1FQKA

Crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
318
structure length
318
Chain Sequence
b'RTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1,Guan
publication title Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 119
structure length 318
sequence length 318
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1fqkA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fqkA01
4WXRA 2D7CA 4DDWA 4C9BA 3CRMA 1KO1A 2OCPA 1B0UA 3W5JA 2O8EA 2XOKD 4E5UA 1T3HA 2AR7A 2CJWA 1JEDA 2A5YB 2V54A 3OIWA 3TW8B 1UKVY 2ZSBA 3P4XA 4L8GA 1NLFA 2WTUA 2P6RA 3GMTA 1E0SA 2REXB 2PL3A 3KB1A 3WY9A 2ZJAA 2BKEA 3OZXA 4YXWD 3OIYA 3SNHA 2QPOA 3T1VA 3BERA 1BYUA 4QBIA 1E9EA 1Z0KA 1AK2A 5BN3A 4ZCIA 3MSXA 4A6PA 2O0JA 2W0SA 4OL0A 4EDHA 1G5TA 4C3ZA 3AF0A 2AXPA 4DRZA 1E2GA 1NY6A 3DHWC 1E9AA 3LW7A 1MH1A 2D06A 5FOSA 3PEYA 2EFDB 2B6HA 4Q1AA 4HLUC 4JS0A 5TY0A 2J5XA 3EZ6A 3W6PA 1F6BA 5DH9A 2ORVA 2QGNA 1CU1A 1EESA 1OFTA 4CF7A 1DARA 1AKYA 3PUYA 4JLNA 1DADA 2W00A 3Q9LA 4QGFA 5FBWB 3W8NA 4A2QA 3L0IB 2FSHA 4LJAA 1CBUA 2XGJA 4MITA 3BB1A 4PHFA 4M9SA 3V4RA 1OKKD 2ZJZA 2ZS9A 3GLHE 1ZD1A 3IO5A 2NIPA 4KBGA 3CH4B 4DSOA 1E9CA 4E07A 3VAAA 4Q7MB 3VHLB 1VPLA 1UDXA 2QAJA 5DO9A 3UMFA 5JS8A 2A30A 3AVQA 2DPXA 1FL9A 1SULA 4IEEA 5FTLA 1G8FA 3OEEA 4AKIA 4BGDA 2IT1A 2P5SA 1ZUIA 2OZEA 4P4TA 2R9VA 5KSPA 1E2KA 3T1QA 1R0ZA 3FFAA 1P2VA 2GCOA 1ZBDA 4UKDA 2QP9X 2XSZD 4V0LA 4HUTA 4AY2A 4GDFA 2EU8A 3GLGE 1VG8A 2O0HA 2ZITA 1AZTA 2EYUA 2PMDA 3BRWD 3C7KA 2Z4SA 1QHIA 1UEJA 2JGNA 1CXZA 1HTWA 2OV2A 1P9NA 3SYKA 2F1RA 2O8CB 3PEVA 4KI0A 3ZLJA 2ZTSA 3BH0A 2RHDA 4CRWB 1VIYA 2O0KA 1GFIA 1E2JA 3AF4A 3D31A 1Q12A 3W8RA 4P33A 3SDZA 4NZYA 5L3QB 2IXGA 4DT1B 1D2MA 2FSFA 4LBWA 2VTKA 1KMHA 2W6JA 2P65A 2E1RA 1NRJB 3U7HB 4PZLA 1KO7A 1B23P 1S9DA 2C99A 2RB4A 3KKNA 1FMLA 5FOXA 4A8JC 3BWDD 5F9HA 1ZCAA 2CJWB 3QOFA 2JLWA 2YOHA 4NYMQ 5GJVC 1N0UA 1G8GA 2NTYC 4JVNA 1JJVA 5DNYB 4FI3C 3CPJB 4KFSA 2I4IA 4RKEA 5JECA 2ZJOA 2JJ1A 4QHYA 1FOEB 1GUAA 2V3CC 3U3KA 1KI4A 4NU0A 1W48A 3C41J 4KYIB 2QSZA 3LO5A 4B3DA 1EGAA 4EPVA 1X8JA 4PQRA 1YZNA 1KAOA 2GK7A 2CE2X 1XMJA 2W6ID 4Q66C 2CK3D 4LYHA 3WMEA 4B2LA 1D8TA 1COWD 4I1SA 5EP3A 3GEHA 2R62A 3JVVA 4AKEA 3PFIA 4Q9KA 4PC6A 3QIAA 1L8QA 1U9IA 1RKBA 4C0HA 1AS0A 1Z0FA 2ZJ5A 1E2NA 1Z6XA 1Q1EA 1GIAA 2ZEJA 1QVRA 3M6AA 3VNUA 2QQ0A 2PJZA 3WNBA 3MJRA 1FUUA 1PLLA 3AGQA 3DOFA 1E2HA 4D26A 1HV8A 1XEXA 1PVOA 2J7PA 3FMFA 3IEUA 3I73A 5F3WB 5L8VA 1WXQA 1E6CA 3RS3A 5TB5A 4DLVA 3FMOB 2WOJA 3MWJA 4OQXA 1HT1E 5LBIA 3C14C 4UNNA 1JI0A 1SVLA 4U00A 2BDTA 4UQOA 5F2EA 1YZTA 4A0FA 4KU4A 3I5XA 3AF1A 2V6JA 2GESA 3EA0A 1E1QA 1FUKA 3CF0A 4PC1A 3A4NA 2IS6A 3NHBA 3ZD6A 1XJ0A 2A2ZA 1P7CA 2HXSA 1CS4C 2B7BA 5GJBA 4MDFA 1W44A 4M21A 4TYQA 1H8ED 3LRPA 4FINA 3U7GA 3IO3A 3K0AA 4C0BA 4NBSA 4TMKA 1AS3A 3PEUA 1T0JB 1QHGA 3KB2A 2GKSA 4PANA 5GJCA 1P6XA 1DTSA 2IC5A 4TQ9A 4TTQA 4EFNA 1TTTA 3AVPA 2FFHA 2OFOA 1BS1A 4JZKA 2E87A 3RS2A 2B7CA 2G88A 1L7VC 4Z8XA 4MGYR 3SFZA 1OKKA 4DUGD 2IA5A 2ZRKA 3I32A 2IYLD 3A58B 4OI0A 1SXJC 1VYUA 4WA7A 1WQ1R 1CR1A 1S1CA 2NQ2C 1DEKA 3VNVA 1TQ2A 3AUYA 2ZRIA 1JJ7A 1BYIA 1LVGA 2FFAA 3A1UA 1JECA 4I4LA 4YMTA 5LD2C 2HJGA 1IHUA 3ZZUA 2KBEA 1XCMA 2A5DA 1RC8A 4R2IA 5SZKB 3CB4A 5DI3B 2FF7A 1NKTA 5FUXA 4DKXA 3V00A 1MOZA 3FTQA 5KO2A 4G0NA 2G1KA 2WHXA 1OIXA 1FFHA 2L0XA 3AQ4A 2OLJA 2XSZA 2J1LA 3DKVA 2IYUA 3TVTA 4PAQA 4D0NA 1OB2A 4NCHA 3TR5A 4EFLA 5JHGB 3GEIA 3X1DA 4TYYA 3SC3A 1M1YE 4OHVA 1OSNA 4QBFA 2R6DA 2J9RA 2RAPA 4FXPA 4WZ6A 3EG5A 3VKWA 3UWOA 2XAUA 3K0FB 3OIVA 6Q21A 3E1SA 1KDPA 3Q8XB 3WHLA 2YZ2A 2R44A 4GFDA 5KNCA 3LH5A 1U99A 4DWJA 4TMWA 4IDHA 4WXPA 3VR6A 2JLRA 3DMNA 4KLZA 1XMVA 1F3OA 3FKSA 5DE3A 4IOMA 3REGA 2JLVA 2IK8A 3KKQA 4NTZA 2FV8A 3BB4A 3KX2A 1N0WA 1AM4D 1Q22A 5FR2A 4P3YA 4BZQA 1KO5A 5B64A 1PLJA 2GJ9A 3RRNA 3WP1B 5IK2A 2G9NA 1ZMXA 1U8YA 1X3SA 2ORIA 1E2EA 1SVSA 1XCGB 1E99A 1FTSA 1VG9B 3IIMA 1W0JD 1DAKA 4S2EA 1TU3A 1UFQA 2ZYTX 1ZINA 2G0TA 2FPMA 1J8YF 2ZSAA 4URZR 2VQSA 2ZI5A 3LVRE 1N6IA 1KIMA 3EA5A 2C8VA 1J2JA 2QMHA 1OIWA 2ZREA 1M7HA 1W36C 4OQLA 2B92A 3WYAA 1OLOA 5HZKA 3C5HA 4XIGS 1W47A 4KLNA 1XEWX 3L8ZA 1COWA 1KK3A 3ZS8A 1UF9A 3GCGA 3K0AB 1UKZA 3P4YA 2FH5B 4TYNA 1KK0A 5CK5A 3T34A 3CR8A 1ESNA 1NBME 3OAAA 5BYJA 2W58A 5FBQB 5TV2A 1DAHA 1Z0JA 4B47A 1NKSA 1LS1A 4BASA 2IWHA 1OXUA 2QMUA 5JSZA 2CL6X 5G41A 4LBZA 3EC1A 4NPHA 3CBQA 1XMIA 3M4YA 5H1YA 2A5JA 1E94E 3LQQA 4DCSA 1IN4A 2GJSA 1U81A 2GEDA 2VLIA 1G5PA 4OQNA 3JZMA 1S1MA 5JJIA 2FPLA 4ERNA 1NL3A 1AIPA 4PPGA 4RVCA 1WRBA 1AA9A 4BFUA 2ODBA 621PA 3BORA 3D6TB 3I92A 5HPYB 3RWMB 4AYWA 1FPMA 2IEZA 3GEEA 4BE7B 2ZAOA 4ON9A 4M1KA 3RAPR 3CRQA 2JIZD 2V8OA 4DLZA 4F4CA 1G64A 5FPYA 2GRJA 3CF6R 2QZ4A 1P2SA 1IXZA 1U8AA 1W4BA 4EPYA 3RS7A 4LZZA 1R10A 2IUUA 2CLCX 4D4KA 2DWQA 4Q9HA 2BMFA 421PA 2G3YA 2Q0HA 1MR3F 4PPFA 4RD1A 3EZ7A 4US0R 4G5GA 1II9A 5J47A 2Q3MA 4GMXA 4DUGA 1VHLA 1VECA 1Q0UA 2ZU6A 3SQWA 2GVDC 2GNOA 3GJ5A 3MAAC 4FWIB 1KTVA 4EUNA 2A5GA 3TLXA 1HA3A 3X1ZA 4G5QA 4RZXA 1Z63A 2V6IA 1P9RA 2VP0A 5G3YA 3I8SA 1E9DA 1NVWQ 3A1VA 4IDOA 3X2SA 3PV0A 3ASZA 1W4AA 2Z83A 1D2NA 