4LTDA

Crystal structures of nadh:fmn oxidoreductase (emob) - apo form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
192
structure length
187
Chain Sequence
TYSIVAISGSPSRNSTTAKLAEYALAHVLARSDSQGRHIHVIDLDPKALLRGDLSNAKLKEAVDATCNADGLIVATPIYKASYTGLLKAFLDILPQFALAGKAALPLATGGSPAHVLALDYGLRPVLHSMGVRHVVQSFFMVQSQFSLAVEDDVASQLNNAIDHFRLSLSSEPSTRHLGHPRPSLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-dependent FMN reductase
publication title Crystal structures of NADH:FMN oxidoreductase (EmoB) at different stages of catalysis.
pubmed doi rcsb
source organism Edta-degrading bacterium bnc1
total genus 61
structure length 187
sequence length 192
ec nomenclature ec 1.5.1.42: FMN reductase (NADH).
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ltdA00
3D7NA 4GI5A 3F6SA 2Q9UA 1RCFA 4YAFA 2F1OA 5EAIA 4Y7CA 1JA1A 1J9EA 2XODA 1XT6A 2ARKA 3NFRA 4N9QA 2Z9DA 5TGZA 3NHUA 3KAQA 3UXEA 3FVWA 1YDGA 2M6SA 2BN4A 4HEQA 3G5MA 1CZNA 5FX2A 3KEGA 3ESYA 1SG0A 1QR2A 3L9XA 3SVLA 4FGJA 5LVAA 3GFRA 3OX1A 1NNI1 2HNBA 2MTBA 3EYWA 2B3DA 1OFVA 3NHWA 3ES9A 2ZKIA 2AMJA 1AKQA 4DILA 3R6WA 4H2DA 4FX2A 1CZLA 1AG9A 3HR4A 4QOHA 3W77A 4DIKA 1E5DA 4N65A 1XI2A 3L9WA 5B3LA 3P0RA 2V9CA 3ZHOA 3HA2A 1FLVA 1H69A 5EMNA 2XOEA 2Z9BA 1FVXA 4NLLA 2QX6A 1KBOA 3QFCA 3ESXA 1VMEA 3NHKA 1XYVA 5BUCA 3EDOA 4FGLA 4M0CA 1ZWLA 5F4BA 2X2OA 1AKTA 1AKUA 2RG1A 2FZVA 4J8PA 2R97A 1TLLA 3NHFA 3ESZA 5LMCA 5NULA 3B6KA 1YRHA 4LA4A 4PTZA 4U7FA 2WC1A 4PU0A 3OVMA 3KLBA 4CETA 1ZX1A 3OX3A 3O2NA 4C0WA 4LTDA 3KAPA 1T0IA 3N39C 3NHPA 4ESEA 4YAUA 2MT9A 4QOIA 4HS4A 3W7AA 3W78A 1F4PA 3K1YA 3B6JA 2BZSA 2Z9CA 4GR9A 2R96A 4BMOB 5B3KA 4ZVMA 1YKGA 1YOBA 2KLBA 1ZWKA 1AKWA 5NLLA 4D02A 4U7HA 1WSBA 1GG5A 1CZHA 2Q62A 1J9GA 2HNAA 3GFQA 4H6PA 4YQEA 2OHIA 2A5LA 3TEMA 4R81A 3NHRA 1FLNA 5A4KA 4DY4A 1AZLA 4C14A 5FUQA 4F8YA 3B6IA 1J9ZA 4QODA 1J8QA 4Y9UA 3N3BC 1D4AA 1CZOA 1OBVA 3F90A 2FCRA 4QOJA 3B6MA 1FLDA 5F12A 2QX4A 2GSWA 1QRDA 3LCMA 1X77A 2FLVA 1RTTA 4QOFA 4S24A 4BMPB 5LJLA 4U7GA 3NHLA 4LTNA 1YCFA 3FNIA 1OBOA 3F6RA 1QHEA 3HLYA 3OX2A 1BVYF 3OJWA 3S2YA 4CF6A 1FLAA 3GFSA 2Z98A 3TZBA 3NHSA 1T5BA 1FUEA 2OHJA 4C76A 2FVXA 1H66A 3NLLA 1C7EA 2KQUA 2V5VA 4XDHA 3RPEA 1V4BA 3U7IA 1RLIA 2OYSA 2QMZA 3FJOA 1BU5A 3FX2A 4ZVKA 1DX9A 1CZRA 1SQSA 4OXXA 2QX9A 3LT5A 2QMYA 4N82A 1DXOA 4C0XA 3OWXA 2X2PA 1QBGA 1D03A 3U7RA 2OHHA 3N3AC 1FX1A 2MWMA 1DXQA 3O73A 3GAMA 1D04A 1WSWA 2D5IA 1C7FA 2HPVA 3JSXA 4FGKA 2BMVA 1YCGA 4ZVNA 1AMOA 2V5UA 1RLJA 2FZ5A 2QR2A 2FX2A 5LJIA 3F2VA 6NULA 2BF4A 5EA2A 4YAWA 4NULA 5JROA 3K20A 2FAXA 1TIKA 4ICIA 5LLDA 2BPOA 4QOEA 2QX8A 3NHYA 4Y9RA 4ZVLA 1AKVA 4LTMA 2FOXA 4PTYA 2N1MA 1YCHA 2FDXA 4LAFA 3W79A 1AKRA 1AHNA 3OWHA 1B1CA 5LBUA 5FA6A 3QFRA 4GQIA 1I1OA 1FTGA 3QE2A 1CZKA 5ULLA 3TE7A 1CZUA 2QWXA 1KBQA 4QOGA 1JA0A 3FW1A 5LBTA 2M6RA 2MOKA 2W5UA 3OJXA 4YALA 1XYYA 4YAOA 3UXHA 3NHJA 5F51A 4XDGA
chains in the Genus database with same CATH superfamily
2WAXA 4ZZ0A 1NOKA 1A4UA 3C6QA 3Q0IA 1WXHA 4ER7A 4TVOA 1HBJA 3E3NA 2CBZA 1MTOA 3U3MA 3I2YX 1VBKA 5IVDA 4TXLA 3GMTA 5EWLB 1RQGA 2PL3A 1RRKA 2ZE5A 5GOZA 2ZCUA 3T54A 4MVJA 4YACA 2IPMA 2YOGA 2CBGA 3VA7A 2D2IA 1ZM3A 3SQMA 3EXHB 1ZM9A 3RS0A 3R7WB 3JY6A 2JBHA 4O4IB 5D6NA 1P7ZA 1EAMA 2QIOA 4J2HA 3AILA 3PYLA 4I4LA 4RHTA 5TX7A 1V3QE 2ZJFA 1OH6A 4A15A 5KYYB 1E3DA 2P9CA 2RGWA 3BG5A 2XD9A 5HK8A 1AXRA 1U90A 5GIOE 3NAZA 1Z7EA 3DEAA 5FUWA 4EFKA 4S2EA 1G8HA 2VP0A 3CE6A 1ZY2A 4QFDA 1YDGA 4XGRA 1K0FA 3ET4A 1JFLA 1MHPA 3WLNA 5EHIA 2IGTA 3G5MA 4E5KA 2B8TA 1AN9A 1BWSA 4HLDA 3QQ5A 4YJFA 5DCYA 4RD6A 1M0TA 3I61A 5AKZA 4ND8B 3FCYA 2W6ZA 2YNMC 4BAZA 4HXGA 1JR3E 4M49A 4L7VA 2JVJA 1SCDA 2OD9A 1P4SA 1P74A 4ZHSA 1J2JA 4PXYA 4P7GA 3ZTYA 5LVAA 1G6Q1 2VCEA 1DKMA 4P4SB 3S2SA 1P5RA 3KEOA 3H8SA 1V25A 1ODJA 2EX4A 1RQ2A 2FN4A 3R40A 5T67A 3S55A 3D8RA 1NVBA 1AUVA 1H0KA 1B42A 3E4CA 1LDMA 3VAZA 4KUHA 1HE4A 2AEJA 3FFWA 1K8ZB 3FH0A 3FVRA 2HK8A 4XUDA 5F1KA 4A6PA 2QTLA 1NW5A 2RGUA 1SU6A 2XE4A 1P0CA 3EPRA 3QOWA 2N3ZA 4NHEA 4WXPA 1UPXA 3RS2A 1XQYA 3VX3A 1EVYA 3Q7EA 5FEMA 4FMCF 2O0JA 4XQ0A 3MUOA 2YJ4A 1MTZA 2GNPA 5L45A 2QVCA 3P4YA 1KI9A 3JYPA 3OO0A 1BD3A 2AMJA 1HFEL 1JAYA 2RGYA 3OC0A 2OHGA 1YHNA 3KKPA 3NWPA 4YI5A 3RC2A 3SEAA 5KU1A 3K5WA 4QARA 2A9FA 3K8QA 3WDSA 2ERXA 4CGYA 1S0UA 4UBMA 4D98A 5HF6A 3W77A 4W8OA 3VTZA 3RTGA 3SFVA 4M0EA 5FO1A 1DIHA 3JWIA 3KWJA 3Q0EA 3CN9A 3L4SO 3LWBA 1NVUQ 3R1IA 5FI5A 4HAZA 4WTOA 3DW3X 2DHRA 3RTBA 5L7TA 3JQFA 4LQDA 1L5VA 4OV6B 1EJ0A 4ND4A 4EZEA 4GZ5A 5BRAA 4L3VA 4AKTA 3AP2A 5KDLA 4D4LA 1XN1A 4F93B 4WBNA 2ZJ4A 3FI0A 4JI2B 1D6SA 2AOVA 3R5TA 3Q6NA 4MRSA 3HV2A 5TEVA 3CF4G 2VDWA 3VVCA 1NKTA 2PL5A 3D7RA 4G8JA 1JFFB 3SQXA 3HYLA 3P26A 2EZ8A 2ZRJA 3LKDA 2R6CA 5E7MA 4HT3B 1WXGA 2I4OA 4XSHA 2BDTA 2FMHA 2X9VA 1U8FO 3PL5A 4J7XA 3K5IA 1IG3A 1Q3HA 2OXEA 4RVCA 4Y2UA 5TJHA 1QYRA 2CSUA 2YH2A 3OKCA 1KSGA 2WU3A 1CY8A 1ZD2P 4NMWA 4G5RA 4QJBA 1TGYA 5AKXA 2YVQA 3TTSA 2R8YA 2FSVC 1WHSB 1DMSA 2AVDA 2UVPB 3H5WA 4RTNA 1L4KA 1TK9A 3T7SA 5E6RB 3R3WA 1NFQA 1WRBA 5KTMA 3F5MA 3T3OA 2NT3A 4LUCA 2IOHA 1Q92A 2PQ2A 3EOZA 2QD1A 5A02A 2FSSA 5JCJA 5IJXA 2QGFA 3MCTA 3C7DB 