3IAAA

Crystal structure of calg2, calicheamicin glycosyltransferase, tdp bound form
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
MAHLLIVNVASHGLILPTLTVVTELVRRGHRVSYVTAGGFAEPVRAAGATVVPYQSEIIDADAAEVFGSDDLGVRPHLMYLRENVSVLRATAEALDGDVPDLVLYDDFPFIAGQLLAARWRRPAVRLSAAFASNEHYSFSQDMVTLAGTIDPLDLPVFRDTLRDLLAEHGLSRSVVDCWNHVEQLNLVFVPKAFQIAGDTFDDRFVFVGPCFDDRRFLGEWTRPADDLPVVLVSLGTTFNDRPGFFRDCARAFDGQPWHVVMTLGGQVDPAALGDLPPNVEAHRWVPHVKVLEQATVCVTHGGMGTLMEALYWGRPLVVVPQSFDVQPMARRVDQLGLGAVLPGEKADGDTLLAAVGAVAADPALLARVEAMRGHVRRAGGAARAADAVEAYLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CalG2
publication title Complete set of glycosyltransferase structures in the calicheamicin biosynthetic pathway reveals the origin of regiospecificity.
pubmed doi rcsb
source organism Micromonospora echinospora
total genus 133
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3iaaA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3iaaA02
4KQMA 4BFCA 3MT9A 2ACVA 2IV7A 2QNBA 1VGVA 2IUYA 3HBFA 3EBPA 5IKPA 3VDNB 3ZCQA 4N3BA 3E3OA 1L5WA 3UYKA 4EJ2A 1Y6GA 2R66A 3GPBA 4YI3A 2X0FA 3NP9A 4LEIA 4RENA 1C3JA 2QRQA 3EBOA 4N9WA 3G2JA 2KS6A 5JTUA 1RRVA 4MI6A 1P29A 2XGMA 2F3UA 2AV6A 3MT7A 4G2TA 2GEKA 1WV1A 2ATIA 3HBMA 2XCIA 3CUYA 2IYFA 1P2DA 1FU7A 4M83A 2PYIA 3C4QA 1AHPA 3BD6A 5C1DA 4W6QA 1GPBA 3T3EA 3G2LA 3DZCA 1E4OA 1F6DA 3OY2A 1Z8DA 2X6RA 4M60A 2IEGA 3D0RA 3HBNA 3MTAA 4N3CA 3SYMA 2PYDA 4MI3A 1NOJA 1FU8A 1K06A 1FTWA 1WUTA 1AXRA 1NLMA 2QN3A 2C1ZA 4EL0A 5DU2A 1E1YA 3E3NA 3NC4A 2VSNA 1EM6A 4CDRA 1M5RA 2BISA 3IAAA 3MT8A 2ACWA 3CUWA 3MRXA 4WHMA 1NOKA 2VCEA 3CUVA 3VUEA 3T3HA 2JLBA 1XKXA 2H1HA 1C8LA 3BD8A 3MTBA 1L6IA 3T7DA 2QLMA 2XMPA 4HLNA 1GGNA 1ABBA 3MBOA 4RIIA 4RIGA 1NZDA 2AZDA 4RIFA 2GPNA 2XGSA 1L5RA 2JJMA 3OTIA 1SXPA 4KQ2A 3Q3HA 4PQGA 1NVKA 3L79A 3CEMA 3L7DA 3WADA 5TVGA 4LDPA 5TMEA 3DDSA 3T3IA 2HY7A 3TOVA 2R4UA 1O6CA 1FC0A 2IEIA 3CV3A 1L5SA 3E3LA 3UYLA 2Q6VA 2XA1A 3CEHA 1SXQA 2QN8A 1JG6A 3T3GA 2QRMA 4X6LA 1Z62A 2FF5A 2XGOA 2VG8A 5D01A 8GPBA 1H5UA 3PE3A 4YUAA 4MRAA 3RHZA 2WTXA 4M7PA 2QN1A 3GUHA 1KTIA 1XC7A 2ECPA 3ZCTA 2R4TA 3L7CA 4NC9A 3RT1A 2FETA 2F3QA 1PNVA 2BFWA 4AY6A 1QKJA 1XL0A 2AMVA 3NAZA 2G9QA 2IW1A 2XA9A 3C4VA 3QHPA 4GYYA 4F9FA 1FTQA 1FU4A 3S2UA 3NCHA 4REMA 1XOIA 2QRHA 2QN2A 1Y8ZA 4MI9A 3G2IA 3ZCUA 1GPYA 1P2GA 2QLNA 4MICA 2C4MA 5DLDA 1HLFA 3ZCRA 3L7BA 3OTGA 1FTYA 2XCUA 2PRIA 4FKZA 3C48A 4CTMA 5HXAA 1GPAA 3HBJA 1J39A 3RSZA 2F9FA 1GFZA 4EL5A 2JZCA 1C50A 2QRPA 4HWGA 1UQTA 2QZSA 5IKOA 3O3CA 4RIEA 2F3SA 2SKEA 4RELA 3D1JA 4YI5A 1JG7A 4AY5A 2C9ZA 5I45A 2QN9A 1P2BA 1L7XA 3VUFA 4BQEA 2BGTA 4GZ6A 4NESA 1C8KA 3COPA 4XIFA 1WW3A 3Q3EA 3BCRA 4X7MA 1L5VA 3D0QA 1GZ5A 3FROA 1F0KA 4CTNA 4EKYA 1JIXA 2X0EA 2YJNA 3IA7A 2VCHA 3OKCA 3G2NA 4WADA 1P4JA 3G2HA 2R68A 3TSAA 4Z5XA 1PYGA 1K08A 1Y6FA 3S0JA 3MTDA 3NB0A 2GPBA 3MS4A 4AMGA 4GZ5A 3AMVA 2SKCA 2C1XA 4X7RA 3MSCA 7GPBA 3S27A 4GPBA 2X6QA 3CUTA 2ZB2A 6GPBA 2QLLA 2BGUA 1WW2A 3BD7A 3DDWA 3OKAA 2X0DA 3MRVA 1NOIA 3CEJA 1UQUA 4N39A 2OFFA 2GJ4A 2SKDA 4X7PA 1NZFA 1YGPA 4GYWA 4F97A 3OTHA 1BX3A 1Z6QA 3NPAA 3VDMA 5JTTA 3T5TA 2G9RA 2QN7A 4CTOA 5TMBA 3ZCVA 1IIRA 3Q3IA 1P4HA 2IV3A 2GT1A 4KQ1A 1V4VA 2F3PA 2VSYA 2GEJA 1Z6PA 3CX4A 3S29A 5ENZA 1P4GA 2GM9A 1QM5A 3ZCPA 3BEOA 3WAGA 4XI9A 3S28A 3PE4A 1L5QA 2P6PA 2IYAA 1JIVA 1FA9A 1A8IA 3H4TA 4MHSA 1PSWA 3ZCSA 3H4IA 3RSCA 1FS4A 4RBNA 3MRTA 2G9VA 1XV5A 5DXFA 1EXVA 3L7AA 1JEJA 9GPBA 3DD1A 2FFRA 3OT5A 2PQ6A 2QRGA 1LWOA 2GPAA 1LWNA 2AW3A 3CUUA 3L01A 4MHOA 5LQDA 1XL1A 4FZRA 2PRJA 4F96A 1YA6A 1B4DA 3QKWA 1PN3A 1WUYA 4L22A 4WACA 4AMBA 3SYRA 3T3DA 2XA2A 3MS2A 4GZ3A 4RIHA 1WV0A 1RZUA 4BQIA 3BCSA 5BNWA 1UZUA 3NP7A 5TMDA 3OKPA 3BCUA 3MQFA 3OY7A 3WC4A 3TAXA 2ASVA 3G2KA 3BDAA 4N3AA 4NEQA 2H1FA 3MS7A 4QLBA 4EKEA 2G9UA 2R60A 1IXYA 4BQFA 5D00A 1GG8A 2O6LA 5GPBA 1RZVA 4AN4A 1JIUA
chains in the Genus database with same CATH superfamily
1Z7YA 2GJSA 5BN1A 2JLWA 1D6NA 3U0BA 4BFCA 3PQ8A 1BQEA 5IABA 2JIPA 2QZZA 1T4CB 2HPHA 4MVJD 1N2CA 1M6EX 1J8FA 4G4SP 4EUSA 4UTRA 1UKBA 4P54A 2VEOA 1SJ9A 3OJLA 4K81B 1HKHA 1HQDA 2OV3A 5FR2A 2TMGA 2O52A 3DMFA 3QWHA 4MW1A 4D45A 2FSIA 3TQCA 1J21A 2ODQA 4MPJA 1EVIA 1LBHA 2OBBA 3QUTA 4OQPA 3V33A 1T1JA 4S3MA 2EKDA 3DBVO 3M5CA 1BMFD 2DTEA 4TKVB 4TWIA 4RENA 1N5IA 2RBGA 1RJGA 1REQB 2QRQA 1R3UA 2YHAA 5FHRA 2GETA 2PLNA 2J0UB 1FYWA 2C8JA 1DKUA 3PUJA 2XZDA 4O5AA 3VAZA 1Z6XA 1N8NA 5MGNA 2CLEB 2XGMA 3KAKA 1EK5A 4TRRA 1E1DA 5AD1A 3MT7A 1NBAA 2QP4A 3N2KB 4CJXA 8MHTA 1G4AE 3KUXA 1RXCA 4GP6A 4PC7A 3E8XA 5BN3A 2BVNA 3TCKA 1ZX1A 9MHTA 4CV0A 5DGDA 1QVVA 1BD4A 2JANA 2YZ7A 3L2OB 1TUEA 1GKLA 4QFCA 2FG5A 3TLCA 1SO8A 1CWUA 1ZNQO 4M83A 2HADA 2FCRA 3AR7A 2A7XA 3GK3A 1V5WA 3L46A 3A32A 3D5EA 5F77A 4JY7A 1EIZA 5E2AA 1CUCA 2HMUA 4L0MA 3E3MA 4B3IA 2BTQA 3EQ2A 3G2LA 1VL2A 6CHYA 5EA2A 4LZOA 4OHOA 1RACA 1UJ4A 4I5FA 4MQUA 4E11A 1IXRC 4CLOB 5HZMA 3REQA 4CM8B 4ZMRA 3GY0A 3ZNQA 3QUAA 4PRYA 2O8FA 2YZMA 4AWXA 3D0RA 1F60A 4NBUA 2QL6A 3DZDA 1N7GA 4PSCA 4XX0A 5AW5A 1LNZA 4CMBA 4UDYX 4QYSA 3TX2A 1VMIA 2IPNA 2OO3A 3JWPA 4B09A 4BNXA 4UM9B 1T24A 2AQHA 3BXPA 3AL0C 2Z3WA 5ANRB 1ZYUA 1GRVA 