5CVTA

Structure of a single tryptophan mutant of acetobacter aceti pure containing 5-fluorotryptophan, ph 5.4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
160
structure length
159
Chain Sequence
b'SAPVVGIIMGSQSDFETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAATRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETFRALQTASVPNSPIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
molecule tags Isomerase
source organism Acetobacter aceti 1023
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
total genus 56
structure length 159
sequence length 160
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5cvtA00
5CLIA 2NSJA 5CLGA 4YCCA 1D7AA 4Z7JA 3OOWA 4ZMBA 4JA0A 4ZJYA 4ZK2A 5BORA 4B4KA 1XMPA 5CVTA 2NSLA 3OPQA 5BOSB 2FW9A 2FW8A 3KUUA 3LP6A 2FW1A 2FWPA 5CLFA 2H31A 2ATEA 1O4VA 4YCDA 2FW7A 4GRDA 4AY4A 3ORSA 2FWIA 5CLJA 3RG8A 4AY3A 2YWXA 2NSHA 5CTJA 4ZC8A 2FWAA 1U11A 5BOSA 4YCJA 2FWBA 5CLHA 1QCZA 5C5DA 2FW6A 2FWJA 4YCBA 3TRHA 3RGGA
chains in the Genus database with same CATH superfamily
4FP9A 2PQ0A 1NQWA 3K0AB 1KEEB 3CJQA 3D3NA 2XVXA 3EJ6A 5KO2A 1ZN2A 4B40A 2QLNA 1RZUA 4ZO7A 2F4NA 2QP9X 2G4CA 3EWIA 5DHRA 5BWBA 2E9SA 4QOEA 1Y4SA 5A7GA 3S4YA 3ZNPA 4DAEA 2WVHA 2JCXA 3LSTA 2OECA 3R6DA 3H5OA 2IEYA 2PIAA 2WVGA 3KKKA 3SFTA 2COUA 2JHFA 1U1EA 1NP7A 3L7IA 4PO1A 3UK7A 2YV2A 4JAVC 3D3EA 3W2IA 2I33A 2G1KA 4MWOA 3SZLA 3HCOA 5K0CA 5I3CA 2YHAA 3VI4B 1KE2A 4IMPA 3ILSA 1FFGA 2Z6QA 4TS9A 1IVNA 2ETXA 1ADBA 2ZYDA 3VX3A 4PNPA 2C5FA 5TMDA 2Q50A 2LV8A 2C9CA 3OH8A 2DCMA 5GGYA 3T3DA 3OCVA 2EW1A 3O75A 4LE1A 1QH1A 4ZA2A 3BMNA 2E18A 3M2PA 1HDCA 3CNBA 3DBRA 1WHTA 3KL4A 3VC3A 1H1LB 1WW3A 3NKFA 3QXGA 3S7TA 3H2YA 2BFMA 3ZXUB 2PSFA 1N9ZA 1N8SA 1QH8B 2CLDX 3MTQA 4ZT7A 5GJWC 5I7SA 2WTBA 3UKDA 2FPUA 1DWUA 1KOJA 1PJSA 1W4ZA 2VAMA 4R2KA 1K2WA 4UUPA 3TWOA 1FIUA 1T9HA 2FWIA 3IBYA 4EYQA 3U4QB 4A0HA 1T9BA 2O2SA 3ORRA 2FG7C 4PHHA 1OXMA 1SXJC 3U09A 1VCIA 2NV6A 3G79A 3F1KA 4RDXA 1KYXA 1ABEA 1ISHA 2Y27A 3RU9A 4YCSA 3N87A 4QREA 2C5BA 4XPIB 3QOXA 1H4TA 1XEWY 3TQCA 3GGSA 1OMOA 1OA1A 2PY6A 4C7JA 4PIVA 1P4HA 1S2DA 3ZH9B 5FBZA 2V0GA 1UKBA 4GC5A 5AKIA 2HA5A 1IY0A 2E55A 4LY3A 4YA6A 1A9XA 5EJIA 3CZQA 1N0IA 3O84A 3AF0A 4YRQA 3RTBA 1C80A 4GI2A 3ZWQA 3BCSA 5D7BA 3MM4A 2QPAA 3TXAA 5KYNA 2ZSHA 3Q72A 2QVYX 5CMLA 1U9ZA 4QOGA 1UZAA 4KB5A 3AW9A 3HYNA 4B8YA 1IZZA 1XAIA 1WP9A 4FBLA 4GX0A 2RKOA 5JHHB 1WMEA 4Y2GA 4CTKA 2ZYSA 4G0PA 4EG7A 2WJJA 1GPH1 2P9FA 2V6JA 2GRUA 1DFGA 1O0SA 2AOTA 5ESRA 4FI3F 5ALHA 3QW4B 1DKPA 1XELA 1MUUA 3PGMA 4JJZA 2C7RA 1GFIA 4B09A 3FYUB 1RI1A 1X80A 5ERXA 2Q6IA 2VDWB 2ZI5A 3A06A 2YNMC 3S1AA 3WIEA 5BSHA 3OIYA 4G0VA 2Y2VA 3IMEA 3R9IA 1U63A 2QT0A 1KEZA 1QB8A 2QVLA 2CYCA 4EA6A 4YEDA 3UJAA 4DIKA 4EF6A 4B81A 2GEUA 5TQ2B 1GPAA 2VHZA 3A4VA 3R6LA 4Y9RA 1UM9A 4YLGA 3ILYA 5FBHA 4CKYA 3BZUA 3H65A 1Y4UA 1Q3TA 3NC0C 2PMFA 2W8BB 1WJGA 3FPAA 3FKSA 2UXDB 1NG1A 5LBUA 3ZCPA 4ZHQF 3OSUA 3R7FA 1PJ2A 3JZMA 5TB5A 1SXJE 2X2PA 5IP5A 2IIQA 3JZDA 3MBKA 3RUEA 1R4NA 2PYZA 1CULC 3Q1KA 4RZ2A 3KC2A 3B82A 4RY9A 4UUNA 2C7PA 2AIRA 3RBXA 4JI4B 4HNHA 1W0JA 5CCEA 2ZBGA 4E12A 4ECEA 2EJUA 4HLUC 4OI2A 5CD9A 3U7EB 1XCJA 5IF3A 3BICA 2AMFA 5BRNA 4DE5A 1Z16A 4B47A 4PW0A 1XU7A 2VYND 3KAKA 1F8YA 2DHCA 3EH2A 4JL6A 3GNLA 4YFVA 5LLSA 4LF7B 3W79A 3G2QA 3T7TA 3JQCA 1P2BA 1GN8A 4P4GA 2O8DA 5D86A 2I2XB 4Z1OA 4OHXA 1E77A 3SYTA 2C4WA 4KQHA 3A3YA 5IU6A 2QW8A 1XP8A 1J2UA 3HCEA 4C07A 2F4VB 3P9SA 2BGKA 4I6JA 4US1R 3V00A 2BEWA 5KIAA 4DMGA 1R00A 3C3KA 4G3XA 4XPZA 3VJRA 2PGDA 2YFQA 3PWZA 1OWLA 1R2QA 1KQNA 3FY4A 3LKDA 1I9CA 5E6RA 2X9LA 1O87A 3QY0A 3QTLA 2IU0A 4MV6A 3A25A 5AKJA 1YE5A 4J07A 2JI9A 1NG9A 2PBFA 3K2IA 4MYRA 1PZNA 4KC0A 4XLLA 1SN7A 4ZODA 4FN5A 3JWEA 3HZHA 1U8UA 3N1UA 4X5OA 1ZICA 1ATZA 2PIDA 5ARBA 5DNYB 2FEPA 4ALMA 1PL6A 4PC7A 1QQAA 1ZOSA 2XY4A 4EG8A 1QZTA 1P29A 4LZJA 1NMYA 3P2KA 1A98A 4UHBA 1M6NA 4CMBA 3U6KA 4CM5A 4BRSA 2JAUA 4GLFA 3NGLA 5M7EA 3CPEA 1B0UA 1X8KA 2BW0A 4GPTA 3RC8A 1CW2B 1X42A 1ZK2A 3BCUA 5E1OA 2AMJA 1M2WA 3J81A 4Z4FA 1EDZA 2QIPA 1LV8A 2ZBEA 3BIJA 2I6QA 2RI1A 4NBUA 5A5VA 5LQKA 3HMQA 3H19A 3PHJA 4L2IB 4YRDA 3HE3A 4IW3B 3A4LA 1MG5A 2CV0A 5EA2A 3PDHA 2GCIA 1OZAA 4NARA 3ETJA 1CZRA 2UVDA 1AY0A 1JKIA 1TUEA 2ATIA 3FCYA 2BJWA 3LP8A 5L3QA 4A6DA 2FJUA 4CMAA 2IYWA 3C3YA 4IHJB 1RXEA 3PV0A 4HDKA 4KVFA 4KXMA 4X95A 3T6KA 3R9WA 3FYUC 4K87A 3A11A 2XMPA 5CXXA 1Q0ZA 3IIIA 4BLPA 4E5VA 5B37A 1CY6A 1SKBA 5BNTA 1NUHA 1UBLS 2HIMA 2Y0CA 4AO6A 5J43A 2BGGA 1I32A 3DHNA 3GD7A 3OQ6A 3N58A 2NUTA 4YHBA 3OF2A 2WRZA 1SHKA 3KFXA 3UHFA 4ZOLA 2ODQA 2YIJA 1KYQA 1Z6XA 1QFSA 3KT6A 2XE6A 2QTNA 2HUNA 3BWBA 2QG4A 1MVNA 3E22A 4OQYA 5THKA 4E4YA 5KTMA 1OPRA 2L0XA 3I73A 1BXGA 3JALA 1OKKA 5AI9A 1IAQA 1L2TA 4L85A 3QVOA 4DXHA 1P4SA 2FTKE 2FFRA 3WJ7A 1U0LA 2PFSA 5C7OO 1JXMA 2FETA 4ZZIA 5FOQA 5MDHA 1MPTA 4KGDA 1XZKA 4EFKA 3P8ZA 4Z2AA 4K6OA 1BSVA 3KE9A 1FUYB 4DXDA 4A16A 4FXPA 1N6IA 5G40A 5FFNA 5CCBA 3NONA 1TMKA 3O8OA 4UHFA 4XM0A 1V5IA 3F6RA 2PXHA 5KOIA 4WOBA 3X43A 1I5EA 16PKA 1J6UA 4J7UA 5DT2A 3RV3A 2G7MC 2WKWA 1CIPA 1FVOA 3L43A 3SWWA 4HNSA 4HHEA 2N3ZA 1CUYA 2E5WA 