1FQKA

Crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
318
structure length
318
Chain Sequence
RTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1,Guan
publication title Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A.
pubmed doi rcsb
source organism Bos taurus
total genus 119
structure length 318
sequence length 318
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1fqkA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fqkA01
2QE7A 5K8UA 3IPYA 4DB2A 4DCUA 4IKEA 2VRWA 3NHAA 3ZS9A 4BFSA 2EFDB 4QM6A 1GM5A 2BKUA 2XTZA 8OHMA 4KFRA 5FBWB 4C0LA 3U4QB 3OAAA 2PEZA 5DHAA 4WOPA 4B6EA 3VFDA 3B1XA 1KNXA 1CLUA 4TL6A 1E1QD 1NIJA 4EFNA 2FGKA 4QM7A 3A1WA 1L4YA 2MMCA 2OFWA 1FL9A 1U81A 1HURA 2QSZA 3Q9LA 3QNUA 1OLOA 3BWDD 3KUDA 2VH5R 1CU1A 4G5RA 1T4GA 2NO9A 2IXGA 4CT4B 1FUKA 3FMPB 4IOJA 3B1WA 4RKFA 2Q9CA 3SJBA 3CBQA 3EZ9A 1QHGA 2ZI5A 2O0HA 1GIAA 2JEOA 4PQRA 5CLQA 4HAXA 4NKRA 3WMGA 5L3QA 2D3WA 2IYZA 4TMZA 4HDCA 4KITB 2CHVA 5D3QA 1VIYA 2C2HA 4G1UC 4XVRA 1OKKA 5GJCA 1JR3A 3Q8XB 1SVMA 3O8RA 3OZXA 3MGCA 5K8TA 4LY6A 2KB0A 3GJ0A 3ADDA 4CF7A 3QBVA 4YONB 1ZUHA 1AM4D 1JNYA 1N6RA 4A8JB 3U44A 1MT0A 3BFXA 2XAUA 4KSCA 4EJSB 4C9BA 1FP6A 4N0DA 2XNDD 2JIZD 4Q66C 4BLSA 4UNRA 2OV2A 4ESHA 3K0EA 4KFSA 3V00A 1AZTA 1IJEA 2B6HA 4NCKA 4P4UA 4HDOB 4B76A 4NCNA 4ZDKA 5BXQC 1F2TB 2G88A 2ZR0A 1QBKC 2ZRNA 2ZSEA 3B1YA 3B60A 1QRAA 1E9RA 4A9AA 1ZD8A 3CWZA 1JQLB 4Q9KA 3WHKA 2O8FB 4URZR 4DCTA 4LBZA 1G4UR 3SYNA 4B3GA 3DZDA 2BEKA 2CE2X 3IQWA 3HU1A 3SN6A 4QXAA 3QF4B 1T3HA 4D26A 1H8EA 4V0KA 5GVSA 3RC8A 3L2OB 3E5HA 2ZROA 4JVLA 1UEIA 1E0AA 4CRWB 3NG1A 4GBMA 4PC1A 1EX7A 4QL3A 1TTTA 4O2LA 1YJ5A 3R7WA 2OG2A 4MYTA 1NBMD 4HZUA 3VR2A 1ESMA 4TQUS 4JYBA 3HYTA 1SHZA 1G6HA 1O87A 3IGFA 3RSOA 4J0QA 3OFNA 2ZJOA 5A4JA 4ZI3A 3AVTA 4EUNA 4G5GA 1EFRD 2ZRLA 4LJ6A 3AVOA 3BOSA 4B75A 1YZTA 2D06A 2BEJA 2C78A 3BS4A 4PPFA 1GVNB 4AC9A 5J40A 5FR1A 4DBLC 4HZIA 5TB5A 4MUAA 3QIAA 2XGJA 3K0FA 2ZITA 3OEEA 1X3SA 2XTMA 2WBLC 2IYLD 4TTRA 2H16A 5TXGA 3H0KA 1U2RA 2H17A 1GNPA 3THOA 4TSFD 4WXRA 3WNBA 4GP7A 2XB4A 1NN5A 4FWIB 4HB0A 3SZRA 1M2OB 2VSFA 4BFZA 2D7CA 2QORA 5E3HA 1HE8B 1IOZA 1TADA 5AJWA 1GFIA 1UBEA 1OHHD 1NN1A 3AP3A 3BB1A 3HWSA 5KOYA 2NZ8A 1S9HA 4MH0R 1ZM9A 2CVFA 5FPKA 1F6BA 1OYYA 2A5YB 3SR0A 5ELXA 3QF7A 2YC2C 2WWXA 2ZREA 2WJGA 2AD1A 3Q3JB 5F3WB 2PCLA 3QE0A 4YMTA 5DN6D 4OHZA 1DO2A 2OZEA 1BYIA 1D8TA 1VCNA 2HYIC 1AJEA 1XP8A 1OH7A 2ANCA 2NIPA 2LWIA 1UJ2A 5EP1A 2BHRA 3I8SA 3TUJC 1FTSA 1XTQA 5HPYB 3CRW1 4Q7LA 4Q4AA 3BIFA 2XTNA 4NYMR 1NSTA 4IDHA 3J81k 4OQMA 3A1SA 1UPTA 3AP1A 4DJTA 3RWMB 4AIIA 1T3SA 4OQNA 2YINC 4YDSA 4A2PA 4MYCA 1CF4A 4PO1A 4RCZA 1Q1QA 5KYKA 3TK1A 2CL7X 1KJZA 2CE7A 4QG7A 1WRBA 3VMFA 4N0EA 1KY3A 2VQSA 5H8WA 2EFCB 2O8DA 5D3MA 3VNUA 1NLFA 4Q1AA 4G01B 4Q4HA 4F38A 4DZZA 4NU0A 2VF7A 1Q1BA 2X2EA 3SBDA 3THYA 1IBRA 3QUSA 2IS2A 3AV0B 2YKGA 2ZYWX 2F1JA 2H18A 2EW1A 2B7BA 3IILA 1JQJC 4QRHA 1G8FA 5JWOA 4URUR 3WNCA 3IEUA 1KJWA 1A2BA 3DEFA 3S1AB 5AWFC 4R7ZA 1FZQA 2VF8A 4I1SA 3KQKA 1WXQA 4UXHA 1AQYA 1GNQA 1KK2A 1R5NA 1XXHB 1OT3A 3DO6A 1G21E 4L9SA 3QI2A 1YZUA 3AKYA 1W4RA 1Z6GA 5FBQB 1CP2A 2W2TA 3IDQA 3MWYW 2WM9B 1R0WA 3RNLA 1BIFA 1XEWX 4TLDA 4NYIR 4EPVA 1XRJA 2YHSA 1MO5A 3MWLA 1DPFA 4Q9JA 2IWHA 2GKSA 4TZ0A 1M7HA 5CJPA 2VP2A 5FI1B 4D25A 2IYSA 2GVZC 2F9MA 2FWRA 3FKQA 3U4QA 4Q7KA 1P62B 4B3DA 4US0R 4HDQB 1N6IA 2QP4A 4AKEA 2XXAB 4HLUC 4M1YA 2V7QD 1N3BA 4QNMA 4D80A 2GILA 3IKJA 1RFLA 1NJGA 1CJUC 1VDZA 1W48A 4PXAA 5FBVB 1DVRA 3QQ5A 1NG9A 1T0HB 3LVQE 1YVDA 2G0NA 2GCPA 1R2QA 1ZINA 3GLIE 2BM1A 4RD3A 2HYDA 3T1QA 4Q00A 2QM8A 4DDVA 3K0SA 1Z6TA 2XEXA 3BRWD 3OEHA 2QN6A 3BD9A 3ICEA 4EPYA 5DIFA 1D6JA 1N5JA 1ZC3A 1UM8A 4Q1CA 4JLOA 1FQJA 2W6JA 4AYWA 1Z0IA 2GJAA 3I3SR 3GFPA 4L8GA 2QM7A 3T12A 1ANKA 2WKRA 1R8QA 2BJVA 2ORVA 1IY2A 5FTMA 5GJVC 3TVTA 4CEHB 1N0WA 1DAMA 1KO8A 1RRPA 1KK1A 1Q44A 1XJQA 2ZJYA 1Q1EA 4JLVA 4V02A 2AXPA 2R2AA 3X2SA 1Q3HA 2I1VB 4KFUA 1UKZA 4EJSA 3LH5A 3EXAA 3EPLA 5DI3B 1G3RA 5FTLA 2ZI7A 2HDNB 2ZE5A 4HB2A 5JFGA 1WBBA 4EKDA 1F2TA 2IEZA 3I72A 1N6PA 4M1TA 4S35A 3UKDA 3FWYA 4AKHA 4K81B 4NYJQ 1UBCA 5KNDA 1OJLA 1E94E 4OQLA 3TR0A 3KQHA 2ZJAA 4JLAA 2O8FA 2CNWA 3AGPA 4LOAA 3ZZUA 1G1MA 4JL8A 4WVFA 1CEEA 5FOSA 1HT1E 2WOJA 4LHXA 4BE7B 1DS6A 1SXJD 3KX2A 1C9KA 4YLGA 1RYHA 3KZ1E 1GAJA 1KI6A 5HZKA 4DRZA 3L0OA 1E1RD 2IK8A 1H65A 3GMTA 4Y0VA 3AEZA 6Q21A 5IF9A 4GI7A 3IIMA 4E22A 1Z0KA 4BRUA 2J0SA 521PA 5LB4A 1GP2A 1G19A 1NVWQ 2JJ2A 5CK4A 4E09A 2O0JA 4FI3C 1SVLA 1JALA 5J4YA 2HT1A 5FOWA 3M1IA 3CM0A 2JLSA 4C0AC 1KO7A 2ZM5A 4QJ4A 1N6HA 3GJ7A 3K70C 3A4LA 3QKRB 4BFYA 4US2R 2BV3A 2QROA 4Q5IA 5J4HA 2HV8A 4JBXA 1KJYA 3HU3A 1YR6A 1DAEA 1S2MA 4DT1B 4Q47A 1G4AE 1XEXB 3QSYA 3ASYA 3SS8A 4ARZB 4C4PA 1P2TA 5B57C 4UXIA 3QOFA 1LY1A 1GSIA 4HEJA 3MD0A 4KLNA 4Q1DA 5E7IA 4QNRA 2YJTD 2WJHA 1YRBA 3ZGXA 1WF3A 3R20A 2BCJQ 5EZ6B 4RD2A 3DOEA 3G0HA 3Q7QA 2IUSA 4PZZA 2GJKA 1R10A 1G8PA 2ZANA 1G3UA 4MKHA 4L4UA 1G18A 1XTKA 2N46A 2WKPA 2JJ8A 1OB2A 2ZRDA 3EAQA 1G20E 4DLRA 621PA 3RRZA 1NBME 5JCPA 1Q22A 4MITA 2ZI9A 5EE9A 5BW8A 4UQOA 4Z54A 3CPJB 2G77B 