1FQKA

Crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
318
structure length
318
Chain Sequence
RTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1,Guan
publication title Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 119
structure length 318
sequence length 318
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1fqkA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fqkA01
2VHQA 4B48A 3BAFA 4A0HA 2FSFA 2ODNA 2REXB 1JXOA 4PC6A 4N1AA 2QPOA 4PPFA 3VU9B 4IW3B 2H7VA 1N0WA 3LBHA 3FMPB 2RMKA 5AR1A 5LDDC 4II7A 4HB0A 2JCSA 1VDZA 5E7IA 3GJXC 2CL6X 1KZGB 2QY9A 1U9IA 4W9MC 3KQLA 4BRWA 121PA 4O0MA 3VR3A 4TYWA 1IBRA 1ETUA 1T3HA 2GWHA 3CRRA 1N0UA 4KFUA 1KOFA 5CDFA 4UNNA 2IYYA 1WBDA 3LLUA 3QF4B 4A36A 1MRSA 1RFLA 4D0LB 2XSZD 1NY6A 2B8TA 1E4VA 3I8XA 5CJ2A 1HY3A 3PEUA 4XVQA 1VYTA 2YINC 4D4JA 3B1XA 1GKIA 1CR0A 2K5UA 3W8RA 4F91B 3IGFA 3L0IB 2HT6A 2ORVA 1M2OB 2J3EA 2WM9B 4DCUA 1D2MA 2A5GA 4Z54A 4C0JA 1F2TB 1NSTA 3OAAA 5KSOA 1CR1A 2NO0A 3Q7PA 1GDDA 3EXAA 2HF8A 4US1R 2HXYA 3IBGA 1KO5A 3QPWA 4DDWA 3THWB 4KFSA 3GLFE 3IDQA 1Z63A 4NCNA 5DYIA 4Q9IA 4OHYA 4TMXA 5EP3A 1A2KC 2EU8A 1BYUA 2TMKA 3FWYA 2OSBA 1E79D 4D25A 4URWR 3UKDA 5KNDA 4J0QA 3AVYA 1CRPA 4DEXA 3MFYA 4ASUA 5HPYB 2YWGA 5KTYA 5AUNB 3GJ4A 1JAIA 3UWKA 4G5OA 5C46F 5L3RA 1CS4C 4D2IA 2QSZA 5CIWA 2JLVA 2ODWA 4M1WA 3TVTA 3HU2A 1R6BX 2B8WA 1OIVA 4TL8A 1JXMA 3QENA 4E09A 1HT2E 5HTKA 4L4UA 1AS2A 4QGGA 1U8ZA 5FL7D 1DG3A 1OXXK 1RIFA 1GTVA 4KVGA 3ZYCA 4JLAA 5DHFA 3OIUA 2AXNA 4M4SA 4DHEA 3VNUA 5LD2B 3T15A 1E1QD 5KNCA 4EFLA 2KBEA 2FF7A 2PX0A 1JEDA 3NTUA 3T61A 3DM9B 1E9DA 2YWHA 2FEMA 3CNLA 3B1VA 4PQYA 5FR1A 3TW4A 4ZDJA 3AF4A 3ZZTA 3NIBA 3VFDA 4BRUA 3U3MA 3OEHA 3BJIC 1TQDA 2A5FA 1QF9A 3B1YA 1KNXA 4LV8B 2JLQA 4XJXA 5LD2C 4B6FA 3AUXA 3E2IA 5JEEA 1ZW6A 5FH9A 1JB1A 2VP0A 3Q5EA 2R6CA 1WBBA 1Q12A 3ASYA 1G8HA 5JBQA 2DY1A 5J4HA 4LCBA 4I1UA 4PFSA 3T5DA 3B60A 3ZJYA 2GETA 1E0SA 1UEJA 1PV4A 3U7GA 1U9IC 4KFRA 1OKKD 4NL4H 3F0TA 4PPGA 2Q3HA 2OCYC 4Q1AA 3TAHA 5FOWA 1JR3A 2OXRA 2WKRA 2ZE8A 2ZYVX 3CBQA 4ZDWA 2KE5A 3A4MA 1FTSA 1J8MF 4LYJA 4TMTA 4MKIA 4DWJA 1MO3A 3NH9A 4H1UA 4MGIR 5F9FA 1N5IA 2B7CA 2QZ4A 4Q66C 1NBMD 1P2SA 2ATVA 2AX4A 2NO1A 2CDNA 4R7ZA 4WVFA 4ZKEA 3WBJA 5J4VA 2HUPA 3VR5A 1E0JA 4WZ6A 4CW7A 3EG5A 4PC7A 5AJWA 2LWIA 4QBIA 1II8A 3PUVA 4V0LA 3ZZ0A 1IN4A 3U4QA 1D2EA 2DFKB 3T1OA 5KDOA 1HT1E 4CDGA 4G5GA 4B3XA 2ONKA 2NOAA 4CT4B 4FWTA 4QKQA 1UFQA 3VKHA 3SQXA 1G3IA 1XCPA 5KUTA 4BFSA 2EFCB 5FUWA 4B73A 4QGAA 2FE4A 4IFBA 2YWEA 3I61A 3LY5A 1U0HC 1ONBA 2IYXA 2VLIA 3BB4A 3CNOA 2W6ID 4UNRA 4HLDA 4EAQA 1XX6A 4HZUA 1N5JA 4GOJA 1GILA 2IS6A 2CLDX 3KQUA 4L9WA 1LTQA 3M1IA 2A30A 1X6VA 1ZD9A 4IRUB 2PZGA 2C77A 4Q02A 4FCVA 4LBWA 3I92A 3BERA 2ERYA 4BUJA 3DKVA 1Z06A 3LFUA 4BZXA 4UXIA 1SGWA 1H8EA 2GZAA 2QAJA 2XZPA 3L8YA 4PAMA 2HJGA 1YR6A 1KO4A 1Z6YA 1CXZA 4RD1A 2RGAA 4AKIA 3KXKA 1SXJD 2EFEB 4Q4LA 5J40A 1ZYUA 2J41A 3B2EA 4NHOA 3TSZA 1E98A 2YV5A 4Y0VA 3ZQ6A 5FPKA 4B34A 1KK0A 2ZETA 2AD5A 1KI9A 3IO5A 1RKBA 1JR6A 1D2NA 1SVMA 3SJCA 2GJ9A 2NTYC 3W34A 2ZRHA 4HUTA 2XSZA 3UATA 4B47A 5FUYA 4D0NA 2HF9A 3Q8XB 3D6TB 1GKYA 2P2LA 2PMKA 4D4MA 4LWZA 3GLIA 1BMFD 2IUTA 4OI2A 3RS5A 2I4IA 3K0SA 1Q1BA 5EE3A 5EXPA 4PHTA 1W7AA 4LHYA 2ZPTX 3A4NA 2REOA 3OESA 1KK3A 2XTZA 1XD2A 4LV6A 5FI0B 3QVVA 4D82A 2J46A 2IEYA 3QJYA 2QP4A 4MUBA 2QROA 1OH6A 3U4QB 4UNPA 1EK0A 2AKAB 2VF7A 2ZR0A 2ZSBA 1E79A 4XIGS 4MA4A 2Z0MA 5KOYA 2W2XA 3GFPA 2ZI4A 2XGJA 1S0UA 2KB0A 1YKSA 3B9QA 3CRVA 5HE9A 3WMGA 4B3BA 3WRXC 5F98A 1VCIA 1OW3B 3BD9A 1TUEA 3BFXA 4IHQA 2QMOA 3X1XA 4JT2A 4OI4A 3Q85A 3AV0B 2IYUA 1CJVC 2PT7A 1P61B 2WWGA 3GJ0A 2Q9CA 4Q9HA 5AUOB 1VECA 3OIYA 3ECCA 3WBKA 4QBHA 1VHTA 4HZUB 2IK8A 1OH5A 4P0TA 3K9LA 2JASA 5EE9A 2F1HA 1WA5A 2V55B 2F1IA 4NYJR 2ORWA 2A2ZA 4N3NA 4YMUA 4M53A 2ECKA 4M1MA 2V6IA 4EKDA 1TMKA 1Z2AA 1LS6A 2RHDA 2ZRLA 3IHLA 3MJHA 4LYFA 2XOKD 3FDIA 5CIQA 3KZ1E 1KSGA 5LB2A 3U3OA 4C4PA 4HAWA 1YZNA 4U7DA 4AKGA 5CB8A 2BVNA 1RYFA 1XCGB 2QGZA 2FA9A 4YDHB 1M7GA 1KHTA 1XTSA 4ZCLA 2NPFA 1CJTC 1LB1B 1Z6XA 2L0XA 1W47A 1OKKA 4CEHA 3AEZA 5JS7A 3DKPA 2J5XA 4URXR 4IEEA 4MGZR 4M8NE 1M8PA 1XB2A 2DWQA 2DPXA 1M7HA 2QPAA 5BXQC 2VO1A 4QBFA 2C99A 4TL9A 3EPJA 2ZIAA 2QEQA 5JHHB 521PA 2HEIA 3GLIB 2QMHA 3IKJA 3FVQA 4UKDA 2ZVQX 2D7DA 1UJ2A 1FMJA 1LV7A 4US0R 4V03A 3FYHA 2I3BA 2VHCA 2AK2A 1NBMA 4BECA 3AVTA 2H1LA 1S9DA 3QOFA 1YRBA 4TN1A 3F3YA 4Q9KA 4Q00A 3UMSA 4BZPA 5IF9A 1Z6GA 2Q3MA 2IX3A 3G0HA 3MWKA 5FPSA 4EDHA 1CR4A 1UEIA 4WXPA 3HPRA 1XPOA 4G0NA 3HU3A 4Z1MD 2GJAA 4PANA 4EUNA 1Q44A 2ZRDA 3FFBA 5TB5A 2ONJA 2ZRAA 2ZS9A 4Q4JA 1B23P 3MGCA 3LNCA 3I72A 1AIPA 4S2EA 1F3OA 3DVLA 3K0AA 3SQWA 1W46A 1U98A 2ZRPA 1E2FA 3WYAA 1W0JA 2R6FA 3ZIAD 1O3YA 2A5DA 2W6IA 4L8GA 3SBDA 4E5UA 3OE7D 4TQUS 4URYR 5J4LA 5JJKA 4QJ3A 1GIAA 2Z6VA 4ILEA 1AM4D 3IILA 3LAWA 3OFNA 2BMFA 1GM5A 2YOHA 4HYYA 5LPNA 1XFAA 2FFAA 3RLFA 2NO9A 3SFVA 2YHSA 1X1RA 1KSJA 4MYTA 4DB2A 5L8VA 4TLEA 5C18A 5JWRA 1MRNA 1KMQA 3SC3A 3F8TA 2ZANA 3IUYA 4ESHA 2WVJA 1E2NA 2FFBA 1W5SA 2ZRKA 4XTRA 1KI1A 1VG1A 1DVRA 1W4BA 4QNRA 2GK6A 2FSGA 2QAGB 