1FQKA

Crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
318
structure length
318
Chain Sequence
RTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1,Guan
publication title Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 119
structure length 318
sequence length 318
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1fqkA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fqkA01
3AQ4A 1ZJ6A 2D3WA 1Q12A 1GNPA 2AWNA 3AF4A 3PENA 4FMDF 1W36B 1TNDA 4ZKEA 3WHKA 3NEYA 1G5PA 1T3SA 4TWZA 5DH9A 3SNHA 5KSYA 2G9NA 2P0EA 2VP0A 4FINA 3ZDQA 2GXSA 2VHJA 1FTSA 1JB1A 2JATA 4XWOA 1CBUA 2PZFA 3SYLA 4IXMA 4Q7MB 1W46A 1Z0KA 3ZZ0A 1VYTA 2ZJYA 1Q21A 1XPRA 2OILA 3OIVA 4HATA 1E2HA 4GOJA 4L15A 4QGGA 1VCIA 3X1DA 4RZXA 5HPYB 4EPWA 1KSGA 3PUWA 3TSWA 1X1SA 2ZRJA 2ZAOA 3DVLA 4NCHA 3ETLA 3WBJA 821PA 2QEQA 2V55B 1SXJA 3UANA 1RRCA 2W6JA 3BFXA 1XX6A 1I4LD 1MO3A 2JAQA 3AKCA 1XPOA 1NN1A 4HB2A 2QN6A 3BRWD 1KIMA 1XJ0A 4XWKA 2V6IA 4KVGA 5DN6D 3BB4A 4CEIA 1CULC 2FV8A 3U7EB 3B7GA 2F55A 3U44B 3CRW1 2PMDA 4G5QA 3NBYC 2F3TA 3W90A 2AXNA 4NYMR 1ETUA 4QBFA 2HYDA 3KDSE 1ZP6A 4QJ5A 2BEJA 2VSXA 3OEEA 1S3GA 4OI2A 3RS0A 1TQDA 1S9HA 3WNBA 1NG9A 1EFRA 1DARA 2ZRCA 2ERXA 4Q4LA 1E0SA 1OH8A 2X77A 3DHWC 1KKLA 5JEDA 4DCUA 1AGRA 5TY0A 3UG7A 3QEJA 2NOAA 1T5LA 2Q6TA 4JLMA 4BWYA 5AJWA 2NG1A 1KNXA 4B2PA 3RWMB 3JVUA 3VKGA 3I62A 1L4UA 2RGNC 4C0HA 1OHHD 5KO2A 4U7DA 2J0QA 3LQQA 2GBLC 4EFMA 2F1HA 4OHZA 3PEUA 1DEKA 2VP2A 2DFTA 3LXXA 2QNRA 2JDID 3MAAC 2WKPA 3I8XA 5BN5A 4G3XA 4PAMA 1LS1A 2A2ZA 1JBKA 4JL5A 2OFOA 1XB2A 2ZR7A 1VPLA 1XD9A 2KSQA 2KI5A 3VX4A 1GM5A 1G64A 5E7JA 1ZCAA 4EQ6A 2X1VA 4TL6A 5SZKB 1E2PA 4B43A 4CW7A 3GJ7A 3QBTA 3K70C 3KUCA 1ZVQA 1JPNA 3BXZA 4V0MA 3AVUA 3BK7A 5JJIA 2Z0MA 2F43B 5JWOA 4JVSB 5CB6A 1TU4A 3ZYCA 3C15C 1YE8A 1KDTA 4TLDA 2GESA 2CLDX 1MKYA 3NBZC 1U9IC 4F4JA 2IXGA 2YJTD 3LVRE 4L4UA 3LD9A 5L3QB 4D25A 1KI9A 4KAXA 5HE9A 5L3VA 3AKDA 1NBMD 2LKDA 1EXMA 2PMKA 4UKDA 3KQLA 1U81A 2ZU6A 3QXHA 4MRSA 2BOVA 5JS8A 1FZQA 3W9YA 1TTTA 1ZD8A 1W0KA 5HKKA 2J0SA 1E9EA 4Q4HA 5A5GA 5FUYA 1NSFA 3MWJA 2GETA 1R5OA 4M9SA 4ZKDA 2C78A 2QP3A 1E2MA 1P9NA 1S2MA 1GKIA 1P61B 4Q9JA 1UEJA 2FFQA 4Q1EA 2QGZA 3TKLA 4IOLA 1NIPA 3NG1A 3EZ9A 2A9KA 1XCGB 4CRWB 3FMIA 1XEWY 5FH9A 1QHNA 4RFVA 2VSOA 3MMPA 5FPKA 2QTVB 4JBYA 3K9LA 1WDTA 4QXAA 4LSGA 2KWIA 3BE4A 2JLSA 1RJ9A 1SVKA 1PJRA 2PLFA 2ONKA 1KOFA 3E70C 3NIBA 3T61A 2ZRNA 3CX7A 121PA 4DDTA 4PPQA 4IRUB 1G3IA 4N3NA 3KQKA 4GFDA 1JJVA 4G5SA 1HE1C 1VCOA 1HYQA 1OH5A 4F4CA 2Z83A 5E7IA 4PC7A 4C0KA 1SKQA 2YINC 4KSBA 4NBSA 4QFMA 5F98A 2EFCB 3X1ZA 1DADA 1GOTA 2NPIA 3IIMA 5D3QA 5GADl 2DWQA 4MYCA 4K46A 4LJ4A 3LBNA 1PZNA 1KI1A 1Z0AA 4WW0A 1GTVA 4TL9A 3CBQA 1Z83A 4B71A 2QBYA 3LH5A 3LDAA 1Q3TA 3PVSA 4CYMA 4DJTA 5J47A 1OB5A 2GXAA 1U94A 5EE0A 1ZUIA 2Q9AA 1SXJB 4Q9KA 2IYYA 1II9A 2FZLA 1KO8A 1IHUA 2FGJA 2QRNA 3CF6R 3W8NA 4ZV4A 4UJ3A 2Q9CA 5EXTA 1K5GA 4CEIB 3SZRA 4Q7JB 5FOXA 2ZSDA 1KI8A 2FE4A 5EXXA 4B3GA 2BMFA 2ORIA 3BWDD 1G6OA 2R8RA 2QY9A 2GCNA 4HB0A 4I99A 1NVVR 4IDHA 4QGHA 3RSOA 2Q21A 4C4PA 1BMFD 3QENA 4ZCLA 3LWNA 3OE7A 1TF5A 2GJKA 2QMHA 4R71A 1K8RA 1E2QA 4UXJA 1FP7A 4EFNA 2HF8A 1GRRA 2XZOA 2NO9A 1KI3A 1SVMA 4JMPA 1CXZA 2ZXUA 4II7A 2P3SA 1X86B 3I4LA 2OCAA 3CLVA 1XTIA 4LYFA 1UBFA 4W5WA 2XEXA 2GEUA 1MH1A 1NMYA 2DY1A 2UZIR 2ZR9A 1AM4D 1W2GA 3O8BA 1G41A 4NCNA 4LUCA 1FP6A 3GFOA 1OKKA 3KB2A 4YMWA 1DELA 2QPAA 3RRNA 4D0NA 1TX4B 2G6BA 4UXHA 2OT3B 4KFRA 2VEDA 2UVQA 4KODA 2YWGA 3A37A 3T1QA 1TL7C 5P21A 2ZJBA 3SI7A 1D6JA 4UNRA 4JT2A 2IYSA 4BGDA 4PC1A 2YC4C 1J2JA 4KBGA 4LHYA 5EXSA 4DLVA 1IY2A 3CZQA 4MGZR 3EA0A 5JMTA 1VMAA 3KZ1E 4EPRA 5FTLA 2XJ4A 4EQ6B 1T9HA 1TADA 3WYGA 3EWSA 4G1UC 2OLJA 1U8YA 1R4AA 2UZ3A 3ZZTA 1P7CA 4MQBA 1MRNA 3QPWA 3SN6A 3VR6A 1JXMA 4RCYA 1XD2A 2JCSA 5FFMA 2Y8EA 2RHDA 1DAKA 4Q47A 5SZIA 3P4YA 4LWZA 1ZM3A 1I2DA 2WIAA 3WRXC 1G7RA 5FUVA 4AYXA 3LXRA 4XTRA 1NJGA 2OFWA 1DTSA 1DO2A 1KI2A 5B30A 4HDQB 2B8WA 2BCGY 1ZMXA 3AUYA 1A5TA 4Q4HB 4NYIQ 1S8FA 1OIWA 3THWA 1XTKA 1KK3A 1CR4A 1KI6B 2O52A 4DSOA 1U98A 2ZR0A 1NG1A 1GVNB 1US8A 1YR7A 1Z8FA 1X6VA 4NL4H 4JLVA 1PLLA 3CKLA 5EP2A 1W4AA 2A5FA 4TZ6A 3K53A 2W00A 4Q18A 1IY1A 4DLXA 2ZI4A 5IDVA 1C1YA 3ASYA 2GZDA 4QBIA 4C9BA 4HZUA 1YZTA 1RIFA 2BEKA 4ZCMA 3QBVA 5IT5A 2D2FA 1E2FA 5AUPB 1MV5A 1RJ9B 3HR8A 5FR1A 3QE0A 5H1YA 1G7SA 1WRBA 1ZNYA 2PCJA 4KYUA 4ASUD 5G40A 2ZE6A 3EG5A 4Z1MA 4JL6A 2AHOA 3IQXA 3QJYA 4LV6A 3WMEA 5FBRB 1HE8B 3CB4A 3UMSA 2JLXA 3J81k 2ZRHA 3L0SA 2ZYTX 4A92A 4Z8XA 4I4LA 5AWFC 1GDDA 1OH7A 3DOFA 3UPUA 1UBEA 3BS4A 1LW7A 1FX0A 2QPTA 3GJ6A 3N5CA 2FGKA 3U3JA 1EGAA 1PLKA 1OSNA 1AJEA 3MUFA 4I1VA 3T5GA 4B32A 1NP6A 4EPXA 1Q57A 2Q9BA 2IA5A 4OHWA 1CTQA 4JS0A 3X2SA 1ANKA 2DR3A 3FB4A 3KTAA 4RD4A 2QBYB 3H0KA 4QC2A 5EE3A 3ZVNA 1B0UA 4E03A 2V6JA 4WBSA 3VR1A 2PLRA 4AC9A 4LBWA 4B34A 3QPVA 1SZPA 4NONA 5DSZA 2MSCB 4GDFA 3VKHA 4AYWA 1DO0A 4BUJA 1NBMA 2IF2A 3A1SA 1Z6YA 2ANCA 2GXQA 1P62B 3Q5DA 4URUR 2IYQA 1N0VC 4C0BA 2CBZA 5F3WB 1SVIA 3OF5A 1LTQA 3TBKA 1OH6A 5BW8A 1II8A 2NO7A 5CYPA 3B8HA 2WWWA 1YKSA 1J8MF 1SHKA 2J41A 5FOWA 5H8WA 2EQBA 