1UEIA 3R77A 3STXA 1NWHA 1FNCA 2FZVA 1N4AA 3NGLA 1OIXA 4FGUA 4L5YA 1QJ4A 2ODEA 5PGMA 1E4EB 3FR7A 3ZV4A 1KMIY 1M2NA 3F47A 1KDRA 2WVHA 1RJFA 2WHPA 3OZIA 2QM0A 4EG4A 5BNWA 4TYYA 3TGWA 3FWPA 1HH4A 4FFLA 3H05A 3KBBA 5F2OA 2YY6A 3P8ZA 3R7FA 1TJNA 5JT1A 3I09A 1OYOA 3F8WA 4TQ9A 5AW5A 1KFJB 1YI0A 1DX4A 1TVKA 3EIQA 4JLKA 3UY4A 1XTPA 3K72B 4GRDA 3IVMA 4M1OA 1XDUA 1R0KA 1QU2A 3BZWA 2O8DB 3B2EA 5I01A 3BZUA 5CX4A 3FPCA 3CX3A 5LB4A 3PS9A 1IPFA 2ZYWX 2DWQA 3PEUA 1UBJS 2AJCA 1CP3A 2EEZA 2KYRA 2QVXX 3FMOB 3NAQA 4RSRA 5DGCA 1PL8A 2Y4OA 5DHFA 4CM4B 2XGOA 3HR7A 3E5NA 1A97A 3QUAA 2M9MA 3ONWA 1KH2A 2JH9A 4ZU3A 4EJ0A 4ZFNA 1SVNA 1T0IA 4NU5A 3PUKA 4XWGA 3NIGB 2C92A 1X80B 3M4NA 4BUCA 2ZBFA 2HK6A 5TF4A 5B55A 1A72A 2O2XA 2Z57A 4DQLA 1QHSA 2VJQA 4HGNA 4EH1A 2NU8B 3CPJB 2CD9A 3BAZA 2V9PA 2Q3MA 3AF0A 3GEIA 4GUAA 3P96A 4E0BA 4MYSA 2OQRA 4WUTA 2BGTA 4GR5A 3K5PA 1BJRE 2O2IA 3E9CA 3NYRA 3OESA 3RAEC 5CHEA 1H5NA 5JUWA 1DTEA 2H92A 3K9HA 1HZZA 3IR6A 2DZDA 5M29A 5TLSA 5CCXA 4LF8B 3BJMA 3IE0A 4JT2A 2XUIA 4HMQA 1VCHA 2VCYA 1JZTA 4FI3C 5BT8A 2VA9A 1YOBA 1GTJ1 1C5KA 1LJUA 2HCTA 2X6QA 3BXOA 4QUEA 3CB4A 4J0QA 2HHHB 4OXNA 4H7FA 2A67A 3DVAB 3BB1A 4O2RA 4DFDA 1O89A 3MK31 3P0FA 3R74A 3QPWA 4D02A 2Q41A 4RTLA 2X3FA 4BY9E 3T9AA 2D3TA 2PG3A 2Z3ZA 1G41A 3DLAA 3TK1A 5J9FA 4B82A 2MYNA 4EW6A 3PWZA 2OENG 2ZSUA 3SJCA 1U2DA 5GZ6A 2P1DA 2OR3A 5DBFA 3MVEA 1RPAA 2J4CA 4JAVC 1JYEA 1E1RA 4E4TA 2GYUA 1EAYA 2WE8A 4IQFA 4QTZA 2VHEA 4IOJA 2OTCA 4M6WB 3MB5A 1M1YB 2DHEA 3WRXA 5TMPA 1G7CA 4KXYA 2Z3WA 3TW0A 4TT8A 2WD8A 5HSGA 2GB4A 3IEXA 1CSEE 4IH9A 1DTWA 5EJ8A 5D7BA 3LI2A 2ZSIA 3DWGA 5LBIA 2W6MA 2HA0A 2OKCA 3A0RB 4F4UA 3IL2A 4F8YA 2A9OA 4JVLA 4Q4DA 4JA0A 2UXBB 3BF8A 2ZYVX 3GRKA 4OY3A 4GOMD 1NX6A 5TGDA 3IAS6 3QELA 2BFPA 2ZU6A 4OL9A 4QD3A 1NT2A 3DVSX 3VU3A 4LDRA 3L04A 4KODA 4PYIA 4LRXA 3LQYA 1M6NA 3RHFA 4JQZA 1Z26A 2XLBA 3K6KA 1XWFA 3F7OA 1CUFA 3LP5A 2FUKA 5BMVB 1F0KA 2VK1A 1ONPA 1RADA 4K26A 3TB6A 1R4MA 5L3RA 5BNZA 3FFAA 3AHCA 5E2IA 5K6AA 1X7XB 1AK1A 4F3YA 1UPBA 3VTFA 4JL8A 2O7VA 4V1CB 2FWPA 3B9QA 3S2FA 2F55A 2GZ2A 2EKLA 4YRTA 3HY4A 3NB0A 3LDUA 4AXBA 8LDHA 4PSDA 3IKVA 4RNCA 1JZSA 4GBJA 2ZYIA 1Y3BE 2J0VA 2XNKA 4YDSA 3TRFA 3WHLA 1VYHA 2I6FA 4GPIB 2CZCA 4Y6PA 1GT6A 4Y2TA 4YA6A 4YUZA 3PNQA 3KQKA 4LFBB 5F9MA 4QO8A 4G1FA 2XB2A 1QKKA 3DD5A 5L4SA 1BWQA 4CTMA 3SAJA 2BSQA 4PINA 1VHLA 1O3YA 4AXXA 4KU4A 1RP7A 5EFOA 2EFEB 4Q1DA 4B44A 4HD8A 3WYBA 3ENZA 3G1TA 1D4FA 2WE7A 4O2BA 2YVUA 2RC6A 3T95A 5ERYA 3AY6A 2AZTA 4UU7A 2EERA 5IH7A 1EX6A 4TWJA 1JG7A 3HG7A 3WLTA 1X86B 2GA9A 3OPVA 4WNCA 4EG8A 4HFJA 2P68A 3DMDA 5AO9A 1Y9EA 2J5RA 2J5XA 2D4AA 3EPPA 1CJUC 2A84A 1IY0A 3IUYA 4ITVA 4RKEA 1BQEA 3FLMA 3JWJA 2WMNB 3ETNA 1BVYF 3DDCA 1NW6A 1ESCA 1IHPA 1ONBA 4PFSA 4ALIA 1CUXA 1GGVA 2R6JA 3PK0A 1Z82A 4YDHB 3IPAA 3RF6A 1E8MA 4C0AC 1KK3A 3L82B 3G0DA 3AFIA 3IJEB 1VP9A 4O1HA 1K7FB 3CJTA 4WINA 3NONA 2GK6A 4C76A 1KEPA 1U0BB 3CZCA 2AH5A 1XMXA 1S3GA 2W71A 1AA9A 3D0OA 3UBMA 4LOLA 4UATA 4CLEA 1I6WA 3R7BA 4O4HB 4H60A 3IPYA 3KZKA 3M1IA 4JZKA 3TQHA 3PNYA 3PNKA 1GA6A 1DO0A 3DT6A 4JYPA 1SG9A 3IDFA 1CDOA 3WRYC 4YMVA 5JROA 5KKNB 1A3CA 1NDUA 3LVBA 2NO4A 2CHEA 4C87A 1P62B 1FCJA 3F4LA 1JKMA 3HK2A 4YQFA 1N6KA 1RXWA 3FLEA 1I0LA 4BFVA 4CKBB 3FJOA 2PH1A 3NRJA 2Z0MA 2Z30A 5IC6A 2VUTA 3FAZA 1L1QA 1B4DA 3SKVA 1ZISA 3RVPA 3Q6IA 4QBGB 5M2QA 2VJLA 5HDBB 3RYFA 1WZNA 2DJIA 5GVSA 2A14A 5F64A 4ZC8A 1ZVJA 4RHFA 4I14A 3ZWYA 4RMHA 3N9IA 1U2GC 2YXBA 3VR6D 1IBCA 2G9ZA 2WJAA 4GS5A 5BUZA 4RUKA 1Z7YA 1JDNA 3P71T 1EESA 1S7CA 4X41A 2PGNA 1AH2A 5DBOA 4H0CA 5LWQA 3NV9A 2P2NA 3WL8A 2C7RA 3DLTA 3M6UA 1DRKA 1TM2A 1TU3A 3ON5A 4I08A 4DSAA 1VSTA 4TL7A 5BVGA 1HM5A 3REQA 3GJ5A 1JAXA 2P2DA 4WBNB 1VG9B 1YQEA 2C3PA 3BB3A 3AR8A 3EGCA 2VJMB 2X86A 1P75A 1YDFA 3SZUA 7ADHA 3LQQA 2H6EA 2AZMA 2H5IA 3LYHA 1CK4A 2RGCA 4LIPD 2A1TS 2VDWB 4AJOA 3H42B 3OJEA 4RJTA 5BXQC 3S7TA 3AB3A 2C99A 4OYLA 1P91A 2WF8A 1QGDA 4JJ7A 5J2TA 1BOFA 3QXXA 3LGXA 3T3MB 3V8QA 2HPHA 3FSEA 2GJKA 4US2R 4TTSA 5BXYA 3LTEA 3S1LA 1AQIA 4LYHA 2WJZB 3TTXA 2VHQA 1WVMA 2OCXA 2PQMA 3EVNA 1TTQB 2NVUA 3NTVA 4K9QA 5LKAA 5B53A 1RWKA 3O4FA 3QSGA 4RH1A 3JRWA 1W2WB 3AM3A 1J0EA 5HWSA 4JNKA 4WN3A 1DC7A 4Z4CA 1QRUA 1EVJA 1PBNA 2JPDA 2YXPX 4INAA 4JKIA 6REQB 2Q45A 4Z4IA 2BL4A 3TFWA 3K53A 4NQRA 1TMYA 2K7FA 2GD2A 1SOWA 5DYWA 1ZMBA 2YQ5A 4QYSA 3QEOA 3ZWAA 1DI0A 1CVIA 4ICIA 3SHVA 2W2KA 3SZOA 4N0PA 1YJ8A 4B6OA 3DQZA 1JPJA 3BJRA 2WHPB 3TFOA 1Z68A 1HDGO 2C5FA 2X40A 5DHQA 1QG4A 3EIXA 3WMFA 4AAYA 1N36B 3I39X 4OIFA 1UOPA 1TM1E 1Z17A 3NBUA 4KQ2A 4TTVA 1KRWA 1H4SA 3HKBB 4D46A 1TVKB 4KLRA 1E92A 2VRWA 1KY5A 2AUMA 4GMGA 4DB4A 1FVHA 3MS4A 5H02A 2DX7A 1QMGA 3C8HA 4OQXA 1ZIDA 2IP1A 3KV1A 1RM3A 1N2SA 2F3TA 1NNLA 3B1FA 2TSYB 4R7GA 2ETXA 4MV7A 1CNEA 4GNRA 2XF8A 2ZUTA 4EJ2A 2CUKA 4D9EA 4Q39A 1CD5A 3AI2A 1PRYA 1DFGA 3PXUA 3QKWA 3SBDA 5ADUS 1WZUA 4OX9B 3CX7A 1D2RA 2HMTA 2G06A 1AV7A 7YASA 3E2IA 1MO5A 2D1YA 5FBWB 3O31A 4FNAA 4IOKA 5CIWA 3HYTA 1EP3B 4E22A 4EB6A 1TCVA 4PLTA 3NG1A 2NP7A 4EG6A 4B5LA 5LXTF 3AEZA 1IPHA 3H1EA 3TF5A 4KN5A 2QJRA 4B40A 1JMKC 2EP8A 1SOVA 2O0LA 1ZG3A 3UF0A 1EQAA 3TH5A 1XNRB 4DIDA 5G3YA 