5CVTA

Structure of a single tryptophan mutant of acetobacter aceti pure containing 5-fluorotryptophan, ph 5.4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
160
structure length
159
Chain Sequence
SAPVVGIIMGSQSDFETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAATRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETFRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 56
structure length 159
sequence length 160
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5cvtA00
2NSJA 5C5DA 4YCCA 5CLGA 3LP6A 4YCJA 1XMPA 2YWXA 3OPQA 3OOWA 4Z7JA 3TRHA 5CLJA 4JA0A 5BORA 5CLHA 4GRDA 1U11A 2FW9A 3ORSA 1O4VA 2FW7A 4YCBA 5CLIA 5BOSB 4AY4A 3RG8A 5BOSA 4ZC8A 2FWBA 3KUUA 2FWPA 4ZK2A 4ZMBA 5CVTA 4YCDA 2FWJA 2FW1A 1QCZA 2ATEA 2FWAA 2NSLA 4B4KA 2FW6A 2FW8A 2FWIA 3RGGA 5CTJA 1D7AA 4AY3A 2NSHA 4ZJYA 5CLFA 2H31A
chains in the Genus database with same CATH superfamily
4DL9A 4INAA 4DEVA 3LD9A 3I8SA 5UKDA 3DZJA 4NK5A 3OPYA 4TTQA 1H0KA 4PRKA 4E2YA 4DNPA 4L7VA 1Y1KE 2ZUSA 3TOCA 3NHRA 3P9SA 4UM5A 5KEIA 5IVHA 4LJKA 5B7NA 2Z1MA 5ARDA 4EUKA 3T1OA 3QXCA 4E21A 1WHTA 2GCOB 3GDHA 1TKBA 1VHLA 3IHLA 3REGA 3SSMA 4OCZA 4D0GA 2D62A 4A0HA 3DXXA 3H5RA 4CWAA 5JJLA 4ZCTA 1Z56C 2WTNA 1NVEA 4GXTA 5J5VA 3KKNA 2BHTA 1NLUA 3IOYA 4S3MA 2V0GA 1QGOA 1R27A 3UJ7A 1E7SA 4OP3A 5PNTA 4COKA 5JATA 4GICA 1MV5A 1F20A 5CM2Z 3QYJA 2LPMA 4R01A 4AO7A 3H1GA 1U9IC 4MJXA 3R74A 5B58T 4BOYA 3K3PA 5I7SA 2QT9A 4IRXA 5K8JB 1LBEA 2GPBA 4WA8A 1KRHA 3DTVB 5AVYA 2RKBA 4PAQA 1U2GC 1T1EA 2XOEA 3F5DA 3N2GA 2VNKA 1GGHA 5CHYA 4WOBA 5G53C 3UC9A 2A9OA 1BW9A 2C3OA 3RU3A 4DCGA 2HMSA 1UOEA 3KU4A 2VSQA 3LYLA 5FLYA 4B3SB 1JHUA 5J2UA 5K8IA 1MAWA 4YRZA 2AH5A 5HGJA 2BUBA 4U2DA 3THWA 2VQDA 4KN9S 4XWWA 1RI3A 2BR4A 1LZKA 3UUGA 1R0BA 2FJPA 4Q01A 4KQGA 3W5IA 2DY0A 4ZYLA 5BMOA 3A1DA 3U9LA 5DYIA 1BU8A 2CHVA 3IR6A 3SD7A 5BV1A 1V26A 1R66A 2C82A 2VJPA 2Q50A 3UMFA 2J6BA 4LYEA 5A6VA 1Z6GA 1JU3A 1XZAA 2P9HA 2PU7A 2ZBFA 3DT8A 3EYWA 4S1OA 2PE5A 1UJ4A 1V43A 4FOSA 4E12A 3F9RA 1PLJA 3ZY5A 1GG2A 1Q3HA 2VF7A 3S8YA 1DXHA 1MOSA 5IW8A 1V1RB 1OAKA 4X45A 4V0MA 1X8KA 5TT1A 3VH1A 3PQ5A 3B1VA 1JJFA 2GXAA 2BH9A 3GUZA 4MLZA 2ZS9A 3UMBA 3R0IA 1RWWA 1JQBA 1LDEA 1DJLA 1O94C 1VIDA 2IYYA 2YWRA 3NUZA 3OP4A 4K9LA 2Q5LA 2I33A 1UDBA 1HFWA 3DZKA 2ECPA 1ZD3A 3OF2A 2H9YA 4IDQA 4ZI7F 3GPCA 2AN3A 1YCHA 3A7EA 4IOJA 5BSMA 3BCSA 2W9XA 1I5RA 1TJ4A 3QPVA 1MB2A 2GLUA 3EGXB 3E18A 1WB6A 2YJGA 1Y1TA 3EULA 4LHSA 5DNWA 3W7VA 1U81A 2CNDA 5LXTA 1D4OA 3I64A 2P11A 3LT1A 4CM3A 1HX7A 2BPOA 2IYXA 1IL0A 4AJEA 2NO4A 4CKCA 1NRWA 1ISPA 4XW2A 1PJQA 2BDUA 2R4QA 3C4QA 3QVVA 2JVKA 2V4MA 4MS1B 4OQZA 4U3JB 4BEJA 4F2PA 2C98A 2QJTA 1ZK2A 2PAFA 4DY4A 3GXOA 2VQEB 1XKXA 4R1QA 4RE5A 2MSKA 3EQ7A 1G38A 4IFEA 1GFZA 5AKJA 3VHQA 1QXSA 5K0LA 1CY0A 5DYWA 4HC4A 4KGDA 1VM6A 4K03A 4YAIA 5F21A 1ECFA 1TTHA 2J7PA 2WJHA 5EN4A 3FKJA 3EPKA 2QUBA 3KIPA 4TQAA 2PUVA 4BKOA 1O95A 1IC6A 1WNTA 1V7ZA 3ESAA 1RCUA 3RLIA 2W6MA 1AF4A 2ISCA 5JNSA 3GAAA 3TLCA 1HRDA 3BFVA 3TX2A 4FFNA 1BN6A 1PR4A 1RADA 2XMSA 3N0XA 3S8EA 4KHZA 1RWVA 2HMVA 3RQSA 2ZVJA 3PC6A 2JFQA 4I99A 3ZCRA 1PR1A 1I4DD 3U7RA 4JIMA 4PZDA 5M3BA 4WNAB 2YRXA 2NVOA 1NE2A 2Q2WA 3T7EA 5DM60 4URXR 4OP2A 4WERA 2PQ2A 2X5JO 3CO5A 4RY9A 4WXYB 2PD6A 1XVVA 2BHSA 2M9MA 4R69A 3ESYA 5DHRA 5IMSA 3JQEA 3MIIA 5H83A 1F2TA 5E6SB 1N78A 4J0KA 1ZNWA 2WSSD 1C1HA 1P81A 1VJCA 3ECSA 1JI0A 1FEZA 4KUEA 4NOMA 5F33A 1E2LA 3T99A 3G9XA 2V03A 1SXJC 2OFWA 2OAGA 5DLPA 3DZGA 3GLIA 4Q4HA 1FYVA 2I80A 3WLLA 1D4ZA 2RK3A 2DFTA 3LXRA 5AVSA 1KAMA 3UJPA 2RH4A 4ZYWA 4ITVA 4UAJA 2V7EA 3JV7A 1M7BA 3CEHA 4QFBA 1GUZA 3KOMA 3DV0B 4WXPA 3N3BC 4AULA 3KR9A 4LHYA 3VU9A 3FNFA 1FMCA 1O5TA 1X77A 2Q6TA 4KNWA 3W1WA 1BIFA 4DPKA 2FZGA 4YCDA 4Y0AA 2AEMA 2PUJA 2QORA 1FRQA 1ODCA 3UKOA 4QTYA 3FCXA 3K1AA 3NIGB 3NOQA 2JI4A 3E9EA 1NBMA 3PR2B 2V9ZA 3AM1A 3S7ZA 3CQ9A 2B1RA 1N5OX 3INNA 1Z7YA 1QX3A 4K9MA 2NNLD 3NNSA 1AKYA 1AD2A 3GJQA 2F1RA 2IUEA 2FA9A 1HNZB 1RMYA 2A92A 3WICA 1GZ3A 4NCHA 2QJOA 3EZLA 3Q11A 4KEAA 3MJDA 2MSWA 4IPTA 1MB3A 1FRVA 2XZLA 4DCSA 3GJTA 1BDBA 4WFKA 4G3XA 2GM9A 4N3AA 3WWOA 4U7FA 3I42A 1DAEA 2QTVB 4EA7A 1CJUC 4A26A 2ACVA 4NFYA 2R6DA 1IZ0A 4FCVA 5J43A 2VTBA 2RSLA 5ELMA 6AT1A 1WDMA 1BC5A 1MA3A 3W1EA 3HACA 1WZNA 3F8SA 1PV4A 5MN4A 3TVDA 4PTYA 5FPQA 3O94A 2AA3A 1F9AA 3K20A 3R24A 2L18A 1ZNQO 2YZGA 3ZC3A 1UMDA 1WCWA 3H5IA 1PQYA 5DKFA 4CQMB 3AIIA 3HNOA 4CR8A 2C5LA 3GP3A 4JA0A 1LDGA 4BX0A 2H1OA 3FCAA 1KK1A 2GYWA 3RUHA 2VLIA 2XSZD 1R00A 2QGZA 4OKIA 4W82A 3TOVA 4M1EA 4Q12A 3CBQA 3KZOA 3L2OB 4XD7A 1MEOA 2HNAA 2RH8A 3FAKA 4HKTA 1Z5ZA 4QGSA 1H0SA 4LNUB 1X15A 1QHXA 4KPUA 4KWHA 2OT3B 2ZIGA 3MFYA 4HWKA 1YHNA 4Y1RA 1ONOA 3RT7A 1U99A 5EIXA 3QX8A 1VE9A 2YV3A 4IIHA 4M1OA 4D4LA 1HRKA 4GI2A 2QRLA 3IL2A 3RSCA 2UZ3A 2F7SA 2JD2A 1ULUA 3D8SA 1VGRA 1KI1A 4JOCA 4OI1A 4DR3B 3T7TA 2IH5A 1YQTA 1IHPA 1RAIA 2HHCA 5DMHA 4HQRA 1OBHA 3MUOA 4AQYB 5COQA 1O7JA 1RRPA 1U11A 2ALJA 5LZ8A 4B5KA 5JAOA 1LS1A 1AGNA 3D8RA 1RWPA 4N54A 4Z8XA 4CIAA 2OFXA 3SBOA 4PPGA 5ED4A 4C7BA 4OFZA 4DW8A 1B0PA 1JHMA 4MO2A 1PJ2A 3A1EA 4PFJA 4OB6A 2HXSA 4OK3A 