5K8LA 1Z06A 2BJVA 2ZS7A 1JXOA 1WMSA 1VHLA 4HAZA 4TSFD 5JS7A 1JQLB 1XFAA 2W6ID 4TMTA 2E87A 5KPJA 1F2TA 3V9PA 2R62A 2WAYA 3Q5EA 2RGEA 3CPJB 2RHMA 2PT7A 2QP9X 3NEJA 2C95A 4B3CA 3B5JA 1YZNA 1UEIA 2BKUA 2J45A 5EZ6B 1PUIA 1SULA 3RSLA 4Q5IA 4M9ZA 2EW1A 4KSCA 5IRCD 1N5LA 3B1VA 2C96A 3R8FA 3UK6A 5LB4A 1WE2A 1WF3A 2WJYA 4LV8B 3VFDA 4LHWA 4D4LA 1ZM4A 4AG6A 3T1TA 1E2NA 3Q85A 4BRUA 1GRQA 4H1VA 1G18A 1EG7A 1M7GA 3PUVA 4H1UA 4PO1A 2UKDA 4R2IA 5AJZA 3GLGE 2BCJQ 1J7KA 1W47A 4EDHA 4A15A 3CIOA 3FFAA 2BM1A 5F2EA 2EYUA 4W9MC 2WOOA 4OHYA 3NDBB 4QGFA 4Q9HA 2QTHA 5AR1A 3MGCA 2QMUA 1WCV1 2PEYA 2V7QA 1J70A 3W3ZB 2R44A 4FCVA 2CHQA 3GFTA 2REOA 2BKEA 1G21E 2Q3HA 4PR0A 1XD2B 1W4BA 3M0EA 4TYYA 2OESA 4RY2A 4DCSA 3ZIAD 1JR3A 2D2EA 3LBIA 4TMXA 3TR5A 2WTUA 5FOTA 4OJQA 1OXUA 1KO1A 1ONBA 3U3MA 1CJMA 1FQJA 2VP5A 5CDFE 2ZUCA 1SQ5A 4EUNA 3GLIB 2PX3A 1ZRHA 4EKDA 3ND8A 1PV4A 3I8SA 2B6HA 4TTPA 2QQEA 1N6RA 2OAP1 3THWB 4LV5B 4DCVA 1ZU4A 3LX8A 3EPHA 3T5DA 2GAOA 1XTRA 1DAGA 1US8B 4NYIR 3K9NA 4I1SA 5CK5A 2FZ4A 2RGGA 3BAFA 5FR2A 1RRPA 4TTRA 2QSYA 1IN4A 2VHCA 1NN3A 5AUOB 1UKEA 1XJCA 4Q48A 3FOZA 1VG1A 1Z5ZA 2R6DA 3UG6A 1KY2A 4HZUB 4OYHA 1YHNA 1E2DA 3HU2A 1GL6A 4OI1A 2VP6A 4ZDKA 1YZLA 1NIJA 1MOZA 4ZDJA 3THOA 4N0DA 3T35A 4D2IA 1SVOA 4TL7A 5H68A 1R5NA 4KVAA 2XTMA 1IN5A 2PT5A 4WZAE 4FCTA 4EIWA 5FBQB 2ZS9A 1PVOA 2V8OA 4JL8A 3SYNA 3TMKA 3WXMA 4IDQA 1E9FA 1H8HA 2CLCX 4PQYA 1CJKC 4NMMA 2XB2A 3CR7A 4MDEA 2CNWD 2ATVA 3EA5A 3PR1A 3AVXA 1G19A 1IXSB 4C0SA 4M1YA 3WBKA 1G4UR 4CT5A 1OW3B 1Z0FA 4Q01A 3EPKA 3GEEA 1G20E 4A6PA 2ZEJA 2ONJA 2XJ9A 3KTAB 1GL9B 5JRZA 2EWWA 2IXEA 2NZJA 4P3YA 2QI9C 3FHTA 1P2UA 4RD6A 721PA 1UKVY 1QBKC 1E1QA 2ZI9A 1N6OA 3SHFA 2LWIA 2B8TA 2YYZA 1G9XA 2FEOA 1ZNWA 2ZQ5A 1G8GA 1HQCA 4DLYA 2IYZA 4DDUA 4YXWD 4ZI2A 4QM7A 1JQJC 1E9RA 1Q0UA 1G17A 2V4ZA 3U6BA 3C8UA 4JJKA 3CUEF 4GPTA 1M6NA 3PUXA 4LHXA 4GT1A 1X8KA 1P9RA 2EVWX 3LLUA 1U0LA 4C0LA 2WJIA 4DSUA 3DMNA 4ERNA 4JLKA 1II8B 4FI3C 1WB9A 2F6RA 4ZI3A 2A5GA 3AB3A 3EZFA 1E98A 2PBRA 3U3OA 1WA5A 3EASA 4EJSC 1XD8A 4TLCA 1U0HC 2OSBA 4HAVA 3FHOA 1F2TB 4FXPA 3I1FA 4V0NA 1NKSA 2EFHB 3CWQA 2ZIAA 1KMQA 2WMOB 3BB1A 1YVDA 1TEVA 2WWHA 4L9WA 4PO8A 4PC6A 3T1VA 2J0VA 1Z6TA 3OIWA 4JBWA 4DDWA 4V03A 1ZYUA 1UFQA 4HLUC 4O3MA 1A2KC 1G7CA 1FL9A 1XEXB 2IYVA 2FN4A 4RFSB 3HPQA 1MO6A 5DI3A 1ZIOA 2VHUA 1BS1A 3A4NA 4GMDA 2D7CA 2I4IA 3NH9A 4XTCS 1OIXA 3AKYA 2R65A 3QSYA 5JJKA 4YONB 1UF9A 2GEVA 3OAAD 4FWIB 4RZ3A 1BO6A 3B1ZA 5KSZA 5KYKA 1FOEB 2RGBA 3V00A 3T1OA 4BFXA 3I92A 4H9GA 4ARZB 1VIYA 1W7AA 1TF7A 1NRJB 2B7BA 2IEYA 3IGFA 4Y0VA 3HDTA 4B6FA 3P4XA 3QUSA 2YOGA 4IHQA 3H1TA 4BFZA 1ZD9A 1TF2A 4OHVA 2OM2A 1II0A 3WYFA 2IYRA 2QT1A 3KQHA 2DFKB 2TMKA 1AQYA 1I2MA 2DB3A 1EK0A 2BIFA 4PQRA 3NWJA 2CL7X 4TT3D 2J3EA 2AFIE 3BFVA 3M4YA 4DLZA 4ESHA 1DAMA 3HP1A 4LPSA 3EX7C 2KJQA 3FTQA 3ADDA 4BFYA 2FSGA 2OE2A 2ZS8A 1KJYA 1OF1A 2I3BA 2FX3A 4KCGA 5K8UA 4DLTA 3HJNA 2FDCA 5F9HA 3R20A 2A5DA 2F9LA 3TR0A 2ZRKA 3LNCA 2KB0A 4MKHA 3EXAA 4A82A 2WJJA 4M1WA 5FL3A 5DI9A 4X8MA 1QG4A 1XNJA 5FI1B 1NF3A 2ZETA 5IF9A 5J4KA 3K0SA 4A2QA 3PV0A 1QF9A 1HY3A 3FKQA 4UNSA 4HDCA 4K81B 4A8JC 1J99A 2QGNA 4C0AC 1TMKA 2PZEA 2ZI7A 2ZJ2A 3CNOA 4B76A 4GRAA 5AJYA 2QA5A 2YWEA 1Z0DA 1KTVA 1E2EA 1W5SA 4IOMA 3SJCA 4O2RA 1XZQA 1HUQA 1M7BA 4MYTA 3L8YA 5B57C 4M1OA 1W36C 5JLJA 2RGCA 2GAAA 2NGRA 5DHFA 3RC3A 3ADBA 4OL0A 4DXAA 4ZIRA 1JPJA 1S96A 1QHGA 4HUQA 1D9XA 2VO1A 1DVRA 3RS5A 1IN8A 4TLAA 4ZDWA 4LJYA 1H8ED 2DPXA 5BWMA 2ODEA 2BJWA 5LDDC 3OZXA 1WBDA 4KBFA 2X2EA 1COWA 2PCLA 2C03A 1W49A 4O2LA 2V54A 4BZXA 2A78A 4JVLA 2CK3D 2ZSBA 2WKRA 2ZJ5A 4DRZA 1LVGA 1T8UA 2R6AA 1NKTA 3DO6A 2RMKA 1OE0A 2J9RA 2ZVQX 4KFTA 4MDFA 5HE8A 2P2LA 4B74A 2VA8A 4BECA 1E1RD 2CCKA 2ODNA 5JI3E 1TQ6A 5EP3A 3NC0C 4MKIA 2A7QA 4AG5A 3BJIC 3W6PA 3FKSD 4EPYA 2ZANA 3EIQA 4LPKA 5DYGA 1D2NA 2WHXA 2P6UA 1ZNXA 4FN5A 2BDTA 2O8DA 2KBEA 3LA6A 1T0JB 4W5HA 1HEIA 2A3RA 1E79D 4RSGA 2N42A 4DUGA 2IS6A 3B1YA 3EZ7A 4PQFA 4L16A 3CF2A 1T5IA 3UIEA 2OBLA 3T06B 1W1WA 4A0RA 5B58C 3IHLA 1S3SA 4AKIA 2QQ0A 5JSZA 1AA9A 3PG5A 1J90A 5G3ZA 4B6EA 4KFSA 4Q4AB 2BBWA 2RAPA 1R6BX 4A0FA 1GZSA 2BMDA 1DPFA 1FNMA 1N0WA 4JVMA 3UWKA 1TQ2A 5DLQC 2RKOA 1F60A 2OEPA 3RHFA 4DLWA 4DLRA 1B23P 2FWRA 4PAOA 4RZ2A 4A4DA 4KYIB 4U5XA 4LYJA 4B75A 3AKEA 5DI3B 5C18A 5DO9A 1MT0A 3I72A 1KI6A 2W2TA 1AKEA 2JJ1A 3IBGA 4N1AA 4Q4JA 1G5RA 2C99A 4Q66C 1RKBA 4NYJR 1TAGA 4KFUA 1G3MA 1KZ7B 4NPHA 4NU0A 1WQ1R 3PJRA 1H65A 4A2WA 2IWHA 1M8PA 1K6MA 2ZJOA 2FOLA 2WVJA 4MYHA 4XVRA 2KBFA 4RKEA 5G53C 5FBWB 3QNUA 1WXQA 4MRNA 1Q20A 3X1WA 1RE0A 4XSHA 3RRYA 3HWSA 1OYYA 1XXHE 4CEHA 2BHRA 4GNKA 3AVWA 3CH5A 2H17A 2HF9A 2JLZA 4FMCF 2OXRA 4ABYA 4IEEA 2FH5B 1F3OA 1CIPA 5LB2A 1GAJA 1UDWA 1Z6GA 5GJWC 1OT3A 2G88A 2GILA 1G16A 5GJBA 3GEHA 3Q8XB 3A8TA 2WAXA 3BORA 5EE1A 1Q22A 2ECKA 4JLJA 3CM0A 4KITB 1CRQA 2HEIA 1KDPA 4OQFA 5KDDA 4LBYA 1VG0B 2J7KA 1P75A 4AKGA 3U3RA 4DSTA 4JLAA 5CM8B 3THXA 2RGXA 3OHMA 2XZLA 3ZS8A 4BZPA 4IEIA 3QQ5A 4L5BA 3SEAA 3GQBA 2GRJA 2HCJB 4Z54A 1KNQA 3AF2A 3AP2A 1XTQA 2JIZA 3OEHD 2XNDD 3G82C 1XU4A 4LDJA 2ZI3A 1VCNA 1Z47A 1AZTA 