4LTDA

Crystal structures of nadh:fmn oxidoreductase (emob) - apo form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
192
structure length
187
Chain Sequence
TYSIVAISGSPSRNSTTAKLAEYALAHVLARSDSQGRHIHVIDLDPKALLRGDLSNAKLKEAVDATCNADGLIVATPIYKASYTGLLKAFLDILPQFALAGKAALPLATGGSPAHVLALDYGLRPVLHSMGVRHVVQSFFMVQSQFSLAVEDDVASQLNNAIDHFRLSLSSEPSTRHLGHPRPSLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of NADH:FMN oxidoreductase (EmoB) at different stages of catalysis.
pubmed doi rcsb
source organism Edta-degrading bacterium bnc1
molecule tags Oxidoreductase
molecule keywords NADH-dependent FMN reductase
total genus 61
structure length 187
sequence length 192
ec nomenclature ec 1.5.1.42: FMN reductase (NADH).
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ltdA00
4LTMA 3NHUA 3UXEA 3ES9A 3QE2A 1YOBA 3OJWA 4PTYA 2OHJA 3HR4A 3NHKA 2QR2A 4J8PA 3JSXA 2AMJA 1C7EA 4Y9RA 1DXQA 3F2VA 1GG5A 4DILA 3O2NA 3FX2A 2QMYA 1D03A 1FUEA 2KLBA 2Z9DA 3OJXA 5LJLA 2FCRA 1AZLA 1FLNA 2MTBA 3N39C 5F12A 3O73A 1FTGA 1T5BA 2W5UA 3KLBA 4DIKA 5BUCA 2R97A 2Z98A 3HLYA 2BZSA 4ICIA 1CZNA 1KBQA 3F6SA 4N9QA 4U7FA 4FGKA 5F4BA 2HNBA 1WSBA 3G5MA 4YALA 3K20A 2N1MA 1ZWKA 5EMNA 4QOHA 1I1OA 1C7FA 3QFCA 2V9CA 1AKUA 5LBTA 3K1YA 3B6MA 2X2OA 6NULA 4HEQA 4M0CA 4LAFA 1B1CA 2Z9BA 5FA6A 3ZHOA 2FAXA 1CZKA 1T0IA 4YAOA 1OBOA 1QHEA 3NFRA 2V5UA 3NHSA 2F1OA 4H2DA 1FLAA 5F51A 4ZVMA 5A4KA 4DY4A 3ESZA 1BU5A 2QX6A 3HA2A 5LMCA 2FOXA 3LT5A 3TZBA 4ESEA 2RG1A 2FX2A 1RLIA 3GFSA 1YRHA 1RTTA 2BMVA 3ESYA 2QX8A 1SG0A 3NLLA 1J9ZA 2XOEA 3KAPA 2QX9A 3OWHA 4GQIA 4ZVLA 3NHWA 1TIKA 1AHNA 2OHIA 4LA4A 5B3KA 3U7IA 1KBOA 1H69A 4N65A 5EA2A 2B3DA 2GSWA 4ZVKA 2MT9A 3TE7A 1ZWLA 3RPEA 1RLJA 1DXOA 1YDGA 3L9XA 1FX1A 5LJIA 2V5VA 1XI2A 1TLLA 2D5IA 3W79A 4Y9UA 3F90A 2HNAA 1D4AA 1OFVA 1D04A 3OX3A 1CZHA 1J8QA 1NNI1 2FVXA 2FZ5A 1AG9A 1DX9A 2FZVA 2HPVA 2Q62A 3KAQA 3NHFA 4U7GA 4ZVNA 5FUQA 1YKGA 1JA0A 3B6IA 2X2PA 4FGJA 1QR2A 1AKTA 4H6PA 5ULLA 3FJOA 3GFQA 4C0WA 5LVAA 1VMEA 4BMOB 3W77A 2ZKIA 2Q9UA 1RCFA 5EAIA 1E5DA 1YCFA 3NHYA 3FVWA 3LCMA 4YAWA 4C14A 3SVLA 5NLLA 3NHJA 1CZRA 4QOIA 4NULA 3OVMA 1YCGA 1CZLA 3B6KA 4QOJA 4YAFA 5LBUA 5B3LA 3S2YA 2QX4A 3OX2A 3FW1A 4S24A 3ESXA 3EYWA 1JA1A 3GFRA 4NLLA 4XDHA 3FNIA 4OXXA 1QBGA 4C0XA 2ARKA 4CF6A 2FLVA 3W7AA 2MWMA 2XODA 3N3AC 1XYVA 2WC1A 3W78A 4XDGA 3P0RA 3U7RA 4LTDA 2MOKA 4FX2A 1AMOA 4LTNA 2M6SA 2QWXA 1BVYF 2BPOA 1WSWA 1J9GA 4QOGA 3OX1A 1FLVA 4GR9A 4PU0A 4C76A 5NULA 2BF4A 3QFRA 2QMZA 5JROA 3R6WA 1CZOA 1XT6A 2OYSA 3F6RA 2R96A 4Y7CA 4BMPB 4CETA 4R81A 1CZUA 3L9WA 4HS4A 4QODA 5TGZA 1AKQA 2FDXA 1AKVA 3KEGA 3NHLA 1FVXA 4YQEA 1XYYA 2OHHA 4PTZA 1AKRA 2A5LA 3NHPA 3UXHA 4D02A 1SQSA 3NHRA 2M6RA 1ZX1A 3GAMA 1V4BA 3OWXA 4YAUA 4F8YA 1F4PA 2BN4A 3D7NA 4U7HA 5LLDA 3B6JA 4FGLA 1X77A 3N3BC 1J9EA 4QOFA 1AKWA 1QRDA 2Z9CA 1H66A 3EDOA 1OBVA 2KQUA 1YCHA 4QOEA 3TEMA 5FX2A 4GI5A 4N82A 1FLDA
chains in the Genus database with same CATH superfamily
2P75A 1TKAA 2WMNB 4E94A 2DKOA 1NT4A 3FZEA 4HTFA 4JBXA 4CHTA 1I6LA 2R87A 2QLMA 2ZJ3A 1V5GA 1SXQA 1Y63A 1AJEA 3ENVA 4RFLA 2GBPA 5J63A 1XCMA 1FY2A 2ZYGA 3DQPA 3ORRA 1ZGBA 3RRFA 1EXMA 3KELA 3CTPA 1VBKA 4WVFA 1DAGA 4B73A 1NUSA 3TUIC 4TT3D 4D6YA 3RGWS 1JDBC 3FYUA 2XCRB 3FOCA 2DFDA 3W8RA 4DKXA 4A8JB 4C20A 4DQDA 1IWPB 3AETB 3D0RA 3AVWA 3IPRA 1W4AA 3SZRA 3OEWA 3D6AA 4AF7A 2YV4A 3LPLA 3N8HA 4ALIA 1EESA 4XIIA 4OH7A 2YDYA 5AKGA 3W1EA 3ND5A 5BNTA 4L8GA 3TVTA 1WXIA 3CH6A 5EP3A 1M73E 2HJSA 1FRNA 1OV6A 4M0CA 1DIHA 3TNDA 1QCZA 5JD3A 1H1LB 2CNOA 3KLOA 4QGHA 3GDGA 1L4HA 1OASA 2WMYA 2WLSA 4AJ9A 1KDYA 4D8UA 3AKYA 1LCIA 3TDNA 2M1ZA 3LT5A 3ETNA 4AF8A 1FVOA 1CUUA 2VHQA 2C00A 2R85A 1H2ZA 3A2NA 1NBEA 4JQCA 4PRKA 4QO7A 3RUIA 2R8EA 4X65B 4LY3A 2OAGA 2XDWA 2IUTA 2SBTA 1R4MB 4DB4A 2PZAA 1E8MA 2RHTA 3DLTA 1TZBA 3RF7A 4YY3B 1R0CA 3DCYA 4MX8A 1X1SA 4L5AA 3ZWAA 2O0KA 4D9EA 3AEYA 3OG9A 1G20B 5J43A 3WRWA 2O5RA 2WF8A 2ZSIA 1E77A 2XBUA 3A70A 4JSRA 4EGFA 5HZKA 4ALJA 4KPFC 3PG5A 4W7SA 1LZKA 4OEHA 3F8TA 4P4TA 4IDGA 4JBLA 4E5DA 3FWZA 2UZ4A 4PVCA 4B6EA 4GP6A 1VSUA 4NBKA 4UVGA 2NAFA 2CK3A 1MB3A 2XTAA 3H97A 1H0HA 2BRUC 3HVKA 2IYQA 4R1UA 2RB4A 3C3YA 3ZU3A 5IBCA 1CVRA 2IHTA 3BK2A 5G0UA 3T7IA 3IV9A 1JE1A 1T4CB 1PZGA 1QV6A 4RM2A 1CY0A 3ZHQA 2E5WA 2QU7A 4R2WA 2KB0A 3U4CA 4MS4A 5KWJA 4PSKA 4FJ1A 3PVZA 1HQDA 4UMEA 1K08A 1RE1A 3HR7A 3ZZUA 3PV0A 4E13A 4RJ2A 4Z51A 3REFA 4IIHA 1QQBA 2FZCA 2WSSA 2R1VB 1IIBA 2I78A 1AQNA 4CLOA 1O08A 3QUSA 1J9GA 3L41A 4M6WB 2YZKA 1E1QD 1BJRE 2IHKA 2Z09A 3B5JA 4DADA 4V1CB 1D9XA 2VCHA 1N1GA 3I37X 3HWX1 1BX0A 5CTAA 1QDUA 2OO3A 4OLHA 5CJJA 4BWGA 3QWIA 4F1WA 1J39A 1I3OA 1VRCA 4D5EA 1ST2A 2ZRAA 1E2GA 3ZWMA 3LGAA 4PN7A 5BVGB 4YQEA 3OIYA 3PQCA 4KQWA 2F9LA 3GFPA 3BX1A 4GVLA 1TCVA 5KWIA 4EG5A 1NTOA 3H1GA 1ESNA 1U3FA 3PC4A 3HKEB 2I4LA 2B1RA 3IPAA 4MTCA 1ZONA 1R6AA 1RLUA 2HSDA 3DBLB 1KTVA 1K8ZB 3GRAA 1E4YA 3KM0A 4M1QA 5HBGA 3TEMA 3A10A 3GCDA 4E21A 5IANA 1Q3KA 2QD5A 1A5ZA 421PA 1KYQA 1VXOA 1F0NA 2C57A 3LKDA 4LF4B 2BRUA 5HCIA 3ZYCA 4DA9A 1DDGA 2HXYA 2QRQA 3FIUA 2HDWA 2VUSA 4JP2A 4Y9RA 3TSZA 3AEKB 3BSYA 3GVCA 3WLNA 1E7WA 5G41A 5BRNA 5B3AA 