2PBLA

Crystal structure of a putative thioesterase (tm1040_2492) from silicibacter sp. tm1040 at 1.79 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
262
structure length
262
Chain Sequence
GMELDDAYANGAYIEGAADYPPRWAASAEDFRNSLQDRARLNLSYGEGDRHKFDLFLPEGTPVGLFVFVHGGYWMAFDKSSWSHLAVGALSKGWAVAMPSYELCPEVRISEITQQISQAVTAAAKEIDGPIVLAGHSAGGHLVARMLDPEVLPEAVGARIRNVVPISPLSDLRPLLRTSMNEKFKMDADAAIAESPVEMQNRYDAKVTVWVGGAERPAFLDQAIWLVEAWDADHVIAFEKHHFNVIEPLADPESDLVAVITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative thioesterase (YP_614486.1) from Silicibacter sp. TM1040 at 1.79 A resolution
rcsb
source organism Silicibacter sp.
molecule tags Hydrolase
molecule keywords Putative esterase/lipase/thioesterase
total genus 92
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pblA01
3AILA 1Q0ZA 1VE6A 5AI5A 5CRIA 2B9VA 4DSZA 1QONA 3FYUB 5AH0A 3WKCA 1CV2A 1ACJA 2HRQA 4BC1A 4NVRA 1YR2A 3I2HA 1X2BA 4DMHA 1UFOA 3FBWA 4Y2UA 3G9UA 1E3QA 5JD4A 5CBKA 2H1IA 2PKYX 4MYDA 1TCCA 2QXTA 1P0IA 5ALQA 5AK5A 2PUJA 3QBJA 4C88A 4H7HA 5JARA 4WFIA 4JH0A 1EX9A 5A7GA 5JYCA 1GKKA 1MTZA 2C5FA 3QMWA 1Q84A 4X90A 3DL7A 4PSCA 1CUVA 2XUGA 3HLKA 2JGIA 1SOMA 3D2AA 5BOVA 3F97A 1M33A 2YASA 3C43A 1XFDA 3T4UA 2JGJA 5AO9A 1YS1X 3WWDA 4MYSA 1U2EA 4X6YA 2WTMA 3D2CA 1ODTC 1R3DA 3NWOA 4FHZA 4B0OA 1XZEA 1UKCA 1YSCA 3VDXA 1PFQA 2OCGA 1FJ2A 4FMPA 1QO7A 4BTLA 4FBMA 3F98A 2H7CA 1R4ZA 2JEZA 3B12A 4B6GA 4K6HA 1ORWA 4UBJA 1EA5A 5HQ3A 5AK4A 5AM0A 1XQWA 5ALUA 5AJHA 5LKAA 1YB7A 4U2BA 1UOQA 2QRUA 4BZWA 3H18A 5JATA 3AZOA 1BCSA 4DM7A 4Z49A 1BS9A 3WK5A 1G5FA 3VVLA 2IITA 4W9RA 3GELA 3H2HA 1XZJA 2GBIA 5LIPA 1DTEA 4FTWA 4ARAA 1KEZA 4DNPA 4PW0A 4HRYA 2QJRA 5FPPA 2PSHA 2WM2A 1EK2A 2WTNA 2Z8XA 4QDUA 4LKOA 1XZCA 2DR0A 5E4TA 3YASA 5ALJA 1FFCA 3R3UA 3I2KA 2HA7A 1X70A 4ZXFA 4KE7A 2XUHA 3D7RA 1AMNA 3ESDA 1QFMA 2O7RA 1H2XA 2J3QA 2VAVA 4IH9A 3WA6A 3M81A 1XZGA 4GEGA 1A88A 3H04A 3RLIA 4WY5A 2J4FA 4HXGA 1YASA 4AZ0A 3C6BA 5FKJA 3QMVA 2VJAA 5DNVA 4OPMA 3FVRA 2VT6A 4J0IA 2B61A 2JGFA 4IH4A 5EFZA 4J0JA 5I8PA 2D0DA 1FSSA 1MO2A 4QWMA 1AGYA 5FP0A 4UUQA 1VJ5A 4QDZA 3BDIA 4E46A 4MWTA 3SX4A 3KD2A 5IVKA 2XMSA 1MU0A 4ETWA 4L72A 3AZPA 2ORYA 1ZI9A 3OURA 5K3FA 5HQ3B 3WJ1A 3DDUA 4GLBA 1XKTA 2E3JA 4QNNA 5IKXA 5HF5A 4UBNA 2DHDA 3S8YA 5CT4A 1ODCA 1P0PA 4KAJA 3GUUA 4OB7A 5JZSA 4AN1A 3PF9A 4FDMA 1BE0A 3OTQA 1AKNA 1USWA 2XMZA 2BGNA 5T4FA 1WCYA 4LYDA 1XLUA 2J4CA 4X85A 2I3DA 4XX1A 5EI5A 5ALWA 4UHBA 4WDRA 1J07A 2XDWA 5AKZA 1CFJA 2VEOA 1JMKC 2G5PA 3I1YA 2BKLA 2X5XA 4C4YA 3OM8A 4X7BA 4BAGA 1GPLA 3FCXA 2GZSA 5LZ5A 1EXWA 1K8QA 5CMLA 4UPDA 5EGNA 2OGSA 4KJXA 2Y2UA 4RGYA 1N8SA 2X8BA 5JAOA 1QJ4A 5C8VA 2RGUA 4C01A 4CFSA 1QIKA 4UHFA 2XLCA 3IUNA 3AZQA 1A7UA 2GBCA 1UWCA 2PPLA 1JJIA 3BIWA 2WQZA 4BE9A 3W05A 3K2IA 1N5RA 2HA0A 1XROA 1XRQA 3MUOA 1XRPA 2V98A 1GQSA 4K2AA 3E0XA 4UFNA 4GWLA 3STYA 2RAUA 5JIBA 3SK0A 4YK7A 5CT9A 2XMQA 5JAPA 3WKAA 1XQXA 2WHQA 3W9UA 4O08A 4Q82A 1CIJA 3VISA 3CCBA 3O4HA 2XQJA 2VSQA 3UMJA 1NU8A 4M0EA 4OB8A 4WCVA 1AZWA 1CR6A 1HPLA 4B85A 4OD0A 3DJYA 3R3YA 1XZLA 4KEAA 4G8CA 4J0DA 4LIPD 1YA4A 4K6KA 1H2WA 1LZKA 1ZICA 3JW8A 4H7IA 1MT3A 4G9GA 4CG2A 3MUNA 1SCQA 3DKKA 2AJDA 2O2GA 1K63A 5ALDA 2RONA 3C6ZA 4CIBA 1ETHA 5D3KA 5AKJA 3WK4A 4X00A 1IUOA 3H17A 1XZAA 1CUGA 4J7AA 4BYMA 1LPMA 3WKDA 5FUMA 3DL4A 3GZJA 5T4BA 3DLTA 5AHXA 3OOSA 5ESRA 2HA3A 4PSUA 5YASA 2VJDA 4Q3KA 4LXHA 3UUEA 4C6HA 3STVA 3IB3A 1W6RA 1E8MA 1GZ7A 1LGYA 5D7BA 2ZJFA 3ICVA 2WIFA 2GZRA 4FKBA 1CUHA 2C0QA 2AJLI 1U65A 5AKLA 2QMQA 3A70A 4AQDA 3H19A 4BB0A 4QDTA 4X97A 4C4ZA 2V97A 5FDFA 1E66A 1IVYA 1ODSA 1CEXA 4H77A 5SYMA 5LZ7A 2XUKA 1HKHA 5D3ZA 2IIVA 2ES4A 3HJUA 1YS2X 3MVEA 3H2IA 3G0BA 4AX4A 5FV4A 5DYYA 1CVLA 2XMRA 3WK6A 2XUAA 1UZAA 4Y2SA 2V9ZA 4UHDA 2D5LA 4AXBA 2WHPB 2DQZA 2VF2A 3DQZA 3I28A 3I6ZA 4H7FA 1BRTA 1ZD5A 2ZSHA 1ZIXA 3DOHA 4UBIA 1XZMA 4ZV7A 3G9ZA 1QLWA 1IZ7A 4X93A 5AKHA 4AZ3A 4FFVA 3F9CA 1IZ8A 3O95A 4I4CA 4DNFA 4Y9SA 1ZGCA 1EK1A 1Y7IA 4JYMA 4FFWA 1EHYA 2VT7A 4UHCA 4EY7A 5FOQA 1AURA 1UK9A 1CQWA 4X91A 3I2JA 3IUJA 1AUOA 1SC9A 2PBLA 4MQLA 4NS4A 3DOIA 1EVQA 5ALNA 1DX4A 2GBGA 4WJLA 2ONCA 3WL5A 4V2IA 3G9XA 3PE6A 4Y2JA 1JFRA 3KDAA 1JT2A 5FLKA 1MAAA 3DYVA 1VA5A 4QEKA 5CTAA 3ZV7A 4MEBA 2C5GA 3ZLTA 1QIGA 1ZD3A 1P0MA 3C5WP 2OQVA 4G4IA 2EDCA 3WZLA 3IURA 3LS2A 1LPNA 2QUAA 5ALOA 1QIHA 4YPVA 5AP9A 3AJAA 5I7UA 3GFFA 5D6OA 5ALYA 4EBBA 2QKYA 2WG2A 1CUAA 3STXA 4OSEA 3W04A 1SFRA 5JADA 3PICA 4K5QA 1HQDA 4DMFA 2ACEA 5FPQA 2XUJA 4EY5A 3PFCA 4EHBA 4BP8A 4HS9A 2OCLA 1L7AA 2WKWA 3RK4A 3WWCA 2CKMA 1JJBA 4Y2TA 5E4YA 1ZOIA 2HFKA 5K5EA 1VZ3A 1BN6A 2XMCA 2FUKA 4GECA 3LIPA 2HDWA 3M82A 3N2ZB 5AI8A 3RM3A 1WPXA 1CUZA 3PI6A 4OU5A 3W2TA 2OLEA 2HHAA 3C5VA 3F96A 1DWQA 5DTJA 3LLCA 4S0XA 5ALFA 1DQZA 3QPAA 1WPRA 5ALTA 2JIDA 3AIOA 3R3WA 5LZ9A 1UXOA 3AFIA 3ANSA 2XUFA 1CUJA 3G8YA 4XIIA 1L7QA 4ZREA 4HVTA 3WA7A 2XLBA 4U2GA 5CT5A 5CW2A 5AOCA 5AK6A 4BRZA 4Q3OA 3R3ZA 2X76A 3T52A 4TPKA 1E8DA 4UBLA 3DCNA 3I6YA 2O2IA 3FYUC 4W63A 3AUKA 4X95A 2PX6A 1EVEA 4DGQA 3OG9A 1K4YA 3VJKA 1U8EA 1EDDA 2WU3A 2QR5A 4MQMA 5JAHA 4HXEB 5DLPA 2QTBA 3C70A 2XMGA 5LYYA 4B80A 5SYNA 