1DAFA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid, adp, and calcium
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 71
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dafA00
1JR3D 2RCNA 2XSZD 3GD7A 5EZ6B 4L5BA 1EFCA 3EZ2A 4HUTA 4DC9A 4DIEA 5F3WB 2O8DA 2C96A 3MCAA 3GLFA 3RNLA 3V00A 3GFOA 3ONWA 1MR3F 1JEDA 1E9DA 3ETLA 2C9YA 3ZVLA 1HQYE 3RS2A 4LX0A 4PTLA 1E2DA 4TQ9A 5FUVA 4YQFA 1HQCA 1VG9B 2B21A 1U90A 3Q7PA 4XTRA 1T0HB 3BB4A 3CRRA 3KQNA 1XCMA 4RSGA 1UAAA 1KY2A 1X8JA 2Q9CA 3D7MA 1DAKA 4TMTA 4CEJA 4MUAA 4M1OA 2ONJA 1Z2CA 3KQUA 2MSDB 1H8HD 3QF4A 5A5GA 1NG9A 4CIDA 2FWRA 3ZJYA 1M1YE 3OFNA 3FOZA 1R10A 2PCJA 4TSFA 1UKVY 3A58B 3GJ7A 1BOFA 5IK2A 3KXLA 1ZC4A 3U6BA 1U94A 3F3YA 5A4JA 1W0JD 1WP9A 5KO2A 3BD9A 3CKLA 5BW8A 1SKQA 4B48A 1G3UA 3JVVA 1HT1E 3AVOA 4HDQB 1AZSC 2FSGA 2F1IA 1VHLA 5J4VA 2VP4A 3DVLA 4CYMA 2FPKA 4HSEA 4YC7A 1AM4D 1E1QA 3K9GA 4DSNA 3CO5A 1D8TA 3L82B 3RRMA 1HV8A 4PQRA 1OE0A 2BEKA 2CCGA 4PQFA 4ZPXA 2AXNA 5M04A 4PC3A 1D5CA 2G3YA 2OHFA 3P4XA 3CF6R 4C9BA 5EXPA 3EPJA 1IONA 2GTPA 4E09A 3B1XA 1KMQA 2C5LA 2KWIA 3EC2A 3WMFA 1MABB 1SQ5A 5CM9C 2IYYA 3M4YA 1KSGA 1W44A 4KJZA 2V3CC 3VKWA 4RKFA 3TGPA 5AUNB 2VP5A 3UMFA 3Q72A 2LWIA 3GLGE 4C7OB 2KBFA 4JT2A 1E99A 1NN3A 2A2ZA 2O8EB 1MH1A 2PMKA 521PA 3FGNA 1TU4A 1NIJA 4A82A 4LI0A 4YLGA 1N6HA 2QN6A 4I81A 1G19A 1OB2A 5C1BA 3CLVA 3Q9LA 1G8FA 2ANCA 1QVAA 2ZITA 4PO9A 2JEOA 3OFND 4M9QA 5HCIA 3FMFA 4CEIB 4TSFD 2I4IA 1K5DA 5DH9A 3TNFA 3CR7A 1KMHA 2WV9A 2BCGY 2IK8A 3DM5A 3NC1C 3TRFA 1AS0A 5IK2D 2XX3A 5FOVA 1XTKA 1EX6A 3SDZA 4BLTA 3DKPA 4B75A 1FNMA 3SNHA 3AQ4A 4ZDKA 2F9MA 4LRWA 2GXAA 4LV6A 3AF3A 4P3YA 3AP3A 4G01B 3SS8A 2OZEA 1HA3A 221PA 2QT1A 2OFXA 4G3XA 4BFWA 1YVDA 4F38A 1II8B 1S2MA 5JI3E 4GMDA 2NO0A 3R7WA 3A4MA 3WBJA 3K70C 2QGNA 3RC3A 3B82A 1UM8A 3EASA 1CKEA 2C98A 2D2EA 2VRWA 2X2FA 1BYUA 5DSZA 4IW3B 2IF0A 4TLBA 1N6LA 2C95A 2JASA 2ZQ5A 2WJYA 5FTNA 4V03A 4PAOA 4BFXA 2WWHA 4GDFA 4FCVA 1RJ9B 2WBLC 5D3MB 4TTRA 4GL2A 1TQ2A 3F5FA 1DAMA 3CRVA 2YWEA 2GESA 3AVPA 2ORWA 2RGEA 1TMKA 4MYTA 2O0JA 3SBDA 1E32A 1IY2A 1SXJE 4TTPA 1TUIA 2WOJA 2ZREA 3QKTA 2PBRA 2H5EA 2ZSFA 4JL5A 2NQ2C 621PA 2JLUA 1JPJA 5F2EA 4Q00A 3BFVA 2DR3A 3NWJA 1LY1A 3CR8A 3UANA 4DCSA 1E6CA 2FU5C 1U81A 1NIPA 2GZDA 1ZBDA 3QBVA 1PLJA 5EQTA 2IW3A 2ODBA 1WBDA 2DB3A 2G1JA 3LQRA 1JR3E 3GEHA 4CDGA 4NYMQ 2QZ4A 4YDHB 3I62A 1SXJC 4NYIQ 3O8BA 3V4RA 1MRSA 2PEZA 2VP2A 2WSMA 1GNRA 4PR0A 4M8NE 1U8YA 2H92A 3LVQE 4CVNA 2R8RA 4BWYA 1J2JA 1FQJA 5FOTA 3WNDA 4MGZR 4DDVA 2GEUA 4G5GA 4QC2A 4QGAA 2AK2A 5FL3A 1PZNA 2WWWA 3N5CA 4KCGA 4ZDWA 3NBZC 2GBLA 1Z07A 1NLYA 1AIPA 3Q5DA 2J1LA 2DCUA 4AI6A 1TADA 1N5JA 2JCSA 3BS4A 4JLKA 3B2EA 1OHHA 2ZAOA 3FMPB 2VSXA 8OHMA 1KJWA 2QQEA 5B2ZA 5DHFA 5FI1B 5LB2A 2VYFA 2ZRHA 2NO6A 3HR8A 4EPWA 1XBTA 2VIIA 2RB4A 4C0AC 3K9LA 4BFUA 1Z22A 1G7TA 4Q1BA 2BEJA 4O2RA 1EFUA 1J90A 2QE7A 1TQ6A 1JXMA 2QMOA 1UPTA 4U00A 1N25A 4GFDA 3R9IA 1GL7A 2RMKA 3TVTA 3SFZA 5J40A 3R9WA 1G3MA 3KFXA 1NP6A 2CL0X 4RZ2A 3GLGB 1Q0UA 1LVGA 2EFCB 1GNQA 3WHLA 4ESVA 4LJYA 3QXXA 2V55B 4AWXA 2G0NA 1F2UA 4RD1A 2V7QD 5CK4A 1YZTA 2C77A 4IVPA 3PG5A 4JBYA 2QPTA 4PFSA 3J81k 5AUQA 1UADA 5FFMA 4URVR 3KQLA 4A8JA 4TYYA 5DYIA 1XXHA 1AQYA 2MSEB 3B9QA 2XB4A 1K6MA 2PT5A 4QGHA 4TMZA 5AK0A 1JJ7A 1LF5A 1A82A 4GT1A 1PUJA 2O52A 3FFAA 1X8LA 4DLUA 2J0VA 2DWOA 2JJ1A 1OH7A 3VKHA 1Z6YA 2XTZA 3H4MA 4UJ5A 1EGAA 3Q7QA 5KSPA 3VU9A 2LKCA 5FTLA 3DO6A 1GAJA 4GI7A 5HZKA 1T6NA 2FZ4A 1BO6A 2OAP1 3AF4A 1LNZA 4IRUB 1RE0A 1KO1A 4AKGA 5EP4A 2D06A 1OHHD 3K1JA 2VP0A 3E1SA 3CNLA 4PC2A 1UBFA 2AL7A 1W36C 4MDFA 3PUXA 4R71A 2ZRFA 3CNNA 4FMCB 2WJVA 4YMSA 4F93B 4L4UA 3W5JA 2PJRA 4PC1A 3O8RA 4A15A 3AGQA 1DBSA 1LFDB 4Q7JB 4A0GA 1G6OA 3QKSB 4US1R 2W6IA 1SXJB 1T9HA 2WWXA 1GKIA 2ZRGA 1Q1BA 2NOAA 3L43A 3PCRB 3SU8A 2D4HA 2JJ8A 5G53C 2VF8A 3FB4A 3FE2A 3EW9A 1OXSC 3T35A 4KU4A 3DOEA 1NVVR 3MFYA 3IUYA 5J47A 2NPIA 3EAQA 3LY5A 3M6AA 5EP3A 4XVQA 2ZAMA 4TL7A 4IDNA 1CULC 5JWOA 3W90A 5G3YA 2F7SA 5EXSA 3BH6A 3A1WA 3K09A 2ODWA 4S2EA 1CJUC 3GP8A 3EXAA 2WPDA 1CXZA 1UBEA 1WXQA 2D7CA 4AKEA 1FUUA 2PCLA 2H7VA 4IEIA 4ACAA 5DI3B 5E7IA 1CLUA 4BEBA 4RFSB 2AKYA 2A3RA 2GRJA 3EWSA 5CYPA 3QPVA 2JJ1D 3ZQ6A 5FPHA 2EWVA 5FBVB 3EPHA 2RHMA 2JLVA 3N2EA 2YWFA 5TY0A 3AVTA 3FWYA 3RANA 3E5HA 1KO5A 3OEHD 2GHIA 1VKJA 2ZE6A 3VNUA 2GK7A 4XTCS 3LBIA 4DSTA 4HLCA 1J99A 1TQ4A 4PAQA 3ZS9A 3F8TA 3VR4A 1KO4A 3A37A 3EA5A 4MGYR 1YKSA 2IYRA 1KO7A 4Q1CA 3MD0A 2NTYC 4I1SA 4A92A 1ZYUA 3UXMA 2OG2A 4URYR 2BDTA 3GEIA 1IY1A 1QHXA 3SR0A 3WYFA 3IBGA 2OBMA 2PZFA 1II8A 3CX6A 4UXJA 2KSQA 121PA 1FFHA 2V54A 4PO1A 3MWYW 2PLRA 3LBNA 4OI0A 1U99A 2AR7A 4PAMA 1VCOA 4Q47A 3W8NA 4B71A 4DLYA 2PH1A 2CLCX 4TLCA 3P26A 4OK6A 3TAUA 3KJEA 1FW6A 3ZS8A 4NCIA 4XIGS 3DZ8A 1UF9A 3QPUA 4A9AA 4DBLC 3O47A 4ASUA 1NSFA 4J0QA 5BN3A 3F0TA 1TX4B 4Q4AA 2B7CA 2WPDD 1BKDR 2DWPA 3BK7A 3GMTA 4TQAA 3NXSA 1G8PA 1WMSA 2HCBA 3ZDQA 1RVDA 2QP9X 4OQNA 4G5SA 3W9YA 1HH4A 2FFHA 1UEJA 1KDTA 3UK6A 1DAHA 2W0SA 1OXXK 2D2FA 1DG3A 2G1KA 1L8QA 5LBIA 1FP7A 1S96A 4URWR 3RS0A 1VYUA 2C78A 1H65A 