5E4FA 2ZRLA 1S0UA 5HCIA 4OJKA 4N0DA 4US2R 2OEPA 3VFDA 1G8YA 5JJLA 3NEYA 2ANBA 5KHOC 4W7SA 3U6KA 4HYYA 1RYHA 1RRFA 1ZUHA 3I4LA 3QEJA 3LDAA 3K0CA 1HE8B 4MRNA 3B1WA 2F6RA 5CIWA 4QOSA 3QG1A 1ZYUA 2IF0A 1N6LA 2XTMA 3F0TA 3BFXA 4PC7A 4TYPA 4URWR 2WIAA 4B71A 5KSOA 1N6RA 4PAOA 3VKGA 2QNRA 1XB2A 4KYUA 3V4FA 4HAUA 3SHFA 2CXXA 2GBLA 1XJCA 5JEEA 1JR6A 5AUNB 4KV9A 4ILEA 4LK2A 1MRSA 4D25A 1OYWA 1A2BA 4XSHA 3L43A 3PITA 4MA4A 4LBVA 5GVRA 3I3SR 1C9KA 5J40A 1BOFA 1RW4A 1ZD9A 5JSZB 1E2IA 3KUCA 4DLXA 2CDNA 2QM8A 4HLCA 4DHEA 5CJ2A 3KJEA 2BC9A 3SOPA 3TJZA 1G18A 3FGNA 3UG7A 2LKDA 4Q4LA 1UDWA 1ZVQA 3AGPA 2XB2A 2OAP1 4O25A 1W0JA 1P61B 4P0TA 2BV3A 5C46F 1W49A 3FHCB 3JZAA 4NL4H 4Z1MD 1A4RA 2KB0A 3VU9A 5FBVB 2ZS8A 3ECCA 4DXAA 5EE1A 3ADCA 1KK1A 4FCWA 4LHZA 3AKEA 3X1XA 3NDBB 2QI9C 2XZLA 4W5JA 2DWOA 5L3SA 1P5ZB 3AVYA 1IXSB 2NZ8A 3EXAA 3TBKA 3CPHA 4O3MA 1HUQA 1KMQA 1NLYA 5FOVA 4YMWA 4CT4B 1NVVQ 2OSBA 4PAMA 2Q3FA 1W4RA 5JBQA 4MGIR 3QKRA 3WBKA 4M0LA 4R2HA 4RD0A 5C4GB 5TMPA 1RRCA 4B3FX 2QPTA 5AJVB 2ODNA 1X8KA 1WMSA 3ZH9B 3GLGA 5GJWC 2WSSD 2FEOA 3NHAA 4D4JA 2VRWA 4QNRA 4EIWA 4UNRA 1XP8A 5TDHA 1J8MF 3B82A 2C9YA 2VBCA 2ZYUX 5CM9C 1IQPA 1TF5A 4XD7D 3VR4A 3LQRA 1YJ5A 2FSGA 3B60A 1G3QA 4MYTA 2ZE7A 2VIIA 4GL2A 3K9GA 5JWHA 2CVFA 4BFYA 3U7FB 121PA 3WMGA 1OE0A 2J0SA 5G40A 3EPHA 2ZUDA 2HF8A 2HLDA 2XNDD 3BB3A 3U60B 3QPUA 4YONB 4XVUA 5AJZA 4G5OA 4LJ9A 1KSGA 3AVOA 4JYCA 4KAXA 4LI0A 2I1QA 4CT5A 1W7AA 2HCJB 3SS8A 3LBIA 3TKLA 2WJGA 2EFGA 5B57C 1NMXA 3RVBA 2YV5A 5HKKD 1IM2A 3ZVNA 2CE7A 2CLDX 2N1BA 4RFSB 1N6KA 2JIZA 2KBFA 4JBWA 5CB8A 2NZJA 4ASUD 3D8BA 1W0KA 5IRCD 4N0EA 1KKLA 1VKJA 3MRSA 3M0EA 4RZ2A 4E09A 3OF5A 3ADBA 2YNMA 1K5GA 1FZQA 1D6JA 1HYQA 4LWZA 2W83A 2D74A 2GXQA 3QVUA 1I4DD 2D62A 4JT4A 4V03A 1VCIA 3AUXA 1SGWA 2NO1A 4P32A 5SZJA 2I3BA 1CRPA 1HT2E 2HDNB 1AKEA 5FPSA 3K53A 1KI1A 2AKAB 2XX3A 3NBZC 1AJEA 4WBSA 1TUIA 1KKMA 1VYTA 3GQBA 1XTSA 3BH7A 4KVGA 5D3QA 1A5TA 4QKQA 4EJSC 4LX0A 3PUVA 1KHTA 3AKYA 721PA 3BGWA 2FGJA 3FB4A 3VU9B 3ZIAA 4ZKEA 2GXAA 3QXJA 1NBMD 5TARA 3SEAA 3R9XA 5IF9A 3K0EA 1XPUA 2R6FA 3CRRA 4BLQA 4IVQA 3U4QB 1TUEA 5JCPA 4LCBA 3LWNA 1CR0A 2WMNB 2O8DA 1ZM9A 1NG1A 2F1IA 5ANRB 3GJ6A 3BS4A 4MUAA 4NYMR 1G3RA 3PUZA 3WNDA 5CLQA 1RZ3A 3GJ0A 4YMVA 1Q3TA 2ZRHA 4QJ3A 1M6NA 221PA 2O8CA 4ZDKA 2IXEA 4MRPA 3MGCA 2KSQA 4BLSA 2W0MA 4PSKA 2CCGA 4OQMA 1KDRA 3RRZA 1E9FA 1XF9A 2BMEA 3QKUA 2HYIC 3OE7A 5DISB 3P20A 1KY3A 1GL6A 1XXHE 4OI4A 1ZW6A 1SHZA 1JAIA 1ZP6A 1JPNA 2BCJQ 4OI1A 4A4DA 4HB0A 1KGDA 1Z2AA 2N42A 2HEIA 3RYTC 3QXHA 3IQXA 1N6PA 2UZ3A 1RYFA 4OHWA 3KTAB 1WP9A 2OBMA 4HZUA 4CEHA 3B1YA 3AKDA 2WM9B 1R0YA 4C30A 3B78A 3DEFA 4M1TA 1G8PA 1I2MA 1G4UR 2FX3A 4Z1MA 1C1YA 4DIDA 3D7MA 3QBTA 4NYJQ 4DCTA 3IBYA 5FUVA 1DBSA 4H1VA 5FL7A 3R9WA 3LW8A 3BC1A 3EIEA 4IVRA 2VYFA 5AJYA 4HAWA 4JL5A 3EWSA 4Y0AA 2WWIA 1D9XA 5FOWA 2ZSDA 2GK6A 1XD9A 4ZKDA 3WRXC 4A9AA 5IT5A 3RC8A 4DZZA 2ZRNA 2R6CA 2IL1A 3KKOA 4NH0A 3CZQA 5JZVA 1AGRA 2HT1A 3QI2A 2IHYA 3B6EA 2IWRA 3TGPA 1E2LA 3SYLA 2UKDA 2ODEA 2CMKA 1JR3D 2BJWA 2WSMA 2JJ2D 1LW7A 2D4HA 3A4MA 2PX3A 2LWIA 2WICA 3ADDA 4DLSA 2FGKA 1F48A 4GPTA 4KJZA 1P3JA 1DG1G 1P60A 4XD7A 1BMFD 5E7JA 3AF2A 4HEJA 1CP2A 1ZM2A 4DSUA 5C2JB 2Q21A 4JJKA 4EAQA 3BXZA 3KJGA 5ELXA 3AH8A 2O52A 1S3SA 1K5DA 4LJ5A 2J59A 1H8HA 2OBLA 1KSHA 1DELA 4JSTA 4ZI3A 4ZDIA 4NDZA 1ZIPA 4AWXA 1GRNA 2P2LA 2WWXA 4D80A 2ATXA 2O8DB 4Q03A 5JWOA 1DAIA 5HKKA 3CKLA 5KUTA 2IYTA 1E1RD 1Z07A 4TL7A 3ZJYA 1EFRD 1Q1BA 4ASUA 5C18A 2CVHA 1W5TA 4LOAA 4Q21A 4DB2A 1X86B 3AEZA 5BYKA 1E2QA 2GEVA 2RGGA 4ESVA 2P3SA 5JI3E 1N5KA 4LJ8A 2QE7D 4M1OA 4PO1A 1E9BA 1NN0A 3A1WA 2IYRA 1EG7A 1HE1C 4FMCF 1L4UA 4Q01A 3VR5A 2ZRAA 1G3UA 3MD0A 3L0OA 4JLVA 1G3MA 3MFYA 1BH2A 4B73A 2EWWA 1LV7A 1CF4A 4IVPA 4HAXA 1P9WA 2OESA 3NH6A 4XJXA 4HZUB 1EX6A 2A78A 1EFUA 2PT5A 4LPKA 1ESMA 2IYZA 1NG9A 1S3GA 3IPYA 3HR7A 4KVAA 2QAGC 1IAQA 3BE4A 4PX9A 5FBRB 3RDPA 4ZDJA 4LV6A 1RVDA 5DI3A 3I72A 1PJRA 3GLFA 4N1AA 3EPKA 3T15A 4HAZA 2KWIA 1NBMA 2WJVA 3B8HA 3I61A 5DLQC 3RSOA 1R2QA 3UPUA 1GP2A 1TF2A 2OXRA 4H9GA 4I81A 3U44B 2G6BA 2QENA 1DO2A 5FTKA 2A7QA 1E2FA 2BVNA 4AKHA 1GNQA 1Y3AA 4U7DA 1S96A 1DAEA 3PCRB 1HQYE 1JXMA 4DCNA 2JLXA 4ACBA 1YZGA 1GNRA 2ZSEA 4NCKA 4MYUA 1GOTA 3U3RA 1CEEA 3BOSA 2ZQ5A 1JPJA 5GVSA 3AKCA 2ZSFA 1GZSA 1QHNA 4MRRA 1VCNA 1ZD8A 4C2TA 1XPRA 3K0FA 4IEIA 1DAFA 4KSCA 3AVVA 2ZRBA 1DOAA 1US8A 5JRJA 1ZCBA 3IGFA 4RD6A 4DLWA 5BXQC 2I1VB 4QFMA 3REFA 1JXOA 1SVOA 1SKYE 4OK3A 3FHOA 4QBGB 4JLKA 1FMJA 5FTNA 1G1MA 1KOFA 1I2DA 2NO0A 4QL3A 4EPXA 3HP1A 2H92A 2ZI6A 2XOKA 4Q9LA 4PO9A 3FOZA 1OT3A 4LJ4A 1R8SA 1R0XA 2RHMA 4EFMA 1DS6A 2AWNA 1EX7A 1QHXA 4XVQA 4GZMA 3DZDA 4AC9A 3ZDQA 4TLEA 2VHTA 1G7CA 3LXRA 4YXWA 1YVDA 5K8LA 4B2IA 4JLJA 4TMXA 2CHGA 4PHTA 4URXR 4XOIA 2QROA 3P26A 4TTPA 4DDVA 3FKQA 1QG4A 2H57A 4UXIA 2C78A 2J46A 1J99A 4DDTA 3KQUA 1OFUX 1T5LA 1JQLB 4OYHA 4OI2A 3W5IA 5JI2E 4QM7A 4L4UA 2FEMA 2ZVQX 1UBGA 3LVQE 4I1UA 4AKGA 1MO5A 1ZUNB 2FSIA 4F92B 4TSFD 4BRWA 3A1TA 2QRNA 4UJ3A 3LXXA 3B9PA 3TQCA 1FP7A 2H1LA 1MABB 3BFVA 2V55B 2R8RA 5EP1A 2JJ2A 5G3ZA 1LNZA 4M8NE 3TMKA 