4AZVA 3L0CA 2XPCA 4TV8F 3C7AA 2BCGY 4Q3CA 1ZI6A 1KOLA 3ANNA 4P80A 3JVEA 3LZDA 1CZNA 1SELA 2NU7B 3BXOA 3PFKA 5B58T 2XA1A 3A4MA 4JLWA 5P21A 3QNWA 1PVOA 1Q3TA 1E7MA 3AKEA 4F92B 1ZH6A 5BSRA 2W42A 4JLAA 4HEQA 3KWLA 4WKBA 1GSAA 1XQ1A 3EHEA 2Q1TA 2RKOA 3K1JA 3PL1A 4PQFA 1P5ZB 2CE7A 4HDRB 1RAHA 4MH0R 3IILA 1QHEA 4PBRA 4RD2A 1W7AA 3DAPA 1EUYA 1V0JA 5LCXA 3HCBA 3M6WA 4JB2A 5I7HA 4BGEA 5TB5A 5HQJA 4CODB 1J8VA 1F1BA 3DLIA 1FMTA 4R1SA 4H7DA 1N33B 3H13A 4G5GA 2VHEA 4LQLA 3PUHA 3GGDA 2I4RA 3ZNOA 4C3ZA 2OHIA 2YMLA 3T99A 5JDIC 3PK0A 1EDEA 4YXWD 3K05A 3A6DA 3WGNA 1AXRA 4KC0A 3GLIA 1VLZA 1VPEA 2RKBA 2XMDA 3TE7A 4ASUA 3MRTA 4BFUA 4YCLA 3L9XA 5IKMA 1TKBA 3AI3A 4KOAA 3SHTA 4RXMA 1I30A 2BFCB 2DPLA 4ZOEA 3IIEA 1O5TA 2GAIA 4UJ5A 3L4EA 4H1HA 5TQVA 5HKBA 1GQYA 5B57C 1ZBDA 2H29A 1M2FA 4R51A 1Y6GA 3INYA 5JROA 4BVKA 3VYVA 1AIPA 2PGNA 2PAAA 2QG4A 3DUWA 5EFZA 2J9GA 4Q00A 5IN4A 2VC2B 3RRYA 1HEYA 1D5CA 3EPRA 3FZQA 1XMQB 4YFYA 3WFIA 2QM7A 1XTJA 2OV3A 3HXOA 5CIWA 3OVMA 2ORIA 1SRRA 2BKUA 4DFDA 4FN4A 4U2CA 4RGBA 1K5GA 1T9DA 2H7VA 3OCYA 4ENUA 1UP4A 3RYHB 1QIDA 2HIHA 5K5EA 3NETA 1MH9A 3JQBA 3HS3A 4G0YA 3I09A 1Q7TA 2O5CA 4CIWA 1WXEA 3ILSA 1JAXA 3QV2A 5CFOA 5JXIA 4YV2A 4ZVPA 1AVTA 5BQPA 3SM3A 4I3GA 1Z16A 1XZBA 3HNPA 4LSMA 1YONA 1MN6A 2RMKA 3E5MA 3K4PA 3M34A 5EYPB 3UGQA 5JADA 5KTOA 3ZDXB 1QZUA 1M1YA 3S27A 1XN4A 4AG6A 1CIVA 2JJ2A 4HB3A 3W05A 2IBTA 3BTOA 4EUEA 2IITA 1G4HA 1P1FA 4IZIA 3GLRA 4JR2A 2XX3A 2Q7DA 2P78A 2P9FA 4IDCA 1Q7BA 1JIQA 1Q74A 2B92A 3LPMA 3DZ8A 2BZ1A 1U8XX 2QN7A 4CFSA 5DHQA 5LUAA 1Z2CA 2DFTA 1H66A 1Z4JA 1TAUA 4Y6PA 1XELA 1TW2A 1MA3A 1NC3A 3TKLA 3IJEB 2A0WA 5J59A 5A9TA 5AKIA 3T5MA 4NJMA 4DRXA 1SU7A 1R12A 1MABB 3DM9B 2QGZA 3I05A 1GTL1 4NE7A 5CRIA 1KZ6A 2NU9B 2BGUA 3MFQA 5BSHA 1UBKS 4QDZA 5CG1A 5K09A 3I9FA 3KTFA 2ES4A 3E7DA 1FS5A 1Z0SA 5JS2A 2OGTA 1NXTA 3ISVA 1EIZA 5K4GA 4IO1A 3AWDA 4ARUA 2PNFA 2PTHA 4DR1B 2GBLA 4WESA 3ZW8A 2Z2YA 4E5PA 5AXAA 1M6NA 1X1QA 1RI3A 1T2VA 1MEJA 2H4JA 2RH8A 3V97A 1JMVA 5HM8A 2QGFA 1X8KA 1YB6A 4FVTA 1YJ5A 1UT5A 4OSEA 2N1MA 3NIWA 5B53A 2ZYTX 4D81A 3AHEA 3PHBE 2PJRA 2EHJA 3BQ9A 4KXUA 1Q7GA 4WFJA 4HC4A 2AI1A 1N6KA 1OBOA 4H7HA 1ODSA 1MHPA 3FF1A 3LD9A 3DA8A 3DGEC 2ACKA 3TFQA 3OQIB 1T9GR 3P9QA 3VU8A 1O8BA 2C7GA 4ZHQB 2AD1A 2Y1EA 1OB5A 1ICEA 2QTAA 2BTEA 3LUKA 4OOFA 4YN3A 1Y6ZA 5C0OE 4E6EA 3STXA 1VYTA 4EDHA 4OMDA 1KDRA 3Q7RA 4HGQA 4A6DA 1UL1X 1RJWA 2A88A 3UAOA 1TCBA 3BE5A 5GTDA 5L53A 1Q6YA 1XRLA 4YJ3F 2YH2A 2XYQA 4Z54A 4H4EA 2BGMA 2I2CA 3H0KA 4V38A 4FWIB 2OXEA 2ZSHA 2NPOA 2PYIA 4R8KA 4ZAZA 3F7MA 1O8CA 5EP2A 3OX3A 3Q3HA 2I3BA 4KDEA 3GPBA 5BT9A 1P44A 3T3MB 2D00A 4BNVA 5D5QA 2JLRA 3ET5A 5JMPA 4D45A 4D8WA 5CBPB 1H4TA 2R7AA 4I0WB 3OC6A 4PO1A 5D87A 3ZD9A 3RS9A 1ZK0A 4C4AA 4CMEC 6LDHA 5L4NA 2JBWA 1SQ6A 3IT2A 4UCWA 1J99A 4B1FA 1Y1QA 4B87A 2QIOA 3FVWA 3CSSA 4FI3F 1WDMA 3NBYC 2J6BA 2YWBA 3HCWA 1H65A 4NC9A 4RETA 1B15A 2FPWA 2DT8A 2JJ1A 3PTZA 1PFGA 1KEVA 2E6KA 4R71A 5AHWA 2WKSA 1LBSA 1O6BA 1VCOA 4DIFA 1M2GA 1A4IA 1DTSA 2XODA 5K1ZA 4W5WA 3T52A 2H1FA 5EJEA 1LUAA 3CC8A 3EGWA 4BN4A 5CA1B 4LRUA 2JH8A 4R0MA 4D9GA 2Q1YA 3DB2A 1NJSA 3RR2A 4FD2A 3HVIA 2EHDA 2JCGA 4FB5A 1C7ZA 2VDOB 3HKBB 4EOGA 2OM2A 2PWYA 1XF9A 5ADHA 1WTAA 1XMSA 1HPLA 3OIFA 3OA2A 4G5OA 4J91A 3KDPA 3MQ2A 4DR6B 2COEA 1X7WB 3AXTA 3GJRA 3KSMA 2YXNA 2JGFA 1IRIA 3G8AA 3DBRA 2CBZA 3KJFA 3PI6A 3OPYA 3DEIA 3GGJA 4FZ5A 3X2FA 2QM3A 3A31A 1ZIDA 3T6KA 2H63A 3R4VA 4IMIB 2G36A 1G5TA 4B4OA 1ETHA 1UDAA 2O2HA 4XKJA 3T7CA 2WTNA 3NTRA 5BV7A 1R4NA 3EXAA 3HBAA 2X58A 4AUNA 2HADA 4C3OB 2HJRA 1T34A 2WHRA 4WN3A 3FUXA 1ZHFA 2Z3WA 5FBLB 3GOQA 2NNWB 3ZVLA 3D8TA 2ZYHA 2FUEA 4U0JA 2PH7A 1NG9A 2V6BA 3OCWA 2JFHA 3SK0A 4CN9A 3K6SB 1RZRA 1UBHS 2EZTA 2R00C 4ND7A 4TXLA 2RGBA 1RQRA 2NT3A 4MAMA 2FZWA 2KW5A 2PZLA 1PZFA 4EJ0A 5SZIA 4G63A 3HEAA 3I6ZA 3WK9A 4D0SA 2P9TA 5IUJC 1IN7A 1CB7A 3IMCA 4BQRA 5EWJB 5LP6F 2HBZA 5LBTA 4BP9A 4XVQA 5FPKA 5CVEA 4WXHA 4LFBB 5FOTA 1M6WA 1P80A 3LCCA 2K87A 4ZVQA 1PUIA 3L1IA 3KKPA 5E38A 4WBNF 1VIMA 1E2DA 1LC0A 3AFNA 4G5YA 1ZD3A 1RM3A 3T7KA 1UAAA 3G9UA 4YV0A 5CA0A 3EK2A 2B5VA 4C0BA 1SKQA 1LSSA 5G02A 1G1MA 4J9VA 5GIOE 3VDMA 1RWXA 3SC2B 4D8TA 4OXNA 1ADGA 4XFKA 2V4UA 3TZHA 3SX4A 1UMKA 2FXIA 4QAJA 4YECA 2OAEA 3G2JA 2R1UA 3AUSA 1NXQA 5B3KA 4KNVA 1YE8A 4TWBA 3RC2A 3KD3A 5GWXA 2C3MA 1FNBA 1F6WA 3C8ZA 4QU0A 4TX1A 3QVLA 2XCUA 4AX4A 3K70B 4RA6A 3PE3A 1UM9B 3WB2A 5CVTA 5EP4A 5KTMA 4P5DA 3MPOA 4RY9A 3MC1A 4ZAGA 1VHDA 3F90A 3LECA 3MS7A 4B2YA 1JNYA 1Y89A 2XUIA 2YV3A 5AVWA 1GZ3A 4MR9B 1G7RA 5TE9A 4D79A 1DIGA 4IGKA 3SEAA 4CIDA 2O6HA 2VZEA 3KYBA 3ZCTA 4EB3A 4Q1DA 2QY9A 5C4MA 4K8RB 3I2FA 5ALQA 2Y3IA 4AN0A 4U2KA 1ZM3A 3SC6A 3WA6A 3WRYC 2G4CA 3K0EA 3DMPA 4ER6A 4NH4A 1VE5A 1JZQA 2VVTA 3GAFA 5B3JC 3OY2A 4RYLA 5TPWA 1P2TA 3CEMA 3R5KA 4YC7A 3E3AA 3TIXB 3AKZA 3C41J 4EFDA 2X5KO 1WUHS 3LKZA 5DN9A 4JI2B 3VKFA 4EUKA 4L4XA 3QKWA 4HFJA 2DJIA 3KHUA 3W78A 1YJQA 3A4NA 4X97A 3FHLA 1SCIA 3OJLA 5F52A 3GFGA 3KQNA 2ZGVA 3CU5A 4ND1A 3K0CA 1A9PA 4D96A 3VZPA 3AZQA 5LMUB 1O6FA 1ESMA 2C82A 3DFMA 3GG2A 3MRSA 1E62A 3TB4A 4QREA 4BB6A 1UF9A 1LPBB 1U28C 4FYJA 1LW7A 3C6ZA 4JJGA 5CW2A 3SS7X 