4NH0A 4OHXA 4ACBA 2QL6A 3U7GA 2G6BA 2RKOA 4BEJA 4A36A 2VHQA 4RJLA 2WZQA 4WW0A 4CEJB 3TIFA 4IFBA 5SZJA 4GOXA 2BJWA 1EXMA 2JLZA 2BKEA 2A5FA 3K0AB 2YKGA 3QF4B 1DO0A 2WTUA 2CHQA 4KBFA 3RDPA 3B5JA 5JSZB 3LX5A 4FIDA 4X8HA 1VCNA 1XTQA 3E70C 4OK3A 1E9SA 3MWJA 2DY1A 2W00A 2D74A 2H57A 3GQBA 3UWKA 3VKGA 2OCPA 4TQUS 1ZIOA 4QOSA 2FSFA 1YZLA 1EX7A 1QRAA 2FSHA 4UNQA 1P2TA 2XZPA 5FBRB 3A8TA 5FTJA 3AVQA 3HYRA 4GPTA 4BLPA 3V4FA 2WMOB 1N5IA 2ZU0C 3QBTA 4Q01A 2GCOA 5K8IA 3SHWA 3AEZA 3HJNA 2WWGA 3VFDA 5KDOA 1L4UA 4YXWA 2VP6A 4XD7D 2GAOA 2CLDX 4LHYA 4BGDA 2RGCA 2ZIAA 4LJ9A 1Z6XA 3C7KA 2R2AA 1TTTA 4KI0A 1U0LA 1Z0JA 3C5CA 1DEKA 4JLVA 1YZQA 1YR6A 4F4IA 1XPOA 4NU0A 5BQ5A 4AYTA 1N6OA 1Z5ZA 1HUQA 1G5TA 3SC3A 4ON9A 4WXRA 3OIWA 2QORA 2IS2A 2HT1A 1KNQA 4F92B 2ZYVX 5DI9A 3LXRA 1OYWA 1U0HC 4FXPA 2GBLC 2OXCA 2AN9A 5LD2C 3ZLJA 3SI7A 3QENA 2VHTA 4M1MA 3ADBA 2DFLA 2ZJ5A 1HEIA 2ZYWX 5FR2A 2YOHA 2ZJZA 5JRZA 4LJAA 4B73A 4URXR 2ERXA 4DLRA 3ADKA 3C4JA 1Z6GA 2FOLA 1VCMA 2IEYA 4GOKA 3WY9A 1KHTA 5JECA 1WQ1R 1O87A 2ODEA 4W5JA 2LCFA 4BFTA 1L2TA 2CK3A 5AJZA 2QM7A 2J46A 2IXEA 2VF7A 4RD3A 2A7QA 4B74A 5JHGB 1XXHE 4HDCA 2CEAA 1MV5A 4V0NA 3U44A 3BIFA 1KMHB 2NO9A 1US8B 3AB3A 4KYIB 2YWHA 1GILA 1NG1A 2WAYA 4W5HA 3OE7D 4ABYA 5FUXA 1JAIA 3CWZA 4RD4A 5KU1A 2FN4A 3TQCA 821PA 1R8QA 4KITB 1XJ0A 2FV8A 4B43A 4WAUA 5C4GB 4Q9LA 3TBKA 1S3GA 1QHNA 2Z6VA 4B3XA 1J7KA 2REBA 3R7WB 3MRSA 2OBLA 4LZZA 2IT1A 2JLYA 1XTIA 2IF2A 2NMVA 4YDSA 1G8YA 4YXWD 3T15A 1X3SA 3D3QA 2WIBA 1JNYA 3AP1A 4E5UA 1DELA 2WHXA 1ZNXA 1U8AA 4EQ6A 2MMCA 5EE0A 3CF2A 3U3KA 2PZGA 1KK2A 2NO7A 5FOWA 2JAQA 2DPXA 3QXJA 4MKGA 1UJ2A 3T5DA 2HXSA 4TTQA 4PPQA 1CBUA 4POAA 3B1VA 1CEEA 5IT5A 4A2WA 3L0IB 1I4LD 2ZJYA 3QEJA 3TUIC 3TVDA 1YR9A 5FOSA 3LFUA 1W2HA 4OL0A 3RWOA 2DWQA 1OT3A 4ZCLA 5FBWB 1N3BA 1Q3HA 1KI8A 1TNDA 1CR4A 1NN1A 3BJIC 3LLUA 4BECA 1P5ZB 2OV2A 1OW3B 2V8OA 1OH5A 2A30A 3VNVA 1Z6TA 2HYDA 2CK3D 5KNBA 2W2TA 3U3JA 4KSCA 5AJYA 1Q44A 3SZRA 2IX3A 2OE2A 4XWKA 3WMGA 1P72A 2QNRA 5DI3A 2JLQA 4JMPA 3UIEA 3AVUA 2D62A 3IEUA 4PHHA 2IA5A 5E95A 4TL9A 4M1KA 2L0XA 4B34A 1AS3A 5HKKA 2AHOA 3OESA 3VR2A 2EWWA 4QGFA 4O25A 1XTJA 1OJLA 2ZRBA 2QSYA 1YZGA 4M2LA 1AA9A 4LPKA 4NBSA 1ZNWA 1E98A 4FWTA 1RRPA 2HCJB 4OJKA 1ZINA 4A0RA 3KB2A 3UMSA 3B9PA 2BBWA 3K09C 5KSOA 2A5YB 2G88A 5LD2B 4Q19A 2J0QA 1H8HA 2BM1A 1G18A 3AKEA 3PENA 5KUTA 1C9KA 1Z3IX 2V6IA 4JVSB 4DLSA 4WXPA 2I1VB 2W2XA 5JS8A 2LKDA 3R8FA 5F9HA 1DPFA 2H8KA 2W2VA 5FH9A 5G41A 5EE5B 3THXB 3GPLA 4U5XA 2PX0A 2CVFA 2ZROA 5H8WA 5EUQB 1P9RA 3U3MA 3U61B 2QAJA 1XWIA 3U60B 4Q9IA 3RRNA 4US0R 2Q6TA 3EIEA 3W3AA 4MYCA 1E2NA 1GM5A 2F6RA 1BIFA 1HE1C 4ZKEA 3VHLB 4EAQA 2J0SA 3EZ9A 1OF1A 1SVMA 2WM9B 2CHGA 1PUIA 4B2IA 2ONKA 2FPMA 2GXQA 5H1YA 3FYHA 4KVAA 4AG5A 2BOVA 4BZXA 4AY2A 1F2UB 5HCNA 4PSAA 4EPTA 4A0FA 4LBVA 4B2PA 2Q3FA 2IC5A 1NBMD 3DM9B 4K8OA 5AJXA 4A8JB 3U7HB 1G9XA 1XXHB 4AURA 5HKKD 4UQOA 2C2HA 4M9XA 4L16A 4DEXA 1N6PA 3NTUA 3I5XA 2AD5A 1G5RA 3CB4A 3VU9B 2N1BA 5G3ZA 1R7RA 3GJ6A 4UNPA 3NDBB 3AKCA 3LX8A 4X8LA 1ZMXA 3ICQB 1YR8A 3K0AA 1OFHA 1T5IA 2C9OA 3DOFA 4JLNA 2F9LA 4AKIA 3W3ZB 4K81B 2AX4A 3BH7A 3NC0C 6Q21A 2ZR9A 5JSZA 2H17A 2IS6A 4IDHA 2HJGA 1RYFA 3QG5A 3I92A 4HZIA 5B64A 1ZUHA 1CU1A 4AK9A 2PL3A 3DDCA 2BMEA 2V1XA 1ZM3A 2ZRJA 4LBWA 2QEQA 4DT1A 2ZRNA 1KK1A 3IILA 4NHOA 2BM0A 2ZRIA 4B6FA 4MKIA 3NIBA 2QMUA 5DGXA 3TAHA 1E2JA 1NRJB 5EXXA 2QY9A 3BFKA 5FTMA 4HATA 4PO8A 4XSHA 4IFEA 1A7JA 3PJRA 1TPZA 4HUQA 3FTQA 3LRPA 5FR1A 1E96A 3X2SA 5TV2A 5JCPA 1IHUA 1E2PA 1G3QA 1G8HA 1E9FA 2WMNB 5F9FA 3IQXA 4ILEA 1CJKC 4UXHA 5TXGA 1G5PA 1AKEA 1E0KA 3LQQA 4DLTA 2KI5A 4E22A 1S0UA 3KJIA 4UXIA 5GJVC 4TZ0A 1CJVC 1P2VA 4A2PA 2GZHA 2GJKA 1KNXA 1RRFA 1S9DA 1ZVQA 2CHVA 4Q9HA 5G40A 4BZQA 5L3SA 4I1VA 1DS6A 4HEJA 4FI3C 1AK2A 2KB0A 2CDNA 1SHKA 5B58C 1PLLA 2A5GA 3B7GA 4I1OA 3PEVA 4C0QC 1T0JB 1Y63A 3KL4A 3RLFA 2ODNA 1U9IA 1E2FA 1UBGA 1MRNA 1JB1A 3N2IA 5JJKA 4LYAA 3VR1A 3LA6A 3PR1A 4D0NA 3CUEF 3X1WA 3UKDA 4B33A 2ZM5A 4Q9JA 1KYIA 1G7RA 2ZRAA 1NSTA 1YJ5A 5KDLA 1US8A 2O8BA 5DO9A 3C15C 1QBKC 2Z0MA 4EIWA 4KSBA 4WZAE 4LJ7A 3I73A 3HDTA 1FTSA 4DCTA 2QGZA 1G4UR 4OHWA 1G17A 3S1AA 4Q4HA 1KTVA 4DB4A 1M2OB 2JLSA 5L3VA 3ZZUA 4KLZA 4XJXA 3I61A 1E79A 1ESMA 1R0XA 1ZM2A 2QTFA 1IQPA 2AD1A 2RGAA 4Q7LA 4G0NA 1VIAA 2J87A 3K9NA 2JGNA 1YRBA 4LSGA 3ZVRA 3GJ0A 2GK6A 4KV9A 4Z54A 2IYQA 4NPHA 2ZSEA 5JEDA 5JWRA 4CZ2A 2Q3MA 4WOPA 3AUYA 4JS0A 2AK3A 3RS4A 3CRW1 4Q4AB 3TJZA 2ZYTX 5JMTA 3AM1A 3FHTA 3SHFA 1WCV1 4RD0A 4UKDA 1KI9A 1J8MF 2XEXA 3BOSA 2ZJ8A 3R20A 5H68A 2YC2C 5BN4A 1F6BA 3W6PA 2WKRA 5SZIA 1XEFA 2DHRA 3CH4B 3SQWA 4DIDA 4D4JA 1M7GA 4HYYA 3PIRA 3I8SA 2W83A 4MYHA 5JLJA 2PMDA 2ZRMA 1FZQA 4IKEA 1U8ZA 1FTNA 4B32A 2WJHA 5LDDC 3IO3A 2JLRA 2XNDA 2BMJA 4DJTA 4D2IA 3PEWA 2V7QA 4Q4LA 4YMWA 5EJEA 3NEJA 2RGGA 2YC4C 1EG7A 3A1UA 1A1VA 3SYKA 1HE8B 3QXHA 2H16A 2XAUA 3KKMA 3O8DA 4U7DA 3T1OA 5HPYB 1OFIA 3LDAA 4EJSA 4ZCIA 4C0KA 2GJSA 4RFVA 2D3WA 1NKSA 3QJYA 4C0LA 4GNKA 3QPWA 1HTWA 1GP2A 2JJ2A 4TMWA 1E79D 4OI4A 3HPRA 4BFSA 2OSBA 4Z8YA 1Z0IA 1G8GA 3FMOB 1OXVA 1N0WA 1R4AA 