1IQPA 2ZJ5A 2C5LA 2BC9A 4U5XA 4O25A 3GPLA 3B8HA 1L7VC 4A6XA 3REGA 2AD5A 5CYPA 2WHXA 4OHWA 3RS5A 4IVQA 5HR5A 4EQ6A 3THXB 2A9KA 1E2JA 2C99A 2WJJA 1E1QA 2ECKA 2DBYA 3KQNA 1FPMA 3DMDA 4RY2A 4PAQA 3VR1A 5JBQA 5K8IA 3TMKA 2C8VA 3L0SA 3MWKA 1E9FA 5HCNA 4B44A 3I92A 3LLUA 3LX8A 5DH9A 2F6RA 4MRSA 5FUYA 4DWJA 2I3BA 3OIUA 2HXSA 5FOUA 3ADCA 2V8OA 3ICQB 2KE5A 4M53A 1P60A 1KTVA 2JGNA 4PC2A 4AI6A 1II8B 3HYRA 5DGXA 5TY0A 1TL7C 2NG1A 2OCAA 2OLJA 1F2UB 2A5GA 3T35A 4O3MA 1T91A 1XF9A 2GCOB 4B6FA 4LX0A 3VNVA 4B73A 4TMKA 3TH5A 2JATA 1PVOA 1ZRHA 5L3VA 3OF5A 4QJ3A 1S1CA 4I1OA 2BJWA 4A0HA 2Z0MA 4ITRC 3S1AA 3B13B 5JJLA 5G40A 1OXUA 3FPAA 4RCYA 1KMQA 1TMKA 1Z2AA 4EPRA 2YC4C 4D4MA 4KJZA 3P4YA 1XCGB 4TLCA 4LV8B 1P6XA 1NJFA 3B2EA 3M0EA 2O0KA 4Q7JB 2BCGY 3TVDA 3ZDQA 3PEWA 4R98A 2XNDA 2QT1A 2JIZA 2GVDC 3TW8B 5KSOA 2FSIA 2R62A 1Y63A 4FD2A 1KKLA 4BFUA 1W36D 5B64A 4FMCB 3N70A 2L0XA 2CCGA 3BK7A 4II7A 2WWYA 1EWQA 1NVXQ 3NDPA 4JLMA 1S9DA 2CK3D 5G41A 3U3JA 1PLJA 3T06B 2GJ9A 1QHHB 3K53A 1D9ZA 4ZCMA 2JAQA 1G3IA 2XXAA 3SU8A 1AS0A 4LWZA 2IYVA 1Q20A 4IFEA 3SQWA 1E69A 2CCKA 2H92A 3LY5A 4QKQA 2OEPA 5KDOA 3W34A 1JR6A 2RGAA 4ASUD 4R71A 3WYFA 2GRJA 2YOFA 2ZUDA 4JVSB 4NDZA 3I5XA 5L3QB 1AA9A 1UKYA 1UFQA 2D74A 3EIQA 3W5IA 1DARA 3IBYA 4ACBA 1W36C 4D82A 1F3OA 2WZQA 4M1SA 1AN0A 2G1KA 4HAVA 2LKDA 5DYIA 2ATVA 5CM8B 3T5GA 4JVNA 1C4OA 2EYQA 2Q0HA 3CKLA 5JWHA 4C7OB 2GF0A 3B6EA 3HPQA 1NBMA 1S3GA 2QMHA 4F93B 4FWTA 5E95A 2IHBA 5KDLA 2QY9A 4NYJR 3MG9A 1E2KA 1V5WA 4JSYA 1KGDA 5FI0B 1H8HD 2QL6A 2OXCA 1K8RA 1NN0A 3AVXA 1EFRA 1E2EA 4B34A 4DIEA 1X8LA 2CLCX 1P7CA 2D2EA 4NCJA 1N5IA 1G16A 2FA9A 3WMFA 1W7AA 3ETLA 1I4TD 1ZW6A 4CEHA 4DCSA 3JZMA 4I4LA 3PG5A 2GZDA 4AD8A 4L5BA 4PQFA 2KSQA 2FFHA 1KIMA 1XEFA 5B58C 4TLBA 1ZU5A 1XMSA 3EZ6A 3GFOA 1DEKA 2AX4A 4LYHA 4TSFA 2GK6A 4DLTA 3D7MA 1VG0B 3CF0A 1AS3A 2IS6A 3VR3A 3ADBA 4Q4AB 121PA 1OHHA 5DI3A 4DHEA 3GLFA 5J4LA 4ZPXA 3KXKA 2BMEA 5SZHB 5FPSA 2P6NA 3EASA 4OJQA 4TYQA 4HAYA 1WMSA 3VKHA 4M22A 4RD6A 2B92A 3OIVA 4I1VA 3PJRA 1XJCA 5HKKD 3RS0A 4XVQA 5H70A 4HLQB 3EPHA 1KDPA 2RGBA 4CYMA 1IXRC 4X8LA 1D9XA 3ZD6A 1XPUA 1LNZA 2AKAB 3LBHA 3F0TA 3TNFA 5D3MB 5JI2E 4PR0A 1IN8A 2VPPA 1YZKA 4Q4HB 4D4KA 1X8KA 3KQUA 5DN6A 5AUNB 4QGGA 4BLQA 1OFHA 4NE2A 2OBNA 4JT2A 4XSHA 1WCV1 1TEVA 4Q1FA 1ZBDA 1IY0A 2YVUA 4B32A 2F3RA 4B35A 3KKPA 3IIKA 3AF3A 5AJXA 1Z6YA 2G1JA 1TX4B 2C9YA 4WXPA 3GFTA 4TMXA 4NBSA 2ZRFA 3L82B 5JMTA 2VYFA 4MKGA 1KOFA 2RGNA 3ONWA 1D5CA 1Q1ZA 4NYMQ 2G3YA 4O0MA 1KI4A 2OFOA 3FHOA 4RZUA 4BZQA 2OHFA 1QZXA 1X86B 5JRZA 5KDDA 2GWHA 3QKRA 4FW9A 1T9HA 1P73A 4BEJA 3TGPA 3U5ZB 1DADA 3M6AA 1KI8A 1E9SA 2IC5A 4C2TA 3GJ6A 4Z8YA 4DT1A 1XEXA 3ZQJA 4FINA 1IY1A 2ZE6A 1TPZA 4ARZA 2F1IA 2IA5A 1NNEA 4TN1A 2QGNA 3HU2A 1SKYB 5EXXA 1HA3A 1M1YE 1P3JA 3DM9B 4TYNA 1M34E 3NTUA 2QAJA 4EPXA 1OB5A 1N0UA 3K0AB 5E7MA 4GRAA 2IXFA 4JS0A 3WRXC 4PSKA 1D2NA 1SXJE 1P2VA 1ZCBA 2PZGA 4QBGB 3AM1A 4PHGA 1HQYE 2XOKD 4MYUA 2WAXA 5CIQA 3EPJA 2DFNA 3W9YA 3PUWA 2CCJA 4OQFA 3O8BA 4AYXA 1EXMA 2WWHA 3H86A 2EVWX 4HLUA 1NRJB 3BXZA 1TNDA 3AVPA 2V55B 2O5VA 1OIXA 3U2QA 2J5XA 4NYIQ 4QGHA 3FFBA 4WBSA 4N3NA 1YZQA 1W36B 2N1BA 3ZS8A 4H1VA 5FBRB 2Q3FA 1CULC 2R6CA 5J47A 5KTYA 2O52A 2QPOA 4JKYA 3UG7A 4S2EA 1HUQA 1II9A 2V7QA 3NBFA 3THXA 1T3LA 2RHDA 4JLDA 1TUIA 5EXTA 3TAHA 2BMDA 3A36A 3RYTC 1JEDA 3PUXA 4D0NA 1HY3A 4JIMA 1G7SA 1D2MA 4LCBA 3CNNA 3W6PA 1E4YA 2ZJ2A 2QA5A 3SYLA 3U3KA 1SKQA 4YC7A 2D4HA 2OM2A 2ONJA 4HAUA 2KWIA 3BGWA 2DFKB 3ECCA 1II8A 3DL0A 4GZMA 1OH5A 3X1DA 1HTWA 1F2UA 1DELA 1XZQA 3Q5EA 2GCOA 4A92A 5FTKA 1TQDA 2J0UB 3ZH9B 3R9IA 3QXHA 1VG1A 4RD4A 4R2HA 4UNPA 4LJ7A 1VCOA 5IRCD 4YMSA 5JRJA 1KI6B 2IYYA 4MGKR 2QU8A 2EWVA 1KKMA 2ZS7A 3LO5A 4TQ9A 3T15A 1QHSA 4Z8XA 4PC7A 1JEEA 4K8OA 3R8FA 2PLRA 4W5WA 3P27A 2ZR9A 2BBWA 3KJIA 4K46A 3AP2A 4P3YA 5GJWC 1XWIA 1MH1A 4KBFA 821PA 4WZAE 2P5TB 1E2IA 2J7KA 5H1YA 2P67A 5CK5A 5BN5A 4LJAA 1VECA 2GXAA 4C0JA 3KKMA 1JI0A 2ZE7A 2DYKA 5TMPA 1SVSA 1ZC4A 2PJZA 4Q4JB 4P31A 1GITA 3NH6A 2B21A 2RB4A 1QHHA 3GJ3A 4TL8A 1DG3A 2F9LA 1R7RA 4LHVA 1ZM4A 5IDVA 1X8JA 3T1OA 5KU1A 3LQQA 1BO6A 1E2MA 3PCRB 4QBFA 5C46F 4ZDJA 3LV8A 4XSGA 3WNDA 3KKOA 3NBYC 4KYIB 4X8MA 1SXJA 3IBGA 3UG6A 1G7RA 1XB2A 2LKCA 4PSVA 4YMUA 3E1SA 3UMFA 5JZVA 2HF8A 3DZ8A 4LYFA 3K9NA 4C2UA 4MDFA 3QXSA 2ZYVX 2HLDD 2RH5A 1E1RA 2IYRA 5DE3A 4LSGA 4V0ME 2DWQA 5EXPA 1E9CA 2JDID 5SZJA 5EZ5A 4H9GA 3VKWA 3VU9B 3ZYCA 3NXSA 4Q03A 1ZD1A 5CDFE 4C7OA 2IS1A 4X8OA 4A2QA 3NEYA 1VYUA 3CF2A 1NVUQ 3D31A 4Q21A 1KZGB 4W5HA 4GT1A 3KXLA 5GADl 2UZ3A 4HI0E 2EFEB 1OXSC 1Z07A 2W2XA 1CRQA 1KSJA 5JSZB 3CZPA 4ZDWA 3EZ7A 2ZS9A 3SJCA 4M9ZA 2F1RA 1LS1A 1ZUIA 1NMXA 3LX5A 3L0IB 4JL5A 3EA5A 2XZLA 2Z5FA 1GWNA 2R6AA 1RRFA 2HXYA 2QEQA 3F8TA 2O8EB 1OFIA 3RSLA 2GJ8A 4PHTA 3QKTA 4XD7D 4M9SA 1TU3A 2V6JA 5CIWA 4RFSB 3WYGA 1U8ZA 4GP6A 4M0LA 3LWNA 3ND8A 1NMZA 1WA5A 3MFYA 4A15A 1OPXA 3GLHE 1Q57A 4HUQB 1R4AA 1MO6A 4ZV4A 2QENA 4GPTA 3DHWC 4EQ6B 2P0EA 1XCPA 2FSGA 2ZRBA 2ZPTX 3H1TA 4B74A 2FEMA 2VLIA 5B2ZA 4Z1MD 1EFHA 1XCMA 2J41A 5UKDA 4CZ2A 1U99A 3T1TA 1G3QA 3UANA 2OCPA 4QGAA 1OE0A 4XWKA 4D0GA 