4WXPA 3IQWA 1NJFA 3ADCA 3GLGA 2QUZA 4NP6A 3F0TA 2FPLA 3KXIA 1S9DA 3RANA 2CHVA 2H8KA 2QE7A 3FMOB 4A2PA 5BXQC 5DISB 1U8ZA 3REFA 2PZGA 1G8FA 2VF7A 3R7WA 1EX6A 5C4GB 5AUQA 5M04A 4WVFA 1X8JA 3GLFA 3QXSA 2FPKA 3AP1A 2H5EA 2WMNB 4PXAA 3O8RA 3I5YA 2FNAA 1CRPA 4YMVA 1UKZA 4JLDA 1L8QA 1XMIA 3B9PA 3CONA 4OQMA 1F6BA 4YQFA 3MCAA 4ZIRB 3P32A 5CB8A 1QVRA 4HUQB 1HV8A 1OJLA 3KKPA 3ZH9B 1KK1A 3NDPA 4NCJA 4B3BA 5L8VA 4DB4A 3M1IA 4KV9A 3WP0A 3LFUA 5CDFA 4US2R 2XX3A 3A1UA 1PLJA 3TNFA 4BLOA 4NZYA 1E96A 1XF9A 2ORWA 3QKUA 1TEXA 3C7KA 3ZS9A 2QPOA 3O8DA 3VMFA 2WWFA 2ZYWX 4BASA 5EJEA 4LBVA 4Q7LA 4BZQA 4CZ2A 1U8AA 3IIKA 3MG9A 3VKWA 2BM0A 4BFTA 1SXJC 3AVQA 4F92B 3W34A 3B1WA 4TLBA 5J5CA 1N6KA 1Z6AA 3BB3A 4P4SB 1OYWA 3PQCA 1HT2E 5KSPA 3TUJC 2ZPTX 3RABA 2OZEA 2EFGA 1JI0A 5JZVA 4FIDA 3BIFA 4FMDB 3UKDA 3QKTA 4OHXA 1G291 1XPUA 4RZUA 3WYAA 1KO7A 1VECA 3EZ6A 4DT1B 3CNNA 4PHGA 1N5IA 1JJ7A 2D62A 2IF0A 3K0CA 2O8DB 1E69A 2GKSA 4Q1DA 3B1XA 1ZAKA 1DAIA 4AK9A 1SVSA 3WHLA 2ASEA 4BLSA 3C41J 2WPDD 3RDPA 4IJMA 3GLHA 3NHBA 1R7RA 1VG8A 2IS2A 1E9BA 2YOHA 3K70D 1M2OB 3GFPA 1SXJE 4LRWA 2F7SA 5J4VA 3K0AA 4AKEA 1CU1A 5JSZB 3TUIC 4ZDIA 1KAGA 4GMXA 3P27A 1TPZA 2CL6X 4Q9IA 5EUMA 4M53A 3IKJA 1D9ZA 4PZLA 4RJLA 1GFIA 1UBCA 5DN6A 3GLIA 2CEAA 1U0JA 2WV9A 4D4JA 4DLSA 4ITRC 4DIEA 1NSTA 4OQXA 4MUAA 1E0JA 1L7VC 3G0HA 4WXRA 4Q4JB 3KKQA 4IFBA 3VNUA 1FPMA 1XRJA 2C9OA 4LK2A 4EFLA 2FPMA 5CIQA 1E9DA 2IW3A 3FMPB 1G8PA 1KJZA 1E94E 2IYTA 1Z0IA 1AS3A 1U99A 3MFYA 3U60B 3B13B 1KGDA 1P5ZB 2O0JA 1P2VA 1KYIA 1GL7A 1JEDA 4CGZA 2QAGA 1IJFA 1HT1E 4OJKA 4B47A 3K09A 4CEHB 4B3XA 4PHFA 1T3HA 1OHHA 5EZ5A 4PO9A 4P4TA 5C1BA 4JSTA 5JRJA 4K8OA 2BBTA 2N46A 1MR3F 4HLCA 3AH8A 3EW9A 2JDIA 4LOAA 3AVTA 1A1VA 3FDIA 4V0KA 5CK4A 3HYRA 4FW9A 2REBA 1JECA 2VIIA 5HCIA 4RD2A 1YZQA 3FMFA 2J59A 3KQUA 4Y0AA 5IHPA 1NNEA 3T12A 4QRHA 5C46F 4G0NA 2HJVA 2AR7A 2IWRA 2ZVPX 3CO5A 2ERYA 5EUQB 2OBMA 3AUXA 1M34E 2C5LA 1FUUA 3KB1A 3THXB 1RYFA 2JGNA 1NY6A 2ZREA 4ON9A 5AJXA 1LF0A 5EP4A 1FNNA 2G1JA 3U7HB 3BGWA 1CP2A 1UKYA 2FU5C 4WAUA 3KUDA 4QM6A 2V3CC 2HLDD 4HLQB 1P9WA 1QVAA 1AS0A 4B73A 3CF0A 4M4SA 3GLGB 1TUIA 2PH1A 5UKDA 4IXNA 5JECA 4GOXA 4DCTA 1OLOA 2WSSD 3IIJA 4M1TA 3KJIA 3R7WB 1QZXA 3RLFA 3UXMA 2G83A 4KLNA 5G41A 1OFUX 4IDPA 3D8BA 1UM8A 2QROA 3GLFB 4PC3A 4US1R 2J7PD 3MWYW 3OFND 2ODBA 2OHFA 4PX9A 1KKMA 2A30A 2O8CA 3TJZA 4C2TA 4B3FX 3RC8A 3QG1A 5FPHA 1KSFX 1U90A 4LYAA 4JSYA 2F9MA 2CLSA 5JWHA 3TRFA 2O8FA 4LC0A 3NH6A 3ZLJA 3GJ8A 1XEWX 1IJEA 3KKOA 3N2IA 4LJ5A 1NN0A 1TQ4A 1VYUA 5HZHA 4I81A 3SU8A 3CRVA 3H86A 2V1UA 4BLPA 3DKPA 3W5JA 5JHHB 4LHVA 1XMJA 3R9IA 1XEXA 2DHRA 2GJSA 2QP4A 3LRPA 4DBLC 3MLEA 4RFSA 4GZLA 3P1JA 4TYWA 2GJAA 2GJ9A 5IK2D 2A5YB 1PUJA 3GPLA 2ZJZA 4JT4A 3X1YA 1OIVA 1QRAA 1GG2A 4PSAA 3U61B 1SXJD 3G5UA 2W6JD 5D3MA 4PFSA 3ICEA 2P5TB 2V1XA 4ARZA 3RWOA 1YR8A 1AN0A 4IDNA 1HQYE 2H92A 2DFNA 2B92A 2NO0A 4MUBA 5FPSA 2QMEA 2QG6A 3NBXX 4D80A 4LJ9A 2IT1A 3R9XA 1XP8A 2XTZA 4IVQA 3THYB 2OUKA 3OEED 5JJLA 3GLHB 3EIHA 2AWOA 1EFRD 2XNDA 1QHYA 1YRBA 2Z4RA 1OV4A 1N6NA 3MWLA 4JKIA 3QF4A 3Q7PA 4B3DA 3K0AB 2WZQA 3WMFA 3LW8A 3MJHA 4D4KA 1E0AA 2JA1A 1ZM9A 5DE3A 2Z5FA 5EQTA 5SZHB 1OFTA 1S4QA 2ZRBA 4UXIA 2EWVA 4M9QA 3L2OB 1E9SA 4C7OB 5EE9A 5CLQA 2P65A 3L8ZA 4R9UC 4GP6A 1Z0JA 5ELXA 5KTYA 4DB2A 1CJUC 1XTJA 4LGMA 3SJAA 2GVZC 1T3LA 3PEVA 1AZSC 1BMFA 5H70A 2BVNA 1ZC4A 2F1JA 2C98A 3AVYA 3QXXA 2ZJ8A 1CKEA 1RRFA 3I5XA 2ZRFA 2WBLC 2NPFA 3UATA 3LX5A 2HUPA 4XOIA 2EFEB 1OXSC 3W8RA 4F91B 3CX8A 2ZROA 1D2EA 4DIDA 2IXFA 2QAGB 4HYYA 1GITA 2QMOA 2AK3A 4JYCA 1OPXA 1ZNZA 2DBYA 3SS8A 1G6HA 3E2IA 1W2HA 2IS4A 3L43A 2OCYC 4B2IA 1P6XA 5E4FA 3HPRA 2XITA 1QHIA 3ND9A 2GWHA 4MGIR 1VTKA 2G1KA 5KNDA 2O8BA 2JLVA 1SKYB 2RGNA 3HYTA 1ESNA 4F38A 2ZE8A 5KDOA 4ACBA 4BRWA 1JALA 2QT0A 2GNOA 1EFHA 2GBLA 2IUUA 3CRRA 3FVQA 3RAPR 3TAUA 4B44A 1QHHA 3JVVA 3A4MA 4WOPA 1Z3IX 4NYMQ 3U4QA 3IILA 4UNNA 3RYTC 4LJ6A 1DBSA 3BD9A 3DM9B 5FBLB 4DZZA 3GEIA 2BV3A 3QI2A 2JEOA 3W5IA 3L0IB 1VDZA 2RGAA 3K9HA 2XGJA 2WPDA 1KSHA 3QKSA 3KJGA 5J40A 4DWJA 5FPYA 4QL3A 3A6PC 2RB4A 5EXPA 2P6NA 4LC1A 4KO8A 4E22A 4M0LA 2IHBA 3CH4B 4FWTA 4BFWA 1XMSA 1T8TA 1U9IA 1GRNA 5FTNA 4HDOB 3B60A 1M7HA 2OO7A 1T4GA 5LD2B 1VHTA 3ZD6A 4KU4A 3PEYA 1BKDR 3AGPA 3LBHA 1G3QA 4ZO4A 2WM9B 2FSHA 3B2EA 1XXHA 2ZYUX 1AS2A 4C0JA 2H57A 4M1SA 4JZKA 4XVUA 1E2IA 3KKMA 2O8CB 4QJ3A 1VCMA 2OG2A 2FSFA 5KSOA 4TQ9A 4URXR 2W83A 4HZIA 4V0OA 3IO5A 1E4VA 2ZRIA 2O8FB 3Q72A 2YWFA 4P33A 4KHZA 4IOKA 4F93B 1AGPA 2JASA 4AI6A 4JBXA 2AD5A 3PXGA 2OXCA 4R98A 2B7CA 5GJVC 1NN5A 5HTKA 2CE7A 5B64A 4Q4AA 2WWYA 4JLPA 2Z6VA 4TTQA 3OIYA 5J4YA 3W3AA 1RC8A 5JBQA 2OCBA 3PFIA 4AURA 1GKYA 3WP1B 1IN6A 1BH2A 2GEDA 3UWOA 4ASUA 1R8QA 2XXAA 5K8IA 3VU9A 3LW7A 4JKYA 1Q1BA 2ZSFA 4MRPA 4MYUA 2J0UB 3IEVA 2Z4SA 2CVHA 1ZIPA 1GUAA 1GKUB 5LBIA 3H4MA 1NL3A 4MRRA 4GZMA 3T15A 4HAYA 4KXFB 1IBRA 3IUYA 4CDGA 1R8SA 4LI0A 4PSVA 5D3MB 2OBNA 1GIAA 4FCWA 3BFKA 3L0PA 1XZPA 3C14C 2PL3A 1F5NA 4NTZA 1TU3A 3PCRB 1L4YA 1N25A 2IC5A 4S35A 1MRSA 3MRSA 1TUEA 2O5VA 3GMTA 4PZZA 1RYHA 3K0FA 3AM1A 421PA 4C30A 3GJ3A 1W4RA 4TYNA 