2KJQA 5FUYA 4LBZA 4C0BA 2GILA 4EPYA 1UEIA 2FZLA 3NEYA 3H86A 3P20A 1W1WA 1VPLA 4ITRC 4KXFB 2GCOB 2HJVA 3TLXA 4ARZA 1SVLA 3HPQA 4L15A 2FFQA 4KFTA 5KYKA 3THXA 3IHLA 3K8YA 1CR1A 3MUFA 4LWZA 1Z0KA 4LCBA 4QJ5A 1AS2A 3SBEA 1XMIA 5JBQA 5E7JA 5FPTA 1Q12A 4OI2A 3MLEA 5DNYB 2ZXUA 2P6NA 4LV5B 5CIWA 4D4LA 2ZSDA 3KXIA 4UJ3A 1R5NA 2JATA 3WP1B 2CXXA 5IRCD 3WRXC 2XNDD 2VH5R 1E2QA 2FE4A 1KAGA 1ZAKA 5JWHA 2XXAA 1SHZA 3NKVA 2WJGA 3P27A 3VR6A 2J5XA 3A4NA 4OYHA 1NN5A 1W4BA 2K5UA 3KUDA 1CJMA 2CNWD 3D31A 3L0PA 3TK1A 5BYKA 1FOEB 1XEXA 1W4AA 5DLQC 2X19A 4IJMA 2BWJA 1DOAA 4A2QA 3U44B 1CRPA 1LB1B 1K5GA 4DB2A 1G3RA 4JKYA 4C3ZA 1KK3A 3V9PA 3RRYA 1WA5A 2JJ2D 4JLJA 2FNAA 3N70A 4XWAA 2XZOA 4A1FA 1XFAA 1RC8A 4FMBB 4B44A 3OEHA 3CX7A 2AWOA 4FCTA 3BGWA 3PVSA 3RS7A 4R7ZA 1D9ZA 2WWIA 4JVNA 4A6PA 4RZ3A 2GA8A 5DYGA 2JIZA 3U6KA 1BH2A 1JQJC 5C2JB 1ZC3A 3BH0A 2HDNB 1XMVA 3ZVNA 3CW2A 3UPUA 4EQ6B 1GOTA 2HXYA 1CTQA 2YOFA 4NCHA 1CR0A 1TF2A 2IS1A 4M53A 4ZI2A 4BFZA 2QAGA 3L8ZA 2J3EA 3B1ZA 2NZJA 2Q9AA 4KYUA 4IOMA 4OI1A 5JJIA 1E9AA 3VHXA 2UZ3A 3HU1A 1KY3A 2FPLA 2OILA 3H1TA 2VTKA 4DKXA 1W5SA 4QHTA 1BMFA 1BYIA 4PSVA 1EFHA 1JJVA 3I1FA 5J4HA 1VG8A 2FGKA 4PZLA 3B1YA 1MT0A 1YRAA 3WYGA 1XP8A 5TMPA 3NH9A 1E2KA 2I3BA 3QNUA 3EZ6A 2QMEA 3T1QA 2HUPA 2IYLD 1KI3A 2MMGA 3U3OA 1VG0B 3OZXA 2FX3A 4B2LA 3AVXA 4QBFA 2O0HA 4GZLA 4KBGA 5EZ5A 4AC9A 1VG1A 5EE3A 3IEVA 4HAVA 3H2YA 3SJBA 4A6XA 4CRWB 1XMJA 4QBIA 3OIUA 2CVHA 3NHAA 1JI0A 2OFOA 2ZJAA 4B35A 1G16A 2F1HA 2DFTA 1V5WA 4LJ5A 3LWNA 4QNRA 4IVQA 3HU2A 1NI3A 1A2KC 2R44A 2R6CA 2ZS8A 4Q21A 4TWZA 4UNSA 2CE7A 5K8TA 1L4YA 2JIZD 3BORA 1OYYA 3ZYCA 5GVRA 1G1MA 4P33A 1UDWA 3L0SA 3QY0A 4HB2A 4Q02A 4LC1A 1QHGA 4FMDB 3X1DA 2OXRA 2Q21A 1H8ED 4EPXA 1UFQA 5KNCA 2V6JA 2FDCA 5KOYA 1WBBA 3ZZ0A 4MQBA 4OJQA 4NDZA 4K46A 3ZIAD 1KSHA 3CZPA 1U9IC 2EW1A 3I8XA 4O2LA 1BMFD 3RHFA 4V0MA 2YNMA 1KZ7B 2CBZA 3QI2A 1GSIA 3PUYA 1W48A 1QHSA 4QM7A 3JVUA 5L3RA 5GADl 2HYIC 3CRQA 1KJYA 1F60A 4GOJA 1TUEA 4XD7A 1KKMA 1T3LA 4LYJA 2OBNA 3KKPA 1LV7A 1OV4A 4I4LA 2IYZA 4PANA 5AJWA 4DCVA 2QBYB 3X1YA 4LHVA 1XRJA 4D4MA 2F1JA 5FPKA 3X1XA 5AUPB 2ZE7A 3ADDA 3U3RA 4NKRA 4CF7A 1EESA 1SZPA 4M0LA 4LJ4A 1XD2A 3OF5A 4IOJA 4V02A 1G291 1E2GA 3LH5A 4CT4B 4MDEA 3G5UA 1WB9A 2BBTA 1ZU4A 2QPAA 1XPRA 1XJQA 3SFVA 5HR5A 2XB2A 2QRNA 2BMDA 2ZUDA 4TN1A 2ZVPX 1QHYA 3LO5A 2WKQA 1S1CA 1NVVQ 4LUCA 3P1JA 1B23P 2ATVA 1OSNA 2F3RA 2WJIA 4M22A 2ANBA 1Z47A 1S3SA 4P4SB 3AKYA 3BFXA 3EG5A 3QE0A 4JT4A 5GJBA 4HAXA 4O0MA 3KJHA 1U0JA 4NYJR 4BUJA 2CE2X 2GEDA 1ESNA 4MKFA 2HLDA 3AF1A 3BWDD 1E0SA 1PV4A 3ZVMA 1XD9A 2FGJA 5L8VA 1KI7A 2ZANA 2IYSA 1F5NA 2Z4RA 4C30A 3OE7A 3PEYA 1LS6A 1Q1QA 1TAGA 2HV8A 5FBQB 3THYA 3ZH9B 2OAQ1 4DT1B 5IDVA 2GZAA 2IXFA 5FOUA 2HT6A 4Z51A 2G0TA 3D8BA 3PEUA 1DAGA 3AVVA 3W8RA 3CH5A 1ZRHA 4GP7A 3SE0A 1HY3A 4AG6A 4EPVA 1DARA 5HTKA 4HUQB 2P65A 3TSOA 1P4SA 3I5YA 1CP2A 4MKHA 1XZPA 3K53A 1KOFA 1FP6A 5FBLB 4TYWA 2JDIA 1AJEA 3VR5A 5FPSA 2QRZA 5BN5A 2EFHB 3AV0B 4B47A 1NKTA 2QP4A 1TF5A 4OHVA 3IIJA 1GKYA 2V1UA 4KVGA 3R8CA 3QEOA 5L3SB 5IHPA 2RGNA 4TYPA 4QM6A 4JSYA 3ZD6A 3GLIB 1X1RA 4HB3A 4A4DA 4TL6A 1OKKA 1AZTA 5AR1A 1EWRA 4PPGA 4OK5A 4TLEA 4TYNA 3HYTA 4OBEA 1Z0DA 4US2R 4JYBA 2NO1A 1Z28A 4QFMA 2QTHA 2ZI6A 1N0UA 4IOKA 4NP6A 5DISB 3EWAA 4EUNA 1Z08A 2H1LA 3QF7A 4KFUA 1DTSA 4NE2A 4C0SA 3A36A 4PHFA 2G9NA 2HLDD 4WBSA 3M1IA 1FX0B 3PXGA 4HB0A 4R98A 5CJPA 2IYVA 2O8BB 5J4YA 2ZSBA 5AWFC 1DADA 1NJGA 3A1VA 2YV5A 1Q3TA 2ZR7A 2XOKA 1OH6A 4IOLA 4QG7A 4HZUA 2WVJA 3H0KA 4P0TA 4GMXA 2GWHA 2REXB 4BZPA 1MO5A 3KX2A 3S1AB 4Q4HB 4V0LA 4DSOA 3IIMA 4C0JA 1DAFA 4EFLA 1VTKA 3I32A 1UKZA 2XITA 1RYHA 2EFGA 2J41A 3HWSA 2VBCA 5AJVB 3UWOA 1HURA 4URZR 3TQFA 1ZIPA 1CIPA 3MGCA 4PZZA 5FL7A 1NL3A 4A8JC 3QSYA 4FINA 4DDUA 3C8UA 1W0KD 3MJRA 3P32A 2JDID 4F91B 4D0GA 3QKRA 1RZ3A 3CONA 2HEIA 3AF2A 1P2SA 4IVRA 5E7MA 3JZMA 3CIOA 1R6BX 1Q57A 2B6HA 2CCKA 3GLHA 3OAAA 4PC7A 4ZIRB 4G5OA 1Z06A 1IN8A 1KSFX 1G7CA 2FEMA 3WHKA 4O3MA 4GP6A 3TSWA 1KSJA 1R5OA 1D6JA 4AIIA 1OKKD 2ZRCA 4JSTA 4ZKDA 4B3DA 3GJ8A 2IL1A 1KO8A 4JLOA 1SVKA 3HR7A 3EZFA 5TDHA 1I4DD 2CL6X 1A5TA 2BJVA 3T34A 1ZM7A 2GXSA 1JBKA 2XTNA 1Z2AA 3FMIA 2FA9A 2VO1A 1NY6A 1S4QA 1BS1A 3GCGA 3UMRA 2VLIA 1TL7C 1UKYA 2ZTSA 2ZU6A 1XMSA 1NBMA 1E69A 1JR6A 2P3SA 1G3IA 2JLXA 4QNMA 2XOKD 5FI0B 421PA 5C46F 5KPDA 4W9MC 4DRZA 4EJSB 3K70D 4HLQB 4WA7A 2X8AA 4B6EA 1F48A 4DLZA 1XTRA 4Q9KA 1N6IA 2B8WA 3PITA 4H1VA 3LVRE 3KTAB 1A2BA 2IYWA 1I2MA 1NMYA 2QENA 3DZDA 4M1TA 4ZI3A 2BHRA 2IUSA 5GVSA 2GKSA 4JBXA 4AD8A 4HLUA 4V0OA 5FL7D 3U4QA 1IXZA 3REFA 3I3SR 5EXTA 4EDHA 4Q1FA 3IO5A 3EPKA 4S35A 3O8CA 2OCYC 4Q66C 3TMKA 4ARZB 1XZQA 4JKIA 2GNOA 3HP1A 5CM8B 4II7A 2A9KA 3W6OA 4Q4JA 4L8GA 3PUVA 1Z6AA 3OAAD 3AP2A 2J59A 5B57C 1OB5A 1KZGB 4NTZA 3AF0A 3BXZA 3FKSD 3ASYA 4IDQA 4JVMA 4TT3D 5EP1A 4Q7MB 4BRWA 1YZKA 1I2DA 2GEVA 4HI0E 3LD9A 1F2TB 3EA0A 5CB8A 2KE5A 2J45A 4V0ME 1GRRA 4HAYA 3EPLA 4D26A 1NF3A 1XEWY 1IN7A 2KBEA 3BBPA 5HE8A 2QBYA 4P4TA 4JJKA 4RCYA 2XXAB 1G20E 3FVQA 3QOFA 2P6RA 3Q5EA 3KKQA 5C18A 3TUJC 2O8CA 2XTMA 1QVRA 1XEXB 1N0VC 