1DAFA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid, adp, and calcium
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHETASE
total genus 71
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dafA00
3VHLB 3SN6A 4F38A 5G3ZA 1TEXA 4FCVA 1R5BA 2HJVA 3AF2A 2RKOA 4Z1MD 5KU1A 3QEOA 1RZ3A 1X1RA 1G8FA 3BB1A 5TB5A 4DLYA 3I61A 1KI8A 2F43A 2SHKA 3I5YA 1U94A 4LHYA 4PZZA 3ZZTA 4M9XA 1COWD 5AWFC 4JVLA 1OXSC 3MSXA 4RVCA 1O87A 1OXVA 3NDPA 3AUXA 4BUJA 4AC9A 1VG9B 4RD0A 3MG9A 4FMDF 2FEMA 3LY5A 3SR0A 5C1BA 3IIMA 3OE7A 3EPLA 2IEZA 4PPNA 4PFSA 3B9PA 3RRNA 3RVBA 5EE5B 2ZUBA 2ANCA 2ZI9A 1NG9A 4JVMA 1XPOA 2WWHA 4EJSC 3KQHA 4OQFA 4PSAA 2AK3A 2I1VB 2WSSA 4Q03A 3RS7A 4DRZA 2PEZA 1YR6A 3FDIA 5DLQC 4PO1A 2IYQA 1GNPA 2OUKA 3I32A 4BLRA 2CCJA 5HZHA 2ZRAA 4XD7A 2WKPA 3DOFA 3A1UA 4DLRA 1P9RA 3DM9B 4WIAA 4IEIA 1W4RA 1RRFA 2IYLD 2WPDA 4YMVA 3OIWA 4IDOA 2J5XA 2R8RA 1VYTA 4B3BA 2AD1A 1KDPA 2C99A 1KO4A 4NYMR 4RKEA 1F60A 1P9NA 3L8ZA 3CNLA 3BRWD 3T1QA 1YZNA 2GTPA 1YZUA 3EA0A 1E79D 4PR0A 4RD3A 2R2AA 3GLHA 1N5JA 2W0SA 4KFSA 1FX0A 3CB4A 3SJCA 4A8JC 1GG2A 5K8IA 2OG2A 2ZYTX 3TVDA 3UIEA 1ZD8A 2XTMA 3LLUA 1N6IA 2DFKB 3N2IA 3VAAA 3IQXA 2FJUA 4X8LA 5GADl 1LFDB 2QEQA 2NO7A 3K70D 2JJ1A 2VP6A 2EYUA 1E1QD 2PEYA 3RS3A 2GXQA 4P4SB 5JJIA 1U8YA 1Z2CA 1S9DA 3AH8A 4V0KA 4PPGA 5FPTA 2NQ2C 5E7MA 1Q1EA 4QGAA 1ZVQA 4NL4H 2GJSA 5JZVA 1VYUA 2WIBA 2CE7A 4X8OA 1S8FA 1M34E 2OESA 1P9WA 3U5ZB 1SKYE 2FNAA 4EJSB 2RGGA 1QHYA 1AS3A 3M4YA 4EPTA 1CU1A 1P3JA 1ZM9A 4ZO4A 4B33A 4E5UA 1NL3A 2BIFA 2Z83A 5IDVA 4TSFD 1AKEA 2QTHA 1E4VA 2C98A 3FHOA 1OH5A 2D4HA 1UAAA 2YWGA 4MGKR 2GAOA 2EFEB 1UEJA 5DYIA 2ZRGA 1EESA 2IHBA 1E2JA 5EZ5A 4Q1CA 3U4QA 1VMAA 4C2UA 4DUGA 4IOKA 1RW4A 1XTJA 1ZJ6A 3OIVA 4M1KA 4N0DA 1IJFA 2JJ1D 4QJ4A 4C7OA 3EXAA 3AVPA 3WRYC 2IW3A 3K8YA 4BEJA 4UJ5A 1E2HA 2QA5A 4EJSA 3OFND 2GWHA 2X1VA 2ZR0A 4HLUC 4ZIRB 4A9AA 4URYR 3U3RA 2OAP1 5DHAA 3HPQA 1W0JD 3U7HB 2WMNB 4URUR 3ZS8A 1KSGA 3CLVA 4QRHA 2BV3A 3QUSA 1L4YA 5JS7A 3F0TA 4JLPA 4NPHA 3BFKA 2Q9CA 3IPXA 1QBKC 1ZM3A 4M2LA 4P4SA 2IS2A 4K81B 3QQ5A 1XD9A 1GNRA 2A5GA 1GWNA 4U5XA 3GEIA 3G82C 4RCZA 1K5GA 2G3YA 4XIGS 1Z0AA 1N0UA 3K70C 4WBSA 4DDUA 3EIQA 4JT4A 4B35A 5J4YA 2HV8A 4PC6A 5DE3A 2GK7A 1VG8A 4BZXA 3LO5A 4JS0A 1J99A 4TL7A 3VKWA 2ZPTX 4QM7A 4O25A 3IGFA 4JLMA 1QVAA 2BHRA 5GVRA 5F98A 1N5KA 2OCYC 3MGCA 2YNMA 2BKUA 4Q9KA 1GKIA 1OSNA 2B6HA 4IOMA 5FFMA 4GBMA 4A6XA 5FH9A 5JHHB 3VR1A 3ADCA 2CHGA 1MV5A 1EFTA 1IBRA 1WXQA 1TTTA 2ZU0C 4AKHA 1TADA 1LS6A 4B73A 3ASYA 2HT1A 1E2KA 1CIPA 3WXMA 5L8VA 2UZIR 1QHGA 4IFBA 1OH6A 4RJLA 3AKEA 4PC1A 2PCJA 3W6PA 3QXXA 4MGYR 5D3MB 2KWIA 1IN6A 1RJ9A 2VP2A 3ADKA 4OKSA 5CB8A 3OESA 1S96A 3GCGA 3QEJA 4CEHB 1LF5A 3TSWA 2HEIA 3SE0A 2VEDA 5JMTA 4FCTA 2AKYA 5AJXA 4GZMA 2D2FA 1JBKA 5JJLA 4FCWA 2C95A 3CPHA 3LD9A 4GFDA 4A1FA 4EFLA 1ZUHA 4PAOA 2FH5B 1AKYA 1CJKC 4A2PA 3HR8A 1KMHB 4HZIA 1W0KA 3I3SR 5EE3A 2ZJBA 1KI1A 5KPDA 1J90A 1P2UA 2ANBA 2PMDA 3WMGA 5JSZA 2WOOA 2A2ZA 3KXIA 5LB2A 4U02A 3MWYW 3THXA 2FV8A 2V7QD 2IYTA 2J7PA 4M1OA 2ZE7A 4I99A 4MYHA 5FI0B 4PAQA 4RD6A 1JPNA 1PV4A 2ZR9A 1FQJA 3QKTA 1AZTA 3H2YA 4QJ5A 1YRBA 4BE7B 1GSIA 3QE0A 3TLXA 4L15A 2GZAA 4V02A 4A15A 2JLWA 4B6EA 5F2EA 1E69A 3I72A 2O8FA 2RHDA 1E9FA 5EQTA 4HLQB 1PLLA 2CJWA 4LJYA 3A37A 3ASZA 1XCMA 2IUUA 4OHYA 2RMKA 3V4FA 4LYFA 1R0ZA 4F4CA 1C4OA 5DSZA 4C0KA 2QL6A 4PPFA 3QKSA 1TQ4A 4ACBA 3KL4A 2G0NA 3GJXC 3ZIAA 1KI6A 3AVVA 2ZYWX 4Q1FA 3NVAA 1Q1ZA 1G16A 2DHRA 3NH9A 4K46A 1UKVY 2GA8A 2GZDA 1OIWA 3X1DA 2F1HA 4IVQA 2J46A 5KDDA 1U8ZA 3A1SA 1OE0A 1T3LA 1KY2A 2ZSEA 1RYFA 5JEEA 2N42A 3GLHB 2DBYA 3WNDA 1T91A 1Z3IX 2A5YB 2QPOA 1N6OA 2AD5A 2IYUA 1EFHA 1XDBA 3PQCA 2OE2A 1JR3D 1FUUA 4G01B 2H8KA 2XJ4A 3QIAA 3VR5A 3SQWA 4I1UA 5GJVC 2JEOA 4KXFB 4C0SA 1G6OA 1XD2A 3MUFA 2XZOA 1TMKA 3SFZA 2E1RA 1W5SA 4DSOA 1OFHA 3SYNA 1FMJA 1Z28A 3AM1A 3R7WA 1FFHA 1JB1A 5C2JB 1DEKA 3TW8B 3THXB 1N6KA 1D2EA 1N6LA 4QG7A 1GRQA 5HE8A 2C78A 4PC2A 5AUOB 2QAGB 1ZM4A 2IUSA 4C0LA 1GUAA 5TV2A 5KYKA 1I2DA 4OK5A 1DAHA 3B1XA 2IS6A 3WYGA 3U4QB 4MKIA 4EIWA 2FFBA 1Z2AA 4HDOB 1A2BA 4P4UA 2YJTD 1SVKA 4BRUA 4HLUA 5FBLB 3ZDQA 3K0CC 4W5HA 3QXJA 2VLIA 4OJKA 2GF0A 1ZBDA 1G20E 1T6NA 2ECKA 2WICA 4KODA 4M9QA 4WVFA 4YLGA 5IF9A 1F2UA 3PIRA 3TAUA 2JLRA 2KI5A 5DHFA 3AP1A 1XD8A 4OQXA 3W5IA 5F3WB 5H1YA 1KI6B 1HT1E 1YJ5A 4BLSA 3QXCA 2CCKA 3LQRA 3KQNA 3NC0C 2RB4A 1G7RA 5EUQB 1I4TD 4TLBA 1JALA 4Q4LA 3RAPR 2V3CC 3P26A 1WRBA 1FTNA 4PO8A 4Q66C 3VR2A 3FFBA 4GNKA 3THWA 2CJWB 2Z5FA 3TR0A 3AF4A 4IDQA 2CHQA 4F91B 1DE0A 3HYRA 6Q21A 3TH5A 3KJGA 2J9RA 3E2IA 4LHXA 1DAMA 1E2DA 3CR7A 4XVRA 3K0CA 4BZQA 