3UUFA 3W2EA 1HG0A 3BIXA 2G67A 4KQXA 4Q24A 4TYQA 4AP9A 3H11B 4AU1A 5HUQA 4ANFA 2NUPB 1SG0A 3CR8A 3E8MA 4UM9D 3WHKA 3WMRA 4XFKA 4TXHA 1QFSA 2NUTA 4ARUA 3VU8A 3DBLB 3H2JA 1VIAA 3RD5A 5C5DA 1M6VA 2FWRA 2IZOA 3CWQA 3G85A 4U39A 5C7LO 2YRWA 4IJVA 4KGZA 1KE1A 1C1YA 3MUFA 5D7NA 2OM2A 2JC3A 3IJPA 4BNLA 2VWPA 3ACBA 1BQ4A 1SXJB 5IJAA 4E6PA 1JBEA 2BSQA 1TUBA 3RODA 3MTBA 3HXMA 2SKCA 3GP8A 5JO9A 4QM6A 1JDPA 5FKJA 3S5JA 3ZKAA 2G80A 4P4LA 1JFFA 1ZBDA 2PR2A 1Y9JA 2CK3D 4KXVA 1OJ7A 1R5OA 1SVNA 4ICIA 4RC9A 3T5BA 3JQ7B 1RW4A 2BUAA 4RVHA 3RS2A 5DZSA 1GARA 2XQVA 3DAFA 1H42A 3FPBA 1P0FA 4I36A 2J4DA 3BGVA 3I01M 4GX5A 1DG1G 2I4LA 4MAMA 4W9NA 5IT9A 3LC0A 1KA9H 2VTEA 4JT4A 1EDBA 4C01A 3D8BA 1N8NA 2C1XA 3QKSB 4MROA 5J3JA 1J8DA 2FZ5A 3DCYA 3JY6A 4CIYA 3KU1A 1JNXX 1Y4UA 4FHFA 4RZHA 2GKSA 2XEDA 5DBGA 5FRDA 1FVHA 4WLVA 2PNFA 4A1FA 3CH5A 1HT0A 2NPOA 4Z1OA 1M2EA 4F3CA 5AD1A 1B1AA 2DPXA 2X8JB 2FG7C 2VF2A 1RHJA 3HCWA 3TTXA 2NMVA 1EEXB 4LFAB 1PGOA 4CCSA 3KQMA 1YJCA 1E1DA 1P4RA 2BCGY 4GE0A 3SJCA 4JVMA 2CUZA 3STVA 5FOWA 5TGZA 3QLUC 1S1CA 3DF7A 4N6GA 3PHGA 4C2TA 2HRDA 3BF8A 4MVCA 3K6JA 4FLEA 2QJWA 1RJGA 2W2OA 3IE0A 3RV3A 4TRJA 4TVBA 4WCDA 5HGXA 4IYRA 3QE3A 1DJPA 3HP1A 4OHWA 5NULA 3UGKA 5JLJA 1FVFA 3VR6H 5LBIA 1RBYA 4TRMA 4MP6A 1ZY2A 4F60A 4CUJA 2KYRA 1I7SB 1KEKA 2DJIA 4C1NA 3LU1A 4TLBA 1M2FA 1W5FA 1XTZA 2XJ9A 1MO5A 1JAHA 4H0FA 4O08A 4U8GA 1RJ9B 1H65A 3TO5A 5IHPA 4XGKA 1JQAA 1TVKA 4LJ6A 5MN5A 1PEDA 1ZRSA 2Q2OA 2P2SA 3BD9A 1FYWA 3IBGA 3Q7EA 4HDMB 2EBWA 3U4AA 2WF8A 4BL5A 2DR3A 4K87A 4YWJA 3KDAA 1EM8B 1SQGA 1X7WA 2BEJA 1O9HA 4OREX 2A5LA 3QOXA 4ID9A 4PNHA 4YJ2B 5CJPA 4DNFA 4EB6B 4LF6B 5E6RA 1QVZA 4LYGA 4XB2A 1WD7A 1MFZA 3K9FC 4PFKA 2Y93A 1LFDB 4MAAA 1AMNA 3IOEA 1IVSA 4CG3A 2DF8A 1DINA 3NM6B 1PR5A 4H0NA 4KNVA 4KV9A 4UVGA 3H8SA 4YROA 4BVEA 4LYYA 1PF7E 4Z4EA 1H3EA 4EGJA 1GTSA 4YGXB 4JYAB 3IQWA 2C5AA 1TAQA 1Z6PA 3RS3A 1I33A 4B3MB 1KI3A 5I3ZA 2BBTA 1JHAA 1E9BA 1YMQA 2A9FA 2BF7A 2VT7A 3F5QA 3AONB 3FSGD 4GMDA 1Z5WA 2H5LA 3EVNA 5BMVF 3KOZA 4A5SA 3IDAA 2VTKA 4CT5A 1C50A 3PXUA 3QX7A 1JKFA 1LB1B 1QE5A 2YH2A 2FWIA 3EXIA 4LSZA 4WFJA 1X80A 4Y2SA 4DMLA 4HNAA 3QYAA 1J8VA 3PC2A 2XCRB 5A6SA 2X9QA 3KVYA 4OGKA 1NXXA 2IP4A 3LP6A 1E3EA 3NHJA 2V6JA 2N47A 3KTAA 5ALFA 2QLFA 1CUBA 3A6JA 3D6MA 3K8YA 5DBHX 4QUIA 1C9EA 2HPHA 3N8HA 1Y6GA 2GAJA 4ALLA 2MSCB 3R7LA 3FDFA 5AI9A 4B81A 1A9PA 2HWUA 2PLAA 1L2TA 2W8ZA 3QEOA 3SVLA 3KAKA 1M5TA 1K6IA 3I92A 3LT2A 3QJGA 1C0EA 3QKRA 5CVDA 5IAEA 2CT8A 3L4EA 5BSEA 5ICCA 2I87A 1J25A 5L53A 1L5HA 1P3JA 2ABWA 2HPZA 4UM8B 4DLWA 4GDMA 2B5WA 1U3WA 3B8HA 2IU4A 2XGSA 4I5FA 3X1DA 2RHLA 5IHXA 3QUQA 4FYXA 2QI9C 1ZUWA 3GY0A 2JEZA 5H5JA 2YVAA 2GFQA 4AJ1A 2UVPB 2JFNA 4MWGA 4B34A 4K26A 1KEWA 4JEMA 3OUUA 5H7XA 3T0GA 1A8UA 1FS4A 3QHAA 2Q8PA 4JQZA 3WLAA 4TSRA 4B4OA 5AW0A 5HM8A 3GLGA 2C7QA 1SVOA 4ACBA 3PFHA 2CCGA 5BVGA 2OV2A 3ABOB 4QXPA 1GJRA 3EOZA 2W6OA 4LTDA 3D0KA 3WTCA 1DAPA 3HQ4O 4FMCF 5FTLA 2C5FA 2CJFA 2HW8A 4FGZA 1EP1B 2IRWA 2CLIB 5I8WA 5KNDA 4BFWA 4IQFA 2WU1A 2BFEA 1DEOA 4RVOA 3A6KA 1F38A 1W6UA 4GC5A 1WMFA 2I03A 2EKDA 2LW7A 3KYDA 4P35A 3F3MA 3UG7A 2V7QA 3KOXA 2NTVA 3Q98A 1SRQA 3QLEA 4YPVA 3BZWA 3OWXA 1RXSA 2I2WA 5LIPA 1D2CA 3GPBA 4GNRA 4Q4JB 1IQUA 4M1TA 1Z4JA 3IHWA 1BSVA 3AY3A 3PSHA 4Q3EA 2IPOA 4REOA 4I3HA 3OIDA 4Y6GB 4HMQA 3VGJA 1L7MA 2W8BA 4D9CA 3PXCX 3QG1A 1B6SA 4YQYA 4C06A 1W2GA 2EFEB 3A58B 3CNEA 4IJ5A 1KIFA 4PO8A 5TS3A 4AG6A 1GTL1 5HOQA 1ZH2A 1LGYA 3ICCA 2ZIWB 1HT2E 3JQDA 4LZWA 4FBMA 5EUBA 1NZFA 4HPWA 1E3IA 2GZSA 2KBEA 5F1YA 4ZDKA 3K1ZA 2C3MA 4D3DA 1DIGA 1YJQA 1MXHA 3TAXA 4D6YA 2FMKA 1KTIA 3PENA 1DEXA 3ZHOA 1X7YB 1ZN8A 4C05A 1XYVA 2N75A 5JFTA 5LMNB 1I7PA 3K1YA 4YXWA 1JR3A 2PQMA 1GZVA 2B30A 4JUDX 1JSXA 1XDGA 2G3YA 2PS1A 3TSAA 1OFHA 2BMJA 4GBED 2OV4A 3AGQA 3C5VA 4DM7A 1MJHA 4KE7A 1D8AA 4H7PA 1DC4A 2R8BA 5LSAA 1O0SA 4CL8A 3P0RA 4L3WA 3F6BX 4PPNA 4UREA 4WCFC 3IRVA 4DUGD 4Z6KA 2XYRA 1LQUA 2XUIA 3UV3A 2DTDA 3FBGA 4S0XA 5HTKA 1AUQA 3GMDA 3RTAA 2CW5A 2VEOA 2PFKA 1XTVA 5JCZA 4ZVRA 1XCBA 2X15A 3TD9A 3TI7A 1V7CA 4CBVA 1XZNA 1P2UA 2O2JA 1K5HA 4MP3A 3ZXUB 3A37A 4LDJA 3FHOA 1WV1A 1JJBA 5L4NA 5DMXA 1XQYA 2D2FA 1GPKA 5EWJA 2WSBA 2BTOA 4W1SA 2AG0A 2QRVA 5LJIA 2BFPA 3Q5EA 1LBSA 3TBFA 2WVAA 1M74A 4MPJA 4J90A 4BDSA 4DNXA 1B7GO 5HDQA 3OHMA 2QN2A 2QW0X 3UGJA 3OE1A 4L28A 4TSFD 3TEMA 4K9QA 5I8PA 2QRHA 2ZCUA 3LHDA 2IWRA 2JASA 1IATA 1MZVA 5DASA 3KX2A 4JR1A 1C1DB 3PUZA 2PGAA 4DCNA 2FK8A 1WQ4A 4Y6SA 4C20A 3ZGXA 2Q3JA 3LJKA 3PWKA 1MAHA 4INPA 2V9PA 5H9WA 1OI7A 3G2LA 3WX0A 1OA1A 4Q9LA 1KGDA 2AN9A 1C9NA 3IFSA 3W2FA 3OF5A 5J58A 2ACEA 3EPJA 4MV6A 5CVEA 2PTHA 1Z08A 2H54A 3BICA 1UBHS 4YRCA 1N1MA 2WD9A 3IAEA 4K2HA 5KBYA 1UPCA 1AF7A 4R8RA 1WD5A 3SXUA 3VVMA 4KNYA 2QRNA 4ARAA 3ZNQA 1RLIA 3EXEA 5EPUA 4QQNA 1VHTA 4F5WA 2NTYC 5KOHA 4US1R 3OP1A 1JH8A 2BZ0A 2HR1A 2YIJA 3NU1A 3PE4A 4M4SA 4CDRA 4ENPA 1MHTA 2W6JA 2BGRA 2KB0A 1AN0A 1D1QA 1R18A 3IR7A 4RQAA 5HTOA 2QG6A 4BZQA 4JELA 4DWJA 4I14A 3UFBA 4LDNA 1A98A 1J00A 1LI4A 3TFQA 1W4AA 3ZQKA 7MDHA 3ZX4A 5HFAA 2TYSB 1ATIA 1C1XB 5D5PA 5DSTA 5D3QA 3BILA 2GZRA 2RGYA 2ZBDA 3U7GA 