4LTDA

Crystal structures of nadh:fmn oxidoreductase (emob) - apo form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
192
structure length
187
Chain Sequence
TYSIVAISGSPSRNSTTAKLAEYALAHVLARSDSQGRHIHVIDLDPKALLRGDLSNAKLKEAVDATCNADGLIVATPIYKASYTGLLKAFLDILPQFALAGKAALPLATGGSPAHVLALDYGLRPVLHSMGVRHVVQSFFMVQSQFSLAVEDDVASQLNNAIDHFRLSLSSEPSTRHLGHPRPSLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-dependent FMN reductase
publication title Crystal structures of NADH:FMN oxidoreductase (EmoB) at different stages of catalysis.
pubmed doi rcsb
source organism Edta-degrading bacterium bnc1
molecule tags Oxidoreductase
total genus 61
structure length 187
sequence length 192
ec nomenclature ec 1.5.1.42: FMN reductase (NADH).
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ltdA00
2MTBA 4BMOB 3B6KA 1NNI1 1OBVA 3FNIA 1D03A 3UXHA 2OHHA 4YAUA 2W5UA 3QFCA 4OXXA 3S2YA 5JROA 4ZVNA 2OHJA 4QOGA 4U7FA 4YAWA 4H6PA 3U7IA 1QRDA 1KBOA 4QOIA 3ESZA 3N39C 1TIKA 1ZX1A 1FTGA 1FVXA 5B3KA 1QBGA 1AKUA 3FX2A 1DXOA 4QOHA 3QFRA 3B6JA 1CZHA 4Y7CA 1XYVA 5FA6A 1J9ZA 3NHSA 3OX1A 5LVAA 2Z9CA 2FZVA 4ZVLA 2AMJA 2BZSA 3FW1A 2FLVA 5NLLA 4FGJA 4C0XA 2Z9DA 4N9QA 3F90A 2Z98A 4GI5A 3ZHOA 2QX6A 4CETA 1CZUA 3SVLA 1CZOA 3LCMA 1D04A 1VMEA 4XDGA 5TGZA 4QOEA 2FZ5A 5FUQA 3GFRA 4YQEA 1JA0A 1C7FA 4LTDA 3G5MA 4LA4A 4XDHA 1AMOA 3NLLA 2ZKIA 5LJIA 3OWXA 4QOFA 2QMYA 3NHJA 5A4KA 4D02A 1QR2A 1TLLA 3OJXA 1WSBA 3O73A 1GG5A 2FCRA 1RLIA 4R81A 1AKQA 1H69A 1DX9A 3NHWA 2FVXA 3L9WA 2R97A 3U7RA 1WSWA 4H2DA 4U7HA 3NHPA 1YRHA 1T5BA 1YCGA 4FGKA 1BU5A 4N65A 2ARKA 2N1MA 4DILA 2B3DA 2XODA 2Z9BA 4FX2A 4PTZA 3JSXA 1B1CA 3ESXA 1H66A 4ZVMA 2V5VA 3ESYA 1RCFA 4DIKA 1YOBA 3W7AA 1J9GA 4U7GA 1F4PA 1JA1A 2MOKA 1C7EA 1YKGA 1AKRA 1J8QA 3OX3A 1RTTA 4S24A 4FGLA 4HEQA 5EAIA 2HPVA 1AG9A 3LT5A 4Y9UA 3KEGA 3NHKA 2QR2A 1OBOA 2X2PA 4YAFA 1KBQA 3KAQA 3NHUA 3NFRA 3OVMA 3K1YA 4LAFA 3RPEA 3FJOA 4GQIA 2FX2A 1FLAA 3R6WA 2WC1A 4QODA 3F6RA 2BMVA 2QWXA 2V9CA 3D7NA 2FOXA 4J8PA 4NLLA 2R96A 3HLYA 2KLBA 4CF6A 2QMZA 2KQUA 3F6SA 4YAOA 4BMPB 2F1OA 2D5IA 2GSWA 2Q9UA 4C0WA 1D4AA 3K20A 1CZLA 4ESEA 6NULA 4C76A 2HNAA 2BPOA 3UXEA 5ULLA 1AKTA 3W79A 3GAMA 4HS4A 3B6IA 1CZKA 3ES9A 1J9EA 3KLBA 3F2VA 2Q62A 3GFSA 1XYYA 2RG1A 3L9XA 3B6MA 3EYWA 3HR4A 1FLVA 5EA2A 1XT6A 2BF4A 2QX9A 3NHRA 5LBTA 4ZVKA 4N82A 4GR9A 1OFVA 1FLDA 4DY4A 1V4BA 1T0IA 1I1OA 2OYSA 1X77A 2X2OA 2XOEA 4F8YA 1AHNA 3TE7A 1AKVA 2QX4A 4C14A 2A5LA 4M0CA 1SG0A 3P0RA 5F4BA 5LMCA 5B3LA 3EDOA 1FX1A 4Y9RA 1DXQA 4LTNA 2BN4A 1FUEA 3N3BC 5F51A 3OX2A 3HA2A 5F12A 5BUCA 3NHLA 1SQSA 3W77A 1YDGA 4QOJA 3OWHA 4LTMA 5EMNA 1FLNA 2FAXA 3KAPA 1ZWLA 1AZLA 1AKWA 3TEMA 1E5DA 2M6RA 3NHYA 2HNBA 2QX8A 2FDXA 3FVWA 4PU0A 1RLJA 2V5UA 5FX2A 3NHFA 3TZBA 3QE2A 5LLDA 3GFQA 1CZNA 3W78A 1YCHA 2M6SA 4YALA 2OHIA 3N3AC 1CZRA 1YCFA 4NULA 1XI2A 5NULA 2MWMA 3OJWA 1ZWKA 5LJLA 1QHEA 4ICIA 1BVYF 5LBUA 2MT9A 3O2NA 4PTYA
chains in the Genus database with same CATH superfamily
4YLEA 1Q20A 4L85A 4I1PA 2C2ZA 1COWD 1NW8A 3IUMA 3R7DA 1E3DA 3W1VA 4EHNA 1KYIA 1DTWB 2IHTA 5H3CA 4ITRC 2WU4A 4NJEA 1CQJB 4FYYA 4MVJM 3TUIC 1CYEA 1PUXA 3WL6A 2WHEA 3R1IA 1DO0A 4HH4A 4WW0A 5SZIA 4D4KA 2F8TA 3WGTA 1M2FA 1V1JA 2EV9A 3CF4A 3F97A 2JIRA 3QE9Y 1VG8A 2HMYB 2O7VA 5KSYA 2NT4A 3BGIA 3KSMA 4DRZA 2IXGA 4FFWA 2ZAOA 1NXPA 4IIBA 4DSAA 3VU0A 3T3NA 4Y9SA 3VR4A 1FDWA 1GA4A 2AFHA 5FPPA 3KPVA 1SG6A 5EFOA 5BN1A 4DAEA 1U4NA 3A28A 4ZYUA 3D5TA 2OHJA 3MS2A 1PJZA 4HN9A 4JI4B 2VK2A 2VYQA 2BEVA 1SCQA 3KJGA 1IC6A 2HJHA 1UJ2A 1EFLA 1ZINA 2ZB4A 3CUSA 3O4FA 4C7JA 4MQEB 3G2HA 2EG5A 1MF7A 2JARA 3O2JA 4B87A 4MVJI 4BDSA 4GU5A 4GSYA 2O54A 3H4VA 4TM8A 1RI3A 4D46A 1S4QA 4EMSA 5F5NA 3AR8A 4OAPA 5GGYA 1E99A 1D2CA 3OZIA 4JP8A 3LX8A 4NY1A 3WL8A 2ZWAA 2EFDB 2A9VA 1NWCA 3H2BA 3SHQA 1PNTA 1TK2A 5DM60 2H51A 4ZU3A 1YU9A 4UQOA 1CV2A 2QP3A 2HLNA 4HDOB 3MYRA 1H4TA 3A1WA 3HVJA 3Q15C 4O2BB 5EHXA 4NV0A 1RC1A 4EW2A 2H57A 3KQHA 2GNAA 2D2IA 1DZ3A 1ETUA 2AX3A 1EP9A 3PQ4A 5ECDA 5KMGB 5AKIA 1M2GA 2AKYA 4JOBA 2ZDGA 1QYVA 4RA9B 1NVGA 3BGVA 3LUCA 1NI3A 5B12A 4JELA 1GCUA 3KKLA 3AY3A 4WKOA 3VNVA 3B3JA 5HDBB 2P2GA 1JEYB 1BXGA 5JPCA 1D2EA 1TCVA 3RVLA 3VHRA 5KUTA 3ZJ4A 2X58A 3C4JA 1JHVA 2Q0SA 1EXVA 4MRSA 4OXRA 5D1NA 2RCNA 2JH3A 5TDHA 3G0BA 3R7NA 2HA4A 1ZQ9A 5ALKA 1M2HA 2V45A 2YXBA 3H16A 3JZMA 3T1YB 1M2EA 2J0EA 3QPDA 4BUJA 5LXTB 4H59A 3DBRB 3QNUA 4PYJA 5KVCA 5ALTA 4ES6A 3BA6A 3QOFA 3CRZA 4CN8A 1C2YA 1UODA 1GAWA 4FDVA 1U4OA 1ZW6A 4KQGA 3NGLA 3PSHA 3M9XA 4ARBA 5J2UA 1ADGA 3FIUA 3HCEA 5D2CA 3ENZA 3GZNA 5TV2A 2YZKA 4GLLA 5AQEA 1T6NA 1P7WA 4U7JA 2QZ9A 4KPYA 4XSGA 3NVMB 1NVEA 1I10A 4KGXA 1BZYA 5JLAA 1EI9A 3HCOA 3PDUA 1PZMA 2GETA 3AFGA 2OORA 2YV5A 4BMNA 4EL0A 4M7OA 2HA7A 3A27A 3UC5A 4G4GA 2ID7A 1SVWA 1KHHA 5FUQA 1TQ6A 2JFVA 4M1TA 5J1TB 4CT5A 4ABTA 1VL6A 1VKJA 5JCJD 4HLQB 4E30A 1QV9A 4RXTA 4YQEA 5C8XA 1P80A 2DFVA 3I9MA 4DLWA 4M86A 3U7QB 1M74A 2EW8A 4DCSA 2NSYA 4P36A 4D80A 3L7CA 2A0FA 4E5VA 3RWBA 3O03A 3T9BA 3H83A 4MKFA 4WNCA 4DANA 1IIRA 4L9AA 3SHWA 4AROA 4ENRA 4AULA 2FQWA 1Q0QA 3QVLA 3ZHXA 2RGRA 3AUAA 3LQYA 4AF8A 1BAPA 2JATA 4BEBA 4AXXA 4OQNA 2PYZA 