5CVTA

Structure of a single tryptophan mutant of acetobacter aceti pure containing 5-fluorotryptophan, ph 5.4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
160
structure length
159
Chain Sequence
SAPVVGIIMGSQSDFETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAATRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETFRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 56
structure length 159
sequence length 160
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5cvtA00
3OOWA 3RG8A 5CTJA 4ZMBA 3LP6A 4YCJA 4AY3A 2FW1A 2FW9A 1U11A 2ATEA 3ORSA 2FW8A 4ZC8A 4ZJYA 4GRDA 2FWAA 3TRHA 5CLIA 1O4VA 3RGGA 4ZK2A 1D7AA 5CLHA 1QCZA 2NSLA 4Z7JA 2FWIA 2YWXA 4AY4A 5C5DA 3KUUA 5CVTA 2FW7A 5BOSA 2NSHA 5CLJA 2NSJA 1XMPA 4YCBA 5CLFA 4JA0A 4YCCA 5BOSB 4YCDA 2FW6A 5CLGA 2FWJA 4B4KA 3OPQA 5BORA 2H31A 2FWPA 2FWBA
chains in the Genus database with same CATH superfamily
1YBAA 4DV5B 3TE6A 3WR5A 4G0MA 1M8GA 2BN4A 3V7YA 2IYSA 3CT6A 3R5FA 3DOCA 4HB3A 4MEJA 5LQMA 1IONA 1GUZA 5AJWA 2HNKA 2X9NA 2GBGA 1V8BA 2GBIA 2Q5EA 4CTJA 1M2VA 2R85A 3JD2A 3D8SA 4M83A 4QOGA 1ABBA 1M2EA 2VL7A 2XE4A 4QUKA 5KOYA 1W9HA 1UP7A 1N2IA 4JLBA 1IBSA 4PLVA 3ZGZA 5HMLA 1Y3AA 4TS9A 1QRSA 4EKNB 1U8AA 3W5CA 2QF7A 1RU3A 4JJ7A 2ALJA 5IZCC 1RCTE 4G26A 1FQKA 1XMSA 5L3QA 1Z39A 4Z4IA 2CE7A 3L0BA 4R1PA 1KAQA 4OJTA 3PUIA 1OZHA 2X8BA 3TECE 3WDKA 4EA6A 4BS9A 5C8XA 4PG5A 2B4TO 2XB2A 1U99A 2Q1UA 4GYWA 5EJ9A 1VRVA 2R9VA 1E18A 3DWFA 5K2MA 5EP3A 2Q6TA 3VBEA 2GD1O 3TLCA 4JEUA 2V4ZA 3EXEB 2QAGA 1M74A 1VI5A 2BEVA 3NYWA 3RYCB 1ZXXA 3VR5D 1YMUA 4J03A 3VKGA 2C54A 1NW5A 2ZDGA 1N6PA 1FX0A 1N2GA 2I55A 3MYYA 3OSUA 1J2TA 1L7VC 2CYCA 4YRDA 4DIKA 3ODGA 2JB9A 5FIUA 1RRFA 3ORQA 5KI6A 4EF4A 4JP5A 5LR6A 5AT1A 2QNIA 1E9VA 4L9RA 4RC9A 5SYNA 1NNI1 2LP4Y 4CI9A 2GXAA 1Q0UA 1WSBA 1A9SA 4Y0VA 3IDFA 2OBFA 3TCKA 3WDMA 1SXHA 1VJ0A 3BRWA 2C3OA 5AKHA 1QHYA 2YYAA 1GPMA 1BKSB 2XGSA 2CUZA 4NECA 2E87A 4Z4FA 4C7OB 1JG1A 3ADPA 2AWOA 3KTFA 3AR3A 1EFPB 3MT8A 3M5WA 4HLUC 4J43A 2DWPA 3VR0A 3NX4A 3U31A 4X6YA 2GRAA 4UCQA 2G70A 4TL7A 1E1LA 3NC4A 4KQJA 4PRLA 5FP0A 2Y76A 1NAHA 3L5KA 5A4KA 4PQGA 3QVGB 1LK7A 1B41A 3WWCA 4FW8A 4FFLA 3A25A 1P18A 3U17A 3ICEA 2B21A 4DPMA 5AKLA 3UGJA 4BX2A 2QN7A 1CX9B 2J9RA 4KN9S 4U9UA 4CW7A 4QSMA 4P4TA 3AUXA 3BMXA 2C9OA 3BB1A 5A0FA 5LQNA 5H4HA 2D1QA 2Q5CA 3VJMA 2AMLA 2CV0A 4QUJA 3W2GA 1G3UA 1ZGGA 3ONFA 1WUTA 3UCEA 2J59A 3VU0A 2BUCA 5ETJA 5H02A 1GZ5A 1T2NA 3TCNA 2YWRA 2C5SA 1IIRA 1X1CA 2XTZA 2D4HA 2ES4A 3FWHA 3I37X 3L6BA 4RFSA 1KFKB 1Z4IA 3L0SA 4Q66C 1Z0SA 4ZQHA 5EP1A 4B34A 4ZYYA 3QSGA 4LI3X 1A4IA 2D0PB 4KH0A 5MN6A 3C8HA 3ABOB 3OHPA 4D25A 4EGCB 1OROA 2AB0A 2B7CA 3OFNA 1DAOA 3EVCA 1ORRA 1LLFA 3LF2A 4HS9A 2VVTA 3TZBA 4AP9A 3PGJA 1L5WA 5B36A 2HBZA 1IIBA 2G5CA 5GV8A 5L8VA 4X20A 5KYVA 2EG9A 4G4JA 3T0FA 4EA9A 3C6MA 4KB5A 1C80A 5K6AC 1LI5A 3CUTA 1Y4DE 3KVOA 3O95A 1BHQ1 3OOYA 2DWQA 4KWHA 5F5XA 2DHEA 2ERXA 2VJMA 3IOCA 4D1YA 3BAFA 1ZIXA 1NDHA 2VF2A 3O73A 3RAGA 3VR2D 4MIEA 4AMGA 3ZCTA 4W4TA 1QK4A 3H1TA 2F9FA 3NIFB 1VKZA 1NJGA 3NGMA 5KVCA 5AW9A 4B8ZA 1H8HD 3DLBA 4PQRA 3QXHA 3PI7A 5FOVA 3TW8B 4XWOA 4B81A 2IEIA 3TEFA 1QE5A 3DUFA 1E2GA 4QNNA 2W2KB 3TVTA 4D8UA 4TTTS 3ZGLA 3U1VA 2DU8A 2VEOA 1OIWA 4FHFA 4BPRA 4C4YA 2O3JA 1SK9A 1QR6A 3AF5A 3NV7A 3NV9A 5IT0A 3KAPA 1R8QA 2BZGA 1U2EA 1X7DA 1SMKA 1E79A 4TUYB 2VTDA 2G4LA 3R77A 1F7VA 4UDNA 5EKTA 2NTJA 4MUBA 1QIEA 4QBIA 2J6CA 4KJXA 4BN5A 2WB4A 5I9MA 5LZ7A 3VU8A 3M6IA 3GYGA 5JD5A 4N7MA 5C51B 1ZPDA 2WG2A 1KYZA 2CLKB 4MZDA 4O33A 3HYNA 3FLAA 2I3GA 3I5AA 4PEVA 4E5SA 1VFNA 3PX2A 4NE7A 1VSVA 1EDZA 1Q2UA 2VBGA 3UTCA 1RVV1 3ZCVA 3UV3A 2CMKA 3BMNB 3PXBA 1PLLA 2Z4TA 4MW4A 4U1RA 1AUOA 3U4GA 4QATA 4F06A 1Z08A 1T9GS 2LCFA 2O8EA 5EKDA 3NBKA 2VJDA 1AKMA 1C9KA 1EFRD 4X44A 3HGQA 3R9XB 4FJ0A 4JBWA 1HI9A 2X4GA 2I8LA 1Y1PA 2ORVA 5F77A 2JHFA 3LY9A 4W6QA 2GCIA 2DBQA 5DCYA 2WNHA 1ZIOA 1QS0A 2EW2A 1T24A 2PCJA 4KQ6A 4OYYA 2HQSA 5HFNA 2PUCA 3E9DA 3TDMA 3FNHA 2XOEA 4W1PA 3TQRA 3N0TA 4GH5A 1PHPA 2IGBA 2J09A 5KQRA 1NOIA 1KNQA 2QTFA 3STVA 7ABPA 1O4VA 1AZLA 4Y6GB 2I6SA 4BNKA 2OC9A 4E5KA 3ZJ4A 5AW7A 3FYHA 4S0XA 3KEQA 4RVGA 2RMKA 3ICQB 4OQFA 5IULC 4PO8A 1KK1A 1WXWA 2FMXA 2W0MA 3KQOA 4GLOA 5CPFA 4Z4GA 5FOXA 5J2UA 1AHPA 4PYIA 1JAXA 1GQ2A 2NUPA 1JNYA 3D8BA 5LP6C 4IXMA 1J8DA 1JYSA 3BMQB 4JUBA 1UUFA 4PCLA 4YQFA 2F3UA 5HDQA 2XOKA 4A8JB 1RI4A 1ST2A 3VR3D 1RNLA 4B6GA 6REQB 3H2BA 1B14A 2CLSA 3R2JA 3AY6A 4WDQA 5IDYA 5G0TA 3W9UA 5K03A 4HDQB 1EXVA 1YFZA 3TRHA 1DU4A 1V2GA 2H2FA 1W2HA 2RGUA 1GGEA 1IB6A 3PT5A 3D4PA 1CRZA 5DI3A 3ZQ6A 2I5PO 5DYIA 3QG5A 5CPBA 1DB3A 3TW4A 4W1RA 3MZ0A 2XUKA 3CXRA 4GPD1 2G09A 2DCMA 5LUBA 2YYYA 4YH1A 3EXHC 1JKFA 3MSXA 4UM8B 5DCUA 3RFVA 2O3SA 2PH5A 5BR8B 2RH9B 1ZJYA 4QA9A 2W6NA 1OH7A 1ORTA 3FHTA 4B83A 3C1UA 2CCGA 3HCNA 5C5EA 3P4YA 4R2XA 3JTMA 4R81A 1KMIY 1CUHA 3O8QA 4L7VA 3F49S 3NTVA 2QRLA 2R2GA 4U63A 1Z4MA 3MUFA 2VJLA 4TYPA 3U3ZA 1JIUA 1PV4A 2WTBA 1U0SY 3KQLA 1EX9A 3P2MA 4OK5A 1ZRHA 2GERA 3H11B 3ZWWA 3ORFA 2E4AA 3KJXA 4P3PA 1VMIA 1XDSA 4DLWA 2PZ8A 4V03A 2GCNA 2JGNA 3X44A 3B13B 1JQ5A 1DHRA 4HLCA 