1KETA

The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
346
structure length
346
Chain Sequence
b'QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-D-glucose 4,6-dehydratase
publication title Toward a structural understanding of the dehydratase mechanism.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 141
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2001-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ketA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1ketA02
1XCBA 1I3LA 3RJ5A 3E5RA 4IQ8A 4QSMA 4YJFA 4RPLA 4BNXA 3AJRA 2YW9A 3HADA 4G2NA 3PGJA 4II2A 4BB5A 3OJEA 2NQTA 2PY6A 3WGHA 4GBJA 2BGLA 4BQPA 4D0SA 2EJVA 4MVJG 4RCVA 3WFJA 1PEDA 4CUZA 3PHJA 3LF2A 4DPLA 3KXDA 4FS3A 2V6FA 3IMFA 4YB8A 2Q1SA 4W7IA 2YHUA 3P19A 1HTBA 3SEFA 2TMDA 2CFCA 4P4NA 2NTVA 3B1JA 2WDZA 3FWNA 1DIAA 1W6UA 4PCVA 3UKOA 2CUKA 3GVXA 4WASA 4K6FA 1HRDA 5TIIA 2JCXA 4FDAA 2RAFA 1OI7A 2QW8A 1OFGA 2QZZA 4NBTA 3AOEA 4B3JA 1QORA 4XEHA 1M76A 4TKLA 3HWRA 4BKOA 4DPKA 4TROA 4ND3A 4IMPA 3TFOA 2Q2WA 3RC1A 3EW7A 3WIDA 2E6UX 1DC6A 3CKYA 3SJ7A 1ONOA 4MVJI 2VWGA 5IJZA 3NGLA 4CMAA 4IINA 2HJSA 5DNAA 1YL6A 4DMLA 4PG6A 1LDBA 1SO8A 4YBZA 1KEVA 3NT5A 1ORRA 4FOSA 3MTJA 1VJ1A 3GVHA 3QE3A 4FGSA 3HSKA 3E5MA 4CQMA 1KS9A 1R4NA 2CY0A 2D59A 4A03A 5JDIC 1N2SA 1BXKA 2O4CA 5C7IO 1HLDA 3BTOA 3PQEA 1O95A 2E82A 3F6YA 3JQBC 1N1EA 3PDUA 4K9DA 1LC0A 4OXNA 1B15A 4PLTA 1I3KA 4HNHA 1GEEA 1BSVA 3LLSA 5U4QA 4NR0A 1YBVA 2WD8A 2G1UA 3QRWA 4RQUA 4URFA 3BXXA 2WMDA 1GUFA 3E82A 4BNGA 4DVJA 2QIOA 1LRLA 3ZH2A 3F47A 1J49A 3L9XA 4IXWA 1JKJA 3MWDB 5A9RA 2X0IA 3KSDO 3TL2A 1HDRA 4YPOA 4RF3A 3EVNA 1C0IA 3NDRA 4GX0A 3QY9A 4MO2A 3W6ZA 1DC3A 2O23A 4DRYA 3CPSA 2ZYGA 2JKVA 1B0AA 3W4IA 1N5DA 2D0IA 2FRDA 3QHAA 4CLRB 3JD2A 4K26A 3PWKA 5DT9A 1P77A 4LCJA 1SZJG 3OM9A 2Y05A 4RVUA 3UF0A 2QRJA 5H83A 4YYZA 1EVZA 3R1IA 4D42A 4GLLA 1BGVA 1ZW1A 2VZ0A 3TF5A 2DQ4A 5COAA 3DBLA 1P1JA 4A73A 1HZJA 3WFIA 2IYOA 1D1SA 5AOVA 1T4DA 5I9LA 3U4DA 2VUUA 2YQ4A 3GGPA 4GL4A 4GVLA 3SC4A 5COQA 4R1SA 1NQTA 4XYEA 4PGFA 3UVEA 1CRWG 4RV9A 3RKRA 1PL7A 4A2CA 2ZQZA 4RORA 4XQEA 1PGJA 1B2LA 4WOKA 1HE3A 3ROQA 3ZGYA 1CEQA 2E37A 2IEBA 4TZTA 2BKAA 1I33A 2R6JA 4FB5A 3DTTA 4IBOA 2Q2VA 4ZU3A 5DBFA 2W2LD 4PVDA 3ZWNA 3DOJA 3H7AA 5ADHA 3KYCB 1IB6A 3L4SO 2ET6A 4UREA 5KIAA 3C3XA 4IM7A 4BGVA 4MVJD 2O2SA 4XR4A 1PJ3A 1K6IA 1P1IA 1U4OA 4RVSA 3QJ5A 3JQ7B 1ZMOA 1XELA 1LSUA 4U7WA 4D41A 3Q11A 4R3NA 5G2OA 1VSVA 3U4IA 2C7GA 5TQVA 4CMGA 2VRCD 5HWSA 2CSUA 2C5EA 4R01A 4FCCA 3VDQA 1A27A 4ZRMA 3MJSA 2PH3A 1MC5A 3FNHA 2X23A 2OMEA 2B37A 4QUKA 2C7VA 4GGOA 2DBRA 4DIOA 2AE1A 3S2FA 4DIFA 1X7GA 4RPJA 2PTGA 3RC2A 2W8ZA 5T5QA 2NVWA 1KYQA 3PLNA 3QVOA 3IC5A 4Z9XA 2WSBA 1FMCA 5TGDA 2E48A 4AJHA 2D4AA 1VM6A 3ZV3A 1E7YA 2GN8A 4YAGA 4UVGA 3JYLA 3JQGA 5DBGA 5HM8A 4OSOA 2DFVA 3DB2A 3MZ0A 1ML3A 2OGUA 3CE6A 4JJIA 2W90A 4RF2A 1K2WA 1LC3A 2X5JO 2VUTA 1HDCA 2O3QA 3NAQA 4IJUA 4UUNA 3I4CA 2CVOA 1VJTA 4FIZA 1XYGA 1CDOA 2AQIA 4J7XA 1GDHA 2EW2A 2WJPA 4NMHA 3I4FA 1EE2A 1LSSA 1YB5A 3GZNB 3AW9A 2C20A 1V6AA 1E3JA 1B7GO 1ZK0A 3PQDA 1UP6A 5L53A 1DB3A 4DTIA 1MLDA 5JAZA 3JSAA 3IUPA 3WS7A 4RDHA 2QRKA 4UUPA 3VPHA 1LBEA 3WGYA 5JDIA 4P4GA 1FDSA 2YY7A 3BA1A 4NH4A 5DP2A 4L9RA 4E30A 3PQFA 3BMQB 3JQBA 4XD2A 4Y6RA 1LXCA 3ETGA 4K28A 3VOSA 3ZDFA 3EK2A 4YQYA 3KETA 3AWDA 2ZTVA 4GAEA 4ID9A 3I5MA 1YL7A 3ITKA 4N7RA 2VHYA 4LMRA 3EHEA 4CM8B 5G4KB 1PGOA 3ZU4A 1PJCA 3AI1A 4Q3DA 3WIEA 1H6AA 2A35A 2Z5LA 1P1RA 4E33A 3K31A 1XEAA 1UP4A 3EVTA 1E7RA 1YJ8A 4MVJF 4FC6A 4B4UA 4A10A 2BELA 2HMVA 4Q39A 4WLEA 1AHHA 1E3LA 1EDOA 3DHYA 3FNFA 4FFLA 1J6UA 4BKRA 1E77A 1PZEA 3OBBA 5I8ZA 1Q7BA 2PH5A 3W1VA 1RM4A 4E21A 1EVIA 4FJ1A 3MJTA 2EHDA 1PS0A 3DZFA 3K2BA 4N5MA 2NTJA 4KOAA 3AOGA 4B8ZA 3GVIA 3WB9A 4YT2A 3ZNNA 1XA0A 2D5AA 4TVBA 1M6WA 4YAJA 3ZWOA 5CDSA 1HE2A 1H0KA 3I9KA 3ORFA 2FOIA 3OECA 1FXSA 2GO1A 1LLCA 1BW9B 1HETA 3VVBA 4MP6A 3DQPA 2Q45A 2WE7A 4FQ8A 5FI3A 1HZZA 4NBRA 4DGSA 1W8DA 1A71A 3NT2A 4YRBA 3ANNA 1FF9A 4UVHA 1N7HA 4JCOA 4L75A 3S55A 3JQ6A 4R5MA 4BNJA 4BO6A 1ADFA 4LISA 3CH6A 1JN0A 5ILGA 4QFCA 1SOWA 2Z1MA 4ZA2A 3MJ4A 1KEPA 4GX5A 3ROKA 1E6UA 1DSSG 1QP8A 1RM5A 4FJ0A 4A7PA 3IP1A 4PLYA 2EW8A 3OIGA 4JNKA 1Z7BA 3IOYA 5L4SA 1EUZA 1ZSNA 1BTOA 2PZKA 3U09A 3K6JA 1BW9A 1KEWA 1QSGA 1LQUA 2QRLA 3JQ8B 1WDMA 3ENNA 2J3KA 3I9MA 4HADA 4FGWA 5A03A 1CQJA 2JD0A 1LTHR 1R15A 3EY4A 1DRWA 2A92A 2B35A 1I2BA 2QG4A 3AUTA 4LN1A 3VTZA 4ZHSA 2IZ1A 4QO7A 3H3JA 1NASA 5CPBA 2DBZA 1HE5A 2HRZA 2PZLA 3VPFA 4CLEA 5A5EA 3DBHB 3QWFA 1P74A 1KVTA 3QV1A 3JD4A 1FDUA 4WJZA 4ALMA 1T25A 5B4UA 4DQVA 4NZ9A 5JY6A 3MTGA 1YXMA 1YDEA 4RL6A 1UXKA 1R66A 2GGSA 3IS3A 2JFGA 3DL2A 3VTFA 1LSJA 3EC7A 1BG6A 1TB4A 3HDJA 4ND4A 5F5LA 3A28A 2YFHA 4J9VA 3BMOB 4J9UE 4D3FA 2I76A 4FSHA 4DWVA 4HNGA 2EP7A 3VZSA 4L8VA 4DLLA 1LLDA 1V3VA 1XGKA 1SAYA 2JHFA 3PYLA 1UDCA 4YJHA 2Y1CA 4B7CA 4FFRA 1NFFA 4XR9A 4R51A 2VHWA 4XB1A 3VH4A 4J3FA 4YT8A 1JA9A 1E6WA 1GPJA 3MJVA 4MP8A 4OXYA 5THKA 2C54A 4BMNA 3VPXA 3L6EA 1X15A 4YR9A 3KO8A 3JYQA 4UULA 3IKTA 4PG4A 1TT7A 5KTKA 2X4GA 3OJLA 2C2XA 3C85A 2Q50A 3G0OA 5DCYA 