3WMFA 2HHHB 2GRAA 4AO7A 2WY2D 2DUWA 2NQ8A 2FHSA 3HZOA 4JN6B 4XUCA 3UM9A 1GV1A 2WFAA 2AC4A 4D02A 1A4UA 2BM1A 4JLAA 3FPGA 4WKGA 4XGKA 3BB1A 2MJLA 2P9BA 5IP5A 4B6FA 1EESA 3WRWA 1JA9A 3R6LA 1IEWA 1P39A 2PKCA 4U0KA 2XUOA 3OJXA 1UJNA 4QJ5A 3FDIA 1SU4A 4KPGA 3G9UA 3RCBA 2X9GA 1XZLA 2X22A 3P9ZA 2OQVA 4L15A 3OUTA 1XZQA 3REQA 3LA8A 1RWMA 2EL7A 1H0KA 2FQXA 1M83A 3MJSA 2C4KA 2DGDA 1ZLYA 2WT4A 2XAUA 3IP1A 2QGZA 2V0GA 5KCMA 1DAFA 4UNIA 2OG1A 2ZSJA 1QOQB 2I4TA 4RXUA 4FK8A 5AKYA 2CKMA 2ZUCA 4GBJA 1GGHA 3I2KA 3NHBA 3SF8B 1YMVA 3VR4H 5EXPA 2B78A 1SO8A 2JIBA 4M8SA 4X93A 4EDFA 4RZXA 4U7HA 3C8DA 5EIHA 2N46A 3DBHA 1ZRNA 1QHGA 3A6KA 2GBLA 4MRMA 4Z1MD 4RC9A 3E3MA 2IHBA 3EQ6A 4XA8A 3EA4A 1Y5RA 4LYEA 1JDUA 3BRQA 4DQKA 1OYYA 3EK2A 1QS0A 5T4FA 5C52B 1W36C 4URUR 5TNXA 4W99A 3ZWVA 2IT1A 4N65A 2HADA 3AL2A 5JBNA 2BRUC 5E1BA 4M38A 3ZG6A 4B3FX 1T8PA 4PZ0A 2I4NA 1N0IA 4JBWA 2NGRA 1U2SA 4LI0A 1NRWA 5CG2A 3PLNA 4TYPA 5IDVA 1D2GA 1KEZA 3RV3A 4INPA 1B1CA 5IKEA 1CQZA 4IW3B 1NU8A 3REOA 1OXSC 1O94A 3FBGA 3LC2O 1JDNA 5IULC 1WCWA 2QT1A 1V6CA 3LLCA 2VP6A 3NTOA 2DUNA 5SYAA 2BH9A 4UATA 3R5KA 1R0ZA 4L3VA 1MVLA 4WCVA 1WXEA 2VAXA 3GLQA 3IUBA 4FTWA 3RHFA 3STXA 2WF9A 1SXJB 3FAZA 2Q3LA 1EQUA 3QSYA 3NVKI 2HXSA 3ECCA 4IF4A 2R44A 5LLSA 3O1HB 2PLNA 2QL5A 3BDAA 3LBAA 1KMHB 1FP6A 1YK0A 5F3WB 4CG0A 2ZAGA 1NU6A 1ORRA 4FW9A 1GYQA 3K8ZA 1GPMA 4NNPA 4KNYA 5KJCA 4R6XA 3R3UA 2VCYA 1E1RA 5CH8A 4LSMA 1KJZA 5AI8A 1INLA 5KHOC 1JYEA 1YUMA 4INJA 3HKDB 3MD0A 3K96A 1FXUA 4JHXA 2PS3A 4UDOA 1NJSA 4BO2A 1Q57A 5CFNA 5IK2D 3F73A 1ATIA 1I4EB 1TU3A 2OZPA 2MHCA 2X2PA 4JC8A 1J7KA 4JB0A 4OI4A 3TTSA 1G5IA 1H2FA 4LEIA 4XKJA 3W5DA 2VYND 1NNSA 1MO2A 4CIWA 1GRNA 3QV2A 4IG4A 5IN5A 3S70A 1U1DA 2AN4A 1OUMA 3QWHA 2YWBA 2O4CA 3OPNA 1F4VA 1ZGGA 3ZGZA 1PYDA 3FJOA 3CUKA 5JMWA 3DXFA 2HCBA 5FOTA 5EIWA 1UXJA 2ZJ3A 4ZIRA 1DVRA 1NXSA 1VIVA 4D6YA 1QGAA 2YWFA 4KN5A 3W3AD 3HBFA 1Y3IA 4CMGA 1Y3BE 1C9EA 3PKZA 4CJXA 4WXHA 4D4JA 4RV4A 2WC1A 3GW8A 4HX9A 1UMDA 2WYWA 2XQJA 4HDMB 4XWYA 4DGSA 3HG7A 4I1IA 4II2A 1FMCA 2VJCA 5K8TA 1P0QA 3RW9A 1ILEA 1AZWA 1B16A 4XR4A 2GRJA 4KU4A 1I36A 2A3NA 4RS3A 4ZVOA 1N5JA 1ZD8A 4EABA 2QV0A 5JTTA 5C7OO 1IK4A 1E3WB 4D26A 1XZPA 3BERA 5JTUA 1DBRA 4LDRA 3VZDA 2XVZA 2ON6A 4EVQA 1PI3A 3IAUA 3PVZA 1QFZA 4CNBA 5E6RB 2CNBA 4AY6A 1YVDA 1UK8A 2HMTA 4R4JA 3O0TA 3PUYA 3GAFA 4PPQA 1JIJA 4NDNE 1FQOA 1RBYA 2Z2ZA 4Q37A 1IJFA 2PKWA 1O9BA 3G82C 2D5AA 3O1IC 5E6SA 4B6JA 4D92A 4EPWA 3T1TA 1OFIA 2O50A 4M6WB 1RWBA 3VZRA 3ZE0B 3MGAA 4JFAA 3CN9A 4ZI7B 1B0UA 4ZKDA 2DWOA 1OY1A 2H08A 3BL8A 4MINA 3ZXSA 4Z7OB 2HDHA 2CE7A 2ZBUA 4ZDJA 4AO6A 1L4EA 3EWIA 2ZE5A 1SKQA 2IX3A 1GLNA 4Y2JA 4EELA 3FFBA 4LSWA 4GKAA 4C76A 1RWOA 1C3OB 1UDWA 1F6WA 2OO3A 1ZICA 3C6ZA 2JEYA 1EEHA 4AJ4A 3SX4A 3KVOA 3UUFA 3RUIA 4C7XA 5F73A 4G97A 3P0FA 2V7TA 2VA9A 2PCLA 4FYHA 3ZEAA 1ACMA 1W4ZA 4IWYA 2WSBA 4TT3A 2VIIA 1THGA 4TL6A 1MVNA 3QYPA 4AVYA 1XC7A 1GUBA 2WVGA 3EX7C 4JQZA 4A5SA 4FHGA 1P3DA 2BMEA 3CRNA 3CZ4A 2WYOA 3IDSA 4X1IA 4BN0A 5C8DA 5JNTA 4BFTA 1WDKA 2F8MA 2OC4A 2FN8A 3HA5A 1BHQ1 2JD1A 2OPBA 1XEXB 3IOBA 3P2KA 1JAXA 4KEAA 4RHXA 3WLIA 4DLLA 4F38A 4YV2A 1W4RA 1HLGA 2XCTB 2Z6VA 1P5HA 4PQRA 1XR3A 4MW2A 2QG4A 3WLQA 2C8LA 2WWHA 5DM1A 3BRSA 5BXYA 1VECA 4UCXA 4Z4CA 1I24A 1O9GA 5D3ZA 2YJTD 2DWCA 1AHHA 4IJQA 4YCCA 4J1TC 4BX3A 1BVUA 1HDCA 3FGZA 2R00A 2BI7A 2C5AA 1VBMA 5K20A 1ZONA 3U0BA 1P2SA 2NNWB 4Y6SA 1KMCA 2IIBA 1P3Y1 4ARSA 3HM9A 1ISRA 2GO1A 4NU6A 2SKEA 1Y5NA 3EC7A 4HDRA 3X1DA 1DFIA 4LZOA 5AKXA 2GLTA 1L0BA 4J90A 2RC5A 3RANA 5JR3A 5FPSA 5JJLA 3VYTB 5JFOA 1BXKA 4CMEC 4I1YA 1Z8FA 3ZY3A 1H93A 3WQBA 4F1JA 2HCFA 3TSWA 3CISA 1FSSA 1BS2A 5EQJB 5CB6A 1GXSB 3O1JC 3G59A 2YJ4A 4XYGA 2HXYA 1B76A 1MJ5A 2H2DA 4QHSA 1N8SA 1E62A 2GLXA 2GVNA 2H0QA 2WTXA 3H7AA 4QHYA 5EMMA 1S2OA 3OQ1A 3SC4A 2YDXA 2H4FA 2RGCA 5EP4A 3L7KA 2AC7A 2Z43A 2HTEA 3A3NA 4YLGA 2ZBQA 2ZXUA 1YL7A 2VHEA 3SK0A 1ODSA 1WXQA 4GXNA 1WZNA 4I4IA 4QEDA 5CA1F 4N54A 5D3MB 2J3DA 1WDTA 3GC6A 4FYXA 4QEKA 5C8ZA 2W71A 1RBMA 4RJLA 2FWPA 2BL4A 2IEBA 4RVCA 3TPZA 4J43A 3TM5A 5EMLA 4LRSB 5GM2A 2F48A 1CUCA 2YXLA 1V5WA 2ZWVA 4MV6A 1PGOA 1ODCA 1U7DA 2ZRFA 4XGQA 1TMYA 4X92A 5BSRA 5JS1A 2O2EA 1QO7A 1T9ZA 3DKRA 1VB5A 2ZYSA 1EVQA 4KFCA 3P8ZA 3TB4A 1MFZA 1KZYC 2X0RA 4GR5A 5AM4A 5HE9A 5IAGA 4RYLA 1AK1A 3I04M 3FUUA 3GBPA 3INYA 3T0IA 3OX2A 2ZI4A 5TQ0A 4DCUA 3EVFA 3FR7A 2COEA 3LKDA 4E08A 4LOLA 2Q27A 3DHEA 3G1TA 3KDPA 1NY6A 4JUCA 1XMXA 1EDZA 2CSUA 1SCNE 1D7OA 1MGPA 5FOVA 3M4ZA 3R0VA 1M75A 5JSZA 4YRFA 4F8EA 1PT7A 4KR3A 4L27A 1I3LA 2DBRA 3KX2A 3BD9A 1Y8QA 1JX6A 2HLPA 3TOZA 3SBEA 2XB4A 1QGOA 1VPVA 2FSGA 4X1YB 3JW8A 3KQWA 4ZCRA 1ZU4A 4G0ZA 4LQ4A 4RY0A 1ZIOA 3W5IA 1CRQA 2QTWB 4L5AA 4S35A 4CCWA 1TUEA 1QVVA 4JEUA 4PPNA 3MEQA 5EEGA 4WBNA 2PBLA 4P4NA 3FVWA 4GZLA 1H1LB 2W43A 4LNUB 4JU8A 2A4MA 3PLRA 3SEAA 5INTA 5HCIA 2EW2A 1BYUA 4FDAA 3GLIE 2W42A 3GN2A 1TQDA 4JT8A 4PZDA 1OHHA 3TTUA 4Z0TA 3DXXA 3QE2A 1QC5A 2E49A 2JFNA 3AB7A 3OZBA 4EAAA 4HNTA 3TI7A 3CUWA 3U19A 5B7GA 1NT4A 2ZSFA 1BXZA 1W46A 2NUTA 4MUFA 3HEAA 2PWYA 3RAGA 3EIXA 3TIIA 1A8QA 2P4HX 1XQWA 1O1YA 3ONDA 2P69A 3M4YA 3O8CA 4F46A 2XNJA 4DR6B 5I7OA 