4RCZA 4FD2A 3BERA 1IXRC 1EFRA 1EK0A 4LYHA 4R2IA 3MWLA 4L9SA 3NG1A 4D6PA 4HAZA 2GF0A 2A78A 4P4SA 2BV3A 2OFWA 2GJ9A 2RHDA 4D81A 1AGPA 5CITA 1QHHA 2ORIA 3G0HA 4D0LB 1D2NA 1Y3AA 2G77B 4JYCA 1W47A 3RWMB 3L2OB 5KNDA 3A6PC 2YVUA 3EC1A 4Z8XA 1Q1EA 3BE4A 5SZKB 2MSCB 1XTSA 1N2CE 2EYQA 3EIHA 3D6TB 4ZO4A 3QQ5A 1OIXA 1TEXA 3IPYA 1WRBA 2BIFA 5C4MA 1K8RA 4QL3A 1W7AA 4H9GA 5D3QA 1PJRA 4DEYA 1DAIA 2QAGB 3VMFA 1AKYA 3A1TA 4IHQA 1EFTA 2P67A 3OEEA 4QHSA 1VDZA 1YR7A 4Q48A 4LDJA 4XVUA 3CM0A 2WSSA 4QJ3A 1DG1G 3EX7C 1IN4A 2UZIR 4N0EA 4Q1EA 4KHZA 3PUWA 4GBMA 5LPNA 2ATXA 4TYQA 1N6NA 2FF7A 5CLQA 2GDJA 3WXMA 4PXAA 4WVFA 3NBFA 1E9BA 1E3MA 1KDPA 3DKVA 1Q21A 2Q3HA 2CJWA 2WOOA 1ETUA 2EVWX 1ZCBA 3LW7A 1VYTA 3ECCA 2IBMA 4LY6A 3X1ZA 3GLIA 2E87A 1GZSA 4N0DA 1EFRD 1L7VC 1COWA 4B3GA 4MRVA 2ZYUX 2ZRKA 2ZUBA 3VX4A 4ESHA 1UKEA 4BLOA 3BC1A 4F4JA 4L9WA 4NYMR 4A0HA 2ZJ2A 2PJZA 3PFIA 1GKUB 1ODFA 4NYIR 4EFNA 1DAEA 3PV0A 2EFEB 1W36D 1ZUIA 2ZEJA 3DHWC 4GRAA 4LGMA 5DHAA 721PA 4KFSA 3BAFA 1UBCA 1WF3A 3FFBA 5A0FA 1FX0A 1OIWA 4EFMA 1GFIA 2ECKA 2OUKA 2VPPA 2O0KA 2GETA 2YYZA 3MAAC 5JI2E 5L3QA 3KKNA 4QBGB 1M8PA 5EE9A 1OH8A 1N5LA 2RGNC 3GFTA 1G41A 1R5BA 2RGDA 2J7KA 1FQKA 1Q1ZA 2B92A 1N6RA 3NVAA 3Q3JB 4FMCF 2P2LA 2RGXA 3LW8A 3WP0A 1RFLA 1SVOA 4BLSA 3OEED 5AUOB 1NN0A 2W6JA 1KDRA 1RW4A 5E4FA 1FNNA 1ZD8A 1JXOA 2WSSD 3LNCA 1WE2A 2W0MA 4OQMA 1IJFA 4Q03A 3SJZA 3VAAA 2PT7A 1IY0A 2QQ0A 2IYTA 4KFRA 3K0EA 4CT5A 2F43A 5HE9A 4F7WA 3K0CA 1P75A 4JLAA 3THWB 4IXNA 5JEEA 1S1MA 2GF9A 4ZIRA 2EU8A 2X2EA 4BFVA 3GLHE 1O3YA 1ZD1A 1XD2B 3I4LA 2VHCA 1E1QD 4YMVA 3U7FB 2R6GA 2Z4SA 3IIKA 4D4KA 1COWD 2AXPA 4QRHA 3GJ3A 4DUGA 4Q5IA 1XF9A 2ZJBA 2QI9C 1YZUA 2REOA 2IHBA 3W34A 2QPOA 4JIMA 3WBKA 2GVZC 2Z43A 3MMPA 4JBWA 1KI6B 5CYOA 3SYNA 1B0UA 4JJZA 4QKQA 4UNRA 1R0ZA 4YMTA 3UATA 2H18A 1IM2A 1Q22A 4WZ6A 1A4RA 1HYQA 2GCNA 5DIFA 1GITA 3KDSE 3NDPA 4BQSA 1QHIA 4B3FX 2QT0A 4OQFA 4JLPA 1NBME 2CNWA 3M0EA 4CW7A 2YJTD 3W5IA 4MRRA 3WMEA 2R6FA 4ZV4A 3B85A 4NL4H 4Z1MA 3CPJB 2AFIE 1E0AA 4FMDF 1T5LA 1NVWQ 2W6JD 3KTAA 4M1YA 4M9ZA 1D9XA 2C03A 2ZI5A 3THYB 4PPFA 4B76A 2IS4A 2W58A 1KK0A 2ZS9A 2EQBA 1KI1A 4M4SA 5JZVA 4I1UA 2WKPA 4RVCA 4V0KA 4BASA 3JZAA 3ASZA 2ZUCA 1XB2A 4MUBA 1R0WA 1XPUA 3DMNA 2YINC 2BCJQ 1VECA 2GCPA 3AKDA 1GNPA 3NBYC 3KUCA 2P5SA 3ZGXA 4C4PA 2Z5FA 3U5ZB 3DEFA 3CPHA 2WJJA 1ZNZA 3TR0A 1TQDA 5TB5A 1OXTA 2ASEA 3PUZA 3EIQA 5FPYA 3ZZTA 1IJEA 2Q9BA 4PX9A 5CDFA 3WRYC 1OXUA 2B7BA 1F2TA 1XD8A 3NBXX 2VP9A 4IXMA 4DUGD 4RY2A 2WICA 4CEHB 1PLKA 1DO2A 5UKDA 2NZ8A 3SQXA 4TZ6A 1MO3A 3LAWA 4LYFA 5J4KA 4G5QA 2R6AA 3WNBA 4HLUC 5EE1A 1ZNYA 4XH9B 4KODA 1KI4A 1M6NA 4P4UA 2DBYA 3CPEA 3FPAA 3SJAA 2NIPA 2FH5B 4LV8B 4JL8A 3AH8A 2C04A 3BB1A 1GRNA 5JFGA 1E2LA 1CR2A 2F1RA 2JLWA 1ANKA 1J70A 2R6DA 4HAUA 1I4TD 1MO4A 2R9VA 4PQYA 1AGRA 2OEPA 3VQTA 4MITA 3K0FA 1KKLA 2VHJA 1JALA 2DFNA 2I1QA 5KSYA 1M7HA 4Z1MD 1GIAA 3LV8A 4RZXA 4F4CA 4C2TA 1LS1A 4BFYA 2RAPA 5JS7A 4M21A 4HZUB 4XOIA 5KSZA 5FOXA 3IPXA 3K70B 5BXQC 4AYWA 5CJ2A 2OLJA 1VHTA 3BB3A 3B13B 3GLFE 3C5HA 1KJZA 4HAWA 2QM8A 3IBYA 1FUKA 2TMKA 2YWGA 4MYUA 4DDTA 2OCBA 4PPNA 1IXSB 1ZP6A 4Y0VA 3C14C 2BMFA 1ONBA 2FG5A 2EFDB 1XNJA 4RD6A 2BC9A 4DDWA 5JJLA 3KKOA 3CNOA 5B30A 3TH5A 2R65A 3WYAA 3TSZA 3T1VA 3QKRB 1H8EA 1Z0FA 2IUTA 3EARA 1P60A 1CJTC 2GXUA 5E3HA 1GVNB 4ERNA 3RVBA 3GLHB 3Q8XB 4DSUA 1TU3A 2E1RA 2VA8A 2Z83A 2GAAA 2QP3A 3ZIAA 3QVVA 1DE0A 1W4CA 3H84A 2C99A 4NCNA 1ZD9A 4OHYA 2CLSA 3T5GA 4FCWA 1WDTA 4JLDA 3KZ1E 1E2IA 2PZEA 1F3OA 4FWIB 1N5KA 3IKJA 5H70A 4AKHA 3U7EB 5BYJA 2J7PA 2QE7D 2QROA 3AVWA 4DHEA 3ND8A 3QUSA 2IYXA 2D7DA 2ZI9A 2J0UB 1ZCAA 4IDOA 3T06B 3GLIE 4D25A 3NHBA 4DLVA 4FW9A 2FSIA 4RD2A 1E94E 5CIQA 2UKDA 3B60A 4W7SA 4HB4A 4WIAA 2ZJOA 1XU4A 3QXSA 1OIVA 1P7CA 5ANRB 4DLWA 1NMZA 1MABA 4JLMA 5DN6A 3VTKA 1E9RA 2ZSAA 3I72A 4MH0R 1IOZA 1LTQA 1RRCA 4R9UC 1JECA 4TMXA 3GJXC 2OO7A 4C7OA 2CL7X 3U4QB 3OHMA 1ZM9A 1YQTA 4AYXA 1KGDA 2JA1A 2O8EA 2C9CA 4E03A 3CZQA 3E2IA 1NVUQ 2DFKB 4Q4JB 4JVLA 1R0YA 3WNCA 2QTVB 2WIAA 1GG2A 2ZI4A 2ZI7A 4N1AA 4PHGA 1OFUX 1RIFA 3QVUA 1IN6A 4JZKA 1SULA 4E07A 4ZCMA 4CEIA 4B3BA 1QF9A 3PQCA 3SN6A 1X8KA 1KI2A 2P5TB 1XCPA 3T12A 4OQLA 5K8UA 1QG2A 4LC0A 3CBQA 1E2MA 4JLBA 2J7PD 3THWA 2W6ID 4OHZA 1T8UA 4G5RA 1FMJA 3CX8A 3B1WA 4PZYA 2NGRA 2ZPTX 2O8CB 1XEWX 2OCAA 4BE7B 5JHHB 5KDDA 2ZE5A 5HZHA 3KQKA 3G82C 2BVNA 3RAPR 2QUZA 1RJ9A 5D3MA 4B3CA 1T3SA 2O8FB 1M7BA 1KAOA 1MKYA 2X77A 3QXCA 1KI6A 2IXGA 3SJCA 1NVXQ 1TF7A 3RS3A 1RKBA 3QKUA 2BBOA 2CMKA 1YZNA 5DN6D 4XWOA 3DMDA 3K0CC 4QGGA 2O8DB 1YU9A 3KFVA 1R8SA 3GLFB 4DVGA 4LHWA 1Z63A 1QHHB 1W4RA 1LW7A 3IGFA 3K9HA 2HF9A 1W36B 3IQWA 3LLMA 5K8LA 3P4YA 4LK2A 2P6UA 2N46A 3TKLA 1T8TA 1P73A 2ZRPA 5KPJA 1G6HA 2VEDA 5P21A 3SEAA 1IBRA 4HDOB 3TR5A 1SGWA 1UDXA 2F3TA 1R2QA 1ELOA 1AN0A 2G83A 4MA4A 1VCIA 3FKQA 3RRZA 1SKYE 1W49A 4Q18A 3RYTC 1J8YF 3VR3A 3W6NA 1W2GA 1EWQA 4KAXA 1W5TA 3B78A 3U2QA 2C8VA 1VYVA 1S9HA 4R2HA 5J5CA 1M34E 3ADCA 2QU8A 3A4LA 1OFTA 4X8MA 2NG1A 4XVRA 1Z83A 2VQSA 2ORVA 1MOZA 4PHTA 1X6VA 1XJCA 4GSYA 4Q1DA 2FEOA 1W0KA 4UNNA 