1AC5A 3O4JA 3KWFA 1SCIA 3C45A 3ICWA 2O7VA 2BGRA 5DWDA 1A8UA 5J3JA 3O4IA 2H7YA 1BN7A 2YYSA 5K3AA 5EHQA 1E8NA 3KOOA 3TRDA 5CXXA 4N8DA 2PL5A 3WK7A 2OAEA 1HLGA 4GXNA 1GPNA 2PU5A 3VKFA 5DNWA 1LNSA 1H2YA 2DCMA 4FWBA 2WILA 1QIFA 1NU6A 3F8SA 1J1IA 5CH8A 4WFJA 2HRRA 2XQIA 1LPSA 4N8EA 5HFNA 3GROA 3GA7A 5C81A 1KU6A 4Y7DA 1XZFA 7YASA 1THGA 4B0PA 3ZWQA 1THTA 3F67A 4FOLA 3K9BA 4KRYA 1J06A 3R3XA 2I78A 1B6GA 5A2GA 4QLAA 1QGED 4DTCA 4UBKA 3O0DA 4M0FA 4RPCA 3EQ7A 4EA6A 3H2JA 4E14A 4K6GA 4U2FA 4D9JA 5AKYA 1MN6A 4Q1VA 5ISMA 1ZJ5A 1H2ZA 2XE4A 4CCWA 5ALVA 4UBMA 3IULA 5AOBA 4Y2PA 5LZ4A 4RE6A 5ALIA 3QH4A 3JWEA 1TCAA 1MJ5A 1EB9A 2EDAA 3VVMA 3S2ZA 2VTVA 3RARA 2HL6A 3D59A 1D07A 2WJ6A 4H7KA 2VA9A 3R0VA 4IH1A 4HAIA 5JALA 1JU4A 4Y2QA 5AICA 4C87A 5ALGA 5BWCA 1QTIA 2YH2A 3HABA 1ACLA 3O9MA 2AJBA 3CCCA 2ZYSA 1UK7A 1Z68A 2HU7A 3L1JA 3LIIA 2WUEA 5A7HA 1XLVA 5AKGA 3I2GA 3KXPA 1BROA 4LXGA 3HI4A 5IVHA 1ZI6A 3WWEA 2WG0A 4BP9A 3Q0TA 4F21A 5JZBA 4DIUA 4B81A 3WLAA 5ALRA 2XUQA 2ZSIA 4ZWNA 3ZI7A 3IBTA 4OUKX 1TK3A 3D0KA 1UT6A 3SC2A 1JI3A 2CB9A 3STTA 3BF7A 3BJMA 4B82A 3O4GA 1YAHA 2GYWA 3N0TA 4EY4A 1MX5A 5C8ZA 1MX1A 4YX9A 4WY8A 4U2EA 4A23A 2HADA 3WWOA 5HF8A 1OILA 1MNAA 3WQHA 4UHEA 4BVJA 2OQIA 5JANA 5AK3A 5AKXA 2G63A 2XMDA 4G8DA 5DJ5A 3FYUA 3I2FA 3V1MA 2XUDA 4L9AA 3PUHA 3C8DA 3E1GA 4J3JA 3A6ZA 4QA9A 1CUXA 2K2QB 4WFKA 2Z5GA 1LPOA 1MX9A 3H1BA 5AOAA 2WIDA 4Q34A 1CUYA 4N5IX 2NW6A 4QWWA 4B7ZA 4ARBA 1UOOA 4GHWA 5HKBA 3G7NA 4BCCA 2GYVA 4LYEA 5LZ2A 4G9EA 4G4JA 2XUPA 2OGTA 1YAJA 5AI9A 1VLQA 1ZI8A 1F0NA 4P9NA 3WYDA 2PU7A 3FNBA 3DNMA 3B3QA 4BBZA 2Z3ZA 5AI4A 3WKBA 1CUFA 3FLEA 4HXFB 4KAFA 5HFAA 2Y2VA 1DWPA 3WL6A 3BE8A 1C7IA 1VXRA 4KRXA 2YXPX 4Y2YA 1DU4A 2Z3WA 4MWSA 4BRSA 1CUUA 4X92A 2VQ6A 3TJMA 4BAUA 1L7RA 1AQLA 4FNGA 4HRXA 4AO8A 2HU5A 1WOMA 6YASA 4B83A 1VXOA 2FX5A 2BFNA 5CT8A 3HSSA 1TCBA 4KR0A 1CLEA 1GT6A 1AX9A 1W76A 4NZZA 3G0DA 3D2BA 4HZGA 3EBLA 4MXDA 2XQFA 1FFDA 4DMCA 1U4NA 3HXKA 4AMYA 1ZD4A 3IDAA 3L1HA 2WFLA 2QJWA 4MJ3A 1QIDA 3G0GA 2HA5A 4H7EA 1DT5A 4PNZA 3WYNA 2H9YA 3ILSA 4EUSA 3FYTA 1FFEA 1YCDA 1JMYA 3AIMA 1EI9A 1QIEA 2FJPA 3OC0A 2AXEA 4B9EA 1RWQA 2PSDA 4FLEA 3ZLVA 2CMFA 1O6FA 1ZGBA 3ESCA 4A5SA 5JD5A 5ALXA 4ZI5A 1CRLA 2BCEA 1F0PA 4H0CA 5LLSA 1EB8A 5HK9A 4RE5A 2IX9A 5CH3A 3UUFA 4CI9A 3HC7A 3LCRA 3V1LA 4X6UA 1JJFA 4BAZA 5AI6A 1DT3A 2QUBA 4ZRDA 3V48A 5JD6A 5BWBA 5H3HA 4J03A 5DYWA 1RP1A 5JASA 3FLBA 2XQGA 2DHEA 5EIHA 3HZOA 2RI6A 2UZ0A 2HA2A 4YASA 1DX6A 2J3DA 4IO0A 3IVMA 3SWWA 5A6VA 5AKIA 2ZVDA 1TAHA 2P8SA 1CUCA 2Y6UA 1LPPA 1LZLA 1YB6A 3EQ9A 4XWGA 4GI1A 4AO6A 3DD5A 5IH7A 4OB6A 3NUZA 1LLFA 3QPDA 3A2LA 4EY6A 5LP1A 3E4DA 1N5MA 3WL8A 5A71A 3FCYA 4X3CA 4JEIA 5DNUA 1E5TA 1QZ3A 3ED1A 2VJBA 4OCZA 3ZPXA 1XLWA 4I3FA 2AJ8A 2O2HA 4J0CA 2R8BA 1TIBA 2G4LA 4JYPA 4UFPA 3C6YA 4BTVA 1QTRA 2CUTA 1RYYA 5HZGA 1GQRA 1XRLA 5KBYA 2RHTA 3H1AA 2PSEA 3QMMA 3U1TA 1H22A 1C7JA 5AKKA 3EQ8A 4BATA 2BAGA 4P08A 5ALSA 3I1IA 1K6EA 2Y1KA 2WUFA 1GPKA 5HCUA 4RNCA 4J0HA 3G0CA 3STWA 5EIAA 1WB4A 4TVKA 4L3WA 4FBLA 3M83A 4Y2VA 1QFSA 4CG3A 2QS9A 2WFMA 3VXKA 5AIBA 2WJ4A 5LKRA 3OPMA 5AM2A 1UK8A 3D5EA 2BJHA 2WG1A 2V96A 2DFPA 4M0MA 1VA4A 3DYIA 4EZIA 1GXSA 1FFBA 3PDCA 2Y6VA 1G4HA 2CBGA 5EHZA 1Q0RA 5E4JA 3U0VA 5HF6A 3X3HA 3ESAA 3MGAA 2ECFA 1XQVA 2W6CX 1CUBA 1N1MA 1BEZA 3TEJA 4FLMA 5JZ9A 4AO7A 2WFLB 2HM7A 2QM0A 4W1SA 1VKHA 2WLSA 4N5HX 3H2KA 2XQKA 4BZZA 1DINA 4QLOA 4U2CA 2FJ0A 5AM5A 1MPXA 4U2DA 3D4LA 4NMWA 3WK8A 1BCRA 4OU4A 2WHPA 3STUA 5T4HA 4EB0A 2ZYRA 3WZMA 2XUOA 4W1QA 2I03A 3R41A 2RIPA 5ALEA 1UKBA 2HU8A 1VZ2A 1WB5A 2HFJA 4H18A 5A62A 4X6XA 1J2EA 4HTAA 3VJLA 3QVMA 2PSFA 1ZJ4A 3M3DA 2VATA 3H0CA 1CQZA 4UBOA 2JF0A 2BUAA 5F4ZA 3AIKA 2PVSA 2LIPA 3WJ2A 1UKAA 3CXUA 2OPHA 3QYJA 4AMZA 1QIMA 2XI4A 3B5EA 4UHHA 1ISPA 1LPBB 2C7BA 3ESBA 1H23A 2QZPA 3E3AA 2DSNA 2VJCA 3EF3A 2OG1A 4G5XA 3ANTA 3I2IA 5CXUA 4QDXA 2ZJ6A 2QVBA 1ZIYA 4ROTA 4P92A 4C4XA 2XB6A 1O6GA 1LBSA 1TKRA 5ALKA 2QT9A 3FLAA 4KACA 3FOBA 4OYLA 4F0JA 1I6WA 2OAGA 1TRHA 3DS8A 2EEPA 3W9BA 2GBFA 2WIGA 2ROQA 2DHCA 2GYUA 1E89A 2JGMA 2HA4A 2JBWA 2R11A 3IUQA 2OCKA 1XRNA 1JKMA 1EDEA 4I19A 4KYVA 2OXEA 1GKLA 2JGKA 1XZKA 5AM4A 4ZGBA 3BJRA 3BF8A 3NGMA 2CZQA 3NOXA 1XZDA 2QOEA 3G0IA 4DYHA 2ZYHA 1G42A 2CEKA 2BUBA 5KWJA 4INZA 1HBJA 2WUGA 1XZHA 2HA6A 4BCDA 3BIXA 4ZV9A 2WUDA 5K3DA 4F5ZA 3G9TA 5JAUA 2JEYA 1LBTA 2WJ3A 3FVTA 5C8XA 4KAAA 2I3ZA 5E2IA 5KREA 5EHXA 1XRMA 2WFZA 3PF8A 1VE7A 4MEAA 1YA8A 5AI0A 3FSGA 1R1DA 2PUHA 4PV7A 3PFBA 1OXMA 1F6WA 1QIJA 3V1NA 1UK6A 4PSDA 5KWIA 5LZ8A 1XQYA 2QXUA 5I9IA 5FRDA 5AM3A 3QM1A 3BL8A 5CURA 3BXPA 4KE6A 5ALHA 4DNQA 1BU8A 3HEAA 4G1FA 1JU3A 3C6XA 5IVDA 3V1KA 1CUIA 1XRRA 3R40A 2ACKA 5K3CA 4BE4A 4WDQA 2C4HA 4J0KA 4X94A 1Q83A 1W1IA 4CCYB 3G02A 2B20A 4H7DA 4JUIA 4TGLA 4EY8A 1X2EA 1WHSA 1GGVA 1XZIA 5IVIA 2XUIA 2WIKA 4AN0A 3FWHA 1HL7A 4DMKA 4N8SA 4KE9A 5K3BA 2W22A 4W1RA 1R88A 4X71A 3W06A 1R9MA 1OCEA 4BVKA 3QITA 3L1IA 4J0GA 3CN9A 3P2MA 3EIOA 3WIBA 4FNMA 1EH5A 4IQ4A 5ALPA 3LP5A 4BCBA 1VOTA 1WM1A 3KWJA 3V9AA 1EINA 4CIAA 4PQEA 1F8UA 3IUMA 1CPYA 1MAHA 4XVCA 5K3FB 1W52X 4DSAA 4B9AA 4LHEA 3PUIA 3FAKA 3WWPA 1P0QA 1HDEA 3R3VA 3C87A 