3K0EA 1ESMA 4DSNA 1CR1A 1YR9A 3QF4B 2JJ8A 4UNQA 3IBYA 2FA9A 3LVQE 2R2AA 3U7GA 4M9XA 4MH0R 1R5BA 3TAHA 3GJ0A 1QHXA 1ZCBA 3QXCA 4AYTA 1NMZA 4A8JB 3SJBA 3QY0A 3PITA 2R9VA 4LJAA 2VLIA 5CLLA 5DHAA 2J7PA 2BMJA 3T34A 3OIUA 4A9AA 2ZRPA 1OKKD 1XBTA 4Q02A 1OFIA 1ZUHA 2J5XA 3AF1A 1G4AE 1Z6XA 3TW8B 1R0WA 1J8YF 2QM8A 4O25A 3TQFA 2ZE5A 4TSFA 2FJUA 2VBCA 1QDEA 2W6IA 3ZQ6A 4CF7A 5TVKA 4U00A 2MMGA 3NC1C 2VQSA 4JLBA 1S1MA 1E99A 4YMUA 2EU8A 5FTKA 2HXYA 4AY2A 1QHSA 3SQWA 3PUZA 4JLOA 4QNRA 2ZRDA 4B33A 2DFLA 1IOZA 3SR0A 4Q21A 2VSFA 3OESA 1NLFA 2O8BB 4KI0A 2OAQ1 1DAEA 4TLEA 4PHTA 1L2TA 2DCUA 2ZI5A 5IK2A 2DWPA 2JJ2D 4D0LB 3HR7A 4XSGA 2C9YA 3LV8A 1ZINA 3DZDA 3P20A 1EWQA 1F48A 5FOVA 1X8LA 3A1TA 1E9CA 1CJTC 5B2ZA 1QHHB 3JZMA 2ZUBA 4TMWA 2WWIA 4RD1A 1MABA 5JFGA 3U4QB 4TQUS 1NVVQ 2W58A 3A1WA 4Q1AA 1SHZA 3K8YA 2WJGA 1DE0A 1N6HA 5DNYB 3SQXA 2OFXA 1YZUA 3SHWA 4S2EA 5TB5A 2FMXA 2JLRA 2HV8A 1CJVC 3QKSB 5E7MA 2GVDC 2XTNA 4GOKA 3K70B 1X1RA 3ONWA 4G01B 3AEZA 1JR3E 3CNLA 3ZIAA 4B35A 621PA 1NY5A 5K8TA 1GILA 4QNMA 1N0UA 3B85A 1DOAA 4P4SA 3I3SR 4W5JA 3U6KA 1QG2A 1ZC3A 4D81A 1T6NA 5HCNA 2SHKA 3QF7A 4E09A 2F1RA 3KXLA 2FG5A 1P60A 4DT1A 1F2UA 1XXHB 5F9FA 3SE0A 3E1SA 4DDVA 3VNVA 1UPTA 4F4IA 2CXXA 1YR6A 3EZ2A 3FPAA 3FE2A 2BC9A 4Z1MD 5BQ5A 3K9GA 3O8CA 3EIEA 4V0LA 3UMRA 3ZVMA 1RRGA 3F5FA 4LJ7A 2ZM5A 2MMCA 2PJZA 3CRMA 3JZAA 4QGAA 4XD7D 3TIFA 2IHYA 4QHTA 4EPVA 1RZ3A 1LF5A 3IPYA 4JIMA 4LYHA 1WP9A 4GBMA 5DYIA 3CPEA 1DG1G 3KKNA 1IXRC 2XXAB 2J1LA 4DLUA 4B48A 4DHEA 3DM5A 3VU9B 3BBPA 3I73A 5JWRA 2OCPA 1E2KA 4TMZA 4GSYA 3EPJA 1N3BA 1O3YA 1E2GA 3QXJA 2YWHA 4QG7A 1UJ2A 3CW2A 4X8OA 1IN7A 5GJCA 2IK8A 3EARA 3P26A 2CNWA 3NTUA 3BH6A 1ZM2A 5FOSA 4RD3A 3RS2A 1KI4A 5AJVB 4D4MA 3D31A 5FOUA 5DIFA 2W0MA 3HU3A 3K0FB 4V02A 4BEJA 5E95A 1AIPA 4QHSA 1FQKA 2RGDA 5KDLA 1YRAA 3WY9A 4WIAA 5AUNB 5BYKA 1Y3AA 1ZW6A 5C2JB 4YXWA 3N70A 1V5WA 3GJXC 4C2UA 4URVR 4M1MA 4Q1CA 2JLUA 3AV0B 1XDBA 2QRZA 3CRQA 4U02A 3LO5A 5A0FA 2E1RA 3R8CA 1KJWA 2HCBA 1G5TA 4D6PA 4G5OA 2OLKA 5KNBA 1ELOA 4YLGA 2MSEB 4TMKA 5TV2A 2W2XA 4US0R 3BERA 2NTYC 3B6EA 3DL0A 1VG9B 5TMPA 3VHXA 3A4LA 1P4SA 3AVVA 1XCPA 4HAWA 4HLDA 1KDRA 2ANBA 1IY0A 1ZBDA 221PA 2ZRGA 1BIFA 1VYVA 1LS6A 2Q3MA 1RVDA 2VL7A 3ZQJA 3AP3A 6Q21A 1LY1A 3S1AA 5KU1A 4M1KA 3B78A 5FUWA 1RPZA 1ZUNB 3VR2A 3E5HA 3TW4A 1VKJA 2BBOA 4WZBE 2ZRMA 5L3SA 2QU8A 3LY5A 5JEEA 4GL2A 3FWYA 2WICA 1Q1QA 4M2LA 4BFVA 5JI2E 3SBDA 5CITA 2V7QD 2GZHA 3IDQA 1N2CE 1M1YE 2ZJAA 3KX2A 1Z22A 3RRMA 4POAA 1RFLA 1S1CA 3A36A 1UAAA 3D3QA 4CEJA 2C77A 4F7WA 4XVQA 1GNRA 2BMEA 2F3RA 3OAAA 1Z28A 1JR3D 1EFUA 3EWAA 3D7MA 3D6TB 3VR5A 2G0TA 1Q1EA 2REXB 3SC3A 2WJHA 1C4OA 2Z43A 1W36D 2PEZA 1KO4A 3UMFA 1MO5A 4M21A 1MABB 3CR8A 1CF4A 3DDCA 1N6IA 3ICQB 2I1QA 2NO6A 3U3KA 1R10A 1SVLA 4ZCIA 1E0KA 2AKAB 1AKYA 3AVOA 2PJRA 4HAXA 4MGKR 4KJZA 3FYHA 1A2BA 5CIWA 2XNSA 2V9PA 2JLYA 4IVRA 1W48A 1FTNA 1E32A 1N5JA 2CHGA 4JYBA 4UJ5A 3IO3A 4TT3A 5J4HA 3GJ5A 1JAHA 1FUKA 3V4FA 2DWOA 2EFDB 5BN3A 2XOKD 5KUTA 2IYXA 2VF8A 3SOPA 1BYIA 4RVCA 1KAOA 2VP4A 5KNCA 3TUZC 2LCFA 4DEXA 1SGWA 1G1MA 1P73A 4PPNA 1JR6A 3C5CA 2GK7A 5EE5B 4XJXA 1F2UB 2AN9A 1W4CA 2YZ2A 3CX6A 2ZU0C 2IUTA 3MJRA 3EAQA 2R6CA 2VH5R 3AGQA 3SBEA 2NO1A 1XEFA 2FSIA 2XAUA 5CJ2A 1HTWA 1W5TA 4IDOA 4R7ZA 1P3JA 4GP7A 1AQUA 3VX3A 2MSDB 3PIRA 1P72A 2IUSA 3THYA 3C5HA 4DCNA 4LZZA 5HR5A 2H1LA 4OKSA 1H8HD 3R9WA 2O0KA 3FGNA 3KJHA 3AF0A 2GCPA 3BH7A 3I61A 1OXXK 2WKQA 4L9SA 1D5CA 4X8HA 2ZUDA 2WIBA 2QAJA 4MKGA 3TQCA 1G8HA 3F3YA 4PAQA 1CR2A 3TSOA 2CCGA 5ANRB 3TVDA 4C7OA 3QG5A 2BWJA 3NBFA 1I4DD 2CVFA 1ZD1A 2J87A 2VYFA 2JJ2A 2PX0A 2ZTSA 1E1QD 2XSZD 3ECCA 1T0HB 4O0MA 1EFCA 4Z8YA 2CJWA 1G8YA 5EP1A 4GI7A 5FL7D 2NMVA 2IYUA 4TN1A 5JCZA 1IQPA 1G3UA 2ZITA 3N2EA 2C8VA 1H8EA 4Z51A 4XH9B 1UDXA 1RW4A 1AK2A 3QPUA 2VRWA 4NDZA 3EC1A 1A7JA 4KLZA 4G5GA 3DEFA 4YC7A 2CK3A 2YV5A 2I1VB 4HAUA 3GD7A 3PEWA 2K5UA 4TMVA 1XTSA 2WJVA 1HURA 1IONA 3Q3JB 1GP2A 3ASZA 1EFTA 3VR4A 5TDHA 5FI0B 1E1RA 1KSJA 4A6XA 4JVNA 1KY3A 3I32A 4I1OA 3X1XA 1Z63A 1UADA 3DPUA 2FFHA 2GA8A 1Z2CA 3FKSA 2AX4A 2XZPA 4RD0A 2JLWA 3WNCA 4DVGA 2IS1A 4N0EA 4MKFA 1ODFA 4XWAA 1N6PA 2OV2A 4UNPA 1KMHA 3IEUA 4DC9A 3NHAA 4NCKA 2B21A 4V0ME 1E79A 3RNLA 4J0QA 5CM9C 2AXPA 4PPFA 3EC2A 4LHZA 3CPHA 3NXSA 4HUTA 2GZAA 3U5ZB 3L82B 2AKYA 1W0JD 3B9QA 4XD7A 1R2QA 2H18A 3U2QA 3S1AB 3BOSA 4G5RA 1YQTA 4QBGB 2CDNA 5KOYA 4EJSA 3TVTA 4BPBA 2P6RA 5FBVB 4ILEA 3H2YA 4A0GA 5L3SB 4AKHA 3Q9LA 2QORA 3RS7A 4MA4A 4NKRA 1LB1B 3SFVA 1NLYA 2HDNB 3WMGA 1LNZA 1XMVA 5BYJA 5FPTA 1E4YA 1R0ZA 3BH0A 4DKXA 3TGPA 5FTJA 4CEJB 3FFBA 4HLUA 1KDOA 2N1BA 1IM2A 4RKFA 1I4TD 3H84A 3EPLA 4XIGS 2ATXA 3AF3A 3QKRA 1Q3HA 4ESVA 3M6AA 4D82A 1LFDB 1N5KA 3V4RA 1WBBA 1BYUA 2L0XA 5KHOC 4ZPXA 1IXZA 3U7FB 1D8TA 2LKCA 1KZGB 4I1UA 1FMLA 3FHCB 4NCIA 2O8EA 3ADKA 2JLQA 1SVWA 2D4HA 2IL1A 4BLTA 1DG3A 3HU1A 4EPTA 2GTPA 1Z2AA 4Q00A 3MWKA 4EAQA 3SDZA 4Q03A 2E9SA 2GF0A 3TSZA 2J0UA 1Q44A 2QZ4A 4FMCB 1MO4A 4YMSA 1ZU5A 1XJQA 2CE2X 4P32A 4Q7KA 4BFUA 1W44A 4WA7A 2CL0X 4LY6A 4PHHA 1P2TA 3GP8A 1E6CA 2ZI6A 4P4UA 1D2MA 1GNQA 2IEZA 3NKVA 3QVUA 4LJ8A 