4LSGA 3OZXA 5HZKA 4LHXA 4M9ZA 1G7RA 4DSNA 3IBYA 1G20E 3EZ2A 3IQXA 4OHWA 5L3QA 1L7VC 4RKEA 3AM1A 3NDBB 1DS6A 2OCAA 2Q3FA 2QORA 2LCFA 5SZHB 2QAGC 1X1SA 3P4YA 2QSYA 3TRFA 4ZDIA 4CEHB 1DTSA 2GHIA 4R2HA 2PJRA 2H18A 4P4SA 2JDID 1R8QA 2WMOB 4OHXA 4GNKA 5JRZA 3H2YA 1U0JA 3E5HA 2PCLA 4A2QA 3VKWA 2WPDA 2WAXA 4FN5A 5EUMA 4G3XA 1X8KA 1IJEA 1KY2A 4MKHA 2ZRMA 1I2DA 4OJKA 2QP3A 4B3FX 3K9HA 2QTHA 3CRQA 1CJKC 2MSCB 4GRAA 3QXSA 4KI0A 1EWQA 4IDOA 4JZKA 1R0WA 4WBSA 1OXTA 2XXAA 2IXFA 1RRGA 1SULA 5J4YA 1P4SA 2OLJA 4LC0A 3EIHA 4RD2A 4NYJQ 1W2GA 1SHZA 5FTMA 4I1OA 1TQ4A 1SVKA 4BEBA 2R6DA 3SFZA 2XB2A 4UJ3A 4D80A 2XZOA 1R5OA 4JT4A 1SVOA 1E2GA 1A4RA 4Q4JB 5G3YA 2SHKA 3QG1A 4M1OA 4PHHA 3EX7C 4ERNA 2WICA 4U02A 3K0AB 3DOEA 2OAP1 3K70C 2NIPA 3K0CA 2OBMA 3FMIA 2X8AA 3SU8A 5TY0A 4M2LA 2QTFA 4I99A 3X1DA 2IXEA 1R0YA 2Z5FA 4CIDA 1NP6A 2IA5A 2PEZA 2FJUA 4KYUA 2IT1A 3U44A 1NY5A 2HCBA 1E94E 3CUEF 3QXJA 2VSFA 3QEOA 3ZS8A 4FINA 4PXAA 4MYHA 2DYKA 4LPSA 4OYHA 2ZS7A 2WHXA 4DDVA 4MDFA 4KVAA 4F93B 1T3SA 4FWIB 4QBGB 4BWYA 1M34E 1EFCA 1C4OA 2A5JA 2J9RA 1IONA 1E0KA 1FL9A 3DO6A 1G5PA 2IUSA 1HV8A 3H1TA 1BIFA 3B8HA 4NYIR 4R2IA 4BASA 4DIDA 1NSFA 1RRPA 3L82B 5BN4A 3A4LA 3I5YA 5ELXA 3W3AA 5GADl 2N42A 2QN6A 2D7CA 5L3QB 3B85A 1G21E 4XSHA 1D9ZA 1N5LA 3SOPA 2C96A 1ZVQA 2V8OA 3KUDA 4LOAA 4FMBB 4IXMA 1MABA 3RWMB 1E9FA 2PEYA 5E7JA 1E9EA 3BB1A 4MRNA 1UKEA 4QGHA 5EE0A 1EFHA 2WSSD 3K9GA 2Q21A 1XU4A 1JPNA 1VMAA 2AK3A 1UKYA 4M9XA 3TUJC 5FOTA 4DIEA 2QGNA 3ZDQA 2R8RA 1LNZA 1N6RA 3EZFA 1ZNZA 1U90A 1GSIA 2V7QA 1FQKA 3TAUA 1ZD8A 1Q22A 5B57C 1RPZA 1F60A 4PZLA 4PO9A 1SKYB 3P1JA 4JLVA 5J47A 2XXAB 4KAXA 4WIAA 5K8TA 3T12A 4DVGA 2WIBA 3FKSD 4IKEA 1Q1ZA 3RYTC 4V0NA 4Z1MA 4AYWA 4B76A 2FZLA 1XTKA 3GLHA 4RD0A 1R5BA 1VCMA 4GFDA 2JLYA 4Q18A 2OFOA 3RWOA 2FEOA 2Z83A 1KZ7B 2BHRA 2QL6A 1XTRA 2ZREA 4GMDA 4A1FA 3ZIAA 3RC8A 5CM9C 4YONB 1NIJA 4NE2A 3UG7A 1T9HA 2ZITA 4EJSA 3OE7A 4JSTA 4LYAA 4IDNA 3Q5DA 4NDZA 1XMVA 1QZXA 1XCMA 3U44B 4NONA 2PJZA 2W2VA 5BQ5A 4A0FA 1OYYA 3PENA 3JVVA 1NRJB 3G5UA 4A6XA 3UG6A 2OHFA 4MQBA 2QMUA 4OK3A 1E2IA 5KU1A 1P6XA 3AP3A 1P62B 5JWHA 4LY6A 1ZNYA 5CDFE 2QRZA 1L2TA 2FH5B 3FB4A 5EE1A 2RAPA 2A7QA 2YNMA 3PIRA 1P7CA 2GNOA 4D4LA 1E9RA 3NEJA 4FCTA 4HI0E 4ON9A 4Q03A 1AGRA 2C8VA 3P32A 4HAYA 2GILA 1AS3A 2FGJA 2KBFA 2KJQA 1GNPA 3U7HB 3N70A 1JQJC 2AWNA 1MABB 1XXHA 3OHMA 1K6MA 4NZYA 4A9AA 2B21A 4Q4AA 3BRWD 3CX6A 2RGNC 2QT1A 4PO1A 2JDIA 4B44A 1FX0A 4DUGD 4PSAA 1EESA 2W6JA 3HJNA 1CBUA 4TLBA 4UJ5A 3AP1A 2C78A 3U60B 3FHTA 1GL9B 821PA 3EWSA 3AVUA 4X8LA 2O5VA 3B1WA 4B43A 4N0EA 5FI1B 3OEEA 3X1WA 2RCNA 2BKUA 1SQ5A 4GT1A 1NI3A 3L43A 2J0SA 1Z6TA 2BCGY 3K9NA 1DELA 2Q0HA 1US8A 1YR9A 3EWAA 2F7SA 1Q1QA 2BMDA 2IYSA 3B5JA 4M1KA 3CRMA 3VR4A 2HJVA 4D4KA 2JJ1D 1IXZA 1K5GA 1OFHA 1NL3A 2Z4SA 4MRRA 4JVMA 4QC2A 4RZXA 5AWFC 5DE3A 2PLRA 3GLHB 4CT5A 3W6NA 4HLUA 4RSGA 4GL2A 4DBLC 4NH0A 2IHYA 1RRCA 3QBVA 5G40A 2ODEA 4HDOB 4FXPA 1A1VA 2IYLD 3FTQA 1NMZA 4NYIQ 4Q1DA 4PC3A 1HE1C 3ND8A 4MRSA 2QE7D 1BS1A 3MLEA 4DLXA 2OT3B 3Q7QA 4EJSB 5HE8A 3C15C 4RY2A 4YMSA 1DG1G 3GJ3A 2EQBA 1OHHA 4M9SA 1QBKC 2FGKA 3BGWA 4BEJA 3REGA 5CB6A 3EW9A 4EJSC 3DM5A 1XMSA 3KKMA 3G82C 1I4DD 1IQPA 2OBLA 2EYUA 1QHGA 5C2JB 1IN7A 4RD3A 3WYFA 5KYKA 4C0BA 2WWXA 2QPTA 3T5GA 1JECA 5SZIA 3IQWA 1T91A 2H16A 3QXXA 1TU4A 2GCNA 4FCWA 1EG7A 1JNYA 1QHHA 2RGBA 2D4HA 4HLCA 1XWIA 3QXCA 4KSBA 3VR6A 2IWHA 3K09A 3FOZA 4BFZA 2F43B 5CYOA 5DN6D 3C4JA 2EVWX 5DSZA 4Q1CA 4DCSA 3E1SA 1ZM3A 3PUWA 4Q5IA 5JWOA 1TX4B 4LI0A 2AFHE 4TL6A 4C0HA 2WSSA 3TW8B 1RW4A 2IEZA 3QY0A 4ABYA 4XH9B 2D2FA 1FX0B 3GEHA 2JEOA 1FTNA 3LH5A 1XDBA 4GDFA 5JJLA 1DOAA 1W36B 3V9PA 3L0SA 3PJRA 2WKQA 1G5TA 5JMTA 1TF5A 2UZIR 2ZJBA 2BJVA 1OB2A 1E2LA 2IYQA 3LQQA 1KNQA 3SEAA 3GMTA 1W36C 1KDPA 2CK3A 3W5JA 3CPJB 3TLXA 3QE0A 1E2PA 2ZQ5A 2ZEJA 1US8B 4HZIA 4W7SA 3FKSA 4H9GA 3R9IA 1Z08A 1XEWY 2GZHA 4XD7A 5DIFA 1D8TA 1D6JA 1FPMA 1DAKA 4MGYR 4PX9A 1XEXA 3NWJA 4XVUA 1YU9A 4OK5A 1XTJA 4YLGA 1CRQA 3A36A 3QG5A 4V0ME 4JVNA 4MITA 2KSQA 1YHNA 1VPLA 1GAJA 4YMTA 3EPHA 2P6UA 3LRPA 4A8JA 2ZE5A 2BEJA 2CHVA 3PEWA 3PXGA 3MAAC 4Q19A 2GJ8A 4I81A 3PUZA 1Z28A 4K81B 2IS4A 1AKYA 2H8KA 1PJRA 4P33A 1OF1A 4G01B 1C1YA 1GNQA 2QQEA 1KK2A 4TMVA 4URVR 3Q9LA 2C04A 4Q1EA 1GWNA 2R6GA 3CB4A 4MDEA 1NVVR 3ZVLA 2ERXA 1DAFA 3CWZA 4FW9A 2ZM5A 2EWVA 4TLDA 2O8FA 3LX8A 4URUR 4OHZA 1G7SA 4DLUA 1GUAA 1G5RA 2ZJ8A 1MT0A 2A78A 2MMCA 5FOXA 1E2KA 5JLJA 4JL5A 4TQ9A 1FW6A 1N6KA 1KDRA 4EPTA 2VTKA 1DAMA 3AP2A 3BK7A 1IY2A 2KI5A 1QHHB 3D3QA 3NC0C 4QNMA 3B1ZA 1P3JA 3OF5A 5EP2A 5CM8B 1GL7A 3TUIC 3CRW1 3A1VA 2AWOA 2J87A 4M21A 1TEXA 3GLIE 1YZLA 1E0AA 4W5WA 3P20A 4QFMA 4AY2A 2GF9A 4P4UA 2P5SA 3RS4A 4DLRA 2QA5A 4YQFA 3BBPA 1G291 3K53A 3CZPA 1ZINA 3V4FA 2JAQA 4KCGA 1XP8A 2O52A 4OQXA 3MWJA 3LW8A 4HDQB 1S4QA 1KMHA 2VQSA 3AUYA 4MRVA 1NN1A 4WZBE 5AK0A 1XTIA 3ND9A 1NVUQ 1WF3A 4IVRA 2EFDB 3VAAA 2O8DA 3ASZA 5FBWB 3RRMA 5JSZA 1ZUHA 3KFXA 2VP5A 1E9AA 2AHOA 3CR7A 4LJ7A 4A82A 4KXFB 4M1SA 2GCPA 4X8OA 1CULC 1Q20A 3V00A 1Z0AA 2GEVA 1HUQA 4L16A 2P6RA 1YZQA 2O8CA 3N2IA 2F3TA 1LY1A 4LK2A 3TIFA 1QHXA 