2HJ9A 1BU8A 1HRKA 2R1ZA 2HZBA 3DUFA 1PNVA 2IHYA 4B8YA 2C61A 2DHDA 3N0VA 4EM6A 1ECLA 1WIWA 1YIOA 2EJTA 221PA 4BNKA 4TYYA 1IHDA 5IMBA 1A8UA 3LPDA 5DLEA 5K0GA 1PJ8A 2QL5A 5BWNA 4GBJA 1MIHA 3ECAA 3RFXA 2C4TA 2FP4A 3LM8A 5A9SA 2FJPA 2RSLA 3DO6A 3AR5A 5LZ4A 3WLOA 3ZS9A 1FTQA 1RW4A 3UJNA 2PZFA 1J6UA 3DL4A 3BCUA 1E6MA 1FSZA 2ZYDA 4ASUD 1UFVA 1W85B 1CJSA 3UAWA 1JEEA 1N5DA 1Z82A 3ZBQA 3Q8LA 1OLSA 4JLVA 1SBNE 2QHXA 5MN5A 1MJGM 3HADA 4NARA 4PYKA 2VUIB 4RE6A 4R7ZA 4AJOA 2H85A 1RZVA 3NVKI 1N1MA 5HA5A 4IUYA 2VJAA 1CQJB 3R24A 3ZHRA 1K7EB 4OBEA 1EAMA 4HDOB 2LW7A 3USCS 4C7BA 1XWIA 2AOTA 3IAFA 4NNOA 3OAAA 2HCRA 2XCTB 5EJ7A 3HGQA 1VHQA 2FPSA 1STOA 4BFZA 3UCFA 1D1QA 4DQXA 2WEKA 1JG1A 1M1UA 1XG5A 3HACA 5GM1A 1HF3A 4CF4A 4DCOA 4JEUA 4DCVA 5ICCA 5LYJF 1A0OA 3OP4A 4W1QA 1W1IA 2WWGA 3ISJA 2OXIA 1JX6A 2O8EA 1Z5OA 1JZTA 2B37A 4L2IB 3NFRA 4HQNA 1L7RA 3QVGB 4IOMA 4N7BA 4YAOA 1AX9A 2JG3A 4KR2A 2PKWA 3M89A 1RQGA 4U2BA 2GO1A 2GNPA 2O1SA 5LIPA 2O2EA 3NEYA 3QUCA 3D6JA 4WDRA 1A9RA 4DNQA 1DB3A 5ADWA 1V43A 3VH3A 3ZCRA 2XYGA 3KOWA 1VG9B 2ZRDA 2C2KA 3FA2A 4GQIA 1DPGA 3QFHA 4RGQA 1L5HB 2NVOA 3QHPA 2IUSA 2IUFA 4I5GA 4UBNA 3RG2A 3SQXA 2O7QA 4NF2A 3QU5A 5B55A 2W2QA 4G6ZA 2JLZA 1QGUB 2EGUA 4C7KA 5JRZA 3II6X 3R8FA 3LF1A 3DTTA 2JLSA 5D1HA 4PM4A 4JJZA 3GHHA 1I2AA 2XT6A 3GMDA 5KHAA 3SYMA 1IXSB 2H0RA 3EXHB 1Y5MA 3NCTA 4NECA 4YI3A 2CDBA 3NWEA 4UD2A 3HMQA 2G6BA 1JAZA 4KYTA 3QOWA 1PF7E 4BNWA 3VX3A 4UQLA 2OFXA 2CEKA 1W4BA 2I5PO 2Q5EA 4JGGA 3TFWA 3UUGA 3TBKA 1C1YA 3NKFA 3FJOA 2PLAA 3KALA 4EVQA 2WD9A 5GOTA 4W5NA 4NCXA 1E7QA 4BUJA 4E4RA 4LXYA 4HI0E 2ZAOA 4GX5A 4JGBA 2AEJA 3FSJX 4D25A 3EVAA 3CT6A 3W3AD 4OYRA 2YWFA 3FXAA 2RHJA 4NOMA 1XR3A 5KVAA 2C5FA 1A8QA 4MWSA 1HL7A 2FKNA 2VJKA 5CX1A 5E2IA 4CTOA 1FFXA 3T3EA 4S2EA 2V7VA 4WX2B 1B8NA 2R4QA 1S8OA 2FP4B 2PLWA 2YRXA 1E1RA 2XGOA 4MB2A 1SOWA 5ENDA 3EXIA 4TM7A 4BVJA 1DIBA 1L5OA 3SZ3A 3GNQA 1FQOA 3TX2A 4ZCMA 5DVZA 1DIOB 2QZPA 2PTGA 1SH7A 4BLVA 3QXJA 2IWRA 3WSVA 1UDWA 4JA0A 2FEOA 2O5VA 5C37A 3DUFB 1T4BA 1VYVA 3A6KA 3LW8A 5SZKB 1TADA 3VAZA 2SKEA 5HJ2A 2VDQB 2VP9A 2O2DA 2X5NA 1FVXA 3CW9A 2R8PA 2XWPA 1NXOA 4ZQHA 4CF7A 4QU9A 4OY3A 3H5NA 2XGJA 1KI9A 2UUCB 4DA4A 2FPIA 2OZPA 1LLCA 3Q12A 2WQ6A 2JF0A 1Q1BA 4ONEA 3GCXA 1OYVA 4YRTA 1HZJA 3ACDA 3HJBA 3IP5A 3S5JA 3MOIA 1YJAA 2DFKB 2GZRA 5HF6A 3A6JA 2WE8A 4CI9A 1EKXA 3FHCB 2GYYA 4X1IB 4IS3A 1ZK4A 3FMGA 4LV8B 4QO8A 5C5EA 2HA5A 3A27A 3O03A 2Z57A 4EA9A 2J09A 1HEIA 2P9ZA 4JUFA 2Y1FA 1BGWA 3F67A 2LUOA 3X1WA 1IB0A 3F47A 4YJKA 4FE7A 1NAIA 2H4HA 4FFOA 2X13A 2Y99A 2WV9A 3C0KA 3CEPB 5HIKA 4FDAA 2OFFA 3EIFA 1YB2A 3T41A 2G63A 3AJDA 4PSDA 4CKCB 1I6KA 2Q3EA 3NHZA 3IDFA 1USUA 3PEWA 5TQ0A 3BPSA 5AM5A 1WABA 1ZH4A 5AVUA 2FFHA 2BMJA 3LFTA 4HS9A 4OF4A 1XQ6A 3CF4A 4RLSA 4UREA 4AJ2A 4BX3A 4C6TA 2PSSA 1NF2A 4RHXA 5DTRA 1A77A 3JYQA 2PLFA 1E6KA 1GGKA 1UC4B 1F7UA 1HTTA 2Y71A 1Y8CA 4JODA 1Q19A 2QE6A 4WBXC 3ZDYB 4M1ZA 3KFXA 5C3UA 4LDAA 4D9CA 5KC8A 3MB5A 4B3XA 2ZBRA 2BLNA 1WF3A 2VBFA 3A04A 3G8DA 3W6UA 1DHRA 4KX3A 2V0GA 3JR3A 3G79A 2LDXA 1JU3A 1XZFA 3UHJA 4ZMBA 2RAUA 2HUPA 4EI7A 1I32A 2AI3A 3K09C 5DE3A 4LA4A 1ZN7A 3VYTB 4DT1B 5BSVA 1MOZA 1Y4UA 1UR5A 1SUBA 2GYVA 4I8XA 4JDPA 3VBCA 3HY3A 3W34A 4AMBA 4NBRA 5EWJA 2JGMA 3HRKA 2VWGA 3HQ4O 4BNNA 3KXIA 5GIPE 1PDWA 1THTA 4L27A 1TQ4A 1XQVA 3DF9A 4MP3A 1P0FA 4IX9A 2JCBA 1A2OA 5BNWA 1AS0A 4ME6A 4TTJA 1C8LA 3MFYA 2APJA 4YGYA 3AJAA 4Q03A 3THSA 1ICIA 1W5BA 3LQKA 2C9CA 1AKTA 3HBMA 2GYUA 3DTVD 3MRVA 1L7XA 3FMOB 4AG3A 2CNKA 3Q3JB 2Q9UA 1Q0LA 3ASUA 1KE2A 3NHYA 5BMOA 2D4HA 2VSQA 2ZZNA 3F4LA 3H0EA 3OPMA 2V8OA 3H2ZA 1MQAA 1TM4E 4AZ0A 2DCUA 3U3DA 1XTSA 4JQYA 3QEOA 5LWQA 1TFRA 2I99A 3COZA 5JSZB 5CCXA 3U4MA 3D4IA 721PA 2VNIA 3ER9A 4PIMA 3FPEA 4C9BA 4EJFA 2YHIB 4BE7B 1DP4A 3MCZA 1QE0A 1Z56C 1QH0A 4ZKDA 5I7UA 4LTDA 3OJEA 2RH9B 4QU5A 3DBRB 1GT6A 4CEJB 2P7IA 4GAEA 1UMBA 2A84A 2REOA 3A14A 1DUVG 2BR4A 5F98A 3B1XA 3PWZA 1A9ZA 1CZOA 1WKVA 2XHZA 3WHLA 1JR3A 2QJRA 4R8LA 1QO0D 3KQQA 3P0JA 4DMUB 1KOFA 2CVPA 3NHLA 2GD6A 1WWKA 4MWDA 4XJTA 1JR4A 4F7DA 1CRPA 2QPAA 3N8GA 5CA1A 3DO8A 1U8CB 4MK4A 1N36B 1DADA 1FFEA 2ZCJA 4Q66C 3ZZNA 1X92A 1PWZA 1JDTA 1TK2A 2JW5A 2XF8A 2MYTA 3ND8A 3L4KA 3K6RA 4QL3A 5C1BA 1JXOA 2XMCA 4YAGA 4D4GA 4RMNA 1XKXA 3GGCA 4QPZA 4QBHA 3UMYA 1KAGA 2YY7A 5FI0B 3VR3D 1XRJA 1L5RA 4XYMA 2E4WA 5E4JA 4MLCA 1HDGO 3NWOA 1RQ7A 1M6VA 3NTQA 4FFWA 4I1SA 4PBSA 3GLGB 4MRMB 3A06A 5CFMA 5HWSA 2OCGA 3MHPA 4LHSA 5HW0A 2CBXA 1TLFA 4DNPA 4LOAA 1E1DA 1XO1A 2RK4A 3PHGA 3IIIA 2V5AA 4J3FA 3X1KA 4B44A 1G4UR 1OFHA 2VQ6A 4FYKA 5HJEA 2UYQA 4MPRA 3TK1A 5C7OO 5D3MB 3VR2A 5HCUA 3BH7A 3FE2A 4MVJP 4HSEA 1D2EA 3V8PA 1I4LD 1O4WA 5GJCA 4WA7A 1HTWA 3UOAB 4I9FA 4KJZA 5FRDA 1K6IA 2QD4A 4MVXA 4NIMA 2QYTA 4RMIA 4RBNA 5A02A 3GIDA 1UDCA 3RBXA 1OZHA 3KQWA 3TQRA 5LLSA 3VV2A 4FSXA 3FMFA 5JAZA 2FEWB 2WM8A 4BO9A 1FJGB 3PHLA 1EE9A 5L51A 2PUFA 2I29A 4KFTA 5DTEA 5GJBA 4KITB 2C9OA 2HQSA 4Q3EA 3GEBA 3IIJA 3HXTA 1EYZA 2YWDA 3DXYA 3IUNA 4V3BA 4BNMA 3VZDA 4BLUA 3I72A 3TWOA 1GFZA 2D54A 3GPDG 4J1NA 1B7GO 2FPKA 3FHJA 1MPTA 1T1GA 2QD2A 2FR1A 1KYYA 2EX4A 3G2MA 1P4JA 4MHSA 8LDHA 2DFPA 4QUEA 5AKEA 5E1DA 