1KETA

The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
346
structure length
346
Chain Sequence
QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-D-glucose 4,6-dehydratase
publication title Toward a structural understanding of the dehydratase mechanism.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 141
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2001-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ketA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1ketA02
1AN9A 1BXZA 4YA6A 5BNTA 5KJCA 3A14A 4OQZA 1LLQA 3DAGA 5A06A 2WEKA 2FN7A 1C3VA 4Y6RA 2D5CA 1L7EA 3ITDA 3GUCA 1ISMA 2IZ0A 2XXBA 4YJFB 3VC7A 3IJPA 1LX6A 4IQGA 1ADFA 2IRWA 1P77A 2VTEA 3E5RA 1I01A 3H7AA 3LSYA 4MO2A 3RBVA 3WJ7A 1HLDA 5KVSA 4BKQA 2ZATA 1HE5A 2G5CA 3AI3A 3KETA 2W8ZA 2WE8A 3NTRA 4E2YA 1X7DA 1I8TA 3PHHA 4AJIA 1F8GA 2BLLA 3H5AA 5EIOA 5FYDA 1HDGO 2J3KA 1PZFA 1J49A 1R66A 4OL9A 1MFPA 4QT0A 3NDRA 4XQCA 1IULA 2CDCA 2BI7A 4MIEA 4JN6B 3PDUA 8ADHA 1YDWA 2AG8A 2AEFA 3PWKA 3ZCXA 1VE9A 1NFQA 4PZCA 3GZNB 1IPEA 2F00A 2XOXA 4J6FA 5CG1A 3TDKA 1V3TA 2ZKLA 5A04A 4FS3A 1T24A 1GZ6A 3QIVA 2EW2A 1H6DA 3GRPA 4II3A 4YEDA 2GNAA 2OUIA 5G4KB 3QWBA 3TL2A 4BO9A 3I9OA 5EQFA 3MJCA 1PGOA 1X14A 2E48A 4JNKA 4BNIA 5JAIA 1NTOA 3ITKA 3TWOA 5L4NA 1YBVA 2FSSA 2OXIA 3JQGA 3PIIA 4DL9A 4K1LA 2NVBA 5AVOA 4TRRA 2D3TA 1PZHA 2X5OA 1X7GA 3HFSA 3MEQA 4XDZA 3LT4A 3T4XA 1LUAA 3KM0A 3TOZA 1NAIA 4YJDA 3JSAA 8LDHA 2PD3A 1HTBA 4R9RA 2Z5LA 4EGFA 2VNAA 1VRWA 3HDJA 3H65A 1CQJA 3KRTA 3ZNOA 2J3IA 5JBIA 3NDIA 1UAGA 4WCFB 1NWHA 3GGGA 4Z6KA 3OHSX 3PGXA 4Q9NA 4B7UA 3IP3A 3U9LA 1ADGA 5IXYA 1LJ8A 4Z9FA 2G17A 2B4TO 1NVMB 2UUOA 1H5QA 1U8FO 4CR7A 2FY8A 4D3SA 3DAFA 3ZNQA 3MJTA 4IZIA 4DMMA 3V2GA 4B8ZA 1SBYA 1M6WA 4X54A 3KEOA 3E8XA 1Y9EA 2Y1CA 2Q1TA 3WNQA 1IOLA 4BNTA 4YAJA 3PZRA 4E5NA 2P5UA 4L75A 3DTYA 1LBEA 5TIIA 1X1TA 4JP2A 2P9EA 1Q7CA 1V0JA 1ZUD1 3IP1A 1DFGA 3DB2A 4B4UA 3L4SO 3TN7A 2UV8A 1E3WA 4TQGA 2HLPA 4WNCA 5DCUA 2X86A 3GPDG 2CSUA 2OGUA 2IZ1A 1GQYA 3WYEA 1KBZA 1CEQA 2CZCA 3AU8A 3RSHA 2PH5A 2NWQA 4YJHA 2P9GA 1YJQA 4NBWA 2OP0A 1LLDA 4D43A 3CZRA 1ZXLA 3M2TA 3OFSA 1CF2O 4E5MA 3IS3A 3GF4A 4ILKA 3FCOA 4DIFA 2X9VA 1LRKA 2OL4A 1PJSA 1BGVA 1EMDA 3PFWO 4IGEA 3GNSA 2UUPA 2O2YA 4XQ9A 1KEWA 3SVTA 1WDLA 3WTCA 1WVGA 3WGHA 5AXDA 2WDZA 1D8AA 3BZUA 5COBA 4DUPA 2VZ8A 3EZYA 1PU2A 3L0DA 1UDCA 3RASA 5ES3A 2C7GA 1ZKMA 3ONDA 2QYTA 3IC5A 4QO7A 3H3FA 2H9IA 3ZWYA 4GLLA 4HWKA 3VH1A 1A4UA 2ZQZA 3A4VA 3DOOA 2FRDA 3A06A 2AMFA 4CL8A 1B16A 1SCUA 2ZB3A 4AJHA 5CPBA 1HF3A 2EWMA 4A0SA 1GD1O 5JMWA 1PJ4A 1PTJA 3JQAB 4LSWA 4RVDA 3WWZA 5EINA 1DIRA 4D46A 1C14A 3PQDA 3NEPX 1XLTA 4RF2A 3DZKA 3QVOA 5F5LA 4AJEA 4PG6A 3QWAA 4S3MA 3HN2A 3K96A 4RF5A 1OAAA 1ADBA 1EUDA 2FP4A 3RC1A 4CM6A 1O89A 3K8ZA 3NGXA 3FNGA 5B4UA 5JY1A 4ND1A 2AA3A 4URFA 1XHLA 4D0RA 2ZYAA 3R1IA 2DTDA 4FCCA 4B79A 2X0JA 3CTMA 3WXBA 2O4UX 1H9AA 2Q4BA 2Z1NA 6ADHA 2YDYA 3KZVA 3CH6A 2RIRA 4UVGA 1YH3A 1GZ3A 3GC6A 1N9GB 4XA8A 2IXAA 5T6BA 3B1KA 5T64A 4YRAA 3KSDO 1P1RA 5CDYA 3C85A 1UP6A 2C07A 1R4NB 3G79A 3MTJA 4AJOA 4J1NA 1Q0LA 4CMBA 4LVUA 2EHDA 4IBOA 3TPCA 4IDCA 5F1OA 1GU7A 1CQIA 1XU9A 5TJ9A 1RM5A 3C7CB 1YWGO 1X13A 1ZK0A 4NU5A 1U4OA 1YB4A 3LF1A 1Y5MA 4U6QA 4GGPA 3GFGA 4IJKA 1Y1PA 1IZ9A 4Y6PA 5AOVA 2ZIZA 4Q3BA 2IZZA 3GDGA 5GMOA 3O26A 1I3NA 3K2EA 5KCZA 1F12A 2Q3EA 4JQCA 4ZA2A 4YVFA 2I66A 4ALNA 4PZDA 4EUHA 4NNJA 4CM3A 1PL8A 1A71A 1VKOA 1BXKA 4DXHA 2CY0A 3MOGA 2LDBA 2RCYA 4BNMA 5A1TA 5B4VA 1KY5A 4R51A 2ZK7A 5JMPA 3U3XA 4DYDA 4WOKA 4JIGA 5KVCA 3VPFA 5IZ4A 4L9RA 4CLDA 5A9RA 4FFMA 4RQUA 3BTUA 1I2CA 3QHAA 1HRDA 5EMHA 2P2SA 4AJLA 1ENYA 2VTDA 2NU7A 4UUOA 2VWHA 4R3WA 1PIWA 1U4SA 5U1PA 3FF4A 4ITUA 5L40A 1C0KA 3ZWBA 5BSHA 4BO5A 2O50A 5U9CA 1YBAA 4BIIA 3WJAA 3U0BA 1E3JA 3GZNA 2FHSA 4CUJA 3DMTA 1YQDA 5KVVA 3C7AA 1NQAO 3LT1A 3ON5A 1Q2XA 1M67A 3GVPA 4XYGA 1SZJG 2P68A 3S8MA 1P3DA 1MXFA 1M2WA 4PZEA 1B8VA 3VPHA 1LDNA 2EKLA 4R1SA 1JA9A 4D79A 5G4KA 5FFFA 1DFHA 3AK4A 5KKAA 2Q49A 4ESOA 4BQPA 1T2EA 5KVQA 2LDXA 4XWYA 4W7IA 3VDQA 1YGYA 3OF2A 5EESA 3WG9A 4OMUA 1K89A 3H9UA 4IPTA 2VHYA 1UZLA 4B4OA 4JLWA 2H6EA 3TRIA 1DLJA 4PVCA 1K0UA 2DAPA 3B1FA 4BB5A 3T7EA 3H9QA 5IZCA 3ENNA 3C3XA 1WNTA 3PEFA 2J6IA 2ZQYA 1P1FA 3TZ6A 2JFHA 3JQCA 4HNHA 3OA0A 4AG3A 3QRWA 4FOOA 3BA1A 4GMGA 2C82A 1LA2A 3DZGA 4OSOA 4Z9YA 2QRJA 4QQRA 2CDBA 3JD4A 3N58A 4TRJA 1I30A 4ALMA 1BVUA 1GR0A 3ETEA 4INAA 4CM7A 1R15A 4EUFA 1LQTA 1QR6A 2VHVA 5U4QA 3TZCA 1JAXA 3SC6A 2NQ8A 1P0CA 1VKNA 2HRZA 3PJEA 3ZWNA 1U2DA 4P4GA 5DN9A 3WQRA 1GV0A 4OAQA 4OJNA 4JJGA 3VTFA 2Y66A 5IFLA 1UXIA 3EC7A 4CMAA 3C1OA 3OIGA 1MLDA 3DMTC 1ZO8A 4L73A 1ZSVA 1X0VA 1YKFA 1LDMA 1C0IA 4NJMB 4U8GA 2NU8A 4KWIA 1I10A 1R0LA 1O94A 2O48X 1KY4A 4WEOA 3M2PA 2G1UA 3QA9A 1B0AA 2PH3A 4E2XA 2VYND 3JYLA 3ICCA 1WZIA 4B7CA 2IDZA 3NGLA 4LW8A 1VSVA 4R1NA 5CG2A 1ZMOA 3GQVA 3FPCA 5H81A 2EERA 5BNFA 1GQQA 2IYPA 3IKVA 3K73O 3QVTA 4R4JA 1PEDA 3MTGA 3Q2KA 3UN1A 5IZCC 3QWFA 1UH5A 2NVUA 3H2ZA 3RAJA 3I9MA 4OKNA 3GY0A 5MDHA 2JHFA 4IDFA 2I6TA 3W4JA 2PZMA 4PLCA 4N7RA 4PLVA 4LCJA 1E3IA 4JXKA 4CV2A 2ZTLA 3IUSA 