2I80A 3ZUPA 3WA6A 1T2CA 5ENDA 1SXQA 3E22B 1LTQA 4F1JA 5K45A 2ZIFA 5F23A 4FHGA 4GEKA 1FQKA 4KNWA 2GF2A 3MLAA 3AUUA 2P4HX 4BNHA 3SLGA 5HRUA 3HFGA 4RIEA 1RZRD 5JS2A 2H2DA 2Q5HA 5KTTA 2W8BA 1OC2A 3QX8A 1XCBA 5KBYA 2ZAOA 2VHWA 4OFZA 3IH5A 3E9RA 5AUPB 5B1HA 1GZDA 3FOBA 3GRCA 3GUVA 1JA1A 3ZDEA 2GZDA 4QT4A 3FB1A 1GPAA 4P4GA 3KPUA 3HM2A 5FRDA 4M8LA 4XD7D 3BWMA 4A2PA 4MCAA 1H1LB 4EGQA 4E33A 3BE8A 4K0KB 4RK6A 5MFZA 1Z4QA 2HXGA 3ASZA 1CYEA 3LDGA 4L6AA 4II2A 1CJKC 4YV7A 5LNK1 3DOHA 1TQ4A 4EVIA 3U9SA 1L5FA 1Q14A 2J3QA 3NHUA 1WTCA 2HMSA 1B6SA 4PFQA 4ACBA 4JLVA 1F0NA 3BD9A 4JQCA 3ZY2A 2YTZA 3DZKA 1DTWB 4FWIB 3STVA 4HPXB 2DUNA 4I7EA 4NEGA 5DYIA 5D5HA 4LZNA 2FG7C 2GFQA 2E4VA 1KDZA 2I6GA 4DADA 2BZGA 2EFYA 1AB5A 1WX1A 1EUZA 4I9HA 4A4DA 3IX7A 4G81A 1K92A 4QHTA 1OUMA 5GJWC 3CLVA 4IJ6A 3RWOA 4PRYA 2CYCA 1RAAA 1S4QA 2ADFA 4I55B 5DSXA 4LX0A 2PYDA 4JJ4A 4CTNA 2FDCA 1ZHFA 1CDEA 4NH0A 5EXDA 4DPMA 2GN0A 3INTA 4NE2A 4UMVA 1HG1A 4Q3NA 5GGXA 5U4XA 3TRDA 1T9HA 4X84A 4XM0A 3TZ6A 1R6DA 4AI6A 1YBFA 3FROA 2I2DA 1QR6A 3KETA 1HE1C 5CB0A 1P2DA 1D8TA 3I64A 1I2MA 4KXMA 3SCZA 3ZK7A 3HCFA 4PGHA 2ZUFA 3LWDA 2Y99A 1NVFA 4C01A 1BS2A 3ELUA 1SGWA 2GYVA 4OMUA 4R9NA 2VWHA 4H2DA 3LX8A 4WA8A 4XA8A 5CUQA 5L3QA 2B4KA 1KYIA 4G41A 1VJ0A 3THRA 3JQPA 1G6HA 1VXOA 4WLUA 1BWRA 1ZFNA 4LC0A 4JI5B 4O2BB 3FJ1A 2ZB7A 2PLFA 3BORA 1UJMA 4YJHA 4FE4A 4HR7A 2JRLA 5IAKA 2HJVA 3FSRA 3VNSA 4BZQA 4IG9A 2P5SA 3IVCA 4F4CA 1QZ3A 4INJA 2X1LA 2QJWA 3T61A 2EXXA 1F51E 1BJKA 4BMXA 1A77A 1CFJA 4NZNA 1HMPA 1ZOIA 3OEHA 1DBIA 1RSZA 4XH9B 4XLZA 2DE0X 2XB6A 5B1EA 2GWRA 3ZE9A 1B3RA 2A9QA 1RAGA 3EC2A 4MB6A 4YB8A 1I4DD 1U6JA 1QQAA 1P3DA 4J3JA 2DLNA 3H17A 2PT9A 3N70A 4GX5A 2IW3A 2VYVA 3BIJA 3RSCA 4V2UA 2FFBA 3SYMA 4D8YA 4EYGA 3TGPA 3ZYZA 1I32A 1F0YA 2AKAB 1O9HA 1RAHA 2B1IA 2B4RO 1YDMA 2MR6A 1E2QA 3L0IB 3LBAA 1R5NA 1G5FA 1OHHD 4BLVA 1RC8A 1XYVA 5BUCA 1FXSA 5DTIA 4ZHQF 1W52X 3BMOB 4OHMA 2Q0XA 2QRVA 3IT2A 4IG4A 4MIKA 1YAJA 3GRPA 3ENQA 4H3KB 4YTEA 5DE3A 3WBBA 4B3TB 1MIHA 5JY6A 4HX9A 1J1IA 3IQZA 4L9AA 2EWMA 2CCJA 4MUIA 5GAJA 3RAJA 4DLNA 1XZIA 4QJ3A 2B3TA 1X2EA 5K8UA 5DGDA 3BA1A 3MJRA 1WB4A 2L42A 3CEPB 3CEAA 4QQNA 3UWOA 2X9QA 4J43A 4QPCA 3R6DA 2CNWA 2M32A 3LLSA 4G01B 4MV8A 4D81A 1U5AA 2WQ6A 3C5CA 1J0XO 4KWHA 2IEBA 1Q57A 4YECA 4F0JA 3MRTA 2DP4E 5NULA 3RYFB 2PSSA 2ZE7A 4EGAA 2VPPA 4KQMA 3UB2A 5EFZA 3QMVA 2MMGA 4UHKA 4Z0NA 1I7SB 3DPSA 1Y9AA 2IHBA 3NPMA 4PW0A 2NQ8A 3ZV6A 4P4LA 3AKDA 1E2MA 4BU0A 1GFWA 3CZRA 3IAM6 3RIHA 5FUYA 4LF5B 1RRVA 1TGVA 3OCWA 3A27A 1VE3A 3DEJA 3G6WA 2O1XA 1YR1A 3EN0A 1JR2A 5C8XA 5D5QA 2VL7A 3KJEA 5E4TA 3KKKA 4GI2A 5LD2B 2OL4A 2Q1TA 3R5XA 2O7NA 3OHPA 2ZPTX 4O4IF 3PCRB 3WFIA 1P0PA 4LI0A 4DMRA 4GL2A 4PX9A 4EQZA 4WZBB 1E1DA 3ZQKA 4JVMA 4IJUA 5IW8A 1GUAA 1OLUA 2X0NA 3QE3A 1W47A 1ZQ9A 2OHFA 4KRYA 2PRKA 3AXTA 4FPXA 5ESXA 2G4VA 5LFAA 2I7TA 4NZ9A 2PANA 5FQOA 5CA0B 5J2TB 3YASA 3CZAA 1T3LA 4ZYVA 4YUAA 1CUBA 1LLDA 1SVOA 3O38A 4KQIA 3WRWA 2BFNA 4C3ZA 4OAQA 4XSVA 4DV0B 3K1YA 3A2KA 1Q12A 1XTBA 1F2VA 1TCUA 4MWSA 4D3XA 2WW8A 3O1HB 5KSOA 3WNZA 3M49A 2Z6UA 3GGOA 4JJ6A 4XIIA 5FWYA 4CV0A 2AT1A 5FUBA 5I47A 5GV8A 2DHCA 3Q4GA 3BUSA 4NY1A 3PXAA 3ADKA 3ORHA 1B23P 2ZT7A 4P33A 2IC5A 5E95A 2CUZA 3GFGA 3OQIA 3T3EA 1ODTC 2W2KB 3O21A 4CMCA 2EZ9A 1PV1A 2FFAA 2QTFA 1Z2AA 4EJMA 1LBHA 4AMGA 4JS0A 2WJ4A 4J7AA 4L9WA 5IF3A 4O4LA 5K99A 4HDQB 1NX9A 1L4LA 2FEAA 1THMA 1SVSA 4DY6A 5JRJA 3ZEIA 1TX4B 5AM3A 2NW6A 5AI9A 2J0UB 4I1PA 4PQRA 2CJYA 1QG2A 1L1FA 1ID1A 5LA6A 3KM0A 3PGVA 4P4UA 4RETA 3RHZA 2D1TA 2V1XA 3EPKA 1Z33A 2IOFK 4OFBA 1Y48E 1TKCA 2VK4A 3JU3A 5AYVA 1F8GA 3EA4A 1S2LA 2YRWA 3BL6A 3LMKA 3GDHA 3NNSA 4GPBA 3W2EA 4X64B 4A7PA 4EFDA 2HU8A 3UMBA 3U31A 2ZK7A 1FVOA 2I8AA 5K3CA 4BGUA 4BU1A 4WASA 5LM3A 4D0RA 3DZFA 3VZSA 1LD3A 3DE2X 4B33A 4C14A 1ZIXA 2P9FA 3NVMB 3SI7A 1Y7IA 4ZRMA 4AJEA 3ADBA 5DSTA 2W0MA 2C98A 1X7WA 1LVGA 1JQJC 3EQ2A 2BBSA 4BNTA 3W34A 4HZGA 1WM1A 1U2SA 2C82A 1OFIA 1QO0A 1RWQA 1TEHA 2YMPA 3M4ZA 5JD3A 1LC3A 3Q7IA 2B99A 4XYLA 3LUCA 3IBYA 3J7TA 1JS1X 3A9UA 1W5EA 4H7JA 3V7NA 1D1QA 1P60A 2K4MA 1CY1A 1CB7A 4IIUA 2JLZA 1Y5RA 1T34A 4WZ6A 2XYVA 5FL7A 3W05A 4DM7A 1ZD8A 3OETA 2ZITA 3KZVA 3C6ZA 1WMSA 3GG2A 2BTOA 3I6ZA 2JCSA 4BYMA 2ATVA 3JYQA 3A1EA 3DYVA 1QHHA 5F12A 1KI6B 3V4PB 5KAMA 1HEIA 4P5PA 4RE6A 1WY7A 2BP7A 2H2IA 2G5GX 1RMTA 2XV1A 4RKRA 1UAAA 3G0HA 3WAGA 2EQ5A 2O0HA 2C7GA 2WYOA 5AK0A 3WYNA 1IBLB 1XDZA 4YNBA 3ZBPA 4ZREA 4S3MA 3TSWA 4PR3A 1HSZA 1EK0A 3AR7A 3QF7A 4B9AA 2C00A 1OBHA 5CNMA 3WLMA 3Q7QA 1T2NA 3KG2A 4BMZA 4INZA 1DRUA 5LMUB 1PSZA 1A1VA 1ODIA 3R5JA 3A6PC 2EARA 4BASA 1RRFA 1K86A 1ZUIA 3F5DA 3LW7A 4MQEA 1N8NA 4MV0A 4U7GA 1T8TA 3PJFA 3QSYA 3HSYA 5CBPA 3AIOA 3R9XA 1D2MA 4D9FA 3DZGA 2HXYA 3RUDA 5FO0A 1D0IA 3BGOS 3QPAA 4NXNB 1JNXX 2PKWA 3P5BA 2EKDA 4MV4A 2CL5A 3DE3X 5DBEX 4J2OA 1KVSA 4M9RA 4TMFA 4II3A 3MRXA 1GPDG 3OLXA 1NMZA 3B8EA 2W83A 3DE7X 1O0SA 1U1DA 1ZNZA 2K7ZA 3TZBA 2FNAA 4HAXA 4ZYXA 2VNAA 5HR5A 2ZCVA 1EA5A 1RKVA 1ZJ4A 2WFAA 2CGEA 1R74A 4KE6A 2JAHA 4LYGA 5JJBA 5IJWA 2C1ZA 4BLUA 2BI8A 4UZSA 3A4NA 3SEZA 5SY9A 5HKLA 2BEUA 2OT3B 2ZKLA 2JLSA 1W0JA 3JQEA 3SXUA 2AHOA 1NI4A 2Q3EA 