1UAAA 3KL4A 1NF3A 3NEJA 1L2TA 3A1VA 1GUAA 1J70A 3NBXX 3FKSD 3SQXA 4BWYA 1G8HA 2RGNC 4IW3B 3C16C 2NO1A 1AQUA 3I1FA 2ORIA 2WOOA 1L8QA 3TSWA 1XTSA 2F43B 4LBVA 1F48A 1E32A 2B8TA 2W6ID 3MJHA 3PEVA 4JLPA 1Z28A 4V0OA 1GNRA 3TSZA 1NKTA 3BAFA 1JPJA 3GP8A 1YKSA 1TEXA 2VHQA 2ZVPX 3DPUA 3BJIC 4QGFA 3HJNA 5JEDA 1YZLA 4IVPA 1N6OA 2FNAA 1W46A 2FSFA 2F1HA 3KTAB 2GAOA 4PAOA 3SOPA 2OILA 3HPRA 1AK2A 3SDZA 1IN6A 3KFVA 1VHTA 2VL7A 4B33A 2JJ1D 1KAGA 2ZJ8A 3LD9A 4TL7A 3W3ZB 4QHTA 2ZTSA 1AZSC 4BLPA 1T0JB 3CW2A 1AGPA 4PPQA 4PPGA 3FE2A 1PUIA 3RRNA 4YMVA 4C3ZA 4OI4A 3IUYA 4IFBA 1Z8FA 4F92B 3MCAA 1J2JA 3AGQA 4DB4A 3PEUA 5CB6A 1XMVA 1M8PA 2V1UA 2K5UA 2R65A 2X19A 5TV2A 2P5SA 3SNHA 4YXWD 4DSNA 1IJFA 4IOLA 2PMDA 4Q18A 3RANA 1VG8A 3PQCA 4XOIA 2MMGA 3K0AA 3I73A 2GAAA 3LXXA 1T8UA 1N6LA 4LC0A 1G6OA 1J99A 1O3YA 2FPMA 3M4YA 2OBMA 4DCVA 4GZLA 5FTJA 2YZ2A 4IDQA 1EWRA 4B3BA 3KKNA 2J3EA 2Z83A 4KVGA 1KSGA 5CITA 4QJ5A 1KSHA 3DDCA 2ZJZA 1UDXA 1DAGA 4C0SA 1OFUX 1EFCA 4NPHA 1COWA 5DI9A 5JCZA 2WWFA 3PITA 1XZPA 4Q9HA 3GCGA 3SFZA 2A78A 3T34A 3BFVA 3OIYA 2WMOB 1GL6A 1JBKA 4L15A 2ZYUX 1LB1B 2GXSA 2QQ0A 2ZRJA 2IF0A 4MYHA 1FOEB 5CB8A 1G5TA 2BIFA 2IS4A 2ZRKA 1P2SA 3LAWA 3FDIA 1XFAA 3P26A 2ZUBA 2XZOA 3FTQA 4FMDF 4OQXA 4ASUA 4EPTA 2XX3A 2H8KA 3PENA 4LZZA 3I5YA 3P4XA 1YRAA 3C5CA 2ERXA 2VO1A 1FQKA 4JLJA 3B9QA 2TMKA 4FCVA 3K0CC 1E2DA 1Z0FA 1E2NA 3QXJA 3GLFB 3PXGA 3QJYA 1KI7A 2A3RA 3QEJA 4BLTA 2VIIA 3E70C 3O47A 3CR7A 4JVMA 1IXSB 2EU8A 5LB2A 3F5FA 3UK6A 1H8ED 2QSYA 4OKSA 2PBRA 4LGMA 2P65A 5AUPB 1E98A 2OO7A 2X1VA 4RZ3A 2DPXA 4LJ9A 1PUJA 3B85A 2BDTA 2YOHA 2IEYA 1H8HA 2CBZA 2GZAA 3ZZ0A 2J0UA 1Z83A 3JVUA 4F4IA 1HV8A 2R6GA 3A8TA 4UNSA 3OFND 2ODWA 1XPRA 1GKIA 4Q48A 2YWGA 2ZRMA 4KHZA 3REFA 2ZAMA 5HCIA 3GEHA 3ZD7A 3E2IA 4LV5B 3CNLA 1PLKA 2QP3A 3CNOA 4LYAA 5JECA 1XMIA 4OBEA 5IHPA 1GRNA 3PFIA 4Q7MB 2V1XA 4GSYA 2YOGA 2KBEA 4MKFA 3FHTA 2OUKA 2JASA 5EUMA 3MMPA 2HCJB 1ELOA 4LBWA 1YR9A 5HE9A 3VR5A 1RW4A 3TAUA 4P4TA 4BLOA 1OIVA 5FPHA 1N6KA 3QPVA 3ZVNA 4DLUA 4CGZA 1SXJC 1Z2CA 1LF0A 2ZRCA 4FN5A 2DB3A 4KODA 2VHCA 2DWOA 2ZS8A 4Q4JA 4EAQA 5AR1A 5AK0A 4P4SA 5GJBA 3P32A 1X1RA 2BM0A 3WRYC 2WSSD 4PANA 1UBGA 2QGZA 2DWPA 5HKKA 3SFVA 1FMLA 2CXXA 5F2EA 2PT7A 3TUIC 4V03A 3RWOA 4DUGD 3Q5DA 4DLYA 3LQRA 1G291 5FL7D 2Q3MA 3A37A 3FB4A 4TYPA 3SC3A 1NLYA 2VEDA 4JZKA 4CDGA 4F4JA 2WIBA 4LYJA 1XXHE 2C96A 2J87A 3GLIA 1W2HA 1E79D 4EPWA 5KPJA 1TF7A 3N2IA 1K5DA 3VU9A 1E99A 2PZFA 1JJ7A 4XWOA 3OE7D 1A1VA 2ZI6A 4FMCF 1QHIA 4B2PA 2O8CB 1EX6A 3FOZA 1IN4A 3UXMA 2VP6A 3SEAA 2ZRAA 1NSFA 2OESA 4UXJA 4ZCLA 3RHFA 5JSZA 2KBFA 221PA 4FMDB 3JVVA 3Q72A 4YMWA 2FPKA 4BLRA 3CRVA 4OHYA 4M1WA 2EQBA 3D3QA 2VSOA 4QBHA 4URWR 1VHLA 5FH9A 4DLZA 4RD0A 1AS2A 4XVUA 2O8EA 3EC1A 1S96A 2AFHE 1NN3A 1XX6A 4KO8A 4E03A 1Z0DA 1OXXK 1EK0A 2OAP1 3OIWA 4C0KA 4RFSA 2NTYC 4GL2A 1ETUA 1R8SA 4GMXA 2XB2A 3BC1A 5EJEA 2WJIA 3CZQA 4JL6A 1E0KA 1W4CA 3EIHA 4IDOA 4D2IA 2ZRGA 1BYUA 4HUQA 1KAOA 2F55A 1XD2B 1NY6A 2XZPA 2AK3A 1SULA 2WSMA 2YV5A 4TL9A 2Y8EA 4C0BA 1P61B 3QXXA 5FPTA 2A2ZA 4GOKA 4ABYA 5JLJA 2FE4A 3FGNA 1GRRA 2CL6X 3QVVA 2FH5B 5HTKA 2WWIA 2VSXA 2ZE8A 2J7PD 2QBYB 4TT3D 2X8AA 2XOKA 1FP7A 2R6FA 5KUTA 1BS1A 2ZEJA 4IEIA 2WICA 3GJXC 2GF9A 2FX3A 3BE4A 3CPEA 3THWB 5L8VA 3PUYA 2H1LA 4BZXA 1OYWA 4KXFB 3QEOA 1II0A 3RS4A 1WE2A 4L9WA 5KNBA 2PEYA 1ONBA 2F43A 2RAPA 5FBLB 1MKYA 1FNNA 1DG1G 4PX9A 5F9FA 1DAFA 4DSTA 1NLZA 1EFTA 1TF2A 3W8NA 3EPKA 2F3TA 2GCNA 4LPKA 2JA1A 1Z06A 3GJ4A 2FZLA 4OK6A 5LDDC 2BBOA 2GZHA 1DOAA 1T8TA 2ZSFA 2OXRA 1CJKC 4G5OA 1VIAA 3NIBA 4PQYA 5BYJA 5KNCA 2PT5A 3KTAA 5BWMA 1CBUA 2ZVQX 2IX3A 4TYWA 2RCNA 5J4KA 5JHGB 2HJGA 2HUPA 2JLVA 5F9HA 1DBSA 4P33A 5HZHA 1OF1A 1JB1A 1Q21A 2BOVA 2QG6A 3GJ8A 3GLGE 3SHWA 4KCGA 5JEEA 4TZ6A 1E9EA 4HAZA 1BH2A 4M9QA 4V0LA 4HSEA 4DCNA 1R0YA 3AF2A 4NCIA 1E96A 4AURA 2JCSA 3X1ZA 4DSUA 3TQFA 2FFBA 5CJ2A 3IIJA 3AUYA 4PFSA 1IM2A 4Q1EA 4WZBE 1KI3A 1W44A 3ZZTA 3PEYA 1YR7A 2GEDA 4D4LA 4JJZA 1SXJB 1DAHA 4BEBA 3TE6A 3TIFA 4CT5A 4JLKA 2H7VA 4FIDA 2PZEA 3PIRA 2NZJA 5C2JB 1E2FA 1DAIA 1S8FA 2QP9X 3R9XA 1ZIPA 4WZ6A 2AK2A 5SZIA 4BFTA 5JI3E 5KHOC 4KVAA 1HH4A 4U7DA 5JS8A 1X6VA 1XPOA 1UADA 1TAGA 3AH8A 1TUEA 1OH8A 2O8BB 1E6CA 3ZVLA 2DY1A 4LJ5A 1GL7A 2REXB 4B48A 4JKIA 4LHYA 4KSBA 3AUXA 4ZDIA 4JYCA 3NC0C 3A1UA 3BH0A 5KPDA 3R8CA 1VYTA 3MWJA 4DXAA 2GBLC 2QZ4A 4XTCS 4V0NA 3UWOA 1KK3A 3U60B 2Q3HA 1WB9A 1KMHB 1F60A 1P72A 1W5SA 1HYQA 1ZUNB 2J1LA 1FTNA 1CR2A 3QKUA 1W47A 3KJGA 3RAPR 3FHCB 4XIGS 4AWXA 5L3SB 2FMXA 3NWJA 2A5FA 2HLDA 2Q9AA 3PR1A 3K09A 4BRWA 2W0SA 4DLSA 3QKSB 1ZIOA 4POAA 2JDIA 5EE3A 2CHGA 3CPHA 2AHOA 2NGRA 2FF7A 2GXQA 2QAGB 1MRNA 3G82C 4IDPA 1DE0A 5BN4A 4MRRA 1OW3B 2NQ2C 3KUCA 1SQ5A 2W0MA 5G3YA 2OFXA 5J4VA 2NO0A 3B1VA 4DSOA 1U8YA 2JLYA 3SI7A 1LTQA 1W2GA 4ON9A 4RKEA 4RFVA 5L3RA 1JXOA 2R9VA 3GJ5A 1F5NA 4C30A 4CW7A 1E9BA 1JR3E 3LDAA 3CIOA 4XD7A 5K8LA 3AKEA 2IWRA 2FSHA 3C7KA 2FU5C 2QTVB 1U90A 4IDNA 4ZI2A 2Q21A 5CLLA 4ERNA 2IBMA 4D4JA 1MOZA 1BKDR 1YHNA 2VA8A 3TJZA 1A2KC 2OCBA 2ZR7A 3UWKA 4KYUA 1EFUA 3UMSA 4PPNA 4M4SA 4R9UC 4UKDA 4UNQA 2E1RA 1QF9A 1E3MA 3KFXA 