3GJ6A 3ADDA 3BWDD 3AGQA 2AL7A 2NPIA 2ZJ5A 3HWSA 4Q7MB 2BBTA 4DZZA 3PV0A 2IHBA 1OB5A 2E87A 4BQSA 4RD6A 4TYYA 2G9NA 3M4YA 2H5EA 3ICQB 2JJ1A 3BS4A 2OFXA 1GVNB 4IOKA 4NP6A 4ACBA 1PUIA 4R98A 4PPNA 1Z07A 1Q3TA 1VG8A 3R7WA 2PX3A 2GESA 3VR1A 4LDJA 4HLQB 2P65A 4A2PA 4A8JB 4BE7B 3KQNA 5F2EA 721PA 4LJAA 4CZ2A 1KAGA 1G4UR 1OFUX 1N6PA 3EA5A 3RS7A 2QE7A 1YVDA 3CH4B 1AZTA 2NO7A 1UF9A 4IEIA 1Z2CA 5FL3A 4EPVA 4TZ0A 2GZDA 3NHBA 4A8JC 1R2QA 1WE2A 3BOSA 3SYLA 5IK2D 4GPTA 3GCGA 3SNHA 3AVXA 4IDHA 4RFSA 3CKLA 4MYUA 1G19A 1F2UA 2GVZC 3HDTA 1U94A 2O8FB 2YJTD 1W49A 4DCNA 5EXTA 4YMWA 3UWOA 2ZJZA 5JRJA 1TQ6A 4NYMR 2HLDD 4DKXA 2QRNA 5CYPA 2C95A 1II8B 4QHTA 1CKEA 2QU8A 2JJ2D 1E2MA 1KKMA 1MO4A 3BFVA 1G8PA 2JLUA 2IYTA 4IOLA 2FSIA 3R9XA 2ZAMA 4M9QA 4PQRA 3CH5A 5DN6A 3DZDA 3SDZA 3RABA 1B0UA 2C9CA 1CF4A 1W0KD 1FUKA 2GXUA 3QNUA 3TKLA 1E3MA 1G8GA 4OI0A 5KPDA 3VQTA 5JJIA 4AD8A 4JJZA 3ZQJA 1KI6A 5FL7A 4BLOA 3ETLA 1VKJA 1V5WA 1KMHB 1IY0A 1E99A 2CCGA 2X2FA 1DO0A 4ZIRA 5IHPA 5JZVA 4NTZA 3T1VA 3W5IA 3QEJA 2O8DB 2EW1A 5JSZB 5H1YA 2V54A 3W6PA 1E1QA 4V0OA 2O8CB 4QOSA 1KTVA 3HP1A 4Q47A 4P4TA 4Q01A 2CE7A 2XEXA 3A8TA 2OBNA 2DR3A 5IT5A 3I8SA 4Z8YA 1E2QA 2XZLA 2GEDA 1P75A 1NLFA 2DFTA 5DHAA 1WDTA 1NVVQ 3V4RA 3C14C 2BIFA 3N2EA 1EXMA 4IVQA 4DDUA 1NN0A 1KSFX 4F4IA 3EAQA 2ZRBA 4C9BA 3KXIA 1S8FA 2O0KA 2ZU0C 4PPQA 3R7WB 4Q7JB 4CEJA 4BZQA 1ZNXA 1XMIA 3KXLA 4JS0A 4EPWA 2HDNB 4BFUA 4ZCIA 5JI2E 3MJRA 1M74A 5FR2A 3RNLA 1MH1A 3FE2A 4XSGA 3VTKA 5EP1A 2VF8A 2IYVA 4CYMA 5H70A 1ZUNB 1KI4A 1CU1A 1HTWA 1E2DA 6Q21A 1KO8A 2A3RA 2VSOA 2G6BA 4RFSB 2ZU6A 3KJIA 1F2UB 5A4JA 3SYNA 4HAVA 2RGEA 1JJVA 1J7KA 1FOEB 1XD2B 2ZI3A 4HB3A 3WNBA 3I62A 3ZLJA 4EIWA 1Z5ZA 4X8MA 1TU3A 4HAXA 1N2CE 4Q9LA 2AFIE 1MOZA 1PLJA 1E6CA 2XAUA 3X1ZA 2IS2A 2RH5A 4O3MA 1QHIA 4PAOA 5L3VA 4AKEA 1K5DA 5JCZA 1GFIA 2VH5R 2RGCA 1UADA 2I1QA 2DWOA 5BN3A 2X19A 4TMWA 4JLBA 3KX2A 3O47A 2OM2A 3UMFA 3DOFA 2NMVA 4JJKA 1LFDB 3B7GA 2WJHA 1G3MA 4NKRA 3TQCA 1GRQA 1WP9A 4PSKA 1P5ZB 2IS1A 3MG9A 1HQYE 3TUZC 3ADCA 2V1UA 1KGDA 1IJFA 2IBMA 5EQTA 2HYIC 1A82A 1G8FA 4KHZA 2GJKA 4P3YA 5FOUA 2GTPA 3DDCA 4B6EA 2QM7A 5FTLA 2WWWA 1KI6B 3MWLA 5D3MA 1FMLA 1SKYE 1ESMA 3CLVA 1DADA 1X8LA 3D31A 3HR8A 1PZNA 2BM1A 3AVVA 5FTJA 3WP1B 1N25A 1NF3A 2CJWA 4CRWB 4LRWA 1A7JA 1HA3A 5P21A 3UIEA 3PG5A 2JIZD 2ZRNA 1CJUC 4ZKDA 3CX8A 3TSWA 1ODFA 2QUZA 3IEVA 1XPUA 3RRNA 4BFYA 3RS0A 3L8ZA 2YWFA 1ZCAA 1SXJA 3SJZA 2CMKA 4QXAA 3KUCA 1WRBA 1AQUA 2IYWA 1EFRD 2YOGA 4DCVA 3C41J 1J70A 3LQRA 4NYMQ 1BYIA 3HU1A 4GBMA 2ODBA 1VHLA 3SZRA 2FOLA 2YC4C 2C03A 2PL3A 1FQJA 1NMXA 1CJMA 1P73A 4A0GA 1SVLA 4UQOA 1SZPA 5A0FA 1UBEA 2GBLA 2OAQ1 1E1RD 2ZRGA 1HEIA 1FFHA 1ZUIA 2FFHA 2O0HA 3U3RA 1BMFA 2NO6A 2OILA 4UXJA 5FTKA 5IK2A 4TLAA 3UK6A 1ESNA 3WP0A 4DLSA 2C9OA 1II9A 4A15A 4C3ZA 4PZZA 3KTAA 3LV8A 2ZYTX 4IOJA 1XEFA 3U61B 3P4XA 2HLDA 1TL7C 5E95A 3B82A 4TSFD 4C0LA 4MRPA 4B71A 3REFA 2FU5C 4TQAA 3CIOA 2W83A 2ATXA 3TQFA 2JJ2A 2OCBA 2JA1A 3X1YA 4E07A 2JLZA 4GZLA 4G1UC 1ZD1A 4B3DA 1SVIA 1G6OA 5GJCA 3WNCA 1T8UA 2XB4A 1H65A 3NC1C 2AR7A 4K8OA 1G7TA 5CLQA 4YDSA 1T0JB 1U0LA 1E69A 1NKSA 5GVRA 1QVRA 4YXWD 4DSUA 1W0KA 4LJYA 1Z22A 4BFXA 2IF0A 3AF2A 2IF2A 3LVQE 2X2EA 1S9HA 1I4TD 2RKOA 4JLNA 2CVFA 3AKDA 1T0HB 1ZM4A 3P27A 5TV2A 1M1YE 5G53C 3R9WA 2IYZA 3L2OB 3NEYA 3NH6A 5AJZA 621PA 5FBVB 2R9VA 3GP8A 2G1JA 1TAGA 3AVPA 1OFTA 3LLMA 4TZ6A 4FD2A 2VP2A 2WMNB 4QJ4A 1DBSA 1D5CA 2H92A 4C0QC 5GJBA 1SVSA 1MV5A 3K1JA 1VYUA 5FBQB 4GSYA 2XOKA 3P26A 4FMDF 2QI9C 3CF0A 1RYHA 1FNNA 5IRCD 2FMXA 2BBOA 4TTPA 3HYTA 1OH7A 4JMPA 1XTQA 3ADKA 3MMPA 1AS0A 2BOVA 1OXUA 3IPYA 5EP4A 2F55A 1SXJB 5C1BA 3TNFA 3ZH9B 4A6PA 3A1TA 2CXXA 4BFWA 4I4LA 4KLZA 2QBYA 2P3SA 4W5HA 1E2EA 3LD9A 5TARA 4LBVA 2DHRA 2G3YA 1JALA 4HAZA 4OQFA 4Q1BA 1SXJC 2VPPA 1Y3AA 1W4AA 1EX7A 1W2HA 2P0EA 2UKDA 3Q72A 5DGXA 4ZCMA 3U5ZB 4P4SB 4EPXA 3PUXA 1IAQA 1EGAA 1RJ9A 4W5JA 4LHZA 3UMRA 2VRWA 2XX3A 3E70C 2ANBA 1NN5A 1RE0A 2ZI6A 3HYRA 5GJWC 4ASUD 3B6EA 4TLCA 4NCJA 3GEEA 2JLWA 1OYWA 3KTAB 3R8CA 2GBLC 1R7RA 3NHAA 4KV9A 3PEVA 3QPUA 1X86B 1QVAA 2W0SA 4URZR 1XD9A 3M6AA 3SE0A 1R10A 3T06B 3PUYA 3UXMA 3I5XA 4GOXA 1G16A 2OESA 3BH6A 1D9XA 1G9XA 2BBWA 3GEIA 1XZPA 5K8LA 2GXSA 3GD7A 4IFEA 2ZJYA 1XEWX 1IN5A 5J5CA 1SVWA 2ZSFA 4L5BA 2I1VB 3KKOA 4B33A 2BM0A 3H86A 3W8NA 3H4MA 1TNDA 3CW2A 2RB4A 1LF0A 2ZRJA 3OIVA 2IL1A 2WOJA 5KHOC 3EASA 4E03A 3BORA 2CCKA 3LXXA 3WYGA 1UAAA 3NDPA 3VU9A 2YYZA 1G6HA 3GFOA 1XBTA 2FPMA 3ZD6A 1M6NA 5KSZA 2NZJA 1KI8A 3CF6R 1C9KA 3GLGA 1CP2A 2D3WA 5TXGA 221PA 1LS1A 2GKSA 3K0CC 1YR7A 2ZYUX 1IN6A 4C0KA 4IVPA 1KKLA 2VIIA 3AKYA 5EXSA 1UM8A 3FHOA 1OXVA 4TYQA 2XTMA 4JIMA 2Q9AA 2JIZA 3PVSA 1EWRA 2ZE7A 3MRSA 2G0TA 2W0MA 2CHGA 1Q1EA 1NN3A 2JATA 2ZSAA 3GJ8A 2NGRA 5FFMA 3ONWA 1I4LD 3AF0A 4XVRA 1V43A 5DI9A 4AKHA 4LJ9A 5M04A 1G3QA 3KDSE 4LZZA 3I32A 3MUFA 1VCOA 2Z43A 5BW8A 2Z4RA 4AYXA 1F2TA 4LJ4A 4RJLA 3THOA 4R9UC 4KLNA 4JLJA 2VSXA 3LXRA 3PFIA 2BCJQ 3KB2A 1VTKA 1XZQA 4NU0A 1S3SA 4JBXA 1FUUA 4JKIA 1XF9A 2MSEB 4PR0A 3WNDA 2OCPA 3W3ZB 5L3SA 2BMJA 2C2HA 2J7PD 1RJ9B 3QIAA 3HR7A 1PLLA 2J1LA 4B3CA 3GPLA 