4KUGA 5IVIA 3O2JA 1H69A 4LNUB 5FTMA 2R5FA 3LDUA 4JDUA 5EEGA 2OYRA 4E31A 1K5DA 2GT1A 6REQA 2CXXA 1V2GA 4OB7A 4OHCA 1DXYA 4MS1A 1XK6A 4GOJA 3VXKA 1F6BA 4C03A 1USWA 2ZEJA 2MYUA 1Y6FA 2HWYA 4KRXA 1EB9A 1SIBE 2QGNA 3G17A 4NPHA 1PK7A 4H4DA 2Z6UA 1DX9A 4WESB 8AT1A 4N76A 3IOEA 3HU2A 3JAWA 3K5PA 2E4VA 3PWSA 4GX2A 4I1RA 1GAEO 1M6VB 1YZFA 2PZBA 4O33A 5CCDA 4UJ3A 1ONNA 2VDKB 1W581 1Z4MA 2B21A 2ODPA 3K35A 4U4AA 2GM5A 4DB2A 3C4QA 4RH0A 3NT4A 1L4GA 4P82A 3T06B 3CX3A 4TUYB 4P3KA 4GICA 2VQEB 4FLMA 4V2UA 5KAMA 5CFPA 4DRXB 2YIJA 2WU4A 4OXXA 1Y82A 2QZSA 1X86B 2IXBA 1G9SA 2GM3A 4UTVA 1JFFB 2P5TB 1R88A 1DJPA 4ZFNA 3T1HB 4NXMB 1LK5A 1YBAA 4XJVA 1MG0A 1N3YA 2I33A 3GJSA 2Y1DA 3O7MA 4MZXA 5IBQA 1CC1S 1CPYA 1XCJA 1X6VA 5T3UA 3V2IA 5ABPA 3E81A 1C0PA 4QATA 1DLJA 2PY6A 1IK6A 2VNAA 1BD4A 1Y34E 5LL6P 5AJHA 5JSYA 4RTOA 1FE8A 1XCGB 3F71A 4P8RA 5DT2A 4XRGA 4I4TB 1FDTA 3G2IA 4Q3OA 3WGHA 1IPFA 3S2UA 4R1MA 4NVRA 1K7XB 4IWXA 3K70C 2X41A 3N6VA 3NHBA 5COQA 3IH5A 2G1KA 2MYNA 3R3ZA 1MVLA 2PMDA 5YASA 2B4QA 3ZDQA 2HO5A 5FV4A 1ILEA 3GJ7A 2BFFB 5HTOA 2IPXA 2WJIA 2X14A 5JSQA 3G6WA 1VMDA 3F96A 4IWNA 5FBQB 4LVOA 1G2OA 2VJMA 4JS0A 5F3DA 1W5TA 2G80A 4O4LA 2OC9A 3W4KA 3AUXA 3O0TA 4HH3C 4RIFA 4FE4A 1R7RA 4O4HF 4JYPA 1WLYA 2X3YA 5FHRA 4DEXA 1CIPA 1GUBA 4V2IA 4EENA 5LWHA 1HDYA 3F97A 2LKDA 3M4ZA 2IYPA 2Q7XA 2WA2A 2XSZD 5KSYA 1J1ZA 5HZMA 1W76A 3BH6A 2PKRA 4YJ3A 4D3YA 5L4LA 2BFWA 4WLNA 3EVBA 1PNQA 3ZDFA 4P7BA 3VC2A 2VDUE 2A1TS 4KSYA 4HWGA 2YYYA 3DHNA 4LIPD 3WXMA 3GLFE 5CHEA 4M38A 1DAEA 1PWXA 1X7YB 4FGKA 4CL3A 2IXFA 2XADA 1AQLA 1T10A 3GUZA 4GT1A 1WA5A 2PL3A 2QZ4A 4TZTA 2NWQA 3QUBA 5CHYA 1NN0A 1VJ1A 4OUDA 2X0FA 3SG0A 3STHA 3G9QA 3B6MA 2GASA 3ZGYA 4BLWA 1EVEA 3OQ1A 1IUNA 2QVZX 4RZXA 3BREA 3UMBA 1UBTS 4MKGA 3U4HA 3IOCA 2R44A 3QVKA 1IEVA 3WIOA 2PUHA 3ZBPA 1RM5A 3E9CA 2HFJA 4RIIA 3U3RA 3HZHA 5P8WA 4MV4A 1XXHB 1ZCFA 4F97A 5JAMA 5JZBA 3BWDD 2HT1A 3T3NA 1DIRA 1OILA 2VYQA 4EAAA 1VECA 2ZUTA 1W36B 5L7WA 2GEDA 4F2HA 1A8PA 1S2OA 3ID6C 5EZYB 3IVGA 4XYGA 4HDRA 3OU6A 3MGBA 2H16A 3AFMA 3D8BA 3EXEA 3T38A 1EP2B 4QG3A 2YWEA 1IWOA 1WNTA 3NIGB 3P9ZA 3GQBA 3R9WA 2BEVB 4POOA 4ZI7B 1OFGA 5BVGA 5KTRA 2WPDA 4DLUA 3RBZA 4Q4HB 4WN9A 1V37A 1PCXA 2G82A 3ED1A 3IBGA 3PDJA 4H1UA 2AN9A 4RKRA 1QU2A 4R8SA 3ZJ5A 4EMBA 3TTYA 4K88A 2QQEA 4P4LA 4DREA 3KP1A 3VVMA 3WHKA 3TM5A 3F5MA 4TKUB 2C7BA 2QLNA 3DZHA 5LQDA 4AKIA 1CS4C 5JS7A 4WUVA 4A36A 5A4IS 1FZQA 1KMMA 3S2YA 2WUWE 1UFKA 4TYWA 1B6SA 1NJFA 1TK9A 5JY1A 2X42A 2FUCA 1W96A 3CURA 1U1CA 2BDTA 1NSYA 1B2RA 2IE0A 2WU8A 4D4MA 2FPIB 1DBQA 2WAYA 3A1UA 3B2QA 2QAGA 1DO0A 4KZKA 3P0RA 821PA 4BLPA 3KX2A 4GXTA 1DFIA 2NUPA 1XDDA 3D7LA 1NXPA 3UV7A 4NE9A 1VP3A 4PXYA 1UK6A 2XUGA 3B82A 4JWKA 1IHOA 3GA5A 4FOLA 2CLLB 1DGQA 2OVFA 1LF5A 1QVZA 3ZDEA 1EMDA 2HH9A 4QX6A 2J5QA 4LRSB 3SEZA 4L28A 4PRLA 3ZDAA 2IZ0A 6Q21A 2O8BB 2PR7A 3SNKA 2AT1A 4PTZA 5A0TA 2XB9A 4X5OA 4XTRA 5B12A 4DR2B 2VHTA 1SUIA 2VH1A 1QTRA 5D01A 3VR5H 4PVDA 5J9FA 3EARA 1FFXB 2JIQA 4UNRA 3RBAA 2XA2A 1YS4A 4XB1A 4BX0A 2HCTA 4QZVA 1DAIA 1V11A 1KFEB 5KX5B 3IOYA 1CDEA 1RHRA 1ZHHA 1OVMA 4X1OA 1SOMA 4AO6A 3OM1A 5IHXA 1CV2A 3GJ4A 1KP3A 2IP4A 1LK0A 4BDSA 1OAOC 3VKVA 4KN8A 3M3HA 4BNLA 4P3NA 4ZV4A 1DINA 3VPHA 3E53A 4IX1A 3SDZA 1SZCA 3NYWA 4RF5A 3U7EB 1RZRD 3DTVA 1JGTA 1XRMA 1SY7A 4FFSA 4GZ5A 5A4MS 4YP9A 1KE1A 1JV2B 2XGMA 4IQ0A 1UXGA 2IV7A 1T6BY 1W0KA 2MJLA 3LQ4A 4BP1A 2OVBA 2JI4A 2ODEA 4OLFA 5F4BA 2Y1XA 3UOGA 3WIEA 3L5KA 1AC5A 4B3JA 3OO1A 4LJ6A 4XR9A 5DEOA 4D2IA 1ZD5A 1IDN1 1KFBB 1XEWY 3PFHA 5AK3A 5DOZA 4G8DA 5JMTA 2ZYRA 2VP3A 3OTIA 4KGDA 1A4XA 1LX6A 4D6XA 3HRHA 1M3SA 2X0RA 3FNHA 1XLUA 1GNQA 2FEMA 3Q2IA 1T9AA 1WMFA 2IVFA 4QFDA 3ONVA 2EJCA 2WNHA 2XVAA 1I8TA 3NBMA 4BFSA 5M5BA 2I1VB 2WSLA 1QK5A 2VOJA 1B8OA 1E6WA 2H1SA 2UYOA 2QUJA 3CBQA 3QKRA 1U5CA 4L2IA 5EXSA 2J9FB 1QO0A 4QPCA 1VL6A 4TRJA 2GTIA 3LYLA 4FFBB 3HDQA 2CKDA 3QXHA 2XY4A 3DE0X 1JHMA 4YXFA 1Z3CA 2HZ7A 3ABSB 1VA5A 3NOQA 3R0VA 4HEJA 4GOXA 4KLCA 2UUBB 3IT3A 2VQ3A 5ED4A 3PYXA 4KR3A 1KSHA 1KZ4A 4J7UA 3GT7A 3SQNA 2BISA 2P9JA 4I66A 2AOTB 5E4TA 3IMEA 4FEEA 1Q14A 2BD0A 4V03A 4HOYA 4RTNA 3UKJA 1DTWA 2ZUBA 1SQFA 5HUHA 3MTJA 3T7EA 2X0DA 4EA7A 1A2KC 1FDVA 1WDKA 3W8DA 4BWYA 1WSAA 1LH0A 2W6MA 3IULA 4WNCA 4CF5A 1MJ5A 4WZZA 5DWQA 1PS9A 3MLAA 2QN9A 5C32A 3UWMA 3VKUA 1OC4A 3SVLA 4NK5A 3H19A 4H17A 4PO8A 1A5AB 3MT0A 3H3JA 3HDHA 5B3LA 2I2WA 3B1WA 2H1WA 2ZVQX 3DPSA 4CG2A 1E7SA 1VJCA 3I58A 5DH9A 4ZJZA 3ORFA 1XZDA 4GYKA 4M0FA 1HDIA 3GELA 3VISA 5A9SB 1YDMA 1A7KA 2DP4E 4IG4A 3LXUX 4KDCA 2SCUA 2FSSA 4L7VA 1KI8A 4YQFA 3B12A 3JQAB 4G1CA 3SHWA 4EPWA 1FFWA 2JFGA 3AR4A 4YA6A 3NVAA 5G0WA 1VJDA 3PD7A 3UC9A 3RUEA 4K9MA 3R9KA 2WSMA 3VYUB 2I9KA 3OFSA 5FFMA 2HRDA 4A03A 1FZTA 1YQUA 1VJ5A 3RIXA 3EZNA 2Q9BA 3EGXA 5AW6A 1QGAA 4BMPB 3HVHA 1SZJG 4PPYA 1O5OA 4KO8A 2Q6OA 3AP2A 2BY4A 4L8VA 5AH0A 3RSQA 1I4TD 4H59A 5FV7A 1BMFA 1C50A 4IICA 2Z5FA 3MWFA 1DZIA 2O8NA 3C87A 1N2CA 4RHYA 5MN6A 5FTLA 2RHOA 1OROA 4Q02A 1XVUA 3HCRA 4Q24A 3OUUA 4REQB 1TVCA 2YOHA 3HNRA 1EXDA 1KOJA 2Q5OA 4Z3KA 1H2FA 3RE1A 4D0RA 1K8XB 3DTNA 2NO7A 4CF3A 4GL2A 2GJ8A 4ZAFA 3CRRA 2Q21A 1I14A 3SC3A 2D2FA 1CRQA 