4NYIQ 2EWVA 3VU9A 3KKPA 4PQFA 4ZCIA 5UKDA 1J8YF 2G77B 2VHJA 4OQNA 2F1IA 1ZAKA 4MKFA 2QM8A 3LAWA 2R65A 2XZLA 1E94E 3VX4A 4FMCB 4QBGB 5B2ZA 1WQ1R 1RC8A 3HU3A 1IM2A 3EZ7A 4OI0A 1CF4A 4BECA 5AJWA 2ZJOA 2WJYA 1WA5A 2O8CB 4W7SA 5DGXA 1BMFA 2OV2A 4UXIA 1Q1BA 1S2MA 5FI1B 3T35A 2WSSD 3NBZC 4D4MA 3EPJA 1M74A 2QAGA 4B6FA 2VSFA 4ZV4A 2V1UA 3SU8A 4A92A 2XNDD 4Q1BA 1G64A 1ZNZA 2ZRDA 1XMSA 2FZ4A 2UVQA 3AEZA 4BFUA 1HYQA 4DDVA 4C3ZA 1RKBA 1JECA 2DWQA 2XB4A 4AG5A 1QHNA 1AN0A 1ODFA 4OK3A 2FDCA 4UJ3A 4JJKA 1I4DD 3T15A 1V43A 2IX3A 3B9QA 1E1QA 2BJWA 3RS0A 4QC2A 4B2LA 2YOGA 1NN0A 4GDFA 3DL0A 1F3OA 1CR2A 1RFLA 5BN4A 4LJ7A 3I62A 4IDNA 4DIEA 1G6HA 3KTAB 2ZRBA 1JR3E 2J3EA 2F1JA 2WJHA 3PEUA 1WP9A 4I1VA 1R6BX 3QF7A 2QE7A 4EFNA 4A0HA 3CONA 3CO5A 5TY0A 1TF2A 2O8EA 1ZIOA 4B76A 3I4LA 3NBYC 1TF7A 5CK4A 1IXSB 3W34A 2OO7A 2Q9AA 2ORIA 5KSOA 4OQMA 4HAVA 4LK2A 4DCVA 5BW8A 2J87A 3H84A 4TLDA 1Q0UA 1IY0A 1XTIA 4QBIA 4DLUA 5FTNA 4DCSA 4Q4AA 1T8UA 1AS0A 1P6XA 3B7GA 3FHCB 2LKDA 1G3QA 3OEED 1EFCA 5H68A 4MUAA 3OEHD 4IXMA 5IK2A 2O0KA 2DR3A 4U00A 4RD1A 2BBTA 4CT5A 3DPUA 1F6BA 2HLDD 4AI6A 2ZRCA 4EPRA 2BMDA 1GNQA 4EPVA 1OFTA 1DPFA 1Z0KA 2VF8A 2ORWA 3BIFA 2WV9A 3F8TA 4GP7A 4P32A 2DWOA 3UANA 5JEDA 4WXPA 2GEDA 4LV6A 2WM9B 3T06B 4Y0VA 4NDZA 3AKDA 2ONJA 4D4JA 1RPZA 1MKYA 2ZJ5A 4Q7JB 1OKKD 3LA6A 5CIQA 2HF8A 2BMFA 3L0IB 1JAHA 2ZJYA 1CTQA 1E1RA 3AUYA 4NYJR 3AQ4A 2WIAA 3O47A 3C4JA 3Q5EA 1FPMA 3KUDA 1AQYA 3U2QA 1M1YE 5EZ6B 5EXXA 3IPYA 4OK6A 3PUVA 5BQ5A 1E0SA 3L82B 4ZI3A 3IO3A 4GI7A 4D0LB 1NSFA 2ZYVX 3R8CA 2D06A 1IY2A 2RAPA 2HLDA 2OFXA 3EPHA 2GEVA 1KDRA 2ZVQX 2FZLA 2VP4A 2W83A 1RRCA 2DFNA 3O8BA 3U60B 1U9IC 2OFWA 1QF9A 3FTQA 2PJZA 2V9PA 2ZS9A 3OE7D 4LBVA 4LJ5A 1FQKA 1SKQA 1NMXA 3KKNA 3R7WB 4W9MC 1QG4A 3CW2A 3C16C 3PG5A 4KJZA 4AYTA 3LWNA 1P5ZB 1UKEA 4ZIRA 1MO5A 4G1UC 4LBWA 3QG5A 4BFTA 2D7CA 1Z29A 2ZSFA 3IUYA 1E9SA 1CS4C 1Q57A 2CL6X 2YVUA 5H70A 1V5WA 3K0AB 4FN5A 4QM6A 3LVRE 3TVTA 3LXRA 4FXPA 3GJ8A 2C5LA 5KUTA 2PZEA 1LS1A 1MABB 5BXQC 3CWZA 1MO3A 5FPKA 2NG1A 4Q7LA 2ZETA 1Z08A 1AGPA 3HYTA 5KDOA 4TQUS 3LW8A 3D7MA 4OBEA 4U7DA 2ZVPX 1VTKA 3SFVA 1OHHD 4KFTA 5KTYA 3R8FA 2F6RA 2FWRA 2NO6A 3IHWA 4GRAA 3WRXC 5J5CA 1NSTA 4MUBA 4MITA 4AG6A 1YU9A 2OFOA 4TQ9A 3C15C 1L2TA 4DBLC 2XTNA 5C4GB 3SYKA 3CZQA 2WZQA 5JWHA 2AWNA 2FPLA 3TQFA 1HURA 2VHUA 3MLEA 4BEBA 3VKHA 3U61B 1ZCAA 5FTMA 1XTRA 1XEWX 4DC9A 2REBA 4OYHA 1UFQA 1C9KA 2QMOA 5CLQA 3ONWA 2O8FB 1EWRA 1X6VA 4HAWA 3KB1A 1X8LA 3SYLA 1ZD9A 4C9BA 2FSHA 4TMKA 4KITB 1N6HA 2J7KA 4KV9A 1S1CA 1SVLA 2ONKA 3VKGA 3THWB 1TU4A 3F5FA 2FPKA 1CULC 2GBLC 2VYFA 2X8AA 1XEXB 3W8RA 1LTQA 1TQ6A 4FMBB 1Q1QA 1GFIA 1WF3A 4OL0A 3EA5A 3DKVA 1WMSA 2JLYA 4GL2A 3PEVA 4R98A 1FMLA 4NYMQ 3H4MA 1VG0B 2QMEA 2ZAOA 3PCRB 4UNSA 1Z0JA 4WZ6A 1KAOA 1R2QA 1GM5A 3GLIA 1CR1A 4V0NA 4TYQA 1H8HD 3RRMA 4Q1AA 2C8VA 2VP9A 1XU4A 1HEIA 4CZ2A 2OCPA 5CM8B 2YC4C 4P33A 4M1YA 4LHZA 3R9WA 4DEXA 5HCNA 1A7JA 5FR2A 3N2EA 1YZTA 5EE9A 2YHSA 3FHTA 2TMKA 2W58A 2NZJA 3DKPA 1NKSA 4DLWA 2FSIA 4DCUA 2W00A 4TMWA 2ERXA 1KSFX 4II7A 4M9SA 4MH0R 4UNNA 2VRWA 2XNSA 2JDID 4JYBA 4ESHA 2OBLA 2XXAB 4NMMA 4EDHA 3KB2A 4BZPA 4FIDA 4HUTA 4PC7A 1ZINA 1KHTA 5DI3B 3PITA 2OAQ1 1NF3A 4DT1B 2D62A 1UADA 5A4JA 1W2HA 2AL7A 2PX3A 5KSYA 1HQYE 3BAFA 3FYHA 4IRUB 3G0HA 2J0VA 5DNYB 1YVDA 4M1SA 1OHHA 1PJRA 4JT2A 2ZSDA 4L16A 4B3DA 3GLFB 1FP7A 4KBFA 4YONB 3RC3A 3W6OA 1QHSA 4FMCF 4HLCA 4G5RA 2ZANA 4KFRA 4MRRA 4PPQA 3K09C 1JXOA 3U6KA 3WY9A 4O3MA 3ETLA 1BMFD 5BN3A 2N46A 2RGBA 4LGMA 5CJ2A 4MYTA 3WMEA 1E9CA 5HZKA 1E32A 4QOSA 4JLNA 1XJQA 4Y0AA 5D3MA 1A82A 2JIZD 2W2VA 4IEEA 2RGDA 3HWSA 2JJ2A 1T0HB 1LNZA 1UPTA 1FUKA 4KI0A 3K0FB 2A5JA 2QN6A 3QKRB 4Q4HB 5CJPA 3CRMA 1AGRA 1AM4D 2Q21A 3TRFA 1U9IA 2HCJB 2HDNB 1E0KA 2IS4A 2J0SA 1OXXK 2FFAA 3T5GA 2GAAA 5G53C 1KYIA 3LFUA 3RSOA 3K0SA 1N6PA 1ZC4A 3QY0A 2CBZA 3AGPA 1XCGB 3I8SA 4LJ8A 2J0UB 1E2GA 2Q3FA 3HU2A 5J4HA 2GXUA 1DBSA 2GKSA 4TYPA 1KZGB 5DI3A 1ANKA 1JEEA 2JGNA 5EUMA 1G5PA 2R9VA 3Q7PA 2NPFA 1E1RD 2FN4A 1LW7A 3PUWA 2GCNA 2H1LA 3GFOA 1GL6A 2GVZC 2B7CA 2P2LA 3Q5DA 1XTKA 1II8A 2GCOB 3PEWA 3FPAA 3EIHA 3U44A 3UXMA 1NI3A 5A0FA 2OCBA 1EGAA 2H17A 4G0NA 1G1MA 4C0QC 2H5EA 4QHSA 1G4UR 1OW3B 2WJIA 2YOFA 4TMVA 3LBIA 4C30A 4PZLA 1TAGA 2QSYA 4C4PA 3GLFA 3K9HA 1Q20A 1UDWA 1UKYA 3PEYA 4D25A 1R0XA 3QF4B 4P31A 1NVWQ 2FEOA 1R5NA 1NP6A 4P0TA 1U0LA 2ZRJA 3NC1C 2O52A 1W0KD 3KX2A 2IYVA 4V0LA 4WOPA 4PANA 1CLUA 1II0A 1OF1A 1ELOA 1OT3A 2EFGA 2PMKA 5KSZA 4D6PA 2PZFA 4LI0A 4IVPA 1ETUA 5JLJA 1U99A 1PVOA 3GJ5A 2Z4RA 5FL7D 3RLFA 1LF0A 2CLCX 1IJEA 2CVFA 4IDPA 4JBXA 1S9HA 1HUQA 3ZD7A 2JDIA 2BM0A 5JCPA 