2VWQA 1Z7GA 4RCVA 2IWRA 1E8DA 4H17A 2OG1A 4ARUA 2TYSB 1EGHA 2G63A 1T8PA 2X0FA 3T7AA 3PI7A 2X8BA 1NASA 1TYDE 3D7MA 4FHCA 1WABA 1E7QA 5LUAA 4LNUA 1RKBA 4DV6B 3BTVA 4D9CA 4ENQA 1BXKA 1FQOA 2EF1A 4IQ0A 1R50A 2FSPA 1B0ZA 3L06A 2BEWA 3P9IA 4ZVQA 3L6RA 2H3EA 3GD7A 2A30A 4WECA 4WZAA 1XA3A 4MS1A 3CVJA 5EJ9A 1ULSA 1CUUA 3VHLB 4FLFA 4IFBA 3N07A 1GYQA 2Z8YM 1DX9A 1QCDA 1R27A 1ZZEA 2R85A 4IJVA 5L3QB 3P1JA 4RZXA 3K71B 4DTIA 3WI7A 4UDOA 4UBJA 3ZGXA 1K4YA 4LOJA 3LZCA 1ES9A 3RSOA 1EFKA 5CGQB 1NW3A 4LXTA 2EOAA 4YJHB 1XKXA 1CETA 2PKXA 1PR5A 1Z5GA 3K9CA 2OGTA 2GLTA 3P45A 4G67A 4DQVA 3QHPA 2W48A 3LG2A 1NBMA 1JSLA 1OAKA 4IZOA 4KLZA 2I55A 1DXHA 2NPIA 1BX0A 1L9KA 2QZ4A 1G59A 4U0JA 1G2QA 1KXJA 1WETA 2GPNA 1R0WA 5LYJA 3GAMA 1E2KA 2PUVA 3EFOA 3KSUA 4TTQA 2QZJA 2QHXA 3FCUB 4I81A 1G3QA 2FI1A 3PDWA 5DKFA 4Y98A 3ZE6A 3TQSA 2AWOA 3TD9A 4YLYA 2RHTA 5IUKC 3MT9A 1V2GA 4ZI7F 3G7SA 1QKJA 3FYUC 2PSEA 4BLPA 2CCGA 3G2PA 4OK3A 3OM0A 5AM2A 2BTEA 2X9LA 4JBGA 4QBFA 1G3UA 1C8LA 1JWAB 1U3UA 3OI7A 4GYJA 5SV2A 5HCIA 2RCYA 3ZDBA 2Q7DA 3KOWA 3JSAA 3SIXA 4BBZA 2YRXA 5EY5B 2CD7A 1L3BA 2ACWA 1QYCA 4WOJA 3K20A 2P5YA 1B76A 5JYEA 4B0OA 3PGKA 5B30A 2FPGA 1FA9A 3L0SA 4AULA 2PZGA 4A91A 3ZZMA 3JR3A 1NT4A 2HMAA 1O87A 1KQFA 3HRIA 2FVYA 2JDIA 3CUTA 3LHIA 3WGJA 5AKLA 3H8JA 2IF0A 3JYOA 1G21A 4WN9A 3JV7A 4YFVA 3DCYA 4UUMA 4YP6A 1AKYA 2A5GA 2VAPA 3RRZA 4F8JA 4HFMA 5AVWA 1FSGA 4Z0HO 3MQ4A 1MEEA 1PS0A 1OLXA 1TKBA 3JVVA 4QXQA 4MKHA 5DHAA 5YASA 1EIZA 3DZBA 5A6VA 4MVCA 1QVWA 5FF9A 3TVDA 4PQGA 2VTBB 1XLVA 4BNXA 3NVDA 5KMGB 2XNDA 4U8GA 3OF3A 3SC2A 3UUEA 3H84A 4K81B 4F97A 3VVBA 1G8KA 3OM1A 1K1EA 1WF6A 5I9SA 1N2JA 3MSXA 5B2ZA 5JDCC 4EO4A 5FH9A 2WQZA 1XG5A 1SUDA 4ND6A 1RRPA 2QNBA 4PZUA 2Q2WA 4W9NC 4MKIA 1Q2XA 4KC0A 4WLNA 5ULLA 5JDIA 5KINB 4FM9A 2J41A 1KP9A 1IZ9A 3CF2A 1ILEA 2DPHA 4RE5A 2OCIA 2IH5A 4B5KA 2EG5A 2H2FA 1NIJA 4D4KA 2Q2VA 2JCVA 1L7OA 4YWHA 2HQBA 3ZOKA 4F91B 5IXYA 1QPZA 1NI3A 1GGEA 4P53A 4JD5A 1SC6A 5GP1A 3V1MA 4IO1A 4JVNA 3ZU6A 3FW1A 4YJ2A 5IBCA 5TRTA 5F5NA 4K03A 4X9XA 5ECYA 3ZCVA 4OXRA 4B09A 4ZT5A 4XQCA 4JU8A 2BT4A 5H82A 1R88A 1XCMA 4N6GA 3OF2A 1AHIA 4QVKA 4Y0VA 3PG5A 5FWYB 3C39A 4MITA 3CUYA 1CQZA 2ATEA 4IO0A 3ELDA 5HCUA 4BB5A 2P75A 4URHA 3WRVA 3DZJA 1QYDA 4LMAA 4PPGA 4H4DA 1WDLA 4A2WA 1OH5A 1N5IA 3RC1A 1WKBA 3E7FA 5EKXA 1TL7C 4LCBA 1SKBA 2VJYA 2Q1UA 1RCFA 4RY9A 1X92A 3COZA 4WOPA 2Q1XA 3PXEA 2IZZA 3U4QA 3W7VA 4O4LB 1U8YA 4G9GA 2V59A 3WJ7A 1IUOA 1BMFD 4A27A 3NETA 2P4QA 1UBOS 1KIAA 1QX4A 3D3WA 3I5MA 3O0TA 5DRTA 4A0HA 4BC1A 5LA6B 3OLYA 2OB2A 3WGTA 3G23A 4M1TA 2IIVA 3DBOB 3OBIA 2Q2NA 2PSJA 4TMVA 3UJHA 2NT4A 4TMZA 3U56A 1YONA 2GPWA 4LDPA 4L8WB 2DQ4A 4FZRA 2Z9DA 4FFRA 1WD7A 4PZAA 3ZV7A 2ZIZA 4EX6A 1H1DA 4F3KA 3KFLA 2O9JA 1ZSVA 3IAEA 3RB8A 4CM5A 2OHOA 4GR4A 1JN0A 5GINE 1XTVA 3IJPA 3DDUA 2VJAA 3TXXA 3ZWKA 3QENA 3VR3D 1RBYA 3FMIA 5FX2A 5GTDA 3GFOA 4X1YA 1MX3A 4HDSA 5BWOA 1SG0A 1E7WA 1XZ8A 3KLPX 4J1TC 2M6LA 4F7WA 1OMOA 1AGYA 1JLMA 3PB3A 2X4GA 3OTIA 1GG8A 4ZQHA 2WMYA 4I8XA 1KR5A 4Z4EA 4UQPA 3B3GA 3KJFA 3AKYA 4MHTA 1LH0A 4ND3A 5EZQA 5JAMA 2HK7A 4CLXA 4ERXA 1LI5A 2Z09A 2AG8A 4XUGB 2YS7A 3IQFA 2QTBA 3O9MA 1N2CB 3UHFA 3VOSA 3DF9A 1L7AA 1P5JA 2VA8A 3AI3A 3M9XA 3ITEA 4NBWA 4WACA 3JYHA 6PFKA 1QHHB 1TCCA 1BEEA 4EO9A 1TEZA 5CDGA 4JLAA 4GM1A 2G9RA 1JVNA 2ZYGA 1PWXA 3DH0A 1BROA 1Q6ZA 3FUCA 4HYTA 4AIIA 4DNXA 2QUIA 4TLAA 3RUCA 1C9YA 4IOMA 2EIHA 3E23A 3TSZA 2JGFA 4LECA 5M5BA 4M1YA 3WMEA 2SKEA 4JJIA 1MOPA 1IHXA 2FP4B 3I6MA 3R6WA 4ZU1X 1KAQA 5ALUA 3UJ7A 2Y1EA 2D59A 1P1JA 5J2UA 1HL7A 2NO9A 4Q9NA 4EY3A 5JAPA 1L4GA 4HH3C 2QUAA 2BWJA 4PWYA 1YZUA 5TEWA 3EFHA 1UEXC 4NZYA 3E9ZA 3UUGA 1WBBA 1ABFA 1BS1A 4OOFA 1YQTA 4MQEB 4AKHA 4LDZA 2I7VA 1VL1A 3FF4A 1IAVA 4PZYA 1RYMA 3D4PA 4MRVA 4PZCA 2VZLA 1HETA 3I5YA 2GHRA 1X1CA 3UJDA 1YA4A 4R1MA 4K3UA 3KKMA 2HIHA 3G88A 1HNNA 3IHTA 2WUFA 3TDNA 1I94B 4K1XA 3TYXA 1GGMA 4CKEB 2LUOA 3D64A 1QIFA 2O19A 2IX3A 4F9TA 2CJXA 2GJAA 4QTYA 2HEIA 1O08A 1PN3A 2XOEA 3TQTA 3USZA 4KQCA 4ZVOA 1E9EA 4FBMA 4AMUA 1CU1A 1JEEA 2L69A 1TC2A 3RRXA 4DKJA 4G0ZA 2EW8A 4OGFA 3W4JA 1RRCA 1FUUA 3LUFA 5J1TB 4RH0A 1BC5A 4W7IA 1T15A 2BMWA 3UCEA 1VL8A 3GHYA 3LYLA 1UMCB 2QSZA 2D5CA 3RGGA 2P6RA 2FXVA 5F98A 3GOHA 2HCJB 5FB3A 1QB8A 2I99A 2QZPA 3F3SA 1TMOA 3IGFA 1KQNA 3UXMA 1C4OA 1D7AA 1K6XA 2CLIB 3HVKA 3EF3A 3PNPA 5DT9A 4YP7A 5KNCH 1QE5A 4YC7A 2CWWA 4F5WA 2D7CA 3SLKA 2HF7A 3AERA 1AKUA 2DY0A 3C15C 3HDVA 1NW4A 3JQ7B 4IINA 4JLUA 4NLLA 4TMTA 2R2GA 4ARBA 5B5SA 3E61A 5HXAA 2BEWB 2YV3A 3TW4A 1XTZA 1BFDA 1YU6A 4DTCA 3H4VA 4WZAB 2JJ2D 1M6HA 2GLUA 4Q3OA 4JFRA 5J63A 4PVCA 1R6AA 1Y8RA 2XMPA 3B51X 2X7JA 1XMJA 5T4HA 1UFVA 2VZEA 5EXEA 2K2WA 5THQA 2M98A 5F1OA 2IYLD 2JHGA 4PGGA 2RMKA 4WFIA 4WWHA 4F1KA 2HRCA 3VOAA 3NDPA 1QIGA 3ZE7A 3LDHA 1N25A 4BLSA 5ARDA 3D3NA 4BP3A 1KTVA 4FS3A 4ZMRA 4EBBA 1YFJA 1FBTA 4X61A 2WIFA 4N3CA 2A5FA 2GCEA 1T1SA 2CHVA 4PLYA 5DWVA 2QTGA 2FR8A 5COQA 2BCEA 4S1NA 3AO0B 3IDZA 1P2BA 1RCUA 1ZEMA 2I34A 2PR2A 2Z2XA 3IE1A 4MZDA 2V0CA 4IVNA 5A2GA 2I66A 1JLLB 3QXCA 5FOVA 1PUJA 5FOSA 1N3BA 3UZUA 3ZGYA 5K2OA 4J4BA 1IWOA 5I9TA 4LZOA 3T52A 4ESEA 2NOAA 3DEKA 1CTQA 