1NX9A 2WHRA 1XKLA 4GDMA 1PJAA 3QPCA 2G5TA 1KU0A 5T4EA 2OGZA 4ITVA 3RKSA 5AKEA 3HACA 2RHWA 4AB1A 3WKEA 4W1PA 2XT0A 5A7FA 1UOPA 4L0CA 3A2MA 5BV7A 2AJCA 1Y37A 4PF1A 1FFAA 2DQYA 3WMRA 5K3EA 3DKRA 2ZYIA 2ZJ7A 1ZD2P 5ALMA 4G4GA 1IUPA 4XJVA 1A8SA 5FXMA 4LXIA 4C89A 1ORVA 5EHNA 1R9NA 4GW3A 4QDOA 3GBSA 3HYSA 4Q05A 3TGLA 2WSLA 1WHTA 4JNCA 1WB6A 4G8BA 4UFOA 3WIOA 4A16A 1K5PA 1A8QA 5ALLA 5HKAA 4FLFA 3H2GA 2C58A 4QE3A 2XMBA 2Z8ZA 1G66A 3BDVA 1CUSA 2PSJA 3CN7A 2Q0XA 2WIJA 4QZVA 1PV1A 1W75A 2B4KA 5HK8A 1BEEA 1CUEA 5DYTA 4DNOA 3ZLUA 5AIAA 2VAXA 3IA2A 3A2NA 1IUNA 3C8HA 1S8OA 1R50A 4OYYA 4IHAA 4Y2XA 5CH5A 1C4XA 2H7XA 3AINA 2BUCA 3QZUA 1LPAB 1W4LA 4BVLA 3WL7A 4BC0A 5DTIA 2JGLA 3I6MA 1QOZA 1DWOA 2HIHA 4KE8A 5C7YA 2CJPA 4H7JA 3JYHA 3D3NA 3BWXA 3HRHA 4E11A 4CG1A 4E15A 1MNQA 3WK9A 1DQYA 4H35A 1TQHA 2WU4A 1CUWA 3VJMA 1QO9A 1Y7HA 1B41A 1XZBA 4Q3LA 4BDTA 2OCIA 4CCYA 3WI7A 1CUDA 3KSRA 5HF9A 4F60A 4P93A 3O9VA 3Q8WA 2JGEA 5CT6A 5AM1A 5EIEA 3FSGD 4GBGA 4BDSA 3K6KA 1EDBA 3IIIA 5ALZA 4Y2RA 1QE3A 1IMJA 1QIIA 1SCKA 2C0PA 4DLNA 4B84A 1T4MA 2PM8A 3DEAA 4PO3X 1T2NA
chains in the Genus database with same CATH superfamily
3F5QA 1M1YB 1ULAA 5ECYA 5F1KA 4CIVA 2MIIA 1XZQA 3TK1A 1VE6A 2FMIA 3H2ZA 3ZE7A 3HCDA 1TD1A 1Z0DA 2B9VA 3GG2A 4CN9A 1ZKMA 3A31A 5BY2A 2FP4A 1OWMA 1Q16A 3OKCA 4F3KA 2JFNA 3MAGA 4BVBA 1PJCA 2B37A 4JODA 1CV2A 2X13A 3UXEA 2CGEA 1Z0JA 3HGMA 3IQGX 3ENVA 4R9VA 1Z08A 2HRQA 1SKQA 3FD8A 4KOEC 3RUIA 1YR2A 1W49A 4KPYA 1X2BA 5FNVA 3OLWA 3T3DA 2Q3DA 3A6LA 3LUJA 2L18A 4F85A 3CPEA 1T9CA 1GU1A 2COEA 2X1VA 4FZ3A 2GD1O 1J99A 1NBIA 1T4DA 2BFWA 2FKAA 3CNOA 3LFTA 4FI3F 4BVGA 1EGHA 3NVKI 4TS1A 3H5WA 3A9RA 2BHSA 4N0QA 5EQTA 2OCAA 4UTNA 3ECSA 3FYDA 1GSIA 3CEPB 3WAGA 2ID9A 4QPJC 2WC1A 4N0EA 5KX5B 2ZVPX 5JD4A 4JP5A 5J40A 1N2EA 2HF2A 2I33A 2IXAA 2F6RA 3DGFC 3OLXA 4BO0A 1L4NA 2H1IA 4MYDA 2VR1A 5KCMA 5LBTA 1RWXA 2P9GA 4JBYA 3L7AA 1OTHA 1N6KA 1P0IA 2C98A 4YCAA 5CEJA 3L01A 5E7JA 5AK5A 1SXJA 4GI7A 4NU0A 4PRZA 2IKSA 1SXJD 3NNSA 1KYVA 2ZUCA 4Q1CA 3G8BA 3GLUA 5H81A 4EH1A 4GIBA 4QHYA 4XCQA 1GZVA 2PMDA 2H51A 1E32A 4YT2A 4WFIA 5JVDF 3CLUD 1ZOPA 3DLCA 5A7GA 4MK4A 4CUZA 1EUYA 5TVGA 3ZH2A 3OZIA 1PP4A 5LQRA 3HYCA 2GF0A 3UMRA 5C4IA 2EG5A 3MTDA 1FPQA 4LDQA 1T9DA 3V80A 1G20E 4R9RA 3GIWA 4CM6A 5BN4A 1I01A 3VGJA 2WWWA 1G2IA 2ZBVA 3K0SA 1NDQA 4M7PA 4MZDA 3IKTA 4IEIA 3G1UA 1FB5A 2N1MA 3RBZA 3UJBA 2GYYA 4R4JA 4FX2A 4RABA 1C9DB 2XWJI 2W8BA 2YASA 5CNJA 3DM9B 1EK5A 5HTOA 4EYEA 1ZYUA 1NJFA 4Q4HB 1L4HA 4XE5A 4DA7A 3QU2A 4EITA 5C2JB 2H85A 2ID7A 3VH1A 4RPIA 1J20A 3FPGA 3JV7A 4PTLA 5AO9A 4AULA 5I9LA 3FFWA 1RYBA 5TMEA 4BQIA 1DS6A 3MTEA 4Z53A 3NHPA 3W5JA 1ODTC 5AMXA 4FMCB 3LQ2A 3VH2A 1OA0A 1GTJ1 3W9YA 2I4IA 3LUAA 3F3KA 4B0OA 2BEUB 3VKGA 2HD4A 3I1FA 1XDDA 4B4OA 2ILVA 3MMNA 5DGXA 3LT4A 4ZVKA 4FMPA 2DWQA 1QO7A 3SQOA 1W48A 1WY7A 3SKXA 2VCHA 3LBYA 2NO7A 4LYHA 2CFSA 2R6FA 2JHGA 1C7QA 1O77A 4HAVA 2CFIA 1HORA 1F0KA 4Q3BA 1NUSA 4AJ2A 4CMEA 4EENA 3L8MA 2X4IA 3CKMA 1R4ZA 2AG1A 1FOEB 2PRYA 2JGNA 3TAHA 3CLVA 3AB7A 2HK6A 1DC8A 1MVNA 1FYVA 1I7NA 1ECGA 1KJQA 1BWRA 3M2PA 3PI7A 4LYFA 1KJ9A 2GRJA 3H9CA 3FR7A 4OHOA 1IHDA 5HIAA 2ZI4A 1G20B 3K9WA 4UUPA 5HQ3A 4BN0A 5AK4A 4D57A 4D45A 4W7SA 1XDBA 2Q46A 1XQWA 5CA1A 1E1KA 4DBLC 4IFTA 3LCUA 1ESMA 3PX7A 4YUXA 4U2BA 3AOEC 2XGOA 1Q7EA 1UOQA 2QRUA 1K7EB 3BCHA 4I8DA 4R9UC 3VDMA 4BMYA 2XB2A 5AJUA 2B94A 2YQ5A 4KZPA 1B73A 4CT4B 1HY3A 2IHYA 1RCFA 3P9RA 5EKUA 3HWX1 4YRRA 1RLOA 1SUBA 2CSUA 3AZOA 4ZO6A 2REQB 4IDDA 4PZDA 2QT1A 2B8NA 3L07A 4RAQA 4U7WA 6REQA 1BS9A 3OFJA 3HY4A 4JI5B 3CVYA 2LKDA 1TUBA 2R5FA 3JYLA 4KMSA 5L7WA 2MCFA 4DJJA 2O8FB 1EWQA 5K8CA 1TQ8A 4LZNA 3DWGA 4AMGA 1IHYA 2GBIA 1YNOA 4WN3A 1R6XA 2VWPA 4FFLA 1U99A 4ARAA 4BO9A 4F9FA 3RU7A 3H7IA 3ES9A 3G3EA 1IJBA 4PW0A 2FPOA 4XDHA 5BSVA 1IOZA 3ANLA 2XADA 1OXTA 2DH6A 2PKRA 3JYQA 2IZ7A 2GTHA 4KL8S 4MNTA 2W4IA 4PCVA 5EWMB 5G1NA 2CXUA 1J8YF 3HP7A 1U2SA 5HTKA 5AVUA 1EK2A 4FQ5A 3VR6D 5GZ1A 3MJFA 2FPLA 4OHWA 4YP7A 1I1OA 3FBGA 3O82A 1X86B 1XJ0A 1FCJA 3WLSA 3OZEA 1LSUA 3ZYZA 1MH9A 2V4ZA 4LZAA 3A6HA 3IIEA 3U13A 3T3MB 1SUDA 3PEFA 4DUYB 2GCEA 5TC4A 4TMYA 2EZ4A 4QLBA 2YTZA 2QSZA 1RP7A 3SXUA 4RA6A 1T4CA 2CXQA 3FTCA 3I2KA 2ZTUA 5JZVA 4ZXFA 3IQDB 5B2EA 3CF4A 2WE7A 4K6FA 2FRVA 3D7RA 3KSAC 2PLWA 2DUMA 1NUTA 4N5DA 3NVDA 2VJQA 1GZUA 1DAHA 1T4CB 2J3QA 3E4CA 2VAVA 1NV9A 4OUDB 1BVUA 3OVMA 3L92A 4UPVA 3UJ9A 3KQNA 3M81A 4YUWA 5KUTA 4MZXA 4DUZB 3U4QA 1CJCA 1L0BA 1OLSA 3IJPA 3PS9A 4M7OA 3DXXA 3PKIA 1WUIS 4DW8A 2YZ2A 1P3Y1 3RBVA 1TUIA 3GP8A 2J4FA 3QOYA 4DIMA 1YASA 3CR8A 4AZ0A 4CQJA 3C6BA 3I5MA 2IP2A 1L4YA 2PT9A 3P2KA 2NG1A 2VJAA 3EISA 3LVFO 1QCCA 4TUYA 4UAUA 4XVHA 5A9SB 5DGCA 5B5SA 4H1WA 2GEDA 2UYOA 3E1SA 4PLHA 3IRVA 3A2KA 3AEZA 1GGEA 1W88B 3K5WA 3OCUA 4PGGA 3AHIA 4Q7MB 2IIPA 1A69A 1M2GA 1DLJA 4ER5A 4IH4A 4I55A 4IDPA 4M7WA 5EFZA 1YR6A 1P8JA 1J22A 1U6JA 1GWNA 3JR3A 4KQMA 4QM6A 1Z39A 1MO2A 1AGYA 2Z2JA 2AA3A 2YC4C 5H9WA 3BFVA 3OP4A 2ZRKA 1XI2A 1TL7C 3OAAA 2HF7A 5TSDA 4GZ5A 3CR7A 2WA2A 4KWEA 2WZCA 3BCRA 3KWLA 4RVGA 1JZTA 4C1BA 1GNPA 4KITB 1OIVA 1E1QD 2P9FA 5DM70 1AM4D 2EHDA 5JAZA 3BDAA 3AV3A 4RACA 1UBFA 4EA7A 