5K01A 4BP3A 5AKHA 4OGGA 2GCGA 4XKJA 3T3HA 1P2SA 3VKUA 1ORHA 4UD6A 1E62A 4O8CA 2VLBA 1R8YA 3OE4A 4ZYZA 3W78A 1D07A 4FMBB 5ICGA 3OECA 3UIEA 3DLTA 3CF2A 3Q6IA 3BRCA 5KQLA 3Q4GA 2D54A 2ZZMA 2CXRA 3G1UA 3U0BA 5AVQA 2FPLA 4Z0HO 2ZXEA 2AZMA 4BV9A 1XRMA 4RSMA 3MBOA 4D25A 3UT5B 5AK4A 4DF3A 2V7WA 4LW8A 1K5DA 2VP9A 3DJFA 2QA5A 3HLKA 1G21E 2VYQA 1DDGA 1V1JA 2O2HA 5IJXA 1I51A 1DKQA 2C4TA 1Z2EA 1WF3A 3KZCA 3LX5A 5IAKA 4D8WA 4FDAA 1TZCA 5I9IA 1YQQA 1JR2A 2ZBQA 4ZTBA 3EBPA 1HLDA 5AO9A 1KDOA 2P41A 3VVCA 4RS3A 4A7PA 4EGAA 3C2QA 4IMPA 1V4VA 5E2AA 2BBOA 1YQDA 5FWAA 5IXSA 3DBHB 2A5FA 2AZXA 4REQA 1GNRA 3H9JA 2O3UA 4FUQA 1FP6A 3GA5A 1KZ6A 3Q40A 4W6ZA 4XGNA 2NXCA 2VQSA 4R3UC 3TQTA 3TX6A 3V4PB 1FSSA 4WCFB 1A72A 4BEWA 5K6TA 3WYBA 1DBPA 4OAQA 4MQ6A 2QYSA 2PFGA 2BFNA 1E5DA 3K0BA 4GKVA 4B3RB 4IJMA 4GOJA 1JXMA 4AB1A 4DKXA 3P9NA 1OYYA 3L6DA 2H3HA 2JGJA 4CV2A 1DUVG 3EPPA 1WB4A 1WEKA 4B3CA 2DEUA 1WPXA 5LDGA 5FO0A 2WINI 2JA2A 4UDYX 5DX8A 2GD0A 5GTDA 1AJEA 1ZD5A 1YFJA 1X7XB 1O5IA 1PR9A 1VIYA 4KVAA 1SFRA 1DIOB 2FKAA 2FW6A 4H3KB 3ELBA 2IUYA 3LQQA 1Z2AA 4TN5A 1DNPA 4AY3A 2XOKA 4MW4A 4PANA 4EB8A 3CTMA 4OLJA 4OVKA 3MCAA 1PTKA 3HGMA 3M6LA 3QXSA 4RCVA 2ZUEA 1WU8A 2ZTMA 2X0FA 3RRYA 4L4XA 4ZPJA 1QHNA 1YRBA 3R5XA 1HDRA 5EXSA 5BUCA 1UQTA 3OJCA 1TT5B 1U3GA 3C3YA 3QRWA 4I1UA 4IL5A 4PSCA 3ROGA 1SC6A 1FQKA 1VB3A 3ZD7A 3P9IA 4IQGA 1YC5A 5KYNA 1K3TA 3LQRA 1LDNA 2GF0A 2Y6VA 2IEGA 5ER9A 5J2UF 3WIVA 2JLUA 5DYGA 4GYKA 1E9EA 1XD9A 1G3IA 3UWDA 3JQ9A 2HIAA 2EFCB 2QTCA 3T1TA 4TWIA 5ECWA 2P27A 2OWEA 1LZLA 2B7LA 1MX3A 2JZOA 3R44A 3I1YA 4XYBA 3JQPA 4N5HX 4ZMRA 4DMCA 1O6CA 3HCAA 3L9WA 4FJ0A 1M2JA 2H8KA 2YQ4A 2O2IA 2VHJA 2OQ2A 4C3VA 4XWTA 5JCOA 1II0A 4HGPA 1QMPA 1VLQA 3DDHA 3GRVA 1U7DA 4B6QA 1B2RA 2R6HA 5TPZA 3QX9A 3W9SA 4E4YA 1V35A 3QNWA 2JB9A 3IXQA 4QDOA 1SQ0A 5FLEX 3V4LA 4CL3A 3ADDA 3JATB 4MCIA 5CB6A 4G5GA 4TKZA 4TYYA 3RNLA 1R12A 1V1RA 1B74A 3DDCA 3PNPA 2NU7B 1R6DA 1XA0A 3R2JA 2YIVX 3GUVA 3NOXA 2O2CA 3STUA 3WE7A 4E70A 1CC1S 1G8GA 1QFMA 1YIOA 1EFRA 3HJGA 5TS2A 2SKEA 4E30A 4OLAA 4QPPA 1FC0A 1QRSA 1W76A 1J42A 1RQ2A 3KZVA 3NBAA 2ZSEA 4J2OA 4AMZA 1TQ6A 2EBHX 3S2ZA 3JQRA 2ONJA 5F51A 3VH2A 3H4MA 3GFPA 2EBUA 3HI6A 2XVMA 4P3NA 1N2IA 3BDAA 4TROA 2ZYSA 3DZ8A 4MS4B 5TE9A 4CM4A 3EGXA 4L4RA 1AURA 5C8XA 1I30A 2MHCA 2YXEA 3FVRA 2PL5A 1GLNA 5LA6B 3TD2A 3TJMA 1R0LA 1T5SA 1T6NA 3HPQA 4RLHA 5F3DA 5F1PA 2RD2A 1Z0AA 2C3UA 3SS9X 3HTXA 5KJCA 4F3KA 3DZDA 4HX2A 4MS1A 3ICEA 4WINA 4U3JA 3SQWA 2XE4A 3RUDA 4BFCA 5D1HA 4CVNA 1GUYA 2X3FA 1PDWA 4TUYF 5D2CA 1YSCA 1ZJ6A 3C6XA 4G0MA 1PK7A 4S1PA 3KVVA 4CMCA 4N3NA 1SQ6A 2FP4B 2F8MA 3U4IA 1G5RA 3IKMB 4X6XA 1ZCAA 4OGFA 2Y0EA 4JOQA 3R5TA 1Y8RB 2GHIA 2IYZA 3HDVA 5JCPA 2P1DA 4EX6A 3QVGB 3L49A 1E8MA 5HF5A 1H2XA 1Q7CA 3IDSA 3HCEA 3S2FA 5LVAA 1SKYB 4J4BA 3QW4B 3MPOA 4TLLB 5B1IA 2MSDB 4CM4B 1XZCA 3LMKA 1JIXA 3OKPA 5LBUA 4EG8A 3TPCA 1Q1NA 4F93B 2C1ZA 2X4GA 2ZIUB 5IJ9B 3K0KA 2VHUA 2TMKA 4LDQA 3ZBTA 4AZSA 2FEXA 4TMYA 4WNAA 4QM7A 1KU6A 2BM8A 2X2FA 1YOVB 2XBUA 3V55A 5LYYA 3WHIA 1SD1A 3KL4A 4A1OA 4KO2S 2ICAA 3QK7A 3FF1A 4U7TB 3GNSA 2ENUA 1J22A 2ZT8A 4IIDA 3ZDZB 4BBAA 1DEAA 5JXIA 3OEEA 3PFNA 1C4XA 3HMKA 5E6SA 2J3KA 2K2QB 5AVOA 1UK9A 4H0CA 2P9CA 2ZJ3A 3ZHYA 1L4MA 2PG3A 2X7HA 3MD0A 1J39A 1IQPA 4JT9A 2IHVA 2AVDA 2A59A 4ZP1A 3PDWA 1XJQA 4A36A 4A16A 2GN2A 1ZM7A 2Z2KA 1IPFA 3HCNA 3DLBA 1IZZA 1OT5A 3UFXB 2WIGA 1L1QA 3HR7A 4MP8A 1U9IA 2J32A 2SICE 3I1IA 3AOEC 3MGBA 3DV0A 1V47A 3AKCA 3TRDA 4QO8A 3U48A 1FP1D 4P9NA 1Z8HA 5EOVA 4RH1A 1U2GA 1NJ1A 1WW2A 2PS0A 4NECA 2ZR8A 1H22A 4CMIB 1A8SA 1OTYA 2PRKA 2OCDA 2C4KA 2RB4A 1U0RA 1V6AA 2WIAA 3LCCA 4QUEA 4ZAWA 2YZMA 3ENZA 1W44A 1CY1A 2QAIA 3OWOA 4JA2A 3B1ZA 4MQLA 5I4IA 4DUYB 2O8EB 3NKVA 1CJVC 2KI5A 3AUKA 2VP6A 2QP9X 1BU5A 2Q49A 1OXUA 4KMRA 2GK7A 1L5ZA 3M4ZA 2WSLA 4RGQA 2FZCA 5FL3A 4MVWA 4BWYA 3ZE1B 1AVTA 5CXQA 5HF8A 5IKOA 1IBCA 5KYWB 1UWLA 3TGPA 4Q02A 2JLXA 4GOND 1BFKA 1E2QA 5HSGA 3W5DA 4JBIA 2XIQA 1YIDA 3RK4A 3A70A 2OHFA 4LVCA 4KN5A 3O9VA 5B1YA 3L0DA 2FI1A 2QTVA 5FTWA 2Z0MA 1CDDA 4K86A 2V7TA 2C9DA 2D4HA 3MOGA 3VNAA 4BNIA 4CDNA 5AHXA 4PQEA 2QTNA 4Q66C 4AIIA 4EQ6B 1ZL2A 2M6SA 3C3MA 4U5QA 5GIOE 1N0UA 2A88A 1P74A 2HZBA 5I7VA 1CDZA 5D3ZA 1YVRA 2JVIA 3QYPA 4I55B 4B31A 4BNMA 1WSAA 1O94A 3WJAA 1L7VC 3R4VA 4FFLA 4CMGA 4ENUA 1BYIA 4CQMA 1IG3A 2QYTA 1H6DA 3O1HB 3CLRC 1NUSA 3QFRA 4ZZIA 1CP3A 4NHOA 3D1JA 1W7AA 3UVEA 1C8KA 4RSHA 1HFEL 1R0ZA 3GAMA 1Q14A 4OGWA 4RVFA 5EVJA 3S40A 2H4WA 1AUVA 1XLUA 3NHWA 4U00A 2PWBA 5FPPA 5M04A 1PZMA 1M10A 1S2NA 2JFXA 4LNUA 4UCXA 2QMQA 1M67A 2ZJ2A 1RZRA 2OCGA 4PAOA 5BSTA 4POOA 3UK2A 4R9UC 3L77A 4OIFA 4LC0A 2PSHA 1OFUA 3Q7IA 5DM1A 1GT6A 3EFEA 1JMKC 5KJ1A 4Q9HA 2OHGA 2X5OA 1QG4A 3T1HB 2LCFA 3AUJB 2WT9A 4Q1AA 5CUQA 1U3TA 1FQOA 3BWCA 3CCFA 2EJTA 2PFSA 3L8EA 5BNIA 1KORA 2BYTA 1JT2A 1M8GA 4ZC1A 4GBGA 2D4AA 1VBFA 1ZIPA 3H75A 1ZU4A 3TB4A 3NRJA 3OICA 3PEUA 3GVCA 4HRAA 4P8RA 2AYXA 3SYKA 1G19A 4EGCB 1OYVA 2FSVA 4OP1A 4M8SA 3OZCA 2X58A 3CPEA 3DOUA 3HWX1 1BAPA 1LSSA 4V0NA 1NXTA 4H18A 4BUCA 3RUFA 3ADPA 3E3OA 3L6OO 3H11A 4WY2A 2X0DA 5ARCA 5NLLA 2NUPA 1ACMA 4A8HA 