2OZPA 4NBWA 4YJGB 1T26A 4FPXA 1W0CA 1E1NA 4HFJA 4Z3DA 3UH1A 4OMUA 2GUGA 3WGQA 2P68A 2O3SA 3UOGA 3WJ7A 4XJSA 3BMCA 3Q6IA 4IGEA 3ZN2A 3VZPA 2JCYA 1A9ZA 4EJMA 2VCYA 4ZN6A 3CINA 5BNTA 3HE3A 1HDGO 3H9QA 2VWHA 1G6KA 4WEOA 5JCXA 3ZNQA 5L3ZA 1QYWA 2Y1FA 4IZIA 4II3A 1P0CA 4BMSA 4D46A 4M87A 3IJPA 1P9LA 2P4HX 3UCEA 3ETDA 3ZNPA 5IZ4A 1Q0LA 3ZWMA 4GX2A 1I5RA 1PL6A 1Q7GA 2O48X 2AEMA 2WD7B 4AJKA 3RUHA 5BSEA 4INAA 4YT5A 3G49A 2X8LA 3LT0A 1PJBA 4R69A 4YXFA 4MJLA 1CWUA 4NK5A 3DONA 2PR2A 4LCEA 4CLDA 4F6LA 3TL3A 1ZNQO 4BQRA 3K8ZA 5A06A 5G0UA 2RH8A 3OF2A 1PQPA 3GVPA 2ZYAA 4E2XA 1HL3A 4D3DA 3B1KA 3F5QA 5AXDA 5IN5A 1JWBB 5JY1A 5L9AA 3GPIA 3H9GA 4NQZA 4KWHA 1WZEA 1ZKMA 4Q3EA 3NV9A 3GOHA 4J7CA 4D79A 4GMGA 2WD7A 4TZKA 3L4BC 4BUCA 3PP8A 3WG9A 1XU9A 4GKBA 1BDBA 4IY1A 5JBIA 4F46A 5TNXA 3ZCXA 1N1GA 3HQ4O 3S8MA 1U5AA 3KZVA 1PQWA 1E3EA 1YONA 4OGWA 2JFHA 5ITWA 1BWSA 1DXYA 3I9OA 1E1LA 1PQUA 3BMNB 2BH9A 3AI2A 5EQDA 3VC7A 1GTMA 1ULUA 1RWBA 3TSCA 3TDKA 2IYPA 1GU7A 2V6GA 4FN4A 3I3OA 2QX7A 4CL8A 5JYDA 3TJRA 1DJNA 1K0UA 1O8CA 1DO8A 2PFGA 4IJKA 4G65A 1YH3A 3LLVA 5AXCA 4Z9YA 3FPLA 1GYPA 4NNJA 3ZV6A 1A72A 4TVOA 2GZ1A 4NDNE 2DKNA 4NIMA 2BFMA 1YS4A 2B69A 1NTOA 8ADHA 3WYBA 2WYVA 2X7HA 4FJ2A 1HDOA 4P38A 5TT1A 3ROMA 4BHTA 1O94A 4F6CA 5C37A 1VE9A 1LRJA 4J49A 3GPDG 1E3IA 1EFLA 1V3TA 2NU7A 4NI5A 4NFHA 1UXHA 3GVCA 1D1TA 3EYWA 1PGPA 2ZCVA 1Y8QB 4BNTA 4B7XA 1H93A 4XRRA 2Q99A 1H5QA 1DJQA 3PVZA 1ISIA 2HDHA 1R16A 4XQ9A 5EMHA 2JCVA 4UUOA 3ZWWA 1DLIA 3NDJA 2OHXA 1XHLA 4CV1A 3SVTA 4OH1A 2D1YA 1IZ9A 1LQTA 1U3TA 3FCOA 5AQ1A 3WSVA 3PRJA 3HZZA 4BL5A 2E4AA 2QYTA 1F06A 1E0DA 2Q49A 1VL6A 4BO2A 4YRAA 3Q9NA 3U3XA 4HXYA 3TOZA 3ZWBA 1DIHA 2HO5A 4UAGA 1IE3A 5IDQA 3WWZA 3NDIA 1MP0A 1RJWA 2DBQA 1JLLA 2HK9A 3S2EA 5CEJA 4TKMA 4WCFC 5JAQA 3HJAA 4AJNA 3WBFA 1ZK3A 2YHIA 5A9TA 4MKXA 6LDHA 3DAPA 1QXSA 4CMJA 2NU9A 3VH3A 4LSMA 3U4CA 4CMHA 1X7DA 5JSFA 3QLJA 3UAGA 1ENZA 3B70A 3PTZA 1LDYA 3HG7A 4EYEA 2G17A 1ZK4A 1JTVA 4AL4A 5ER6A 3AY7A 4CV3A 1C1XB 4YJFB 1NX6A 3DMTC 1K3TA 4MIYA 2AQHA 4JLWA 2NNLD 4WECA 4PLFA 4KP7A 4BO7A 4Y98A 1IPEA 5BSHA 3V1UA 2YUTA 1GV0A 5CG1A 4MOWA 4ALNA 1DAOA 1E7WA 3INTA 2Y1EA 4PRKA 4BGEA 2GNAA 3E03A 3D4NA 4NG5A 4EITA 4YQZA 4ZGWA 3TNLA 1ADCA 4NJMA 4J16A 1XQ1A 5KKAA 3T4EA 2I99A 3PHHA 1RYDA 1EVYA 3P2YA 2EKPA 5H81A 3K73O 4RPGA 5HRUA 3COSA 4XJTA 1C1XA 5F5NA 3WOHA 2Z1NA 4YWJA 5THQA 5JCJA 1Z7EA 1YDWA 3Q9UA 4MVJP 5JE8A 4J91A 1U28A 3GT0A 3RUCA 1E1MA 4I1IA 1G0NA 2GRAA 3ONEA 4Q3BA 1IULA 1KOLA 4DLAA 2YZ7A 3U5TA 4IPTA 1KC1A 1DOHA 3LVFO 4TRRA 3CEAA 4JQCA 2DTDA 4DBVO 4DMMA 1BHSA 1ZJYA 3F1LA 1N7GA 3E9NA 3M2TA 2YV3A 5DN9A 3M2PA 4E2ZA 1NP3A 3L4BA 4NU6A 1U8XX 1FJHA 3W8EA 4CQMB 1R4NB 1EVJA 3Q1LA 2V65A 3WMWA 1O0SA 4BO4A 1MX3A 4I9NA 3N74A 1ZMTA 4D7AA 1J0XO 2WYWA 3OQ6A 3H5NA 1P3DA 3H9EO 5G0SA 4DIBA 2X9VA 1HYHA 5TX7A 5JAIA 3Q0EA 1BXZA 2UDPA 3GHYA 3L07A 4OM8A 4UEOA 1ZSVA 3DBRA 2BRUA 2BHLA 2UVDA 4TRJA 2PD3A 3L77A 4GVXA 3C7DB 4GLOA 5CAEA 1NQ5A 1YB4A 2I3GA 3AU8A 4HX5A 1E7QA 3KSUA 4HUJA 2D2IA 4L0QA 5CHEA 3DR3A 1JAXA 1CYDA 4YA6A 4U0JA 1GQQA 4PLZA 5BSFA 2SCUA 2WM3A 3WICA 3A06A 4J4TA 4H15A 3LDHA 3QVWA 4PG5A 3OH8A 2VZ8A 1PU2A 4FFPA 1OC4A 2W2KA 4DQXA 4ZJUA 4HY3A 2PZJA 1DBVO 2VTEA 2VWPA 1ONPA 1LLUA 3KM0A 4H7PA 5IXSA 4WCFB 4E12A 1H6CA 3DBLB 4EBFA 1B3BA 2Y1OA 4XCVA 3GUCA 4FD3A 3ZNOA 1T1RA 3KYBA 2XAAA 4N18A 5ER9A 1B8UA 1I2ZA 1XQ6A 2I9PA 3H6KA 3IKVA 1F12A 3FTPA 3UICA 4CLOB 1PS8A 4CR8A 1EMDA 4DC1A 5JPIA 4AJ2A 2G0TA 1YQXA 4ZD6A 2HQ1A 4UVIA 4BOYA 4BO1A 1ADBA 2AEFA 4DQUA 1NAHA 1E7SA 3G17A 2C0CA 2DU8A 3PJDA 1KEUA 1WVGA 4CM6A 1P45A 5BSGA 4B8WA 1KIFA 3R6DA 3E6AA 4KWIA 3UGKA 4B3IA 2GDZA 4R1UA 3GF4A 1Y8RB 1R0KA 1C1DA 3BYZA 5DP1A 4GKVA 4GPD1 1HLPA 1GL3A 4QT0A 4DBZA 1VKOA 4WCFA 2ZJ1A 4BNKA 1I8TA 1OBFO 5KVVA 3DZBA 5I7SA 5AVOA 5LCXA 1KBZA 2EKLA 3TZHA 4CLOA 5JXWA 1SCUA 1PX0A 2F00A 4DC0A 1HSZA 3I6IA 5TSDA 5L4NA 5T8KA 1VC2A 2FSVA 4J90A 3WYCA 4RPKA 2HAEA 2Y1DA 1UUFA 1YO6A 2QQ5A 5EJ2A 2NU6A 3W4JA 1HKUA 3DMTA 4I08A 3G1TA 1ZVMA 2WYUA 1TXGA 2DLDA 3QWHA 4Y6SA 1H2HA 4RPHA 1SEPA 1X0XA 2A4KA 2C07A 2O7QA 3DXFA 1BRMA 1LDEA 1Y8RA 1R6DA 4EJ0A 1E3SA 5ES3A 4XYMA 5L40A 2H6EA 2BGMA 3MJEA 3QWAA 5CEFA 1DDOA 1IY8A 1F8GA 1NR1A 1UH5A 3ANLA 3I52A 3TN7A 3TQHA 2ZKLA 5CG2A 1UXJA 2EGGA 3M6IA 4OIMA 1X7HA 1ZSYA 2YYYA 4WLVA 4W9NC 3QQPA 5DOVA 3CUKA 5DOZA 1WLYA 3CTMA 4BNVA 4CMBA 2JHGA 3JQGB 4IQGA 1JW9B 5HS4A 2NV6A 1MFPA 5IZCC 5IG2A 3G79A 3PI7A 3GH3A 3V1TC 2VHXA 1OAAA 1PJLA 1LDNA 3JV7A 1GAEO 1EE9A 2VN8A 4WUVA 4JBHA 4EUEA 1NWCA 2FP4A 3OIDA 2VYVA 4J7UA 4GH5A 2QYSA 2TMGA 2OUIA 3I9NA 4J43A 2FSSA 4IMRA 2FZEA 2OORA 1ZIDA 3QVSA 3QVXA 3RBVA 3WQRA 2J3IA 2B5WA 2HJRA 5DF1A 1I01A 4YACA 1JQBA 4QECA 1E5LA 4PZDA 3RUAA 4BGUA 1F0YA 5JMWA 3F46A 4ZQFA 1U4SA 3V5NA 5A9SA 4XB2A 2P5YA 4B79A 2OBNA 4JP3A 4ZVVA 3LQFA 1ZO8A 4UVEA 1ISHA 4ALKA 5F21A 4WK6A 3PJEA 4CPDA 3DZGA 5DCWA 5C3MA 1B14A 2R2GA 2QHXA 3EAGA 5JO0A 3E8XA 1TLTA 3UUWA 5C7OO 4TRMA 4XRGA 3ONFA 2IODA 2PWZA 2OXIA 4Y9DA 1M66A 3C8MA 3DTYA 2LDXA 3WR5A 2Q4BA 3INRA 2X86A 3WX0A 2HMWA 4NJOA 1P44A 1KVRA 2GF2A 1B26A 1XWFA 3D3EA 1UJMA 3OEWA 4CUKA 