1FBNA 3KVYA 2Z5GA 4M1SA 3PNYA 3P2YA 4OI1A 4A2QA 4CR6A 2CYCA 1CUAA 2FUKA 3OLZA 4NTZA 1T9ZA 3UJBA 1GPJA 5DULA 2P91A 1H22A 2PWPA 4GLFA 3ZR4B 5DSZA 1Q0ZA 2Q1SA 1NRXA 1TIBA 2CVOA 3BTVA 4V39A 2GA8A 2QVLA 5TXGA 3PJGA 1JVBA 3O3MB 4P2GA 4R0NA 4MAFA 4TTSA 3ZHCA 4Z1OA 2BSXA 4EG6A 1B00A 3O9ZA 2OUKA 1L3BA 2HD4A 3PVSA 3QLVA 4RJIA 3I32A 3ZWPA 5HIMA 1QAMA 2AEFA 2PEYA 1IY9A 1QG6A 3L6DA 5DCWA 5FYDA 4QUJA 5CK4A 2UUPA 3N28A 1SKYE 4IGIA 3ADBA 1TYBE 3N2KB 2GK3A 3KKNA 4BFXA 2A9KA 2WVJA 1T3ZA 2C3PA 4HG2A 3ETGA 4LFCB 1W36C 4OQPA 3HA3A 3FPGA 3DMYA 1FVFA 4P5EA 4BNZA 3U7JA 1T9CA 3STYA 5IJWA 2ONKA 2GN4A 2OZEA 1XTUA 4CMIA 2QA5A 4DLPA 3GRKA 3KG2A 1PGQA 2HRBA 4CIBA 1XEFA 1UJCA 2P9YA 4LZZA 2NG1A 3LT2A 4EPVA 3RVJA 1NW4A 1ENYA 3SS8A 3VVLA 1M2WA 2ZBUA 5TPZA 5AUPB 1DT3A 4ZU1X 4ZOAA 5KQSA 3VNAA 3UYKA 3K9GA 3E1GA 1QYXA 3OM9A 4I14A 4LPSA 4M1MA 5C1OA 2X9VA 4QDJA 1H1TA 2YJ6A 2WJVA 1U3DA 3ZHTA 1S02A 1TE2A 2ZS7A 1ZUNA 3K96A 4RA9A 1KWGA 1P2SA 3EQ7A 4IINA 1JDUA 4ZJUA 3P4UA 4L51A 1K66A 3A1WA 3NAQA 2EDCA 3N6RA 4F45A 1Y7TA 5G1PA 1GRQA 1UKEA 1K9SA 1NI5A 3W77A 2Q29A 4OREX 3CSDA 4UOEA 4GKKB 1N5RA 3I9NA 1B6GA 3B85A 3QYFA 2JNWA 2V6IA 4KQEA 2FB9A 4ZT3A 3BXPA 3VSEA 3U6KA 3ETJA 3FKSA 1EDDA 3KOOA 1RIFA 4CM7A 5BUZA 4U1RA 1WSDA 2WB2A 4C88A 1OHHD 3KJEA 5JMOA 1GKIA 4GR4A 3T9FA 4J1TC 4RF2A 5B2EA 1II0A 5LDDC 3QLTA 1J56A 4MRNA 1JBKA 2ZSFA 1KDZA 3WP1B 4JYZA 2GDZA 1BD3A 4YP0A 2MOKA 2XUAA 1JVNA 1CLUA 4R1PA 3ZQ4A 7MDHA 4EG7A 3E9DA 2CXTA 2F4VB 1BVUA 4YI5A 1QTNA 5HMLA 3OX1A 2X0EA 4JT2A 2Q1XA 1OWNA 1U0OC 2BHRA 3QFRA 2ORYA 2NU8A 1XC7A 4XQGA 3E8SA 1BCRA 1GTG1 1YRYE 2GK7A 4Q01A 2H1HA 4ENQA 1EDBA 2IPNA 3K7EA 1GGHA 1R6BX 1YZYA 5CPBA 3SMQA 1GU7A 3LYAA 1XEWX 3VHXA 5H4GA 1CQXA 3RM3A 4BV8A 3IP1A 2HA0A 2D5CA 1E2FA 3JQ8B 3Q3EA 3V8NA 4OI2A 4YP1A 5KEIA 4GHWA 3GVPA 3ZS8A 2RC6A 3NW9A 2PO5A 4NMMA 3AQIA 4YRFA 4Z7OB 5HQ3B 1UPUA 3KXKA 3OF5A 2LZ0A 3TSAA 4CT5A 1U0FA 3IHTA 3PCRB 2B5OA 1RRKA 4MEAA 1AE1A 2EFCB 2ZU0C 3WGKA 5G2OA 3U48A 2WQ7A 4HAYA 2GD1O 2V3CC 3VC7A 5I3CA 3MS4A 5F7OA 5LJLA 3AERA 3TL2A 4GOKA 3EZ7A 2QS9A 1OAOA 1X1EA 3RHSA 4AMZA 2J4CA 4I4NA 3A6FA 1NRIA 2ZRKA 4DUGD 2RI0A 4BO1A 4P38A 5FBZA 4TTPA 3FR7A 5ARBA 1G3IA 2C9ZA 5ES3A 3SJAA 3J80A 4DWJA 2OXRA 1V6SA 1XZEA 3CR7A 1E20A 1IBRA 1L5QA 3IVAA 3I6YA 1K6JA 1U3UA 3Q7EA 4MVJF 2REQA 1I7LA 4QNRA 2VPXA 2Z5VA 1IVNA 3DONA 4QASA 3OFVA 4UQPA 4ALNA 4NBWA 2PD4A 1JALA 4D98A 4QFMA 4XYBA 2QTHA 1WV0A 4GP7A 4YRRA 3ZGVA 4B7ZA 3EAGA 5BO5A 2A5YB 4NCKA 9MHTA 1FQWA 4MV5A 1T8WA 3I64A 1VL1A 1XTZA 2GVDC 5FR2A 4P0QB 3GT3A 4CDNA 4O4JA 1UDBA 1WRBA 2CLMB 3M8KA 2GFQA 4L0DA 1ZW6A 2AFIB 1P17A 2QTNA 2WZCA 3GRZA 3MJ4A 4TWJA 2JHGA 1D4OA 1DJMA 3PZRA 1GDTA 1UWCA 4RFVA 3TTUA 1R8QA 4EKIA 1NQXA 4X93A 2PA3A 1C29B 2R47A 2ZI4A 3R7AA 1DXOA 2JGLA 1PKEA 2WWFA 4RIGA 1XCOA 1D04A 5FEUA 4PE5B 4GBMA 4RKFA 1NNI1 4QYSA 3CVUA 4IHQA 3O5AA 2PS1A 1PX2A 4KBGA 1P7CA 2CYAA 4KQIA 1UXKA 3WK6A 3JQ7A 4W1RA 5FCDA 5LP6B 1UJNA 2OBYA 4ARZA 2C2XA 1RCFA 5CYGA 3CSUA 3Q3VA 1NBAA 3IBSA 5J2TA 5EJ2A 1IOLA 1RD4A 3NHJA 3K53A 4EF5A 3RADC 2XYPA 4QEZA 2F55A 1GYQA 1WZ2A 2VSYA 2JHFA 1A96A 4HN9A 2GPAA 4L50A 5L4SA 4Y1FA 4R2HA 2J9YB 4L76A 3K1TA 4GLJA 3QUTA 5B1SA 4R8VA 3ELBA 3KB1A 4HQ6A 4EO9A 3U3XA 4N3NA 2JIZD 1LD3A 2JATA 3EVDA 2XWSA 2JIBA 2PMCA 5DCYA 1N8NA 3LT1A 4FC6A 1ADBA 2M2IA 2ECQA 3MJDA 6NULA 1P72A 2BF4A 4RLHA 5L9AA 3O47A 3RJ5A 2JGJA 3LX4A 4GOLD 1Q7RA 2JJ2D 3SXUB 4I50F 3T35A 3ZI0A 4CI0B 3K0FB 3RSHA 1BQ4A 4W9MC 4MVJI 2RCNA 1PEYA 4TZKA 4EARA 4RD3A 3RYTC 4GRDA 1JT9A 2VSNA 3GT4A 4I55A 2WFAA 4OO3A 5A9RA 2BT4A 4BV9A 4IKOA 3SICE 1JEOA 3RI3A 4C06A 5CT6A 1UJ5A 3TLCA 1JQLB 4EY3A 2AG0A 3ADOA 2O19A 3JYLA 2KX7A 1Y5RA 1FTWA 1PNTA 1U1FA 4FGWA 4JH0A 4MUKA 3RNOA 3THWB 1SCBA 1TO6A 3ZU6A 1AQJA 3NHUA 1U1IA 1UDRA 2WVGA 1RU3A 2P0EA 1PSWA 3S44A 2C77A 3UH1A 1Y8QA 2TMGA 1Q0SA 1U7DA 3BJRA 3DEJA 1TOAA 3K0KA 5EHXA 2HQOA 1AH2A 2GAOA 4LE0A 5KNDA 1UEIA 3KZOA 3CJQA 1T5BA 2DKFA 3D6MA 2VHYA 5CPFA 4B3BA 4F4DA 5K0ZA 2IHZA 1P3DA 2ZBPA 3O4IA 3N05A 4CQJA 3N9IA 3IKVA 1MT3A 1FP2A 4Q9JA 1TQ2A 4ZPJA 1NJ5A 3RS2A 4N9QA 3ZHUA 1YFJA 4HN4B 4UZEA 3LF2A 4B2LA 1A4RA 1G2PA 2GCEA 3G02A 2IXEA 2FDCA 1IN5A 2HPAA 4ARVA 5LR6A 2GEBA 2A7XA 3D8RA 3ANLA 4FNGA 3LJKA 2GCPA 1P33A 4H6WA 1WDTA 4OAPA 1QFMA 1R0XA 1SXPA 4YYZA 1QOQB 1MAAA 2V7UA 5AM4A 1WBDA 5ALKA 1XXLA 4V1CI 5EC8A 1OFIA 3C6QA 1SHUX 1KU0A 4X44A 5B1DA 1TYAE 5CFNA 3JARA 4MQEB 1HYBA 2P4UA 3DT9A 4OB8A 5ELLA 3ZV3A 4F2WA 2BTQA 1NY6A 1X9HA 1X7GA 5EZSA 5H81A 3PFCA 4J94A 4RQAA 2PX5A 3EGDA 1FNMA 4OFWA 5L3QA 1SCUB 4CEHA 1XNRB 1Z33A 1VP9A 1X7ZA 5AVQA 1K27A 2PCJA 3OJFA 5HIAA 1GADO 4GPBA 2GN6A 4YO8A 4D92A 2EFHB 1GYPA 3MWKA 1USIA 1HLPA 3EOZA 2E3JA 4FEYA 3H3XA 3X1YA 2O6LA 2XYVA 3GLFA 2D13A 2D1RA 3LKBA 3PJDA 4FEGA 4JZYA 1YB1A 3O8CA 2PDAA 4NL4H 2X8BA 3I8XA 5FBHA 4IM7A 1VBNA 1RPNA 2GEJA 2QRKA 1LDNA 5B2ZA 3ZJUA 2C3YA 4GL4A 2FZ4A 4MPJA 5REQB 3GFQA 4XVCA 5KQLA 1EDOA 2ZYSA 1TMGE 1CP3A 1ZJ4A 1XKQA 2YHAA 3PSAA 4K5QA 3S4YA 4W8GA 5ADUS 1EUZA 4UAJA 2C2HA 1G1AA 2HK8A 3CR3C 3QFSA 4P33A 4N5IX 5KYYA 4LXUA 4LBYA 2KYRA 5KKNB 1C30B 1I3NA 2DQ4A 3ZOKA 2I62A 2Q5LA 3W5SA 2IXGA 3MBKA 4MQUA 3WLPA 3ME5A 4IUCS 2W6JA 4KPGA 