4ACAA 2D7DA 1CEEA 4URZR 2AL7A 3VHLB 3TH5A 3RS4A 4AIIA 1Q1ZA 1GWNA 4DEYA 3CWZA 3KJEA 1G7TA 2WSMA 3SFZA 1FW6A 3GJ4A 1HH4A 2GCOA 5E3HA 5CYOA 3OEHA 1NI3A 4NHOA 4PC2A 3ZD7A 4A36A 5BN4A 1K5DA 3Q7QA 2X8AA 5G3YA 4AWXA 3IPXA 2WOJA 5FUXA 4MGYR 4HB3A 4OI0A 1NVUQ 4YDSA 3QVVA 2X19A 2IYWA 1JEEA 2P5SA 3RS3A 1VIAA 2R6GA 1COWD 4BLRA 1U2RA 4A8JA 3GLFE 4JLNA 3RRZA 2GDJA 3KL4A 4Q1FA 3BC1A 2J46A 2VTKA 3DMDA 1KHTA 4HEJA 1R0XA 4URYR 1Z07A 3KFVA 2CJWB 5SZJA 4P0TA 5JHGB 2X2FA 1NMXA 4A0HA 4IVPA 3DZ8A 521PA 2HYIC 2QSZA 1GSIA 2IYLD 1G3RA 2AK2A 1E2JA 2WWXA 3GCGA 4TYQA 3K0CC 4C0QC 2ZSEA 2C2HA 2QTFA 1EWRA 5KPDA 2HJGA 2YKGA 1DAFA 4WZ6A 3QOFA 4RCZA 3SJZA 2HXSA 2VPPA 2P67A 2ZE7A 2KE5A 4OQLA 1CR0A 4URWR 4DUGD 1FFHA 3MD0A 1KO5A 3VAAA 4OQNA 1EX7A 2Q0HA 2NQ2C 2GJ8A 3W6NA 4OBEA 1YZKA 2AD1A 2XOKA 2FFAA 3DKVA 1EESA 4QBHA 1OB2A 4D0GA 2G0NA 2RCNA 3WRYC 2R6FA 4QOSA 1C9KA 3QIAA 3MSXA 3CZPA 3PUYA 1T91A 3ZZUA 2GXUA 1W0KD 2W0SA 4OK5A 1KMHB 5HKKD 2IX3A 3U44A 1JNYA 1IAQA 1P2SA 5JCPA 5AK0A 4BEBA 3A1VA 3C16C 4Q1BA 4OK3A 2D74A 3GLHE 3F8TA 2JJ1D 4TL8A 3TE6A 3ZVRA 1OXTA 2ZRAA 2GHIA 2HT6A 4AD8A 4OI4A 4IOJA 2QAGC 1FX0B 4NH0A 3NVAA 4A1FA 4EJSB 4BQSA 2AFHE 3K09C 5A4JA 1DAHA 1NVXQ 4MITA 1A4RA 2QENA 1Z08A 3GLIE 2C04A 2HT1A 4HI0E 4HB4A 4P31A 4QHYA 4PTLA 4L8GA 4YMTA 3ZGXA 1BOFA 2C9CA 4JJZA 2QL6A 4E07A 3W6OA 3C4JA 4FMBB 3TK1A 4OK6A 1CS4C 4PANA 3ZVLA 2H7VA 4HSEA 2YVUA 3O47A 2XSZA 3TLXA 1O87A 2ZAMA 1X3SA 4M22A 3LAWA 3VR3A 3QKRB 5FL7A 1LV7A 2VHTA 5HZKA 4CT4B 4PZYA 2YNMA 3KQNA 4TYPA 4BFSA 3VTKA 2O8EB 2Q3FA 3RVBA 1E3MA 4M8NE 2ZYVX 4TQAA 5GVRA 2O0HA 3LLMA 1N6LA 1Z29A 1R0YA 3KFXA 2D06A 1SKYE 5GVSA 2FFBA 5LPNA 1XWIA 1Y63A 3VQTA 4BE7B 2F43A 2VHQA 1KK0A 3AVPA 5DGXA 4Q19A 2JIZD 2ZSAA 4LX0A 2G3YA 2NZ8A 2F1IA 8OHMA 4QJ4A 4W7SA 2YC2C 2GF9A 4C3ZA 2H16A 2RH5A 1NLZA 1UBGA 3DOEA 3IHWA 5C4MA 3KXKA 2QE7D 1FMJA 3LQRA 5L3QA 2IBMA 5LD2C 4LBZA 1M74A 4IFEA 5L3RA 1OFHA 4IKEA 1DS6A 1JAIA 4D26A 5TARA 1ZM7A 2FEMA 2ODWA 3A58B 2YHSA 4IW3B 4PSKA 4QKQA 5J4LA 4NE2A 2G77B 4NYJQ 1NVWQ 3L0OA 3SYKA 3QEOA 2GCOB 2FF7A 1KK2A 1KI7A 4CIDA 1OXVA 1W0JA 2HLDA 1S0UA 3OE7D 1YJ5A 1YZGA 3K1JA 4R2HA 4YDHB 2NIPA 2WWGA 3ZJYA 4BLQA 4TZ0A 4FD2A 2QM7A 2CCJA 2ORVA 4MRVA 4X8LA 1HA3A 1NBME 2W2VA 2EYQA 2XB4A 5FTMA 1V43A 4CVNA 2WSSA 5TXGA 4E5UA 1A82A 3B82A 1E2LA 2BBSA 2GK6A 2VP9A 2ZRLA 1YU9A 4PPGA 3WNDA 4Q9LA 3REGA 4LCBA 2CMKA 2YOFA 2A5JA 3OFNA 1XCMA 5CJPA 4B2LA 2DYKA 1CLUA 1E9AA 4UQOA
chains in the Genus database with same CATH superfamily
1CUEA 1RI4A 3IAFA 1Q12A 3N2KA 3G2QA 5HF5A 5JC8A 1LI7A 4IGAA 3P7MA 4FMDF 4NXNB 1QTIA 3WHKA 2WG0A 1T9DA 3I9NA 4NMXB 2X5NA 1TRHA 2G9NA 3VOBA 1BKSB 4DIBA 5WRFA 1ENPA 2GXSA 3DF7A 1FTSA 3TTYA 4YMHA 5A5DA 1GZ3A 4Z5XA 1NOKA 2VT3A 3CYFA 5ECWA 5I7HA 5L3ZA 2XMZA 3O3MB 4DV5B 5CAEB 2ZJYA 1L7XA 5LKRA 2XBUA 3BAZA 4FOTA 1XPRA 3LXUX 3OIVA 4L6AA 1VCIA 4AJLA 3KPVA 3B7PA 1KSGA 3TSWA 1X1SA 1OZAA 1BVHA 1Y9ZA 3DVLA 2WPNA 3JD3A 3R24A 3WBJA 5IXYA 1VLJA 4E70A 1V71A 3I6MA 5HZGA 1SXJA 2M6RA 1OA1A 5DNCA 1V8OA 1Z0UA 4AFNA 1XX6A 3AKCA 1VJ0A 5K0NA 4Z3OA 1T0UA 2LBPA 1VI2A 1KIMA 3JQ8B 1ECGA 2VKQA 4XWKA 5DN6D 1ND6A 2CXUA 2BHSA 3BB4A 2HU8A 2R79A 3B7GA 4WFKA 3U7EB 3U44B 3CRW1 1G66A 4G5QA 1FFXA 2E4XA 2C9BA 4GLLA 1RLJA 2VNIA 1K4YA 4NYMR 3MIZA 4XUGB 1ZGCA 2HYDA 2HBZA 4IQ0A 2BEJA 3JYQA 1FP4B 4XJVA 3RS0A 3F7MA 1TQDA 3WNBA 2Z6UA 5EESA 4N3GA 1B6GA 4FYWA 4NHEA 1DARA 2ZRCA 4QVIA 5A4FS 1A9PA 4KQ6A 4Q4LA 3E58A 1Z39A 4XUDA 2X77A 3UY4A 3DHWC 3WGJA 1KKLA 5JEDA 4DCUA 4OXNA 4Z4FA 2VXOA 4R9RA 3UG7A 3UHOA 2F48A 4WEQA 2ZQYA 2JIBA 4FFOA 1TKCA 2NNWB 4FYKA 1A9ZA 5AJWA 3WYCA 4YJFB 1EUCA 2NG1A 4R1OA 4RDIA 5G4KB 3SKYA 1NFQA 1CX9B 3JVUA 3ORFA 3R40A 1UIRA 4WY2A 1L4UA 2RGNC 4N65A 4II3A 4JYZA 4TVSA 3F6BX 3AXSA 4NOJA 4U7DA 4KR7A 3I04A 4J03A 2GBLC 5I47A 4EFMA 4DDKA 2M32A 3PEUA 5JASA 2VP2A 2DFTA 3LXXA 1WV0A 2JDID 3A06A 3MAAC 1Q0HA 1TO1E 3HJAA 4G3XA 4E32A 4ZMSA 3AM5A 3PC8A 3F46A 3QFCA 4IMPA 2OFOA 1UP6A 1VPLA 1C9EA 1XD9A 2KSQA 3EGCA 4BX9A 2KI5A 3PRYA 1PR0A 1NYLA 2EJTA 2HCTA 4GMGA 3X1MA 3FUCA 1QZUA 1QGOA 2PR7A 1NXXA 3SSMA 4ARBA 2CF5A 3M1YA 5SZKB 1E2PA 1RMYA 4CW7A 5EEGA 3IB3A 2YFHA 1O89A 1EQ2A 3ABIA 4Q15A 3K70C 4EKEA 2QRPA 4V0MA 1NRWA 2NZXA 5JJIA 2E5LB 2V6BA 1W94A 2Z0MA 4OHKA 4JOBA 1R0LA 3FJOA 5FLEX 4TLDA 3ZYCA 5BW4A 2CLDX 1BE0A 4WLVA 4AY3A 5ALTA 1X38A 2HGZA 3NAGA 4CUZA 2IXGA 1A9YA 3M9XA 4HV4A 3IP5A 1TQ8A 1KI9A 2CFCA 3AYZB 1H2EA 2EZUA 3FSJX 3KAKA 2FDRA 1HC7A 4KAXA 4P93A 3RYIB 3ZBQA 3ZZMA 2R0QC 1A8HA 5B53A 5KI6A 3SXUA 4ROSA 3W9YA 4IV0A 2EGGA 2V7GA 1W5EA 5ALFA 3C7DB 1USIA 4LI3X 1E9EA 5HKKA 3DA8A 5BSTA 5A5GA 1JQ5A 2EIXA 4P81A 1J1IA 4IQ4A 3AVVA 2GEBA 2GETA 1KQGA 2O1WA 4M9SA 5C80A 1WXEA 4KE8A 1Y5MA 4ZOLB 2LPMA 2QJRA 2ZWOA 3DB2A 2AF4C 5I7FA 4OQ4A 4Z6KA 2D1RA 1GKIA 5FBHA 4Q9JA 4FX5A 5HIKA 2WHPB 3ZCSA 5AESA 1Y7HA 1Z18A 1NIPA 4OAQA 4E7PA 1RC1A 2BAGA 3WRVA 4EL5A 4KH1A 2A9KA 4CRWB 1SD1A 4ER3A 5ARBA 3FSGA 3FTPA 3M8KA 5FH9A 2IU6A 4K6CA 3SZUA 2QTVB 4JBYA 5FPKA 5AHKA 2BPOA 3HJUA 4LNUB 4C4AA 4RZHA 5MN5A 2VDQB 4DZTA 3FNRA 3LNTA 4R81A 1R9MA 4UAUA 1G3IA 3T0GA 2FW8A 3B3QA 2QLTA 4IWXA 3IP3A 