3LSYA 3UHOA 3H1EA 1NI4A 3ES9A 1Q0ZA 1OGIA 3F6BX 4L74A 3I28A 3D0RA 4JITA 3PBKA 1N6OA 2HSZA 4F9FA 1MOQA 1SKBA 5EFZA 1VGRA 3QIAA 3WK5A 1ZL0A 4F1KA 1MO6A 5FWXB 1B15A 2ZTVA 3ZD6A 4HX2A 1EB8A 1YK0A 5BMOA 3KSDO 4R0NA 5K0TA 1WOMA 4YMUA 1H2WA 4JJIA 1MX1A 3BXZA 1ZIPA 1T4MA 4IHQA 4NRDA 4ZVQA 5AVUA 1IMJA 4FT2A 2CWWA 4YPOA 3HHPA 1ZK1A 2XTJA 3U48A 5L3QB 2R00C 1JMKC 5IZ4A 3ZVNA 1E6UA 1C7EA 4IKPA 4J7CA 5AXBA 3FR7A 4MVJE 3TSZA 1N7IA 3L82B 2BIFA 1Z4JA 5EG5A 4DUPA 2HC9A 3SSAA 4BO3A 1U6KA 4QULA 1K7CA 2ZJ1A 4PCAA 3OESA 1SQ5A 3E9EA 2AQHA 4HYTA 4QPZA 4JNKA 2YZMA 3KOUA 1Z28A 2C2WA 4QGBA 5CB4A 5ECYA 3QBVA 1WETA 2BR4A 5JCJA 3GMSA 4YJHB 2IA5A 1NKSA 4C4SA 4MS4B 4QJ3A 1DO0A 1G291 2FRVA 3I01M 1D4ZA 2R6R1 2DFLA 2QSYA 1GKUB 1ABFA 1TEHA 3CJTA 3D3JA 5IK2A 5CA1B 4GP6A 4QLOA 4TQ9A 3KLMX 1SKYE 2RI6A 2Z95A 4I2VA 4KTVE 2ZP1A 4Q03A 3TKLA 3ABSB 2C2GA 3UMRA 1GAQA 2G25A 3O83A 1D07A 5HGJA 2UVDA 2JIOA 2J3DA 1Y5RA 4FXPA 1NBMD 3GHHA 1G4UR 4AUEA 1IVSA 1GLVA 5CNIA 2LCQA 3ETLA 1PWZA 3DMGA 3OKFA 5LA6B 2ZBGA 3UJAA 3QIVA 1BTOA 3VR6D 1XFDA 3RD5A 2QTGA 3HA3A 4JI7B 2RB4A 1NUHA 1BCRB 3GB9A 1KFEB 4ZJPA 4M49A 4PO3X 3FM9A 3GQBB 2B3TA 2A58A 2AJBA 2FPXA 3O2SB 3FY4A 2CLDX 3G89A 1SBCA 4GOLD 2XRFA 3HDQA 4RGBA 4RE5A 2BHTA 2B69A 4I9FA 4N9QA 1B73A 4TS4A 1T6NA 3H2JA 3ZR4B 1U1IA 3NWEA 3Q5GA 4I5IA 1BDMA 3EY4A 1E6LA 3KD3A 4LOJA 3HLKA 4KVGA 4R5MA 2JBWA 4N8EA 2VNIA 4HEHA 2QUAA 1BWRA 4BNXA 2QGNA 3UATA 1SOAA 4MR7B 4BATA 4BMVA 4G09A 1GU1A 3PQDA 2HOQA 3VTFA 2FQQA 4HB4A 1PJ3A 2PVSA 4LDNA 3RUPA 2H07A 1DBVO 3RO7A 3ZX4A 1PE0A 5IM4A 3KPVA 2WQ7A 1IB0A 1HPLA 2X2FA 1CY7A 2FQXA 3OLXA 4OREX 1CW2B 1LDGA 3GDGA 3I4LA 3WNCA 1Z2PX 3HZHA 1OIXA 1JDPA 2YUTA 1J4AA 3ZJTA 4KFRA 1T9ZA 1CR1A 2OXRA 3JAWA 1W35A 3NC1C 4KBYA 1KY4A 3T1YB 5BSWA 4ZVLA 4CCAA 5H4GA 1IY0A 1C29B 1PTJA 1WZNA 4PLFA 2QTRA 5LYJA 3LUJA 3UV7A 3W7VA 5HF9A 2XD4A 3QHQA 3IUYA 3SQOA 1VL8A 3MUEA 2V6JA 1TCBA 2DHCA 1U7PA 5MGBA 1NXPA 1NULA 3BIXA 1EAMA 1PU2A 4X92A 4L0QA 3VHXB 4ZN6A 3FUXA 2W2OA 4WJLA 3NORA 4NV0A 1XKLA 3WLSA 2LWIA 3CRRA 1PFVA 5GOTA 3KB8A 4Q3EA 2B8EA 4I5DA 4RH1A 3TIFA 3BICA 5C7YA 1JLKA 3EBLA 1M6HA 1QVVA 3RABA 3RLIA 2RK4A 4H31A 2Z4RA 1X0XA 5AK6A 4YMHA 5E7MA 3V9AA 2PYZA 4YCJA 4AMUA 1GO2A 3DR3A 3DDHA 4R1UA 1FJXA 1B7GO 1TYCA 2Z9BA 4UMEA 5CDHA 3R44A 2A0KA 2EW8A 2PKEA 5JSFA 1QIDA 1OAKA 5JNWA 3BK2A 1SA0B 2W6JA 4JX9A 4PICA 4U7PB 3RWMB 1YCHA 5C8YB 4YP5A 1IMOA 1S2DA 5LBIA 3A9TA 2FRDC 4AJNA 2PMKA 4XW2A 2JI7A 1PW5A 4HNSA 3DBLA 2IZZA 5CU7A 4MA5A 4F3CA 1QAMA 3LRTA 4NNOA 4FBMA 2NYRA 3M4ZA 5JNUA 4X1IB 4ZOAA 4IFEA 3DO6A 2X40A 3GD5A 3I52A 4QBHA 3UC9A 2C4TA 4EJFA 3CRVA 4AJ4A 5ADVA 1QG4A 2H1IA 1R15A 1JHOA 1BFUA 3KXIA 1L4EA 2QRZA 5GM2A 1LD3A 2P3SA 1IJBA 2EL7A 3PXAA 4FDLA 3FYUA 5AW2A 1UXOA 4JAVC 1P5FA 2W2LA 4Z53A 3EC1A 1SKYB 2C2BA 3CO0S 3ECCA 3UGKA 4XM2A 1DDGA 1H66A 3OCWA 5IJ9A 4UFNA 2C95A 3HKDA 3KLPX 1GYRA 3GT3A 1KJJA 1I01A 2O0KA 3LC2O 4BGIA 3NTUA 2AMJA 1IAQA 3E3NA 2NSYA 1TI7A 2SKDA 4NV1A 2BEWA 4K6KA 1TADA 2BGGA 4FB5A 1HLDA 1P2TA 4UATA 5T64A 3LRPA 1ZGHA 2BFEB 4YUWA 1Y3FE 1NI5A 4BKPA 2GKSA 3M6VA 2H4WA 1HDXA 1CUIA 2M1ZA 2VHEA 3OZSA 4XOUA 5DDIP 5F12A 3V4SA 1SRQA 3HRIA 3CLUD 3O90A 3SM3A 2VRCA 3C3BA 5F4BA 3LFHA 5JO9A 3C4JA 5F4ZA 3PPWA 4MI9A 1M8FA 1W5FA 1RBMA 4HQFA 4CIWA 5KWSA 3DAYA 5HRUA 1E3WA 3LP5A 4DUYB 1WMEA 3P0JA 3VMMA 3QEBZ 5EWJB 1TUGA 2V7EA 5ALFA 1AMNA 1F4VA 3LUBA 1U98A 1E7MA 1X86B 3DV0A 5ALQA 2VHZA 5I47A 2X9QA 3R0QA 3DZJA 5LZ8A 3WAGA 4D5GA 1U5BA 3SN6A 4HB2A 4M9SA 4MPDA 1R9JA 1TM4E 4UM9D 2VSYA 3C7TA 2WC1A 4YV7A 1M6WA 2OGTA 3PD0A 2PUWA 1GSIA 1KETA 3GMTA 3ISTA 4KNWA 4QGSA 1BXZA 4S2UA 1MBZA 1TTQB 2V96A 3SNKA 1AA6A 3X1ZA 4KPYA 1I4LD 4PFJA 1GNVA 1G8KA 3AF4A 4FGJA 3WRXA 1UQTA 4YRIA 2OP0A 4RJTA 1XJQA 1FYVA 4LWZA 1CR0A 3UFXA 4X90A 1OH5A 4DLYA 4DR5B 2W71A 3UV6A 2W8BA 4FEYA 2QPOA 2Q0HA 4DWOA 4NU0A 5C7LO 4ZAGA 3COJA 3H5WA 4KV9A 721PA 5FX2A 3O8CA 3SGLA 4HRXA 4H3SA 2VP6A 1GPAA 1J07A 4LS3A 4WN9B 3WRYC 1H05A 4F4FA 2IIBA 2DOKA 5PGMA 3U5ZB 3EEFA 1A2OA 1EWYA 2HLHA 3OWOA 4IDOA 3AKZA 4Q18A 1B2LA 1E60A 4J1TC 3ZWBA 4RYLA 4YCSA 1U1CA 2CBZA 2XF2A 2OV2A 4JODA 3W06A 5EMJA 2ZRNA 3X1MA 4KQWA 4FGLA 2CJXA 2YWDA 1QG0A 2F9MA 1KY2A 1T4CA 3C3JA 4KXYA 4LZOA 4YWHA 3TCXB 1ZIYA 3KSMA 5DVZA 1QAQA 2AHOA 1XVLA 3ILHA 5DHSA 3LPMA 5I9BA 3ELWA 3UQZA 1OC2A 3JVUA 4BMZA 2JLYA 1S5PA 2WV9A 1I5OA 3AERA 3DDUA 4C2BA 2PNJA 3TIIA 5IUJC 4KFCA 5H68A 3VR6H 1I0LA 3BRQA 4POAA 3VSEA 2HBQA 3FFAA 3T7AA 3TXAA 4B0PA 1YL7A 5L3SA 2PLAA 1IVNA 1LF5A 1P60A 3AY7A 2VNAA 1HYGA 3OJOA 1NWCA 1P33A 2PXHA 2CLEB 3PHGA 2BM0A 2VXYA 1Y5MA 1WHSA 2DJIA 3OPYI 3F9CA 1FTYA 1USWA 1VLZA 2G67A 4V2IA 1FRVA 1O87A 2VA9A 3UMCA 2J9YB 1ZG3A 2YV3A 4C0HA 4HGRA 4S3MA 3R5TA 2JASA 2POQX 4UUQA 3TPCA 4F6RA 2YWXA 1KEEB 1FJGB 4UOEA 1CQWA 3SKVA 4X00A 4PZYA 1L5VA 3X1DA 4QEDA 1KS2A 5ICGA 1B2RA 1T10A 1EPUA 1SG9A 3QKSB 4D43A 5IASA 2QTMA 2F8MA 4RABA 4EYEA 3LHFA 4G4IA 1FFXA 1ICEA 1JDNA 3D7NA 4I2NA 3R3WA 3VFDA 1N0UA 4D97A 4JP8A 3BCSA 5F2EA 1TUIA 1TT5A 1VG1A 1VKRA 3H5OA 1ODLA 1SULA 1QQ6A 3P9NA 3Q3CA 2XZDA 3AUKA 4KX3A 4GI2A 4QARA 5CVJA 3HJCA 4BTLA 3LY8A 1OXKB 3P7MA 1UC5B 2CJPA 3HEMA 