5I8ZA 4DSNA 3QEAZ 1RQPA 2C20A 1ADFA 2QYOA 1PO7A 3ZR4B 4HAVA 3TKLA 4IVPA 1YSCA 3ER6A 3IHKA 4NTZA 4BJ6A 3TFQA 2PKQP 2RH5A 4EHFA 3DZIA 1PFKA 4EUEA 1DDIA 5DX8A 1F3LA 1KI4A 2OM2A 4XEHA 4HWSA 1JUDA 4D9BA 2JGKA 1M8PA 3IBTA 2C8VA 3U7QB 4LEIA 1RR6A 2QMUA 3WZLA 5I6DA 2C9ZA 2DPGA 4Q4AA 1JHVA 1NULA 4C4OA 4YK7A 1RKXA 2JNWA 5DEOA 3SM9A 4YXFA 1LI7A 4P83A 5A62A 3CEMA 4J90A 3QXSA 1KYXA 1I6LA 3T1QA 4IH1A 1GG5A 3AZPA 4GC9A 5ALYA 4KW7A 2OFXA 1WHTA 7MHTA 1SZDA 3E5MA 4IV8A 1KP3A 3M6WA 2P9YA 4JKOA 1G21B 2XECA 1JNYA 4KMRA 3GFQA 4MUEA 4PXAA 4WN9B 4EL0A 3AEXA 5JYCA 2DMRA 5GPBA 3JVUA 2FK7A 5LQJA 4FUQA 3R44A 3BFXA 1HQKA 3AJ8A 4R81A 3OQVA 5TS3A 3F97A 4MKFA 4ZO8A 1Q7TA 1EDZA 1COWD 2QYTA 3OSUA 4R8SA 3VAAA 1Q84A 3WL6A 1YKSA 2C54A 1Q83A 2PTGA 5FI1B 3P0JA 1C8BA 5IG2A 2GCNA 3BGVA 4PV7A 3C7TA 4X95A 4YY3B 4EI7A 2AE1A 5DYGA 1SC1A 3IP9A 3SC2B 1YL6A 1P2FA 3TX6A 3DFUA 3L40A 4G4SO 2VEDA 3CCCA 4Q1FA 3ZE8A 2FPSA 3EA5A 3IP8A 3KD2A 4AQDA 1S02A 1Y1SA 2GBLC 1CJMA 3QOFA 2AEMA 1Z8DA 4H1UA 4CHTA 2DHDA 3PC2A 4Y9UA 4C03A 2WV7A 1I24A 2XTAA 2WDPA 5EZYB 1FFEA 2GJ8A 2FV8A 2C4KA 3WLIA 4NDAA 5HKBA 2QN6A 5DCUA 4UM8B 2EGGA 4KGXA 1JEQA 1P1RA 2WVJA 4RS4A 4S0ZA 4TSKA 4YJ2B 1EE1A 4Z9XA 2FCRA 2GEBA 4IF6A 3EXAA 5IT5A 2BMJA 3MFYA 5G1PA 3TLZA 4MLCA 3T99A 2PVSA 4NF2A 1MT3A 3B8HA 3HE3A 3H8WA 1V16B 2I3GA 4JJGA 3L3BA 5BWNA 2QNIA 3UJ3X 1XTQA 2WP8J 1V6AA 3CNQS 4NENB 3VYTB 1NLFA 4D92A 3ZD6A 1Z08A 5KKAA 3A8TA 3HHPA 4ZCLA 2VATA 3II6X 2VBFA 1YR7A 3KL4A 1NQUA 3SJUA 2XBMA 1DGQA 4J6EA 1IWBB 2AX3A 1RTTA 3AYXB 3OEWA 3O6VA 3Q15C 5K3AA 9LDBA 4M9SA 4MRAA 3TIVA 1O94C 5AK3A 3JZMA 1QH8A 3H5RA 2A35A 1OX4A 3H2BA 3U4QB 5H80A 2QLBA 1YIDA 4F5EA 2J67A 2ZUSA 1Z07A 3NM5A 5KCZA 5KJ1A 5COBA 5LJLA 1W5TA 3OOEA 2DPLA 4I9FA 421PA 1IUPA 2ZXUA 3D3JA 5IMSA 5AR1A 4D99A 2O2HA 3UT6A 3AUTA 4HAIA 4HXFB 3A6DA 3W5UA 3DUWA 3RVKA 2OC4A 2AFIB 3G8CA 1YA8A 2BFDB 2OP0A 1JEAA 1HI9A 2NYAA 1YACA 3HSSA 3RVMA 4IYRA 4CF7A 5LKRA 4C7OA 3PC7A 1PNVA 3H9UA 3KOZA 3GYGA 3WWYA 3X1JA 3OE7A 1JQBA 1SUIA 4L6CA 2CUNA 3HUDA 1OZGA 3A6EA 1GRVA 1Z25A 1T5BA 1IE3A 4MA5A 4MUJA 3U26A 1YQXA 4X1YB 2JGJA 3PV0A 3DZDA 2WINI 4HDSB 3VDQA 5TJ9A 3AR4A 1XXHE 2CYAA 5DW0A 2CNNA 1L5YA 1GNSA 1CKEA 1RXUA 3DO5A 3IDQA 5E2BA 3T7JA 2PY6A 1G2PA 5HJEA 2JHPA 1SBNE 3HBJA 4MW1A 2HLDD 1A71A 3LIPA 1ECCA 3B3FA 1UIMA 1QVAA 4LRWA 5AK4A 3CO5A 1ST3A 4AVYA 4KPYA 3HXMA 5I9MA 4ZV4A 4U0KA 1JB9A 1E8NA 4JMLA 3EWNA 1XCOA 4P80A 4Y0NA 4CJXA 2G0NA 1P1HA 1LPAB 3UJCA 1F8XA 2R1ZA 2V7EA 2YN2A 3QY0A 4H6VA 5TGTA 3FX2A 4ETMA 2GHIA 4ZVKA 2JCYA 1SBQA 2VPQA 4WY8A 1XJCA 4DPKA 4FJ0A 1W35A 4H6XA 1J20A 5CJ2A 2NUTA 4E5DA 2AKYA 4DMLA 5DNVA 3BDIA 5J2UB 2XVMA 4XTCS 1XN4A 4UTOA 2DPYA 3IQDB 3OCUA 1EHYA 4Q05A 4CTJA 2VQDA 4GSYA 1LK5A 1N3YA 1U9ZA 2J5QA 2MJLA 3EZ6A 4FR2A 4KR6A 1QVZA 5KYKA 2OYRA 1NJ2A 2WHQA 3BXZA 3DLPX 3UAOA 3QLVC 2CJFA 3MPUA 2JJ1D 2ZSAA 3E7PA 4DBZA 4OXYA 5JIBA 3D7KA 1LW6E 1I3LA 3FNRA 1QWSA 2ICAA 4ZK2A 3H87A 3ORYA 1C7FA 2HV9A 3PGJA 4PF1A 4I1RA 1M1NA 2IHTA 2PK3A 4Y67A 3A9SA 5CEJA 1RACA 5ICMA 2V3CC 4MV9A 1NXOA 2DTDA 2I4LA 3KDPA 3SU8A 3BHIA 3DEZA 4J3FA 1U1CA 2FSHA 3VR6A 1POXA 2FRVA 4C43A 5JADA 1AQ6A 4XFDA 2ET6A 4CDGA 1S89A 4YRQA 4ZQGA 1NUQA 1QFXA 4R2MA 4XPIB 1XZQA 3WDKA 4AWXA 4AMZA 3MWEA 5A03A 3D9QX 3ZZ0A 4EWLA 2VDPB 4HC4A 4Q12A 1KSHA 1OD6A 1QH1A 3UA3A 4NOKA 1FF9A 2GTPA 3VU9A 1ENYA 3QX7A 4F2GA 1RPJA 3RKRA 5I5EA 1DG9A 1VIYA 2QN1A 2B69A 1GADO 1KVUA 2IZ7A 2DFLA 3CWQA 4GOLD 5HBRA 4BO2A 2WWIA 4K9LA 5KEIA 1TU0A 2DEUA 4YP0A 4E51A 5AVXA 2HHJA 4YI3A 5K2MA 4YT2A 2V1UA 3WYCA 2RHCA 1NJ5A 3RIEA 1KKUA 1G4UR 2GN4A 4YP1A 2RH9B 5SICE 5LLDA 2CVPA 4UZFA 4YIKA 4K2HA 2G1JA 3WRYA 3I5XA 1V3VA 3UT5A 2HSZA 4JKYA 3ESRA 3H9GA 2C83A 2GPJA 3DE6X 4W9RA 2VR1A 3D6VA 4NJOA 3I6IA 4HRXA 4AZVA 4XCVA 2Q07A 3KYDB 3DP7A 4P22A 4CIVA 4U3JA 2XQJA 1BX1A 1RHRA 4O63O 4ZPXA 1Y33E 1FNBA 2OSBA 2P79A 2ALJA 2QMOA 3V8MA 1C8VB 2CLLB 2I9KA 2YQ4A 3B78A 2Q3CA 3NUGA 4XWKA 5C51B 2HBQA 3VKWA 1FDVA 3UFBA 4C7VA 3ZNOA 1FTSA 1L3IA 3DAGA 2VSQA 3HPQA 4HXYA 4MQ4A 4BQOA 1CS0A 2RONA 5GZ1A 4GQIA 3D02A 4FEAA 1PWHA 1Z8NA 4RA6B 3RYHB 3LUAA 4E7PA 1XF1A 4ND5A 1FTGA 3E7WA 3H1GA 4D0LB 3QE2A 821PA 4YRZA 1DJLA 5HE8A 4Q3DA 1OYVA 1XEWY 2QWXA 5CURA 4Q16A 4HRYA 2OVFA 2QAGC 5DSZA 4BVJA 3FVTA 3K9BA 2IEAA 2B5OA 1G7RA 1W93A 1RLTA 2AJ8A 4QYMA 4RHYA 2FRDA 2WOOA 2ODTX 3DBRA 2C1EA 1VBFA 3TNLA 1OXKB 5AVSA 4US0R 1NG9A 3ZJ5A 2DJ5A 3NKVA 5BN3B 2VZ8A 5LQRA 1XXHA 3KSAC 1R1DA 1FYFA 1XYYA 4Q24A 4YAOA 2H48A 4DV4B 4R05A 9LDTA 2VEOA 1M2VA 5KYWB 3I1FA 1UMDA 4ME6A 4NS1A 2ADOA 4UUOA 4RA9A 4UVHA 3GUCA 2ZI6A 4HRAA 1J0BA 3I62A 1TB4A 3W04A 3GPBA 4RTJA 1BNCA 4OHUA 1R0SA 1UODA 5F5XA 2I1WA 4MKXA 4CN8A 5C37A 1QE0A 1KAGA 3F9IA 2PBZA 4RTKA 1WXFA 3FPFA 3WL3A 3INYA 4ZOAA 4ATNA 2XR1A 3K3PA 4UAJA 3O3OB 1QH0A 5A05A 4IIFA 3H18A 4Y7CA 3Q2KA 2JZOA 3AX6A 2NVOA 4FMPA 4AWAA 3PICA 1X15A 2WF6A 5BWCA 4OP3A 3TMKA 2POQX 3FHTA 4IJWA 4E31A 2CE7A 2H16A 2IYSA 2WBLC 4N9QA 1WB9A 2DH6A 3PIRA 4J16C 5DNUA 3A9WA 2RBGA 4Z9FA 1Y3IA 3BZBA 4LFAB 1PGJA 4DSTA 4ZV7A 2YN0A 4RTOA 5E7JA 1XMPA 1N5JA 2AXPA 3L7NA 1RZRA 1TMKA 2AD5A 2BN4A 3RW9A 4DWVA 4E5UA 2XGJA 3QU7A 5HG0A 2O2GA 4ON9A 1U8XX 3AHFA 4HQOA 