1BN7A 4NULA 2NYVA 3MW8A 1JZSA 5NULA 4BAGA 3B70A 1KJYA 4HZUB 1HDIA 1WX1A 3PX3A 3Q0IA 4I4NA 2X13A 3DQZA 4IWNA 3RE1A 5FI1B 2OK7A 5K8JB 4Y1RB 4ICIA 3E70C 4MDHA 3QEMB 2TMDA 4ABYA 5IM5A 3G68A 3EZXA 4I55F 5LP6F 1VE1A 1U7PA 3MWJA 5LP1A 4FGWA 4BE4A 1W4CA 4O2AB 2ZRKA 4FMBB 3EMDA 4M53A 1BCRB 3P9IA 4LHWA 1K6MA 4BMOB 5CVVA 3TD6A 3BXXA 3Q9LA 3PG5A 1OI3A 3FPFA 4JL6A 3B2NA 4B3HA 4ZTUB 3C5HA 3K6KA 5EXDA 2WTMA 1PLLA 4ZOQI 3E9DA 3PNVA 4GE0A 4JWKA 3D9QX 3EHEA 1CEXA 3WL5A 1L4GA 2I8LA 1UCFA 3BZBA 3ZCRA 2JJ2D 1XEAA 2X0IA 3ISJA 4RPLA 4AC9A 2O8CB 2O20A 2E6UX 1SCBA 1D6NA 3D8BA 5ED0A 1GG9A 4YYZA 2Z6AA 3MBKA 3MWEB 1CUZA 2KSQA 1QHNA 3H8JA 1UJ6A 4FYKA 4N3CA 1QO0A 2OAP1 2B4KA 3NW9A 2CL6X 2WK1A 2AEMA 4QPPA 3VR3A 3WK5A 4TVOA 4EFKA 2XX3A 2VHVA 5F64A 5BMVA 4UARA 1EJ0A 1QKJA 4FFRA 3D4OA 4GYWA 4JB3A 1ZD5A 3I37X 1MU0A 4Y1FA 4X20B 4QOIA 4AKEA 3CZ9A 1NKSA 4JCOA 1NBHA 4HN4B 2YC4C 3FKJA 3FNFA 4KYIB 5I9NA 2JFQA 3N39C 1EIWA 4LVUA 1NP6A 1GDDA 3A6FA 3VX4A 5KOYA 4NZZA 3ZIUA 5B3KA 4LJ7A 4LJSA 4BV8A 2Q6VA 1AKUA 1B8OA 1KI7A 2GX6A 2XRMA 4K6KA 2X5KO 2DCUA 2XE8A 3F9CA 2VYVD 4BZPA 5CA0F 4LI3X 2OVBA 4JZYA 3D8SA 5BN5A 4FMCF 5FA6A 3ZY2A 3FTEA 3GDWA 4X64B 2VJMA 3OUUA 3ODGA 1HR0B 1M2JA 4M9CA 4TZTA 3ETDA 3TL3A 1FJ2A 1FB5A 2B21A 2DQSA 3L7YA 5EJ6A 5EKUA 1V1MB 1Z7BA 1LV7A 2Q49A 3AEUB 1R50A 4MWGA 5T67A 4FYIA 3QW4B 4DMFA 4HMQA 1CUXA 1R3UA 1E8DA 3C16C 3NTQA 4G36A 4D9GA 4EG6A 1KQOA 2C2XA 4N40A 4I46A 5JIBA 1Z6XA 2XUDA 2CHGA 1NURA 5ICGA 2ODQA 2OHXA 2WNIA 4BZXA 3L1HA 4YRJA 1I7NA 5JXIA 5JZ9A 1TAUA 2JS7A 1O0BA 1ORIA 1U99A 5K3SA 3ZHOA 3SZ3A 1USUA 4EP1A 1GN9A 2XMSA 2EFHB 2NAFA 4QYWA 3HCCA 3F5MA 3JD1A 1WWKA 2JVJA 2AT1A 5BR7A 3EPJA 1UXGA 2BIFA 4OSOA 4X00A 3TX2A 4AJNA 2PEYA 1KC3A 5DBFA 2OILA 4BU0A 2DH5A 3OLXA 1TTPB 4BQEA 4E31A 2KWIA 3G8YA 4ISCA 5FI5A 5LJIA 1PLKA 4C4XA 3ZWDA 5IEJA 3THYB 4LOHA 5EWLA 3LLMA 4QUIA 1CY6A 4JGGA 3WLSA 2LGJA 2H1WA 2C4TA 2DX7A 2YJNA 2INGX 5JDCC 4DLNA 3LH5A 5C3MA 1P81A 1WUHS 2ZI3A 1ZCBA 3S6JA 2BISA 3HXTA 4ZQGA 3DAOA 4UBKA 3V4PB 3WJ7A 1SKMA 3DMYA 4L4RA 1GJRA 1JS1X 1IY2A 2PGDA 1RXSA 3G23A 3LKBA 1NQTA 4CM3A 3AP2A 3EIHA 3N5CA 4PONA 1QANA 1MCZA 1N5LA 3N6VA 2FXIA 3W3AH 3EVCA 1ZZEA 3NM5A 4HZGA 4LTDA 2JLUA 4D4LA 1EXMA 1JG4A 2I34A 3N87A 4B7AA 3N2KB 5B64A 5JQGF 3IQEA 3CNHA 5DBIA 4B0PA 4WCFA 3PQ2A 1AMOA 4WLVA 1YZHA 1SUCA 3NC1C 1V7CA 3NAGA 4TVBA 3ZV5A 3R4VA 2N9UA 2ZS7A 3KHKA 1IN1A 3BZUA 3QVKA 4QAJA 1RYZA 4RO0A 5AHRA 5AJHA 4F97A 5LDHA 2I6GA 3WK7A 4W8GA 1SVMA 1Z35A 2PSFA 1A2QA 4PLGA 4MDFA 2B82A 1TCAA 1TA9A 4IG9A 2A0YA 2RHHA 2JCGA 3ZGLA 3EG9B 3LQ1A 2EFCB 2DHQA 2OM6A 2WJPA 4Y8VA 5TR9A 1NP7A 4DF3A 3DBLB 4IZHA 4Q66C 2ENUA 2GAAA 1S1CA 2D8AA 2FEPA 2Q1WA 3QPVA 4JH0A 4TWRA 2EVWX 1UOOA 2QIPA 1G21A 1TW3A 2FCRA 4JNKA 4JJKA 4KJZA 3G5AA 3DKIA 1JJBA 2Q5JA 4MR8B 4G67A 4XCXA 1PR9A 2MSWA 3S1AB 3ZW8A 4D56A 4LIPD 3PNKA 1CB7A 4XE5A 5DV9A 1KXJA 1Z5OA 4C4YA 2D74A 2G6BA 4LVOA 1Y3CE 1QH8A 3WLRA 4B3RB 1JEAA 1TPZA 4A10A 3VBCA 3U7GA 3LCUA 1T9BA 1AS3A 1B15A 1RFGE 4M1KA 1F0PA 1UL1X 3DEAA 2HMVA 2X0JA 1YQWA 2G0TA 5EHQA 1ZJWA 4KQKA 2QNRA 2HZBA 1C8KA 1JALA 2BMDA 4OQDA 1ENOA 2LTAA 3IBGA 1JSLA 4RK5A 5FH9A 4KBYA 2JAQA 1L5YA 5IJ9A 2WJ3A 3RTEA 4XDZA 3B52X 4AECA 3I9OA 3OCCA 4ZEXA 3T9EA 1N4AA 4LHSA 2D0PB 3ILHA 1WABA 5JANA 2DEUA 1HOTA 3Q4GA 5KSPA 4KR9A 5IJZA 2JGRA 4YJ3F 4CIBA 3KWMA 3BG5A 3AJ9A 4IAOA 3IJPA 3P2JA 5C35A 2J59A 4Z3DA 3TW0A 3ETNA 4I5DA 3UV7A 1E2GA 5D84A 4CMHA 1VGVA 2WQ7A 4BBAA 4G0VA 1S9HA 4BQPA 2E1RA 4WACA 3H5LA 5LD2C 3PC8A 4QBFA 3AL3A 3D2BA 5KC8A 3KETA 4ND8A 3P9YA 4L08A 2R1VB 5AHXA 4JSTA 4KOAA 1G8KA 3S40A 721PA 4FHDA 3OCUA 5JRDS 4UTPA 1V3TA 1NW7A 3CY6A 1YBFA 4BJ1A 4E7OA 5JAOA 1WCV1 3P1JA 121PA 3IDAA 4HEQA 2XXBA 4Q9AA 3RQSA 5CDSA 2I66A 5CAEB 3T7EA 2Q3DA 5KSWB 1G16A 4CEJA 1QMPA 2JJYA 1BWQA 4DDVA 5KQPA 1W75A 2XSZD 3DNFA 1XQ6A 1G6KA 4GMGA 4HQ0A 1P5RA 1AXRA 3GGCA 3B60A 3LT5A 3NH6A 3RSFA 2B6NA 1YJCA 5JZBA 1V9CA 1XJ0A 1XJQA 2W22A 4DLKA 1K0FA 3EWSA 3FPJA 3A8TA 4KAXA 3TX6A 3ILVA 2ILVA 1OZHA 4BQSA 2FE1A 3DW3X 3EGDB 3MPOA 4RJJA 1MB2A 4QTYA 2GM4A 2FWMX 4ANFA 3OZCA 2H06A 3H5RA 3DFUA 3I05A 5IUJC 1XN4A 2D2VA 4CKCA 2GPYA 3UK6A 1OT5A 1N2CB 4M0FA 5BR8B 2JC3A 3UKOA 1KKUA 2J48A 5FNVA 2C3UA 3GOQA 3QLUC 3ZH9B 1SM4A 2IHZA 1PDWA 5J43A 3VV3A 3ZDBA 2Q7DA 3OU7A 3X1JA 4MWOA 3N6RA 4FN4A 4LDAA 2ZRDA 3DTTA 4HWOA 5GV8A 2PWPA 3U0VA 3F5QA 1IE3A 4EEZA 1PNOA 1BEZA 1T6YA 3F98A 5CEEA 4B5KA 2OGZA 4CV1A 1N6LA 1G6OA 1P73A 1TKAA 3ABOB 4YONB 1U8XX 4EATA 2O3TA 4Y9DA 1ZN9A 1W93A 4ZXPA 1ZVVA 1V3VA 1LJUA 3SQDA 5WRFA 4WKBA 3GJYA 1NA5A 2VHXA 2I2WA 1N6HA 2C99A 4DIFA 3MTBA 4ZI5A 1E2DA 2P77A 1B93A 2ZJ6A 5EE0A 2D2FA 1CUIA 2D3TA 5EQDA 1F2DA 4IDHA 1UC4B 5K2OA 3QU7A 4ZV7A 4V0OA 4AF6A 4BVKA 5SY9A 2IHJA 1IZ0A 3SJCA 2AN1A 2V5AA 1KRWA 2GFIA 2HUPA 1T29A 2FSUA 3S0JA 5F2OA 3IDFA 3DOUA 1CE8B 2C1XA 2F1HA 3C7CB 2CWWA 2D06A 2R1TA 3E27A 3M82A 1AIPA 3IP8A 1YRBA 2W9XA 3JQFC 1NG1A 4L57A 4LZZA 2DHEA 1E6EA 2QQ5A 3MMPA 1R64A 3LPAA 4MRRA 3LG2A 3EEIA 5DHAA 3LWZA 4DLUA 3AOEC 2IX9A 4EB8A 4PZLA 3BF7A 5EWJA 1CP2A 4MYTA 1YK1A 3KQMA 4L75A 3G0DA 4K88A 5EZQA 5IAAA 2CJXA 3AWIA 1IZ7A 3NYWA 3PRHA 2QD4A 3ZE8A 2ZRBA 1NBMA 4RM3A 3ITNA 2OR3A 2Y77A 