3UKDA 4ERNA 5FUYA 1TNDA 4W5WA 4GP6A 2VA8A 1Z0FA 4Q00A 3W8NA 1ZIPA 2AWOA 3L0PA 1E9AA 1M6NA 3IIKA 2CNWD 4I1SA 1F2TB 3CKLA 2ZRKA 5TDHA 2FX3A 1FTSA 4M0LA 3TUJC 5C4MA 5J4LA 4WZAE 3VR3A 4CF7A 3K9LA 3KJEA 2RGAA 4BLOA 5M04A 3VNUA 2GJKA 3B8HA 1IN5A 2GBLA 3QPVA 1E2MA 3DEFA 2REOA 1S4QA 3CF6R 1BOFA 4QGFA 3OAAD 1XNJA 2WPDD 3T61A 1E9RA 4AIIA 3NBXX 2J7PD 3A58B 2QBYB 2ZI7A 2WHXA 4D82A 4MYUA 3KKQA 1BYUA 3LDAA 1JAIA 2QENA 2VQSA 4KCGA 4LBYA 2BEKA 3CWQA 1VKJA 2DFLA 2OCAA 4M53A 4Z8XA 4RCYA 1ZD1A 2C2HA 3WBKA 1NNEA 2DY1A 4HDQB 3B1YA 1WBDA 3DOEA 2G0TA 3VR6A 421PA 3IHLA 3RS2A 4KYUA 3ND8A 1DAGA 2CK3A 3CM0A 4RKFA 3X1WA 5JRJA 3U3OA 5F9HA 2RCNA 2OM2A 1N2CE 1VCOA 4CRWB 4KFUA 1DADA 1P60A 4FINA 1XEXA 4OJQA 3U3MA 4ZCMA 4ZI2A 4YDSA 3VTKA 1SZPA 1P75A 1Z6YA 3BC1A 4LHWA 4QBHA 5J47A 3AVUA 4IXNA 3V00A 1KSJA 4HATA 1DO2A 2D74A 1JEDA 1OJLA 4NP6A 4QGGA 4TTQA 3UMSA 1KK1A 1CP2A 1P62B 4I4LA 4D26A 1D9ZA 4DT1A 3R9XA 2YWFA 2D3WA 2ZI4A 3BERA 1G3IA 1GKUB 2G6BA 3U3KA 5C18A 2MSEB 1MABA 3BB3A 1KMHA 2BBSA 3EG5A 4Q1EA 4RD4A 3TAHA 3QPUA 1KK3A 4DLZA 5JECA 4QJ3A 5K8TA 3ADBA 4RFVA 2HXYA 1U0JA 2NZ8A 5BYJA 3W6NA 2CLSA 2O0JA 3A4NA 2CHVA 2Q3HA 5FPHA 2FGJA 3RNLA 1R8QA 521PA 1R5OA 2LWIA 2QPTA 3MMPA 1W49A 3EIEA 1IOZA 1EFRD 1NVVQ 4IHQA 3RWOA 1Z06A 2H57A 4CEHA 3W3AA 3GQBA 3ZVMA 4D80A 2PCLA 1G8HA 1S0UA 2VL7A 2IBMA 2JLXA 2KJQA 2IT1A 2Y8EA 1OXUA 3N5CA 5FOVA 5K8UA 2O8DA 5KPJA 1IXZA 4XH9B 3BFVA 3X1XA 1WCV1 1BO6A 2QT0A 4R7ZA 4JL8A 2ZI3A 4F4IA 2WWIA 3KQUA 4E07A 4XTCS 5J40A 2GJ9A 1GKYA 3TSZA 3NDBB 4KLNA 3OIYA 3ZGXA 2D2EA 3H0KA 3LXXA 2MMGA 3ZLJA 3AF0A 4XSGA 3NEYA 3CBQA 4LV5B 2CL0X 2WBLC 3CF0A 2ZE5A 1KK2A 3P1JA 2ZRLA 1VCIA 3A8TA 4NONA 5E7IA 4HZUB 4YMWA 5FUWA 1S1MA 2GJAA 2WJVA 5B64A 2ZRMA 2QMUA 3GFPA 3SHWA 3RWMB 4CGZA 2FPMA 4FI3C 4IJMA 1VIAA 4OI2A 3AVYA 3EWSA 1LY1A 2CCGA 3A1VA 4XVUA 4RSGA 3GLGA 2AN9A 4ILEA 4V0ME 3PVSA 3DHWC 4LJ9A 3B2EA 4ITRC 3TNFA 4Q9HA 4YQFA 121PA 4JLVA 5CIWA 1J7KA 1HY3A 4CDGA 2JLVA 4IOLA 1NLFA 5DN6A 2O8BB 4QHTA 1M2OB 4HSEA 4DLXA 5L3VA 3X1YA 1G41A 4Q4JA 4JLDA 4JYCA 4FWIB 1AA9A 1R0WA 2F7SA 3B5JA 4B3XA 1UJ2A 1JPJA 1US8B 2GXAA 1DARA 3DVLA 4NBSA 4O2LA 3D3QA 3WBJA 1U81A 1DAFA 1Z6AA 3QBVA 4NH0A 2ZRNA 1VHLA 1P73A 1OIVA 3QBTA 1MT0A 1Z22A 1ZCBA 3PXGA 4D4KA 2FU5C 2KE5A 3T1TA 1W7AA 2NPIA 1NLZA 1E9EA 3WP0A 3OIUA 3AP2A 2C03A 4F92B 1CJMA 2EFCB 2BBOA 4Q7MB 3THYB 3K1JA 3NXSA 3ZQ6A 1MO4A 5L3QA 3RDPA 2IXFA 3BWDD 2QM7A 3MD0A 4JL6A 4MRVA 3VU9B 2LCFA 2I1QA 4FWTA 1R7RA 1XMIA 5EJEA 1EXMA 2GCOA 1VIYA 3RABA 4ZDKA 3EZ2A 1ZM7A 2YOHA 2Q0HA 2RGNA 1GL9B 3IQWA 5ANRB 4KO8A 1EG7A 3FOZA 1FOEB 3C7KA 4R9UC 3BXZA 1G19A 4ZDIA 4US0R 1XEWY 2YWEA 1MO6A 5JSZB 2AX4A 2YYZA 4KYIB 1EWQA 4C0BA 1NVVR 1L7VC 5JHGB 1YQTA 4BLPA 4QGHA 4JJZA 4XWKA 1NVUQ 3GJ3A 3BH7A 2OILA 2JAQA 1EFRA 2A9KA 3KFXA 5JRZA 2A30A 2ZE6A 1N6RA 3UMRA 3L2OB 2ODWA 4DZZA 4B2IA 4Q18A 1GIAA 5GJCA 3A36A 1GL7A 4LJ6A 2RGCA 4PQRA 2QE7D 4DSUA 4EAQA 4A2WA 3M1IA 4KAXA 3SJBA 4WA7A 1RVDA 2KBFA 2RGNC 4LHVA 4OQLA 2GVDC 1HT2E 4TLCA 1P2SA 3UPUA 4TL8A 1T0JB 4J0QA 1XB2A 4MRSA 3RSLA 3ZJYA 3GEHA 3Q72A 4YXWD 2A3RA 3EZ6A 3BGWA 1KMQA 3FGNA 3Q8XB 4NYJQ 3RANA 4MDFA 1M7BA 4JKIA 2BC9A 2HT6A 1SVSA 2QGNA 4A0GA 2XEXA 2Z43A 5DN6D 4CYMA 5KHOC 3I1FA 4RD2A 4Q9IA 1JR3A 4JL5A 1G8PA 3KJIA 4OHWA 4XD7D 2BKEA 1ESMA 5FL3A 3TMKA 1A4RA 1N3BA 2ZJ2A 3CRW1 3FKSD 4HB4A 2ZJ8A 3MRSA 3SC3A 5AUNB 3THYA 3B6EA 1KZ7B 2ZQ5A 4EPYA 4DDWA 4TL9A 3SJZA 4ACAA 1W36B 3ZVNA 1X8JA 4I81A 3UG7A 1N25A 3TR5A 1HE8B 4LPSA 2QUZA 4QNMA 2PLRA 1XEFA 3ZVLA 2P6RA 5IK2D 4PX9A 2VPPA 2ZSBA 3OHMA 3KZ1E 2O8CA 1KKLA 4NCJA 3HU1A 3I92A 1QHXA 1RE0A 4LV8B 1B0UA 1KI4A 4ZKEA 4JZKA 4DSTA 3DMDA 4N0EA 5FOUA 2VP0A 5AJYA 2FF7A 4FW9A 2J0UA 4N1AA 4N3NA 3BH0A 4B3FX 1HTWA 4R2HA 4DCTA 3QSYA 4RFSA 4DEYA 1XXHB 2YKGA 4Q4AB 2ZS8A 2ZRPA 3AP3A 2XNDA 2ZITA 1RRGA 1ZRHA 1HV8A 1XZPA 2QP3A 3GEEA 3KDSE 1KI2A 3QVVA 4AYXA 4IOJA 2JLUA 3EAQA 3MCAA 1W48A 1E9DA 2B92A 1GAJA 4HB2A 4V03A 5E3HA 4NKRA 2PH1A 4V0MA 4YC7A 2ZUDA 2ATXA 2DCUA 3SZRA 1X3SA 4L5BA 2ZM5A 4KVAA 1OXTA 3NKVA 2W6ID 3L0SA 4PAMA 5AR1A 1FW6A 5HPYB 2IYSA 1OPXA 4CVNA 3WP1B 1TPZA 3H86A 1XMVA 4MYCA 1KO8A 5DISB 1XPRA 2C96A 2QMHA 1XRJA 2DPXA 1NIJA 2UKDA 2C9OA 2L0XA 4QNRA 5E4FA 5FBQB 4XSHA 2IC5A 2ZU6A 3IO5A 3FFAA 4BFSA 3FB4A 1U98A 2W2XA 2ZI6A 4HZUA 4BWYA 1E99A 4X8MA 4A6PA 2QSZA 1OV4A 4EFMA 5LB4A 5EE1A 3LBNA 1KDTA 1W2GA 1YE8A 1G5RA 4HAXA 4ESVA 1G8YA 1JJVA 3DMNA 4KSCA 4WW0A 4DLVA 3GLFE 3M0EA 4JLAA 1QG2A 3PUYA 2RGXA 4UNPA 1SXJD 5FUVA 3GD7A 1QHIA 1T3SA 1S3SA 1ZNWA 4LC1A 2CVHA 2ORVA 3AF3A 1VCMA 3LX5A 2HUPA 4JSTA 4RZXA 4MA4A 2IXEA 1IXRC 4IKEA 3I5XA 1F5NA 3CH4B 5GVSA 2QT1A 3K9NA 