1KETA

The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
346
structure length
346
Chain Sequence
QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords dTDP-D-glucose 4,6-dehydratase
publication title Toward a structural understanding of the dehydratase mechanism.
pubmed doi rcsb
source organism Streptococcus suis
total genus 141
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2001-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ketA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1ketA02
2FSVA 3NRCA 3AOEA 4J0EA 4AG3A 2ZYDA 1C3VA 1UDCA 5JE8A 4KUEA 1NVGA 1GZ4A 2IEDA 3IP1A 3LU1A 1DJQA 3FRJA 1PJ2A 3BTSA 4NBRA 4IXWA 2YHUA 3OM9A 1WMBA 4L9RA 2RIRA 4IDDA 1W6UA 1M6WA 1EEHA 2YW9A 1PWXA 5ITWA 1XU7A 1T26A 1IZ0A 1LDNA 1C1XB 3PQEA 3ZWCA 1L1FA 3QVTA 4CMAA 2PKQP 3BAZA 3S1LA 3O38A 4ZJUA 3QVSA 4PLCA 5CDTA 5LC1A 4FQ8A 4CM8A 3GNTA 4DC0A 1WVGA 3RC9A 4WEQA 2BGKA 1UH5A 3Q6IA 4WKGA 5IDWA 4JBIA 2J5RA 1KERA 1QYXA 3JYPA 4DC1A 4MVJD 1IY8A 4JIGA 2HKIA 3KEOA 1CJCA 4TROA 1Y5MA 1B7GO 1C0LA 1N92A 3MOGA 4XA8A 4KQWA 1Q7CA 2OMEA 1R0KA 3VVBA 4BKOA 4BO6A 1T25A 4ONEA 5L51A 1A5ZA 1XG5A 3V2HA 1X1EA 3EVNA 2O4UX 1ISJA 3KSUA 1PGPA 4P4GA 3RSHA 4TWRA 3RC7A 3U9LA 3BYZA 3WGTA 2HMTA 2Q1UA 4RF4A 5T8KC 4I8XA 3UKOA 2PZJA 2DFDA 1C14A 4OM8A 1E92A 4OQZA 1IPEA 2DVMA 4ND2A 3WS7A 1WXDA 1ZK0A 3DFZA 1NQOA 5ADHA 2JHFA 3K9QO 4INAA 4BVAA 5B4TA 4NMHA 1ONPA 1VSUA 2XOXA 1U4OA 2Z1MA 3LT1A 1S6YA 4I9NA 4RLHA 5DT9A 3RUHA 3I4FA 3ZWVA 3EY4A 4I08A 1TT5B 5DN9A 5A9SA 4HWKA 3WGZA 5GZ1A 1KYQA 2FP4A 1JVSA 4NFYA 3DTYA 4QFDA 1HYGA 3AJRA 3ZU5A 1H9BA 2YQ4A 3QSGA 4OL9A 4BS9A 4O0LA 1ZVMA 2Z5LA 4FD3A 3W8FA 2CDAA 3GLQA 2EGHA 1V9LA 1WMAA 3HN2A 3G49A 4IMPA 4DYDA 6LDHA 1QMGA 1I2BA 3PPIA 4J4HA 5HTOA 5EESA 5G0VA 1TEHA 4FJ0A 5A1TA 3RI3A 4DYVA 4B7XA 3OFSA 5BSFA 5U4QA 3WQRA 1O95A 4A7PA 5IDQA 1AXGA 1HF3A 2VCYA 5A06A 3GVCA 1MFPA 1QYWA 3C1AA 4B4WA 1CF2O 1SB9A 2I76A 2NVWA 4NJMA 2OORA 4CV3A 3U3XA 2ZJ0A 1X7GA 2BRUA 3WLEA 3TOZA 4LISA 1P1IA 5JDIC 1WDLA 1R4MB 5ER6A 2ILTA 4LGVA 3WMXA 3I1JA 3S2EA 1DOHA 2Y1GA 1DC6A 5IDXA 1YJQA 1CIVA 3A1NA 3WGQA 3R6DA 4CLRA 5IXSA 4Q39A 4QUKA 3A14A 4F6CA 3B1KA 2B5VA 2AG8A 5A05A 2X7HA 3AY6A 2NTNA 3C7DB 1BG6A 1Z73A 5COAA 3K92A 4G65A 1RM5A 3QVWA 1WZIA 4RVGA 2DTXA 1Y8QB 4WJZA 2ZYAA 2GO1A 3DBHB 3JYQA 3DZBA 4MVJE 2WYWA 3LT0A 1UXHA 3L4BC 4WCFC 4XDZA 3ZHYA 3A4VA 3JQBA 1ZSYA 2VOJA 1LXCA 1E6UA 4RVHA 4OJNA 1GD1O 3WYCA 4H3VA 3VTZA 3OQBA 5IN4A 1LLDA 2JFGA 5G0WA 4AJKA 1KEVA 3DO5A 1K5HA 4XIJA 1GZ6A 3D1LA 3NGLA 2IYOA 5ILGA 4NPCA 1LC0A 3KSZO 3U5TA 3H5RA 1ADGA 1OAAA 3DAPA 3MJTA 2GZ2A 3OJOA 2NACA 4ID9A 4R1UA 1NWCA 2FHSA 4MKXA 4R5MA 4XWYA 5KNLA 1LBEA 4YEDA 4Q3DA 4B7UA 3RD5A 4WLVA 1HDYA 4GVLA 3AW9A 1PGOA 1HTBA 5JFOA 2XAAA 1ENOA 2PD4A 2W2LA 1H93A 4JGBA 1TLTA 3QVXA 3WJAA 4UVEA 2J5KA 2D1YA 4NBTA 5KJCA 4WNCA 3GZNB 3DHEA 4CM6A 3HDJA 1FJHA 2XXBA 5FWNA 2NV6A 1SO8A 4E31A 2ZTLA 4Z3DA 2P9GA 3H9EO 3FWNA 1DJNA 2PA3A 3A9WA 2ZB8A 3BMOA 1PJ3A 4I9UA 1MB4A 4JK3A 3AUUA 4ZVVA 2Q4EA 3PGXA 3QVOA 5JCJD 2Y0DA 4BO2A 2YV3A 2IEBA 3EUWA 1X7HA 4MVJH 1JWAB 2V65A 3HB5X 3TWOA 2W98A 4A2CA 4ALNA 3PHHA 4FFMA 5TJHA 2YV2A 1JAYA 3RROA 3VZPA 3AU9A 3SC4A 1U2DA 1LI4A 3GVXA 1XA0A 3C7AA 3H2SA 3QA9A 2X5OA 3ZV5A 1CEQA 1NPTO 4BMNA 2HUNA 2WEKA 1QR6A 5F3RA 1NFQA 1GEGA 4YJGA 4PLWA 4B79A 4FS3A 4AJ1A 4R3NA 5DBFA 2NM0A 2Q1SA 3QY9A 1LA2A 1RM0A 4ZRNA 5KJ1A 2EF1A 1J0XO 5H83A 1OC2A 1Y1PA 3BHJA 4R01A 4QT0A 1EDOA 3DONA 3P5SA 4OOEA 3K31A 4MVJA 5GZ3A 3GPDG 3LVFO 4FN4A 4M1QA 1VL8A 4J1QA 3TL3A 3ZGYA 2JL1A 2X6TA 1BW9B 1YBVA 2ZATA 4OXKA 2J3HA 5TX7A 1NX6A 1S7CA 1EFLA 4LW8A 1J6UA 4JJFA 5L7TA 2OP1A 2F00A 5FFFA 1G0OA 2PD6A 4DIFA 4N18A 3EW7A 1LSOA 2E48A 4FOSA 4IDGA 4IJUA 1NVMB 4NBUA 4H7PA 4QEDA 4RDIA 4YACA 1R4NB 3DBRA 3JQFC 2C5EA 3OHSX 4HP8A 2UYYA 2P4HX 3DXFA 4S3MA 2IE0A 3JQ6A 2DT5A 3KVOA 1Y8RB 3RAJA 3R3SA 1QG6A 3BHMA 1U3TA 1PJBA 4CL8A 3WGOA 4NR0A 2OO5A 1NQTA 1E77A 3DEYX 2X1HA 4XCVA 3TSCA 4FCCA 5COBA 3N58A 4RPHA 4BO1A 3PJEA 3P19A 4PZEA 3ZHXA 2Q3EA 4J16A 2B83A 1AUPA 1DEHA 1ZK2A 2HMWA 1Y5RA 4CMHA 3GRPA 3ENNA 4GVXA 3UICA 3E6AA 2V6GA 1XCBA 3ZWPA 1BXKA 1LDMA 1JQBA 3HJAA 3GOHA 2X0JA 4ZA2A 3ZV6A 1PJLA 1ISHA 3H65A 3MJVA 3UAGA 1E7WA 1HKUA 1PJ4A 5GMOA 5CAEA 1SOWA 2I9PA 3ORFA 1SAYA 2CMDA 4RZIA 2PH3A 4MKRA 4ROSA 4J91A 1WWKA 4RZHA 2HK7A 5L40A 1GFSA 4MP6A 1DIGA 4R51A 1TT5A 3H9JA 4OYRA 1A71A 1NPDA 4DUPA 3BMQB 4J4TA 5KVCA 1YB5A 2O3RA 3F4LA 1HE2A 3GHHA 3I6QA 4CMEA 2Q49A 1UXKA 5T57A 4RPGA 2I6TA 1X14A 2POQX 2IZZA 5A3VA 1ZJYA 4ZQHA 3PWZA 1NQ5A 3PJDA 3L9XA 3CMCO 1B26A 5KJFA 4LVCA 1FDUA 3EMKA 4XIYA 3VPSA 1IOLA 7MDHA 4URFA 1P1FA 4QTZA 1HETA 2CDBA 4GAEA 3RQSA 1K2WA 1LLUA 2EIHA 3QQPA 3O8QA 1M2WA 1PS9A 3C24A 4KUGA 4L8VA 4OHUA 3WTBA 4K6FA 3H9UA 3INTA 1CDOA 4TRRA 3R0IA 1HSOA 4M8SA 3DMTC 4PCVA 3JQAB 5GY7A 4PZCA 3L6DA 3U4DA 3ZWBA 1H0KA 2HRZA 1UP6A 3DZKA 4O1MA 5TS3A 1EUDA 4UUMA 3I9KA 3IC5A 3NYWA 3MWDB 4L0QA 4LSWA 4PLPA 4Z9FA 4ZN6A 2HK8A 2FPPA 2VZ8A 1P77A 2X58A 4IJKA 1UP4A 1WAMA 1HT0A 5I7VA 5CP8A 1CRWG 1LQUA 1DFHA 3TPCA 2C2YA 2B4QA 3N7UA 3VOSA 5I7FA 1ARZA 4YRBA 1A7AA 3ZW9A 4ZHSA 3OETA 