4LBZA 4P4SA 2FJUA 3ER6A 3JR7A 1G59A 1KK2A 1HFJA 2E82A 5L95A 1W76A 2SBTA 3GD5A 3KHTA 5ULLA 3UOAB 3QEAZ 1PQUA 4D9BA 1VIYA 5HIKA 1VI5A 1N0VC 1XPOA 1JHRA 3SYKA 3CX6A 4DUYB 1SHZA 1YS7A 3D2CA 3I2GA 2IH2A 3B6IA 1PX2A 3JYPA 3CLSC 5JD3A 3SNHA 3OSUA 3G6WA 3PPYA 4FHEA 4XUGB 4K6MA 2JL1A 1PJSA 1G20B 4X1KB 5C4IA 1NC1A 1Y80A 2JBAA 4ENTA 5DSZA 3H75A 5HRAA 3HNRA 1VP3A 5FLXA 5JSKA 4XYLA 3MJVA 1DP4A 5JAZA 1Y7PA 4O33A 5GONA 3PUZA 1K3TA 1Z7GA 5CNKA 4I81A 5ALPA 5K3EA 4LF8B 1CS0B 2G5PA 2FRVA 4N3BA 2JLQA 4N9WA 1YDMA 1CVRA 3DYVA 1GO2A 5L7YA 1UZLA 1XX6A 4MTLA 1MENA 5CB4A 4QBTA 3LP8A 3ZDZB 2V7QA 3M6XA 4KUHA 3ZH2A 1G17A 5I9LA 2X7XA 5ARDA 2WHQA 4F4DA 5M2QA 2JHAA 2HWKA 3TMAA 1XZBA 2IH5A 4GBED 1XA0A 5DKFA 1KYVA 4N82A 1IPFA 5JJKA 3ZDEA 2O0MA 4MLZA 2YYZA 3QUTA 4L4ZA 5TS3A 3MIZA 1ICEA 1AHIA 2GCOA 3LBFA 3N8GA 4K86A 4D9NA 4G5FA 5JD5A 3GROA 3G2MA 2UVQA 5LA6B 3M4XA 3G9TA 3R24A 4GC5A 4QVGA 1E1CB 3HVHA 5E4JA 2XMPA 2H2WA 2R48A 4I1UA 2PJRA 3T8YA 4CM5A 2B8JA 1X7ZB 3DMTA 1S02A 2O5RA 2X5XA 4KO2S 4KX5A 4Y2PA 5GOTA 3UENA 3W8FA 4XH9B 3ONEA 1SZCA 2FEAA 1Z0IA 4GM0A 4HWPA 5CITA 4HGNA 1IH8A 3V42A 5F4BA 2A59A 2PA0A 4A16A 1SUSA 1O4WA 3NV9A 3QK7A 1L6IA 2WV9A 2AR7A 1BQ3A 1VHWA 3S28A 2QYSA 2WKWA 2VDRB 3QVMA 3ZDRA 1GZ7A 2YHIA 5FUBA 2NT3A 1M1NA 2D6FA 2CLMB 2H4YA 3TWOA 2LZ0A 1OVMA 1MB9A 3ZK7A 2HRRA 5CNMA 1U3VA 4J1NA 4U2FA 3R3XA 5EKDA 3V4SA 5C8YB 1DWQA 5JSHA 1TU0A 1Z6QA 3O9ZA 5CX4A 5CB0A 4JT2A 1RLMA 3K15A 1A2BA 2CWDA 2L42A 2ZULA 4LXGA 4H3SA 4X90A 4ZK6A 1QOPB 3CF4G 2V65A 4B17A 1AGXA 1LSUA 1WTCA 4HQOA 4J6EA 1B8VA 1ONPA 1V48A 1N2XA 1Q95A 2X0KA 2GK7A 3KAPA 3TS1A 3AEQA 1RI2A 3CBGA 3F6BX 4E5YA 2CJYA 4R1PA 2UYYA 3FUWA 3BZWA 3I64A 2O05A 4ZJZA 2A94A 2YFYA 2JFZA 4EA6A 2P9CA 5C5EA 3PDHA 2XZOA 2HNBA 3HUTA 4L9SA 4B83A 1BA2A 4KQHA 4RIIA 1ZN7A 2EDCA 1RQXA 4YT5A 1J2EA 1DU4A 1EFHA 1OREA 1Q17A 3MJFA 1NUHA 3N2YA 1XL0A 4Q15A 4B2IA 2J67A 2NVUB 3H4MA 5D87A 1XPUA 3AXTA 3VA7A 2WAAA 4KGVA 2IOFA 4RQUA 4BAUA 5I51A 2XT0A 4TLDA 1E9SA 3WNBA 3G9QA 3HACA 1WP9A 5KYUB 1Y7IA 2RI6A 2QJTA 4JBGA 3P9CA 4MKGA 1ODJA 1K75A 3EF1A 2ZBRA 2JIPA 1FQWA 1KP3A 4M8NE 1D1TA 4U6QA 1QWSA 2QVBA 4ZOCA 1WZEA 1YQEA 2X6QA 5KX5B 2PUAA 3RRBA 4YJDA 1VTKA 3ZGOA 3A3YA 1JHZA 1X2EA 3QBVA 2QNIA 3I8XA 4R8RA 4WBXC 5AKEA 1ZOIA 3VX3A 3VR0A 3F6EX 4E6PA 4EGJA 1AQNA 1XRNA 2SCUA 3BWDD 3CJTA 4PAQA 4JA0A 2XUAA 1I7QB 5A3JA 3R41A 3H0CA 1A8HA 4XAQA 4GL2A 1EK5A 2IH4A 2C29D 3WIBA 5DHRA 1U80A 4MS4B 1NMZA 1N75A 1QIEA 4E22A 4KTVE 1FU4A 5IDWA 2HF2A 3IAM1 1N7JA 2EFYA 5IF3A 1DJNA 3L43A 1VE3A 3V4VB 3ZVRA 4O2BF 1E2PA 5FYQA 3W2EA 4B6GA 1PFQA 2YOHA 3FOCA 1FS4A 1I7SB 4ZYLA 1ND6A 1U0NA 3EIEA 3O1LA 2AG1A 4ZOLB 3IURA 2QQ0A 2XDYA 1P3JA 1Z8HA 3LVFO 4F9TA 4JS0A 4NMMA 4K26A 1L8QA 2YZ7A 4PAMA 1G64A 3BCSA 1EJ6A 2OHHA 2QAJA 3DOHA 1CRLA 1TGVA 1BKDR 3QVGB 4WRRA 4XLLA 2WVHA 3VU8A 4BJ6A 1XRRA 1BFDA 4PE5B 3RT7A 4RE5A 1H5QA 2DWUA 3G8BA 1Q6ZA 3QVXA 4NMLA 2ZVQX 2CD9A 4RHUA 4YA6A 1IWOA 2GBPA 5DGIA 2FWBA 4GPIB 3J80A 2LIPA 3BL5A 3F67A 3LDGA 1MB4A 1QCCA 1QYRA 1V1RB 4GUDA 4EAQA 5LXTF 4R9UC 1DZIA 6AT1A 2EHDA 3KZKA 3T61A 2ZTUA 3THSA 2WP0A 3U7IA 1U6KA 1IVSA 1WY5A 2YZGA 3E82A 3ESZA 1UC5B 1W85B 4KMRA 1F5SA 2O0KA 3S2IA 4DA8A 1QORA 1JDVA 3WY9A 5BT8A 3I6BA 3V1LA 4E15A 1KO7A 3H2ZA 1W88A 3RASA 4EG8A 4XJXA 2IEAA 2BFEA 2IODA 4GI3A 1W4LA 4H31A 4F3TA 1EP3B 1QHHA 3VNRA 1N5DA 1TMOA 4CTKA 1U98A 3E7PA 4NH0A 4V39A 1QLJA 3OI7A 1AUOA 1YZVA 5CU7A 4PLTA 3WQSB 3N0RA 4GX5A 1XKXA 4Y9TA 4RABA 3NHSA 1RWKA 2W6PA 3CBQA 2YFKA 2FPIA 4G0MA 1JU9A 3R6DA 2PZJA 3VYVA 5K8LA 3DKPA 3AR3A 4XIJA 5IKPA 3NH9A 1XAHA 1CJVC 5EP3A 2BZSA 1U5CA 2AWNA 3DT8A 4G89A 1GRVA 4LXUA 2E5WA 5C32A 3GEHA 2QRLA 2CHUA 3CLKA 3K30A 2OCGA 3F90A 1M6VA 3IPCA 4KNWA 3KM0A 1E2JA 2QUKA 4BIIA 2O07A 3B3AA 1Q1EA 2REBA 1PIWA 3R6TA 4IIJB 2FK8A 4LXYA 3X44A 2XTMA 3PFNA 1JG3A 5E3IA 1KORA 4NEGA 5B1YA 4G0QA 1X86B 4YMIA 4RPJA 4ZOLA 4YP5A 3L7OA 2QTVA 3A04A 5EJEA 3WISA 3H9QA 4S24A 2B5VA 2A35A 3LUKA 3U1VA 2QAGC 4YMUA 4ZVUA 4I9GA 2NXEA 1COZA 1QJ4A 3DF9A 1XQVA 2DUUA 3F6PA 3UT6A 2HW8A 1H3EA 3KJNA 3LF2A 3JALA 4OQFA 2JGLA 3E1KA 1K7XB 2VTDA 4C01A 1R8YA 3CR7A 4QOEA 5E8JA 5CLIA 4KVAA 3V48A 1MG5A 4H4CA 1IONA 4WOBA 4CCYB 1E20A 4MZXA 5BMOA 1GZ5A 2ZJ7A 4O4IB 4X8HA 5KVVA 2DETA 1K7YA 2X1LA 4OEHA 3GFRA 4PWZA 4BZQA 4N48A 4Y6QA 4HNRA 2B92A 3D6VA 3FF4A 3KYDA 4HSEA 2EBHX 3GLHA 4MS1A 1B3BA 1XWIA 3N7TA 4JP2A 1HORA 1V5EA 1JTEA 2P35A 2IZOA 4LZPA 4WZBB 4EG0A 1QCZA 3DULA 4G2NA 1LI7A 3ZHUA 4TV8B 3CNEA 2J0UB 1DOAA 1FOEB 2MINB 2O52A 3L3BA 4OBXA 1EIZA 1M1UA 3L0SA 3NLLA 3KT0A 5CDYA 2CV0A 2AQKA 1PYOA 1R88A 2NZYA 4I5EA 4KO3S 2PLFA 3OWXA 3WGYA 1WQ1R 1E3TA 4OX9B 1AURA 4IFTA 4YXFA 5GADl 4FWTA 3OCYA 3FETA 1C29B 1Y89A 5GJCA 3CUUA 3WDSA 4HVAA 4DUPA 2VF2A 1A77A 5JBQA 2OO7A 4MK4A 1XL1A 5J47A 1R0WA 4UPEA 1WVMA 2J32A 2L69A 4FCTA 3TQFA 4AQ7A 4NK5A 4XFKA 5J2TA 4E21A 3D0QA 5K3FB 2FZLA 2QY6A 2IBTA 2FP4B 3ICEA 2RB5A 1GNPA 4EKDA 1U3WA 2JFHA 3RUEA 3BICA 4JDUA 4B48A 4ZMBA 1UKCA 4C21A 4KRYA 2AFIB 1RLIA 2J9GA 5F7ZA 1TVMA 5JUWA 4NQRA 4Y98A 2WAXA 4NYMQ 3U4HA 4RU1A 1USGA 1W2HA 2HEGA 4HNQA 4WK6A 1KRHA 3VKWA 1C7ZA 2R8XA 4RE6A 1GL7A 4ZV9A 2JANA 1BJKA 3SZUA 1MIOB 1FYFA 3RSHA 