2NO5A 5CIQA 2G1UA 5CT6A 5H4GA 2WV9A 5ULLA 2YH2A 3PCTA 4PQRA 2C3UA 3QKSB 2FN3A 1SIWA 3G17A 4CLXA 4XJTA 5REQA 3TMKA 5CTAA 4FCWA 3BRQA 3BJRA 3FSGD 4JXJA 3GEIA 4KQMA 4MVCA 1FTYA 4ZU1X 3IELA 4R1SA 1R0BA 4YP6A 4E2YA 4X1OA 5JCJA 3TCXB 4RPKA 1K06A 2CFRA 4HWPA 3U37A 4OQQA 4D4GA 2HKIA 2IEAA 5IUJC 2I99A 4O33A 4H60A 2OZKA 4RX1A 3WRYC 1IBKB 3A37A 4PBTA 2Q3CA 3Q1LA 3KD2A 3OFVA 4PVDA 5ICSA 1QGDA 2BH2A 2HXYA 3N8IA 2EW8A 1JQ3A 2EQBA 3HA2A 4OK3A 4H1VA 3M4ZA 1XR3A 2QM7A 5FWDA 3ZQUA 1NKVA 1SBIA 1T91A 4TTQA 3LK7A 3WSWA 1D2NA 1NJ8A 2ZAGA 5K20A 5LP6A 1XMSA 3E23A 2E1RA 3NOVA 4C4XA 1I6KA 1O7JA 1V3QE 1MH1A 2XCLA 3F6EX 3K1AA 4IDHA 1M8GA 4CEJB 3R7WB 2YN0A 4IQ0A 4XCXA 3B1JA 4Z9FA 2Z0MA 2VF5X 3VTZA 5JFTA 2WHYA 4XCQA 1E1QD 1TECE 4FFMA 5IYZB 1OC4A 1UZUA 2ZBUA 2OVFA 4L4UA 4EM6A 5DCUA 2VNJA 5EFZA 3QNMA 1LEHA 2ZR8A 4FMPA 5IH7A 3H83A 4YJ3F 1CIVA 4Q3BA 1KTVA 2E4UA 5CFNA 3B6JA 4OAPA 3HO1A 4CQLA 1LK5A 3WV4A 1DC7A 3GFTA 5C5IA 4Q18A 3LW8A 5CCXA 4CRWB 1AHNA 4KO2S 3KQLA 1ML3A 4URWR 4TRMA 2HQSA 3TBHA 1A8HA 2AWOA 3Q8WA 1BEZA 3H2JA 2D74A 1B3BA 1Y8RA 2BM9A 3C14C 3DKKA 4IOMA 3TTSA 4MRNA 2AN9A 2O5EA 2EHJA 1IMOA 1Z8HA 3EGCA 1EZ4A 3DL2A 4PSDA 5EPUA 3WRXC 1E9AA 3NCHA 1SVUA 1T36A 1SNYA 1WMDA 3DUFB 2YHBA 2OCXA 2YWGA 3R09A 3U3RA 5DF1A 1M6EX 1QO0A 1TYCA 3G49A 1K4KA 1VE6A 1SCDA 3N8NA 4RXUA 1H6AA 5K3FA 4WCFA 3O1LA 1H2XA 3FNEA 4PIMA 3AUJB 1EE9A 1NPTO 2ZRPA 3DM9B 1BQEA 3VR6A 3EGEA 7ADHA 1DI0A 4N5IX 4TVKA 3C7DB 2JC3A 5F1OA 4BMXA 3U4CA 1AJEA 3I9MA 3X1JA 4ACBA 1IQRA 2X1HA 2JG3A 5DHAA 5HJEA 3V4ZA 4HLNA 1RBZA 3T3EA 4FOTA 2HADA 1WVMA 1Y9ZA 3ROPA 2AK3A 4I50F 1QS0A 2EZTA 4OJTA 5G3YA 1W4RA 1FPMA 2O5VA 1VYHA 1SHTX 3C45A 4TMWA 1U8XX 3TQHA 2QHXA 1UWCA 1MN6A 4ZO6A 2QPLA 1ZI9A 3JQRA 2XCRB 5HWSA 4RD2A 1CRQA 1DBPA 1UBCA 1EVEA 2JIDA 2Q3MA 4QFCA 2PL3A 2XJ9A 2H54A 1EM6A 2QAGC 4E33A 4PTLA 1KAQA 4AZWA 2BBWA 1XN1A 2O59A 1DX9A 4Q15A 4Q4LA 3ZHBA 3ONVA 1CR0A 1J0DA 4AWAA 3CB2A 3FCAA 4F12A 4Q1BA 3HADA 3Q15C 4S12A 3S8MA 2C31A 4JT2A 4D4JA 1MXHA 3E9NA 1UEJA 2E6UX 3IV6A 4ZO4A 4FYYA 4Q9KA 3UA3A 1X7WA 2J5XA 4EY6A 1W52X 1F38A 4ZGWA 4BV2A 3LMKA 1IXZA 4JP8A 3GP5A 3IESA 4NZZA 2BGJA 5BO5A 4EG0A 3P9NA 3K94A 3COYA 4EX6A 3H0EA 2G63A 1TMYA 2P6OA 1HA3A 2J0VA 3GEMA 2OORC 3NHFA 2PDAA 4MQUA 2REQB 4H0NA 4MR8A 4TYMA 4X60A 4D6YA 3U4MA 5EYPA 3PFHA 1G9SA 1JPUA 3FBGA 2XTAA 1T2FA 2CMGA 2ZRQA 3BD8A 4IH4A 4MAFA 3DCJA 1D2HA 3MERA 2RE8A 3M9LA 5C8DA 2VR1A 1ZNXA 2VJQA 1NYRA 4E2FA 1Z34A 4URFA 2Q5IA 2YJTD 3NMUF 1B6GA 4FYHA 1A7JA 2IUSA 3K96A 1PGPA 3AGPA 2XA1A 3CRQA 4WRRA 1CB7A 1GQYA 1WZIA 4OYRA 4ZTZB 4TV9A 1YZTA 2FEAA 3E9DA 2JD2A 3FLAA 4IBOA 4X1IB 4K2AA 2D0OB 4RF3A 1FDTA 4D3YA 1QTQA 5KJFA 1F2DA 1ISPA 4KYTA 2ZM5A 1B4DA 5I48A 1Q84A 2ENWA 1ORIA 3BA6A 4DTIA 1ES9A 4OM7A 3VUFA 4PEVA 3LUDA 4F8JA 4I4IA 2DR2A 1BMFA 1W5SA 1E7RA 1XPJA 4ONEA 5LSAA 5EHZA 3ZVMA 1E1MA 1IDN1 2CUKA 4KMMA 2GBCA 1HG0A 4GP9A 2J0UB 4JLOA 3RK4A 4BQRA 1I4OA 4A36A 5KJ6A 3TE7A 1DAFA 4JQOA 2EZ8A 2PMWB 1SWVA 3E9YA 1NQXA 1J1UA 3AIMA 3QVGA 3I6MA 4IYJA 4PY2A 4U00A 5HFJA 2IYSA 1XBTA 4RD1A 5EZSA 2JZCA 3B7PA 4QVKA 1AT1A 1RLIA 4UQPA 5BV1A 4NZ9A 3PLRA 3TD6A 3ZHCA 1TEXA 2G3YA 4JBYA 4W63A 4UMVA 2OWDA 4PINA 1M0TA 4JLNA 4PLCA 2AR9A 5ALEA 2CXHA 4QT0A 4C22A 2HEIA 2XT6A 1WW8A 2PUVA 3DAFA 1G6Q1 5JXGA 5EMLA 5FLXA 2XITA 2FRDA 5B7GA 4EB0A 5CK5A 3AG5A 3FB4A 2V6FA 4B0PA 4C6TB 2D00A 1VPWA 1KY4A 1X1TA 4KR3A 1ISRA 1H2YA 2J7PD 4CEIA 4GMDA 4IF6A 1YNOA 4BX8A 3OCYA 1TB4A 2OB1A 3PFWO 3FR7A 3HXKA 3EULA 4RBNA 3V1TC 3WK4A 4NCAA 3LT2A 1MO3A 3H86A 1XPRA 1OX6A 4FMDB 1LBIA 1C2TA 3K0CA 4O4LB 1G4UR 3GLQA 3NPMA 3OU6A 3AEKB 1RWBA 3WRYA 1MRNA 3LCVB 4DJFC 2I62A 5FR2A 1LVGA 4TYYA 3WKDA 2VBGA 2H5JA 4PR0A 3CH6A 2B5OA 4GI3A 4YAEA 4UE3S 1G59A 4H1WA 3R3UA 2XRMA 5BSRA 1JU4A 3WBKA 4E31A 3CZ9A 1CVRA 3KVNA 3RC9A 3ASZA 3OQOA 5A4KA 4DRZA 2OOKA 4Z2YA 1NRIA 3T12A 2PSHA 4CQMA 5C8VA 1AV7A 1YR1A 5FLKA 3L49A 4K9MA 5FWXA 1K86A 1UPTA 3CZRA 3MT7A 4RFSB 2P1ZA 2W7TA 4EARA 6ADHA 4OHUA 2GNPA 2PSSA 2VJOA 3BZBA 4LGYA 4WOCA 3HHEA 4RAQA 3G2KA 4KFUA 3LP5A 5F73A 2OG2A 3IAUA 4WINA 3SBDA 3DCYA 5CLFA 1MTOA 5IAGA 1QGUB 5DP2A 1WBDA 1SVMA 1U0EA 4QQFA 1I80A 1T5DX 1K8QA 2CEAA 3H6GA 4ZGGA 2DR0A 3C8MA 3GQBB 4FYVA 5IKXA 1FQOA 2AH5A 5H4HA 1FQWA 4EECA 2ZWIA 2QJOA 3QLUA 1IM5A 4XIYA 5FPTA 5F21A 1IATA 4UAVA 4HDNB 4C29A 2D8MA 2WYOA 5D3MA 4MZDA 1YQXA 1MNQA 2VK1A 5IT5A 3WLKX 1R16A 1QTRA 4ZJYA 1QYCA 4X7BA 1YJCA 2HBYA 1IN7A 3RCBA 2ZLBA 5JCOA 1C8KA 3ZY2A 5IMSA 5A9TA 3C48A 2G9ZA 2A0KA 5E7JA 1WA5A 2WM3A 4FKBA 3R0IA 3K09A 1DTWB 4Q4AB 4C0JA 3MUOA 1Q17A 2DRIA 1YQTA 1JKFA 1SO8A 1UBHS 4B33A 1GP2A 2P6UA 1WDMA 4ZANA 2C9YA 2BN4A 3WG9A 2HEGA 3NAMA 3GEPA 2GEKA 2DWCA 3DDOA 3M8KA 2BWJA 1JA0A 3Q7TA 4BNVA 2G5GX 1K8YB 2HMYB 3R7AA 3LA8A 1Z36A 2FWMX 4KIUA 3PRJA 5JSUA 4K6GA 1JKMA 4DGSA 1Z07A 2GEFA 3PQ7A 1OLSA 3CUEF 3FMVA 3Q5EA 1A5BB 3EGIA 1J7JA 3UB4A 2QAGA 3NYWA 3JARA 2VDWA 5JR3A 3G5TA 2O9JA 1JTEA 1P8JA 2CLFB 4HH1A 1KDOA 4YJ2A 2IHZA 3DPIA 3AUTA 5KYWA 2GJAA 5JMPA 3E3LA 3NH6A 4DG8A 1W88B 1NPYA 4OEHA 5E9JA 2F64A 2O6HA 2GOYA 3T3IA 4HL6A 1Z8FA 1IHOA 3NM6B 3OOJA 1KFEB 1GT91 4FNAA 3DAYA 3M49A 1HOXA 3PXBA 5AW7A 1QX3A 1FDSA 