3KVOA 1CHDA 4HVCA 3L0CA 1CUEA 4NBKA 3GJ6A 5LBUA 3FGNA 3OLYA 3H8VA 3HLKA 1E4VA 2XZTA 5D51S 3UAWA 1YB7A 5KS2A 3U4AA 2ANBA 3E3NA 1GNTA 1GAWA 1KYYA 3CGGA 3KJXA 1WP4A 3ORHA 3WO1A 3ZXXA 1CZLA 2AS0A 4HDAA 1PDVA 2YWEA 1BXZA 3BILA 3NGXA 4NFLA 1VIVA 2JGJA 3EVCA 2IPOA 3AEZA 1AHNA 3R8XA 5ALFA 4D97A 3ZPXA 4Z7QB 3V8NA 5DF1A 2IXTA 5H5JA 2HHCA 2WW8A 2XOKD 4EG3A 4WHMA 4YP6A 2C99A 1DWUA 4CM5A 5LMUB 3T3HA 1GVHA 1F4VA 1MNAA 2AOVA 1P7PA 2JLBA 3MLEA 5CA0B 2P9HA 3C8ZA 2F8SA 1XKXA 4IUYA 1XKQA 5HE8A 3P4YA 4GICA 4W4TA 5BURA 3N2YA 4FYMA 4TWJA 4NVRA 1PEAA 1RZRA 3LSTA 5J2TB 1TQDA 2EX0A 3L8HA 4KC0A 1RVV1 4RANA 4OQFA 4LVOA 4DA4A 1NSYA 2EOAA 3W1WA 5CP8A 3ZE6A 5A0FA 3OE4A 5C5EA 3E58A 5JRDS 3EFOA 3MBOA 4QXOA 4E14A 2WPNA 1IN5A 3ZTWA 1Z17A 3G5LA 2P11A 2VUUA 4J2HA 2HXYA 1U1IA 4EHNA 1INLA 4FMDB 4FIZA 1VLLA 3KZMA 3Q3HA 5IMSA 5AVWA 2VWQA 3OPMA 1TADA 4Y18A 3TZQA 1MDFA 2W4IA 4KNYA 5TARA 2X4GA 3LPCA 2GEVA 2V9ZA 1M10A 4YA6A 1I4LD 1W93A 1XRSB 1UKEA 2NTNA 4JT4A 4RZQA 2E49A 1EVJA 3NUQA 4MWZA 2IUEA 1XK6A 5E9QA 4DF3A 1C3VA 1Q2XA 3BWEA 1EGQA 2GLUA 2ZWPA 5C1OA 4GPEA 1D1QA 2CMGA 2GCIA 1U04A 1T26A 4RKFA 1LU9A 1QVZA 1RKBA 4FHEA 3T3IA 4C4OA 3FB1A 3KYDB 4CQNA 5KX5A 2AYXA 8OHMA 2A8YA 5HQ3A 2D54A 3Q8LA 1DC5A 1N2EA 3O1JC 5D7NA 4OFBA 3C7CB 1Q11A 1MJGA 2QM3A 2DOKA 3ENVA 4YJ2A 1KY5A 1ODSA 5BRJA 1KZ4A 1C4OA 1EKXA 1G20B 4PZ0A 4MWDA 2VZLA 1U81A 4M0EA 4Y2QA 4X3CA 5AVUA 3ZHRA 1ECBA 1QH8B 4RF5A 1KZYC 4HWRA 4II2A 3TTTA 1Y1PA 2XVMA 4UAVA 1SKQA 5BYJA 3VDRA 5CBPB 2D8AA 1VP3A 3PQDA 4MB6A 4A5SA 2Q3MA 3NNNA 3HZOA 4KFTA 3UMYA 4RVCA 2GASA 4G5FA 1W4ZA 1V47A 3DJYA 1EWYA 1J90A 2Z6UA 1Y8CA 3SNHA 4Q6BA 3HADA 3P0RA 3W3AD 3HB0A 2WNIA 3FI0A 2FPGA 2W37A 1GQ2A 1OSNA 1FLDA 2EQBA 4FXOA 3ZXIA 1VMKA 3TR6A 4OSOA 5E9WA 4LOLA 4D6PA 3NHZA 3A4VA 3S2ZA 3D3JA 1P18A 3SEQA 1DV1A 4Q4JA 5HOQA 3K8YA 5KNDH 1OI3A 1AMNA 3DQZA 3IJPA 2QS9A 5TPWA 4MKZA 4P7JA 1MA3A 1JPVA 1KZ9A 1L8QA 2GTIA 4PWYA 1QQTA 4DSNA 2B34A 4EY8A 1J24A 4FCWA 5LDDC 1Z8HA 3ISJA 1RJFA 2TSYB 4FX5A 4YCAA 2NSLA 2HHHB 1S02A 3DVQX 4OGKA 3FCSB 4J0EA 3O47A 1KTVA 4L2IA 1TC1A 1Z26A 4Y30A 5EXPA 3OZRA 3ABOB 1JWBB 3DD5A 3OHMA 4MUGA 3P96A 4QTUB 4DA9A 2VSOA 3RAGA 5IJ9A 1ZIXA 5CAEB 1SOAA 1BVUA 1KFKB 4GNKA 4M8IA 1G18A 1R9NA 1Z2AA 4F9FA 4WCFC 4F6CA 2FHPA 1OFUX 2GM3A 3LCVB 3V6MA 2I4TA 4J43A 2AN1A 5THKA 4REMA 3BMCA 4ZQIA 1K4YA 4TWAA 1E9FA 1A97A 4LQLA 3SQDA 2OO7A 3MMPA 1GEGA 3DTVB 4K1XA 1BXRA 2X23A 3P9RA 1FNNA 5ARCA 3WHKA 5DOZA 1N2CE 4Z1MA 3SC2B 4GOMD 2W42A 2NU8A 1T5BA 3TBFA 4LMRA 2ID9A 1QHNA 5AI5A 4B6SA 3HA3A 4DV3B 2WJHA 5KB3A 3GIWA 3ZHSA 3WP1B 5DLDA 2A9KA 1HNZB 5KAPA 3ZCRA 1YFKA 4JLKA 4G09A 1GPKA 1DEHA 3R44A 4LTDA 5L7YA 3IT0A 4BV3A 4PZPA 2D62A 1LKZA 4AS2A 4XWAA 1U8EA 2R47A 1G9TA 3MWGA 1D1TA 3CC8A 1G8YA 2WOOA 4Z0NA 2WVGA 1V3TA 2PRYA 3C48A 4M49A 3PPVA 3ORRA 3NALA 1VHTA 4OQLA 4UDOA 3RSZA 1JZTA 4OLBA 1KDTA 3I52A 2J85A 1XYYA 1W0KA 3O2QB 4B4WA 4L5CA 2FI1A 4BL5A 4UVDA 1PU2A 3V8MA 3M0EA 4TMXA 4J0HA 4HZUA 1USUA 2XUPA 4H9GA 1A5ZA 3GNSA 4NAUA 4RD1A 1SQFA 4D9MA 1Q0ZA 2EP8A 3IKMB 4R2MA 4UU8A 3AEUA 1SEVA 4ZWNA 2HSJA 4HDRB 5DNVA 1RWBA 5BSKA 2C2ZA 1W85A 3MOSA 4AY5A 5I7HA 1W25A 4QXPA 3TECE 4PG5A 2FUKA 1U0EA 2FZVA 3OSUA 4CMIB 4U7FA 5ADHA 1QR2A 1Z2PX 1XMJA 3G5TA 3OD1A 3L0DA 5ESXA 5KTNA 2LCFA 1A95A 1U3GA 2Q2VA 4MGZR 3V7FA 1HETA 3DFUA 5J4YA 4PNPA 2C5GA 2HQBA 2JHFA 1LCIA 3A26A 1J9EA 1Q44A 3E1SA 5FI1B 3ZWWA 3ST7A 3AGPA 4P4SA 3WGOA 3FDXA 1JL3A 4Q9HA 3W4KA 4Y0NA 3WIVA 2OCBA 1CUZA 3DG9A 4WOCA 1W1IA 3DAFA 6NULA 2WM3A 1W0JA 5IMBA 3ZS8A 2YICA 3HO6A 3G0GA 3HVIA 3RC8A 1H8EA 1DAHA 2PGXA 4MR7B 4ZGGA 1HDIA 4LFBB 1NVVQ 5B37A 1TCVA 2ZRLA 1ZOOA 2VBCA 2A9VA 2VJMA 5G2OA 3O84A 4GVLA 3C4JA 4GD3Q 2HSZA 1C80A 2QR5A 4PFSA 4Z5XA 1C30B 1ECCA 1Z39A 1QZ3A 1J5PA 3S5JA 4IGKA 3GLFB 5CTJA 4E1AA 1E2MA 3TW8B 4LVUA 3DAPA 2D6FA 1CTQA 2VPWA 4N01A 3I09A 5BQFA 4RZXA 1PJLA 1T4GA 2PZ8A 3FWNA 4I4NA 3RHSA 3SPXA 4LRQA 3K9CA 3EEOA 1RWVA 4J0CA 3NTOA 4GZ5A 3CB4A 2IYZA 2ZBDA 4MP6A 3B9QA 5KU1A 2DWOA 5LWHA 2P75A 2C0PA 3OCXA 1L7VC 2F43B 2Y3IA 2X6QA 1IWBB 4TZKA 2Y4OA 6GPBA 1D09A 2HQRA 1WU8A 4TV8A 5BUQA 4H7JA 1CRQA 5C4GB 5K8IA 2XKKA 3ZJVA 1GYPA 621PA 5D6NA 5HRUA 2PRZA 3GUYA 4R98A 1P19A 3DVAA 3MRVA 5BWCA 1X1CA 1TQ6A 1UMCB 4Y9UA 1K6JA 3ILYA 5E6SB 1Z0FA 2JD2A 3BE5A 2KB0A 3I9KA 1XG5A 3HP4A 3JALB 5I4CA 4DV6B 2QMYA 5KPDA 2OFFA 3FDZA 4X7PA 1R9MA 4IRMA 4L15A 3FF4A 1WLYA 2HCTA 2IH4A 3X1KA 4IIYA 4GSYA 1J33A 3OCYA 1G5QA 2FZKA 4INZA 2G67A 4MW6A 5B57C 2FQWA 1FB5A 5C1BA 2ZJ4A 3QPWA 3F3YA 3PXGA 2ENUA 4GMDA 4Y0VA 1C4XA 4NYIR 5AKKA 3F6EX 2IC5A 4KMOA 1PV2A 4P53A 4KYIB 3WLFA 3ZCVA 2RSLA 4UPDA 3P26A 3NBXX 3R7LA 3H11B 1F2TB 2H1SA 5EWMA 4QDJA 4EPXA 4LV6A 3OF5A 2D1YA 2GXUA 2WPDA 1MMFB 3GFPA 3IIJA 2R1UA 1U0JA 4E70A 4ALIA 2QXTA 4M4SA 4AI6A 2AKYA 4JLVA 3VSEA 2PSFA 2ZAIA 2JJ1A 1KEWA 2BAGA 3GP3A 3GRAA 4LCJA 2RD2A 5KCZA 3I37X 3KKKA 5E2IA 5ENVA 3IQDB 5AJWA 1KK3A 3LNCA 2P6PA 4IW3B 3TRFA 4G0WA 1NL3A 3AR5A 3EQ8A 3MHTA 1HSOA 1JKFA 3BUSA 4AJEA 2IOYA 3UKOA 1U4SA 3M6WA 4MGHA 4EJSC 1QGUB 3ND8A 1AKWA 1ZRSA 4Y2XA 4LTMA 3ZXSA 4YHHB 5H80A 5CR9A 1B8NA 5LMCA 4AMUA 3QOYA 5JNVA 3LYHA 5F12A 1J1ZA 1O03A 2OB2A 3D2CA 5DXFA 2CHQA 2EKLA 3FF1A 3ZLUA 