4PZDA 4D79A 5L4SA 3JQAD 1NAIA 3RKRA 4D0SA 3BZUA 2O23A 3WDSA 3DZJA 4CMKA 3MOIA 5BNFA 2TMGA 3TZ6A 2YJZA 4CM3A 4DWVA 3KHUA 3S55A 1PGQA 2EGGA 3E82A 4RVFA 4PVDA 4I5GA 4CV0A 3U09A 1DFGA 1W4ZA 1O0SA 1QKIA 2FMUA 4TZTA 3JD3A 1YB4A 2Y1OA 1MC4A 1CYDA 4NIMA 4FIZA 4AVYA 2O4CA 2C54A 3BMCA 2WMDA 4YTEA 3I5MA 3Q9NA 1ENZA 4ND1A 1DC3A 1QV6A 4CMIB 1EQUA 1WNTA 2DM6A 1E3WB 1MFZA 4NQZA 3MJ4A 1DSSG 4MINA 4EJMA 3SJ7A 1X7DA 5A5EA 5THQA 3WR5A 1HL3A 5CPBA 3W6ZA 3PYXA 1T2FA 4ZU3A 1XWFA 1UZLA 2Q4BA 4P22A 5I9NA 2A94A 3KOUA 3NT5A 4CLOB 2O2YA 5DZSA 4LK3A 4XR4A 2Y68A 5JCJA 2C7GA 5IXYA 3VC7A 4A27A 1XR3A 2BKAA 4K1LA 5H82A 3V5NA 3JYOA 3KYCA 3ZV3A 1HDOA 5H81A 2X9NA 3C1OA 2VZ0A 5G2OA 1R15A 1M6HA 2VHVA 3H3FA 4CUKA 1W0CA 1BVUA 4IUYA 4WCFB 1YL7A 3K73O 3K96A 2SCUA 3QRWA 4HADA 3SLKA 3WGYA 4HKTA 2YFQA 2ET6A 4W4TA 4IMRA 5JO9A 1K6XA 1B3BA 2Q2WA 1QYDA 4TVBA 2J3KA 5IFLA 2YHIB 2VHXA 4UEOA 1C0KA 2PK3A 3DMYA 1DC5A 2ZB3A 1D1SA 4YAJA 3ON5A 4W7HA 5AXBA 1D4FA 3SJUA 3DZHA 1Q0LA 1ZBQA 4U6QA 4D44A 2AQKA 5THKA 4ZQBA 2P9CA 2ZB4A 3JQ7B 1U7TA 7ADHA 3QJ5A 5HS6A 3GUYA 3ITDA 4XGNA 1I5RA 5JDCC 1HDRA 1N9GA 3L77A 2WE8A 5CDYA 2NNLD 3DOJA 5CEJA 2CFCA 2J3JA 4HV4A 1UZMA 1HLPA 1A72A 1DHTA 1PZHA 3D5TA 2JAPA 4PLVA 3GHYA 2UV8A 1GUZA 2E6UX 2PGJA 2O2SA 1DDOA 2FWMX 4YT5A 3FTPA 4CR6A 4YVFA 1E6EA 3GN2A 4JQCA 4XQ9A 3M1AA 2CSUA 2O3UA 2EWMA 3U4IA 4WOKA 4YBZA 4B8WA 4CMGA 2BF7A 3HDQA 4DQXA 1GUFA 2Y05A 4BNGA 1V6AA 3OMLA 3ZI0A 3FNFA 2AA3A 1R4NA 4BO0A 3ZNPA 3EC7A 5JNLA 4A0SA 1Y8RA 4BL5A 4ZICA 3E03A 1C1DB 1GYRA 1U28A 3UN1A 1EE9A 4KDFA 4XYEA 4ESOA 1VJ0A 1H5QA 3TZQA 1ZZEA 5C7IO 1I24A 4Y6SA 3V2UA 5I9LA 1DXYA 3FNEA 1VLLA 1K89A 2VYND 4IZHA 1MC5A 4B8ZA 1XELA 2WWRA 4PRKA 4RLSA 4R9SA 2BGLA 2DFVA 1P1KA 1R37A 4EUEA 1VL6A 3NT4A 4J9VA 4WEOA 4GX0A 2X4GA 1JVBA 3GNQA 1UAYA 1IUKA 1NNUA 1FDWA 2PTGA 4N5MA 1EDZA 4RGBA 2QZZA 2IZ0A 4BGEA 4PLFA 2HAEA 1YL6A 2GZ1A 3LDHA 2PWZA 2C7VA 4BO5A 4BO8A 3NJ8A 3LC2O 1F14A 4EZBA 3RIHA 3PGJA 1YDWA 1RKXA 4N54A 4GH5A 3BMNB 3G3EA 3RFVA 4PLZA 4UUPA 5A02A 3SX2A 2PKQO 4FSHA 3WYBA 2HK9A 1ADCA 4BNWA 4L73A 3R1IA 3RKUA 4R1SA 1TI7A 4HBGA 5BSHA 1Y6JA 3BMQA 3JQ8B 4JCOA 4QXMA 5AXAA 3UCEA 4RQTA 2DBRA 3OJ0A 1HEUA 2GN6A 2VRBA 1MV8A 2VOEA 3AY3A 1WZEA 3H9QA 2Y1EA 3M6IA 4OMUA 2D3TA 4DBVO 3QHAA 3GGPA 3KYDA 1JW9B 1HDXA 4IY1A 1B2LA 3JSAA 5I9MA 1N7HA 2YDYA 4NNJA 2FZEA 4YQYA 3LT2A 2Y93A 2AE2A 2BGMA 1KEPA 3H2ZA 4MO2A 5IZCC 4CJXA 1VKNA 4GBJA 1LDYA 2CUKA 2D5AA 3JQGA 4JP3A 4Z3KA 3E9QA 4NI5A 3FF4A 2DUUA 1SPXA 4B4OA 4RDHA 2GN9A 4XZ3A 5B1YA 1E7YA 2FRDA 1EE2A 1Y9AA 4IINA 3Q11A 1XLTA 1X1TA 5TT1A 1OZAA 2X23A 5FF9A 3RC1A 1GPDG 4OKIA 2Y66A 6ADHA 3W4JA 3I9MA 1LC3A 5JYDA 1DPGA 2EJVA 5DOVA 3I83A 3UOGA 4TRNA 3E18A 2NTJA 5JC1A 4UAGA 3GEGA 1E3LA 1TB4A 2CVOA 1VI2A 4QECA 4EUFA 3LYLA 4HUJA 3OIFA 4FDAA 1PSDA 1F8GA 1PR9A 1YOVB 5C37A 3AU8A 4EJ0A 2A35A 3OEYA 4CV2A 3RUCA 1E3SA 3PEFA 2NU7A 3WFJA 4BGUA 3G79A 5KKAA 1T1SA 1FDSA 5IAAA 2Z95A 2O3JA 4ALMA 3AUTA 3LSYA 2BI7A 1DIAA 2DQ4A 2YFHA 1PQUA 3F47A 4AFNA 3Q2KA 4BNHA 3HADA 4DLAA 4Z6KA 1MXHA 2X8LA 4BQPA 3CSDA 3FNHA 3KTDA 3KLPX 3EYWA 4CMJA 4F46A 1E3WA 5IDYA 2BFPA 2PZMA 5AQ1A 5JDIA 3ONDA 4GGOA 1P33A 5C3MA 1Q2XA 3OEWA 4XB1A 1P9LA 3DZIA 2HLPA 3ONEA 2EW2A 1ZCJA 3HN7A 4O5OA 5TQVA 3WOHA 1R0SA 2EKLA 2WE7A 5TLSA 4FFOA 4TMFA 4CLOA 2AEJA 5T67A 4L4XA 4JBHA 1Z82A 3UW3A 1H2BA 4W6ZA 4IDEA 1Q0HA 3PI7A 2FZWA 4K9DA 4HFNA 4EJ6A 3MWEB 4L4SA 3GH3A 3VZQA 2B35A 2PGLA 1NVTA 5AOVA 2AW5A 3I9OA 4LCJA 1BGVA 1P0CA 3O9ZA 1QYVA 1F12A 4WCFA 5G4KB 5CDGA 2CZCA 1M67A 3E5MA 3QP9A 3WIEA 3IJPA 4ALKA 1ISGA 3ZNNA 1NASA 2J3IA 2EJWA 4YYZA 1SBYA 1DAOA 1HYHA 2P2SA 5C7OO 1V3TA 4NZ9A 1E7MA 1P3DA 3PK0A 1PZFA 2VZ9A 4U7WA 2BELA 2VUSA 4I5FA 4GLLA 3LT4A 4R5HA 1ORRA 5B37A 1VSVA 4CM7A 1BSVA 4QO7A 1G6KA 2VQ3A 1LRLA 2VWHA 2CNBA 1QLHA 3JQ7A 4FOOA 3ZCXA 2QIOA 2I5PO 3JYLA 4HFMA 5DULA 2D59A 2X0NA 4ALLA 4LN1A 4G2NA 1R66A 4M86A 5J23A 4YAIA 1GAEO 4GGPA 4IIUA 5ENDA 4CM4A 5JS6A 5A3JA 2W2KB 4A73A 3L0DA 3MCVA 1ONNA 5JAQA 5JMPA 2CVQA 1RYEA 4W99A 4J2OA 1A9ZA 4CQMB 1ZK1A 1YKFA 3D4NA 2A92A 4YJFA 3MJCA 5KJEA 1QRRA 3AOGA 4A10A 4PFJA 3HDYA 3ROMA 2J8ZA 3OQ6A 1LDBA 4E4YA 2QZ9A 1T2AA 2NVUB 3GQVA 3D3EA 4XGIA 5JAZA 4BNXA 1SZJG 3JQ9A 2EKPA 3DTTA 3VPGA 4XQCA 1GCOA 4LSMA 2YZ7A 3FWZA 2GUGA 2FY8A 1C1DA 3ZHZA 5HRUA 1MG0A 1H9AA 4E2WA 2GERA 4A5OA 4CQMD 3VH1A 4EEZA 1NTOA 2B69A 4M49A 4ND4A 1OI7A 4C4OA 3F1LA 2PZKA 1SC6A 3AFNA 1VE9A 2VWQA 2O7QA 2VUUA 3C7CB 3GMSA 5DCYA 1AE1A 3CXRA 5A9TA 4YRAA 4UUOA 1PQPA 2D0IA 2C82A 4NJOA 4XJTA 5C5IA 4IGEA 5CEEA 4DRYA 3GDGA 4WECA 1W8DA 4BNZA 1JU9A 4CM5A 1HDZA 1LLCA 2IZ1A 3S8MA 4UULA 1G1AA 4PIVA 4CM1A 2DU8A 3RASA 1NXQA 5CG2A 1YJ8A 3WIDA 3DBLB 4MDHA 4MKZA 1XEAA 3BMNA 1H6DA 1T4BA 2R00C 3CINA 1E1KA 4KZPA 1LNQA 1CWUA 4I5DA 1T2DA 2O3TA 2ZQYA 1EVZA 1U2GA 3JQ8A 3IIEA 3L9WA 3UCFA 4P8RA 4XR9A 3SBOA 3W8EA 1YQDA 4CLDA 1HE5A 1U3UA 4IIVA 5B4UA 1OFGA 3D3WB 3WX0A 4Z9YA 3U4HA 4CLEA 5JAIA 4BKUA 1QLJA 1E0DA 1ZMTA 2I3GA 1ZIDA 1LLQA 5KIAA 3VPXA 5MDHA 1F0YA 2VT2A 2ZTUA 4BIIA 3CKYA 2VTEA 3I9JA 1ZXLA 1BDMA 1XDWA 3I9NA 4OKNA 3JCZA 1Q7BA 5JMWA 3BHIA 4J1TA 4B3IA 5EQDA 2V6BA 3D7LA 1DO8A 