3AF1A 3SHWA 1RWKA 4FGJA 2QAIA 3CSDA 3SVLA 2YRWA 4IUDS 5AVYA 4DSAA 1D6NA 3OZEA 9LDTA 5CG1A 1AQIA 3VNBA 4KACA 2ILTA 3CY6A 4Q7MB 4KN9S 4KUHA 1GDHA 3IERA 5GTDA 5HIMA 3EEYA 3CO5A 4B4WA 2P2LA 4NAVA 3QEMA 4U5QA 2NZUG 3AFOA 2VJKA 1ZRHA 4EYSA 2NU6B 5DSXA 3LHFA 5CFOA 1Q0TA 1W1UA 4IIGA 3QVMA 7ABPA 3G9UA 1WD5A 4KQ1A 1UEXC 4J1TC 4TYWA 4CN9A 5DOVA 4D7AA 4C4YA 4JK3A 3HCFA 3HP1A 3ZWCA 1UOQA 2W2OA 3HACA 5EG5A 4AKEA 5T8KA 2Q4OA 1Z5OA 5LYYA 4M8NE 2H1IA 3TJZA 2IXAA 4FBMA 1IHPA 2WTAA 1YTUA 2PUDA 1TEVA 3IOBA 4FFBB 2QTMA 2OCBA 1BS1A 4WTOA 1UKCA 3D1VA 1KZYC 1DAIA 2QMEA 1JAYA 4H7IA 4J7CA 1E2QA 2G0NA 3DE2X 1OYOA 3I04A 2Y1GA 3TLJA 3ZR4B 5EZQA 2VYFA 1ZO8A 2OXCA 4MK4A 3TVDA 2IEBA 2WWFA 5CVCA 2XXJA 1CJBA 4FDTA 3PNQA 3BSWA 5L95A 1W4CA 4FHCA 5IM4F 2X7HA 2B1QA 5TIIA 2NXJA 4M99A 2IGBA 2B92A 1BGXT 5CPBA 4F7WA 1FLVA 5GM1A 3UOWA 1J56A 1ZIPA 4C4RA 4EELA 1I7SB 1S01A 3R3WA 5KUTA 4O4HF 2YX1A 4YCBA 3VRHA 4HQFA 3W3AH 3ZHQA 3IOCA 4BV3A 2OAP1 1B6SA 4F1JA 4LHYA 1Z6PA 1X7XA 4NK5A 2B7CA 3JRNA 3N7TA 2AL7A 5H83A 4E13A 1PSDA 1ZJ6A 2N75A 4G1BA 4TRNA 1ONOA 4KFRA 5EZYF 1IZYA 5HE9A 2TYSB 5JALA 2DHDA 3PEVA 1JG2A 5TQ0B 5LOVB 1IEVA 3ZDBA 2CFOA 1QDEA 4QGSA 1W5BA 2LWIA 3ZHYA 3CE9A 1M7BA 3AR7A 3GZNB 1NVVQ 3D3QA 2QTCA 1KI4A 4HDMA 4I14A 4TS1A 3X3HA 1LQ2A 5J5AA 4CF7A 3CVWA 1RTKA 2YUTA 2FPPB 3AZOA 3UAOA 1O4WA 3ZX4A 4W8GA 3NEJA 4DW8A 1UBJS 2J09A 2P5SA 3LVFO 1SKUA 5K01A 2AOUB 1MJNA 2AOUA 4MV8A 1YBHA 3IE1A 3GLFA 4LMBA 3TNFA 4YCMA 5E38A 4KVAA 5EI5A 1WNTA 3CU5A 3H2SA 5ALQA 4ATNA 2GPTA 3CKLA 3FNGA 3EXHB 2X6TA 5BR1A 1XT6A 1DJLA 1KJYA 2WDPA 3H3JA 3RU2A 4MS3A 4KREA 2WIFA 2Q2VA 1GFZA 1SA0B 1LDBA 2NYAA 3PNOA 1QDLB 5TQ0A 4CQJA 4D4HA 1IBSA 4YRAA 4C2UA 4M88A 2DQKA 4P3KA 4Q3KA 3NIFB 4KMSA 4WK4B 4NICA 4NYIR 2DZDA 4J76A 2CMHA 2GD1O 1AB6A 2DWOA 2QRLA 3V97A 2J3QA 2IYQA 3N7UA 3PL1A 3ZDAA 5IJ9B 2FPXA 3UJDA 1LSSA 1Q92A 4E5YA 3DL7A 3TTXA 5JDIA 1KI1A 2I29A 5ILQA 1RYHA 1P5ZB 5AP9A 3HA7A 1MJ5A 3HZOA 2NTVA 4B46A 1ANKA 3OIGA 4GMXA 4M21A 2VBCA 4OJYA 3NXKA 4DCPA 3D8TA 2Z4TA 3T99A 3W8RA 5JWOA 4RS3A 1T4BA 2ZB3A 1NXXA 2D5CA 3OKFA 1OI2A 4NABA 5TJ9A 3RC3A 4EFLA 1K2VN 2QE6A 5A4JA 5BSGA 3MOSA 1N1DA 3HKEA 3L7NA 3PWSA 3UMMA 3LO5A 1H5NA 3NBUA 3R0ZA 3VVMA 1UJBA 2NSYA 5K0LA 3P1JA 4U7TB 2WF8A 4HTFA 5B2FA 4LY9A 1RPJA 1E6CA 3PEWA 3BFKA 1TUBB 2MWMA 2Z2KA 3K8YA 5I5EA 3JQGA 5BMVF 1TZKA 3K9WA 3UMVA 4R9UC 5ENZA 3T06B 2IT1A 2NIPA 3FZNA 2CJYA 1P18A 521PA 4ARVA 3WIDA 1XEFA 5TLSA 3KV3O 3EZXA 4TLAA 3UT6A 4ZAWA 3ZLJA 4B8ZA 2PO7A 1RC1A 3TSZA 2R66A 1D2CA 3GEGA 4N0QA 4WSOA 4NJEA 4Q16A 1N3LA 2NU6A 1RHUA 1NXWA 4RM3A 1ODIA 1ZH4A 3UJCA 3EGOA 4EG1A 1Z7YA 2CBGA 1D04A 1S2OA 1C4KA 1SMKA 1YUMA 1ZW6A 2VKTA 4UKDA 4A1FA 3LQFA 3AF2A 4AXXA 4HB3A 4YUWA 5CYGA 1N9KA 5C1DA 5LUAA 3F1LA 4F3KA 1NV8A 1TKRA 2QLJA 4EK9A 1MEEA 4OXYA 3QU7A 4X91A 3VHXA 2X5XA 2QQGA 1Z4MA 2WFLA 5HDBB 4NU0A 5J2UF 1PJZA 3GRPA 1FVXA 1E2IA 2ZTLA 5H7XA 4YREA 1G4AE 2AC7A 4YDHB 4RKRA 2ZSFA 4PG7A 1JE0A 2R96A 5HILA 5J4VA 4ALLA 1UFRA 3DONA 3EYWA 3N39C 3O6VA 4LJ8A 4MITA 4OG2A 4F6RB 2WHPB 4CETA 4JUAA 5FP0A 5C8YA 2YC4C 1MOZA 3ON5A 1VDMA 2OVBA 3ZLVA 1O95A 2EVWX 1D9ZA 1MKYA 1QTIA 4NCJA 4QGFA 5FHRA 1HZZC 3NGXA 4HDOB 2ZSEA 4NDZA 4AYXA 4CODB 5JSYA 1F0PA 3LDFA 4ITUA 4KVZA 4AY6A 4WL0A 3RUIA 2AXQA 3E9RA 4GXNA 3I76A 5JD4A 1M74A 1BN7A 3PDIA 4X1YB 2B6HA 1U2PA 1WIWA 4CHTA 2BCGY 3BRSA 4F9FA 2CXTA 4I46A 4Q1AA 1MX5A 2FMIA 3N2ZB 3OE4A 1FRZA 5AQEA 2Q5FA 2R8OA 2HAEA 2BI7A 2GD0A 3I9OA 1PT5A 2VI5A 3DO6A 1S2IA 4ALIA 3IL2A 3T1NA 4QBTA 3BJMA 2WYHA 1Q50A 1STOA 1DQSA 5BT8A 3IAS6 2LR0A 2P9EA 3AVPA 2OZLB 3THYA 2RFLA 2FMFA 4IHJF 4EJSB 4JUIA 2PTHA 4MMXB 5DTQA 2WB2A 2Z3VA 1YR2A 5EKUA 3U7IA 1UDXA 4IP0A 3FOAA 3ORQA 2GK7A 1X8XA 3BXEA 5FNVA 3SZUA 4CDMA 5ECGC 2PMCA 1NJFA 1P1JA 2VRCA 4MCIA 4XTCS 4LZWA 3DMTA 4WIAA 1WG8A 4HEQA 4QU0A 2XGGA 4FJ1A 4YT5A 1XQVA 3IUBA 2V59A 2PLRA 4BCBA 1WXWA 3VR5A 1NRJB 4Z4IA 3U19A 3EC1A 4Y2YA 4R16A 3FRHA 5FD8A 1AURA 1XCBA 3AOGA 3GZ4A 4GZ3A 1Z7BA 2WLSA 2F9FA 3HEBA 3P94A 3D0OA 5DLQC 4CF3A 1XJWA 4YJ3B 4GR9A 3N74A 4RVHA 4XB1A 2C7VA 3U0BA 1SC9A 2BFFA 3ADPA 3LUHA 1QH0A 4EP1A 5JROA 5ALUA 5FPYA 4ITRC 3D4PA 5IZCA 3A3PA 3BFPA 2OC9A 3HMKA 2H2GA 5ALYA 5TX7A 3E3OA 3WP1B 2Q5JA 4OHBA 2A5JA 3AINA 2CHFA 3WMGA 1V39A 3AUYA 2WYIA 2XB2A 4HUQB 3T1HB 4C0LA 1N8NA 4YXWD 3ASVA 1WUKS 2OV8A 3B20A 3P4YA 2OK8A 4MJ7A 2GB4A 3COJA 3DVQX 1F9AA 1YAJA 3DBHB 4D8WA 3NORA 1NVDA 2Q1TA 4C88A 3U39A 3M4XA 1GNTA 3OCCA 3C6QA 2QTVA 5TV2A 4MIOA 2X6RA 1QIMA 3PIDA 5FI3A 5IK2D 5K8IA 1OD6A 2CNKA 1P0CA 2FP4B 1BOOA 3IT2A 4EPRA 1WXQA 2IXFA 4CR6A 3D8BA 4FNOA 1GSAA 1I1HA 1MR3F 3MGCA 4H0CA 5EPOA 2RGYA 4K40A 5HQTA 1DWQA 2GNOA 1EBFA 2WJVA 4BNDA 4CF6A 3W78A 3W06A 4EHFA 1MEJA 2VUUA 3EJWA 1YCDA 1ZD1A 2RG1A 3BC1A 3G0GA 1M5UA 2Q7XA 1CKEA 4IHAA 4OXQA 3WZLA 4J8PA 2I4TA 2YXBA 3TSWA 4HCJA 5C0OE 2W90A 4URVR 1I7NA 4ARUA 4OU4A 4LEIA 1PR1A 5IWCA 1OLXB 1OASA 4HOYA 1YZGA 1X7GA 3OE7A 4WKPA 4RDCA 3VPFA 5LP1A 1OZGA 2JK1A 4ZPXA 3UAGA 3U48A 1VJRA 4F2GA 5DM1A 1AS3A 4G37A 1DJMA 4P7KA 5EJ4A 5DN9A 3SDZA 5AVJA 4N8DA 2VXYA 2ONCA 3LVQE 3FPHA 5AUQA 3ER8A 1A82A 4C2TA 2MSLA 1YC5A 1NW6A 2WWVD 1T9GS 1NKTA 2YMPA 3T38A 