1JFLA 2XVXA 1OWLA 2ZUBA 2JFQA 1SHZA 2VPYA 4WMLA 3CMCO 4CCYB 2CLOB 5C8ZA 3WLPA 4CRWB 5EZ6B 1QONA 3LBFA 3R09A 2PT9A 3S2YA 2BM0A 3O2SB 3IBCA 1RWOA 4ZI7F 1UP6A 1QWSA 3BWYA 3GW8A 5KTYA 1JHZA 2CLCX 2IZ7A 3D8HA 2PT6A 1X8JA 3HI4A 3B85A 4W82A 1UPUA 4HDMA 3RKSA 3QWAA 4DL9A 1JI3A 4MV0A 5JASA 4EWLA 3BH7A 4L8VA 3WQHA 1LEHA 4KE7A 1FP6A 1GUAA 1O5IA 1ACLA 4FZRA 1ATIA 4PGFA 3EZFA 1PFKA 3DDHA 2C29D 3I4FA 1B7GO 4Y2JA 4P22A 2I3ZA 3KL4A 2Z4SA 3CUSA 2NSJA 3I9JA 1E1QD 3L0BA 1TU3A 3KZNA 4NBNA 4URXR 1V9SA 2WT9A 2UZ4A 2OV4A 1IYZA 3CNEA 5CURA 2CDAA 5C18A 2XDAA 4DA0A 2Q21A 3AFMA 4OAQA 5ARDA 3OAAA 4MWTA 3MTQA 1OT3A 3A4IA 5EHQA 1U2ZA 2ORVA 3OPVA 1Z5ZA 1FFGA 2WWTA 3AEKB 3IHLA 3MUFA 2VNKA 2IYEA 3R6LA 4PQYA 5GV8A 2IYYA 3R8CA 2ZK7A 2ZYTX 4DUGA 1N3YA 1RKQA 1ZW1A 2LZ0A 3VR3D 1SIOA 1Z4IA 3LP6A 2Q5FA 2YVAA 1DBIA 2G63A 3KWJA 4QULA 4F0JA 4NXNB 3DFIA 1N36B 1EJ0A 1P8JA 2G25A 2XLBA 3F71A 4WXMA 5A4DA 2QUHA 3H9BA 1F8FA 3R0ZA 1ENOA 2UXBB 1CJUC 1M2OB 3OFSA 1P2UA 3R7NA 3PU6A 4EKEA 4ZYVA 2BHSA 4ICIA 1LJUA 1IXYA 5A5DA 1CX9B 1LS1A 3BMNB 4RV9A 2B69A 1OWOA 3C3KA 3JQ7A 2INGX 5HJ5A 1IQUA 2R1TB 4IQ8A 5TSDA 3Q5GA 3FLMA 1CJCA 5SZJA 1DMSA 5CLIA 1R5BA 5AKIA 3BPSA 1G8GA 5NULA 2ZBFA 1ZFNA 3L4KA 1EZ4A 2H08A 1M54A 2AF4C 3O2NA 1M74A 4H1UA 4K9LA 2CDCA 2XJ4A 1AKMA 1QYRA 1QZZA 2FW7A 2O0LA 3KBBA 4FYHA 1CFJA 4JA2A 4ZHSA 1OZGA 3I0NA 4WBSA 3QXHA 2AJTA 5B2ZA 4TXLA 1SXJC 4BRSA 4MGEA 1XMIA 1T1IA 2VJQA 4YUVA 5TS3A 4BN0A 4AS3A 1XX6A 1DFIA 3Q7TA 2O9JA 1K7XB 4WX2B 4X6YA 3RASA 3SK0A 4HXFB 3ES9A 1MX5A 1T5OA 2HHJA 3GPBA 1Y9EA 4LWQA 4LGYA 1KQ3A 1SUCA 5B12A 5I7UA 1UBKS 1LNSA 4KDRA 4XGKA 4EF4A 1WZ2A 1HQYE 3TIXB 2I9PA 3MUNA 5F4BA 1ZI8A 4PGHA 5JCJA 3ZDCA 1KI4A 1IZ9A 3WMGA 1U5BB 3K32A 1E9RA 5FI5A 4ZYTA 2PGAA 5TQ0B 1RRVA 5I6DA 1Z68A 1P29A 2X2FA 1BD3A 1BDBA 5JD3A 3IP9A 3LD9A 4IF4A 1RPZA 4ZI2A 1KNXA 5A7FA 3KPUA 2Q7OE 1KYVA 1MFZA 2BUCA 2DUJA 4CNBA 2JD1A 4QT0A 4ZODA 1O2DA 1H4QA 3EARA 2R6HA 3TOCA 1CE8B 3B6KA 1K3FA 3FMPB 1TJ3A 2ISQA 1M5UA 3BTOA 4P7FA 2F8MA 1L5MA 4EKGA 3CRW1 4FFSA 3H7IA 1NNEA 5DX0A 3PIIA 3L77A 3J7TA 1W4BA 2XRFA 3W8RA 3OY2A 1YIDA 3KALA 3IP6A 3LHIA 3B53X 4FLMA 2H4JA 1LNQA 1WUIS 3T5DA 2J3JA 3TGWA 1KAQA 3DLHA 3BB3A 3HBNA 3C41J 5E4FA 1HI9A 1I1NA 1ZUNB 2VYCA 4MS4A 5DP2A 2YYSA 4DKXA 1ZEMA 1DRJA 2ZJBA 1YB4A 2UYCA 2PGLA 4UUOA 5HR5A 3DZFA 1HFJA 1KVSA 4Z3DA 4J9VA 4Q3AA 1MOQA 3K5WA 2BRUC 4DIMA 3ROMA 2PD6A 5M5BA 5IVKA 3INYA 3BMOA 3LTNC 4EI9A 4P7GA 1I7QB 3VV2A 1M0SA 4U6NA 1E9SA 2ET6A 1Q7CA 1VSVA 3IUNA 2LGJA 5DGXA 4O59O 3FFBA 5FB3A 1M34B 3O3OB 3OT4A 4B81A 3UAVA 1O4VA 1PT9A 2HUPA 4OBXA 1XE3A 4F9TA 1HPLA 2G80A 3FRIA 5HSGA 1TA4A 2IPXA 3B89A 1VG8A 4BNYA 2NNWB 2R3SA 1OU0A 5A4FS 4FKMA 4OH7A 3S4YA 4R2XA 2TYSB 3R5KA 4LTNA 2RH8A 1IN7A 3JQBC 1C8LA 5C32A 2JI6A 3P9XA 4A0RA 3IAUA 5IDQA 1PJCA 4GQBA 3PTLA 1IJKA 2HSGA 5KYUB 5H82A 2FFQA 5HFNA 2XMPA 3QWFA 4E5PA 3ZKAA 5J1SB 1JR6A 1KR2A 1XQWA 3OIVA 3C6BA 4EA6A 1PEKE 1M7GA 1JHDA 2JHCA 4AQ7A 3HY3A 2AZDA 1ZJYA 4RIFA 4IIJB 3EGDA 4CL3A 3T15A 5CDUA 4D3SA 2FG7C 1NUSA 3WAJA 5KX5F 4E5VA 1BE1A 1I2MA 2GFHA 1MH9A 1GVNB 4KMSA 4Y2GA 4KQIA 3U60B 2VZ0A 4G07A 4QOGA 3QKRB 4E13A 2ZUEA 5SYMA 4EJ6A 4TOIA 3K2BA 1QCYA 5A3VA 1U2GC 1XD2A 1GZ3A 2AFHA 4U7WA 3B51X 4HQRA 2HM7A 2ZRAA 3AJAA 1EAMA 3DXYA 3QKTA 3H65A 4I55B 1PZFA 4IFIA 2J9YB 1YJAA 4TMTA 1AOXA 3FMIA 3Q11A 5DLPA 2I55A 4DARA 2MSDB 2JA1A 3IAHA 1UFOA 2P91A 1PG0A 1JG3A 1TIBA 1E1MA 2A2ZA 2OCDA 4G4IA 2VSFA 5C34B 4LVCA 4JLPA 3E3LA 3JQGB 1LZLA 3ZN2A 1FYDA 1U0BB 4L16A 1M8PA 3NOQA 5IN5A 1KAOA 2OD9A 3PF9A 5F7OA 3LDHA 1JLLA 3CEHA 1CUYA 5JJLA 4DV1B 3QYFA 2BR3A 3MWEA 2G5GX 3OESA 5AXAA 3K0AA 1DBPA 4CKWB 4CT5A 5JU6A 1W52X 4GE3A 1MT3A 4O4LA 4D4JA 5ENDA 4UHKA 4XYEA 3NKFA 4HYEA 1BDMA 2XPCA 1KAEA 1W5TA 3EZ7A 2J59A 2J7KA 3UB3A 3SZLA 2WAMA 4LF7B 3PICA 3NONA 3H5AA 3ZD8A 2OFOA 5EIHA 2WILA 2R7LA 5J40A 3DBLB 2XDYA 3LC2O 3RSQA 2QLTA 1E4YA 4N8SA 2XTMA 1PFUA 3ME5A 5FWYB 1JKIA 1OAAA 5EIEA 2H5IA 3AF2A 2NZYA 1CZUA 1UEJA 3B1FA 2FZWA 2CLLB 3IMGA 4JXJA 4PCUA 1ORTA 4BVGA 5JMOA 4LRSB 2KSQA 3W5JA 3G9UA 1LD3A 1VL8A 4ZOEA 4Y2RA 1MGPA 3R3YA 3ZCTA 5LWQA 4PWZA 2BUAA 1QH1B 3OQ6A 2FRDC 5HDQA 2EVWX 3L7CA 4L3VA 3IQGX 2JLQA 1QYWA 3IOEA 4UBJA 3OC0A 2BFWA 3F6SA 4AY6A 3QNUA 1MHPA 3OZDA 4DR4B 3F1KA 4EQ6B 3R20A 4ZGBA 2AHOA 1I3OA 3A1UA 2F1OA 4PPFA 3D8TA 3RM3A 3ZWDA 1K8QA 2RBKA 4C7BA 5CDTA 4RS3A 1PJSA 1YULA 3P9QA 2F90A 4LY3A 2PWPA 3QKUA 4NMMA 4PTYA 4D4GA 3ONFA 1PJ4A 4H3KB 1C1XB 1CS4C 1IEVA 1U11A 2A5LA 2IYPA 3Q4GA 4XOIA 4AAYA 3CRNA 1IPFA 4L78A 4TKVA 5LQRA 1W48A 1KQOA 1SC3A 4IXNA 4N7BA 1REQA 3A36A 3K1JA 1JT2A 1RYYA 3QY0A 2J0UA 2FZ5A 2GYWA 4C78A 2JBAB 2RHDA 4R31A 3TXAA 4BWYA 4DRYA 4ZMBA 1ZGJA 2YC2C 2FPMA 4ES6A 4MQFB 5JJBA 4KIGA 2R8EA 2ZFUA 4P36A 3VH2A 2H00A 1ZBQA 3N2KA 2OY0A 3QUSA 1YS1X 4XDZA 4Z3KA 4BNUA 2HA7A 4D9JA 4PE5B 1YIAA 1B0ZA 1PJ3A 4RA9B 1L0BA 3NANA 2O8DA 4PR0A 3JR3A 2QD3A 2P2SA 3OFND 1QDEA 4IHKA 1XNQB 5LZ7A 3P71T 4D44A 1CK4A 1KR5A 1RXSA 5CH8A 4NCIA 3OTGA 3QP9A 1NN5A 4HNVA 1XCGB 3NDIA 4TMWA 2J87A 2HU7A 4RJIA 3PGVA 1FTSA 4B7UA 2OPBA 1VKHA 4YNBA 2OGWA 5JRZA 1X87A 2EZUA 3T3MB 3DZHA 4G5QA 3EW7A 3IHKA 3N0WA 5IXSA 4YGYA 5ESDA 1UBFA 2RJOA 4L02A 1UJMA 5CX4A 2V7BA 