2I6UA 1E3MA 4Q3BA 4YS6A 3CWCA 4X61A 2G04A 4EFNA 5FBWB 1PJ4A 3IQFA 3SQLA 4B6RA 2JIMA 3BFVA 4BQQA 1M73E 2AZTA 1VM6A 2WSSD 1GFSA 1SPXA 1K7EB 2BR5A 2YXPX 3A1EA 4AY3A 4EENA 4KITB 2YRWA 3CVVA 3PXXA 2ZSIA 2JGJA 3RC7A 2RJNA 1T5BA 1WMSA 1YCGA 1X1QA 3MS7A 2CNWD 4HQRA 4MR7B 4WBSA 3PFIA 3HA3A 2EARA 2YIJA 5D01A 2R4TA 1SU6A 1LBIA 3DEFA 1RYFA 1FDIA 3G3EA 3HDTA 3EGWA 4RGVA 1PR0A 3QG5A 5K5EA 1IG3A 3BJEA 3KTFA 3DDSA 2XRZA 4DILA 3KDAA 3B82A 4Y30A 2AUNA 5JCXA 1K7SN 1QKIA 2VP2A 3O90A 2HB6A 2HA0A 4FFBB 3SHTA 2HSZA 2VP3A 4BEWA 3DT9A 1IBRA 2V98A 1XZEA 4BJ5A 2XRYA 2GDJA 2NV6A 1FU7A 4C30A 2HDOA 5JZMA 3L0OA 2Q5IA 4NFYA 1QGYA 3ZI4A 1DV2A 1NW9B 3ESYA 4BLRA 3G0CA 2YVUA 2ZUEA 2BVNA 5B53A 4Z0PA 3STTA 2PWZA 1ZK2A 2YJ3A 4Z7JA 1H85A 1N7GA 3EZNA 5H4GA 1QLWA 1R6VA 4GEGA 4RLHA 4DMGA 4DA4A 4OOEA 2EEPA 4DE5A 3KE8A 3A0RB 1TZKA 3DZFA 3GGJA 1ABEA 2GA9A 2YY6A 3OZTA 4N18A 4Q9NA 2I91A 2VYCA 1YKGA 4NYIR 2YRFA 4C89A 2FE4A 3U17A 4HDNA 3DZKA 4JXKA 2PX3A 3DE6X 4KKXB 3KYCA 3S2FA 2NMVA 1L5FA 1ISMA 4P7JA 2LUOA 3HFJA 2A0KA 1JJ7A 5AM5A 2A0XA 1Y3FE 4PPFA 2VT2A 3KQSA 1KI9A 4LRYA 3A9SA 3KNZA 1Q91A 3GMTA 3HBAA 4J7CA 2APJA 4KLZA 4KV7A 2F3QA 5H3LA 3WBJA 2XYQA 4KXLA 4L1KA 3DZIA 3OCJA 2I7TA 3MRVA 3IXQA 1ZXXA 3JYNA 3EFOA 4NH4A 3ERCA 2X8LA 3LKVA 2ZT5A 2VZ0A 1FSFA 2EATA 3C1AA 1OBOA 5K6AA 4OQLA 1DIOB 4ZI7F 3OPYA 1A5TA 1UBLS 4M1MA 1XSEA 1XHLA 4ZVTA 4JEHA 4Q16A 4E5DA 1UKZA 3PEFA 4KE7A 4LJ8A 2J5RA 3TR5A 5DLPA 5HGXA 5B1SA 1KZGB 1ZH6A 1R74A 2G76A 3H1AA 1UR5A 1R0KA 2J09A 3E22A 1SH7A 4FEGA 2IITA 4IRMA 2XNSA 2FSSA 1TDJA 2L17A 5AJTA 3KVYA 4CQJA 3R0ZA 4C5BA 2VBFA 2QQGA 2Y05A 1J8FA 1F8YA 2E7ZA 1FVOA 3U7EB 1M7GA 1IPHA 1NF8A 1Q14A 1DRKA 1VLJA 2C96A 3K73O 4IO0A 4MVJF 4NOMA 2J46A 3NOQA 2ZYRA 3EGXB 3N0VA 1TF5A 3TW4A 2G09A 3CR8A 4GMXA 3ZWQA 5CCXA 3GLGE 1BSVA 1ISJA 5JYDA 2FHPA 4OLBA 2FV8A 3EEOA 2IZ7A 2PT9A 2JJ1A 2QVCA 1GZVA 1XKLA 2CK3D 4PQYA 4PZPA 2BFPA 2HMSA 3KWFA 4WADA 1AQUA 5EYPB 3WGKA 2IXTA 4F0JA 1V11B 4KSBA 1MZPA 3G2KA 1W0CA 3FGPA 4CMJA 5LWHA 1GL3A 4MWDA 4K9MA 2UYHA 4B43A 1VYUA 1JHYA 3K5PA 5G3ZA 3FBTA 4QYXA 3U6BA 2QM3A 1FFBA 3A2NA 1ONOA 1SBTA 2C59A 4Z9FA 1RC0A 3PXEA 2XBUA 2KLBA 3HCPA 1YJAA 1GGMA 3W2FA 3FPCA 2JK1A 1KI6A 4V0RA 3EC2A 3FJYA 2Q9CA 2W6QA 4OP3A 2ZROA 4U2EA 4WFKA 1FSPA 2PV0A 3MSXA 3THWB 2E4YA 2WG2A 4HATA 3IEVA 1RPZA 3H2SA 1ZAYA 1T2DA 4DBZA 3I3OA 4RULA 1I8TA 3AEXA 3E1SA 2CB9A 4DZZA 1TYZA 2CN1A 3SKXA 4IMIB 1D4AA 2BFDB 1Z45A 4GDMA 1Z47A 4O5AA 3RU3A 2YMLA 5AHOA 4JJIA 2G7MC 1N25A 3HYRA 4YYEA 1MN6A 3ZKWA 3TTYA 3CRMA 2H7VA 4K7JA 4JI6B 3T4UA 2OHGA 5IDXA 2BDUA 3AH8A 3O4JA 2VLBA 5C5DA 2J0SA 5EVJA 3TAUA 3RS5A 1FRQA 4HDKB 1XD8A 2JGNA 5FBZA 1U0FA 2DY1A 2Q07A 4TL7A 3WIDA 5FBKA 1NMEA 2VHCA 4Z54A 2WMDA 5CA1A 1N2ZA 2X0DA 4B71A 2MU1A 2JLXA 4ARZB 3KK0A 3FVQA 2FOIA 5ALYA 3S2UA 4R7GA 3UT5B 1BMQA 1Y0BA 1JFLA 2BGWA 3L8HA 3RKRA 1GTVA 3O93A 2HH9A 3S55A 5FV7A 1CEQA 3GJ5A 2DLNA 5DDIP 4BN4A 4EUEA 2XUFA 4XQGA 3UA3A 1U63A 2M32A 5DNYB 2RGUA 5FA5A 5HEKA 4CQNA 2IYTA 2YY7A 1JHXA 4JX9A 4MUHA 4HTFB 4R68A 3LMKA 4Q9LA 5BQ3A 1XDDA 4DR3B 2VDWA 3CU5A 4RBNA 2HKIA 3MFYA 2ONJA 5JPDA 1KZ7B 2XMRA 4EMTA 5EJ9A 3D4NA 1K63A 3OF3A 1FSZA 1L1QA 1GIAA 4C7BA 1BFKA 1E6CA 4PSUA 1TYEB 1OH6A 4LDPA 1YF3A 3HLTA 2OLEA 4XD2A 5DK4A 1JILA 5E38A 4ETIA 1OAOA 1KKMA 2G4LA 2G8LA 1D7AA 4DTCA 1GCIA 1KEUA 4NAHA 2RHDA 5MN6A 2FUG6 3UANA 2HQOA 4I50A 3QXCA 4XR9A 1DO8A 3A1TA 4B73A 1ECGA 3FTDA 3H5OA 3NHMA 4KXXA 2YCLA 1S2NA 2XA1A 5EVCA 4CM9A 1MAVA 3RBZA 1RP1A 2JIZD 2BEWB 2BKEA 4JQSA 3W04A 4YCNA 2XMCA 2BY4A 1XA4A 4CMKA 1OXBB 3S5UA 1ZC3A 3AI1A 3GGPA 3KP1A 4KIFA 3IVCA 4FINA 3QHQA 3AR9A 3EEBA 4N7BA 4MQ4A 2FPGB 1UXOA 2L19A 2QTAA 3HFRA 4GT1A 1J1UA 1ULSA 1V16A 2HHAA 2JGDB 4M0CA 3UMBA 1BE8A 4D8UA 5JG7A 4S1OA 4J76A 1HT0A 1NOJA 4ZRMA 1E1MA 4XGIA 1EVJA 1UP6A 2XKAA 4S1NA 3F5FA 1DEAA 1HNNA 1FMTA 1MUUA 6ABPA 2JGFA 1JKJB 2OWEA 4LTNA 1EX1A 1QIDA 1MJGM 1G8PA 1GTZA 2JCYA 3DO5A 3LQ4A 4YIKA 2O7NA 2Q50A 3JQ6A 1LXCA 1B7GO 1T8WA 4Z7NB 4E7PA 5K09A 3E9NA 4G65A 3RUPA 3VC1A 2YL2A 3EXHA 1F2VA 2EWMA 5IMSA 1RKQA 3RRFA 2O2CA 2X14A 2J6HA 3PJEA 4PHHA 1Q7EA 3NKLA 3EPKA 1TEHA 2NZJA 4XD7A 3UB2A 1DUSA 2P30A 3GDGA 1ECBA 4TTPA 4EJ2A 5EL0A 5AYVA 1KOLA 1N6PA 2ZR0A 3QNWA 4A4DA 4POOA 2GD6A 4W5TA 3I39X 1JPVA 4QSMA 1W48A 1P18A 1T36B 2JJQA 4GX2A 5LQKA 1YS9A 2HBZA 2ZUDA 1P7PA 2M6RA 1A69A 1UUFA 4M1OA 1XKTA 5KVAA 4YMSA 1J2TA 3KUCA 4YJGB 1QB7A 4KQEA 4RKWA 5JNSA 1UJCA 4GVPA 4LWOA 2I99A 3O2QB 1H2HA 4QLOA 4WNIA 4BO5A 1IWPB 1Q83A 2QI9F 3DZDA 1XNGA 3FNGA 1YS6A 3FVTA 4NCNA 1BKYA 1V2GA 2WAOA 2ZYTX 4NHOA 2NN3C 5G4KA 3OECA 3AEZA 2ONYA 5IW8A 4BNUA 4D9JA 1KJQA 4CCYA 1VI6A 4CW7A 1MXFA 3K70C 1NNEA 1EXDA 1FX0A 1PWXA 3R7AA 3LLVA 3T3EA 4P3OA 4D82A 1A5BB 1DELA 2D1QA 2GQ0A 2ODAA 4JUIA 2UYOA 4DGQA 1GVNB 1LF0A 1QQ7A 4Z4IA 4A91A 2OHIA 2OBYA 4I4TA 3N3AC 2VAVA 1NTRA 1ES9A 3OTGA 3W2GA 4GOLD 1W6RA 2OORC 1SBNE 3Q0EA 3WO1A 1PE0A 3U7HB 1N2CE 3BWMA 1C1XB 5AOVA 1XMOB 4ZT2A 1I30A 3H2JA 1FC0A 5DTJA 1ACJA 1N2BA 3WWCA 2B36A 1F17A 5HNKA 3ZJYA 3ZI7A 3F2IA 4L16A 2TMYA 3MMSA 4QJIA 3SQMA 3HKEB 3T7RA 2Q1TA 1CBUA 2XHEA 5CA0A 5L3SA 4EWLA 4IVQA 1QF9A 3OLWA 4NMXB 1YOVB 3VDMA 3DO6A 5THQA 4QUGA 1GNRA 