5A04A 1V3UA 4J0FA 4DREA 1C1XA 3U0BA 3BA1A 3CTMA 4DPKA 3P2OA 5JSFA 2O3QA 4W9NC 2HDHA 5TC4A 5IG2A 3HUDA 3DHNA 1EVIA 4XB2A 3KO8A 1ID1A 4NH4A 4NBWA 2HSDA 3NTOA 2UUOA 2AQHA 1PJTA 3GK3A 4BNIA 1NFRA 1JKIA 2I66A 1PR3A 1ENPA 3WWZA 3F3SA 2IXBA 1MLDA 1U8XX 3TOXA 2B36A 1R0LA 3MZ0A 3ZWAA 2OGUA 4BNTA 1ZNQO 4NK5A 1NFFA 1SCUA 2WYVA 3ASUA 1TVEA 3U62A 3WFIA 4R1NA 3GDOA 4EEXA 3SC6A 1EVJA 4DBZA 1I10A 4TZKA 4DA9A 3BTOA 1GR0A 4DIBA 1V3VA 2GN4A 2FR8A 3KM0A 3MJSA 1KY5A 3Q1LA 5CHEA 5L7YA 1KEWA 3UH1A 2DTEA 5KKCA 3Q0EA 3OJLA 4PLYA 3ETGA 2WTBA 4M89A 1PX0A 3D0OA 2P4QA 1U3WA 2D4AA 4WE3A 4UVGA 3HWRA 4X54A 1IYZA 3S2FA 3NX4A 5G0SA 4WUVA 5DCUA 9LDBA 4M55A 4H16A 4R68A 4H15A 3ZU3A 3PLRA 1HRDA 1WDMA 3OP4A 2OZPA 2Q46A 4BNMA 3TF5A 2DBQA 2RH8A 4PLTA 4DLBA 4D46A 1AHHA 1E3JA 1LSJA 3AI2A 3OECA 3IL2A 3D4OA 1H6CA 4BKQA 2I67A 1X0VA 4DPMA 1BRMA 1O8CA 3P2YA 4KOAA 4MIYA 4CQLB 4IZIA 5G0TA 4AJOA 1FK8A 4FFPA 1HZJA 1P0FA 3TFOA 1WW8A 3F5SA 3JQCA 1UR5A 2OL4A 1LTHR 4YJHB 3DWFA 5F1PA 2QHXA 3WWYA 4OOFA 1EK5A 2ZKLA 4RV9A 2X0RA 3TJRA 2BD0A 5G4KA 4U0KA 2PZLA 1F8FA 3RU7A 2B37A 2HMUA 4FW8A 4HY3A 2RHCA 1I32A 4BMSA 4RO0A 4E2XA 3GF4A 4GX1A 4EGFA 4YT4A 2ZYGA 1DAPA 2EEZA 1KS9A 2ZB7A 3IUSA 3COSA 3GFGA 2GR9A 3VH3A 2D8AA 4IDBA 4CM9D 1UXIA 5JCXA 4XGKA 3AI3A 3P7MA 1B8UA 3PJGA 4JX8A 4E5MA 1NYTA 3PQDA 3TQHA 1LSUA 1YONA 3PVZA 2X86A 1R4MA 4E32A 3I52A 1OMOA 3FPCA 5KVQA 2G82A 4CPDA 2X9VA 1XQ1A 5HM8A 1B8VA 4Z9XA 3FD8A 2OOSA 3E8XA 4YAEA 3RVDA 2JFFA 2V7PA 4BNKA 2IXAA 3GUCA 4WOJA 4UVHA 4BHTA 1VM6A 4GQAA 4OXNA 1Y7TA 3ZU4A 4WK6A 2B4TO 4CM8B 4R16A 4IM7A 2W2KA 1VJ1A 3RWBA 4KUHA 1KC3A 1Y8QA 4XYLA 4FJ1A 2CD9A 2VYVD 3FSRA 3DBHA 3RJ9A 3I9LA 1J49A 4DIOA 5JC8A 2WYUA 4R41A 3GMDA 2RBEA 2J5QA 2TMDA 4E2ZA 4HX5A 4CMEC 3OA0A 2O48X 4JROA 5I8ZA 3C8MA 3MEQA 4YT8A 3NAQA 4W82A 1PZGA 1I0ZA 1PGNA 1YBMA 4NG5A 4YCAA 4NFHA 1IL0A 4N7RA 3PRJA 1K3TA 4MIOA 4J1NA 1KVTA 2NUAA 5CG1A 4WLNA 1SEPA 1DLIA 3ENKA 3DZFA 3IS3A 4ALIA 5KVVA 4PGFA 1P45A 2RH4A 1DBVO 2LDBA 4MPDA 3K6JA 2Q1TA 3JD2A 3WICA 1EBUA 1YBAA 5F1OA 5JDCA 1E7SA 2WM3A 2JD1A 4PG7A 3WNQA 5EL0A 4NU6A 3IQDB 2DBZA 1DIHA 4DLLA 4DGSA 2JCXA 3ANLA 3AWDA 1UJMA 3HG7A 3GZNA 3QWFA 4IDAA 4CLXA 1X0XA 1PTJA 4HFRA 2HJRA 4NK4A 1BVRA 2GN8A 1ZO8A 3FN4A 4DL9A 1QYCA 3LLSA 5A9SB 4J7XA 3PTZA 5AVOA 1JLLA 2GLXA 3WG9A 4RQUA 5JW6A 1ADFA 1E6WA 3QE3A 1ZFNA 3EHEA 3DL2A 4Y6RA 1HE3A 3ICCA 4MVJG 4IJVA 3CEAA 4XJSA 1NBOA 2G76A 2OUIA 3UVEA 4E6PA 1NM5A 5BT9A 4FFNA 4BGVA 1SMKA 4BOYA 1A4IA 4G81A 5MGBA 4AL4A 4E21A 4J3FA 2OBNA 2P91A 3ANMA 3GC6A 1A7KA 5BNIA 2H6EA 3RC2A 4ZQEA 1DFIA 1MXFA 4XKJA 3RUFA 4YQZA 4TKMA 4B3JA 3GG2A 1D7OA 1HZZA 4AJIA 3WNVA 4JXKA 1PU2A 3GG9A 4GI2A 3RUEA 4NBVA 4R9RA 3HE3A 3ICPA 2AQIA 5HS4A 2VHZA 3L6OO 1EFKA 1IZ9A 1NR7A 2HMSA 2OHXA 4TRMA 4MVJF 2JKVA 4DMMA 2UDPA 4FPXA 4CR8A 1NAHA 2D5CA 4ILKA 4J49A 4RVSA 5DP1A 1U5CA 4C7KA 4XRGA 5IJZA 3ASVA 4AICA 2EXXA 3ZNQA 1BW9A 5HBRA 4BUCA 1I3NA 4XDYA 1XGKA 4OH1A 4BNUA 5DP2A 5ITVA 4CLRB 1Y9EA 5K6AC 1LRKA 4FJ2A 4JN6B 1PS0A 2Z1NA 5L45A 5KVSA 3N74A 3VPHA 4YJDA 3X2FA 1NHGA 4I1IA 1Z6ZA 3PDUA 2UAGA 1LSSA 2JAHA 3UCXA 1Z45A 2GSDA 3W4IA 1DHRA 5B4VA 1ULSA 5ICMA 4GX2A 3OQ1A 2OBYA 4QX6A 1GTMA 4B7CA 5FEUA 2EV9A 4O59O 1FF9A 3EDMA 3OIDA 4PG8A 3K30A 2PGDA 2HRBA 4Q3CA 4MP3A 3K2EA 4CODB 3G1UA 2NLOA 1FMCA 2DPHA 4GX5A 2R6JA 1RJWA 2GF2A 3GNSA 3HHPA 3GAFA 2QYSA 1PL8A 3GR6A 4JP2A 5ICSA 1ZUD1 4WLUA 3R3JA 4QFCA 2Y0CA 3B20A 1X15A 3DZGA 3KYBA 5A5FA 5C7LO 3QWHA 3GVHA 4FFRA 5U1PA 5DNAA 5ER9A 2GNAA 3NDJA 3VKUA 5EPOA 3H9GA 3HDHA 1H6AA 2LDXA 4CL3A 4OQYA 4B4UA 3LK7A 1CQJA 1GQ2A 3DB2A 1I36A 4N5NA 5JLAA 3NTRA 1KIFA 1GEEA 3GRKA 4LRTB 3M2PA 3VH2A 2PH5A 1E5QA 1DB3A 1P1HA 1HSZA 2BHLA 4LRSB 4K28A 3E9NA 3LLVA 1PZEA 1J5PA 3BMOB 4GSLA 1QSGA 2EG9A 1N1GA 2P68A 1SOVA 3ZWNA 4IGFA 2W2LD 3B1FA 2Y99A 1ADBA 4Z0TA 4PN3A 4CM9A 1SNYA 2NU6A 4YJHA 3ZN2A 4A03A 4J7CA 3WBBA 1R16A 2Q50A 2RAFA 1YE3A 3RBXA 2X5KO 1PJQA 3ANNA 1GQQA 5G4LA 5T8KA 2FOIA 1XYGA 1EBFA 1AN9A 2AG5A 1I01A 5COQA 1WP4A 1GV0A 3WBFA 4MVJP 3GGOA 4Y9DA 4YJGB 4OXYA 1UXGA 4MVJM 5JY6A 3A06A 1RWBA 3JQAA 1Q0QA 4J2HA 5CFZA 4DQVA 2C5AA 1YGYA 1V0JA 5L95A 2ZQZA 4YB8A 4F45A 3WSVA 5DOZA 2VYVA 1TA4A 3QV1A 2C2XA 4BB6A 1IHYA 4BKPA 3MTGA 4D7AA 1JKJA 2C59A 2C29D 3E9MA 4PG6A 1N7GA 5JY1A 3KB6A 4FGWA 1P1RA 4Z0HO 4TQGA 4XQGA 3I3OA 4BNFA 1GCUA 1YXMA 4DXHA 4EW6A 1YS4A 4BNJA 4FB5A 3PDJA 1PJCA 2VNSA 4KWHA 4EI2A 1K6JA 3UFXA 1U5AA 2BH9A 3KSDO 5IN5A 1EUZA 3PHIA 4PG4A 1ML3A 3FBTA 3G1TA 3DBRB 1NR1A 3ZH2A 2ZTMA 2W90A 3EK2A 4ZRMA 5JXWA 3E48A 4WNIA 2AE1A 4K6CA 4D42A 2EERA 4LMRA 3ADOA 4R4JA 3AK4A 5BQFA 5AXDA 2NQTA 3NGXA 3KETA 4S1VA 1FXSA 2NQ8A 3ITKA 4J7UA 2H63A 5BNTA 5U9CA 3B1JA 1O6ZA 3HB4X 1LX6A 4W7IA 4CMIA 1KVUA 1KVQA 4KTTE 1WPQA 3LQFA 3AOEC 2Y67A 3IOYA 5JBIA 3H8VA 5KTKA 1HDCA 3KRTA 3QWAA 5F1KA 3IAHA 2ZCUA 3KEQA 2DKNA 3CZRA 3GY0A 1CQIA 4WCDA 1XKQA 4QSMA 2P5UA 2WD7B 3NT2A 4PG5A 3T7EA 3GVIA 3ROQA 2WDZA 5LDGA 1B14A 2C20A 4E13A 3BXXA 4J1SA 2V6FA 3K2BA 2PLAA 3JD1A 1H2HA 3JV7A 2PFGA 3AUAA 3CUKA 4Y98A 3C3XA 3T4EA 3FNGA 2X0IA 2F1KA 3C85A 3L4BA 1L7DA 3PFFA 1A27A 5FI5A 3VDRA 4YWJA 2O7SA 4ND3A 4YT2A 