2WFLB 4BZXA 4CM8A 4DYHA 3L4JA 3ICEA 3OI7A 1GPJA 1QX3A 1XRQA 2PVPA 1SCBA 2V6GA 3E81A 2HOQA 3H42B 3L8CA 5JAUA 5BXYA 4G8BA 1QDUA 2WBLC 1MO2A 1IVNA 5J58A 4LNAA 2TMDA 5U1PA 3GPCA 4GGPA 2BEVB 3U7GA 3WS7A 4LZZA 2B7CA 2BFMA 4OXNA 1FFXB 1JYEA 4OHBA 3Q5EA 4DDTA 3SR0A 3KEQA 4Q1DA 3PLNA 2JGFA 3C1UA 5LA6A 4FYJA 1RS0A 2IELA 4NMWA 1GQQA 3WLQA 2GO7A 4J3JA 1WZNA 1V5IA 1Z34A 3C3BA 3HCAA 4LXTA 4TYQA 4X63A 1EUZA 2C61A 3HJBA 3LOQA 4KQXA 2ENWA 2IEDA 3R7SA 1MLDA 2JGMA 5AHKA 1N8TA 1P2FA 3ZV5A 2AA3A 1FLAA 2O2GA 2LBPA 2UUBB 5CK4A 1FL9A 4GVPA 4C5AA 3EUWA 1VBFA 4C0HA 4YAGA 5CUQA 2NUTB 4CKXA 1B0UA 1V1JA 2VUIB 3NETA 4ZV7A 5CA0A 3DZBA 4RE5A 3KQLA 3M9WA 3VNBA 1ZMBA 4BGEA 1WO8A 2OBLA 3HFSA 3LF1A 1Z2OX 2C3OA 2RC5A 5WRFA 3ZJYA 4YK7A 1DAOA 2WB4A 2JH8A 5AP9A 5J2TA 2I22A 3QX9A 3RWMB 3D3QA 3D8SA 1OWMA 2PX0A 1ODJA 1QG0A 4YPVA 1EH5A 3WRXA 1Q17A 2GH1A 3SY8A 2DBQA 3TW6A 1J99A 4IDGA 4HGPA 1LDNA 4IFEA 1WDLA 4O2RA 3RSHA 4JIGA 3UHFA 1E5XA 4FJ2A 3K1AB 1WSDA 4R2IA 2VIIA 1V1RB 2Q5LA 3MTDA 4IDBA 1JSRA 4RQAA 3V4SA 2HMWA 2UUOA 4F1KA 1OGYA 3KSAC 4N6NA 4IHJA 2RHWA 5EQFA 3P9KA 4Q1AA 5AKYA 3QYJA 3U3OA 5BSGA 4QOHA 3UAGA 5KNBH 1U6JA 5C8DA 5DGTA 5A9TA 2D4AA 4A0QA 2HRBA 3RTEA 2QY6A 5HKLA 1PDOA 1A9ZA 1XDDA 4CR8A 1XQ1A 1I7DA 3ISVA 3LWBA 1FDOA 3OJXA 4M1WA 1KKLA 2VF2A 3WDLA 5KNCA 3L06A 1QE3A 4ML3A 1RJDA 3G0OA 3E05A 2QN6A 4KWIA 4EDHA 5L3SB 4RVHA 2BFNA 1F2UB 1RJEA 1SZCA 3A3OA 2AB0A 3PV0A 4R1LA 5IUKC 4D4HA 4D5GA 5JNTA 3AIKA 4N39A 4ER3A 3KYDA 3BSWA 1MB9A 2ACEA 3K0KA 3TLBA 1O94D 1T9GR 5DT2A 1SG9A 1P3DA 5A4JA 1GTZA 2AWOA 2IH5A 4HUTA 3NR2A 3CRZA 2Q5CA 4GYWA 1XIVA 2ADMA 4TMVA 5DCYA 3KKLA 4KREA 1XZEA 3G0BA 1XTJA 1ZJ5A 1YR1A 5KCMA 1TVKA 3EGWA 2JVKA 2AKAB 1JVSA 1CP2A 3H9UA 4IDOA 2I6FA 1ZL0A 2P77A 5BPHA 4MUBA 2X8JB 4EPTA 4MWCA 1OX4B 4B3TB 3QFTA 3RRBA 3ZR4B 1Q3KA 1A88A 2EJBA 2VRCA 4DVJA 1IJEA 1KO8A 2FWIA 4CODB 1XQYA 5CB4F 4UJ5A 3SSOA 1L5FA 4UFNA 3BAZA 2H1OA 2A33A 2NYRA 2Z2XA 5EKUA 2QTLA 3QBTA 4EW2A 3I1FA 4F2WA 3K9NA 1VHWA 1FYVA 1YQ9A 1FUIA 3DOOA 3IUBA 3T5AA 1NXVA 1XZNA 2OD7A 3DUFA 4IRUB 4LI0A 2IKQA 4AJ2A 4IYRA 4P4TA 3WXMA 5KNDD 2WWVD 3DMGA 1IWOA 4OM7A 4IJ5A 4P31A 4IEEA 5CMLA 5FUWA 2PX3A 5TV2A 1USKA 3PNMA 1FA9A 2H85A 3RC2A 3V7YA 3NXKA 3K20A 2ZB8A 4J7CA 1F7VA 3ETHA 1TB4A 1G8AA 1B41A 2HK7A 3GH1A 1H65A 3MAJA 3RSCA 4OVKA 1WZEA 2NO1A 2R6AA 1GKIA 5D5QA 4U39A 5KSOA 1KOFA 5TGTA 2POQX 2XRZA 4IMPA 4Q7JB 4TT3A 4P38A 1J8QA 3DL7A 2C78A 5IUJC 4DHWA 5CAEA 4KV9A 4QAQA 3AY7A 3DD1A 3DC2A 2Z2IA 3LLCA 4HF7A 2REOA 3RWBA 5CFLA 1OIVA 3A25A 3T52A 4FDTA 3ONWA 2R1VB 4ZVUA 4C22A 5KNBA 5AVYA 4ZTUB 2LWIA 3WIBA 1OVMA 4AZTA 1QLHA 4POAA 3OLCX 4FGKA 1GP2A 1RCUA 2WIBA 3WQQA 1VLHA 2OB1A 4YP0A 1SM4A 4Y2HA 3DTVA 4WLFA 1ORWA 1T9KA 2WZDA 3IO3A 4G41A 3DV0B 4WOKA 3IQEA 2D5BA 3STWA 3H5NA 8ATCA 5CYOA 1N0WA 3SC2A 5HQTA 1XNHA 2PK3A 3FLAA 1RQPA 1G3IA 1V5FA 3I5XA 5L3QB 3PGKA 4YRIA 3C7TA 3K0SA 1JHPA 1Z4KA 4RKRA 5JAPA 2QZPA 5BQ5A 1MBZA 1XXHA 4OQZA 3J81k 4EYEA 4BP3A 3UG7A 3GEGA 4YRTA 1D2HA 2WI8A 5CDFE 3F67A 5BSUA 1DAMA 3MWKA 4Z4FA 4JXZA 1PK9A 3FZGA 4KODA 4O1MA 2MU1A 5HW0A 4YMIA 3CLRD 4C0AC 4L9SA 5TMPA 5C52B 4P92A 4DYVA 1TKAA 1DO0A 4S04A 4BIIA 2R85A 4R0VA 2H4XA 4NWIA 2X0JA 2ZAMA 3MTJA 5FWDA 3FWYA 4UU7A 4H7DA 3RANA 4D74A 3ZI4A 4BMPB 2GCGA 4RGYA 1RR6A 2O7QA 3MMZA 3UV6A 4DV0B 3WIUA 1R4AA 3K94A 2C4WA 4QLBA 3ND6A 1YOVB 2CCKA 4HDRA 4EI2A 1GGFA 2ATEA 4QVKA 5DSTA 3T7KA 4OI0A 1DVRA 2LCIA 2JAUA 2HX1A 5HZKA 1SC4A 4O4JF 2FPPB 4O4IB 2COEA 5D00A 3ZVNA 1W4LA 3BF8A 2BZ0A 4MA0A 4WNAB 2ZTMA 2V74B 2O2DA 3BKWA 3QF7A 3HHPA 4OJMX 2QVYX 1F12A 5C1PA 5HRCA 1IOWA 1GA4A 1FMTA 3R3SA 3OUUA 2JIZD 2FQYA 4GPAA 2IE8A 5K3SA 1EFVB 1UPBA 2XCLA 3H2GA 4R41A 1SXJE 4TKMA 1H0KA 1K5PA 1X1EA 3D6MA 2V98A 3NBYC 3I2IA 4U9IS 1W581 1A4UA 2EP7A 2PPVA 3GAZA 3K6RA 3CX3A 3NXSA 3VR6H 1JI0A 3DHEA 2PZAA 1QE5A 3E9QA 4RLFA 4ZU1X 2WHPB 2OXCA 1B26A 4JP3A 3EC7A 4ND8B 4Q9AA 2VDVE 5K3OA 3AHFA 2HU2A 1DIHA 2AN3A 5DZSA 2Y1CA 3DO5A 3PHLA 1D0VA 3CLTC 3KJQA 1C30A 4BEVA 3LS2A 1BCRB 2ZSFA 4OMUA 3GLFA 1L8OA 1SZJG 2D0DA 3BA6A 4OYHA 4P3PA 1UJ5A 1C7IA 2RGNC 1BS2A 2KS6A 5HFAA 3SJZA 1JQDA 2PUJA 4EYGA 1P6QA 3ZHCA 3H5RA 4HNAA 4PO8A 4DPKA 3WHPA 3EVFA 3MW8A 1W5FA 3F8WA 1LW7A 4GF5A 2F43A 4LKOA 3FPKA 1DC4A 3S2GA 4MJXA 2AYYA 2Q50A 1T0HB 4ZT2A 2OILA 1NDQA 3CPSA 4BNMA 1GKUB 3IQIX 3MFQA 2IYFA 3MG9A 3PDJA 2CV0A 2BGJA 3HDHA 1OB5A 3R6GA 5C1DA 1UMCA 3LDGA 4RDHA 4U8HA 1Z47A 1X8LA 2WF7A 4CM3A 2C00A 2ERXA 1CW2B 3JALA 4IJ6A 1OH8A 3SN6A 1HFKA 4Y2YA 5DK6A 3RFFA 2NYAA 2RHMA 3TQIA 2EGUA 2GD2A 1CR4A 1E4OA 4BKMA 4GI2A 4EZBA 2ZYHA 4L74A 4XPZA 2IYSA 5IM5A 4J16A 3RVLA 4FGLA 1X3LA 3ETNA 4EW1A 4OHYA 3FA2A 2BI4A 3SYMA 2YFYA 5F9FA 4GPIB 4HQFA 4MITA 2VOJA 3KJGA 3O38A 4X84A 1XZBA 4OGGA 2PMFA 4EG0A 1JQAA 1NLMA 2FHSA 3MGAA 3H11A 1F2TA 2C1EA 3H2HA 5DGHA 3KQWA 5B1IA 5H8WA 4MKRA 5EE5B 3UOWA 1K68A 5FJIA 4JDPA 3RRNA 2XKBA 1SRRA 4BEWA 4GIBA 3QYAA 4QBIA 1UKYA 4D2IA 2DLCX 1LI4A 5MF6A 2PFKA 3H5WA 1BVHA 3F0TA 1HYQA 1GCIA 1H5NA 4XLTA 3RBZA 2AJ8A 4GC9A 1HE2A 1J2RA 5JCOC 3RQSA 1NOKA 4AQDA 1EWTA 3L6CA 4YMVA 3AUSA 3FCXA 1G20E 2VOEA 1KI2A 3M34A 2H2WA 1KP3A 4LXYA 3VR6A 2I7XA 3JAKB 1AKTA 2JFNA 3HFRA 1E5TA 1QGUA 2FQ1A 3LAWA 