1FX0A 3B5JA 2Z6VA 5CJPA 3HPQA 1NJGA 4PFSA 4JKYA 3RABA 4FN5A 4TL8A 1W5SA 1G7TA 3RHFA 1SXJD 4CVNA 3VTKA 4C0LA 1BO6A 2IYYA 2C04A 4LDJA 2BEKA 1AQUA 2BIFA 4CEHB 2DHRA 3CO5A 3GLFB 2WWYA 4URUR 1GWNA 4RD2A 5H68A 4PPQA 2QTHA 2VF8A 1AGPA 3K70C 4W5HA 1IJFA 1NVXQ 1DPFA 2OCAA 3THYB 4B3BA 1KZ7B 3T5DA 4DSTA 5EP2A 4NKRA 4OHYA 4TLAA 1IN8A 5C4MA 4PZYA 1TQ6A 2ZRGA 3Q7PA 3L2OB 5FOUA 1RRPA 5BQ5A 5A4JA 1NVUQ 3CX8A 3TK1A 3CNLA 5HR5A 1G291 1SKQA 1CJTC 3UKDA 1Z0DA 4FMDB 3K1JA 5FPKA 1DG3A 3L0SA 3FPAA 5LPNA 4OK5A 4BZPA 2QBYB 2CCKA 4DIEA 3UIEA 4TWZA 2QE7A 1SVMA 3U6BA 3SR0A 2G77B 1KNQA 3T12A 5IHPA 1DVRA 1US8B 3CNNA 1OV4A 3P1JA 3RWOA 2C9OA 1Z3IX 3K8YA 2OT3B 2FA9A 2G0NA 3PG5A 1JQJC 3U3OA 1KNXA 4D0LB 2ZRMA 3B9QA 3KDSE 4B74A 4A82A 4LSGA 4U5XA 4A6XA 1Q21A 1PUJA 3QXSA 2O8BA 4NE2A 1YRAA 1NNEA 3KQLA 4LY6A 2GBLC 1PZNA 2OXCA 4V0MA 3PJRA 2CNWD 2A5FA 4V0NA 3W34A 3W6OA 2GA8A 1E79D 4M2LA 4Q1FA 2DBYA 2MMCA 3IKJA 1XX6A 3TIFA 4M1SA 5UKDA 3TQFA 1Z22A 1KI8A 3KL4A 4POAA 3NBXX 3MWKA 4II7A 2GETA 3KQKA 1HEIA 5K8IA 5CYPA 4QJ4A 1KI2A 3VR3A 1CTQA 5TVKA 1P4SA 4GOKA 5SZIA 4C0JA 1Z0IA 3CLVA 2ZXUA 2YVUA 1V5WA 1Z2CA 2W6IA 3NC0C 3NIBA 1QVAA 2EQBA 2Z43A 1F2UA 4PTLA 1SZPA 3WBJA 2CK3A 3BH6A 2IYVA 2AL7A 2YKGA 4HDOB 2VSFA 1X6VA 2DR3A 4FMBB 3GLFE 5FPTA 2WJIA 4Q4AA 1I4TD 3NKVA 2IBMA 2Q9BA 3KJHA 4A0RA 4PC2A 1FX0B 2DFTA 4Q7JB 4TT3D 4ZPXA 4DLTA 4LHWA 1CKEA 2H17A 4PHGA 3QNUA 3HYTA 3FFBA 4ACAA 4TQUS 1UKYA 2ZJYA 4ZI2A 2GHIA 2ODWA 4DEYA 1NVVR 2BM0A 3K0SA 1IOZA 4LHVA 1GDDA 5CDFE 1RIFA 4TN1A 4AURA 4QGGA 2VHQA 4MKHA 4YMUA 2BWJA 2IYXA 1KO8A 3CONA 2ZIAA 5FPHA 2ZI3A 3B13B 1E9RA 1G17A 2QMOA 1TEXA 2PLRA 4JJZA 3CNOA 5CB6A 5JFGA 2X8AA 3RANA 2VSOA 1T3LA 4B2PA 3LV8A 4XTCS 2FN4A 1G6HA 2ERYA 4B34A 1II8B 4DLRA 2WPDD 5BN5A 3CRW1 4JL6A 2YWHA 3EC2A 3FWYA 2JLQA 4D2IA 4WZAE 3OHMA 1N6HA 3WNCA 3ZD7A 2VL7A 1OH8A 2QORA 4Q47A 2WV9A 2KE5A 4BLPA 2JLUA 2O8FA 3TSOA 4RCZA 2CHVA 1EFTA 1H8EA 2CHQA 2NOAA 4TSFA 5E7IA 4KITB 1KSJA 1VMAA 3LY5A 1JALA 3G5UA 2IHBA 5FUWA 1ANKA 4LHXA 3NWJA 1M8PA 1XCPA 1GILA 3HYRA 5J5CA 1Q3HA 4A2PA 4W5WA 4ZV4A 2PZGA 3CM0A 3MJHA 2D2EA 4KHZA 2JDID 2B21A 4F7WA 4JVMA 3KJIA 4HUQA 2F7SA 2QM7A 1SXJA 4YLGA 1GVNB 1XDBA 2PBRA 4GMDA 4LV5B 4M53A 5EP4A 3VX4A 4FWTA 2O8BB 4JL8A 4Q4HA 1M34E 3G0HA 4IOJA 4PHHA 2QP3A 1Z28A 2A3RA 1QRAA 4ZIRA 3J81k 1AZSC 1XXHA 1ZU5A 2XEXA 1X8LA 2MSEB 1PV4A 5CM8B 1JR3E 4B3GA 2WWWA 4HB3A 2BM1A 2A9KA 4RZ3A 4XWAA 3SBEA 4WVFA 3EPLA 2WZQA 2Y8EA 2YWGA 2V7QD 3WMFA 1QDEA 3WP0A 1R5NA 4PSAA 4RFSA 2ZS7A 1K6MA 4MQBA 3G82C 2RGXA 1MO3A 1F2UB 4BEJA 4O2LA 1Z6TA 4AD8A 2KI5A 3HU3A 1F60A 1NP6A 2G1JA 4DCVA 4URVR 4NYIR 2P6NA 3HU1A 4B48A 4BFWA 2CCJA 1AN0A 2Q6TA 4Q4AB 3FYHA 3IIJA 1E0JA 1I4LD 2VSXA 2BMDA 3SN6A 1G4AE 2ZYVX 4F93B 4B75A 3QY0A 3B1XA 2JJ8A 1HH4A 3PR1A 2J7KA 4HI0E 5FBLB 2KJQA 5DHFA 3O8CA 1E2PA 3EZ9A 3Q3JB 3PXGA 5KPDA 2ZJ2A 3RRMA 1D5CA 2CNWA 3CPEA 1ZU4A 4DDUA 3L0PA 3WRYC 4B3CA 5JCZA 3I1FA 4HLDA 4M9ZA 4TTRA 2IUTA 2NPIA 3U4QA 1ZRHA 3KXIA 1XZPA 1OPXA 4Z54A 3R9IA 2K5UA 3EZFA 4BPBA 2BBWA 4TZ6A 1M2OB 3I8XA 2XZPA 4JLOA 1GSIA 2QG6A 3JVUA 2PCJA 2X2FA 3K9LA 2O8FB 1OB5A 4NYJR 1XNJA 5KSYA 2QSYA 2J0VA 4A36A 2GZHA 1GTVA 3LAWA 1QF9A 1VG0B 2GZAA 3AVWA 4V0ME 3CWQA 1WBBA 2FE4A 1II0A 2P5TB 4BFSA 2AN9A 3R8FA 4GNKA 4Y0VA 1N5LA 3TSWA 1ZJ6A 4V0KA 1ZM3A 4C2UA 4UJ5A 4M9XA 2QT1A 3DL0A 3MG9A 2V1XA 3R7WB 2HUPA 3W3ZB 3BD9A 4HATA 4HUQB 1J70A 1KY2A 1SXJB 2AD1A 3GPLA 5FFMA 4LHYA 4PQFA 1M7BA 2IYSA 3DVLA 2C5LA 3B1ZA 5JEDA 1E3MA 3KTAA 1GNPA 2QP4A 3CX6A 4M22A 4Q4HB 1LTQA 4YC7A 4ARZA 5LD2B 4MH0R 1LFDB 1WBDA 3SBDA 4L5BA 4A15A 3M1IA 4ZIRB 2C9CA 2OAQ1 8OHMA 1XXHB 1W2GA 2YJTD 2OILA 3TSZA 3VQTA 2QEQA 2YOGA 3T1TA 2ZETA 4DBLC 3RS4A 3KQHA 1MKYA 4KBFA 1GKIA 2ZPTX 5TXGA 1ELOA 3NEJA 2WPDA 1AQYA 1EWQA 1R4AA 1OIVA 1FNMA 3BFKA 1ETUA 1XD2B 3N5CA 4DVGA 1N6OA 5A5GA 4JLBA 2OCYC 2ZI9A 4B3XA 4EKDA 1AS2A 2DFLA 4LRWA 3MUFA 2NO9A 2Q9CA 5CK4A 1Z29A 1Z08A 2B8WA 2XXAA 1KDTA 2G83A 1R8QA 1KO4A 4JIMA 3WXMA 2PEYA 4GBMA 1HY3A 3PUWA 2YHSA 3IEVA 2ERXA 1XZQA 2W2XA 4H1UA 3VKHA 1T5IA 5EE9A 2YOFA 1P72A 4IJMA 1GRRA 1S4QA 2YC4C 2HT6A 1Q44A 5EE3A 4BQSA 1GM5A 4Q1CA 1M7GA 3OFND 3UANA 5JWRA 1R0WA 3LD9A 4V0OA 2WOOA 4RFVA 4A0HA 1TNDA 3TW4A 1XRJA 1L4YA 1P75A 2W6JD 5E3HA 1OXSC 3H84A 1QHSA 4IFEA 3UG6A 1IBRA 1TPZA 1XMSA 2ONKA 3HR8A 1W46A 3HWSA 2ZUBA 3GLIA 1R6BX 5DYGA 1O3YA 2Q9AA 2V7QA 3GD7A 1BKDR 4LJ6A 2F3RA 2D3WA 4DB4A 1U0HC 2R2AA 2UZIR 4QHTA 2AX4A 1SXJE 4BLTA 2VP4A 1T8UA 4L16A 4Q19A 5BW8A 3S1AA 2ZE6A 2QTVB 3IPXA 2QTFA 2J41A 1KK2A 4LBYA 2RH5A 4L15A 4P4SA 1N6NA 4G01B 1JAHA 2LCFA 3CR7A 2V1UA 1JB1A 5EXPA 1NN5A 3K09A 2EFCB 3PIRA 4YDSA 4WIAA 1WCV1 2VEDA 1G5RA 1QHHA 2X19A 1T3SA 4UNPA 3ND8A 4A0GA 4B43A 5KU1A 3ICEA 1TQDA 2VP2A 4FMCB 1CRQA 4IOKA 2GCPA 2DY1A 1XWIA 3FE2A 3C5CA 3CH5A 4HSEA 4KO8A 4O0MA 4D82A 3CUEF 1CIPA 4ARZB 5J4LA 2GZDA 3OEHD 1YR8A 2FZ4A 2IXFA 5CLLA 1RRGA 5EXXA 2J0QA 4QGAA 3THYA 4XH9B 4CIDA 1GG2A 1U9IC 2R6AA 3QF4B 3B85A 1KZGB 3QJYA 4CEIB 4NCIA 3RS0A 2OM2A 2FDCA 2DWPA 1SVKA 2ZM5A 1ZNXA 1GL7A 1U90A 3W9YA 3ZQJA 3U44A 1UBEA 2FU5C 2AHOA 4JBXA 4AK9A 4Q5IA 4Q9IA 3U2QA 3PUXA 5FTJA 