3ROPA 4IS3A 3V2GA 2PKRA 1NPYA 1PL6A 4LVUA 2H9IA 3STHA 3V1TC 1R6DA 2XF8A 5A4DA 4DQUA 2YHIA 4L75A 3WXBA 4RPLA 2QX7A 1O94A 3AUSA 4NFSA 4IXTA 3FBGA 4FR5A 4GWKA 4J43A 3SVTA 4MVJI 3RUAA 3ZWYA 4EYEA 1DLJA 1ULUA 1BDBA 1D8AA 1KY4A 3O8QB 3WSWA 3ZWXA 4E5NA 3CH6A 2PNFA 4BNLA 3I6IA 3PZRA 1RPNA 4II2A 3ZDFA 1Z7EA 3DBVO 4BKRA 1N2SA 3RU9A 3IMFA 4PLHA 2NU9A 5AXCA 1BXGB 3M2TA 5ES3A 3I4CA 2NU8A 1T2EA 2G1UA 4BV9A 2YQ5A 3Q9UA 1OBFO 3QWBA 1CETA 2BI8A 3GDFA 1MP0A 5TSDA 4D45A 1GDHA 5JAMA 1UDBA 2DC1A 2GD1O 3EZLA 3ETEA 4IDCA 3FHLA 2GYYA 2NTVA 4Q3NA 3UXYA 5IF3A 2JFHA 3PIIA 4FBGA 3PWSA 1KEUA 1LDGA 1QORA 3JQDA 4ZQGA 2VYNA 4R54A 3TNLA 4AJPA 3DOCA 5TJ9A 1JDJA 4E5KA 5FI3A 2R00A 1OC4A 3RUDA 1E7RA 4XD2A 4Y67A 1KOLA 2GPTA 3ZWMA 1GUYA 3OSUA 5AYVA 2YUTA 4RL6A 1ENYA 3NTQA 3L07A 3PIDA 3AM5A 4D41A 3IUPA 4M54A 2V6MA 2VUTA 4D3FA 3ZNOA 4EBFA 4F3YA 1X13A 4HNHA 2BFMA 4Q3BA 2G5CA 3K8ZA 1N5DA 3TRIA 1J4AA 1E3IA 3ROKA 4AJ4A 4Y8VA 3F6YA 3O4RA 1GU7A 3BMCB 4MJLA 1KC1A 3WMWA 4WLEA 5CDSA 2C07A 4AJEA 1CERA 1V8BA 3PJFA 2RCYA 4OSPA 1GV1A 5I7EA 3SXPA 1O5IA 3PLNA 2EHDA 3IKTA 5F5LA 3Q3CA 4KTVE 3RJ5A 5JO0A 1QV7A 3AM4A 2E49A 2WJPA 4L4RA 1MUUA 2JJYA 3T7CA 5EJ2A 2HU2A 4JJIA 3H7AA 4R3WA 1QP8A 4B3HA 1SEVA 1D1TA 4CUZA 2NADA 4Q3AA 1DRVA 3DFUA 3GEDA 4TSKA 4AJNA 2Q2QA 4W9NA 5DDIP 3JQFA 3KYCB 4CMCA 3OBBA 2UUPA 1WLYA 1PGJA 2GRAA 2X9GA 2JD0A 5HA5A 4BB5A 3RFTA 4AJJA 2CY0A 1GZ3A 1JTVA 1EMDA 2DTDA 3OF2A 1VJTA 4WGGA 1HE4A 2EP5A 4UREA 5EQFA 4AJLA 1U9JA 1GQYA 1ZEJA 4G5HA 2YYYA 2YV1A 4BO3A 2QW8A 3SEFA 1YVEI 1XSEA 4U6SA 5IZ4A 4RJTA 3TFQA 4A26A 3E5RA 1KETA 4O63O 5TGDA 1F06A 1YQXA 4E3ZA 3JQBC 5JYEA 2VNAA 4PVCA 5TNXA 1UUFA 3W1VA 3NDRA 2WD8A 1Y81A 1UP7A 3FR7A 5LCXA 1NWHA 2YDXA 4IPTA 1XQ6A 1JN0A 4WLOA 1FDVA 3L4SO 2B0JA 2Q45A 3VH4A 1M76A 1BHSA 2BFAA 3DAFA 1T2CA 3JQ9C 1LEHA 1T4DA 3INGA 2A9FA 3F9IA 1W73A 3WQSB 4BNVA 3MJEA 3PP8A 4L76A 4Q9NA 1YO6A 3GGGA 4WASA 9LDTA 3H6KA 5FYDA 1A9YA 2DPGA 2VTDA 3BIOA 3ZV4A 3CIFA 3FI9A 4OGWA 4ND5A 1I33A 4XRRA 4YA6A 1P44A 3D4PA 2ZCVA 4FC7A 4FGSA 3WGIA 2H1SA 4J4BA 1N9GB 4IQGA 4JBGA 5EINA 5T5QA 1EVYA 3DDNA 3VVCA 2BMAA 4CR7A 2Q2VA 4AJ2A 4E5YA 1ZKMA 2DUWA 1U7HA 3VHRA 1HWYA 1IE3A 3VZRA 4D0RA 1ISFA 2O3SA 4MP8A 4Z0PA 1JAXA 4LCEA 4XQEA 4GKVA 5TRTA 3ST7A 3IDSA 1EUCA 2ZK7A 5ENVA 2CF5A 1I2ZA 1XU9A 4JNKA 4BQRA 1LQTA 2HO5A 3F5QA 3W8DA 5DBGA 4RCVA 3ZZNA 4CMBA 4GLOA 4RVDA 4C7JA 4UEKA 3GFBA 3FPLA 4ZD6A 1GADO 1NP3A 1YOVA 4BO7A 1HLDA 1LRJA 3BTUA 2C0CA 5CPFA 5K9ZA 1UDAA 2EKQA 3EZYA 2CVZA 2PV7A 1Z75A 2HMVA 1KVSA 4E12A 4EDFA 2JHGA 1E5LA 2VRCD 3PHJA 3AFMA 1E1NA 1A4UA 1UXJA 4BV8A 4Q3EA 3W6UA 4YXFA 3JTMA 1KVRA 3LC7O 2XXJA 5F21A 3DMTA 3OJFA 1P31A 3EAGA 3ONFA 1UZNA 3U4CA 3ZHBA 3ZWWA 1KBZA 2ZIZA 1YB1A 4TKLA 4U5QA 3V8BA 4HFJA 3UUWA 5ILOA 3JQEA 3CMMA 3E1KA 4DTIA 1E3EA 1ZH8A 2PD3A 3NKLA 1BTOA 5L4LA 4E33A 3AY7A 4PRLA 3WLFA 3RBVA 4RVUA 4YR9A 4OSOA 3EGOA 1ZMOA 1GY8A 1ZSNA 2WD7A 3GEMA 8ADHA 3UGKA 2FSSA 1EK6A 3D5QA 1I3MA 4J6FA 2FR1A 3GAZA 2B4RO 5EMHA 1DRUA 1PWZA 3AI1A 4FC6A 1DIBA 1F17A 1YL5A 3GN1A 4KWIA 1IHXA 2GDZA 4MOWA 4II3A 3NUGA 4I5EA 2IRWA 3CZMA 3F46A 4RPJA 3INRA 2QYTA 4UVIA 5T6BA 2GGSA 5L3ZA 3K5PA 2Y1CA 4R69A 1JKFA 5DCWA 3KYDB 2YY7A 1V35A 3NDIA 3B6ZA 3VPFA 2GASA 3AM3A 2Q1WA 3H3JA 3X2EA 4U8GA 1HXHA 5I7SA 3V1YA 4M87A 4NU5A 3ULKA 4HNGA 2AQ8A 3JQGB 2Y0EA 2JCYA 3O26A 3LF1A 2CF6A 1EZ4A 1PQWA 4NDNE 1GYPA 1GL3A 3DAGA 3PHLA 3ZWOA 1RM3A 1RYDA 1PEDA 3D64A 3HNPA 1I2CA 4ZGWA 4P38A 2E4AA 2G0TA 1E1MA 3TN7A 4DVJA 4N5LA 2OXIA 3PYLA 1RM4A 2DBVO 1BXGA 4HXYA 2HQ1A 2E82A 4KDEA 1O89A 4J9UE 4OIMA 3VAZA 2I3AA 3PZBA 4NHEA 1Z74A 2AHRA 3DR3A 4CV1A 1Q1NA 3H5AA 3OIGA 3ETDA 3LF2A 4UEJA 4XEHA 1YQGA 2P5YA 4XYBA 1I3LA 2HCTA 4CQMA 3Q2IA 2A4KA 4KMSA 1TT7A 2QRKA 1GPJA 5L4NA 4F6LA 2FR0A 4B4VA 5DBIA 4AJHA 1DIRA 1AXEA 2NVUA 1NQAO 4RPKA 5L53A 3CE6A 1NHWA 3G17A 1IB6A 3PQFA 3KLMX 4BNYA 3HFGA 3U49A 3WTCA 4XX0A 2X5JO 3VTFA 1YH3A 2RHRA 2VWGA 3LC1O 4IBOA 4YAGA 1Q7GA 3F1KA 1AGNA 1IULA 2NWQA 1PL7A 5A03A 3OICA 5L7WA 2AMFA 4CUJA 4P4NA 4QQRA 3TDKA 3I23A 5BR7A 2VT3A 3JD4A 5HWSA 5K0ZA 5L9AA 5DF1A 1K0UA 5CEFA 3QW2A 1BWSA 3IP3A 4ALJA 3NV9A 4CLHA 3ADPA 1ZK3A 4QO8A 5EERA 2VHYA 4XYMA 2AEMA 1MG5A 3IJRA 4E0BA 1AHIA 4J90A 1P74A 1PIWA 8LDHA 2DAPA 1YDEA 1ONOA 3TZKA 4BNNA 2AXQA 4RORA 3OJEA 2VHWA 3GPIA 2E37A 3RUIA 3RCBA 1ISIA 5TF4A 3W4KA 2VN8A 2Q99A 4MIEA 1ZW1A 3WGGA 5K6AA 5A9RA 2D2IA 1H6BA 3DBLA 3KZVA 3GA0A 4E5PA 2AEFA 4YAKA 4BO9A 1DRWA 3LZ6A 4P4LA 4GL4A 3L6EA 2HJSA 3KV3O 3WYEA 1ZK4A 3DC2A 4WLFA 4ZQFA 1H94A 3UHAA 2W8ZA 2JD2A 4OAQA 1N1EA 3C1TA 5JPIA 1WDKA 2O50A 4TRJA 3VZSA 4LMPA 4TVOA 3HFSA 1C0IA 4BO4A 3D3WA 4OO3A 2I65A 4BMVA 1C0PA 3DHYA 2QRLA 3ABIA 2G17A 2Y1FA 4KQXA 4GWGA 3GT0A 3V1UA 3QLJA 3NJ4A 5T64A 3RBZA 4NJMB 1LU9A 1VC2A 1YRLA 3WQQA 3OH8A 3WGHA 5TIIA 3BTVA 3FCOA 2VWPA 1VKOA 3TZCA 3NEPX 1BXZA 2NSDA 1JWBB 1D3AA 2H5LA 1MGOA 1SB8A 2GCGA 3UF0A 4L74A 3HZZA 3OA2A 2EW8A 2IDZA 4UUNA 1B3RA 2QQ5A 1E7QA 1EQ2A 1LJ8A 4EUHA 1QXSA 5F5NA 1I8TA 3O03A 3PHGA 1M75A 3VDQA 4IDFA 3JYNA 1N8KA 4CM4B 4YRDA 4DMLA 1PS8A 1PJSA 4E30A 4IS2A 2B5WA 3GZ4A 4I9HA 2VRCA 1XHLA 4D43A 4FFLA 2R2GA 3S2GA 5TT0A 