3ZJYA 4G0NA 2QTHA 5IK2D 3AB3A 5CYOA 3CO5A 4IOMA 4Z1MA 4LRWA 1Z63A 1TF5A 1GOTA 1T6NA 3CRQA 3MSXA 5LBIA 3ZIAD 1Z6AA 3K9LA 4Q19A 4NL4H 4RD1A 5DISB 4LV6A 1HQCA 2I4IA 5JJIA 1BMFD 2G6BA 2PH1A 1OSNA 3RRMA 2OE2A 3TQCA 3FKSA 2EFGA 3U3MA 1IHUA 1ZYUA 2A30A 1P75A 2VBCA 4G5SA 1NG1A 2G0TA 1ZM3A 2ODBA 4I81A 2W6IA 3L8ZA 4M1MA 2AR7A 2RGEA 3HR8A 3T61A 3A4MA 1V43A 2GESA 2WPDD 3D6TB 5BYKA 1MO4A 3BORA 1SVWA 2O8CA 4TMTA 2VP0A 3LFUA 1CJMA 5C18A 1A4RA 1ZJ6A 5AUQA 3ADKA 3AVWA 2DCUA 4A1FA 4AG5A 1FW6A 1NMYA 2GXUA 1IAQA 2RMKA 2R6DA 4U02A 3CX8A 4MGZR 2XJ9A 1LFDB 1S3SA 2JJ1A 1CKEA 1N0VC 1QHYA 2HJVA 3BBPA 3DOFA 1A5TA 4IHQA 1YU9A 3U7EB 2IF2A 1KDOA 3MUFA 4OI1A 2LCFA 1P2UA 2E87A 3GLHB 3W5JA 4BGDA 3QENA 2GETA 3SJZA 2JLRA 4EDHA 5FUXA 3U7HB 1IN7A 1W5TA 3A6PC 1RPZA 1MV5A 1RC8A 4W7SA 3GEIA 5TDHA 4JSTA 4X8HA 3KKQA 5JS7A 1XD2A 3AVYA 2NO7A 4YXWA 4UJ3A 5C1BA 3LW7A 1Z22A 3TSOA 2C98A 3HDTA 4PZLA 2WWGA 3RRYA 4BFVA 4PC6A 4PO9A 3U6KA 2BMJA 3WXMA 4D0LB 3BH6A 2CL0X 5EE1A 2QBYA 2A5DA 1GKUB 2QTFA 4ZIRA 3U6BA 2OLKA 2ORWA 2WIAA 2H57A 4U00A 3AF4A 1MRSA 3KQLA 4G3XA 4A82A 4B47A 1C1YA 3THWA 2C9CA 4HATA 4XTRA 2AN9A 1G9XA 1NKSA 3NH9A 5IT5A 1KI1A 1XD8A 3K1JA 3K0CA 3V4FA 4M1OA 1FNMA 1NVVQ 2MSDB 3DKVA 1U94A 4US1R 3QVUA 1UKEA 1YZNA 4BQSA 1XD9A 2QQEA 4R2IA 1MABA 1U9IA 2IYXA 4HLCA 1XDBA 3TRFA 1MO3A 2VP4A 3NKVA 3WP0A 3VX3A 1ZM2A 2J0VA 3V9PA 4MRPA 4URXR 4F91B 2B7CA 3EWSA 1A82A 1P9NA 1M6NA 3SYKA 2ZXUA 1G17A 1GRQA 1Z6XA 5JJKA 1NI3A 2QMEA 1KYIA 4MRVA 2FG5A 1NY5A 1KO4A 1PZNA 4CEIB 2QRNA 2RGCA 1OH6A 1ZM7A 2YNMA 4JJKA 4CIDA 4W5JA 1G41A 3RS2A 4KV9A 1OXTA 2VHUA 3RABA 3H4MA 2IYTA 1FUUA 2WAYA 4NONA 3UMRA 3NDBB 4P4SB 1S1MA 1W49A 4JBWA 3B1ZA 3U7GA 4IXNA 4A0FA 1N6NA 3IEVA 3OHMA 1Z29A 3EA0A 3T5DA 2YWHA 4IEEA 4GOJA 4F4CA 1WP9A 2ASEA 5TARA 2HF9A 2Z43A 2ZRHA 1YQTA 2W83A 3ZLJA 5FFMA 4ZCIA 3AKDA 1E9AA 1KHTA 5FTNA 1LS6A 2HT6A 3KXIA 2J59A 3NC1C 4MKIA 3ZQ6A 2AWOA 4LBYA 3U3RA 1EESA 3GLIB 2ATXA 2C03A 2G83A 3CONA 4DDWA 1ESNA 3UATA 5KSYA 2NPFA 2O8BA 2MSEB 4IRUB 2CEAA 3RS7A 3PUVA 2QRZA 3CB4A 4GOXA 4G5QA 1YR8A 2E9SA 5TVKA 1DTSA 3C14C 3A58B 3ASZA 5B30A 4MQBA 5DSZA 1K6MA 1ZD9A 2XSZD 2WJYA 3K09C 4EFMA 4CEJB 1LW7A 1B23P 3IPXA 3HP1A 4PAMA 2WSSA 4EFLA 2QNRA 1P4SA 1SKYE 5LD2C 1KMHA 4DLWA 4PSAA 4Q1BA 3WY9A 4AY2A 2REBA 4DUGA 1VG9B 3SJAA 1MR3F 4A6PA 1YZGA 5FL7A 2QI9C 5L3SA 5F98A 3AVUA 1R6BX 4B71A 1KO1A 2BVNA 4IOKA 1Q3TA 4B43A 5FL3A 4LUCA 4NCHA 4HB4A 1U0LA 1W0KD 4O2RA 5EQTA 3QKSA 3RC3A 1E79A 2BBSA 4DLXA 2JLZA 4MDEA 1ZAKA 2QAGA 3OE7A 1E0JA 4MGYR 3WYAA 1CJTC 4LI0A 2AL7A 3EWAA 1CJVC 4A0GA 4OI0A 2ZRIA 2P6UA 4FXPA 2FJUA 4W9MC 2QPTA 2VHJA 1KDTA 2C95A 2X2FA 3DMNA 4KFTA 2W2VA 1G64A 3IHWA 1TQ2A 2IYUA 3MAAC 2A7QA 2QPAA 3C5HA 3CH4B 3LW8A 2V54A 4RSGA 1G8GA 1R0ZA 2VTKA 1W0JD 2NMVA 4OHXA 1AKYA 1KI9A 3G5UA 3EZFA 2QUZA 2V6IA 3MRSA 3CWQA 3WBJA 2Q9BA 3L0PA 3X1YA 3FMIA 3AF1A 4LDJA 3KB1A 3FYHA 4Q9IA 2QE7D 3PVSA 2IXEA 3WP1B 3BERA 3I32A 3AKCA 3VR4A 4XJXA 2KJQA 5GVRA 4M21A 1SZPA 2BWJA 1GG2A 1Z0JA 3LRPA 3OAAD 3SE0A 5DNYB 2ZU6A 1Q12A 1RZ3A 5E7JA 1AIPA 2DR3A 3JZAA 2X77A 5EXSA 2NPIA 3CH5A 4Y0AA 2IHYA 2AFIE 2EWWA 2J7PA 3EZ2A 3N5CA 4RZXA 4TT3A 2GEVA 3VQTA 3X1WA 4HUTA 4GDFA 4HYYA 1R0XA 4Q9LA 1RVDA 4KI0A 3NVAA 4NH0A 4TYYA 1E2PA 2PX3A 4LC1A 2ANBA 1JAHA 4LJYA 4WAUA 4MA4A 5AJZA 2CJWB 4V0MA 1DO0A 5ANRB 2XJ4A 1ZCAA 4AKIA 1KDRA 3ND9A 4KU4A 4BPBA 2C9OA 2WKQA 5CDFA 3SBEA 3NHBA 2JLWA 4L16A 2PJRA 2P2LA 3U61B 4JBYA 2EYUA 3K9GA 3TR5A 2WTUA 1OXVA 1FX0B 2VP9A 1ZNYA 1J90A 4HB3A 4GFDA 3P20A 5FR2A 1OKKD 1SVOA 2ZSBA 3VAAA 1T5LA 5M04A 1JR3D 1U98A 2J45A 1LF5A 4NTZA 5HE8A 1ODFA 2ZSAA 2KI5A 3LBIA 4LHZA 5A5GA 4NZYA 1LVGA 1WBDA 4B3CA 1UBFA 4PHFA 4E5UA 2JLXA 3D8BA 2HEIA 1K5GA 3FMOB 3GLHA 2REOA 2GTPA 4LPSA 2R8RA 1NVVR 4ZKDA 1KY2A 3W90A 2CK3A 4TLEA 4DVGA 3I61A 1U0HC 5DYGA 1RIFA 3ZVMA 1TU4A 4JT4A 3B82A 4N1AA 2GDJA 4UJ5A 4DC9A 1GZSA 3PV0A 3C15C 1GKYA 3VR6A 1HT2E 5A0FA 1FFHA 2C77A 4PHHA 2QMOA 4PTLA 1G7TA 4OK3A 1G8YA 3V4RA 5DO9A 3BB4A 1QDEA 3EW9A 1KI2A 2GBLA 4KLZA 1AKEA 1U9IC 5AUOB 4XWAA 2ZAOA 5G53C 5LD2B 1I2DA 3VTKA 4JLBA 3C41J 2CLDX 1E4VA 2PMKA 4URYR 1Z3IX 3GQBA 5J5CA 3WHLA 5H68A 4BZPA 1E0SA 3W6OA 3A1TA 1RKBA 1W1WA 4PZYA 1NP6A 2G9NA 4A8JA 2Z4RA 3H2YA 2B8WA 2P3SA 2VP5A 1YE8A 2W58A 2VHTA 2ZETA 2QMUA 4I99A 4P0TA 4AKGA 2J46A 3QPWA 2RGXA 3LA6A 5E4FA 3EX7C 4KBGA 4BFWA 3OESA 2HCBA 2WWWA 5CM9C 1AGRA 3L8YA 2A5JA 3BH7A 1D2EA 5FPYA 3OEED 4P32A 5KO2A 4D81A 4QC2A 4B3FX 3GLGB 2D2FA 5AJYA 2JLUA 4TQAA 1FMJA 2Z4SA 1JJVA 1CR4A 4CEIA 1U8AA 2OCYC 3CX6A 1IN5A 1JXMA 4OI2A 2V3CC 3RLFA 1VCMA 1ZU4A 1RJ9B 1L4UA 1NIPA 1GDDA 4NHOA 3QF4A 3K70D 3FVQA 3VHXA 2ODEA 2FV8A 1S4QA 4A4DA 3DM5A 4F7WA 4RZ2A 1WQ1R 4ESVA 721PA 3KDSE 4AYTA 2XNSA 4LHWA 4E07A 1US8B 1SVIA 5KSPA 3A4NA 1XU4A 3WBKA 4URVR 1P5ZB 3AVQA 3C8UA 3HR7A 5JWRA 1G5PA 1Z08A 2BKEA 3O8CA 2J9RA 4YQFA 4TTQA 1G7CA 1KZ7B 3LXRA 1XTJA 4M2LA 3C4JA 4QFMA 4M9XA 2IL1A 4IVRA 4B2LA 2OBLA 4KAXA 2IUTA 1VMAA 2FEOA 4TTPA 4YDHB 3IHLA 4PO8A 4QHYA 2IUUA 3W6NA 3LVRE 2ZSDA 2W00A 3N2EA 5JHHB 2UZIR 3MJRA 1RE0A 1B0UA 1P9WA 5IK2A 1CS4C 1XNJA 1CR1A 3QY0A 2F7SA 5EP2A 3UPUA 3I62A 4CEJA 2FGJA 