3NWJA 3JQBC 5A4AA 2V6GA 5AJXA 1H1DA 3K9GA 4AJNA 3DBLA 2QK4A 4YAWA 4AS2A 3RVOA 3AM5A 1QCCA 4Z86A 2A14A 2EWWA 2FKNA 4M8LA 4PS1A 4HRVA 3U6BA 4MUKA 3EG5A 2AFVA 3L8DA 1GA6A 1SXJA 2AF3C 2ZAYA 3GMTA 4LSGA 3RF7A 2OLJA 2Y0PA 1E89A 1N3LA 4XGQA 1MC1A 5FD8A 3T3IA 3FG9A 2Z8ZA 4WTOA 3QY0A 4WKNA 3FH0A 2XWSA 4C4AA 4YMTA 1ZITA 2EDCA 3A4TA 2G5CA 3Q5DA 4YQEA 5C46F 1RYHA 4QO7A 3JQ7A 4B40A 1PG0A 5FORA 2B2CA 3D02A 2QBYB 2Q6KA 3KJNA 3TMKA 1XWWA 3W05A 1PZHA 4LY9A 4V2IA 5T8KC 4DA4A 2IU3A 1Y8QB 3HZRA 3L1KA 4UC0A 1IHOA 4YRTA 1U8FO 3HYSA 4J7CA 5BUSA 4OTZA 4Y2QA 4A73A 3P9CA 3QKSA 3MERA 3CR3C 4WRRA 1L4YA 3AW9A 1ODFA 3PX2A 3VOSA 1YHYA 2SBTA 2Z2ZA 4CM9D 5AW7A 1E6CA 4H3SA 2OILA 2QQEA 1LI5A 1KRWA 3U3JA 3K0AB 3BIFA 3DV2A 3IEMA 3H4IA 2AFHE 2R1UA 2X8JA 4QARA 1M5RA 3NBFA 3ORYA 2CLCX 2ATIA 1DKNA 1GQOA 2X41A 5BPHA 4FYWA 4NS1A 2HTFA 1IHDA 4DC0A 5A4MS 2AOXA 3QENA 1V71A 2FR0A 2JGAA 4MKXA 5A5VA 1QIEA 4KHPB 1CT9A 3ITDA 1DAIA 2O3TA 2SECE 3N0RA 1JBQA 1O6ZA 4JXZA 4LDAA 4WUVA 2VAPA 5IAGA 2J3IA 2VDJA 4HYYA 4OUKX 2VTVA 1ZESA 4YACA 3R9IA 5B57C 3COVA 3KD3A 3AXTA 4UEJA 4G5OA 5EMHA 3VDXA 4AL4A 4WFIA 4KR9A 1LCIA 1DXYA 3H2IA 4WK2B 4GRDA 4BNYA 1CG6A 4ER5A 1XNQB 4HP8A 5DHTA 4TZ6A 2IBTA 1PSWA 1P31A 4D79A 2PMCA 4C7OA 3CPHA 3A06A 2IHYA 1HQYE 2DGDA 2GXSA 4L8WB 3LIIA 3TIXB 1RJ9A 2HJGA 1IHXA 2X77A 2AX3A 2F9LA 3IEKA 4HDMA 5ALRA 3SDZA 1N9KA 4YDRA 1PT8A 4RHYA 4DLKA 1CXZA 2PU5A 1GADO 1Z17A 4KDCA 4PG8A 1U0HC 4EB6A 4YJ2A 1CQWA 2FSHA 2EERA 1M1NB 5FBZA 3NHZA 3WA6A 2X8LA 1PR3A 3RFCA 2IY9A 4ALNA 5AKIA 2IA5A 4H7FA 5ERGB 2BFDB 4KAJA 4OJKA 4X1OA 5KJFA 3VOTA 1AUPA 3PTAA 1F4LA 1JV2B 2XNDD 1CUCA 4A2CA 1MCZA 4QOGA 3OCJA 2H1VA 3N0WA 4GFDA 4KJXA 4WOJA 4E7PA 1Z5GA 2ZFUA 4HDRA 4MV4A 1GNTA 4LOLA 5C7YA 4C6TA 5J63A 4HLUC 3OVMA 4F46A 3AUUA 3Q12A 2KBFA 5IZ4A 5KTRA 1PZGA 3LA6A 2VP3A 4M36A 5FL7D 5JISA 4FK8A 2H52A 1Z5OA 4F45A 5IXJA 4HYQA 4QJIA 3W6PA 2FW0A 5KHLB 3TFOA 4WKCA 5DYTA 3ZPXA 1SVSA 4Q1CA 3UANA 1JQ3A 3KALA 3D31A 3WBFA 4NV1A 3C3EA 1PDVA 3OBIA 1GCAA 1VLMA 3OT1B 4I1OA 3DHNA 3SF8B 3MJRA 3BXGA 2P2GA 3D4LA 4XM0A 3L8HA 4Z4HA 2FZVA 4JWTA 1XRPA 2J9YB 3C43A 1MBZA 5AKLA 4MUXA 2OAQ1 3AI1A 2O14A 4BBJA 1UBUS 3B9RA 4ARZA 5AFSA 3L01A 3I53A 4BVLA 4AROA 3DT9A 2QX8A 3E5MA 4BY9E 5BQOA 3RB8A 1UEIA 2OSBA 2EEZA 2WWHA 1KZ1A 1WKBA 1G21B 4A2QA 4Z9YA 1GSAA 5CB4B 1Y7HA 3GGOA 3CE9A 2OL4A 1W4LA 4HH3C 2WHQA 1QTRA 4JCOA 3AK4A 4LV5B 3LC1O 3FMVA 2I2FA 2JEYA 4HB0A 4PZCA 5AM4A 2OD2A 2UVPA 4FWTA 1VI6A 3ADKA 3B3JA 721PA 3AV0B 4N48A 3RCBA 4B46A 4EYKA 1XNHA 3JAWA 2HIGA 4Q5IA 1N5RA 1SUIA 1Q15A 2HV9A 4ZVUA 5K3SA 1MW8X 4JK3A 2HLDA 2PKQP 2Q28A 3CR7A 1L5GB 4KLZA 4NG5A 4EHHA 3HXOA 2JH9A 2WWVD 2JFGA 2C9BA 4C4PA 3M6AA 4BPBA 3ZH2A 4H08A 1E58A 5M2QA 2VJNA 3LLMA 1NMXA 2ZSDA 5I6DA 1XB2A 3ABZA 4ITRC 4B3HA 5FBWB 3IAS1 5A9RA 1K7SN 3G0GA 6ABPA 4BVKA 1TU0A 3OG9A 4FM9A 3KXPA 2ILTA 3LDFA 1L7RA 4DMFA 1KH2A 1EXMA 2WVGA 3STWA 4LE0A 5JU6A 1G64A 4AG5A 1G6Q1 2EFYA 2W6QA 5JMWA 1J8FA 3DVAB 3QLUA 1J2YA 2PMWB 2XUFA 1RM4A 4EY4A 4RV5A 3GMSA 2PGNA 2QX9A 1AQUA 2VHZA 2AR7A 3D8HA 1QG2A 8LDHA 3G0HA 4B6PA 2W98A 4DNQA 1SD2A 4YBZA 4MKFA 2QN6A 3WJ2A 1E0KA 1R16A 5I4CA 2IU0A 3G0IA 1ZOLA 3HV2A 4UAUA 4JQCA 3BULA 3GFBA 4O2RA 3R6TA 3L41A 4DSUA 4XUCA 1CULC 2PLRA 4EJ2A 4DY6A 4ENTA 3OD5A 5JV5A 4RTKA 5JWHA 2HBRA 2FH5B 2N1MA 3UOGA 5JXGA 1QC5B 1X7YA 2BZ1A 2GBPA 1FLNA 2ZGVA 2P0YA 4JLNA 3EXFB 5HNKA 2RE8A 1QO0D 1GUDA 1UKVY 4EW3A 3LHKA 1ZGBA 3VPFA 4DCMA 3NRBA 4J3FA 3ASUA 1K88A 4JB3A 4LI3X 4R41A 2B34A 5IH3A 5KKNB 4ZEVA 2CLMB 2Z9CA 3CXUA 3UMYA 3N58A 5JC1A 1IY9A 1J0XO 1KVTA 1OVMA 4RF4A 4ZYVA 3S28A 3W6ZA 4OV6B 3ZNPA 3ORRA 2VNAA 1XMJA 1IN5A 4G1CA 3SR0A 1OI3A 1V8DA 3GGCA 1U7PA 1PJTA 4RZXA 4L27A 2ZXUA 1I6WA 2WJGA 4W5HA 3HDJA 3EVDA 1YUNA 1CUSA 3NNNA 3B5JA 3DNPA 1UMCB 3AG5A 1WTAA 2CN1A 4RMIA 2P2CA 3A1FA 4MKHA 1NTOA 4YP0A 4DWVA 3LZDA 2F64A 1AS2A 1H1TA 1BGWA 2WUFA 3A7DA 3I6YA 2BMVA 5BRAA 1NV9A 4Q6BA 2XRZA 4NH0A 1XQXA 5JR3A 2WIJA 1E20A 3RT1A 3PDHA 4N6OA 3V46A 2B36A 1MR3F 2CSUA 1LDYA 2XVZA 4CE6A 5BSFA 1PL8A 2A86A 2FOIA 1T0IA 3E15A 2O2SA 3B70A 3CX3A 1C1DA 3PV0A 2YZ2A 1RTTA 1G59A 1PQ4A 3KKKA 2ONCA 2RBKA 1RCTE 1WDKA 2ZI9A 3CX8A 1YB1A 3FVQA 1FE8A 4OQNA 4WADA 4PM4A 1IUNA 2ZBEA 4BVFA 4N12A 5AXBA 3A32A 5HRCA 1KR5A 3QKIA 2ECOA 3R8CA 4R9SA 2AJ8A 5DTIA 3VTFA 4R2WA 1VJ0A 5DOZA 3L9XA 4LYJA 5A5FA 3NKFA 1E9DA 3U4QB 3HCOA 3O31A 2IYLD 1EA7A 2Z2IA 4OU4A 1UM9B 2R1TB 1AHNA 2QPAA 2GZHA 2V1UA 1Q7TA 1EVZA 5TRTA 1GGEA 1M6EX 2FWJA 2BLLA 1T2NA 4G1EB 3ZW9A 3ME5A 4KRGA 1TECE 3SU8A 1RLTA 3GP5A 4WE3A 1QRDA 1RLJA 3ZNNA 3IUPA 3UO8B 8AT1A 4NV0A 3NR2A 3CJQA 3QUAA 1IRIA 2IFTA 3NQ41 4M1YA 4RK5A 4Y6RA 5JXWA 3OT5A 4HAVA 3Q2KA 1FTGA 4RHEA 4L3VA 7YASA 2R6GA 1I2MA 4R3NA 5CM8B 1VCNA 4V38A 1VIMA 3NYRA 3S6JA 3T9AA 2I4NA 1CY7A 1KETA 1C1XA 1J06A 2VAWA 4J0IA 1C9JA 5CLIA 4YVFA 5IYZF 5JIBA 3FJ1A 1CUJA 1OGJA 4RPKA 5IPFA 1Y1LA 2PX3A 2VPWA 1UXHA 3T9DA 1RC0A 1TJ3A 1JDBC 2VG8A 2HL6A 4HEJA 5IM5A 1H66A 5BR4A 1ZM2A 2HJRA 2IUTA 1SUWA 4P3OA 4D6PA 2IH2A 1Q2UA 1ML3A 1O97D 1U7TA 2Q3EA 3AI3A 1F48A 3QXXA 4IDGA 3P8ZA 4NICA 1YB6A 5BYKA 2ZAGA 3HB0A 2W83A 4JJ6A 3QPWA 4QSMA 3FNHA 