3W9BA 4EG1A 1AV6A 1VKHA 3I83A 5LUAA 3FLEA 3ZZ1A 1I80A 4MW9A 1E4EA 1FBTA 3L6UA 4QGAA 1R6VA 4E5MA 3BBPA 3AUAA 1E0AA 4OHRA 3HKCA 3N07A 4MJLA 4YROA 4JL8A 5HCNA 4QT4A 4CQMD 2RG1A 3RSLA 4RM2A 1FYXA 1HSZA 3HPRA 3OUTA 2NUBA 2IF2A 1KIFA 1GAEO 3ZHQA 2C0QA 1DJOA 5DEOA 4HD8A 2O6LA 1C9MA 1W85B 3NUQA 4L0MA 5TX7A 2OV1A 1K4MA 3D4OA 5D8DA 3LTNC 2Q07A 3A6HA 3UWKA 4MQ4A 5ESDA 1NTRA 5HRAA 1CD5A 4QNRA 1NU6A 1PW7A 1SVIA 3I8OA 2PUDA 5K8IA 3ONEA 5FBWB 2D6FA 3P5BA 3ABQB 2GS9A 4OLHA 5TPZD 4R1SA 1T26A 1Q50A 2XRYA 4JP1A 3TSWA 2Q2WA 1SCJA 4RK0A 2G6TA 4AC9A 4WINA 2OILA 1CUFA 1OYYA 4K3VA 2OA0A 1I9GA 2EKBA 2Y9MB 5EE5B 3CU5A 1FLDA 3JVIA 1WM1A 3HO6A 4FBLA 4G84A 4TXLA 4KWEA 4KJZA 1NONA 5AWFC 1LSOA 2F00A 4KBGA 4BP9A 4IJMA 2EBFX 2ONYA 3RFXA 1DV1A 4X24A 1O8BA 3FCAA 4TMTA 5HGXA 4Z3KA 2RHRA 2OXEA 2V03A 5D1HA 4PPNA 2IYEA 4CTOA 1NOJA 2DTXA 1KY3A 3SYMA 2R5NA 1KMNA 1M6VB 4GR4A 4NK4A 2AOUA 2E1RA 1ZN7A 1O6CA 1L1FA 1TK3A 3GEEA 3OCYA 1K8RA 1YTUA 2OZEA 4M1OA 1Z4QA 4EI2A 3IBFA 3VPSA 3WISA 5JJLA 1MPTA 1DO2A 4O02B 5B3AA 4C0XA 3QRWA 3AZOA 4QAQA 5E2IA 4LTDA 1M5RA 3BA6A 10MHA 4GKJB 2IV2X 4M9ZA 3VVLA 1XMPA 2GAFA 4HH3C 3T4UA 1JG3A 1JNXX 1OWPA 4FMBB 4JA0A 4F91B 4V0OA 4CVNA 4HATA 3GR6A 2ATXA 4RSHA 2YJ5A 3V4OA 2RCYA 1PX0A 2VUUA 4AJLA 3CUEF 1HLGA 1AZTA 3LQQA 4UEJA 3PUHA 2ZT7A 1O95C 2H2AA 4FDVA 4W7IA 3VH2A 3K5HA 4RAOA 1GTL1 5LKRA 4WASA 4KE7A 2VHWA 1H6DA 2H5IA 5AM0A 4YX9A 5DTIA 1HMYA 3R9KA 5DSZA 5AVTA 4XQGA 3EYAA 3QBDA 1E9CA 3ZH9B 1UM9B 4H1UA 5DBGA 3X2EA 4QICA 1DQZA 1WAMA 4CHTA 3G2HA 4H3VA 3LDHA 2DLCX 1D4AA 2QZSA 4K6OA 4TWJA 1BWQA 1M7BA 5IJ0B 3P9YA 1SR8A 1ULZA 5LD2B 4QWMA 1SOUA 3KPUA 2WKRA 4D92A 1NNSA 2W83A 3B1WA 3M5DA 4YBZA 3WG9A 5CCEA 4FYVA 2NU7A 2EKZA 4Q9DA 4L6AA 5K0SA 4TWZA 5AKZA 3IDAA 2R62A 1Z13A 3HUUA 3PPVA 3BQ9A 5CXQA 2WIJA 4R8MA 3INRA 3F3SA 1E2HA 2BC9A 4MVXA 2OOKA 1M6NA 4PXSA 5BSUA 2MCFA 5JLJA 3P94A 1XZQA 2TYSB 4OVKA 1ZK3A 4E15A 3ICCA 2IYZA 4FBGA 2QDKA 4HSGA 4Q82A 1GT6A 1T3LA 2DB3A 2OC4A 4QOEA 1KO1A 4B4OA 5I7HA 3G2IA 1NA5A 5AIBA 2B0JA 2J33A 1F2DA 1FS5A 4KN8A 3RVRA 3GGSA 3U7EB 3W2EA 3FGZA 1MJHA 5IVHA 4P0TA 4L51A 3U37A 3HJRA 1ECFA 4MGIR 4NEHB 2KE5A 5BWMA 5KBYA 1R9MA 2QJOA 2OYSA 4O4JB 4EY8A 4OYHA 2B7BA 1T0JB 2ZJAA 3SR3A 2OK8A 2O5CA 2PAFA 3K1YA 4LGCA 1R0BA 2VRWA 3I5MA 1VJ5A 3KV3O 3NOVA 3V3KA 1ZD3A 4MDFA 4W8GA 3A31A 2Q7DA 4GUAA 3UICA 4DKJA 1JG7A 3BTSA 1XF9A 3MMXA 1SC6A 2E5LB 1LQTA 2P77A 1SWVA 3OPYA 4AD8A 3ZOKA 1Z0UA 4YMTA 4HAXA 2D7JA 2HWUA 4EHHA 3FVQA 2Q3JA 2W98A 2R96A 1IHXA 2PSDA 2WFMA 2WHPB 3CLTC 2W5UA 3I4FA 4OQEA 3AHGA 2ZYDA 3QW4B 4PVCA 4UNSA 1UFQA 1NP7A 3THSA 3F97A 3MCVA 3ZGNA 3CZ5A 1G3RA 2YCLA 3OIUA 3TYXA 2AI1A 5BNTA 1PVOA 3ZC3A 1EP2B 2L0XA 3QPBA 3ZDAA 4DY6A 3T5PA 3AY3A 3G9QA 3HR8A 3P19A 4GI7A 4I3FA 3CKKA 1K89A 3ZHZA 2J7PD 3TBKA 4X66B 4LWPA 2PCLA 1AO0A 2GARA 1XTJA 2WZDA 1P2BA 2QW8A 1B8VA 3DZDA 3DXZA 4YTEA 3HXLA 2FQWA 2JDIA 3PYXA 2QVXX 4Q93A 4N47A 2WJ4A 1FYWA 3K0KA 1AGYA 2WILA 3Q11A 3JYHA 4FZRA 3MAGA 4BNNA 3UGQA 2Q2VA 2Q3MA 2H11A 1IATA 3IPXA 3RSQA 5JC1A 2ILTA 3U13A 5A7FA 1LPPA 3ZE0B 1VPTA 5FPSA 1T4BA 4ZO8A 2NO0A 5I7VA 1ZUNB 2DKNA 1Q91A 4I8IA 5K8VA 4J16A 4F60A 3AVTA 3SZLA 4N9WA 4O4JF 3AJ9A 4HI0E 5A5EA 3ZHBA 4ZVNA 4CKWA 1SUSA 1KFJB 4NCJA 2R3SA 5CHEA 4FGUA 4ENTA 4RZHA 3WBBA 5FB3A 2F1HA 1YRWA 2HSDA 1KYVA 1FUYB 4KR3A 1Q21A 1ORDA 1MP0A 4BLPA 4GKKB 5ALTA 1W0KD 3S2GA 1U7DA 3DKVA 5EUCA 1SXJA 3GJYA 2CDBA 1ZL2A 3EVDA 4MLZA 4XOIA 4WZAA 3VZCA 2CV2A 3VSCA 1G17A 4FYMA 3ETJA 4JYPA 3FHOA 3TWOA 3F5SA 4HEQA 2XQKA 1UAAA 3SJCA 2FX3A 1F48A 2IP4A 1AJEA 5T4BA 3CRW1 5IKXA 5CVUA 5DTJA 2BFWA 5TJ9A 3W2HA 3HBAA 2W42A 4ANFA 3C3WA 1JSCA 3OMWA 2HPZA 1RD4A 2G4VA 1DARA 1QYRA 4QRHA 2WUEA 5EIHA 3TLJA 1L8AA 3KXKA 4D6YA 3JQAA 5C7IO 5LNK1 2WR8A 2O0LA 3K0FB 1FS6A 1JHPA 1OXSC 2OYRA 4B45A 1FFHA 2CVOA 2OP1A 4Z7JA 4D45A 3GPBA 3IHWA 4LNUB 5GPBA 4L07A 4O2RA 4DQKA 2XUDA 3ZHCA 4XUGB 5FUVA 4PAGA 4Z9AA 3RHTA 4IFBA 2QN3A 3P2IA 4JWKA 4CQLA 4JP2A 1Y9AA 1NE7A 3TVDA 3WL7A 2JIQA 4BKOA 3GEMA 1BZYA 4MQFA 5FOWA 1IM8A 3ROKA 3I2HA 1T3HA 1KRWA 1NMQA 1UPFA 5CD1A 1B0UA 4IV5A 3ROTA 4UHBA 3WYEA 4ZC8A 1JA9A 2DQKA 4H0FA 3B82A 4UCXA 4CYMA 1U04A 2CT8A 3PJFA 3W9SA 4EA7A 4LEIA 2GNOA 3WP0A 3ON5A 1VZ3A 2JGRA 2XVAA 1ZS9A 2ZB7A 3QKIA 1E9EA 3H05A 1P8AA 2NZ8A 4R31A 5ANRB 3MJRA 2XYGA 2PM8A 4M55A 3AUYA 1Z5WA 3WZMA 3IXMA 1P9LA 1A8PA 2VH1A 1HE5A 3S29A 2FA9A 2NTNA 3ZZ0A 3CNOA 4GEKA 3NBZC 4EVIA 5MF6A 1CC1S 2WTMA 4PHFA 4MTLA 3LKDA 3OJCA 2GJ4A 2IL1A 1WY7A 3B52X 4YI3A 1YZNA 1RYYA 1Y4ZA 4N40A 4REMA 3T95A 3IA7A 3SHQA 3GT7A 3U4MA 4DNQA 3ZU2A 4QOHA 1QHSA 4AKIA 2OHJA 3PCXA 3HVIA 1CKEA 4N41A 1JEDA 4NCKA 2VKQA 4AZ3A 1YS2X 1H1LA 1JA0A 1EXMA 1O9BA 1UBEA 1ACMA 2B8TA 2H7YA 2OKGA 2VBFA 2W2XA 2ZBFA 4G3XA 1W30A 1SZPA 2DKFA 3RVQA 4BNDA 1P0CA 1XDWA 4PYLA 3IJ5A 1SO8A 4WGFA 4JHXA 1O0CA 3N74A 1JP7A 2JAXA 1RLIA 1T1GA 2I03A 2VDWB 2Y6VA 1S6YA 4QYIA 3VOTA 3PXXA 1TXGA 3GLIE 3DE3X 3GRAA 4ISBA 5E0OA 2MSEB 2XVYA 5JSYA 3E7WA 4O0MA 1JMVA 5C1OA 1VJ1A 1DTWA 3C7KA 4NHOA 2ZIUB 3PTZA 2G5PA 2PV0A 4PY2A 4XD7D 5BORA 1YB7A 2P4HX 6GPBA 2L69A 3ODPA 4IQ0A 4W9MC 4AF6A 1GEEA 3WMXA 4FQ5A 2VQDA 1QLWA 1RHQA 3FNBA 