3X1YA 2DFNA 2VO1A 3N70A 1NJFA 1KJWA 1ZNYA 3NDPA 2J7PD 4UXHA 5DIFA 1UPTA 3QKSA 5HE8A 5SZHB 5CYOA 4AG5A 1CJKC 4Q1EA 2HXYA 2C96A 1A82A 5F9FA 2RGBA 3B1VA 2XXAB 2PMKA 2RGNA 4HDQB 4YDHB 1VCMA 2GJAA 2WJJA 4K81B 4UXJA 3R20A 2Z4RA 1SHKA 3W6NA 4JMPA 2O5VA 3SQXA 4LJYA 1NN1A 5EE0A 1ZNZA 1NY5A 4XSGA 5JS7A 1E1QD 2MSCB 3A37A 1QBKC 5JMTA 2WSSA 2WJYA 5J4YA 1EFHA 3THOA 2GAAA 2X77A 2RKOA 1CR4A 3OIUA 4PC3A 1HQCA 1YU9A 2AFHE 1FNNA 5B2ZA 2GILA 4J0QA 4LV8B 2EWVA 2VH5R 2WBLC 1VYVA 1UAAA 1NI3A 1U8ZA 3CZPA 4DSNA 4BLOA 1G9XA 1YQTA 1KAGA 1MV5A 3L82B 2R6GA 2XNDA 3BBPA 1UM8A 3H4MA 1T4GA 3U5ZB 4WZBE 1FP6A 1SKYB 1E2MA 5EZ6B 4PSVA 5EZ5A 4B44A 3LNCA 521PA 3B7GA 1SQ5A 1VIAA 3E5HA 3GLIB 4GT1A 1ZC4A 4K8OA 4IXNA 1UBFA 4G5SA 3AP3A 2WWHA 3VX3A 3ZS9A 2EYQA 3GJ3A 3SJAA 4AI6A 5EXSA 1LF5A 4GSYA 1GKYA 3GFPA 1U94A 3S1AB 3QG5A 3ZVLA 4IKEA 1YR9A 2QPAA 3U3MA 2ZRJA 1CJUC 5DYIA 2NG1A 4P4SB 1Z6YA 3SI7A 1MABA 1F2TA 4E03A 2BMJA 3ZYCA 4EQ6B 2IX3A 5LDDC 1QHHB 1UADA 3KZ1E 821PA 2GJKA 4UNSA 4DC9A 2F9MA 2IS2A 4JVLA 3GFOA 2C95A 2EFEB 4OJQA 2C98A 1P2UA 3E70C 2B8TA 3MWLA 5HCNA 5IDVA 5LB4A 3HU2A 3TVDA 1ZM7A 5JJKA 4TLBA 4I1VA 4TL9A 3OFNA 5HE9A 1KI6B 1CULC 3O8DA 4EJSA 4Q02A 4QJ5A 5LB2A 4OHZA 3GFTA 2ECKA 5DSZA 3LLUA 4TMZA 2E9SA 5FI1B 1N25A 2VP9A 3EZ2A 3FKSD 4IXMA 1QZXA 5HZHA 4GRAA 4B76A 1SVWA 3ZGXA 4HB2A 4BRUA 1IY0A 2XZOA 2NO6A 5L3RA 1F5NA 3A4LA 1G16A 4KFRA 4RY2A 5CIQA 3AVTA 1H65A 3DZ8A 2O8EB 2Z0MA 5CDFA 1VHTA 5IK2D 1NMZA 1R7RA 2QT0A 3QKSB 4G1UC 2RGEA 4IDNA 1Z5ZA 4IDQA 4Q1DA 3IIKA 3KKMA 2AWOA 4TQAA 1TX4B 1OH6A 3NVAA 2FPKA 4L9WA 2XB4A 3T1OA 2QBYA 2P6UA 3TR0A 2F43A 4RD3A 4GI7A 2ZANA 2FWRA 2GWHA 1OHHD 1CR2A 3D3QA 3WHKA 1XEWY 1EK0A 3KXLA 1G21E 4HZIA 4RD4A 4TLDA 5EXTA 4TMTA 1OFHA 1UEIA 3GLIE 4CEJA 3GJ7A 3QPVA 2NMVA 1LF0A 1G20E 4I99A 2AKYA 4C0SA 4M1WA 5A0FA 1YE8A 2ZJBA 1JEEA 3OEHA 4BFZA 3AVXA 4C7OA 3N2IA 1TU4A 1EFCA 4X8HA 2IUSA 3DM5A 4Q9JA 3TUJC 1WDTA 2NGRA 3LBHA 5AUOB 3FDIA 3LX5A 3LBNA 2VHCA 3OAAD 5KDDA 4OQFA 1G6OA 3EX7C 3P27A 3FHTA 5J4KA 1E96A 4M1MA 5CITA 4JSYA 5KDOA 1Y63A 2ZI4A 4MDEA 2GXSA 2OLKA 3VR2A 4D4MA 4E22A 2OHFA 4X8MA 2RGCA 3Q7QA 4NONA 4IRUB 3NC1C 2EFHB 4B6EA 2F1JA 4RSGA 1XTKA 1TF7A 4MUBA 2YINC 4HLUA 3ZVRA 5FI0B 3KXKA 1A7JA 1VDZA 4XWKA 1E9SA 1C4OA 2PZFA 3EPJA 3VHXA 2OFWA 1IY2A 1U0LA 4WW0A 1F2TB 4DJTA 3ND9A 1JR3A 2GCOB 4QBHA 5EJEA 3QVVA 5HTKA 1WA5A 2ONJA 3KQNA 4Q7LA 3ICQB 4NCNA 4JLPA 3I5YA 4CGZA 1IXRC 2R65A 2XTZA 2WWGA 3QEOA 4JLDA 2REBA 3DO6A 3GP8A 4BFXA 1A2KC 3QXXA 2VA8A 2QN6A 4FCVA 2FG5A 1BMFA 1TL7C 3T5GA 4AYXA 1Z83A 4Q1BA 4Q7KA 4I1OA 4EJSB 1CLUA 2IYWA 2HV8A 4GOXA 4OK6A 1M74A 3SE0A 3DDCA 2IW3A 4D6PA 1ZIOA 2HCBA 1Z8FA 2D2FA 3NG1A 1KMHB 3K70D 4G3XA 5K8UA 4O2RA 4QG7A 5E95A 3SHWA 1JNYA 1LB1B 3E2IA 4MKFA 1O87A 1TAGA 2BBSA 2VP5A 3MCAA 2V9PA 1IONA 2OUKA 1E1RA 1II8A 2AFIE 1EFRA 2ZUCA 2J45A 2JATA 4JLMA 2PH1A 1OF1A 3PEWA 3HDTA 3THXA 1RE0A 5DI9A 3IHLA 4B35A 1OH7A 3I62A 2XJ9A 3L8YA 2ZU0C 3P32A 2FNAA 4Q18A 3UWKA 4LGMA 2F43B 5EE5B 4LPSA 2WMOB 4GP7A 5FH9A 5JHHB 2ZR7A 3PVSA 2CL7X 4YMSA 3QKTA 4R98A 5K8TA 1ZC3A 2PX0A 2QL6A 3T61A 2EVWX 3SJZA 2DYKA 4PO8A 1N3BA 4TL6A 3K0CC 4R9UC 3A1SA 2PJRA 2CEAA 1XTQA 3KUDA 1ZAKA 3EW9A 1CJMA 4CEJB 3AV0B 4A8JA 2BKUA 3RLFA 3BAFA 1NSFA 5JRZA 3O8BA 1RFLA 2OG2A 1CJVC 1P73A 3BK7A 2YWEA 1A1VA 4C7OB 2JLSA 2PLFA 3RSLA 1DO0A 2QAGA 4OHXA 2RGDA 2QRZA 1Z6AA 3HJNA 3O8RA 1YZUA 1E4YA 2FOLA 1UKEA 2QU8A 3EWAA 5KTYA 4CYMA 4AIIA 5DHAA 4AYTA 4B32A 5EUMA 1Z6GA 2JASA 4X8LA 1LS6A 3RS5A 3PENA 4C0QC 1G19A 4A92A 3T35A 1XEXB 3RC3A 1QG2A 1V43A 4QGHA 3U7EB 1FQJA 3ZZ0A 1W36D 4PZZA 1KI3A 4KCGA 5H8WA 4QM6A 3TAUA 4GZLA 4KXFB 2W2TA 1WE2A 5KNBA 2ZAMA 3AP2A 1ODFA 1NMYA 2QY9A 1NF3A 2GTPA 3SYNA 1Q20A 2PZEA 4MKGA 1OHHA 4ZCLA 2BOVA 4HDCA 2AD5A 2BHRA 4QXAA 2P67A 5KSZA 2WJHA 1W1WA 2XNSA 3F3YA 3QSYA 1YR6A 3EIHA 3SJBA 3C4JA 2PEZA 1RPZA 1GKUB 1E4VA 3GJ4A 3W90A 1YKSA 1P2TA 3SU8A 5D3MA 4RCYA 1GRQA 1IJEA 3T06B 5J4HA 5DN6D 3A8TA 2BJVA 1T6NA 2RMKA 1E0KA 2JEOA 4ESHA 4EQ6A 3A6PC 1YZQA 4RZUA 4KFUA 4GP6A 3LA6A 4P31A 3UMSA 5B30A 4F38A 3TUZC 3O47A 4QHSA 3K9NA 4US1R 1OXXK 1W2HA 3WYFA 2XTNA 3QE0A 4CDGA 3ZZTA 3UATA 2VPPA 3NBYC 4MYHA 4IHQA 2FMXA 3THXB 4Q4JA 2X2EA 2F9LA 2VHUA 4G5RA 4QRHA 3IILA 1XU4A 3FMIA 5M04A 1KSFX 2H16A 2VP6A 2HLDD 5AWFC 1J7KA 4Z8YA 3IHWA 4XWOA 5BWMA 4W9MC 2HJVA 2AK3A 4NHOA 2N46A 4JYBA 3NTUA 2ZRFA 4N3NA 4C0AC 3C16C 3A36A 4M9QA 2HYDA 4TYWA 1DE0A 1NLZA 2J0UA 4C4PA 4FMDF 4EPWA 3U3JA 2X1VA 4M4SA 4PPNA 3R7WA 4TLCA 5E7MA 5JLJA 4EPRA 2QMEA 4URYR 4A8JB 4M1YA 2C03A 4MRVA 5AJWA 1NIJA 2MMGA 4PXAA 4IDPA 4LJ7A 1BIFA 4IOLA 1IY1A 3AVUA 1K8RA 2CLSA 1W0KD 1N0VC 3C8UA 1TADA 1WF3A 4EPTA 3CIOA 2H7VA 2OFXA 2CL0X 4LYFA 3DKPA 2QAGB 4B33A 2GJ8A 1Q57A 4NCJA 5B58C 2VF7A 5KOYA 5G53C 4HAVA 3BIFA 2WAYA 1R5OA 3RRYA 3H86A 3K9HA 2ZR9A 4K46A 4F4IA 2JLZA 2Q3HA 1KJYA 1XD2A 4DCUA 1NSTA 1HURA 2ORWA 3WYGA 3HPRA 3ETLA 4JBYA 5AUQA 1MO4A 1Z06A 3Q72A 1P62B 2OO7A 4LC0A 1D9ZA 3ZIAD 4DEXA 1XEFA 2DFKB 2Z5FA 2OE2A 2MSDB 2VHJA 3IDQA 3QQ5A 1U98A 1ZM4A 2JAQA 2WKQA 2WWFA 1UBCA 2C77A 2ZI7A 3LFUA 4OBEA 2F55A 2REOA 4LYAA 4KSBA 5EUQB 2GAOA 3UXMA 1W4CA 