2WVHA 3K73O 5GJCA 1JG3A 2I1QA 3R1IA 4EFNA 2FN4A 2PD4A 3IAS6 4CRWB 2IXAA 3UT5A 3WYDA 1P72A 5HQTA 5JPCA 1I3LA 2HI0A 5EINA 3SVZA 3RBVA 2JLSA 1NONA 3EZYA 5DWQA 4FVTA 1TCUA 3KHKA 3NJ4A 4IDDA 2FSGA 1WM1A 1W36B 1POXA 3W4KA 5IU6A 3KUUA 1J4AA 5J4KA 4LXTA 5JFOA 1M66A 2AN4A 5DDIP 5I7UA 5C5EA 1IQ0A 1GU1A 1WA5A 2QPLA 4QAJA 5AP9A 1F1BA 4JI7B 4WD3A 3E5HA 3E9RA 1FPMA 3DBHA 3IQEA 4H3VA 4KR3A 4AC9A 3V4SA 4ARCA 4YECA 3QVSA 3DW3X 5KX5B 4YS6A 2VHCA 1JU9A 4IQ8A 1Z3IX 1EJ2A 1II9A 2OE2A 4WCFA 1SIWA 1Q7EA 2J6CA 5EHIA 4LEIA 1T15A 3HA2A 4KKVA 3HZZA 1EUCB 3JQQA 1R64A 1NYLA 3B7WA 3QJYA 4L72A 2QV0A 1V5GA 4GZLA 2WAAA 3LBHA 5HF9A 3O3CA 3U7JA 1KQFA 4CKYA 1S4QA 2Z83A 3EIWA 3TRIA 2B37A 5JPDA 4DPMA 1X7XA 3C24A 1NJ8A 1NVAA 1JTFA 4K9OA 4D82A 1XZQA 4UM7A 2E1PA 3AKEA 3WBKA 4F11A 4JI2B 3I2FA 1QZTA 4D46A 2L42A 5IANA 2PJDA 3DBVO 2YV4A 3RSGA 4CV1A 1LW6E 4IX9A 4NR0A 5JADA 2R8EA 4JVNA 3I39X 4JCCA 2Q3FA 3UUEA 1KQ3A 1PJ3A 3HCDA 4HWTA 3ZZNA 5AW8A 3ZBQA 2PX8A 1AG9A 2GBLC 4Q7EA 1DLJA 1VE7A 3IA7A 1TM7E 3N28A 1V41E 5ULLA 4MVJD 4XTCS 1YR7A 3ACDA 4MWTA 5C1IA 4D81A 1XRNA 4D8TA 3R3ZA 3VM6A 2G40A 2PGDA 1MU0A 1TADA 4RIFA 2GASA 3L1JA 2O06A 2PBZA 2P1ZA 1COWA 1IN7A 2NSDA 3G89A 3KKEA 4RMNA 4R0NA 5CBKA 4JLVA 5HQJA 1DTEA 1ZNYA 2JI7A 2JLAA 3AM4A 3QHQA 3QFCA 4Z2YA 3L6CA 2HNBA 4HNTA 4NXMB 2I91A 1QV7A 4LXGA 1K4MA 4X95A 3UMCA 4JB2A 1D6JA 2RKOA 1EFHA 3AHDA 3FTQA 5AK3A 2CHQA 1G2IA 4PVCA 4AKTA 2B6HA 3TNYA 2IOHA 4I2VA 4CN9A 4Z3KA 3JATA 2VA8A 1M9NA 2B8WA 5CXUA 3TCKA 2NU7A 5HILA 2H5JA 8ADHA 1FW6A 5K4GA 4Z1MA 2OQIA 3ASZA 1LNQA 1KSHA 2ZJ0A 3H5AA 3EA5A 3BGSA 3WYGA 2WYOA 1B43A 3HFJA 2QTRA 1Z8FA 1Z6QA 3ABIA 4L76A 4BN5A 4M9SA 1GGFA 5IC4A 3OFKA 2Q1TA 3R8XA 3VVBA 2REXB 4DSNA 4RU1A 1TNDA 3HJHA 2VDVE 1Y6FA 3R3SA 1HDEA 4K8OA 1KDZA 1JDBB 1NFQA 4MS4A 2KJQA 4BMPB 5K6AC 3HADA 3KQUA 1IK6A 5LA6A 1P29A 1QPGA 1DB3A 1LLCA 3G8DA 4YRLA 3F3KA 1RBZA 1V8FA 4PVDA 4BMVA 2WG2A 1PBTA 1ZGGA 1YS4A 4Q7MB 5CIWA 3SQNA 3T7IA 3H1EA 2DQYA 1KVQA 2YKGA 3AR2A 1W5EA 1SUAA 3SICE 1DBWA 1V0JA 2QLMA 4NK4A 1EP9A 2WJZB 2HUPA 4WHMA 2JJ2D 1EK5A 3NYQA 4OYLA 2FP4A 3LRXA 5KAPA 3UHAA 2CSXA 1D2HA 4IIVA 4BFSA 1YDEA 1Y8RA 4DRZA 3N70A 5JY6A 1ANKA 1N7GA 2HA2A 3CEJA 3QVGA 4F2WA 4NBNA 4FHGA 1CW2B 2H4HA 1L7OA 4B48A 4KRFA 4U2BA 4J7UA 4XARA 2AFHB 1NLMA 3ZY6A 1U5CA 2YNMD 3QVOA 1PNRA 2JCSA 1TRKA 4DXAA 4ZQCB 2R68A 4BE4A 1VG9B 3PVCA 1AKTA 4OGLA 2W71A 2ZP1A 5T5QA 2BFMA 2EFJA 5IJ9A 3UTDA 3OPYI 4PAGA 5DN6D 1E0AA 1U28A 1EIWA 4WVLA 4FC6A 5AW3A 5K6RA 4W5RA 1YOVA 4GQBA 1MVLA 4IH4A 1UZUA 2X14A 4IV5A 5I7HA 1SUEA 2R5WA 2WA2A 1Z4IA 3MCWA 4UHEA 3HB7A 2WUEA 3T9BA 4BAZA 4Y67A 2P9GA 4JP1A 1U1EA 3U09A 3C1TA 4YUZA 4HDNB 2P9YA 5EHQA 3W4IA 3DXZA 4JSYA 3PP8A 4I19A 4EARA 1EJ0A 2Z43A 3FLAA 4Q7KA 1TTTA 4QL3A 4ZYTA 1KF0A 4UU7A 2HSGA 4JC8A 2IXGA 4B47A 1EQUA 4GGMX 4JH0A 2FUEA 1Z35A 3PWSA 4B3FX 3UMJA 4RD0A 4EENA 1XR3A 2JIZA 1T1IA 4FEYA 1AKUA 1W35A 3CSSA 1VL2A 2D06A 1NUPA 1SEPA 2ZIZA 1O96B 2I71A 1GDDA 3IELA 4G9GA 3WZMA 4R4JA 1B6RA 4DTCA 1EM6A 1NNSA 4CODB 3G8BA 3CLSD 4IP0A 2WP0A 1ZGHA 2R8PA 3QFTA 4QUGA 1EE2A 2G9UA 4RPCA 3TZHA 2OV8A 2OQRA 3SQOA 3DONA 4DILA 5FWXB 4QEKA 3CLVA 4CMIA 1Q5PA 2CL7X 1WPRA 1G2PA 5ESWA 2BGUA 2F8TA 4O59O 2O8EA 5HMMA 3GIWA 4LE1A 4DCUA 1ZRNA 4OF4A 1SCUB 3CG0A 5CYGA 2R6FA 1ISGA 1Z0JA 3ROPA 5JCXA 2IXBA 2JK1A 4WA7A 1GGNA 1Z7BA 3CTPA 4HDOB 5JAQA 1CFJA 1KXZA 1MVNA 1X7HA 1T3HA 2HQRA 3D0RA 1J0DA 4R8VA 1PL0A 3T15A 4R3WA 5KYWA 4V3BA 4X71A 3T41A 2GJ9A 2YN0A 4QICA 1GXSB 2WU4A 5CJ2A 1J5PA 4NBLA 4R5HA 1PKEA 3PKZA 3ZE0B 5I47A 3EZNA 4DCJA 4RK6A 1D3AA 4OSEA 5AT1A 4F38A 3B1FA 1X86B 3CC8A 3LGXA 2QNRA 5F7ZA 4EQ6A 3BFKA 4ND3A 1ID8A 4LDPA 3KJIA 5HP4A 4M60A 2QUAA 3H65A 5AHKA 5ELLA 2YHAA 4I55A 5F2OA 4UTNA 2GD1O 3GUUA 4EHAA 5H02A 3PTLA 4LCBA 1PEKE 4ZARA 2E87A 3G8YA 4B2YA 1QUFA 1RWOA 4HF7A 1PYOA 5GMOA 4RKFA 4C0LA 3LVFO 3TINA 3VZDA 1GLGA 2XBLA 5DHPA 1X19A 2I4OA 3JWEA 3NUGA 4PLTA 3C1OA 4PLFA 5HX7A 1H5UA 1CUXA 3FOEC 3KXIA 4K0KB 2XXAB 3P2YA 2VK4A 1DAOA 1RDFA 2AUTA 4A6DA 3R5JA 3E1GA 3I5MA 4YP9A 4ZCIA 3H1TA 3I73A 3V8QA 4P0PB 5H9VA 3DE1X 4IR7A 1JYEA 4KO4S 3B2QA 4R1OA 3EOBI 4UXHA 3IQDB 3ESQA 3I9MA 2W6NA 4JGBA 5F9MA 4KJZA 2FPPB 2QTAA 1CLUA 3KB2A 2DFLA 4G4GA 4MCHA 1OJLA 4XOIA 3V8NA 4DG8A 5BY2A 2CNLA 2QL6A 1R15A 4N0QA 4DMHA 2W43A 3ID6C 2P6NA 4LTMA 4IJKA 3DC7A 2J30A 4I6EA 4PC7A 3KBBA 4M8NE 4RK7A 3V8BA 4MRNA 3L1IA 2G36A 2XQFA 4UTOA 4EW1A 1PW7A 3KSBC 3BD6A 4KQWA 2MYTA 1YO6A 1SG9A 4XEUA 1NJ2A 2O52A 1N75A 3O4VA 3STXA 4M0LA 4KK3A 1H3FA 3TPFA 1A1VA 3EWAA 2VDRB 6REQB 3X1YA 1FZTA 4OJYA 4EKIA 5LP6C 3UF0A 1NE7A 3WTBA 1UUFA 2O2ZA 1ICEA 2PSSA 3C8HA 4QVGA 1LH0A 5JCJA 4PN7A 3PG5A 2DKNA 2PUEA 5BNTA 4XWAA 3QOWA 1SCDA 4B6FA 3COYA 3I3OA 1YA4A 3MJFA 2G6BA 1NYQA 1HR0B 4KR6A 1RRFA 4W1PA 1XZLA 1BE6A 3KNZA 1E6MA 3LK6A 1NBOA 1B2LA 1DKRA 3B82A 1F12A 1BTOA 1BVYF 1N2GA 1PK8A 2P7HA 1IY8A 4LQLA 5DGDA 3MHPA 3Q15C 2OUIA 4ZAXA 5KYKA 4LOKA 4KQ2A 3UK6A 5HZHA 3P2OA 4RTNA 2EIXA 4E33A 1U02A 4O4HB 1QQ7A 3PQFA 1F0PA 2PXXA 1I2AA 3D7KA 5CITA 3ESZA 1QQ6A 3LAWA 4JODA 3Q72A 1S3IA 2W2VA 4INOA 3LNTA 4C4RA 1AQIA 4XB1A 1GGVA 4ZAVA 3ZEAA 2VKQA 3AOEA 4RFSB 