5BPHA 4DGQA 1IXYA 4KXLA 1JSCA 1T2VA 1T13A 5D01A 3DDHA 2NT3A 3CUSA 2E4WA 2POQX 2BFEA 1VPDA 4MGEA 4IVNA 2Q29A 1LCIA 1EP2B 2QTWB 3KXPA 1QFJA 3RFFA 4RYDA 3IC5A 4J1QA 1BEEA 5F52A 3RYFA 1OFHA 1ZD2P 4CG3A 2PA0A 4HEA6 3U60B 3MCAA 1T6ZA 4G9EA 5LMUB 1E1RD 3RW9A 1C3OA 3LQKA 3NT5A 1FQJA 3GUVA 3SHFA 2QR5A 3CG0A 1K6IA 4OLFA 1JWAB 4BGUA 4JLWA 3VZBA 4V3BA 4JFRA 3ZU6A 1AX9A 1L4YA 3DOIA 4RTMA 1HNZB 3LUFA 4DDUA 3DBVO 4K9LA 2QWXA 1UINA 3AESB 1M67A 4QUIA 1ZOOA 1RAAA 1USVA 2FF5A 3A31A 1MAWA 1IXSB 3V7NA 3TUZC 4BMNA 2P2SA 1RYNA 3FWYA 4BX0A 4CYMA 1V25A 4LWPA 3C3XA 1F7VA 4V0RA 1L7AA 5P8WA 4W7IA 1EP9A 4A2WA 3CNEA 2VG8A 4N7JA 1Z15A 4DB4A 5CRIA 1J90A 3FUTA 4PYMA 4ZYXA 1UM8A 3LNTA 2O52A 5KQLA 3G2NA 3E4CA 1KQFA 1PF7E 2ONYA 2Z5LA 1V5EA 3FETA 3IUEA 3MSXA 2KBFA 4GOXA 4WLNA 4FX2A 5KAMA 4NE7A 5IASA 3VR6D 4G1UC 2WUGA 3VZCA 1T4GA 3G8DA 1BCRA 2V7WA 3WL6A 3WQQA 2IZOA 5BV8A 1XZ8A 3FGZA 4EFMA 1SURA 3W2HA 2LW7A 2FEKA 2ZQ5A 4URYR 3L8EA 1M1UA 3P45A 5AVOA 3CNNA 3TOCA 1M34B 1SCIA 3QENA 4D2IA 5GONF 1NURA 3IUQA 4RTJA 3SM3A 1XC7A 1M5RA 2AW3A 1B2RA 1FL9A 4JD5A 1PZGA 3TFOA 2ZPTX 3QFCA 4AO7A 4IIJF 4DIBA 1NHGA 1H8HD 4UTXA 2VDPB 3BXXA 4WDQA 4Y2QA 1UBRS 2VSQA 3ZY6A 3TSCA 3UMSA 1NAIA 2FZEA 3ZIAA 4WVLA 3TF5A 5EUBA 4U3JA 3U3MA 2AZXA 1IZ9A 1RRVA 2C83A 3PE6A 1R66A 2DY0A 2ATXA 4B43A 1O96B 1U5AA 3F97A 1RBQA 1XZEA 4WLOA 1G3UA 1R88A 1ZZGA 3RHZA 1J20A 2IYFA 1ZL0A 4I5IA 1M2HA 1NF2A 1MQ9A 2NTEA 5EFOA 2FEXA 3S3TA 2QR2A 2HHCA 3E7FA 3CINA 1ZITA 3ODGA 2O8BA 1G8JA 1NL3A 4BU1A 2IZ0A 2CNLA 1RWNA 1PEDA 2I6SA 5KNDH 5JMWA 2FRXA 4ACAA 1G21B 1VKZA 4JL8A 2B7BA 3JSXA 3VOAA 1MC4A 1GA4A 1YS1X 1LB1B 3GLVA 4CFZA 1QMGA 2Q8QA 3HJRA 4TSRA 2BCJQ 2P3LA 1XQ1A 2IHNA 3WIVA 4DEXA 4MR7A 2FVXA 1TZ2A 2O2YA 3KELA 4HQOA 4JUBA 4OYLA 3QVWA 4V0ME 1YQEA 2LKDA 5F77A 2ATEA 2IW1A 1ZM3A 3Q12A 3RODA 1BDBA 3ZBUA 3V3TA 4MI3A 2PSJA 3BTUA 3DNFA 2WMYA 3ET5A 3PA8A 4RVGA 3EFOB 1PG2A 5IXYA 4TL6A 3EXG1 4WOKA 3OJWA 1Z5ZA 4A5SA 1H3EA 1NYLA 2ZAIA 4Y6GB 1ISSA 3KYDB 3KZKA 5KOYA 4IDGA 2EX1A 2C97A 1ZNQO 1ZVKA 3SKXA 3HKCB 4NEHB 1ESMA 821PA 2YV3A 1ECCA 2R84A 1YMUA 1Y5MA 4EMBA 1XRLA 3SLGA 2F3QA 1GPNA 1FDOA 3NTRA 3DTVA 1C0PA 4Q05A 1MABB 4OJQA 2OENG 4PX9A 1CWUA 4Q9HA 2GO7A 1E2NA 1G5QA 3L02A 4XKJA 3ADDA 3WRVA 4JIMA 5BNWA 3ZYCA 1XPUA 2D5LA 4KPFC 3CBQA 3PVSA 3DLIA 1FDRA 1L8LA 2CCJA 1UJNA 2BSXA 1IN6A 1SU8A 3L6EA 4R01A 1KO1A 3UXHA 7REQA 3QE2A 3D2BA 4IXDA 1VKHA 2WJWA 3JWHA 4M54A 5HKKA 1VKNA 1T6BY 1CQIA 1FEZA 3KHSA 3R3VA 3OMXA 3UCXA 3ZE1B 4S24A 4CKEA 1YZ3A 3CVVA 3EXAA 2QMOA 2LDBA 4ND3A 1TLTA 1DRUA 4PYRA 2YXDA 1T8RA 1PS9A 1Z2OX 1RJDA 4ZU6X 1PP4A 2YZ7A 2QD2A 1Q83A 1GFSA 3IQXA 4Q7LA 3NU1A 2CT8A 1LV7A 2QG9A 4F1KA 3N2NA 3CB4A 4QPPA 1SVWA 1WEHA 4UEQA 3KKLA 1BWSA 1LF0A 3JQAA 5D1HA 3B78A 2O7VA 1G6KA 4YN3A 1YHYA 1TUBA 4NCNA 2ST1A 4FJ0A 5FNVF 2J1LA 1WPRA 5LCXA 1E9VA 5G0UA 4RF5A 4OLAA 1KTIA 1QQBA 3L6BA 3OLYA 2QU7A 1XZIA 5D2CA 3A0UA 3HXTA 2QV7A 3ZV4A 1S7GA 3GV0A 5KYYB 5LP6F 1NOJA 1CUXA 2A9JA 1VBFA 2W0MA 4QDUA 3K2EA 5CR9A 5J58A 4AQ7A 3HY3A 1KJWA 2B8TA 3MQFA 2MSDB 3BJZA 3I2FA 4L57A 3TAXA 1DKQA 3UGQA 1YA4A 5EIFA 3V55A 4WBSA 2RGRA 2EJWA 5ERGB 1OSNA 2VQ3A 4MQBA 1NW3A 3GJRA 2NTYC 1V1MB 2B4RO 2IU4A 4ZDIA 1S0UA 3AIKA 1RAFA 2W00A 4CNBA 4G84A 2QRKA 4J9UE 2GDJA 1A4XA 1Z29A 4U1RA 1ZJYA 5A6SB 4Z7NB 4UEOA 5JTUA 4PAWA 1VG8A 2K7FA 4UTOA 4ZAZA 3LDUA 1BROA 1VLVA 1HFKA 2VYCA 4JI1B 4CF4A 4BVAA 1IZ8A 3ZXYA 4XYMA 2YW2A 2XLBA 5IKEA 1US8B 1O9BA 1WR8A 2SICE 2HDOA 3F4KA 4LTMA 1YL7A 1YOBA 1XZHA 4RHYA 2W4IA 1QVAA 4WGGA 1YQDA 5KSPA 4L95C 4ZAYA 3W7VA 2XXAB 3WRXA 3I6BA 3PIIA 3T3HA 1T2DA 1ZA2A 4MX8A 3WYNA 4XEUA 3WK9A 1WMAA 1FS4A 4NFHA 3RKUA 3OWOA 3WTBA 3CVOA 4GR4A 2UYCA 1GR0A 4MVWA 4UBOA 1KBQA 3K92A 5CLHA 2B1RA 3WQHA 3IIEA 1FNSA 2B35A 5HFAA 5BSUA 2H1OA 3HJHA 1NVEA 5HGXA 1V7ZA 3FJOA 3VU9B 1V35A 2YJ3A 3O26A 4B6GA 1IHUA 1ZGGA 2XT9A 3PUJA 1H9AA 1F51E 4FGUA 3G8BA 3U7QA 5BN5A 1DZ3A 1I4TD 1LRKA 1W0CA 1E2HA 2PH5A 2VVTA 2IU3A 1OLUB 4TXNA 3VKUA 3NFYA 4BTEA 4EGFA 4EUKA 1JFTA 2A58A 4RY8A 3GLIE 3C5EA 2FSGA 2QMUA 1FYXA 2Q45A 3CLKA 4LXXA 4J0KA 4O3MA 4K86A 4ZVRA 4LBVA 1N57A 2ZQZA 4YQEA 1YVPA 3A0RB 3W3ZB 4WADA 2G8NA 2GYYA 1JKJB 3OI7A 4A3SA 4BDTA 3BBLA 1R0SA 2OV4A 1QVZA 3HVKA 1FLAA 1UP7A 3TIIA 1T1EA 2IZ7A 3FMIA 5DNDA 5EWJB 3EGDA 5KJEA 3ZW8A 2P90A 2G40A 4MWGA 5F2NA 4KO8A 4RACA 3WJAA 3REFA 3CKYA 3PIRA 3O1JC 4UJ3A 2UUCB 4O29A 2ESRA 1DKLA 2E3JA 3ETDA 1MO6A 2AI2A 3JRXA 1KMQA 1RZ3A 1RZVA 3SE7A 3HCCA 4HD8A 4F38A 2IOYA 2AOTB 1RHRA 1Q44A 1PFKA 1XWIA 1IIRA 1O08A 2HDNB 3I58A 3PRYA 5GOZA 3WB2A 1KZGB 3P2JA 3PYMA 4D0LB 2WJIA 1U90A 3P2OA 4HG2A 4KMRA 1J7KA 3IBCA 2VAVA 4DM3A 4DF3A 1E32A 4B45A 5IKOA 2DPMA 2ZRBA 1ZHHA 4M0DA 4RA6A 3G02A 8AT1A 2Q6OA 1RHMA 2DQ4A 1RMYA 2E4AA 1G16A 3K9BA 4QWWA 5AHKA 4BNFA 2BAGA 4O4IA 3UWPA 3PJGA 4Q02A 3T9EA 1YIOA 1XIVA 3BIOA 3ASUA 2XE7A 3C4JA 3EXFA 1Q5PA 3WMFA 2QTRA 1MDFA 2D3TA 3OD1A 4HWKA 1N5LA 3QEMB 5FO1A 5JAQA 1QE0A 3N3AC 1OTXA 2PLFA 1U2QA 2QZJA 4RVNA 4E5PA 5K2OA 4D9JA 1NNEA 1NBHA 1POWA 2EOAA 4DB2A 1KZ9A 3C43A 3RSGA 3V8BA 1Y1LA 3NANA 4JNKA 3TFWA 2NUBA 2EZ9A 3KJZA 4B4VA 4BNMA 5B30A 3ROXA 3BKWA 1IOVA 4D9GA 1R0XA 2GXUA 4IOKA 