1XTIA 3NXSA 3IUYA 2JA1A 3QBVA 3NBFA 3QXCA 3EAQA 3AP1A 5FTMA 4MRSA 4HB4A 2QGZA 2PT7A 3MWYW 5D3MB 3H1TA 3B2EA 1OFIA 5F98A 3TNFA 3BJIC 1XTJA 2BEJA 3QF7A 3FMPB 1OXTA 5H70A 4WAUA 2GEUA 1E79A 1PUIA 3K09C 4AG6A 1XFAA 3ASYA 3OE7D 1E2DA 1G7SA 4WOPA 1TQ4A 1G41A 4OKSA 2GDJA 2ZVPX 3Q5DA 4F4JA 4ZCMA 2OCBA 2H5EA 2TMKA 3VR1A 4XTRA 1N5JA 3QUSA 4DLUA 2C2HA 1E32A 4CZ2A 4FD2A 3THWA 1MT0A 2WAXA 2SHKA 2NO7A 1IN7A 4Q4JB 3EARA 2AXNA 4HLQB 1VCOA 5EQTA 1FTNA 3UMRA 3R8CA 1J90A 2V4ZA 1IN6A 3KFVA 1KDOA 1ONBA 2RCNA 4BFVA 1RJ9A 1PLKA 3ADKA 2GF9A 2ZYWX 1E98A 3N2EA 2GVZC 1S9HA 3F8TA 4Q00A 1OH5A 5FL7D 3MLEA 4XVRA 3AM1A 3LLMA 1G8HA 3AB3A 2AK2A 1G7RA 1NN3A 2J0UB 4TT3A 3GLHA 5P21A 4D0GA 2W2VA 1Z47A 1YR7A 4KODA 4FCTA 5KDLA 3IBGA 4V02A 1FW6A 1KI7A 1VG1A 1MRNA 1FQKA 2BCGY 1WB9A 1XTRA 2H18A 2NPFA 5DGXA 3ZVMA 3OESA 1XBTA 4C0KA 2XJ4A 4BUJA 1T9HA 4U02A 2WVJA 3PQCA 4YQFA 1T8TA 2OBNA 1XPOA 1E69A 2WKRA 3NH9A 4KFTA 5GADl 2P0EA 2RGNC 5DN6A 1LY1A 2FJUA 2IS1A 1L2TA 1N2CE 2ZRCA 2XITA 3QF4A 1UJ2A 2ANCA 3K70B 4CEIA 1DAGA 2GXUA 2ZJ8A 1YRBA 5KNDA 2D7DA 4D81A 4R71A 3DM9B 2ASEA 4JKIA 3GJXC 2IYQA 2QUZA 3MMPA 5FOTA 5FUYA 3TE6A 3CX7A 2BBOA 1Q1ZA 1DAMA 2YC2C 3KFXA 1EWRA 3EASA 3C15C 4GOJA 5FL3A 2ZRDA 2YYZA 3QPWA 2F1HA 4JLAA 2CBZA 3OEED 1E0AA 1MO6A 1Q1QA 2DCUA 3DPUA 2RGAA 5AUPB 1H8HD 4UNQA 1KJZA 1U0JA 4LUCA 3CF2A 4L9SA 2BBTA 1T91A 2J87A 1OYYA 3ONWA 4NMMA 1X1SA 4MKIA 2GF0A 4RKFA 2FZLA 4Z51A 1N5IA 3H2YA 4IW3B 2LKCA 2ATVA 2JDIA 5L3VA 2DB3A 5KYKA 5J4VA 3X1WA 2QQEA 4QNMA 1GL9B 1KI9A 4P4UA 4TZ0A 2FFQA 3SZRA 5C1BA 3ZQ6A 4A2WA 1D2EA 2ZRPA 4PR0A 1VTKA 3QENA 4TMVA 4RJLA 1SVIA 4X8OA 3EIQA 4QC2A 5FR1A 1OJLA 2ZR0A 4FW9A 2J3EA 3F5FA 4MGZR 2QA5A 1KYIA 1R5BA 4Q48A 3H0KA 3TH5A 4BFTA 2IEYA 1QHYA 2YWFA 4F91B 5AR1A 1X1RA 1YZLA 4BEBA 3TUIC 3LX8A 4BLRA 4NP6A 4BWYA 3THWB 2GCNA 1W36B 1T0HB 4MGKR 1TEVA 4R7ZA 3DOEA 3KKPA 1GAJA 1YHNA 3VMFA 2UVQA 1RJ9B 4CW7A 3SFVA 4D4LA 4FIDA 4NYIQ 3TAHA 2JJ1D 3CRVA 2ZROA 2FFBA 4A1FA 2F3TA 4BZXA 1NIPA 1OW3B 4BECA 4DLYA 1IN5A 1OXVA 2WIBA 3GLHB 1GITA 1G3IA 3RNLA 3DMDA 3Q85A 3AF3A 1Z0AA 5L3SB 2PCLA 4ZDWA 3CW2A 1XJQA 4PQYA 4ABYA 1TMKA 3W3AA 1U2RA 3Q5EA 4ZO4A 2HF9A 2ZE8A 3CWZA 2IF2A 1YZKA 2ZE5A 2H8KA 1XD8A 2WKPA 3SJCA 3QKRB 4MYCA 3UK6A 1JBKA 2JCSA 4JVSB 1S8FA 1EXMA 2EW1A 1KI6A 3GJ8A 5AJXA 4LYJA 1S2MA 4IFBA 5L3QA 4B6FA 5KPJA 3U61B 4JT2A 4S35A 4DT1A 2JLYA 5BN4A 3GLGB 2IS4A 3FVQA 3TRFA 4ITRC 5AK0A 4HAYA 1ZNWA 3V9PA 3IQWA 4LC1A
chains in the Genus database with same CATH superfamily
4WXRA 3I2HA 1O58A 5JDIC 3WGHA 3W5JA 4BNKA 2O8EA 2XEDA 2XOKD 4WCDA 4BNXA 2AR7A 1V37A 5AOAA 4O4HF 3NAZA 1J0DA 1L5VA 2YHIB 1OI3A 1P81A 2C4UA 2A5YB 4MXDA 3JALA 1U31A 4X7PA 4L8GA 4ZQFA 5LJLA 1NLFA 1NZDA 3GMTA 4PLGA 2REXB 3MGAA 3ORYA 3G23A 1MHPA 2NZXA 1E7WA 3OIYA 4DANA 5JNRA 1TD9A 4GVPA 5KWSA 1G59A 3T1VA 3BERA 1BYUA 1GFSA 4GR4A 1PG5A 1Z0KA 2QS9A 1AK2A 2VWQA 4MEAA 1SC9A 3ZDEA 4A6PA 4BIIA 3WLIA 4OL0A 1NF9A 5ALUA 4XWYA 3B3QA 1RJWA 4C0WA 3W34A 1GD1O 3QA3E 1XQ6A 3BWBA 4HFJA 4O4IF 3H2KA 3F4LA 4GPD1 3PI6A 3DW1X 4QYSA 4EJMA 3NHFA 4HGQA 2EFDB 2ZB2A 4QUGA 3RPEA 2FN8A 3S27A 5TY0A 3M89A 2R5WA 5BNFA 1F6BA 1Y5NA 1RMQA 4FW8A 4RJJA 1CU1A 2XKKA 4PU0A 4JLNA 1DADA 2W00A 3Q9LA 5FBWB 3L0IB 1R4MB 1UKBA 2WD9A 2A0FA 4WGFA 1U0GA 2RBGA 2XGJA 3PF9A 3VVMA 1KS2A 2XUKA 2FUEA 3UCEA 3HEMA 1IE3A 2ZJZA 4DIMA 1MC5A 4X44A 1T0IA 4FMPA 4D3DA 1CJSA 3UJCA 4H16A 4B6SA 4DSOA 2WHPA 4V2IA 5LL6P 2VHEA 1E9CA 4Q3CA 1VBFA 3BHJA 3VAAA 1P1RA 3K35A 4B31A 1UDXA 4QIHA 5DO9A 1W8IA 3UMFA 3AVQA 3UTCA 1H2EA 2QX8A 1PHRA 2WFLA 1G8FA 1SK9A 4YRPA 3ZU2A 4DY4A 1Z0UA 1K97A 2IT1A 1K2VN 3SKYA 1MCZA 4P6VF 5ITSA 3I9V6 5KSPA 1V4NA 3WLMA 4AUMA 3TJRA 4L3VA 3AEUB 1P2VA 5KTTA 1DOZA 2GCOA 1ICIA 1PV1A 3DBRA 1EUCB 3PIDA 5CBPB 5JC1A 2XSZD 1SBNE 4HUTA 4NLLA 4GDFA 2IU4A 3GLGE 3GP5A 2ZITA 1EFAA 1V11A 3V4OA 2XTAA 3KYDB 1UK8A 4BYGA 3C7KA 2Z4SA 4MW0A 3SEQA 5KNCH 3TTUA 5BUCA 3KVYA 4EBFA 5BW4A 1ZK0A 4HQ6A 1HTWA 1XL1A 3HN6A 3O3MB 4H7EA 4R2LA 1NUTA 3EXHB 3PEVA 1E5QA 1YUBA 4L2IA 1XZJA 3NHSA 5I4CA 3EBPA 5IG2A 2JZOA 2FUKA 2O0KA 3F71A 1GFIA 5CVTA 5DLYA 3VYWA 4JA0A 1QV6A 1VL1A 1Y34E 1IUOA 4P33A 3SDZA 2W4MA 3V1YA 3QMVA 5BN4B 1KMHA 2FYTA 2W6JA 2P65A 2I3GA 4DWOA 1YL5A 1U8EA 4HGRA 5BV7A 3WI7A 2C99A 4Y9SA 1GRVA 3KKNA 1PR5A 2H8GA 5FOXA 3QPBA 1YI1A 3BWDD 4FHZA 4LECA 2VPWA 4XR9A 3UW1A 2ENUA 1X1TA 3MTJA 1M8KA 4HKTA 5AESA 3DBHB 1DRWA 3WK9A 1N0UA 4CT0A 3ZZMA 2NTYC 1YA6A 3MT9A 1EAYA 3E7WA 1JJVA 4JVNA 2XE8A 2IEDA 4JJEA 1SCDA 5EGNA 2I4IA 1PS0A 1FSZA 5JECA 1FRNA 3IR6A 1JIUA 1EAMA 1F06A 3FUUA 4P54A 3JPWA 4DCPA 4CIAA 4FE4A 1FOEB 2B1QA 4QQNA 2WUGA 2WINI 2ZGVA 2V3CC 1YULA 1TKAA 1UAGA 2FR1A 2DUNA 4A27A 1ORRA 3EQ7A 1FIUA 4XA8A 5DWVA 2CBGA 1RWNA 1NSYA 3DB1A 4BVAA 1E6KA 3LO5A 3QU9A 2AN5A 2AB0A 2GLXA 2Q6KA 1EGAA 3MK31 4FYHA 1YZNA 4BP8A 2GK7A 2YYAA 4DAEA 1XMJA 2W6ID 2LE0A 3BMNA 1CC1S 4JB8A 1OLXB 1SG9A 1GDTA 4PX5A 4BEVA 2OYSA 2YR0A 1M67A 2A9QA 2D00A 3DL7A 4L51A 1PNVA 1BDJA 4PYIA 4LFCB 5KOHA 1JR2A 4PC6A 4X54A 4CU5A 1C81A 1KDYA 4FFOA 3DAGA 2IJGX 1K6JA 2NNWB 3B7PA 1SM4A 3D2LA 3LI2A 1CJBA 2WWTA 4B7ZA 2G6TA 3RVRA 5FOQA 1Q1EA 