4RS3A 5FBKA 3BXXA 3ZVMA 4RHUA 3LQFA 1F6DA 5K3FA 3KSMA 2NNWB 1WMDA 4GICA 4OL0A 3S2GA 2WB4A 3OOWA 2I2BA 1G5HA 4XD7A 2FFRA 1P9LA 2W6CX 4UCXA 5TXGA 1YTLA 1SU7A 3L4BA 3X2EA 2QPTA 4ZOLB 3LV8A 1NYTA 4MIYA 3PHIA 1QV6A 2QRHA 3JARA 4PPYA 2DKFA 5FWXA 3WQHA 3QWHA 4L22A 1P19A 2O7SA 4P4TA 3ASYA 3QHQA 1T9AA 4G4GA 4IKEA 4DCGA 4P81A 1YF3A 2PUWA 5JNSA 4RORA 4KV7A 3KQOA 4JSTA 1E7SA 3KB2A 4F6RA 1FQWA 4HQNA 4R1QA 3SXJA 2D1RA 2RCNA 2V7UA 2IT1A 4MO2A 5B7QA 2OBBA 2CKDA 1JPNA 2BFBA 4W5RA 3AUSA 4M0MA 4CKCA 3UXYA 1RLMA 5LZ8A 3T3GA 3EVFA 5BQPA 1GQOA 4F12A 4B7UA 1JECA 3B3QA 3MPOA 4R9VA 5CVVA 3GYBA 1QH8B 5I7UA 2GWHA 2CDAA 3E2PA 2G88A 4XDYA 4PNHA 5DYNA 1N33B 3DPUA 1K2VN 2OV6A 4YRDA 5I48A 4LJ9A 2XITA 1NTRA 4HLQB 5MN5A 2BGNA 3WIOA 4JY7A 1QS0A 3HKEB 1Z6YA 4LS3A 2ZRDA 3O2JA 5FOQA 4ARIA 2X0IA 3P0RA 3E7DA 3KEQA 4C7OB 1XZHA 3HACA 1ZM4A 3HA2A 3QBJA 2XUDA 3ENVA 2XCTB 2HJWA 2CV1A 3UHAA 3NAGA 3IV9A 2PCLA 4I5FA 4UBIA 6AT1A 4FLEA 2WD7A 3BMNA 2WG0A 1TPZA 4KXLA 1PZHA 3BSYA 3P20A 3WK5A 4MYTA 4NK5A 1B0AA 1C80A 2OCYC 1GL6A 1RVDA 2X4DA 1A5TA 1YRYE 1PTJC 2OZKA 3LQKA 4YGYA 3RRMA 1KAHA 2XMZA 3D6AA 3T3NA 5DGXA 2CWDA 2PUJA 2IUYA 4OQDA 4XQ9A 3A6FA 4MA0A 4F6CA 1I7QB 3KHTA 4Y2SA 2DB3A 2PL9A 4KQ6A 4QUIA 3JAMA 4UCQA 3QEBZ 5U1PA 3VKFA 1TD9A 3T41A 1Y5NA 2PUHA 5EQDA 1PQUA 2D0IA 3IELA 3HCPA 2PA3A 3JD3A 3LPNA 5DN9A 4W5JA 1E59A 3TKAA 4H3HB 4LGCA 4V39A 3WZMA 1CF4A 2YQZA 3SIRA 3L01A 4RKFA 4OYHA 3GRYA 1N9GB 3L0DA 3ND6A 4MJLA 4XUCA 1YHYA 3TLCA 3VH3A 4Q4LA 4E07A 4NZMA 2UUOA 4PAWA 4EJSC 3SR3A 1TUBA 1Z0UA 1NYLA 2C4MA 1AT1A 1CJSA 1X13A 1XU4A 2YWJA 5KC9A 5JMPA 2WIGA 2A4MA 1OHHA 2LVBA 1RAIA 1VRVA 2H7XA 2NUTB 2OGSA 4FUTA 4IV0A 1LC0A 4BIIA 2YVLA 4LJ5A 5JNTA 3K70C 1J25A 1T2DA 2QQFA 3HFJA 4TXJA 4XB1A 3ZDDA 4E5VA 1J1ZA 2WSYB 3KLBA 4WNAB 3SDBA 4QULA 1L7QA 1W4RA 2J6CA 1IRXA 3R0QA 2IFTA 2MHCA 3WAKA 2C88A 4OIMA 4WJZA 1BCRA 2BSAA 3P5SA 4A1OA 4AMVA 2GK4A 2Z5GA 1LPBB 4Z7OB 4PLVA 1I2AA 4YHHB 3F0TA 1PZEA 4QUHA 2GF0A 1G4AE 1HDZA 1QGOA 2QSYA 3A6GA 2ORED 3AJDA 3QEKA 4BPBA 4CTKA 4ROTA 3AIKA 3CNLA 3SC3A 1G55A 1N5RA 3A6KA 3CPHA 2MT9A 3HI4A 1IATA 1PJCA 3W5CA 2CDRA 4J03A 3WK8A 4HAYA 3T1YB 5LIRA 2QBYB 4BKOA 3MMPA 4UTXA 2Z58A 1GZUA 1K06A 2GFHA 2IP2A 1QDLB 2UV8A 2WIAA 2L0XA 2QKYA 5I9IA 3VPAA 3FE2A 4QU8A 5IBQA 4I8IA 5JTUA 1I01A 2ZVJA 3AOEA 3AU9A 4FFDA 2REOA 4Y6OA 2W0SA 1EVZA 2X4LA 1VXRA 1MW9X 1QH1B 4QO7A 1CE8A 2KLBA 3I4FA 3KSDO 4U2GA 5DULA 2P78A 3ZKWB 2RDMA 4RULA 4PNEA 4ZTUB 4RIIA 2IS1A 4IIJA 4KQKA 1E79D 3PQ4A 3UNXA 3ZWCA 3O47A 2C5EA 621PA 1Y9DA 3LHDA 3E48A 3F6CA 3HH8A 4FC7A 4E2YA 3HVRA 1FDIA 4ZDJA 4BO6A 1OI2A 3DMTC 4B35A 4AJJA 3WBFA 4YJGA 3T9BA 4C6RA 1PSDA 4CT5A 3P2OA 3QUTA 1TW3A 1OXBB 2G17A 3GRRA 4HDKB 4R98A 3REFA 3GUZA 2G28A 4Y1EA 2CFIA 3RO7A 5KUTA 3RAFC 2IPNA 2G7MC 3EW9A 1GFZA 4C78A 1K0UA 4IZIA 1CUYA 3LUGA 1ISPA 4TV9F 3VKUA 4Z6KA 4EAQA 4IF4A 5B3JA 4I1SA 3AB8A 3IQWA 2IYXA 4RHEA 1YK1A 2P3OA 1K63A 1WV1A 1E1MA 1YNOA 2BGUA 2YZGA 4H77A 3ASUA 4RMIA 4X20A 5DK4A 2ANBA 5C18A 3K09C 4RELA 3RNLA 3DXXA 3G89A 5TQ0A 5CBKA 4DHEA 1GKLA 4NFHA 4G5OA 2AEEA 1O6FA 2AIRA 1QV7A 4ZTBA 5HW0A 1TQHA 3V00A 1CS0B 2G1PA 5FORA 4FBGA 1JDSA 4MRNA 1I13A 1VBMA 1FS4A 1PG2A 2N9UA 5FOWA 4WLVA 2XQKA 1Y6GA 3LS2A 4S1WA 1J06A 3R09A 3V55A 2B1RA 1V9LA 1ML3A 1MO2A 2OFOA 1XKTA 3UKOA 5LZ9A 5H3LA 5JD5A 1A9YA 1HT3A 5BWLA 4NNPA 4KYTA 1XQ9A 1DNPA 3MGBA 5ENVA 2QS9A 4HI0E 4B3FX 3GLKA 3DBRB 1UWVA 2BH2A 2EWVA 4KRXA 3ABRB 4IR7A 4MWOA 3BH6A 4ZO7A 3H11A 3Q7SA 1EE2A 1X7GA 1F60A 2AK3A 3ZZTA 3ENWA 3VHXA 1T24A 2Q5JA 4M83A 1JVBA 5IXJA 4EY8A 1TF7A 2C9YA 2A5YB 3PC3A 3DXFA 4RFVA 1D4ZA 3I0ZA 3DT8A 1Q1QA 1Q15A 2IHVA 4OGWA 1SHZA 4ZCMA 4ZI3A 3P2JA 2NPOA 2IBMA 2QTVA 2HK9A 1UMDB 4GYWA 3WLAA 4BRUA 4DR7B 4RA9B 3EC1A 4Q18A 2JBAB 4EHKA 3Q3IA 2IPOA 5EJ2A 4WBXC 3S5JA 1KEEA 1OREA 2PZLA 2J31A 2QZSA 1BVUA 5AKJA 2OYCA 5D3QA 1EFHA 4RGVA 4C0BA 4AY6A 3CCFA 3W90A 1M74A 2X8AA 4Q4HA 4RZ3A 4LF4B 4QLBA 4LZLA 1SBCA 3PE3A 4RNDB 2DQZA 1PJ8A 4JODA 2NO5A 3K4QA 3OEED 4S2UA 2F90A 2WHRA 2QJFA 3AM4A 4TS3A 5IJ9B 4LTNA 3COSA 3G85A 4YT4A 1OBOA 4DDKA 4C04A 3ZN2A 5GM1A 1XDBA 3KYCA 3BHJA 2NXEA 3RGWS 1K27A 3V4RA 1P81A 5KPJA 1YE8A 3UTCA 2BZ0A 2J3JA 3ZS8A 4CF6A 4X3OA 2QE7D 1R18A 2JAPA 4IGEA 3RHSA 2DECA 3BOSA 2UAGA 1VKOA 4IIYA 1MU0A 1RWBA 2IA5A 3TR0A 1G5QA 2QV7A 4W6QA 1G64A 1E2LA 1X1DA 1Q0PA 2RHMA 1Q0RA 4BE7B 1FE8A 2VC2B 4H59A 2VDMB 1SNYA 4KQ1A 2XADA 2BHRA 2GCIA 5K3FB 2PKCA 2LGJA 2C5GA 4KJXA 4O02B 1QFJA 4FE3A 4WXMA 4JI0B 1H66A 2V3VA 1WPXA 2F8TA 2JVIA 3QLUC 5E7QA 2QNRA 2RH4A 3QVWA 4RXUA 2OPHA 5IAAA 1CF2O 3FCOA 2FMIA 4ZAGA 1JLHA 4FDVA 3D8UA 5LYJF 1KO7A 3L43A 5G2OA 1FP1D 1NXQA 3QTBA 4FW9A 1T35A 3JARB 4JOCA 3ILHA 2GTIA 4G5SA 5TMBA 1QLWA 1XJWA 2OBXA 4IUYA 3MT0A 4WXEA 3TIGA 4ARSA 1B6TA 5FWXB 2OGUA 3MLEA 4DBVO 4PZLA 4A0GA 2EBWA 3J7AC 3I58A 1U0FA 1P31A 2V7PA 3BXGA 4MVJI 2QMZA 4XVQA 2VBCA 1BE0A 1MJNA 5CU7A 1V8ZA 3TKYA 4OMCA 2GPYA 5TS2A 2PZKA 1F5SA 3PEVA 1R4ZA 1SCNE 3F2IA 3VU1A 3ZBUA 5ES3A 1BU5A 1Y1TA 3KJHA 1YTUA 2FW0A 5ERGB 2Q5CA 2R9VA 2O3RA 4UVDA 2WUVA 1K7SN 3A1SA 3HADA 4ZVUA 1AGRA 1BW9A 4EHIA 2VDNB 5CT5A 3VR4H 1NN0A 1SA0A 2GRAA 2IZOA 5EVJA 3UJ9A 4CKCB 5JG7A 3U0BA 2FHPA 