4EJSC 3C16C 3ZD7A 3REGA 1NLZA 2ZE8A 2VHUA 2AWNA 4QXAA 2CJWB 2ZETA 1P6XA 1SVWA 4NZYA 2WAXA 2OT3B 1W46A 5EP2A 5CDFE 4BLQA 2GJAA 4CEHA 5TVKA 2XJ4A 4PSKA 4ASUD 1KDOA 1M74A 4P32A 2FJUA 4LJ8A 4QBHA 2PEYA 1G4AE 1CF4A 3KJGA 4RKEA 2WWYA 4MRPA 2V9PA 1E2EA 3FHOA 2A5JA 1C1YA 1U2RA 4IDPA 3AVYA 1FPMA 3GFPA 3QG1A 4TMKA 2R62A 5GJCA 5IF9A 3L8YA 5F98A 4N3NA 4G1UC 1CS4C 1ZM4A 3OIYA 3GLGA 2YOGA 3CRMA 4OQXA 1E1RA 4NCKA 4Q7KA 2NPFA 2QMHA 3RABA 1VMAA 4LBYA 4ZDJA 5L3QB 1CRQA 1GUAA 3RSOA 3T61A 3KB1A 3IHWA 2RGBA 1Z0AA 1P9NA 3C41J 2BBSA 2QSZA 4JL6A 2Y8EA 4BRUA 1X1SA 3MG9A 4YONB 3B8HA 4M1WA 2FFAA 1NNEA 1T3HA 2FMXA 2X1VA 2DYKA 4FN5A 2XZLA 2RH5A 2GVDC 4C2UA 1QG4A 3FHCB 3DL0A 3THOA 3UG7A 4D82A 2VSOA 2WWFA 3LBHA 4PC6A 4IEEA 4DCUA 1GL6A 1T91A 1P3JA 3SOPA 2F55A 4MGKR 3RC8A 2J9RA 4DXAA 1OLOA 1NY5A 4NYJQ 2E9SA 1IAQA 1II0A 3AUXA 2F43B 4KLNA 1E9CA 4KO8A 2XJ9A 3CWQA 4U02A 5DE3A 3R9XA 2XNSA 1RPZA 1YE8A 2YZ2A 2CCJA 3K0SA 2QG6A 3QIAA 3MWKA 3IDQA 5FUWA 3FKSA 4TT3A 2IWHA 4P31A 2XGJA 2V4ZA 1TEVA 2ZI3A 4GZMA 5CB6A 5ELXA 1C4OA 1IN5A 3RS5A 5JRJA 4NONA 1GL9B 4CGZA 4NMMA 3B6EA 1P2UA 2ERYA 1II9A 1Q20A 3TW4A 3FDIA 3QKSA 4DWJA 5JCZA 1SXJA 1YHNA 1E0JA 5CLLA 3TW8B 3ND9A 1AQUA 2GJ8A 5SZHB 1MO6A 1XDBA 1JAHA 3HU3A 2IWRA 3RSLA 2OLKA 3VX3A 1U98A 2QAGC 1P61B 1D2MA 2J0UA 4D80A 1E1RD 4QHYA 5LB4A 3EZ7A 2BKUA 3MSXA 5GJWC 5TARA 3BRWD 4C0HA 5KTYA 3GJ5A 1ZJ6A 4MRSA 2IEZA 2ZS7A 4Q1AA 4NCJA 1QZXA 1OPXA 3LXXA 1D2EA 1N6KA 1FMLA 2AFHE 1Z29A 3UG6A 1X86B 4MRNA 1V43A 1SKYB 4TMVA 3ICEA 1SVSA 1JR3A 2XSZA 1Z8FA 4LHZA 2IHYA 4Y0AA 1DVRA 4YMUA 1XCGB 5KHOC 1XX6A 2IYUA 1QDEA 5CK5A 1NLFA 4RFSA 1E4VA 2ZRLA 4MGIR 4DCNA 3A1SA 2N42A 1ZUNB 1G21E 4LPSA 4QJ4A 1G64A 1KIMA 1JEEA 2SHKA 2PLFA 3OIVA 1FL9A 4LHXA 4M9SA 1P62B 2EYUA 4EKDA 1E2HA 2P0EA 5FTKA 4HLDA 4OKSA 5EUMA 2B8TA 4TLAA 4H1UA 2ZVQX 4WZBE 4LJ6A 2VSFA 4RZUA 3ZQJA 4EPRA 1RRGA 1JQLB 4LOAA 3SYLA 4I99A 4TLDA 1ZU5A 2Q0HA 1GTVA 3TUZC 2YHSA 2ZR0A 3AGPA 3KXKA 1S8FA 2A5DA 2FFBA 2IUUA 1E9EA 1NJFA 1JPNA 4XSGA 3MJHA 1GDDA 3NH6A 1GRQA 3KQHA 3DPUA 4DZZA 1SXJD 4X8OA 2QA5A 3Q85A 3L0OA 4DLXA 1E4YA 1T4GA 4BPBA 4ZDIA 1LF0A 1W0JA 2ZRDA 1SVIA 3T1TA 3CF0A 1GWNA 5J4LA 3GJ4A 5BWMA 1VIYA 4W5WA 3GEEA 3K0FB 2PX3A 1NMXA 2VL7A 2OESA 2O8FA 3TE6A 2OM2A 1HT2E 2AKAB 1ZW6A 1G7SA 2O5VA 4URUR 4TL8A 2UVQA 4M1SA 1PVOA 2HF8A 1P9WA 4BLRA
chains in the Genus database with same CATH superfamily
1X1DA 2H2DA 4CKCA 2RCNA 3WQQA 3UGTA 1VE6A 2D1RA 4KXLA 4DC9A 4G89A 1L3IA 2RDMA 2O8DA 1HMPA 4OXRA 4BNTA 3JQFA 3AERB 4JROA 5EIBC 2OORA 4Q9NA 1Q77A 4FGUA 1W5EA 4EEXA 1C7RA 2QYHA 3RS2A 4ARBA 4EHAA 3EH2A 1E2DA 4YQFA 3MCZA 3VR2D 2B21A 1USVA 4E4RA 3WFZA 3A31A 1OD6A 4XTRA 4LF4B 4RVNA 3EODA 3KQQA 2ID8A 2EJWA 3CX4A 1XCMA 2QX9A 2Q4RA 2R25B 2JGKA 1X8JA 3FW1A 3KS9A 3MRTA 3FOFC 1PNOA 5HOEA 3R1IA 3QBDA 4M1OA 1Z2CA 3ZCUA 4DMHA 3OURA 4ZAFA 5BQ3A 4XSVA 3QF4A 3HO8A 4C4XA 5A5GA 1CB7A 1B42A 5TT0A 3ZHRA 1M1YE 1NVFA 2PDAA 2JJQA 3PPXA 3N28A 3RU3A 3JWJA 4PF1A 4TSKA 1Q7GA 1N33B 1QCZA 3A9CA 5AKLA 1P6UA 3FBGA 2X0EA 3PHLA 1BOFA 5IK2A 5I8WA 3EXG1 2PO5A 3E3LA 1AHHA 3DB1A 4QD3A 1RLMA 1B73A 4HBZA 4LMBA 3SZGA 3F3YA 1JEQA 1W0JD 2B6NA 2AG0A 4BNMA 1WP9A 3GT4A 3PNMA 3TLGA 5KO2A 2BH2A 1G3UA 2H8GA 3BJMA 5DNVA 2ZOSA 3WIBA 4I5GA 4YRNA 1V16A 3TPZA 1VI5A 3HCFA 2C97A 4XWGA 2HZ7A 1Y5IA 3EB9A 4K26A 4WKGA 2VP4A 2Q6IA 3WRVA 4DV4B 4YC7A 5TGDA 5JS2A 1AM4D 2DQKA 3EIWA 1Q15A 2BONA 3H9QA 3OZFA 4G8DA 5F78A 2CYAA 3L82B 5EQDA 1CQXA 4ZPXA 2VYNA 2XRYA 5HW0A 5M04A 3R7LA 3IS3A 2AFHB 2G3YA 3P4XA 5L7WA 2DRIA 1WF6A 3JPYA 2CLEB 5BVGB 3EPJA 1IONA 1R18A 3MTAA 3VUEA 3LUCA 3DOJA 3HKBA 4FNMA 4D92A 3PRYA 1KSGA 1IVYA 3E4DA 2Z95A 4KJZA 5WRFA 2R751 3NHJA 4Z7OB 4JASB 3SC6A 4ZEXA 3W3AH 3TGPA 5AUNB 3A9UA 3MM4A 5FBHA 3E18A 1CFZA 4GKAA 1NI5A 2LWIA 2ZRQA 3EBPA 3G23A 4QIHA 3ZU5A 2KBFA 3AW9A 1ESDA 3GLGE 2BGIA 2QW0X 1TYAE 3O1LA 1DQZA 1DQSA 1NN3A 5H59A 1ORTA 3LBAA 4KUHA 4OJNA 3WLOA 5KZMB 5ERYA 4B6GA 521PA 3FGNA 1UBTS 5AI6A 1TU4A 1TZCA 2EP8A 1XU9A 3PWSA 4FDLA 3HMKA 2BGTA 2QN6A 4YLGA 5DMHA 2G8NA 2QG4A 5JCXA 3EFOB 3BMXA 1VYHA 1ZY2A 3IMCA 2AVDA 4HTFA 2OYCA 2H2AA 1N3IA 4AIRA 2EEZA 4PV7A 5IK2D 2XX3A 5FOVA 4O33A 2J30A 2WYUA 1OMOA 1EX6A 2CXPA 3T1NA 4B2YA 3DKPA 2IZOA 1SQ6A 3AQ4A 4ZDKA 4LRWA 5FAKA 1U7ZA 2P30A 3AF3A 1AG9A 3GMSA 1FSZA 4FDMA 3V7FA 5LR6A 4LFCB 4BFWA 1YVDA 2OMEA 1RWNA 4ONEA 2A9JA 1UMDA 1T9DA 1I2ZA 2NO0A 4PG7A 3WBJA 2ZT5A 1FRQA 4LYYA 2WU8A 1UM8A 3EASA 1EUYA 2X2FA 4FR0A 1BYUA 1NVEA 2A5LA 2FXVA 3IJ5A 4M6WA 4Z2YA 3RK0A 3RTBA 1B6RA 2VYND 2W2MA 3QVKA 2WBLC 4WINA 1IPEA 1QR6A 4TTRA 1MHPA 2C8JA 2AEJA 1J22A 1DAMA 3F5FA 3QFCA 5DWVA 1GQ2A 1V11A 2ORWA 1HDYA 2BL4A 2ILVA 3BHNA 3QJGA 2JGEA 3QELA 3VJKA 2O0JA 4H7EA 1V0JA 3TKAA 2QN2A 5SY6A 2QVCA 3MELA 1U2PA 5CNJA 2UYYA 2PBRA 2ECOA 2HO5A 4CG0A 621PA 3SG0A 1VLZA 1OLUA 2PBLA 2C4NA 5GGXA 3ZCQA 2RI6A 1L1RA 3IALA 4UQLA 2X5OA 1I1NA 1U0SY 3FNHA 3UANA 4CTKA 1E6CA 1LK0A 5CVJA 3FBWA 1FUEA 1S2NA 5F5LA 2AJLI 2ODBA 3HYLA 3P7MA 3JQ8B 4K05A 4M60A 4MROA 3HB5X 3LQRA 2QRLA 2J3HA 3JD0A 3JQGA 4ROTA 3IMFA 1RI2A 2OD7A 3GEHA 3O1HB 5DCYA 4DC0A 4D57A 