1QJCA 4L4ZA 3WK8A 1QTQA 5COBA 1J8YF 4XASA 4DGSA 2QBYA 5LYJB 2XA1A 3LF1A 1VMDA 1DADA 4UBOA 1YRWA 3D6NB 2F8SA 1JEYB 4MJ7A 2WY2D 1BKDR 2J9FB 2MMCA 3CWCA 1Y8QA 5I7RA 4XVRA 3DM9B 4J1TA 1P7ZA 4BDTA 1YDHA 1KBOA 2GPNA 1FFSA 1TFUA 3HXPA 4NU5A 3WB9A 1IEVA 1VIVA 3AHEA 2QXUA 4BGDA 2HDHA 3RIMA 4WZBB 4IZ6A 2IYNA 3AEYA 2UUCB 3K0AA 5FR1A 4D9MA 3B6JA 3EUFA 2HMWA 2VWHA 1X0VA 1Y9EA 2J1LA 3ZDFA 5LUBA 2HRCA 1G2QA 3BH6A 2QTZA 4M0FA 3H2HA 4HL6A 4K9RA 2Y2VA 1PQPA 3GLFE 4LXIA 2JFYA 1UH5A 2CYBA 3IE2A 4IEIA 2F9FA 2DXIA 2O1SA 3PVSA 5E7JA 4RKRA 3W2GA 3WS7A 5B12A 2EKLA 1DIHA 5KHOC 1ZM9A 3EOAI 4CF4A 1G8HA 2WU0A 3CW8X 4BJ6A 4P08A 2EVWX 3L0YA 2A9VA 3ADOA 5A9TA 4PYIA 5F7OA 1EA5A 3U7EB 3LGAA 2YVQA 2YFHA 3DMTC 3ITEA 4FNAA 3C74A 4JB0A 4Q48A 5AOCA 5FUYA 5ELXA 2ARKA 3DSRA 4YO8A 1ZUNB 3CYFA 2QY9A 4PPFA 3CRVA 2AKEA 1JDUA 1YBHA 2ESRA 2NXWA 3KXKA 4IAOA 2R87A 2WJ6A 3LWNA 2ZJ6A 4YJ2F 3TLEA 2R3SA 3RV4A 3CNOA 1M1NA 2C7PA 5ES4B 3MT7A 4P7KA 4G4IA 1E0SA 1M72A 1MX9A 1OI2A 2F90A 1YZGA 3BBPA 4J9VA 4H27A 3ZE7A 5CTAA 3O9ZA 3DH0A 1YZYA 2BFDA 1C7EA 4D97A 1K8YB 3PFFA 5CVCA 1H8ED 4LRYA 3KUCA 5E4YA 1NL3A 3RG2A 4EY8A 1T5TA 3BRSA 3VAYA 4KDFA 3SC2B 3W06A 3G7NA 4MICA 4B3BA 1W49A 3PRKE 4DOMA 1MXFA 1KYVA 1SUDA 2XKKA 3HEMA 3SZ3A 3ZHCA 2R62A 1MG0A 2GERA 1RS0A 1RXVA 1LSJA 3RYFB 3KXLA 2C9MA 3F8WA 3T3NA 4NMMA 3M2PA 2FW8A 4Y1GA 2XF2A 5G0VA 3MF4A 4ZAFA 4CF6A 3DGEC 3LBYA 5FBVB 3A28A 5LP6B 4KWEA 1MOPA 2RI6A 4OAPA 4FFSA 1FDIA 1CRWG 2XUHA 1W96A 4DIEA 1EDZA 1IEQA 5CLQA 1YJ8A 1QCYA 2OXIA 2F67A 2YUTA 5HRAA 2JKZA 4OLBA 3BFJA 3OT1A 4YLGA 2DE0X 3JQBA 4YCNA 4CM1A 3E23A 4AICA 2WWXA 3SF8A 1IXSB 1WUYA 3N86A 1DG3A 3QI7A 5K3CA 2BM9A 3SYMA 2ZR7A 1WY7A 3OZWA 3CH6A 1U8ZA 5CCDA 2NVWA 4GL2A 1VL1A 3CXRA 3OTIA 5CLLA 1D5CA 1G21A 1LBHA 1TCVA 2QRZA 3IJ5A 4R1LA 5ESDA 4ZCMA 1DQNA 1TGYA 4J0QA 5IJ0B 5ITWA 4N9WA 4KPEC 2C29D 1PD0A 2D3WA 1NI5A 2OZVA 3BD7A 3C5CA 3A05A 1QMGA 4LJ5A 5K20A 2JJQA 1TZ2A 2DMRA 2OFPA 3ADCA 1HETA 2O7VA 3IBTA 2IY7A 3BSYA 4LTNA 1Z5NA 1TEHA 1J07A 2YJ6A 2P4SA 3ZKWB 3HEBA 2ZSBA 3ZXXA 5EWMB 5T8KA 4BX9A 1EGHA 1DV2A 3RAPR 1J6UA 4XSVA 3PUKA 4IUDS 2OO5C 4BMZA 2GJSA 4LZPA 4ZOAA 5DW0A 2O23A 4I4TB 4S24A 3ST7A 1ISHA 1DXOA 1VL5A 3DMRA 4CYMA 3EGEA 4L4YA 1J9ZA 2ID8A 3UJBA 3OFJA 1GQFA 4C7XA 5CH5A 1SRRA 1NOJA 2G09A 4MVJH 2FWMX 1CR6A 1QYWA 3MN1A 2JIDA 1I2ZA 2VHYA 3BXHA 2FXVA 2HCFA 1N1EA 1PYGA 3TW0A 3LPAA 4W5OA 1IHYA 1P9NA 2H7VA 2ST1A 4JLOA 4UNPA 5T6BA 1UIMA 1H0HA 2P69A 3DVAA 4RZQA 2ZJ7A 1NQAO 2RHWA 2RJNA 2YIMA 2ZYHA 3PA6A 4LK3A 4MQEB 1L3BA 3FCOA 4GMGA 4B6JA 4EH1A 5B5SA 3IKTA 3HR8A 3S70A 2BFFB 1TJYA 5JJBA 3THRA 4PFQA 4PGGA 4V03A 1QFXA 3T5GA 4RPJA 2PT7A 2AZTA 3AVVA 1TPZA 4LNAA 2Y1KA 2C83A 3AI2A 2L0XA 3I0MA 2YDYA 5HKBA 1K86A 1UZAA 2WPDA 3BMCB 4MO9A 2XKJE 3N6XA 3LSTA 1U0JA 1X1AA 3JR7A 4I1YA 5AUNB 2ZSKA 3L4SO 5AHWA 3KLPX 3PT9A 2Q2NA 4GEKA 2OYSA 2GJKA 3BJEA 2VSOA 2QT1A 3FPLA 1BGVA 1GFWA 2QX6A 3EWNA 1KY2A 3KT3A 3EXFA 3PGKA 4E5SA 1MTOA 1P1HA 4QC2A 5J4HA 3N2KB 5F3RA 2HSJA 2XD9A 1UP4A 4TMXA 5KNBD 4ER3A 2Z09A 2WE7A 3FDXA 2PX6A 4OXRA 5G4KB 4BN0A 1NQVA 4F4UA 1C8LA 1BWQA 2HGSA 2G08A 1FFAA 1CZHA 3OQBA 2W58A 1ODLA 3IQFA 4AECA 5CFMA 4R8LA 1Q3TA 3KP1A 4FFVA 4DZRA 4CT4B 5GZ1A 1UBJS 3JD2A 1WMSA 1N2SA 1A8PA 1XDSA 2WIKA 4Q3KA 4QASA 1R9NA 4BHTA 4D6XA 4QOFA 4IMIB 1G55A 4HLUA 1T8WA 5HIMA 1NXSA 1UMCA 3GG9A 3QWIA 1RQLA 1ECBA 5AUQA 3T38A 4CTJA 1F51E 5HQ3B 4LBVA 4WL0A 3LECA 6YASA 4FI3C 4ZEOA 2AE1A 5B4UA 2CLOB 3KUKA 4UNQA 2IX9A 4N41A 3A10A 5CK5A 1T4GA 4FE7A 3WRVA 3ZHZA 3WAJA 1EUYA 2FMTA 1J1UA 4DREA 5IFLA 1JHXA 4QOHA 2IXEA 4LMRA 5EE3A 1EFVB 4QXAA 1FYFA 3RJ5A 2FJ0A 2VAVA 3ZGLA 4YMLA 4UPDA 3J81A 1NHGA 4P82A 2AYZA 3F6PA 3FPFA 1HF3A 4AI6A 1BXZA 2WSYB 3X0DA 3PFGA 3WQHA 2A57A 3FKSD 2MWMA 3OI7A 3EVGA 3U13A 1CDOA 2HBQA 5ENVA 1O54A 2IDKA 3L0IB 3LP5A 4B76A 1FTYA 5CEEA 4WH0A 3AJ8A 1USUA 3DD5A 2QI9F 4RMJA 3W5UA 2C8LA 1E8NA 4OQPA 2XR1A 5LOVF 4S2UA 5LLDA 3U4QA 2O2GA 1YBFA 2IPXA 4HLNA 4P2BA 3IB6A 2G07A 2JJ8A 1UM9A 1UZNA 2R1TA 3RUAA 1L7DA 3EPHA 4QUKA 5FPYA 5JAMA 1G42A 4UCQA 3RREA 3KEFA 5FL7A 3DMDA 4L85A 4Q19A 5A06A 3KG2A 3JQAD 3RVMA 4BWGA 2Y71A 4QXRA 5FULA 2H0AA 2O0LA 3DCJA 2BGIA 3Q6NA 2WF5A 1J5XA 1K27A 4FR5A 1LPOA 4GPEA 1I6LA 4ND6A 5A3SA 3URMA 5TMBA 2ZYRA 1Z4NA 4FQ8A 5EKDA 3DMFA 3MWGA 3RVSA 1NSTA 2PHZA 5E7IA 3RS8A 1N6IA 2UXDB 3G7SA 1YZHA 2QZ4A 3GEMA 3HDQA 2BSXA 4QFDA 4ZI5A 3V7UA 4CU2A 2H1RA 3F47A 1I01A 3HJCA 4E09A 3K0HA 3LBIA 2YS7A 2ZJFA 3I1JA 2H08A 3AR7A 3GFGA 2DWQA 3P19A 3INTA 4UDXX 3ICOA 4H3HB 4A5OA 4LPSA 1L4LA 1ARZA 4DFDA 1EWKA 3FFTA 4GGPA 1MJFA 1SKBA 2WVJA 4KQJA 3G79A 2CZCA 2HN9A 5AXAA 3DXFA 1WLYA 1O9BA 3GZ4A 3NB0A 4J29A 3QBVA 5TC4A 2VCHA 5SICE 5JHHB 2OWDA 4KO3S 4XR4A 3LHSA 1R2QA 2YWJA 3GJXC 3L0CA 4P3XA 2VJOA 2AQKA 4YFYA 3W90A 2N1BA 3ZS9A 2PUWA 3F96A 4OLHA 4GR4A 1PL7A 1QFZA 2ZG6A 4WLFA 5CH3A 4CF3A 4EM6A 3NM5A 4BB5A 4A92A 4ETMA 4QTXA 3B1XA 2JJMA 2ES4A 4CMKA 4OFWA 4KI0A 2RGRA 3ETJA 3OO1A 1QNLA 1KC3A 1RRMA 2B25A 2D8AA 4NULA 3RR2A 1OB5A 3IO3A 3NAZA 3V7YA 3QF7A 1SAYA 4MUMA 4PZPA 4Z8YA 1GLVA 2VWQA 4KFSA 4WIAA 3SM9A 2NTEA 3L7LA 4C2UA 4F97A 1FVXA 2Y1CA 3MOIA 1EVQA 1F0YA 