1VBNA 2Y68A 3S1AB 4DRXB 4LWOA 4EY3A 4UNQA 2QYHA 2JI7A 2WM9B 1SBQA 2JGAA 4RKQA 4NZNA 4MRPA 4YUWA 1ILEA 4ZAWA 3WA6A 1XCJA 1G4UR 5DSXA 3Q8MA 3SX4A 3DKIA 1M5TA 2IWHA 4EVSA 2EG9A 4CCYA 4QUDA 3FYTA 1CNMA 2WF5A 3ZTYA 2WG2A 1RQLA 2GPNA 1H23A 5ICCA 3IP1A 4P0PB 2VQDA 2X3UA 1MO3A 2XGSA 4WK0B 1M1UA 5BW6B 4XQ0A 1SXPA 4DZZA 4AN1A 1S7CA 2EBUA 4Y6OA 1K8YB 8LDHA 1PT5A 1I4OA 2ZIUB 4RGBA 4S1NA 4MQEB 4ZZ3A 2HQ1A 1JN0A 1I6WA 3TKYA 1THTA 5DTQA 1WHSB 4BVAA 2QAGB 1J0CA 3QZUA 4CM9D 5KTKA 3BGIA 5IAKA 3ICWA 1L1EA 5HCUA 1MB3A 3QKSB 4BV9A 4BS9A 1K97A 4PR3A 3WADA 1S8AA 5ERGB 4JCOA 4I8XA 1P61B 3E1KA 4NAHA 1PDWA 3A9RA 4O4LF 5H02A 4CIYA 1SUEA 1W2HA 2HJ9A 5AW0A 2HY7A 3PWSA 1M6VB 3OCCA 4X6XA 1QP7A 2EQAA 3KCQA 4KO4S 4AS1A 4QUEA 1Q0PA 2CMHA 2GVNA 3OCUA 4MPDA 5ITVA 3O7WA 1T3LA 3OEWA 1KYXA 3L6BA 4YWHA 3QLJA 4LRYA 1P0IA 4OXXA 4CKEB 4ZTZB 1FJGB 1NBIA 3AY0A 5L3RA 1XVIA 1NFRA 4G0OA 2ODTX 2IXBA 3NBKA 5DE3A 3AEKA 5AOAA 3W2IA 5KYWB 4ZYXA 1VBKA 5GJCA 4AJLA 1Z08A 1L5HA 3SSNA 3V7UA 4X00A 2A9JA 1L8AA 3D7MA 3FSGA 5GTDA 3GZ4A 1H2RS 4A8JC 3BCHA 4OP2A 1MP0A 4PNHA 4B2IA 3A1VA 1ZGZA 2XAAA 3CZQA 4P9NA 1PR5A 2DFNA 4WNYA 1JH9A 2HZ7A 1A8QA 2YXBA 1SU6A 3DR5A 3MJFA 4YUZA 5BWBA 5I7RA 1G16A 3EA0A 1VRCA 1R0CA 2YX1A 1RHUA 3DFZA 2O50A 2QSZA 2WYVA 3ESBA 3OJFA 1NI4B 4Q1BA 2HU8A 1ODCA 2P0AA 4QTXA 4F7WA 2R1TA 5KZMB 2ICAA 3UTDA 2UXDB 3GUHA 3VBEA 1U9JA 4XLLA 2O8CB 1J49A 2IHJA 1OXUA 1SVLA 3T1HB 2WDZA 1C7RA 1XALA 1I5RA 2HCFA 3BG5A 2XNDD 3FY4A 4FBLA 4N5LA 2I0FA 3R5XA 5KSWB 2JIQA 3AVQA 2W11A 1AGYA 3KYJB 5K0BA 3NG1A 4W5TA 1XRMA 4C6TA 4XFKA 2BYTA 1NNSA 1FK8A 2X9GA 1BAPA 1KI8A 2O3QA 2ZRKA 2VJCA 1Q77A 1E61A 2V8OA 2COKA 3QFSA 4I6EA 2AMVA 4MO9A 4D8TA 1T29A 2Z4TA 3GFQA 3FPCA 2WAAA 3T7IA 4EMSA 1ZVQA 2ZUWA 3WLEA 4KITB 2VNJA 3ZZTA 5AVXA 2IVFA 5J4VA 5K45A 4MCAA 1OH7A 3W8FA 4Q24A 1K0FA 1RMYA 3N2EA 5AHXA 1EFAA 3LL7A 2IT1A 1FTQA 5HF6A 2J5XA 4BFXA 3U5TA 2Y1OA 5DW3A 3C3PA 5CVUA 5DO9A 4YXWA 1M6WA 3VO8A 5TQ0A 2XBLA 1LDBA 3B7GA 4GBGA 3G2IA 4Z99A 5C7OO 5ELXA 3EIOA 1QPGA 2ZJ6A 1CEEA 2PLFA 4I6GA 3O8QA 3KLMX 1XCBA 1L7OA 5ER9A 5J4LA 4GPTA 4OLHA 4ZQCB 1FW8A 1Q0HA 1TPYA 2VPXA 5GM2A 4E6EA 4ERNA 5ICGA 2YZ2A 3WYCA 4MICA 5LQNA 3DMHA 1CE8A 1NVMB 5KEIA 2BIFA 2ZS7A 3FW1A 5CT6A 1P17A 3NW9A 2H9AA 2Q2QA 1WDMA 1A5BB 2B21A 2WVAA 2XCUA 3NBQA 1K2WA 3OIYA 4U2BA 5LOVB 1W35A 4B8YA 1O89A 2PRIA 2OOKA 1A8PA 3D2LA 3QX8A 4FKZA 2AFVA 4A2PA 2B8JA 3WYGA 5LA6F 1LQUA 2Z8YA 3HUFA 5ER6A 4BXOB 3AF0A 3HBJA 4UQLA 1JG1A 4JBNA 2QB5A 3LRXA 3DZJA 5EMHA 3LHFA 2QRPA 5FT9A 5M3BA 4YXFA 1MXHA 5K0ZA 4G8DA 1CZRA 4ZEVA 1FZTA 4F7DA 3NASA 1E96A 1N1DA 3DDCA 5GWXA 1ZUNA 3UMCA 1RPNA 2CNLA 2F3SA 1K7YA 3NC1C 4HWTA 5H1YA 3RUCA 4L8YA 2XRMA 2TMYA 3OE7A 1BRTA 1C2TA 2CZGA 4ETIA 3S1SA 1TIKA 4YI5A 3U3ZA 4Y1RB 1ZNZA 1UBLS 2H5EA 5FYDA 3ZDDA 3PR1A 5EFOA 3FNQA 5KHOC 4J0FA 1NTOA 2XZOA 4R69A 2QMOA 2QIPA 1CY2A 2NW6A 2PSDA 2H18A 4MTLA 1V6CA 2H4ZA 1OUMA 3KVNA 4G85A 1OF1A 2QVZX 3MERA 5EJGA 2XUHA 1YTLA 4DCCA 2JAQA 4JYCA 1XRPA 1J9ZA 5D1NA 1KRXA 1IUNA 1CCWA 3EQ6A 4Q12A 2YW2A 4YASA 1XN1A 4D42A 3F97A 4X7MA 3EIFA 3HR8A 1TU0A 5REQB 4DNXA 4N0PA 3EMKA 2ZIXA 4IHJF 3CX7A 3I9OA 1GN9A 1A1SA 3Q7EA 5K3AA 2PGDA 1HOXA 4H7KA 2YMMA 3MAGA 4HFJA 2HMTA 1UPFA 1EHYA 3VHRA 4D0GA 2R97A 1OIXA 4HMQA 2P3QA 2PD4A 1M7HA 1BCSA 1TF2A 2QTWB 2RONA 4FMCB 3SX0A 1RYDA 3TSAA 3DVLA 3BIXA 2H1IA 1W87A 4YP1A 1QOQB 4PZAA 1KKMA 4IDPA 3FR8A 2W2KB 3H9EO 2V0CA 1QS0B 3HUDA 4R6WA 4IIJA 3S0JA 4A6EA 3NYIA 5E0OA 1SWWA 2XUOA 3T3OA 3IDAA 4RKEA 1CR6A 5FLYA 1XZFA 4WBNB 5EIXA 3IXLA 4G1BA 3N1UA 2W2MA 3TRDA 5F23A 2JFUA 2ZT5A 2YBDA 4YQYA 1MOZA 2F1HA 3E27A 3ENQA 5C8VA 1HOTA 4JBGA 1J2JA 1TOAA 4CMJA 5KYGA 1HKUA 4I55A 4BO7A 3UK1A 3F6PA 1R66A 4NCNA 4AF7A 3HA5A 1LK5A 2Q2NA 4XGIA 5I47A 1NC1A 2XQGA 2ZSIA 3G8BA 4J6EA 4TM8A 2QQEA 3ZDZB 4ATNA 5IRCD 1YQDA 5TE9A 3TO5A 1O08A 2FP4B 4QDTA 4JCCA 3OFVA 3ZE2B 1KC3A 1OVGA 2H29A 3LPDA 3VU0A 5JXGA 1WSBA 1ZVJA 4RVFA 1SXJD 1NJ5A 3JQGA 4QOJA 4BQNA 1KIMA 1X7XA 2CJFA 1NVTA 3CZMA 4HGQA 2QTBA 3MCAA 1PUIA 1ESCA 4R1TA 4ND5A 4JI2B 1JQ3A 4F8JA 3KVYA 2FSSA 2WIFA 4UUPA 3E03A 3QUCA 3U61B 4CKWA 2W2OA 3GPLA 4N65A 4R0NA 4QVGA 1RWQA 1FFSA 3IT1A 4QGBA 4IXTA 2VZ9A 1SOWA 5DWQA 4AJPA 1QVAA 3REGA 3PL1A 1XELA 5JYBA 5TY0A 2J6HA 2J32A 4XASA 2QJFA 2VXCA 5TNXA 1F17A 3CN9A 4OQMA 3ZLTA 2XCOA 4JNCA 3S7ZA 4M7WA 3GHYA 2XB8A 5CW2A 4CF7A 1TK9A 2WJYA 4OXYA 4MV3A 4QPDA 4OKSA 5DI3A 4B76A 3DBLA 4C3VA 1T4MA 3QXGA 1BWSA 2FEKA 4OLAA 4KQFA 2QLBA 3GLKA 3SC3A 4PTLA 2QTFA 5FWYA 5LNK6 3A9SA 3FYDA 3KYBA 3ED5A 3GX1A 3H9QA 1D9ZA 4V0KA 4G86A 4XI9A 1VSBA 1W46A 4KK3A 3R9WA 2WSYB 2IIBA 4BCCA 5JR3A 2GNAA 3F96A 5ALIA 4ILEA 5F3DA 2EIHA 4DEYA 1W75A 3KWLA 4YS6A 2HJVA 2AMJA 1J7KA 5K8VA 1TYBE 1PD1A 2CL7X 1I2AA 2FPKA 2GWHA 1CD5A 2NAFA 4R6XA 4MO2A 4EQ6A 4K86A 2MJLA 1GG9A 1PR9A 3I01M 4UVGA 3IVMA 3VYTB 1WF6A 4J7UA 1E58A 3K16A 3OU2A 4L0QA 3VR2D 3LT0A 5EJ4A 4B75A 1UWKA 2QU7A 3TEJA 4HDNB 1HT0A 1UBJS 2GZAA 1C1XA 2Z57A 4M2LA 3T7RA 4EYQA 4LY0A 2PQ6A 2BDEA 4L8WB 3LX5A 4UXIA 2WKRA 1OAOA 3T1QA 1P0QA 3UWSA 5KYTA 5BVHB 2OFXA 4Z4IA 1W1WA 2P1RA 3F9CA 1ZJ6A 4OHUA 2WWWA 4I9NA 4QHTA 3VPCA 3OOYA 4KXUA 4CLDA 4BB6A 4JI7B 4MQFA 2B4YA 2QT9A 1RYZA 3ITDA 2BY4A 