1E4EB 2BCJQ 1O3YA 5C5EA 2J41A 3V5NA 1NI4A 4L72A 1AVTA 2ATCA 2QSJA 1RZUA 3RJTA 1JTEA 3VU8A 1ST2A 3HZRA 4PZEA 3PYXA 5DHAA 4N82A 4IPTA 3LPNA 2C2GA 4DG9A 1NW4A 1D6MA 1XDZA 2D62A 2FVYA 2R2GA 3ROQA 3WJ1A 1QKJA 4GLBA 5KOYA 4RIGA 2GF9A 4WXPA 4ZVNA 2W00A 3T3IA 1ZITA 4IEFB 3OFNA 4B4VA 4RO0A 4F2GA 1YU6A 1P0PA 2JBAB 3ESQA 4MPDA 1J1UA 1P1CA 2W11A 4AN1A 3PF9A 3WLMA 2J7PA 1T8TA 3DE7X 2B4TO 4E5VA 3O8CA 1PQUA 3R7NA 2DOKA 3A9UA 3AWDA 2XMZA 1U3VA 3INNA 3RIYA 4B7CA 4DDHA 1S2DA 3UQZA 4C4TA 1DKQA 3DAFA 2J46A 2QNBA 1V7CA 1VKJA 2QTAA 4C2AA 1QVAA 1PZNA 1W2GA 2QL5A 5CEEA 5LMZA 4RJIA 4XX1A 5EI5A 2OHJA 2G06A 2GOYA 2ZB4A 1E6CA 2C7VA 1IY1A 1JIJA 2HSEA 2IU3A 2XDWA 4G1UC 4HB4A 1YS6A 1K68A 2HPHA 2AOTB 2Z1MA 2VYFA 3HXMA 4NAUA 3C3YA 3NTQA 5BWMA 3IAM1 1DJLA 2G5PA 2QHXA 3I1YA 4Z7NB 3FMPB 4JDUA 4EYKA 4EO9A 2AFRA 3RFXA 3PD0A 4K3VA 3PBKA 1QC5A 4FJ0A 1PZEA 3OM8A 4DA6A 3V7NA 1WHSB 3IOCA 4B31A 2CDBA 3AEKB 3AUJB 5JI3E 3QWIA 4RGBA 4N47A 1G8PA 2Y92A 1Q2XA 4HFMA 2IH4A 1PTKA 1MA0A 3O31A 5ICFA 3AQIA 3H5LA 3K8QA 2V54A 2O8CB 4BXOB 1OW3B 3I04A 3KJIA 4IXTA 4MP8A 1SZDA 3P0HA 1UXHA 4JCCA 4KJXA 2NZVG 3NVAA 3ZGNA 4AJEA 4EJSB 3AU8A 1BNCA 5JAOA 2OBLA 1QJ4A 3IJRA 1GCUA 1DOAA 1MABB 4KQGA 3SSOA 2DPMA 2IS1A 3BEOA 2BL4A 5F2KA 2WI8A 4WA7A 2NWQA 2ODNA 4D3YA 2MYTA 4XKJA 1L4EA 1ZM9A 1TA9A 3C6KA 3EH2A 3VNSA 2EKQA 4CLRA 3IHLA 4JP3A 4EKNB 5HGXA 4S04A 1R0BA 3HV2A 4NBKA 5JH7B 1GHTA 4MR9B 1TMGE 3HDQA 2CLLB 1BH6A 4IM7A 2GH1A 1P8AA 4DDMA 3AZQA 3L77A 4DLLA 1YCHA 2VG8A 1RMYA 2PPLA 1JJIA 1YJ5A 3BIWA 3EC7A 2YIMA 3H5IA 4W5QA 2FZCA 1XLTC 4FSHA 2PD4A 1EQUA 1OC4A 2CDAA 3ESYA 5DGIA 1CWUA 3UUWA 4EDHA 9MHTA 4TM8A 4B17A 4YYZA 4B32A 2O06A 2BF4A 3DZCA 2QG6A 3C98A 2CMKA 3IDOA 3TTTA 3WGQA 1C7EA 2P3QA 1X92A 5JO0A 3VZDA 3RIEA 4X8LA 4KN6A 4D0GA 1V6AA 1Z45A 4UFNA 4A6PA 1W4RA 1UBKS 3E1KA 3ELUA 3Q7IA 4JT4A 4DPLA 2O5CA 1HF3A 1BJRE 1RLMA 1JX6A 3U44A 3J7AC 5JSZB 3SK0A 3OIYA 4ER3A 3GPLA 1QHGA 3C3DA 5FNVB 3ON5A 4JVMA 4CLHA 5JAPA 4Z0TA 2YFHA 1MAVA 4DY4A 3THSA 1XNRB 2R7LA 4BFUA 3QWHA 1TC1A 3QU5A 2DFKB 1KKUA 3IYLW 4Q82A 1JXQA 3N70A 4ND8A 3VISA 3UYLA 1T0BA 4HFNA 1MPTA 4EELA 1I94B 2ZZKA 4GPBA 1GPWB 4EPRA 2P2SA 4NWIA 2ZCUA 1DDOA 4G3XA 3UMJA 1J2UA 1NU8A 4A2PA 1AO0A 2H06A 5KOHA 1CR6A 1A27A 1B0ZA 2ZWVA 3ZS9A 2VOJA 1U9IC 2CLCX 1NT4A 3FNGA 2ZWPA 4URFA 4FSXA 3DJYA 2AMLA 1CR0A 1ZM3A 4L1KA 1Y9ZA 2R8RA 1QK5A 3OAAD 1XCGB 1O95D 4CM7A 1M2OB 1P2BA 4J0DA 4RX1A 1YA4A 1L7DA 4K6KA 5DTMA 4CJXA 2Y0DA 1MJHA 1ISHA 4C20A 3R5TA 1AZSC 1WKCA 1VC2A 4IOJA 3L2OB 3JW8A 1YZHA 1J9EA 3QPVA 4GVPA 4D8WA 4A6EA 1Q3KA 5DBEX 1P6XA 2BDUA 2OENG 5EIOA 3RNLA 3V3TA 4Z3KA 4TVBA 5LQMA 3TN7A 2G04A 2CK3A 3FKSA 5IT4A 1T2CA 2O2CA 4CCAA 3GLSA 3MUNA 3MM4A 4LISA 3OEHA 2EL9A 3PNOA 2IPOA 2BI7A 2Q0HA 4KK3A 2AJDA 1V9LA 1K63A 2Q5CA 5EPEA 3UOWA 2WJZB 5ALDA 2RONA 3EG9B 1X7XB 4PVCA 1ETHA 1JGTA 4I99A 2YJ4A 4AUEA 4CIBA 3IAXA 1XF1A 3HGTA 2E4UA 2NZ2A 3WK4A 3F3MA 4KMRA 4Z8XA 5KJ6A 4OATA 4GMFA 3X1XA 1YQXA 1IUOA 3L0IB 3KBBA 3NAGA 3PPIA 1QOPB 3UWSA 5C1OA 2PS9A 1QUFA 1ZUIA 1JVBA 1TF5A 2WF7A 2Z5FA 3L4BC 3AUXA 1M2KA 1JEQA 3PGJA 5FLEX 3OX2A 4CDMA 2NSYA 4EL5A 1G0OA 3H97A 3DLTA 3MMZA 4ENVA 3I62A 1UEIA 5AHXA 1R4NA 2C4VA 1TRKA 2EIHA 1Q91A 3EA0A 3OOSA 4JEHA 2AN1A 1QTNA 4S35A 1G60A 3G2PA 2VJDA 2QVXX 2OO3A 4PLTA 5A4JA 1SOWA 3CZQA 3EH1A 2E5WA 1JQDA 4JXZA 1FXWA 1ZOOA 2H5IA 4C6HA 4BFWA 3QTBA 3T1VA 2C7PA 3IB3A 2AF3C 1DEXA 1LQUA 5CA1F 2WJGA 1GZ7A 2Q3LA 3VZBA 5D7BA 4LBYA 1HLFA 1EM6A 3ICVA 2WIFA 3LWZA 4G4SP 3OIFA 1M75A 4G5HA 3I9JA 5FBHA 5DHQA 1B00A 5EIBC 3RAJA 4RK4A 3AQ4A 2WIBA 4CMEC 1CUHA 3DB1A 1ZH4A 1CR2A 3C3KA 3TLJA 2JG3A 2WWRA 1V37A 1TIPA 1U65A 3K0AA 4FZVA 4ZXPA 3LKVA 4URXR 4EARA 3Q11A 4WCFA 5HMMA 5G2OA 3RLFA 1L5FA 4ADSG 2ZIFA 3OQHA 4BB0A 1C4WA 2RH4A 5L3ZA 4AI6A 1JYFA 1NMEA 1O58A 4C78A 2V97A 1ZDMA 2WWIA 1IVYA 4AL4A 1MW9X 4GPTA 1A9TA 1ODSA 2DJIA 2HQRA 3H86A 5SYMA 3SHQA 3CVJA 5DMXA 3WFJA 4GGOA 1N6OA 2F8LA 3C3EA 3FA2A 2CNLA 3UHOA 5CB4B 5JDCC 3ZHRA 4Z3OA 1JQ3A 1FLAA 4YJ3A 3A1CA 4QGGA 2V7WA 4PAMA 3ZZNA 2XH8A 1YS2X 1PD0A 1XL0A 3FHLA 2D54A 5HKOA 1I3NA 4IIJA 3W79A 1P1FA 3BVPA 4PPQA 4O5AA 4MV6A 4IOLA 1BG6A 4R0NA 5DBOA 4WUVA 5KNBA 5FV4A 4QO8A 3B20A 3VOBA 4EPWA 1DWUA 3G1WA 1GADO 5KMGA 4I2NA 5FWAA 1S4QA 3S2GA 3TL3A 4D9EA 1Z22A 5DFAA 1JZQA 5JAQA 4CV1A 5LXTA 3U5ZB 2VF2A 1KEUA 3I28A 1R0XA 2GCOA 4RTNA 1QGDA 4N12A 1RLUA 4F2PA 3P9CA 2WA1A 3SOPA 4ZYWA 3LKDA 3Q72A 5AW1A 3C7CB 1HYGA 2P6OA 3IJ5A 5IC4A 1NNSA 1NSFA 2HHLA 3R5XA 3B38A 4E1AA 3GQBA 3DWIA 2H52A 1M3SA 1UM9B 2Q3CA 4FXOA 4HDSB 4WY2A 1P2DA 4YECA 2I3AA 4ZV7A 1QLWA 3KTFA 5EAIA 3HB4X 3SHVA 1IZ7A 1U9CA 4IGIA 4LYYA 1BVYF 5AJTA 3W1WA 2C88A 4X93A 3TD2A 1WNTA 3CSSA 3MSCA 3IV7A 3VU1A 1UBNA 2HJGA 2PUWA 1DBQA 5A05A 4PO8A 3B52X 3BPSA 1X9IA 4Y9SA 3UN1A 1ZGCA 3BH6A 2HDHA 4PHGA 4KBYA 2GA9A 4DCGA 1JKJB 1KH1A 2GAJA 3ZY2A 3A1VA 4HUTA 4MO2A 3PGVA 4HNQA 3IUPA 4UHCA 2XA2A 2VPQA 2VAPA 5TRTA 4ISCA 4M0CA 3D3EA 1UIMA 3OA2A 5JNLA 4X91A 3K1YA 2M2IA 4IIFA 1D5WA 1S1CA 3QVSA 2GM5A 2OXFA 4FGZA 3JQ9A 4GE0A 4MQLA 1XMXA 4KNWA 4RETA 5CYOA 5K20A 2PZGA 1K66A 4TLAA 1SELA 3LLUA 4EB3A 2JK0A 2FZWA 1AHNA 3CF0A 3ILXA 3UANA 3T5PA 3FPEA 3M6LA 4D5GA 4G0ZA 5EY5B 