1XTSA 5LDDC 3B1ZA 4CEIB 1Z0IA 3SS8A 4LYHA 1E2IA 1DS6A 3ZD6A 1QZXA 2WAYA 4RZ2A 4G3XA 4G5OA 4BQSA 1JQLB 2F3TA 3I73A 4JVSB 3REGA 1RYHA 1YHNA 1QHHA 4EKDA 4FMDB 3HPRA 1LV7A 2F55A 4KLZA 3BJIC 3TE6A 4HAUA 3OAAA 3ZQJA 3Q3JB 4DSNA 3AKCA 4TMZA 3KXLA 4NCKA 2CL7X 3KUCA 3HR7A 5P21A 1KAGA 1Q3TA 1GOTA 1W1WA 3B82A 1KK0A 3AB3A 3LNCA 1UBGA 4BFZA 4I1OA 5EP1A 1N0WA 2VSOA 2HF9A 3C14C 4KBGA 3GJ7A 4LRWA 4UNRA 1NY5A 2ZSAA 1W4CA 2PZGA 3AVWA 4B71A 5CDFA 4Q5IA 4DB2A 2BJVA 4ABYA 5IT5A 4Q48A 5HKKD 1FNMA 2QP4A 2IWRA 5JWOA 4XVQA 1FP6A 4B48A 4AURA 4WZBE 2IF0A 2FSFA 4JVNA 621PA 3TIFA 4H1UA 5FBRB 2XAUA 4FD2A 4DLTA 2EFDB 4TN1A 1GTVA 2F3RA 2QRNA 3SOPA 2BOVA 4H9GA 3SJAA 5AK0A 1DAKA 5CM9C 4NCHA 3TBKA 3KXKA 1IN7A 2KB0A 1G17A 4G5QA 4HEJA 3LLMA 2HCBA 1HE1C 1TQ2A 2J45A 3LW7A 3TSOA 2WAXA 1G3RA 1S3GA 1SXJC 3SI7A 2QPAA 1IQPA 2P65A 3OEEA 4KSBA 4BLQA 5TARA 4C0JA 1SGWA 1A5TA 4E09A 4LPKA 4M9ZA 2O5VA 3WYAA 1MR3F 221PA 4IFEA 2IYZA 1SVMA 2P5TB 1KY3A 1NN5A 2E9SA 3LVQE 1AIPA 3RRYA 1JXMA 4Q47A 4NZYA 5LD2B 1W47A 2B21A 4RZ3A 1WE2A 2IYWA 3RHFA 2HXSA 1A2KC 2AKAB 2ZROA 3PV0A 1E98A 3IBYA 3A4MA 4ON9A 1GILA 2WWFA 1XJ0A 2P67A 1XD2B 5FBWB 3TKLA 2NO0A 1TX4B 4OI1A 3ZZUA 1LB1B 2XSZD 1SQ5A 5LBIA 3GLHE 5CK5A 4Q9LA 4URVR 1OLOA 3QNUA 1U0HC 2EWWA 5JS8A 1E96A 4S35A 2ZJZA 2E87A 4URWR 2ODEA 1MOZA 2OEPA 1ZNXA 2Z4SA 2RGEA 2PX0A 1JR6A 4JLBA 2BWJA 1Q21A 4HUQB 2EFHB 5KSPA 3SBDA 1Z07A 3FKQA 2CE2X 3AF1A 1I2MA 1NBMD 2BCGY 1G3UA 3IKJA 4M22A 3SBEA 4B3CA 2UZ3A 3R9IA 5J4KA 1G291 5E95A 1SXJE 4B3GA 4MRPA 1TEVA 1N6NA 2FGKA 1GRRA 5FR1A 2XB2A 1YRAA 3CNNA 5SZIA 4UXJA 4LDJA 3WHKA 2Q3MA 5L3SA 4TMXA 4YMUA 3KKOA 1Q3HA 5EP4A 2FOLA 3U7GA 2XXAA 2DYKA 1OYWA 5IRCD 1TL7C 4LZZA 2HJGA 1RJ9B 3B78A 5IHPA 3WMFA 1VYVA 1FNNA 4C2TA 4TTPA 5EXTA 3OZXA 5E7JA 1IAQA 1M8PA 2AXNA 4TQAA 3HDTA 3SDZA 1QRAA 3EC2A 1J2JA 2J41A 3FVQA 1DG1G 2QTVB 3MFYA 3SNHA 1YR8A 1YZLA 1Z0DA 3KKMA 3GJ6A 4PHFA 2JJ8A 1NN1A 1EX7A 1ESNA 1W44A 2GCPA 2W6JA 2BMEA 2XGJA 1D5CA 1F2UB 4H1VA 3VNVA 4Z54A 1E0AA 3N70A 3B1WA 3CF2A 1T8TA 3P4XA 1W5TA 4D0NA 4ASUA 4D0GA 1L4UA 4LY6A 3IEVA 4IW3B 4JLOA 5D3QA 4QBFA 5DIFA 1HQCA 5SZHB 1E0JA 3MWKA 3RRZA 5F9FA 2QTFA 5B57C 3L8YA 3CRQA 1KIMA 5CLLA 4CEJA 5GJWC 2VH5R 4GZLA 4V0OA 4TSFA 3VMFA 2IL1A 5KNBA 2BM1A 2H7VA 2JLQA 2A7QA 4EQ6B 5ELXA 3JVVA 4TT3A 1CJTC 1NIPA 3QJYA 1L8QA 3K0FA 2V8OA 1UBEA 2ZEJA 3CX7A 4MGIR 3UG6A 4MKHA 2JJ2D 3U7EB 1XPUA 1RIFA 1KGDA 3UMFA 4NTZA 3Q7QA 4CEIA 1N0VC 3LRPA 3Q9LA 1AJEA 4AKGA 1U90A 5K8LA 4B47A 3P32A 1FL9A 3CR8A 3IEUA 3UK6A 5CB6A 2WWGA 4WXRA 4B74A 3ZYCA 5KO2A 2JA1A 1VCNA 3LX8A 4HDCA 5G41A 1II8B 1E3MA 2X77A 1OIXA 3VHXA 4NYIR 3JVUA 2GK6A 3QVUA 2IXGA 2P3SA 3THOA 5C46F 3S1AB 5DO9A 3NBFA 3R20A 2MMCA 2GJ8A 2EVWX 2OBMA 2GF9A 2B7BA 5JI2E 3C5CA 3A6PC 3REFA 3MAAC 1E79A 2B8TA 2PLFA 2GEUA 2QNRA 4JMPA 3TUIC 4PHHA 4A8JB 2XOKA 5JI3E 2OXCA 4XJXA 1OB2A 4QFMA 1KNQA 5FOTA 4IVRA 1OH7A 1KNXA 1E2LA 1NKTA 2WSMA 4GOJA 4JBWA 3HP1A 1SULA 5J4VA 1NMZA 1KO5A 2AXPA 1YR7A 2QAJA 4G5GA 1HH4A 4DUGD 3QXSA 1U2RA 4AK9A 4TYYA 4GT1A 2J0QA 4ARZB 3J81k 1Q44A 2N1BA 1CBUA 4UKDA 1P7CA 2FSGA 1R4AA 1P2VA 5GJBA 2GRJA 2IF2A 2CMKA 1XWIA 4A2QA 2IWHA 1DOAA 1C1YA 3GLIE 3AVTA 1Z8FA 1KJZA 1DAIA 2NO9A 4US1R 3C5HA 5TXGA 1M7GA 5JFGA 1E2QA 5FPYA 2ZJAA 1CKEA 3OFNA 3GJ0A 1W4BA 4PTLA 2XITA 1KKMA 2R6FA 3DO6A 4EQ6A 1DG3A 2AR7A 5EXSA 4YXWA 2ODBA 2OHFA 1PUIA 3SHFA 1G4AE 2BCJQ 4Q4JB 3BORA 3K9GA 4F4JA 2P5SA 4CEJB 3FMFA 2O8BA 3ZH9B 4AKIA 2ODNA 3ECCA 4CT4B 3KQLA 3IIJA 1KTVA 2C77A 2QBYA 4OHVA 1ZYUA 3NHBA 1IN4A 3O8RA 2QU8A 1DO0A 5AJVB 3ZZ0A 4Q4HA 1XP8A 1NVXQ 1P61B 2NOAA 4BFXA 1H8ED 3NH6A 2REXB 3P20A 3U7FB 3LQQA 1KOFA 1QVRA 2J59A 5G3YA 3G5UA 3TJZA 3RC8A 1XX6A 2DWPA 2PBRA 4JLJA 2YZ2A 3A4LA 3WHLA 1TUIA 1VG1A 1BYIA 1H65A 3BD9A 1B23P 821PA 4Q01A 1AZSC 1M7HA 2OLJA 3CRRA 2GILA 1G7SA 3VQTA 3BH6A 1XBTA 1T3HA 5AJZA 4NCIA 4AWXA 5JWRA 5FPSA 2X2EA 4DB4A 3IDQA 2JATA 3L0OA 2JLSA 1X8KA 4UXHA 1BIFA 2C04A 5FOWA 3AVQA 1XXHA 2BEJA 3MWLA 4JLKA 5SZJA 3RYTC 2A5FA 1K8RA 3WNCA 1ZP6A 2QI9C 2D7DA 2CDNA 4G5SA 4TWZA 4A8JA 3T34A 5KNCA 1G9XA 1W0JA 1YZGA 3DDCA 4RZUA 4B32A 1AK2A 3FMPB 1T5LA 4DDTA 2ZRHA 3T12A 1E2FA 4JSYA 4NE2A 3E70C 1VDZA 4LCBA 1D2MA 1ZUNB 2FFQA 3K53A 1R8SA 4ZKDA 4D81A 2H18A 4OHXA 1XCPA 2AK2A 3TUZC 3P27A 5DYGA 1EK0A 2VHTA 2ZREA 4AYWA 1COWA 1E2PA 2VIIA 1I4LD 2GESA 4LX0A 4QKQA 3V9PA 1K5DA 2VBCA 3DZ8A 2ZRIA 3KTAA 5H8WA 2ASEA 3D6TB 3K70B 2EQBA 3Q85A 1CJUC 4PHGA 3E1SA 2IUTA 1ZW6A 2ZTSA 3C8UA 3FMIA 2G1JA 1OB5A 1Z6GA 4W5JA 1JI0A 4DWJA 3EX7C 2FMXA 2OBNA 2O0HA 1D8TA 1JQJC 2IYRA 3AVOA 4OI4A 2P6NA 4NCNA 1F48A 5L3QB 2W2TA 2B8WA 3TW4A 1GVNB 3U3JA 1E4YA 5EXPA 