2QENA 1J8YF 3VKGA 3RRZA 5FPHA 4IDQA 4AK9A 4A92A 1KSHA 4QHYA 3WXMA 4WAUA 1Z83A 4Q21A 4DC9A 4QM6A 2GRJA 3LDAA 1NJGA 2IW3A 1G17A 4ZI3A 4OJQA 3TK1A 3IHWA 4K46A 5DI3A 4DLVA 3TVDA 1XNJA 1ZU5A 4D26A 3EPKA 2CHQA 4TSFA 4GZMA 4B75A 3GJ7A 1NLZA 2VP4A 1T5IA 4QM7A 1G1MA 2OLKA 3OIWA 4IDPA 2YZ2A 3AF1A 4Z8XA 2KWIA 3UANA 3C5HA 1YRAA 5FBRB 2EYQA 3CR8A 1JJ7A 2FPKA 3DHWC 2QG6A 2HV8A 1UDXA 1GZSA 2CCJA 1NJFA 4YXWA 4BLPA 3VR2A 5HKKD 1NIPA 3T1TA 5F9HA 1H8ED 1FNMA 2ZJ2A 5FOVA 3NBFA 1IOZA 3VHXA 1Z0FA 2Q9BA 3TR5A 3GLGB 2HXSA 4HUQA 1VIAA 3DEFA 4DLWA 1LF5A 2R65A 2ZUCA 5HCNA 2QM8A 5C4GB 4GP6A 4OI1A 1WQ1R 3D7MA 2CVHA 2D74A 2DFNA 2VA8A 1N3BA 4JLMA 1KDTA 5H68A 2PZEA 2GCOA 4PSVA 1L4UA 5BN5A 3SJBA 3WMEA 2R62A 3KB1A 3AKCA 1Z47A 2O0JA 4NBSA 1ZIPA 3NG1A 4AWXA 4LV5B 1EFTA 1BOFA 4PAQA 3ZVRA 4LJ8A 1GKUB 3LBNA 1T5LA 2VYFA 3TR0A 2J0VA 2VHJA 2ZUBA 1JR3E 1XD8A 1ZCBA 1QG4A 3EZ7A 1X8JA 1DAGA 2BC9A 3BB3A 4RVCA 3IEUA 2BV3A 3AH8A 3WY9A 2OFWA 4LPKA 1XXHB 1GRNA 2NG1A 1OV4A 4DSOA 1CTQA 5L3SB 4Q4AB 2JJ8A 2OZEA 1JAHA 1U81A 3F5FA 2P6NA 3O8DA 5H8WA 3B78A 1F5NA 4M1TA 3WMFA 4F4CA 4OL0A 3AVQA 3X2SA 1KI3A 1P2TA 1U99A 1PUJA 3ZVMA 1QHYA 5FPYA 4TMKA 5E4FA 4BFTA 1ZNWA 4BPBA 2CLSA 2AD1A 2PBRA 1RC8A 3SHFA 5DI3B 5K8UA 3MCAA 3C16C 3Q3JB 2OUKA 2WJIA 2BDTA 2GA8A 2P67A 2ORIA 4JYBA 2OG2A 4FMDB 3R8FA 1TF2A 1YR8A 1VYVA 2ZR9A 3O8CA 1AKEA 2Q6TA 3T35A 1Z29A 3TGPA 3U3KA 2FNAA 5DYGA 2WJYA 4RCZA 1CIPA 1DEKA 2OEPA 3EA0A 5FOSA 1RZ3A 5JEDA 1NG1A 2REBA 4DB4A 4H1VA 4C0SA 4LGMA 4F38A 3IIKA 4HEJA 4ARZA 4HLUC 1F48A 3CO5A 3VMFA 1JBKA 2GXQA 2GAOA 1YZTA 2OV2A 4DRZA 4C7OA 1R0XA 2F9MA 4JKYA 1DPFA 4M1YA 3ZS9A 1KIMA 1BH2A 2CBZA 4HUQB 3AB3A 3BH0A 2WZQA 4O2LA 1QG2A 3RANA 1BKDR 2ASEA 3CONA 1OSNA 5FTNA 2CNWD 5B30A 3GLFA 3LVRE 3LBIA 2GCOB 4E22A 4JL8A 2GK7A 3EZ9A 2ZAOA 3QUSA 4LJ6A 5JECA 5E7MA 4ZPXA 5CK5A 1XJ0A 4KU4A 4MH0R 5GVSA 5DISB 1T3LA 4NCHA 1W5TA 2W58A 1ZIOA 4XWOA 2FFQA 4LBYA 4OQNA 2V3CC 2ZI7A 3IIMA 2YOFA 1N5KA 3DPUA 4MYCA 1OXSC 5EZ5A 3ICEA 2B7BA 3EC2A 2IXGA 3T34A 1E4YA 5JCPA 1W4CA 1KJZA 1P9WA 1KYIA 1VG0B 5AJYA 4UNQA 2WJVA 3IO3A 3SBEA 3K09C 2XJ9A 3JVUA 3NBYC 3TH5A 4ESVA 4JLDA 3U7FB 1PLKA 2DCUA 2J7PA 1G41A 2OXCA 4TYNA 4DUGA 4RCYA 1XRJA 3K70D 3NXSA 5TDHA 1Z0IA 4KSCA 4BFVA 1IY1A 2RGXA 2WTUA 1DAEA 2DFLA 3VX4A 3CWQA 4IOMA 2ZI9A 1GOTA 1OIWA 3BE4A 1N6NA 2B6HA 5B2ZA 1ZAKA 3GJ5A 3MD0A 2ZI5A 2IUUA 1OFIA 2UVQA 4B2PA 2ZJOA 1W0JD 1XJCA 2IC5A 1G8YA 4YMVA 1WXQA 2WKPA 4HSEA 2RGDA 2W2TA 2P5TB 4V0MA 2ZE6A 4PZYA 2BEKA 3OFND 1XEXB 3PEYA 3RVBA 5SZJA 5E3HA 1H8HD 1N6IA 5EXXA 1CLUA 1RVDA 3AGPA 4AC9A 3QVUA 1W4RA 4Q4HA 3KKPA 2FX3A 2F6RA 4FIDA 3A1UA 3K0EA 3SI7A 1G18A 5BYJA 5KNBA 1GNRA 2G88A 2EWWA 3S1AA 5HKKA 3ZVNA 4ARZB 1ZMXA 2BWJA 3A58B 3AVOA 5KO2A 3LO5A 1COWD 4HAUA 4G5RA 4C7OB 4YC7A 5AUPB 3NVAA 2PT5A 3AF3A 3J81k 5EE5B 5JS8A 5BYKA 3TSOA 1TQ2A 1IXRC 1HH4A 4B2IA 3PR1A 2JLXA 4A2WA 3GLFB 1TUIA 2O8BA 1ZRHA 3WRYC 4WOPA 4BGDA 1UBCA 4TT3D 4AG6A 4HDCA 2GAAA 3FKQA 1N0VC 1ZJ6A 5B58C 3R20A 1AGPA 1J2JA 1SHKA 2FG5A 4P32A 3VHLB 2X77A 2R6AA 4Q7KA 2WPDD 4PC2A 2DBYA 2ZSEA 4Q1FA 1IHUA 5LB4A 3H84A 4C2UA 1E9SA 3JZAA 4V0KA 4A4DA 1FP6A 4EFMA 3VX3A 1UDWA 1II0A 4KBFA 4BLRA 4AIIA 3LX5A 2QT0A 4Q48A 4MGKR 3TE6A 4POAA 3JZMA 1NMYA 3SHWA 3A6PC 5FUVA 1NBME 5SZKB 2J45A 1U8AA 4QG7A 3SS8A 5J4KA 1FP7A 3KQKA 2A9KA 2QP9X 3CM0A 4UNSA 2V4ZA 4FMCF 8OHMA 3FMFA 2H57A 2WWFA 1J90A 2MSDB 4BLQA 2ZJAA 3LA6A 1VIYA 3CNNA 4OQMA 1T8TA 1R5NA 1Q3HA 1ZC3A 1KO7A 4PTLA 4RKFA 4HATA 4XTCS 1HURA 2GXAA 3NKVA 3TBKA 4C2TA 2JLRA 1KI7A 1Z0JA 2PMDA 5G3ZA 3GFTA 4MKFA 4RZ2A 2CL7X 5HZHA 4U00A 5EUQB 4FI3C 4QJ5A 4QHSA 4KITB 1JQLB 4DCTA 4M0LA 3TMKA 4LJ5A 1NVXQ 2G1KA 4JYCA 1GP2A 1IXSB 5UKDA 1QHSA 4F92B 4Q4HB 1UKZA 1DO2A 1OH8A 4XWKA 4HB4A 2FPLA 1YZUA 3K0FA 1FZQA 2Y8EA 2F1JA 2ZS8A 3RHFA 4WZAE 3S1AB 1UPTA 5EJEA 1W44A 3THYA 1XMJA 1E32A 3BFKA 1JEEA 3QQ5A 1E9BA 2J0UA 1AQYA 2V9PA 1JPJA 4LX0A 2QAGA 3EZ6A 2QQ0A 2WIAA 4JL6A 4XOIA 5DLQC 3AKEA 4I1SA 3I3SR 2GF0A 2OE2A 3SYKA 1AK2A 2CNWA 1S2MA 2O8BB 1SXJE 4WA7A 4TTQA 4F4JA 4RZ3A 4DT1A 1J99A 1OE0A 3EIQA 1WCV1 1E96A 1YQTA 1G3RA 5KDDA 4LHWA 3T1QA 5B64A 4GOKA 1Z6AA 1N6LA 1KDOA 4DLZA 3QI2A 5AJXA 4AURA 3SN6A 4JLKA 2XITA 1K8RA 4B74A 2QTVB 2XNDD 4KBGA 3QKUA 4JLPA 2DWPA 2WWIA 1HE8B 4RD4A 2ZXUA 2ZSDA 1AZSC 2D62A 2V7QD 3AVWA 1ZM9A 3EPLA 2WAYA 4JVLA 1P9NA 3IPXA 1YE8A 4Q9JA 5FUXA 4OQLA 1Z3IX 1JI0A 1KI2A 1DARA 2N46A 2GEUA 2XTNA 2ZRIA 2LKDA 4RZUA 1UBFA 2V6JA 4JSYA 3GQBA 4OK6A 4ZIRB 1DE0A 1P9RA 4ZDKA 3ZD7A 1QRAA 2OO7A 4US2R 3U3JA 5CLLA 4NPHA 3M0EA 4Q7LA 4PC1A 4PO8A 1AN0A 2VP6A 1ZU4A 3RAPR 5DNYB 3WHKA 1WMSA 3NBXX 3DZ8A 1IM2A 1BO6A 2ZRCA 1U2RA 2FSHA 4HB2A 2ZRFA 3SR0A 2O8EA 4KJZA 4JBYA 5JI3E 1YJ5A 5KSYA 2WV9A 3HPQA 2CE2X 3RSLA 3B13B 1H8HA 2B92A 1O87A 3W90A 2CL0X 2ZYWX 1P72A 1YZGA 1WB9A 4CEJB 3K8YA 1NG9A 3CZQA 3K0FB 1OPXA 4MUAA 3THYB 1DAIA 1F6BA 1KO1A 3MSXA 2MMGA 4KO8A 3RRYA 4D6PA 2ZROA 2BMEA 1ELOA 4CGZA 2J0UB 4OHVA 1COWA 4DXAA 3KJEA 1S1MA 3W6OA 2IYRA 3IIJA 4GI7A 4G5QA 4O2RA 5CITA 4L15A 1G3UA 4B3GA 4CVNA 2GVDC 3NBZC 2WOOA 2ZTSA 4DT1B 1Z8FA 2VEDA 4TT3A 3L0PA 4L9SA 2JGNA 2HYDA 3QPVA 1AJEA 