1QYDA 4BB6A 4WKGA 3CXRA 3KVOA 2POQX 1PZGA 4DYDA 3C1OA 1XLTA 3F4BA 4E3ZA 5JYEA 1N8KA 4CODB 4YVFA 1JKFA 4F3YA 1FK8A 1TA4A 1KY5A 1G1AA 1H6DA 1A7AA 1V3UA 2Y99A 3E9MA 3WYEA 3RASA 1GUYA 1UXIA 3NKLA 4YDRA 4X54A 2D8AA 4L4XA 1LA2A 1RYEA 3WDSA 4O6VA 5KNLA 4QFDA 3ETEA 3H5RA 3NEPX 4YJDA 3TZCA 2EXXA 4B4WA 3RFTA 3Q2IA 2AQKA 1FDWA 3PHLA 4A26A 2NSDA 3TWOA 1B16A 3O4RA 4BKUA 4I8XA 3PWSA 1QYCA 3NRCA 2Q1WA 5CFZA 3IL2A 1DC5A 5C5IA 3IQDB 2HKIA 1IZ0A 1UZLA 1PGQA 1KETA 1YE3A 4HV4A 3TZ6A 2AXQA 4PVCA 3LK7A 5K6AC 1U8FO 2XOXA 3DFZA 4CMKA 1J5PA 3VZRA 3AI3A 4W99A 1YBAA 1C0KA 4MP3A 3S2IA 2F1KA 2NM0A 4C7KA 3ROPA 3BAZA 1ADGA 4MKRA 3M1LA 2UYYA 2P2SA 2PKRA 1GCUA 3PLRA 4LRSB 1ZCJA 4ZRNA 9LDBA 5L95A 4HFMA 1U3VA 3GGGA 4DYVA 3GN2A 4FOOA 1R37A 1Q0HA 2LDBA 3LZ6A 3WQSB 1CQIA 1L7DA 2Y0EA 1G0OA 4D45A 4E5YA 1J4AA 1DHTA 5KJ1A 1HDXA 1ENOA 2Y1GA 3FPCA 3ITDA 4PFJA 1SPXA 4A5OA 1Z75A 1EQUA 1CETA 3JQ9C 4RF4A 2RHCA 3STHA 3JD0A 4PLHA 4WPGA 1I36A 1NPDA 1U2GA 4FFMA 3U4HA 4GWGA 1XIVA 3DOCA 5U1PA 2VQ3A 4AJOA 2WTBA 2PZMA 1T1SA 3GEGA 4W82A 5TS3A 2IDZA 2J5QA 4W9NA 5GZ1A 1D8AA 4B7UA 4BS9A 4EGFA 5EQFA 1M2WA 1DC4A 3WGGA 1MG5A 3P5SA 1NNUA 3QWBA 5IFLA 3RBZA 3PJFA 3NJ8A 3Q3CA 5IZCA 3K2EA 3QWIA 2AHRA 1JDJA 2Z95A 2H1SA 2PNFA 3AUAA 3BHIA 1AUPA 3HFGA 4YJHB 1R4MA 3BHMA 2AG5A 1EEHA 1GADO 3OFSA 2BD0A 3UFXA 1ZJZA 4CQMD 3AUUA 2VHVA 3ZHXA 1DRVA 4ZQGA 1P1FA 1O5IA 2NADA 3IIEA 5BNFA 2OL4A 3RWBA 3GLQA 1D4FA 4I5EA 4OOEA 3ICPA 1YQDA 4R5HA 1LEHA 2GLXA 2CZCA 1MXFA 3VH1A 1VL0A 3I1JA 5KVQA 5B4VA 1T2DA 3UN1A 2UAGA 4WLFA 4YAIA 3BMCB 4K1LA 3WTBA 4BNHA 5FEUA 3AFNA 1IPFA 4FFOA 5DCUA 4R68A 4XX0A 5L7YA 1E6EA 2J5KA 2V7PA 3S2GA 4BV8A 1GY8A 4KQWA 3TZKA 1I3MA 1WAMA 3S1LA 4CLXA 4CJXA 2O3RA 1Y5MA 4BKPA 1Z6ZA 2VZ9A 2X9GA 4I9UA 5JFOA 4XA8A 2BGKA 4IJWA 3W8DA 1SEVA 1IOLA 2CDAA 1KVUA 4OHUA 1JKIA 3QIVA 1UZNA 4XGNA 3SLKA 3LT2A 3GRPA 5BQFA 1MG0A 4QTZA 3TPCA 3ZU2A 3RROA 4TMFA 4HFNA 3FBGA 4B4VA 3G3EA 1PJ4A 2YDYA 3GQVA 5CP8A 3AM5A 5DULA 4OQYA 2H63A 2VHZA 1PWXA 2BFPA 1Y5RA 3KSZO 2R00C 2RBEA 3DOOA 3OMLA 7MDHA 1PR9A 2O3TA 3NTOA 3RUEA 3H2SA 2ZB7A 1GZ3A 1E92A 5CPFA 3RI3A 1UXGA 1ONNA 2XXJA 2C82A 5G0WA 4JXKA 5TC4A 1NVGA 2FPGA 1YBMA 3KRTA 5EL0A 3WWYA 4WNIA 1V0JA 2FY8A 1E3WB 1MGOA 2CDCA 1SB9A 4S1VA 5I8WA 2BFOA 2B0JA 5L51A 3GRKA 4CMIA 1WW8A 1NXQA 2IZ0A 1PJ2A 3MCVA 2Y0CA 3KEOA 1NHGA 4ZQHA 3RFVA 3G1UA 5FWNA 3HN2A 4ONEA 1JU9A 2P9EA 2EGHA 4KUHA 3KOUA 2VTDA 1YB1A 3FNEA 5K6AA 2GZ3A 2C29D 4L74A 3ZHBA 5TRTA 4RQTA 4YT4A 3LYLA 2NQ8A 5JC8A 1KERA 5JDCC 5IF3A 4BNNA 1I3NA 3OA2A 3DHEA 3GAFA 2JAHA 4PLWA 4U6SA 5DBIA 5HA5A 8LDHA 4IGFA 4IDEA 4L4SA 4CQLB 4IIVA 4ITUA 5L4LA 4WOJA 3VPGA 3V8BA 3DEYX 4K6CA 1E3WA 4J1TA 4HP8A 3HN7A 4JBGA 4U6QA 3UXYA 1EDZA 2I5PO 3WGOA 4XIYA 1WDLA 2C5AA 2EIHA 1LDGA 1T2AA 3H9UA 4KTTE 3CSDA 3RSHA 1HDYA 3Q2KA 5B1YA 3RKUA 4XDYA 5G0VA 3FF4A 4E5PA 1O89A 1I2CA 2AMFA 3RBXA 4RLHA 3JQ9A 4YEDA 2PLAA 1NBOA 2J3HA 3ANMA 4GSKA 1NPYA 3ZWYA 4CQLA 4ALLA 2W2LA 4E4YA 2WE8A 4GSLA 6ADHA 1N9GB 2PGJA 3DZKA 3ZI0A 3E1KA 3ABIA 4XWYA 1A4IA 1WMBA 1ZBQA 2I3AA 4NU5A 1M6HA 4P4LA 4Z6KA 1NQAO 5C7LO 3GHHA 4ZICA 2OOSA 3L9WA 4GX1A 4LGVA 4B4OA 1Q7CA 5IXYA 2PGLA 3OETA 1DHRA 1QV6A 1MV8A 3GR6A 1MUUA 2HK7A 5L7WA 1TEHA 1S6YA 4IDCA 4AJ4A 3JTMA 4PN3A 1L7EA 2VRCA 3UCXA 4W6ZA 4YRDA 3VZQA 4EDFA 3CZRA 4NHEA 4LW8A 1MXHA 4WLUA 9LDTA 5L45A 5DDIP 4C7JA 2ZCUA 2HK8A 2YHIB 1TT5A 3JD3A 1P1KA 1Y7TA 4ND1A 1MC4A 4A0SA 3I23A 3W6UA 1YJQA 1N9GA 3VPSA 4EW6A 1ZXLA 1JAYA 4F45A 4E5KA 3O26A 3U62A 1GQYA 5IDWA 3DAFA 4OSPA 4M8SA 5F1PA 4MKZA 3GEDA 5AXBA 1QYVA 1LI4A 5A02A 5A3VA 4NFSA 2VYNA 3QA9A 1EFKA 3SBOA 4CM7A 4JK3A 4MPDA 4EJ6A 3ADOA 3FWZA 5I7FA 4L4RA 1VJ0A 3ADPA 4JJGA 4OO3A 5KJEA 5T57A 1ID1A 1PL8A 3I9JA 2EEZA 4I5GA 4JJFA 2B36A 3PPIA 2YV1A 1DIRA 3GEMA 3IJRA 1Q0QA 1QRRA 4OXKA 5A4DA 5A5FA 3TOXA 1JWAB 1WDKA 2GSDA 3BTVA 4R1NA 1HE4A 2H9IA 4L73A 4NJMB 3A14A 2B4RO 3WLEA 3C1AA 3VKUA 5T8KC 5IAAA 5TT0A 4KZPA 2HUNA 4D3SA 1LRKA 3HHPA 1GZ6A 4IS3A 4BNLA 3MOIA 4D43A 2B4TO 4CMEC 3GC6A 1PJQA 4DLBA 3MOGA 2R00A 3JYOA 4RGBA 4BV9A 3D4PA 2FPPA 5JAMA 2O3UA 3OJOA 3ICCA 1PS9A 2ZIZA 4KDEA 4KMSA 3RU7A 4D0RA 4D44A 5B4TA 4IIUA 1BXGA 2VNSA 4R9SA 4EZBA 4PLCA 5HS6A 2FR0A 4Q3CA 3ON5A 1ZXBA 4CM4A 5KJ6A 3ONDA 4CM3A 5EINA 1Y6JA 4B3HA 4BNZA 1NYTA 3ULKA 1X1TA 4LVCA 2HSDA 3IAHA 1BDMA 1PZHA 4OKNA 2IRWA 1HYEA 4O5OA 3T7CA 5HBRA 1N92A 4BNUA 4YCAA 1M75A 1NHWA 1F17A 1ZEMA 5JDCA 3DBRB 4J2HA 3EZYA 4BNMA 3RQSA 2X0JA 4CV2A 3R3JA 3PHIA 4JP2A 5BR7A 5IN4A 3N58A 1E5QA 4IZHA 1UAYA 5G0TA 1MA0A 3F4LA 3EZLA 2W98A 2Y67A 4E5MA 1U5CA 2UUOA 3ZWVA 4UEJA 3FD8A 4WEQA 3AUSA 3PHGA 2IXBA 3T7EA 3PZBA 1I0ZA 3OP4A 3QVTA 2X22A 4CLHA 1K5HA 4DA9A 1WNTA 2O3JA 5CDYA 4PG7A 4E0BA 3FNGA 3OJFA 2W2KB 3PEFA 4ROSA 4MINA 5H82A 1W73A 3RD5A 1XU7A 5I9MA 1VRWA 5I7EA 1EK6A 2GN9A 5ITVA 1GZ4A 2VOEA 3NTQA 4XZ3A 2OP1A 5BT9A 1I32A 5FF9A 1MB4A 4H3VA 2PA3A 1EBUA 7ADHA 4J4BA 2ZJ0A 1R0SA 2W4QA 2PK3A 4GGPA 4EEZA 1R0LA 3EGOA 2JAPA 1T2EA 5CDTA 4O63O 4RJTA 2FZWA 1PSDA 3PFFA 5J23A 5EN4A 3E9QA 1BVRA 3VAZA 3A1NA 1IUKA 3WJAA 3RFXA 3V2GA 4Y67A 4J4HA 1C1DB 1E7MA 1MFZA 3GAZA 4L76A 4OAQA 3K92A 3ZV4A 5TF4A 