4HAYA 5THKA 3THXA 5CDGA 3GJ5A 1S4MA 4GMKA 4K9DA 3MGCA 3A14A 1ZSVA 5EIWA 1FW8A 1L9KA 1LPBB 1TQ4A 1CZHA 3BB4A 3KSRA 4PCVA 1ZUHA 4GDMA 3VPHA 2ID9A 3K8YA 1GNLA 4WERA 2BTEA 4O2AB 4CKYA 1G8YA 4WFJA 5J2TA 4HQOA 2P90A 2AVDA 3H8VA 5HDBB 1PJ2A 4J49A 5DZSA 4PZ9A 4A16A 3QMMA 1A7KA 5F5LA 4I6EA 4WADA 3USCS 3WIDA 5GJBA 1OFUA 2FQYA 4NDAA 2JFFA 1DMSA 1VBNA 4P5DA 5B53A 4EG4A 4HBGA 4ALMA 1NX6A 4PPGA 2BKXA 2D1RA 3BM5A 5DM1A 2VXCA 4D4HA 2N1MA 4RMGA 1MA0A 1EFKA 4UPEA 2OHFA 3A4TA 3K0BA 4P5PA 1EGQA 5DGTA 2GPBA 2I2XB 1E2EA 5T67A 3D8RA 4P4SA 3H7AA 1U0JA 4OI2A 2CHEA 5CDSA 5CFRA 1XNQB 5CFQA 1N2CE 3ORHA 2FZVA 5FJJA 1C3OA 4GNRA 4CMGA 1Y1LA 1S3IA 3UZUA 5BPFA 3G02A 4ZAVA 3HABA 2R6ZA 4XWGA 4YJ2A 1X38A 3DD5A 3ZTTA 5F1YA 3WNZA 3PR1A 3MS2A 5BYBA 2OO5C 4WY2A 2QA5A 5C34B 2C9CA 1VLHA 1GSOA 2AUMA 3LCRA 4R7TA 1U5AA 3PVSA 1LV7A 2V0CA 5JXGA 3U7IA 2F67A 1P4AA 3D7KA 3TTXA 3I6QA 1XTBA 4TZ6A 1AQUA 3GA5A 3HXKA 3OQ1A 3K2IA 4P6VF 3T3PB 1NE2A 3CEMA 1DKNA 3W5BA 2PFGA 1FDTA 5FFNA 1KGSA 4UUBA 5F9FA 5LLTA 4C20A 3U4CA 4GGOA 1CETA 3UHFA 4F4IA 5A1TA 1CSEE 1M67A 1ZLXA 4PYJA 1VP9A 6LDHA 1YDGA 2WSMA 3F5MA 4UUMA 2JK0A 1JBKA 1JR3D 1T3GA 4FX2A 1NVBA 1RXUA 1V4VA 3PQCA 3ZBPA 4U02A 4DGSA 4UU7A 2WJ6A 4ZJZA 1JA1A 1LRJA 1YQWA 2WZQA 5A5FA 1OWMA 3DL2A 5A3QA 1EVYA 3WLMA 2P3LA 4ZJYA 2YDXA 2PMCA 2P2NA 4I5EA 2WSIA 1JR3E 4NAHA 3RYIA 2WTUA 1A5ZA 1HLPA 4HL6A 1V5EA 1QP7A 1WABA 2GGSA 3UB2A 1ESNA 4WXRA 1RVDA 4NP6A 3D1JA 2SHKA 1U94A 2XUZA 3G68A 2IVZA 3ENKA 2Y66A 4EMTA 2HIAA 1EX6A 1WVMA 1XXHE 1KJZA 3RRJA 5K0ZA 1VB3A 1PVDA 2AN9A 5F3DA 2BGTA 4MCAA 4ZCLA 3KOOA 2I80A 4EVRA 3GLIB 1RZRD 4ND8A 4TYWA 4A91A 3FUVA 4KACA 5FWDA 4Q4LA 5LQDA 4QPCA 3CSDA 4ABYA 4ZMBA 1FDSA 1G19A 2GWHA 3PG5A 4GKAA 4JJ4A 4IIHA 4U2DA 2R6HA 5FOSA 3VSDA 3DNFA 4GYKA 1P6QA 4X65B 5HR5A 2A67A 3TF5A 3S55A 5FEMA 2NNLD 5I51A 2IYWA 1AQYA 2ZULA 1E98A 3P2KA 5DT9A 3NALA 5BYAA 1STOA 1WB6A 2R65A 4P3YA 3C5HA 2LKDA 3FMGA 3PFBA 4PLCA 2COUA 1HE3A 1I30A 3G0DA 3X1YA 1XLVA 1IDOA 4DA7A 5JT1A 5LQCA 4RPIA 2X3YA 1WWKA 3HR7A 1GA4A 4D9EA 3AM4A 2YV1A 3QKWA 3Q5DA 1SCDA 1KR2A 4Q7KA 5DYYA 4DJJA 1ZIDA 2NU8B 5DNVA 1XNJA 3FCXA 3HNRA 1RXIA 4AJIA 3VSBA 4HDSA 3FYTA 3EEYA 4ZVKA 3QLTA 4RFLA 1R8XA 2CNLA 3V34A 1O97C 2AMYA 4URFA 2X9LA 2VWHA 8ATCA 1A3CA 3DEAA 1O94C 3IKTA 2PV7A 2XB9A 4HEA1 4KMMA 4HV4A 3OJLA 2B1IA 4GRIA 1E5VA 1I2CA 1UT6A 1JFRA 1FFDA 2PXAA 2YFKA 1N2CB 4COOA 2NAFA 3NDJA 1F06A 4U3JA 1HYBA 1RQNA 1PV2A 1PZGA 3BKWA 1K5GA 1WMFA 2FWBA 4Y9SA 3KQHA 1W6RA 4AY5A 1ONNA 3K16A 2PRJA 3FPFA 3L18A 3MYRA 3AEUA 2I6GA 3A1FA 4GYJA 4R84A 1PEYA 4NHEA 5KCZA 1JU3A 4M0MA 5JSKA 4FS3A 4ZYWA 4Y6PA 1Z38A 4P86A 1ZGCA 4LPKA 3E1SA 1MAWA 3WP1B 1HEUA 1NJ8A 1ZUD1 1SUEA 5F1PA 3WNVA 1ZQ9A 2CUKA 2GYVA 4H9GA 1Z75A 4PYMA 2ERCA 3AETA 4KRXA 3V55A 4HGNA 4GBJA 1R64A 5JR3A 3KQYA 1WY5A 4FYXA 4FSDA 2WUWE 2VJPA 1K92A 3H9UA 2V0GA 1X3LA 3AI7A 1JXOA 5L4NA 1XMIA 4RIHA 3IQIX 1QHGA 3QE0A 4LRSB 3WLKX 3L9XA 2DUUA 1P4JA 2OCIA 5H0IA 2PTHA 4Z49A 4M0FA 1RW4A 4V3CA 1YRLA 5HHTA 3EPKA 3P9IA 2QMHA 1XTQA 1NXOA 3W05A 4ZQCB 4BGUA 5HBGA 1EP1B 1URPA 3PDHA 4KO8A 3UAYA 3HSSA 1XCBA 1JAYA 1PZMA 1P7ZA 2CXSA 3BS4A 4N82A 1V96A 1L7AA 3H8WA 3VTKA 3DP9A 1GFSA 3ICVA 3OBBA 4ZVUA 5GONA 4ZTBA 2AR7A 3SYTA 1AQLA 1XU7A 4Y2SA 1YWGO 1JQAA 2OSBA 3CRNA 1RI2A 1RJDA 2WJPA 1ZHFA 2H8GA 3OG9A 5EE0A 4CKBA 3RUIA 5FBVB 5KHLB 2JD2A 1ZUIA 1EQUA 4PWZA 2A5LA 2CC2A 1XXHB 1Z0KA 3JYQA 4M3NA 3AEZA 2WKWA 3FDXA 1PFGA 1XRSB 2WE7A 1QHIA 2CVZA 4NH4A 4PLGA 4RIFA 5LU9A 2JH3A 4FHZA 2XQIA 3GLFE 2NNWB 4XE5A 4CKCA 2CNKA 2DFNA 2FPGA 2QTWB 2QJFA 4X5OA 2J5RA 5E4YA 1KHTA 2GZ1A 2EFHB 3H04A 3OT5A 3TIXB 3WKAA 2A0WA 4DMGA 4R9SA 3IEIA 3G0IA 2V54A 3UXYA 3DDNA 2NU9B 1E9AA 2LCIA 4PC6A 2BDTA 3LLSA 4HDCA 1FLAA 1XMJA 1Y5IA 5B4VA 2X0KA 4EKYA 3PNSA 2IELA 4BASA 1J0CA 4N3AA 5JATA 3CNQS 4YP9A 5D5QA 1AKRA 1JB9A 4JR2A 3TE7A 3VTAA 3GFRA 5IUNC 1HZZC 3BT7A 2NW6A 3OQHA 3OQIB 3X2SA 3HY4A 2VPPA 7ADHA 4KLZA 1JQKA 1GV1A 3AHCA 1MA3A 3DOJA 3T9EA 2H3HA 3K1TA 3EGXB 3DCIA 1J5EB 2BFDB 2BEUB 3CJRA 3NONA 4KFUA 1KKMA 2FF5A 3AK4A 3LVFO 1JQEA 3UWDA 3TFOA 1EUYA 4YMSA 3C4QA 1YQXA 1DAFA 1HL7A 3DW1X 1JSRA 2HZBA 2OHVA 3M1YA 1Q11A 4JD5A 1WBJB 4CR8A 5BUCA 5FI5A 1DO8A 2Y0EA 5C4MA 1V9LA 3OZCA 1UOEA 4D3YA 1UWVA 2FR1A 3GRVA 2AXEA 3QXJA 2J3JA 2DFPA 3LZDA 2IZOA 4DW8A 3NCHA 2C7PA 1IZYA 1YU6A 1DC8A 4DCPA 1VG8A 1DLJA 1LI7A 1MNAA 4M1TA 3GNTA 4JVLA 2J4DA 3UH0A 3QE9Y 3QLUC 1CERA 3AEKB 3C43A 4Y1FA 4OQYA 3FKQA 3T5MA 4EITA 3D6HA 1HK7A 2X6RA 4MCJA 4KXNA 1HSOA 1NC1A 2QZJA 4NBRA 1UFVA 3OT1B 5IN5A 4EG0A 4QIHA 5FXMA 3AY0A 3AFOA 3G88A 3I04A 5NLLA 3S4YA 4S2EA 1XLTA 5JS1A 2HLDA 1HBJA 3C1AA 5DHTA 2EC5A 4B2LA 3AVXA 1YQTA 1M0TA 3DOFA 4JP3A 4OF4A 4KIFA 2HV9A 2WFLB 4OM8A 5CT6A 1M2OA 5FR1A 5AXCA 1K0FA 1ADCA 2IYRA 1DE0A 4TMWA 1WUJS 2XA1A 1YBMA 3MTGA 4L0CA 4QDJA 3RLFA 2HMWA 3WC4A 4D8VA 5UKDA 2OWEA 1ZESA 3EBOA 5KX5A 2PKCA 4QQFA 3TSAA 2VXBA 3WRVA 2DUMA 2Q5IA 4BUZA 5L53A 1LBSA 1YCDA 1OLOA 4ALNA 3DAHA 3E0QA 1LSJA 4J9UE 5ES4B 2XGOA 3D6TB 4QEZA 2WJGA 3D6UA 3U3DA 5C53B 1R8JA 3KHKA 3NAGA 4BVHA 3PFWO 4RYDA 3H5VA 4M8SA 3HZRA 3FSEA 4O5OA 1E1DA 2RAUA 1L4GA 2WVHA 4P08A 3ORRA 