4RTKA 1TT7A 2OCIA 2PJZA 2XW6A 2YZMA 4FS8A 4WOCA 4DA4A 1FUUA 3N58A 5A04A 3LF1A 4WL0A 3GHHA 3DOFA 1E2HA 4UUAA 4D3XA 2B69A 1KVRA 2EW2A 2Y27A 3DHEA 3FMFA 5EIHA 3I73A 2JGIA 4WFKA 5BV0A 1WXQA 5LOVF 4JC5A 4RWZA 5TB5A 3H1GA 4AP5A 4RM3A 3MWJA 2WVAA 4PZCA 5LBIA 1NVGA 4BQNA 4UNNA 2HA7A 1N8TA 3GN1A 4RAQA 3VVCA 4DM4A 3AL0C 2P9CA 4LOHA 2BDTA 2O0LA 4IVNA 4XB1A 4YNBA 1SD2A 5EIBC 3ZHXA 1BHO1 4E46A 3O7MA 3WL4A 5C8ZA 1RFGE 1Y6FA 1K86A 4CG3A 2HLNA 2JGFA 5HUHA 1H3NA 2LBPA 4ZZ0A 3NTLA 4WBNA 1IHDA 2GESA 3AEKB 2VZ9A 4UW9A 4D9FA 3BEOA 4O6VA 2CY0A 2HCRA 3TXYA 1AMOA 1NGSA 2LZ0A 3A4NA 5CB0A 5EHZA 4HGNA 3DMTC 3WTCA 1P4HA 3FFTA 1NW6A 2A2ZA 3C74A 3Q11A 3R3ZA 3UAOA 2HXSA 4TXMA 3KPVA 1E2UA 4ZALA 4KG7A 5C37A 2BELA 3IIIA 4UFPA 1TZ2A 3T3PB 2Z2XA 3VC1A 2OR3A 4ZGGA 2O59A 1W44A 1PJQA 3PYMA 5IM4A 3RQSA 3R5HA 4BO1A 3U7GA 4REQB 4MV4A 1X87A 4H60A 2HSJA 1T0JB 5KTMA 1QHGA 3OQMA 1Z82A 6ABPA 1TTTA 3KL2A 4JOSA 4TQ9A 4TTQA 4WXHA 4ZT4A 4EFNA 1YTLA 3OTIA 1X2EA 1P4JA 9LDBA 2P68A 4KO2S 3RS2A 3L92A 5GIOE 5THQA 1DCFA 3H4IA 1OKKA 4MGYR 2IA5A 2ZRKA 4TRJA 4DUGD 4UTNA 3WISA 2IYLD 2W6CX 4XM0A 3VH2A 2F8TA 4E5YA 2XDQA 1VYUA 1K7FB 1GCOA 2HBQA 1UPAA 4KN6A 2JGJA 3A1UA 4I4LA 5IYZA 3H1BA 1ADBA 3A28A 2FPRA 2QLFA 2VF4X 5DI3B 2H1VA 1FBTA 2HQRA 5SZKB 1NKTA 1FRVA 5FUXA 3RFUA 5IXSA 3V00A 3FTQA 1P2FA 2HA4A 4TVBA 4WCVA 1VKRA 4ZMRA 4XQCA 1C3EA 2V7BA 3TW6A 2AC2A 4V2UA 3AERB 1UC5B 2IHUA 3UA3A 4D0NA 3GP3A 3E53A 3VZSA 2MWMA 1QTQA 4TYYA 3SGLA 4CM3A 3DCJA 4QEDA 3NKLA 4TV8B 3HVHA 1FXWF 4BNFA 2EZ9A 4R2XA 1REQA 1ZSNA 2Z9DA 4I66A 4CQMA 1O0BA 4REOA 2ZYGA 3O1IC 4YJGA 2Y2UA 3EG5A 3EFOB 3HR4A 3ZWQA 4D9NA 4GXRA 3WDSA 5L45A 4J1QA 5ESXA 1WX1A 1SO8A 5EIFA 3UWOA 3OIVA 4M7RA 4OKIA 3BXHA 3FCAA 3WIVA 4N5LA 2RSLA 2NLOA 3Q8XB 5EJIA 2YZ2A 5DM1A 2GN0A 1ORHA 2CSUA 2H9IA 1ZVKA 1F3OA 3REGA 1XZCA 3BL8A 1VSQA 1N5DA 1TKCA 2FV8A 1NDUA 3OOYA 3TTSA 5K9ZA 1HYGA 1N0WA 5FR2A 1BW9A 4EGJA 3GT7A 2Q6OA 2IV2X 4BZQA 1PLJA 3G7UA 3WP1B 3WB0A 1SPBS 4FGWA 4G97A 5B7GA 2G9NA 3KQOA 4M38A 1U8YA 3T9FA 4W5NA 1Q50A 1X3SA 1E2EA 2NZ2A 2P6MA 3TDKA 1JKIA 2D1TA 2ZYTX 5CGZA 5EMNA 1ZINA 2NSHA 1J8YF 3MWEA 2B25A 2VQSA 1XTUA 4BMDA 1J5XA 1ZKDA 3UW3A 3PVZA 2D0IA 3DE2X 2FLVA 3IOEA 4IBOA 4MWSA 5FX2A 3AU9A 4IQFA 3F49S 1QE0A 2AQIA 4WX2B 3ZE0B 4EL5A 1OIWA 3C6KA 1MJNA 5JPCA 1M76A 1X7DA 4YJHB 3UYLA 2I2AA 4OP2A 4MV3A 2C57A 4F3YA 3GUCA 1OLOA 4B83A 3G2QA 5HZKA 4RC9A 2FP4A 4IIXA 1B8NA 4PINA 1AZWA 1AXEA 1IM8A 2OGZA 3DEKA 2Q5LA 3L8ZA 3SEFA 1LPOA 3OJLA 3ZS8A 1CWUA 3ZD9A 5GIPE 3GCGA 1LFAA 4V39A 4R81A 3FLMA 1NT2A 3HYLA 2A0WA 4H1HA 4RENA 5CK5A 3UJ6A 1ZO8A 4ODIA 4TYNA 3G5MA 3CR8A 1P8JA 1O5IA 1EM8B 1RBZA 4B09A 3W77A 3NIDB 2WM3A 4O5AA 2Z1DA 3S81A 2W58A 5FBQB 5TV2A 1NXTA 3FVRA 3LOQA 1J2UA 4CCYA 2HW8A 4NBTA 1KJ8A 5KQPA 4KPFC 3CT4A 1B41A 3ANNA 4DCCA 1OFUA 2PMEA 4E21A 2K2QB 3PQ5A 4HX2A 5G41A 4EKEA 2XB9A 1G2IA 5AM4A 1NW3A 3EC1A 1NW5A 3M3HA 4KQMA 3TRHA 3VOSA 3VR4D 4J2OA 4DMKA 5IARA 4FFMA 3KQYA 3S7ZA 2QD4A 4Y6PA 1WCIB 5BMVF 5K5EA 4A3SA 1W5FA 2QLJA 2NSJA 4FZRA 4I08A 3LHKA 1VJ1A 4Q24A 3I0MA 5D5HA 1CQIA 1LLUA 3I01A 1CE8B 4PPGA 4X91A 5HBGA 4QTUB 4NU8X 4Y9DA 4PYLA 3Q3IA 4OHPA 3HM2A 621PA 2G63A 3BORA 5DNUA 1RWMA 1Z4KA 4X97A 5HPYB 3HEAA 4Z4HA 2WK1A 3RWMB 1RLIA 2IEZA 4CKEA 4H7JA 2ZAOA 1Q7TA 1O97C 1H2ZA 1QG6A 1CDDA 1AQIA 4AY5A 1YB4A 5KCMA 2YY7A 1ISFA 2X5XA 3V9AA 2V6MA 3CF6R 4UCWA 1P2SA 3W4JA 1L4LA 1IXZA 4KZKA 4MV0A 2A1IA 4H17A 2I2CA 3TIGA 2CLCX 3EIWA 4MR7A 4QSHA 2G3YA 4FBLA 1CX9B 4BV2A 4PPFA 2Q28A 4OM8A 4MHSA 2C3OA 4AUNA 2O3TA 2Y4NA 3B12A 4GMXA 1NFRA 3UFXB 4MVJG 1QYDA 2JLCA 2YL2A 3NR2A 2GVDC 3AV3A 4FWIB 3RG8A 3USES 1KTVA 1L8AA 2A5GA 2OCGA 1HA3A 3GGCA 4G5QA 5D8DA 4RZXA 5LYYA 4AVYA 1Z34A 2VHXA 1RCUA 5EZYF 1GPLA 4W5QA 4Z4CA 1ULTA 2E5FA 1P1KA 3I8SA 1E9DA 2VTBB 1A9SA 3PV0A 1Q1NA 1RM4A 3LDFA 5AXDA 2ISQA 2HWWA 4R1QA 5JXHA 5LQUA 3LU1A 3VDQA 1VPEA 2WWVD 1S0UA 2GA9A 4OJKA 3D7KA 3T3MB 2B20A 3TSCA 2AUNA 3N0WA 2QJWA 2OEPA 1T1RA 4F06A 1ENYA 3NEYA 2ANBA 4UUBA 4W7SA 5BNTA 3A0UA 3ZOKA 1LVUA 5EKDA 1RRFA 3I4LA 2GRAA 3QEJA 4U3JA 3LDAA 2VQ3A 3CG4A 2HCTA 1M2NA 1A4UA 2F6RA 1IQ0A 5KTRA 3BJRA 3DULA 4ENQA 3CKMA 4H35A 4UHCA 1VMEA 2XTMA 4PC7A 4URWR 2VAWA 4DR1B 5KNLA 5ER9A 2IIPA 4KYUA 4Y6RA 1QKKA 4HAUA 1MA3A 1TAQA 4C6TB 3RK0A 2H0AA 2XKBA 5H4GA 3QI7A 5T4FA 1JR6A 4DJFC 4GRIA 4ILEA 4LK2A 4P7FA 4PQGA 3RK4A 5K0EA 4D25A 3HRHA 1E6EA 3PITA 2TMGA 4MA4A 2H2FA 5IDQA 3F7MA 1C9KA 3PIIA 2OKGA 5TQ2B 4DXHA 2YJ3A 5DBHX 1XKQA 1ZD9A 1T8SA 3DT8A 4F5WA 3NP7A 3KUCA 4JEUA 4MKZA 3DV2A 4DLXA 2QM8A 5JAUA 2DE0X 1FFAA 2VXYA 4K9RA 1F4PA 3MSCA 3TLKA 3A2NA 2QRMA 2IKSA 4JR2A 3AGPA 1YBMA 2JHAA 5FHQA 1G8AA 1L8LA 3IT1A 2PKXA 4O25A 1W0JA 1P61B 4P0TA 5DTIA 2PNFA 4D1YA 3KAJA 1E3WB 1W49A 3FHCB 3GVIA 3V8MA 3ZHZA 1AUOA 1E1DA 2Q4RA 2CNBA 4E33A 3CCFA 3T94A 1J0BA 2PUFA 1U1EA 3G2LA 3BM5A 1OLUA 2GFQA 2NU9A 3DZIA 3WL8A 4CLDA 3FTDA 4V1CI 1VJGA 4L72A 3BUSA 3N39C 3WGGA 5HKAA 1TT5B 5CB4B 3H5LA 2W2LD 1SD1A 2AUTA 4Z3OA 1F9EA 4LHZA 3AKEA 1TB4A 5JD4A 3EEOA 1QH0A 3QHQA 1K06A 2XZLA 1P5ZB 4YYEA 1C41A 1ZRMA 1JA0A 1IXSB 2W71A 3WNZA 2V7PA 1BHQ1 3TBKA 1PUXA 1W9MA 3BDVA 1HUQA 