3ZIAA 4OYHA 3TLXA 2QAGC 3W8RA 1BMFA 4NMMA 1XEWY 2GHIA 1CRPA 3GEEA 1VCIA 4M1KA 3SHFA 3K8YA 4ILEA 3RDPA 1T5IA 2DFTA 2XITA 3CRRA 1E2GA 2ZRPA 4JMPA 1JPNA 1ZNXA 3CLVA 4Q4LA 4WW0A 2ZI4A 3LBNA 1I4LD 5EUQB 2RHMA 1RRGA 1SVKA 4MUBA 3WMEA 5DLQC 1W4BA 2OAQ1 3PUZA 1J7KA 3T1VA 2WPDA 5KSZA 5EP4A 1IONA 1LV7A 1QVAA 2WV9A 5EE0A 2ZIAA 4FCTA 4ZIRB 3QPUA 3LNCA 3W3AA 1ZMXA 2JLQA 1Z47A 1QVRA 1E2LA 3CR8A 3GD7A 1QG2A 4GMDA 4AG6A 1SGWA 1M74A 1XBTA 1VPLA 2GK7A 4MGIR 3TW4A 5BN3A 2FFQA 3NBZC 2V9PA 1GL9B 5FUWA 4XH9B 2Z6VA 3U44B 1N5LA 2FFAA 1CR0A 1MABB 2YYZA 3IO5A 2WJVA 1HE1C 1X1SA 3B5JA 1RRCA 3GLFE 1QG4A 1PLLA 2OSBA 4DKXA 2GA8A 1XTRA 2H5EA 5FOTA 1TQ4A 4LK2A 1J8MF 5FUVA 3IO3A 1UEJA 3K9HA 1M7GA 3F3YA 1N25A 1CXZA 2PL3A 3B9PA 3Q7PA 4OK5A 2ZUCA 1HEIA 1Z0AA 1KO5A 4AK9A 5C4MA 2DHRA 4TMVA 4DEXA 4ZKEA 2PLFA 5DHFA 4EIWA 4A36A 2EFHB 2GEUA 1KSFX 2CJWA 2IW3A 1R5OA 1XXHA 2CDNA 3Q85A 4NP6A 1EGAA 3VHLB 2J0QA 3R7WB 2R44A 2GNOA 4HZUB 1I2MA 3EARA 1EG7A 1XJ0A 2CMKA 1KK0A 2NOAA 1ZNZA 5LPNA 3OEHD 1JECA 4BUJA 2CLSA 3H84A 1COWD 4DDUA 5AJVB 3FMFA 4TLAA 1FX0A 4JLNA 1RYFA 4RVCA 1N2CE 2W6JD 4OL0A 2PX0A 3K0FB 1IXZA 4WA7A 4B3XA 3VKGA 1GILA 4FCWA 3QBTA 1TQ6A 1PJRA 4ZO4A 2ZYTX 3LLMA 3U7FB 2YWFA 1A7JA 1VYVA 1XMJA 3P1JA 3QXCA 4C0QC 2FN4A 3CUEF 3EG5A 1I4DD 1XTIA 3AF0A 1PV4A 4C0HA 3K70B 3CF6R 2D62A 1JAIA 3TBKA 3AVVA 4RJLA 3AQ4A 4LJ4A 5SZKB 2ZU0C 2D7DA 3TUZC 2ONKA 1P9RA 4WIAA 5FOVA 4BFXA 2FOLA 4Q02A 5P21A 1CTQA 1SHKA 2CNWD 4MRNA 2SHKA 1BOFA 1WDTA 4A8JC 4EJSC 2YWEA 2ZJBA 1UKVY 3BB3A 2WMNB 3QG5A 4Q01A 3O8DA 3UIEA 1ZVQA 1OIWA 4IJMA 3VX4A 4HAWA 4LJ8A 3I8XA 5C4GB 2IT1A 2MSCB 1OFTA 1ZP6A 4QBIA 2PCJA 2ZI3A 4M8NE 5EE5B 4A0RA 4DLVA 2ODNA 2GJSA 2JJ2D 4I1UA 421PA 1E2HA 1Q0UA 4QOSA 1VTKA 1ZNWA 4Z51A 2XSZA 1Y3AA 1QHNA 1UF9A 3QG1A 2ZQ5A 3MLEA 2OT3B 1UDWA 2AWNA 4TWZA 1QHXA 1S0UA 1E2QA 3EC2A 3DKPA 3BFKA 3B7GA 3RVBA 2Q6TA 2NO6A 2RKOA 2IYWA 3DVLA 4CVNA 2AXNA 1U0JA 3GLGA 2FDCA 1G3MA 1NL3A 2N42A 2P6RA 3R9WA 4D6PA 3CX7A 2BBTA 3CRMA 2O8DB 3IQXA 4OHVA 5EP3A 1VKJA 1W0KA 2IYQA 2UKDA 3ZVRA 2FPLA 1J8YF 4A2WA 1KNQA 1N5KA 1CIPA 1OV4A 1R5BA 1RJ9A 3RS3A 4B2IA 4GNKA 4DEYA 4OJKA 4H1UA 4ACAA 1M7BA 3THYB 2QT0A 5FOXA 3X1XA 4FMBB 2C04A 4DIDA 4QHSA 3KB2A 1US8A 3EIEA 5G3ZA 3FFAA 3U3OA 2V4ZA 1E9DA 2AKYA 3TKLA 1DAKA 1W0JA 2ERYA 4UNNA 5BQ5A 1GTVA 2UVQA 2BMFA 1G5RA 3B78A 4PC3A 2RGDA 4HLDA 3I4LA 1Z5ZA 4IXMA 2CVHA 2CHQA 4BASA 2WVJA 3KJHA 4DDTA 3KJEA 2DFLA 1W4AA 2FZ4A 4TMWA 4BECA 2RGGA 3L43A 2I1QA
chains in the Genus database with same CATH superfamily
3IPYA 2H11A 1YV9A 4G0QA 1YE5A 2VRWA 1UBKS 3ZS9A 5E3JA 3WIEA 1Z62A 2HA3A 4OXKA 2IKQA 3ZD9A 2KX7A 4KFRA 4EG0A 1IYZA 4C0LA 4H7IA 2BEVB 1DFIA 3RHTA 1UK7A 4RDXA 3CISA 4K9QA 2EATA 3LYUA 4WOPA 3SEQA 4U6NA 1JH9A 1JDSA 4I4TF 2OP0A 3A9RA 5B2FA 2ZT6A 4A1OA 2YFQA 3ED1A 1MFZA 3EQ9A 2FGKA 3FYSA 4BLWA 4QM7A 3A1WA 2HWYA 4RLHA 1O8BA 1LSSA 2OFWA 4S1WA 2OC9A 3VU8A 1XJWA 2PAFA 4JC5A 1H1LA 1KU0A 2HU7A 3NFYA 3FWHA 4BMPB 3BWDD 1VJ5A 3HVUA 2YS7A 1DOZA 4EYOA 3GJRA 5LQUA 2C4NA 2O48X 1MD9A 1EM8B 1R0BA 4E31A 4B85A 1P2BA 3RUHA 1PJQA 4A27A 4FVTA 1IQUA 4YRIA 2IEBA 1IK6A 3DYVA 4I08A 2PKQP 4QD3A 4RKFA 4C7BA 3QBEA 5IAAA 3NRBA 2G4VA 1XZBA 1QHGA 1B00A 3AJAA 3R4CA 5U4QA 1I2BA 1DUIA 2AYZA 4PQRA 4CF5A 1EVZA 5CLQA 4HAXA 4UVHA 2HA0A 3ZU4A 3DNFA 2FYTA 3EWNA 1DIRA 4V0QA 4LJRA 1C3VA 1YIDA 2IYZA 4JLUA 1R8YA 4XLZA 4FT2A 2OO5C 1UOOA 1VIYA 2C2HA 2R5FA 3QPDA 1OKKA 4G1UC 4GYKA 4XVRA 3HJFA 1JR3A 1WDKA 2H48A 1RC0A 4MXDA 5JS2A 1SVMA 3O8RA 5KX5B 5IJ0A 1NW7A 1V11B 1HTBA 1UBMS 2IQ5A 1ZSVA 2VXCA 3H5LA 2J0QA 2LE0A 2ZULA 1KAEA 1N6RA 2HO5A 3U19A 4GX0A 1UJ4A 6YASA 2XAUA 1DDOA 3FUVA 3E8XA 4KSCA 4C9BA 4UNRA 1P4RA 4Q66C 4YA6A 5CT5A 3JATA 4KFSA 3RYHB 3V00A 4Q1VA 5BV1A 3BT7A 4ZDKA 2G4LA 1RJWA 3NNNA 3B1YA 3CF4G 4J8PA 5T4HA 1IPFA 4TGLA 3U0VA 3FOBA 2QD3A 3KZXA 2NQ8A 1E9RA 5HBRA 5B12A 2QRKA 3SZOA 3EWIA 3IHKA 1J9GA 2JD1A 3CWZA 1U9ZA 3PLNA 2HWUA 2ZJ0A 3MINB 4URZR 2ZXFA 4ZT2A 5AKHA 3TZCA 2H1WA 1W6RA 1EHCA 1GZ7A 3KWMA 2AYYA 1G66A 1L8XA 2BEKA 4UM8B 1SHJA 4QIHA 1JT2A 1X19A 2JI6A 2XUQA 5LUBA 2Q5QA 1T3HA 1NOIA 1NF9A 3UAGA 4D26A 3JTEA 3RC8A 2VNIA 4MZXA 4YYEA 4JVLA 1K4KA 2A4MA 1U31A 2O3SA 2OGSA 4GBMA 4KUEA 3V4PB 3HY6A 4RE5A 2QVCA 3D6JA 4QL3A 3WLSA 1YJ5A 2ENUA 2XD9A 1T0BA 2OG2A 3OP4A 3R7WA 4YRSA 5LP1A 1QYXA 1ESMA 3MT7A 3OLXA 4JEMA 4NJEA 1Y3DE 1RQ2A 1A3CA 2B20A 3QFHA 4HN9A 1FCJA 1SVUA 3CLKA 3GVHA 2DVMA 3OWOA 2E0IA 3RSOA 3H19A 5A4JA 2ZB7A 4E6EA 3PLAE 1BWRA 3LZDA 3F46A 2WJ6A 3QJ5A 1ZMBA 3HJRA 4G5GA 2JZCA 4LJ6A 3AVOA 4NVRA 2D06A 4RIGA 1ATZA 4DBLC 4JT8A 2W8BA 2XGJA 1FK8A 3PDJA 2V5AA 2XLBA 2XZDA 3P9RA 3K0FA 4PFKA 1JQAA 4F3YA 3OPXA 1M0WA 2IYLD 1M2VB 4LZAA 3X2EA 1SXQA 1RTKA 2CL5A 4QUAA 2H17A 1I33A 1K68A 3UVEA 2GPNA 3MMZA 1OBVA 3I9FA 2IP4A 4JWTA 1Z2PX 2ZBGA 1NN5A 3C8HA 4E4YA 2B98A 2QORA 1XALA 1X92A 1HE8B 2EZTA 4CCYA 3WLAA 4I55A 5AJWA 2QX9A 1Z38A 3KBBA 1N34B 1MV8A 1NUHA 1PRYA 1NN1A 2X22A 3EPRA 3LLSA 3LGAA 3NI2A 3HDQA 2NZ8A 4NECA 2PBFA 3FW1A 3C8MA 1HC7A 4MH0R 2NUPA 2Z30A 2Q6LA 3IOCA 2VKTA 2OFPA 2FRDA 3BD7A 4XFKA 1XUOA 3DQQA 3E3NA 4GR4A 2QLBA 1RCUA 4N8DA 5DYTA 1KTIA 