1DJNA 4ZQEA 1P1KA 4TSKA 1XIVA 2E49A 1KVTA 1DEHA 4CPDA 1ARZA 5HS4A 4Y67A 4CM8B 1PQUA 2YV1A 2ET6A 4KDFA 1BMDA 1C0LA 3RIHA 1HETA 1Q0HA 4I5FA 3H8VA 3VH2A 4E4YA 3JQGB 5I9MA 1LSUA 1N2SA 1PGJA 4KUEA 1WZEA 3JYPA 3MWEB 5HWSA 3FD8A 4KDEA 4FD3A 3U49A 2Q1WA 3GMSA 1JQBA 5THKA 5G4LA 2GERA 3FHLA 4J1TA 1DDOA 1TA4A 2Z1MA 4ZVVA 1PJTA 2VCYA 1D1TA 1H93A 3D1LA 3ZGYA 2C5AA 3A28A 4N54A 3BTVA 3WLFA 1UUFA 1XWFA 1E3EA 1AGNA 1ZK4A 2FSVA 3PK0A 1RM3A 3G3EA 3QLJA 4ALJA 4XX0A 4A27A 1BXGA 4R16A 3ROMA 3VH4A 2P9CA 2WD7A 3ZWVA 4RLSA 5IN4A 1ONNA 2WE7A 4K6FA 4YCAA 1T2AA 3DDNA 4D0SA 4EJMA 4XRRA 3OJOA 1FF9A 4PN3A 3NTOA 1A9YA 2I9PA 2NTJA 4TRNA 1PJ2A 3VVBA 4BV8A 2X9GA 4FC6A 4WE3A 2HMTA 1MV8A 4GH5A 1NQ5A 5KJ6A 3Q1LA 1QLHA 4FFNA 2VQ3A 4ALLA 4R1UA 4YR9A 3C1TA 3O38A 4E32A 1D4FA 2HJSA 3PWSA 5A03A 1HE2A 2YV2A 2JFFA 2JFGA 4XZ3A 2Y0EA 1YO6A 4BO4A 2BELA 2JCXA 1AE1A 1R4NA 1MX3A 5JPIA 4PLTA 2W98A 4M89A 2G76A 4DLLA 4AJ4A 2ZTVA 3RUDA 2Y68A 3Q6IA 4DQVA 1MA0A 4TVOA 4YJHB 3TFQA 1QV7A 1DC4A 1P0FA 3U5TA 1Z82A 2IE0A 4RDIA 1XYGA 2VYVD 5CHEA 4BB6A 2PY6A 1GPJA 2PNFA 3ZU4A 5IXSA 5T67A 4YAEA 3GR6A 2AQKA 2IXBA 1G6KA 2G0TA 1UP7A 1I3LA 5A05A 4GVXA 3E9MA 3JD3A 4E33A 3DQPA 3RQSA 4D42A 1H2HA 3ADPA 3W8DA 3ST7A 3ULKA 1GFSA 4DPMA 1GEGA 4G5HA 1SO8A 4CR6A 3MZ0A 5IDXA 1SB9A 1NPYA 1Z6ZA 1LTHR 2POQX 1J0XO 2QX7A 3KLPX 3CIFA 3W6ZA 1M76A 2ZCVA 1ENZA 1E77A 3ZW8A 2W2KA 3HNPA 2UYYA 1LC3A 4FFOA 2EJVA 4BO0A 2VZ9A 1N7GA 4I5DA 3WGIA 4WLVA 1YB1A 1H6BA 2OHXA 1R16A 3DC2A 2J5KA 5CP8A 1ZEJA 4J4HA 2GZ2A 2Q2QA 3TJRA 4NMHA 4UVEA 1YL7A 3GT0A 3TZHA 5G0SA 3NUGA 4FFPA 2EJWA 4WLFA 2B36A 2CF5A 1T2FA 4I9NA 2YDXA 4BS9A 1NHWA 3UKOA 4DQUA 1GEEA 2IYOA 1PL7A 2W90A 3AWDA 1EE2A 4RV9A 4GSKA 2BFAA 1YDEA 2DFDA 1E6WA 2XAAA 5ADHA 4XD2A 3F4BA 5KNLA 3I9NA 1KC3A 4MDHA 1E6EA 4ND2A 3HADA 4IDGA 3AW9A 4MP8A 4JROA 4GX5A 4R68A 3W4KA 3VZRA 4WJZA 3GFBA 5F1PA 3I5MA 1F06A 1G0OA 1EZ4A 1BSVA 2Y0CA 2EGHA 1CERA 3EGOA 3CSDA 4GKBA 4JCOA 1U3VA 4PLWA 2JD0A 4GI2A 5HS6A 1U9JA 2TMDA 5I9NA 5JW6A 1IYZA 4Y8VA 3S55A 4KP7A 1WLYA 3AY3A 2P4QA 2RAFA 4YJGB 4AJJA 1MP0A 1V8BA 3AU9A 4GL4A 1NPTO 3RVDA 4KOAA 4N5LA 2AXQA 1QMGA 3GHYA 2Y1OA 2WM3A 3EVNA 1FDUA 3R0IA 4BNKA 4YAKA 4ND4A 5JFOA 2Y1FA 5T8KA 5TLSA 5AXBA 4WOJA 1I33A 2GN4A 4LK3A 1GYRA 5IN5A 3K2BA 4IIVA 2VWQA 5AXCA 1I36A 1U5CA 1P31A 3I6QA 4E0BA 3DBVO 3G49A 3H9GA 2DPHA 2P4HX 3BHMA 3MJVA 4PLFA 1UXHA 1Q7GA 3ZZNA 4NJMA 3U09A 2HDHA 3JQBA 1U7HA 2FR1A 4ONEA 4IQ8A 3HJAA 1PJQA 3ADOA 4I5EA 3SXPA 1BW9B 5IDYA 4CR8A 2I3GA 3O03A 2HSDA 4FIZA 3OJFA 3QSGA 3X2FA 4WASA 1NFFA 4CUKA 2VYNA 4HV4A 4QFDA 2C54A 4LSMA 3OICA 4DQXA 2BH9A 1ULSA 4CMHA 3IMFA 3G0OA 4DWVA 2OO5A 4IIUA 1Y8QB 2YZ7A 4Z0HO 5L45A 1AHIA 3JD2A 2E4AA 3UCEA 4UULA 4E21A 3AM4A 1K6JA 4BGEA 2DBQA 3GEGA 4ZU3A 4IJWA 2J3HA 3ZWXA 1WP4A 2VRBA 4K26A 4OQYA 1YL5A 2C20A 2X0RA 2Y1DA 4Q3CA 2JD1A 5T57A 4J2OA 3ABIA 4M86A 3SJ7A 2FOIA 4E13A 5T8KC 2ZB7A 1F17A 1HDCA 2QW8A 3COSA 4M87A 4OXNA 1VJ0A 3A1NA 4FGWA 4CM8A 4B4VA 4OYRA 3K5PA 2NADA 2X7HA 3ZHYA 3U4CA 1N5DA 5A5FA 3I9LA 3TZKA 4EBFA 4WGGA 3LF2A 3ICPA 3PQFA 5DP2A 3UW3A 3KTDA 4HP8A 3OETA 1PZGA 1HKUA 3E03A 3JQBC 3DHYA 3D4PA 3RFVA 1DIGA 2SCUA 2DQ4A 2EV9A 4OXYA 2RBEA 1T1RA 4MVJI 4QFCA 1EDZA 3JQFA 2HKIA 2PZLA 2ZJ0A 4BGVA 2GUGA 4IDEA 3PYMA 4L76A 3QJ5A 3WGZA 3GLQA 2Y93A 4KQXA 3VZPA 1NQTA 2FR0A 1EFKA 5IF3A 3PDJA 1PWZA 2AG5A 2NNLD 3BTSA 4UUNA 5L95A 2UDPA 3ANLA 5L7TA 3VZSA 1AHHA 4IY1A 3ZWCA 1CDOA 3NJ8A 1DXYA 3PIDA 1XG5A 5BSGA 3ENKA 5TSDA 2BF7A 4DBVO 3NV9A 1DHRA 1RYEA 1WMAA 3VZQA 5B1YA 1YL6A 3NDJA 4D3DA 4J0EA 1XCBA 1GUFA 1JWAB 1O5IA 5LCXA 1XKQA 3JQEA 2WJPA 1EVIA 1LRJA 1LU9A 1T26A 4FGSA 4PCVA 1JVBA 2AEMA 1E7MA 2GN8A 1E7YA 1CRWG 2O7SA 4CLEA 1W73A 3PPIA 2YW9A 4FJ1A 4PIVA 1GY8A 1H9BA 4YT2A 1XELA 3D5QA 2J5RA 1VL0A 1OFGA 2HUNA 3F5SA 2DUUA 2TMGA 1XQ6A 3DZBA 4P4LA 3DFUA 1OI7A 4AJ2A 2NVUB 1K5HA 3FWNA 1BWSA 4JBHA 4F3YA 2VUUA 1H0KA 3JQFC 3QWHA 5DBGA 3KOUA 4IINA 4CQLB 2GZ3A 4RPJA 3RC9A 2VYVA 3CUKA 2Q1SA 4W7HA 1AUPA 4QUKA 1X7HA 2VNSA 2A4KA 4PG8A 3IL2A 2ZB4A 4FQ8A 2VT3A 3R3JA 4MVJE 3WGYA 4FC7A 4F45A 1ISFA 4YTEA 3D3WA 3GN1A 4CMKA 4DIBA 5L4LA 3WYCA 1HZJA 1EFLA 1DO8A 2HU2A 2PK3A 1UR5A 4NBRA 4PRLA 5DP1A 4FJ0A 4XIYA 5CDSA 3EK2A 2CMDA 1G1AA 3GAZA 3LQFA 1ZJZA 2X6TA 3TQHA 4FDAA 5F3RA 2DBRA 1X0XA 1ZBQA 2GASA 4BNHA 1PJBA 1MB4A 2F1KA 1KVRA 1ZCJA 1QV6A 3GVHA 4HFJA 3V2UA 3LYLA 3P2OA 3T7CA 4YAGA 5JCJD 4C4OA 1J6UA 2Z95A 3E82A 5F5NA 3RI3A 4AL4A 3QVWA 1XQ1A 3QW2A 2VUSA 4GPD1 3ZWMA 1EBFA 3PI7A 2Q4EA 3S2GA 2PKQO 3BXXA 4DGSA 5BSFA 1E7WA 3EZLA 4XGNA 4PG4A 1QSGA 1SMKA 5JDIA 1BXGB 1HYGA 3OIFA 2JAHA 3KSUA 1FDWA 1O8CA 2WD7B 1MC4A 1PL6A 1MC5A 4HADA 4IJUA 4GSLA 2HMSA 4OXKA 4AJ1A 3WDSA 3DR3A 1O6ZA 3DZIA 4N5NA 3M1LA 4Q3DA 4QEDA 5L7YA 2B35A 4CLRB 5CEJA 5I9LA 4ND3A 2X22A 2V65A 3LC2O 1E7RA 1Z73A 4XQEA 1DB3A 1F14A 4EDFA 3I3OA 2W2LD 1UJMA 3FTNA 1D3AA 4BMSA 1XDWA 5ER9A 2VWPA 2AE1A 4B4WA 1Y81A 3ETDA 4GWGA 4YJGA 4TKLA 1HLPA 3I23A 4DRYA 3F6YA 3A9WA 5A4DA 4D3FA 1NR7A 1ONOA 5BT9A 3JYOA 4GLOA 1DIAA 5JC1A 3UICA 2JJYA 3WMXA 3PVZA 5KJEA 2WYWA 4EJ0A 4W4TA 4H16A 4XYLA 5HTOA 3VAZA 3WIEA 2D8AA 1Z45A 3AUAA 2Q1UA 1Z7EA 