2ZATA 3RUIA 3RUFA 4LK3A 2GASA 1U1IA 1ENPA 1U2DA 2EP5A 3DMYA 2UV8A 5KKCA 1S7CA 2GYYA 1C3VA 3TFQA 4M86A 1IHXA 4BNYA 4ESOA 1QKIA 4HBGA 4OL9A 2FMUA 4P8RA 3OJ0A 3LT1A 3KLPX 1K6JA 2CF5A 3BTSA 1CIVA 1YKFA 3INGA 4LMPA 4LVUA 4WE3A 3RIHA 1SBYA 2EF1A 3A9WA 3PJGA 4BVAA 3FR8A 4O0LA 5JO9A 1P31A 4DL9A 2RH4A 2JD2A 4G5HA 4EI2A 2O4UX 1ZEJA 3F5SA 3GA0A 4OQZA 3CMCO 3RVDA 2ILTA 5T64A 3H9JA 3B6ZA 2G5CA 3D5TA 5JMPA 3L6DA 3TRIA 4JIGA 1ULSA 2BF7A 1ISJA 3O38A 2JFFA 2PKQP 3NUGA 1GQ2A 2HRBA 1XG5A 2AA3A 4R3WA 3HDYA 3U0BA 2ZYDA 5CDGA 2NU8A 1VPDA 4IQ0A 4Q3NA 4XQGA 2B4QA 2JD1A 1R12A 4CMEA 1T4BA 2O2YA 4I5DA 2JJYA 3KV3O 1V9LA 4R16A 4WGGA 1XR3A 1NPTO 3OIFA 4NBUA 3C1TA 3BHJA 5DZSA 2RCYA 4IS2A 3JQAB 4J2OA 2A94A 3NT4A 1K89A 4WLNA 1T24A 2NUAA 5KJFA 4IJVA 4CR7A 1YWGO 3AFMA 5KJCA 4R9RA 3GMDA 3I6QA 5F3RA 3LU1A 1H2BA 2VUSA 5A9SB 2GD1O 2EWMA 1KY4A 3WGTA 4CLRA 4O59O 4YTEA 4XQCA 2ZTMA 1A5ZA 3HDQA 1UP7A 5ICMA 1GD1O 1U9JA 3NJ4A 3K9QO 3GK3A 1LUAA 3I83A 1IYZA 3NX4A 1AN9A 4NK4A 4MIEA 3JYNA 3LSYA 4MIOA 2I65A 4XGKA 4R1TA 2GN6A 1B8VA 2IXAA 3GDFA 1F14A 3FHLA 3PXXA 4J1QA 4U0KA 3JQAA 2CDBA 3UW3A 3X2EA 2J5RA 2RIRA 2X1HA 2FWMX 2X6TA 1AE1A 4Y8VA 4AVYA 2Y66A 3F9IA 3RJ9A 5L7TA 1HYGA 2DTXA 3GDGA 2DM6A 4HKTA 1O6ZA 4E2YA 3HUDA 1DFHA 3H4VA 2X0RA 1HWYA 1GFSA 4Q3AA 4XYGA 5G4LA 3AK4A 1XDWA 3GNTA 2BI8A 1Z82A 4IDDA 2PD4A 4BO8A 2NACA 4MVJE 3K96A 3KYCA 3LF1A 3P7MA 1GPDG 2Q1TA 1XSEA 5KVCA 1LSOA 1PTJA 3M1AA 2CNBA 2DT5A 4QXMA 3ZU3A 1P0FA 1QMGA 4J1SA 3C7CB 4N5NA 3JQ7A 4WLOA 3WXBA 3L0DA 4IDBA 3OICA 2HMTA 4JBIA 4CM9A 1DAPA 3A4VA 3ZU5A 1DIBA 2VYND 3W4KA 4AG3A 3JQFC 1T2FA 4Z0HO 1HSOA 4I5FA 3LC1O 4PLPA 1HXHA 3GN1A 4EUHA 2VT3A 4Z3KA 1UDAA 3PIDA 1FDTA 1Y9EA 2YV2A 5GY7A 3ZHZA 1A9YA 4CM1A 1I30A 2Q46A 4Z0PA 2AQ8A 4KTVE 1VL8A 2EKQA 4CV0A 4Z9FA 3MEQA 4J1NA 4M49A 1O9BA 2OFPA 3IUSA 4U5QA 4BIIA 2DC1A 3PYXA 4RO0A 2PD6A 1C0PA 2Q1UA 3WGZA 1H6BA 1TI7A 3F3SA 2EG9A 2CD9A 3GDOA 5LDGA 1RPNA 5A04A 3DAGA 4AJLA 2OBYA 2CVZA 3GY0A 1NWHA 2HCTA 3AM3A 1BMDA 1OOEA 2X58A 4TWRA 3T4XA 2RHRA 2O50A 2QZ9A 4AJ1A 2BFAA 3C24A 1UZMA 3GZNA 5ILOA 5COBA 1DPGA 1L1FA 1WZIA 4KDFA 2X5KO 1BVUA 2X5OA 3PWZA 5A1TA 5MGBA 4N54A 3K30A 1B8PA 4CUJA 5JCJD 2NVUB 3QSGA 4XGIA 5F1OA 1DFGA 4RDIA 1VKNA 3WTCA 2I67A 1WPQA 1OMOA 1E1KA 4BNWA 3BMQA 1WXDA 3V2UA 1SNYA 3K5PA 4RVDA 5FYDA 1WP4A 2B83A 1R4MB 1M67A 4CM8A 2VWQA 5G4KA 1GEGA 3RUDA 4CL3A 4CMCA 2FR1A 3UCFA 3JD1A 1LJ8A 3ZW9A 5JNLA 3HFSA 3DZIA 3FI9A 1H9AA 1PJSA 4ALIA 1JVBA 5TJ9A 4BKQA 4HWKA 2CVQA 2NTNA 3HB4X 4MVJM 5LC1A 1Z45A 3JCZA 4LSWA 5KVSA 5EIOA 3KLMX 2NVUA 3RU9A 5A3JA 4AJIA 5JC1A 3ZWCA 3WMXA 1KC3A 3BZUA 2PKQO 2OP0A 2D5CA 3HDHA 3O03A 3VKVA 1X0VA 3D3WB 1A4UA 4GQAA 3GNQA 2P9CA 1Y81A 1PR3A 1SC6A 1X14A 2ZTUA 3EMKA 4AJJA 5K0ZA 4U8GA 1CERA 1KVQA 3D0OA 3FTNA 1DFIA 3AY6A 4MVJH 4EUFA 5IDXA 2NVBA 3HNPA 5K9ZA 1W4ZA 5CDUA 4C4OA 1ZH8A 2HLPA 4FC7A 1YVEI 4N5LA 4NPCA 1Z73A 4UEKA 1SMKA 4E5NA 3JQEA 1H94A 4I9HA 2PV7A 2P4QA 3AU9A 3ZZNA 2VOJA 2Q3EA 4KUGA 3MWEB 1EUDA 2YFQA 3AM4A 3V1YA 3MJCA 3ASVA 3NGXA 3E18A 3D64A 4QX6A 3SXPA 4E13A 5I9NA 2V6MA 2XPCA 2AW5A 3EUWA 4DREA 4KUEA 4BNIA 2YDXA 4IUYA 3F1KA 3D3WA 3V2HA 2VT2A 1UAGA 1NFQA 2BLLA 4UUMA 3P2OA 1P33A 3ST7A 3B20A 2UUPA 3D5QA 4Y6PA 2P91A 3NTRA 4AJPA 2P9GA 3SC6A 1UR5A 1Y1PA 4IXTA 1PWZA 1QLHA 3R0IA 4PRLA 1UDBA 4YAKA 3H2ZA 2XF8A 5I7VA 3AY3A 4GI2A 4ZQEA 3RCBA 1XKQA 3D4OA 5JS6A 1C14A 3JQ8A 2ZK7A 2ZTLA 5AXAA 1V35A 3BTUA 1YL5A 2E49A 4BGIA 4W7HA 5T6BA 3JQFA 1NQOA 2EV9A 1JVSA 4UVDA 3ZW8A 1ENYA 5ENVA 5EERA 4LRTB 3KTDA 3DBVO 2EJWA 2GCGA 3EDMA 4CMIB 2AG8A 1K6XA 4CM5A 3DBHA 4ILKA 2PGDA 3LT4A 3FSRA 4M89A 1Z74A 1EUCA 4RLSA 4R4JA 1ZFNA 1NR7A 1EBFA 3PYMA 3DDNA 2IZZA 3JQDA 1YOVB 3WNQA 5KWEA 4OKIA 3O8QB 1DIGA 1VI2A 3FR7A 4PZEA 4QQRA 3PZRA 1LNQA 4RF5A 3BMOA 4XDZA 3WLFA 4E32A 1PGNA 2J8ZA 2IEDA 4OYRA 1KVSA 1CF2O 1NAIA 4RVGA 1ZUD1 2NLOA 5F1KA 1U3UA 4OJNA 1YQGA 1CJCA 4NFYA 4BO0A 4IDGA 3D1LA 2Y68A 2YQ5A 1AGNA 2G76A 4PLGA 4HFRA 3DZJA 3ENKA 4P22A 4Q9NA 1NVMB 2AE2A 3LC7O 3UHAA 5GMOA 1NM5A 4JX8A 1I24A 2DAPA 3PDJA 3GG2A 1GCOA 1AXEA 3OQ1A 4FR5A 5FFFA 2C59A 1P1HA 2IE0A 3OEYA 4FFNA 1V8BA 2P5UA 2WEKA 1U7TA 1YOVA 3KHUA 3O8QA 3QP9A 3BIOA 3N7UA 4OOFA 4H16A 2EERA 3KYDB 4AFNA 1RM3A 1X1EA 2VYVD 5AYVA 3CZMA 3FRJA 4YJGA 4BMVA 4E31A 1DEHA 1GYRA 1TVEA 5ENDA 2NWQA 3GMSA 1QYXA 1GYQA 1SB8A 1I10A 3JQAD 1A7KA 4PLVA 1AXGA 1U3WA 2D3TA 4E6PA 1ZK2A 4ND5A 2ZQYA 3L6OO 2YJZA 1FDVA 4IDAA 5GZ6A 3GZ4A 3PFWO 2O7SA 3ZWPA 5FI5A 1EQ2A 4PIVA 2VNAA 3B1FA 2ZB8A 3GGOA 3JYPA 5BNIA 4TSKA 5MDHA 3U9LA 3WSWA 1SOVA 1OZAA 2A9FA 4R54A 4GWKA 1VLLA 3HB5X 4RVHA 3SJUA 3W8FA 2JL1A 2BMAA 4BNFA 2VRBA 1TT5B 2V6BA 3DHNA 4J0FA 3ZWXA 1GR0A 3KYDA 4RZIA 3GFGA 1NFRA 4BO9A 5TJHA 2GZ2A 4MVJA 3JQCA 2HMUA 2XXBA 3R3SA 3AOEC 2WWRA 4FBGA 3X2FA 2GR9A 2DVMA 2FR8A 4CM9D 4JGBA 3KEQA 1QG6A 5B37A 3GUYA 1AHIA 3DWFA 1YGYA 3D7LA 1OC2A 3C7AA 4CR6A 5EPOA 3CMMA 1PJTA 2Q2QA 4XKJA 5KCZA 1IL0A 1QLJA 1DLJA 4R41A 4TRNA 2DFDA 3H5AA 2C2YA 4RZHA 3IDSA 2ZB3A 3QW2A 1YRLA 2J3JA 2X9NA 1ARZA 2CMDA 1PZFA 3FN4A 1QR6A 1X13A 3DC2A 3E48A 1HDZA 1NVTA 5CEEA 3DZHA 4ZQBA 1ZK1A 3KBOA 1T2CA 1ISFA 5TLSA 1F8FA 