2WVJA 1IUPA 1TKRA 3EQ2A 3IIEA 3UQYS 4MX8A 2XE8A 4I9NA 5CXXA 3CYFA 4Y2VA 1J2YA 3UAVA 4P7FA 5JBQA 2VYQA 3OE1A 4IDGA 1TQDA 2JATA 3MWFA 4NX2A 1RTTA 2XMBA 3RS7A 5AW6A 4BFLA 5COQA 4ZOBA 3CLRD 1UK8A 1DBRA 4C3OB 1Y7IA 1E3LA 2AZMA 4QPDA 3AMVA 5CYGA 3PDCA 3SE0A 2ZSEA 4RE6A 5JD3A 3MCAA 4IV0A 1NW9B 3S5JA 1T91A 1MHPA 4J0DA 3WLEA 3B38A 3K73O 4L5BA 5LVAA 3P9RA 1OX6A 3CH6A 3E81A 2FPWA 2M2IA 3HM9A 2WPDD 2ZANA 3RRXA 1QO7A 4E30A 3GLFB 4QEKA 1S2OA 5C8ZA 1C1DB 1QVRA 4FFWA 2DG2A 1HE2A 2NSLA 3WMRA 2QK4A 1UZUA 3ZWQA 5BYKA 5M29A 2YXLA 1T15A 2BMEA 1RPNA 3VUEA 1U1EA 1G64A 2H2IA 1HFJA 3DCJA 4FSHA 4WOJA 2N9UA 2WIKA 1TFUA 2O2SA 3CX7A 4UTXA 5IF9A 3EDMA 2GHTA 1TAQA 2PANA 4YRQA 3W5JA 4I4LA 4X94A 2V3VA 4RTKA 3C3KA 2VH5R 3HFGA 3A1SA 4RV5A 1G3IA 2Q1SA 4KXWA 1HG1A 4LTNA 3LWZA 3PI6A 4TWBA 3R7AA 1JDVA 1RAIA 3R7FA 4BJ6A 1HDCA 4RANA 1YJCA 3DYBA 4TSFA 3Q8WA 1UDAA 1T6YA 2FR8C 2DLNA 4EW1A 2ID4A 2EARA 1Y37A 3GJ3A 3ZUGA 2X0RA 1KO7A 3TSCA 3WGTA 2ZU0C 3VA7A 2DXIA 3E70C 3NS7A 4KL8S 3B60A 4IHAA 4IKEA 3KU1A 3ROQA 4MEAA 4URHA 4BQNA 1XZBA 7MHTA 1QQTA 5JEDA 4UEQA 3OTHA 1VE9A 4RW0A 4EJ6A 3BFKA 2C2HA 5GTDA 2DPLA 1JYEA 3SR0A 1QGDA 4AJ1A 2Z2IA 1WB9A 1N9GA 4RHFA 1LJUA 1RRMA 5LDGA 1U0OC 1JE0A 4CNQA 4NENB 3WK7A 1N33B 1TMKA 2REXB 2OD9A 4NBWA 4HNVA 3EH1A 1G5TA 3IQEA 3OKAA 4MZXA 1SUWA 1M1ZA 4NL4H 4YBRA 1KQGA 1E64A 5JE8A 5JAIA 5FPKA 2HK9A 1SCBA 1Z17A 2WWIA 5ILOA 3UH1A 4QQRA 4MA4A 3EQ9A 3TG2A 5AK5A 3HS3A 5LMCA 2KYRA 3ZZNA 1FMCA 2C98A 1K8QA 2ZETA 3ZHRA 2IH5A 1OKKD 4FEEA 4B3RB 2D62A 2FX5A 3FNEA 1PR4A 3U7JA 3TAHA 5CVVA 4J2OA 5AICA 4JELA 4DR7B 4X6LA 3DAPA 4OOFA 5JAQA 4URXR 1L3IA 3V42A 2GJSA 5HF8A 1QSGA 3ZKAA 1D4FA 4MUXA 4QOJA 1SVWA 2QLNA 4F8YA 2PD3A 2HQOA 3F0TA 4J7UA 5F73A 1RQXA 1OLUA 3F1LA 1TW2A 3KZMA 3FPEA 2GN4A 4LQLA 2J3MA 1AA9A 3GVHA 4GOKA 3G7NA 2DX7A 4TMXA 4PZAA 4TZ0A 3HXQA 2QXYA 4Q01A 3O74A 5EMHA 1DIRA 5KJ1A 1PRYA 1TJNA 2PE5A 1WTCA 2PA0A 4G2TA 3EVEA 5BV1A 1JH9A 2GM9A 3T3GA 1X7WB 1SCUA 2QSJA 3KR2A 5E6SA 4MV0A 3AI2A 2XB6A 3R5JA 3L7BA 1VOTA 1OBHA 2P35A 1IG3A 3TXXA 3IX7A 2D1FA 1CY6A 2YZGA 3TD2A 2D2EA 3L07A 4WUVA 4RVHA 3R0VA 2XMQA 1BMFA 1IJFA 3OE7A 2LRHA 2PT9A 3M6FA 2R86A 3ESDA 4PSCA 1DXQA 4B47A 3CJQA 3F3KA 2DCUA 4J1NA 2BGKA 1Z5ZA 5EHQA 1F2UA 1N8TA 1R0CA 3A1WA 3FRHA 3UJ6A 2DSNA 1Z7WA 2EL9A 3I2YX 3BREA 1E69A 3FCEA 3I2KA 3O94A 4IUDS 5AXAA 3SVLA 1MABA 4V0QA 4L8VA 4HX9A 3B1YA 3DNPA 1AN0A 3GRRA 1V37A 2QRNA 2FPPA 3EISA 2ASEA 4BYMA 2A9KA 2E4ZA 2MTBA 1CJTC 5BMVA 4BVJA 1F6DA 2VUHB 2C0CA 2WM9B 2AN5A 2YR0A 4XDZA 4R1QA 4QUBA 1A8HA 2NTYC 1OF1A 2EBWA 3KOMA 3MPOA 2GJ8A 3PK0A 4JYBA 4FMCF 4UBKA 4LJ5A 4C06A 1YB4A 4AX8A 1VPEA 5ALJA 1ZJWA 2H7CA 1NW6A 2OZLB 2DWOA 2VK8A 3RBVA 3TI7A 2BTQA 1DBPA 2A9OA 3G2LA 2V9PA 4R16A 2AW3A 3EN0A 2GKGA 3B3QA 1LTQA 2FSGA 3GCWA 4RMJA 4Q4AA 5DISB 1M66A 4M9CA 4ZK6A 4JBNA 4JC0A 4RTPA 5G40A 2PUEA 4IIJB 4CF4A 3NWPA 3EZ9A 1XPOA 1NC3A 2RIRA 1XZLA 3VUFA 5CK4A 3C8ZA 1G9SA 2ZBDA 4TL8A 5I5GA 1OY1A 1PGJA 4ZOCA 1VDZA 1GCUA 2R8RA 5JAMA 2BDUA 5JNSA 3NT2A 2F4VB 2FKAA 1L8OA 2QP9X 3GXOA 3A6JA 1A5AB 2FSVC 3BAZA 1O3YA 3CS3A 4GOMD 4HN4B 1PL0A 3CEAA 3FDZB 3MF4A 4LMBA 5A71A 3PLNA 4XIYA 3UXEA 2AFRA 3CRZA 1I4DD 2FCAA 3RIMA 1UEIA 3WBJA 1E2UA 4TLBA 3ESCA 4K8RB 2R97A 2QLMA 1NSFA 4XB2A 2FFQA 3A9CA 4K0RA 4LJ6A 3I30X 1ZHHA 5B37A 4I4CA 2H1VA 1C4WA 1D3AA 4M1ZA 3RWOA 2FW7A 3FYCA 3HB1A 4CG2A 4OYRA 1LX6A 1VPVA 1FRFS 3ZIAD 4QC2A 4JLDA 4BAUA 3KQPA 1AX9A 1RZ3A 2FN9A 4NMLA 1L5YA 1JHZA 5JDCA 2PFKA 2VYVA 2WAAA 3QP9A 2ZROA 3HB7A 1QDEA 2YW9A 4NV3A 4ZAFA 1H4VB 2PMFA 3KIPA 2WPNA 3L0CA 1E3IA 3GCDA 2A35A 2MYNA 2E49A 5E6RB 1ACLA 2XXAB 3H42B 4TTSA 1OLSA 1T5BA 3WKDA 4DMRA 4A6PA 2JJYA 1K3FA 1T3SA 1SUDA 5KTKA 1P73A 2PQ0A 3GJRA 2VTBA 2DWCA 1VL5A 4I19A 5HQ3B 2RI1A 2G77B 4MQLA 1ZCFA 4NCXA 2NV6A 2IIPA 2VT6A 1BS1A 3E9ZA 4KNVA 4F0JA 2CHFA 3AR6A 3T9DA 1QJ4A 3A4VA 2ET6A 1PR6A 1E1NA 3CFYA 3RGGA 4WCVA 4HAVA 3RUDA 3S0JA 3ZCRA 1JFSA 1UZMA 3A9WA 4TTQA 5CYPA 5EKUA 1PQYA 1XBTA 2OPHA 1U0GA 1OPXA 3IAS6 2SCUB 1XZ8A 1I3LA 4YV1A 1JT2A 1ZUWA 3AF2A 1AOXA 3NT5A 1I5RA 1YUMA 3MWGA 2G3YA 3QE3A 4C4XA 1CUXA 4QM7A 3C98A 3A4MA 3I8XA 1DJMA 1UWLA 4DHEA 3AX6A 1RQLA 1XALA 1JPVA 1HE8B 3HDJA 4XDHA 3CE9A 1WW3A 3U40A 5IDWA 1SM4A 4AKSA 2ZBQA 3U3KA 3QVLA 1KZ9A 5J1TB 4ZDKA 4YI5A 1MQ8B 3F67A 4L3OA 4U39A 2ZRHA 2HF2A 4IZIA 1Q12A 4Q39A 2PS3A 2W48A 1FYDA 3U4QB 1N0IA 4TV8B 4YR7A 2ECQA 1NWHA 3HVJA 3QVXA 3RYFB 3TINA 4PZPA 3BHNA 4XJSA 1ZNXA 4HFRA 5FHQA 5TNXA 3VJLA 2YWEA 1ZSNA 5H59A 4PTLA 4EG7A 2PUBA 1T0PA 2NYAA 4J0IA 4MGYR 2D3TA 3CNLA 1BCSB 3HP7A 3IODA 5EJ2A 4BMPB 1F3OA 2WQ6A 5IPFA 1DP4A 2FW8A 3MFYA 1F8UA 2HWXA 3KFVA 3O82A 4FKBA 3VPFA 3LGAA 4FT4A 1I7QB 4WLUA 1HTTA 2W6ID 2QXTA 2NO9A 2WJAA 1WV0A 2V3CC 3HJBA 2I2AA 5MDHA 5ESRA 4DMMA 5ED4A 5BUZA 1PGPA 1X87A 3LVBA 1V3TA 4KNYA 1NTOA 2O8BA 3O7WA 4MIKA 3E5RA 2QWXA 3LX8A 3K31A 2GZ2A 3DOOA 3HTXA 4ZOLA 6ADHA 3AESA 2CXNA 1GQSA 2AXPA 2Y4NA 4G5OA 1TJ3A 4JMPA 4JKIA 2O1XA 2BFNA 2NU6B 3ED5A 3FYDA 2VSOA 3H65A 4M7RA 5FKJA 3RAJA 2PIAA 1E3MA 1Z5GA 1EX7A 2NVBA 2HXYA 4R1TA 3FNIA 3MGGA 4XYBA 5K0EA 4ZZ2A 2BBWA 2FJ0A 4M88A 2FEMA 3S1AA 5F1KA 2CEAA 1JU4A 2G6BA 