5BN5A 3GLGE 2O8DB 1E6CA 4C0AC 4BGDA 4Z8YA 2FA9A 2BDTA 2OXRA 4YDHB 2AFIE 2XTZA 1Q22A 2CNWA 2Z0MA 3HJNA 4EPXA 4XOIA 1OKKA 1XJCA 2WMOB 5JJKA 4LC0A 2X19A 2IK8A 3LBHA 3P4YA 5HTKA 2O8EB 1IN8A 1NJGA 4IDHA 2IA5A 3A1WA 3CZPA 1UDXA 1ZMXA 1GDDA 2GXSA 4Z1MA 1E9BA 2VO1A 4BLTA 1WDTA 3O8CA 4P4TA 4GOKA 1US8A 1G5TA 4O0MA 3ZS9A 2EYQA 2Q9BA 3AGQA 4DVGA 2ZAMA 2IHYA 1OFIA 4HAYA 1N5LA 1TF5A 2WJGA 4DIDA 4LWZA 4HI0E 3AVXA 4MGZR 5BWMA 3VR4A 5FBVB 3OEHA 4MDEA 2VF7A 1CRQA 2F9MA 3W9YA 2ZUCA 4M21A 3CUEF 4Q21A 1CR0A 2HYDA 1PLJA 2WKRA 4P3YA 4LJ4A 4PSKA 4A0RA 3PUXA 3QOFA 1D9XA 2CLDX 1ZC3A 5EE0A 5L3RA 5CITA 1ONBA 1KI9A 2XJ9A 3V4RA 3O8DA 5FOXA 4OHZA 1BH2A 2ZS7A 1EFUA 1UM8A 3C41J 1AS2A 2R62A 4TMTA 1KJWA 1JJ7A 2V6IA 3MJRA 1NRJB 4HLDA 3D8BA 4B2PA 1TQDA 3NIBA 4URZR 4JBYA 3NHAA 1XMJA 2V1XA 4L4UA 3U6BA 2DFTA 4ZDWA 1ZUIA 3WNBA 4YMSA 2PT7A 1P2TA 1Z47A 1NBMA 2ZR7A 3B85A 4GMDA 3OF5A 1II9A 5KDLA 4LOAA 3BS4A 1UF9A 5BYKA 4O2RA 1P4SA 1G8GA 4QL3A 1XFAA 3QI2A 3X1ZA 5FUXA 3EARA 2GZHA 4D2IA 4PZYA 3CH5A 4A82A 1GP2A 1GRNA 4XWOA 5KNDA 3QKUA 4C0HA 2ERYA 2R44A 5LPNA 2QROA 2F9LA 4GSYA 4TTRA 1SKYB 3GJ4A 4Q02A 3UWOA 2V55B 1SXJB 2RHMA 2WKQA 4DLSA 3TK1A 4DXAA 2R6AA 1KDOA 4B75A 2Q6TA 1A1VA 1KI3A 2GNOA 4F93B 2R6DA 1W46A 2GDJA 4S2EA 4LSGA 2ZYUX 4BRWA 3EZFA 1NLYA 2WWXA 5DH9A 5FL7A 1K6MA 2CK3D 3TQCA 1GITA 1CR4A 2PL3A 4ZCLA 2V7QA 4HAZA 1SVOA 4AKEA 1DTSA 3ZIAD 4AY2A 4YMTA 3KJHA 4M1MA 3W90A 2Z6VA 2QP9X 4KU4A 2G88A 3GPLA 2I4IA 3FMOB 2BMJA 2QG6A 3B1VA 3H1TA 4HUQA 5L3SB 2R6GA 1YR9A 4M1TA 4M8NE 4TLAA 3T1VA 4B43A 3QPWA 4E03A 4X8HA 1TU3A 3TGPA 1Y3AA 2IYXA 1BKDR 2GHIA 4DCNA 3KQKA 1OYYA 2XSZA 1GZSA 3I8XA 2IYYA 4TYNA 4LUCA 2V54A 3L43A 3PR1A 1QDEA 1KJYA 1NN3A 2VP5A 3CIOA 4GPTA 2HYIC 2W6JD 4B44A 4TT3D 1KO1A 2A78A 3WYFA 4Q1DA 3MWJA 2FG5A 2JCSA 5FOSA 2P6UA 2V6JA 2VHCA 2QQ0A 1SHKA 4EUNA 1AQUA 2PJRA 2F43B 2KSQA 3EW9A 4Z51A 4AD8A 3JZMA 2KBEA 1SVWA 4M1WA 2ATVA 1G7TA 1G21E 4R71A 4ASUD 3DZDA 1IONA 1LVGA 2QRZA 4XWAA 5TMPA 2ZIAA 4PHTA 3VFDA 3PJRA 3RS5A 2ZXUA 3MJHA 3ADDA 3EASA 2WTUA 1CXZA 2QGZA 2XX3A 1UBFA 2QORA 4BASA 3QF4A 5B58C 3GMTA 4Q9JA 1T5IA 1XF9A 1Z6XA 2MSCB 3CPEA 3CX6A 2C9YA 2NO1A 2NMVA 1F2TA 1XZQA 4NHOA 1KI7A 4A0FA 4L9WA 4BFVA 4JKYA 4BFYA 2JIZA 2G9NA 2GETA 1T4GA 2BVNA 1R0YA 2VSXA 3NWJA 2DB3A 3CNOA 1DVRA 4RFSB 4MKGA 1G3MA 3BFXA 2EW1A 4PSVA 3EPKA 3UATA 4E22A 2YWHA 3IBGA 4NU0A 3FE2A 3ICEA 3DM5A 3ZVRA 5KOYA 3M6AA 3NG1A 2BBWA 2FFHA 5HE9A 4M4SA 1CEEA 2X2FA 3W5JA 1E2EA 3RS4A 1E2NA 5AUPB 1VHTA 1RRPA 4PO9A 2R6CA 5JCZA 4KVGA 3GP8A 1WBBA 1TUEA 3BE4A 2H92A 1MRSA 2P0EA 1J70A 1WB9A 2ZRFA 4MRNA 1D2NA 1HA3A 4CIDA 3QENA 3CRVA 3AKYA 1PZNA 4L9SA 4JIMA 3K09A 1P72A 1NJFA 4D4LA 4TL6A 1Z83A 3K0AA 4DKXA 4Q19A 4TLEA 1CRPA 2NGRA 3X2SA 1MRNA 5LD2C 1X1SA 2YV5A 3BK7A 3NTUA 1W4AA 4CW7A 2A5DA 3GFTA 3UWKA 2ZI5A 3FWYA 4ZPXA 3B13B 3CPJB 2WWYA 3NEJA 2WOJA 1KSHA 3E5HA 3LV8A 3PUZA 4UNQA 721PA 1PUJA 2V4ZA 4GMXA 1SVIA 2NTYC 1Z5ZA 3QKSB 5B30A 1VECA 5SZKB 3T1OA 2NIPA 3BBPA 4QXAA 1W36D 1PLKA 1ZM2A 2C9CA 5JBQA 2VTKA 2VHQA 4ARZA 4F7WA 1BS1A 2W6IA 1U8AA 2IS1A 1NG1A 3BB4A 5TVKA 4DHEA 4UQOA 1R10A 2IEYA 1D6JA 2FE4A 1O3YA 1SHZA 1ZU5A 4LBZA 3SEAA 4BFWA 1G7CA 2YINC 3PENA 4Q7KA 1X86B 3U44B 4POAA 3D31A 4XTRA 3PFIA 3AV0B 3BOSA 4ZDJA 1XXHE 4QHYA 4C7OB 4PXAA 5CDFE 2OSBA 5HCIA 1UBCA 2OT3B 3QKRA 3W3ZB 1G18A 5HR5A 4HB0A 1YZKA 5AUQA 1ZNYA 1VPLA 3A1TA 3EWAA 2W0MA 1QHHB 3FKSA 3K0EA 1KO7A 1ZU4A 5HKKA 2H16A 2YC2C 3T5DA 3F3YA 2WWWA 2QQEA 3QXHA 8OHMA 3GLIB 2OLKA 2WJJA 4B34A 3B60A 1NY6A 1J8MF 1FZQA 2EU8A 2G83A 5A5GA 1Z6TA 2XZPA 1T9HA 1IY1A 2MSDB 2XOKD 4TZ6A 5CYPA 4DJTA 2K5UA 4LJAA 4TZ0A 5CYOA 1Y63A 2ZE8A 1H8HA 4WAUA 2G1KA 2QAGC 4KHZA 5FTKA 1H8EA 4PQYA 4A36A 3IILA 1DELA 3JZAA 4LYAA 3EZ9A 2I3BA 4A4DA 4BPBA 1YKSA 2AHOA 2QY9A 1JNYA 3ND9A 5EP2A 4EPWA 1OFUX 4US2R 2CEAA 3EC1A 1NBME 1N5IA 1XTQA 1CJVC 1EX6A 1YZQA 2F1RA 4RY2A 1FX0B 4HYYA 1Q12A 1OH8A 2WVJA 3S1AA 2PT5A 2LKCA 2AFHE 4GOXA 2CXXA 2JASA 5G40A 1Z63A 1UEIA 4L8GA 4R2IA 1NMYA 2JLZA 4TYWA 3KFVA 2OZEA 1MH1A 3LH5A 1DAEA 2J1LA 2RH5A 1UKZA 3CX8A 3QG1A 3VX3A 1IHUA 1SXJA 2QZ4A 4LYJA 3SQXA 1W36C 3ICQB 4HB3A 4PC3A 4K8OA 4MQBA 5FTLA 5DI9A 5EP3A 5FTJA 3GLGB 4URXR
chains in the Genus database with same CATH superfamily