3U4MA 3V4RA 1XTVA 4ZI7B 1MF7A 1V7ZA 3K9QO 3IUEA 4QX6A 4M8NE 3OC6A 1QHFA 2H92A 4Z6KA 2XWJI 2YY5A 3HL4A 4NS4A 2R8RA 4FFRA 5KYUB 2GK3A 5J2UA 3R2JA 4WKNA 3LFHA 2XCRB 4G5GA 4P9NA 3WNVA 3O2QB 5FL3A 1NXWA 4NMLA 2WF6A 3HDHA 3PSHA 4ZO7A 3NBZC 4CTJA 5L9AA 3H4VA 1HTTA 1DSSG 1AIPA 1VE1A 2FZGA 2QXTA 2WA2A 4AI6A 1F3LA 2DCUA 4AUEA 1Y33E 1TADA 2JFYA 2DKFA 2JCSA 3LI2A 4HADA 1YT5A 1OHHA 1K9SA 3QEKA 1AUOA 3RHSA 4ZHSA 1Z7BA 1SKBA 3RSSA 3R5JA 5DHFA 1W59A 2VYFA 1XXLA 1U31A 2NO6A 2WV7A 1BFDA 2ZRHA 3HR8A 3I9OA 3MTGA 2RB4A 2LIVA 3TLCA 1CUGA 4E15A 1Z68A 4KQXA 4BFUA 3STYA 3WGVA 3DGFC 2J85A 1G7TA 1QH8A 1XFDA 4PR3A 4JAVC 4BGUA 5EINA 1J90A 3IHTA 1CUCA 3P2KA 2QMOA 1K7SN 1P0FA 3F5MA 2HI0A 4O2AB 2UV8A 4MW6A 5ALDA 5I4BA 1RXSA 4YLYA 5AW6A 5JAMA 4GFDA 4P7GA 4BBPA 2DOKA 3DMFA 4HXYA 4F3RA 4ARUA 4F3YA 1U8CB 1SRRA 2H06A 2CL0X 3ETHA 4LZOA 3GLGB 1Q0UA 2AZ4A 1LVGA 4LRXA 2EFCB 1FDRA 1GNQA 1U7TA 5CB4A 3EIXA 4MUKA 3LWBA 4EG6A 2ZJFA 3KPWA 3ZH2A 4U6NA 3QUAA 2ZB3A 4AWXA 1MFZA 1FEZA 3LWDA 1CZKA 4N54A 1DOZA 1P77A 2VJPA 4GKVA 5ALHA 1YZTA 2C77A 2DFPA 2YDXA 1ZOOA 1RQXA 1GQYA 2QPTA 3PG5A 3J81k 2NSDA 5AUQA 2CLKB 1XGKA 4TYYA 1WPXA 3UY4A 3B9QA 1A9TA 1JFLA 1EHCA 2A0UA 2W71A 1K6MA 4QGHA 5AK0A 3V3KA 5B1IA 4F6RA 4KRFA 2HL6A 1N2IA 2AEMA 3AR9A 3PGA1 3T0IA 4B6OA 5BURA 3AY7A 5EZYA 2HWWA 2DWOA 2DVMA 2I22A 4QVIA 3V4PB 4EMTA 3D6JA 5JPCA 3HCEA 3AUFA 3PEEA 4OHRA 4KXWA 2G67A 3AESB 1BO6A 3VR0A 3EW7A 2XRFA 3MTIA 3RSQA 1BVYF 2IVFA 3D4IA 1V7PC 1KO1A 4AKGA 2O2IA 2D06A 1OHHD 1JQ5A 1AF7A 2NYVA 4YMIA 4EJ2A 3E1SA 3U48A 2EBUA 3KQMA 2WIDA 1AN9A 1T9AA 3K4PA 2WJVA 4YMSA 4CHTA 2PJRA 3JVDA 1T5OA 1I1HA 3O38A 4AY3A 2BFBB 3RFVA 4A15A 4G0QA 1ETHA 3MUNA 1DBSA 1V6SA 4NRDA 1KU0A 3QKSB 4US1R 4HNHA 1U3WA 2W6IA 3UAWA 1Y3IA 1GKIA 2ZRGA 1X15A 2JJ8A 3AJ9A 1MVNA 2F3SA 1LD3A 3EPPA 3KHUA 5C7IO 1WR8A 1OXSC 2BHTA 3AEYA 3EW9A 3JQBC 2HJWA 4RHEA 4N6OA 5JR3A 2V7BA 1TW3A 3UOWA 1R27A 1I36A 3EN0A 4TQGA 4EVIA 1JWLA 3F4LA 1ZXBA 4ZAXA 3F6SA 4RKQA 4ZT2A 3G8CA 3RSHA 9LDBA 4YMGA 1TYZA 4DV3B 3RQIA 3TDNA 2HREA 4Y1FA 3SMVA 2WU4A 2ODWA 3VR6D 5B12A 3RADC 1PR2A 4GR4A 1EDDA 1FU7A 4KX5A 3GP8A 1KFKB 3D7NA 2WINI 5CVTA 1Z34A 3NHMA 3OPNA 1UBEA 3EUAA 4AKEA 3PQ7A 1FUUA 1DIGA 4M7PA 1DDGA 3ENWA 4Q12A 5E7IA 4E32A 4C7MA 3IP3A 1XHLA 4RFSB 4WADA 3ORQA 2X6TA 5C1OA 2A3RA 1QFMA 1LRLA 1PJQA 2W6MA 3D6FA 5JAQA 4ZANA 4GI3A 1YUMA 3QPVA 1Y4UA 3M3HA 3EPHA 1K88A 4YRGA 4NE7A 1QRRA 4K9NA 1PNVA 4P6VF 2QR2A 4K9DA 3PNLA 1DT3A 4X1IB 4XDGA 2OXIA 2ZE6A 2RB5A 2C3UA 4YV1A 8ATCA 2I2AA 3FCUB 1GUDA 2GS9A 2Q0XA 4KREA 4M98A 4PAQA 2P2ZA 3FFWA 3IUSA 4W5QA 1VXRA 3F8TA 5HJ5A 4FFOA 1SIWA 2Y9MB 1WXXA 2BHNA 2II6A 1AGXA 2YV4A 4L0QA 4EY4A 1LSJA 1SAYA 4MPRA 1VL1A 1L8LA 5B4VA 1ZYUA 2QZJA 5JSKA 2E4VA 3TLYA 5LA6B 3WYFA 3P2OA 3GMIA 1QV9A 1RQNA 3KYBA 2NUPB 1OAOC 1RBMA 3AHIA 4R83A 3RUEA 2P9YA 1HLDA 3U13A 1GTRA 1IEQA 3O3CA 2COEA 2Y1FA 3A4VA 4EHHA 3D4BA 5AMXA 3FHLA 4PZ9A 2AR7A 1N1MA 5DWQA 1VRCA 2PH1A 4KQ2A 1WCXA 1V41E 2O50A 2CLCX 3GLQA 1C2YA 4OK6A 4C6RA 2V4UA 1T0PA 3U0VA 4A9AA 2P8JA 1FW6A 3RF7A 1UF9A 1SBQA 2GPAA 3GDHA 3MC1A 3MRVA 5FAXA 3ESAA 2GPJA 4J0QA 4EKIA 4IMPA 2Y4OA 3CMCO 4JK3A 5BN3A 4XJSA 1TX4B 2VYQA 3FVRA 1QTNA 4D74A 2ZIEA 1RWWA 1QYIA 3GQVA 3K9WA 4JOBA 4V2IA 3FZQA 1EBFA 4D6YA 4LFAB 1YVUA 1BKDR 2OBYA 2PZLA 3E7PA 3EZXA 3NXSA 5CVDA 1WMSA 3WLJA 3JD1A 3ZDQA 1RABA 1RVDA 1AO3A 1BEUB 2O4CA 2FTKE 1DV1A 4ZD6A 3DMTA 2VQEB 2FN9A 2Q27A 1KDTA 1AQIA 1HZZA 1KOJA 2W0SA 3UK6A 4UTVA 5MN5A 3T5TA 1BD3A 3DVAB 3IVCA 2G1KA 3P9YA 4GEGA 3TLMA 4URFA 3NYWA 2GKOA 3RS0A 1VYUA 3PDJA 4YALA 5K0BA 2C4TA 4JC5A 2WNIA 3JQ8A 4NH0A 2G6BA 1HZJA 2KW5A 1KYYA 3HDQA 3HMQA 1DLJA 4WD3A 3GT3A 4V0RA 1K92A 2VPQA 2OCDA 4IFBA 3H6HA 1SD1A 2BJWA 1EXMA 1QIIA 3BWVA 2JPDA 2YKGA 2D0PB 1XA4A 4H7FA 2WTUA 3BREA 2Y1XA 4D8YA 4DA4A 1BNCA 4BX8A 1TGVA 3TNYA 4K03A 2P2DA 2P4EA 4X8HA 5KYUA 3WWDA 5I7SA 2JGFA 3E70C 2AUMA 3G8BA 3RVLA 1SCNE 1NVDA 2FWMX 3MXOA 4Y6RA 1Y34E 1OY1A 1NQ5A 1E89A 1ZIOA 2ZWPA 2C5BA 1NTRA 2I6FA 2HCFA 4ZJZA 5FWNA 3ORRA 1LUAA 3N53A 3OTQA 1ZH0A 4LK3A 4EY8A 2GM3A 2WMDA 3FWNA 4IS3A 3AVQA 1AQLA 3VRHA 4CM1A 3V4FA 4YRLA 1CZLA 5K8IA 2VXCA 4UVEA 2WWGA 1C3OB 1MC5A 1L4UA 1W8DA 1RYNA 1W36B 3O4IA 2HXGA 4LHYA 2RGCA 2JGRA 1Z6QA 5BSMA 1XTBA 1Z6XA 1OCEA 3C7KA 5DYYA 1VIMA 4EVQA 5JNVA 2PFSA 1U0LA 3WWOA 3VO9A 3DUWA 4FEYA 3R75A 4PSCA 4JLVA 1D4OA 3F1KA 2ONYA 5LSAA 5MF6A 1J8VA 5DJ5A 1M3SA 3GUCA 2FZEA 4YRAA 1PL7A 2PX4A 2CLFB 4AYTA 1Z5ZA 3ZDCA 1CETA 3PL1A 1I30A 1B3BA 2QPLA 4XYBA 5DIZA 5F52A 3SC3A 7REQB 3RJMA 3ZBTA 1XYGA 2QORA 2JHAA 3UF0A 1UK9A 3E4CA 1O95D 5DI9A 3LXRA 1OYWA 3QU5A 4LE1A 4HNAB 1QDLB 3ZLJA 2JFGA 2D13A 4M1MA 3HEBA 5F9MA 2DFLA 2ZB4A 2CUTA 3DDZX 5EMJA 3M8KA 5JRZA 3BEDA 3NGXA 3SWWA 1RCUA 4GI2A 1SIBE 4B73A 2A0WA 2Y0EA 3AOEA 5E6SA 5C8XA 4URXR 2C88A 3Q7IA 4PM4A 4WL0A 1Z6GA 1EA7A 3H9UA 3KOUA 3SQDA 1S2IA 1O87A 2H0QA 2JFQA 2QN7A 2Y68A 2XCLA 4X61A 5FA5A 4AFNA 1L2TA 1UDBA 4BFTA 1B15A 5E3JA 2J46A 2Z1MA 3U80A 3EQ7A 2V98A 1GQOA 1U6IA 1XXHE 2CN1A 2CEAA 2BGRA 4EKNB 3MBOA 2W2KB 2O7RA 3OFJA 1KMHB 2HH9A 4BVFA 1JEYB 4HEA6 4XGKA 2AOXA 