1D3AA 4IDFA 1D7OA 4J0EA 4S3MA 2BI7A 3BMNA 4GMFA 3I9LA 2I66A 4PZCA 5IDYA 3DO5A 2DUUA 2CF6A 4FW8A 4M54A 1EK5A 1ISGA 1HEUA 3OHSX 2GN4A 3VDRA 4DUPA 3ZWAA 4EEXA 3OA0A 1LLQA 5HTOA 1DRUA 1GV1A 3DFUA 4XYLA 1BXGB 5JLAA 2AEJA 3PGXA 1LDMA 1Q1NA 5A05A 4J6FA 5KOIA 3PK0A 4JROA 2FPIA 3OSUA 2J6IA 1LX6A 4KQXA 4CM4B 5U9CA 3RAJA 5LDHA 3OQBA 3IP3A 1PIWA 4XIJA 3SX2A 4QO8A 3CIFA 2DTEA 2HMSA 3KUXA 4Z0TA 4BO5A 1VSUA 4QEDA 3VHRA 3H3FA 3O9ZA 4JN6B 4RVFA 4NBVA 4G81A 1QV7A 1RM0A 3ZHYA 1WMAA 3WQQA 1ISMA 1B3RA 2GPTA 4AICA 1Y8QA 3U49A 4MDHA 4WNCA 5GZ3A 3WGIA 4ALJA 2FHSA 2Y0DA 4M1QA 3TZQA 3VVCA 2H5LA 2X0NA 3GNSA 4TQGA 3WBBA 4WCDA 2G82A 4BO3A 1ZZEA 5B12A 1Y9AA 4AJEA 5EESA 4PG8A 1Q2XA 4M55A 2I6TA 2Q4EA 4YAEA 1HF3A 1IHYA 4W4TA 3RC7A 3PIIA 3FBTA 1C0LA 4O1MA 1H9BA 4XYBA 3SLGA 3WNVA 1RKXA 3RC9A 5T67A 2OO5A 3NYWA 4A27A 4E2WA 1U7HA 4ND2A 3LC2O 5ICSA 5JW6A 2DBVO 2FN7A 3GG9A 2B5VA 3ZV5A 4DPMA 1HT0A 2Y93A 2GERA 2DPHA 1WWKA 2DUWA 1EZ4A 1GUZA 3KB6A 3H65A 4DXHA 2DPGA 1LU9A 3H8VA 2HU2A 3VH2A 2ZB4A 3ASUA 3GFBA
chains in the Genus database with same CATH superfamily
4JYMA 1AQUA 1TW2A 3ZCVA 5DNUA 4YJFA 2HZBA 4KJXA 1D2CA 4BNXA 5EHXA 1HYQA 4RK6A 4UQLA 5ALYA 5KU7A 1FNSA 1KZ7B 4F71A 5DGHA 3PGJA 1I5EA 2JC3A 4HVTA 1WMEA 1E69A 3VV2A 1KDZA 4GBJA 4BMDA 3B6MA 1DADA 5IJWA 2EJVA 2ZRLA 3ELYA 1AF4A 1S96A 2A8YA 3KB2A 4MVJG 2ZXFA 1G6HA 2AOUA 3ROZA 2HBQA 1F8YA 1MGPA 1Q74A 3PHJA 3KXDA 3A1EA 3KZ1E 5JRZA 4FS3A 4RAOA 2K5UA 2R85A 2Q1SA 2WSMA 1BZYA 3LZCA 4YB8A 1KKMA 2G08A 3KD3A 4MH0R 3VKGA 5J58A 1M2OA 4YMTA 3EFHA 2PT6A 1F9AA 4GXNA 4H6XA 2CFCA 1F0KA 4L9AA 4B45A 2WDZA 2GBGA 2J59A 1K7SN 3Q88A 5IJ0A 4TKVB 4WASA 3LDGA 1CUVA 1HRDA 1ZVKA 5HGXA 1RBZA 5FL7D 4MPJA 4PYOA 3DFKA 2P65A 2LIVA 3HXLA 1IZYA 1L5MA 4KXQA 1OFGA 3UA3A 1YB2A 4I3FA 4R1LA 5GWXA 4Z4CA 3AOEA 1RADA 5DM1A 1WOMA 3FKSD 3NHLA 3TCXB 3WLOA 4FBMA 1EFRD 2PEYA 3DE2X 4JWKA 5K4GA 1Z0UA 3G2NA 1X7XA 2C4VA 4X61A 5GONA 3K6RA 2FQQA 3ROEA 4YV7A 5LJIA 3Q8XB 1L4BA 4N82A 1GFIA 1SVNA 2G9UA 3VU3A 4MVJI 2PQ6A 2VWGA 4Y1FA 5J5CA 1W94A 3UXEA 3BQMB 1GQOA 4HVCA 2HJSA 3R5JA 2BM8A 1RQRA 1YL6A 3BILA 4FMDB 4D80A 3NNNA 5FLKA 1SA0A 1TU4A 3TQOA 4X93A 3FTQA 3QPUA 3T06B 2I4OA 3M83A 3QE3A 2EDAA 5CHYA 2ECQA 1R4NA 2D59A 2A9VA 2QP3A 4TXMA 5JDIC 2J0QA 1SBTA 3BTOA 1XQWA 2D13A 3ZQUA 1ZOLA 3TW8A 4EVRA 2XF2A 3ZDXB 4ENVA 1N1EA 2P2DA 5JMOA 1LC0A 1E99A 2AFRA 1U0GA 2CL7X 4OXNA 4OUDA 1NBIA 1XRNA 4HNHA 2XUDA 4L95C 3LD9A 5FOXA 2VR1A 3LLSA 1PT5A 3OWOA 2PWYA 1OH6A 4URFA 3TMYA 3U26A 4MCIA 3SICE 4U9IS 2GJ9A 4J0JA 3ZH2A 2YR0A 4C7MA 1LCIA 1OYWA 2A7QA 3KQMA 3OOWA 4MQ5A 5DGDA 4V1CA 3NVAA 3AEXA 5E8JA 3QEJA 3Q9LA 3FVWA 4BJ1A 2WPDD 3KU4A 2BGJA 1SXQA 3KSDO 2ZJ8A 4RF3A 2NUAB 1C0IA 4BFWA 1JVNA 2DP4E 3T7DA 1EAYA 3QBDA 4N5DA 4DM3A 3THWB 4MO2A 5K8VA 1TYAE 4EB6B 3F8TA 3UJHA 4GBED 2ZYGA 1S3GA 1B0AA 2XCIA 4ZI2A 4JU8A 4ADSG 1SBCA 2A5YB 2PT9A 1E6CA 3NEAA 2DEUA 3RSGA 3PWKA 4CRWB 1FBNA 4MEJA 3S1AB 1IQPA 3AESB 3QKSA 4OFBA 4GEKA 1G63A 4LQCA 4OIFA 4YYZA 4J2TA 3TXXA 1VRCA 1K63A 4X84A 1N2ZA 4XOIA 2PH1A 2OLEA 2REBA 4I36A 4L9WA 3TF5A 3PUXA 1F48A 2F3RA 2XNHA 1PR1A 4A73A 1HZJA 4P2GA 3KOXA 2KM1A 2OYRA 2QRPA 5HRAA 4UPVA 3SXUA 1JHUA 2BZGA 1DCKA 5AOVA 5KCMA 1EINA 1RCUA 2VUUA 3LNCA 1TPYA 1SKYB 3PR1A 4GVLA 1M6VA 5IMBA 2PJRA 1RLTA 5AVKA 3D8RA 3BA6A 4HF7A 4PGFA 3R7BA 3UVEA 2Q21A 4L78A 2F3SA 4A2CA 1M0SA 2WABA 2PSFA 4XQEA 2IITA 1PGJA 1YCGA 2M98A 1ULZA 3BE8A 4IICA 1HE3A 1T34A 1CEQA 2IEBA 4IHJF 4Y2VA 5CT8A 5E4TA 4KMMA 3A4NA 4G0UA 2BKAA 1EP9A 5JCZA 3KB8A 2Q3LA 1J8FA 5ILQA 3W5CA 4IBOA 4S1TA 3CZQA 1ETHA 3FIJA 1JA0A 3H7AA 3QELB 1ZHOA 1L5KA 3KYCB 3L4SO 1ORIA 2PKWA 1ZL0A 2XY4A 3C3XA 5KIAA 4JLBA 1NRJB 1Z07A 5BVHA 2P6NA 4XR4A 3CA8A 3URMA 2FG7C 3SIRA 1U4OA 1PFQA 5KNBD 3TQQA 4CBVA 1JIXA 3LUCA 1ZHHA 1LSUA 4U7WA 3OPYI 3Q11A 4HNSA 5G2OA 3VUEA 3NR2A 3MWFA 3PGKA 3MOSA 4QOIA 3UMVA 5I4BA 1B4DA 2VRCD 1A5AB 4FYHA 5FT9A 5LVAA 4FCCA 1Z4IA 1WETA 1P2VA 2Q9UA 3ZYCA 4E03A 4GM0A 1MC5A 3BWDD 3V1KA 2PCLA 1JQJC 4YV1A 2RARA 4PWYA 2C7VA 3H5VA 5C5CA 3H2GA 1NDUA 2ZWPA 2DBRA 1S2OA 2YHSA 1J33A 3S2FA 4JKYA 4DIFA 1X7GA 1S2LA 4XTRA 3ZGOA 3C5HA 1HR0B 13PKA 2VAWA 3FWHA 4JL8A 3PLNA 4BLUA 3OC0A 4RS4A 2J4CA 4HLUC 2IUYA 1II9A 2O1SA 3G9XA 3DFMA 1FMCA 2G83A 3UJNA 2D4AA 3L01A 1HE8B 1YZVA 5T4BA 2Q5QA 4ZOLB 3ZV3A 4JBXA 3DG9A 4C78A 4YAGA 3CU5A 4Q4JA 5DW3A 1ZNWA 4M8KA 4Y2HA 2QP4A 2IF2A 4LY3A 1CY6A 1Q0RA 1YJCA 3A2MA 3MZ0A 1ML3A 4KRFA 4CNQA 3FZQA 4EFMA 1P8JA 2EFCB 8ATCA 2GM4A 1K2WA 5DK4A 1GN8A 2HRQA 1GGVA 2NZUG 2R65A 4RKFA 5DGXA 3U80A 4OX9Y 2GN2A 4N47A 3NAQA 4EUNA 4ZYYA 3NTXA 4OY3A 2CVOA 4G0NA 1F3LA 1XTVA 2YX1A 1XXHE 2HA2A 3GJ8A 4FIZA 2AQIA 4NPAA 4AMBA 2VP5A 5NULA 2FEWB 2AMJA 2JHPA 4LQLA 4NMHA 3O9VA 1JKMA 3I4FA 1LSSA 4OI0A 3GZNB 2BTEA 3AW9A 1S9DA 2QPOA 3IR7A 1NBEA 4G4SO 2RE8A 5CVTA 3C6ZA 3GLIB 5E6SA 1YTUA 1CNMA 1J8VA 1JHPA 2YWJA 3HCRA 3ECAA 3G5MA 4Q4LA 5GJWC 4DTIA 2XMBA 4PC2A 1ZOPA 4GRAA 5JAZA 2FTKE 1HEYA 4DMCA 1JEQA 1QOPB 4WOCA 4CEHA 3BJMA 3T1VA 3VPHA 1UBKS 3NHRA 1LBEA 1QIHA 5JDIA 3HFRA 5FA8A 1FYVA 3OIUA 3A2NA 5CT6A 1QHFA 4LE1A 3L7YA 5CD9A 4DZZA 1WF6A 4UNIA 2O5EA 3IRUA 5BUZA 2QE7A 