2IW3A 2PJUA 1NULA 4UE2A 5FTWA 5IAJA 4EYQA 1QQ6A 1GDHA 5E9WA 2G0NA 1KI3A 2IXDA 2N47A 3TOCA 5FB3A 2BTQB 4OQQA 4ZAFA 1FRVA 2ZJFA 5EUCA 5BSWA 3SPXA 4KUEA 1D03A 3JAKA 5BSFA 1E9RA 1WZUA 3E5MA 2RHBA 3PR1A 4N0MA 2XDQB 1A9YA 4QOSA 4P3NA 1TC2A 2QD5A 4LOKA 4OXXA 4FEAA 1HY3A 4RH0A 3RAJA 1XNJA 2GCIA 4GGPA 5JMTA 5DNWA 5IXJA 1G63A 4JJ4A 4S0XA 2VQDA 4TS4A 5DCYA 2RGBA 3KQLA 6REQA 1SD5A 2GXAA 1NHWA 3E8MA 1TUBA 2E48A 2CVZA 3EMKA 2AF4C 5DZSA 1Z39A 2EF1A 4TSFA 2A67A 2H0RA 3G1UA 3HP4A 4H18A 5B7QA 4TYNA 3IL2A 1CCWA 1A95A 1A9RA 4RPIA 3B89A 4RF3A 4RVSA 5DWQA 2UAGA 4RGQA 5D7NA 1IULA 3A11A 1P5FA 1JKIA 2XJ4A 3N58A 5JOQA 3V6MA 2X9LA 3GQBA 4G84A 4TUYB 1L7OA 2HU2A 4BX0A 1VJRA 1DC3A 3EUFA 5AUPB 4NQZA 3P2MA 5ALZA 3OICA 1OV6A 3DPUA 3GIDA 2BBSA 5B7PA 5BVHB 1IRXA 4CV0A 1QV6A 2GBLC 2VK4A 2G9UA 4CR8A 2ZQYA 5DE3A 2J3IA 3LCCA 3MTGA 5CGQB 3EYAA 4UQPA 3UQYS 2Q41A 2HQBA 2ZRLA 3CT6A 5BV2P 3ZTYA 1X9HA 3H2IA 5KQGA 3GMIA 4KIGA 3DOIA 3QVOA 3DE0X 3DLBA 1YQUA 3COPA 4QUEA 5EWMA 2Q45A 3E5RA 3SQNA 1KSHA 4IHQA 5AO9A 3VPFA 4EI2A 1YS1X 1M0EA 1M76A 1ZM7A 1QYWA 1GQSA 4P4GA 4A8TA 2VP4A 3I2HA 2RGEA 3D3NA 2XF2A 3FNEA 1JIQA 3V80A 4U8GA 3KQTA 4QULA 5CNIA 1O94C 5A4AA 3RAEC 2Z30A 4B3GA 2R6FA 2V7GA 4LQLA 3I72A 4DADA 2UXBB 4W8OA 4C4SA 3RYHA 4WESA 2H3HA 3SDZA 3ZWYA 1EVKA 2YZMA 1S89A 1IQUA 4M98A 3WYEA 2QRVA 3PXDA 1MAUA 2D54A 3L6OO 3N0TA 2HRCA 1A04A 1DLJA 3LUJA 3OKPA 2NU6A 5DIFA 4RVGA 3DYBA 1YIDA 4AP6A 4CM4A 1M2OB 3GEEA 1VG9B 3ECSA 1W36B 5HIJA 4Q9DA 5IMBA 1Z0DA 4PGAA 4IY1A 4OFWA 4P53A 2CXTA 1DIGA 5HMMA 3RSZA 1MQAA 3KV3O 3WGJA 1MEEA 1P1BA 4YO7A 4HI0E 1M10A 1SA0A 2ZYIA 1GHTA 3U44A 4BQNA 1QYDA 3RTBA 4GSLA 1M1XB 1U8AA 3AGQA 2D00A 4UNQA 1GLVA 3ENQA 3V8RA 5H9VA 4HGYA 3ZUPA 1XRPA 2TSYB 4ZYYA 3ADBA 2CF5A 3CYFA 1PFWA 2NU8B 1N5RA 4C0JA 4GUAA 5BY2A 3GLIA 4BMCA 2GM9A 3BE8A 4LBWA 3PNPA 1E3EA 3I3SR 1DPFA 1XEFA 3EA5A 4YMGA 1D2HA 2FEKA 4QBGB 3Q3EA 4BVLA 2CHVA 4E4RA 3NIBA 4JLJA 1L5ZA 1NVUQ 3OQOA 5ALEA 4DR7B 4X8LA 4JR1A 1P60A 2WBLC 2XQVA 4DPMA 3IIJA 3NB0A 5G3YA 1EJBA 2Q1SA 3LE8A 2QIOA 1LUAA 4FYPA 4HCJA 2FCAA 3V32A 4D9KA 3Q3VA 4FR0A 3U3KA 4ENVA 1GZHB 4H77A 5LBIA 5M29A 1D8AA 1R4ZA 5J23A 1TYDE 2ECKA 2QUJA 3DUFA 3KQQA 4UZEA 2G06A 1YFKA 2R5FA 3I23A 1C9KA 3PNLA 3ZR4B 2FUEA 2ZIXB 3IMEA 2JD2A 5FWXB 4JASB 5C1BA 3PTAA 2J6BA 3N1UA 3N07A 3N74A 4YDSA 1JBQA 1DKLA 4OQXA 1T5DX 2FF7A 4S0ZA 3EJ6A 1DJLA 3FAKA 3LECA 3SMQA 3OZAA 1RYHA 3TTXA 1XTPA 5ILQA 1C9MA 4TXNA 4ZARA 5DF1A 5JVDA 5CIYA 1W2WB 1DDIA 3WWPA 3IA2A 4F92B 4L5JA 4MAMA 1AKQA 1CQIB 3IAS1 3NQ41 4EOGA 4ND1A 3RIGA 1SELA 4PHGA 5HILA 3X2SA 3EGCA 1EBFA 1MABB 2A57A 3ZD7A 3E18A 4OFXA 1C7QA 1I33A 2FPXA 5KQLA 4MICA 4N8EA 1MW8X 3SHOA 3K2QA 3LJKA 1EGHA 4M0KA 2F00A 3PDWA 3QVUA 5LQUA 4UVGA 3I4FA 2NOAA 3RHZA 2NUAA 2QJFA 4BX8A 3ABIA 2X42A 3B1VA 4LZNA 3M34A 3CNNA 2J9RA 4I6EA 1E1QA 4QTXA 4IS2A 4CT0A 4I14A 4DDUA 3QZUA 3H86A 4OXKA 5AWFC 2OV8A 4M54A 1JAIA 1M2VB 1RMQA 3DJFA 5CEFA 3R74A 3LBIA 3BXPA 1FYEA 1Z6GA 1HE4A 5EY5B 2OCBA 3HN7A 4KR2A 3H04A 1EHCA 3IR6A 2PO5A 3E61A 4CDGA 3UAVA 4WFQA 4ZALA 3L6CA 1KQNA 1VKZA 2R6JA 3GJ7A 3OZ7A 4JB8A 1DSSG 4MO2A 5FL7A 2G9NA 4CMIA 4EHIA 1HZZA 1HBJA 4EECA 1E2UA 2OD2A 3GFBA 4MYCA 5DN6D 1UMBB 4H6XA 2IELA 2IUUA 4DQVA 5JRJA 1BX3A 1XZGA 3DE5X 1UQUA 4G1CA 3V2UA 2NSJA 4H7EA 1XF9A 1PT5A 1A8SA 1XRMA 3O7MA 1Y6GA 4YDHB 4OA5A 4N47A 3RARA 3C5WP 3VHXA 1OLUB 1IB6A 5EC8A 5CD9A 4G37A 4AF7A 3MM4A 1PT9A 1KI2A 4LN1A 3GLSA 3X1MA 2GLUA 1TJ3A 5I3ZA 4XM0A 3H99A 4R2IA 3LT0A 3OX3A 4AN1A 4EGQA 2GZAA 2Z5FA 3AKCA 2R00C 2OECA 1DC7A 1K27A 3P26A 3TDKA 4JR0A 4NJMB 2JVIA 4E2WA 5ABPA 1C4KA 1Q7RA 3CVYA 4IIUA 3BMQB 3DA8A 2IYEA 4GD3Q 1JJAA 4HG2A 5DPMA 4CL2A 2XIJA 4UNPA 1QRTA 1AG9A 3FTQA 3DPSA 4IDQA 1SXGA 3O4IA 3OPYI 5JMOA 3B2QA 4I2NA 4UAJA 4LFAB 3EWNA 2JGIA 3HRKA 3M6IA 4MHTA 2XNDA 1K0UA 3QX9A 3R6GA 1GZ4A 1JE0A 1O7JA 1S3SA 4IILA 4PS0A 3USCS 3CIOA 4KQJA 2GTHA 1VGRA 2K2WA 5AICA 2DQZA 1N0WA 3FYDA 3HL0A 5T6MA 3WL4A 4GI7A 3KAQA 2P79A 1L7AA 2BDTA 4LJYA 3IMGA 1YVPA 4UASA 3DZBA 1G5HA 4IYJA 1WKBA 3FNRA 4MS3A 5E2AA 3JZDA 3R7WA 5BWBA 1ESZA 4JEMA 1FTWA 2AS0A 1LTQA 3V2HA 5TS2A 4MNTA 2ZRHA 3VNSA 2PLAA 1N3IA 1JVSA 3VKUA 1HDEA 1WF6A 3CH5A 4ALLA 1CDDA 2XVXA 4A2PA 2FQQA 5A4FS 3AIIA 1NUUA 1ZCFA 3CNQS 2ZDQA 5DI9A 4RF4A 1M34A 2EX4A 5JEDA 2GMWA 3TM4A 4E4YA 1YSCA 2PWAA 3KFXA 3FCSB 4HX5A 3WADA 2CLIB 1NT2A 2MSNA 5EG5A 2ZJYA 1DKRA 4QODA 2ASEA 2QWXA 2V9CA 3MTDA 5H7XA 1U04A 1YZYA 2OL4A 1Z34A 1C0KA 2I4LA 4J0FA 4NMWA 3ZLBA 4E11A 4OQPA 5KSZA 4CTJA 4JWTA 1IN5A 2UXCB 4GOOD 3JD0A 3ILSA 4U8HA 3I34X 2DXIA 1TVCA 3S8EA 1DEXA 4H16A 1MJFA 1T3LA 3C24A 3Q3HA 3TLBA 1FXWF 1NBEA 4YV0A 3T7AA 4AX8A 3PD1A 2C61A 4K1LA 4MCJA 3RIHA 3VVBA 3B38A 1XTZA 2YXEA 3IO5A 4UC0A 3ME5A 1M6HA 5LN1A 3E3NA 2GSWA 3TG2A 3GLFB 1HK7A 3V7FA 3UCFA 4DJEC 4YR7A 2WJAA 4KKVA 3FCUB 1R5BA 1PCXA 3K9BA 4OFZA 3S2ZA 4F3KA 4FD2A 4ESEA 5TQ2B 3K0EA 4A0GA 1H4QA 4RZ2A 2QRQA 3I30X 3SAJA 4DCPA 3AFIA 4Y2UA 4CQMA 4IIYA 3DV9A 4BGUA 5LA6F 4IX1A 1Z8NA 2YY5A 3EPLA 4OBEA 2JCVA 5JWHA 3WBBA 3N2ZB 1ZLXA 3R0QA 2EKQA 1MEOA 1V25A 4F2GA 2B9EA 5KVSA 5L9AA 1LPNA 3CLTC 1R4NB 3NC4A 4EMUA 3M49A 1VL5A 2Q2VA 5BSMA 1R6UA 2K7FA 2AEFA 4KXFB 2P65A 