3A10A 1VOTA 4NMLA 4NZOA 1H3FA 5E4YA 4AKGA 3U62A 2RHGB 2BM8A 4CIBA 3UC5A 1N2HA 1PQPA 3FCXA 3HO8A 4G86A 4KSCA 4URWR 5SY4A 2HF9A 5F2KA 1SXJC 1ZXLA 1B8OA 1C14A 2GOYA 4OXKA 4Q9IA 2QQEA 4N0MA 4BJ1A 1YE5A 1J1UA 2R1UA 3WNDA 3MTAA 4YPFA 1YJXA 5GIPE 2G04A 5KYNA 1NLMA 1DB3A 2P0EA 4AURA 3HB7A 5LZ4A 5EUCA 4DSUA 1GUZA 3U7GA 1KZ6A 3O73A 3C3MA 3RV4A 3L7MA 2A3RA 3AR3A 1Z7BA 2I6UA 2YIDA 1UWKA 2WA1A 4HKTA 4HQ6A 3HUTA 4Z49A 2WD7B 3BMNB 3UCFA 3DSRA 3T35A 1SHTX 5EMKA 4URXR 2JAXA 2XRMA 2RAVA 4G97A 1ZH4A 2ERCA 2GHTA 3AWDA 4U2FA 5JASA 4MVWA 2WTXA 2ZAGA 5T7BA 1UBSB 5HRCA 2QR2A 3TQIA 3P9NA 1T4CB 4GSKA 3IOCA 3PQ6A 3GJ7A 3EZLA 4ZT4A 1K7EB 1PK8A 1CR6A 2TMKA 3AK4A 5M7EA 3A6HA 5K0CA 4WUVA 2QW8A 3G2JA 5KJCA 1Q0TA 1RXCA 4DLUA 2IHNA 2AQIA 1OFUX 4Q7EA 3UA4A 1G8FA 3JYNA 3PHGA 4LOHA 1Z0SA 4LXQA 3R0XA 2IHJA 4TTAA 3JX9A 3KQSA 1U63A 3VYUB 4GVLA 1SCUA 2JEYA 1P73A 2YCLA 3EZYA 3E3OA 4RGBA 1Z6ZA 4ZZIA 4ND7A 4MQBA 5KKCA 1YHZA 3L6BA 1F9AA 5DYYA 5KCMA 3SIWA 4QREA 1O95D 3N5CA 3HCRA 4UE6A 5KOHA 2PIAA 1SXJD 4MV5A 3VH1A 4ESVA 4DIEA 4C4RA 2ECOA 2ZFUA 1VPDA 1XL0A 1N2GA 4QQKA 1EK6A 1NN1A 4MV6A 4TVKA 5CPFA 1JQDA 1KJIA 1JBQA 4IHJA 4KGVA 2R7AA 3GAAA 2NPFA 4J29A 1U8EA 2CHGA 4HCJA 3EZ7A 4DMMA 5BMOA 5KWVA 4M53A 4KYVA 3IB6A 4Q1EA 5BURA 1XEFA 4DCJA 2A2ZA 8GPBA 2JZNA 2RD2A 4IWYA 4BEVA 4CM9D 3BWDD 3H3JA 3EQZA 3CJQA 1B41A 1E6CA 3D4IA 4C4XA 1QP7A 2FSGA 3MWDB 3R8XA 3S6JA 3RARA 1TI7A 2WWHA 3G0CA 4U2CA 1PDVA 3DA8A 1EVEA 5HYVA 1U8ZA 2WB2A 2E5LB 1T0UA 5E3HA 3K2BA 3R3YA 1U1IA 2Y3IA 1VTKA 4DARA 3EXFB 1GITA 2GSDA 4FZ5A 3EE6A 3EEBA 1XR3A 3KT6A 2I33A 2IXFA 4C05A 2RKOA 5I4KA 2BFWA 4ENWA 2PJUA 3O1LA 3L07A 2V4ZA 4PVDA 3K0AB 4KO8A 1U80A 2W6OA 3HHEA 4HVTA 4S05A 3EXHC 4UCWA 4R7TA 1T6BY 1I7DA 2D00A 4Q9DA 5EZ5A 1EJ2A 1JP7A 1NJGA 2GZAA 5F5LA 4YRFA 4ZKEA 4EHAA 2GZ3A 2COUA 3NIFB 3V80A 4GKKB 4WESA 4D3SA 4D4MA 3QA3E 5EQJB 1LPNA 4XARA 2D0PB 3EVCA 1CEQA 1SVLA 1PEAA 4XM2A 3UXHA 1G16A 2FW9A 1KYWA 4MVJP 4ZVVA 1TEXA 3EDCA 5CA1F 4L3WA 1C3XA 1CE8B 1K7XB 2OP1A 1NVXQ 1JQ3A 3BIXA 4JK3A 4R6WA 2B6HA 2JKZA 5F51A 4XDGA 1NA5A 1YQWA 3AUAA 3IXMA 3CR3C 3ZLJA 2F00A 4URFA 5AH0A 4MWBA 1JYSA 1ZUNA 4KVAA 3FXAA 4OJQA 4QDOA 2BCJQ 1O9GA 2JJYA 4D0NA 5HKOA 5BN4A 2HA5A 1ZH6A 1JEDA 1EFUA 2Y66A 2C31A 4H7PA 4QXRA 2C8JA 2DR2A 3C1TA 4TWAA 4QIHA 3AV0B 5EP3A 2CLEB 1R8QA 3K0FB 4GFDA 1DKOA 1R9JA 2J3IA 4WK0B 4YJGB 3L7OA 5JZVA 1WMBA 2V6MA 5KJ6A 4EW2A 3GCXA 1YVRA 3PSHA 1U11A 3PJDA 2COEA 4RACA 2UYYA 4FFWA 1S4MA 2GEUA 3GZNA 3I05A 4Q7JB 3TLYA 4XAQA 4E2XA 1PJAA 1W25A 4BB9A 3AKEA 4EK9A 4ENVA 5JMTA 2J0SA 1JB1A 2OAQ1 4M55A 4H15A 3TUJC 3V2HA 2B30A 4AZSA 5PNTA 1DIBA 1JT2A 2OORC 2GEFA 3PU6A 5TGZA 3TCNA 1ZJYA 2P9QA 2XMBA 2WKRA 4MCHA 3Q98A 3SHFA 2FW1A 1GDDA 3IA7A 1I9GA 1E0JA 2VAXA 4WMLA 2YHAA 1CFZA 4B87A 1J8MF 3P9CA 1ICEA 3AF2A 4YLEA 4M1MA 1Q3TA 2O2ZA 2HYDA 5CMLA 2DKNA 5K0SA 3BHMA 1EXDA 2PSHA 1FX0B 1BMFA 4AUMA 1W49A 1SR8A 4U2KA 4V38A 1CY6A 1SVWA 1L7EA 2J1LA 4JB3A 4QUAA 4E14A 2X0EA 2Y68A 1VKJA 2QMEA 4GPAA 5MN4A 1L1RA 2VF2A 1T3HA 1JSRA 3HO6A 4RF3A 4UE3S 4G5YA 2Q50A 4F21A 4YH1A 1NMQA 1NNI1 4P38A 5D85A 4NE7A 1LNZA 2ZIAA 3JZDA 4C7XA 2QVZX 1WB6A 2YZKA 3EARA 3EY9A 3LZDA 3N6XA 4RF2A 3RT7A 2B3DA 4FJ1A 1FDRA 3GLVA 1M1UA 3NCTA 2E4YA 1IM5A 3CX4A 2WV9A 1XJQA 3NJ8A 4X45A 2ZT6A 2OM6A 4PPNA 4QFBA 3P9ZA 5K0LA 2BEVA 1OZAA 2MIIA 3U3OA 4KGDA 3V6LA 1A5ZA 5A1JA 1EFDN 1XEWX 3PQFA 4MHSA 2ZKIA 1Q11A 1AK2A 1J09A 1DJOA 4FGSA 5TQ2A 2YWFA 3M6LA 5DI3B 1A96A 3KJQA 3TL6A 4XLLA 1C1YA 1GVNB 3FF1A 4ZYLA 1AB6A 3HR4A 1Y8CA 1M2WA 1PVDA 4OQFA 2GD6A 2ZWAA 4Q4HB 4RXMA 3E53A 2ZW9A 4K88A 3MTDA 4MW9A 1SRQA 4XJVA 3TNJA 2HXSA 1BYIA 3A9TA 4JBIA 1G66A 4QATA 4KACA 1VLJA 3EQ6A 3EWAA 3GLGB 2YINC 1M2OA 4U5QA 4IS2A 5FBLB 4B4OA 3RD5A 1YJBA 3HFSA 2EDCA 2CLFB 1PWZA 5EL0A 3SYTA 1OPXA 1XI2A 1CIVA 3HMKA 1KEVA 1OB5A 5FV4A 3KYCB 3RABA 2CV0A 1IQUA 1PFVA 3K1TA 5ALGA 2IH2A 2WG1A 1HE2A 3SD7A 4O4JA 2JIOA 1OA1A 3GRAA 3OJOA 1U8AA 1H6BA 1K3TA 1H69A 4RZSA 1R0CA 5CCDA 2WU8A 1R0LA 5EINA 1ODSA 1RLUA 4BXOB 2F64A 2FX5A 4XLTA 5FNVA 2DQKA 3A4YA 2AQKA 2QXTA 5CT9A 1FVXA 3AEQB 3CT4A 1T25A 3CLTD 3DT9A 3LXXA 4MKZA 5EUQB 4DV2B 1W73A 2G4LA 4DWWA 2ST1A 2B0JA 1NGSA 3AHJA 5CP8A 5D00A 4A16A 3V4LA 1B00A 2CVOA 4L7QA 3UG7A 4XYMA 5LSAA 1N2BA 2JGIA 2CJWB 1T9GS 2R44A 1USUA 4EPTA 3W3AH 3MMSA 1C1HA 5TPWA 3H4MA 4FXPA 5KOYA 2A9VA 4KN9S 4TKMA 4WW0A 4HNVA 2O8VA 4G1MB 3DVQX 4MLDA 5F4BA 3OWOA 5HUQA 1FTQA 2G25A 1D1TA 1T9KA 3DFMA 3WIBA 5A3JA 2OHVA 3GX1A 3IUJA 1R9GA 1TA0A 3F49S 2OVBA 3BGWA 3PENA 1TK2A 3T3PB 5ICEA 2ISSD 2FWJA 1I30A 2JATA 4GQBA 2R1VA 5LDHA 4EPRA 2NUBA 5KNBD 4M89A 3ZW9A 1BW9B 1PI3A 4R68A 2FUG6 2WIDA 1A9SA 2A58A 5E6SB 1SA0B 5TE9A 1ZBDA 2OD2A 1ZIPA 5ALPA 1M5UA 4OBEA 3R3XA 1WJGA 2GXUA 4JMPA 1XAHA 1XTJA 4FYIA 4RV4A 5I9LA 2CN1A 4GOXA 3W0LB 4XWOA 3HZHA 1ORWA 2AB0A 1ZGZA 4MVJH 5JATA 5DZSA 1ZL0A 4PGAA 3M5DA 3RSFA 2GD1O 4REMA 2CLHB 3FFTA 3W1VA 3GK3A 4M7OA 1VI2A 4B3IA 3C8ZA 3OOYA 2VHCA 2V58A 1UKYA 1GU0A 1M76A 2JJ2A 4M1ZA 4RMJA 3SEQA 3T0FA 3F73A 3H2SA 3N39C 4RANA 3ISVA 4NFSA 3RSLA 1EEHA 3ZQJA 2JD2A 1FZQA 4GZ3A 4OSPA 4BVGA 4PS0A 1WNFA 3NHPA 3AINA 5H83A 3GXBA 2Q2QA 3NAMA 4G3XA 3RS3A 4BMNA 3IODA 