5LQDA 1XTUA 2W2PA 2GKGA 5K4AA 1NULA 4K6GA 1GN8A 1II0A 4AZ3B 3M5PA 2ZANA 5FTNA 3A3NA 1MVLA 4RA9A 5LXTB 3TVDA 1PN3A 2RGYA 1QTIA 2W6ZA 3KOYA 2YXPX 3NGMA 4WDQA 4PN3A 1VMEA 5JIBA 1XSEA 4WACA 1R0KA 2YWFA 2BGIA 2R25B 4R8VA 3SYRA 2G5CA 5DNCA 1F1BA 2PZKA 1XCPA 2Z8XA 3I1JA 4P33A 4RPLA 2JGNA 2ZI6A 4X93A 2BGNA 1JUDA 3H9JA 5E3HA 1ISGA 4EF5A 4F21A 1CY8A 2ETXA 3TL2A 3DE0X 3KPJA 4WKPA 4BQIA 1GFIA 3OEED 2WMYA 4HYQA 5G0TA 1U3UA 3AR8A 3P8ZA 2B5VA 4XKJA 3RYFB 1Y48E 5LQAA 2OQVA 3FTEA 3M1YA 2DHQA 4FFNA 4FYIA 4KFSA 2NO4A 1S5PA 2D2FA 4NY1A 4QO8A 3SHVA 2XNJA 3H4VA 3G2KA 4B43A 4HB3A 3TL6A 1C0IA 4IVPA 1GA1A 3IULA 5G1OA 1YAJA 1RRFA 2J7PA 4LDZA 1SA0B 2BEVA 4P35A 1GZSA 1P5FA 4LDNA 1FFXA 4YDSA 1CUSA 4BHTA 1AN9A 4CTJA 2ATVA 3X1JA 3GYBA 3BZBA 4KR9A 3E9ZA 3WK4A 4INPA 1GG8A 1Z4QA 1JAYA 1NBHA 2AT1A 4CNQA 4V0MA 4XGRA 4EF6A 3PVCA 4MV8A 3D7SA 4LC1A 2G88A 4AVYA 5E1DA 3RGWS 1YFLA 3FDFA 3VR4A 3PNBA 1QIJA 8AT1A 2XEXA 1RBMA 1PLKA 3IIMA 2JB9A 1XMOB 1YACA 1L5YA 2CT8A 2CBXA 2R7NA 2LP4Y 1GZDA 3ZJ5A 5I4BA 3O9MA 2BFCB 2NUTA 2EZTA 2YL2A 1T0IA 4WN9B 1ZA2A 2QNBA 2JASA 3UTCA 2A0YA 1VGVA 3AZQA 4AP9A 3THYB 3NVMB 4QQNA 2JI9A 3TAUA 3OJWA 1W4RA 4RKYA 4Y1GA 3QELB 5T3YA 4NV0A 2NPFA 3EH2A 5D8DA 1A5SB 4ZJPA 5B58C 1LBEA 1XZLA 3NHUA 6REQB 1F8YA 3SC6A 3DYBA 2H2GA 4EB3A 4OHWA 4JT9A 3C5HA 1NP7A 4PSKA 1HNNA 1TQHA 2OL4A 1VM6A 3K0BA 4X91A 4U2KA 4R40A 1FFWA 4FJ1A 4DBZA 1PZXA 4DNOA 4KBFA 2ZYIA 3TKAA 2CV1A 3AQ4A 4QE3A 1V1RA 1K4KA 4QBTA 1D2GA 2RK3A 1F5NA 2VS1A 1CU1A 1NY5A 1EVKA 1M34E 4WLOA 4JBLA 2CSXA 3JTEA 1S4MA 2HDHA 3GRYA 2AV6A 3KWMA 1J8MF 4DRZA 4ZPJA 1DOZA 4B6GA 3NTVA 2VC2B 5LC1A 4PG8A 3U19A 1OJLA 5DN6D 3CUYA 3PKIA 4GI3A 4CYMA 1YRHA 1VXOA 1E2QA 3DKVA 3F5QA 1R4NB 3M6XA 3OP1A 1IHOA 3PIDA 4TS9A 5EWJB 3SR4A 5L3SA 2RHRA 3DOIA 3K0EA 5JZOA 3AYXB 3PRHA 1BHO1 3DXZA 2O2XA 1F2UA 4OD0A 3TXYA 3A6EA 2GZ1A 5IHPA 5C1IA 1MRSA 4EGCB 4ZI3A 1YB5A 4W6QA 3N7UA 4UM8B 2PTHA 4C4PA 2HTFA 4K88A 3OQOA 1GU7A 5HK8A 5JC8A 3ELYA 3IUQA 4BQPA 4LF9B 4ZP1A 4TYMA 3GB9A 3I6MA 4JQYA 4P4GA 4YMLA 4IHAA 3L04A 3R0JA 3HCOA 3ASVA 4PYMA 5JO9A 3DE5X 1LBTA 2FPLA 5BO5A 4JUCA 4ETNA 1SB8A 2Z3ZA 3JWGA 2PYDA 1C4WA 4R8LA 3UFBA 4KSBA 3VI4B 2YHSA 1Z7WA 2X8JA 2YIMA 3E18A 1WCV1 1AXRA 1RRGA 4DV7B 5C9ZA 2DQ4A 2OZLB 2ZYUX 1CKEA 4HAVA 4CWAA 3ZV3A 4F5YA 4K3UA 4UCFA 4ZO4A 5CA1B 4OV6B 1XDSA 3COJA 1PTJA 4XGNA 3KSRA 1MH1A 2QAGC 4I2NA 4PHCA 2OA0A 3A9TA 4KUEA 5EP1A 2QK4A 1ZM9A 1WXIA 2UDPA 2V0NA 5HA5A 3H0CA 4NBVA 4C0KA 1RAHA 3HVHA 1M5RA 1EX6A 3JWEA 2WP0A 2BISA 1R6AA 4I4TF 5AVRA 1Z0AA 2NACA 4DANA 3SI7A 1QFZA 1CDZA 2EHJA 4ZVLA 4AJJA 5BQXA 2VCEA 3V4VB 3EGOA 1M2NA 2W0SA 3R24A 2W2LD 2YCBA 1ONOA 3GJRA 3QUBA 3L1IA 1JZSA 3V8VA 5HM8A 1F14A 3CVXA 2W6PA 5EIAA 1DC3A 3T7DA 2CL5A 4BO6A 2VL7A 3B1YA 5D87A 2ASEA 5J4KA 3CIOA 1TM5E 3ZBTA 3P2OA 1V48A 4HQ0A 1J06A 1YNSA 4JLUA 4PG4A 3SP1A 4MDEA 2E2WA 3V1NA 1J0BA 3JVUA 3LVFO 4TS3A 4G8JA 3TTXA 1NW3A 1NZDA 4M9CA 3CRVA 2N3ZA 3A6KA 3D6FA 4RDCA 4UARA 4ZEWA 3TLKA 1FRQA 5HIAA 3MHPA 4YRJA 2QM0A 5HPYB 2YMPA 2BSXA 4BMYA 2KWIA 2HYDA 3OVMA 1Y81A 1X15A 4NZMA 3VSBA 4UCXA 1XTSA 3KLPX 1KJQA 3CEMA 2Q9UA 5DCUA 5LD2B 5CDSA 2AL7A 3U2QA 3AI2A 1YASA 3L7IA 4Q7KA 2CXSA 1YTUA 1G9SA 2X2EA 3IE2A 5LMNB 1TA9A 2J3EA 2ZVDA 5TVGA 4UOQA 2GBFA 2R6DA 3DV0A 4NX2A 2BSQA 1XI2A 1V3UA 1V8ZA 1Y0BA 2X1VA 1KMHA 2XDQB 1IXKA 1I3NA 3DO8A 5THXA 1A3CA 3OM8A 4CKCB 1T4DA 5K3CA 1MA0A 4TRNA 3OZCA 5L3QA 3GVPA 1XMQB 3CV3A 4ITVA 1DI0A 1L5SA 3V4FA 4IGEA 5KTRA 2BBOA 1ZD2P 1ECJA 3GLSA 1V7PC 1LX7A 1PKEA 3PWTA 2ECQA 2BM9A 2JI8A 4M1TA 5L4LA 2AQKA 2F55A 2E7ZA 2L0XA 1JG6A 3MIZA 2V3CC 3CLSC 3GLHB 4YC7A 1KWKA 4ZD6A 3L41A 2ZTLA 5DNWA 2LDBA 4JGBA 3V42A 3JU3A 3PJFA 3AC0A 3N70A 3DAOA 4KXFB 3F6BX 4RXMA 4AKEA 1KQFA 1KEKA 4E21A 4KGXA 3WG9A 4JVNA 1X2EA 3ZHVA 5AM3A 4YHBA 1PZEA 2W8ZA 5DNEA 1DJOA 1L3BA 1BGVA 2YQ4A 3NEYA 4V0QA 2FMKA 1YOVA 1OBFO 4OYYA 5FPPA 5JC1A 3DNMA 5EJMA 1C14A 4QJ4A 3C3YA 2FPPA 4O4IA 4DAEA 4ZQGA 1RAGA 1YFJA 4WNAA 1CF9A 3QU5A 1DXQA 4HNQA 2FWNA 2PH5A 5EYPA 3IV9A 2W71A 3DMYA 4GP7A 4DDWA 2EFEB 3W2HA 4MPPA 1JEEA 3LCCA 1U1DA 3HB7A 1IOLA 3B2EA 3NIDB 3QLEA 4JBXA 2H1LA 4MH0R 3W06A 5CM8B 1ZSNA 1FRNA 5L45A 4OIFA 5B64A 2Q1XA 3QFHA 3TBHA 1OC4A 3WXBA 1XL0A 2QSUA 3QBJA 3TJRA 3IEUA 2WHPA 4M6WB 4U2FA 5TLSA 1G2PA 4IV0A 4WZAE 3R9KA 4G36A 3MGKA 4X1KB 1XZCA 1KBQA 5A7GA 3OQNA 3GG2A 3FWKA 1QIEA 2R00A 2CNWD 2OCYC 4X6UA 1E3SA 1ULUA 1B8VA 1P45A 2V6BA 3I9V1 1BCRA 1RBZA 4PFJA 1SU7A 4YRZA 1PGNA 1XFAA 1NRIA 1CERA 4X44A 2LE0A 4Z8YA 3M6VA 3PFHA 5B1HA 1EYZA 3V80A 3WLAA 2BBSA 3FOWA 1IBSA 1FDVA 3N3AC 1UXJA 2XSZD 2WR8A 2YFQA 5JANA 1GLGA 2Z8YM 1P9RA 2FUNB 3FZEA 1IMOA 1UBCA 1VJ5A 2D7JA 1Y37A 2FPRA 2YUTA 3D8BA 4WXEA 4NMLA 3ESAA 1T2UA 3I4LA 4GZLA 3O5AA 4OG2A 5LU8A 3AVXA 5E9JA 1UZMA 3UAOA 3L7LA 1ZIDA 3VMMA 2D0PB 3C3CA 5F35A 2DBYA 3GGDA 5KVAA 1UF9A 4QDOA 4IDHA 1UXHA 4H7IA 2J31A 1Z33A 4G23A 4XPIB 2VNHA 3QNWA 2JFOA 1SU4A 3S1LA 1Y1LA 4YR9A 3LCRA 4LAFA 1UJ6A 3GJ0A 1CYEA 2OFWA 4F06A 1F06A 3RSLA 2WKWA 4HAWA 1YWGO 4OHRA 4JI3B 1LF5A 1CIJA 1QCZA 2AK3A 4DDMA 3WYEA 4GX2A 3UWOA 4B5LA 3VXKA 4UTNA 3LVRE 4MUIA 1QC5B 2OV1A 4IJVA 3GGCA 2FW0A 3JRNA 4FB5A 5FOVA 2AEJA 5AR1A 3ICQB 1UQTA 3IUYA 5B2EA 