1EGMB 1SWWA 1EP3B 2WHEA 4F4JA 3O9MA 4TTAA 3UNXA 2GUWA 1ZICA 2Q4TA 2NAPA 5HCIA 3AO0B 5CT6A 4X65B 4WNIA 2GUGA 2QRQA 5JQWA 4PLCA 4OBEA 3R9WA 4ZN6A 4X63A 1UAYA 2J31A 2Q7OE 1EUCA 4QX6A 2CZQA 3LFUA 5C0OE 3IA2A 1VYHA 3IDOA 3GJ8A 3WKDA 4B17A 2FWPA 2BFBB 3PB3A 2DSNA 3ZGNA 3DEZA 4ZOQI 1I32A 3GDGA 3SR4A 1Z6XA 3E61A 4GWKA 1T0PA 2Y0BA 3E48A 1KAEA 1ULZA 3WLTA 1S2GA 1VJ5A 5AVWA 3WRXC 1T9AA 2Q29A 1TOAA 1XEWX 4DQ0A 2AZDA 4F96A 3RVKA 1X6VA 2WNHA 1Y6RA 4YQZA 4JYZA 3NMUF 3LV8A 1CVRA 6Q21A 1ZD9A 3C85A 3NANA 4MS3B 4O4LA 3TIIA 2Q4RA 3DTYA 3ZHUA 4IFIA 2JANA 1XMPA 1QRUA 3LFHA 4PSAA 3DO6A 4IGIA 3E2PA 2EWVA 5JD4A 1K7FB 4WKGA 1FU8A 4JYPA 4LV8B 3A4VA 4YJFB 2C54A 2HCJB 1ACJA 2FSSA 3L6RA 1WB5A 1R88A 5EKUA 1ECGA 3SJZA 1X1DA 3BHIA 4OXQA 5M5BA 4JV5B 4R2HA 1D9XA 4LXYA 1NVWQ 3R7BA 4UZSA 3W7AA 3R3VA 1YZVA 4YRBA 1F8UA 1OBOA 2GPWA 3I4CA 2XVAA 1DRWA 4MV7A 1HYGA 1IAQA 1QVAA 1H93A 1U04A 3DULA 3QLVC 1Y5MA 2FE4A 2EZ9A 2PBFA 1J56A 1D0IA 2GMWA 4R2KA 4D74A 1RLUA 2HD4A 1MTZA 5SY9A 1NKSA 4HJXA 2IPLA 5IS2A 5DLQC 2VH5R 3FM9A 3FUWA 2VXBA 1XZ8A 4YCJA 2NZYA 3LQYA 4DDTA 3ZH9B 3ZWAA 1TT7A 4R9NA 2P6OA 3PGVA 2O59A 5L45A 4R1NA 1Z63A 3TW4A 3MTEA 5GGXA 2CHFA 1N2HA 4NMHA 4BMYA 2Z6AA 4DUPA 1HQDA 3PNOA 4DJAA 1T0JB 3AIKA 4YJ3A 3HNRA 3X3HA 2AK3A 2AN5A 2LKDA 3H4TA 1RYNA 1W93A 2NO7A 2RGAA 4E5NA 3I34X 4MR7B 1SNYA 3V2UA 4I9FA 1KOGA 2OBYA 1YUMA 2VBFA 2W6PA 1HT1E 4XLLA 1C14A 3BAFA 2DCMA 4LGMA 3TXXA 1XEWY 2B21A 3M81A 2YBDA 4PC3A 4RH0A 3BWDD 1IG0A 4FHZA 3ED5A 3KSAC 4OQQA 1K89A 2ZRMA 3FFAA 1XMVA 1PVVA 3FROA 3N6RA 3PCXA 5BWBA 3WWDA 1I3MA 4W9MC 1VRCA 3PQCA 3KFLA 3DPUA 4UZEA 3WXMA 4AUMA 1UXJA 2IGTA 3NORA 1TJ5A 3MTQA 1NQUA 1G291 2F43B 2FW7A 1ZIDA 2HO4A 1E99A 2AOVA 1XDWA 4KXMA 3SKVA 3K2IA 2MDTA 4H7KA 4GPBA 2ZB2A 2J3DA 4WXMA 3ULKA 4OJNA 1Q1BA 1S3SA 3GDWA 4M7OA 3QSYA 2VUUA 1R10A 4E5MA 2QU8A 3EISA 3IBYA 4X7RA 3TRFA 2FFQA 1NVDA 2Q1YA 3N7AA 4W5WA 4XR9A 2O2YA 2CVFA 9ATCA 3RRXA 2VRWA 3G2OA 3OSUA 5DPMA 1WOMA 1T8PA 3A4IA 3BSFA 1RR6A 2PX4A 2AFHA 1IBLB 3HO6A 1S2DA 5FYQA 5G1PA 4RTLA 2PZEA 4LY6A 4TSKA 3IT3A 4ZK6A 3GEPA 1QUEA 2O3QA 1TC1A 2EG9A 1FRNA 4IZIA 3L8FA 2P62A 4WJZA 5FFFA 5KIAA 2EKQA 2V6FA 1MAUA 1MNQA 4JBLA 1RM5A 4RA6B 3SHTA 4JUAA 1NR1A 3LW8A 4FYKA 4HAUA 5F5LA 3TI9A 4UQLA 1XA3A 2P5UA 5T3UA 3ZJ4A 4HDNA 1UBKS 3PKIA 1L4HA 4GKBA 4ZI7B 4DCVA 5C5IA 2G72A 1L3CA 1T0HB 2X40A 3BGIA 5B64A 1S8NA 5C1OA 2KMLA 3COWA 2WKWA 5TJ9A 5JD3A 1UPTA 3ZQ4A 3BVPA 4NS4A 4L15A 4BLSA 3UB4A 4JKOA 1I10A 1O96A 2IEBA 2PUTA 4M7RA 4OHMA 4UEKA 1TM1E 3NP9A 4P31A 4RDXA 4BO8A 2RH9B 3GA7A 3QI2A 2C5HA 5EE0A 1TW3A 3DFMA 4G5SA 3UH0A 1JR4A 1K6XA 2IUSA 3R0ZA 3ELDA 4UDOA 1GNVA 2ZRHA 1IUKA 2Y99A 3Q3EA 3AL3A 4BFYA 4CTMA 1VJ1A 3GJ0A 4HXFB 3AP3A 3W5CA 1YH3A 1HEYA 4WK4B 5L6MB 1SCUA 5DLEA 4J6EA 4MV5A 5J23A 5LB2A 3DWEX 1RP1A 1CYDA 1WMAA 3CCCA 2IPNA 3E1KA 4OLFA 3HXKA 2LE0A 2PGOA 1IXZA 2A1UB 2X7XA 4O5OA 3WY9A 5BW4A 3GRFA 3TH5A 2FK7A 2P90A 3SCZA 2OBFA 4UHDA 4BMCA 4DV0B 1GXSA 2G1UA 2O9JA 3HE3A 4I08A 4JKYA 3DTVD 5K8VA 4HEHA 1OXTA 2F3UA 2Q6IA 5A5GA 4XSGA 2TRSB 4MEJA 1QIMA 3BEOA 2ZZKA 1PFWA 2IHJA 4IJQA 2QMZA 4HXGA 5ALVA 5JFGA 1OROA 2FVXA 3G82C 5DNDA 3WGUA 4OI0A 4YEDA 1PW5A 3RAEC 5K0TA 2WB4A 4D8VA 2OENG 2PKWA 4G0VA 1G18A 1SU4A 4XWGA 4PHFA 3EDRA 2JA1A 4OHXA 3WI7A 1MB0A 3BB1A 2G9RA 5ED0A 5B4VA 5JS6A 1IZYA 2QDKA 3EQ2A 1O89A 3CRQA 3ESCA 4W8HA 3VO9A 1EFUA 5AVTA 3ILYA 4UARA 1NDHA 2CE7A 1BJTA 1Z4MA 2GZAA 3LCVB 4K6OA 5AW6A 4JIGA 3F6YA 5K6AA 2XXAA 4K9PA 3PQDA 1O6FA 1N77A 1SU8A 4W7IA 5AW9A 2GYYA 1G8FA 1GPUA 4P7JA 3WP1B 4YASA 4PHGA 2WHYA 5J40A 3ZBUA 4N7RA 3LDHA 3TUJC 2FPPA 1A8HA 2QD5A 1NNEA 3UV7A 2GEKA 1XEXA 1ADJA 3KTOA 4R31A 4IFTA 3KE8A 2D1YA 4U2KA 3OESA 4LZAA 4XCQA 3EGCA 3AEKA 2C4WA 2HCRA 3CMCO 1ST2A 1VPVA 3ZGVA 5FAKA 1C9DB 1SJ9A 2HRRA 1KS2A 3MS4A 4OG2A 1JG7A 3MRTA 4H1VA 3OM0A 2QE6A 4F7WA 1EWVA 3IULA 3WJ1A 6REQA 2Z30A 4QUAA 1YR6A 4G0PA 4G2TA 2NAFA 4HZUB 4IWXA 4Y9TA 4BZXA 4A15A 1KDPA 1ZFNA 3BREA 4K88A 1ZSYA 2DUWA 5EMJA 5JNVA 2UU9B 5KNBH 5CYOA 5HKKA 1ESMA 1X1TA 4H7IA 1G3UA 2BMEA 2VT3A 1ODTC 3DR5A 3NIBA 4GZ5A 4OHZA 2IV7A 1O6GA 1UFQA 2CUNA 4ENSA 2D2EA 2EBFX 3AB7A 3F98A 4MGIR 1U8TA 5GV8A 4F6CA 2PANA 3JQ8B 2VBGA 1X38A 3KLMX 3AFIA 2YMLA 4ZRDA 5T4FA 4DDWA 4KPYA 5KKCA 5I7AA 1M54A 2C2WA 2XPCA 5DSZA 2FDRA 3UJDA 5IG2A 4EW2A 5SY4A 1JPNA 2J59A 4EVQA 3CFYA 5T67A 4XEHA 4C4YA 5KYTA 2GEVA 3LXMA 4H17A 3HM2A 3LL4A 1X7DA 3BXXA 3U4CA 1SURA 3V33A 1MIOB 2HREA 3MWEB 2WU8A 5LQJA 2ZI4A 3VO2A 1NU6A 1T6YA 1QOZA 4RD4A 2MOKA 2XWBF 3QMMA 1KDTA 4MVJP 4QTZA 5BW6B 3R7FA 2B6NA 4RFSA 3V00A 4E1AA 3CVUA 1EFLA 3Q9LA 5IZCC 3PUIA 2JHAA 2ZU6A 1Y4AE 5LYJA 1W4RA 1WKVA 5GJBA 1JEYA 4JP3A 5K0EA 1NAHA 1U31A 3OZAA 1TLFA 3QQPA 3QU7A 4ER0A 5CVVA 1CQPA 2A0FA 1BCRB 4O0LA 1VA4A 3BL6A 3DL0A 5WRFA 2BI7A 5CRIA 4GWLA 2J3HA 4IRMA 2OQVA 1XC7A 4NJMB 1UADA 1J8MF 2DZDA 3SQDA 4DLXA 4XLTA 1LWNA 2OAEA 4WZBA 1NW4A 1UDAA 5H3CA 5GPBA 3JAMA 3S2EA 2K7ZA 2EZ4A 3L6UA 4AN1A 3PNVA 4MW6A 3PJFA 2EGGA 2HF9A 1VPWA 1WUKS 4DARA 3E2MA 4ABTA 4QU0A 1Y6QA 2P3OA 3PC3A 2FUKA 1CIVA 1OWNA 3FPGA 3L92A 4X7PA 5DHFA 3WWYA 3ZWQA 2ZPAA 3NEJA 1H23A 2XQKA 2QUHA 3HU5A 3VYTB 