2WM3A 4LX8A 3VHLB 3SN6A 5H3HA 2FY8A 1JTVA 1SIBE 3OJWA 3B36A 3AF2A 5FO1A 3UAZA 4YPVA 1AHHA 1TT5A 4Z1MD 1ISRA 4J4BA 3ZKAA 1M2EA 1J2RA 1KI8A 3RCBA 2NXJA 3TPFA 1U94A 4LHYA 4M6WA 1NVMB 1I1HA 1X80A 3D5EA 4RC9A 1OXSC 3MSXA 4XRRA 3FRIA 1GGNA 1P0PA 5IVIA 2WY2D 4G0WA 2C4MA 2W71A 4IR7A 1YBAA 5CFPA 1FJXA 3W5SA 4HRAA 4FMDF 5IJZA 3Q87B 3I30X 1HT0A 3IBCA 3ZGOA 1NUQA 3HVKA 5DNDA 2GEJA 4PPNA 1FRFS 3SXUB 1H3NA 3O8NA 4DC1A 1P39A 1AXEA 1UINA 3GLQA 3NIGB 5EE5B 2VT3A 4KMSA 4AXBA 3H3FA 4PLFA 1UC4B 4Y1RA 4ZQGA 3WAKA 1HT3A 3R3WA 2WWHA 4EJSC 5K5EA 4IL5A 3KQHA 5A1TA 2X2OA 5L51A 3A9UA 3SEQA 1HFJA 2WSSA 2X7JA 4F8EA 4UQLA 4Z7JA 4R51A 3ICPA 1YR6A 4ZANA 2HDHA 1G8JA 1SOMA 1XU7A 3GK3A 1GNPA 2Q3BA 3ET5A 4QE3A 4L85A 4PHCA 3UJ9A 3ZXSA 4O5AA 4JI8B 3N0RA 4QZVA 3Q6IA 5KCZA 1EU1A 4M60A 3WKDA 3OECA 4WK4B 2FE1A 1K8XB 5ALHA 2WKPA 4LF7B 3A1UA 3GUCA 4DLRA 3DM9B 3LECA 4J3FA 4D98A 2IYLD 4QRDA 1QGUB 5DXAA 4MQLA 4X85A 3TZCA 2VTBB 3L8EA 2ECOA 1QX3A 2R8RA 1O97C 1RTTA 2EJUA 2Y2VA 3HZHA 2AD1A 4WGGA 2DGDA 4WLOA 4CL3A 3CNLA 3T1QA 2GTPA 1YZUA 1T2VA 3WBFA 3D3NA 2QYTA 1E79D 1RWOA 2A0FA 3QK7A 4GOOD 2Z5GA 1EWTA 1M2HA 2P9ZA 4UPDA 4WEQA 4C2AA 3EEOA 5EG5A 3HDJA 1U1DA 1N5JA 1TVCA 2W0SA 3AJRA 1W36B 3NLLA 1NI5A 3CB4A 2Q4RA 2AJ8A 3B5IA 4HF7A 5FA5A 3V8BA 4MIEA 4F60A 3L7CA 5K8IA 3LLUA 1N6IA 4YCAA 4RMNA 2R60A 3IQXA 4J90A 1LSOA 4Q3BA 4Z2AA 1DI0A 1NYRA 1RFGE 5DGCA 1Z37A 1V45E 2QEQA 1UOOA 2NO7A 3VAZA 1HSOA 2PZMA 1YRQA 3ABOB 2VP6A 2YY7A 2EYUA 3OPVA 2K2QB 4IV5A 3PDIB 4P4SB 3R41A 2F3UA 1C29B 1A0OA 1SQ6A 1Z2CA 3BMQA 5D51S 4EM6A 1DUSA 1S9DA 1GY8A 3OPYI 1HLPA 4PG7A 2B98A 3HACA 1RWWA 4FYHA 5JAHA 4DIOA 4KLAA 1Q1EA 4RHFA 1O94C 2YMMA 4XQGA 3RS9A 5BY2A 4NL4H 4EECA 3U48A 5JZVA 4JUDX 2QRGA 2BEVA 1RD4A 1CQJB 1S8FA 1P9WA 1T36A 2GB4A 3KZCA 3F6CA 5L7WA 5DMXA 3E1KA 8GPBA 4EJSB 5EWLA 1JI3A 1N9ZA 4Y2XA 4QOJA 1ZM9A 4B33A 4TSFD 5JSFA 4Y1RB 3C2QA 1E4VA 3FHOA 1UAAA 2C84A 3DG9A 3N75A 2I9KA 2G1AA 4MGKR 3UA3A 2WHRA 3FUUA 4GLOA 1UEJA 4K6FA 3GCWA 3V8EA 2ID9A 2ZRGA 1DU4A 1HEUA 3EUWA 4YRPA 1U2QA 2Y67A 3BK1A 4IOKA 1X77A 4KXWA 1RW4A 1JG1A 2ENUA 5C7IO 3RVLA 1A4IA 3V2GA 2PQMA 1A97A 1IJFA 1JLMA 4QJ4A 5BSUA 3EXAA 3AVPA 1K5PA 3VU3A 1ABFA 16PKA 3FR7A 3KQWA 4KN9S 5EZQA 4EKNB 4BEJA 4UJ5A 2WU1A 5FPPA 5FUBA 4RELA 4L4YA 3JQBC 3V1KA 1TKRA 1PJZA 4L9RA 2D1FA 4XUCA 1RCTE 1I3MA 1CRWG 2VAPA 3WV5A 1DG9A 3E9QA 1Q0LA 2WMNB 2NACA 2XQFA 3HUUA 3ZS8A 3CLVA 3H5RA 4BRSA 3IMEA 4QRHA 1IG3A 1THTA 5A7FA 2X9VA 5JS7A 1R6DA 4JLPA 1Q7EA 4LWQA 1XCBA 4NPHA 3IE1A 3G1UA 5AQEA 3IPXA 1TJYA 4P4SA 3HKBA 1UOEA 2HPVA 3GELA 2AFHA 1GEGA 4FBLA 1A3CA 3RUAA 1C0PA 1GWNA 2BF7A 2C2MA 3RBXA 3G82C 3AESB 3V1TC 4MWZA 1EE1A 1OJ7A 1YOVB 3M4XA 3FUVA 3WKBA 4GKAA 3QMVA 3JWEA 1QK5A 1B8UA 5J4YA 4UHKA 2WWTA 3OJEA 1XLUA 3FROA 1I33A 2QX9A 1VG8A 3OZEA 3WNVA 1NOJA 4NICA 3VKWA 3H8VA 4FEEA 2IW1A 3QUCA 4ITVA 4JLMA 5HIKA 1JHDA 1F2VA 5F98A 4RY9A 1XZIA 1EQUA 3DEIA 2JFNA 1QCZA 4OJYA 1QIIA 4GM0A 1LTKA 1OSNA 4JXZA 1U2SA 4IOMA 5FFMA 3CN7A 2ZAGA 3OQBA 3KVOA 4BP8A 2H4YA 1XRSB 3ADCA 2CHGA 1U3VA 1Z4KA 4G4IA 1ZLYA 1QH1A 2JFUA 1QIKA 2GASA 5HYVA 1TADA 1EQAA 2J32A 4FFLA 4B73A 2B1JA 3JQAB 4FOLA 2XUIA 3C8ZA 3ZBQA 1LBEA 1KE2A 1QHGA 4DBZA 1QO0D 2GT1A 3ZGLA 3CLTC 5F23A 2C5FA 3DH0A 4UDXX 2FWPA 1Y8ZA 3PPWA 1KMCA 1AU9A 2X5XA 1CDOA 2IUYA 3CG4A 4JOSA 3ZPXA 3AY0A 1MXFA 2KWIA 1TA0A 4F9FA 3ZR4B 1A2QA 1GCUA 2PGAA 3O2NA 3ELBA 3QEJA 4CEHB 1LF5A 3TSWA 3NOQA 2BZGA 4TWBA 2IHZA 1GD1O 2WG2A 4RHUA 4RVHA 3C8MA 3ZIUA 1PGOA 3X3HA 1MAWA 3OTQA 3RIYA 2D2FA 5AW4A 2O2SA 2BN4A 2VJCA 2ZSHA 3C6QA 3T54A 3F8WA 1XZFA 1L4BA 1XZAA 1PSZA 4GFDA 2AMJA 3LPMA 4X95A 5CBKA 1M0WA 4PAOA 4AQDA 5BUZA 1CJKC 4EEXA 4A2PA 1O03A 1B73A 1KP2A 4NOKA 2BFEA 5EE3A 2ZJBA 5FQOA 4CQJA 1OMOA 2QY6A 1J90A 1P2UA 4FOSA 2C3MA 1STOA 2PMDA 4LJSA 4RIHA 3VZCA 3RAEC 4WXYB 4IV8A 3RVOA 3RPEA 2A2ZA 5AVVA 5HTOA 1JKIA 1E7WA 1C41A 2FV8A 2A4MA 3DMFA 3OFSA 4ZVTA 1NNSA 3GMIA 4B7CA 4B6QA 4M1OA 1UMBA 5E6RA 4M9CA 4WZBA 4ZEVA 3G85A 3H97A 4PAQA 1C30A 3GXBA 4IYJA 2M6LA 3SZGA 1PV4A 1B41A 2P41A 1FQJA 4X24A 4EW2A 1AZTA 1O95D 4MV6A 3Q3VA 4NK5A 3QE0A 4L15A 2FUCA 2TYSB 4V02A 4JX8A 5F2EA 2GLXA 2YBEA 3I72A 2QTGA 5EFZA 1FFGA 1P4HA 1E9FA 2XKBA 5ECYA 1PLLA 2CJWA 2R8YA 1SIOA 3DEHA 3PI6A 3ZH2A 2RAUA 3WGVA 1XN1A 3V4FA 1Y9EA 2C5SA 2VPTA 4LYFA 4F4CA 5DSZA 3V2IA 3LBYA 4C0KA 3O82A 3OCCA 3OCVA 1I94B 4PPFA 3F6RA 3L01A 3KL4A 4KQXA 3PX7A 2XMPA 3ZIAA 4BP1A 1R6AA 2B8NA 1JHZA 1YKGA 2Q5EA 5G0TA 2ZYWX 4Q1FA 4R8KA 3TLYA 3AVVA 4XCXA 1UKVY 3KPJA 3KQVA 2GA8A 3PX3A 3MB5A 2F1HA 3PE4A 3VNQA 3X1DA 5LSAA 3O2SB 1VI5A 5KDDA 3QE4A 1UC8A 1N9GB 1V3VA 2OVFA 4INZA 2DE0X 4OFZA 1KY2A 4ERXA 4GWGA 1V9LA 3VZDA 2JIRA 1RYFA 1NJ2A 1RCUA 4UHCA 2VNHA 5IT0A 1HYBA 2DBYA 4S1VA 5JXGA 2I4TA 2A5YB 3EGVA 1VB3A 2AD5A 4NMHA 5BMVB 2I2XB 3VR5H 2IYUA 1MLDA 1EFHA 1A5ZA 3B53X 1ZI9A 3NNNA 2X6TA 5F64A 1JR3D 1FUUA 3GIDA 1W5FA 2H8KA 3QIAA 3THSA 1W1IA 1EJ6A 3S2EA 4PX5A 4DR6B 1V4VA 4B7XA 2QN1A 2V7WA 1SC4A 3RSCA 3UK1A 1P5HA 1ZICA 2FXVA 1G6OA 2X4LA 3GZJA 5A5FA 5I48A 2X5JO 2XPCA 3CCFA 