1H8ED 1X77A 2LTAA 3M6XA 2PFSA 4H6PA 2BUBA 3OZTA 1YULA 2X4DA 1FU4A 4G41A 4JNGA 3FOBA 1H2FA 2ZTVA 3AWDA 3GELA 1CPYA 5JWHA 4G0YA 1QUFA 1YL7A 3ITKA 3VO9A 2IEZA 4CM8B 3M70A 4JEHA 4Y2YA 4PNEA 1J9ZA 4QL3A 1QRAA 1W88A 2A57A 1WA5A 3AI1A 2WHXA 4IUDS 1MOSA 1P1RA 1O58A 2HCFA 3K31A 1AQLA 3VYTB 1Y7IA 1WZNA 4YUYA 4K9SA 1QTRA 2FUEA 4MLZA 3T12A 3LVQE 5LR6A 2W00A 3NH6A 2C84A 3O21A 2GD2A 3OE5A 4IIJA 4MHTA 4B4UA 4R9UC 3EVFA 3E9CA 4ZJYA 4KFCA 2O59A 3DHYA 2NOAA 4FFLA 4BKRA 4DSTA 1E77A 2E5WA 1JDZA 3E3OA 4I50F 1O6GA 1X1DA 2BCGY 4E4RA 3A1VA 2OBFA 1KTVA 4ZALA 1PS0A 2IVZA 4BRSA 1I0LA 1QQ7A 2WSYB 1RWKA 3IR6A 3O6VA 3L7OA 2VF5X 3PQ2A 4GC5A 3AOGA 5HHTA 2F4VB 2X0FA 1MX1A 2VJBA 2ZE8A 3GVIA 1I1NA 4L6AA 1U5BB 4E07A 1DCTA 1XA0A 1TFRA 2D5AA 4MYCA 4YAJA 3X1KA 3ZWOA 5C8DA 2WJWA 5L3SB 1H0KA 1O8BA 2J3LA 3ORFA 2FOIA 4ATNA 1JXOA 4DYHA 2DJIA 5A6SA 4NENA 3LC0A 5EP1A 5B7PA 4I99A 4KIWA 2Z4RA 4B7ZA 3DQPA 1G291 1NKVA 3MSCA 2WE7A 4RM3A 1II8B 4GLBA 3ZC3A 2HWXA 4C0LA 1SVUA 3NEJA 1D5WA 4LPKA 1GJRA 4F6RB 3QXSA 4F5YA 3NT2A 4X1OA 3LSTA 4DT1A 4YRBA 3PDIB 4N0MA 3FOWA 4KQJA 5B7NA 3JQ6A 2HGZA 3EGWA 3R6LA 2VCEA 4BNJA 5DU2A 4DNXA 3GRYA 5DWDA 2GI4A 3BJEA 2Z1MA 3FMIA 4QFCA 3TQCA 1KEPA 5D5HA 3I9V6 2A7XA 3TMAA 3QX8A 3B82A 4U2KA 3G59A 3A6GA 1DSSG 3HEAA 4IHJB 3SEAA 5JYCA 2ZUFA 1F2UA 2VNKA 4HWPA 3ABZA 4FNOA 4LHXA 1ZGCA 2FPLA 4WN3A 1EUZA 3X1MA 2I91A 3P9ZA 1U7OA 2GPYA 1R0ZA 4KYIB 2PUAA 4DJTA 3GFPA 3NALA 4Y1EA 5CA0F 3VGJA 5DXJA 2QRLA 3JQ8B 1KHTA 1NXPA 2Z04A 3ENNA 3I9MA 1NI3A 4LNAA 4P3XA 1YJ5A 4TLEA 1D6JA 2JD0A 5EIAA 1LTHR 5A03A 3UIEA 1V2GA 1NVWQ 1R15A 3GXBA 4I8IA 1XMPA 1AUOA 2QG4A 3NJRA 2X2FA 2IZ1A 1U8YA 4MRSA 5I3CA 3GFSA 4MAMA 3L7BA 1DRJA 1NASA 1TIKA 2P3OA 3H84A 2E55A 4GNKA 2HRZA 2PX4A 2YIMA 5D3MB 3WGJA 4CLEA 3GLKA 4UM7A 5CA1F 3O91A 1GNRA 4F84A 3G23A 5L8VA 1EZ1A 2RBKA 1FDUA 1G8GA 2VDOB 4KK4A 1NVUQ 1T25A 2O7NA 2WIFA 3GT3A 3NVMB 2PT7A 2CB0A 5B4UA 4FZRA 4ZQCB 3QVUA 2ZYRA 4CF5A 4XM0A 4Y9SA 3A26A 2GGSA 1ZJWA 1BIFA 3FXAA 4HLUA 5TVKA 1NN3A 2VDVE 1AV7A 1E1CB 2XYRA 2Q9CA 3D8BA 3VTFA 4EGCB 1JLHA 1TB4A 3DCYA 4DR1B 3TVTA 1Z83A 3BOSA 4LYJA 3OY7A 2Y0BA 5F5LA 2OZKA 1MABA 2YTZA 4R8RA 1FYDA 2C95A 4DZRA 3BMOB 2AZDA 2ZUTA 4ETMA 1U98A 4J9UE 2C9YA 4O5AA 3UENA 5CIYA 1H4QA 4FSHA 4OBBA 2XB6A 5G41A 2IHZA 2NO7A 4L8VA 2HNBA 1E9FA 4QVGA 3K9NA 1SAYA 1U9ZA 2IE8A 4OSEA 4BLWA 1V5FA 1RWOA 1TPZA 3KCQA 5EHNA 4BFZA 5IRCD 4YJ2B 3KOWA 4C4XA 1X19A 1Z63A 3VH4A 1NKSA 2O0KA 3BL5A 2VCHA 3WLAA 1JA9A 2J9YB 1M2FA 2QK4A 4YCDA 5IANA 3HN6A 2FSHA 3KLOA 2C54A 3P97A 3O31A 5HQ3B 3LHSA 1WUTA 1V7PC 4HCJA 4TT3D 5CFNA 1RRKA 2W2PA 3NTVA 3JYQA 5AW0A 3LDUA 4UULA 3IKTA 3TB4A 1E98A 5ELMA 3TE7A 5I7RA 3SY8A 2PBFA 4G5RA 2JEYA 1J42A 2C2XA 3C85A 3G0OA 3VPBA 2Q3HA 2PMKA 1DAKA 3FX2A 2GAAA 1BEEA 1ZH4A 3M81A 4NBWA 4WWHA 4C7VA 1CR0A 3D2CA 3O1LA 1UOEA 2Q0SA 2NZVG 3WGQA 4BGDA 2RAVA 3UOGA 3WJ7A 3OLZA 3ZJYA 4XJSA 1DBIA 3BMCA 3HC7A 4IGEA 4BMYA 4GOND 4RIHA 2X6QA 4LWZA 4QHSA 4BN5A 2VCYA 4YAFA 4ZN6A 4I9FA 1WZCA 3HE3A 1HDGO 4IRMA 4MVCA 3TLZA 2X41A 1G6KA 1QG4A 3CF2A 1L5GB 1T9DA 3HHEA 3CEMA 3T94A 5KC9A 4KXNA 1UWKA 3G0IA 3NNDA 2XNSA 3OQPA 5L3ZA 2CLEB 3TOVA 3B9PA 3FDZB 1A9PA 1VPEA 1Z0KA 5FV7A 4M87A 3RRJA 2QVLA 1RZUA 4HVLA 5D6NA 4Q6BA 3UCEA 1W1IA 3ETDA 5IZ4A 2IHVA 2QUAA 3L7CA 4GX2A 4LOHA 3VU8A 1QFYA 3LP5A 3R23A 2ASVA 4QBFA 2DECA 2WD7B 2DB3A 2BKUA 3D6MA 4AJKA 4G5SA 2XVXA 1R9JA 3K2IA 5EE5B 4INAA 4YT5A 3RUHA 5BQXA 5C8ZA 1XFDA 2D8MA 1A5BB 3LT0A 1DQYA 1W9HA 1ZOOA 2YN0A 4GYYA 4YXFA 5EQTA 1YDGA 3GCXA 4G4JA 4HMOA 1VIMA 2ZSDA 4N9WA 2BJHA 1DXOA 2W4MA 4IKPA 1EE1A 2NYRA 1S8OA 1K0FA 1U28C 1UBRS 2G07A 2HMAA 3TL3A 4OLHA 4D6XA 1SCIA 1U7XA 2IYWA 4GP7A 4PO9A 2ZJYA 4WUTA 4XJVA 3E4CA 5CCBA 3ZLAA 2L42A 1I6LA 2Q1YA 1X7WA 4KQIA 4MCAA 4D3DA 5AXDA 5IN5A 1BU5A 1JWBB 1NMXA 1RAEA 2P1DA 2QL9A 3GPIA 3NOVA 3QKTA 3VJKA 4C87A 3AJ9A 5BNWA 5IS2A 1MOQA 1N9KA 1S3IA 4UOEA 4B33A 2G6TA 3GOHA 3WV5A 2IIBA 1QVWA 4D79A 3HRKA 5CYFA 2QV7A 2ZITA 3LOPA 1MEOA 1JHMA 4GKBA 4IY1A 2Z6UA 5BSKA 3HSYA 1JZTA 5JBIA 4F46A 4AO7A 1G3RA 2DX7A 4P7KA 2B7LA 3RTCA 3CPHA 1U5AA 2YCLA 4OGWA 5C1OA 4QJ5A 5CH3A 1Z8FA 3RVNA 1N6OA 2C0PA 2M6LA 1Y8ZA 3QH4A 1DXYA 2ZUCA 1E2FA 3I9OA 1MJGM 1C0EA 1VBMA 1M6YA 1PQUA 3BMNB 1VE7A 3AI2A 3VC7A 1P91A 2GQ0A 4Q1CA 5A1JA 3UPUA 2RGEA 2V6GA 4MEBA 4REMA 5AW3A 5F2NA 3ZI4A 4TLDA 3G88A 1P8AA 2Q3CA 3TNYA 1C2YA 4MVYA 1K0UA 2QTGA 3LRPA 2CV0A 2DMRA 2XJ4A 1ND5A 1YH3A 2H4JA 3DYIA 1Z35A 3PKZA 2N0SA 3FPLA 1GYPA 1T9BA 1DQZA 1FE8A 2VYCA 3GPLA 1QIJA 1UZAA 3I2IA 1RR6A 4ENTA 3HXPA 4HOYA 3AXTA 5DASA 2XI4A 3DM9B 3PEYA 1M0WA 1OBCA 1SVIA 1ORWA 2BFMA 2PMCA 8ADHA 3QLVA 4LYAA 3DEFA 2WYVA 2X7HA 3GWGA 3NI2A 1KYVA 4GPTA 4G63A 4J76A 4RTLA 2C88A 4BHTA 4FNAA 1RYZA 2OV3A 2WFLA 4EGAA 3M4YA 1VMEA 3VR5D 1U9IC 1KJIA 2O2EA 1E3IA 2QJTA 2NU7A 3WKDA 4TXHA 1RZ3A 4I46A 1ZLYA 1IN6A 1D1TA 4ESVA 4BV3A 1PGPA 4ZI7A 4GYJA 5BSTA 1JSRA 1Y8QB 4TMVA 1YU9A 1V5WA 1CUFA 1W48A 2WT9A 3SSNA 2QE7D 1QPBA 2CUTA 2FJUA 5HE8A 4KC0A 2JDIA 1XN4A 5IH3A 4RSMA 1J1UA 3RUIA 1ODSA 5JRJA 1R16A 1EFTA 3BS4A 3KLNA 5HK9A 2CFOA 1DLIA 2JGFA 1XHLA 1L8LA 3NIGB 4CV1A 3SVTA 3ETCA 3FLAA 4BFYA 