1MX3A 4Y6PA 3GVPA 2FPGA 2I99A 1BMDA 3TZHA 2JCVA 3WB9A 4EITA 2ZJ1A 2Y1DA 4K26A 4YJFB 3TL2A 3PWKA 4RF2A 2X22A 4YPOA 1LDEA 5G0UA 4GPD1 2ZTVA 1VPDA 3KXDA 3QWIA 2FPIA 2PR2A 1ZEMA 5IZCA 1U4SA 4E2YA 1Z7BA 3PFWO 3SLGA 3PXXA 1R12A 1ZJZA 3A28A 1I30A 1U8FO 1HDGO 2J6IA 2WSBA 2QRJA 4IQ8A 5I8WA 1B15A 5KJ6A 3MTJA 4GSKA 1O9BA 2FN7A 2IYPA 1ISMA 2XPCA 1LUAA 3FTNA 3JD0A 2UVDA 2P9EA 4WPGA 5B12A 5KOIA 1TXGA 3KUXA 4KP7A 1B16A 1VRWA 3QIVA 3DOOA 1L7EA 3S2IA 1IPFA 3FR8A 5LDHA 2BFOA 3T4XA 2CDCA 1T1RA 4YDRA 4O6VA 1G0NA 1U1IA 4IJWA 1T24A 3G0OA 1K6IA 3H4VA 3VKVA 3KBOA 1YWGO 4U0JA 4R1TA 2PY6A 5GZ6A 5KWEA 1U3VA 4RF5A 5EIOA 4RF3A 2QG4A 3ZU2A 1E1LA 2GZ3A 2DLDA 4UVDA 5BSGA 4GKBA 3ZW8A 1ZSVA 1I3KA 4GMFA 1DC4A 5KCZA 3DQPA 4PLGA 4CQLA 2EP7A 1OOEA 3EVTA 4XYGA 3RFXA 3B70A 3M1LA 4D3DA 4GMGA 2OP0A 1B8PA 2OFPA 3PYMA 4DPLA 5CDUA 1VL0A 4IQ0A 3HQ4O 4BGIA 5EN4A 1ZXBA 4ITUA 4JLWA 1MA0A 1P1JA 3HSKA 3IKVA 2IODA 3CPSA 1FDTA 3H5NA 1M66A 1UAGA 2NVBA 5BSEA 3WJ7A 2BLLA 1JA9A 4JJGA 3F4BA 1HYEA 1GYQA 2W4QA 1B0AA 1XIVA 4D3SA
chains in the Genus database with same CATH superfamily
2FSVA 3UMVA 1UK6A 3HKEA 4J0EA 5TARA 3TDNA 1LS1A 3RBAA 2XVXA 4C0SA 3KAJA 4AY5A 1NVGA 1R6XA 1SBIA 5JSZA 3LU1A 1P5ZB 3SEAA 1WO8A 4KXFB 3ELUA 2Z09A 3NBFA 2YHUA 3O3OB 4D57A 4X84A 4IOJA 1GQSA 5AM5A 3R7LA 1TM1E 4L3OA 1ZYUA 1NF2A 5FBQB 1M6WA 4NS4A 3LCUA 1XHEA 1H4VB 2WWFA 2YW9A 2CSXA 4M1EA 5ALQA 3IR6A 5FLKA 4IIHA 3K9NA 1YFLA 1C1XB 5HJEA 1ULAA 2PKQP 4BP3A 1YQ9A 3O38A 1NZJA 3TYXA 2WWHA 4FGLA 3QLVA 4FQ8A 3OX1A 4R2KA 2G9VA 4EMTA 4CKEB 1WVGA 1Q0TA 3PCXA 1LI5A 1UH5A 2BGKA 2ZGVA 2EZ9A 2HXYA 3EHDA 3F7TA 3AEZA 3I01A 3UMCA 5K05A 1LCIA 4IF6A 1EFTA 4DC1A 3QX8A 4MVJD 1IY8A 4JIGA 4EY5A 1HG0A 3ZCUA 4ZT5A 1CJCA 3I6YA 1C0LA 4C0KA 1IATA 3FGOA 5B2FA 1U9YA 4Q93A 2DWCA 1BJTA 4KQWA 5JZOA 1RYMA 4PSKA 1Q7CA 2VJAA 3FX2A 5BSKA 4Q16A 1R0KA 1VDZA 4JOCA 1T25A 5EE1A 4ONEA 2PZFA 1U9IA 1REQA 2JARA 2RGYA 2OFWA 4QOGA 4AT1A 4DDMA 4D25A 1PUIA 1XDZA 1ISJA 1Z6XA 1JG6A 3N2YA 3COYA 1SBQA 1QV9A 3SQXA 5HOQA 3CN9A 3RSHA 1NOJA 4CIWA 4UU7A 2Q28A 3WGTA 3KOYA 4NV1A 3KWJA 5T8KC 3AZPA 3CX6A 1U6JA 4U7TB 5GIPE 2HA3A 1QHHB 1YDFA 3NAZA 3FVWA 4Y2PA 5IM4F 2G4CA 3G02A 3KR2A 1HC7A 3AEUB 1JEEA 1QIMA 4KGZA 4ND2A 4NEGA 3VTFA 1JT9A 3WVNA 2IS2A 1XLTC 4C0JA 1NQOA 1UJ2A 1Y3FE 2EFGA 1JEAA 4II7A 3F5FA 4NMHA 2GN2A 4I9NA 1GZHB 2VTBB 2Z1MA 4DYHA 5I01A 1IHOA 5AW9A 1TVCA 3EY4A 2AMJA 1VBFA 3GQBA 3HO8A 2PKWA 4UEWA 5CYFA 3TXAA 4E88A 4QG3A 1BA3A 4PO3X 1JJBA 4JI1B 4KLZA 5EHXA 3NANA 2EZUA 5CRIA 1I7DA 3DTYA 3DWEX 1KIAA 3SU8A 3ZJTA 1EPUA 3AJRA 3NYQA 1U0JA 3L5OA 3QSGA 2X5XA 4RTJA 3DMDA 1ZOIA 1P4HA 1Z37A 1ZP6A 4OFZA 1ZVMA 2Z5LA 5KSYA 3WIBA 1S2IA 1CK4A 5CVVA 5BV8A 2XA1A 4C6TA 4HWTA 2Y9MB 1BXRA 1WMAA 3CJQA 3IMEA 4MR8B 5FYQA 4DYDA 4OMDA 3EVEA 2YMLA 3I6ZA 4GVPA 3UGTA 4EARA 4F9TA 4RADA 1ECGA 4J4HA 3WNCA 4AZWA 4BVJA 1MAWA 1MPXA 3GA5A 3SQDA 3OPMA 5EESA 4BB0A 4FJ0A 2RAUA 3HPRA 2WIFA 5A1TA 4B7XA 3TZLA 3AHGA 5AKGA 4CDRA 1FFXB 1UL1X 1GP2A 4ZGGA 2CXOA 1JQKA 2GPNA 4MB2A 5FPHA 1YVDA 1RP1A 3GVCA 4B47A 3KQTA 4GI5A 2I76A 1R0XA 3EZ7A 2ZT8A 3QMVA 4GC9A 3K15A 2PSHA 4LZJA 2X42A 3H9CA 3WLEA 1PZNA 2H1FA 2QTZA 3I0ZA 4LISA 4M8NE 4WVFA 3VXKA 1H0SA 1WDLA 1Z25A 1Z08A 4A6EA 4BCCA 2XB2A 2ILTA 3T1VA 2GA9A 4LGVA 4CTJA 2V5VA 4PCLA 3KSRA 5TQ0A 2FPPB 2VAVA 5MFZA 3W9YA 1AY0A 1DC6A 2Z2YA 3OLQA 1HQCA 4KQHA 2EX0A 3TIGA 5BYJA 5A4MS 1WF6A 3IAS6 1RXWA 1OYOA 1Z2NX 4HWPA 1CIVA 4LXUA 2QD1A 3ZBUA 4MQ6A 1G291 1PT8A 1X9HA 8GPBA 3LUAA 3R6DA 5IXSA 2QUBA 2M1ZA 3RSCA 2DSNA 1N6KA 1GTG1 4BMDA 3B1KA 3EXHC 5H68A 3L79A 4ES6A 1BG6A 1ZU5A 1K2VN 3OQVA 5LMZA 1Z73A 3K92A 3Q3GE 4G65A 1RKQA 1TA9A 2VDWA 2DUMA 2XOKA 2HREA 3EXIA 2P0EA 4TLLB 1MOSA 2GO1A 4CEJB 2G6TA 3LT0A 1UXHA 3I5AA 3ZHYA 1W59A 3A4VA 3EGXB 1W7AA 2VOJA 1SD1A 1UDXA 3MD9A 3TPFA 4CF4A 2K87A 3ORHA 1NMZA 1Y4UA 1KBOA 3GXBA 1VJRA 2W6IA 3IP7A 4RVHA 1GD1O 3K0EA 3T7AA 5BN3B 4E15A 1UK9A 1P7VA 4LYFA 5D85A 4OY3A 1ZAYA 1K5HA 1FQOA 3BH7A 2EW1A 2CCKA 3CEHA 3NGLA 2I8AA 4MUMA 1LC0A 2BMJA 1U7DA 1CHDA 3ZI4A 2JI7A 4GM1A 1ADGA 1XLWA 1Y5LA 5FPPA 2EP8A 4YO7A 3FJOA 1B6RA 2D7JA 2HJWA 3OWHA 5IDVA 4HAWA 5DHAA 5KTRA 4TYYA 4Q3DA 3RD5A 3EZXA 2FSHA 2PANA 4GVLA 1PGOA 2QD2A 1CS0A 2OBMA 2I2DA 4TS3A 4CFYA 1BS2A 2ZE5A 1AKQA 2QYHA 3QVXA 4NNOA 3UPUA 2J5KA 5KNBD 1TM4E 2D1YA 3GWGA 4WXRA 1P1CA 2W58A 3HYCA 4ZVSA 4BWYA 1KI1A 1FJHA 5FWNA 3K32A 2BVNA 3RSLA 3WJ1A 2CLEB 2ZTLA 1JSRA 2F64A 1IBRA 2P40A 2F48A 2G4LA 1JLLB 2PA3A 2ST1A 5CFPA 2ZB8A 1CY0A 3DMHA 2XKAA 4OI1A 4IMIB 4JUFA 2IYYA 2Q4EA 2O5CA 2VSYA 4MYCA 1B1AA 2ZJ2A 3EUWA 4PW0A 3LRPA 1JWAB 2W98A 5IT9A 3ML1A 1CDDA 4FFMA 4MWGA 1XZIA 5TJHA 3SNKA 1NI4A 3RROA 4M98A 1AH2A 1OYVA 5KMGB 3VZPA 2GTIA 1KAOA 1RRFA 4MV1A 4B9EA 3G7UA 4DNXA 1LI4A 2O7VA 3UJHA 5JH7F 2NZXA 2DHEA 3EQ9A 2ADOA 3LQQA 2Y92A 2DB3A 1RTTA 1ETUA 1U8ZA 3DDZX 2CN1A 1S2LA 2D0PB 3DV0B 3OQIA 3HPQA 4DNPA 1L1QA 1TPZA 3GLIA 3ER8A 4INZA 1ODJA 4BMNA 2WEKA 4TPKA 1QE0A 1QR6A 5CYOA 4B2YA 2QJWA 3JASB 4RJLA 1GEGA 1IUOA 1Z0JA 2BSQA 4MS4B 7YASA 3DOUA 3QY9A 3VNSA 2Z3WA 1RM0A 5KJ1A 2ONYA 4HWOA 3HXMA 3QKWA 3RYCB 2AD1A 1Y1PA 4CWAA 3BHJA 1IBKB 2ETXA 