4FMCB 4ZZ1A 4IOKA 2FFRA 3GXOA 2HMYB 4B85A 4HQRA 1G7TA 4F5WA 4F56A 4AW9A 4QG7A 4N0PA 2OE2A 4II2A 2RJOA 1WP9A 3D4LA 3I04A 1JR3D 1KY4A 2QMZA 4KSCA 3ZE7A 4EA8A 2HHLA 4HGRA 3U3JA 4V1CA 5LNK1 2QLBA 2VAMA 1V71A 2IYSA 3C43A 3CWQA 2R1VA 2OV6A 3MTDA 3V34A 3QM1A 3G2LA 2D3TA 1M5RA 1ZMRA 3R0XA 4J43A 1K6MA 4K6CA 5FTKA 1ATIA 1XPOA 4OHWA 4BO0A 3IQZA 2UZ1B 1K7CA 1NR1A 4GFDA 2I8AA 1FXWA 2E6UX 2CLKB 4IHJB 4MGZR 3IC5A 2I2XB 1SKMA 3GR6A 5LQJA 1G8KA 1RXVA 2XOKD 2ETVA 4G56A 2FSUA 1JKJA 4LTMA 1XTBA 3CXUA 4PTYA 3LZ6A 1I94B 4F7WA 1HFJA 4PG5A 3SMVA 1DRJA 4C4RA 1XPRA 5LMNB 1K86A 4LYEA 5IT9A 4BJ5A 3F2VA 4O6VA 1T9KA 2COUA 4BC1A 1QFYA 4UNQA 2WUEA 5JMWA 4AI6A 3L0YA 1T3HA 2ZP1A 3WYEA 3N7UA 4TLDA 4ZT2A 4PGFA 4F60A 1Z63A 2P77A 3WZMA 1CUIA 2AYXA 1EWVA 1S9DA 4EHKA 3FKSD 4JKOA 3K31A 3ONDA 1IPHA 1UOEA 1N8KA 4L74A 4MV7A 4PNZA 4R9NA 5FEMA 4IIGA 1N78A 3PEYA 1B1CA 3H8JA 1HSOA 2GCGA 3OOJA 4DM7A 2YV1A 4M0EA 2N47A 3HVRA 2ZUFA 4CQMA 4EJMA 3AC0A 4OQEA 4ZEXA 3HGMA 1SUAA 3DLBA 5DX1A 5E8RA 1TRKA 3PNQA 1ISIA 4YJHA 2JKYA 2CFRA 1RXWA 3BJEA 2REXB 3PFNA 4D44A 3MZ0A 3S2IA 1MQSA 4Z7NB 2ZRPA 5K3EA 4E0BA 3GW8A 4G3XA 1OX6A 1TVMA 4IIEA 3EIWA 1B8PA 4QLOA 2B5WA 1QRTA 5E2AA 1S2IA 2UKDA 1N5KA 3ZGZA 3EGIA 2PQ6A 1BE0A 2A30A 1FJHA 2F90A 4FR2A 4IJVA 2LRHA 3I6IA 3SR4A 3KR0A 3IGFA 1N3IA 2N9UA 2EIHA 1A8IA 4YRPA 3UWSA 3DDNA 3T1YB 1QPBA 1ZRSA 3DJFA 1PTKA 1BCSA 1YDGA 3MTGA 3PC3A 4JVMA 4I5DA 2OXFA 3ZGXA 3PBKA 2GEVA 3F9CA 3DYBA 4A8JA 4IZHA 4MO9A 4QJIA 1L7NA 5KPJA 3A1FA 4YQYA 4D43A 1GZ6A 1TAHA 5IM4A 1UJ6A 3I53A 4FGJA 2C0CA 2PSFA 3HJAA 1K3TA 2F6RA 4MB0A 2XSZA 3TZQA 4U7TB 4R0VA 2AQKA 3QKSA 4EGAA 2RCYA 3LCMA 4P3PA 1KIFA 3E18A 2Y4NA 3JATB 1EHIA 1SXJA 3D2LA 4KGZA 1FS4A 2C84A 3EDMA 3OJCA 1JPUA 1Z7EA 4F3NA 5GJWC 1I4WA 3R74A 4KSBA 5JWRA 2HDNB 1W93A 5F3RA 1JYEA 2FK7A 2FE1A 3QLUA 4IEEA 1C0LA 3B3FA 3LYUA 3QITA 4FIZA 2YZ2A 1U7XA 1V5EA 3L82B 3FLAA 1ZUD1 1RNLA 1MUUA 2ZJBA 3L1UA 1QGYA 4LHYA 4I3FA 1KEZA 3U62A 2UDPA 4Q47A 3KYIB 3SFZA 3FOFC 2O7NA 2EJUA 1KRWA 2G7MC 1HGXA 1H5QA 1TD9A 2N0SA 4UMDA 1EA7A 4XUGB 5GM2A 2WF6A 4N18A 4B09A 4EI2A 1L5LA 1F0YA 1XYYA 1XMXA 5FDFA 1A1VA 2IYTA 3V46A 3RIHA 4CUKA 3TGLA 2VPTA 4M0LA 5I01A 1Z5NA 1JIKA 2BYTA 1SFRA 5B1HA 1GPAA 2II6A 2OLJA 2WT8A 2WZDA 3BSSA 3OOYA 4TSRA 1V4VA 3SKYA 3OTGA 3FWKA 3EF1A 1SXJC 1C4OA 3TSOA 4CMJA 1U0RA 3WLEA 2JDIA 4ZRMA 3UMVA 1V1RA 2OSVA 2WD7B 1SG9A 4A0RA 1NZJA 3QI2A 3FDZA 2HIMA 4RMHA 5TQ2B 3AMVA 1XWFA 1TJ3A 3OPNA 1GPH1 4TTTS 2CXOA 2O3RA 2ZSUA 4UNNA 3TTWA 4G4SO 1U4OA 3GAZA 1CUYA 4B2IA 4ZAVA 1SR8A 2EG9A 2JFOA 3DXXA 4POAA 4LZWA 3ZK8A 1VJTA 4R2LA 4G5HA 2R1TA 3HBLA 5CAEB 4F1JA 1FYEA 3IS3A 3WGVA 4U7FA 3DDZX 4GI2A 1N8SA 2G77B 1SXJE 4LRTB 3ZXSA 5DHSA 4BFCA 4LSGA 2VHXA 3U5ZB 4B0PA 1C1DB 1CP2A 4BP8A 3WL5A 5EZ6B 2XB2A 3VKWA 2FR8C 4KW7A 4BCDA 4QT4A 2ONCA 2E4YA 2SICE 3QLJA 4HLUC 2HPZA 3E35A 4RSMA 4ZCQA 2I66A 3LGXA 5LZ8A 1E58A 2HB6A 3ONNA 3QELB 1P6XA 4ABYA 5A7HA 1U90A 4QBIA 5CIQA 5HTKA 2QP9X 5ESRA 3OOHA 5AJUA 4Z2AA 3X1XA 4Y18A 3DHEA 4AJ1A 3AZOA 3KQVA 3FRJA 1GV1A 3LXXA 2EU8A 4HXGA 3CF4G 3WLHA 2DETA 2BKVA 3FYSA 4MYSA 4P1ZA 2AQIA 3AGPA 1C41A 1CK4A 1M2VB 5A62A 3DV9A 2OHFA 4X64B 3FNGA 2NN3C 3EMVA 3QPBA 5KCZA 2ZIGA 3OEYA 3AX6A 3T4PA 2WM3A 1KO4A 1QFSA 1MJFA 3IBTA 4QICA 1EBUA 4N8EA 1R9GA 2VTVA 1XI2A 4JIMA 1Z5UA 4LOJA 5K3BA 9LDTA 5HXAA 2IY8A 1ZGJA 4Q93A 1B8VA 2I55A 1DL5A 3QW4B 2OV4A 1MA0A 4J7XA 2Q6VA 3A11A 1EUDB 1TZJA 1TCAA 2C9BA 4AJJA 4QTXA 5GQSA 1ZISA 4JAVC 2IEGA 5BWLA 4JA2A 1U02A 4TKZA 1L7QA 4X3OA 4IFEA 1AXGA 1A8HA 2ONYA 2ZI3A 4JEMA 3QXXA 4QNMA 3OKFA 1FMCA 1YJBA 4OHYA 3HNOA 2AX4A 2WTUA 2QX4A 3PF9A 4JI7B 1JLRA 4IIUA 2VP6A 5L8VA 4ZCPA 4XDHA 4MULA 3A1TA 1ML3A 2HTEA 4M8NE 5JUWA 4DV5B 1PL6A 4MWCA 2DG2A 1R9JA 3DKPA 1CQIB 3SX2A 2GPSA 4CCYB 3ZJVA 4UFOA 1WD5A 2BFBA 1DU4A 4MCIA 4C7XA 2YQ5A 2FG5A 4BIMA 2PXXA 2CSUA 4C4XA 2YW2A 4OLJA 1EQ2A 4O3MA 2DMRA 5C1DA 2J0VA 1EVIA 2Z4RA 1IHUA 4OLBA 2BVNA 2E9SA 1V8DA 3QLEA 3OTWA 1IK4A 2E55A 3HDGA 4TXJA 2EQBA 5FA5A 4XWTA 3TNFA 4ZZ3A 1ZPDA 3A2LA 3G6KA 3PYMA 1XE3A 4DG8A 1T0UA 3AM1A 4G4SP 5G53C 2GFHA 3DLHA 5K0FA 1V45E 2DUNA 2CCGA 3MWEA 1LPOA 3PXBA 4KQKA 4R1OA 2OK7A 2XDQA 3VVBA 1SIWA 2I67A 3R23A 4WPGA 3SSOA 2PVCA 2PCLA 1T1JA 3KR9A 5JS6A 2V7XA 1QUFA 3IVCA 4CT0A 1CSEE 4HNRA 5F5NA 1U63A 2BGKA 4BXOA 3C4JA 4Z4CA 3DVAA 1G64A 5SV2A 1QZZA 4MAAA 3H5WA 4G2NA 2CXHA 4PYIA 3QVOA 4KR7A 3KHSA 1ZMTA 1EEHA 1B3BA 3Q5GA 3ZGNA 2MSWA 3BMQA 2PWBA 3OQHA 4LG1A 2RJ3A 3LYHA 3AUJB 4H3HB 2W6IA 4RPKA 3CISA 5ICFA 3JSAA 1YR3A 4RYDA 4FJ0A 5K9ZA 1UKAA 3UUFA 4DSZA 3OECA 2BMEA 5DEIA 1RJFA 3V3KA 1XZJA 4I6GA 3TLMA 3TTSA 2CWDA 1XAIA 3F74A 1IVYA 3T5BA 1YB7A 1L8LA 1FP4A 1CVLA 3FPHA 4M86A 2UZ1A 3O75A 5TX7A 3U26A 3UAXA 3BIOA 1G98A 3AL2A 2PBFA 3H17A 4A8TA 1ZM2A 4YBZA 5IJXA 1Y3BE 2ZE8A 1Q84A 2DSNA 2YUIA 4HSGA 4MMXB 5JFTA 4TLEA 5DI3A 4C4TA 2G1JA 4LZOA 5FQOA 2YQ4A 3FBWA 3R7LA 1HI9A 1HZZC 4I9GA 1SBZA 2O7VA 4P22A 3DC7A 3NGLA 4ZYWA 1N2CE 2IVZA 1ATZA 1SA0A 3IP3A 2CDAA 2EBHX 2FQ1A 4TXHA 5E2BA 5TMEA 2FRDC 3RO7A 3WLTA 1YFKA 4BQQA 4A26A 1XVIA 4RSGA 2ZR0A 3A4IA 4DA7A 1GNTA 3RASA 2WZQA 3I4CA 4DV6B 1HE4A 2NPFA 3AU9A 2ZREA 3DBHB 1L4EA 5IX8A 1DE0A 2ETXA 2V5VA 