3KVRA 4DJEC 2O1XA 2I6UA 4ZVMA 5CLLA 1E8NA 1GGHA 3GBSA 4F6LA 2FEXA 3HACA 1RFGE 4M1SA 3W5SA 2XV1A 5TF4A 3CKLA 3EA5A 2GRJA 2RHTA 4NK4A 1I1HA 4XOUA 3RQIA 3WRYC 4ZAVA 1GL3A 2BKLA 4XVHA 1RWPA 1G1AA 4FI3F 5GZ3A 1QGOA 2B82A 1KFEB 5FULA 1FY2A 2ZXEA 1N0IA 2CUNA 4PICA 2FJPA 5KOIA 4ZANA 4DXAA 1QK5A 2QUZA 3MYRA 4W9MC 4TZ6A 3WWYA 2IHKA 1AGNA 1D4AA 1XF9A 1KFBB 4NLLA 1B8OA 3I0ZA 5IHXA 2PX6A 4RO0A 1NW4A 5KYNA 3VQTA 3DXFA 4JOQA 3KU1A 4WJKB 2VAVA 2BI7A 1GEEA 5AJHA 5DPMA 5AOCA 3V9PA 3ZI7A 1MB2A 2AVDA 2DQYA 2RI0A 3JSXA 5B55A 3CWZA 1T3TA 1QZXA 1XT6A 1MRZA 3O1HB 5FD8A 4F4IA 3BTUA 5B7PA 5A3QA 1X7ZB 4G9GA 4DQXA 4MEJA 3C8DA 4L75A 4N3NA 3HCPA 4NULA 3WLIA 5IDYA 1P4JA 2AJDA 1W47A 2AJLI 3VZQA 3EGXB 4GWGA 4LBZA 2Q29A 3T0IA 4BNLA 1M6NA 4HSEA 4DQKA 4PVCA 3JV7A 1XZ8A 3VTAA 4RMGA 3TNLA 1GUZA 4REOA 1VKOA 2ZCUA 1G6OA 1PYGA 1TD1A 2YYZA 3N8NA 4OHKA 5EJ2A 4AMVA 5A1TA 5ARBA 2YWXA 4TV9F 1N2HA 1RT9A 1G19A 1N2SA 4IZHA 5EMKA 4MLZA 1SKYB 2HBZA 4A8PA 4W5QA 4X20B 3LY7A 4AMGA 2OXEA 4B45A 5KQGA 1KS9A 5IZCA 1AF7A 4MQEA 4N5IX 3C5WP 1Z5VA 1SHUX 1WHSA 4UASA 2W8BA 7GPBA 3ZD6A 4W7SA 1BXKA 3OHPA 2QLLA 2ZRDA 2JGDB 1KPHA 3OQPA 4KRYA 1GU1A 1RPAA 2CB0A 5CVEA 5F9MA 5BQ3A 3QKSA 2YNMA 1P6UA 2GPWA 1IHDA 1V6AA 3ZVKA 1AE1A 2X0DA 1ZINA 3HGMA 1NMQA 3RPEA 4U00A 3CEJA 3MMNA 2A0FA 3AHDA 2WYWA 1JDBB 3CJRA 1NG9A 4GKJB 5BMVB 1F20A 3G8CA 4JP5A 1S1MA 4K9QA 5C7IO 5JBNA 1ZRMA 4BKQA 4TTSA 1JIJA 4ER7A 5LIPA 3JZDA 1CXZA 3TNFA 1QYVA 3BRWA 4FE3A 3KZ1E 4P7KA 1VYTA 1YA4A 4R9UC 3ZU5A 1M8FA 1CQJB 4CKEA 3OZXA 2O57A 4LA4A 1AM4D 1AU9A 5KYWA 5HBGA 1JXAA 4R8KA 1MW8X 5GVRA 4Z53A 3CLTD 4CXMA 3L4EA 3OIDA 4NNJA 3OWHA 5B53A 4PLCA 1QGYA 3L3BA 2UVPB 5DVZA 1P6XA 3HLYA 3LQ4A 4IPTA 3COVA 3TRHA 5L6MB 1E0AA 1KFJB 2QQ0A 2WUVA 3EQ7A 1JBKA 4PSUA 3NOXA 5EN4A 2LCQA 1G63A 2C77A 4IIHA 2FOXA 1QHSA 1Y3CE 3CX4A 4XW2A 1GTMA 1PJ2A 1NI4A 1AX9A 4PSAA 4RTQA 1NUUA 4TVBA 3ZCPA 5BWLA 4CR7A 2NZ8A 2QJTA 4GRDA 2J0SA 3QOFA 4PXAA 4KE8A 3CLHA 2C4KA 4WXRA 2AR0A 3EIWA 4XJVA 1DCTA 4IIFA 3WGZA 3ER8A 1EXNA 1H93A 1E2BA 2BBWA 3ORSA 3Q7QA 3GT7A 1DIRA 4J94A 2HBYA 5EXDA 2VJNA 1RWXA 2XNCA 3IAEA 4D9IA 4MK4A 1H0SA 3U0VA 1FS4A 2IU3A 2A9QA 2X5KO 1MDBA 4YJ3A 4RD4A 3ZDQA 3U3JA 3DMTC 3JATA 4ZJZA 3W9BA 1ISIA 2PV7A 3C6ZA 3RD5A 3BVPA 1RE1A 4FPXA 4MVJP 4RCVA 5GIPE 1UZAA 5TQ2B 3N59A 2LW7A 1FDUA 2V03A 5EI5A 1H2FA 1SBNE 1SQGA 5AUOB 1WTAA 4NFHA 4LCBA 1U0NA 4RK1A 4CI0B 3QQPA 2YKGA 3ZQ4A 1G3UA 2OAGA 1DKMA 2ZWIA 5A06A 1ZJWA 4TYNA 1FP1D 2BR4A 1FSPA 5AOBA 1AA6A 3NAQA 1KSHA 4BE7B 1YIOA 2B7BA 2OECA 2P4UA 1Y4AE 5EWLB 3SGLA 3TM4A 3TNYA 2XOEA 1PSZA 3B9BA 3W04A 1V5EA 1B3BA 1XVAA 1DG9A 2VHQA 2F17A 1KJYA 1YS9A 3BZWA 3OOJA 1KERA 5DTJA 5BV7A 3QEBZ 4F8YA 4B4UA 1E79D 3D4OA 5FO0A 4C1BA 4CU2A 3ZE9A 5B6JA 1A69A 2ZJZA 2WIGA 3NC0C 2W2XA 4YT2A 3V46A 5BORA 2W9XA 3L49A 3PUYA 1MAVA 2ZR7A 4PSDA 4A1FA 4D1YA 5I9LA 1Q1BA 2PLAA 3L1HA 3DBHA 2P9CA 1NR5A 4FBMA 4Z2YA 5ALWA 4EY5A 5LOVA 2HF8A 4U4AA 4WFJA 4AO8A 4DCOA 1GLNA 1V8FA 2C31A 2SBTA 5CJ2A 5E4YA 1ZDMA 4BXOA 1IJFA 4W7HA 2LPMA 4J90A 1WEHA 2I80A 3DE6X 4YWJA 3AVVA 4KAJA 3RE1A 4FXPA 2QGZA 1ENZA 2DBVO 1SR8A 2FGKA 3L0IB 1YAHA 3QA9A 1E32A 2PXCA 2QV0A 3A9UA 3QMPA 4FHGA 4Y9RA 3T9AA 3RHFA 3T3PB 3ZWNA 5IYZB 2Z5GA 4DUYB 3LBNA 2HKIA 4QELA 1YI0A 4XB2A 4H59A 2EHDA 3BORA 1ZN9A 2JLRA 1HDGO 1NU6A 3GMSA 2CXHA 3OQ1A 4V0SA 3LBHA 4Y1RA 4ABTA 2PJRA 4ZEXA 2IXDA 3IHWA 3U4CA 2ORED 5DTEA 3X43A 1G8JA 2H1WA 3QF4B 4XUEA 5EZYB 1COWD 1DZIA 3I8XA 3IDZA 4WKOA 4BFLA 4PHFA 4B2LA 1L9KA 2HDNB 3L9WA 1WCIB 2HRQA 3H3FA 1US8B 3ZWCA 4YMWA 1W2GA 3ZEIA 5BQOA 2BGWA 1DX4A 3HP7A 4QYXA 2QXUA 3AFNA 1VFPA 4RK7A 1FNBA 3U37A 5REQA 3RFXA 121PA 3N2GA 2AG5A 3PKZA 2PS1A 4FS8A 5JJ5A 2CEAA 2GZHA 4COKA 5A02A 2FSVA 2J09A 2CXXA 1Q95A 2VHYA 1FYFA 3ZJUA 1NNUA 4YB8A 5TPZD 2ZB3A 4JUBA 4G5XA 4JGIA 3ZHYA 2ZP1A 4N76A 1R4MB 3ZU6A 1S01A 4QPPA 1UXIA 3QFFA 4OM8A 1A7JA 1NM5A 1RWWA 1Q16A 4N8DA 4GU5A 2V6MA 3ZVLA 1Y6GA 3QPAA 5FLEX 2WG1A 4KEAA 3PNYA 2X0FA 1AS0A 4X62B 2CSUA 1J42A 2G9NA 4WTOA 1D2MA 1ONSA 1A77A 3QK7A 2A57A 3IMFA 2HJGA 2JFXA 1SVIA 1PNTA 1WMEA 1ZM7A 3LP5A 1OD6A 3WGJA 1BO6A 1ZUIA 4XVQA 1H8HD 3BXEA 4P84A 4MI6A 1Z13A 3F8SA 4WBNA 1DJQA 1OZ0A 2QJRA 2AXNA 5EKTA 3V3TA 3OZGA 3EOAI 5JZ9A 2GEKA 1OX6A 1PWYE 2HA3A 2VP9A 3B48A 1WG8A 3RC3A 4YAFA 3FYUC 3GOHA 3WJ1A 4NYMQ 2JH9A 4DN6A 2ZCVA 1YRLA 2B78A 5L40A 1SUIA 4CV2A 4R5MA 4F1WA 2HJHA 5E6UB 4CN9A 1RXWA 2VYVD 1T5HX 2PKQP 3QEOA 1HLGA 1OXSC 2QTNA 3KHUA 3LX6A 4IWXA 3FUUA 3TSWA 3DFFA 2UZIR 3UUGA 1E9VA 5LQUA 3FJYA 3UATA 1TO2E 4OHVA 2FEAA 5DW0A 5FBKA 5FNVF 3VYRB 4DEXA 5LN1A 2QY9A 3E35A 4E7PA 2B3DA 2IBSA 3UH0A 3OWXA 1O6GA 3B6JA 4O4HB 4I8IA 4Y2SA 3UT6A 2QVXX 3JQAD 1W5BA 1FDTA 3LI2A 1MV5A 1UEXC 2OLJA 4HN4B 3AU8A 1M1NA 1YF3A 2WJPA 3TQRA 2JHGA 3IA2A 1GUDA 1Z0ZA 5IKEA 1PYDA 2XUKA 1VL0A 2JARA 1NOJA 2JS7A 3KG2A 3PC8C 1FU8A 2CFCA 2OYSA 2J9ZB 4KZKA 5AJXA 3IRVA 4Y2VA 3ZJTA 1Z63A 5E1BA 3VPDA 2O2JA 3RJZA 4MLCA 1JEAA 1E62A 1T15A 2X0KA 4U7HA 1MV8A 4GKVA 4H0CA 1E9CA 5ECGC 2JLCA 1VKNA 3AL3A 4CMCA 5LD2C 1R0LA 2Z6VA 4CQMA 1GA6A 3PTAA 3LA6A 2F67A 4ZVTA 1PFWA 3LXRA 3PXCX 1N5KA 3MT8A 4JHXA 2OBXA 3CUWA 3EMVA 1NVUQ 4JL6A 4QNNA 3U62A 4MI1A 4JQOA 4OHXA 3VGJA 3VR5D 