3NKFA 1NLYA 2FQYA 3P9PA 3L07A 4YECA 3WFJA 3UYKA 5KQMA 1W4RA 5DGTA 1LW6E 2DXIA 4MGIR 5BOSB 4LXYA 1UXOA 3KS9A 3TNDA 1GUBA 3WBKA 4ZHQA 4M0LA 4WZZA 3SZUA 4CMHA 3D6AA 3G1WA 1XMOB 3PQ2A 4I4TB 4B3FX 2QAIA 4ZOEA 4DWWA 2DSTA 1T3ZA 2XKJE 3IXQA 4RLFA 4CIXA 1OREA 3ZH9B 5DK4A 4S05A 3ZCQA 4LXQA 2WSSD 5T7BA 2FEOA 3DAOA 4D4JA 1YQWA 4EIWA 3CRNA 4UNRA 1XP8A 1J8MF 3B82A 3HLYA 2VBCA 3UJPA 1UWVA 5CM9C 3PFWO 2GPTA 2VCHA 4X00A 1N5RA 1UANA 2K2WA 3B60A 3BTOA 3GEGA 3K4HA 3N6VA 4MYTA 5AM1A 5AVZA 2YHIA 1HLGA 2HU7A 1JMKC 4BFYA 121PA 4B82A 3U7FB 3AY3A 4HBGA 5A5VA 1X80A 3LYLA 4LZWA 5G40A 3UJAA 3E18A 4HFNA 1YF3A 4NJOA 2GHRA 2XNDD 3GDFA 1T1EA 2RHWA 2XQJA 1CF2O 4O4HB 1N7JA 4YONB 5AJZA 3E84A 2BTQB 4O02B 1QCDA 4JYCA 1DFHA 5KVVA 3UT5A 3FIJA 4QXPA 4A1OA 4AKTA 4D7AA 1CUEA 3LBIA 4JUFA 4CL2A 2UZAA 2WJGA 3L6OO 1B1CA 3NHLA 1IM2A 3LFHA 1PEAA 4R69A 2CLDX 1N6KA 3CW9A 2JIZA 5K03A 1HSZA 2DQKA 2KBFA 3IVAA 4R1TA 2VHZA 3EE6A 2BZSA 5AI6A 3STWA 2PGNA 3T9AA 3VU1A 1QQTA 1W0KA 3ELDA 5IRCD 3O4RA 1VKJA 1MG0A 3SR4A 1JFFA 3VHQA 1KQFA 4Y1RB 4H6XA 2YNMA 3AHFA 3GJZA 4O4IB 4PLVA 3ZCVA 4M60A 4N5IX 2ACVA 1U5BA 5CVUA 3PXAA 2G9UA 4C6SA 2FEKA 1JH8A 1TPYA 3INTA 4JA2A 3N6XA 1L5MA 4J91A 1I4DD 3AYZB 3UFBA 1R4MA 4JT4A 4V03A 2O2HA 3MPUA 4MJ7A 4MO9A 1CY1A 2YDYA 1V8DA 3MQ2A 3K53A 4EF6A 1KI1A 2OXEA 3CVUA 2AKAB 3NBZC 1L7QA 1AJEA 2DBRA 4LHEA 4YMGA 1SCAA 3PP8A 1F14A 5HKBA 1Q6YA 4Y1FA 3RCBA 1F0YA 1UOQA 5D3QA 4E4TA 3ANYB 4EJSC 1R9NA 3JQDA 3WIOA 1T1SA 2BHTA 1LPNA 3EDQA 3I5UA 3WGJA 4EYQA 5I6DA 4L78A 1QYXA 2AUMA 4A23A 3O6VA 4NS1A 4LGYA 5BW6B 1SNYA 4AO8A 3CLSC 3LKZA 1VJRA 3R9XA 1CRLA 4AS1A 2BKLA 1FMCA 1YT5A 1MFPA 2R87A 3GCWA 1T9DA 3H3FA 3A4VA 3K0EA 1UKCA 3L7KA 3OBIA 4N9QA 2ZIFA 5KYWA 2AH5A 2WMNB 2ZUWA 2RKBA 3G7NA 1Q91A 2J9GA 4GZ3A 4H77A 4KOAA 5DM4A 3OPNA 3BS4A 5KHLB 4NYMR 2H1HA 5KWEA 1OTYA 3BSSA 5CLQA 3KAQA 1FUYB 4RVNA 4BU1A 3DDWA 3GFVA 3NT2A 1P9LA 5G1OA 7MDHA 3QH4A 3DP9A 5E38A 2F1OA 3WK8A 4ZDKA 1JG6A 4I3FA 5LYJF 3MGCA 1PK7A 4BLSA 5A4FS 1DPGA 4CUKA 1DQZA 3EUWA 3NHYA 5K2MA 2Q4EA 4LGCA 3SAJA 1DJQA 1E9FA 1V7ZA 2HYIC 1U2QA 2BMEA 3QKUA 5JPIA 2B3DA 3WRYA 3EULA 4C21A 3PTLA 1DAOA 1F38A 2H29A 2PGDA 3A25A 3D8NA 4LHSA 1JPNA 2BCJQ 1PGJA 2O3QA 2JHPA 3FWKA 3KT0A 3Q0IA 4HB0A 4KXQA 3V97A 1GV0A 1RS0A 3L6CA 2JFNA 1B8UA 3H3JA 1UBSB 1Y1TA 5HM6A 3WYCA 1NBEA 4BOYA 3C45A 3RSZA 4EMSA 3MTQA 5HX7A 3GGSA 1CYEA 1J4AA 8ABPA 2Q27A 4P36A 1R0YA 3B78A 2W6PA 4ZTBA 4M1TA 3F2VA 3C1OA 4ZOBA 1G4UR 2FPPA 2NT4A 4Z1MA 1YC5A 1TJYA 4DIDA 1MZVA 1W59A 5AMXA 4F9FA 3D7MA 4G5XA 2VXOA 5FUVA 2R1TA 3SICE 2IZ5A 4I6GA 4LVOA 3EIEA 3CF4G 4HAWA 4WOJA 3KLOA 4G8CA 5G1PA 4S24A 4Y0AA 3WO0A 2QTWB 3LC2O 3QNMA 5B3JA 2WWIA 4AP9A 4CV1A 1R0LA 3JSXA 3AYXB 1Y98A 1D9XA 1LJ8A 2Z2KA 1A8PA 1V8FA 4L9AA 5FOWA 2GK6A 3O2JA 1I6KA 2XQIA 4U2DA 4A9AA 2Z1NA 2CD9A 3KD2A 4UHDA 4DZZA 5BNZA 4TVOA 2IL1A 2NYRA 5FQOA 3RM3A 1Z6ZA 8LDHA 3K1YA 5NLLA 4H18A 2PKWA 5JZVA 2C5BA 4I4NA 3QI2A 2IHYA 2BI8A 3HVJA 4MP8A 3QU7A 3GIWA 4Q3DA 3P2YA 3SYLA 2WSMA 2WIFA 2JJ2D 1NOIA 1PIWA 3HCBA 3A4MA 3I1IA 2BFFA 5AOCA 1VRWA 2I4NA 1WMAA 2JGLA 2PX3A 2CUZA 3OT1A 1PYDA 2WICA 3SQMA 3ADDA 1EP9A 5EAIA 4DLSA 4CV3A 2BEVB 2EKDA 3PX2A 4KJZA 1ST2A 5BRAA 1YDGA 1DG1G 2XE7A 1BMFD 1C0IA 5E7JA 5KAPA 3UV6A 1KQNA 3AF2A 3ZGNA 3FYTA 4IZOA 3RR2A 4Z4EA 1MH9A 4KLCA 3BRSA 2V74B 2DTDA 3AH8A 1RHKA 1YB2A 1VFNA 2X4IA 4GPEA 1RLUA 1ZY2A 2ZW9A 3WWYA 1P1IA 2FEWB 4EDFA 5A9SB 5K0FA 4R9RA 1KSHA 2SKEA 1DELA 4DV1B 3LRXA 4JSTA 4MI9A 4ZI3A 2JEZA 3OLZA 3WRVA 4IIDA 1S02A 5F23A 4Q03A 3CUTA 5LQJA 1DAIA 1N1MA 3WHPA 1ZSYA 2BSAA 3CKLA 4N6OA 1YOBA 1J8DA 3HXMA 4KE6A 1EFRD 4LMPA 4ASUA 2EAUA 3FOCA 2QVCA 2WW8A 4Q21A 4YT2A 1X86B 3REOA 3M5WA 4GE0A 1E8MA 2GEVA 3WGNA 3B53X 3VRHA 2RGGA 3CLTC 1FJ2A 5LQCA 4N48A 2P3SA 3UHJA 1N5KA 2XUAA 4LJ8A 4M1OA 4PO1A 4JC4A 3V34A 2C2YA 2IYRA 1EG7A 3SSNA 3UNXA 2IIBA 3G5TA 4AUKA 4CL8A 3WZLA 3HVUA 4QPDA 4JGIA 1N75A 5BV8A 4B73A 5E1BA 4ZGWA 3NPAA 3FCCA 4BMXA 4IVPA 1ES9A 1RAIA 1TIKA 1X9HA 1IPHA 2QQFA 1R0CA 2IQ5A 2V0GA 1XYYA 4HZUB 4IHAA 3FMGA 1H42A 1EX6A 2FRXA 3IKMB 3O26A 4ZTUB 4MI6A 3K15A 2XI4A 1KXJA 1U7TA 1JIIA 4LWQA 3KU1A 5LXTB 5I5GA 4PX9A 3IPYA 1NW4A 5DP2A 3PTZA 3F5DA 5FBZA 3NHPA 4MP3A 5D1HA 2D1SA 4LV6A 4PYKA 5DI3A 4NU6A 5FUBA 1RLJA 4OL9A 3QWIA 5IMBA 2KWIA 5K3CA 1NWCA 4HZGA 2WJVA 3B8HA 5DLQC 4ZEVA 1R2QA 4KJXA 1GP2A 2IFTA 4I81A 1IZ9A 1X7WB 1N2JA 2QENA 3HBLA 4CDRA 4WESB 3AERA 3DMFA 4YASA 5HZMA 1GNQA 4U7DA 3GYBA 3K2EA 5U1PA 2IDMA 2WKSA 3HJBA 5F4ZA 2GBCA 2YVLA 4Z9YA 3IQEA 4R1PA 3BOSA 1V2GA 1FDRA 3AKCA 2DPHA 3PR2B 5HP4A 3EFOA 2Q2OA 1W52X 4BN4A 4MRRA 4TLMB 1VCNA 1ZD8A 3JVDA 3LYHA 1TK9A 3B2QA 2RAFA 1YJCA 4LNAA 1Y3HA 4M9RA 1DAFA 3PS9A 1A4IA 4RK6A 3BAZA 3AVVA 3T6KA 2XF2A 5BR1A 4JXZA 1M1UA 2HIAA 4L22A 5LC1A 1US8A 5ICMA 1ZCBA 2FEAA 3O7WA 3IGFA 3W0LB 1KVSA 4DLWA 4D98A 3H7AA 3PQDA 1SKYE 2AVNA 1P80A 2VJDA 2VKTA 4JLKA 1ISRA 2PUCA 2MYPA 1G1MA 2BP7A 4Q82A 1I2DA 4HWKA 4QL3A 4YY3B 3T5MA 1XQ9A 2OZVA 4M9UA 3RKRA 4JC0A 1X9IA 1BAPA 4N49A 1S2LA 1DS6A 2QJRA 1DX6A 1QHXA 2IHVA 2KMLA 1JU3A 4XVQA 2ZJ4A 4AG3A 3ETNA 2NTJA 1IHOA 1H1LA 4EKGA 4TLEA 2VHTA 1TD1A 3LXRA 