1RXVA 5I9BA 4HEHA 1F6BA 4CKBA 2R4TA 3U1VA 5B6JA 3FROA 5LLDA 1RZRD 3NIGB 1Z82A 1E1MA 3KEQA 5DN9A 1NC1A 3MBOA 1GZHB 3QF7A 1P1KA 1MRZA 1R6XA 3R6TA 4N39A 5A3SA 4BBAA 2HHHB 5CDYA 2MINA 4FFWA 3V8EA 2Y92A 1SA0A 1DO2A 1IH8A 4DSZA 4F9EA 2OB2A 4LG1A 1OI2A 4FYVA 1U2GC 2HYIC 3MM4A 8MHTA 1XP8A 1MJNA 3DDHA 3QIVA 5H3CA 1OH7A 2ANCA 1MG0A 2NIPA 4JP5A 1NW6A 5JCJD 2XHZA 4YRQA 4G23A 1OQAA 3OLYA 5EJMA 2Z57A 2AZDA 5DZSA 2QSUA 4IZ6A 3DW3X 1HZZC 1FTSA 2H29A 3QVXA 3MWEA 3HYSA 3URMA 1D0VA 5HPYB 4PICA 4WDQA 4Q7LA 1CSEE 3F7OA 2O6HA 2XTNA 3GFGA 1W25A 4NCXA 3J81k 4OQMA 3PZBA 4RM2A 3WRWA 3RWMB 3TCKA 4JHXA 3KSAC 1CF4A 2EGHA 3I04M 4PO1A 3ZDXB 4F1JA 2FXVA 1VI6A 2VUIB 3MQ4A 3OT4A 1Z18A 2CVZA 4MI6A 4X90A 1FJHA 5KYUA 3UAOA 2IS2A 3F71A 1GDTA 1BXGA 3NMUF 4PBRA 1MHTA 3NPAA 5C31A 3VNUA 3HJGA 1NLFA 4F38A 2VRCD 1G5FA 4NU0A 2VF7A 1KYZA 3ABIA 4WXMA 5AKKA 3SBDA 3THYA 5JVDB 2YXEA 3HBLA 1D2CA 4Q6WA 4BGVA 3AV0B 4Y6PA 3HHEA 5AM1A 2YKGA 5MN4A 4PLFA 2D1RA 5KJEA 1DXYA 2B7BA 3KVRA 4M7RA 1JQJC 1UJ5A 1GZ6A 3KVYA 3PHGA 1L5LA 2QOEA 1IDOA 2IGBA 3WNCA 2OZVA 4EUSA 2HREA 1KJWA 1A2BA 2V74B 3DEFA 3S1AB 4B3IA 2R1UA 1ENPA 5AWFC 5U1PA 4D8TA 4BOYA 2C2YA 1WMFA 3K5WA 4X20B 2GLTA 5FFNA 1AQYA 3L8EA 4N7BA 5B53A 5LKAA 1S2LA 3DO6A 3SLGA 2PV7A 1YZUA 4PYJA 3A0UA 3RKRA 3PPWA 1CP2A 2AEJA 5FBQB 3IDQA 3MWYW 3RHSA 4DA0A 3ILVA 1BIFA 1POWA 3DDWA 1E5LA 2AXQA 4J7XA 1UWVA 1V9LA 2D59A 3FYUB 1MO5A 3DOOA 4E3ZA 1DCKA 4Z4HA 5TGZA 1DPFA 2YJNA 1LJUA 4Q9JA 5FRDA 1M7HA 4IF6A 2H3EA 4JUCA 3GDHA 4AY5A 4D25A 3P9NA 2GVZC 1YVUA 1ZN7A 2F9MA 2ZUWA 3AT1A 3R7SA 1XCLA 5A4AA 3U4QA 2Y1OA 1P62B 4AZSA 4UTVA 4E6PA 2R8EA 2VDPB 2XXAB 4HLUC 4M1YA 2V7QD 2WA1A 1O9HA 2GBPA 4HQRA 4OJMX 4QNMA 4FYYA 1HOTA 3SXJA 2P8SA 3T0GA 3S1LA 5ULLA 3AUAA 2PV0A 2C1EA 3UYLA 1O0SA 3SXUB 1DVRA 3QQ5A 3DKRA 1A9ZA 3RSZA 4M6WB 3TM4A 4UOZA 1NYQA 2RHOA 1PFKA 4GE3A 1RBZA 3KNZA 3LVQE 3QUCA 2V7GA 2G0NA 4Y1FA 3PJGA 3P0FA 5ECWA 1IBCA 1JDPA 3H9QA 4RVDA 3M4NA 5K3DA 4UMEA 1PNVA 2GBCA 2TSYB 3D7SA 4KG7A 4HHEA 3TD9A 3TGWA 1V1RB 3LBYA 4U6QA 3WK4A 1HZJA 2FP3A 3ZY6A 5DIFA 3Q8LA 3HCBA 4AS1A 5BNTA 4I3FA 1M1ZA 2AZ4A 3G8CA 4R1NA 3RB8A 4O3FA 5JO9A 1L5KA 4XRGA 4MA0A 1X80B 2C0PA 1KBOA 1WMAA 1U7PA 2I67A 2WU0A 2XUFA 4IWYA 2JANA 5ALYA 1ANKA 1O96B 2J6IA 4LRSB 1IY2A 1PR0A 3ANYB 3G2QA 3O7MA 4BWFB 4CEHB 4KACA 2I4RA 3GCWA 4K7JA 4TUYB 1Q44A 1XJQA 4QFBA 4J7CA 2ZJYA 2V58A 3D4PA 2OZLA 3H7IA 3R3VA 3EMDA 5TPZA 3J7AC 1V96A 1RAAA 4YWJA 5C3MA 1Z4PX 1YMVA 1JRLA 2X8LA 1NXTA 3KWLA 3LH5A 4CLRA 2N75A 2NVWA 4MWEA 3EPLA 1ONNA 5FTLA 4IKPA 5DMXA 4HB2A 1EFVB 2E55A 3O4VA 4JJ4A 1TA9A 1TTQB 3I72A 3RARA 3RFCA 1AVTA 2JGLA 3ORRA 3GP8A 4Y1GA 1E94E 3TR0A 5DNAA 2HF7A 4I5EA 4O1IA 2FWNA 2AFIA 1A9XA 2FSVC 4JLAA 1R6UA 2CNWA 3AGPA 2O5CA 3ZZUA 3IOYA 4WRRA 4WVFA 5ICGA 3B2NA 3RSQA 1BRMA 3BEOA 1SMKA 4ZOLF 2XBMA 1NULA 4K6HA 1DL5A 1V7QA 2UZ1A 3B38A 3GXBA 3N0XA 5A3VA 2XKKA 4KQWA 3B53X 1P29A 3BIOA 5HZKA 1I7DA 1P2GA 3M5PA 5LC1A 5EJ7A 2IK8A 3GMTA 3AEZA 5IF9A 3F96A 3PXUA 1QAOA 4ZT3A 4NBVA 4E22A 4ECAA 5HRAA 1CFZA 2DP4E 3L46A 4RV4A 4E4RA 2RHBA 2AOXA 2A1UA 4MQ4A 5CK4A 1TI7A 4X1YA 5DTQA 3UAXA 4AF7A 4E09A 2NVOA 2W2LD 4EBBA 1UDAA 2Q7DA 3QVGA 1PJ8A 3PIIA 2HZBA 3OH8A 4BWVA 3MERA 5ALNA 4OHCA 4UFNA 2O14A 1SVLA 4FI3C 4JJ7A 4CF3A 1WU8A 2EBUA 2IHUA 1N2CB 1NNI1 3EW7A 4GPIB 1J21A 1V7PC 2X1MA 2C9ZA 3UMYA 4BKRA 3QKRB 4DQUA 2BV3A 5BOVA 3FFWA 4FR5A 4Q5IA 2JH8A 4V38A 5KAPA 5J4HA 1DC3A 2FOXA 1KJYA 1Z73A 4B4WA 1M1NA 3QELA 5CT9A 3MN1A 3ZGZA 3S5UA 2WVAA 3T7DA 1G4AE 3QSYA 1B6RA 2Q0QA 1T9GS 3JYOA 2CKDA 5MFZA 1R4NA 1ULSA 2ZT8A 4YFYA 5EJGA 1ISHA 1NX9A 4C4PA 3DCJA 4PFJA 4UATA 4EYEA 3O4GA 3O2NA 2VH2A 1MC4A 1FUIA 1MU0A 4KLNA 1YBAA 4JEIA 5E7IA 2YJTD 4DHWA 1YASA 2VFAA 2C3PA 2I34A 5H02A 2WJHA 3UK7A 1R15A 3GMSA 2AUTA 1V6SA 3GG2A 2BCJQ 4OIFA 1CNFA 3DF9A 4CG3A 3NYRA 4RD2A 3CS3A 3DOEA 4ZZIA 3CY6A 3WMXA 1NQ5A 3G0HA 1UKBA 1SU4A 3Q7QA 2HMSA 3DXYA 4FGSA 4R2KA 4XIJA 1RLUA 4E5VA 2DPYA 1G8PA 3G0GA 1Z35A 1G3UA 4MKHA 3TJRA 4L4UA 4RTNA 1G18A 3MCTA 2N46A 5KTRA 5FWYA 2ZRDA 4MO9A 3L79A 1ILWA 1ZH8A 2NAFA 3L6CA 3ZH2A 1MO2A 621PA 3KR2A 5JCPA 3PQ4A 2G06A 1IEQA 2ZI9A 1N5RA 3WRXA 1VP3A 5H81A 1HFJA 5A7HA 3QYPA 3PNLA 2QRMA 4M7PA 5A7GA 1ISJA 4EEXA 5LR6A 2C5LA 4ZYVA 3P5BA 3GPLA 1PT9A 3B8HA 3EJWA 5J5AA 5E8JA 1YBHA 3PVCA 2PYZA 1DFHA 3VH4A 1E60A 2R1TA 3ZWXA 3QNWA 4JQSA 5EA2A 3LGSA 3O8NA 4WKBA 4C4RA 1L5YA 4YT8A 4D3FA 5KCMA 1FP4A 1O5OA 5IJ9A 4RTQA 4YJGA 1D6MA 1E1QA 1FVXA 4IHJF 3JQGA 1V1MA 4H6VA 4MYDA 5AHRA 4C29A 1NP7A 5HM8A 3H9BA 5K8IA 3ZJVA 5JY6A 5DGHA 3CXRA 2XQGA 3BZWA 3LLUA 1C1DB 4MRSA 5BSVA 2I2BA 3P2KA 2OO5A 5FUYA 3CZRA 2I3BA 5ALWA 2OECA 2XWBF 4G4SP 4FZVA 4M53A 1P60A 4ZMSA 4BLRA 4OHOA 1KTVA 4MUJA 4PC2A 1C1XB 3IOMA 3DHNA 1HQKA 4FR2A 3IP5A 4MMZB 1MXHA 3ILHA 4PLVA 2H1FA 1TL7C 1JZQA 2NG1A 2OLJA 2A5GA 4S12A 4O3MA 5TMBA 1XF9A 3WQHA 4C4SA 5AI5A 4LX0A 1L9XA 3M49A 4YAUA 4TMKA 2HSDA 5J2TA 3RU7A 1MQ8B 5IYZB 1HDCA 5B37A 3A1CA 4OX9B 5L3VA 4I1OA 5REQA 4B82A 3UB3A 5K3BA 2FE1A 2FN7A 3TTWA 3UJ8A 3F4LA 3JYQA 3UJBA 5B4UA 2Q62A 2CZCA 1O57A 1BS9A 5G40A 4OJYA 5DASA 3AM3A 1TMKA 1Z2AA 3CUVA 3U4AA 3VYSB 4EPRA 4ID3A 4J1NA 