2E7ZA 4QT0A 3ROTA 3KTOA 5HF9A 1J0AA 3LDUA 1JG3A 3DONA 4NMWA 2ZIUB 2H08A 1PDVA 4G26A 1V95A 4K8OA 3FH0A 1OPRA 3F7NA 3LVFO 3FUXA 3TL3A 1WY5A 1EFRD 3ZGYA 1BHJA 2H7CA 1YR3A 2JL1A 2O1EA 2X6TA 1RXIA 4GO1A 4B87A 1D6MA 3D54D 5CVJA 2XCOA 1NX6A 1OY1A 1S7CA 3WLSA 1EFLA 3M7IA 4ZOLF 4LW8A 2JIDA 2WM2A 2W6CX 5L7TA 2OP1A 3BULA 3OQNA 3P27A 4MWTA 2I0FA 4DIFA 2Y2VA 5JNUA 3EW7A 4KV7A 5BT8A 3H11B 2MJLA 4FOSA 4IDGA 1AG9A 4H7PA 4ZV7A 4CKEA 3VYSB 4AS1A 4AZSA 1FA9A 3I76A 3DXFA 2P41A 2IE0A 2DT5A 4H6PA 1Y8RB 2OBFA 1TK2A 2XUHA 4YIHA 2ORWA 1OH7A 5K8CA 2VBFA 3WGOA 1ZWKA 2XRFA 3UENA 2JA2A 2R7KA 1E8MA 3GXOA 1DKRA 2MSNA 3DAOA 1PG0A 1Y6RA 1CJKC 1JX6A 2X1HA 3K4PA 1AV7A 1TECE 4D9EA 3TSCA 3GCZA 4WXYB 2XT6A 1A8SA 2GESA 3D0KA 3N58A 5COBA 4BO1A 3KB1A 4IVRA 4LJRA 3P19A 4OI0A 3N2GA 3WC4A 2Z0MA 1IVYA 1Z5ZA 3PENA 2UU9B 1DEHA 3RF7A 5DXJA 4LY0A 1Y5RA 4Q47A 1XHFA 4Z4CA 4OHVA 2EJTA 1JHVA 3ENNA 3R76A 4ERNA 1EGAA 1ZNYA 1WHTB 1NMYA 2DKFA 2PBFA 1MAHA 2QNRA 2C9DA 3VI3B 2YWJA 3BN3A 5KC9A 1CEEA 3ZWPA 2QN6A 1LDMA 4Q1CA 3W2HA 1DWQA 2N1MA 3GOHA 3IRVA 1NJSA 1QGDA 2X0JA 5EXPA 3MGKA 3GLHB 3LTEA 5KSPA 4C21A 3H65A 1T35A 5HUHA 1E7WA 1HKUA 1MQAA 2W2MA 3AEUA 3M34A 3NO4A 5GMOA 4C4RA 2I9PA 4DFDA 3IO3A 4KX3A 3ORFA 5BXYA 1SAYA 5KNCD 2PH3A 3COZA 4C30A 4URWR 1K8YB 1WWKA 1JQDA 2XZPA 3Q88A 4J91A 4Q48A 1PLLA 1D2AA 3W90A 1G3UA 2VTBA 5L40A 4MP6A 5I5EA 2H0RA 5E1DA 2XOEA 3UXEA 5LMCA 4LXIA 3CRQA 4HF7A 3TLAA 4OYRA 1A71A 1MO5A 1N0WA 1X74A 2BWJA 3PNQA 4JLUA 4MKGA 4RH0A 3WHKA 3WK5A 4DUPA 3V4PB 5C46F 5J59A 2FMHA 2YRXA 3IJ5A 2JKYA 3F4LA 1Z35A 3N8DA 4FMDF 2JATA 3ICVA 3MT8A 4CMEA 1SFRA 4X90A 2OB2A 1A95A 2Z5FA 2XWSA 2CLKB 3A32A 1WW2A 1LGYA 1QIEA 2I7VA 4XIGS 4OREX 1NXTA 4XUCA 5A3VA 3EXFA 4I0WB 4FUQA 3PJDA 2ZVJA 1N6NA 2ZRLA 1RRGA 3NPMA 5KJFA 1WXIA 4MARA 4MR8A 1CV2A 2C42A 3TLXA 3VPSA 4YS6A 7MDHA 1IZZA 1P1FA 4KR2A 3FVTA 5DNCA 1K2WA 1NW4A 1RJFA 3QQPA 2Q5QA 1M2WA 1PS9A 3C24A 1T5HX 2N75A 4CIYA 3FPBA 3U81A 4L8VA 4N0DA 5HPYB 3LUDA 3TH5A 1G21B 5F4ZA 3HU1A 3H9UA 4M8SA 1ZN7A 1Y5IA 1UDRA 2RSLA 3DMTC 4PCVA 5GY7A 3KT6A 4P7FA 1QTNA 4ARZB 4A2QA 2J7KA 3CLUD 4FEAA 3WLTA 4OHFA 3DZKA 3SOPA 3ZE1B 2QENA 2QL5A 1RS0A 4A8PA 2XMBA 4JQZA 4G5QA 4HVTA 4L0QA 3RHTA 2FMKA 4N3NA 1CRPA 3E05A 1H85A 4NYMR 4RW0A 4ZN6A 2FPPA 3R0QA 1VKJA 2V7XA 1T0JB 4K9PA 4ZYYA 3MSXA 1HT0A 5I7VA 3L3BA 1LQUA 5CP8A 4HDKB 2O2IA 1ZGAA 4JWTA 2X4IA 1T8RA 1P17A 4MMZB 5E2AA 5EUCA 1XXHB 4BX3A 4QHTA 2GETA 4OBXA 5I7FA 4ZT3A 1CUBA 1CUSA 4P92A 3ZW9A 4KKVA 1UOQA 2YFKA 4WY5A 1XZMA 2PKYX 1EVKA 3JQAD 3IUNA 4D0SA 3LCJA 1HK7A 5IHPA 1FFHA 3BZUA 5BXQC 1QTQA 5ALTA 2FKAA 4BNKA 5AM4A 1QG2A 4MQBA 1Q5PA 2TMGA 4DWVA 1Y3AA 4WINA 3S55A 2EOAA 1PGQA 3BFPA 1RHRA 2JLYA 1U94A 1ZGCA 4RVFA 3S27A 1L5RA 4PVDA 4Q12A 2HDWA 3ESCA 3KHKA 4F5YA 1NV9A 4HAUA 1P61B 3AFHA 1BGXT 1DFGA 4J0DA 1UFRA 3PRHA 4P86A 5JTUA 4TZTA 1ZLYA 2PUAA 1MOPA 3AWIA 1FU8A 1DX6A 1RBMA 3SS9X 2C54A 2WMDA 3OP1A 2QW1A 4ND1A 1DC3A 1V96A 1WNTA 4RANA 1IBSA 3NJRA 3QKRB 4WNAA 4NQZA 1C30B 3ZVLA 2WHYA 4MINA 1DSSG 1K86A 2DYKA 2YR0A 3U3OA 2PZGA 3F6CA 3DVSX 1HL3A 2DQYA 5NULA 3PYXA 4EHBA 4BB9A 1Y6GA 1SPBS 4NAUA 4KBYA 1W36D 2HLDD 1MTOA 4ZDWA 4ETWA 1UEXC 3L7JA 4DCCA 2A94A 3NT5A 4UW9A 4CFZA 1TIKA 3MFQA 3OKPA 2O2YA 5F5XA 5JMOA 1CQIB 5CA0B 3B9PA 4O4IA 4XWKA 4QD3A 3IYLW 4B31A 1CEXA 3EF1A 4A27A 3D8BA 4M9ZA 3X0DA 2IE8A 3EXHB 2QRZA 2A8YA 3MT0A 4FFDA 3SIPA 1NVVR 1YCHA 3EA5A 1QU2A 5H81A 3NC0C 3EPKA 4MYSA 1SXHA 4HN9A 3J7TA 1GFZA 3TKLA 4MRMA 4LJ7A 5G2OA 2FMFA 2VHVA 4JR2A 4UXJA 3AONB 4WOCA 1YL7A 4RBNA 5TPZD 4ATNA 1PFWA 1K7EB 1T1GA 4RDCA 1SBZA 3I04A 2YFQA 1Y7PA 4BPRA 3UUGA 2L19A 1G8MA 1QBKC 2X6QA 4UFPA 4HEA1 3RKSA 2Q2WA 3MCZA 4LG1A 3AIIA 4N03A 4UPEA 1AMUA 1QBGA 2VHXA 4JB2A 4EI9A 2VXBA 4JWKA 1SOAA 4OGFA 4UEOA 3OZEA 2PVCA 1C0KA 3TB6A 4C3ZA 4N01A 1DC5A 5FORA 2ZULA 2ZB3A 3KAKA 2GWHA 3P94A 4H18A 4H77A 1QIDA 4MV5A 4TT3D 4HLUA 1L7OA 3ON5A 2V45A 4Q21A 1NN1A 3OQHA 3SJUA 2ZIAA 4WT7A 1Y0BA 1ZBQA 1OFUA 4U6QA 4R2HA 5IM5A 4D44A 4E70A 1ZJWA 5IKEA 1MV5A 2HDNB 3JASA 5KQSA 2J46A 5JSHA 2OBXA 2OV8A 3NR2A 4KXXA 3D1VA 4E1VA 4DRXB 4NCXA 2DWOA 4BKMA 4EHDA 3QTLA 3M1YA 3HBNA 1GNQA 1E2JA 1CQWA 3O8CA 5ELXA 1HDRA 3L77A 1P62B 4OI2A 2IKSA 3A6JA 5EGSA 1CUWA 2NNLD 3L04A 2C95A 2NU9B 5CEJA 1R4AA 1E99A 4K5QA 2CFCA 4URVR 2X19A 1IHUA 5EEHA 4EVIA 1HLPA 1A72A 1AQYA 4UOZA 1PZHA 5KS2A 3HYNA 3AR9A 2JAPA 3SZLA 4AXBA 5JASA 1A98A 3BF8A 4E6EA 3RS8A 3M6FA 1GUZA 2E6UX 3UPDA 2O2SA 2REXB 1I0LA 2FWMX 2XJ4A 2ZBRA 2IHNA 1V7PC 2O52A 2FEOA 2QD5A 5J2UF 3OKCA 3OURA 4YVFA 1SVNA 2JFUA 1S8FA 1M6EX 1SGWA 2CSUA 4DG9A 3MM4A 2C2GA 2R1ZA 4B8WA 1UZAA 4WACA 4WOKA 2BF7A 1GUFA 3VYRB 3PU6A 4E51A 4F9EA 4LV8B 2BSXA 3ZI0A 1FOEB 3GLIE 3CURA 1CZNA 2IVFA 2AN1A 3E84A 4ZDIA 2P9JA 4N8DA 3RTAA 3ZNPA 5JNLA 2GDJA 2R8ZA 5F7XA 1Y8RA 5KWSA 2W2VA 3JVVA 2K7FA 3FZQA 3W6NA 4ZMSA 3CH4B 1QF7A 2ZJFA 5EJ4A 4MRRA 1K3UB 1GPWB 2V6IA 3AX6A 4QYTA 5DNDA 3V1MA 1R6BX 4JYCA 2VDQB 5KDOA 1I24A 2GQ0A 4TUYA 4Y6SA 3TNJA 3P0IA 5I9LA 5DYNA 4X65B 1FUKA 3HJHA 1K89A 1HZZC 1OIVA 1Q15A 2OHOA 2VYND 3R6WA 4IZHA 4RLSA 4YUWA 1RCTE 1P1KA 1YR9A 2FW0A 3DCJA 1NJ6A 4EUEA 1IBLB 3HYRA 2J6BA 