2CEAA 3IUEA 3JYOA 4EJ2A 5DNUA 3QKSB 2XNHA 1SC9A 1X39A 3H11B 3W7VA 2B99A 1XAHA 2JK0A 1TW3A 1SHTX 2CFSA 5CYPA 2ET6A 1U7PA 5DYGA 3KJZA 5C8YB 5ENVA 1H2XA 4QGFA 1T26A 2HCBA 2WJGA 4PINA 3I61A 1XEXA 3FUVA 5LKRA 2ZFUA 3RVDA 2DU8A 4C6SA 4LVCA 2BOVA 4MUAA 5AP9A 3T3GA 3EX7C 2OD7A 5F2KA 4Z8XA 3ZU5A 4N48A 1C3VA 4FQ8A 4PEVA 5L95A 1IATA 2CCJA 2P8JA 3CUSA 4J0DA 2OEPA 4JOQA 4MPTA 1OAAA 3N8NA 4O1MA 2FLVA 2FPGA 5EHQA 3SR0A 4ARCA 3A6PC 1QP8A 3BYZA 2DHCA 1PFUA 5TGTA 1L5NA 4FMCF 4Y2RA 2VBCA 1KI4A 4RESA 3IR7A 5L3QB 3TLGA 3EGDB 2EWVA 5AUNB 2A0KA 2IXAA 4IQ4A 5I7OA 4BO5A 5CEFA 3AOEA 1K0FA 1EHCA 1MNAA 2FUG1 3RUDA 2AQHA 5GZ1A 2HU7A 2WJPA 2VHVA 2JI8A 1NASA 5M2QA 1VB5A 3PIRA 4BCCA 3GROA 5F2EA 3NZEA 1AKQA 1CR2A 2JBAA 2W0SA 1M1NB 3KWFA 4L4UA 1GCOA 1EI9A 2IXDA 5E95A 4UM5A 3ZD7A 1ZX1A 4J49A 2E48A 4OJNA 2H1RA 4BFVA 2ZSBA 3OHMA 4UNPA 3S1LA 1BEUB 1LB1B 1PLKA 2CLHB 5B7QA 1NUQA 4Z9XA 3TDKA 3WNDA 1F1JA 4ZI2A 1UOPA 1MOQA 1Y1PA 3FYDA 3GNLA 2ICAA 2BEJA 1MX9A 2Q3JA 3B7WA 3PEFA 4M8SA 1DC4A 5H82A 1P3Y1 4WNYA 1YR2A 1NOKA 3F1LA 5F64A 3ZTWA 2JKVA 2A4KA 1BXRA 1GNLA 3EXFA 4DAOA 4E88A 1EE1A 1PQYA 1SC1A 3RSSA 2OILA 3PQ6A 3ZXXA 1H4SA 5JJLA 5EN4A 3UNXA 1ZRNA 3DJYA 3WRXC 3OX4A 4GMGA 3WDMA 2XCSB 4KEAA 1K97A 4R05A 2P5SA 1FLNA 2W6NA 3S29A 5IUNC 2B8EA 3NJRA 3MXTA 3WK4A 2E89A 2C59A 4U3JB 5THQA 4C5AA 1DFGA 3GC6A 3LP5A 4FW8A 4RTJA 4K9RA 3F78A 2AWOA 1A2BA 1V6AA 1E2BA 4LF9B 2YN4A 3UK2A 2ZE5A 3U13A 1EXWA 3IP7A 1B0UA 3L04A 4CL2A 3KQUA 5AVKA 4M55A 3RFVA 4KYUA 1YQQA 2FUNB 4A5SA 4QVIA 3G2OA 4KVFA 4IWYA 1Q83A 1C1XA 5CVCA 4L85A 4C4OA 2QUKA 3IPYA 4P6VF 3GBPA 3NJ8A 3TTXA 1KFKB 1Z0UA 3QKIA 1M1ZA 3D6UA 1OJLA 4D8XA 1GTSA 2JAWA 4ON9A 4TKLA 2A9RA 1YRHA 4ENWA 5BW5A 2C1EA 3AVUA 3QP9A 4JLUA 1DQYA 2HJWA 1QKIA 1A97A 1WCWA 3P9PA 3HE3A 2FA9A 3IDZA 3UAZA 2C9MA 2Z83A 2ZRJA 4PSVA 2JGAA 4LJ7A 2OQVA 3H1EA 4ZT7A 5E0OA 4HYEA 4AICA 3PRJA 1H8ED 2W4MA 1VMAA 2XRYA 1M8GA 1LWOA 3THWA 3BMCB 4CMAA 2AL7A 4BAZA 3COJA 4TV8A 2WIJA 3DAGA 4FTWA 4BASA 2V0NA 4X60A 1HYEA 1TD1A 1Z68A 4KHZA 5LQMA 1DAKA 4N7RA 3HCDA 1MCZA 1DEHA 3MYRA 4Y8VA 4XGQA 1PJLA 3L8ZA 1BJTA 2Z2IA 3CUYA 1Q5PA 4J0HA 3I4LA 3OP1A 1EEXB 3BGVA 2G1AA 1R9MA 1GZUA 3KEOA 4H7EA 4QA9A 3QYPA 3PC2A 4A1FA 1K7YA 4BNDB 1X1DA 1HH4A 1BN6A 2NPIA 2PVPA 4KI7A 5C8VA 3R7WB 1QIKA 4B32A 2OORC 3WWPA 4GC5A 1R6VA 3QSYA 4CEHB 4ESVA 2IYLD 2VS1A 3HB1A 2Q2OA 4G1UC 5DNEA 3FETA 2ZJYA 2ZDQA 5DHTA 4MQEA 3BEOA 1IMJA 4J0FA 4X1KA 2O2SA 1GL3A 3WB1A 2DOKA 3FG9A 3ZG6A 3CUVA 1F8XA 1PR5A 3TQQA 4DJTA 2YNMC 2FMXA 1ISRA 4M36A 4Q37A 5IJAA 1ZOLA 4FFVA 2IYZA 1VHTA 2XCQA 4EPXA 1P9NA 5ERYA 2J87A 3Q6MA 2I4NA 1EU1A 3EVFA 2JZCA 4YMIA 4PLCA 4M21A 1EHYA 1O95C 2H65A 2Q5IA 2R3SA 4PC7A 3JS5A 1EVZA 4M4SA 5JJIA 3GEPA 3DNMA 5IKOA 1GNSA 4QOEA 2HKIA 3P2KA 4GH5A 4RX1A 2H1VA 4U9IS 4UBOA 3UMCA 3OQOA 2CT8A 2VJLA 2PRSA 3EUAA 3V6MA 2FWPA 3V4PB 4KLNA 2HMSA 2EF1A 5H7XA 3VJKA 4B0OA 4J2TA 3SN6A 3LMKA 5D3KA 4WOCA 1W94A 3WGGA 1TVKA 4E5NA 5ALTA 1DRVA 5CB6A 1V16A 3KOMA 4HZGA 4OHOA 2JJ8A 4ZYYA 5I4BA 4I1OA 4Q4JA 2KLBA 3AERB 1MTOA 3TOSA 1WUYA 3GRUA 3PIDA 4L4YA 5GONF 1DOHA 3L4BC 4RORA 2QUAA 2BZSA 1XWWA 2VSOA 2IA5A 1JNXX 1KA9H 1PR4A 4ICIA 1OHHA 2G83A 3KKQA 4HX2A 1E79A 1NUUA 1QYIA 5FOXA 1XFDA 1QH8B 2YNMA 3I5AA 5K8VA 1RJ9B 1XPUA 4J1SA 3G9XA 1POWA 4LDPA 4UNIA 3U4DA 2R6R1 1P1JA 1I9GA 4CKWB 4Z86A 4LXTA 4V0NA 3AVTA 1E0DA 4PRYA 5AXDA 1G6OA 5AICA 1N6IA 3REGA 4K46A 5HUQA 1Z75A 1O96A 4QXQA 3SXUA 4C21A 5IH7A 4BMYA 1U7OA 1YDFA 4LOLA 2XQGA 1JEDA 4EVSA 5C8XA 3H2BA 3OZDA 5B6IA 2PWZA 2WQZA 3LRTA 1W52X 4X6UA 5TRTA 3PNBA 1WQ4A 3O4HA 1D2GA 1PWYE 3BCRA 3BTUA 3KVVA 3ZV4A 2WYWA 1VE9A 2YVQA 3EAQA 2J67A 3QYAA 3BL5A 1J0CA 3IUMA 1HFKA 3KK0A 2PSJA 1XNGA 4YJ2F 1YVEI 1Z8DA 2JCYA 1PRYA 3LFUA 4YMLA 3ONFA 3AHGA 1MIOB 5KCMA 2A1TR 4D9MA 1XX6A 4RTSA 5J2TB 1VDZA 4QJ5A 1DC3A 1LVGA 1T0PA 3RJ9A 1J8QA 1OBHA 4MRSA 5D51S 4G8BA 3O4VA 3C6YA 4M37A 4H7KA 4UFNA 3TW8A 1II8A 4EPTA 3IE2A 5FUQA 5LP6A 9LDBA 1FOEB 3KUDA 2NSHA 3ICPA 2VATA 5K0TA 1X8XA 5KSOA 2XYRA 3MJCA 2Q0SA 3QRWA 1TQ6A 1C9EA 4B6JA 1ZCBA 5L3RA 4DM4A 1C0KA 1IHXA 2JASA 3UT0A 1KPGA 1ZIYA 3OLQA 1U2GA 2DBRA 2OCBA 3O4JA 1RHUA 4S24A 4DCJA 4I1PA 2QMHA 3EPPA 1L7VC 4HBGA 3VHLB 2ZIVB 3FNIA 2PH3A 7REQB 2BR5A 3P71T 4ZO6A 4NV1A 1QAOA 3TGPA 4IS2A 3A2MA 4EY5A 1ND6A 1M67A 3LGSA 4C87A 3TOXA 1Q77A 1UMCB 3IAAA 1N5MA 1HURA 3FYCA 4FX2A 3UK7A 5AW8A 3LT0A 1U9YA 3GDHA 5IASA 1LPMA 2VAWA 3Q2OA 3UWDA 5KNCD 5FPSA 2PMKA 2QN1A 2W6OA 1BX1A 3JVDA 4KAJA 4PYQA 1EM6A 5GPBA 3HVUA 4IIVA 4LKOA 3LUHA 2G1UA 1CZUA 2BEUA 1KAOA 3KOYA 3PDIA 4G1FA 3VR4H 1F9AA 1CY6A 1XZLA 1G59A 3RUHA 1ZSVA 3MN1A 5ESXA 4EF6A 2OMKA 2BFDB 3D3EA 3PGMA 3CRMA 3LHKA 1NFFA 2B83A 2PUWA 3AINA 1PLJA 2RGYA 3H2JA 3R3JA 5EIBC 3PGXA 1S2MA 4E3WA 5HM6A 3B8HA 1EWQA 4UHHA 4PLGA 2EKLA 2O52A 3X1JA 1PLLA 1QNLA 4GPZA 4KAXA 1GTRA 3V1UA 4C2UA 3F6EX 5ICEA 1M8KA 3WRXA 3TI9A 4HQLA 1OSNA 2WP0A 3KV3O 1ZEMA 4GM0A 3ZWCA 1BDBA 1L4MA 1KOGA 3V2HA 3FWPA 4FMBB 1OIWA 1N6NA 3EULA 4PZEA 1QU3A 2PL9A 3PT9A 2P4QA 4NYJR 2ZW9A 1GG5A 4OQMA 4TL9A 3VTAA 4KHPB 2J32A 4O8ZA 5E9AA 4BVGA 2QN8A 2R5NA 1WMDA 2XQJA 4KQHA 4LFAB 4BZXA 4R5HA 2H9AA 3W3AA 4HNAB 5C8ZA 2LVBA 3RVKA 4IY1A 1EJ2A 