2O8EB 1BKDR 1GUFA 5JMOA 3DFFA 2ONCA 1V7PC 1S8NA 2ZTMA 5EHIA 2Q3FA 1CSEE 1GTG1 3EIHA 3OEYA 3BWVA 3DM5A 4Y2JA 3TBHA 4AY2A 2RHCA 2EFYA 2ZG6A 4HNRA 4A5OA 2D5IA 1DEAA 1Y8AA 3EZ6A 4JJFA 3N8IA 4L0DA 1DKPA 1U0EA 1NF2A 3AP3A 5FLKA 4CW7A 3FDFA 1A9XA 1VA5A 4N7BA 2YX1A 1Y98A 1RQ7A 4BNVA 4MEBA 1Y3CE 2C20A 1QIGA 3K15A 1P0FA 4ZPXA 3UC9A 4U0KA 1WZCA 3UV6A 3IE2A 2AJTA 1ZLXA 4Y9RA 5IXSA 1ULUA 1M6HA 2HLPA 1O97C 3AWIA 1Z56C 4L8FA 4WKBA 1OJLA 1O0SA 1SCJA 1YDHA 1MDFA 4PZ9A 2OQVA 3VM6A 3Q9SA 4JC8A 3IOEA 3L8YA 3HUEA 3O83A 4N3GA 2F17A 2NU9A 3ZTWA 4NV3A 3IURA 3L0SA 3OHMA 3QRWA 4JA0A 1T3SA 3K30A 4ENUA 3OA0A 4FE3A 4HGZA 4NK5A 1GR1A 4XDZA 3VSCA 2GBLC 3SM9A 1K6IA 3KNZA 2R47A 2ZXEA 2A5FA 2YRXA 1P4GA 1LXCA 4UOEA 4R1QA 5JS7A 1PVDA 1K8RA 1UJ2A 4X61A 3DZGA 2A0YA 4FIZA 1J7JA 1E3EA 2MYNA 1KOLA 3GFFA 4D3XA 1MOQA 2BFCB 4NIMA 2IBSA 1NW8A 1T6NA 1N3IA 2A5JA 2WG2A 2A9VA 3ACDA 1JR3E 4GZLA 4ZO7A 3W04A 1SFRA 1W94A 1OYWA 1Y7LA 4K5QA 2C9DA 3R5SA 2BC9A 5GAJA 3AY0A 3ZGVA 3EVZA 4EB8A 4RY2A 1KY2A 1PTJC 4EVQA 1PJSA 3WYGA 1B42A 1QFXA 4TKUB 5FA5A 4E31A 5KOHB 1R5OA 4YROA 1TO2E 2P0YA 1JYEA 1W4BA 1Y48E 3E84A 3AR6A 3L93A 3GEGA 2O4UX 2A1TS 3PYLA 4K81B 3O6VA 4CLOB 1NJGA 3HBMA 1KBQA 4IW3B 2CJWA 2F4VB 3IPXA 3JD1A 1YUNA 1AN9A 1X9HA 4RF5A 2WKWA 1IBRA 4QQRA 3B3JA 3O8DA 3OCCA 3OLQA 4XGIA 1SM4A 3DMHA 3WLHA 3WWCA 5ETJA 3H87A 4J91A 2Q1SA 2EP8A 3TKLA 4CQLB 4D46A 1ZOIA 2ODQA 4AJOA 1VZ3A 1YDEA 3HDJA 4JI2B 2Q3EA 5H5JA 5BOSB 3WGTA 1NOKA 2CNDA 3IT1A 1G3QA 2NYUA 5EJFA 4GL2A 3LIPA 1TAGA 2CYCA 2BE9A 2PQMA 3WMFA 3VYTB 3M82A 3CVVA 2XCUA 3EGCA 3V4ZA 5EERA 4JC5A 3RM3A 4JFRA 3TNJA 5BOSA 4LAFA 5H70A 2F1IA 1QWOA 2C00A 2C2OA 2ZRNA 1QANA 4QPCA 2GR9A 3MSXA 2Y8EA 3PI6A 3LT2A 3QY9A 4OU5A 5E6UB 2I80A 3RYHA 4BUCA 1RZRA 3CLKA 1JSLA 3T0GA 2O2JA 2D00A 2OLEA 3EIQA 4KGZA 5C0OE 4ZOCA 3K3PA 4RWZA 3OT5A 3C5VA 3CUWA 3F96A 1DWQA 1YR3A 3OPVA 4UPEA 2QX6A 1Y0BA 1NRJB 2P6MA 3KWMA 2ESRA 4M1YA 3NASA 2QWXA 4S0XA 1GUZA 4RD3A 2AYXA 4U1RA 1LD3A 1FSGA 3PIRA 3BMNB 3IRUA 4JXJA 1GAXA 1I3OA 5EMMA 5CFPA 2DZDA 3QUTA 2PKQO 2F43B 4LGVA 1AKEA 1N2HA 1NN1A 4MVJP 5IFKA 2XYQA 2JIDA 3FPJA 3QHAA 4QTYA 3CG0A 4OVKA 2JAPA 3D0OA 4ZJZA 4F86A 2HY7A 4NCKA 1CUJA 2JL1A 3CNLA 3FPHA 4I66A 1U9JA 4GICA 1E79D 4N5MA 4YJ3F 5L4SA 3WA7A 2HHCA 2PSSA 5CT5A 5CW2A 3QENA 5AOCA 4TMXA 3NAZA 3AC0A 1G5HA 2QF7A 4HGNA 4DMLA 3CB2A 2W90A 4HN2A 5KX5F 3BYZA 1OX6A 5JS6A 4RAOA 1UPUA 3O7WA 3HZZA 5JSHA 4WD3A 3VV3A 3FNRA 3DCNA 3HQ4O 5EP2A 1V45E 4D9HA 2O2IA 2XOKD 4MPRA 4Y18A 4Z1MD 4K2HA 3AUKA 4RMJA 4HQFA 4TTVA 3MCWA 2ERYA 1ESEA 3QYPA 1U8EA 4HB3A 3TB4A 3WQBA 2YCBA 3WYEA 3B6KA 4AJ4A 2FPPB 1QYCA 2GAAA 2QR5A 3IL2A 2GVNA 1RNLA 2P0EA 1JKXA 3TX6A 5HYVA 2VYCA 1E59A 1M2WA 4HXEB 4PX2A 5JQWA 2ZSBA 4F72A 3HJFA 4QVGA 4OH1A 2O3SA 4OP3A 2BW0A 4B80A 1Z0UA 4FZJA 5SYNA 3GLQA 5REQB 2FW0A 2ZRCA 1W5FA 1NQUA 2GZ3A 4FE4A 4M1KA 3VU9B 3PVSA 4L7VA 1EG7A 1NF3A 3Q3GE 5DGHA 4UUBA 1TU3A 1KE1A 1TOAA 1PTJA 4HQKA 4PZCA 3H5VA 2WYOA 2ZB2A 3W2GA 2BGRA 5C7LO 5I3ZA 3IBSA 4HSEA 1OLSB 5D8DA 4EA9A 4EOGA 1QF6A 2XDYA 3H2YA 4GE3A 4RXMA 2JGDB 4X0EA 5J3JA 1E3DA 4ZDIA 2VKQA 4J2HA 2H1HA 1TM4E 2CNWA 3E05A 4GPEA 3U19A 3BAZA 5JR3A 4PG8A 4V1CI 2MINA 2FEOA 3ZJYA 2YYSA 4CODB 3GLHE 3HV0A 4BMPB 1ULBA 2IYSA 2PMKA 4UKDA 4KR3A 4V0MA 1RHJA 3HM2A 3M4NA 4EKDA 1PBTA 3PUVA 3TRDA 3RT7A 4M8IA 2WKQA 2CZGA 5JAIA 1ZX1A 3ST7A 2H2HA 1P1JA 4N8DA 3NIBA 4NX2A 1JKJA 2PL5A 2QRQA 4FUTA 5DVZA 3UW3A 3ZQ4A 2EJTA 3C7AA 4WWHA 1C30A 2X15A 4CR8A 4E2ZA 2OYSA 1W0KA 4D4IA 4ZVUA 2BM9A 2PU5A 3BB3A 3AI3A 3JARA 4PQGA 3HSYA 2PWBA 1VJTA 4LJSA 1XTIA 4AKEA 4KTVE 1Y9AA 3HVIA 1LNSA 4HDNA 1AZLA 2VPIA 2LNDA 3KUDA 1H2YA 4FFBB 1ZCJA 3RS5A 3ZHSA 1PT8A 1T2EA 1NNLA 3RSQA 4J43A 4IV8A 2WILA 4EVRA 4B79A 4IDGA 1QIFA 3PUJA 1OKKA 3QXSA 3SU8A 1J2JA 1E79A 2PO7A 2NO1A 3B7WA 3DAOA 3GCZA 4ZQFA 5AVOA 1II8B 5CH8A 3H65A 5DNAA 2O8FA 1DADA 3M5DA 1LPSA 5ULLA 2BGKA 1XMIA 4KOAA 1QPGA 1HA3A 1PFYA 1ZWLA 3TZLA 3M6UA 3SCZA 3ZCQA 2Q62A 2X9GA 4MMXB 1CERA 3V2HA 5FBQB 3AONB 1I2DA 4KQKA 5KTNA 3AW9A 2EFDB 5BPHA 4Y7DA 2GPJA 2YXDA 1Q0QA 3U4QB 4WERA 3W90A 4MS3A 3ZWQA 2GGSA 2FW6A 1RXVA 4M6WA 3GN2A 4P33A 1PEDA 4YONB 1GAWA 1QF9A 4GNKA 4KXYA 4DZZA 1G6HA 1YT5A 2PWZA 4XFKA 3VAAA 1RZRD 2QZ9A 5K0CA 2H3EA 5K4GA 1CHDA 1JG2A 2B92A 4KLCA 3EUAA 1JNXX 2ZT5A 1B74A 2FWMX 3QVOA 3DEIA 1TQ4A 1WXGA 2WPNA 1VPVA 5D85A 4KXUA 1PFVA 2B21A 4NLLA 2Q4BA 1KRHA 4RPCA 5KWEA 1N78A 1ZM7A 4EA6A 4A15A 3PC2A 3I83A 1MABA 4BFTA 1H8ED 3QWAA 1RKUA 3NTXA 4K6GA 3R7WB 4PYIA 3SJBA 3ZKAA 4YCCA 4D74A 5AKYA 3RK0A 1RKBA 4N49A 2Q6VA 4MW6A 4OP1A 1A9SA 4PYQA 5IWCA 1O0CA 4S2UA 2BONA 1ZJ5A 1H2ZA 2XE4A 4CTOA 1AOXA 4YMVA 3NRBA 1MJGA 4IDFA 2V0GA 1L4BA 1ZMOA 3IP3A 4D1YA 4IMJB 1G1AA 1QBGA 2YHSA 2OZVA 5KNCD 1A71A 1OFIA 2BEKA 4PIPA 2HMAA 3CXRA 5JY1A 5H3LA 2VC2B 2IXBA 1K4MA 1XTRA 4MQEB 4NMMA 3WLLA 3FOAA 4Q02A 4YXWA 1TF2A 1UPTA 1R0WA 2BEVB 4RE6A 2V7QD 4IJMA 3WQRA 5A0VA 4JB2A 2SKDA 4QARA 1TCAA 4TKVA 1KQOA 1N2BA 3ONFA 4WQMA 3G17A 4RMHA 3RRFA 4I4TB 4JOCA 2GUWA 1CVRA 3GGDA 3L6DA 3ZZTA 4Q4AB 1HG0A 3RARA 1VYHA 3HTXA 1ZA1A 4WEQA 1EFCA 3TLXA 1RHKA 2R48A 2CLEB 3WDMA 1WWKA 1SBNE 3D59A 2L0XA 3N59A 3UJ3X 3WV4A 1A2OA 4FJ2A 2IEYA 