4A7PA 4E5KA 5F52A 4DR6B 5DSZA 1OCEA 1Z0JA 5HJ2A 3RARA 5KJEA 5K1ZA 4JC5A 3LUFA 1ZL2A 4TTRA 1LLFA 3LC1O 2IWRA 2EJTA 4NJMB 3DBRA 4BAUA 3OTWA 2FWMX 3GDOA 3CRMA 5AIAA 3FPFA 4JB2A 4G4GA 2GOYA 1X1DA 3C16C 4RYLA 4J7AA 4DCUA 1NKTA 1V7QA 2ORYA 3O90A 4YEDA 3SM9A 1ZSYA 3ZHOA 1TFUA 1D0IA 2PA0A 4OHFA 4RIGA 2OVBA 5JXWA 1LRLA 3GLGB 4YT4A 1NY6A 4MZDA 1YB1A 2I6XA 3B8HA 3Q10A 2JJMA 3QG5A 2PG3A 2VBFA 4MCHA 4X1YA 3SIRA 5C5CA 4IMRA 1CIPA 1PQUA 4ZYYA 4UEKA 4UREA 3KQNA 2W22A 2YOHA 3H5IA 2Y1FA 5IEJA 2AD5A 3RIMA 1YZKA 3UUWA 3V9AA 1U2DC 5ECDA 3QEMB 4AZ3A 1GTVA 2BKAA 2FN8A 1GZ4A 2WJAA 1ODIA 4MUKA 2NXNA 5DASA 2QHXA 4EW3A 4LNHA 1X7HA 5LXTA 3UIEA 1ND5A 3O7MA 1PJ8A 3BE8A 3QGMA 4WERA 4BJ5A 3Q2KA 2ZBPA 4UW9A 1U0SY 2YMQA 4TTVA 5BN4B 1UOOA 1PZHA 4RH0A 2WU3A 4D25A 2WV7A 5SV2A 2CVPA 1T4BA 3DMDA 1C29B 2BFEB 3C3XA 1T2VA 5YASA 4JROA 1T1EA 1GM5A 3OZ7A 4N0MA 1GDHA 1TCUA 3UYLA 3QU2A 4D3FA 1YZNA 2YVUA 3IDOA 1FDRA 5E0KB 1T2NA 2NXCA 4LX0A 4MKHA 4U8GA 5CVCA 4BMVA 1XB2A 3ET5A 3RYFA 2B8EA 1Z62A 4Q01A 2JHPA 4YFVA 3TLEA 2J3MA 2QA5A 3PLAE 1EWQA 2Q99A 1R18A 3RSFA 3KXKA 3GLQA 3VNUA 1RTTA 3NIFB 1BGXT 3A6DA 4GSLA 5ALYA 3WWCA 4GLLA 1RYMA 3RYIB 5ITSA 5JNRA 3QRWA 4F3KA 4XSGA 1SA0A 1S1CA 4MJ7A 1FSSA 2V7VA 3C3WA 2PIAA 3DMPA 3EGCA 3RHZA 1JEYB 2JRCA 5HIIA 4IY1A 1JF8A 5DX1A 4DLLA 3FFWA 4F2GA 2XMSA 1XZGA 2VJKA 4W8OA 5KOHA 2XRYA 3BWDD 4L4UA 4R2HA 3UHOA 4EZIA 1PEYA 4G1FA 5B1YA 1YDFA 4QUGA 3M9LA 4TS1A 2B0JA 4ZAYA 5GM1A 1L3CA 3C6KA 2V6JA 3SZ3A 4IYJA 3ZY2A 1C7FA 2CUKA 1NVFA 3FTNA 2H11A 1YRYE 3Q7IA 2EEZA 4KTTE 5BSWA 2XNHA 1I2DA 3KZCA 1JAZA 2BFCA 1RLUA 3BXFA 3RT1A 2NPIA 4WN9A 3VYSB 4DQVA 1ECLA 3IVRA 4YAUA 3R9IA 5HGJA 4K8OA 3THYA 5JMPA 3RRFA 1SUFA 1PLLA 2FEPA 2XAUA 3F74A 3HDJA 4NZZA 4RTKA 3QELA 1ENYA 1U63A 2ZQYA 4LSZA 1TL7C 6REQA 3BJZA 2ODEA 1Z2NX 1CT9A 2BH9A 4I4LA 4D0NA 3W8NA 3M4JA 1HQKA 3BHNA 1QV9A 2PGIA 4DV2B 3NBMA 1L5OA 4HYYA 3ETCA 3NVAA 1HMYA 5H4GA 4D81A 1ZZGA 3MWFA 4MKFA 3ZY4A 4B74A 1K63A 2JKVA 1A72A 4B8WA 4LHXA 1YZQA 1ACJA 5AWFC 1T5IA 5K6RA 2AC4A 1X0XA 1A9RA 1FRVA 3O31A 4KR0A 3HN2A 1NMXA 3AM5A 1B6SA 1UR5A 1NE2A 4HNRA 4AW9A 1AQUA 4P4NA 4YLGA 1R4NA 4WFQA 5EWJA 4ACAA 4EHKA 1GR0A 3TOXA 5ES4B 2Z2ZA 3VDXA 1T35A 4QUIA 1GQRA 4ND1A 2NIPA 5I7AA 2XXBA 4Y9TA 3B2NA 2B35A 5DHSA 4XCXA 4QRDA 1DBVO 5G0UA 5G02A 4C88A 2XI4A 1KE2A 1E9EA 3CR3C 4N54A 1ZMXA 4L3WA 4FZ5A 3DLCA 2XGGA 1PGQA 4KPYA 1AQIA 1IRXA 3IALA 4N1AA 1SN7A 4XE5A 4HWGA 1N0UA 2IYRA 3UGJA 4JI0B 1MXFA 2VPZA 1PEDA 5KVVA 1X38A 1Z4JA 5C5IA 2XWSA 3DMRA 5IC5A 5K5EA 4AO7A 1DZ3A 3OBIA 4FQ7A 1KH2A 3AM3A 5EC8A 4DMLA 1I7SB 1OY1A 1AKVA 3D1JA 1B1CA 3BMXA 3IPCA 4G65A 2OZLA 2C9ZA 3VPSA 1FOEB 2A59A 3VMFA 5BRAA 1BWRA 1W4CA 3VUFA 1BOOA 1U2PA 2O2YA 3EF0A 4C20A 4ZZIA 4KQCA 1IM2A 2Z2YA 1I01A 3WQBA 3M83A 1TTPB 3NIWA 3AHHA 3L4BC 1B6TA 1EX1A 2C84A 3DF7A 3SLRA 3WBJA 2PUAA 4XWYA 1L5VA 2G1UA 4R54A 1UC9A 4A8TA 5D3MB 5LP6B 2C3MA 1N6KA 4M0KA 1N2JA 3WLSA 1FJHA 1JEDA 2AF3C 4V3BA 1RHRA 2VCHA 4FCCA 4N8EA 4XEUA 5EXTA 3QH4A 5FBRB 4C3OB 4MW9A 4NR0A 1HG1A 3T06B 4DSUA 2JW5A 1A9OA 4EO9A 5C35A 5JY6A 3KSBC 2R68A 4LJAA 2X2PA 3HEAA 4MPRA 3W9YA 4E30A 2BT4A 4H6PA 4DMUB 5ALKA 4XXHA 2G1JA 3ANYB 4CM4A 3EYAA 3I39X 3V48A 1WY7A 4J1QA 3SYLA 3K5HA 2ACKA 4V3CA 1E2EA 2A1UB 2YWBA 4XDGA 1P5HA 3RIXA 2NPOA 4BV2A 4Z6KA 1IHPA 4F12A 3U5ZB 5H3CA 3GG9A 3NB0A 5BSHA 5A6SA 1GYQA 2C8VA 3QMVA 9LDBA 3G9ZA 3AK4A 4K6KA 4F5WA 3PC4A 1OI2A 4R1OA 5FOQA 1IEXA 2A3NA 3BF7A 4N0DA 3BAFA 2Z6QA 4HZGA 4I19A 3FJOA 3SJ7A 2REQA 1PZGA 4S2EA 3W5DA 2XWBF 3K09C 4F85A 4R0MA 1N2XA 1U8XX 3KV3O 1TMYA 4IVRA 2F4NA 3ZHZA 2MINB 1ULBA 2ZUVA 1KIFA 2XDQA 2X7HA 5KO2A 3K9QO 3GGPA 4ZK6A 3KEGA 5BSRA 1EZ1A 1U9IA 1G4HA 2FMXA 4OI2A 1VLVA 5DHRA 5A0TA 4M55A 2ODWA 4CKCA 3QE9Y 3DEJA 5CXUA 1QMPA 3GLUA 3ZLVA 1WX1A 2OORA 1KMNA 5KMGB 5BR8B 1E9AA 3TVYA 5ICMA 1O9GA 5T64A 1HRDA 1NYRA 4C21A 5DM2A 2Q7XA 3CKKA 4WW0A 4BBZA 5BSEA 3OTQA 2XMGA 5F2KA 2VP2A 2CC2A 3AUJB 5A4AA 3SOZA 3IE1A 4EVQA 3FIUA 4COOA 1JJBA 1Q12A 4X66B 1XZAA 3CRQA 4PONA 4PANA 4IDFA 4RFLA 2N1BA 3C5EA 3IDFA 3CX8A 2WJWA 1Y1SA 2LTAA 2QM8A 4K6OA 5KU7A 2G0TA 3PFWO 4KMRA 3IPLA 1JV2B 3OJEA 4RE6A 4UFPA 4Z1OA 5LQCA 1PR2A 2F9LA 1U1EA 3OJOA 4QZVA 5AK0A 2WLSA 4YCSA 2G3YA 1Q20A 1YVRA 4J1NA 2ZWMA 2NAPA 3LUCA 1QUFA 2HLDD 3DDUA 2O48X 1DMRA 2ZUUA 3GRPA 1DS6A 4YJ3F 5DXAA 1RLJA 1DAKA 1KOGA 1PR1A 4LE1A 1H1LB 5H9VA 4WLUA 4NE9A 1WE2A 1TMKA 3FPSA 3N6XA 5LBIA 3VKUA 2CV2A 1Q74A 2CFIA 3TSOA 1ZONA 3HRKA 4DIKA 5FV7A 4XD7A 3UWPA 3EZ2A 2Q5OA 3FIJA 3OBBA 3U4IA 1Y5RA 3JQ9A 3HEBA 2GPSA 3I30X 1QFXA 1PUJA 5A4IS 3AHJA 1EUDB 4Q3OA 2BMEA 3BFVA 2IRWA 5FTKA 1G6HA 1RZ3A 3RODA 1M0TA 2HDWA 1B73A 2Q0HA 1VSTA 2RIRA 4M6WA 1K7CA 1A9SA 1YJQA 4NARA 3VH4A 2I8LA 3LYLA 4X1KA 1DRWA 1E4EA 1E6UA 2PY6A 3R6TA 4IUDS 4JEMA 7YASA 1LPSA 2J1LA 3MPOA 4GX0A 4JJ7A 5JLJA 5DK4A 5KWIA 2FFRA 3KXDA 1MUUA 2VDUE 2XEDA 4QG7A 2B1JA 2IZ5A 3A4NA 3IFSA 2WHXA 2ILTA 1H2AS 2WSSA 4IOKA 4YCMA 4ZYUA 4RTMA 3C8MA 1LWNA 1PVOA 3JQQA 3OOHA 3CUUA 1RXIA 1YKGA 2ECKA 3FDJA 3LM8A 1V16B 4D4LA 1QG2A 3EWIA 3PDUA 4DCSA 4YJHB 1U7UA 3GRVA 4H3VA 2XVZA 1KORA 4QAJA 3STXA 2V65A 4CKZA 1O0SA 4X3OA 3RBVA 2QJWA 1ZKDA 1EJ6A 1ESNA 5EIOA 4CKYA 3B60A 1PX0A 2WJGA 4QASA