3UXEA 1L4MA 3NM5A 2H2FA 1DMRA 1P0QA 3KUCA 3ZV5A 4BNKA 1EBBA 3HDJA 5AVRA 3G9XA 3OTHA 2FPMA 3CF2A 4ZD6A 3OE1A 3GVXA 4AY5A 4TS4A 3RS9A 2PXCA 4B3RB 2IIPA 2VSXA 2PL5A 3EIHA 1CHNA 5JWRA 3QG1A 4XIGS 3DEJA 3RABA 3UGTA 1F9EA 1TKBA 2X9VA 1CCWA 3MC1A 3ACDA 4X61A 5A3VA 4CQMB 4CT5A 2BMWA 4JSYA 3DWGA 1L3BA 4K0RA 5JVDF 2F7SA 4H0FA 1NRWA 9ATCA 1GUAA 1RP7A 5F7JA 4LHXA 3TLXA 4C3UA 2CLOB 4PHFA 3QPBA 2HK7A 5DSZA 1YVRA 3UHOA 3LCUA 3NHZA 1YRAA 2C5LA 2CJFA 4OMCA 4BHTA 1WDWB 1H2AS 1QIKA 1AS0A 4RXMA 1TLLA 2VAWA 2XVYA 1M0EA 3EUFA 1CUSA 1YT5A 1VXRA 2PGOA 5A0TA 1R5BA 5F2EA 1LWNA 1P1FA 1T0IA 1XXHE 2O4UX 4FHFA 4G2TA 1FFHA 1N34B 4P5PA 1OLUA 1WXXA 3PFKA 2FNAA 5AJHA 4EW1A 3GP8A 2HK8A 3KSRA 1JNYA 4S0ZA 1AE1A 1KY2A 4ZAGA 1PBNA 1R9NA 5KTTA 1W5FA 3C5CA 1W8IA 1Z7EA 2EU8A 3H8JA 3OX2A 3JYLA 3NHMA 3JQAB 4NAUA 3T9FA 3RUCA 5H68A 2UYHA 3OU2A 4PXYA 4X7MA 2RGGA 3O7MA 2RAPA 3QQPA 4PYKA 1GZ3A 2VYNA 2Q5QA 4KK3A 4UTVA 2IOHA 3BHJA 4BQNA 1WZ2A 3ZDFA 1X7WB 3HBAA 3FCXA 3W5IA 4HXYA 2E85A 5CA0A 2FAXA 4JLKA 5JZOA 1BTOA 1G64A 4ZCRA 1E2DA 1IY8A 1NQAO 3HS3A 5H81A 4IY1A 2DB3A 4IFBA 2QTZA 5AW2A 3RVKA 1M1NA 1O97D 1EM8A 1Z4QA 2P65A 4OQPA 3UWSA 2HHJA 4CKBB 4E5SA 4MHTA 1K75A 1HDRA 3KEOA 2EYUA 1GNPA 1HG1A 2XVMA 3QVGB 5EIBD 5C8YF 3UYKA 2WTUA 3EBLA 4KJXA 2YXPX 4YC7A 1US8A 4RJLA 3LC7O 1W2WB 3I12A 2A0FA 1E9RA 1QSGA 1H2HA 4J43A 1J0XO 3UB3A 1XFDA 3U26A 2WWYA 2B8EA 1KL7A 5A6SA 1TAHA 4IDDA 4M1WA 2R6HA 3KTFA 3AI1A 1Y6FA 4LDQA 4TWZA 2DWPA 2JIRA 1E7MA 2GWRA 1I13A 2X8AA 1U7WA 1EBUA 1FCJA 4AMGA 5C18A 1TJ5A 3MBOA 3TZEA 1W85B 2EFJA 3LV8A 3U61B 3IA7A 1D09A 1NATA 2NO6A 4M1KA 4EI9A 1GCIA 2QTTA 2UUOA 4NENA 5LZ4A 1YBMA 3HA5A 3K1TA 3KUUA 1R10A 3YASA 4YTEA 1C2YA 1H5QA 3C85A 3B1ZA 3I01A 4BVBA 4OXRA 2FWRA 2IYXA 1CT9A 1RQNA 1E2GA 4J1TA 4XYLA 5CLJA 4O4IF 4FFRA 2FX2A 2GAOA 2QZ9A 3SC6A 3R9XB 4CMCA 1RYEA 1GRCA 3HABA 2GN2A 3IR7A 4O2AB 4LYHA 5EE3A 5DO9A 2TMGA 3IAM1 3NCTA 2K5UA 2J9GA 4AN4A 4FZVA 2F8LA 2ZTUA 5KOJA 1Q0PA 1KFBB 1MZVA 1QYIA 2QI9C 3AM4A 3CFYA 4CT0A 3B1XA 1HOTA 2TECE 3GLHA 3H5WA 4GS5A 4EY5A 1X70A 2FLVA 4CIDA 4ENQA 4JBGA 3JQ7A 4JHXA 2K2WA 3CWCA 3T1YB 1P1HA 2UZ4A 1EXWA 1FX0A 4D9FA 1CRZA 4BGEA 2RONA 4RVOA 5FOSA 4IDNA 4TV9F 3K0BA 2QPTA 3A4YA 4JMLA 2CXNA 2FXVA 2IWHA 5CA0F 1M83A 3P0IA 4DLXA 2J9FA 3FI9A 1CV2A 1E1LA 3Q3CA 4EPTA 4KBFA 4L78A 2LKCA 4WZ6A 4WFIA 2HSJA 4Y2PA 5A3QA 1Z73A 4GE0A 4KSBA 1PGOA 2YNMA 1LDNA 5EIWA 5B53A 3VUEA 4ME6A 4BLSA 4F06A 4EB6A 5B6PA 3JQ9C 4YMIA 1E5VA 1S3FA 2FGKA 1XDGA 4YPOA 4JT8A 5KWVA 4U0JA 2CZGA 1QIGA 5FUBA 4MIEA 4E5KA 1BJTA 1WUHS 1P91A 4JUFA 2V54A 3DTVB 1C41A 1QP7A 1CUWA 3A05A 1QANA 5LKAA 4JP3A 5KYKA 4LRSB 5KYGA 1H0SA 4X1IA 4QE3A 1YQGA 5JAPA 1T34A 3V7YA 3JD2A 1Z6GA 2ZI3A 3P0EA 2X0JA 2AXEA 1P7CA 3OX4A 4YUZA 3K53A 3JQFC 1NFQA 1R8XA 2C29D 2ONJA 3VJMA 1NQTA 2I34A 1WB4A 3QUSA 4M49A 4MJ3A 2IHJA 3CJRA 3O94A 4X8HA 3L8YA 2I55A 3HCWA 2QN8A 2KM1A 4BX9A 2XCUA 2E48A 3MLEA 2R97A 1RP1A 1VL5A 1DIBA 1EFRA 4MR8B 1QGOA 3MS4A 4UDXX 4YECA 1U3TA 3A32A 3P9YA 4JUDX 3W2TA 1V11A 3HXPA 2I6GA 2P8JA 1Y9EA 8MHTA 2AKYA 3MD0A 1FFAA 3AETB 4MIYA 2GAAA 5IJAA 3R5JA 4EMTA 2Q1YA 5G4KB 3QFSA 1GCUA 1W8DA 4QAQA 5DK4A 4KR9A 3RTDA 3ESQA 1H4SA 4M9ZA 1G3QA 3EQZA 3KQMA 4BX3A 2VRBA 3UAYA 2WSSD 4JJAA 4NCKA 1MXFA 1OIXA 2HCFA 4MYTA 5HF9A 2H0QA 1MRSA 4FE4A 1HT0A 3K32A 3ZZTA 1LFAA 2NOAA 3FOCA 3JQBC 4D44A 5LQAA 4H1TA 3HNPA 3MK31 3PPYA 2XUGA 4RDIA 3U4DA 4DZRA 5JRDS 4IG4A 4QPCA 1Y6QA 3L8GA 3OQVA 4YWJA 1XZCA 3PFIA 2MSCB 1HO3A 3KDAA 1ZN7A 2QSUA 2XBLA 4HAWA 3COVA 4RHCA 1J70A 1KKUA 4N6NA 4NL4H 4MICA 3ZWWA 2JGEA 3KJEA 1DU4A 3CNQS 3VO1A 4UTZA 4ZOLB 2GZHA 3L7OA 5L45A 4RH3A 5CDSA 1GARA 2P79A 3DZBA 4C43A 3FF4A 4HAVA 3GA5A 2HBQA 5K0JA 2A1UB 1RW4A 2F3RA 3HU5A 3MWYW 4U7GA 2YQ5A 1D1SA 5CYFA 2G17A 2OYRA 3IKMB 1KBOA 3NPAA 3P32A 4BFVA 1TOAA 4CLOA 2XUHA 4L4RA 1FQKA 2YN4A 4G5GA 3WK7A 5JDCA 1PVDA 1XD8A 1EFLA 4ZZ3A 2YOFA 2ACWA 3OQBA 3EQ2A 1LK7A 1X13A 3CRW1 1LJUA 3BDVA 4GM4A 2KW5A 3FR8A 2OXEA 4J0HA 3SX4A 3OZAA 3N6VA 5L3QB 2HRCA 2MYPA 1XHLA 2GPBA 4FFSA 4LYYA 4W5HA 1MFPA 3EIWA 4ZT4A 3RS5A 2P0EA 1BEUB 2Q4TA 4CL3A 2QM0A 5F9MA 2R6FA 5ADHA 3ZK9A 2I71A 1ULAA 5CDFE 3HRKA 1FJHA 2Q7DA 4WZBE 1V9LA 4R1NA 1NUQA 4UU0A 3WO1A 1Y5NA 1XMOB 4KGZA 2QXTA 2NO7A 2GN8A 4KO1S 2XDQB 4CI0B 5I9LA 1ZWKA 3WRWA 4TT3D 3VAYA 1P45A 4LY0A 1WCIB 3FBWA 3O0DA 4ETMA 5BP7A 1XVTA 3JPWA 5IAJA 3RIYA 1P9WA 3NJ8A 4YUVA 3RWBA 3U49A 4FT2A 4EUEA 1NDHA 1E0JA 3HDHA 4LKRA 1LBEA 4IDBA 3QNWA 5LBIA 2O1WA 5EMHA 2FZWA 1JAHA 1KDTA 1XKXA 3DQQA 2NXCA 4FI3C 5IYZA 3DC2A 5ADUS 1SD5A 4RNDB 2YCLA 1F0YA 4BNHA 3D3WA 4EHBA 1O0BA 3IPCA 3RADC 2RK6A 4MLPA 5IS2A 3DZCA 1K66A 2FXIA 1KO8A 2AC2A 3GJSA 2HLDA 2QL6A 3HN2A 4GE3A 4PE5B 5TRTA 3RPEA 3V9AA 4AG6A 4GDFA 4DR5B 5ES4B 5AHRA 3KBOA 5A7HA 1XRSB 3SE0A 4IRXA 4F92B 2PQMA 5FTNA 3ILXA 2DPXA 2APJA 3L4SO 1TUGA 3QKIA 5IM5A 5JS2A 3W2EA 3KJGA 2BGRA 2Y0BA 3WKAA 1AKYA 1K6XA 4B73A 4CMGA 4AUEA 1Q1BA 1A8SA 3CT6A 3EN0A 4MYSA 3ZGOA 2HHHB 4UEWA 5KOJB 1IL0A 1PL8A 4ZEWA 5CFPA 2YBEA 2I2WA 3FVVA 4IIXA 2EJTA 3A1UA 3FWZA 1YSCA 3AHIA 3PXUA 2YXNA 1F06A 1X6VA 4MQMA 2AMVA 2PD4A 4PZLA 4RK1A 2J4FA 5F5LA 2XWJI 4L27A 2IYOA 1XLUA 3N7AA 