1UT8A 4HNSA 4OOEA 1T9KA 5I7RA 1U3UA 3U4HA 3DOJA 3SVLA 1KI9A 1JAIA 1SVWA 4IUBS 3HCOA 2XITA 4E08A 2ZRJA 4B75A 1ZESA 1I7LA 3OCZA 1EUCA 4ZVTA 4GKAA 1G20A 5K01A 1NXVA 2QUJA 3NB0A 2OLKA 3SKYA 2XECA 4TKZA 4C87A 5HUQA 4XDYA 3MQ2A 2P2LA 4HPXB 1V5WA 2R66A 3F5FA 3WX0A 4DHWA 5F3RA 1PZXA 5K8UA 2YH2A 2XAUA 2NO4A 1KAHA 3HABA 4CTMA 5J58A 4IKPA 3WLEA 1ULTA 3F7TA 3MG9A 4OQYA 4C5BA 3O9MA 2OZKA 3ISJA 1WUJS 1Y1RA 2AD5A 1OZHA 1EA7A 2AJBA 2SECE 3UTCA 1QHFA 3ZNQA 1FP6A 2X1HA 3EZYA 2ZYSA 3IEKA 1JHAA 3W4KA 4A0SA 5JI2E 1RDFA 1Z68A 2HU7A 3BZWA 1JQEA 2ZBGA 2OCBA 1WCIA 1WMSA 1UANA 3C74A 1SU6A 3WZ2A 1VLVA 2P1ZA 1XLVA 5AR1A 4V0KA 3KPWA 4TTSA 5B3JA 1G8YA 2ATVA 3K72B 3N9IA 1FQJA 5ESDA 4Z5XA 1KAEA 4QQNA 4NJEA 3UGJA 4JASB 4O4HB 1Z6YA 2WU0A 1VGRA 4LW8A 4TTJA 1P1RA 4Y0NA 3U3XA 3ZBPA 4ZHQA 3CJRA 3VR2A 1NVAA 3N2GA 1PT5A 1FYDA 1X1BA 2VYND 4KGVA 2VTBB 5KSZA 4R2WA 4EI7A 4W5OA 2W6JA 3BH7A 4KLRA 3PFHA 2QE7A 2ZIXB 4RFLA 4KXLA 4P53A 3FIUA 3GEDA 3WBJA 1YVEI 5CDUA 2KLBA 3QLVC 1R7RA 4BFCA 3AF4A 4HNVA 3CUSA 3BIOA 3L0CA 3ORFA 2VF8A 2IY8A 2I6GA 1PJ4A 3WLAA 3HCRA 2Q3BA 1EFKA 5I45A 4ZWNA 5TV2A 4XLTA 1RPTA 1ISMA 1XPJA 3UQYS 3OO1A 4YJFA 1GQOA 1O6BA 3KYCA 2Q3HA 2O8EA 1TK3A 1QQBA 1ZHOA 1Q57A 3D0KA 3SC2A 3LF2A 2FWJA 4RKQA 2Y93A 1B0AA 1BWQA 1TK2A 4ZIRA 4N03A 4H3KB 3BF7A 4FW8A 1SAYA 1JA0A 3I34X 1E1YA 1NSTA 1ZRMA 2DM6A 4R8SA 4LF9B 1BHO1 2XX3A 3AESA 1R6AA 1QGOA 3IAUA 1YAHA 1DAIA 2GYWA 3PITA 3N0TA 4QGAA 2Z2YA 3WXBA 1Z2EA 1L7PA 3M9LA 2QAGA 1PG2A 3S4YA 1BXGB 4DCMA 3B1ZA 3U0BA 3WRXC 1EXVA 2R65A 4I5EA 2ATIA 4E6EA 4MR9A 3FNHA 3ZK9A 1ZNXA 2Z2XA 1U0LA 1ODLA 1FDUA 1QYVA 2JI4A 2YMPA 3CRRA 3K0AB 2VKTA 3RFFA 4OA5A 5JPDA 1GGNA 4NBVA 4NE7A 2Q7OE 2DPHA 4MVJE 1TYDE 4DC9A 1DUVG 3L8DA 4D0SA 1TQDA 5EJAA 5P8WA 2GF2A 5JFGA 2IHUA 2IY7A 4LZOA 2AEFA 1N4DA 2YHAA 4NOLA 5IYZB 3HKDB 3U7FB 1GLVA 4RHUA 4V1CA 1MNAA 1SKYE 3WQHA 2XDQA 4BVJA 2QENA 4FEEA 4CKBA 1E2NA 2WV9A 4JJ7A 3KZ1E 1GCGA 2O8CA 2A30A 1ZHHA 2FG7C 2UXBB 1PW5A 1DIBA 2WTBA 4G8DA 4TL6A 1CTQA 5HQJA 4ER6A 4Y3UA 3TLBA 3OTGA 3EBOA 3EIFA 3P7MA 5F21A 3SF8B 3C8DA 1DQPA 1O96B 1VRWA 2C84A 2KW5A 4G5GA 4LYJA 4AUNA 1FFYA 4JUFA 4E2XA 4O8ZA 4F8JA 2JCYA 1RWVA 2G72A 3W3AA 4DQVA 1DG1G 1VI2A 4KU4A 4LVCA 4BNYA 2HF8A 5HIJA 3FSJX 5D1NA 2G9VA 2QJTA 1II0A 2EJCA 3HCNA 4E6PA 4OQNA 3A37A 5LQNA 4IDOA 3LBHA 1HNNA 5LOVF 4YBZA 3OC6A 4ARBA 3C3MA 3ABSB 4X63A 2I91A 1JIIA 1I2BA 4GHWA 2Q9BA 1GKUB 1SIOA 2NUTA 1H1TA 5A5VA 4LJKA 4G9EA 5LWHA 2QPOA 2XWBF 3A3NA 2HXYA 2OGTA 4XWTA 3VR4A 4WTOA 1TI7A 4J7UA 2C97A 3EW7A 2ZUWA 3LDFA 2GJAA 1RXEA 3OUZA 5BYKA 2PUCA 3I04M 1U2DA 5C1IA 1ZJJA 3IOYA 4QOSA 4FBGA 2ZJ4A 3TLAA 2BKAA 1GV1A 5DU2A 4DBLE 3E7FA 1LK0A 4NCHA 1KI7A 1PJLA 1D4AA 2X3UA 5CM9C 6PFKA 2W6IA 1ZKDA 3CQ9A 4AZWA 1FU7A 3RYCA 2FDXA 1JG6A 2JCGA 3FOFC 3VOAA 3QHPA 3DNMA 1E64A 3MERA 4GXTA 1NC3A 3B3QA 4F1JA 1VHTA 1YQWA 3QY0A 2WMDA 3WKBA 1CUFA 3RT9A 3FLEA 1WXWA 2YRWA 4P83A 4AUMA 3UATA 4M37A 3USZA 1WSDA 4F91B 1R18A 3ELBA 4DV3B 5JBNA 1GA6A 4ZVRA 1C3OA 3H9BA 4JELA 1XEFA 2IZ1A 3TUIC 3LX5A 5B30A 1QDEA 5CA0A 4U2KA 3UJPA 1CDDA 4JSYA 3V6LA 3UT0A 4X3PA 3RW9A 1AUPA 1TLLA 1KDTA 2EW2A 4C0KA 4KRXA 2FR0A 3I23A 2O3QA 2YXPX 4Y2YA 1DU4A 3AXTA 1DOZA 2EFGA 2W8BB 2ZRMA 5LP6F 1D2GA 2QUKA 4MWSA 5JNWA 3DAGA 1ODIA 2CVFA 1IE3A 2VQ6A 1E96A 3TJMA 2WP0A 2O5EA 3WWZA 2JJYA 2C57A 2VNIA 4EW3A 4FNGA 4HRXA 4NAVA 2W6JD 3W5SA 1SXJE 1SOUA 1HH4A 1YQGA 3B3AA 3DNFA 1PJ8A 3OCWA 5CLHA 3PEUA 3B7PA 4YRAA 3H11A 4R1MA 1SXPA 1MO3A 2AWOA 2H1RA 3C6QA 4R2KA 5L53A 4BPBA 2B3TA 2BFNA 1E1CA 1H0RA 3BJZA 4PANA 1LI4A 3TL6A 4MW7A 5HEKA 3VSEA 2FQ1A 5BRJA 1U8UA 2BOVA 3IPCA 3FDIA 1P1KA 2HEGA 3LT1A 1W76A 4FC6A 3WGGA 2O1SA 3G0DA 1GA1A 2WYHA 2JIMA 3VC3A 1AKVA 3GCDA 2I87A 4UULA 1HEYA 1FFDA 2KQUA 2G09A 1ORIA 2W2KA 2POCA 1ORHA 3I42A 4HDCA 1X1QA 4JL5A 2ZJYA 1D7OA 3R44A 4LXYA 1G55A 3KL2A 4OUDA 4Y98A 1ABBA 5CLLA 5G3YA 5KVSA 1RYMA 1ML4A 2FEXA 1UWKA 2Q8NA 3ICCA 4GR9A 1JLLA 5GJBA 4H60A 4OA8A 2HA5A 5GV7A 4BASA 3CKKA 4H7EA 1F0YA 1SY7A 2P7HA 1FNCA 1DT5A 4KW7A 2VK2A 4OHUA 5I9MA 1GFWA 1JEDA 3A9CA 5CFMA 1G2OA 3KPYA 3WBBA 4HV4A 3K7EA 4X66B 2P9HA 1SK9A 1TW2A 1XDWA 2WSSD 3FYTA 3SHWA 4Z7QB 1FFEA 2PGLA 3TQHA 3P5SA 2G5GX 4IR7A 4QYMA 4D0RA 3I6BA 1YVPA 3CNEA 3AIMA 2EFCB 1EI9A 2GN2A 2XNDA 3IDQA 4LWZA 4NESA 2H11A 5AVZA 5F2NA 2FJPA 1AB6A 4HUJA 4NCJA 2QUZA 2WHXA 4L74A 4K88A 4YAGA 1RWQA 2PSDA 3V42A 5EE9A 4D9GA 4E5KA 3EXEB 2VXOA 1CLUA 2CMFA 1ZGBA 1MOZA 5JD5A 5DLDA 3IKLA 2Q5OA 2XRYA 3PQ5A 1UP7A 1CRLA 1G5IA 1H69A 1R00A 2BCEA 2VHYA 3PG5A 1C3EA 2D2IA 3QP9A 2NTNA 4KG7A 5LLSA 3PDJA 2VNHA 3REFA 4UOQA 3H75A 3FCEA 3E3MA 3TI9A 2Q5JA 5CH3A 5CAEB 4BJ6A 3OSUA 5DM2A 3UAYA 3MTQA 3O1LA 3DXYA 4CI9A 5ECDA 2O2ZA 4DT1A 3IT0A 2WJHA 2WWTA 1EBFA 3AUTA 2WF5A 2IWRA 1J5PA 1D9XA 3PHIA 4HFJA 1DV1A 1XRJA 5HM8A 4MW5A 2JI8A 2J9XB 5BQOA 3TPZA 5TR9A 3E22A 4RBNA 1EWYA 2WT9A 4JKOA 2C2ZA 2X2FA 2R4QA 4JX8A 5EWLB 1N6IA 4JR2A 1V71A 1IEWA 4ZRDA 3M9WA 1EVLA 3MTGA 1R6BX 2Q7XA 1CY2A 3OOYA 4MX8A 5CIYA 2DPLA 5LD2B 1HLDA 5H3HA 4DUGA 4J03A 3AEUB 5DYWA 1RP1A 3EVDA 2X0JA 3FLBA 1GVHA 4MDHA 2RAVA 3R2JA 4P7GA 3DFZA 4QJ5A 3AF3A 4LOLA 3DBIA 4IIYA 1YS9A 4XI9A 1TM5E 3SZ3A 3U3KA 7ADHA 4AT1A 