2X13A 5ECGC 4N76A 2X4GA 3AF3A 3BE5A 3O93A 4EW2A 1N32B 1E3MA 1VPVA 2JCSA 2K6GA 2CLHB 1IUKA 2XYRA 2NXNA 1XTIA 2PTGA 1EDZA 2AN9A 4BZWA 4YMHA 2QZZA 2WWGA 3F98A 3T1HB 4GRAA 4R6XA 5AKZA 4KQIA 1NN3A 4Y2VA 4BY9E 1DARA 1I4OA 2B4KA 2GZ1A 4CEIA 3LDHA 1UPFA 2PWZA 4NZMA 1VCMA 1T10A 2GD2A 4OYLA 3NJ8A 4BO5A 4QRIA 3P20A 3RIHA 1O58A 2AJTA 3BS4A 3RRBA 1KI7A 5C8DA 1YDWA 1RKXA 4MQ4A 4N54A 2G07A 1PK7A 4MV3A 3BMNB 3G3EA 4WZAB 1GGJA 3OE7D 4BMCA 1CB7A 4MROA 5F9MA 3FJ1A 1W0KD 2P2ZA 5CGZA 4FSHA 5IEBA 1NA5A 1ADCA 3WGKA 1WVMA 1EYZA 3LDAA 4L73A 3UB3A 2B3DA 1IVSA 2FE1A 4MPTA 2F1IA 1WV1A 1SOUA 4H08A 1Y6JA 3U3JA 3MAGA 4DLTA 3K35A 3D6UA 1XZQA 2R4UA 1YFZA 1HEUA 2GN6A 2VRBA 2VOEA 4ZDJA 2ZYWX 4O1IA 4F4FA 2Y1EA 1MAVA 3FZYA 2D3TA 1IM2A 4OMUA 3KYDA 3VNVA 1JW9B 4FR2A 2GEJA 1THMA 4O2AF 4EP1A 2NSHA 1HDXA 1U8AA 2Q1XA 1L5QA 4IY1A 2O8CB 1B2LA 2ZFUA 4Q03A 1SUBA 4XOUA 1R5BA 2JRLA 4XWOA 1XKTA 1L3IA 3L1JA 5K8VA 4DV7B 4FW9A 4H4EA 3PNYA 4R1QA 1IPHA 3I0MA 2FZEA 1H0RA 3OLYA 3SR3A 2HCRA 2BGMA 1KEPA 5IZCC 5JRJA 1WL8A 4CJXA 1T1EA 3MC1A 3C48A 2D3WA 1O0BA 5K8IA 4NI5A 2PFSA 4RDHA 2XCIA 2OKGA 4ARAA 3TLGB 3G23A 4TS4A 4YMWA 1WZ2A 3RC8A 1E79D 4BFXA 2G4VA 1Y9AA 1I80A 3BEDA 4QWMA 1SUSA 1V4BA 1XLTA 1FBNA 3IVRA 3Q11A 4OJYA 1ESMA 2EZ8A 4ARZA 2VHJA 3E2IA 4EB3A 2VJNA 3GP8A 1XQYA 3MA0A 4URYR 3V9AA 3NP7A 3D0RA 3RC1A 3P0JA 1EGQA 4OKIA 2Y66A 4R71A 2AFIB 3P9SA 5ED4A 2GBPA 4H0NA 5LD2B 4JB0A 3TGWA 5ARCA 1OTYA 4KPGA 1T9ZA 3E18A 2NTJA 4PQGA 3JAMA 4YXWD 4BRUA 2WR8A 4HDKA 4NCIA 4BVFA 1VA5A 3ET5A 3FMOB 1E3LA 1XRNA 2QD4A 2C1XA 1GCAA 3CUTA 4QECA 4U7DA 2V1XA 5J2UB 1JHAA 4B4KA 4EUFA 1JVNA 1YIAA 4XVRA 2FPRA 1JYFA 4HUJA 3Q7SA 4JC0A 4Z7JA 4M1TA 3IEMA 1P0MA 2GXQA 3P71T 1SHZA 3OC6A 4HO1X 4LTDA 5EXDA 3FW1A 4D9HA 4EJ0A 4ARIA 2CLOB 2OR3A 3L7LA 1E3SA 3LGAA 4GGMX 2ACEA 4QE3A 3SQLA 4BGUA 5J1SB 1E9FA 1E5TA 4Y7CA 4X8HA 1KJ8A 1FDSA 5IAAA 3HM2A 2ECPA 4ALMA 1RXYA 1AS3A 5B1SA 2BKLA 2CXRA 4AFNA 1PQUA 3A7DA 2CXQA 2VT6A 3Q2KA 4RTQA 2SNIE 3ER6A 4EPVA 1B6GA 3B2NA 3LUFA 4ENWA 4NF2A 2X8LA 3HUFA 4KDRA 4M9CA 3RVKA 4D9IA 4GR4A 1YA6A 5K8LA 1WBDA 1G4HA 4X3OA 3NNNA 3CSDA 3ZZUA 1Y98A 3KTDA 4LDZA 3RS9A 2BP7B 3V34A 4F46A 3W5CA 1LBSA 1ATIA 2W83A 2WT8A 3QKRA 5DPMA 1SKYE 2JKZA 1C30A 1VHTA 2BFPA 2KYRA 2AC4A 4NOKA 5AQ1A 1SVKA 3B1VA 3MQ2A 3H0EA 4UMVA 5LP6C 4AIRA 2EX1A 1JP7A 1SQGA 3LY8A 2PS9A 3OEWA 5SY6A 4EL0A 2EW2A 5LJIA 2R6AA 1RQ7A 3AETA 1R0SA 4M36A 2WE7A 5LZ9A 3EOZA 1CYEA 4QTUB 3LFHA 5CT6A 2V7VA 2EFHB 5CA0A 1Z82A 1H2BA 1KYZA 5G3YA 4DA4A 3GYGA 1X1BA 5AD1A 2FZWA 1GQOA 3LUCA 1F2VA 4K05A 4L6AA 3STTA 1KK2A 3QZUA 4EJ6A 2WWYA 4X7BA 1Y7LA 3K4QA 3CF4G 2GM5A 4L4SA 3NONA 2ZE6A 4ITRC 4M0UA 3BK2A 1LPSA 3GH3A 3VZQA 4HJXA 3FHTA 3HMQA 2P1RA 4XOIA 4RKFA 2C9ZA 2C9MA 5AOVA 1DAHA 5GGYA 1PVOA 1P0CA 2AI3A 4KQGA 3O9ZA 1JHUA 1QYVA 1Z5UA 4IOKA 4Y0AA 3UAVA 3W9SA 4QU9A 4JUDX 1MRNA 3IJPA 2BBSA 3ZNNA 1FPMA 1V41E 2A0KA 4PQEA 5F12A 5DW0A 5E6UA 2VDVE 1SBYA 4H4CA 1JMVA 2ERXA 2C31A 2P2SA 2PT7A 1R0CA 4LYYA 5CXSA 2ZUWA 1C3XA 2D5BA 4LF5B 2W6JA 2GCOB 1P3DA 4JJZA 3ADBA 2QN9A 1ILEA 1PZFA 3CM0A 1ZIPA 2VZ9A 3NTUA 2BELA 2CYBA 4U7WA 1UBJS 4I5FA 3HN6A 4GLLA 5EFZA 3H83A 1RRMA 1XL0A 4CM7A 5GGXA 5AK0A 2P6OA 3AP3A 1A5AB 2ID4A 3Q7PA 2Z5VA 3V9PA 2V0GA 2F9MA 3GH1A 3LBYA 2V59A 3BSYA 4MXDA 3Q7EA 4HMQA 3B78A 4KQMA 4DRXA 3SZUA 2I5PO 1QE3A 3DHVA 1I7QB 3JYLA 1Y42X 4RTSA 5DULA 3VO8A 4ALLA 3VNUA 4M86A 3O90A 1S2OA 4EG6A 3LWBA 3L7YA 3UBTA 2J3QA 2VSQA 4GGPA 2HCJB 4IIUA 4IRXA 2QORA 3F9RA 4MPJA 5ENDA 5B3KA 4CL2A 3G0BA 2XITA 2FQ1A 2VJYA 3A9SA 5I4KA 2ZYUX 1R10A 1PUXA 1G6Q1 4B74A 3ZXSA 2IPLA 3OLZA 1ONNA 2ZP1A 3V55A 4D80A 2CVQA 4DWWA 2DR0A 4H7KA 4W99A 1WP9A 2OXEA 4KWCA 4HB2A 3DEFA 4UKDA 1YKFA 3K9BA 5K3CA 2G0NA 4ZVNA 4HDMA 1EAMA 1ES9A 3CW9A 1J23A 1EE1A 3MJCA 5KJEA 3RHZA 3SJZA 3AOGA 3MRTA 2GB4A 1GFIA 3OE5A 3ROMA 5T4HA 1OZ0A 4HGQA 1T2AA 2NVUB 4A1FA 1K8QA 4FQ5A 4BNXA 1NVEA 5FLYA 2EKPA 2B7BA 1XX6A 2AKEA 2BL4A 2NGRA 2QVBA 1VJGA 3I6BA 1JA0A 3KJXA 4XQCA 5DN6A 3LBIA 3UYLA 3HVRA 2PIDA 2C03A 4FYKA 5IVIA 3X2SA 4U3JB 1PF7E 3ABRB 1XA4A 3FIJA 3FPAA 1KZGB 3HVKA 5HBGA 2OWEA 4N3BA 4A5OA 2IYWA 1NTOA 4DEYA 1SVIA 4M49A 1CRLA 4K40A 5JD4A 3TIIA 2PG3A 3OFVA 4FYHA 4OJKA 2P6UA 3VA7A 1A9QA 3E58A 3F1LA 3DTVB 4RM3A 3JU3A 1VE9A 2Y27A 4OHCA 3GMSA 5DCYA 1NBIA 4DMUB 4YRAA 1ZXXA 2QXUA 4ZXPA 1N8NA 5DSZA 5T6MA 4MWOA 4RKQA 5SYAA 2C82A 1GSIA 2OORC 2ZIVB 3QLEA 2OXCA 2FDCA 1RR6A 1Z22A 2Z04A 1PW7A 1T3HA 1IQPA 2NYVA 1PT5A 2QJRA 3BAFA 4CDMA 2YN4A 2C8LA 1PD1A 1MO2A 2FDXA 4PCAA 5D1HA 1IY9A 3WK4A 4DSZA 1G1AA 4N82A 1OXKB 4OMFG 1JDPA 1KP9A 3VV3A 4FYJA 2H8GA 4DW8A 1HNWB 1YJ8A 1EQAA 1XB2A 3OJCA 4MKZA 4P5EA 1NT2A 3BMNA 1J5EB 3HJBA 2LWIA 4LK2A 1BE1A 4Q9LA 3A6GA 4M2LA 1ZH0A 3H2HA 4ZI5A 5D8DA 1PJAA 4I5DA 2H52A 1OWOA 4F8EA 3L9WA 2AVNA 3OD1A 2IH2A 2H7XA 3BQMB 4XR9A 3ECAA 3W8EA 1GA1A 5B4UA 4RHXA 4CDGA 1OFGA 3ZI7A 4HLNA 3WLJA 3GP3A 4Z9YA 3U4HA 5JAIA 2AW3A 4MPPA 1QLJA 4S2UA 2QT1A 3U9SA 5ELMA 1JECA 2PYZA 1XZFA 1BVYF 4M21A 1VL2A 1FTWA 3VR6D 1YC2A 5CM9C 3VPXA 5MDHA 3H4TA 3FB1A 3P0FA 3KAPA 3NCHA 4PR3A 4F6RA 3CKYA 4N7BA 1SUAA 3I9JA 3S8YA 1VJDA 2JGDB 2O5VA 3CNOA 1BDMA 