4UEQA 3CEMA 1HE1C 4CQMB 3VDNB 1R4NB 4FYPA 4RTKA 1X7XA 5ALSA 1GRVA 3IAUA 2UYYA 4D42A 5J63A 4NBSA 4QTUB 4QFMA 5IVKA 2ZWVA 4N0MA 4UVGA 2NVWA 2I78A 4OP3A 5ALGA 1XOIA 4DIMA 5DHRA 4BEWA 4QXMA 3IR6A 4RXUA 2QL7A 3BMNA 5FP0A 4XI9A 4DADA 4CL0A 5K9ZA 2R751 3S4YA 4KV7A 4PLYA 3IB6A 1QAQA 4HN4B 1PZNA 1XK7A 3H4TA 3T3NA 4H7DA 2IBTA 4JXZA 3CBQA 3K6SB 2I1WA 4B71A 3LH5A 2OA0A 1NHGA 5J47A 2GXAA 2FPGB 3BRCA 5IKXA 5EE0A 3GDOA 1C80A 4RCVA 4D9MA 4YRZA 1V45E 1OX4A 4LG1A 2YZNA 1P9OA 2IYYA 2OB1A 1QCYA 2WUGA 3RREA 1DQSA 4I50B 1UK6A 2PWBA 4YR9A 3FTEA 1HRKA 1XGKA 1O6GA 2GKOA 1M2NA 1K5GA 3F2IA 3OMWA 3PQDA 3ILSA 4ZREA 5EXTA 4FJ2A 3MJSA 3SZRA 4BV3A 4Q7JB 3X2FA 3RYCB 3KHUA 4Y1RA 5I4CA 4B3GA 1VRCA 2OWEA 4UQPA 3IXLA 3BE5A 3K35A 4HB0A 4I99A 3OCUA 4K40A 4LXYA 5E2BA 2JFUA 3RSOA 3UJNA 4KFCA 3KVNA 1ATZA 2B1IA 3S2GA 4QBKA 1VJ5A 4D57A 4FU0A 1BXGA 3ZWWA 2GJKA 4PFQA 2JBAA 1FP7A 4E88A 3GK3A 2I8AA 2HF8A 1GRRA 3AYXB 1KI3A 1RFGE 2DKFA 1TEHA 1D0VA 4F5DA 2BE9A 3IOYA 2HK7A 2UZ1A 3HEMA 1MD9A 4K6GA 1C0KA 3ANYB 5G1OA 4JI3B 2I4TA 3UYKA 1XVIA 1AM4D 2XE6A 2FZEA 1E3IA 3ABSB 1Q0SA 1CETA 2FHPA 2RK6A 2YFKA 2QG9A 2A8YA 3IP8A 1ZY2A 4GKBA 2QPAA 3RRNA 1TX4B 5T3UA 1QZTA 3WFJA 3QFHA 2VEDA 3ETCA 4FGWA 1EGVB 2C9MA 2YWGA 2AH5A 1C7FA 1NDQA 3WJ1A 1O5TA 4MA0A 4UBJA 5TMEA 2ZT6A 3T1QA 5JD5A 1V3QE 1BXRA 4DCJA 3IJRA 4JT2A 3TJMA 2CLLB 3DE5X 1OAOC 4BGDA 1J2JA 2YDXA 4G23A 1SC4A 1I6WA 1YO6A 2B83A 4J90A 4JJFA 4KBGA 4DMUB 4MGZR 3EA0A 4ERXA 1XRMA 3GDGA 2G5GX 1R0BA 2AYYA 2FPPB 1B8NA 1T6XA 3HQ4O 3M6MD 1T9HA 1C0LA 1TADA 2B6NA 2FMUA 1Q0RA 1BD4A 4KMOA 4I8XA 4I55B 4LE1A 2OLJA 4EHHA 5A4AA 5K20A 2UZ3A 2FF5A 1P7CA 3KTOA 4NBNA 1MRNA 3B8EA 3G1TA 8GPBA 4L50A 3VR6A 3HBAA 3RFVA 4PICA 4RCYA 3GV0A 5D5PA 1XZAA 3UAYA 1DAKA 1VJTA 4JDUA 4Q47A 3HCFA 4IJQA 5CVDA 1YU6A 2C2GA 1JDSA 3CKKA 4DV3B 2NZVG 2FK7A 2NUTA 4D74A 1RCUA 2FPIB 4YX9A 4U7FA 1E3WB 2HSJA 2I2DA 1ZH2A 2IHJA 1DTSA 1WP4A 3H1BA 2VR1A 3NOXA 3UB2A 4GPEA 3UZUA 3LCRA 1OYVA 1QK5A 4C06A 3UK0A 3BYZA 4Q3BA 3U4GA 4Q4HB 4E13A 3MBOA 4EHNA 1C7JA 1CVIA 4F45A 1Y1SA 1OIWA 5TMDA 3FY4A 2I8LA 1Y8RB 3IT2A 3N8KA 1KI6B 1XCBA 3CUTA 1WUHS 1U98A 1AV6A 1QZ3A 1GVNB 4PRYA 1K7EB 2NUAB 4YAIA 2GM4A 1Z74A 4U2DA 3LQ1A 1CF2O 1BZYA 5CXUA 3D1VA 4NL4H 2JGEA 5B1DA 1PLLA 1RJFA 3CKLA 2DWUA 1AKMA 2A5FA 2Q0QA 3K53A 3QA9A 4TZ6A 3KV3O 3UMYA 1HSZA 1C9JA 1IHOA 1WAMA 2ZI4A 3DLHA 3DBHB 4K9KA 2F4VB 2J9GA 3V3KA 1NYTA 1XXLA 3QVTA 5A05A 3WHPA 5EZYA 4YUYA 1U6JA 4CMEC 3D0QA 2D2FA 5IT5A 5JVDA 1MV5A 2X0NA 2GKGA 3HR8A 1XJWA 2PCJA 4GPZA 1PK8A 1N5RA 4JJ4A 1HO3A 2DPYA 4ASUD 4BZZA 3EG5A 1HZJA 3PXUA 4Z1MA 2H7YA 1QGUA 3IQXA 3KKZA 4FZVA 1PSDA 2BONA 5GZ3A 3WWYA 5FBRB 2UXCB 3AV3A 3CB4A 3UMSA 1SA0A 1ETHA 3R3HA 4GLOA 1YJXA 3LZCA 1NXSA 3UPUA 1P8JA 1Y3DE 1XLTA 1LW7A 2BP7A 1RI3A 2L19A 2QPTA 2GPTA 3N5CA 1U7XA 4KIWA 3U4AA 5I9TA 2FGKA 5LU8A 3U3JA 5HF6A 2JD0A 2NXCA 3FD8A 5CDUA 4AJNA 4I1VA 2ONYA 4H7EA 4P5EA 3OQJA 4IFIA 4K9RA 1NP6A 1XRQA 1R18A 4MUFA 4BC0A 3CO0S 3L6EA 1H3FA 4RIGA 1UXHA 1CQIB 5MFPA 4JS0A 4TRJA 2JC3A 1O8BA 2HDOA 5ARCA 2ISSD 1K4MA 3FB4A 3KTAA 3AU8A 4GQBA 4RD4A 5DBIA 3WK7A 4X3CA 3QU5A 4QC2A 5EE3A 1XRNA 2PANA 1WY7A 1ENZA 3G7NA 3VR1A 2YY5A 2IPLA 5EKTA 4LBWA 3DBRA 3QPVA 1SZPA 2WJPA 4JU9A 5DSZA 3VV3A 4ATNA 3ZNOA 4XX0A 1I3LA 1A2OA 3C70A 3TLAA 1NBMA 4AROA 2PUAA 2GO1A 1Z6YA 2ANCA 3TRDA 4LDAA 2XGMA 4U7HA 3HNRA 2WQZA 2V7EA 1ZFNA 2XMQA 2OV3A 4PQGA 2I9KA 3OF5A 1OH6A 4EG0A 4NVRA 5AKYA 5BW8A 1U4SA 4KYTA 4WLUA 4GC5A 4YBZA 3WV4A 1SUFA 4HWKA 4DGSA 1SHKA 1CUXA 1XZ8A 2R4TA 2FCRA 1C3XA 1KVUA 1M33A 3FCXA 2J5KA 4IDAA 5ALLA 2ZS7A 4W5RA 2BGGA 3S2SA 1VHLA 4TSFD 4F5EA 4UOEA 5LZ2A 3WLHA 1XFAA 4KIJA 2W6ID 4Y0NA 2E87A 5E2IA 5KTMA 5A4MS 2Q27A 1W5AA 2R62A 2NW6A 4PNHA 4XLTA 3VJLA 2RHMA 1K2VN 4B7CA 2QP9X 3T5BA 3W8FA 2C95A 3UVEA 4Z9AA 3K0KA 1INLA 3W9BA 3BXEA 2B4QA 3KYCB 2BUBA 4N18A 1F2DA 1SULA 2WYIA 3O91A 1T0IA 1U5BA 2EW1A 4KSCA 2W4IA 3JARB 2HC9A 1LDNA 1P7VA 1ZH4A 2B9EA 4P7GA 3R8FA 4MULA 1FDSA 4DS3A 3PQ4A 3EY9A 3DZJA 4NBTA 5A9RA 3FSRA 2WJYA 3HKBB 4BN5A 1E61A 1VMIA 2Y0EA 4IIGA 3KOUA 4D4GA 3T1TA 1ULAA 3AVXA 4BRUA 2Y2UA 4GXTA 3KJZA 3L92A 5LL6P 4OKNA 2PGDA 4XB6B 1EG7A 1NW8A 5AJZA 3ML1A 4FK8A 3ZK8A 3H5AA 4EDHA 2HOQA 3N6XA 1TM1E 3R0QA 5EA2A 3FFAA 2PIDA 5F2EA 1D03A 5H3HA 1XNQB 4ZCSA 1TKBA 5K2OA 1I7SB 1LSJA 4IHAA 4Q9HA 4H1HA 3T3MB 5AR1A 2KLHA 3TXXA 3ZV5A 3LK7A 3HB9A 1V4BA 1RJGA 2PEYA 1XTBA 2HPHA 3JASA 2CHQA 2G5CA 1TOAA 2REOA 4C5BA 1XD2B 1SXPA 4YAEA 1SKUA 1T2DA 4OAPA 3DEHA 3K1YA 1DKMA 3KZKA 2DKOA 1JT9A 2OESA 2VNJA 4DCSA 3G2PA 5LMZA 4OFXA 1RHJA 2OFPA 4X7RA 3FNEA 2YN4A 2Z3ZA 3K7EA 3PD7A 4TMXA 4PW0A 5FOTA 2O2JA 3TR5A 2WTUA 3H16A 9MHTA 2C5AA 3HJGA 5IM4A 2VP5A 5JALA 2QG4A 1PHRA 4E94A 4IPTA 3NM5A 1BJTA 4EUNA 5T64A 4PO3X 5JDIA 3Q88A 2JH9A 3JD0A 2IH4A 3I8SA 4X7PA 1IVNA 1G2QA 1WMEA 5HFNA 4TTPA 3TVYA 3THWB 4DCVA 1BDJA 5AFSA 3MJDA 2JGKA 2ZUVA 1W4ZA 4D3SA 1EE2A 4PAGA 4UHEA 2JARA 3T5DA 1WKBA 2C9ZA 1I7NA 2B61A 3QVXA 4EZEA 1F9EA 2REQA 1Y34E 5C5IA 4D8YA 1OVGA 1X7GA 2A1TS 5FR2A 4N0QA 3HDYA 2XNCA 3H4IA 1FU4A 3MRVA 3A9UA 3GXOA 4TTRA 2QVCA 4M8LA 3D2AA 1JEYB 3I30X 1NN3A 4BN4A 2IJGX 