3N7UA 4YDRA 3DEYX 5DF1A 3ZW9A 3D5TA 1BDMA 2EKPA 2ZYGA 1B2LA 3F1KA 1TT5A 4RPLA 1LSJA 2GN6A 1J5PA 2PGLA 5JDIC 4XR4A 2AW5A 5FEUA 5BSEA 4KZPA 5DNAA 3HB4X 4QTZA 1LSOA 3H2SA 3RROA 1K6XA 2UAGA 1BW9A 3LC7O 3F1LA 1EE9A 4JBGA 4L4SA 1UXJA 2PR2A 1W6UA 4IXTA 3UGKA 5CPFA 2Y05A 2NUAA 1P1JA 3L6EA 5CEEA 3QVSA 2W2KB 3QV1A 5DBIA 3OECA 1U28A 4BVAA 4ID9A 4UEKA 1EUCA 4J43A 3VDRA 3STHA 1JKFA 1UXKA 2VOJA 1Y8QA 4YPOA 4DC1A 3L9XA 4D45A 3AI1A 4EITA 3DHNA 3H5NA 4H15A 1IL0A 4E31A 3VHRA 4G81A 2GCGA 3PTZA 5L7WA 1LDGA 2X58A 1CJCA 4JK3A 1IE3A 4CV1A 1DOHA 2RH4A 4L4XA 3KXDA 1NP3A 3HQ4O 3R6DA 1UAYA 5TJHA 5C37A 1JN0A 2PFGA 2FPIA 4IMRA 3UF0A 4A73A 1I3MA 2V6FA 1PJLA 1QYVA 3ASUA 3RUAA 2YHIB 1ZFNA 2QZ9A 3QE3A 1E6UA 1BG6A 4RLHA 5JYEA 3CMCO 1ORRA 2P5YA 1U1IA 4CM4A 1CIVA 4QECA 3GZ4A 1OZAA 1Q1NA 3VKUA 3JD1A 2V6GA 4MINA 1PQWA 4CMGA 3RUCA 1EVYA 2JCYA 2DPGA 3ZHBA 1PSDA 5AYVA 1WXDA 4ROSA 1NYTA 3FBGA 5TF4A 3ZNNA 4AJPA 1I5RA 3WBFA 1LDBA 4K9DA 2O3QA 1OC2A 5JAZA 2B5VA 4U0JA 5HA5A 1LDYA 3ZNPA 5KJ1A 2PTGA 4IDAA 1UZMA 1ZK3A 3ONEA 3VOSA 3HUDA 4WLOA 4YQZA 4YQYA 4MOWA 3KYCA 5DT9A 2Y1EA 2HMWA 3WGGA 1ML3A 5F1KA 4AVYA 4PGFA 4N18A 3BMCB 1W8DA 3EDMA 2PLAA 3MCVA 1V3UA 2C0CA 4P38A 1JWBB 2YJZA 4O63O 3ZWPA 4YRDA 1RJWA 2H1SA 1TI7A 4PG7A 1S6YA 3HN7A 3ZI0A 2BFMA 1PGNA 4P22A 1ZH8A 4ZN6A 4BNFA 1D1SA 3LLVA 4R9SA 4IQ0A 3DAPA 1GV1A 1E3SA 3ZHZA 2BFPA 3FWZA 3RFXA 1IB6A 2HK8A 3DHEA 1N1GA 3ZWOA 4I9HA 3DBRA 5DCWA 1A27A 1C1XB 1Y7TA 2PGJA 3HDHA 3LK7A 4MVJD 4TWRA 4BQRA 3BAZA 3I1JA 3DZJA 1UXGA 3VKVA 4Z0PA 3H6KA 1RM0A 3PJDA 4KQWA 4CQLA 5EQDA 4BV9A 4E5PA 3AJRA 4ND5A 2EG9A 4Z3DA 3KEQA 5L51A 1DC3A 3NT4A 4NQZA 5IDWA 2GLXA 2BGMA 2QG4A 3HDYA 3UH1A 1PQPA 5TS3A 3WNVA 4RF4A 4XR9A 5LC1A 1DRVA 2EGGA 4OIMA 4RCVA 4HBGA 3JQ7B 4M1QA 4DPKA 3GDOA 4L74A 1R4MA 1B8UA 3FTPA 3E48A 3GG9A 3PRJA 4UUMA 3S2EA 2C5EA 2RH8A 3LZ6A 5TT0A 1ZIDA 1V35A 1DSSG 5T5QA 1N8KA 3NRCA 2BHLA 3OJ0A 1ISJA 1XSEA 2IEBA 2O3RA 3V1UA 1LI4A 3KO8A 5JAMA 1WMBA 3V2HA 5C3MA 4E2ZA 1IUKA 2AQ8A 4OO3A 2ZYDA 1HDZA 3OSUA 4D41A 5L9AA 3WOHA 4OGWA 4R41A 5I7EA 5FI5A 1NPDA 3FR8A 3MJ4A 4WLEA 3IAHA 3QWIA 3UXYA 1RYDA 5JCJA 2D2IA 3W4IA 3PFFA 3WGOA 2OP1A 4LGVA 4DVJA 1PR9A 2CFCA 3ETGA 3P2YA 5KTKA 5ENVA 4W9NA 4IDBA 5TT1A 3ZV6A 1VL8A 1VJ1A 2HK9A 1C0PA 4EJ6A 2Q50A 2YV3A 4CM9D 4QX6A 1LRLA 2QYSA 1GDHA 3CXRA 1XGKA 1PJ3A 2GO1A 1KEVA 4DLAA 1HZZA 2VWGA 3DOJA 2J5QA 1LLCA 1Y9AA 2GD1O 2O3TA 1Y6JA 1M75A 3ORFA 1NQOA 2A35A 4CLRA 3DZFA 3H4VA 2AQHA 2O23A 3NX4A 2OOSA 5EL0A 2X8LA 1N92A 3OEYA 1ZNQO 4IJVA 2C59A 4OH1A 2FR8A 1LNQA 2EKQA 3M6IA 1EK6A 5KKCA 2WYVA 3GOHA 3RJ5A 3KBOA 3Q9UA 2DM6A 2W2LA 4DIOA 4TVBA 1ZSYA 2O4CA 1MUUA 3KYDB 1U3WA 1IHYA 5ITVA 2NTNA 3FNFA 3DZHA 2DBVO 1KS9A 4I08A 4YRBA 5A02A 2A9FA 2B83A 4Y98A 3KHUA 3SBOA 4F46A 1GYPA 1X15A 2X1HA 3OP4A 1VC2A 4MKXA 4TKMA 4XGKA 5COAA 5A3VA 3PHIA 3V8BA 1B26A 1EK5A 4ZQFA 3ZHXA 4EYEA 4QSMA 3DBHA 1P9LA 4KUGA 4A10A 1NASA 1QXSA 3HSKA 2RHRA 4YWJA 3LLSA 5IAAA 1WDMA 2EF1A 2BGLA 4DBZA 2H63A 1LC0A 1U3TA 1DPGA 4W9NC 3TZQA 2B0JA 4RPHA 2VZ0A 1PX0A 4D44A 3FRJA 3D3WB 2B37A 4CV0A 4BKRA 4Z0TA 2I3AA 2CVQA 1B7GO 1JU9A 3AY6A 1NR1A 3GNQA 4Y6SA 4YB8A 4QXMA 3JQ8A 3WTBA 5GZ6A 2X5KO 3WLEA 4DTIA 4Q3AA 5ICSA 3DXFA 3VTZA 2X4GA 1ADCA 1P33A 1R12A 4XKJA 1ZSNA 2VHWA 1VM6A 3MJEA 4CM1A 5B4TA 4JP3A 1W4ZA 4LCEA 3GVCA 3DFZA 3SC4A 4UUPA 1IZ0A 1V3VA 1NVTA 1NHGA 4YAIA 1O0SA 1T1SA 4FFRA 3L6OO 4LRTB 3FI9A 4TZTA 4BO2A 3KSZO 2ZTMA 1H94A 1K6IA 4E5YA 3PLRA 4QO8A 4GWKA 4RVFA 4LMPA 3JTMA 5TGDA 4UVIA 1ID1A 5IG2A 5C7IO 4RF3A 4ZQBA 4J49A 4A7PA 2HMUA 2DFVA 1GZ4A 3WYBA 1K3TA 1UDBA 2YHIA 3Q2IA 4RQTA 3OQ6A 2G82A 4MVJG 4N5MA 4BKPA 4R1TA 4CUZA 1SB8A 4NBVA 4FOSA 2EW8A 5BNIA 2GDZA 1YE3A 2WYUA 4J7XA 3PJGA 4E5KA 4JX8A 3UFXA 4Y9DA 3FNHA 2B69A 3VPXA 4PLHA 3LVFO 1WWKA 3FPLA 2Y0DA 1FMCA 4L0QA 4AICA 4Z3KA 1KERA 5C7OO 4NFSA 4XDYA 3K9QO 1TXGA 5IDQA 3RFTA 1A72A 4A5OA 4PLYA 1TVEA 4ZRMA 5ICMA 3W6UA 4WUVA 4BNGA 4IMPA 3EAGA 3ROKA 2HO5A 1XR3A 4FFLA 1AXGA 2CF6A 4NPCA 2FPPA 4BMNA 3R3SA 5HRUA 2WTBA 3DBLB 5KJFA 5F21A 3RUIA 4HFMA 4JGBA 1YJ8A 2Y99A 3NT2A 3WSWA 4CLXA 3BMCA 5K9ZA 3OJLA 1MFZA 3MJSA 3QY9A 5K0ZA 1TT5B 2PA3A 2GSDA 3S1LA 1GYQA 1PWXA 4FBGA 4RL6A 1PS0A 2R2GA 5TQVA 4TRMA 2B5WA 4O5OA 5THQA 2BGKA 1E7SA 4BOYA 2Q46A 4HFNA 2CD9A 4W99A 3DTTA 1EEHA 5GY7A 2YUTA 3NJ4A 4GQAA 3UCFA 3TF5A 1DRWA 2GGSA 1ISHA 4P4NA 4XYBA 1QYXA 1I3KA 2J8ZA 3WQSB 4BNXA 1LDEA 1HE4A 3RUEA 3Q9NA 1C1XA 4L4RA 3ZU5A 4FW8A 1NNUA 1ZVMA 1LQUA 4GGOA 3EY4A 4RPKA 1F0YA 3D7LA 4MVJA 4PRKA 4MKZA 4RZHA 5TX7A 3WR5A 4EZBA 2E6UX 4GX2A 4GX0A 5KIAA 2NU6A 4O0LA 1QG6A 1M66A 3CPSA 4Q39A 4RVUA 3K92A 4MPDA 4J91A 1ULUA 4KTVE 3RBXA 3DO5A 4ALKA 1EDOA 1U3UA 2YFQA 2WWRA 3AM5A 5JDCA 1ZK2A 2OFPA 4WECA 3TOXA 3JQ7A 3JYQA 5JY6A 3B1JA 3OH8A 4LRSB 4ZQHA 1SOVA 4TROA 1LLUA 3CE6A 2ZJ1A 1QLJA 3CZMA 5FI3A 2Y1GA 4ZJUA 4LN1A 2EP5A 5G0VA 3UVEA 5DZSA 1Y8RB 4KMSA 1N1EA 3RCBA 4CM4B 3SX2A 2DBZA 1GCOA 3M1AA 4TZKA 3SLKA 1RPNA 4XRGA 2CVZA 4K28A 4J7UA 2GRAA 2XXJA 3EYWA 3ZH2A 2YY7A 4NFYA 3PP8A 2QZZA 3RU9A 1KEPA 1W0CA 2IEDA 4HXYA 3AOEA 3ROPA 4D7AA 2AHRA 2CDAA 3IUPA 3LDHA 2VUTA 1YS4A 2H5LA 2WD8A 3IQDB 4E2WA 