4CKWA 1RXVA 1XRJA 4ZJUA 1FIUA 2PUCA 3DE7X 1U3DA 5EIAA 3W90A 4MEAA 3VMFA 2MYNA 3W2GA 1I5OA 1VMEA 3ND5A 3RCBA 3MJVA 3ACDA 3PHCA 1JXQA 3L1UA 1K8ZB 2OZLB 4H60A 4OI2A 4PCLA 4X6YA 5IS2A 2DQKA 2BRUA 5AVZA 4F4CA 1T8TA 1M6HA 1X87A 5DHTA 2O2HA 3L8GA 3NBMA 4F2PA 1SVIA 5A7GA 4EBBA 5DIZA 2NU6A 3N05A 3Q15C 5F1OA 4EKNB 4B8ZA 4EUSA 3EF0A 2X4LA 3AHIA 5TPZD 2OWEA 3FDZA 1LW7A 4JVLA 4Y1FA 1TA4A 2FUG6 2KS6A 4L07A 1MIHA 1HI9A 4WUVA 4R9RA 3TL3A 1RHKA 4ODIA 1TXGA 3ECSA 5EKTA 2MSNA 5G3YA 5TMEA 2XADA 3W5AA 2NSHA 2OHJA 2R5NA 4LJAA 2H1LA 3P52A 3ZK9A 4QD3A 1ST2A 3T9EA 2CXUA 2W2NA 2YUTA 1H85A 3NMUF 2W6CX 3IDOA 4B4OA 4KIGA 2QMOA 4RJJA 2IYYA 4LXHA 1PF7E 1THZA 4G24A 3R7FA 3BDVA 3HB5X 4CJXA 2WYOA 2ZRQA 1NYQA 3KV3O 2AF4C 3OE7D 3CF4G 4UQPA 4YK7A 2FWMX 1XCBA 4KBYA 2ZZMA 1B8OA 4P08A 4BJ6A 3LQQA 4BCDA 2WUDA 3D3KA 3IV6A 2QLMA 2M9MA 3R75A 2YFHA 4EL5A 3O31A 4ZQIA 1XQ6A 1RM0A 3SSOA 3T1YB 2F8SA 3MWEB 3GAAA 3RWOA 3WLOA 2MSEB 1UCFA 1YBAA 3D4NA 3G0IA 3KZ1E 4QPCA 3SP1A 3VM6A 3PDIA 4M7PA 2OP1A 4NV0A 5CA1B 8LDHA 5KJEA 2RJ3A 4KQFA 1IDOA 3HFSA 4D3ZA 1GN9A 4C0QC 1YBFA 4G9BA 5K8IA 4DTCA 1J2RA 2NUBA 2YXPX 1EK0A 1P4AA 3DEKA 4J1QA 3RQIA 1W1IA 5JUWA 2VP4A 2ZI3A 2J48A 3PDCA 5CK4A 2B3DA 3SZOA 1G5RA 2EJBA 3X1KA 5IKPA 3IHTA 1T34A 2V5AA 1QIKA 4MS1A 3S8MA 3AVTA 5A5VA 1G3UA 3G3EA 4BXOB 1SBNE 1Z45A 2WINI 4MNTA 2G70A 2LW7A 3I6QA 3SU8A 2VSXA 1FJHA 5U4QA 4X65B 3PKZA 1UADA 3IKJA 2HMAA 4ZQBA 1CB7A 2ZS8A 3NHKA 4GOND 1NRIA 1M2VB 5FPPA 3S1LA 2TMDA 3T54A 2FZLA 5DMHA 4DC9A 2MYUA 3THRA 3B9RA 4FKMA 5M2QA 3NWEA 3ZH2A 4LOHA 1ZX1A 1E6UA 3L40A 4IO1A 4Q4HA 3KZVA 1G98A 3UFXA 1T6YA 1EX6A 1HZJA 3FPKA 4MR9A 2P6RA 1JYSA 1JMVA 1XHFA 1XGKA 2BJHA 2H8GA 3QSGA 4QGAA 5DLYA 3HJBA 1B1AA 5AKLA 5JMTA 4URVR 2FSHA 2HXSA 4RA9A 2A0UA 4O4HA 1LLUA 3HWWA 3I23A 2JK0A 1CY2A 4ARIA 3QFCA 3LHIA 4JBGA 2I6GA 1UKBA 2XCSB 4K7JA 3IQXA 1GARA 2QGZA 3ZWVA 4ER7A 5ICGA 1QLJA 3ROMA 2EWVA 4Q3AA 1OZAA 2YHAA 4IH9A 5EINA 4HDRB 2MWMA 3ILVA 5DNYB 1H1LA 2ERXA 3TI7A 4JJ6A 2WTXA 3LCUA 4G0VA 1QX4A 2I62A 3Q87B 3AR4A 3EVDA 2GEKA 5TQ2B 3KC2A 5IDXA 5A3RA 4PLFA 5AW4A 5C4GB 4DR1B 1HA3A 1H2FA 3A1TA 4PFKA 1YS2X 4Z3KA 4CDGA 2IX3A 1TUEA 4HJXA 1NKSA 4MRVA 4S1WA 1KEVA 3EARA 2FN9A 3C8DA 3KLBA 4Y7CA 2H11A 3A1CA 3QP9A 4Y2TA 3IAS6 3USCS 1E20A 2CWDA 3EPHA 1RQ2A 2UZ1A 2PMBA 4BQOA 3J7AC 1NLYA 1SUFA 3BJIC 3O3NB 2Y1OA 3BSYA 4LS3A 5FOTA 2RGRA 3JQAA 3UCFA 4L0CA 1E3JA 4BB9A 1F06A 3CH7A 2EATA 2XPCA 4WACA 1U8XX 4ANFA