1IJBA 3M49A 3SX4A 4DSOA 4CKWA 4NI5A 2F00A 3SYNA 3R7WA 1FBTA 3ONNA 1ACLA 1H5NA 4D9HA 3QUAA 3DTVA 2PT6A 1D2EA 2XB9A 2Y9MB 1CS0B 3G2PA 5IANA 1GRQA 3OLXA 3QY9A 4PC2A 1CJCA 1JHYA 1A5AB 2PL5A 1GPYA 2IZ1A 3STUA 1GPDG 3GN2A 4OK5A 5F52A 4CKEB 1DAHA 3RRJA 3WYGA 1CY8A 2Y1LA 3U4QB 2OHJA 2WNHA 4U1RA 1V95A 3W9UA 1YK0A 1A2BA 4YACA 2CYAA 2FMKA 3EISA 4BRUA 4DQKA 5FBLB 4W5HA 4NXMB 4LMPA 2VLIA 4EF5A 4OJKA 3BK2A 1T6NA 1W93A 1C9JA 2GYVA 2RBEA 5AXCA 2FCRA 2AYYA 1Z4MA 2DT5A 3NBUA 4DCJA 5E4JA 4YUAA 3B7PA 2PO7A 5IF9A 3Q9NA 3TAUA 2QW8A 4R83A 1GU1A 1OX4A 1UZMA 4XFDA 1WHTA 2ZB8A 3O4FA 2WINI 4OOEA 2Q45A 5F3WB 2CSXA 3DKRA 1KI6B 2PXHA 4LDZA 3UW1A 2XCTB 5DX8A 5I9TA 3LQRA 4BLSA 4OV6B 5FDFA 1CDDA 3M6UA 3KQNA 3D4IA 1EXVA 5IJ9A 3W5CA 4PYLA 4BDSA 1JALA 1FLAA 4ZAYA 4ND6A 4BV9A 3MLBA 6REQA 3RGWS 1C8LA 2QE6A 2OM6A 1KEEB 4X61A 2H2AA 2ESRA 3LDUA 2R87A 5A9SA 2PBZA 3HYRA 4DIMA 6Q21A 4Q3AA 3UWPA 2J9RA 3D7KA 1RP7A 4XVRA 1FNBA 3CR7A 1IYZA 1R0KA 2EIXA 2QN9A 3BEOA 3BDAA 4NYIQ 3X1KA 2A5LA 3A1CA 1VJDA 4FX5A 4EKEA 3MUNA 1J8YF 2VHJA 5AOCA 5AW7A 4C7VA 5JS8A 3AFGA 4MRPA 4BLUA 1UFOA 3P0JA 4FMCB 5IBPA 1KARA 4U39A 3VX4A 1WQ1R 3OTOB 1SK9A 3KLBA 4Q3KA 4OI0A 1P18A 2ZJOA 1V8ZA 1QU3A 1BMFA 5TQVA 4RACA 1S2MA 4HNSA 5FI1B 3V42A 3RG8A 2WSSD 3MTJA 4NZOA 4ZCRA 1B6RA 2WD7A 5GZ3A 1RZRD 1B6TA 1M74A 4F4HA 3L40A 4GZ3A 2V1UA 3W7AA 2FR0A 2R97A 4Q3LA 1IDOA 4LXUA 3OZAA 1OFVA 2HFJA 1ZNZA 1TA9A 2ZRDA 5J63A 3KOMA 3UHPA 2UVQA 4BFUA 5JATA 4AQ7A 3DOCA 1ZHFA 1GN9A 3QU7A 3D3WA 3E7WA 4G8DA 1A2OA 2PPVA 1ODFA 5AI8A 2J9XB 1DBQA 1Y5LA 2PMBA 4J0HA 2P8JA 1DIAA 1C7JA 4GICA 2FW1A 4JJKA 4OKNA 5TQJA 1QNLA 1SM4A 1XLWA 4MX8A 2HJRA 4MYRA 3T3EA 4DFDA 1TQHA 4CBVA 1XQWA 1ZQ9A 4GQBA 1SC3A 4LW8A 3TI9A 5BVGB 3JY6A 4QC2A 3PNPA 1U5AA 4R2XA 1VPTA 3B1JA 2JEZA 1XNHA 3R7AA 1CR2A 1RFLA 2H11A 4MVJF 3F2VA 3BICA 4U2EA 4I3GA 5JSHA 3N0TA 3GRFA 4RADA 5J2TB 1G6HA 1Z7GA 3KTAB 3NHLA 3LPDA 5LLTA 3L1KA 2XOXA 1RWKA 3PEUA 4I1VA 1VIMA 2DWCA 4NR0A 1P7WA 1I2ZA 4A0HA 3CO5A 3O7MA 4MV8A 2F3QA 4DOMA 1TJ4A 4KAAA 1OGYA 1TF2A 3ETEA 2APJA 4MLPA 3NBYC 3DFKA 2IITA 2Q1WA 3W34A 2BUBA 3NWEA 4KKXB 4DCVA 1WW8A 2Z3WA 2J85A 4I14A 1IY0A 1RWVA 4O4LF 4GWLA 4R2LA 4F5DA 2WD8A 3HVIA 4NABA 4QBIA 1TZKA 4BB0A 1AS0A 2G9QA 3UM9A 2LKDA 3OEED 1EFCA 5IU6A 1CZOA 5GINE 3EBOA 4IXMA 2IE8A 4KXQA 4WFIA 4N8EA 4DNXA 2DR3A 2BBTA 2CB9A 1GVHA 3DPUA 1FP1D 3KOUA 5EJMA 4CT5A 4UHBA 4BMCA 3CLUD 1F6BA 3CTPA 4Q37A 1XHLA 4WKGA 1SRRA 4RW0A 3GGSA 3P94A 5BWLA 1BA2A 3U0BA 2P0AA 2HRRA 2F8TA 3K2BA 3USES 1CUEA 4ARVA 3Q10A 4P32A 2DWOA 4YP6A 5CFOA 3PDHA 2NSLA 2CXTA 1R0LA 4P38A 2PUVA 3IE0A 3MQ4A 3CT6A 4LV6A 4J29A 1JXAA 3PDIA 3JAWB 3WTBA 1AOXA 1XLTC 4NDZA 4YGXB 3AKDA 1BW9A 1O77A 5AKEA 2YWBA 4BQQA 3DB1A 3NHUA 2NZUG 2HL6A 5DYNA 5BW6B 2GUWA 1P31A 3LA6A 3C98A 3OU2A 4QEKA 2Q2QA 2AQKA 3GZ4A 5KVVA 3A6LA 2NZYA 4FZ3A 3ZLBA 1BN6A 3VAYA 4JYAB 4UM5A 2X8LA 5SICE 2L18A 4B80A 2WIAA 1CT9A 2EBFX 1E5LA 2GN8A 2HUNA 3O47A 5LOVB 1OV6A 2HK7A 2NV0A 2DF8A 2PX8A 4BO8A 1O2DA 4H59A 3FVRA 4XUEA 1YS2X 3C7CB 5JWOA 1DQNA 5EZ6B 5EXXA 2CYCA 3FTDA 3T7JA 3UNXA 3HEBA 5BQ5A 1E0SA 4M98A 5KTRA 3G0GA 5TLSA 4BV8A 1VL5A 2QVBA 3EGOA 4JXXA 4EFKA 2D06A 1IY2A 2RAPA 5ADUS 5K6RA 5A05A 1QTQA 3U62A 1ML4A 1UJMA 1ENOA 4Q12A 1C0EA 1DSSG 5B4TA 3X44A 1C3JA 5AW2A 2DFNA 1MT3A 1Y8RB 1OD6A 1B00A 3O8BA 4FFBA 3R7NA 3U60B 2IXTA 1E8NA 5TE9A 4BP9A 1QF9A 3WB2A 2ZS9A 2NXEA 3OE7D 1V8PA 3FSJX 5AVKA 1SKQA 1NNLA 1Q6ZA 2J5KA 5AYVA 3ZY3A 2ZPUA 3O3NB 1TKBA 3CW2A 3C16C 3PG5A 1J07A 1WEHA 1CSEE 3LWNA 1UKEA 4ZIRA 1MO5A 5CR9A 3W3AD 2HK6A 1VBFA 3AWDA 3QG5A 3VPAA 4BFTA 4DPKA 1ZOPA 1QSGA 2CL6X 3RJMA 1OFGA 1V5WA 4FN5A 3ZHSA 2DPHA 2VSNA 3LXRA 4R16A 4DMHA 1E6KA 1U1GA 2PZEA 2AFIB 1MABB 2IIVA 4FKMA 1MO3A 1NQXA 4KGVA 4NATA 4S3MA 4DA0A 1NYLA 1T2AA 3WDSA 4OQYA 1VJGA 1H66A 4GSKA 5KDOA 3PXAA 2V6GA 3HDVA 3R5KA 3LE8A 2W6MA 3SFVA 1HWYA 1W0CA 1XGKA 2F6RA 3IHWA 3M6VA 1YOVA 4GRAA 3WRXC 1YKFA 3NJ8A 2YJ3A 3G13A 1TK3A 2CNLA 1SUPA 4RSHA 5BMOA 2GTIA 2LVBA 4RH1A 3NHPA 4F2GA 5HVNA 1R3DA 5ITVA 3H1PA 4WY5A 1T15A 2ZYDA 4UOEA 2IHNA 3MLEA 1K6XA 2YFQA 4QYTA 1S8NA 1Z7EA 5ETJA 1QBGA 1UZAA 1XEWX 5CT9A 3LQYA 2NUAB 2JH3A 4OXXA 5E1MA 4DC9A 4N76A 4N5LA 1ENPA 2HAEA 4DRXA 1KAHA 2OL4A 4R5HA 5JJBA 4JBLA 4HNUA 1K4MA 5LBTA 3K15A 1ZONA 2WDPA 4LGYA 4LZPA 1N77A 3T7IA 1X6VA 2GNPA 3L4EA 4HAWA 5CDTA 4JODA 1E7YA 4TMKA 2W48A 2R79A 4K2AA 1N6HA 2J7KA 2Y0PA 3FTCA 1GQYA 1ZQ1A 4WWHA 3DBHA 3S5UA 1T5TA 1SVLA 3WL5A 3VKGA 3THWB 3TUZC 1CY6A 1CULC 3SSAA 1UDRA 1W5BA 1XEXB 2GAFA 2C7OA 2QXTA 5T41A 4CG3A 1OWNA 3H2KA 2ODAA 3ER9A 3UJPA 3EA5A 3LXUX 4G4SP 3SICE 1LBTA 3PEVA 4MSUA 4OYLA 5EJGA 1EDZA 4ETWA 