4B2LA 5K8IA 1SKQA 2VL7A 2W6JD 1QDEA 3RSOA 4KFTA 4QGFA 1M7BA 1W36D 1R4AA 3C5CA 4CF7A 4CEIA 2C9YA 3KFVA 1X3SA 2R2AA 3OEED 1CEEA 1A5TA 3EARA 1MKYA 2QNRA 2WBLC 2J0QA 3SJAA 1A2BA 4AYTA 4WW0A 4G5SA 1ZC4A 4B35A 2FDCA 3A1SA 2BJWA 2GDJA 4P31A 3KJGA 2NQ2C 4DEYA 3DMNA 2GJSA 2CEAA 4ZO4A 3QF7A 5D3MB 3EIEA 3KL4A 4Y0AA 3K70B 2FN4A 3PITA 2VHUA 3BXZA 4NMMA 3U2QA 4EPYA 4DJTA 4JBWA 1MO6A 1ZP6A 1ANKA 2ANCA 2CJWB 1OIXA 2ZUDA 3FGNA 5D3QA 4DSTA 1S96A 3LWNA 3CF2A 1I2MA 5AUQA 2E9SA 3GLHE 3ZGXA 2HCJB 2WWYA 4D0GA 4C0AC 1MO5A 4ZV4A 3QBTA 3TJZA 3QKTA 2WJJA 4TYPA 4C30A 5JHGB 4DDTA 3WHLA 1L4YA 1R0ZA 1GL6A 1E9CA 5TVKA 2O8EB 1TADA 1N6OA 1OHHD 3CPHA 4TTRA 3I4LA 3AQ4A 2ZVPX 3RS3A 3GLGE 2VP9A 3O8RA 3OAAD 1P60A 1KJYA 1PVOA 2JLSA 2EFGA 1HYQA 3FFAA 2X1VA 5HR5A 1GG2A 1NVWQ 1G64A 2J7KA 1S1CA 3ZZUA 1CR2A 3O8BA 3QKSA 3DMDA 3VNVA 3FMOB 2G83A 1ZM2A 1NLYA 3KKQA 4IXNA 5FBLB 3THXA 2QMEA 3KJHA 5EZ6B 1GRRA 1DAHA 4MKGA 4PQFA 2YC2C 2DB3A 1NKTA 1W1WA 2AXPA 2XNSA 1E2JA 2F9LA 4ACAA 2EFHB 2RGNA 1Z0KA 2D06A 1ZBDA 2PZFA 3FPAA 4FMCB 5KSPA 3U6BA 1TPZA 3H0KA 421PA 5F3WB 4LC1A 4NCIA 1OJLA 4U5XA 1RRFA 4GP7A 4LBZA 3RDPA 4ZI2A 2PCJA 1G7CA 2LKCA 1XXHE 1Q0UA 1TEVA 2H17A 1YZKA 1LVGA 3B9PA 3CX7A 1LW7A 1Y63A 3QKRA 1U8YA 4LHVA 4X8HA 4CEIB 4BLTA 3PQCA 3U6KA 2XNDA 1Z0DA 4F7WA 4EQ6A 2WSMA 2YVUA 2VHTA 2C5LA 3U7EB 4NCKA 4KODA 2CK3D 1KY3A 4DLYA 3CPEA 4EPRA 3BIFA 3OEHD 2FV8A 4AI6A 3BC1A 5AJVB 2ZR7A 4M22A 3I1FA 5HCIA 4XD7D 1KK1A 3RS2A 5ANRB 4A0RA 5KPJA 1VG9B 2N1BA 2RHMA 4EFNA 1EX6A 1TF7A 3DL0A 3ADBA 4S35A 1XPRA 1T4GA 4KYIB 5TMPA 4JVSB 2WWHA 3A1WA 4B32A 3LW7A 2PLFA 3D8BA 3EC1A 2F3RA 3QF4A 4ITRC 4D81A 4Z51A 4QL3A 1UBGA 4LYHA 5CJPA 2HT1A 3QXHA 1JR3D 1UKVY 4O25A 5IDVA 2J59A 3BH7A 4DLTA 2AKYA 4PHFA 2PH1A 1NNEA 4UXHA 5DH9A 2WJGA 1N6HA 2G0NA 3L0OA 1MR3F 1P2VA 2QBYB 3W9YA 1EFRA 2NZ8A 1S3GA 2BKEA 1IN8A 3PCRB 4IJMA 4XWAA 1T6NA 2AN9A 1P2UA 2F1RA 2V1XA 4V02A 4RFVA 4R71A 5JFGA 1EFUA 3QKSB 3THWA 3FHCB 2YKGA 3A37A 3MWYW 4BLSA 3UPUA 3THXB 1KJWA 1ZM7A 2RGGA 5CK4A 3C8UA 2D2EA 1GITA 2CLCX 4AG5A 1E1RA 2FWRA 1QHNA 1HQCA 2C98A 2F43A 4TMZA 5C4MA 3RC3A 4N0DA 5BWMA 4GMXA 2G77B 2IWRA 1Q57A 2FZ4A 4TWZA 3I73A 5FPTA 2E1RA 1TTTA 4PHGA 1AA9A 3C7KA 5KDLA 5GJVC 5G41A 1VCNA 4LUCA 2UZ3A 3KKNA 4JLOA 5A5GA 4TL7A 1R8SA 1OT3A 1G4AE 3N5CA 3QKRB 2W00A 4QRHA 4OKSA 3KQHA 5DO9A 1XJQA 2BBSA 4I1VA 1Q21A 2A5YB 1E2HA 1KAOA 2XJ4A 5LBIA 3QSYA 1OLOA 4WXRA 2VBCA 4EQ6B 2R44A 4OBEA 1L8QA 1W48A
chains in the Genus database with same CATH superfamily
2OR3A 4H6WA 2WZBA 3ZHUA 4RUKA 1PRYA 3RIMA 2F59A 4N1AA 2QPOA 2VPZA 4J0FA 2ZCJA 3CY6A 3FSEA 1XCLA 2WUVA 3BILA 2QR2A 3PYLA 1N0WA 3PRYA 3FMPB 4CPDA 4WCFB 1ZVKA 3LLSA 3MF4A 1FDIA 3N59A 1RXIA 3EULA 5F5LA 1XEAA 1GUFA 2AG1A 1RQRA 2QTCA 3GUCA 4ZQFA 4ENSA 5FX2A 1THMA 3NNSA 4L51A 1N4AA 5EJ5A 2YYYA 3M1YA 3Q6MA 4ZVLA 2FXIA 1RKUA 2OOKA 2WD7B 4Y2HA 4WCFC 1L7RA 4XGIA 4KFUA 1B26A 3DDZX 1M34B 3FUCA 4UNNA 1BCRA 1OGIA 1C1DB 3T5BA 2G4CA 2BE9A 3AC0A 2ZSKA 2XR1A 5A4DA 4LQDA 2JH9A 4C08A 2BEWA 5JT1A 4D0LB 2XSZD 3AILA 4RNDB 3VC1A 1CQIA 2Q5HA 5B4VA 4ZQCB 4RSMA 4V39A 4XVQA 4UFPA 1PX0A 3HL4A 4MW5A 2EJBA 3G79A 1M2OB 3A2NA 3RHTA 1TTHA 2XKBA 1FFAA 2GCGA 3M83A 4OAQA 5D86A 3TRHA 1W94A 4JK3A 4NDNE 2OVFA 1F2TB 2VPIA 4IM7A 4D4IA 5JNVA 3NPMA 3BHJA 1ARZA 4M0KA 4RL4A 4US1R 1W6RA 2AG6A 3AEKB 1KO5A 1PN3A 3QGMA 1Y34E 1UT5A 2I4RA 3NTXA 4KFSA 3GLFE 2QXUA 1Z8NA 4Q9IA 1O95C 4CCWA 4CL0A 4HRVA 4B3RB 1A2KC 3VR6H 2HOQA 2ZYDA 4I4TB 2EU8A 1I2AA 1T4MA 2HO5A 3HXLA 4BMXA 2OSBA 3UKDA 1EVQA 3MJ4A 4J0QA 3CJQA 3KVYA 3STVA 3FBTA 2A0YA 3AVYA 1CRPA 3MFYA 3RRJA 3KTFA 1V9CA 5BWNA 1QG0A 3GX1A 1CY6A 3KB6A 3LK6A 3ACDA 3VDQA 2BDEA 4OHCA 3GZTB 4I6EA 4UVIA 5C46F 1CS4C 3GBSA 3VSDA 2PANA 1IVYA 5CIWA 1OLXB 3RFVA 1CQJA 1Q0QA 2ODWA 4FZ3A 1XLUA 5DMHA 5F64A 3TVTA 4OLAA 1EUCB 1R6BX 1YAJA 2AB0A 4BVHA 2IYOA 3EJ6A 5HTKA 4XCXA 3G0GA 1NQXA 2WU3A 3O9MA 4GPD1 4L4UA 4QGGA 1GGHA 5IEJA 1OAOC 2ZSHA 3H42B 3TLJA 4EHKA 4L02A 4NBUA 4AMBA 2IH5A 3PNPA 1BGXT 3IAS6 4RY8A 4JLAA 2IY8A 2H4XA 3OIUA 1LWNA 3LIIA 1FFXA 4KOAA 3VNUA 5IBCA 2V5UA 4MCHA 3WGQA 5KQRA 4BVBA 2AGVA 5KNCA 4FKMA 2KBEA 2M6RA 1RTTA 3NTUA 2PX0A 2ACEA 4IIJA 1J0DA 3VPCA 1E9DA 3CNLA 2FEMA 3IUMA 3QUBA 4JYMA 3NB0A 2VPWA 3ZHYA 3VFDA 4FR2A 3ZY6A 3ABIA 2QLNA 3BJIC 3VKGA 2V58A 2W2KA 1KNXA 1ECCA 4L76A 4M6WA 3AUXA 4KG7A 4B6FA 1ZW6A 1VP9A 5FH9A 4HDSB 1WJGA 4Z9BA 3E03A 3T7EA 1G8HA 2DY1A 5J4HA 4PFSA 2CN1A 3F6CA 4MVWA 4Q82A 2Q5JA 4QJIA 1Z4IA 4QFDA 1NFFA 3T0FA 4ZXFA 1JFRA 1UEJA 2A57A 2Y6VA 3AR4A 4LRYA 4M0MA 4KFRA 3V7YA 1PV4A 4DR6B 1KEEB 1Q74A 1H2RS 4M8LA 1QIIA 2RGYA 2OCYC 3G2OA 3INTA 2BTEA 1LH0A 1TFUA 1UCFA 3CGGA 3TAHA 5EMHA 1JR3A 1P6QA 4IGKA 2ZYVX 4ZDWA 3WDKA 2E7ZA 1PR4A 1FTSA 3TIIA 1J8MF 1F3LA 1NGSA 4LYJA 4H77A 4XFKA 1UZUA 2A59A 4WKGA 4IIEA 1YBAA 4MGIR 4YTEA 5EHGA 3UY4A 2H1FA 2YN4A 2ZT8A 2QZ4A 3PDUA 4Q66C 3DEJA 1R6TA 1REQA 3HO8A 3MB5A 1P2SA 2RHRA 4R2XA 1F9AA 2AX4A 2HWKA 2CDNA 1VC2A 5T8KC 4A8TA 4Y0NA 4CMKA 1HE5A 1VL5A 2CF6A 2HUPA 3VR5A 2WHYA 2Z56A 3EUAA 5AK5A 4LJRA 3VYRB 2Q2NA 4EW6A 3HJBA 3PUVA 1Y5IA 5C53B 4R7TA 3G13A 2O0LA 2BKLA 2ZAGA 3G9TA 5CH8A 