1TJ5A 2P6UA 1L8LA 3F2VA 1GQFA 5DCWA 3U4DA 1I7LA 4PSDA 3UK1A 4JUCA 4OBBA 2I3BA 3EPRA 5JQGF 1THTA 1V8FA 2F7SA 2G28A 4JSRA 5EMNA 1U0RA 1SAYA 2PGDA 3TZQA 2NVOA 1YIAA 2WBLC 3H5NA 3LCMA 3QVTA 4KSCA 4TV8F 2O07A 4G1VA 4KREA 1G2OA 1GUYA 3Q2KA 5F78A 3U3MA 4CF7A 1ECJA 4RU1A 5GZ3A 2YYSA 3ZLTA 2PKQO 1RHUA 3VO8A 3OY7A 2P7IA 1RBZA 2YOFA 4FYHA 4GXQA 1YJXA 5B3LA 1NJ2A 3R6WA 5E9AA 1CUDA 4B5LA 3T1TA 5FI0B 2UYQA 4ESOA 1JG2A 1JG6A 2XCQA 4TVOA 3H84A 1MR3F 4RA9A 1Z6YA 1F4PA 4DWVA 4GPEA 1CTQA 3UO8B 3WLTA 2PWPA 5BP7A 3UGTA 5IG2A 1GG2A 4ZQFA 2OFOA 1NDUA 1KORA 2JPDA 3GLGE 4JLSA 2WA2A 4EJ2A 1NQTA 2IIVA 2PJDA 3JZMA 1J1IA 4TXJA 5FBLB 1YR9A 1R9NA 4DSTA 1Y80A 1ESMA 2D2IA 1X1SA 1YKGA 2V7VA 4J2HA 4C4ZA 4C78A 4OQZA 4K5QA 3KR1A 5JWOA 3EFBA 3RRMA 4C2TA 4MR8B 1C3EA 3PEFA 4RPHA 2ZRPA 3JQ6A 3DJYA 4PG4A 1NLMA 3X0DA 1U7ZA 2JAUA 4HQRA 1TLTA 2EBHX 2ZTSA 3JWIA 3NMUF 4C6SA 5KNCD 2I2WA 4IO0A 4JQYA 2O2CA 1XQXA 1KYQA 2C97A 4YN3A 3LI2A 3PWKA 1NYQA 2A78A 1XD2A 2D5LA 1UIRA 4JQCA 2W2KA 1RWPA 4XIFA 3KSUA 3Q7IA 5TV2A 3SS9X 3WLFA 3S70A 3IMFA 4MUIA 4D8XA 2QR2A 1RE0A 4JJGA 4L78A 2O6HA 2Q7OE 3K94A 4XJTA 1OBOA 3FLBA 4JJZA 1QZUA 2Q4TA 4DBZA 4NYJQ 4D42A 4ZO6A 1L5GB 3PIIA 1EG7A 5DE3A 3TSYA 1PT6A 2ZIEA 3HCBA 3RBXA 4AURA 4ZMSA 5KTNA 1VJCA 3PC8A 2VP2A 1FQJA 3BFJA 4TN5A 2GF0A 2SICE 4IJWA 4ND1A 4NULA 1XCGB 1SXQA 3WI7A 2C2XA 1LDEA 3EXFA 3THRA 3ORSA 1IG0A 1LVHA 2B5WA 4ZU1X 4CPDA 1N6LA 2Z3VA 4IVPA 4PANA 1V5IA 1V8OA 2ZXUA 2HKIA 4NF2A 4Q15A 4M21A 2JAHA 1SPBS 1OXXK 2Q5QA 3HN2A 4QDKA 4ZCIA 5CEFA 2LGJA 4PBSA 3LC0A 3PIDA 4YGYA 3W8DA 1TO1E 1XF1A 1B0AA 3T7DA 3HKBA 3KSBC 2JFHA 4WOPA 1TJPB 1KWKA 2QG4A 3QMPA 4OH1A 3ROZA 3R9XA 2PGIA 2PZJA 2HO5A 3GUCA 1JRLA 4H1HA 4ZYUA 1F8XA 1QGAA 1FE8A 1DZIA 2F1KA 2IYFA 1INLA 3ENZA 4LCEA 5FI3A 3OWXA 1N2BA 1UOPA 4KPGA 1Z8FA 2XY4A 4MUAA 4PQFA 3VR5A 4IF6A 4IDNA 1AQ6A 1JHYA 1QZTA 2ZJYA 4OHXA 3ZDQA 4BEJA 4OGWA 4BVKA 4CGYA 3OEHD 2IZ5A 4A0RA 3KKPA 1MH9A 3KZOA 1WUHS 5DO9A 1XZNA 5LP6F 1S3FA 1WULS 2CD7A 5A05A 5E1BA 2P67A 3ZBUA 4OI4A 1Y7PA 1P4HA 1MX3A 1ZD1A 2VDPB 3FGPA 5G0SA 4LF5B 3KVYA 4PBRA 4AQ7A 2G40A 4Z0PA 3B6ZA 1EEXB 3IQGX 4FMPA 4E03A 1QIGA 4NMXB 2TECE 3JY6A 4WXYB 3ZI4A 2OV3A 2HNBA 5CD9A 1FTWA 2EZ4A 1XAHA 2OBXA 2TMYA 3VGJA 4CV0A 5JALA 2WAXA 4EIWA 3T9CA 4M6WB 2E82A 2VQFB 3G1UA 3AJEA 4R8KA 4M53A 2ZJFA 1D1PA 4C4OA 4U7JA 3SF0A 2OL4A 2WWHA 4OB8A 1Q1EA 1CFJA 1H4SA 4AB1A 1Q5PA 3FZGA 5EJ4A 1W5AA 2XMRA 1F9AA 3JALB 3M6AA 4HZIA 2OBLA 1HDOA 2WTXA 3QU4A 5K3AA 3W9YA 1FMFA 1AZWA 1IXSB 2AV6A 2VO1A 3ZU3A 4DQVA 4HF7A 1LH0A 1O08A 1XEXA 3O8OA 3LLVA 2IYVA 1RJFA 4WOKA 1YIOA 1V41E 1I6LA 2XMSA 1NVAA 3RASA 4WBNB 4MVYA 1LA2A 3EGIA 4V0ME 1R4MA 3GLGB 4OGKA 3BF7A 1EQ2A 2VCHA 1U1DA 1J25A 3NHRA 4GXTA 3ZV4A 3UUGA 1ZY2A 3A2KA 4U9IS 2CNNA 3LX4A 5MFPA 1OLXB 2BSXA 3H11A 3E3LA 4LE0A 2Y1DA 1KQ3A 5HK9A 2GYYA 3I61A 2RH5A 1DC6A 4C3VA 1RWXA 1JQDA 4D4IA 1TIBA 3EEOA 1VE3A 4K2HA 1EBBA 3B9PA 3GH3A 1X1AA 3V9PA 3QUSA 5TQJA 3GOHA 1G8SA 3BMCB 3R0IA 4D7AA 3GDHA 2C7QA 3ZWAA 1ID8A 3EK2A 3JYOA 1QH8B 4OATA 3RCBA 5KQPA 4G37A 2XQFA 5ALDA 4FKMA 1ZM2A 3FZYA 1B3BA 1G7TA 3HU2A 3PDJA 3IPLA 3BWBA 4O1IA 5DHUA 5JPDA 1C7FA 1U8FO 2Q5JA 1CR6A 4YUVA 2J9GA 4FWIB 4LDRA 3VR2A 2JLAA 3EFOA 4U5XA 4Y98A 4Y9RA 3SY8A 1IQRA 5FO1A 4DV6B 1YVEI 3VTZA 1VPWA 1H8HA 4QYSA 4RZXA 1EJ2A 4PTYA 3DLHA 1SUAA 2VPYA 3T7SA 4XYEA 1CPYA 5KU7A 5CFPA 3TW6A 4CI0B 2HCBA 3KV1A 1D2GA 4YJGB 3I9JA 1KDPA 2BZSA 2JAQA 5TGTA 2ATVA 4CU5A 4JJ6A 2O7SA 2AFIE 2UUPA 3TEMA 3THOA 3BH7A 3ESRA 3KYDB 3L1JA 3T5TA 5IU6A 3U6BA 1M34E 2C5AA 3WA6A 1MRSA 1U0BB 4ZICA 3B9QA 1M1NB 2B4AA 1X1EA 1B6RA 3QX8A 3LLUA 1N1GA 1PCXA 1RWQA 1X15A 2M32A 3CLSC 1Z4NA 3PFFA 1T6BY 2FYTA 4QLBA 2AS0A 1K66A 5IXJA 2J3QA 2FOLA 4GI1A 3FBWA 3PC3A 1Y8RB 4N1AA 2YRWA 1GNSA 5JADA 3V1MA 1SIWA 3PGA1 4WNYA 3UM9A 5LPNA 2BSQA 2O1WA 3HKEB 1PWHA 5FNZA 3GQVA 2GN2A 1QOPB 2E6UX 4N01A 3DMTA 4UHFA 4CDNA 3Q6NA 4IDHA 3K7EA 3HU5A 3LXUX 4UOQA 1TJ4A 3L7MA 1GFIA 4HBZA 1GU0A 5CX1A 3D8UA 5CDYA 3RHFA 3NT4A 2QRPA 3ZVRA 3DEFA 3EIQA 2ZUEA 2WUFA 3DSRA 2PU7A 4JOCA 2FAXA 2VSFA 5HYVA 2Q28A 4B85A 4E5PA 2FDCA 3IHTA 3IEPA 2FY8A 3KEOA 1EFRA 1ZRMA 3KKLA 2IUSA 3PPIA 2BGUA 4GVXA 4JXKA 4E88A 4IJVA 1GXSB 2JLVA 4G81A 4L57A 3B1VA 1FU4A 2R44A 2ODAA 4A6DA 4ARCA 1BCRA 4YR9A 1VMAA 2CWDA 4ZXFA 4LYFA 4DEVA 1NHGA 1QTQA 1GR0A 2BLLA 1FP7A 1D2NA 3B78A 2OHXA 1WMBA 1RPAA 3A9SA 1WZIA 5CFOA 3I5YA 1FVHA 2IHBA 4MEBA 1WZCA 3IBGA 2AJTA 1ND5A 4L72A 1GILA 4EI8A 5KNCH 3RT9A 4B74A 2J08A 1NRWA 3PE4A 5ISMA 2QX4A 4F2PA 4KUEA 3U6KA 1M54A 1EGVB 2VBIA 2ZB2A 3I3SR 3WADA 4FYKA 3ORYA 1UBRS 1JHUA 1CP3A 5B3KA 4FI3C 2EQ5A 1E77A 4D3DA 3VR3A 4MKFA 1L1RA 3TNDA 1NLFA 3H9JA 1AUPA 4J6FA 2YOGA 3U80A 2J9FA 1F8GA 4J91A 4DYHA 5LLDA 1L4BA 4PNPA 4I55B 3JPYA 1Z7EA 4HWTA 3ZCXA 1N4AA 2QJTA 1KMCA 3LW7A 2OAGA 3SM9A 2B1QA 2ZVJA 3DTNA 4RACA 1N2JA 2HLPA 3K0AA 4WRRA 1YDWA 4TXNA 2IH2A 2J30A 3AUTA 2XCTB 3RC7A 3ZOZA 1Z3CA 3SSNA 4QU9A 4QOSA 1NXSA 2FFRA 2OCAA 1FZTA 1W75A 3MWYW 4KDRA 4MWCA 2YY6A 4KZKA 2ZAMA 3ZNOA 4PPYA 2HSEA 1ZU5A 3E9RA 3KZVA 2FRXA 5TVGA 4GMHA 5DNYB 2ZVPX 3N6RA 3FROA 5SY6A 1XKXA 4O2LA 5DEIA 3GEPA 3GAFA 4MKXA 2EJVA 