1NE2A 5L3QA 1KEVA 2X6RA 3P4XA 5L6LB 2UZ0A 4FSDA 3KOWA 4W7HA 3HG7A 1VE3A 5JS8A 5LNK6 1U9ZA 3GXOA 4D4KA 1I8TA 1T5BA 2P5TB 1UBMS 4XQCA 5FL3A 2F1OA 5A6SA 4BB9A 5BR4A 1SB9A 4LWOA 3JWGA 3GUYA 3K32A 2ZVDA 3KLBA 1TAHA 2ZFUA 3ONNA 4YGXB 3O4VA 4DREA 2TMDA 1RBQA 3FZEA 4YP5A 4PSKA 3TSWA 1LPPA 4XWWA 3L6OO 1R66A 2F1RA 3D7MA 3EEFA 5IAGA 2BEUA 4CNQA 2AK3A 2VJYA 5DPMA 2IPLA 3EQ9A 3FSEA 4Y9UA 4PAWA 1Q3TA 2PK3A 3DCJA 3G6WA 3OJOA 1EE9A 1QORA 4CV3A 3OFND 4DE5A 4L8GA 4U7GA 4B4KA 3QKSA 1LLFA 3ITEA 4HH1A 4JHLA 1G7TA 4U5QA 5F2OA 1UZNA 2E6KA 3RVKA 1RE1A 3E4DA 5GY7A 1NRXA 2A0WA 1Z5PA 4GPIB 3NBXX 1V1MB 1JL3A 2GPTA 4PQRA 1EQAA 1OKKD 1W88A 1Z2AA 2VK8A 2J32A 4L9WA 4XSGA 3U80A 2PUGA 1TEVA 1E5TA 1QZ3A 4CV2A 2IFTA 2R68A 4L5AA 2FH5B 4UU7A 4OCZA 4WESB 3FYSA 5IARA 4DSUA 5CCDA 3HB1A 3F6PA 2IVZA 2O2HA 3LBAA 3N5CA 4J0CA 2FU5C 2J3MA 4R68A 3T7DA 4BLVA 5TXGA 4JYPA 2EJUA 3U3OA 1ONSA 4FN4A 3C6YA 2RCNA 2FCAA 2ZUSA 1IY9A 1JWBB 3JVUA 1W85A 4QUIA 2DKFA 2RSLA 5D84A 3EQZA 2J3IA 4HYYA 4I9FA 1XRLA 1JLMA 1QXSA 1SD2A 1JDPA 1NXOA 2LD4A 4LZWA 1ZN8A 2HX1A 4I81A 5EXDA 2RHTA 3BFKA 3QMMA 2JFHA 7REQB 1EX7A 4KZKA 1EVYA 4FS8A 4PLGA 1SUCA 4DIOA 1C1YA 2G82A 3ENKA 1FTNA 1KH3A 5JXWA 4YPOA 4M3NA 3HE3A 4OY3A 4I8IA 2I6TA 2P3OA 4L76A 4KPFC 4ZEVA 1QUEA 2WUFA 4U8HA 5JG7A 2VP5A 1QQTA 2QN2A 1P6QA 3R8XA 2HJHA 4IP0A 1KPHA 1GRNA 1KVUA 4J0HA 2I54A 1Q14A 4BMNA 1SHZA 2XCIA 4ZICA 3O2SB 5EIAA 4B6SA 4MKXA 2AR0A 1P1BA 1JFSA 3ZY3A 1OYVA 5FOTA 2NVWA 3ITNA 1KYXA 2WKPA 4OV6B 2GPBA 3IMFA 3M83A 2YQZA 3GJRA 1M9NA 1XTVA 2P5UA 2A9OA 2R7MA 5JHHB 1Y6GA 2QR2A 5ENDA 2I4TA 3LUKA 4F1WA 4CHTA 3EVBA 2GEBA 5D5QA 2VDWB 2NXJA 2QS9A 3HRKA 4HGQA 1KSJA 5AIBA 2JASA 3R1IA 2UZ3A 5BRNA 4BN4A 4DLSA 3BD8A 5LKRA 3ZVNA 5TF4A 1DV2A 1B8OA 3IKMB 3ISTA 5KHLB 3P2OA 4HGYA 4H6VA 4DPKA 1PWHA 2VHUA 2ZE7A 1FTWA 1S3IA 1ORDA 2AZTA 2AN4A 1EVIA 5B53A 4X62B 1IWPB 3H1EA 5F1OA 2AFIB 1RJGA 1V3UA 1LC0A 3WYBA 2GK3A 1LCIA 1PT7A 1S5PA 3ACBA 4V02A 2Y6VA 1LH0A 4BMSA 4Z86A 2VQEB 5E4JA 3CYFA 3N2NA 4MUYA 4TXLA 2NPOA 1P0CA 3X3HA 2BFMA 5JSYA 2ZI3A 2P35A 1XQVA 2QAJA 2B4AA 2CLFB 4LRWA 1N1MA 1OB5A 1XUOA 2ECKA 3DV2A 4MKRA 3RYFA 5B1EA 3C48A 3QFFA 4ZOBA 4LEIA 4FLMA 3A05A 1U3DA 2PV0A 2W8ZA 3CF2A 3IUYA 3ORRA 3QPWA 1U0RA 1WPGA 4HAXA 5EXPA 1ID8A 1CKEA 4XX0B 3QEBZ 4ZVQA 4PYJA 5ICSA 2NVOA 3ET5A 2RGXA 5TQ2B 4L9RA 3JY6A 4LY6A 1EJ0A 3KOUA 1VKHA 2FZGA 3TFWA 4P58A 4EL0A 1KFKB 2XF8A 2ZWAA 3GRKA 3R7LA 4BB5A 1N6NA 3QUAA 3FMFA 4XYGA 5K7SA 3JQAB 4PFKA 4LKRA 2CBXA 3Q88A 4D3ZA 1N4AA 1X39A 5IKPA 4MMYB 3HRIA 3AW8A 1HFJA 2D5BA 3PENA 4MB0A 2WMOB 4TWJA 4ZDWA 1A9PA 4G67A 2ERCA 3DWEX 4NZOA 2BKEA 3L46A 4ZCQA 4NYMQ 2AIRA 2Z1NA 5A3VA 2B9EA 2FJ0A 3H11B 3ZHVA 2CUKA 1MQAA 1VYVA 3D4LA 4URUR 3FGZA 5GIOE 3F71A 5LCXA 1Y82A 1W5AA 2O0MA 4OU4A 3U2QA 4DBZA 621PA 1YQDA 2AFIE 1KK3A 2QL9A 4WNCA 3DZFA 1OVGA 3BTOA 3E9QA 3SMQA 4YDQA 4EB0A 3U3ZA 3WZMA 4WN9B 2PYDA 3USES 3VNAA 5DV9A 3PCRB 4TLLB 4ZAXA 2RIPA 3D9QX 4M49A 4MLDA 4YHBA 1UKBA 1Z3CA 1Z0ZA 3TFQA 1CQIB 1U7UA 3QYFA 1WB5A 2HFJA 1PJ2A 3ER6A 3MRXA 2YN2A 1J2EA 5IJXA 4M1OA 1CJBA 5TF0A 1GPAA 2JCBA 3U9LA 4RK6A 1MVOA 3VH4A 2DF8A 3LA6A 3AHHA 2QYSA 4ZN6A 3OQMA 1KQFA 2OBNA 3VJLA 4GSLA 3EVNA 2YY5A 2G6BA 4B4WA 1V8ZA 2VATA 3BE4A 2ZETA 3NZEA 5KHAA 4ZFNA 3H0CA 1CQZA 5EXTA 1XELA 5A6SB 3R7AA 5ITZB 3N74A 2AN9A 3Q8KA 2Q5QA 3ZU3A 1P9LA 3T5AA 5HKKD 2PKCA 2I2WA 1W19A 2Q2OA 2LIPA 4LRQA 1LKZA 5CK5A 3WJ2A 4NEGA 1UKAA 1E60A 3DFMA 4L4SA 4MGIR 2OPHA 3C7KA 1U7OA 3T7RA 4EA8A 1QFYA 4EMBA 1ZWKA 1QIMA 2UUOA 4ZPJA 1DAEA 3N75A 2NZ8A 4JI8B 3L7CA 1Z7EA 3C1UA 4UHHA 1PI3A 2X5OA 3AM1A 5AW3A 2DXIA 1ADFA 2IEIA 3BD9A 1ZK1A 2WBLC 3AOEA 3DZKA 2BN4A 2QM7A 2BMDA 1H23A 1XVTA 3P2JA 4K9SA 4LV5B 3PWKA 5EWJB 4M8KA 3DEFA 1O97D 2QZPA 3A10A 3LC2O 4HFRA 3QVLA 3MUFA 4RZQA 3BK7A 5DHTA 2OG1A 4BNTA 1R0ZA 4MKZA 4WZAE 5EE1A 3RIMA 3RYHB 4IIJF 1EP2B 1WW3A 1FNDA 1SQ0A 2QTLA 1ECPA 2XGSA 2ZJ6A 3BE6A 3NH6A 3PIIA 4C0WA 4EW6A 4GOND 2JLSA 4RSRA 4BWFB 4Q3CA 1DI0A 5JCOC 1SU4A 2XB6A 3HNOA 1ZSYA 3CEMA 2V7BA 1V1JA 3MMPA 3MWGA 5M3BA 2ID8A 1O6GA 3KTAB 4IHJF 4NEQA 1DPFA 4UCQA 3VPFA 4AK9A 2XJ9A 1M2FA 3HYLA 3WDKA 3FOBA 4MKIA 4ON9A 5IPFA 1U0NA 5FHQA 4X6LA 1I6WA 1HT3A 5AUOB 4A36A 2EEPA 4GMDA 1J4AA 3OOJA 3W9BA 3MT8A 3NR2A 3W8EA 3FWPA 3OIDA 4LVNA 4CCSA 1AQUA 1SMKA 4TMVA 3HB0A 3NO4A 4ND1A 2GYUA 3ZE6A 3ZD6A 5E2AA 3LECA 2HRBA 4G07A 4KFTA 4YB8A 3HA5A 3H05A 3L40A 4OMUA 2JBWA 3G8CA 3V8PA 2R11A 1TA4A 3GHYA 1JKMA 2FSSA 3SBEA 3L7LA 1BJKA 1Y1QA 3CWZA 3BM5A 1TQ6A 4R2IA 2NU7A 2PRZA 2ZJ2A 4FYXA 3RS4A 2WUWE 3RJ9A 3QXCA 1MJFA 2JGKA 4PHFA 1FEZA 4IQGA 2DPGA 4KR6A 2V58A 4MS4B 4RV9A 4ZGBA 5JYDA 2QQ5A 4G85A 4KXMA 2QLLA 3BF8A 4YRLA 1SBTA 4KB5A 3K6SB 1XVAA 4K1XA 5JWHA 4MVJH 1KYTA 3KR2A 1VYUA 2CLSA 3EFEA 3QI2A 4UEOA 3ZTYA 4E21A 4DLZA 1HE2A 2ZYHA 1VIYA 3ZV4A 3TE7A 3PJDA 2B1GA 4NJOA 4O63O 1GZ3A 2BFPA 2VPXA 2EXXA 2XYGA 3PXDA 4INZA 5DLQC 1Y89A 2GEJA 2WUGA 2X86A 2PY6A 1XTSA 1ZA2A 3OJCA 3R74A 5E7QA 4H1TA 3S2UA 3B82A 4ZV9A 4NENB 3NHYA 4P4SA 1Y80A 3OZFA 4ZO9A 5K3DA 4LF4B 4WVLA 3G9TA 1P2SA 3A25A 3OZWA 3NDIA 2QW1A 4JJ8A 5BWLA 4MUBA 1WA5A 3V4LA 2YOHA 4O4JA 5PGMA 2HNKA 2IYRA 4U7HA 2I3ZA 3H1PA 1IMOA 2Z08A 3ND7A 3O1IC 2GA8A 