2I62A 2Z57A 1W0CA 1YDEA 5KDOA 3IEPA 2ZT6A 3T1OA 1DX6A 4XIFA 4QKQA 5EHZA 2IV7A 3KBOA 5COBA 1GTMA 3LZ6A 2EFCB 2BH9A 5EZYF 4DM4A 4B73A 4PBTA 3BG5A 2FE4A 4FB4A 3T5AA 3S28A 3K5PA 1P0MA 2X42A 3NVDA 1C3EA 2ZIGA 2M6SA 3LY5A 1ONBA 4G4IA 3M5DA 3CNOA 4PYNA 2AOUB 5JTTA 2ID4A 5CBKA 4GOJA 4IGIA 5EESA 1JG1A 3KQUA 2PVPA 4YP6A 4L9WA 1RCTE 1LTQA 2BGKA 1NR1A 4E5SA 2RD2A 4TT8A 4YACA 2O2HA 2PZGA 4D57A 4YAKA 3L77A 4WUVA 1JFFA 3KRTA 3I92A 3BERA 4ATNA 5E1BA 4W5QA 2VQFB 4P83A 3K92A 5CT4A 5ALRA 3NOVA 5TEWA 3LFUA 5AW8A 2F8MA 4BZXA 3NHFA 4UXIA 1SGWA 4YMHA 3ED1A 2XYGA 4MSUA 1R3DA 1NXXA 5DULA 4BZWA 5CVCA 1Y89A 1IQRA 2HJGA 1Q1AA 1PWEA 3F67A 3JW8A 1ONSA 1Z6YA 4WDRA 3UUWA 3OEYA 3SD7A 4Z3OA 3MTDA 2MTBA 4RVDA 1X94A 4NHOA 3C4VA 1SWWA 3OOYA 3WI7A 3A04A 1AK1A 2JGAA 3L6RA 5FNVF 5JXJA 3DV0B 4L75A 3MT9A 4MO9A 3FCSB 2RIPA 2Y0BA 1RKBA 1UZLA 3IO5A 2WSBA 4M7OA 5FV7A 3S2GA 5E8RA 4ARCA 4NVRA 1SBNE 1VHJA 2X13A 4IFTA 4EGFA 1A2QA 2ZTMA 4LNHA 4OD0A 2V6FA 2GJ9A 1X8XA 3RYFA 4CLHA 2XSZA 4W9RA 3W4JA 1XRPA 3K9WA 4NZOA 5I7HA 1A97A 1PQPA 2P2LA 2PMKA 4LFCB 2WI8A 4C3OB 2OECA 3GLIA 3WZMA 1DBQA 1BMFD 1UIMA 2IUTA 3ZLUA 2NUPB 1DTWA 1L4NA 1MW9X 5EE3A 2O5RA 5EXPA 4PHTA 1W7AA 3MLAA 3D7NA 5JSZB 1I6LA 4TLMB 2I8LA 5CEFA 3L84A 1BE1A 1M6HA 2PBLA 1QZZA 3DKRA 1GNVA 4C1BA 2PLWA 3QVVA 5FI0B 1DL5A 4DS3A 3QX3A 2J46A 3NUGA 2QP4A 3GAZA 4EG1A 1G66A 4DVJA 3H1AA 4LSMA 2QROA 1G9SA 4LVNA 5TMEA 1EK0A 5EIOA 2E4WA 2ZR0A 2ZSBA 5JO9A 4A6EA 1NI4A 1RAIA 1WUYA 2Z0MA 3PS9A 1A5ZA 2W2XA 3L6CA 4HS4A 4MA4A 2P5YA 1S0UA 3B9QA 3W5HA 3WMGA 4BBZA 3VJLA 1VCIA 1OW3B 3OJWA 2Y1EA 4HWKA 3ZWOA 1RLJA 3PQ6A 2KS6A 2QMOA 4MYRA 2C7QA 1P9OA 1Z5UA 1OWOA 2Q4BA 3OF2A 1P61B 1Q3KA 2XBLA 2ZAYA 4JEIA 3RBZA 1B0ZA 1Z2EA 2G9ZA 3ECCA 1I6WA 2FQYA 4LTDA 3A32A 1VHTA 3DCYA 2I55A 4ZOQI 1IC6A 1ZQ9A 3BVPA 1ZWLA 4N5MA 2CZCA 3GUYA 1DRKA 4WNCA 2V55B 5IAJA 4C1NA 4N3NA 2ENWA 2PKYX 1ZUWA 3HLYA 3DLBA 4F5ZA 5A5FA 2H51A 2R85A 2CNDA 3UUEA 2CFOA 1ZD5A 2Q28A 3Q9UA 2V6IA 3LPDA 2H1VA 4EKDA 5DNDA 5LZ7A 2OBYA 5FA6A 5A1JA 3VPGA 1VGVA 1O08A 1R16A 4X7PA 4HNRA 3VSEA 3KZ1E 1YMQA 5LB2A 5CMLA 4C4PA 1YZNA 4Z4FA 5C8DA 4AKGA 5C8YF 2JANA 3ZI4A 2J6BA 3NYQA 3R0IA 3TPCA 1J42A 4X6LA 3GVCA 3LQYA 4JR0A 1XCGB 4LF4B 3NTLA 3HCRA 1DBVO 3JAMA 4LFAB 2FA9A 3A6LA 1TZJA 5IARA 2EAUA 3OQIA 1MPTA 2EX1A 3W04A 4AUMA 4B6SA 2GPTA 2YH2A 1CJTC 4MPRA 3ZV7A 3GLFB 4IV0A 1E7YA 2ZZMA 1Z6XA 5C1OA 4FONA 4HRAA 3UHFA 2FP4A 4CEHA 2JFOA 3AEZA 4EHJA 3LSYA 1DO8A 4MGZR 5JO0A 1KFEB 3DMYA 4M8NE 4BX0A 2DWQA 1U2GA 5BSGA 4HNTA 2QPAA 2M9MA 4JD5A 4QBFA 2NTNA 2CXTA 1N2BA 2ZIAA 1W88A 4W1RA 2IHKA 4NMXB 2QEQA 1J20A 1SBYA 521PA 3IUBA 5C7YA 4PS1A 1Y1LA 5E4YA 2BKXA 2QMHA 1SCBA 3SOZA 3OQJA 1EQ2A 2X8JA 3LQ4A 2VWQA 3H5IA 3DZJA 1CUYA 3ONEA 4YJKA 3MJCA 4E14A 2NNLD 3E5MA 4EMUA 1NVMB 4NR0A 4R0MA 1E2BA 1SVUA 4M1QA 3GT3A 2JHGA 3QUAA 1P9LA 2GYYA 4IJQA 5FPSA 1ZHHA 5ICSA 2N0SA 1UEIA 5D5QA 5DMXA 1CE8A 4EKIA 3IESA 3AY3A 3QE2A 5G1OA 3AUAA 2ZIWB 5F1YA 2ONJA 2ZS9A 5ALJA 5IEBA 1LV8A 3FPHA 4JUAA 2L17A 4S2EA 3ONFA 4C4SA 4MI1A 4D4HA 1SIUA 3ROQA 4UASA 5TS3A 3TINA 4BMVA 4WNIA 2ZRPA 3IA7A 1P3DA 1KH1A 3WYAA 3ZIAD 5EWLA 4AMYA 2A5DA 5F78A 2BFPA 4E5UA 4DIBA 4URYR 3HB4X 4QDOA 1GIAA 4G0MA 3LPNA 3OFNA 4YRJA 4MEJA 3AUSA 4TVSA 3IT0A 3RLFA 2NO9A 4RORA 2WB2A 1UMCA 1ZGBA 1FU7A 1T4CA 2EGUA 3DQZA 3OOWA 4PQEA 4YREA 3BBLA 3U37A 4CV0A 1FYWA 3NHLA 1K8QA 5L8VA 3V7WA 4HMPA 2DH6A 2ONCA 5ALYA 1N9GB 1ODJA 1TZMA 3ZX5A 5HEKA 1L5MA 1MXFA 2J9FA 4BNFA 2OQRA 2OCXA 4XTRA 5JAUA 4E3ZA 1KGSA 1E5DA 3T9BA 1V41E 4K0RA 4DILA 2QAGB 1QUFA 1C30B 5HZKA 4KDFA 5JMWA 3R3XA 1V7QA 3IBYA 1G20E 3D4OA 3KSRA 3A1FA 4DRXA 4RJKA 5L3QA 2WM8A 1U2EA 3AM1A 3HV0A 3NDBB 1DS6A 1MG5A 3FOEC 2X4IA 1D07A 4RANA 3U80A 5SZHB 2QAGC 2RC5A 1B76A 2Z95A 3P4YA 5EZYB 3RT1A 4KQMA 2RONA 3P9KA 1L7NA 1DTSA 2DHCA 4R2HA 1AV6A 4WFJA 3DV2A 2IXBA 2IPXA 3MT8A 4YUVA 4OSOA 1IUPA 2JDID 1O9BA 1CUIA 1KQ3A 4P4SA 5DTMA 4YWJA 3VGJA 3UJAA 4GNKA 2H1SA 1TPYA 4L08A 4CJXA 3H2YA 1U0JA 3KOOA 4RVSA 4FFOA 1CZNA 4B8ZA 2WAXA 2A58A 4G3XA 1HNNA 1X8KA 3ELUA 3OTHA 4FDTA 4PXYA 5AM3A 4CKCB 4OJKA 2QP3A 4I9GA 1T24A 4B3FX 2JAXA 4XB6B 1AD2A 2WYIA 1XRMA 4M55A 2ET6A 2JH3A 1FW8A 2EV9A 2X5JO 4JC5A 2XPCA 1Y9EA 1DX9A 2QPLA 2ZATA 3LC7O 4JWTA 5BSKA 4JZKA 2LGJA 2CD7A 2FPSA 1BDMA 1NC3A 3A6JA 4WBSA 3DDOA 5F2OA 2AG8A 1P4SA 2OLJA 5J4YA 3EIHA 1J0BA 4RD2A 4X71A 1SHZA 4H7EA 3RASA 4I1OA 1IWBB 4ZYTA 2ZAIA 2AMYA 2IQIA 2C2OA 1YOVB 5IVIA 3EXHB 1GZ4A 3K9CA 3FR8A 2M1ZA 1RPTA 4A91A 3RVSA 4AICA 4C4ZA 1HSOA 2IELA 2FW7A 1E2GA 2AOXA 1T43A 3KAKA 3QG1A 4E7OA 2G9VA 3K0AB 5AM0A 1W76A 3T3GA 3KO8A 3K0CA 4MVJH 4EELA 1N77A 3EEIA 1TRKA 5LMCA 3SU8A 1XCBA 2QTFA 2XYHA 4HGOA 2R00C 4X41A 2CSXA 1VL6A 4LNAA 2VHVA 1NWCA 1NFQA 4URFA 2CMDA 1NJ2A 2IXEA 2Z5FA 4WT7A 1VMKA 3SCZA 1TO2E 2FJUA 1V26A 2NSHA 1DZ3A 1ZJJA 3RC1A 2HCBA 2CNOA 3MJDA 3RVJA 1E94E 5IAKA 1GYQA 3CUEF 3QXJA 3GLTA 5B7PA 2O6HA 4P81A 3RTCA 4F5WA 5LOVF 4FOTA 4TGLA 4C3UA 1LPOA 1SWVA 1J56A 1ZI9A 2HREA 4MO2A 4ZAYA 4G0UA 4KVAA 4F93B 3QTTA 4BMSA 4QBGB 1J2RA 5I47A 1M34E 3PIDA 4MB2A 1C4OA 3DO6A 4JP2A 1Y1KE 3C3PA 5HRCA 4D45A 5BN4A 3FIUA 1NJ8A 4Y1GA 