3U4IA 2IYZA 3BWVA 4G26A 4LCBA 3RGGA 1A4RA 4F5YA 3QPBA 3TSOA 4C7OB 4IOLA 1HQYE 5F35A 5FHQA 2EGHA 1KC1A 3INTA 2I2XB 2IC5A 5DYTA 1J8YF 5I7AA 1E8NA 2IUEA 3DFZA 4MPRA 1ST3A 4MW7A 5BR4A 3SVTA 2ZM6B 1NE7A 3LBNA 4LQCA 2NYRA 4C1NA 3UJDA 2OO5A 3VKHA 4PLYA 2GHIA 3WTBA 1VYVA 5ESWA 5FADA 2XNHA 2YNMD 1NASA 1XU4A 1D6JA 4LRTB 5FFMA 3VRHA 2Z4RA 5ALDA 5C8YF 2CKDA 3DC2A 2IVFA 3A3KA 1ZAKA 1P9OA 2FFQA 4GKJB 3NBKA 2E0IA 3JX9A 2PRJA 4HAXA 5FPYA 3UAYA 3CG0A 2ATCA 2OXTA 4P86A 4B3IA 1E1KA 4ALNA 2AFRA 3LHIA 1BXRB 4GKKB 4AD8A 3CC8A 1E9AA 3SR4A 2PA3A 1QHFA 3OOJA 1DG9A 4FI3F 4LQDA 4MR9B 1XTUA 2IVZA 5DT2A 5HS6A 3TNLA 1GNTA 2CGEA 4RIGA 1I7DA 4TTJA 2KYRA 1S9DA 1UWCA 2PANA 4P08A 4NZNA 1C0LA 2AFIE 3VPCA 4GDFA 2GF9A 4DAOA 5JY6A 5FR2A 2BSAA 3L2OB 4IFEA 2CCJA 1S2DA 1T0IA 1DMSA 1JU4A 5L7WA 5DH9A 3I9FA 3R8FA 1VJTA 1GILA 1PG5A 1W29A 2JW5A 2JLZA 3P4YA 1WP4A 1O58A 4OJQA 4K9SA 1Y3HA 3VH2A 2JFUA 2QX4A 3UJNA 1SXJD 2MDTA 1CYDA 3KXLA 3NBMA 4RORA 1M9NA 3FOZA 1N34B 1WCIB 2J07A 4M0PA 5AUOB 4UAVA 5JE8A 4YWHA 1G7SA 2WM9B 1KOJA 3UPUA 1S4MA 1WU7A 4KZPA 4JD5A 5KX5F 3IMCA 1XIVA 3ED1A 3UUGA 3P0IA 2IU6A 1NKVA 3TLYA 2GJKA 4TMZA 2CDAA 5SY4A 1PR2A 5M5BA 3DTVA 3RAFC 1KYZA 1P8AA 3W0LB 2J3LA 3QHAA 2V97A 4DQ0A 2VRBA 3KS9A 4PX3A 5F12A 2O3QA 2R62A 3VR2D 4EF5A 5BUCA 2PN1A 2W2KA 5JALA 3IR5A 2FZWA 1GGEA 3JQPA 3LYHA 3TPCA 2HA5A 3MJDA 3HADA 2P5YA 3M1AA 4UMFA 3HJNA 3F9IA 3LY7A 3OE4A 1FTYA 2XTNA 4JYAB 4QICA 2AK2A 4O08A 1S2LA 2OXEA 1F2UA 4C7VA 4RPHA 2IYYA 1Z4IA 5EXTA 2B8EA 3QF7A 5B4UA 5A03A 4PF1A 1H6BA 4ENPA 2CV1A 3IVGA 3AFOA 1BHJA 3IUQA 4R1QA 4ZU6X 4NFSA 5A6SA 3LZDA 5TLSA 3JWGA 4MW5A 4EHHA 2F64A 1VDZA 3ZCSA 1NYRA 4PQFA 5ANRB 1JMKC 1XMIA 2VCEA 3BHMA 1SEVA 3AVPA 1PZGA 4MW4A 4BV9A 3GP8A 5CFMA 1D1QA 2B8WA 3EOZA 3UHOA 4LV5B 5IG2A 3NHFA 2AJCA 4WNAB 3LFUA 5K0LA 1BH2A 1Q7TA 2JA2A 4YRPA 3TZBA 3U3OA 4CMBA 1SKAA 1NFQA 5LLDA 1S8AA 4G07A 3D7SA 2A5FA 4N7MA 1ZITA 3C3MA 3ELWA 2P0AA 2XMGA 1FZQA 1X8KA 3LNTA 2SHKA 3JVUA 4R8KA 3ZDFA 5BWCA 4B3CA 2JLWA 5DFAA 3G2PA 3VR5A 2VUIB 2W2NA 1I0IA 4G25A 1Q0LA 2MR6A 3DMRA 3F4BA 4KXNA 5FT9A 2AR0A 2HEIA 5AFSA 1XRSB 1B73A 2C04A 4JC4A 3X43A 2O1EA 2CLFB 4OGKA 5LC1A 1Y5IA 4AIRA 5B4TA 5HM8A 2VZLA 4HC4A 3U4AA 2FEMA 3I8SA 5CGZA 1QU2A 1TZ2A 2LDXA 1ZHFA 2LPMA 1FFWA 4JXZA 3RYFB 1J1ZA 2GFQA 2H65A 1BVYF 3R44A 5F4ZA 4MUBA 5IC4A 4FC6A 4FOPA 1VKOA 4TYMA 3G13A 5HKOA 1ZGAA 2C9MA 4FM9A 3WLJA 2A1TS 5FTMA 3NUQA 3VFDA 1CY2A 2A2ZA 2ZJ8A 4RTQA 4UXIA 3AM1A 1CR1A 4C4PA 1LLDA 3Q3GE 2H54A 3B6KA 1ZVMA 4IOMA 4WCFC 2NU7A 3PHIA 1GOTA 3ECAA 4L8YA 3R7FA 1Z29A 5KDOA 1BDHA 1CULC 3BMNA 3ZBPA 4P22A 2B99A 1U2GA 1HRKA 1TNDA 4ZZ2A 1MHPA 1RXEA 1VYHA 2CMKA 3UIEA 4KO8A 4I8IA 4BTVA 3ANXA 3GD7A 3P5SA 4EITA 3OF2A 1HI9A 5FEMA 5JROA 3AETA 1ZHHA 4I9FA 4IQGA 3ZYCA 4LVNA 2FLWA 1UZUA 1ML3A 2GZHA 2LWIA 4PYQA 3JCZA 1CB0A 4HQ6A 4A8JA 1L6RA 4JNCA 3H84A 5G0VA 3L4KA 4KUGA 4IEIA 3PQFA 1ZM2A 1ZL0A 4PTLA 2W6JD 3RFFA 2H4WA 2QUZA 2XDWA 2O2JA 1CJTC 3L0ZA 3RFUA 3U56A 1R0CA 2AGVA 1NMXA 3SOPA 4BNIA 1R0SA 1GAEO 2CXOA 3PQCA 3HU5A 2J08A 4AZ3A 3L77A 4R2JA 2W70A 1DX6A 1E5LA 4QKQA 3P20A 3WFIA 2W8ZA 3P32A 2WJYA 5DSXA 1VQ1A 2ICAA 2UYQA 4W6ZA 2XW6A 3HNOA 4ZQIA 4Y6RA 4FR5A 1K2WA 4P0QB 4NYJR 4G4IA 5HXAA 3B85A 1NMQA 3RYCB 2YCBA 1LK0A 3PITA 3H2KA 4O4IF 2DPGA 3AVUA 3I9V6 1V95A 4YHHB 3D1VA 2EW1A 1E59A 3B6JA 3DP9A 5CXXA 4ZC1A 2CMDA 3OLZA 4NCJA 4I2VA 2M1XA 4OCZA 2YDYA 2VBCA 4PLPA 5JHHB 5A9SB 4RTRA 1QDLB 3ZQKA 1DGQA 3AHJA 5FQNA 3GGSA 4R7TA 2WLSA 1E92A 4MIYA 5TEVA 3IJRA 3WYGA 2B2XA 4E07A 2X4LA 1GSIA 3ZE1B 4TV8F 2RHOA 4GC9A 3EE6A 3T5CA 3E9EA 1ZGCA 4UBLA 4YV7A 1YR8A 2EFJA 5ICMA 1EG2A 3WJAA 2IPLA 4LKOA 2OBBA 3L8YA 3MRXA 3TRIA 1Z4KA 2I3BA 5EPEA 1K8XB 1HMYA 1OWLA 1X3SA 4P98A 4RSRA 2QTNA 5CFQA 1II8B 2WM8A 1OLSA 4FC7A 1DC4A 3CSSA 1WM1A 2FN4A 3HR8A 3BL6A 4NZYA 5CYFA 3SM3A 4CETA 1TW2A 1K89A 3DDUA 3L7MA 4R01A 3OIYA 4MJ3A 4WGGA 3SIPA 3SVLA 3DR3A 3PC8C 4WKPA 1EM6A 4CKXA 1ZNYA 2O48X 1AM4D 1HYQA 1O4VA 1T1RA 3AR7A 2CLHB 4J0IA 1PSWA 5FFNA 1KDZA 2Y92A 3RFTA 2Y0BA 5JS2A 4QDKA 5CG1A 4F84A 2HSWA 4O4HA 4ZJUA 1X80B 4DB4A 4YAIA 3NPMA 1WU8A 1RJFA 1XCLA 3O8OB 4OUDB 2OPHA 3KB1A 4G8JA 5BT9A 4KO1S 5A62A 5KYXB 3OAAA 3G89A 4OB7A 4Y1GA 1KS2A 4PFQA 5BN4B 2JJ8A 1UH5A 3DDCA 1CLEA 4HXFB 3HO6A 4KC0A 4UAUA 5ADHA 1ZHOA 1H8HA 3KJZA 3EAFA 3OP4A 3FRJA 4KPUB 4J0HA 4QPCA 3T7DA 1OZAA 1QSGA 1V37A 4KXMA 1MT3A 4JBIA 4NP6A 1I3CA 4PIVA 2KBFA 1NBAA 3ZV7A 4NXMB 2WQZA 1U7OA 1J8VA 1JI3A 1WB4A 2Q2NA 1KZ1A 2B6HA 1EDOA 1X74A 2EF0A 1RRFA 3ETEA 3VR2A 3O8QA 1WF3A 1MP0A 5LD2B 2Y1OA 3LGAA 5E3JA 1QKKA 1P9NA 4KR7A 3JR3A 3FROA 4C7KA 4FFLA 5T57A 1UBJS 1R37A 2H9IA 3FFWA 4V1CI 1W0KD 2A8YA 3OEEA 5KTSA 4RQAA 4EYOA 5COBA 4F6CA 3B1XA 4ESHA 5EHIA 1GSAA 3JS5A 1W5TA 5C37A 1R4MA 1LJLA 4O2RA 3MJRA 2ESRA 2GBIA 4A3SA 1YMUA 2PT5A 4OLHA 4HGPA 3TG8A 5A4KA 1XN1A 1K3UB 1Y82A 4EB0A 2WF8A 3NATA 3NOXA 3KJHA 3AXSA 5AXCA 4BMZA 1DB3A 2G4VA 2ZSEA 4JP5A 2GZMA 3VVCA 4GBGA 3BTUA 3QOXA 3JPYA 2ZRQA 1GYPA 3W90A 3ASUA 5U4XA 4C2TA 1UQRA 3H6KA 1NJ5A 1SC6A 3DAYA 1FS5A 2XVAA 1PJLA 4F91B 4J3FA 2G5TA 1LPAB 1XD2A 5JI3E 4D3ZA 5IFLA 4FUTA 2P90A 1IZ8A 2BEUB 3HUFA 3Q6IA 1T2CA 2JGEA 3JQAB 2IYAA 5DOZA 2Y1DA 1IIBA 