1JQAA 5M04A 4JB3A 4A0QA 1SH7A 1UDXA 2DUNA 2OM6A 3TCKA 1Z2PX 5KREA 3RC3A 4CIWA 3EWAA 1WULS 3ESXA 3HFGA 3L8ZA 4GQBA 2RHJA 4XSHA 3EGIA 5EHXA 2H57A 4KDFA 1M83A 3WLTA 5MF6A 3ZJ5A 2WMYA 5CDGA 4A8TA 1WMEA 2AH5A 1NWCA 5HCIA 3DTYA 5EG5A 3ROFA 5B4TA 5JDIC 3DMDA 4OBWA 3P1JA 3P0FA 4EQ6A 3LOUA 4BNDB 1YA8A 2CYAA 1ZD8A 2MDTA 2CN1A 4BMVA 1QG6A 1E3SA 1P4RA 1ZGJA 3IP6A 3EVFA 1GSHA 2ZIXA 3OU2A 5TPZD 1V8FA 1P7YA 2JLQA 4LZJA 4Q12A 3T3NA 4JGGA 4HKTA 5KJ1A 1I1HA 1V35A 3NDPA 5ENZA 5CK4A 1J7KA 1D0VA 3U4IA 3BTUA 3I45A 3KZNA 4Q3EA 4AJ1A 4PSDA 4R2MA 5F1PA 4M22A 5DRYA 1JDUA 3G8DA 3K71B 4XQGA 2IZOA 2NUAB 1XQYA 1BYIA 2ZCJA 3QKUA 1PO7A 3A1DA 3BL8A 3QM1A 1RPAA 3LC1O 4NQZA 3BXPA 5I3CA 1HM5A 4KE6A 3SC6A 1J42A 3P2IA 1IXYA 4ZT6A 1TZMA 3CR3C 4G1FA 1DCMA 3BE5A 4HQOA 1D1QA 1AK9A 1JU3A 4JCOA 5GADl 2QYTA 3SIWA 3OZXA 3DE5X 2D2XA 4Y7CA 5T67A 2C42A 5AVRA 4GLLA 1ORTA 1L4LA 3HKCA 5BR8B 4BO5A 4G23A 2OC9A 3ZZMA 1DUSA 2R25B 3D6VA 1AKYA 3LHKA 2WQ6A 2QTMA 1U7ZA 4AW9A 5LLDA 3KM0A 5GGXA 4NABA 3U37A 3LTEA 4NHOA 1SQGA 4QOJA 4HCJA 2HLHA 4DM4A 4XWAA 3W5UA 1OWLA 3K0CC 3HB9A 1Q83A 2VF4X 1Q44A 2PN1A 1WX1A 2YW2A 4CCYB 2B20A 4HNGA 4Q6WA 3L4JA 4JUIA 4D2IA 2E1RA 3M1YA 3CVUA 5H7XA 5K0SA 1D4FA 1SCBA 2QZSA 2YL2A 4L7QA 4QXPA 5EUMA 2DY0A 4RA9B 3ILHA 2OV3A 3O93A 4QEZA 2NOAA 3R6GA 2ODPA 4MS3B 4MYTA 5CB6A 4L8YA 1XZIA 2QPTA 4DEYA 4FMDF 2XUIA 2QQGA 3GX1A 4KLAA 4QQKA 2YINC 2PUTA 2H17A 4AN0A 1HL7A 3PT9A 3V8BA 3DR3A 1UZLA 1SBIA 5JYBA 2KBFA 2BLNA 3E9CA 2IYNA 3QKRA 1Z17A 4JDPA 3UK7A 1R88A 2VJMA 2I4NA 3LHIA 4FHFA 4NNOA 4X71A 2PLFA 5GTDA 3W06A 1UFKA 5DXFA 2R85A 3BFXA 3UENA 2Z9CA 1J21A 3A9TA 5AHKA 1JSCA 1GZDA 2C9CA 3QA9A 1JTVA 4EABA 3CN9A 2Y0PA 4Q1EA 5KNDA 1JEAA 1QR6A 2C3MA 1SB8A 1XEXA 2W93A 4KH0A 2IC5A 3KXLA 4GL4A 3WIBA 4B3XA 1Q6ZA 2FGJA 1YIDA 1U3WA 4PLFA 5CX4A 1DC3A 3LP5A 2J4DA 5E9JA 5J47A 1F2DA 3HA2A 1VOTA 4JVNA 5IYZA 3DEKA 5C1PA 3QU4A 3V9AA 3ZEAA 3VR0A 4X8HA 1X80A 4DLBA 1K6XA 1ZRNA 3LBNA 5DCYA 4BO4A 1EINA 3ADBA 1GCAA 3V2GA 3A6GA 3OPYA 4CIAA 1V4VA 3HDGA 4DFDA 1IB0A 4B3HA 4E4RA 3FAZA 4NMXB 1V48A 3DMPA 4WCFB 4YDHB 5B2ZA 1MAHA 4XVCA 1F7UA 2FN9A 1EP9A 2GZAA 3CG4A 1H2RS 5J9FA 3T6KA 2BGMA 1IEQA 1W52X 3IMKA 4GGMX 5HDBB 4QG7A 4B9AA 4FFNA 5AUQA 3H7AA 4ER7A 1SC1A 3NC4A 2XD4A 3AESB 4ZAYA 2V7PA 1C50A 2JKZA 3GW8A 4PC2A 2FPKA 4FYPA 1GRRA 2Q5IA 1JFTA 4DR5B 2DERA 2HZ7A 4XUEA 3PUWA 4OFZA 5KC8A 1RVV1 2JA1A 5BPFA 4KR2A 1G6Q1 3EK2A 4CYMA 3QX9A 1X1TA 1NX9A 2WHRA 2YDXA 1UFVA 4V0NA 1XKLA 3LXRA 1S96A 1X77A 2X58A 2QE6A 1KS2A 3KYCB 4BLWA 1H66A 4IOKA 1L5MA 4OBXA 1KU0A 5LDHA 3WGIA 3FF4A 1F9EA 1SUAA 2H5EA 3K31A 4JR0A 3TM4A 3RKSA 3GLIA 1U3GA 2OCXA 3W5BA 1VBKA 5REQA 4Q7EA 4RTRA 2YJ5A 1WS6A 3ORSA 2QN1A 4A0GA 3EXIA 4KQEA 5EGSA 1L5LA 3VOSA 2UXCB 2C3PA 2XT0A 1OLUA 1PL8A 5FTMA 1N3YA 1V5FA 3HY6A 3EPKA 1ABEA 1UOPA 1TDJA 1V7QA 2PKEA 4MAFA 1HYHA 3HCCA 4AWBA 4FU0A 4WLUA 3EIWA 3M4JA 3EDOA 3T7IA 1I9GA 1HFEL 8OHMA 2AJCA 1HKUA 2X0FA 3TX2A 3LLSA 3QEMB 4MB6A 4V1CB 5CIQA 3NV9A 4O4IB 1COWA 1KYYA 1PR3A 4PF1A 3RUEA 1LVGA 1FFAA 1RW4A 2GAOA 3WMRA 4TMZA 4ITUA 5ED4A 2FUEA 1K8XB 4NDZA 4PPYA 1DC7A 2XB4A 3TDMA 5ALMA 2ZM6B 2WF9A 5FOVA 2JB9A 4OXRA 4QD3A 1IAQA 1A8SA 1T0PA 4GI5A 5FA8A 3S44A 1OR8A 1AKRA 5JEEA 4X7PA 4A8JC 1TTTA 2P9QA 2B5WA 2H8GA 2J0UB 1N2CA 1YVRA 4GW3A 2PS3A 4H1UA 1Q20A 1OI4A 4Y2HA 1OXXK 5FLYA 4ZJYA 4N9WA 1VCOA 3N07A 3RS2A 1QDUA 1G2QA 1G5PA 1HOXA 1T4BA 3HYSA 5IDXA 1CY1A 4YJDA 3N87A 1Q77A 1ISIA 1U31A 2WSLA 3R7SA 1X8XA 1SCUA 5MFZA 3PSAA 2DWPA 3R9XB 4MWZA 1WHTA 2XCQA 1VB3A 2CCGA 2SKCA 1F06A 3AX6A 4JNCA 3UB4A 1XVLA 1I5EA 1PS9A 2QD2A 2X3FA 3M4ZA 3WIOA 1F2VA 3CUUA 3H1GA 1V9CA 4JL8A 2BFBB 4GPZA 2XBLA 4LCBA 3VMFA 2A9KA 4M46A 4QTZA 1I7SB 1KQGA 4YCNA 2VF5X 1GRVA 3ROKA 2OPBA 4GX0A 3CX7A 1F1JA 2V74B 3UMBA 5FUWA 3NT4A 4D6XA 1IEXA 1VLHA 3I01A 5E38A 4ZYLA 2QYHA 1NUQA 4Q37A 3EXG1 3WTCA 4FR5A 4HEQA 4ENSA 1L7VC 4E4TA 4CMIA 1P60A 3EQ6A 1QQAA 3GLIE 3TLGA 2XMBA 3VVCA 3REGA 4B3FX 4C04A 3NAQA 1WEHA 2LP4Y 1E3IA 3EODA 2LTAA 3CN7A 1ZM2A 2Q0XA 4MQUA 2V9PA 1GNQA 2WIJA 2WKSA 3IDSA 3HVJA 3D8NA 5D3QA 4YI5A 1GSOA 3AYXB 3T5DA 4ZI3A 1T8WA 1PV1A 3RVRA 1FLNA 3PGLA 1W75A 5J2TA 1MHPA 2FSGA 1L5NA 3KZOA 1ZXBA 2QLMA 3SM3A 4WNAA 5LWQA 1CUEA 5DYTA 4DNOA 3ED5A 4FW9A 3IAFA 2YQ4A 3MFYA 4HS4A 2V0CA 1T6ZA 3BA6A 1E4YA 3JQBC 3A9WA 4IWXA 1QP4A 1K5GA 3P8ZA 1VPTA 3VHXB 3GYGA 1IUNA 1I32A 1UIRA 4FGLA 3G2QA 1ZXLA 3RTEA 2E7ZA 2IH5A 5FI1B 1FTQA 4Y2XA 1FA9A 4ZTUB 3KCQA 3SQMA 1VSQA 221PA 4F6RA 1E4VA 2OSVA 2OILA 2ZYDA 4N3CA 3AINA 3DMYA 1XU7A 3BXHA 3QZUA 4G0MA 1WZUA 1HURA 1GILA 5DDIP 1F60A 1FMLA 3K0EA 3H0KA 1RI1A 4EFMA 2G1UA 4NULA 4KX5A 4QU5A 1HDXA 1UOEA 3DC7A 5I9BA 3CZ5A 1ANKA 3ZIAD 4FWIB 1TO1E 1XE3A 1AKQA 1ZVKA 2JGLA 2P40A 2W0MA 5DHSA 4II3A 1FP7A 1W30A 1Y3AA 3I6MA 3ZWPA 4EJ2A 1DWOA 1K7YA 2NXWA 4HPJB 4EJFA 4BZQA 3I61A 4Z6KA 5DHUA 1P3DA 4IHKA 1DBVO 1XTPA 2I34A 3DGEC 1PQYA 1BWSA 1X8KA 3E82A 4DPMA 1YE8A 2X77A 3EXAA 4JVOA 3BRWD 4IIDA 2YVAA 5IBRA 2VZ9A 5A02A 2R1TB 2GZHA 3VO9A 1Y4ZA 1IHXA 3PVZA 2O48X 3DMNA 4C0BA 1PK7A 2NO5A 3BBPA 1A4RA 1N5KA 2AMVA 4FZ5A 4LWQA 3T1NA 4B45A 4E11A 3D0QA 2V5UA 3LWBA 2K2WA 3F73A 2R4TA 2GNPA 3KC2A 1L5RA 5L3RA 3WK9A 1HE4A