1CFZA 2Z04A 3RPEA 1RBQA 2QN6A 3VR6D 1OREA 2B3DA 5EAIA 3A6DA 2OGWA 2Q1XA 2YV2A 4I5GA 3BTOA 1D9ZA 1CIVA 3ED5A 4LY9A 1PGNA 3KUDA 3ITDA 4IXMA 4KVFA 1E64A 1MABA 1E8DA 1N2ZA 3RWMB 1N2SA 1Y82A 1MX1A 1HRDA 1UMBB 2AXQA 4GLOA 3BB1A 4HGRA 4I1IA 1UKEA 1NRXA 4L4SA 1RYEA 5EE0A 3RT7A 1DAOA 3UKJA 5CVTA 3UKOA 2Y67A 4NV1A 1DQRA 5E0OA 4A3SA 7AT1A 2AK3A 3OFSA 1UKYA 1JYEA 5TNXA 2QR3A 4CR8A 1XAGA 1FTQA 3FUVA 1PL0A 1FRFS 1NE7A 3WL5A 3E58A 3RC9A 4F1JA 4HNUA 1PL7A 2WP0A 5MF6A 2PGIA 4HDRA 4AQYB 1Q0HA 5B57C 1RPZA 3RSCA 5LYJA 4MV0A 2W37A 1IOVA 1A1SA 1IWPB 1ZVJA 1E5VA 1NURA 2HL6A 4OXKA 2VF5X 3QI7A 4IIUA 4PZLA 3ZJ4A 1ORTA 3BD7A 4ME6A 5ECGC 1LSUA 1XELA 5J47A 1GTG1 3T12A 2A9FA 3QJ5A 3NR2A 2GSWA 3EXG1 1Q1ZA 4N4AA 5C8YB 4V0NA 1RXWA 1YL6A 5SICE 4C0XA 1JIVA 2ISQA 4YALA 1FS5A 3U19A 4B76A 4UD6A 1NASA 3I9V6 3FPLA 1W9MA 1R5BA 2IZ0A 3RAJA 4EENA 4GFDA 3URMA 1U3UA 5HBRA 1UK6A 3Q11A 1HDOA 2VT7A 3LT4A 3N0WA 4RTLA 3LGSA 3OT1A 4U2BA 1NR5A 2BF7A 3FTDA 5CA1A 3D0KA 3L4EA 5FWYB 3ASUA 2VTBA 1O57A 4HMQA 4A1FA 1BFDA 2N47A 3ZIAA 1W5FA 2C5AA 3LOPA 5CM9C 2QTTA 4YONB 3RC8A 4NE2A 4ZAFA 4IIDA 3UG7A 2ZITA 1MJGM 2WWTA 4CM4A 4NDZA 1YCGA 2XMZA 4IDNA 1UT8A 3EMKA 3GCWA 3E9MA 3GY0A 3ZGLA 1M6WA 2ORYA 3U3KA 3GIDA 3W2FA 3D2CA 3SM9A 3M3PA 4QXOA 1Z9BA 4EA8A 4N7RA 3WAGA 4F9EA 1OYYA 3KC2A 4HGYA 5EKSA 2DT5A 3JVVA 1HK7A 4O63O 4XOUA 5JOQA 4QVIA 4BTLA 3KPVA 4AM8A 2OHFA 3MINB 1HDRA 3F6YA 1P62B 4LY6A 5CDFE 1U1EA 3G2LA 1L2TA 4G4SP 4K6CA 4P7BA 4WASA 1IQ0A 3CA8A 2IOYA 1GUYA 2YNMA 1JHAA 3O8NA 3NEJA 4FCTA 1M2VB 4WV3A 1ZAYA 5JTUA 3Q8MA 1F0KA 1L8OA 3OP4A 4MV4A 5HUJA 4HI0E 3R3WA 4MW7A 1QP7A 4ON9A 1NBIA 5LN1A 3MTBA 4OHMA 3BJMA 5FLYA 3D6MA 3QLJA 1XNQB 4ZU3A 1AS3A 2FGJA 1M0WA 4K87A 2KJQA 4BNDA 2Q5OA 1GNPA 2BMAA 4BDTA 3N70A 3GWGA 1JQJC 2ZJ4A 3BKXA 4MWEA 1TJ5A 4CMEC 3ZHBA 5ILOA 2BYTA 2RH9B 3NRCA 4DA4A 5ICEA 1VM6A 3UZUA 4BO7A 3AOGA 4A9AA 2B21A 3C4QA 3ILYA 1JDBB 2P4QA 2RGNC 1UKBA 2JDIA 3IR6A 3IJ5A 4HH4A 4PO3X 1FX0A 2IP4A 3IMFA 4R8MA 4WY5A 3BMOA 3S3TA 4ZMRA 1CBUA 4E51A 3BMNA 3FUWA 821PA 1XI2A 3AOEA 4UM9D 4CG2A 1Y8ZA 5BR4A 2O5VA 3RAFC 2BEVA 5FI1B 3OEEA 4N3AA 2RCNA 3P0FA 2BKUA 4MZDA 3T9CA 2PSSA 5IKPA 1Y9JA 4GT1A 1NI3A 3L43A 4MOWA 5F51A 1Z6TA 3K9NA 3WFZA 3OPXA 4TWAA 2RI1A 3H7AA 3BHIA 1JHUA 1KY4A 1TVKB 4FWBA 3SXUB 4EG0A 1YR9A 1L5SA 2AE1A 5DTRA 2BMDA 3H0EA 4L6CA 2YN2A 1DCMA 2DU8A 4W1PA 1CVRA 4ND8A 5DTEA 3CRMA 1J07A 2B4RO 2JJ1D 1AU9A 1M6VB 1MN6A 4QC2A 3KR0A 3KT8A 5FA5A 3KCNA 3AX6A 3AM5A 4HLUA 2PX2A 5U9CA 1VP3A 2H3HA 4IYJA 2NWQA 3JQRA 1TJYA 1SUPA 1J2UA 2H63A 3I01M 3QHQA 2ARKA 1BG6A 4XPZA 4XWTA 1NMZA 1SCUB 4AN1A 5E7JA 1X92A 1QKIA 4CI0B 4MRSA 4RKRA 3MOSA 2OFPA 1H2ZA 2OT3B 2HEGA 3E0QA 2R1VB 4KK3A 1XCOA 4CKEA 1DJOA 1K27A 3N05A 3PHHA 5DX1A 3K20A 1HF3A 1OHHA 4R16A 3UHOA 4M9SA 5IDQA 5JIBA 2FEKA 5GQSA 2FMTA 3BGWA 1O9HA 2GHTA 2HH9A 3D7RA 2C7RA 3REGA 5CB6A 1I1QB 1J25A 3DA8A 3M81A 2WHPB 4X63A 4IO0A 4LZPA 3UV6A 3ZGYA 1BX3A 4HDKB 4YI5A 1QHGA 5C2JB 1N5OX 2Q07A 2B37A 4YT5A 4WFKA 4C0BA 1IHPA 2C57A 3U62A 2C88A 4XQ9A 2PGJA 2C7PA 2GM4A 3PCXA 3N2LA 5K3EA 1RLOA 2FJ0A 2CEKA 2FPXA 1T91A 4OMUA 3E84A 4O59O 2RGBA 2XWQA 4OHRA 2IFTA 2X8WA 3VR6A 4QG3A 2CXHA 5JFTA 4YRRA 3CNBA 1R3UA 1RBZA 1YK0A 1JHQA 3C4JA 4KE7A 4NESA 4Q9DA 2PX5A 4KQ9A 1V37A 4ZQEA 4GSKA 3W7VA 3E1SA 5JWOA 2AMJA 4RO0A 3ERCA 1VKRA 1EWTA 3BDVA 5EGSA 4DF3A 3BL6A 1EM8A 1USIA 2WYWA 3GGSA 5C31A 1TM5E 2C3YA 3G2QA 4UREA 3VZCA 5LSAA 2C20A 1R4NA 2P75A 4ZALA 3FMVA 1CY8A 3L4BC 4ABYA 2MR6A 3ISTA 3ZWNA 1FYXA 2RCYA 2JEOA 3ASVA 4JX8A 4GDFA 1DOAA 4QA9A 3L0SA 1IH8A 4Y2UA 1TF5A 4BNNA 2CNLA 1JHVA 4MUMA 1OB2A 5D00A 4UDYX 2H29A 5DW3A 1OC4A 2QL7A 4YRZA 5LOVB 2C1EA 1AHHA 1P2BA 3H75A 5D1HA 1YF3A 1E1NA 3WKDA 2DUNA 4Q0MA 1K6EA 1C3XA 2GBGA 2DHEA 3QUTA 2QN1A 4HZIA 5DBEX 4BBPA 5CIYA 3EH2A 4A8HA 2VHZA 3BSYA 3R9IA 4XD7A 4XAQA 4PX9A 3NWJA 1PKEA 2A35A 4UTPA 1EZZA 3PFBA 1ZWKA 4YLGA 1BGWA 1WO8A 2J9ZB 1BRMA 4MITA 3ZZ1A 4CLOB 3AJEA 1VPLA 5HRAA 3LTNC 2OPBA 3SNKA 2YFYA 1GAJA 1U3DA 3QFHA 5K05A 2QUKA 5A7HA 4FFPA 4PXSA 2ZE5A 2CHVA 1RWPA 3QVKA 4L07A 4DR1B 3LUJA 1IOLA 3IS3A 1AZWA 3GEBA 1ZA2A 4IXWA 2A3NA 3GZJA 1AKYA 1EK6A 5EZQA 5AXDA 4G01B 1GGNA 3MPUA 3R4CA 1YQQA 4U8GA 2YRFA 3M4ZA 4G0PA 3KSBC 2FN8A 1YC5A 5EIBC 4F3YA 3AEUA 3IT2A 3A28A 3THSA 2R6GA 4ZOLA 4F21A 4W5TA 4PYOA 4MWTA 4O4JF 2K4MA 2Z2YA 5J1TB 2HDWA 2ERXA 2QB5A 3CWZA 4FW9A 2FSPA 3WGLA 2O8FA 1PZMA 1SB9A 3LX8A 5KYXA 8LDHA 1XZBA 2R7MA 1G5RA 2GZSA 3JCZA 2O3UA 1MT0A 4REQB 4XFDA 4OGWA 3RW9A 3OPNA 2JHAA 3JQ9C 3OM9A 4A1OA 2PN1A 1E2KA 5KYUB 5JLJA 4JL5A 1FW6A 3LQFA 1G2QA 4UUBA 4NABA 2VTKA 4MQ4A 1P3Y1 4WOBA 4AUEA 2X3YA 1W8IA 1Q0SA 3GNLA 4ZCSA 5KJ6A 2COEA 3KYCB 2RHCA 2HNBA 1BROA 1LA2A 1P3JA 2PZBA 5F5NA 3LLVA 3I23A 1UPUA 1GL7A 3TUIC 3ZXSA 4ZO9A 2W7TA 4JJFA 1L8XA 4QTXA 3DKKA 2AWOA 1TEXA 1PR3A 1L5VA 1YZLA 4Y30A 5FFNA 1JKXA 1K2WA 3G7SA 5LXTF 4WOKA 4EEZA 4XFJA 1QYIA 1CEQA 3G89A 1V9LA 1U0OC 2H6EA 1NNI1 3BBPA 4X44A 4JBNA 1ZINA 1ICEA 5A6SB 3KU4A 3HFSA 3M89A 4OQXA 5M29A 3L0CA 3LW8A 4H6XA 2E37A 2A92A 3EFOA 1KMHA 4CR7A 4CM5A 2PUGA 1GZ6A 1NVUQ 2BMWA 2FUNB 1SZCA 4IVRA 4ZODA 2XRMA 4MIOA 5FBWB 