1SKAA 4UM8B 2J9FB 1KK1A 2D2EA 3ZDEA 5KI6A 1JDVA 3ND6A 1XZNA 3PRJA 5K0FA 1C4WA 1QYRA 3QBJA 4BL5A 3UT5B 3WAJA 2ZBDA 4XVHA 1EM8B 3IAS1 3Q9NA 2VJCA 1NU8A 3M3HA 4AZ0B 4MS1B 1Y6RA 3ZKAA 2B8TA 4MI6A 4E94A 1IE3A 2G7MC 5IDQA 1A9TA 3HGQA 1UIRA 1MP0A 4AUKA 1ZX1A 3MUNA 2UYHA 3PUZA 3S2EA 4K9QA 4TKMA 1FRFS 2NYAA 3HJAA 1U8ZA 1UK7A 1Z47A 3IP8A 4FCWA 2IFTA 2VT6A 4MWTA 4AJNA 1VMIA 3SWWA 3K0CC 4AQYB 5A9TA 1N4DA 1IWBB 3IAM1 4P92A 3DAPA 4ZO9A 3V4FA 6LDHA 1KA9H 4LSMA 3U4CA 3VH3A 1X7DA 4Z1OA 5CX1B 5JSFA 1GTRA 4ZEVA 1EK0A 2PIAA 3DEZA 2O2DA 3FYDA 3THOA 3FPSA 1RLJA 5F4ZA 1W36C 3LA8A 1NQUA 3HG7A 3PTZA 5JNTA 1QHHB 3IP5A 2G17A 1ZK4A 2BTQA 2IYQA 4R7ZA 4OREX 1VCNA 4AL4A 4MULA 4ACBA 4D9JA 4Q24A 4B6RA 2CXOA 4HZUA 1UPFA 2F62A 3OE1A 4D26A 1NX6A 3DMTC 1K3TA 4MIYA 3CFYA 3T5CA 3W5BA 3K0SA 1ORTA 1J8DA 2VBFA 4JLWA 2NNLD 4YLEA 4MKFA 2IBSA 3BSYA 2HW8A 3UMMA 1P9NA 3JRNA 4JT4A 4K8OA 1N2GA 1O6BA 1AY0A 1GO2A 5BSHA 2CNNA 2YUTA 1YASA 4JLNA 5DSZA 1TQDA 2RG7A 5FBVB 3PRYA 2ODNA 1DAOA 1E7WA 3ER6A 3LDAA 2OPHA 4ALNA 2DRIA 2QRZA 4HWGA 4PRKA 4FEEA 4BGEA 2X7XA 2ZSBA 1V5GA 5EC8A 3OOEA 2ZE7A 5DM0A 1HH4A 3KOZA 4EITA 4EI9A 4ZGWA 4GQIA 4S1WA 5IBPA 1ADCA 4NJMA 5P21A 1XQ1A 5D01A 2H0QA 3MINB 1EVYA 4FR2A 4WK2B 2EKPA 1CS0A 3WLPA 4RKQA 3IQXA 1Y1KE 3BWCA 4RPGA 1J00A 5LBUA 4RH3A 4O3FA 2QROA 1I4OA 1E18A 4OP3A 4B09A 5HRUA 4XJTA 1QS0B 2GT1A 1JX6A 4YWJA 2VDMB 1Z7EA 3QXGA 5LIPA 3OHMA 5IBQA 5TQ0A 2HGSA 3IPCA 4J91A 1U28A 2BIFA 3HKBB 5BY2A 2R79A 2WZDA 1IBMB 4I4TB 4Q3BA 1N0WA 1NJ5A 1KOLA 2YZ7A 3VISA 5I7OA 4YUVA 1W85B 1BD3A 1FUUA 2YRFA 1DOHA 1XWIA 3Q1KA 4QQNA 1E1DA 4TRRA 3TLAA 2BFCB 4ED9A 4KXXA 5C9ZA 2ONZA 3EFEA 4HAXA 4P7FA 5J4LA 3HO8A 4INZA 4MWOA 1AMOA 4JQCA 1Q6ZA 4DBVO 4IHAA 4DMMA 4NABA 1N7GA 2VJMA 3C8HA 1OHHA 5SV2A 4XGRA 1ZR2A 1NP3A 3B8EA 2IYZA 1L4EA 4MW5A 1U31A 4B43A 2XKBA 2F6RA 5HG0A 4EYGA 3HZRA 1EVJA 4LVOA 4WNYA 2V65A 4ZGGA 5KYWA 4W5TA 3LW8A 3TINA 4BO4A 1JJBA 5CFPA 5JSQA 4C4TA 3CVYA 4I9NA 3N74A 2PMEA 1ZMTA 5EMKA 1Z08A 3D2BA 3NLLA 3OQ6A 1C5KA 1TC2A 1YMVA 3H9EO 4RD1A 5G0SA 2C4KA 5JXIA 1NIJA 4GT1A 3P45A 1F4PA 3Q0EA 2H5IA 2UDPA 4OM8A 3ILVA 4UEOA 5ABPA 5JAIA 2GEFA 2Q5LA 4O2BF 1ZAKA 2WK1A 4TMXA 2B7BA 1LVGA 3VKFA 3ZE1B 2AWOA 1F8UA 2UVDA 3DJYA 1E62A 4KMRA 4QU8A 3L8ZA 5DCLA 4GLOA 5CAEA 3BDVA 4C7OA 4MR7A 3FOCA 5EKXA 1E7QA 3G7SA 3KSUA 5T3YA 5DN6D 4HUJA 4ZT6A 721PA 4L0QA 3GPCA 1MX9A 1TCUA 3DR3A 5CBPA 1YMQA 4HAIA 1ZBDA 1DRKA 1WG8A 1NMYA 4QBIA 3L4JA 1MHTA 1JQ5A 2E4ZA 4HDMA 2ZVDA 2IDMA 3M4JA 1KR2A 1Y4DE 3WICA 1ELOA 3U6KA 3I45A 3S27A 1CRZA 3W0LB 5TGZA 3A06A 4J4TA 1JDBB 3LDHA 1I6MA 4G8DA 2UYGA 4DDVA 1OC4A 2Q27A 4NNPA 2CLKB 2GAJA 3AIKA 1OSNA 2AW3A 4JLOA 1U9IA 3LO5A 1KYWA 1GGNA 2PZJA 4HY3A 3CR3C 5JVDB 1YRBA 1ONPA 1N32B 2GAFA 1J39A 2CHFA 3KELA 1H6CA 5CB4F 4EBFA 2C3PA 1B3BA 4LXTA 3B5JA 1NBWB 4L0DA 1JAHA 1U3FA 2VF7A 4O4IB 3WL5A 1M0TA 3H4MA 3KYBA 4X8LA 4N18A 4XDGA 3N2GB 2I9PA 3CH4B 3T52A 3C3EA 3UICA 3NFRA 3BIXA 4JA2A 2R8ZA 2OM6A 5JPIA 4D3ZA 4PSAA 4F3TA 2ZJ3A 1ADBA 5K0LA 2QSUA 4MQMA 3AP2A 2ECFA 1GVHA 4KFRA 1IAVA 1Z5OA 2I3DA 1P72A 4MYUA 3SC2B 4LTNA 4TTQA 4U4AA 2DPYA 2RSLA 2C0CA 3TI9A 1NVFA 3K9BA 3B7PA 4CM6A 4I55A 3MMSA 4B8WA 1GILA 2DYKA 2RHBA 3B6EA 4ZCRA 5BR4A 2H59A 1XTQA 2IHKA 3I6ZA 4KWIA 4UDYX 1R0KA 2Y4OA 1KXZA 4GKVA 4P35A 1GL3A 4HDKA 5M04A 3K6SA 3AVXA 3RRZA 4UQOA 2QUBA 2FEPA 4ECAA 3JZFA 4WKOA 3U7QB 3K0CA 1DPFA 1TKAA 1MDFA 4XIFA 1A4RA 1DUSA 1U99A 5C2JB 2ZIVB 2VQDA 2ONJA 5KYXB 4KLZA 3IVXA 1KBZA 1O9HA 2XWSA 1E2DA 1Z22A 2EKLA 3H4IA 4GR4A 3RRYA 5JXWA 5L4NA 1FMLA 1HSZA 3AF5A 4M99A 1NNEA 3S2SA 4FI3F 1W93A 1WMSA 2IUSA 3MWKA 3LCVB 4RPKA 4UMDA 4C2AA 4WN9B 3REGA 1SU7A 4D82A 2QM3A 1MEJA 1KO7A 1R3DA 4G86A 4EPRA 2YWGA 3WK9A 3DMTA 1XRJA 1TUGA 4Q48A 3AF0A 5LQUA 1Z68A 3Q7EA 1K7XB 2G70A 3SYKA 3RS9A 3BIFA 4GXTA 3THXB 3TL6A 3B5EA 3PFNA 5JJLA 2QLJA 5IM4F 1BRMA 1Y8RA 3NUZA 4EJ0A 5ES3A 3PA8A 5L40A 3ZJVA 1BA2A 2XTZA 3FGOA 3BAFA 3AG6A 2V54A 2QE6A 3MJEA 3N2YA 1NR1A 1U2GC 1AVTA 1Y1RA 5EUBA 5CG2A 2EGGA 3KBBA 3L0CA 1RRFA 3M6IA 4L7QA 2G4LA 4D4IA 4Y6LA 5AHWA 2B2CA 2GXQA 5DOVA 4WBNA 1E9DA 4Z7QB 3AGQA 3CUKA 2JIPA 4P32A 3R3XA 4CMBA 4IQGA 3RSZA 4RACA 1VDMA 1DAEA 5IZCC 5IG2A 1WXQA 3G79A 3H99A 3GH3A 2VHXA 3B51X 3RDPA 1OWOA 1XVLA 3BXOA 1H4VB 1SELA 1N6HA 3JV7A 4WUVA 4EUEA 2F1OA 4JBHA 2FFJA 3PFKA 1H2RS 4J7UA 2AFHB 3WOVA 1N36B 4C2UA 3I9NA 5DHPA 1QKJA 3Q7IA 4N49A 4BECA 3QVXA 3AUKA 3RBVA 1V8PA 2FJPA 3AVUA 2A9QA 4PRZA 4MKGA 3GROA 5BN3B 1QTNA 1E5LA 4X71A 3IKLA 4CG3A 2JZNA 2G1PA 4GW3A 2GHIA 1BC5A 2JRCA 3MCWA 4BGUA 1GIAA 4R2JA 3A04A 3UMJA 2XRZA 4MWCA 4DLTA 1V11B 4XB2A 3U31A 4A6DA 2OBNA 3JVVA 3G5LA 3N28A 3H5IA 4JP3A 3LQFA 3OG9A 2W2QA 4DLWA 2IS1A 2BP7A 3E61A 5HILA 4RM2A 1T36B 1JDTA 4FYKA 3O2SB 4HDSA 3CQ9A 5AVXA 4WFQA 4D25A 5HCUA 5BWMA 2NAFA 4Z5XA 3DZGA 5C3MA 3DKRA 2HREA 2FX2A 3HJGA 3LXMA 4TV9A 3QOXA 4MB0A 4L8YA 1QGZA 5FULA 4EFKA 4PPYA 4TRMA 3H6HA 5BPFA 1U2EA 2IODA 4WXYB 5KWJA 3HWWA 3AL0C 2RGDA 5AT1A 3EE6A 1NW7A 4AMUA 1NLZA 4TL7A 4R9NA 2IS2A 4M9UA 3RQSA 3INRA 3V4VB 1W2WB 3B89A 3WX0A 4LBVA 3WB0A 1SBNE 3IDZA 3ZVLA 4O2BB 1TECE 2FVYA 1ADJA 4PZYA 3QUCA 1N34B 1T43A 3JR7A 