1PNTA 4Y1RA 5CLJA 3F5FA 1XJWA 2LPMA 2WOOA 3T9FA 3KQUA 3WIEA 2LKCA 4JOSA 1H5QA 1UF9A 1WSAA 3ZJUA 2H7XA 1JIJA 4YCMA 2VAMA 4HP8A 4B35A 5ADUS 1XLWA 4KRGA 1OMOA 1DEHA 4CEIA 1YZUA 2V5VA 2BHRA 4DQXA 2BEKA 4MYTA 4DKXA 2HT1A 5E3JA 2A9RA 4URVR 1EFCA 1ETUA 2AFIB 2IU3A 3OZVA 3ADBA 1CS0B 2AIRA 3TZEA 4BCBA 1FIUA 3NDRA 1M34B 2O05A 3ZZMA 3PC4A 2QD5A 2HFKA 3AEQA 2IITA 2WD9A 3EHEA 1V3UA 4X1IA 3RRFA 3ST7A 3IBSA 4NNPA 4DLSA 1PNQA 3HBLA 4E11A 1OPRA 3C85A 2J0UA 5DLDA 4DDMA 4BZPA 1E92A 2ORYA 4I55F 3W5HA 4DC0A 1HO3A 3FMPB 2HWKA 5EXEA 2UZIR 5BWCA 2Y0DA 2WU8A 3SPXA 2YMPA 1JR2A 4YJDA 5M04A 2VSXA 2HU2A 3LQ4A 5BQXA 2MWMA 3H2SA 4R0MA 4MUJA 1UCFA 2C8KA 4G0XA 4BRUA 2UVQA 2WWFA 3L40A 4J0HA 4YJ3B 3UA3A 2AFVA 1SC4A 4RQAA 2V6GA 3JWEA 1TD1A 4MVJM 3H5IA 1BVHA 2OFXA 4BFYA 4EABA 2XIJA 1KVRA 1C3LA 1CV2A 2CLIB 4CN9A 2KQUA 4X1YB 3MJSA 3DBRA 3L4BA 3ABIA 4A0SA 4CMIB 4XLLA 4YRJA 4EJ0A 4NDNE 5G3ZA 1XCMA 1AGXA 3SS7X 4Z2AA 1ISHA 3KBOA 4CLEA 5F7XA 4AY3A 2AYXA 5EXTA 3FOFC 2BKLA 4XXHA 4YCAA 3TPZA 1NBMA 1EKXA 2E3JA 4BKMA 4EDFA 2O5EA 2LR0A 3CKLA 3QUAA 3OFJA 4M76B 2OOSA 2Q3LA 4NC9A 4W9RA 1NVUQ 4ZAYA 5IMSA 2Y1FA 4RSMA 3VR6A 2IX3A 3E7FA 1VL0A 3GAMA 5K51A 3UMVA 5K8TA 4AI6A 1MV8A 4R8VA 5GADl 2P78A 4M1SA 3MJHA 3NHUA 1PJTA 2QKYA 4LOAA 3LBAA 5JYDA 3LQFA 2VYND 3ESAA 4J3FA 4JSTA 5BSEA 2B2CA 5AJYA 1AS2A 3OCZA 4PQYA 3RS9A 3T3DA 3MERA 4LWOA 5K4AA 1NFRA 2VF4X 1ADGA 1YE3A 4TLMB 2NT4A 4EECA 3HCEA 3GCZA 3QFFA 4A27A 2NTEA 1FDOA 1Z2CA 3IV9A 2QXUA 2W11A 4WK6A 5A4DA 3UMBA 1F2TB 4KOAA 4M99A 3X3HA 1JVSA 1A88A 5KYKA 4AM8A 2Z5GA 1OFHA 5BN1A 3IVGA 4NZYA 5HKKD 1ZJJA 5FOTA 3Q41A 1XVTA 4PO9A 3PHBE 4YJ3F 3RFCA 4A8JC 1H2HA 5KOHB 1G63A 1TYBE 2G17A 2H1LA 3CIOA 4HR7A 2BGLA 2CY0A 2IS4A 5DHFA 3LPNA 3FPLA 4BKRA 3Q0IA 5CK5A 3ZJ5A 4WN9A 3SHTA 2QMEA 3K6SB 1RJWA 1UMDA 1P1JA 4LCJA 4LSWA 3RHZA 3P45A 3TLBA 1NU8A 4D4KA 2GN1A 4EGQA 2WWWA 1IQUA 4TKVA 4YDQA 1QMPA 2BV3A 2VNSA 3RC3A 1E6EA 9ATCA 1V5FA 3MK31 1QORA 2CDAA 1ZD4A 1GGKA 4JN6B 1SFRA 4OXKA 5I5EA 2R8ZA 2WD7B 4Q3NA 3IT2A 4LY0A 4RK7A 2X13A 2ZUUA 7MDHA 3I2GA 3M9XA 1HDEA 2LE0A 5FF9A 2XNDD 4UULA 4QSHA 4WNCA 2W2PA 3OKPA 4OSPA 3DFUA 2XUGA 4OXNA 4D81A 4EYOA 4Z4EA 1B23P 4BQFA 1IN7A 3DULA 1DRUA 1WPXA 3IJPA 3LGSA 3ZVKA 1JUDA 4DV2B 1A9XA 2LDBA 2I54A 1HT3A 1N5OX 2OO3A 4R2MA 3ZUPA 4BOYA 4CEHB 3I3OA 3RC9A 1G38A 1RXWA 1KU6A 4YQZA 5BV8A 3O1IC 1ZLYA 3KEGA 2ZIVB 5AI0A 1N6HA 4NCIA 1D9ZA 1RXSA 3A2LA 4K40A 4LMPA 2Q27A 1MJNA 2HPVA 2UZ3A 3G1WA 3LW8A 4OL0A 5TF4A 1WEKA 3U7HB 1M7GA 2NPFA 1ETHA 2ETXA 5H1YA 3UFBA 3AFMA 4K28A 2G8NA 2IRWA 2FZGA 3Q6IA 3UMJA 2GDJA 1XWWA 3I6ZA 3P71T 5JS7A 3LE8A 4AKHA 3S40A 4MQEA 3NHJA 1QXSA 2CJWA 4URUR 4ERNA 1I32A 4F7DA 1FW6A 1J2EA 3D59A 4OSOA 1NMZA 4LYGA 4AUNA 1PR5A 4LGMA 3W7BA 1ADYA 3ELBA 1WPRA 4KSYA 4QDUA 1Z47A 4EYGA 5CRIA 3W90A 3W6UA 2JGKA 3L7OA 1AKYA 1JHMA 2J3EA 3OLQA 1Z5OA 1SQ0A 3PRYA 4LHZA 4QO7A 3EX7C 3SJAA 4BNMA 5AKGA 4G2NA 3OLZA 3C1TA 4OHBA 3VOAA 2B4KA 1QHHB 4LDZA 5BO5A 1FVFA 3H5AA 2P6PA 4GBGA 5EKSA 1TVMA 2GAAA 1MEEA 1EP9A 2CL0X 3F5QA 4FLMA 5ICMA 3FW1A 2QD1A 3KOYA 4QJ5A 3MCWA 2HDOA 2CFRA 3ETDA 2XDQB 5DHRA 3C3XA 5CB0A 2CLMB 1U2ZA 2W00A 4YMIA 1CY0A 4FCVA 1GUFA 3LUPA 2H4JA 1D2RA 1L7PA 2OGUA 1NMYA 4UNNA 5DM2A 1W0JD 4BRWA 2RHGB 2BWJA 3IPRA 1BOFA 1EK0A 3L8DA 4MUKA 4FNMA 4RM3A 3PIRA 4GOJA 4A1OA 1PUIA 3IFSA 4MW0A 1W85A 2FEKA 4OJYA 5FORA 4DLNA 1IZ8A 4CLOA 4C30A 4LJSA 3MN1A 4V0SA 4F84A 4ARIA 4Y2GA 3B9RA 4IICA 4BU0A 1XRNA 4ZQBA 3VU1A 5F7ZA 4AN1A 5ER6A 1XRMA 2GD6A 3DZGA 3RRZA 3WSTA 3EEQA 2YQZA 1U2SA 3KPWA 1H2ZA 3NATA 4K7JA 1S1CA 4WZBA 1DBWA 3EGVA 3QLVC 4KAJA 1PNRA 4FFRA 4WLVA 5JVDB 3G5AA 2X2EA 1TMYA 3MLBA 3PNOA 4G8DA 3VOSA 1MX5A 2X8WA 1O9HA 2Y2VA 4D74A 3OQPA 5KPJA 4OQXA 4OGLA 4DM4A 4IGFA 2JVJA 2EAUA 4XYGA 4BNGA 3C7CB 4DUZB 3QXCA 3ZWKA 2BHLA 3KQQA 4IINA 3KHUA 3NNSA 3BDAA 2SKCA 3EZNA 1YS1X 3G6WA 4FGZA 4G6ZA 4LYDA 4D4MA 2CSUA 2HRDA 1R0KA 2G04A 3RYHA 1M6VA 1BMDA 2PJUA 3A1NA 2YN2A 3ZHUA 3N8IA 1O9GA 5LB2A 4CTMA 1XU9A 2YRFA 3JWPA 4QQNA 3DTTA 5CXUA 4AJ2A 2Z1MA 3NH6A 5ALYA 1T2DA 2YN0A 4HNAB 5DM4A 3ZK9A 3IKLA 4EMUA 4KGZA 1M1XB 1WUKS 3NAMA 4YAOA 3UJNA 4AQYB 3ICWA 4UOZA 1RADA 3DHEA 4P22A 5FAKA 3B2QA 1GNPA 4LDJA 4EW6A 3AYZB 2IXDA 3G59A 4V1CI 3LYLA 3QPDA 1T6XA 1ULUA 2CXQA 4R8SA 4NBKA 1EEHA 4KRFA 3D5EA 5G1OA 1GAXA 4L0DA 1MN6A 2LNDA 4P4NA 6NULA 1AIPA 2WJWA 3G5LA 1RC8A 3OX4A 1XRPA 4YUYA 1J00A 3LPDA 2RJOA 5JAOA 2INGX 1X80B 2XADA 1F12A 5TT0A 3TEJA 1DHTA 4ZHQB 2OD2A 1QIJA 4ZODA 1UJ4A 3UHPA 5MGNA 5I7RA 3DMRA 4JC8A 1BDHA 4FFMA 1JJVA 4FW9A 5I9NA 3WQSB 4U2GA 1UM9A 1V1RB 3SQLA 2J4CA 1EVZA 4DREA 3MWDB 2HEGA 2ZJ0A 3T52A 4HLQB 3JQBA 1ISJA 1SIOA 2XCUA 1IWPB 5JVDF 5IJ0A 1X1QA 1PEDA 2RGNC 4Z2YA 2ONKA 1GGNA 4K6HA 1FP2A 1VJTA 2IY9A 4UARA 2C1XA 2OY0A 3A58B 4Q4DA 2QPTA 2EZ9A 1Z6TA 3GGGA 4AF7A 3ZWCA 1RLMA 1V7QA 2V6MA 5GQSA 2DMRA 2PJRA 3QI7A 2JEOA 4Q1BA 3SS8A 3SC6A 1T1EA 4QGHA 5T4EA 2C57A 2YOHA 1I3MA 1P29A 4D98A 4YAGA 2YMLA 1JFFA 3AU9A 3GDFA 2VHJA 4BLVA 3B1XA 2ZXEA 4P9NA 4Y2YA 4YDSA 1L5QA 1Z4PX 4JCOA 5DBIA 2QX8A 4HRVA 5KSPA 1E6WA 5TQVA 2WP0A 1NAIA 3V2UA 2QMZA 3UANA 4BJ5A 5K45A 4HS4A 4E2XA 3RADC 1EVQA 2Q45A 