4HGRA 2P77A 4G2NA 1Q0SA 1TPZA 4KZKA 5HCIA 1ID8A 2JCBA 5CVUA 1Q16A 2HHAA 2Z95A 3T7SA 2ZROA 3QX9A 5LDDC 3TGWA 2FLWA 2VHWA 3OOWA 1ZGCA 4A4DA 4L4YA 2IELA 1PUJA 1SQFA 2L19A 2W8BA 2XNKA 4P34A 4E70A 4AZVA 1WXFA 2ATVA 2C59A 4NP6A 1FNDA 2OZVA 3D7KA 4MWSA 1JIIA 1N4DA 4ZJPA 1KPGA 1N9GB 5DW0A 2HYIC 4ZV9A 2FHSA 3AYZB 4HNTA 2P9JA 4BWFB 1D5WA 3D0KA 4J1SA 1UJ5A 4LFBB 1ETHA 3OO0A 3EEFA 2HY7A 4RU1A 4ES6A 6NULA 4AKGA 3J7AC 4TT3A 4FFOA 5FWNA 3JW8A 1JFVA 4LOJA 3GLGB 4WECA 4TN1A 5D51S 3RUAA 3M6XA 3PRHA 2CLEB 2GI4A 3HG7A 5KKCA 1W7AA 3NIWA 4QAJA 5BSVA 4LK2A 1H8ED 1HYQA 1HWYA 2W70A 1G60A 1YBVA 1G42A 2LCQA 1XEXB 5FOVA 2VDVE 4BVLA 4I4TF 1L5QA 2ODBA 3LQ4A 4A8HA 1H65A 3O03A 1G5FA 3URKA 1JWLA 2G1PA 2A7XA 4HDAA 4OI4A 4OHOA 1XX6A 2HPZA 4KU4A 1CEYA 3F8TA 1TRKA 5T67A 1JB1A 4G6ZA 5T7BA 4DV2B 3NIBA 4JBIA 1JH9A 4XIFA 3K1YA 5JEDA 1NDUA 1E3TA 4DMUB 4EJ0A 1W87A 1Y7PA 2AD5A 4PNHA 4AYTA 2FFAA 3O4VA 1QOQB 4QXPA 5AUNB 5IVKA 2RAUA 1ZY2A 1JW9B 1RLUA 4GEGA 4ZVKA 3T34A 2IYUA 3KKPA 3UOGA 3NASA 3JVEA 1MJFA 3C8DA 3H6HA 4M0MA 1JP7A 1I4DD 3QF4A 4J2TA 3R7LA 4AO8A 1QCCA 2I03A 3AZPA 4TV8B 4GD3Q 4D4MA 4JKOA 1VJCA 4RABA 2OV3A 2WJ6A 3UMJA 5A2QA 4E3WA 1FDIA 2ZAMA 3VKWA 4OMFG 3SGLA 1N5OX 4WXPA 2R6ZA 3U5ZB 4DNPA 4MP3A 1EE1A 2XIQA 1M2EA 3GLTA 5L3VA 1Z5VA 1BH6A 1WTCA 2V55B 3TRIA 1C0EA 1V5FA 4QA9A 1THZA 2YL2A 1UM9B 3I8SA 2G08A 2A9RA 5GM2A 1XROA 3TD9A 1J1ZA 3EGVA 4D6PA 4JDPA 1VGQA 4DWWA 3WA7A 1J8DA 4D1YA 1T8YA 3L82B 3MCTA 1XZFA 1TFRA 4HQNA 4QXMA 4ZJZA 4OREX 1TMGE 4AU1A 3DWEX 3WNCA 3BXOA 1MJHA 4FINA 3QRWA 3WFIA 2IF2A 4YDQA 2Q3LA 2B5WA 1EWKA 3WE7A 1N25A 1X80B 4JZKA 1PT8A 5C31A 1MQ8B 2DJIA 3LF1A 5DGCA 4X66B 3N6XA 1LSJA 3JD0A 3BDAA 3GFGA 1WEKA 1J21A 1K0UA 1LBTA 3KS9A 2NU8A 5HF5A 4B3GA 3OTGA 4M8LA 3DQPA 4NV1A 5C9ZA 1DEXA 2V7TA 1ADGA 3X1MA 5B4TA 1ODFA 3QVXA 1U6KA 3KZXA 3KKQA 3IHWA 1MP0A 3RSCA 3DXZA 4EITA 1JHAA 4TSFA 4H3VA 3PUVA 4PFQA 2BMFA 2VQEB 4BMPB 1ZMBA 5G2OA 2Q0HA 5EKDA 1HRKA 1E4YA 1UC9A 1XZQA 2EL7A 2JKZA 3QMMA 1L5LA 1ZM9A 1P39A 4I8IA 4MQLA 1B6TA 3HBFA 4G5YA 3HSSA 4NCIA 5L8VA 3A9RA 5FO0A 3HA3A 1ST2A 3KQVA 3B3JA 1NM5A 4RHUA 5DLDA 1U3WA 3OLCX 4M46A 2X86A 5KMGA 3CEPB 1E2MA 4Y6SA 5J5VA 5KNLA 4RV9A 3QWFA 3GVPA 4D92A 1NGSA 4ZAXA 1XZLA 3U4QA 1EX9A 4K9SA 5AW1A 4IILA 4F85A 4QYMA 4LYGA 4XIJA 1AOXA 3TPZA 3PZRA 5A4MS 3JQGB 4RD4A 3ES9A 2BR4A 5AI6A 1OWMA 5C7YA 2VHQA 3TRDA 1TIBA 1B93A 2WD7B 3B9PA 1UEIA 3DZ8A 1GPKA 2NV0A 4FGKA 5EGNA 2I3AA 3ETEA 2BFBA 3BMCB 5EEHA 4NKRA 4OHRA 5TDHA 4XJVA 3SBOA 1E2PA 2DUJA 2P30A 3N0XA 5ITZA 4XE5A 2IYRA 2X8BA 4MWZA 3SVZA 4CG1A 3VPCA 4YRCA 4YGYA 5KZMB 5LYJB 4JV5B 3SP1A 1WY7A 1EA5A 3S40A 4OB7A 1JXQA 1FJXA 3ERCA 4EAQA 1V0JA 4AJ2A 1N2GA 1E5QA 2B69A 2FYTA 3PYLA 1JZQA 3E7DA 4IR7A 3ZPXA 1KH1A 3F74A 5CHEA 2IYNA 4V0OA 3VO8A 2B30A 3A2MA 1V1MA 1JQ5A 1GFWA 3ZUPA 1XF9A 2A0XA 4GUAA 3ZZNA 1QCDA 3UANA 1G21E 4H6WA 3NHAA 1JKJA 1NN3A 3R0JA 4MW2A 4DRXA 5CM8B 4IDPA 1T3HA 4ZHQA 3PRKE 2R1UA 5I9SA 5GZ1A 3BERA 4MUEA 3JQ9A 3E81A 5TT1A 1DXYA 1LZLA 4QRHA 4G65A 2HNBA 3RM3A 3AR9A 1O2DA 3H2ZA 4NE9A 2D1RA 3VVCA 3HUUA 4DS3A 5KTSA 1KEEA 3FIUA 3NV9A 3HLKA 4FILA 5MN4A 1DJNA 2CVPA 1C9NA 1A9XB 4I4LA 4U9UA 3T5GA 1SA0A 3DULA 3GEEA 3RAEC 3TR6A 1HF3A 2JJ2A 4LYEA 3V1KA 5THXA 2VYVD 3I9V1 3LZ6A 4PZ0A 3GN2A 5DGTA 4DA7A 2B2XA 2FUNB 4GT1A 4KAAA 4DEYA 1BAPA 3JQFA 1J8FA 3PXEA 4TKUA 2X3UA 4V38A 5JQWA 1T2NA 1ADFA 2XBMA 1U9CA 1E2FA 2KS6A 3ZHXA 2IY9A 1FX1A 3KR2A 1X2BA 4GUDA 1GZVA 2JNWA 2LVBA 1FNBA 3ZGXA 3UQYS 1BX3A 4REMA 1P62B 1EFAA 1NVGA 2V3VA 3VC1A 2ZCVA 3OQHA 2C1XA 2ODTX 3M4YA 3MJRA 3D2CA 3OX3A 4WI1A 4FDMA 4F4UA 1GJRA 1LDGA 3EZ6A 3E5RA 1H6CA 5FJJA 4TZKA 4MW9A 1UKEA 1JIXA 5FTLA 2B3DA 1GZ5A 2GASA 1EAYA 1KEVA 4P83A 5FUVA 4DIFA 5E3IA 3M33A 3V34A 1K4YA 1KARA 2NT4A 1Z9BA 3EXHC 3HJGA 4BEJA 4YYZA 1MGOA 3GFQA 5HPYB 2HR1A 4GSYA 4OJKA 1VGRA 3QELB 4G4IA 3PITA 4JJFA 2X9GA 3HDQA 5ESWA 4ZALA 1UBNA 2N9UA 3AERB 2AN1A 1V95A 4QZVA 5ALDA 5K3OA 2DY1A 4OI0A 3B6MA 3AP2A 4ROSA 4LRWA 2C5HA 1LWOA 1T1IA 4DLZA 2Q4DA 1PJ3A 3LT0A 2GTIA 2Z5FA 4LNAA 1PTJC 4GMHA 2JASA 3GMDA 3F7NA 1JFFA 3VPXA 4MPPA 3FFWA 5IDVA 1FP4B 3QFTA 4XI9A 4EY7A 3WTCA 3ELDA 1HTBA 1AHIA 1T4CA 1J9EA 2FPSA 2Q28A 3OHMA 2XOEA 3HGQA 4NZOA 1R4ZA 2FK8A 2ICAA 3LCJA 3T5PA 1DBRA 3BWCA 1E20A 1VCMA 4DQ0A 5CNJA 5JXHA 3H5NA 4YROA 4XX1A 2WHXA 1OHHD 4ZOEA 2AEFA 3PUWA 4N18A 3E8MA 4IV8A 2IZZA 3DE5X 1YRWA 3PXAA 4DRYA 3F6YA 4S1TA 3MRVA 4QTTB 3DE6X 3E8SA 1G8KA 3F7MA 2NPFA 5IXSA 5LWHA 2O3RA 4UMEA 4LRQA 4JASB 1QQ6A 2IP2A 1NQOA 1C9MA 4MVYA 5FWYB 4MV9A 1GKKA 4QYIA 1PNTA 3PI7A 3F73A 1L4KA 2EQ5A 2ZYVX 2AX3A 5I7WA 1IFXA 3ZGZA 4E46A 2ZUVA 1AUPA 4JKIA 3LDAA 3OZ7A 1TZMA 5A0FA 3SXJA 1KEKA 4LGCA 1QPBA 3WYCA 2VL7A 3GJ5A 2PNJA 1D07A 4OL0A 4NS4A 2B8JA 3R3HA 1NUTA 4EW2A 3H3XA 1HLDA 5K6AA 2HK9A 3DKIA 4II2A 1ITZA 1P7YA 1TYBE 1PJ8A 1V47A 1YR6A 1NUUA 1MCZA 2A9VA 2M6SA 3C16C 2CDNA 3I42A 3QFFA 5C5DA 1QGUA 2RKWA 4S1NA 4ERNA 1EG2A 2MMCA 4P6VF 2WHRA 2G70A 2JZOA 1A9SA 3AJ8A 3N0RA 3P4UA 3PUKA 5IFLA 3I61A 1ZNWA 1YFZA 4LI3X 2VOEA 1T25A 3GUHA 3BH7A 3ZE0B 1GIAA 2QTHA 2FW9A 4BU0A 1NW9B 1WCYA 3CR8A 4PG5A 4YJ2B 2OB2A 4HEJA 4E5NA 1HMPA 4GMGA 2P6RA 1P61B 2JCSA 