4XWAA 1IQUA 3OEWA 3JW8A 3ESXA 1E96A 2C9ZA 2G1KA 1IK6A 3H5TA 4OEHA 4CUKA 5C80A 3B1XA 3OT1B 2L0XA 4LYFA 3RF6A 3SE0A 3BQ9A 1SD5A 5J4YA 2R11A 2P6PA 4EY6A 4LXUA 5AKKA 1IZZA 2G1JA 3HDVA 1JKFA 4MV7A 4F3YA 3CX7A 1H2AS 3AETA 1HI9A 1TA4A 1QZXA 1ZC4A 1P9OA 5BWCA 1GTVA 3QHPA 1H6DA 3ZJTA 4F4DA 1IWPB 3DCJA 1GUYA 1Q0ZA 4YDRA 4Z54A 1UKZA 4IH4A 1IXYA 2B78A 4B31A 1QZTA 1LA2A 2FDCA 3TTTA 1ODCA 4XXHA 2JLSA 2Q8QA 5AO9A 1GPAA 1PAUA 3DM5A 4UHFA 3P9XA 2DBYA 3Q2IA 1QC5B 3L79A 3BGWA 3GBSA 2VBGA 3UWKA 4ARAA 2C7OA 1EFHA 3WJ1A 2Z3VA 3HL0A 2AUMA 4I8XA 1QYCA 2XUOA 3SQNA 4BY9E 1KKLA 1DC5A 4C1NA 3EVGA 3TG2A 5BOSA 3KDSE 1VPTA 3ER8A 4HGZA 1PGQA 4AUEA 4EYQA 4F1WA 1A7UA 3NHUA 2AXQA 4W5WA 5SZKB 1R0XA 4BCDA 2QRMA 2INGX 3R7FA 3KWMA 3OCZA 2RGNC 3OZSA 4B85A 1WD5A 2I7XA 1CP2A 3E7WA 4F06A 4AY6A 2G06A 3SD7A 1CUGA 5A6VA 1KI6B 1E1QA 3S2IA 4NZNA 3LKBA 1VHWA 5IKEA 5FPTA 1E5VA 1YZQA 3OZRA 3C5VA 4F9GA 1NBMA 1G6Q1 3M1LA 2QTHA 2Y2UA 1CLEA 4TUYB 3SHOA 4CE6A 4QRIA 2P2SA 2WINI 4GM4A 3W5DA 3L8MA 2R6HA 4LRSB 1CQJB 3PLRA 3Q3GE 4IEEA 3RIYA 1TZMA 5L95A 4CKBB 3N0VA 3WBJA 2ZJZA 3GGGA 5FBQB 1L4GA 3KJZA 3NCHA 5GJBA 2ASEA 1R37A 3FI0A 5H7XA 3AF6A 2ZRCA 2XQVA 3WQSB 4E5YA 4D45A 5B1EA 3GLFB 3N07A 1J4AA 1DHTA 1CR1A 3VC2A 4X62B 3K1JA 2O8BA 1DBPA 2OHGA 1OHHD 4PFJA 4PSVA 4S12A 3KQOA 1XFAA 2G8NA 2IU0A 1IG3A 3A37A 5ED4A 2I6UA 1AV6A 1OZFA 1Z75A 3JQ9C 2I4MA 3HCPA 4RF4A 4BEBA 1PR0A 3OQIB 3ZX4A 1GM5A 5TMBA 4R2WA 4BX0A 3FYUC 2G7ZA 3JD0A 4LDQA 4PLHA 4D98A 1Q92A 1RLIA 1D2EA 1GTSA 1NPDA 1U2GA 4FFMA 2G72A 1OKKA 2YJNA 2WTBA 1XZCA 3T9EA 3SS7X 4EG4A 3GEGA 4KXVA 4TYMA 1HYBA 2W6JD 4AURA 4NAHA 4EGFA 3T9CA 1GN9A 1M2WA 2OHJA 3P5SA 3UJ9A 2XD9A 3LCCA 3PJFA 3NJ8A 1NVBA 3T38A 1N5JA 1TL7C 5IZCA 2XQIA 5IT9A 1PG2A 4IWNA 2QTVB 2X3UA 3P4UA 4L50A 4EKEA 3MD9A 2QBYB 3AWIA 1VOTA 3BRWA 4JWTA 2REQB 2Z98A 3GARA 3K09C 3MXTA 4Q34A 3M9WA 4RE5A 5IMSA 3LCMA 2R86A 5KNBA 1FFXB 2ADOA 2GBIA 2H00A 3I12A 1T1JA 4YV0A 4UASA 6REQA 3JVUA 2QZPA 1NI4A 1FLNA 1OXSC 3TZLA 2VQFB 3PNQA 2I1WA 3ZHXA 5KKNB 3NYRA 1ISRA 3U4GA 4IXDA 4FYPA 1RXWA 1N0VC 2VDJA 2V7WA 5BNFA 3RWBA 1SVOA 1T5IA 2DHEA 2ILVA 3A6PC 3EEBA 4I5EA 5IH7A 4D8TA 3ICPA 2CYBA 1ZHFA 5AICA 2EYQA 1F51E 1NN0A 4V0OA 1MXFA 5E4YA 3I1JA 1EAMA 3AZOA 2R0QC 3TECE 3X2SA 4C04A 2ZGVA 4JY7A 4HDRA 4JEIA 3H0CA 2GM5A 1TO1E 1EXDA 2VT7A 4XVRA 1BEZA 3HCEA 4GOKA 4XI9A 4G1MB 1G9SA 3RM3A 1KIMA 2E85A 2J5KA 2Q62A 2QN7A 3EVBA 1IC6A 2AI1A 3T5PA 1BRTA 4BV8A 3H0KA 1GY8A 2OV8A 4LQ4A 3N86A 1I3MA 2WKWA 3LXXA 4KJZA 4G4IA 2NO6A 2O3RA 3LYAA 2R7MA 1A5TA 4O2AF 2EFEB 1XQ9A 5HMLA 1Q7RA 3PHBE 2TYSB 1OLOA 2X9GA 3MWEA 2CJFA 1IHDA 4IJWA 5LQNA 2C57A 3VR6D 3WMGA 1P2FA 4RNCA 1W2GA 2IZ5A 3W2HA 4F2WA 1KVUA 2R9VA 3ELUA 1T5SA 4TKZA 4UBKA 3IAAA 4L4YA 5M34A 2GEDA 1KARA 4LWQA 4DMRA 1WMDA 4OMDA 4PO3X 4F72A 3ZDBA 4HFNA 3FBGA 1PJ4A 2YDYA 1TIBA 3I2GA 8MHTA 5CT9A 3TX2A 1GKIA 2H63A 3AR2A 1PWXA 3KFLA 5FOWA 4E2FA 4PPFA 4FK8A 1DJMA 4M9XA 1SUEA 3HKDA 1Q57A 3SIXA 2RBEA 3D4BA 2EJCA 3LHIA 5JZBA 3WMEA 1OBHA 2H2IA 2O3TA 2V7XA 3RUEA 2ATXA 2ZB7A 3HU5A 3KHSA 1D0IA 4OHXA 1QP0A 1N0UA 1UXGA 2PXXA 4A8JB 5C46F 5TR9A 4U7TB 3RRMA 4I3GA 1ZIPA 4D0NA 2PGAA 1YBMA 3JALA 3T34A 1M54A 3ENVA 1EGQA 1E3WB 2QT1A 2HL6A 3CC8A 4U02A 1KH3A 5L51A 2C1ZA 1V47A 2PL3A 1SD2A 1X87A 1PJ2A 2JBAA 1RJFA 2Y0CA 3WZ2A 1RJ9B 2HO4A 1NHGA 3G1UA 4ONEA 1AQ6A 3BD9A 6GPBA 4NOKA 2VTDA 3UK1A 4RJJA 3GX1A 4L74A 3OEHD 2RGNA 2GF9A 1U63A 4R8MA 1M2VA 2QQGA 4CF3A 3QSYA 1W87A 3FNQA 2FZGA 5AKJA 4HRAA 1Q91A 5D51S 5IJAA 2POCA 1WXXA 5JDCC 1I3NA 1BX1A 3DHEA 4MDYA 3ZIUA 4U6SA 4BNNA 1ZNZA 1DXQA 2FEMA 3PRKE 8LDHA 1EH5A 4IDEA 2H4FA 5AUQA 4BC1A 4J1GA 1Z6YA 4LX0A 2VH1A 4ITUA 3RU2A 1D1PA 4ND8B 4J0CA 3CR8A 1J09A 3D43A 1NF3A 3DEYX 1LFAA 2QLTA 4XIIA 1RYFA 1U2QA 4U6QA 4JBGA 4D9IA 2FGJA 1XVIA 1EDZA 1RXSA 3VFDA 2I5PO 3G9UA 4AP5A 5IVDA 3VBEA 1XN1A 4GMKA 1XK7A 2NPFA 4B0OA 4B3GA 1TZ2A 4KGVA 1CJBA 1KI2A 3AVPA 1U0OC 3CSDA 2P7HA 4D97A 3TLGB 5KQPA 2OHFA 5FWDA 3E0XA 2KHZA 2PO5A 3LGXA 4BVBA 2LVBA 2PX5A 1I2CA 3CX3A 3ANYB 3F49S 4RLHA 3JQ9A 3ZD8A 1T8TA 1W4RA 2DY1A 4TV8A 4POAA 2QAGC 4K9RA 3QEMB 3FYUA 1Z88A 3A3OA 3NHFA 4DAOA 3ZQKA 2QL6A 2OO3A 2ZRKA 1I3OA 4R1QA 3ANMA 2ZBVA 1NPYA 3ZWYA 4CF4A 4ALLA 4D1YA 5JR3A 1REQA 1GUBA 3TKYA 2IEYA 1R88A 1FFCA 1V48A 2Z2JA 4HNQA 1A4IA 1QJCA 1WMBA 3WL8A 3I30X 3LWDA 4N0QA 4IXMA 3RT7A 2Y6UA 3IEXA 3LPLA 1HC7A 1HNXB 1M6HA 2WU4A 4P4LA 4Z6KA 1NQAO 3GHHA 4GGMX 4LGVA 4GX1A 1V2HE 3ND8A 4G5YA 1Q1ZA 3L8DA 3NM4A 4CEIA 3HBNA 4I50A 2I7CA 2CXPA 3K09A 5L7WA 1UBUS 4N12A 4AJ4A 4X6LA 2GPJA 3OOJA 3UCXA 2FW1A 5JD5A 1QAOA 3CZRA 1A77A 2KLBA 4NHEA 4F96A 2JLYA 2V5AA 3G7UA 3M33A 3HYNA 1DAGA 3P2EA 3U3RA 4C7JA 2YHIB 3ESYA 4MYSA 1TT5A 1WHTB 3JD3A 2ERXA 3F5DA 4MMYB 1A1VA 3AI7A 1MC4A 4RE6A 1XDZA 2B8NA 2YVQA 3UJAA 2H17A 2YXLA 4A0SA 5K3EA 3AR8A 1YJQA 2I4IA 1TVKA 1VHLA 4EW6A 3RYFB 5AW1A 4JLVA 2PL5A 2IYVA 3QENA 3FCSB 1AGYA 1RI2A 3WWCA 3Q87B 4ZT4A 4ZZ1A 4OSPA 3FGZA 1R9NA 1QGUA 1TM1E 2Y9PB 1QYVA 4IAOA 1W75A 5HP4A 2C2KA 3T5DA 1DX6A 2ZVJA 4AYTA 3MWGA 2RONA 4RGYA 3SBOA 4CM7A 4FCVA 3E22A 3FUXA 1VMDA 2V7EA 4EJ6A 3ADOA 1G3UA 5I7FA 2WWTA 3I1IA 3KPJA 5FBRB