2WINI 1UKEA 5EEHA 2QYHA 3FOZA 2X13A 1Z5ZA 2O7RA 2FQ1A 1A27A 2QRJA 3C6XA 3I1IA 4S0XA 4CKZA 3OZIA 5KVCA 3IAM6 5M29A 4JI4B 4IWNA 1N92A 2VP6A 4ZDKA 3C39A 2CBGA 1YZLA 3VAYA 3D6NB 4ZDJA 4RH1A 3VU0A 2RONA 3T35A 2BKLA 4D2IA 2MDTA 1LPNA 3KV1A 3LDGA 2XTMA 1JQKA 2PT5A 3R3WA 4WZAE 5B4VA 5IAGA 2ZS9A 2V8OA 4JL8A 1YMVA 3C6YA 1JHMA 2A0XA 3KJXA 4YECA 4WNAB 1H8HA 3ZX4A 1O5OA 1DFHA 4PQYA 1ORVA 4MDEA 1FFAA 3LUJA 5HS4A 1G19A 2VJMA 3W77A 4C0SA 3WBKA 4DPLA 3BKXA 5A3SA 2OC9A 5EJIA 1J20A 4ED9A 1BDIA 2LVBA 4B87A 1FUYB 5TVGA 3FDZB 3LX4A 4OQYA 4G86A 2ZEJA 3GUZA 2X14A 3PC6A 4G0XA 5JRZA 3URKA 4XJTA 1K2WA 1YNSA 2QI9C 2IW1A 1QFMA 3HVKA 1TA9A 4HGYA 3IBTA 721PA 1E1QA 2ETXA 5TF0A 2WWRA 3QV2A 2LWIA 3SHFA 3I28A 1L5HA 2WRZA 4XZ3A 5ESRA 4PN3A 4ETMA 5HRAA 2ZQ5A 1GQ2A 1TMOA 1WXDA 1G8GA 2FEOA 1PK9A 5I7RA 5JDCA 2FP4A 3DLBA 3U0VA 1Q0UA 1G17A 3UCFA 3K20A 2V4ZA 3CT4A 1MJGA 4GE3A 1H1TA 5A4DA 1EFPA 4QASA 3O2JA 1W9MA 2OK8A 1VJGA 1MQ8B 1BG6A 3PUXA 3LRTA 5T6MA 3UH0A 5E9AA 3STUA 4CI0B 4L0QA 4UAVA 2WJIA 1XDUA 2UDPA 3F7OA 2C58A 2CKMA 4LXXA 5LOVB 1II8B 4V1CA 3CGGA 3OLXA 4B9EA 3KP1A 3QE3A 4K2AA 2F59A 2AJCA 2HXGA 2P9BA 3HB4X 4IXDA 1XMPA 4V1CI 3EK2A 4ZANA 3AB3A 3EB9A 1AXGA 3GQVA 1WCYA 4LF5B 3M5CA 4R8MA 5CFPA 2BD0A 3FZQA 3U3OA 1F0NA 1K89A 4C1BA 2DHDA 4CLOB 2A4MA 3WGIA 3MHTA 1QP0A 5KOJA 5U4QA 3T5MA 3FHOA 4ARAA 3L05A 1M8GA 4ZT4A 3UOWA 4OP2A 3CWQA 2XMGA 2YXBA 3ETNA 4YALA 2YL2A 5LA6B 1TEVA 1XA4A 5B1HA 5IG2A 2AEMA 4RENA 1EXWA 4DC0A 3DTVD 1Z6TA 3OBIA 4QDZA 3MPOA 3OIWA 3WIDA 4DDWA 5A62A 5JY6A 1XDDA 1FYEA 5F35A 3ND7A 4HLUC 5BQOA 3WWZA 3DFUA 1NW5A 9GPBA 2PKQO 4CDNA 1U2TA 4EBFA 4CV3A 1N2CA 3HPQA 2WIJA 1ZIOA 2VHUA 3A4NA 2HIGA 4R1UA 4ZC8A 4EBBA 4QOIA 4CMJA 3AKYA 2R65A 2UYOA 4RSRA 3QSYA 5KSZA 5GPBA 4FWIB 4RZ3A 4DV0B 2OLEA 1AQIA 1EWVA 2CMHA 1FOEB 3B1ZA 5ALXA 5KYKA 1M6YA 1JLSA 4HNRA 5JZ9A 3BXGA 3AR3A 3DYBA 2K2QB 3OICA 4H9GA 5DTIA 2XQFA 1GT6A 4Q3AA 1DRJA 1SCQA 1SCUA 2BGUA 1TF7A 3UYLA 1P91A 4DNXA 1Z0ZA 3GFBA 1BVUA 1EFVB 2OQIA 3KJFA 1EZ4A 3ZY5A 2D1FA 1G8MA 1FNDA 4IHQA 5JD3A 1H6BA 2Z9DA 4LRYA 1GNTA 2C97A 2PBFA 1KVSA 3T5CA 1W35A 3I3OA 4CU5A 1G2IA 2H1RA 2QT1A 2WUDA 2JD1A 4V24A 4BKMA 1EK0A 2P69A 3JQ9C 1XFDA 3NWJA 4NESA 3L79A 3M4NA 2A4KA 4YRSA 3LC1O 2PUVA 2FHSA 2HSWA 2JVJA 2H29A 3OT1B 4F3KA 2EKZA 5TIIA 5KNCD 4FP9A 3WWOA 3JQDA 3CE9A 4YGXB 2I2FA 2KJQA 4WY8A 5CFNA 3D4OA 3IR7A 4JP5A 3ADDA 3N28A 5CNMA 4UFPA 1RKQA 2PZJA 2ZS8A 5A2QA 1KTIA 2IUEA 1OF1A 2Z2XA 4RZQA 1ORHA 3HB0A 2VHXA 4XDGA 5L4SA 5LMUB 1ECFA 3QQPA 5DBEX 4KQWA 4AJKA 5FJIA 4D5GA 2CUTA 4EA9A 3QVSA 1F4LA 1T2AA 2CNBA 4UDYX 3WB2A 4DR2B 3R20A 3TR0A 3ROTA 5AVZA 3EZYA 3LNCA 3SD7A 3G2NA 4ZQHA 2WJJA 4YJ2F 1PU2A 3I53A 3GAMA 3UAZA 1ZXBA 4GKJB 1W52X 2PH5A 3B3AA 1U2SA 3EGDB 4HDNB 1XNJA 3PCXA 1VMDA 2Y9MB 5CT4A 3RJ9A 3V8EA 4GO1A 2VRBA 2ZETA 5IF9A 5J4KA 3PQ8A 1HY3A 2I67A 1PT8A 4UNSA 4K81B 4HYEA 2Q4BA 4L28A 1XQ9A 2QGNA 2VJAA 2NNLD 1X77A 1F6DA 2PZEA 5IJAA 4NMHA 3WI7A 4YLYA 1N2XA 4B76A 2QA5A 3I39X 5ED4A 3UJHA 2FQXA 4OM8A 4UZFA 1ECJA 4FFSA 1M7BA 3PHLA 1IATA 4PYJA 3CN9A 1I9CA 4UCWA 1WO8A 2IQIA 5ICEA 1W36C 3ZIUA 3M6VA 3PQ3A 5EMHA 3SLRA 3N8GA 4QUBA 2G4VA 4YUVA 2JHPA 2OXTA 1NI5A 4OL0A 4ZIRA 3ADBA 2H5IA 4NFSA 1QHGA 3BK2A 3IT3A 2LCIA 2QZJA 1IN8A 4BLVA 4AULA 3ILHA 3N0TA 2DPXA 5E1MA 2ODEA 3LT5A 5IC5A 1A04A 1UKCA 2RHCA 5GZ6A 4PG8A 1PJZA 1NVTA 1P5FA 4N5LA 4MW0A 4GX2A 3VHQA 1IBLB 1CUSA 1W49A 1XYVA 2IP4A 4O2LA 2IOFK 3LOQA 3MUNA 2A78A 3ST7A 3WQQA 2ZJ5A 2WKRA 2X8LA 4DRZA 2XXJA 1LVGA 2PMEA 3NV7A 3I09A 3D5QA 4MVJM 4ZT3A 3AFHA 2R6AA 3UB3A 4ZRMA 4EG7A 2J9RA 2ZVQX 4M8IA 4MDFA 1RBMA 1PG5A 2ETVA 3GVHA 3L6BA 6REQA 1R37A 1L7BA 2H1CA 4BECA 2CCKA 2ODNA 4LFCB 5JI3E 1JQBA 1TQ6A 2E55A 4UHFA 1VE6A 1UFOA 5EP3A 5K3BA 4TKMA 1B7GO 5I9SA 4O1HA 3AB7A 2DBVO 4LRQA 3CY6A 4X6LA 3SBXA 3Q0IA 3ZXUB 2WHXA 2P6UA 1ZNXA 1N2JA 1UOOA 2BDTA 3LHFA 3OM9A 4L9AA 5JR3A 2CMGA 3JR7A 2UYCA 1E8DA 4RSGA 1OMOA 1D7AA 3L93A 4NFYA 4XQ9A 5J5AA 3EZ7A 3SK0A 4REOA 3SF8A 1YUBA 2GD0A 4L16A 3CF2A 3UIEA 1VE3A 4Z7QB 1UBHS 2QQ0A 5JSZA 3PG5A 4OX9Y 1FDIA 2Q4TA 3FR8A 2RAPA 2BGIA 2FMKA 4WZBB 3GFFA 4JVMA 3UWKA 3W0LB 4DG5A 4TMYA 4DLWA 1F60A 1W8IA 3EFBA 4DLRA 1J2EA 3ESAA 5DWQA 2JCXA 3TLKA 4RZ2A 2WIFA 5E6UB 1CQXA 4KYIB 1BEEA 2RHHA 4QTTB 5C18A 5DO9A 4N1AA 1V1MB 4LGVA 1AKEA 1YBHA 2C99A 4NECA 5SICE 3HUUA 1TAGA 1G3MA 1KZ7B 1H4VB 3PFBA 4JA0A 3RVLA 1M2KA 1JDUA 1RQNA 1U4OA 2Q5JA 2XRMA 4FIZA 2IWHA 1EJBA 3ZOZA 4LIPD 4A2WA 4PSUA 1Y6JA 2DFDA 1PNRA 5G53C 2WVJA 4MYHA 2HNBA 2R11A 4KPUA 2C8KA 2JW5A 3DMFA 1Q20A 2Q9UA 3IHKA 4RPJA 5B6IA 1R0KA 4R8KA 5LXTF 3X1WA 3NKFA 3BQ9A 3S2EA 4RV9A 3HWSA 2XOXA 3H5RA 3CH5A 5C5EA 3ZU6A 2IITA 5DYYA 4HS4A 1RWXA 3E61A 2OXRA 4IEEA 1M0TA 2BF7A 3W5SA 4BWFB 1NW7A 1UKBA 1NYRA 2ILTA 2AMFA 2PUTA 3GXBA 4OHCA 4BP3A 1Z6GA 2OCGA 4ZZIA 5ILGA 4FX2A 1LBEA 3H2SA 2VXCA 2CWWA 2JGIA 1G16A 3GN1A 3MNFA 3Q7SA 2BMWA 3Q8XB 4GQIA 4JR0A 4KDRA 4L76A 1MN6A 2WAXA 2GN2A 5EE1A 1XTZA 3CPSA 3DMGA 1FRZA 2ECKA 4JLJA 1GZHB 3DE2X 3RRBA 5LBIA 3VYWA 5EFZA 2M98A 1PJTA 1KJJA 3V6LA 3EXIB 4Q93A 1GG5A 2R6R1 3F7TA 4PVDA 4QDJA 4HTFA 3U3RA 3KOWA 4AKGA 2RGXA 1RDFA 3OHMA 