3IO5A 1VMIA 2FZ5A 4IKOA 4KV9A 4PS0A 4HLDA 2R6CA 4MPTA 1IBLB 1EJ0A 3I8XA 1B23P 4MINA 1I2AA 3OIVA 4HNGA 3RROA 4CMHA 1WSDA 1IHDA 3EFOA 1I3CA 1EX7A 3BUSA 4O2BA 3TVTA 1JSLA 1EE2A 4LUCA 2HBRA 4YCJA 4BNUA 2A84A 3QK7A 1NW4A 2ZZMA 2WE8A 4ARZA 1N2CA 4RV5A 4CCWA 3BORA 6CHYA 1SU4A 2ET6A 3WMEA 3OPYI 2CXXA 1GTVA 2R6GA 2QN9A 3TTTA 1E79A 4BKRA 1Q7CA 2D7CA 2DPLA 2PT9A 1E9FA 4LJ6A 2AMLA 1L5MA 2DQZA 3PJRA 1QKJA 1XCLA 1B41A 5AJWA 3LRTA 4JR0A 5AXDA 2J0SA 1QK3A 3G59A 2ZBFA 3RARA 4A82A 2FP4A 3KJHA 5DTIA 5TC4A 1YKFA 2BFNA 2F6RA 2ZIXB 5JCJD 3GELA 1G21A 2ZKIA 3BVPA 3LNCA 1U1DA 1C5KA 1TF2A 5D3MB 2P3SA 3B2NA 2WZQA 2Y2UA 4CEIB 4A9AA 2SCUA 2Y76A 4UHDA 1JQKA 2R79A 3KZOA 3B1WA 4FSDA 1VLLA 4J91A 2C98A 1FSFA 1P6XA 4NC9A 5CBPB 2BYTA 2PT7A 1QV9A 4IIEA 4HTAA 4J9VA 1G7TA 1QORA 1HDGO 3Q10A 4RD3A 4ZVLA 1NSTA 1YK1A 3G23A 3RVNA 4EFDA 3EXEB 4A03A 3QYAA 1H1TA 4HWTA 3TYXA 1X7YB 3VV2A 1H4QA 4L7VA 5KTKA 1XNJA 4QG7A 1U2ZA 4Y2TA 2R87A 3G7NA 3DP7A 8GPBA 4R54A 3KSUA 4KH0A 3GXOA 2IDJA 4AP9A 3I0MA 4PRYA 1GOTA 4Y9TA 5BSTA 4D3XA 2CV1A 4JLDA 4Q39A 2HJRA 5I7RA 3AVOA 1PR0A 4OQEA 3EE6A 4ZTUB 4IJMA 4ABYA 1LH0A 2CZCA 3ZBQA 1DIAA 2O0MA 1I6LA 4JJ4A 2FFQA 4UUMA 4B84A 5B1EA 5IX8A 4WK0B 1DTSA 2D2VA 3Q8LA 3KEQA 5AHOA 1NBEA 2PFKA 1O1YA 1JVBA 4MDYA 4JMPA 1DFIA 1JZTA 2QMZA 3L05A 4TWJA 4BNJA 4EHNA 1G4HA 2ZTSA 2IRWA 4PZUA 5LP6C 4AVYA 1SXJB 2VEDA 3D81A 4RMNA 2G9NA 5I7EA 5EHNA 3WYGA 2MYUA 3RI3A 2HNAA 3MMSA 4KUEA 4PPQA 5HUHA 4QNNA 1OJ7A 3GX1A 4G0OA 1QOZA 5TVKA 4DSZA 1ESZA 5JNTA 2VOJA 1I3OA 4M6WB 4JX8A 4RIHA 5A4AA 3O90A 1XXLA 1KC3A 1WDTA 3ZKAA 1XLVA 2IVFA 4FD3A 3AEKA 1Y7IA 2E0IA 4ZVUA 4Q24A 4HQ6A 1XD9A 1W2HA 3PHGA 2DC1A 1YU6A 3N8DA 4TTSA 3R0VA 5C32A 1I14A 1RABA 3PDIB 4X1YA 1RXSA 4GQIA 3UAXA 3UC9A 2GN0A 2H07A 1U0GA 5CDUA 2OL4A 3OESA 4CHGA 4DDVA 2G8LA 1VIMA 2G9UA 1E1CA 1TA4A 3EG5A 3O2NA 4DR4B 5C5EA 2GXSA 1MB9A 4LCEA 5DBEX 5I6DA 2IC5A 3MINB 4R3NA 3I92A 3SQNA 2AKEA 1N6OA 2Q5LA 3OZSA 2JFXA 3LI2A 3WGUA 4Z7OB 4DC1A 5B3KA 4OOFA 4H18A 4F3CA 1IOZA 4AZ3A 1CRPA 3VNSA 1KYTA 1QR2A 3OEEA 4J3FA 2C2BA 2E4ZA 1J0AA 1L1RA 1QF9A 1C14A 1EYZA 3P26A 4PAOA 2JH9A 4NG5A 2AZ4A 3R41A 5I4CA 1BFUA 3V2HA 3WGHA 4BE9A 1MF7A 3NJRA 3H9BA 4OQDA 4WXRA 3LF2A 5HKBA 1W59A 1YJ8A 3SMQA 4DA4A 4DVGA 2QGNA 2C2OA 3KZVA 5B5SA 4GO1A 5C3UA 1XZDA 1A04A 2XPCA 2R00A 5KYXA 3CZAA 2P69A 8ABPA 3PA6A 3J80A 1NR5A 4DILA 5KKAA 2F8MA 1VBNA 2V7PA 5JE8A 3KEGA 3RVRA 1RHKA 1VHWA 2ADFA 3PR3A 4FOLA 5HBGA 4YV7A 5B7QA 4BIMA 2MINB 2BZGA 4WUVA 4YR9A 1PK9A 4DQVA 3GJ4A 3BWYA 1P2DA 2R60A 4MUMA 4P7GA 1D1QA 4YJHB 5CA1A 1YKSA 2ZRJA 3CS3A 4ZWNA 2VUSA 3C7KA 2ZYTX 3BULA 3AETA 5J5CA 1I7DA 3VSDA 4CQNA 4J29A 1Q3HA 1TCAA 3O74A 4C3ZA 4ZVNA 1RKXA 5D7NA 1D6MA 2JKVA 3GRVA 1KDVA 1O5TA 4BMZA 5ALPA 2PWPA 5EHIA 4BLWA 3U1BA 2WE7A 4K88A 4QIHA 2GK6A 4D9BA 4WNYA 5KHOC 1S4QA 3DH0A 3WJ2A 1IMJA 2C03A 2QKYA 3UM9A 1HT3A 4FDVA 1JJFA 2DQSA 3FKJA 5FUMA 4NTZA 2Z83A 4J6FA 5EWLB 2F8TA 4GPIB 4GEKA 4OHYA 1LLDA 4MROA 4P36A 1EUQA 2PN1A 3IKJA 3QFRA 3IFSA 4NZPA 4U7PB 4L28A 3VYSB 3WGTA 5CNMA 4ESEA 2ZWAA 5I3ZA 3EEBA 5BOVA 4ZT6A 4HZUB 3LTEA 4O63O 4QGGA 1O4VA 5HQ3B 1HLPA 3L8HA 3X0DA 3LUPA 2X4IA 1PWHA 2VK2A 3O92A 1SBYA 4RA9B 5GINE 4TQUS 3EPKA 4H16A 1U0FA 1XTQA 1Y3FE 3D02A 4HTFB 5GVRA 1SUIA 1RTTA 3ET4A 2H51A 3E03A 3FDFA 4JGGA 4O08A 4BEBA 2P9TA 4ENTA 4C0BA 1VPEA 2H48A 4H2DA 5CT4A 4NNPA 4D5EA 1UBTS 1U3GA 2AZDA 2QOEA 2YYYA 2HGSA 3BKXA 4H9GA 4V0NA 2C0PA 5MN5A 1CZHA 3VISA 4I3GA 2NZ8A 1V9SA 3V46A 3ZIAD 5HM8A 5GJVC 3V4SA 1PS8A 2HWUA 1XAGA 3Q7SA 2ZR9A 3SZ3A 4BO5A 2YRFA 4C7XA 3GNTA 3C6YA 3FSRA 2VHVA 2DFTA 2WYUA 3LBAA 2OOSA 4M55A 4N9QA 4QDTA 2B2NA 4WKCA 3GJTA 5A2GA 2E5LB 1URPA 1MDBA 1ZIYA 4G5QA 2FKAA 4A1OA 4ITVA 2GERA 4R2JA 3A6ZA 1L8XA 1Z18A 3VHLB 2GCOB 2XH8A 3VSBA 3SHQA 2G1AA 2Q4EA 1YL5A 3HSYA 3HWRA 5ALGA 4CTJA 5G3ZA 4C03A 4JDUA 2HB6A 4U39A 5BUZA 1KH2A 3AEYA 3MEQA 5H0IA 3O9MA 1V11B 2V0NA 3LC1O 1H9CA 5WRFA 5CDTA 2QRHA 1V3UA 1SC4A 2COEA 1NMSA 4AULA 3OIFA 1CJUC 2UZIR 1FXUA 1UPCA 3GU3A 3H42B 3TEJA 3V2IA 4AECA 3W6OA 1CY1A 2FN8A 4XQEA 1G5IA 2Y1FA 4LHVA 4E6PA 2BC9A 1VPTA 1K7FB 3T9DA 5HUJA 2C7OA 1YI1A 1BRMA 1UPFA 4WK2B 2PUFA 1R3UA 3SYKA 4OXXA 3ZS8A 1YDFA 4ZOLF 3NBQA 5IDQA 1H94A 3RBZA 1QYDA 3THRA 1E2UA 3I2IA 2WWGA 2AQHA 3ABIA 3E1SA 3OF3A 3OZTA 3BILA 2AI3A 4RANA 1RQXA 5NULA 1VSVA 3ZHRA 5I01A 4D56A 2ECOA 3L1VA 4FS3A 1YQUA 2GPYA 4YRGA 5CITA 1W36D 2IHVA 1GPMA 1T5BA 5KSOA 3KQYA 3WYAA 4P98A 2PGLA 1XVIA 3BIXA 4JJ8A 1H2WA 2R1TA 1E98A 2G9QA 1GQRA 2RHLA 1Z37A 5ADVA 1Z0KA 2MSNA 2WNSA 4FFLA 1YBAA 5FORA 2H17A 1X39A 1TD1A 1WQ3A 1C30A 5LA6B 3MWEB 2P5YA 3K30A 1ZJJA 4OHMA 3S27A 4C0QC 4BP1A 5BV0A 1DUSA 2I8LA 5A05A 3QYJA 1XEWX 1N4AA 4EEKA 2HT1A 3V7FA 4M2LA 4IJ6A 1CS4C 1O5OA 1SIOA 5BXYA 2XTNA 3NTUA 4G1MB 5ITZB 2EFCB 2JAOA 4ER7A 3KSAC 3DMHA 3BK7A 3TPCA 3K2QA 3EWAA 4BNNA 4HX2A 3KB6A 5JVDB 1G3MA 3SY8A 1BWPA 4BGIA 4U6SA 3I9LA 3PQDA 5C4MA 1CVIA 2I2CA 3AX6A 3N0TA 1PTJA 1LDYA 1WB5A 3Q7IA 3RQSA 3ZWKA 1UBFA 4AC9A 3THWB 5K0ZA 3ZCTA 4IIHA 4TYPA 3SJAA 1C3VA 2BI4A 1M1XB 4TZ0A 1KZ7B 5JJKA 2EC5A 4UBMA 2B37A 5KMGB 1H2BA 1ZK1A 4M38A 3STVA 4CDGA 2ZUSA 1Z62A 1JQAA 3H5RA 1KNXA 2A1TS 2GHTA 