4RDHA 2NU9A 4BO1A 1NXQA 4RVSA 4I1IA 3BTOA 3V5NA 5A9SB 2BRUA 5L3ZA 5K6AA 4NZ9A 3KYCB 4HUJA 3AUUA 3G17A 4CM9A 4CODB 4J2HA 1NVGA 1BTOA 3DWFA 1TB4A 2PD4A 1DBVO 3EVTA 4DPLA 4NHEA 3GGOA 3WBBA 4EI2A 2YYYA 3GGPA 4J90A 5JDCC 4CQMA 5KWEA 2AE2A 1P1IA 4CLHA 2DT5A 2X9NA 4XEHA 2DTXA 4IXWA 1KETA 2NLOA 2DUWA 2W4QA 4R01A 4FR5A 4HFRA 4IS2A 2PD6A 1F8FA 3DBRB 4MIYA 3KYDA 1H6CA 5CEFA 2V7PA 1E1KA 5HBRA 3ONFA 4XIJA 2NQTA 3ASVA 2D1YA 3RUHA 1RKXA 3ZV5A 3QQPA 4NBTA 5GZ3A 1R0KA 1GPDG 5CFZA 1MGOA 4XB1A 3LC1O 1QKIA 5BR7A 3U4DA 2GN9A 1L1FA 3P7MA 4BNWA 1HEUA 4DYVA 1B3RA 2GZ1A 1EBUA 3ROQA 5DOZA 1NAHA 3D0OA 3HZZA 4NH4A 3S2IA 1B15A 3AOEC 4NU6A 3HE3A 5LDGA 5EJ2A 4J4TA 4FB5A 2OBNA 1YOVB 1YONA 1ZMTA 1FDVA 1JLLA 4CMEA 1R4MB 1UZNA 4A26A 2X0IA 4PLZA 3W1VA 5K6AC 1ZK1A 3PHGA 3KYBA 1Y5RA 4G2NA 3GMDA 3PZBA 3GNTA 3NYWA 3JQ9A 2NSDA 1EQUA 5TRTA 1HDRA 1Z74A 4GMFA 4OOEA 4BO3A 2X0NA 5ITWA 3SLGA 3I4CA 1CYDA 1CETA 1KC1A 3RD5A 4CV3A 4MP3A 3GVXA 3E1KA 1KYQA 3WICA 4BNJA 4ZICA 1T2CA 3OQ1A 3BMQA 3JQ6A 3I9JA 3OEWA 3JYNA 4XQGA 4W82A 1A7KA 3IDSA 4MIOA 1ZZEA 5EN4A 4PLPA 3L6DA 4BO6A 7ADHA 3BHJA 5A5EA 5I7FA 3GDFA 3Q11A 3ZDFA 2HJRA 1I24A 1OMOA 5G2OA 1K2WA 1T4DA 3OBBA 2C7VA 3D4NA 1HL3A 2Y67A 4G65A 4NDNE 5G0TA 2DKNA 4R5MA 7MDHA 3JQAD 3K6JA 3TSCA 4BL5A 3JV7A 4NK4A 3L4BA 1E7QA 1WDKA 2VHXA 3PGJA 4I9UA 3GAFA 3RBZA 6LDHA 1B14A 3C7DB 2HAEA 3AFMA 1LSSA 4CMEC 2DC1A 2HQ1A 4FSHA 1FDTA 1EVJA 3C24A 2JAPA 3Q3CA 2YHUA 4XB2A 4RPGA 3K30A 1U2GA 2C2XA 3B6ZA 3GHHA 4BNZA 4E3ZA 4CLOA 3HG7A 1QYWA 1Z75A 4KTTE 4NJOA 1FK8A 5JE8A 3PXXA 1I32A 4I5GA 2VT2A 4O1MA 3JQ9C 4CMIA 4UVHA 1HDXA 3U4IA 4S1VA 1DLIA 3D64A 3D3EA 3E9QA 1PGQA 2VN8A 1E1LA 4J3FA 3WS7A 4BNUA 2QQ5A 2VRCD 4TMFA 1SNYA 1C1DA 3DBHB 3PLNA 4H3VA 3DBLA 3AM3A 1DAOA 4YYZA 1ENPA 4PG5A 5JC8A 4Q3NA 4NFHA 4MKRA 1JVSA 1IHXA 5JS6A 4RVGA 2PGDA 2UVDA 3TL3A 3INRA 3O8QA 3WGQA 3ZV3A 3CINA 3I83A 3ZU3A 4A03A 2A94A 3AI2A 3CKYA 3DL2A 4CM5A 1B8PA 2P91A 3PHJA 1JKJA 2Q2WA 3JQ8B 4II2A 3RKRA 1VL6A 2NV6A 4RO0A 3W8EA 2I5PO 3L4BC 4BMVA 2QRKA 1EVZA 3N74A 1U5AA 3UOGA 4YJFA 1Z7BA 1BHSA 1SC6A 3RWBA 4WLNA 4WEQA 3KB6A 4XYMA 3PWZA 4LVCA 4NBUA 2X5JO 4U6SA 4U5QA 1FXSA 1JKIA 2X23A 4OM8A 3I6IA 5JYDA 3O9ZA 5JCXA 2I67A 3WX0A 1B3BA 1S7CA 2HMVA 4M54A 3LT2A 4BNNA 1CWUA 1D7OA 2GR9A 2JCVA 4RGBA 3VPGA 1GTMA 1ZXBA 2FWMX 1ZEMA 2JHGA 4R3NA 3S2FA 5B12A 4GKVA 1ONPA 4ZD6A 3BMOB 5CDGA 3NAQA 2O3UA 4YACA 3I4FA 3PYLA 1NFRA 5AXAA 5TNXA 3VVCA 3ANMA 1HXHA 4EEZA 1IY8A 1A7AA 3IOYA 3FNEA 5JAQA 4YT8A 5H83A 4IM7A 1Q0QA 1RWBA 1MXHA 3BMNB 4J1SA 2EP7A 1JDJA 4Z9XA 3GEMA 3H5RA 1A4IA 1M6HA 4FN4A 3KUXA 2WMDA 3H3JA 3OA2A 4GAEA 2OZPA 1Y8RA 2FPGA 1QP8A 4XCVA 3HFGA 4YXFA 3HB5X 1PZEA 2Q99A 3KVOA 5ILOA 2Q45A 1QYCA 1QRRA 1NX6A 1VJTA 2BMAA 1QYDA 1NM5A 4RJTA 4WKGA 2ILTA 5CDTA 1N7HA 3FN4A 3IJRA 4J7CA 3DOCA 4B3JA 1DRUA 1OOEA 4BKOA 5A3JA 4GVLA 3ZN2A 5DDIP 4BO7A 2YQ4A 3RJ9A 4WLUA 1P74A 3I52A 3P19A 3F9IA 2XPCA 5IJZA 4J9UE 3ZU2A 3QP9A 4DC0A 1YRLA 5A9SA 3SEFA 3VH3A 5C7LO 4IS3A 2PKQP 1XU7A 3WSVA 4NIMA 1E3LA 1GQ2A 4E30A 5CDUA 2CNBA 3GG2A 3RU7A 5JXWA 1XA0A 5C5IA 2NVWA 1P45A 3PQEA 5EERA 1HDOA 1HT0A 4WCFA 3MOIA 1DHTA 1SOWA 4YBZA 1DC6A 2ZB8A 3UAGA 2GYYA 3F47A 3IKTA 4JJFA 1PJCA 1V6AA 4BHTA 4DMLA 3WB9A 4XYEA 4AJKA 1QORA 3HWRA 2PV7A 3U4HA 4M55A 5AQ1A 4UVDA 4FPXA 2QHXA 3AUTA 3AOGA 3ZWAA 1R6DA 2EIHA 4B7XA 5ENDA 3RC7A 3H9EO 1JW9B 1E1MA 2ZCUA 3F4LA 4XJSA 4GBJA 4EUEA 1SAYA 1GL3A 1PGPA 4IDDA 4MVJM 1SPXA 1IPFA 4BGUA 4O59O 4WCDA 4ZQGA 2EXXA 4NG5A 2VHZA 1KVSA 4ZRNA 2EEZA 1WAMA 4WNIA 4U0KA 3PYXA 4R54A 1MG5A 1BVRA 3NT5A 1GAEO 1TLTA 3V1TC 4MJLA 3OM9A 1VLLA 4HX5A 2NACA 5TC4A 4KUHA 4AFNA 5A9TA 1HSZA 2D4AA 4UAGA 3KLMX 1YOVA 4ZGWA 1ISGA 3UCXA 2J3JA 2OBYA 3P5SA 1E1NA 9LDBA 2JKVA 1HE3A 1I2ZA 4M8SA 5BQFA 2XF8A 3EHEA 2OMEA 4L8VA 3I9KA 4RVHA 5JO0A 3WFJA 2HRBA 2AEJA 4CJXA 2GPTA 3RC2A 3WGTA 1KEUA 2B4RO 3B70A 4WCFC 4YT5A 4C7JA 4WK6A 4J16A 1BRMA 3L77A 1YVEI 3FR7A 1YBMA 5FWNA 1E5QA 4P8RA 4FJ2A 3DONA 3AUSA 3OIDA 3SJUA 1KIFA 3JD0A 1EQ2A 4C7KA 3OJEA 1TT7A 1A9ZA 4J9VA 4J1QA 3WMWA 1I0ZA 1XEAA 9LDTA 4JBIA 2PZJA 1OC4A 1VPDA 2BFOA 2B4QA 3GVIA 3E5MA 5DBFA 1T4BA 3BIOA 1YQGA 4OOFA 2JL1A 3GPIA 5G0WA 2FZWA 4PLGA 1KOLA 3QVXA 4BNLA 2ZTUA 5JO9A 3T4EA 4MVJH 1U7TA 4W6ZA 1UP4A 4B3HA 1WW8A 4OSPA 4RZIA 1E5LA 1HYHA 1X1EA 5H82A 3BHIA 3JQAA 4UREA 3E18A 1UDAA 4CQMD 5FF9A 3UHAA 3TFOA 5KOIA 1NBOA 4CQMB 2OORA 1H2BA 2D5AA 3AY7A 1GADO 4KWHA 1DIBA 3NTQA 3DMYA 3WFIA 2V6MA 4H7PA 2R00A 2R6JA 1O9BA 2IODA 1PR3A 2AQIA 3L07A 3EUWA 1FJHA 4E12A 3UUWA 2Q2VA 4BKUA 4DA9A 1SEVA 2D0IA 4OHUA 3IIEA 3F5QA 4HKTA 3INTA 4PVDA 2VOEA 5ILGA 5JSFA 4CMJA 4IGFA 1JTVA 3WIDA 1HDYA 5B37A 1YB5A 5MGBA 1T25A 2O3SA 4BGIA 1R37A 3HDQA 1DFIA 3O4RA 5JLAA 2VRCA 1PS8A 5I7SA 1VI2A 1N9GA 3F46A 1E3WB 1EUZA 2JD2A 5L53A 4ALIA 4F6CA 1DIHA 3C8MA 2QIOA 3FBTA 4GX1A 4F6LA 4A2CA 1O95A 5DULA 1TEHA 4BNYA 4BUCA 1RM4A 4DLBA 1R0SA 1KVQA 1DC5A 3GRKA 5GZ1A 3L9WA 1KVUA 4BNVA 2D59A 3OQBA 5JNLA 1OBFO 1LXCA 4J0FA 1HYEA 1A5ZA 3TNLA 4R5HA 3GH3A 4E6PA 4ZHSA 5I8WA 2QRLA 4XGIA 1DJQA 2YQ5A 3JCZA 1JAYA 3GA0A 4XJTA 3VPSA 2CUKA 3G1TA 2O3JA 3ZWWA 1MG0A 4U7WA 2I65A 5G0UA 