1BMTA 1Q0LA 2BELA 3H05A 3QQ5A 4L5BA 1NJ8A 4OXRA 3GQBA 1USGA 5C3MA 2VDNB 3KC2A 3AR8A 4Z54A 2G07A 4M7PA 2IH5A 3E3LA 3G9ZA 4RK5A 3TNJA 1XTQA 2DX7A 2JIZA 3E3AA 1JX6A 4FHCA 4WCFC 4WXMA 1OBHA 4LF7B 4JI1B 1VPWA 1Z47A 2HA4A 4UU7A 1Y7LA 1NV9A 2VPQA 1W5FA 3ADCA 3PUIA 1P44A 4NP6A 2FPLA 4ARVA 3RANA 4A2PA 2BLLA 1KL7A 2DLDA 2H8KA 2QE7A 3ADOA 3FMOB 4MPPA 1JLLA 3DKRA 5DISB 3SYTA 4DMLA 5F7OA 2C2KA 1HNXB 3RRJA 4BVEA 4YTEA 5ECGC 1VKHA 3PQ6A 4LWOA 5JS2A 3DMRA 4ALIA 3ROGA 3KQSA 1YR1A 3UT0A 3QXSA 2B5WA 1J7JA 2FPKA 1F1JA 4UHBA 4X1YB 1PW5A 5ENZA 4WADA 3RFTA 3O8RA 4FHEA 1UKZA 2OENG 1CF9A 2BR5A 3OECA 4DA9A 1L8QA 3CONA 3B9PA 4XM0A 5COQA 3R75A 3ZGLA 4BP9A 3MCAA 1XLUA 3P32A 4ZYZA 2C3MA 2II6A 4W6ZA 3KEOA 4NCJA 2HDHA 3M1IA 4D8VA 5HOQA 3HFSA 1TIBA 3GOQA 3WP0A 4IH9A 4DLNA 5EIBC 4ITVA 2XUPA 1XQ6A 4D3ZA 2WA2A 4L02A 3RBAA 2R7NA 1DC6A 4MWOA 3M6XA 4BLOA 1V6CA 2YJ3A 3DQQA 5BUZA 5C8VA 1UBOS 3A3NA 3EGEA 3PLNA 3C7KA 3FIUA 3QKUA 2PKYX 3ZS9A 2XRZA 1RXWA 3EPRA 4CZ2A 2XQJA 1IZYA 3ZE2B 3P71T 3AHIA 2PXXA 3KLBA 4LRSB 3RUIA 2FTKE 1M5TA 3VKWA 3G02A 4MR8A 1P3Y1 1R6UA 1D5WA 4AW9A 4RTSA 2XYPA 1FB5A 5JYDA 1VB3A 3O92A 3BB3A 2O07A 3K9QO 4EEKA 1EEXB 5ALOA 1U7PA 3PQCA 4NEHB 4YCCA 4XGQA 3TUJC 5EHXA 1C8KA 3GFRA 5KKAA 1JI0A 3AX6A 5CB4A 1IL0A 1FNSA 5JZVA 4FMDB 2JG3A 3QKTA 4F6RA 2BDUA 2O48X 4RZUA 1ZGJA 3H7AA 1KO7A 1VECA 3EZ6A 3T6KA 2FK8A 1QRDA 1NW4A 2Y92A 4DT1B 5CEEA 2PWYA 2DT8A 3AFOA 1VE5A 2O8DB 4EITA 1E69A 3FWNA 1NX9A 3B1XA 4Q1DA 3IEMA 2FRVA 1ZAKA 1C7EA 5K6AC 3C24A 1TO6A 2D0IA 3E8SA 4GPIB 4WNIA 2ZJ1A 3FYCA 3TQIA 5D86A 4EHDA 1P18A 5JATA 2H0RA 4M9RA 2GCEA 2HBYA 2WPDD 4P8RA 5F1YA 3DWGA 2V7UA 1E9BA 2DBZA 1IBCA 2PVPA 3IXMA 1YQDA 3OCJA 2G17A 4LRWA 2F7SA 4PTYA 3HFRA 4ECAA 5AVSA 4FHZA 1Y7PA 4P2GA 3UJ6A 5CLHA 1GPMA 2DE0X 3CLTD 1LNSA 3MTGA 3JQ7A 2B4AA 5CX1A 2IYFA 5C8YA 4ZDIA 1UZUA 1NRXA 3BRWA 2NXNA 2AFHA 3Q6IA 4DYHA 3OTQA 3GFSA 2NU6B 4FE7A 4RJLA 1KFEB 1EK5A 1K63A 4D4JA 2W2PA 4CR7A 4MLCA 5K05A 3WLKX 1NSTA 2CD9A 3FLMA 4GVXA 4DWWA 4INOA 4MUAA 4REQB 1OFUA 4WXRA 1DQYA 2EW2A 5A6SA 3TZHA 3KKQA 4D9HA 1UQUA 4H4EA 4LK2A 2R5NA 3DXFA 3M4XA 5ED0A 4D0RA 4ZOQI 2V8BA 1KRHA 4D43A 1G8PA 2C3YA 2IV3A 3P9IA 2RGRA 4V2UA 4D56A 1NMQA 3PBKA 4M0EA 1KYIA 5MGBA 1UINA 4RM3A 4CGZA 2EKQA 4EAAA 1O95C 1K7FB 3NP7A 4ETNA 1YFLA 4B47A 1AQJA 4B3XA 1LJUA 3K5IA 4Z4IA 2E4ZA 5C1BA 2RGWA 2IUYA 4K8OA 2BBTA 3C3BA 4GHWA 5BRNA 3TZLA 1GYRA 3SXJA 2HMTA 1MR3F 1JDBB 2HADA 5T57A 1JIKA 1DP4A 2N0SA 2VJPA 4BQPA 2HJ9A 5CK4A 3LWZA 4FW9A 2B5VA 4CCYB 1B93A 1JECA 1WF6A 2IXTA 3O9ZA 4YB8A 2VF4X 4FBGA 4UBIA 3RJZA 3HI4A 2I03A 1H1LA 1SZDA 2AYXA 2JS7A 1NQXA 3A1DA 3R3SA 4Y0AA 2GS9A 5DPMA 3KEMA 1FFYA 5C46F 2QVGA 4NRDA 3P5BA 1MQAA 5EXEA 4PZUA 2IWRA 3G2IA 3NQ41 2BMVA 5JNUA 1E6WA 1B1AA 4S3MA 3VPHA 4QPPA 4A23A 1JJBA 1PG2A 3KB1A 4OMFG 3TZQA 1RYFA 2C20A 1NY6A 2FN9A 4UCQA 1LF0A 2XKKA 3OP1A 5BSUA 5HIMA 2GUGA 1FZTA 3TXVA 1RRKA 3U7HB 1FSFA 2EC5A 2CV0A 1UMCA 3HMQA 4L27A 3UXEA 1YB6A 5IVHA 4ZV7A 5AJHA 3AEQA 2GASA 4ODIA 1PFVA 2B4TO 5UKDA 3E22B 4EX6A 2X3FA 3D3EA 3ED1A 4IXNA 3A3OA 4UM5A 5CDYA 3WLMA 5KWVA 1QCCA 2BSQA 1HRDA 3PLAE 1OLOA 3QBJA 1KEVA 1I94B 3OJOA 4BXOA 3R7WB 3RLFA 3I0ZA 4LZLA 5G41A 1IG0A 2V6MA 1UM8A 3L4BA 4KO3S 3R7DA 2C7RA 1U2GA 2HWUA 4KQJA 1UQRA 4E0BA 3GLFB 2J7PD 4FR2A 1E3LA 2CLHB 3S5JA 1H5QA 2ODBA 3R0ZA 1P4GA 5E9QA 1LLUA 1N2HA 3IKLA 2Y68A 4JJGA 4PX9A 4RVNA 1PWEA 1JYEA 2OYRA 1PJQA 3D8NA 1FPQA 3R23A 1M10A 3IPRA 4OYYA 4TTVA 5CXSA 2C83A 3DP9A 5K4GA 2IYNA 3E8XA 4Y9RA 1GGFA 1DC8A 1L7NA 4QO8A 4LYAA 2IYOA 5I01A 1JNXX 1W4LA 3DV0B 3KCNA 3NH6A 1P7PA 1YCDA 3GJ8A 4MIOA 1YFZA 3DF9A 5JZOA 2WIDA 1PTJA 4LMAA 2X4DA 2C61A 2HGSA 4UPEA 4X6UA 4O0LA 4RIFA 1E92A 4HK4A 3H86A 4BLPA 2OY0A 5EXPA 3R9IA 3DEJA 3UOGA 1XEXA 2QP4A 2GJSA 1F4VA 3MLEA 4RFSA 4GZLA 3KQQA 5D3ZA 3A2MA 1NA5A 2G70A 2A5YB 4DG8A 3GPLA 1Q7GA 3R09A 4IV5A 3LFTA 4PLCA 3F78A 3TAXA 3X1YA 4BN0A 3PFFA 3K2IA 5LP6C 3JQAA 2NTEA 1SXJD 1XF1A 3AEXA 3TNDA 3D64A 1JH8A 1R6TA 5D3MA 2XECA 2P5TB 1KJNA 2BGTA 2J5QA 3TZEA 3K5WA 2X4GA 3EVTA 3GZJA 3NOVA 4KWEA 1ZJJA 4Y6OA 1T8WA 3GPDG 5EWMA 3RWOA 1CVLA 3OLZA 4EHFA 4IDNA 1U5AA 2H92A 1YQ9A 1DUVG 1RKXA 2O2XA 4NV3A 5FPSA 1RAFA 2QG6A 5EHGA 4BBPA 4EG3A 3ONEA 5LWHA 5LWQA 3MN1A 2C4TA 2OGUA 2XTZA 4GBED 3PRKE 1XZHA 3MJVA 5DGTA 1P17A 4MK4A 1F8XA 4B2YA 3GLHB 3MC1A 4AP6A 4DILA 1IWPB 1T13A 2AG1A 3S2ZA 4AM8A 1OV4A 1N6NA 3MWLA 4ZQGA 1K3UB 3QTBA 4L8LA 2WZQA 2XYRA 1RM5A 3NAZA 3LQ4A 2LXNA 5FIUA 4RF3A 2Z5FA 4XCQA 3RU9A 5CD1A 1UC5B 4GH5A 3PK0A 2ZRBA 5BSWA 4TS4A 1RXSA 2QUKA 3ZHTA 1M2VA 3Q6MA 5BUSA 2P65A 1L5MA 1PQ4A 4R9UC 2OD9A 5HP4A 2HZ7A 1AMOA 4B6GA 5ELXA 4DLAA 5KTYA 2GVZC 1ZMRA 2PZAA 5H70A 2W2OA 4A36A 1JA1A 3TW8A 4JI6B 3OM8A 1T8SA 1UXGA 4N7JA 3H7IA 2ZJ8A 2NV6A 2VQDA 2WI8A 3GVPA 3MYYA 2ZRFA 4HSGA 2NPFA 4ND8B 1YA8A 3W8RA 4KYVA 4F91B 5K4HA 1PZGA 3UTDA 3LF1A 2IXFA 2QAGB 1ADFA 4HYYA 1O97D 3DYIA 2AK3A 2EAUA 3N2NA 1ZNZA 4TWAA 3E2IA 1W2HA 3EQ2A 2B94A 1Z5NA 3HPRA 3NVMB 1M2EA 1QHIA 2VBGA 3NHJA 2XKAA 4YRIA 4JROA 1TKRA 1ZL2A 2JLVA 3E9RA 3ZDCA 1SKYB 3WB0A 1KEKA 4G0WA 2D6FA 1QPZA 5FT9A 4LQCA 4RSHA 2RAUA 5EMKA 4F38A 2VTDA