4DRXB 3SJ7A 4E88A 2BMFA 3CLKA 3MWDB 2H2GA 1SPBS 4U63A 3WR5A 1T13A 4Y2GA 2WV7A 2O7QA 4N7MA 5D86A 3VR5D 3LW7A 4PSKA 5JANA 3A4MA 3DL4A 2F4NA 3ELUA 5F3WB 3WIDA 1AK9A 4MRAA 1FSZA 1TQ4A 3LQ2A 1CRZA 1FUYB 2R47A 1G5TA 4IIBA 1ZOPA 5C4MA 2RB5A 4LXQA 1D2EA 1WSWA 1B16A 2GT1A 2NTJA 4MWEA 4IWYA 2OBBA 3BEDA 1V1MB 1ZUNA 1ZEJA 3T4UA 3VTAA 3K6RA 1HT3A 4CLXA 4ENRA 2HA6A 3SKYA 4DLVA 3ZJ5A 1XZPA 5CX4A 2JLCA 4HPJB 4NFHA 1Y81A 1YD7A 4WX2B 4A0RA 5LZ2A 1X1SA 4ZQBA 1ZVJA 3K5HA 4K3UA 4BYGA 2AK2A 2IOQA 1KARA 1XRQA 2I55A 2VUIB 2XUKA 4MIOA 1BDMA 2IQ5A 1AV6A 4UE6A 1QIDA 2HQOA 2CFOA 2OXRA 3NG1A 2BJVA 4NAUA 1A9XB 1NOKA 3ZLVA 4F91B 3SC2A 3ROTA 1L6RA 3W5BA 1Z88A 2PNJA 1E2BA 1ZUHA 3PIDA 1ZMBA 3QFFA 3FNEA 3FDJA 1E66A 4IGEA 4K28A 4AMUA 3IP1A 4B79A 2VQ6A 1Q1AA 5EGSA 4CL2A 1TAHA 3NAQA 5DRYA 2VP4A 1YZUA 1RHMA 4ZYYA 4ZGWA 4MI6A 1M6YA 1HE3A 1OGYA 3RYFA 1EGQA 1GNSA 3BUSA 4IGFA 2E2WA 3DF9A 3R0XA 5HK8A 1WMBA 2C7RA 2ZM6B 3MB8A 5LP6A 2H1CA 2WFLB 1WLSA 3I0NA 4AYWA 4IDNA 2CXHA 2VPYA 1EVYA 1E94E 3RUIA 5JJCA 4CG2A 3DFFA 3OZVA 5DFAA 4BLPA 1GPMA 4P86A 4RVCA 5AW5A 5CLHA 5TQVA 5JNRA 3QBTA 1IWOA 3DMYA 1G2OA 4BV8A 3TQFA 1LA2A 1T3SA 4G8CA 1FIUA 1ZI6A 1WKCA 2FWBA 4E6EA 2K2WA 2NW6A 2XUAA 1LQTA 2PH3A 2FPUA 4Q3CA 2NACA 4GZMA 1N2XA 4QDTA 4CLHA 2B9EA 1N1GA 2H9AA 1BVHA 3V2HA 4AF8A 1SVWA 1KI6B 5IJ0A 1D7OA 1J70A 2IF0A 3LUPA 2IP2A 4RV4A 3D7LA 2JLYA 2B5VA 3TW6A 1JB1A 1M6NA 5DISB 4MQFB 2LUOA 2Q0HA 3ND5A 5IULC 3B6KA 3OOEA 3GRAA 3GCZA 1EBUA 1HDCA 3S2UA 2H1WA 1ETUA 1BMDA 1EG2A 1NXQA 5EWMA 3GJYA 1ORTA 4RWEA 4MDFA 4YV1A 2QTMA 4ECEA 5F35A 1ZAYA 2IDJA 4HFNA 2YS6A 4K1LA 2X6QA 1QG6A 4I4TA 4I6JA 4HDAA 1QGDA 2O8DB 4M1KA 3GHYA 4BFTA 1Z0UA 5DEIA 1E0DA 4JUCA 3DP9A 3ER9A 1Z4QA 2W22A 5JSZB 5FAXA 4BMDA 3KQWA 3ZWDA 3GJRA 3H2KA 2YC2C 3AFMA 1XQWA 5L3SB 2BFWA 4ZT4A 2P2NA 4DC9A 4JBWA 1PE0A 2QDXA 4J3JA 2ZWMA 1FJGB 3DQQA 3BRQA 3H97A 1B8OA 2JATA 2O5RA 1ZMXA 4D9HA 3E4DA 4BRZA 3FFXA 3A9CA 4MQEA 2KS6A 1YS6A 4L16A 3ETGA 5M29A 4C5BA 5EERA 1G17A 3A8TA 3UCEA 2P8SA 3SEFA 4EPVA 2B82A 1IOVA 2R5FA 4K6MA 4M1ZA 1W88A 1YKGA 2HEIA 2OCIA 3PGJA 2G7ZA 3NV9A 2I34A 3BMCA 4ALMA 1H4VB 3QE0A 3QF4B 4NYIR 1S5PA 1A1SA 2BR5A 1Y4DE 2J45A 2C9CA 3A1NA 3DMTA 4UBNA 3TEJA 4DQVA 5CDUA 3KM0A 3I62A 1NAIA 2WYIA 3DB1A 2WF6A 3R5HA 4MI1A 3FHJA 1EI9A 2NU8B 2BV3A 2E1RA 2I2AA 2FJUA 3N2KA 2Y1FA 1JEDA 3IDFA 4RABA 3NBXX 4TT3A 1D09A 1YDMA 5G4KA 3SIWA 4GOOD 1SUCA 2FFJA 1R1DA 3SNHA 1IOLA 1K1EA 1XNGA 2UYOA 4MUBA 1FP4B 4NEQA 3FA2A 4G5QA 3ANTA 1VP9A 3WLHA 3ES9A 4I4LA 3RVLA 3H9QA 5CGZA 3ETCA 3OE7D 4IG9A 1FTQA 2V7UA 4UCFA 1E6LA 4OQXA 2Q3HA 1GDTA 4KACA 4XYGA 5B2ZA 4P4GA 3V7FA 1GM5A 1P77A 4HWRA 3COJA 1HTBA 3ZDXB 2D0OB 5CFRA 1C3LA 1Q2XA 4DYVA 1U3FA 4ER6A 5HQ3A 4GP6A 3E82A 5TY0A 5I7OA 3ZZ0A 4Q47A 2W2TA 4EHKA 4S1TA 1XTTA 4YYZA 3SVTA 3FWYA 2Q6LA 3I4LA 3KPYA 3BA1A 2G4VA 3GJSA 3M8KA 1D04A 1TF5A 3U3KA 4AN4A 2MCFA 1P91A 1O6BA 2XZPA 3LGSA 2RG7A 3QM1A 1CUGA 2A5YB 3LWZA 3QLJA 2FP3A 3BD8A 3DZCA 3FNIA 1SD5A 2IF2A 5IEBA 5KKAA 4FHCA 4BFUA 3FOWA 2GHRA 4B6RA 1BRTA 3GO4A 4DM3A 2FVYA 4K6HA 1JRLA 3W2TA 1ZMOA 3I4FA 1G8AA 2RC5A 2E18A 1RZ3A 4LJ4A 3MIZA 4M21A 4XDGA 3ZYCA 5EMMA 2AIRA 2WT4A 3D7SA 2KWIA 2A0KA 3OZDA 4LWZA 5GY7A 4F86A 4MA4A 3A6EA 5IF9A 4MQMA 1NJ6A 1UJCA 2QMEA 2QQFA 2WG0A 3WKAA 4EEZA 2C7VA 1XT6A 4GYYA 3SZGA 2ADMA 4AQ7A 4YHBA 3I2HA 3DYIA 5KZMB 4Q93A 3K9WA 1E9VA 3CBGA 1SHUX 1Y1SA 3IPYA 1BD3A 2CXTA 2A0UA 4PC1A 5BN1A 2J85A 5C52B 3KDPA 2OCPA 4HN4B 2CXQA 2QAGC 5DM2A 1YI1A 4R5MA 3OWHA 5I7FA 4O4IF 2OO5A 4BAGA 2P2YA 1SB9A 1P1RA 4CW7A 1UBLS 3AV3A 1A8QA 4WESB 1D2RA 1X1RA 1TVCA 1YNSA 5LQUA 2FN7A 4GL4A 3OPQA 5BT9A 5LZ9A 5DULA 2JBHA 2PUAA 2CJYA 1E4EB 1NVFA 3R0VA 2I9PA 1VCOA 4GD3Q 4G9BA 3VSCA 1C7ZA 2A3RA 5KTMA 3A14A 2Q2VA 1RXUA 3D8TA 4UEQA 4YB8A 4QNNA 5BWLA 3D7NA 2WOOA 3DS8A 3NBUA 1CKEA 4QYIB 4JOSA 1GO2A 2FUNB 3E7DA 1KXJA 4KBGA 5JAPA 1W0KD 3WKEA 1XVUA 2XTNA 4JEHA 3COZA 4MOWA 2XT6A 1SXPA 4QOSA 4G24A 1ADCA 2J09A 2CJWB 1UJ5A 1GTZA 2J5BA 1JP7A 2B20A 3RGWS 4XLZA 2VTDA 1DRVA 5BYBA 5HIKA 1ADYA 2FPGB 4QEDA 2SNIE 4HY3A 1C4WA 2R7LA 2YVUA 4Z7JA 1U8EA 4U7GA 1UIRA 2PV7A 4I81A 2RHHA 3SBXA 1HY3A 1IXYA 4M0PA 4WAUA 4DE5A 1YL5A 4ZV4A 4C87A 5H0IA 2I6QA 3KKZA 5F64A 3ZD9A 5AIBA 2EGHA 4XQEA 1UKZA 3AXSA 3BHNA 1V25A 4FZ5A 2C3YA 4ESHA 4RAOA 3WQBA 5DV9A 4HAZA 3F49S 3PQ4A 1GIAA 2ZUCA 4PS0A 4TXNA 4DJFC 1A69A 2AVNA 3WNQA 4EFDA 5FTNA 2I2DA 1ZNZA 2BMAA 5DCWA 4TLEA 1O8CA 3AKYA 3KB1A 3DAHA 1X2EA 4LCEA 1VMIA 1NYRA 4V0QA 4BO7A 5B30A 3DW1X 3WK4A 1N5IA 1FDTA 3H8JA 4EUEA 4FIDA 2ZIAA 3PHBE 3U0VA 5B1EA 1NY6A 5ITSA 5LWHA 2WTUA 4JJ7A 3G8AA 3NTQA 4I46A 3VSDA 3J7AC 5IEJA 4UHJA 5EHGA 1HZZC 3EHDA 3PCTA 2YICA 3A4LA 5EMKA 1SEVA 2I8CA 1ZC3A 3BS4A 1BZYA 1MD9A 1DBQA 3GQBB 2B1QA 1MW9X 1W9MA 5D7BA 2JGIA 3KJQA 5LQNA 1JPJA 2BFBA 4L02A 1G20E 1U6IA 5EKTA 4MA5A 3TVTA 5C4IA 1EFPB 4FLMA 4W5NA 1QAOA 5AUOB 4BX2A 4H16A 4GZ3A 4L0QA 5MHTA 1TGVA 4TQGA 1FUEA 3P94A 4GUAA 1JSLA 3BE8A 3FN4A 1IQRA 4G23A 3NTUA 1NATA 4UOQA 4YTEA 4O4LF 3FWNA 1TB4A 3KPUA 4JI5B 4P0QB 5K3FB 3SAJA 4MS3A 1YKSA 2GK6A 3TG8A 3Q8KA 4URYR 3OX2A 2HWXA 3VNUA 4YJFA 2HO5A 2QZPA 3BYZA 2DQ4A 3O47A 4M0CA