3GN2A 4OKIA 3E6AA 2R00C 4I8XA 2HK7A 2GF2A 2PKRA 3BMQB 4B8WA 1E0DA 2BI8A 1FDSA 4CL3A 1H6AA 2PWZA 3EW7A 4LMRA 3WWYA 2I99A 5CAEA 4R69A 1I2BA 2C29D 2I76A 1PS9A 4DREA 2HCTA 1BDBA 3U62A 3ZV4A 1E92A 2FMUA 2E82A 3BMOA 4M49A 2V6BA 4MVJP 2DTEA 3K31A 4AJNA 3EMKA 4CMCA 1YQXA 4IZHA 3HHPA 5I8ZA 1L7DA 5I7VA 3RKUA 4O6VA 4NI5A 5LDHA 1GUZA 2O2SA 4HNGA 3GUYA 3X2EA 1Q7BA 3BMNA 1ENOA 4K6CA 4J4BA 3GK3A 5ER6A 1WPQA 4JJIA 4WPGA 5J23A 2FZEA 1LEHA 1P1HA 1DAPA 3BYZA 1U8XX 2CVOA 4RORA 3W8FA 2YFHA 2DLDA 5COQA 3Q0EA 1NWCA 4HY3A 4MVJF 3JQDA 1J4AA 4CLOB 1HWYA 2RHCA 1T2DA 3RUFA 1YXMA 3C1AA 1HSOA 2PZKA 2NM0A 3OMLA 5DOVA 2DU8A 1AXEA 5EPOA 4Q3EA 4PFJA 1G0NA 4CMIB 4B3IA 3CMMA 2NTVA 2DVMA 4EW6A 4NR0A 2BD0A 3H9JA 1GUYA 3V1YA 3LU1A 4MP6A 3PHLA 3D4OA 1ZW1A 3PJFA 1ZJYA 5HM8A 1C1DB 3AFNA 1ISIA 3G1UA 4YT4A 3CEAA 1P44A 2WSBA 5L4SA 3ANNA 3KV3O 4LISA 3F3SA 3NKLA 1SEPA 1VSUA 3LT0A 4UEJA 3GEDA 2A92A 2O7QA 3WQQA 4BO8A 2C2YA 3FSRA 4IUYA 2BKAA 3MWDB 4UEOA 5DCYA 2E37A 3O8QB 4NK5A 3E9NA 4EEXA 3INGA 3B20A 1V9LA 1GCUA
chains in the Genus database with same CATH superfamily
4YA6A 5K2MA 2LD4A 4MQBA 5ALVA 4LJYA 3A14A 2GILA 1JHQA 2AT1A 2PT7A 1LCIA 3ZGLA 1E20A 3Q3IA 2AD1A 4HWRA 4AUMA 2FN7A 4Y6RA 3UFBA 3SQNA 2AF4C 3BJIC 1VBMA 4M83A 1WB6A 1E0JA 1ISMA 3B1YA 5J3JA 5CT4A 1X6VA 4YRNA 2F1OA 3L1IA 3FOFC 2IRWA 3QEOA 4LKRA 2IQIA 4EB0A 4HRVA 1I01A 1YT5A 4MO2A 3TXYA 1VG9B 4A0QA 621PA 3D6UA 1QRDA 2ONZA 3F6EX 2RD2A 1KFJB 4WMLA 3WXMA 3CVVA 1HE5A 1H23A 1M72A 3AI3A 4L28A 2YHSA 3CB2A 3TNYA 1GCAA 1NBAA 2W8ZA 4XW2A 3AFHA 2O06A 2VCHA 4FMBB 3UY4A 3BD7A 4P7KA 1T1JA 3PHHA 1F8GA 3G9XA 2BLLA 4OLBA 5DM70 1VIVA 2D2VA 3DFIA 4K88A 1BE0A 2J3KA 5BW4A 2VDMB 1EXDA 1J49A 1R66A 1ZM2A 4RAQA 4WESB 3ZKWB 2OBFA 4A5SA 4YCMA 3IE1A 3NDRA 2CJWB 1IULA 5FBZA 2QX6A 5LYJA 1ETHA 4OB6A 5JU6A 1F1BA 4MIEA 4HGZA 1QR2A 1V9SA 1O57A 3HU3A 4JN6B 2HYIC 2J0EA 3AB3A 3TBHA 5BVGA 1V11A 1NBIA 4KLNA 2GZAA 5DMHA 2AG8A 2MHCA 4FMCB 4OHCA 4BMYA 4IHQA 4PZCA 2OXEA 4FYWA 3C6QA 3TR0A 5A04A 4JYBA 3NB0A 4RMHA 4F4DA 2AZDA 2XA2A 1GZ6A 3IR7A 1A76A 3QIVA 4IOMA 2I4NA 2HV8A 3GRPA 4HAWA 3O4GA 4II3A 4QYXA 4B35A 1V48A 1NLFA 1V5EA 2P6RA 1K7FB 3CJQA 3RSSA 4JA2A 1M10A 4BO9A 2XVYA 3AY0A 1P60A 1BJTA 2B0CA 4UHKA 3M49A 4P81A 2B7CA 3QJGA 2E48A 4Y0VA 2ZJAA 4L15A 2R4UA 4BNIA 1UBRS 2G09A 4IIDA 1BCSA 1M7HA 1C7IA 3D0KA 4AQYB 5L4NA 1NF2A 2FSSA 1MAVA 1VJ5A 1KKMA 4Q05A 1MOPA 1WL8A 3B2NA 3NVDA 4TRRA 4K9OA 1PZHA 1C8LA 2ZOSA 3HFSA 3MEQA 3SF8A 3V48A 4J7AA 2IBTA 4KXFB 1SOUA 2Z43A 4ZTBA 1Y8CA 2WQZA 4KXWA 4YJDA 4BIMA 2PD3A 1XTQA 5AM5A 1KZ1A 2Z5LA 4TVKA 1OFUA 4G0MA 1UJ6A 3CUVA 2E4XA 1PJRA 3EVAA 3JW8A 4O2AA 4U7GA 2VP9A 4KO3S 3ZNOA 2DQZA 2P9BA 5FLYA 2I7TA 3T6KA 3OC0A 4LZZA 3BEOA 1Z28A 3PGXA 3LGSA 2XDWA 3PNYA 1XI2A 3IP3A 4MUBA 4Q9NA 3KT3A 5FBVB 4RULA 1LJ8A 2OO5C 4JNCA 1RVV1 3A9UA 1NVMB 1W75A 4D8VA 4ILEA 3PNKA 1U8FO 4OI0A 4LWQA 3WAKA 4O4JF 3MJTA 4L2IB 5AKZA 1ETUA 4IZIA 4F56A 1KO4A 4GRDA 1AHPA 1SBYA 5FOTA 4MJ3A 1X8KA 4X54A 4OMCA 1JR2A 2QX9A 1LF5A 1URPA 2Q1TA 4IIHA 5AVUA 3ZTYA 4QDOA 4EZIA 1O94D 2NU8B 4BNTA 1LY1A 4KXXA 1DOAA 4LVNA 5D87A 5AWFC 1DBRA 2ONYA 1YCGA 2P9EA 3O75A 1V0JA 2QJTA 2D62A 4XM1A 5CT6A 1NZJA 2W43A 3DB2A 2Q6LA 4OATA 1ANKA 3P9KA 1GSOA 4EOGA 2MSDB 4HQNA 4WIAA 3NORA 3QUQA 1P4GA 1G5IA 1N2BA 1IZ8A 2CEAA 3DDUA 2ERXA 3ILYA 4Q18A 2IZ1A 2Y1KA 2HWYA 4G63A 3V4PB 1WSBA 1D2NA 3OQIB 1EDBA 1KRWA 1OI2A 2AW3A 1TTPB 4X61A 1KI4A 1PRYA 2QI9C 3ELYA 3VO2A 3BRWD 1YR3A 3RSHA 2E2WA 2Q4TA 4F4JA 1PQYA 2WKPA 3G59A 3B3JA 3I28A 3RTDA 1DWUA 4WACA 2OP0A 4YP1A 3C6MA 2BFFB 5KDOA 2OUKA 3FSJX 2P2GA 2AL7A 3MAAC 3MQ4A 4DWJA 3KL4A 1S3FA 2WC1A 3B51X 3GF4A 3IS3A 3KJGA 4ILKA 1RCFA 4RA9A 4CKBB 1QTIA 4KN8A 2DPMA 5A3QA 4F96A 4EHBA 2O0HA 2OL4A 1CUHA 2PBFA 4HK4A 5CJPA 4Y30A 5D3MA 3HCFA 1RLMA 1CVIA 1SUIA 1WDLA 3S1AB 2M1XA 4UAVA 1WVGA 3MOSA 3VJKA 2IQ5A 1D8AA 2HBQA 3OKAA 2I6GA 4DNFA 3MWFA 5HF6A 4DUPA 1PR4A 3SSMA 2VZ8A 4G85A 4HB3A 5HNKA 1GKYA 3EZYA 3A4LA 3L0DA 4BYGA 2JIZA 1CLUA 2F59A 2HWXA 2C7GA 4R2IA 3VC2A 2QYTA 4LNAA 2CHVA 3V4SA 3ZWYA 4HWKA 3VH1A 4QUHA 4PU0A 3DTVA 4OP1A 4D9GA 3ORHA 3I1IA 4UE2A 2O8EB 1UFOA 2RMKA 3H1AA 4FFVA 3EUFA 4LZJA 5BSRA 1B16A 1VSTA 2CVHA 1D0SA 1G8SA 1UJ2A 3DKVA 5CW2A 4IIJB 5CYFA 1L5MA 2I54A 5CPBA 2I4LA 3MINB 4HRXA 1IN1A 5JMWA 4Q4JB 4LSWA 2E85A 2WV9A 5CCDA 3WMRA 4DR1B 4D46A 3VA7A 3KBBA 2BHNA 4WADA 2PUCA 3HRIA 3KWMA 1AV6A 1PYGA 2JLBA 5I7WA 2HA7A 3S6JA 4C7OB 2Q8NA 3O1HB 3HN2A 1MHPA 2A0WA 4PQRA 1NBMD 2H4JA 4JJ4A 1IN6A 3SOPA 4DUYB 2H1CA 2F55A 2GFIA 1QH0A 5LA6F 3ZDYB 4DG9A 3LX6A 4CM6A 1O89A 3SQOA 3I5UA 3OFJA 3NGXA 3N2NA 2C83A 4I50F 4JWTA 3VI3B 5CLJA 4ND1A 2AA3A 1J2EA 4EY8A 2HJ9A 3UXMA 3ME5A 1J97A 1XBTA 1YZGA 3PQ8A 5JH7A 1KRXA 1ZIPA 3CZ5A 3JZFA 5LXTB 4MULA 3VR5D 1Z13A 1H9AA 3L7BA 3K53A 3FDXA 4QVGA 2RIRA 4L4ZA 3ML1A 3GC6A 3L06A 1N9GB 1A69A 3HBAA 1I1OA 2QT1A 3KE9A 3M4YA 1JEYA 2R8BA 4OFWA 4E5SA 3RJMA 3VNRA 3IO3A 4X6XA 4O5AA 4WAUA 4C08A 5EAIA 3T41A 3NBYC 4L57A 2ZE7A 4DJ5X 4J1NA 4DCPA 1AS3A 4QOIA 1XUOA 4IF4A 4PCLA 4F1KA 3CR8A 4IDCA 3D2LA 4NAUA 1ZC3A 2FRDC 3KLOA 2P8JA 4X93A 1XZQA 2W0MA 5T6MA 3KAPA 3C7CB 3OWOA 2JFBA 