4C22A 2XB9A 2YWHA 1GILA 4A27A 2AR0A 3E9ZA 5FUXA 5G1NA 4RD4A 5GAJA 3RTAA 5J23A 2FN4A 2MWMA 3TQCA 3DE0X 3MMXA 4PZUA 5IBCA 3GDWA 4B43A 1I1OA 1GV0A 3GPCA 4LZWA 4WAUA 3HA5A 1NC1A 4Q9LA 5C4GB 4BMSA 1RYEA 1QHNA 3HCNA 4B3XA 5CT8A 3A32A 2X0FA 2J8ZA 2VVTA 2Y1CA 1TRKA 4LZZA 4YT5A 5TE9A 1XTIA 2HLHA 1Z4PX 5ECWA 4R1OA 2FK8A 4YDSA 3T15A 4JITA 3RWBA 4GI5A 1BU8A 3KYDA 1MQAA 3NW9A 3O9MA 4ZC8A 1IJBA 2I0FA 3H5VA 2VQDA 4L5CA 5J1TB 5BV8A 1XSEA 2BFBA 4EQ6A 2OC9A 3D3NA 3PIIA 5C80A 2HSZA 5EJ9A 1VP3A 3U3KA 1KK2A 2ZJ6A 5IJWA 1WMBA 2J3KA 2YMLA 2P5UA 2A9QA 4IIBA 3I8OA 4NCXA 3U39A 5ERXA 5C32A 3IERA 1UJ2A 3B3FA 4BNGA 1JG4A 3QMVA 1L7DA 4WN3A 3RRJA 3UPDA 3B1VA 1CEEA 3I34X 4PNHA 3LQKA 1L8OA 3L0IB 3AEQA 3ONEA 1I4LD 4Y9SA 2PL9A 2ZJYA 3QEJA 2GVNA 3JVEA 5DZSA 1QVVA 5FOSA 3WGTA 1JPVA 4I9GA 3V1KA 3C6QA 1VE5A 4OL0A 2YXDA 4TV9B 3N58A 3MOIA 4BUZA 3RVJA 1UBHS 5KKAA 1KI8A 4E31A 5IF3A 1NXQA 5HQ3A 1P5ZB 2Q2NA 1P80A 3ABZA 1OH5A 2V8OA 4ARSA 3O4HA 2YXEA 2HYDA 4HGYA 3HB1A 3W1VA 4WECA 3WDSA 1W52X 3WLHA 4Z4EA 2W2TA 4QLAA 1E7QA 1Q44A 4G5YA 1N4AA 4XWKA 2XY4A 5CVCA 4CODB 1P72A 2QNRA 2VUUA 3R09A 2CBXA 4JMPA 4ISCA 2ZIUB 2D62A 3IEUA 3VISA 1YB2A 3K4HA 3OCJA 4NV1A 3Q10A 4ANFA 1NW9B 1U80A 1RACA 1AS3A 5HKKA 3EDQA 3OESA 3Q12A 3GBVA 1SA0B 2PKQP 1NW3A 1LBEA 4DQLA 1LSUA 4PZCA 5FWYB 2ZRBA 5KTKA 1YZGA 1QX3A 2CLMB 5FBZA 2PNFA 3VBEA 1E98A 5K0LA 3WJ2A 1ECFA 4YVFA 3WWZA 4FWTA 4KVZA 3N05A 1ZINA 3U9TA 3ZN2A 1BG6A 3KB2A 1WQ3A 5AKZA 4IJVA 2I1WA 1YS4A 3U16A 1O97C 4LVUA 4DE5A 4TKVA 2ZYGA 3TTUA 3M9WA 4DR2B 4RGQA 1CS0B 1H8HA 1LBIA 2J0QA 3HDJA 1H2HA 2G04A 3MHTA 2WHPA 4ZJYA 3QU4A 3R3SA 1E2UA 4RE5A 2FHPA 1Z3IX 3IAS6 4C5CA 4RETA 1TLFA 1NZDA 1LJUA 2WFZA 1O9BA 4K1LA 2BGJA 4WXPA 4BBZA 1CUZA 4QT4A 4ZEMA 3C24A 1INLA 1S3IA 3D6MA 1YDWA 1M75A 3QPAA 4FLEA 4FEGA 4DLPA 5F9HA 2W2VA 3G2NA 4GOOD 5FH9A 3BBLA 3FUWA 3GDFA 2F8SA 2MSLA 1FNCA 4JWTA 4R0VA 4U5XA 2ZROA 2CVFA 4BFCA 5H8WA 5EUQB 2P9QA 3C5EA 3RVQA 4WJZA 5GONF 4R6WA 1FJHA 3C3EA 3K0KA 4WJKB 2ZXFA 1ZXLA 1F5SA 2O7QA 2E21A 1X9HA 5KVSA 1I6KA 3GELA 4OP2A 1AB6A 5C5IA 1BIFA 1HE1C 5EESA 2FRDC 1JEAA 3M5CA 4RUKA 4BQIA 4XFJA 1SC1A 1ADBA 5ELLA 2PS3A 2B78A 1TUBB 3OOSA 2ONKA 4D8TA 2FPMA 1XOIA 1YFKA 1W85B 3A26A 1E1CB 1R15A 3FYHA 4XD2A 1OWPA 1V25A 4UFNA 2JARA 1F2UB 1Y9EA 1HOXA 2JEYA 2KM1A 4PSAA 3EBLA 3MTEA 1IUOA 1VGVA 2QJFA 1M5RA 3N0RA 4LBVA 1N5MA 1NBMD 2R6ZA 1ADFA 1M33A 3CLSD 3BA6A 4K8OA 4S1WA 4WH0A 5EYPA 4H1WA 1XXHB 2WUVA 1EJ6A 3M81A 4CETA 5HKKD 1XNQB 4M9XA 4FK8A 3WMXA 1K86A 5LC1A 4JB2A 5C8ZA 5EJ8A 1W76A 4KK4A 2G36A 1ZZGA 2GNPA 2JIDA 1YHZA 2VPZA 1A2QA 2IX9A 1RPNA 4TWAA 1L9KA 2CDAA 3R3UA 2AD5A 1SB8A 2WY2D 2Z2KA 4IS2A 2N1BA 3CZMA 2ACWA 4ZAWA 2NXWA 5IWAB 4X8LA 1YR8A 5HFNA 5HKAA 1OFHA 1T5IA 1FLDA 3FOCA 2JFFA 3EXG2 2F9LA 2WSIA 4JLNA 3W3ZB 4K81B 3K6KA 5FD8A 3D6HA 4CV3A 5BWCA 6Q21A 1GFZA 2HWXA 2C3YA 3OX1A 5AK6A 4F11A 4V39A 1GYQA 1DIBA 1JYSA 1E7RA 1Z4OA 4OKNA 3SXJA 1GGJA 1ODLA 1I7LA 4LE0A 2X0RA 5H82A 3FMGA 1P5FA 3PFCA 4Z9FA 3ZOZA 1S89A 4FC6A 1RNLA 1LLUA 1T10A 1QTRA 1U02A 1TK2A 2BMEA 2VDNB 5JXWA 4HVCA 2JD2A 2ZRJA 3AL3A 5F7OA 2L19A 1O6ZA 3ENVA 5E6RB 5BW6B 1ZEJA 1TM1E 2HY7A 2L69A 3DT6A 4ILKA 4BRZA 1RYYA 1B2RA 1LU9A 3MWEA 3NIBA 5JS6A 1NDUA 3TAHA 1NRJB 5EXXA 1ZLXA 3FSEA 4CU2A 3A6EA 3I58A 2WHQA 5FTMA 4HATA 3TCKA 3WIOA 4EY3A 5BMVF 1MTZA 3S2ZA 2O2GA 1KP9A 1TPZA 4MVYA 4JFAA 4FUQA 2P0YA 5JCPA 5TV2A 4KO3S 1F6WA 2ZLBA 1G3QA 1G8HA 2EFYA 3F5SA 3Q1LA 3QLJA 4ILEA 3O9ZA 1CJKC 4WGFA 4DMKA 1UOEA 3BK1A 3T3GA 2JJMA 3W1EA 4RANA 1NV9A 1QP8A 1Z18A 1Y4DE 4HGNA 5ECGC 1EU1A 5JMWA 5KVCA 3CS3A 4CM8B 2GPNA 3R7NA 1TC1A 1ZVQA 3JYOA 1MIOB 3RIMA 2ENWA 3DFIA 4L3OA 3V2HA 3IAS1 2EF0A 3KQYA 2KB0A 5KCMA 1YB4A 5KC9A 1SHKA 1H6CA 4CNBA 5KQPA 3LJKA 4I1OA 3J7TA 3QFRA 4L28A 3X2FA 2HF2A 3FJYA 3HKDA 4DUZB 2YASA 1O9GA 3KL4A 3RLFA 4ND2A 2ODNA 3AF5A 2W11A 2YZKA 5GTDA 4BV9A 1U9IA 3GLVA 4MUEA 2AZXA 1UBGA 1GKLA 5FJJA 4GPBA 4F2DA 1T29A 4LYAA 2CV0A 4D0NA 3OX3A 3CUEF 4WOKA 4C03A 4OBXA 2ZM5A 1ZN9A 4P4GA 3V33A 2ZRAA 4NMXB 2NTEA 4GX1A 4EYOA 4U6SA 5CA0B 4H31A 3TDKA 4QRIA 5BV2P 1AOXA 1GO2A 2C9ZA 1BKYA 4LJ7A 3HDTA 4O1MA 4X71A 5DHRA 4IV0A 3ZGVA 1L1QA 4KR7A 5D1NA 5HBRA 3TZCA 1G4UR 2H7YA 5IC6A 4J76A 3ZHZA 3ANMA 1GV1A 3K4QA 4DB4A 1GLNA 5A0TA 2JLSA 3ZZUA 1XRRA 2B36A 4EB6A 4KLZA 2JFUA 2O2ZA 2A1UB 4XJXA 5ALJA 3VM6A 1R0XA 2EQAA 2AD1A 2AEFA 4ED9A 3AYXB 1VIAA 1YVEI 3L6BA 3HFGA 4ND8A 5KNDH 1VPEA 5IAJA 3HJGA 2P8SA 3AR8A 2W90A 2B3DA 4XWYA 1NQAO 3IQDB 4EFKA 1Y4SA 2J67A 3MMZA 3N2GB 4G4GA 5LLDA 2IE8A 2HB6A 1JIUA 1AKWA 2CSUA 1AQNA 3W9UA 3PD7A 1R6TA 2AK3A 3WO0A 4W8OA 3SSOA 2Y4NA 3TJZA 2ZYTX 4HJRA 3FHTA 3SHFA 3AFMA 4UKDA 1QS0A 2FPPB 3F5QA 5A1JA 1VLJA 5A05A 4YT2A 4H3VA 2JBHA 1MQ8B 2GLUA 3QXGA 4HDNB 1BJRE 1MB2A 1SU8A 4J16C 4AZTA 1LC0A 3CH4B 3TD2A 2XQJA 3V2GA 1SBHA 3V48A 1M7GA 4HYYA 4L72A 5AM5A 3NNDA 2BFOA 2I99A 2F1KA 1GD1O 1QPGA 2UZ1B 2ZRMA 4KGVA 4B32A 3C8HA 5LDDC 1YCGA 4M37A 1N8SA 2L42A 3MGKA 2JLRA 1FVHA 3U4IA 2W9XA 3NR2A 3ZWVA 4DIUA 4B4OA 3Q0EA 1BS2A 2BCEA 5DULA 2QRQA 3BULA 3NYRA 4M8LA 3IFSA 3A1DA 3NEJA 4Q4LA 4YMWA 2RGGA 1VLVA 2Q3CA 