3I04M 4M9ZA 4UFPA 2PWBA 2IGBA 721PA 4YT5A 3E9DA 2E4UA 2WP0A 4KQFA 1NF9A 3SQLA 3IRUA 4Q19A 1H2FA 5DLPA 4X1KA 1PD1A 1ZD9A 1HUQA 1ZP6A 1EMDA 4DLPA 4OHKA 1FVFA 2H2AA 3A26A 1IFXA 4GP6A 4MOWA 4DJJA 1WPRA 2Y8EA 3O4RA 4KPUA 2W9XA 1IQPA 3HJTA 1PD0A 4FEGA 1TJ4A 1YC5A 4I2VA 3H1BA 4ZVMA 1QGZA 4C4AA 4E2WA 3KEFA 1K5DA 1X8JA 4IZ6A 2BHLA 4F4IA 4IHQA 4U9IS 4DCSA 2Z1NA 3HJNA 3RI3A 1L4YA 1XJ0A 4Y2QA 5B1YA 4EG3A 2VHVA 2YMQA 4ALJA 2P2YA 1NDHA 3U40A 2WSBA 3WJAA 2Y2VA 3S68A 2X6TA 3GGPA 2CFOA 4PRZA 4KKVA 1JFSA 1M2FA 3DLHA 4BRZA 3ICCA 2FX3A 2XYPA 1WP9A 3L7KA 4KTVE 4P7FA 4TUYA 3UN1A 3VUFA 1N77A 3TNYA 3BK7A 2WUGA 4A3SA 2ADMA 2WWTA 3AF1A 3T4XA 4PY2A 2E87A 4R1PA 2X8WA 1C2TA 1OTYA 4BKPA 2QB5A 2PPLA 4FHEA 4H6PA 4TKVA 5ITVA 5L3SA 1OH8A 3PLAE 2HD4A 2J9GA 3NI2A 1G8YA 1R9NA 1R3DA 2OV3A 2GBGA 1M54A 3CBGA 4HNGA 1XHFA 3TOXA 1Y63A 4RSHA 3S5UA 1TUIA 1V8FA 3PNSA 4OK5A 4YRBA 4YCLA 4KFRA 3ZY4A 4AZ3B 2Q6VA 1I8TA 2FW8A 4QGBA 4JR1A 1JIUA 3DKVA 2IYVA 4DY4A 5LOVF 1P44A 1CUVA 2R7NA 4GMKA 3RR2A 4F72A 1MGPA 2AG1A 1XNHA 3AUFA 4RHXA 4TYNA 3DOCA 5HFNA 2XT9A 2EZTA 4ZK6A 5LU9A 3RVRA 4U9UA 4ZWNA 1IVYA 4I8DA 4HWKA 2VP4A 4JL6A 4HYYA 4NABA 4NAUA 4QLOA 4YAKA 2ZI4A 4AYWA 1WZCA 2EDAA 1G3MA 3ROMA 3RRBA 2Y92A 4ZI5A 2NU6A 3NTOA 3M1AA 4YT8A 4INOA 2IQIA 2EW1A 4YJ3B 1LX6A 3GJTA 5C4IA 1U94A 3SYNA 5JHGB 5CXXA 4KHPB 4RPLA 5FL3A 4CM1A 4GOOD 4RD2A 2E4ZA 5E6UA 4BO3A 4RPGA 4C0LA 4DV5B 4C2TA 4LYDA 3TUIC 3H99A 4PNPA 1HO3A 3NHZA 5EZSA 2HRBA 4JC4A 1OSNA 4CMAA 1QIKA 3ANXA 1NW7A 4GBED 1DAOA 3GHHA 3K9QO 3ME5A 4Q9JA 5D8DA 5J40A 1KK2A 2HDOA 2FSIA 1KF0A 1SCJA 1UBKS 2OWDA 3I2JA 3RIGA 1ZUNB 1GZSA 5IC4A 3GBPA 1YR3A 1L5QA 4DYVA 2MSEB 1W6RA 2QMQA 3LHFA 3TCXB 4EVQA 1Y6RA 5BSHA 3GPLA 4L15A 2XI4A 4W1PA 5DBIA 1O57A 5B4UA 3CZMA 1NJSA 1W87A 2VTDA 1KDYA 4GWLA 2ZIVB 4ALLA 4FOOA 1E6KA 3QE0A 3SSNA 3GIDA 4RPKA 1BRMA 1IZZA 3GZNB 4HNUA 5KVSA 2WFMA 1EUQA 2FZEA 3RF7A 4HY3A 4B71A 1UZNA 5AVTA 1IULA 4XDZA 4JR2A 1GZ7A 4PZPA 2WTNA 4ZRDA 1J2UA 1QPGA 2CNKA 3LXUX 2QP9X 2YC2C 3CUVA 2Y27A 1T13A 2XGMA 1BQ4A 3E6AA 5FLXA 1J90A 4C4TA 3CBQA 3PHHA 5LQMA 1GLVA 4BATA 2XJ9A 1T2EA 3K2IA 5FHRA 2ESRA 4CF3A 1C4XA 4TQAA 1IN7A 1QNLA 3BEDA 3S2IA 3V2IA 4TM7A 2WAYA 1IQRA 1HA3A 1ZGCA 4R8VA 2KQUA 4M3NA 4MGIR 1QMPA 4P3YA 5E4JA 1UC5B 2AGVA 1XGKA 2LCFA 3D6MA 3FHJA 3LPAA 3IB3A 1US8A 3LYAA 2IXEA 3JQFC 5CLGA 4DDHA 4GMHA 5JD4A 2GBLA 5JD6A 3EVEA 2I6SA 1EBBA 1ADYA 3U81A 4JSYA 3N5KA 2Z8ZA 2G83A 4QTUB 2EJUA 4BGIA 2HCBA 1DAMA 1HT0A 5DHSA 1X1QA 2YZMA 2F9MA 1J2TA 4G1UC 4TQUS 1ZUWA 2VWPA 1PW7A 5FXMA 1YVDA 4XPZA 2D8AA 3IILA 4W5NA 1ESZA 1I3NA 2WF5A 5EEHA 5IAJA 2W42A 2PM8A 2RGEA 5TQ2B 5DOZA 3WKDA 3H86A 1SD5A 2VVTA 4HGQA 4Q5IA 4DIOA 4ZPJA 4FDUA 1YDHA 2HLDA 4Q02A 4PBTA 2QX9A 1JAIA 1JIQA 2RHJA 4FMDF 1YJQA 1KZHA 3LFUA 2ZB3A 1JEOA 3BKXA 3OIFA 4ZJYA 4DBLC 3LVQE 3A7EA 3QXHA 4QDXA 3GLGE 1MH9A 4UBNA 1M2OB 2OG2A 2CLCX 3U7RA 1B2RA 1YUNA 5DOVA 1ORTA 1GKKA 1NNEA 1WXEA 4MAAA 3SDZA 3T9FA 5M04A 3WNVA 4JV5B 5EI5A 1KU0A 1SKQA 5JH7A 3ELBA 3BE5A 3N2IA 4COOA 1Z3CA 2PRIA 1P6UA 3AONB 3NWEA 3WGHA 1YZHA 1L6RA 2YICA 4BQNA 1FRZA 4Y2JA 1ZMTA 3E1GA 5DNYB 3WQSB 1O58A 3CYFA 1WUYA 2AE2A 2RBKA 1CIJA 3Q3CA 3R5HA 4Q3CA 1XCGB 4ZXPA 4K6GA 4M88A 5EPUA 1U0RA 1EWKA 1MX5A 4Q03A 3V5NA 3ZWVA 3QKSA 3BEOA 3RVDA 1FUYB 1N5KA 5HRAA 1E20A 5CLHA 4ZOEA 1AKMA 5GONA 1XVLA 1TO6A 4D3DA 3Q1LA 2N42A 3BRQA 4LGVA 4PLPA 1BEUB 2RJ3A 2P3SA 1E1CA 1YRLA 2VSXA 4K28A 3U4HA 4KAXA 3PWTA 2O48X 2O1WA 4DDMA 5JZOA 4I50B 1YQ9A 1II8B 1W5SA 2JJ1A 4NBUA 4D45A 5TPWB 4PR0A 1W9HA 2Q3FA 1GQYA 3CLSD 4KR0A 4PLCA 2H54A 1IN1A 1DIAA 1YMQA 1KIFA 2E89A 1X1RA 4UXJA 3LYUA 5G0UA 1Z2NX 3AQ4A 3T5BA 4L0QA 1TIKA 4BNDA 4BXOA 3WIEA 3F9RA 1E4OA 3AZQA 5DWQA 4MUNA 1MVNA 1XYGA 4L85A 2OCDA 2XWBF 2ZYSA 4AW9A 2QRMA 1OXXK 1L5HA 3IDOA 4N49A 3WADA 5BQ5A 1FP7A 1QC5A 3LCJA 4CDMA 1NR5A 4I3HA 2NYRA 1MLDA 1VHQA 3G2NA 2P2ZA 4NH4A 2P90A 1M0WA 4H4EA 4C4SA 2OZLA 4BQFA 2VLBA 3V1YA 1EIWA 3PUVA 4ZCSA 1WOMA 2FDXA 1VL5A 3RNOA 3PBKA 5JXWA 1MO3A 4LBWA 2QRKA 2XBLA 3Q41A 5EP1A 4EQ6B 2EU8A 3BSFA 2J4FA 3RG8A 3OWHA 2D0OB 1SZJG 2JEOA 4QEZA 3EUFA 4U7TB 1WO8A 4J9UE 2G9NA 3KD3A 3H65A 4KI0A 3CLRD 4UHBA 1KOLA 1GGJA 3TM4A 4B48A 1P17A 2RKBA 1E1KA 1MNAA 3NT2A 1AMUA 1EVIA 3K6RA 3MTJA 4XYEA 1CDZA 8OHMA 3W2FA 4UHJA 5IF9A 1ZLYA 1RM0A 1CUDA 3MJDA 3M5PA 2CVFA 1Q1AA 2V55B 1T91A 2BRUC 2YR0A 3ONNA 3U6KA 2EBHX 2ZJ8A 4KIFA 3HR8A 3FSGD 2JIBA 3QNMA 4TKUA 3FDIA 1U2DC 4KK4A 2H8KA 2EQBA 2C4HA 2UZAA 5LBTA 1XPRA 2HA6A 3OQBA 1OILA 2QUHA 5EIBC 1DC6A 1WEHA 4ZC1A 3SDSA 4MW7A 4ECEA 1UBTS 1G20E 1SCIA 4EGCB 4YCAA 4MRPA 3C8MA 5BR7A 4KPUB 3ESDA 1K5GA 3WRXC 4XCQA 1J2RA 3OJFA 2R11A 4GLFA 4ODIA 1RZUA 1XRPA 1YDWA 3UEOA 4BX8A 2E3JA 5A6SB 5B7GA 3ZDXB 2RC5A 3GAZA 1NYQA 4IIVA 5D3MB 3N2GA 2QQ5A 2B1GA 4GI5A 4NFLA 2ZBVA 3QUQA 4P93A 2O7RA 4ZEVA 4BMCA 4CDNA 1DBQA 1I4WA 3WNCA 3A70A 3BT7A 3LSYA 4AX8A 1G9TA 3BWCA 2AC4A 2VN8A 4TUYB 4EI8A 2PT7A 2YY7A 4LJ7A 4DNQA 1RHKA 1EXMA 2F3UA 1TA4A 2JIRA 3JS5A 3JZIA 4LK3A 4PYLA 4QYIA 9ABPA 2ARKA 5L3SB 1RWNA 1SCBA 4W5QA 2BFCA 5K6AC 3CVUA 1DJMA 1OPRA 1GYRA 3RTDA 4QXPA 3D4NA 1Y6ZA 4D1YA 3TG2A 1IVNA 1WCYA 4YMUA 5IM4A 2GN6A 2VPTA 4M54A 1TZ2A 2FE4A 4PYQA