1ODKA 4ERNA 2GCIA 1YZNA 2VC2B 4M36A 3RK1A 1SVIA 1YB4A 3LF1A 1KAGA 1KYZA 2A0YA 1VLHA 2J6CA 2PN1A 4U6QA 2YBDA 1HQYE 1Y1PA 4Y6PA 3MLEA 4BASA 5KYXA 3LH5A 3HH8A 4Q3BA 2IZZA 3N7AA 1O03A 2IP2A 1LZKA 2MMGA 1DAHA 3L8HA 1XMVA 2CHEA 3O3MB 2M6SA 4JQCA 2XWQA 2RB5A 3C5HA 3IIJA 4CIXA 4Y2GA 2EZTA 2NGRA 4YVFA 1JEJA 2VJCA 3BUSA 4AP6A 1G20E 4ALNA 2PEZA 2BFWA 1IMJA 3LXRA 3VJMA 3C74A 2NPOA 5BW5A 1XMSA 3MOGA 4MV1A 3R5SA 5AFSA 3UV3A 1KY5A 3GA5A 5BOVA 1TJNA 3GMIA 5CA1F 4DYDA 4RDCA 1D07A 3PTLA 1NL3A 1B6TA 1I2CA 2DWQA 3ORSA 4YRJA 1HRDA 1UK7A 1MDFA 5B7GA 2OD7A 1WR8A 2VTDA 4FEEA 3MLBA 3O1JC 1ZN7A 3QF7A 4R3WA 3V7WA 1FTSA 1Y7IA 2AWOA 3TAHA 1H65A 3DGEC 3UJ6A 5H4GA 1Y89A 2P67A 5HJEA 4JUFA 4XWAA 3LPLA 1M2GA 4CUJA 5DTIA 2B61A 4LBVA 3SZLA 4JV5B 5GOTA 1NQAO 1YTLA 3OX3A 1Q2XA 1M67A 3BXHA 4JT9A 1CD5A 3ROFA 4P5EA 3WBKA 4IZ6A 4R1SA 4LC9A 1JA9A 4LOHA 4ACBA 3ZY5A 2GK3A 2QN2A 3G2QA 4AO7A 2VJAA 1TK2A 2H65A 3H5WA 1A8UA 5CNKA 4ESOA 2ZTHA 1T3TA 5KVQA 2LDXA 2ZWOA 4D2IA 2O0MA 3C6BA 3LKVA 3WG9A 1B93A 3OF2A 4M0MA 1XJ0A 3OE5A 1K89A 2Z56A 3VZDA 3T3MB 4IPTA 3B3QA 4DM3A 3VAAA 4IIFA 4PVCA 3UG6A 1RRPA 2DAPA 4BB5A 4UNSA 3VGPA 2I1LA 2I6QA 2PMBA 2C03A 1NYRA 3GP5A 3C3XA 4OHRA 4HXGA 3JQCA 1E9FA 3ZBQA 3OA0A 2V97A 3V4LA 3KKOA 3QRWA 4GMGA 3Q7TA 1LA2A 4A2PA 4P7JA 2O52A 4QQRA 2WAOA 1O7JA 4YRCA 4HGYA 3JD4A 4I6EA 3N58A 1YB2A 4OG2A 3VU0A 4PYQA 2C0QA 4NWIA 4O3MA 3GT4A 3QNWA 3AVWA 2E9SA 4NARA 4INAA 4CM7A 1XMIA 3MRSA 3SHWA 1LQTA 3TZCA 2WI8A 4DILA 3DLIA 3UM9A 1MQ8B 2RI6A 2I9KA 2P7IA 4M46A 5K3SA 3OU2A 4D6PA 3MCUA 1I6KA 4CTOA 4JT2A 4JQOA 4L2IA 2YWCA 5DRYA 1CNEA 2NP7A 3EC7A 4JFAA 3V34A 4CMAA 2WWYA 1C29B 4RPCA 4Y2UA 5LP6A 3HS3A 3WIOA 1M1YB 3ISTA 1DE0A 2REBA 3QLTA 4RFLA 2A9JA 4NJMB 1NVVR 4RHUA 4KR9A 3RVKA 4ARUA 4J0QA 2QL9A 1SG9A 4KAJA 4RZXA 1BJKA 2NU8A 2YMQA 3FY4A 1KYTA 5DGHA 2GO7A 1I10A 1R0LA 4UTPA 1XNJA 1NNSA 2A84A 5CTJA 2QLFA 2DHQA 3QA9A 1ULZA 5B2EA 1J2UA 5JQGF 2IUEA 4JYZA 1YQQA 3KVYA 2XLBA 5E2IA 2X8BA 4UBIA 4YH1A 2ZP1A 2X6QA 1PJ8A 1FUUA 1ZMOA 4R1NA 4XWOA 5CG2A 5KPDA 2YXPX 5H81A 5E3IA 2VSQA 3L0BA 1R5NA 4RXUA 3V8EA 4R4JA 2YWGA 4HDSA 3Q2KA 3UN1A 5IJ9A 1PVDA 4AKSA 3F4KA 2NSHA 2W11A 3DKRA 1O5TA 3H2ZA 3LBNA 1UPUA 2GQ0A 4Y7DA 4ZARA 2C9CA 3CURA 3ZZ1A 3C48A 2XUIA 2X6RA 2I6TA 2OTCA 3C3WA 3EDQA 2PZMA 4RC9A 3W4JA 4PLVA 3MW8A 4DADA 1VFPA 4EB6A 4ZAGA 4G0VA 2NSYA 1REQB 4MUKA 2QP4A 3IUSA 3V4FA 1C7EA 1P1KA 4ESEA 1UWKA 1AMNA 4REOA 1IOWA 1KVTA 3DV0B 1DEHA 3S1AA 5EUMA 4DCTA 1U2DC 4B43A 3EODA 4DV7B 4CM8B 1K5GA 4XLZA 1Y63A 4FHFA 4GDMA 3PQ3A 4JEHA 2IU3A 4FK8A 5EWJA 2NZUG 5CDHA 5J4YA 1NUPA 2XQFA 4KQKA 3PNQA 4KO1S 1S8AA 1HT2E 1OVMA 4MDEA 4E4YA 5FO1A 1E9RA 3PXCX 3BHNA 2CXXA 3F97A 4RSRA 1LSUA 1N2SA 1CHNA 1X3SA 2RKBA 3G0IA 5GTDA 5HWSA 2VQEB 1V7ZA 4X97A 5D3ZA 4WZBA 1D6JA 2O8EA 4Q03A 2VDQB 2YZ2A 2ZI3A 4NBSA 4PAGA 3WRYC 2XGSA 2IYZA 1OWNA 5G4LA 2GERA 2IUFA 1ZM3A 2JI8A 3F73A 2WWHA 3I4LA 3VYSB 5DTMA 3HKEA 3C87A 1E5VA 2IS2A 2VCYA 3MINA 3HCWA 3E61A 1D1TA 3NEJA 4G4SO 4OQLA 4Q1AA 2JA1A 4XWTA 5DHUA 3SM9A 3ZGYA 4Q4JA 2CVFA 4Q9HA 1WNFA 3BTVA 4G1BA 1JT9A 1UUFA 2AH5A 4HAYA 2INGX 4IMJB 3AH8A 2F43A 1CIPA 4ZODA 1AGNA 4EYQA 2EW1A 2QL7A 5A7GA 3I12A 1JG6A 3PD1A 4XX0A 5J4KA 1BXGA 1XEWY 1ZA2A 4BX8A 5B1HA 3SJUA 5DLPA 4DCCA 4M0UA 3VH4A 4TLCA 2P9CA 4D3XA 5CXUA 3ZI7A 4N0DA 3CKLA 3ZI4A 3LMKA 3TIVA 4BHHB 1P2FA 5F1YA 2EZ8A 1M7BA 3G88A 3I61A 4PC3A 4RA6A 2EZ4A 1TKCA 2NTJA 3IMCA 3MT9A 1PJ2A 3BL6A 3X3HA 4K0RA 3Q98A 1IJEA 3VVBA 4X66B 3ZD6A 4LF9B 2X9GA 4WE3A 5LXTA 1NURA 3V33A 1EI9A 2BMEA 1KS2A 2LUOA 4X1YA 5AW9A 5B7QA 2OCYC 1VE6A 4P36A 5B53A 1MU0A 4GSYA 1ODCA 1RBYA 4D8YA 4W5HA 4OHXA 1O97D 2YV2A 4HWTA 2ZJBA 4KNVA 5FWXA 2EDAA 2FPXA 4XZ3A 4AXBA 1WUJS 2GPSA 4AO8A 5C7YA 3N2ZB 4YAOA 5JJKA 2V4MA 3U3ZA 2XZOA 3Q3HA 2VDRB 1J7KA 1EA7A 2E0IA 3HY6A 3VR6H 1ZR2A 4RWZA 1K4MA 2O2CA 2G76A 3OAAA 2KQUA 5HW0A 1H2XA 2RGCA 4AJ4A 1T36B 2Y68A 1MR3F 4DQVA 4LYDA 3UJPA 3TFQA 4KLAA 4DGQA 3U5TA 1POXA 4YCNA 2YXBA 4RDIA 1H2WA 3S2ZA 4J1TC 3P2JA 4EJSA 3D6VA 2PY6A 3BGIA 1GPJA 3JASA 2PNFA 4ZO8A 3RIGA 2FWAA 1XAJA 3WLAA 4KMRA 4YAEA 2QUZA 3I76A 1G17A 1R5JA 4HL6A 1UP7A 1Q1BA 2VAMA 2YVQA 4OSEA 3JD3A 4IEIA 3DQPA 4ZEWA 4D42A 2ST1A 1IZZA 4EKYA 3QEAZ 2W2MA 1GAXA 2A1UB 3D31A 1SWVA 4JASB 3W8DA 4AUNA 1LS1A 2EHJA 3PITA 3GELA 4YLEA 4DPMA 1DUSA 1LVGA 5IWCA 1P61B 4X24A 2DUJA 1SCDA 2E7ZA 4GYYA 2VJOA 5IDXA 3HU2A 2QX7A 4ZOLF 1QHEA 4QU8A 4C78A 3W0LB 3HZRA 2CLKB 1E94E 1M76A 4OHZA 3GRAA 1RC0A 5ICFA 5HXAA 5KNDH 3ZW8A 2LGJA 4N3AA 1OY1A 1ACMA 4C20A 4J94A 2SICE 2BN4A 4B45A 1LC3A 4JOSA 2FWNA 1Q1AA 3LKZA 4FN5A 3AKZA 3A4TA 3OZXA 5HF9A 1GNQA 1SCUB 3NG1A 4NTZA 1DAEA 2YW2A 2R7KA 4IFEA 5ALJA 1Q14A 3AGPA 3HWSA 4NMHA 4D9BA 4UTZA 3T3PB 3LPMA 4WZBE 1YL7A 3J81A 2AI2A 3GT0A 1O4WA 1WMFA 3EZNA 3EA0A 2CF5A 3CEPB 1T2FA 4HTFB 4M76B 3VRHA 5IVDA 3KT0A 5JRZA 1GEEA 2IYOA 3AWDA 1DKMA 4AJ9A 1EUDB 4EAAA 2BFAA 1RRMA 4POOA 3LP6A 3P52A 2FP4B 4BEBA 4MLPA 3RS3A 3T1OA 3ZS8A 1S1MA 5EOVA 5ADHA 2DMRA 4B74A 3A6PC 5JAHA 3DNMA 1KC3A 2W6CX 2XSZD 1COZA 3HBNA 1DGQA 2ZREA 3HADA 4EMTA 3CM0A 2ATCA 3BGSA 2FWPA 4JROA 4N03A 3L6BA 4R68A 4DHEA 4PSDA 4JLNA 3MT0A 