2O4UX 3E3NA 2G80A 1RMQA 4X92A 3G0IA 5ED4A 2G4LA 1EZ4A 4DGSA 1H94A 3SLKA 1BMQA 3F7MA 3QXHA 3O8DA 3HCOA 4U2GA 3VVMA 4DMUB 1XVTA 3N0VA 4CMBA 4U7DA 1TE2A 1K6IA 4MQ6A 4Q4DA 2YX1A 1TJ5A 1PG2A 4UHKA 2HIGA 4DNPA 4GNKA 1ZK1A 2Q5FA 3LY9A 3MGBA 2VYCA 3Q87B 4GPZA 1L7PA 2IU0A 1YTUA 2JJ2A 5LA6F 1U2GC 4OI4A 1Z0IA 1Z35A 1RXYA 3OU2A 1OXVA 4MO9A 1R4AA 1C0KA 4YRDA 4OL9A 3F2IA 3PQ4A 1XDZA 3TLEA 5IKPA 4RAOA 1YJCA 4GXRA 1A1SA 4DAOA 4EPYA 2AUTA 4OMFG 1UWVA 2GM5A 3NEYA 4MR8A 3QEMB 3BHMA 1FDTA 4XQ9A 4ZCTA 2GCOB 1K8QA 2QRPA 2GAIA 4ARZA 3K1ZA 3ZY3A 3EEIA 4DIBA 4QU0A 3DT9A 3LGXA 5EJGA 3WMRA 1U7OA 3HPQA 4NZMA 3GF4A 3QOYA 2HNKA 4X5OA 5IEJA 2FFQA 3ODGA 4L3WA 1C4WA 4GGOA 1OI4A 3PFFA 4NBRA 5GIOE 1MPTA 1Z0KA 2WLTA 3NP7A 1AS2A 2EZ9A 3O1JC 2XMZA 2VAVA 3TG2A 3L8HA 5E7JA 4BN4A 2D4AA 1T15A 3RF6A 4EA8A 4YGXB 5JDCC 1FYVA 1H0KA 1OZGA 3A9VA 3UXEA 2GD0A 4AP9A 4HJXA 4HDSA 4HYEA 1U2DA 4J49A 5CIWA 3UC9A 4D4LA 3C3CA 1OAKA 5DNUA 2I34A 4FT2A 1WEHA 4MP3A 3G6WA 2IYPA 2RE8A 3IDFA 5K2MA 1W85A 5CNIA 1E1CA 3H7AA 3KVYA 5E2AA 4I2NA 3WDLA 1RKVA 1ZAKA 3UB4A 4QDUA 1SHZA 3BHJA 3NKVA 2PX6A 2E6UX 3SVTA 2K6GA 1LVHA 3ID6C 2XBMA 1KZ1A 5FV4A 1C1HA 4RBNA 5E4JA 4BO2A 3WADA 1DRJA 3TEMA 3D31A 5T4BA 2ZTMA 3NRCA 2C2GA 4CM3A 1XEXA 4TWJA 3V8VA 2X19A 1C2TA 2HRQA 1WSBA 1CNMA 3FVTA 4QUAA 2A9VA 2FZCA 1YA6A 4DB2A 4IX1A 3DQZA 4JKYA 1G66A 3V9PA 3RRYA 1WA5A 2JJ2D 3DL4A 3IOBA 2NTNA 1H0HA 5DCLA 3BIJA 1G55A 1LV8A 3N70A 2XZOA 3QVWA 2FPIA 3K1YA 3OZBA 1UKBA 2J6CA 3OG9A 4LEIA 1RC8A 4FMBB 4DR4B 3OEHA 1YQQA 1USUA 3THRA 3BGWA 4E5MA 2EGUA 1V8OA 2PD6A 3HJRA 4AW9A 4DABA 4JVNA 4KYTA 4A6PA 3O90A 5DYGA 2JLXA 2DUNA 1NR1A 3CURA 1WSAA 5BQOA 4FC7A 4E88A 1PRYA 3BSSA 4UU0A 1TC2A 4EW3A 4BCCA 1K89A 1X94A 4NCHA 4D4HA 1CR0A 2VYVA 1RS0A 2Y1OA 3NDJA 4YQZA 2QF7A 5COQA 4Q7EA 2X3FA 3UJHA 2NP6A 3NHRA 2Q9AA 3PXCX 4KYUA 4PAWA 2BGUA 5FCDA 2QLMA 4KTVE 5CAEB 1EP1B 2UZ3A 1P5RA 4TVOA 2FPLA 1ZITA 3ENKA 4TLMB 2Y66A 1KFBB 1W5SA 2R8XA 3TLJA 5A7HA 2TS1A 4PSVA 4DEVA 1EFHA 1WXFA 4RACA 4JHLA 4BS9A 2FGKA 1SHUX 5HF8A 3B1YA 4UEQA 3U37A 4AJJA 1U63A 1GTJ1 5AI9A 4FYMA 3C8ZA 3EZ6A 1CQJB 3T1QA 2HUPA 1SR8A 3DD5A 1Q0ZA 1M8JA 1AKVA 1JHDA 1CD5A 4ZC1A 1PDVA 3Q7RA 1KI3A 1ZMTA 4N65A 5LWHA 1P4RA 3GVCA 1A27A 4DN6A 3CEAA 3U3OA 5THQA 1MIOA 1OAAA 2HQ1A 2J9FA 4B2LA 3LDGA 3AVXA 2EKPA 1XK7A 3TEJA 4QBFA 3G59A 2V03A 4QJBA 4GZLA 2EGGA 1UK7A 3VVBA 4EW1A 3KPYA 3U7QB 4LDZA 4EGJA 1D1PA 4REQA 4ZA2A 5EE3A 5F5NA 3PPIA 3GEBA 1TRHA 4CRWB 2K2QB 1H05A 4I4IA 4QBIA 4BUCA 4B3JA 3OIUA 3V1UA 1RPTA 1MW8X 3K73O 4YRQA 1HDIA 2DFTA 3VZSA 3NTLA 3M6VA 4LJ5A 3LWNA 5EWLB 3V4SA 3O91A 1P31A 4RHXA 2GBPA 3KVVA 3KZNA 5ER6A 2ZS8A 1SG0A 2C5EA 3ILVA 4Q21A 4RSHA 4MW4A 1I4OA 3OZEA 5ALUA 3UCEA 4L4YA 3BORA 4B84A 3LE8A 3JPWA 1OYYA 4DA7A 5BSVA 3S0JA 1ZOPA 3HGTA 4J3FA 4PFQA 1IY8A 5K3AA 4K28A 4M9RA 3X1DA 1RJFA 2OXRA 1DX6A 1IIBA 2DSNA 3EEBA 2VYVD 4JX8A 4WGGA 3V7NA 4E7OA 1UFQA 2CFRA 4I0WB 1PSWA 2ZJ1A 1CUEA 2V6JA 4YJ2B 4DA0A 5KNCA 1MXHA 2FDCA 2E18A 1THMA 2A1UA 4OJQA 5IARA 5F23A 5ALGA 2JK0A 4N47A 3BWYA 1ADYA 2ZW9A 3KAQA 3VV2A 1ORHA 2RHJA 2B99A 4KKVA 3RHFA 3LC0A 4MQEB 2YNMA 3KE9A 1KZ7B 3S28A 3PUYA 5JMOA 5L3RA 3ACBA 3UA4A 5CDTA 1SZDA 1F60A 4LZAA 2D1TA 1KKMA 3HB4X 2ZPAA 3A25A 4DCVA 1E2BA 1NMEA 1OV4A 4TV9F 4X45A 4C4SA 2QBYB 1ZJJA 4D4MA 1BMDA 1NXXA 4LZNA 1G20A 1A7KA 4CCWA 4GMHA 5D51S 3U3RA 4CF7A 4OD0A 1SZPA 2ZG6A 3P0FA 4QTTB 4UULA 2B4KA 5CVEA 3GHHA 3HA3A 3WHPA 1QQ6A 4HDNA 5C31A 3LH5A 4HNVA 4BDTA 3G5UA 1WB9A 5ECDA 1LZKA 3AOGA 3W2FA 4QATA 4MWGA 3RBZA 4WCVA 1N2EA 1U7UA 2QVBA 3EXHA 3KVOA 3L6UA 1QANA 3BJEA 3R3YA 3TMYA 5KYYB 2XB2A 2X76A 2UZ1A 1DX9A 4CKXA 1NVVQ 4JP1A 4CF5A 3L7DA 2A9FA 1MJHA 3OWXA 3P1JA 2ATVA 1OSNA 1GGKA 4M22A 3A6FA 3ZIDA 3ZW9A 4IHJF 2CEKA 1S3SA 2XUAA 4J1TC 4P4SB 3IXQA 1HNZB 3QE0A 4MEAA 1Y3DE 2WIGA 3I09A 4HAXA 4QDXA 1WABA 3N6VA 3NHFA 1U0JA 2WE8A 4GR5A 2J9GA 2OL4A 3FPKA 3G5AA 3IQHX 4NYJR 2NZYA 2CE2X 4BKQA 5IAKA 1TFRA 2JVJA 2XYVA 1E0SA 1O1YA 1PV4A 1XD9A 3PT5A 5LQRA 1M1XB 2J5KA 2IEBA 4QBKA 1RPJA 5F35A 3OE7A 3PEYA 1LS6A 1Q1QA 3LZ6A 1KFJB 1XTPA 2HV8A 4EO9A 2P68A 2HMVA 3I83A 4OXIA 5TS3A 4J75A 1EUDA 3U7RA 4JWKA 1T8RA 5HR5A 1NFQA 3ROKA 1BX3A 2E5WA 2B5OA 1ZMBA 3T0FA 1DXOA 1NYLA 3OOEA 3ORFA 2YNMD 3QU7A 5CCBA 1LK5A 2BFFA 3JQ9A 1NJ2A 4QUIA 1ZRHA 4GP7A 4WOBA 5JG7A 3AVVA 3E0QA 1MLDA 1JHRA 2DC1A 3QNWA 4HQ0A 3EGEA 3SE0A 4F4FA 4U7HA 5F3DA 3O8QB 3DMGA 1E6UA 2WF8A 4HUQB 3TSOA 4CV1A 4P38A 4J0JA 5C8VA 4P83A 4D45A 2EERA 1QNFA 3KEMA 4MV4A 1LBQA 4XM2A 1FP6A 1YFZA 1S01A 2IEIA 3H1EA 1XVIA 5GV7A 3M4NA 1USWA 3OOWA 5FPSA 2EFHB 3AV0B 5D87A 5HCUA 3INYA 4L8VA 4A8TA 3ITKA 4JJ8A 1GKYA 3F74A 2HJSA 3HKEA 2INGX 4KQMA 5D86A 4QM6A 3I2FA 1N9ZA 1PL6A 1YR3A 2OG1A 3HRIA 5C0OE 5KWIA 2REQB 4MR9A 4N39A 1ZSYA 4ATNA 4PPGA 5T4HA 4OK5A 1V39A 1IOVA 1MAVA 3PWTA 1N1EA 3HYTA 1Z0DA 2FW0A 4HYQA 2AMLA 4KDCA 4YP5A 5ALMA 3NJ4A 3GGGA 1RWPA 1N0UA 3NHKA 2G1PA 4J91A 4COOA 5AKEA 1KBQA 1TIPA 5LZ8A 5LYJF 2IY7A 1DTSA 1CZUA 3DKIA 3A36A 3ZI0A 1CK4A 4BKMA 1A3CA 4C0SA 1I3MA 4LWQA 3ZCRA 4JUDX 4OAQA 3ROEA 1EUZA 3AHHA 4IP0A 1SIOA 4HB0A 3JR7A 4XQGA 2UAGA