4NZNA 3P96A 1HBJA 4W1RA 3OZVA 4BQSA 2DLNA 3I9NA 1NKVA 3NKFA 5JWHA 4OQEA 1VYHA 2YHSA 3IQGX 3JCZA 2CKMA 4J07A 3MB5A 4J3NA 3WMEA 2F1JA 1NU8A 2FTKE 3WBJA 4V1CI 4OA8A 4DDHA 4L4YA 3KJQA 2OHGA 2BKEA 3L93A 4ITVA 3PUHA 4ACBA 4PYMA 4ER0A 3A3OA 3HCWA 4QICA 1QFJA 1TGYA 3RS5A 1DS6A 4U7PB 1ZI6A 2CMKA 4ML3A 3QVJA 3AL0C 1RWWA 3R5FA 2H1CA 3RRFA 5G1NA 2WG0A 3F5DA 2ZG6A 5TC4A 3TUZC 4LC0A 4MUBA 4QXPA 3AJ9A 3QOYA 3U3ZA 4B3TB 2HPHA 4JLNA 4NBWA 4NH4A 3VAAA 1DL5A 2F3RA 4GBMA 3KU4A 3GK3A 4TWAA 1OZGA 1X7ZA 2FPGB 3CQ9A 3EMDA 3F3SA 1WDTA 2QPOA 1MLDA 5CT5A 3TOXA 5FEMA 3H84A 1KQGA 2IPNA 3U4QB 2ROQA 3MZ0A 3ZWAA 4JSYA 4DN6A 2WAOA 4GRDA 3LQRA 2E1RA 3U62A 1SCUA 1TVEA 3FROA 2VIIA 4IW3B 4R1NA 4R8RA 4RFSB 3UV6A 1V1JA 3HGTA 1W0JD 4NBSA 4TZKA 5EKDA 4DA9A 4YCSA 1J1UA 1GR0A 2AWOA 1U9CA 4JLKA 5HUJA 5F76A 2GN4A 1U2DC 2HQRA 2A3RA 2KM1A 2NO0A 3DBIA 3D4LA 1HOXA 2BY4A 3L8ZA 1DJLA 1P2UA 2RHBA 1YRYE 5KKCA 3QEBZ 3LCVB 2PO7A 1NW9B 4AX4A 3A0RB 2FMXA 5FBRB 3OJLA 3NMUF 5HQTA 2WTBA 3A1UA 4M89A 1FU7A 2P4QA 3EEQA 4V0ME 1T6ZA 1ZJ5A 4BYGA 4PS0A 4DIUA 4HTFB 1IYZA 1P2DA 3T12A 1GN8A 2VRNA 2F7SA 3NX4A 4AULA 1ZJ6A 4FWIB 4Z99A 9LDBA 2O8VA 1QOPB 4H16A 4QPPA 1DKMA 2P6MA 1Q16A 3OM1A 4H15A 1YR1A 3EH1A 4HPXB 4QFMA 1Z62A 4KSCA 4CKWA 5KX5A 1X7WB 4P34A 1ZLXA 2N46A 4WKNA 2Q46A 3A9CA 3F3KA 3QI7A 4W5WA 3SVZA 2FNAA 2JFYA 2RH8A 3OWXA 3NWBA 4PLTA 1Q91A 2YJ4A 4UDNA 4DLBA 1E1CB 2A5DA 4DSOA 4EVRA 1AHHA 1K75A 1UWLA 1X1SA 3T5PA 2Z2XA 1YTUA 3DOIA 1O8CA 2ZM5A 4MIYA 3CLSD 4IZIA 5G0TA 1FNBA 4FFPA 4KFUA 1P0FA 4DQDA 5EJGA 4QPDA 3UAYA 1YRWA 3WRWA 3F5SA 3BWVA 4JP8A 1GQFA 4OHMA 2J3LA 2OL4A 4ER6A 4JJ8A 5FA8A 2QOEA 1NOIA 3STWA 4M0FA 4B73A 1DT5A 1GAJA 1N5LA 2AOVA 2JFBA 3G8CA 3L8FA 4QJ5A 3THYB 1IXZA 2H2WA 1S2NA 1KI9A 4UM9D 4FW8A 5TY0A 1WQ4A 3K8QA 1EGHA 1PWEA 3WYNA 1RE0A 4E2XA 3VSEA 3I30X 2HTEA 1GUAA 2EEZA 1KS9A 2P9TA 3RARA 1VI6A 4UAJA 4RD4A 3COSA 1JHPA 2QT0A 1ZD1A 2R60A 3VH3A 4PU0A 4CM9D 1UXIA 1VYUA 1EP1B 3EX7C 4MGZR 1Z17A 1GG8A 1NYTA 3W5SA 2IH4A 1PO7A 2V7BA 4YP6A 3PVZA 1ZISA 2H4YA 4X7MA 1JEJA 5LQSA 2L17A 4D4HA 2DF8A 3I52A 3W8RA 2X9VA 1XQ1A 3SY8A 4N3CA 4TXHA 5KYWA 5IVDA 5EJMA 5BO5A 3O2SB 2AMVA 1U1EA 1T36A 2XECA 2OLKA 3E8XA 3FD8A 3GJ7A 3HCRA 3RVDA 1GU1A 3UAXA 3RNOA 4KNWA 2BN4A 2IXAA 4UVHA 1OPXA 1X8KA 2HF9A 1UFQA 1Y3BE 2CMFA 1K63A 2YHBA 3ZU4A 1TZ2A 3AUJB 1O96B 1M2KA 5AI0A 4BECA 4J03A 4AURA 1II9A 3LL4A 3RH0A 2A9JA 1X94A 3S6JA 1VJ1A 1IHDA 1VPTA 2HZBA 1KC3A 2DX7A 2FSFA 4JC8A 2BR3A 4XYLA 4JD5A 4XSVA 4XSHA 3M9WA 1WUJS 4QDKA 3LUBA 2HA6A 5A71A 2IXTA 1ZD4A 3T0FA 4A0QA 2F8SA 1FMFA 1EP9A 2WYUA 1EU1A 3R5KA 5AICA 3GMDA 1GO2A 1G5FA 1V43A 3H86A 4YRSA 1MB3A 3GX1A 4HB4A 2W43A 4UXIA 4F4UA 4DLZA 1HE8B 4KJZA 2OZEA 3RGGA 4DY6A 4YUXA 2KS6A 1QQ6A 4PYKA 4JEMA 4LF4B 3BB4A 2QDKA 3MEQA 2FEKA 5I8ZA 4YT8A 1PZGA 5EE3A 1YBMA 1PGNA 4YP9A 4MJ7A 4YCAA 4JMLA 5A4IS 1YV9A 4ZEVA 3M4NA 4MIOA 5AJYA 3PC7A 1SWVA 1T4MA 3I4LA 2BFWA 3ILHA 3ZE6A 1OU0A 5KVVA 3DZFA 4Q7LA 1TL7C 2PX4A 3N0WA 4KVAA 3MUOA 4DDTA 4RMHA 4FWTA 2LDBA 3ZK9A 5KPDA 3I05A 3DGEC 3WICA 1YBAA 1R6UA 1Y1LA 4H35A 1QWOA 4HGYA 4JVLA 5LMUB 3PDIB 4PG7A 2WSSA 2IIPA 1L7VC 2OYSA 1R0YA 4DGSA 1JR2A 4EVQA 4BYMA 4YR7A 1S4QA 4Z9BA 3W79A 3COVA 4C5BA 1TZJA 1H4SA 1F38A 1U0LA 1ICEA 3QWFA 4LWPA 4LDQA 2OCDA 3KZNA 1OHHD 2GN8A 4I1VA 1DUIA 4PAQA 3FNBA 1ZO8A 3RT9A 1Z34A 4TSFA 3GELA 4B2LA 5CCEA 3SC2B 4KRXA 1AF7A 4LDRA 3T4UA 1Z5PA 3LUPA 2MYNA 2ZIXB 2EEPA 5A9SB 3RSZA 4AX8A 3BQ9A 4MQFA 4LS3A 4EKYA 2FQXA 1KFEB 1ZFNA 2W0SA 3QLUA 2RGWA 3ZQJA 3ICCA 4PX9A 4IJVA 1XP8A 4XJSA 2O2DA 3DDHA 3MWJA 1TJYA 3UVEA 3CNBA 3A26A 1MT3A 2ZUBA 3IEPA 1NM5A 1ZD5A 3LO8A 3DPUA 3I34X 3T15A 4U7HA 4B34A 5BT9A 1FMTA 1A4XA 4EFKA 2R25B 5KYYA 2YMQA 3KVVA 2P62A 1P6QA 1TIPA 1JB9A 1DTSA 2VF2A 2LE0A 3SJCA 3X1XA 1ZN8A 1CJTC 1WSDA 2OAGA 1GXSB 1W5FA 2OBNA 1SK8A 2ZVPX 3E7FA 3EVGA 4HMPA 3RABA 3UYKA 1ZVKA 2M6SA 2VC2B 2CUTA 5FOWA 5BNIA 4PWZA 2H6EA 4YO8A 2BFDB 1G3QA 5REQA 1DFIA 3VKFA 3C5HA 2E4YA 1V4NA 3GG2A 1D7OA 1HZZA 1QCZA 3CNQS 5B2EA 4W9MC 5NLLA 4HVCA 3IALA 4W5RA 1CJBA 1SXJB 1JBKA 1Z6AA 4JAVC 2CXUA 2GYVA 3FI0A 5HOEA 1KYYA 4RA6A 2HIAA 3ICPA 1QC5A 1FTYA 4EA9A 4ETNA 1O94D 2VHZA 1IZ9A 2C4UA 2HMSA 3GRUA 4OXIA 2NU8B 4MVJF 4EHKA 2ZJOA 4Q02A 1FEZA 1MVOA 4V03A 1JLKA 3IBSA 3SS7X 5K6RA 4CR8A 1NAHA 2D5CA 5DP1A 1KJZA 5HFJA 3F78A 1ZONA 5J5VA 4EO4A 4XRGA 5HZKA 4M7RA 3W2FA 3ASVA 3I5YA 2EXXA 3LPCA 4MX8A 1XEXA 3OTHA 2JGJA 2DWUA 4BUCA 1I3NA 3QG5A 1XGKA 2HSGA 2AC7A 1QTRA 1ZMRA 5HRAA 3IUBA 4ZT4A 2WIGA 3TW8B 2MWMA 2E4VA 4B48A 4ICIA 4JJ7A 4LQ4A 4P0PB 2FI1A 2ADMA 3DHWC 2HOQA 3ZEAA 2PLWA 3N74A 1C2TA 3QVVA 1IEXA 2PL1A 3HBLA 1NHGA 4IG9A 5FOTA 1DV2A 2QUJA 3X2FA 1C3JA 2UAGA 1LSSA 2GTHA 4NVRA 4RD2A 3HCPA 1Z38A 3PC2A 5D5QA 5ICMA 4RK5A 5KINB 1AU9A 1CHNA 5DO9A 2RAVA 2OBYA 4QM6A 2QN1A 4N40A 5E3HA 5JQGA 2I4IA 1L8QA 7REQB 3BKWA 3WISA 4AAYA 1MX1A 4ISBA 4QDUA 4WESA 3Q7IA 3OIDA 3VPCA 3W3ZB 3MBOA 2CBGA 3JS5A 4TT8A 1YAJA 3K5HA 2F8TA 4NDZA 1XN4A 4RFSA 1PD0A 3G1UA 4TV9F 3T61A 3NHUA 3KYIB 1V37A 4Q4CA 6YASA 2J0UB 2QL6A 3V4FA 2R3SA 2R6JA 4KQFA 3ZXIA 4BP9A 3K0CC 3GNSA 4KFCA 3HHPA 5F23A 3CPHA 4QXQA 2Z58A 1H2AS 4WLUA