3ZYZA 1NXPA 2XQIA 1HNNA 1K66A 3GFBA 1X7XB 1BJRE 3I5MA 3LYHA 1CZUA 4Q21A 5EFOA 3RF7A 4BP8A 1BSVA 3DEFA 1QE3A 1OLOA 1XZDA 2ZUFA 3FVRA 3VTKA 4PLWA 4TTJA 1M2VB 2MSKA 4FP9A 4GI2A 5I9NA 5CU7A 3T0IA 4Y8VA 3E1GA 4Q0MA 5TR9A 1BEZA 1FDIA 4KP7A 2P4QA 4LCBA 1MP0A 1V8BA 4AN0A 3II6X 4GL4A 5HBGA 4XDGA 4KOAA 3RVDA 1COWA 2AXQA 3I92A 1A50B 1X9HA 1YE5A 3RIEA 3HB9A 5CFPA 2WM3A 3EVNA 1FDUA 4IKPA 4L9WA 4YAKA 4FKZA 1Q1GA 2XIJA 4DDVA 2UYGA 3PUWA 3DEZA 4M1WA 3ZQKA 2WHQA 4JLOA 1N6IA 2G77B 1JTEA 1I33A 1GYRA 1WW2A 3F9RA 2VWQA 3H8SA 4O33A 4E08A 1FMTA 3BWCA 2P62A 3EW9A 1Q50A 1U5CA 4MS4B 1P31A 4ZV7A 5AXCA 2JANA 2DHEA 2ENWA 2OV6A 4AP5A 3MHTA 5F3DA 3G49A 2ZAMA 3TJMA 5EMKA 2DPHA 3BHMA 1KARA 3MJVA 4PLFA 4YMVA 5SY9A 2BJWA 3TLXA 3FZNA 1RZUA 4MR7A 4NJMA 1XROA 2IYYA 4NYJR 3CNEA 4RABA 1U7HA 3WC4A 4GP9A 4MJXA 1AO0A 4UU7A 4Q3OA 1K9SA 3HJAA 1PJQA 4FFBB 3ADOA 1H2RS 1NY6A 4IYRA 4FM9A 2I2DA 4RH0A 2W6MA 4JZYA 2HSDA 1JA1A 1H0HA 3QSGA 3HFRA 4QU5A 1XP5A 2G5GX 4XM0A 1MIOB 5LMUB 1HFEL 3EXEA 1OA0A 4TV9F 1TF5A 4LSMA 4IIYA 5EHQA 4V0QA 2BH9A 2HIMA 2MYTA 4GC5A 4V2UA 4CMHA 4N7MA 4B6GA 4DS3A 4C6RA 5JLJA 3G0OA 1ZRSA 3ZC3A 2UXDB 2HBRA 5K8IA 2XWJI 1V96A 4ZAVA 3H0KA 4EG1A 1AHIA 3JD2A 2E4AA 4D4GA 1OPRA 1KPGA 5DN6A 1UBLS 4HQ0A 1K6JA 4BGEA 4FKMA 1QKKA 1A8HA 2R7LA 3L4EA 3NBKA 4MR9B 5DE3A 5HVNA 3OG9A 4NZPA 1Q1EA 4K26A 1RHRA 4EMUA 1YL5A 1OXVA 2C0PA 3SXUB 2FW0A 4FGLA 4BX3A 1KQOA 2GAIA 10MHA 1KXJA 3ABIA 4J2OA 4IZOA 4LV8B 3ZZ0A 4ZQIA 2PGNA 5T8KC 5BMOA 3A9VA 1JHPA 1HDCA 1MA3A 2EJUA 4Z9AA 4OJKA 1RPAA 3URMA 4B17A 2H11A 3OKPA 4QGSA 3LUCA 5HZKA 4IHJF 4BVBA 3GLGA 2CUZA 2DUNA 1GFZA 4FGWA 4CM8A 4DSUA 1BOFA 4OYRA 3ZHYA 2NADA 2V58A 1L8LA 2VTVA 1U1EA 1SKQA 3ROTA 3FMVA 3I9LA 1JR3A 4EBFA 4WGGA 3LF2A 4Q48A 1DG9A 2XTNA 4GHWA 5DGCA 3BC1A 4P92A 3W2TA 1J0AA 1PZGA 4OYYA 3T9DA 3JQBC 3DHYA 3KKEA 5EKDA 1V5FA 4NEGA 4O2BB 5CVEA 2SCUA 4LK2A 2PLWA 3W1EA 4BLRA 4WI1A 1JG3A 1UC4B 1XKTA 1D1PA 3K1AB 2IXDA 3DE6X 3MXTA 4A0GA 3MB5A 4ASUD 2UZ4A 2B4YA 5JS2A 3EZ7A 2ZJ0A 3IVMA 3OLCX 4BGVA 1XRJA 1OGJA 2Q07A 3QJ5A 4Q3LA 3VKWA 1H8HD 1U02A 3WGZA 1AQ6A 1J1UA 1QPBA 1NQTA 1RAIA 1ZG3A 3EPJA 1K3UB 2FR0A 2R8EA 3BQMB 4B09A 4CKCB 4MZDA 4CF5A 4CTJA 5IF3A 4RETA 4ZT6A 3RVBA 1ESEA 2NNLD 5L95A 3ZDBA 5TQ0B 3GLVA 1A7UA 1W6RA 4LHWA 4ZOAA 4BVLA 1M2EA 1QE0A 3UO8B 5FBHA 5L7TA 3AERB 5DIFA 1NLMA 4S35A 4RK5A 1YFJA 1XG5A 1UAAA 4RFVA 2DGDA 1OW3B 3KJNA 3DJYA 1IM5A 1DHRA 2CNDA 2PL9A 1WMAA 3KQMA 3VZQA 3ZH9B 1YC5A 1CEYA 3RJTA 4CTKA 5B1YA 4L5IA 1SU7A 5FOSA 1IJFA 1GUFA 1G8FA 1S2OA 2WINI 3PX3A 5EIHA 2AJCA 3A6ZA 1L8OA 1A98A 3NPMA 1YCFA 4KXMA 3WK8A 2Z2XA 5FPPA 2QXTA 3C5VA 1LU9A 4FGSA 1WVIA 3R41A 1JVBA 2VHCA 4UTNA 2R7AA 5LIPA 3V4OA 1E7YA 2GN8A 3QM1A 1EXNA 4IIXA 4QT4A 3ICQB 3PPIA 4EGAA 4IIBA 2AJBA 4KU4A 4L0CA 4B80A 1H9BA 3T99A 1R50A 4D9EA 1RQ2A 5IM4A 2J5RA 1KK1A 2Q3LA 4DLTA 2OZLB 2WHEA 2TMGA 2JIBA 4M37A 1XQ6A 4PTLA 5FB3A 4ANFA 4WFQA 5HKBA 1OI7A 4OHFA 1JU4A 2NVUB 3FWNA 2IPMA 3IIIA 3NWBA 3LUFA 3RTEA 3HPRA 3ZIAA 4M0LA 1SQ6A 4LI3X 5DBGA 4F7DA 2IDKA 4AN1A 4EFLA 3OE7D 3VOTA 2A9KA 3HGMA 2Q1SA 4YN3A 4W7HA 4X6YA 2PRYA 1X7HA 2VDJA 5LN1A 3S2UA 4XDHA 1OV4A 4ZYZA 1LFAA 1S8FA 4PG8A 5K3CA 1PSWA 5CVTA 1MENA 3CG0A 3FW1A 4FBLA 5BYAA 4GICA 4ZJZA 3R3JA 1SXHA 3WGYA 2B8NA 4DLZA 3IL2A 1UFRA 1QVRA 1CVLA 1FU4A 1M1XB 2A1UA 3HBLA 3HEAA 3D3WA 2GJAA 1U2QA 3GN1A 4LOLA 5E4FA 1NXTA 1IIBA 5ENZA 3QE0A 4AP9A 5KNCD 1K7SN 4CG3A 3UHJA 1HZJA 2FJ0A 2HU2A 1UR5A 1DWQA 1F8UA 3T3OA 4HN2A 2J3DA 3EBOA 2DSNA 2H2IA 3NRJA 2D8MA 2X6TA 3F6SA 4LOIA 1GPKA 221PA 5F3RA 2KBEA 1Q6ZA 3GLGE 4XVRA 2GASA 4BNHA 1F4VA 1SOMA 1ZCJA 4KI7A 5AHRA 2P9TA 3FZGA 1QV6A 4G8BA 4HFJA 1G5TA 2BKLA 1DT5A 5LOVF 1JR3E 1CUAA 1J7JA 2F3RA 2WOJA 3L7LA 3T7CA 3H2YA 1J6UA 1JIVA 2Z95A 3QF4B 3RI3A 2OAQ1 5BR8B 5F3WB 1D8TA 3QW2A 3ZWMA 2ID4A 3M5DA 4HVAA 2C4NA 4Q37A 1B2RA 3BXXA 3FHCB 4Z2YA 4C4ZA 4DGSA 1O08A 2D5IA 1U9CA 2EX4A 2C9YA 4HTFA 4UD6A 3WIUA 3FE2A 3U6BA 2RHWA 3I9V1 2BCGY 1XC7A 1ULTA 3VUEA 3CVXA 4AKIA 3KSUA 2H9AA 4AZSA 4QYIB 1EXVA 2WD7B 4M1TA 3L1VA 1PL6A 4BC1A 1Z47A 3TTTA 3KZOA 4EPWA 2WZCA 2QD2A 3OZDA 4M7WA 1J23A 4O0MA 5KOJB 1D2CA 4AJ1A 2J9RA 4HVLA 4DCSA 2AV6A 2XLCA 4OYLA 1USWA 3OMXA 5FA6A 4Q3DA 1T3HA 1S96A 1YJBA 4IVRA 1LB1B 1QNFA 1M2NA 3QA3E 4LGCA 5I9LA 1RYYA 4ND3A 4ND7A 1QOZA 4I4NA 3ZBUA 5IMSA 2DSTA 1WS6A 3QYJA 4P4TA 2ADFA 2V65A 3EZGA 2XITA 3HKDB 2QYOA 1QO9A 3L0ZA 3AL3A 4GECA 2PWYA 3IIMA 1DB3A 3R9XB 4DA7A 2GEUA 2PZGA 1YJCA 3D3QA 3I3OA 2BGIA 821PA 1W85B 1OXBB 2W2LD 1YBFA 3BD6A 3M82A 4YRRA 2BIFA 2O59A 2HF9A 1C1HA 3DFFA 2FEMA 4XH9B 4ZCMA 1XDWA 2JLUA 3E2IA 5HMMA 3S2SA 1DWPA 4FMDF 4A8JA 1IEQA 1HLPA 3X43A 2YY6A 3IBFA 3KWJA 4CKYA 2EKZA 3A9WA 4JDPA 5DGDA 2W6ID 1Z35A 3EOAI 4NCKA 5C80A 1U0TA 4JSTA 1ONOA 2CLEB 5BT9A 4GLOA 5JC1A 2NQ2C 3PGKA 2JJYA 5I48A 5CLIA 1F0KA 1L1EA 4NEHB 2AG1A 4H16A 4O4LB 4XYLA 1FFCA 2RGEA 3VAZA 2Q6TA 4H7KA 3NHJA 1E6KA 3AUAA 3LBIA 2Q1UA 3GRZA 3N7UA 3JWEA 2O20A 4L7VA 3L7YA 2WWIA 3Q7PA 3QFFA 2PU7A 4YRPA 3UTCA 2EKPA 4F8YA 4QM6A 3ZIDA 4MB0A 5HK9A 4RPLA 1TT5A 1DMSA 5BWNA 1J5PA 4LIPD 3UWSA 5JDIC 3THWB 1TJ5A 3A2NA 2AW5A 2FFRA 3FI0A 4FHZA 3WK9A 1UM8A 