3CM0A 4GLOA 2HN9A 4TXMA 4NCBA 1EXMA 4YS6A 2HUPA 1VJ1A 2A33A 1XRNA 4Q1EA 1BHJA 4ZXPA 4Y1GA 4O2AA 3VDRA 3IP3A 3NXSA 1YJBA 1RWOA 1UIRA 1U2GA 4UE6A 3NEPX 4UHHA 3EFBA 2A9PA 2C5EA 4ZOQI 3T1OA 1DQPA 1QRRA 1HDYA 3W6ZA 2G82A 2JIZD 3PXCX 4BKPA 4UPEA 2XOKA 4QBIA 1OYYA 3E58A 4KGXA 3X1DA 3NRBA 1FS5A 2B21A 3IKLA 1RE0A 1BOFA 1YRLA 3SXPA 5T5QA 3H9QA 4KE7A 2FPKA 2WYVA 2BZSA 1P1CA 3ZH2A 4BUZA 5JAOA 2Q3HA 3EIOA 2R2GA 1K7SN 4YRIA 1FP2A 3K0HA 1R37A 5HE8A 1UJ4A 2J5BA 3K6SB 1J49A 4CIVA 3FN4A 4S1WA 1MO5A 1IWPB 1SVOA 4D0GA 1HLGA 1O6ZA 2JHGA 3D43A 4MEBA 4YI5A 3UEOA 1JIUA 1UR5A 3NV7A 2YZKA 1N0HA 2XAUA 4BFUA 2AFHA 4Q1DA 5CU7A 2GRJA 4F5WA 4HUTA 4YRMA 2FZCA 3I6YA 2GR9A 2PYIA 3G8YA 1JRLA 2YRXA 1WXHA 2PGXA 2BFBB 3JU3A 2PVPA 5HRCA 3U7FB 3B85A 5DNUA 4LSMA 4B7CA 3CLSD 4KW7A 4V03A 3EH1A 2PGJA 4W6QA 1ECPA 1SUPA 2IHBA 3PPWA 3LRXA 4LXYA 3GLRA 3UMCA 3VPAA 4DCVA 4YMLA 3LCRA 1BU5A 1M1NB 1QE5A 3LLUA 4FGZA 2Q4RA 4Z3DA 3GAAA 1I30A 4HI0E 5DNVA 3EIUA 3S2IA 1R50A 1SKYB 4LBWA 3SHVA 4DQUA 4EGJA 2WOOA 2PPLA 2J45A 3O8CA 4IQFA 2YWCA 1K6JA 2JLCA 4FD2A 3DOEA 2TMDA 1L7XA 4M86A 1TQ8A 3RTGA 3BH0A 3GVHA 2XYHA 4L0DA 2A0WA 3D64A 1V43A 2JFOA 3E0XA 3IXQA 1MFZA 4RADA 1POXA 5J63A 3ZE2B 3DD1A 4LPSA 1JECA 1YU9A 3ROQA 4CMKA 4OFBA 2QRUA 2FMXA 5E4YA 2PM8A 5KSZA 1ABBA 4UHEA 4OOEA 2WWWA 4B83A 3KVVA 4BCDA 5I9NA 3GQBA 4O4HB 5AOVA 2HGZA 1NR1A 2B0JA 1NOIA 1V7PC 2OHHA 3IODA 4MVJF 4UFPA 1PV4A 3L93A 5ALNA 1YIDA 3IEXA 4RS4A 1RIIA 3EXIB 2ZS8A 4RQBA 2C2ZA 1VA5A 4K9RA 2IP4A 4QUBA 4AJIA 1OUMA 1SCKA 2N47A 1EDDA 1TM4E 2BKVA 1RDFA 2B7LA 4RFVA 3KSZO 4YMGA 1S6YA 4YGXB 3ONWA 2BUAA 2CHVA 2GF2A 1B74A 1FJ2A 1PNQA 4ZICA 3B6ZA 1JYSA 1DOHA 2VSNA 3ZXIA 3OZBA 1ZSNA 1RXWA 3QWBA 1A4UA 3INRA 2C0CA 3KO8A 5JOQA 4UEKA 3CLRC 3WLEA 1JDJA 4G0MA 2PKCA 5B7PA 1UJCA 2FLKA 3O73A 4CIWA 1WDLA 2O3SA 4IJVA 2VTVA 4B6QA 3SMVA 1ORVA 1F8GA 1E8DA 3V1NA 3ZD8A 3OD5A 2I1WA 4NYMQ 5H1YA 1Z56C 1P81A 2BHNA 3OCZA 4KBYA 3ZHTA 2G07A 2XKKA 1VL2A 3PGXA 5B58T 4X84A 1XSEA 2PD3A 3M5PA 4LVNA 4YONB 4Y6LA 3PX7A 3NC1C 2O57A 1TD9A 2YWHA 1LSOA 4IKEA 2XD9A 4LPKA 5CUQA 1VLJA 3ZY5A 1N6LA 1CR4A 4L8VA 3VKVA 4BKQA 3CTMA 3ZZMA 4JGBA 5H59A 3KOYA 3QMVA 2EFYA 1SK8A 1PR4A 4OI1A 2REOA 1EXNA 2ZBVA 4FYMA 4EG5A 5AIAA 2Q99A 3DVAA 4UASA 2FQWA 2UYQA 1CIJA 3U3KA 5DCYA 4ZQEA 3ECCA 3H17A 4C89A 2J9RA 5JT1A 2NZ2A 3UV7A 4BVHA 3AKDA 3RH0A 1PW5A 3DFZA 2HDHA 3OT4A 2F3SA 2HBZA 4MW6A 4EWLA 1QPGA 5KNDA 4ETWA 3DOFA 3ENZA 3OOYA 3PGKA 4N9WA 1EVQA 4PGHA 3BB4A 5I7HA 1CPYA 5J47A 4IXWA 1VJ0A 2QJFA 1GZDA 2PMKA 2YICA 4GXRA 2C8JA 2FFBA 3IS3A 5I47A 4NEGA 3AHDA 3S28A 2P68A 3E3MA 3QPCA 3TW8B 3HXQA 3U62A 3S0JA 4JT9A 1GUYA 1GTZA 3EZ2A 4HUJA 1JEEA 1A96A 1I6MA 2OXRA 4PX5A 3UHAA 1M3SA 3L77A 4G1VA 5GWXA 4A73A 2BFDA 1A8QA 3ROZA 2J9XB 2G4LA 3A1WA 2QE7D 4HRYA 4I9GA 3BZWA 2ZAYA 4Y2JA 2Z5VA 1MH9A 3W7AA 3BAZA 3HCAA 3OF5A 5DEOA 1HE4A 2XZTA 3EVDA 1ZG3A 3M3PA 2B4QA 1U5CA 2EYQA 3W05A 2HW8A 1OBVA 1MJGM 3WL7A 3WYBA 2RIPA 1C9DB 3BRWA 3UTCA 1AGPA 5KX5A 3OFJA 2PUWA 1A5TA 3IVAA 1RU3A 4GLBA 4Q1FA 4UNNA 5JNUA 3SZOA 4UHCA 1ILWA 1QJCA 2JAHA 3PQEA 3SQDA 2Z9BA 1GPBA 4DDWA 4X41A 5JJLA 2WD8A 4QDXA 3CSSA 5BRAA 5L40A 3EBPA 2HQRA 2JVKA 3INYA 4G85A 1U94A 2QRJA 1DTWA 2QVGA 3NHYA 2DSTA 2J08A 5PNTA 4IJ5A 1N3IA 2PMBA 5FCDA 3M6IA 4NBVA 3JYQA 4B6JA 4EEXA 4W9NC 1G2QA 3QVJA 4FWBA 1HGXA 4E7PA 3KOMA 3ZE7A 2H0AA 2ZW9A 1H2FA 1R0ZA 4L6CA 1BDHA 1DRVA 4Y2XA 5KPDA 4S05A 4RIFA 4F91B 2AN4A 1AXEA 3NHBA 5EZYB 2VYVA 2ZT6A 5DEIA 5F1KA 5JH7B 4HDNA 3DDWA 1U3CA 2BDTA 3NG1A 3GAFA 2WNHA 3PD1A 4PX2A 1DZIA 3GVIA 4IVQA 4Q82A 3KT0A 3SQWA 2QVZX 4LS3A 2PUJA 3WICA 2J6BA 3OFND 5K8JB 5IEBA 1GU7A 2BELA 4W7SA 2AGVA 3GJ0A 4J16C 4IRUB 4XWGA 4A6PA 1Y4ZA 3HWX1 4BVFA 1HURA 3JQ6A 3OAAA 3AOEA 3RVMA 3G7UA 2A5DA 2EBHX 1RR6A 4ZQCB 3VR2D 4QNMA 1F4LA 4MVJD 4BMDA 1GPYA 3U3JA 4DDTA 5E3HA 3PHIA 1QFXA 3CHYA 4CKEB 5IN4A 3THWA 3Q9LA 1ZBQA 5K6RA 3TMAA 3UNXA 1K7CA 2QNRA 2VHXA 4ARSA 2IDKA 2JLBA 4FU0A 1M0SA 3U80A 2HSZA 2JF0A 2VJAA 4ASUD 1KXJA 3DAGA 3ESXA 1GYPA 4KN8A 4WD3A 5DN6A 1K98A 1DDGA 5F51A 4G0UA 1MZPA 4CU5A 1VKRA 2ZANA 3R7DA 4ZCQA 2VF2A 3Q9SA 2G1JA 1D2MA 4XDGA 5LWQA 2GZ3A 1RRMA 3T7EA 4D82A 5TS3A 3URMA 3ZUGA 3V8VA 2QUHA 3FXAA 4M0UA 4DQXA 3FPFA 4P8RA 3TGLA 3B38A 5ESDA 1G2PA 1UMDA 2D2XA 4UXHA 2PWBA 3TQFA 1MIOA 2CUNA 2GYUA 2ZKLA 3KT8A 4RZHA 1IN5A 1PR2A 4F60A 4LX0A 2XQGA 2Q0SA 1PLJA 5LN1A 1M6VB 1UODA 3PD7A 1RZRA 1E5XA 1NLFA 1NM5C 3ZW7A 4UATA 1I6WA 1UBOS 2FMUA 3DXFA 1JSXA 1II0A 3DXXA 4H31A 2QENA 4IQ8A 4LZPA 4RH1A 2PL1A 3GJZA 4EHLA 3B1FA 3N2YA 3V80A 4BO1A 5C1BA 2AVNA 4TTIA 3L4KA 3K0AA 3QU5A 2O2EA 4ZEXA 4XEHA 4CIBA 1PN3A 3PGA1 5DT9A 3VMFA 3I9FA 4C2BA 4WNAA 4DNXA 2WZCA 1K63A 4Y1EA 3ZKWB 4KQXA 4X54A 1IK4A 1R8SA 1I2MA 1Z2DA 4DTCA 2XGJA 1G0NA 1XXHA 2BRUC 1XTRA 3L0BA 3GJ8A 4QTZA 3KIPA 1HH4A 1ZPDA 3QG5A 2E6KA 3LHDA 5EP4A 3PEUA 3C15C 3SC2A 4N1AA 3G1TA 3T4XA 2Q49A 4XRGA 1OF1A 1GUZA 2H4HA 2NZJA 5FL7A 7MDHA 4RGBA 4IIJB 2W6JA 4C06A 1O0CA 5DLEA 2GPAA 3G6KA 2AZTA 3GLSA 4L9RA 1YZHA 3WHKA 4IJUA 1B0AA 1NSYA 4YO7A 3UTDA 1YFLA 4CM1A 3CF4G 2OFXA 1YS6A 3O5AA 2CDAA 2O7SA 3PQ4A 4GLLA 4L5IA 1L7OA 1ZDMA 3DMGA 2WTNA 2ZDQA 3L1UA 1T6NA 2V4MA