1ZJJA 4OL0A 5EIAA 4ZVVA 3VTFA 1YD7A 2I76A 1UKAA 4IP0A 5EEHA 4NCBA 3NBFA 1GPNA 1SCJA 1ND5A 5LDGA 5TT1A 3WYBA 3MUNA 4KQ2A 1UJ4A 3WIEA 2O8BB 1Z4PX 1ODKA 1MB0A 1X7XA 1BN6A 1TF7A 2VT6A 2WNHA 1GVHA 2YVLA 3AK4A 3NHPA 4KLNA 3ZD8A 4DRXB 2JCXA 3UMCA 1QQTA 3SXJA 4LG1A 2CLLB 4PG6A 5A0FA 1TFRA 1EB9A 2Z2YA 2WFLA 1RYEA 2PTHA 1A2OA 5DJ5A 2DTXA 1Z5UA 1DAMA 1RIFA 2BUBA 4UBJA 4YO8A 4DDTA 3LPDA 1BRTA 3QMMA 3KTDA 3MK31 2X3YA 2PRZA 3AR6A 2B83A 1X7WA 3D3EA 2VK1A 1MEJA 3H11A 1G0NA 3KQYA 4TQUS 5B1DA 4ZEMA 2N1MA 5T64A 5F98A 3SE0A 2IIQA 4OHWA 4DV2B 1JRLA 4B32A 1DDGA 4QWMA 4AWAA 4GM1A 5L3QB 2HNKA 1KDTA 3NOOA 1P72A 3CXRA 2JD0A 4JBXA 2X9VA 3KD2A 4Q4AA 3KZVA 4X6UA 4CLOA 5M34A 3MTQA 5CYGA 1ULBA 3HRHA 2WJWA 4R1MA 4QAQA 2XB9A 4WJKB 5H1YA 5JCOA 3SXUA 3WB9A 4PY2A 3ZLUA 5THKA 4CTMA 5LKAA 1O6ZA 3AERB 5B57C 4TPKA 1LC3A 1YI1A 5HWSA 2NU9B 1ZIDA 3HDJA 2GEDA 4Q48A 1HTWA 2JHCA 3VR6D 1TD1A 1XDZA 1T5HX 1ZSVA 3BFPA 4U0JA 1SU8A 4HWRA 3AEKA 2H2IA 4RK0A 2I7XA 2IOYA 1JFTA 4KI0A 1FPQA 3TRJA 2FFBA 5EAIA 4DPKA 4MQBA 2PXCA 1Z5PA 4LE0A 1EE1A 1HSZA 4RHYA 4X7PA 1EVEA 1PL7A 1X13A 4QQRA 3HB1A 1K9VF 1U7WA 3K53A 1LDGA 1RRVA 4HAZA 1L4FA 2JAOA 4FHFA 3IVAA 2P6MA 4FYJA 4Q4LA 1DX4A 1G2IA 2X2FA 4BVFA 1Q5PA 3FPHA 3IT3A 1IM5A 2AG8A 4IHJA 4YMLA 1TI7A 3ZBQA 1MMFB 1JIXA 2OVFA 2FQYA 4MROA 5F21A 5TGTA 3JQ8A 3IUEA 4CKEB 3ZNOA 4LY6A 5EXSA 1KBQA 1MOPA 2H5EA 4YPFA 4BNJA 1GR0A 3KFLA 1WW3A 3LTEA 1N8NA 2WZDA 3UT0A 4OP1A 4PFSA 1F06A 1VHLA 2PR7A 1HUQA 4DW8A 1OX5A 5DI3B 4LZJA 2JFYA 3CX7A 4MVJP 2XZLA 4JJGA 2JFOA 1Q1QA 2NO9A 3Q5EA 4L4SA 2PGJA 1TVEA 3PXAA 3DXZA 1VPDA 1JKMA 4OH7A 1F48A 4OXIA 5TGDA 4FNOA 5FCDA 5LUBA 4D3YA 1AC5A 1MB3A 5MGBA 2VHQA 3WRXA 1JEQA 5JDIA 5ALVA 3OD5A 5D3MA 2WHPB 1Z6PA 1VJDA 1PJAA 2EIHA 5I47A 2HWXA 2O2SA 2XMDA 2KE5A 3MCWA 3I76A 1SNYA 4DS3A 4EJFA 4BFYA 2QEQA 1Q1ZA 2DR2A 1TVKB 4ZXFA 3JRXA 2DTEA 4WOJA 3I28A 1EVIA 4BWVA 4YCSA 1O6FA 4J8PA 3LPMA 3EVAA 5ALFA 1KRXA 1SBCA 4GGMX 1WA5A 3WMEA 3EXEB 2YWRA 4R0VA 4BLUA 2GD2A 4TXLA 4YRKA 2A5JA 4OO3A 2WJ4A 3ZWPA 4URYR 4DL9A 1G66A 1OGIA 2JASA 3D7RA 3AVXA 1WG8A 1J06A 4HNSA 4JVSB 4ED9A 5BOSA 1E2BA 1EWQA 4B6SA 4EG7A 2ZE8A 2EL9A 2POQX 3MJHA 3GRRA 3TMKA 1NR7A 1DS6A 1EDBA 1HEYA 2BBOA 4R1TA 4ZFNA 2HM7A 4Y0VA 3CZQA 1OILA 2Q9UA 4EHKA 4N01A 2AZXA 1TQ2A 1UJMA 4N5LA 4ZAVA 1EFDN 3CURA 1WV0A 4TTIA 4V0ME 1KY2A 3RWOA 1LDYA 3E9MA 2PS9A 4MQFB 1I2BA 2WNSA 2ZR8A 4IGKA 4X1YA 4JI3B 4MOWA 1T2UA 4MP3A 4NBTA 1Y6JA 4OIMA 2XDAA 5HZKA 1GPH1 2PUJA 1YZQA 5AVYA 2R5WA 1J0BA 4BPBA 4ZD6A 3WSVA 4AP5A 2OAGA 4G81A 3KJEA 4CU2A 3OJ0A 1DAOA 4HS4A 1UBHS 1H9BA 1DG1G 2R11A 3BXZA 3TNJA 3L06A 1IUOA 1SXHA 1V7QA 2QZ4A 1OXKB 1Y9ZA 4LMPA 2GPWA 3KO8A 4B34A 1E7RA 1PQPA 3HU3A 5H59A 4DWJA 1Z3CA 3MHPA 5HKLA 1ODFA 3OE7A 3B1JA 1MJHA 3BTOA 4MH0R 2IV3A 3RSSA 1IOWA 3V9PA 1G8YA 1YNOA 1JLKA 1G9TA 4R41A 2WP8J 2ECQA 3BHIA 3WXBA 1Z75A 3OEHD 2FWIA 4M0EA 4MDEA 4FSXA 3ZDQA 4PX9A 1V8BA 2W00A 1QVWA 4KFSA 5B2FA 2QYHA 3T06B 4PZUA 3T1VA 1EJ2A 1QIIA 1B00A 1XLVA 3NHRA 4BVGA 4KK3A 2I80A 2Q5EA 5AK6A 4D43A 5HQJA 3QEMA 3RRMA 4DJJA 5CBPB 2KBEA 2NM0A 1CUBA 3AUJB 2FW7A 3UGQA 5HM6A 1I7PA 1U6JA 1Z15A 5TPZA 1P0FA 4BB9A 4DWOA 2V9PA 3GUHA 1JR3E 4NG4A 4KH1A 3ZHYA 4YUXA 3I6IA 4C0QC 1U0LA 3NWJA 1X7YB 4IQ0A 4UTOA 2BH2A 2W6NA 3FE2A 4J4TA 1L5GB 1R9MA 3AKEA 1PV1A 4ROSA 5U1PA 3TCNA 3BX1A 4CI0B 4DYHA 3MTJA 1VLQA 1TEVA 1UDCA 2H8KA 2C1ZA 3NDRA 1QONA 4G23A 2XGGA 3W5AA 4ZJPA 5BW8A 5CMLA 3JQEA 3WOHA 2HIMA 4O4JA 6YASA 1DRVA 3GELA 1P91A 1CUJA 2R8EA 4RCZA 4Q9JA 1IHPA 3T7KA 4CQLB 2EQBA 1H3FA 3JQ7A 4MDYA 3UJ8A 3TLMA 1Q0HA 1FJGB 3RI3A 1T24A 2H7YA 4KBGA 4MUIA 4ZPJA 2WA1A 3P19A 3TTVA 1L4UA 1R1DA 2LP4Y 3I5YA 1KK3A 4QDXA 4KCGA 3UHAA 3MFQA 3VR6A 2IYWA 1D0VA 1NYTA 3L8ZA 3PUKA 5K0ZA 2OCAA 3TSYA 2PV7A 5DGXA 3L4JA 2I7VA 2QTCA 2ZT8A 2XCRB 3O31A 1MX3A 1PJBA 3CEAA 4J0KA 1M8GA 1GQYA 4TXJA 5AKZA 3R9IA 2QG6A 5CD1A 1AUVA 5F2NA 4EGAA 3DEYX 3AF2A 4DG9A 5L40A 4HRVA 3O8DA 3GLGA 2JKYA 2NTEA 3I9KA 3PEVA 4ZZ1A 1KDRA 2FW8A 2UXDB 1XTQA 1HPLA 5EMJA 3TD9A 2GR9A 1JHUA 3EDQA 1ZUNA 4XQEA 2XUQA 1I7LA 5JISA 3TBFA 3E6AA 2QTMA 1E9FA 3UB3A 1NX9A 3GG9A 1YHNA 3GLVA 2EYUA 1OTYA 3CTPA 3PGVA 3SICE 1N6RA 1MLDA 3BSSA 3HH8A 2DQ4A 5EHZA 2C2HA 2PGIA 4TV9B 2ATIA 2PX8A 3W6ZA 4B44A 4EUHA 3I6YA 2W11A 4MPJA 4UHEA 5EZSA 3IEIA 3I53A 3V4LA 2R7NA 3N7UA 3MT7A 4N0EA 4OMCA 1JU3A 3WOVA 3ZU3A 1EFCA 2WILA 1IMOA 2Z58A 3M8KA 4CR7A 4DM4A 1PUIA 1W5EA 2FWRA 4HVLA 1DPGA 4YUZA 1N6KA 1TPYA 5FUMA 2UUBB 3HMQA 1ETHA 5C5IA 3JQQA 2YASA 4BQOA 3RK4A 3D64A 1MO6A 4YAGA 5EJ7A 1E8MA 1XMPA 3WYAA 5IVHA 1A8IA 1EFAA 3WNDA 1J5XA 2D0OB 3UN1A 1XZFA 1E4EA 1QH1A 3KSUA 2IQIA 5E9QA 1CDZA 5LDDC 3WGHA 3MD9A 1Y81A 4NRDA 4D6XA 3I4LA 3NVDA 4PPGA 1FNCA 3MCTA 4DMKA 3CVOA 4YTEA 4FFSA 4MKRA 5CM9C 2OT3B 2AOUB 4G2TA 4YXWD 2W37A 3NMUF 1XCGB 1HSOA 1GNVA 1XXHE 4OLFA 2Q4EA 1A5AB 1GAJA 1RYYA 1GQOA 3DHNA 3G2QA 2C4MA 3V00A 1CJMA 4BFXA 1T0HB 1RHRA 4YREA 3C3CA 1LLUA 1YHYA 2A5DA 4P5EA 1DUVG 1C4WA 1M7HA 1RLOA 1YBVA 2WYVA 3A6DA 4M8KA 4NFLA 4RHTA 4D0NA 1I13A 4FZJA 1HYHA 2OBMA 2ZYWX 2NP7A 1P1KA 3N53A 1AK9A 5B5SA 1XAGA 2OBFA 2QAGB 3VH1A 4X3CA 3IQWA 3JSAA 3S29A 4PSVA 5C4GB 1U3GA 4JI1B 3O7WA 4ONEA 1D2RA 1N5IA