2FPLA 5EGSA 1OA0A 1LWNA 3TLXA 1GL7A 4AZ0B 1VPLA 4RLHA 5LP6B 3V6MA 1DBQA 3CEJA 3MCZA 3W5IA 1NUAA 3RS4A 4JEIA 2RBEA 3N0RA 4EUHA 4F5YA 2OM6A 4JI4B 3UKDA 2EATA 4Q0MA 2UZ1B 3LM8A 5BOSB 5KQGA 3JARB 1K5PA 1CBUA 1REQB 4O4JA 4BLQA 2CL5A 3G5UA 4YAJA 4IILA 3MT7A 4QUAA 4TZTA 1B43A 4HYEA 2Y71A 2AC2A 2VBCA 1P72A 5H80A 3RVBA 1CDDA 2IUEA 4EPTA 4ZHQF 1T9KA 2WRZA 1Z45A 1UQRA 2GTHA 1PFUA 2HREA 1N7HA 4H7HA 1EFTA 1C41A 3WNQA 2FETA 2X5JO 5E38A 5LQSA 1J0BA 1CUCA 1IJKA 1ECLA 1NVEA 2HN9A 4P2BA 1GIAA 1Z16A 1ZH2A 3RSFA 3T5CA 4BB5A 4B3GA 2PQ2A 4CQMA 4EG5A 4ABTA 3LIPA 3RIYA 4HWKA 3CR8A 4DQ0A 2ODPA 1GADO 2ZE8A 1W88A 2GN8A 4JKYA 5TMEA 2IWHA 3WNBA 1PNOA 2YWCA 5CW1A 3VOBA 2C8JA 4OX9B 4RSGA 3KP1A 3TNLA 3VC7A 3ASZA 3D3QA 4K0KB 4H27A 4QLAA 5HE9A 4RTOA 5F9HA 3RARA 2ZIAA 4CL8A 3MJ4A 3T35A 1V4NA 1G2PA 1KYWA 1HT1E 3M33A 5TPZA 2R8EA 1LGYA 2DJ5A 2R6FA 2VP4A 3FZEA 4TWAA 4IUBS 3RIXA 5A9RA 5EIEA 1DKMA 4NVRA 5K6RA 3B1KA 4NMMA 2FPIB 3LPAA 1DQPA 2FZLA 1F9EA 2P68A 1PP4A 3A2NA 1YUNA 2MSDB 4GLJA 2GF2A 4LNAA 5EZYB 3WGYA 3QTTA 4K6FA 4PTZA 5C81A 3DZBA 4RJJA 4OBWA 1P6XA 1ZUNA 2FZEA 4X1KB 2VG8A 2CBXA 3CQ9A 3COPA 3N8HA 3VHLB 4BMDA 1PT8A 3QSYA 4GUDA 4HJXA 3K09C 2GVZC 5KKAA 4TLDA 3LUFA 3REGA 3N6VA 1HTBA 4B6FA 1U3VA 2X2OA 3F4BA 1VE5A 4EM6A 4H1WA 1KI1A 1ONOA 3KL4A 3K6JA 3TRJA 1A1SA 4JI6B 3SJBA 2IOFA 3SEAA 5JRDS 2F1JA 4WBSA 1W87A 1NQAO 4HQLA 3YASA 4BP1A 3ROXA 1P3Y1 3PGKA 1C3JA 1SC3A 2PUHA 2Q1TA 4ND2A 4PINA 4R2IA 5EOVA 3UOWA 1UBTS 3DEZA 3UWPA 2G0NA 3OQMA 4ZI7B 1GKKA 3JD4A 3PX7A 3RK0A 4D9BA 4TV9B 4FZVA 2GEUA 4GP7A 3WLRA 4RDIA 1YZFA 2HCTA 4GP9A 3ZW7A 3AW9A 3K2QA 4BRSA 2ZYWX 2BOVA 1CJMA 2RAPA 1C0LA 2K7FA 4A1FA 2CF5A 2C4MA 4MWEA 3FBTA 5FBZA 4BDSA 1QB8A 4DS3A 3S2YA 3JQ7B 1MJGM 3UT0A 1R12A 1TYAE 4Y6RA 5ALVA 1G41A 3DONA 4BO9A 1W581 1FY2A 1UIMA 3BZUA 3NIWA 5HX7A 3IVAA 2VYFA 4H60A 2Z8YA 2C3MA 4CN8A 3F90A 1KF0A 3KG2A 5J40A 1I9CA 1HFKA 1P7PA 1SU7A 4OA8A 1NM5A 2HA3A 2DE0X 3KU4A 2Q1XA 4WN3A 3ZDZB 1PWYE 5JXJA 4J16C 1L2TA 1MAVA 2ONCA 2D3WA 1YZQA 2BM8A 2HK8A 3HA5A 3A70A 5G1NA 1DTSA 2VP0A 2ZAOA 1EE2A 5DT2A 4EL5A 2IF0A 5HF6A 4RF3A 1SCIA 3LF1A 1BFDA 1LRLA 2JFOA 1R0XA 2OMEA 2UYGA 4KZPA 1NW3A 1O97D 3L8EA 2X76A 4ND3A 4B4WA 4C0LA 4V1CA 2GCPA 2NZWA 4BNIA 2A4KA 2OMKA 1TU0A 1KSHA 1BD4A 1IN1A 5LNK6 1V5GA 2PY6A 4M86A 2J41A 2RIPA 1O94D 1JLMA 4EB0A 3MAAC 3D9QX 2FMIA 2EGHA 5AUQA 5KAMA 1GPH1 1XKTA 2F48A 4JK3A 4QASA 3IP3A 2ZZNA 3HSKA 4MWOA 4O4LB 5A3RA 2MT9A 4NNJA 4E32A 1LQUA 2P3OA 1CYEA 1LI4A 4IMPA 3SIXA 4F3NA 5JAHA 1JKXA 1H5NA 4TV9F 3P20A 2XA2A 6REQA 1FSPA 1AUXA 3CX6A 2BFPA 4E07A 3Q9SA 4RNDB 3I62A 1SXJD 4BVFA 2QYOA 4S12A 2PKYX 2JZCA 1E5QA 4GLFA 3BCRA 1GL3A 5ECGC 1EFUA 1L4FA 2W90A 5TQ0B 4F2DA 3LL4A 4LBVA 1GN8A 2KHZA 1JIVA 4TS3A 4Y1EA 4EG3A 5CBPB 2I7CA 2ZT5A 2M9MA 1CQPA 1O0BA 3R4CA 4DTIA 3R20A 1R5JA 1HXHA 4UFPA 5TPWB 4RH3A 2JGDB 4L8LA 4B2YA 4KQGA 1A9ZA 2C84A 3QF4B 2E85A 2LDXA 2E5WA 2VDWA 4RA6B 3WB9A 4Z51A 2AI2A 4QECA 4G1CA 1BO6A 3ZDDA 2VUSA 3B48A 3CF6R 1JFLA 1PR1A 1XCOA 2PZEA 4R2JA 4OEHA 4RD2A 3V8NA 2XHZA 5HKLA 3N53A 1ZCBA 3FPGA 1D6MA 1ZM4A 3DBVO 4OXXA 3DXFA 2ZS7A 4L5IA 2FVYA 2F8SA 3HA2A 4LECA 2XUIA 3D2BA 1IL0A 3ZVLA 2OWDA 3G2JA 2GD2A 4Z9FA 3AH8A 4LXXA 3GZNA 2FP3A 5DM0A 3ZHVA 2O54A 1E7RA 5CVDA 2O2EA 1CZUA 1U3UA 3D64A 3FWNA 5AI9A 3WK4A 1KDVA 4DXDA 1LNZA 1BN6A 3FB4A 4FUQA 1BKYA 2FMKA 1KDZA 4EHDA 1PIWA 4QXOA 4UU0A 2NG1A 1OXVA 2QB5A 2HLNA 4M0DA 5HUJA 3M2TA 6PFKA 2WIBA 2ZJOA 4LYAA 4LJKA 4PX9A 2H1SA 2IYQA 3H9EO 2HTEA 4M87A 2AG0A 2AF4C 1U7TA 1FNMA 1JEQB 2DKOA 3TD6A 4GXRA 3FFXA 1T2VA 5CUQA 4F92B 2Q99A 3HY6A 1AKTA 4IYJA 1RIIA 4BCCA 4EMSA 3K05A 1W0KA 9MHTA 3COYA 2PYIA 2AFHE 4ZQIA 1G6HA 5KSZA 1YQDA 1JR4A 2QN9A 2Z57A 3DC7A 4I1IA 3QK7A 3G9UA 4Z0NA 2C5GA 5LLSA 2CNOA 2PUGA 1UJ6A 2RGBA 1MRNA 1NIJA 3HPQA 3KQMA 2DSTA 2YH2A 5EC8A 3R5HA 4HQNA 4RK6A 3JQGB 5IABA 3FCSB 3VPBA 1MW9X 3SHOA 1OT3A 1PDVA 2CDNA 3AJAA 3EYWA 2YV4A 3GLRA 5I8WA 2H2GA 5K8CA 2WP8J 2H08A 2RKWA 3DM9B 1Z35A 2DVMA 2QRUA 2QD4A 4JU9A 4NOMA 1N6IA 1DCMA 2RHOA 3QUQA 1V1JA 1ZRNA 1FVXA 3GCGA 4LZWA 3AFGA 1US8B 4JASB 4OGGA 2IOHA 4DDKA 2NZUG 4OO3A 2AZDA 2H92A 4I99A 3NCTA 4KKVA 2AJLI 4RETA 3U4HA 5LD2C 1S7GA 4CJXA 2E37A 3G2PA 4DV0B 1T36B 1VE1A 1GQRA 1YS6A 2HMVA 4J0QA 1H8EA 4AG6A 1QWSA 1XRQA 2RG7A 3NDIA 3HFJA 4W99A 4MINA 3IC5A 4RXUA 3DZIA 4ZO9A 3E48A 1IN5A 1NDQA 2YMQA 3RUHA 2NV2B 2WF9A 2CVQA 3WZLA 2WK1A 3NM4A 2EKDA 1ESDA 1FTSA 4BMSA 3VPAA 5JZMA 1RC0A 1QH1B 1Z6AA 2EX1A 4YASA 2QP4A 1LFAA 1LPSA 2IYYA 4K9OA 3A7EA 3BHMA 1EQAA 4PFSA 2ZIGA 1JKMA 3M1IA 1RLOA 4M8IA 4D3ZA 5G4KA 4EGFA 1RKBA 4RK5A 4AS3A 1H6BA 1V1MA 5FUYA 1A76A 4F1WA 1DELA 2QS9A 2PD4A 3NBMA 3GRFA 3H2HA 4QX6A 1NZFA 4QXPA 3CXUA 1FRNA 4BP3A 3H18A 1DC7A 2ZQYA 1VIAA 4OQ4A 5DYTA 4RTJA 3L46A 5G1PA 1HEIA 2YNMD 3C8MA 1AU9A 5TQ2A 3RJZA 1ORVA 3A1UA 2H54A 2MSLA 3ZE6A 2UVPA 4G97A 2REBA 3KDAA 1IH8A 4D41A 2QX7A 4FDTA 1R16A 4BEBA 4HXGA 2V3WA 3I72A 2BMAA 3GEHA 1VHJA 5LMNB 4WPGA 2CFIA 3WB0A 5EJIA 3EXG1 1AQIA 3O0DA 3FFBA 1EXDA 2YWFA 4TL9A 4BV3A 5DM70 4M98A 1ZAYA 3K70C 4PSVA 3NNDA 2RBKA 5E3HA 1MVLA 5IC4A 3KPYA 2QUKA 5DBFA 3FPKA 2FUNB 2R6DA 1BJRE 5HILA