1YOVA 4LV8B 3GELA 3X43A 3B2EA 2ID9A 2X7JA 3M0EA 3TVDA 1Z6QA 4D79A 5AVOA 3PEWA 1L4HA 5C1PA 3LKDA 3OPYI 4R98A 4HDMB 4AJJA 3ZBUA 2JIZA 1JLHA 4ZZ0A 1T4CB 4LYDA 5B1IA 5KTOA 4FD2A 1KKLA 2Y9MB 1W36D 5FI5A 2XDAA 1G55A 3HFGA 3MJDA 1O6BA 3I04A 3D1VA 5LA6A 2WWYA 1NVXQ 3NDPA 4MWOA 3R3SA 1F0KA 1I14A 1S9DA 2CK3D 2HC9A 1L5NA 5EIWA 3TE7A 5SY6A 3USCS 1MZPA 1D9ZA 3DAFA 1G3IA 4LWZA 4ZHSA 2H8GA 4JI7B 2CCKA 3VNRA 3LY5A 2Y6VA 4NMXB 1P4HA 2XVMA 3VR6D 2A84A 3WYFA 1GZDA 1ZJJA 5M3BA 4J1QA 3I5XA 3TSAA 5DVZA 3TRHA 3HDHA 2WHPB 3Q2OA 4UZEA 1JFTA 3HM2A 2GFQA 3L7OA 5TJ9A 4D82A 2F67A 2GSDA 1I5EA 4TXLA 4XAQA 2LKDA 3CVXA 1QF7A 4L78A 1FDIA 1I8TA 2ZDHA 3SICE 1C4OA 2EYQA 5JWHA 5BUZA 3ZNQA 1FZTA 2GF0A 3ITNA 3DC7A 3D4IA 5L6MB 4RFLA 1Y3IA 4WKGA 5E95A 2QY9A 1P2FA 4EATA 1E2KA 1PNRA 5FI0B 4WASA 3IMFA 3FVVA 1Z5WA 4XQGA 1H8HD 2A57A 2OXCA 2XTJA 3H16A 5AIAA 1HPLA 3B36A 4OAOA 1EFRA 1KFBB 4LOLA 2VXOA 1EM6A 2ZZKA 3ZE8A 1X8LA 5FORA 4WLUA 1P7CA 3QUAA 4KVFA 1N5IA 4ZYYA 3ACBA 2FA9A 3UCEA 2L69A 3GMIA 3V46A 4D3SA 1V39A 2DTDA 1Y98A 2VK8A 3KEMA 3EAFA 4B8WA 1ORRA 1E58A 2A86A 2J5QA 3KVVA 3PG5A 4AVYA 3QU7A 3VH3A 3BDAA 3L93A 3AL2A 4PQFA 1VLHA 3ZCPA 2KSQA 2OCDA 4N5MA 2VSYA 3D4BA 1ZU5A 5A6SB 1X7WA 3EZ6A 4W63A 2AX4A 5EJFA 5T67A 1V0JA 4MEBA 5CFZA 1E64A 1MP0A 2ZSIA 1QX4A 3QFRA 3FI9A 4ND7A 3FTEA 3NVKI 1UP6A 4BVBA 4K9KA 4EW6A 4DR4B 5DXFA 3QMMA 3ADBA 2FUG1 4DHEA 2JI8A 4J29A 3MBIA 4E70A 1SUPA 2HGSA 1DXQA 1JG3A 3A3PA 2IHVA 3AI7A 3NETA 1JUDA 2WSIA 4I6GA 4BXOA 1FFCA 3BM5A 3FPKA 1U2GA 3EVTA 1A88A 4AF8A 1IK4A 4OB6A 4M22A 2B92A 4RF3A 3DFMA 3QYAA 3RLIA 4XVQA 3SX4A 2JIBA 2RHRA 1HZZA 1UAGA 2OHGA 1IXRC 3PXXA 4PYRA 5D3KA 4E5NA 1SU7A 1MJFA 3LBHA 4O0LA 2RC6A 2V6GA 4UD6A 4QT4A 5JI2E 4PR0A 4W9NC 3AFGA 1U2QA 1X8KA 3PRHA 3H8JA 3S2UA 1JHUA 3A04A 4B6SA 3Q3HA 1U1GA 1IDN1 5D5QA 4BATA 2WYHA 1M2EA 4LJLA 6ABPA 3O8LA 2WWVD 3JR7A 1XDUA 2UU9B 3D64A 3W8DA 4ZJZA 2Z5LA 5A3RA 4JV5B 4JMLA 2I8LA 5BWBA 1UMBA 3IIKA 16PKA 3AF3A 2TECE 4BMXA 1J9EA 4WXPA 3GFTA 4YUXA 2F8TA 5FBKA 1RPAA 1Q16A 1Q1ZA 1D5CA 2DRIA 4P36A 4WCFB 4O0MA 1Y1SA 1JG2A 4MHTA 4BZQA 5LMNB 1ZGHA 1X86B 3C3CA 5E9QA 1QVZA 1OI3A 1DJPA 3LPMA 3OZSA 2YVLA 4IUDS 3KAQA 1NDQA 4QUEA 5KDDA 5EIEA 2JAWA 3AEQA 1HEYA 4N7JA 3N8DA 1JQ5A 4BEJA 1QPGA 1Q6ZA 2J3HA 3D7NA 1E9SA 2IC5A 4IIBA 4C2TA 2RHCA 3P0EA 4BNZA 2BR3A 5DNCA 3C3XA 3NPMA 3JZFA 5K0CA 3OKFA 5F5NA 5KNLA 1GA4A 2Z2YA 1XMQB 4ARZA 5F3DA 2IA5A 4MYSA 3SQOA 4QQKA 3VH2A 2ZDGA 3L3BA 1NNEA 2QGNA 1YOBA 1T4MA 4GAEA 5EXXA 2PX6A 2ILTA 1P3JA 3KKLA 1U1EA 1M34E 3NTUA 1QUEA 4CGYA 4F7DA 1AB5A 1IOVA 2XB9A 4G2NA 1M10A 1A0OA 4NY1A 4W7HA 4JEUA 3CE6A 4GRAA 4JS0A 3V97A 4MP8A 3WJ7A 5LU9A 4PSKA 1U0BB 4HD8A 2J0EA 1JR2A 1ZD3A 3ZUPA 4P93A 3ZGOA 1GL3A 3A4TA 3ZKWB 4EO4A 3AM1A 1H2EA 2XOKD 5KTSA 2IOHA 4O4HA 1UKAA 1V47A 3W9YA 3NOQA 4TTTS 2CCJA 3E82A 2OPHA 5B7QA 4IINA 1FNSA 1XQWA 2EVWX 3D2CA 3EHDA 4HLUA 1TNDA 2C5GA 1HETA 1L6IA 4KSYA 3IPCA 2V55B 3U2QA 4GPAA 4LGVA 1NUUA 1PFQA 2F1KA 2J5XA 3AR8A 4QGHA 9LDBA 2XOEA 1GHTA 3IDAA 3QLUC 3FFBA 3AI3A 5CBPB 5DWQA 5DV9A 4BP3A 1YZQA 3DHYA 1AX9A 1I3OA 3E3LA 3I6QA 4U9IS 4I8DA 1CP3A 4Q3DA 5D7BA 5DDIP 5FBRB 4NLLA 3NYQA 2EEPA 3ZS8A 4TYMA 1EEHA 1RWMA 3QU5A 2Q3FA 4H7DA 4YO7A 4CKEB 1BFDA 4C05A 2R6CA 3PTAA 3H4TA 4W5RA 3FCCA 2IOYA 2O52A 2WZCA 3L5OA 4LHEA 5BWOA 3DXZA 3K6SB 2DHCA 4AKTA 5EKSA 2DBRA 3V8RA 4D0RA 4D9BA 3UG7A 2ZZMA 1II9A 3H5TA 4MICA 1K8ZB 2RHDA 4JLDA 2YDYA 1TUIA 3OF2A 3BWXA 2BMDA 2JBWA 2PH7A 3A36A 4V3CA 3RYTC 3VTZA 2IBTA 2F8SA 1EVLA 4CKCB 1FFXA 3BA6A 4EHHA 2UVPB 1BQ4A 4JUFA 1D2MA 4MW4A 3GVPA 3R3UA 4UBIA 2CNOA 4NZNA 2QA5A 1DJMA 3CX4A 4YC7A 1ZVMA 2D4HA 3DAOA 4RPCA 1IUNA 2GH1A 1RBYA 2KWIA 1CUIA 3ECCA 4RAOA 4AZ3A 3O2JA 1ZS9A 2NXJA 3WGQA 1A9PA 4DARA 3DB2A 3ESBA 2B1RA 3Q6NA 2VQFB 1A69A 2UYHA 3AERA 3OZFA 4A92A 4HWGA 3JD3A 1LRLA 1PVDA 1FDTA 1RU3A 1U1FA 2P2DA 3E22A 1AU9A 4YP0A 5JFTA 4QQNA 3QXHA 3KQWA 2R86A 1VG1A 1DRWA 1JNXX 3SSOA 3OO1A 4TN5A 2ZVDA 1PK8A 5EUBA 3ITKA 3AJDA 2X4IA 4RA6A 2VZ0A 4MGKR 1V71A 2ZS7A 3LO5A 4TQ9A 3T15A 4CM1A 4DF3A 1NNLA 5FHQA 3SF8A 4N5DA 4RLSA 1SCJA 1JEEA 3PPIA 3SYRA 2BUAA 3LRXA 3OOYA 5AKLA 5JAQA 4EB6A 3W5BA 3RT9A 4ENTA 1Q0ZA 3KT6A 4P3YA 1IBKB 2Q1XA 4K6FA 3ENWA 2V5VA 1AUQA 4WZAE 4KIWA 1HE3A 1E6UA 2P9YA 3GI1A 3LIPA 3LL7A 2BMWA 1QP8A 4J7UA 4U2CA 2PPLA 4BNNA 5BN5A 1DRJA 2XUIA 1DBRA 2GAJA 3JYHA 4QXOA 4WADA 1V5EA 5JVDF 2GA9A 3NBKA 4WK2B 1DCTA 2DYKA 4K6GA 4M1EA 1P1CA 3C87A 4YPOA 4ENSA 2DLDA 4S1PA 4CQLB 3IALA 1JBQA 1FYVA 4YQYA 3T1NA 3IAM1 3V4VB 3L4BA 1NZFA 2F9LA 4J0IA 1ZM4A 4KWTA 5AW5A 1WOYA 1J0EA 1X8JA 2EAUA 3BXGA 3LQQA 4FP9A 3T1OA 4AN4A 3PCRB 4QBFA 4Y30A 5C46F 4UHJA 4WH0A 4JJAA 1UQRA 3PHBE 1R6AA 1SXJA 3IBGA 5L3QA 1G7RA 4QOHA 3JQAB 4IJWA 4PSVA 1GT91 1UBTS 4LYFA 2ZJ1A 3COPA 2RI0A 1DQNA 1U8UA 2RH5A 2AW5A 1E1RA 2IYRA 1QZUA 1RAIA 2JI9A 3NHUA 5IZ4A 1DI0A 1JP7A 3RF7A 2JDID 3O8OB 4TYWA 3IEMA 5F7XA 5HF5A 4C7OA 1P4JA 1GJRA 2O5EA 2WNHA 1EWVA 5FADA 2HDHA 1YA6A 3JAKA 3K9WA 4GT1A 4BYGA 3FNIA 1WPRA 2W2XA 5JSZB 4DLAA 3CZPA 2C92A 3L41A 1QOQB 4FHGA 4LN1A 1CZLA 3C5WP 2JIDA 1LS1A 1ADCA 3GJYA 1ENYA 1BW9A 4IDBA 4PX5A 4Z2YA 3Q8MA 1J0DA 