3V1KA 3L0SA 2VT7A 2NV2B 3HB4X 3RRJA 1LSOA 3ITEA 4FUTA 4ZHQA 3GJ7A 2W8BB 3MWKA 2NPFA 3L7JA 2PR2A 3RS2A 4IXTA 2D5LA 5CPFA 3GGSA 5EZ5A 2XOKA 4K05A 5H0IA 2WF7A 4W8GA 5F35A 2QJFA 4MZXA 3ZCTA 4EPRA 2B2CA 1WOMA 3G89A 3QVSA 4RX1A 4UXJA 4DLXA 5ALDA 1ZM7A 4ID9A 4UEKA 4J43A 1F51E 4DZRA 1UXKA 2VOJA 2H2DA 4EKDA 1PWHA 5DHAA 1QGOA 1Z6AA 3L9XA 4ENUA 2I3DA 3AI1A 2VHQA 4ZK2A 1SBNE 1E2NA 3DHNA 3DKKA 4Q00A 3VR5H 1EPUA 3NGMA 1CT9A 4UNRA 5BNWA 5IUNC 1WPRA 2VPYA 3ZUPA 3BIXA 1FJ2A 3USZA 2X58A 1Y4ZA 4JLUA 3EAFA 1CJCA 3SXUA 3HJFA 3O4FA 1YIOA 2GXAA 3ISVA 3FFTA 2ZJ8A 3HB1A 2JGDB 3MN1A 5IKXA 4L4XA 3VXKA 3R6DA 4IEFB 4MQFB 1GM5A 2PFGA 4IMRA 4L9SA 5A6VA 3TPFA 4UM9B 1O0BA 5ALHA 3K15A 3QFCA 3SZ3A 1Z3IX 1SUEA 2V6FA 4A73A 1JG2A 2R5WA 4XIFA 4EF4A 2HTEA 1SBQA 3GLHB 3RUAA 4ZO6A 1ZFNA 4AKGA 4RM2A 2V8OA 4AS1A 1JIQA 1PK8A 3EPKA 5LP1A 1QTNA 1ORRA 2P5YA 2G28A 1QZZA 1P75A 3NWPA 4CM4A 2II6A 2OMKA 4O2BA 2VF4X 1Q1NA 3QKTA 2DH5A 3D8RA 5AKJA 3K1AA 1PQWA 3RUCA 2CUTA 2PX4A 1FS5A 2IK8A 3OI7A 3TR6A 3JZMA 1J56A 5A2GA 1W0KD 4ZZ1A 1M2OB 1ZRHA 3NTXA 1YD7A 3O4HA 5AYVA 4F8EA 5A1JA 1WXDA 3DBIA 2E89A 1SZPA 4KIGA 3ZNNA 4CKCA 4RD2A 1UMDB 3WBFA 1U2TA 2GUWA 5JAZA 1YZKA 4QUIA 1LDYA 5TQ0A 3VOSA 5LD2B 2AIRA 2QQGA 3FA2A 4TGLA 1VL2A 1Q5PA 4WLOA 3AERA 2V03A 1FYXA 5DX1A 3RYTC 1V5IA 2FZGA 4QPDA 2HQSA 4MYSA 5FX2A 1P2BA 4ER0A 2Y1EA 2HMWA 2J08A 4AVYA 3KJFA 1UT8A 3GYGA 3EGDB 1KO1A 3MCVA 4G0XA 4ZCIA 3O8RA 4ZAZA 2QTVB 2FUNB 3WA6A 1T5HX 1CS0B 3WRXA 4P3OA 3JVEA 4CI0B 2FAXA 2NAPA 3KSBC 4L3VA 2W48A 5AVTA 1TI7A 3SN6A 1NQVA 1HUQA 1GVHA 3DV9A 4O8ZA 3V8QA 4H0NA 4DY4A 1QHHA 2ES4A 3ESZA 4P22A 2BMDA 4ZN6A 3IEIA 1FFGA 2Q4RA 1HYQA 3NHLA 4IX1A 5J4HA 4LEIA 4KACA 3KDPA 4CF7A 1T5SA 3ZLTA 1GV1A 3PC6A 4FBMA 1CVRA 4O1IA 1E3SA 2FQWA 2BFPA 3GFRA 1E58A 4TVSA 2HK8A 3ZWOA 2XUOA 3AT1A 4Q4CA 2E4ZA 2D2EA 4I9HA 1ZZGA 4MEAA 5FTNA 1WE2A 5FOWA 4R84A 3MUFA 2W4MA 4XSHA 3VPCA 2PGJA 3HDHA 2CBGA 2X2PA 4D26A 4XGQA 4ZPJA 4BQRA 2QSJA 2JPDA 4EA6A 5JHHB 4HYYA 4GMDA 3VKVA 1H0SA 2H1WA 4Z0PA 1JG1A 4KR3A 1FX0A 2X40A 1RM0A 4KQWA 1SHUX 4EPTA 2ZRQA 4QPPA 3R5XA 5EQDA 3UAXA 1WKBA 4RELA 3V00A 3QYAA 2ZI7A 2OOKA 5L6LB 1EX7A 1E5XA 1JYSA 3P0FA 1DC3A 3NT4A 5E6RB 2BBTA 5CXQA 1V7QA 2BGMA 4Z3OA 3BDVA 2GZHA 3HDYA 1GSIA 4JH0A 5TS3A 4O25A 2C4VA 2EGGA 5CLQA 1WSDA 2PSFA 2WY2D 1ULHA 2F90A 3AHHA 1QONA 3GDOA 3MS2A 1NTRA 1U0SY 1B8UA 3O2QB 4L74A 5DV9A 3E48A 1XPOA 3RHZA 1VZ3A 4HG2A 1ZI6A 4OF4A 1BKYA 2Z08A 5TPWB 1NYLA 1DSSG 2OILA 2OQ2A 2CLHB 3ICVA 1N8KA 4LMBA 3W5AA 3U19A 1IEWA 5D51S 1U3CA 1HTTA 1CB0A 1QC5A 2AFIA 3C7TA 3CO5A 3KO8A 2OK7A 1WMBA 3LHIA 5FFMA 5DNDA 3V2HA 3H7IA 1HDZA 3NXKA 3CC8A 1R0YA 1U1GA 5EP3A 1RCUA 1FJXA 4WK2B 2QLJA 3MGAA 2R3SA 2GKSA 3I09A 5C34B 1RYDA 1OZGA 2D2IA 3W4IA 5DYYA 1R9MA 2NX2A 4LGVA 4C87A 4DVJA 2ZUVA 2C9OA 5ENVA 1GRQA 3NH6A 4LYGA 3QIAA 4REMA 3E7WA 1PW7A 4IDBA 4C7XA 2F4NA 4CDRA 1VL8A 5C32A 3FROA 5LKRA 3SDSA 4US2R 3FDIA 5B3JA 4KHZA 2PBZA 4EJ6A 4QJ5A 2YV3A 2R8OA 3OQVA 4QX6A 1M0SA 4ZVRA 1PJ3A 4EF5A 1KEVA 4DLAA 1HZZA 1JSCA 1XZAA 5CR9A 2ODTX 2H2GA 4GQIA 2O3TA 2BWJA 2GCEA 2GPJA 2LCQA 1RP1A 2WFLB 2FMFA 3ZBPA 3LP8A 3AVTA 3EUEA 3IUQA 5HKLA 4OD0A 2ORVA 3RS4A 3V7NA 1N92A 1X7YB 2FMKA 3A1SA 4FNGA 4OH1A 3TSYA 3U44A 2JGRA 1O87A 2FR8A 3PCXA 4YCDA 3R9XA 5KKCA 4ZMRA 2QRMA 5DO9A 4Q6WA 1JH8A 1W85A 3ASZA 1GGNA 5EXTA 3P26A 1EH5A 1KHTA 2DM6A 2NZ2A 3NO4A 4S2UA 4TVBA 4AECA 5FL3A 4NENB 3ADDA 1CJMA 3FUTA 3I1FA 2C3PA 2DBVO 1KS9A 4I08A 2WICA 4R2MA 1QYRA 3W5IA 4BLVA 5A02A 2B83A 5F2NA 4AAYA 3K9CA 3JAWB 1VHQA 1U8EA 3V9PA 2VI5A 1VC2A 5J4LA 5A3VA 2COKA 4F2DA 2A1TS 3PHIA 3DOEA 1EK5A 1PT9A 1WJGA 1ZCBA 2HHLA 3ZZMA 3DBHA 3CRVA 1MB2A 3RYIA 3ESYA 2HT6A 1Z2NX 1OFTA 3AF5A 3T7SA 3ZE9A 1NASA 4V0MA 3B6EA 3DEKA 4D5EA 2VSOA 4DBLE 1MAHA 4EHIA 4DBZA 1DPGA 2GEDA 3OC6A 2W2PA 2XUQA 1KMIY 1VIAA 2COEA 3L7MA 4M99A 2VSYA 4B0OA 2QM3A 3THWA 2R8XA 3ELBA 4GP7A 2YYSA 2FDXA 3HCNA 3ZPXA 1VIYA 4BFLA 4G5XA 2I3AA 2XZPA 3B48A 4O29A 2CUNA 2F62A 3WL7A 2R79A 1T1IA 3L82B 2W8BA 1Y6ZA 3OTGA 3AY6A 4MRRA 3UIEA 2JDIA 4YB8A 5DHQA 3N0XA 5DLDA 4NKRA 2ATIA 3IHLA 5GZ6A 3O21A 4UNQA 2F1JA 4G86A 2BEUB 1OYWA 4Z8YA 1A5BB 4NYJQ 5KYUB 5ICSA 1RXSA 3G2IA 3VTZA 1ONSA 1U8AA 3KAJA 4C0LA 1TCBA 3WDLA 1P33A 1K27A 3RR2A 2RGAA 2EJBA 3RVQA 2QL6A 4GD3Q 4JJKA 5CVDA 4CM1A 2VH2A 1W4ZA 1X2BA 1YKSA 4DZTA 3GVCA 2WG1A 3O91A 3ZE0B 3ADBA 1V3VA 2WNSA 4F4UA 4O4JB 3VNVA 3LX8A 1TM4E 4YAIA 5EA2A 2AFIE 1MAAA 2BGGA 1ECLA 4UMEA 3IIKA 1T8YA 2MJLA 1D03A 2PRIA 4OHKA 4JLAA 3UAWA 3PE3A 1NONA 2FTKE 3DLCA 4B3BA 3M4ZA 1V4VA 2BMJA 1J20A 1OI3A 1SC4A 1FQKA 1TLFA 3HVIA 3JAKB 3HM9A 2P2NA 1CZRA 1W52X 3PLRA 3ZHOA 5MHTA 4GWKA 3ZD7A 1NJSA 4RVFA 4X62B 1GNTA 2ZUTA 1VG0B 3UOWA 4MQFA 4MI9A 3WIBA 1NJ6A 3D43A 1MJFA 4OL0A 5C7IO 1D2EA 3B52X 3DVAB 4ZTZB 1E2DA 2FKAA 1QQBA 2DFVA 2H85A 3GLHA 2EQBA 4S1TA 3PEYA 1AGRA 3RS5A 4MHTA 1EJBA 3D6AA 1ULBA 4N5MA 2AX3A 3TLJA 1RWNA 1TW2A 4R1TA 1W30A 2YH2A 3OKCA 1SB8A 2ZAYA 4CUZA 1RZRA 4FOSA 2EW8A 4PPGA 3T3IA 5BNIA 2VUIB 3O9MA 1QZTA 1TJYA 1Y82A 4E5KA 1SK8A 3BK1A 4IQFA 1TYAE 2GBLA 3GA7A 1NGSA 2Y2UA 3LVFO 3VVMA 3FPLA 3KQLA 3KT6A 2BH2A 2H0QA 2IY7A 1GR1A