2ZTLA 3VAAA 1FFYA 3WGHA 2VP5A 4A82A 2AHOA 3OX2A 1D5WA 2GEVA 2O8CA 1U5CA 1YZQA 3NLLA 4H7KA 1KEPA 1TLFA 1LY1A 2F3TA 2HMUA 1U9YA 4LK2A 5AIAA 4EGCB 2ZDQA 1F0NA 3JQ8A 5C34B 5DNCA 1AA6A 3ADDA 3FLBA 3P45A 4HSGA 3C6YA 5FADA 2ZJ5A 4O4HF 4GEGA 3ZBPA 1GAXA 1UDCA 4BQSA 1GV1A 4CM3A 3KHTA 1MF7A 5CBPA 3LX6A 2IDKA 1D8AA 3M4YA 2J4CA 1ORIA 2CVQA 1FY2A 5BNIA 2JJ1A 2VK1A 3BS4A 1PBTA 1Z7YA 1QH1B 2YDYA 3RO7A 3NFYA 2OQIA 1VIDA 3VXKA 2UV8A 4HK4A 5KNBH 5ERXA 3S40A 3R7WA 2C00A 5AVSA 2DPHA 2PX3A 3ULKA 3T5MA 3I30X 4HLQB 2RK6A 4HDMB 4A8JB 1KYVA 3IERA 4NQRA 4Y2JA 3KQNA 2QJRA 2VJBA 2G9QA 4FIZA 3DL4A 1MBZA 4FGLA 3EA5A 3PQ4A 2UYQA 1WY5A 1KQOA 3JQFA 4NECA 1UF9A 1Z2CA 3LUFA 3NHBA 4A8JC 3N0RA 1R2QA 1WF6A 2GNAA 2LPMA 5K0GA 1USKA 3PC4A 2PA0A 2OL4A 3JQ7A 4YJ3A 1MIHA 3CKLA 3IDFA 2Q2VA 2GVZC 3HDTA 3KQOA 1IYZA 2VDWB 2ATIA 3EG9A 2I2AA 3EB9A 3HA7A 4X90A 4DCNA 4MHTA 3EGDB 3IVMA 2ZJZA 1VCHA 3MWDB 4KR2A 3QFCA 3G9UA 1GEEA 3VPDA 1ENPA 4KYVA 1UBSB 4DKXA 1U1DA 3I4CA 4G1CA 5CYPA 2C95A 5H7XA 1II8B 1NMEA 3KLPX 4H18A 1RCFA 1KDZA 2H4ZA 2QU8A 5M7EA 2C4HA 1E2MA 1L5HB 4YDQA 4KHPB 1MO4A 4MKRA 1XF1A 1BNCA 2JLUA 5FLXA 2JZOA 1K4MA 3CVUA 3H99A 3R9XA 3HE3A 1U28A 4OYLA 4JLWA 5KOJB 1HG1A 4R3NA 1HWYA 3VPXA 3SDZA 1GPLA 1NBOA 1CF4A 1CLEA 1SQGA 3WGJA 1FXWA 1VJ5A 2WHEA 1DC7A 4E4TA 3WGIA 1ZICA 3KSUA 3IVAA 1GLGA 5CPBA 4EGQA 3GPDG 5KPDA 2E48A 3OA2A 3SQLA 3ROMA 4AD8A 2Q1YA 3QLVC 3EVEA 4WY2A 2BFFB 5FL7A 3TNLA 5D6OA 3TOSA 4E11A 2IV3A 1V5WA 2NP7A 1IY0A 2CCGA 5IZCA 5LBUA 2HHCA 3GYGA 3NWPA 1G8KA 5JZ9A 2O8DB 1QP0A 1X7WA 3P19A 5H1YA 3ZOKA 4GMFA 2W71A 4ZRNA 4DARA 1E1QA 1H94A 2D54A 1IDOA 3G49A 4DADA 2FW6A 2Y1OA 3HP1A 5KC9A 4Q47A 1GARA 4P4TA 5SYNA 4EI8A 5FDFA 1QPGA 5ALSA 3VVBA 3E0XA 2XEXA 2D0DA 3H1BA 1T0UA 2VJQA 4U2GA 4UW9A 1SQFA 4RMJA 4OOFA 3RUAA 4DGSA 1HZZC 3KXDA 1PFWA 3B70A 1ISIA 5IT5A 4ZOEA 4G4GA 1K7XB 3CVYA 1E2QA 2VFAA 1KE2A 2OK7A 5DHAA 1FJGB 1XRLA 3C14C 2BIFA 1EXMA 4OATA 1EIZA 1GQFA 4DPMA 3T5PA 5LM3A 4F4IA 2ZRBA 3T3EA 5FPQA 3KXIA 1S8FA 3Q41A 2XIJA 4D8YA 1YRLA 3PJEA 4CEJA 4IDCA 3FZNA 4GR9A 1EA5A 2HU7A 2XH8A 1G42A 5DRYA 3TQIA 3OLWA 2V7UA 3ONDA 2XGOA 3ENZA 1V6CA 4RTQA 2QX4A 1U0TA 2V03A 2VXOA 3K30A 4J0JA 2WFAA 4W82A 3KDPA 3WG9A 5EP1A 2VF8A 2CKDA 5H82A 4YX9A 4UM8B 3AHGA 5JADA 1ZUNB 4JQSA 2C8LA 1KI4A 4MUHA 2L69A 6Q21A 1WU8A 2A3RA 2Q3JA 3F9RA 5DYYA 2AC7A 1PW5A 3PQ2A 3SYNA 3I2GA 3NHMA 4OUDB 5T4EA 1GPNA 3AZOA 3H2BA 4CM9D 2CJYA 1Z4OA 4GQBA 3ZLJA 3HCCA 4HAXA 4RABA 3T7RA 1U0SY 1CJCA 1MOZA 2XAUA 4DUPA 1YWGO 1QHIA 1W25A 3C1OA 2QRMA 3DXFA 3K8QA 1NJ6A 1NPYA 1SG0A 1NU8A 2J8ZA 1EBUA 2DWOA 4L5CA 5BN3A 3KELA 1AKUA 2X19A 3KSDO 3PX2A 1KMNA 5HRUA 4ODIA 2Z2KA 5EERA 3O47A 3HXQA 2H00A 3DNFA 2OM2A 5DHRA 3DOFA 5A3SA 2NPOA 3B7GA 5G4LA 2WJHA 4ER3A 1DKNA 3ZD7A 3V6LA 3AHHA 3GVXA 1GT91 4NC9A 3TUZC 3P96A 1MCZA 5EQTA 3WO0A 4DL9A 5H4GA 2E18A 4EUKA 4P3YA 4B6EA 2RK4A 4BP3A 4JGBA 4KXXA 1K89A 4HOYA 1KI6B 4FHDA 4MKZA 2ZJ0A 5D3MA 5G1NA 3WZ2A 4QQRA 3H6GA 1G5QA 1M8FA 4G0OA 4RNCA 3SICE 1NUHA 1PZNA 1M2GA 2BM1A 3AEXA 3LMKA 3MVEA 2UUBB 3AI1A 3H18A 4OUKX 3WP1B 1TAUA 2V7PA 3JWHA 3MCUA 4LRWA 5ESRA 3O91A 4CRWB 1A8SA 5JY6A 2QQGA 5P21A 5BNTA 2BD0A 4UU8A 5HQ3B 4O4JB 1MQSA 2JFXA 1FP4A 2JIZD 4LMRA 4BO1A 1BDIA 1WDMA 4YO7A 4BAUA 3TE7A 1DKMA 2QUZA 4J76A 3HI6A 3TB6A 1USWA 4BFYA 1K0UA 3RS0A 3AT1A 4XYEA 4DIOA 1P2FA 1K98A 1PFKA 1RYMA 4JR1A 1I3LA 4F4UA 1L6IA 1DC5A 3JD4A 3KUCA 3KBBA 1WRBA 4KPUB 1N2GA 1LDMA 1O95D 2C92A 2RAFA 2LXNA 2ZUUA 3KYJB 1AGXA 5IXYA 2DSTA 2X4LA 2ZBPA 4Q4CA 1I5OA 5LMZA 1P8AA 2C5HA 1J70A 3LQRA 2E6KA 4P4LA 4BNHA 3EWIA 4DR7B 4DABA 3SZRA 1SIWA 5CM2Z 1C9EA 1DMSA 1GPYA 3V1UA 5AESA 5LXTB 5IVDA 4MS1A 4UUMA 1NMXA 1CJMA 1P73A 5ESDA 5H0IA 4F9TA 5KJFA 4F3NA 2I3AA 1GCOA 1SG6A 2WIFA 1QS0B 3LK7A 2OAQ1 1Y9AA 3DONA 5KVQA 4CQMB 3OLVA 4UCWA 1QIMA 3WKCA 4YRAA 4RKQA 5EHXA 4RTKA 2FFHA 1ZL2A 3ETNA 2QZJA 4UXJA 4Z5XA 2AG5A 4YRSA 4I5EA 4TLAA 1ESNA 1S2LA 3WP0A 2AEFA 2I1LA 3HCEA 3MZ0A 3OJEA 5TMBA 4A15A 2DG2A 3VYTB 3OHPA 3T5TA 3BSFA 1EKXA 3EEYA 1CNFA 2D1QA 1AF7A 2ECFA 2V8BA 1ZOPA 4GC9A 4LDPA 3F96A 1ZIYA 3U61B 2WZDA 1CEYA 3TL6A 5DNAA 4TSFD 5CX1B 5E95A 4C0LA 2P30A 5F12A 2Y3IA 1I30A 3F2VA 3KVVA 4O4HB 1SBQA 2I2CA 4BMYA 3F3MA 4J3JA 2OCBA 2I99A 4GGOA 1JBEA 1ZD1A 3TS1A 4P54A 3ANXA 4BV9A 3DWEX 3OZSA 5M2QA 4G9GA 1KVUA 4YDSA 3BIWA 2EJVA 4K8OA 3I64A 1NKSA 1SCAA 1QVRA 5IM4F 4WLUA 2P9YA 3CT4A 1OLSB 3JQBC 1KORA 3O8LA 4ITVA 1HRKA 1QQTA 1W4LA 2IF0A 1QX4A 4LRQA 3LVQE 1CUZA 3KWLA 2QM0A 3SSNA 3LFHA 2BGGA 2RKOA 4INOA 1ZBQA 1VMIA 1Y4AE 4MVJA 3P27A 2XGSA 3D2BA 3SXJA 2WVHA 3DVRX 4EWLA 1M72A 3NH6A 4MWGA 2WFLB 3T3IA 5FBVB 4CIAA 2R9VA 2YHIA 3VR3D 5AQ1A 6YASA 1WIWA 1O4WA 3A2KA 1FBTA 1TAGA 3COSA 3LLMA 3AEQA 5GGYA 2P78A 5GJBA 4C0QC 2W6CX 2EC5A 2O2YA 3K1JA 1VYUA 1TCVA 2ZYHA 3VZSA 4GSYA 1O0SA 3GPBA 3ITEA 5I51A 2C3PA 5B6PA 2NUTB 3LKVA 4X95A 3WS7A 5LIPA 2C7GA 4BV2A 3ZOZA 1CUBA 4JAVC 5IRCD 1FLDA 4EHFA 2G5GX 4N01A 2UYYA 3NHUA 3OWXA 1SR8A 1YA8A 3RVQA 1Y4SA 2A1UA 3ADKA 1AS0A 3MMPA 2BOVA 4W6QA 3L05A 1ZJ5A 2HD4A 2I4OA 3AFGA 3HUTA 3IPYA 2P91A 4Q24A 1SXJB 4LXIA 4ESEA 2ST1A 5C1BA 3DBIA 4JNCA 3VTAA 3JWPA