3P71T 2QG9A 4X97A 2ACKA 4FWBA 5M5BA 4R16A 1HMPA 2XW6A 3OUTA 2Q5LA 4RANA 3REOA 5KJ1A 2TS1A 3LLCA 5DCWA 1QB8A 4M1ZA 2C7VA 2VPYA 3P0RA 1CDZA 1PQ4A 5CIWA 1U7WA 3A27A 3BIXA 3CEHA 4MJ3A 2I3ZA 3ND8A 1NMZA 1MTOA 1WA5A 3HWRA 4C07A 3PJFA 5EJ5A 4G65A 4LA4A 2XXJA 1XRRA 4AIRA 4Y2QA 3JV7A 3V33A 1T34A 1Y8QB 2EJCA 3OQ1A 1UC5B 5DM0A 5PGMA 3WGOA 3WA7A 2GZRA 2QENA 4P86A 5FUQA 3RHZA 4RSMA 3NTVA 4KLAA 2P0EA 3CG4A 1XCPA 1KMIY 3ZXIA 3RYCA 5FJIA 3H1TA 2FEMA 4Y6QA 1PR9A 2VLIA 5FAKA 4Z1MD 2I3AA 2VS1A 1XCMA 2YY7A 3I4FA 4J16C 4CZ2A 3WB1A 4BKMA 1U99A 3BAZA 5BSMA 3ORHA 4MINA 4N76A 3VKVA 1OE0A 1ZCFA 4CMEA 1XG5A 3KL4A 2EHDA 3NVMB 1K5HA 4ODIA 4DA9A 1EXVA 3CXUA 1RWKA 5AI0A 3HUEA 1DDGA 2CXTA 3NBXX 1F1JA 3SQXA 1HQDA 2COKA 2RJ3A 3ZEAA 4F85A 1JILA 3M2TA 3EEOA 4IW3B 1OAAA 3C16C 1U0NA 2NO1A 4CF6A 4HVLA 2WAOA 5JQGB 1XHFA 2WF6A 3TSWA 5C5DA 1V7ZA 3CG0A 2VKQA 5H9VA 4IIHA 4HX5A 5CNIA 1TIKA 1S8OA 4LBVA 3RE1A 2B8TA 2W6ID 4M98A 4RL6A 1Z28A 3S2EA 3BAFA 1C3XA 1E20A 4WPGA 1JPJA 4YRTA 3E8MA 3SHOA 1TEXA 2UXCB 4KQ6A 5CTJA 2BKVA 4OMDA 4TRNA 2R5WA 3MWDA 3H9CA 3LDUA 4QGFA 1DBIA 1E3WB 2H1IA 1QUFA 3G2PA 4IVPA 5C34B 1N6OA 2FNAA 1W46A 3HB9A 3QOWA 4ZTBA 1RLOA 2F1HA 4YQZA 3KTAB 1KJ9A 3MK31 1DDIA 5CLJA 1G5HA 3HPRA 3IJ5A 1JAZA 3KFVA 3SDZA 1NJ2A 2VL7A 1P81A 1JJBA 3LD9A 1BJRE 4Y2XA 3P9ZA 1RZVA 1JU3A 1NPYA 1T0JB 3CW2A 1AGPA 2E49A 2JLBA 4Z3KA 2XCIA 3R0IA 3RRNA 4ARIA 3QPBA 4G1BA 5EPOA 4Q9NA 3IUYA 4QTXA 1O54A 4POOA 2GN9A 1XROA 1Y5IA 3AGQA 1ULAA 3GRZA 1X1TA 3JVIA 3MCAA 3PEUA 1XMVA 1N2IA 4GLBA 3AI2A 1J8QA 4PY2A 1M8PA 1YS4A 4AMVA 2GLXA 1UPXA 2SCUA 4O2AB 4BNLA 3RIHA 3PRKE 2X19A 3I9JA 1WMDA 2P5SA 4MS1B 5JZVA 3GBSA 4IOLA 2W43A 1SBYA 1XQXA 1Y82A 3PX2A 4JCOA 2P9JA 3K0AA 3TQSA 3I73A 5FPQA 3LQ2A 1AD2A 2Z5VA 1PT8A 4D9NA 2UVDA 1UEXC 5IF3A 3LXXA 5IMSA 3EH1A 1AMOA 1G6OA 2GBIA 1O3YA 4XM2A 4DLLA 2DKFA 2QX7A 4JELA 4RH1A 3GEDA 4DCVA 2VNJA 1QMGA 2GD0A 3EQ7A 1IG3A 4Y8VA 4GZLA 3V1UA 5A6SA 1T13A 3KFLA 4ZD6A 1W29A 1PEKE 5FTJA 5I4CA 3AJ8A 2F3QA 3Q9NA 1EUCB 2ES4A 3EB9A 3ECAA 4AMBA 2SKEA 5CITA 2O5RA 4UW9A 4QJ5A 1HDXA 2EARA 2II6A 3OCUA 1BMDA 4BGEA 1PP4A 1DAGA 3VR6H 4UZFA 3IPLA 3ZWKA 1OFUX 1X1AA 2HMVA 3JASB 3JQ9C 3ZIUA 2RG1A 5DI9A 3T5CA 1RXWA 3G5MA 1XZPA 4M7WA 4R69A 2QUHA 5DK6A 3PA8A 1SQSA 2PRIA 3JALA 4ZQIA 2A78A 3T34A 1TCAA 4YRDA 4OBXA 3BFVA 2WMOB 4H1HA 4L15A 1P5HA 3OA2A 3ZHBA 4EKGA 1HNZB 4KHPB 2IF0A 4MYHA 3UH1A 5CB8A 1YTLA 3EBLA 4HNAA 2Q6VA 5DM60 1ITZA 3FDIA 3LT1A 1XFAA 2N3ZA 3A9VA 2Y1WA 4RQAA 2J4DA 1U4OA 3Q3GE 4FMDF 4E2FA 4MV9A 3GZTB 4YHHB 3P4XA 1YRAA 3WGYA 5KQSA 2AXEA 2TMKA 2PFKA 4RVOA 1T6BY 3DVAB 5EWLA 5TMEA 3S70A 4UDOA 1TXGA 1Z0FA 4ZQBA 4LSMA 2IW1A 3QJYA 1KI7A 1T8RA 3CJQA 5BO5A 1TB4A 7ABPA 1YVPA 3ORSA 1F8XA 1ZD2P 3K9BA 1QV6A 4TZKA 4F9TA 3RK0A 2QF7A 1GNSA 2EU8A 1EK6A 4UU8A 5LB2A 2HKIA 1I80A 1XQ9A 1J00A 3AY7A 2PBRA 4TMYA 4LGMA 2QRVA 2ID7A 1D1SA 1ZXLA 5LZ5A 4DIOA 1CK4A 3Q7TA 4S24A 4Q05A 1I2CA 4UE2A 3W6NA 3ZWCA 1EJ0A 3ESDA 2BDTA 2A0FA 2IEYA 2J32A 4XVCA 4TKZA 5WRFA 4X92A 3ZZ0A 5HGXA 3UV6A 5CFPA 4KPFC 1D8AA 1G59A 1TD1A 3A9SA 3I0NA 1JA1A 1EFPB 2ODWA 2YBEA 3HYNA 3OFND 4MLDA 2TMYA 5ALKA 4HWRA 4YCMA 2CEKA 4YIKA 1YQDA 2W93A 2AMFA 1U28A 3OPYB 5JJ5A 1HDRA 2Y0CA 1CHNA 3CZCA 3DDUA 3F8SA 3GEHA 4MKRA 2Q7OE 4RTRA 1BDBA 1Y9ZA 2QP3A 4OBEA 1LBIA 4Q7MB 3KWFA 2CLEB 2P11A 5FULA 1TGVA 2KBEA 4MKFA 4DV0B 4KR3A 1BHSA 4YJHB 4TSKA 1U0FA 1WOMA 5EUMA 3JAWA 4J6FA 2H5LA 1Q1GA 1YR9A 3MMNA 3PPYA 4XCQA 1QO7A 4Z9YA 3VR5A 4W4TA 2DT5A 4UPVA 3QPVA 2ZTHA 4KLCA 3OIFA 4KQEA 3W1WA 2MHCA 5CXUA 4KODA 4JYZA 2VRBA 1VLJA 3IB6A 3N76A 1A8IA 4Q4JA 2OFFA 1FYWA 4AZWA 1L7RA 2FW1A 5IYZF 5AK0A 3EXHC 1WCYA 1OPRA 3P32A 5GJBA 3DPIA 3VZDA 4Y98A 3N2GB 3LHFA 4MVJA 1CY4A 3RTAA 1WIWA 5HKKA 2I2DA 3B20A 2O3RA 4ZA2A 3SFVA 5K3FB 3SKXA 4V03A 5G0SA 1HYGA 2HMYB 3RWOA 4DUGD 1QR6A 3HG7A 5CA1A 4Q6BA 4UAUA 5DIZA 4D99A 1SQ6A 3FOCA 3P4UA 5MGNA 3PWZA 1HYBA 4IWXA 2WIBA 5EL0A 4WJLA 2HI0A 1XXHE 1LCIA 2C7GA 3M82A 1AK1A 2AMJA 2W4MA 3PNKA 4XGIA 5I45A 3GLIA 2IXAA 3N2IA 3NHFA 1AQJA 1E99A 1XFDA 5K3EA 4QBKA 5FEUA 2ZI6A 3WR5A 1NQWA 3FUXA 4DJDC 2QJFA 1R74A 2O8CB 1YU6A 3AUKA 3IXQA 1THZA 2FPOA 1EWYA 3SEAA 4C88A 2OESA 1RQNA 3BMQB 2KBFA 221PA 3GN2A 2IYFA 2O2DA 2OHJA 1LBHA 3GD5A 1LLDA 3KAJA 4LECA 1Q7CA 2VNKA 3CRVA 4P3PA 1YO6A 4N9QA 2C2ZA 2EQBA 2NV2B 3QVWA 1GADO 3IB3A 3D3QA 3SQMA 2VSOA 3OEWA 1E1CB 1G2IA 5FH9A 2W2PA 4XVUA 1AS2A 2A9OA 3R6DA 4MKZA 5I48A 5LZ2A 3ZDYB 2UZ0A 5DBHX 1SXPA 1Z0DA 1WO8A 1OXXK 1EK0A 1DHTA 3RFTA 4ROSA 5ALJA 4B80A 1ETUA 4OQYA 1SWWA 3K7EA 2XB2A 1VJ0A 5E6SB 2FWMX 5EJEA 2WJIA 1KFJB 3CZQA 1ZFNA 3F6EX 1KBZA 5CAEA 3DE6X 3F3SA 1E0KA 3BL5A 3B8EA 4IDOA 4JD5A 4RPIA 3IP1A 1C9YA 4DBLE 2WSYB 2JVIA 2YXNA 3LM8A 3PJEA 2RK6A 2ZIVB 2F55A 4U7HA 3COSA 5TGTA 2NYUA 1VIVA 3EC7A 2Y8EA 3QLUA 4WCDA 4QOJA 5HF9A 5FPTA 5SICE 4ABYA 1NM5A 1A5BB 1Q1AA 1ISMA 3BCHA 3HL0A 2CL6X 5TC4A 2FH5B 4H59A 1K89A 1NF2A 2ZE8A 4TKUA 2X0FA 3SOZA 4EL0A 2X8AA 2P9QA 3L02A 1DX6A 2W6QA 1BS1A 1POXA 4IEIA 3ZW7A 5CFLA 3DMPA 3G5TA 3BG5A 1A77A 4ZANA 2HMUA 3IV9A 4YIHA 5JALA 1YHZA 3BE4A 3CPEA 4JQYA 1CQXA 1ISIA 4H17A 4YREA 3RTBA 5HIKA 2PS3A 4NS1A