2RH4A 3B3AA 3F6BX 4FSDA 4B2IA 4I6JA 1ZMBA 4MB2A 4URXR 4XOIA 1VL6A 2CFSA 1TA4A 2WC1A 1EDOA 4I50F 3ZZNA 1I51A 4TTPA 2CHEA 2WUVA 1V1MB 1IJKA 1K7YA 2X0FA 3DPIA 4GI2A 1A5SB 2C78A 2J46A 2RJNA 1UMDB 4DDTA 3MYYA 1OFUX 4OYHA 3LTNC 3KQUA 2R6ZA 3I9KA 2X9VA 4QASA 3HKEA 2ZVQX 3F98A 1ND6A 3LVQE 4WINA 4H4EA 5LP6F 4AKGA 4ZVVA 4ZYUA 5E2BA 2HIHA 2WIDA 3SHQA 3T4EA 5CCEA 1EVYA 1G2PA 3CRZA 4EMBA 5A4IS 1CJCA 2YXNA 1T3TA 4Y6GB 3VGPA 4LMBA 1SHJA 2FWIA 3BFVA 3B2NA 2R8RA 1HDGO 1FDWA 3KOWA 5G3ZA 4RPCA 5HF6A 4BJ6A 2GEKA 3FBTA 1FX0A 4M8NE 4OUDB 1I5EA 4PRYA 1DJPA 1DEXA 5CJPA 1NF8A 3BWEA 1JEYA 4FN5A 4TL8A 1T8RA 1W5SA 5TT0A 3B5IA 2R97A 4B4KA 1SXJD 3HU5A 3CX4A 3HCDA 1PEKE 2V0NA 3QFRA 4ZXPA 1HXHA 2HRBA 4KN5A 3LT4A 2QLMA 5DM60 1K08A 4RSHA 2BIFA 4HK4A 3VH4A 2QM0A 4WUTA 2DHRA 3CO5A 2IH2A 1PKXA 1PZEA 1WCIA 3G0IA 2QI9F 3UHPA 5JYBA 1RU3A 2QTHA 2ZBUA 4RPGA 4ZOLB 1R8YA 4FZ3A 4ALNA 1KZ9A 1CE8A 3HYSA 2DZDA 3EXFB 3N7TA 2UYOA 4ZCQA 1JIKA 6YASA 1CSEE 5BMVB 3PWTA 1LDNA 2D54A 1E6WA 1EK1A 3OT4A 3PCXA 3QV1A 3N0VA 2PUEA 5EP2A 4UUNA 4TLAA 1IN8A 4Q9AA 1D09A 3GZNA 5AHRA 4KIGA 3NORA 3Q7PA 4PZYA 3RC2A 5C4MA 2WQ6A 5A4JA 2MSKA 3W7VA 3PQ6A 4B40A 1WUIS 5I7RA 1SKQA 1CJTC 3UY4A 2C9BA 1YCDA 1EA7A 2P4EA 3K1JA 3ND5A 5K0NA 3GRYA 3FPAA 1U7HA 5LPNA 4RTMA 1P2DA 3PGVA 4BZPA 5BSTA 4DIEA 4WY8A 4JJ8A 2QE7A 4DIOA 5C1PA 4L08A 3EISA 2H54A 5AICA 4D79A 2ZSUA 3RROA 1DVRA 1AU9A 2YQ4A 3L8FA 3CNNA 1UL1X 4DQKA 3MTEA 3ZWBA 5ADHA 2BI7A 1OGYA 2FA9A 3I2YX 3NHMA 1MD9A 4RHEA 3UFXA 5TPZA 3SYTA 2Q3JA 2ZRMA 3B9QA 4AO6A 5D87A 1KE1A 1VFPA 1MA0A 2P0AA 3A05A 5IFKA 4L75A 4A6XA 2IP2A 4IIVA 2J0EA 5ECWA 4OIFA 4DJDC 1IEQA 4NE2A 1V9SA 4LVUA 2NV6A 3HFJA 1YB1A 3AUKA 5BRJA 1RLOA 1J9EA 1VBNA 1WAMA 1F0KA 4KSYA 1PZNA 1SUCA 1AGYA 1VB5A 1XRPA 3T8YA 2FK8A 1J39A 4V0MA 2PFKA 2CNWD 4V0NA 1R4NB 4XFKA 4F3RA 3LQ2A 3PC7A 4GM4A 3VXKA 3IKJA 3TIFA 4M1SA 3A9VA 1TAUA 1NVDA 4II7A 4D9BA 1YZFA 5BWBA 3KQKA 1YR2A 5AJTA 2WSIA 4HYTA 4IZ6A 3KR9A 3KZVA 4U2BA 3QVGB 1ZHFA 3F74A 4QJ4A 4XQ9A 4BNJA 5FO1A 3SSOA 3V2HA 4LNUA 3S1SA 1KI2A 1KGSA 4GOKA 1Z0IA 2DR0A 1TMYA 5DXFA 5LCXA 1V5WA 1Z2CA 5EQDA 3NC0C 5KEIA 3WBJA 3IDZA 1E7SA 4RA9A 2HADA 2EKQA 1JX6A 2AMFA 3HGTA 3CUSA 4C6TA 5COBA 3GK3A 3HGQA 4FMBB 5IVHA 5FPTA 4BWFB 4AAYA 2CV2A 2WFAA 5CRIA 2IBMA 2HWKA 4PC2A 4E5PA 2DFTA 2BGNA 3K1AA 3BN3A 4Q7JB 4F4DA 1QGDA 3HNRA 4F4UA 1R0RE 4XFJA 1VE5A 2Y6VA 3DVAB 4FZJA 4RVHA 4ACAA 1N9GB 4J7XA 3O92A 3PDHA 1MTOA 2A86A 2D0PB 3A3YA 3VC7A 4D9CA 4UM7A 2AG6A 4DEYA 1DX4A 4MVJE 3KOYA 3K0SA 1M83A 3K92A 3HUUA 3FI9A 2QD5A 3JVEA 2NP7A 2XYVA 1DCKA 3I6QA 1WQ3A 2BWJA 2IYXA 4R1UA 3CONA 3WJ7A 2ZIAA 3B13B 3ONFA 4NENB 1CUCA 1G17A 3HGMA 1C4WA 1GAWA 4R16A 1CW2B 1P29A 2JI4A 5CAEB 1K8QA 4BKOA 3WTBA 4CMAA 2DVMA 3EQZA 1IBMB 2IBSA 4JJZA 3CNOA 5AW1A 3ANLA 4NARA 1N78A 4TVKA 1ADGA 2B98A 3RU3A 2HHAA 1F8XA 4RV4A 4U7GA 1O96B 1QVWA 5IJXA 2P9FA 2FN4A 1ZJJA 2E6KA 3OD5A 5HS4A 2WPDD 5BN5A 2E4UA 1VHJA 4JIGA 1PD1A 5TQVA 4A0QA 3ORHA 4WZAE 5JV5A 4W6QA 1Z4PX 2ACKA 2P30A 3WNCA 2BFCA 5DDIP 2YFHA 3ZWMA 1J9GA 4QM7A 1C9MA 1OBFO 2DWUA 3BKXA 3FLBA 1OZFA 5ED0A 1UMBB 1EFTA 2CHVA 2NOAA 4XLTA 3NXKA 4KR3A 3PWSA 4C5AA 1KSJA 1KOLA 4AJ2A 4X3CA 1NNI1 4K6MA 2IHBA 3SR3A 5HYVA 4LHXA 1HI9A 4BNZA 1NOKA 1H4QA 4MIYA 4HVTA 3WKEA 2QLNA 2V58A 1PGQA 2Z2YA 4RQTA 3CM0A 1YAHA 4GGPA 1O9BA 3EBOA 1ENPA 2PS0A 3QVTA 4KIJA 4F7DA 1WF6A 4G84A 4UATA 2OXFA 3M3PA 4WLNA 2PFGA 1J2RA 4IDDA 1GVNB 1QOPB 4LV5B 3VX4A 3ZHBA 3OFVA 4RCVA 4FWTA 16PKA 3AU8A 5AVRA 1ADCA 3ADOA 3G2NA 5DP1A 4Q4HA 2ZCJA 5JY6A 2RG1A 5LMZA 2YNMC 3G0HA 2EGUA 1DSSG 4TV9F 5G4KA 3E35A 3BA1A 2A3RA 5B6JA 1C9YA 2KPOA 1JU4A 4DBVO 4S3MA 5ISMA 2C83A 3RRJA 2PIDA 5LU8A 3IP6A 4PO3X 5D5QA 4UAVA 4WQMA 3TRIA 1NMSA 1ZMOA 1L7RA 2HMVA 5CM8B 1JR3E 5JADA 4JU8A 3BULA 3IB6A 2IUEA 2SECE 3D8RA 1MDBA 3PXDA 4KQIA 3SBEA 1IN1A 2PMBA 2Y8EA 2YWGA 1LX6A 2QNBA 3EVZA 4W6ZA 1CT9A 2BFNA 3L7DA 1QPGA 3WP0A 1DIHA 1KYWA 2PVSA 4C4OA 2BEUA 3TRKA 1UK6A 4LF6B 5PGMA 2I91A 2HOQA 1A95A 2W8BA 2XVAA 3H65A 2CDAA 3HU3A 1TM7E 1NP6A 2G1JA 3C8HA 1Q3KA 4URVR 4NYIR 4YMHA 5DTRA 4JI5B 4GGOA 2X42A 3EGVA 1E3JA 3LT2A 2UUCB 1QZ3A 2Q6TA 2TMYA 4ZVKA 3FAZA 4TLLB 1XZLA 5BSMA 1YNSA 1WHSA 3FYHA 2GNAA 1E0JA 1I4LD 1FMFA 1Y8AA 5CDYA 4MAFA 1DQPA 3M4XA 4AS3A 3PHIA 2JS7A 1EFPA 3AESB 1JDZA 4HRYA 1G4AE 1P4RA 3T0IA 4X5OA 3VM6A 3FOEC 1DEAA 5HQ3B 2CUTA 3OIDA 4F93B 3N53A 4Q6WA 1VSVA 2CMGA 6REQB 4LOLA 3FUTA 3K8ZA 4DSZA 5DHPA 3PHHA 2UYCA 1A9PA 1V26A 3BSYA 4HI0E 4LRUA 2GCIA 1Z4QA 2X3YA 4KO4S 3O8CA 3NV7A 3KETA 2H2DA 2VT3A 3FWZA 3TTWA 4EGAA 3FPLA 4IL5A 3OPYB 1ZU4A 4GMFA 3CG0A 4YP9A 3WRYC 4OFBA 5JCZA 4HYQA 4HLDA 1GTRA 1TCAA 4CMIA 4TTRA 1CFJA 2PH7A 2ZB3A 4RTOA 1ZBQA 4LJSA 2JL1A 2NPIA 4E5VA 1ZRHA 3KXIA 1OPXA 1D4ZA 3PEEA 4NIMA 3R9IA 4DIFA 5IJ0A 4V1CA 3EZFA 5J5VA 1ZD5A 1B16A 4BV3A 1YVEI 2QG6A 1ZUWA 4ZV7A 2PCJA 5IC5A 1FS4A 2X41A 1EGMB 3K20A 2O14A 4NYJR 4YJFA 4J4BA 4HNGA 5HIAA 5HRAA 3KWFA 3W4IA 1ODKA 5AXAA 4NATA 5DTQA 2GZHA 2VOJA 3H17A 1QF9A 3IEIA 3PGA1 5CD9A 4AECA 4UASA 5AKLA 1M6EX 3LUGA 3CWQA 3GN2A 3S28A 5K2OA 2AN9A 4OA5A 3FYSA 3EGCA 4Y0VA 5CR9A 3TSWA 2M98A 4V0KA 5B3JC 4AJOA