4U7JA 5HFNA 4YRDA 4EYQA 4XWAA 4EY6A 2A57A 2IIPA 4J9UE 1G8GA 4F9EA 4YTEA 2CFTA 5JI3E 2DBZA 4D1YA 3H42B 4L9SA 1L5GB 2WNIA 3RK4A 3VPSA 1VPTA 3KJGA 3UT5A 2JIZA 3CB4A 4FFRA 4G0OA 5KYGA 2ADOA 1GJRA 4HLNA 2H8KA 3ZXUB 1GVNB 1NU6A 2YJ3A 4R8RA 1Z12A 5EUCA 2WWRA 3KDAA 4JR0A 3PNKA 1BCRB 3O90A 1BHQ1 3TZBA 1J0AA 2GETA 3ILHA 1HOTA 1JS1X 1U0SY 4EI8A 3P0EA 4IUDS 1FK8A 1HE3A 4OX9Y 1L4KA 4LJKA 4HTAA 5A4FS 1BTOA 2ATCA 2DFVA 4QXAA 3EGCA 4KTVE 3PWKA 4GGPA 2AFIE 2I2DA 4BKOA 4KPYA 5E0KB 1E2EA 1ZITA 4GKBA 5AKXA 1ULAA 2VTDA 4BZZA 2Z3VA 1HRDA 1JIJA 2I6SA 4RY2A 1NLZA 2R8XA 1N5LA 1FU8A 4KE9A 2F3UA 1THGA 4X8MA 3B1FA 5I4IA 1PG5A 1FFGA 2V9PA 3IKJA 4V0SA 5FOWA 4KXLA 5AVRA 3AI1A 3S2GA 2VYNA 3H99A 1NM5C 1NX6A 3NHFA 4YT8A 1FFDA 3P20A 4ZO7A 3N58A 2WWIA 3WQBA 1LS1A 4JUCA 4DANA 1R6TA 2NZWA 4Z4FA 1PNOA 5KHLB 1CKEA 1NQ5A 3HB0A 4DMCA 3GYBA 1V6CA 1NYLA 5HK8A 4KAAA 4HV4A 1RFLA 3FF4A 3FVQA 4Z0NA 4R2XA 4JC8A 2FN7A 4JJIA 1PEKE 4WHMA 4B31A 4RKEA 4S2UA 1NL3A 1VXRA 3BXZA 4M8KA 4MVJG 4DTCA 1XDBA 2O3JA 1V9LA 1P9LA 1ZN2A 2C88A 1ZCZA 2A78A 1LU9A 1P8AA 4ZREA 4HMPA 5DYYA 3WKEA 4FK8A 2M6SA 1EB8A 1JSXA 2X4IA 3HN2A 3M2TA 5EWMB 4MWEA 3T7AA 1NVFA 2JA1A 2OCXA 1RCUA 2WTAA 3L6CA 4Y9DA 2EG5A 4CMIB 1HT2E 5I7WA 3DFKA 1WBJB 3SAJA 3CNHA 3G49A 4IXWA 3EPLA 2PV7A 1E89A 1YACA 3UZUA 3H7IA 2I7XA 4W6QA 5F2NA 4IJ5A 3GJZA 1MFPA 1BDIA 2BJHA 4HUQB 3TL6A 4BNFA 3KKEA 3GAMA 3UQZA 3P0FA 1N32B 1SVNA 2PD6A 1KKLA 1IEWA 4ISBA 1E2QA 1ZD9A 4KJXA 2FMHA 1HE8B 1FB5A 3CEHA 2HPHA 4LS3A 3UC5A 2GD2A 2ZLBA 3NC4A 1Z2AA 3L7KA 2EATA 2JGRA 3H2YA 5AJZA 2YXLA 2H4FA 4OI4A 2C0PA 4FGUA 4AMGA 4GOOD 2Y0CA 3WLLA 5KMGB 1QQ5A 3L6EA 3N39C 1W4ZA 3E9RA 4Y2YA 1J2YA 2X8JA 3KLBA 3ZUPA 4F4CA 4IJ6A 4HDNA 1XCPA 2IYAA 3NBXX 4DUPA 4IIXA 4MRRA 3UGJA 3UMGA 4RDCA 5BQOA 4NPCA 3AL0C 2WWHA 2GNOA 4Z4HA 1TPYA 3E27A 2ID8A 1P19A 2G67A 3IERA 3AEQA 3VR6H 1ODKA 3CNBA 5GINE 1YQGA 3R6DA 1SUSA 3E22B 3OIVA 1OH8A 1SUEA 3E5NA 1XHFA 5AIBA 3WQQA 1EFKA 4HWRA 4BRSA 4G36A 1DBSA 5FWAA 2IV2X 4E46A 1IE3A 4LYHA 3DDHA 3OE4A 2Q2NA 1EFVA 4MJ7A 2ZAMA 4UVIA 2HA6A 4Q7EA 5DNVA 3ZWVA 3RDPA 3D5QA 4UMVA 4B4WA 3HKDB 1WU7A 2CKMA 3LBFA 1FSPA 1DEKA 1WB6A 3OZEA 3P2IA 4MYDA 5AKYA 5BN3B 2XE4A 4GMKA 4URHA 1ZC4A 4YLEA 1U0TA 2C1ZA 3TECE 1O9BA 4AS2A 1GSOA 3LIIA 1QF9A 3GAAA 4RZUA 1EFRA 2VJBA 3E4CA 2R4TA 2LIPA 3FOWA 2BEWB 4MUBA 1ESEA 1NQAO 2DSTA 5JLAA 4DV2B 2QAGB 2VZ0A 4MMZB 4DSOA 3PXGA 2HF9A 3TI7A 1WCIA 4FT4A 1C9KA 1OY1A 1RXEA 1QS0A 3S0JA 4MR7B 3W1WA 3BCSA 4BNYA 2I6FA 2F2TA 2MSCB 4HMOA 4WLOA 5T5QA 1AV6A 4O2BA 4MQ4A 1B2LA 3WOVA 1FP1D 1QR2A 2XE6A 4M0UA 1UEXC 3PUXA 5B30A 1RBZA 1YSCA 1E2UA 1E3WA 3RS4A 4F21A 3K4QA 1L7AA 3KS9A 3HB7A 1OGYA 1JMYA 2IYXA 2OV8A 2P1ZA 4Z4EA 5JAOA 2XNDA 3BILA 3TMKA 5LMZA 3WSWA 3UQYS 4BYMA 1QYWA 4O59O 5CXXA 2ZBGA 4MQLA 1V3QE 3D2AA 4AJLA 1UJBA 3EXEB 3I01M 4DJDC 4JJEA 2IH4A 3T0FA 4G0ZA 1H1DA 3WQHA 2FZEA 4U39A 3RREA 4C3VA 2K7FA 4AMVA 1FDSA 2FX5A 2J9FA 3IAS6 1QH1B 3WFJA 3JVVA 4AULA 1SD1A 1CUVA 1WAMA 4NYIR 4D7AA 4PPQA 4ZU6X 4B33A 3MRXA 5EMLA 1KEEB 5CB4F 2X7JA 2HA2A 3BB4A 2H4XA 1MD9A 1G9TA 3I6MA 4EYEA 4R2KA 2ZTMA 2P62A 3TIVA 4TYNA 1N6PA 4ZC8A 2QQ0A 1U6KA 3HBJA 4TYQA 2OV2A 3H1TA 3MHTA 1C9JA 1VDMA 4NI5A 1H8EA 4UNSA 2OZLB 2K5UA 3ZDRA 3MAGA 1AM4D 2JD2A 4NHEA 5EJFA 6GPBA 2Y77A 1G41A 5F77A 3EZGA 5FAXA 4DCNA 1A1SA 2C5AA 2CMGA 2RHWA 5ARDA 4MQFA 5EQTA 3BZBA 5IJ9B 2A35A 1ULHA 1NNLA 1QE5A 2O2YA 4G65A 5CMLA 2B1IA 3W9YA 4M0PA 4DIMA 3HK2A 4NICA 3TLXA 2P0YA 1AA9A 2QYHA 2P69A 3CXRA 4ZU3A 4ROTA 4YASA 3A37A 2UZAA 2JS7A 1PZEA 3D54D 2XCOA 2HSJA 4Q9NA 4YJ3B 3NWBA 4Q3BA 5C2JB 5I4KA 4M1OA 1ISMA 1ZVKA 5KNDD 5HYVA 3QVXA 3BN3A 5K01A 2YYZA 5SYMA 5IT4A 1KORA 2GCOB 1XSEA 3N2IA 5JCZA 1Z3IX 1V11B 2ODQA 3B7GA 4DR5B 1R0LA 2X1LA 2YV5A 2VJMB 4CM4B 5CB4B 2OOSA 3TZCA 5TMBA 5JXGA 3STVA 2C7PA 2PPLA 2VLIA 4Q1BA 4Q3DA 1T3SA 3L7NA 4JI4B 4CG0A 2QN2A 1UXOA 1GFIA 2EP8A 3FCEA 1CEXA 5K6AC 2QRLA 3G5LA 3E2PA 3DEFA 3ETLA 3ISTA 4YRBA 1TYEB 5FWYA 4G0VA 4KBYA 4DDVA 3UG6A 3WL6A 3AHFA 1U3GA 3Q0IA 1YDWA 1I9CA 2DH5A 1E3EA 2PQ0A 3PQ4A 3WIVA 4KQ2A 1X87A 5ALRA 1P1RA 2WJYA 3MWLA 2F1IA 1OUMA 4RHUA 1OI7A 3NP7A 2KPOA 2WJ6A 4QTTB 2JLAA 3A1EA 4X20B 1I01A 1VZ2A 3WYDA 1KO8A 4TUYA 4OSPA 4B47A 1LVHA 2HPVA 5DU2A 4UM7A 3U3OA 1FYDA 3K9QO 1WY5A 3HJCA 4JD5A 4AZWA 3TSWA 4NOLA 1RAGA 3OMXA 3ICWA 4K05A 2WIGA 3C1OA 3QUQA 5ALOA 3EOBI 3AVPA 1WU8A 4WN9B 2HA3A 1S8FA 3PXAA 1N2JA 2GN0A 1MW8X 2UVPA 4YAFA 1Z29A 3GQBB 4EG1A 1KK1A 3ICOA 3U39A 3GJ5A 2C5SA 4L4SA 4D6PA 5E4FA 4E2YA 2UXCB 3QHAA 4JJFA 5A5EA 1VJ0A 3WI7A 4WT7A 3A28A 5MHTA 1SOVA 1YBVA 5JPCA 1VIDA 2I4MA 6REQB 1HDOA 4IGEA 3QE0A 5EZYA 4YX9A 3KSDO 4ZV7A 1V26A 2F8LA 2W6JD 4RNDB 1M7HA 2PS3A 3OOEA 4BO8A 1TVEA 4RH1A 1SQ5A 2K6GA 3JD2A 4NEGA 4GI7A 5THKA 4DXAA 3FTFA 4K9NA 4JB3A 5ER9A 5IBRA 1LY1A 2HHJA 5FOVA 2IHBA 2NO5A 1BQ3A 1B1AA 4JQOA 2WR8A 4B6GA 5JXHA 2H92A 2GPYA 3VNVA 4M0DA 5A5GA 2IYUA 1ISFA 3CZAA 3PDUA 4RQUA 1ISGA 4XZ3A 3SLGA 4H6VA 2X4LA 4KWHA 4ETWA 3PJRA 1KVQA 4WFKA 4X3PA 3BXEA 4AVYA 5CD1A 5JQGF 1Q16A 1JDPA 1X7YA 2G71A 3CR8A 4HWKA 4XB2A 1RQPA 2XMBA 3WLQA 2EZ8A 4AC9A 1VQ1A 4UOZA 4TN5A 3IUYA 2GCIA 3VYWA 1W1WA 3QXSA 4UVDA 5EL0A 3SLKA 5C7IO 4DW8A 1UT8A