2J4CA 3H4MA 3ME5A 1P7PA 4J3JA 5FB3A 4YRJA 4EWLA 2QMEA 2ZAOA 2C4UA 1HGXA 1E64A 1R9NA 3ODGA 3A6EA 5D86A 3GLIA 1BFDA 1L0BA 1Z16A 2J9FA 4D9MA 3QU4A 4BBZA 1BCRA 4G9EA 3ULKA 1ZR2A 1ACJA 4Q1AA 4Y9TA 3MJSA 2A59A 2C8VA 1M6YA 3TFWA 3WOHA 5F7OA 2OZLB 1XU4A 1HEIA 2OCPA 1VSQA 3ENNA 3EUAA 3QI7A 4CPDA 4M1YA 1SEPA 3O0DA 3GJTA 4L50A 4LHZA 3R9WA 2HQRA 3OC0A 1ES9A 2WZDA 1K7YA 1YZTA 2XAAA 2YHSA 2YZMA 1PJAA 1RXCA 2VPWA 3DLPX 2TMKA 4BWFB 1L5RA 1RPNA 2W58A 2NZJA 3ESAA 3SS9X 4B09A 3FIJA 1LSJA 4Y2UA 4Y67A 3RYFA 2FSIA 2BONA 4TMWA 2ZJFA 4JROA 3V1LA 1CZHA 5H3LA 3ONEA 3AOEC 5G0SA 2VRWA 3JASB 4JHLA 3VC3A 5A02A 1SCNE 2R8EA 1LRLA 5AW8A 1RQ2A 3WFIA 3DEJA 3ZHOA 1YXMA 2Y1EA 2IUEA 3KB2A 2II6A 1ZH6A 3BX1A 3EB9A 3JR7A 3PL1A 4WN3A 3HKEB 1KHTA 1U2DC 3PDCA 4BHTA 1NULA 3ZGYA 2D8AA 1NM5C 4M49A 1E60A 1UADA 4WBNA 3WLKX 1QYVA 5BVGA 3G0HA 2XYHA 3IMGA 3JU3A 4JP5A 8ATCA 4M0KA 1RWMA 5IXYA 1W75A 5E0OA 3WLNA 3I76A 4JT2A 3UJ8A 4L16A 4B3DA 3BF8A 3H7IA 1GT6A 1YS9A 2M6SA 5I3ZA 1FP7A 1XZ8A 4I4TF 4W8OA 5K0NA 5CCDA 3BT7A 1XCJA 4G5RA 2A35A 2OOSA 1X8XA 2D5CA 5CT8A 3U6KA 4D44A 3ZLTA 2H1CA 3NHFA 1X1AA 2N46A 5BN3A 5CJ2A 2JAOA 4MYTA 1E9CA 4TXNA 1OWLA 1KS9A 1ODJA 2Q5FA 1Z7WA 1AMNA 3NYQA 1E32A 4QOSA 4B79A 1XJQA 1QP4A 4CJXA 4MQUA 4J3NA 3UOAB 5JTUA 2IVFA 5IKMA 1OLSB 5ALXA 2FEPA 2O2XA 2B7LA 1J0EA 3GDOA 4RVGA 4DMRA 4BVBA 3R77A 1LNZA 4TVOA 1FUKA 1YJ8A 2YRWA 3K0FB 2A5JA 4QBTA 3GFBA 3RADC 1HDOA 2AQHA 3AU9A 4YFYA 5F5NA 2COKA 1V4NA 4RK6A 2Q21A 3IQZA 4DR4B 2HCJB 2FZEA 2GKGA 3GGJA 4YUXA 1ZOIA 3LTEA 1SBQA 2GAAA 2OO5A 2BGUA 3TNDA 1J2TA 4UUMA 1PNOA 2Q50A 2QG4A 3E23A 4J7UA 4D8VA 2X4GA 5BOVA 3UVEA 2QDKA 1RQPA 1F8XA 4IRMA 2VN8A 3GJZA 4ICIA 4AECA 2E2WA 5T57A 4YRGA 1Y5RA 3AGPA 3MELA 2PZAA 2J0UB 3N87A 1M6HA 2EGHA 3FOWA 3FI0A 2CLHB 3HVUA 4KNVA 5F5LA 2HRCA 2IKSA 2QMZA 3HNRA 1QGDA 5DI3A 4ZMBA 4E08A 2RAVA 3RC2A 1RAHA 2R9VA 3Q7PA 4WH0A 3RKRA 1E1RD 4GX1A 1JYEA 5LCXA 4K0RA 3T7DA 3CEAA 1NW3A 3GFOA 1GL6A 3NFRA 3OCUA 3Q6MA 3BSFA 2P2LA 4CQMA 4IG4A 3KDPA 4KQFA 3TYXA 4EYGA 5HS6A 4BKUA 3DWIA 3IUNA 3N6VA 5B6PA 3TX2A 4MGEA 1D0IA 3AUUA 1Z2EA 3F49S 3F5MA 2ILTA 4IFTA 2H5EA 4CR6A 1HZZC 1YK1A 2AQIA 2YIJA 3INTA 3ESDA 1L5NA 5CDFE 3DW3X 4MVJA 3UMBA 3TS1A 4DIFA 3L4BC 3QV1A 4IV0A 5FYQA 2YOFA 3CZ4A 5DV9A 3P97A 3KVVA 4ROSA 1NE2A 4C03A 5A06A 4G4GA 3I52A 3GLFA 1UDWA 1XNGA 4M1QA 2CMDA 4MVCA 4LXTA 5EJ7A 3PEYA 1M5UA 1R0XA 2EG5A 2YYAA 3LP6A 3QF4B 4P31A 3UMJA 3KPVA 4TRJA 2X3YA 2ZRJA 3GR6A 2JL1A 1F1JA 1JLRA 1XE3A 1IZ7A 3KX2A 5LZ8A 2CZCA 3EMDA 4WOPA 5HKLA 4E94A 1X14A 2I2DA 1QDUA 3N3AC 3VR4D 4W63A 1HETA 3HV2A 1XHFA 1T2DA 5IZCA 4IVPA 1EXNA 3PWSA 4U7HA 1F5SA 1SQGA 1YQUA 2WMDA 1JFLA 3D2LA 3GJ5A 3NHWA 1JIIA 2VTDA 3BXHA 5DM2A 3RLFA 4UUOA 4OX9B 1A69A 2JNWA 1IJEA 4CF3A 2XUAA 4JBXA 4UVDA 2FPGA 4I1YA 2BP7A 4BO1A 1LQTA 2ZJ1A 3DMTC 1MIOA 4I2VA 2JDIA 1WPXA 4EG5A 2YN2A 5HQ3A 4OYRA 5FUYA 4O5OA 4W5WA 4QPZA 4GP6A 5ICSA 2VA8A 2PS3A 2CXQA 1HLGA 4PO3X 4CL2A 1BDMA 5KB3A 5IF3A 1ZIPA 2AWOA 1NI4B 1PF7E 2QYOA 2FDRA 2W2MA 3PNLA 4MP8A 4UVEA 4V24A 4B8ZA 4EHKA 1MDBA 1QO7A 1VJ5A 2CNWD 4P9NA 3DTVB 1F2TB 2YN4A 2FX3A 4M0LA 4A6EA 1ZVVA 2Q3EA 3CKKA 4YMIA 3JVEA 4L8VA 1D1PA 1Q1NA 4C4SA 4P1ZA 1PFYA 2BY4A 4U6SA 5AW5A 4FEGA 3IP6A 5CRIA 3RVMA 2GBLA 4ESEA 2XVYA 1D0VA 2CBGA 3CW8X 1QZ3A 1ZOSA 5EL0A 2E6KA 5ESWA 4AN4A 1XA4A 2REOA 3DEFA 3G2KA 2CVOA 4QGFA 5ECGC 4KDCA 3RG2A 3KOWA 2Q2OA 3AERB 3MTEA 4BO5A 1S2LA 1AQLA 4TV8A 3J80A 2J7PD 2YCLA 1ZJ4A 3A58B 3KUUA 3LT2A 4JDUA 1TGYA 3RJZA 4EJ6A 5C5CA 1TRHA 3RUEA 4WACA 4Z8XA 1VHJA 5J2UB 3UK7A 1JDSA 1EFDN 2OCAA 3WBKA 4YHHB 1U1EA 2BFPA 4RCYA 3ZU3A 3TCXB 1GQ2A 3DOEA 4H17A 4YJFB 3VR6A 5A3RA 1EGVB 2C4TA 1ILWA 3W0LB 2Y71A 2P9JA 3CM0A 4FDTA 1A71A 5JRJA 1KWKA 3CVVA 3U3OA 3L7JA 3BMNA 3QM1A 5B2FA 4HWRA 1KIFA 2ZYAA 5IYZF 5IKXA 2QZSA 1YDMA 1QE5A 1BJKA 5JPDA 1XEXA 4P7FA 1LK7A 3U3MA 2JAWA 4YDSA 2ZBQA 1UPAA 3S8YA 1P75A 3M6XA 4E2ZA 4N7BA 4MKRA 4XQ9A 4YT8A 4QWWA 5JYBA 3K1AB 1YR1A 1MTZA 3BD7A 3V00A 2OC4A 1KSJA 1XZMA 1DKLA 3V6MA 3KZKA 4QGGA 2Y68A 1F4PA 1UWKA 1CP2A 2VXBA 3CRZA 3GHYA 4JGGA 4RH3A 2D3WA 1VLVA 2ZI4A 4RPJA 1JT9A 1G3IA 1GKUB 2B20A 3TJRA 4UUPA 4RPHA 3QHAA 4DLZA 3TAHA 4B87A 5ERGB 4W7HA 1DIRA 4MO2A 5FEMA 4CN8A 3UN1A 1JAYA 1P4GA 2NZ8A 4Y6QA 2NUPB 1Z74A 4FDAA 5AI6A 1QE0A 2O0JA 1T3ZA 1NFQA 2CHVA 5FPHA 5GAJA 4UZFA 3WWCA 4PLCA 3SAJA 3BRCA 5KYYB 3GFQA 1OY1A 4EG6A 2PWZA 2QPTA 2CC2A 3WVNA 1L7NA 5FWDA 4GKJB 3RWOA 4KZPA 2FMFA 1WMAA 4PW0A 5K4HA 1F8UA 1G9TA 2PCLA 1G8HA 4E7PA 4ZYUA 1S0UA 3T5PA 4KREA 1PQYA 2VL7A 2XNKA 3MWDA 2WVGA 3QW2A 1UXGA 1KETA 1DIBA 4R1OA 2CWWA 2O8DA 1I0ZA 4UBIA 3NORA 2X4IA 4TGLA 1ADFA 4XH9B 3LRXA 1E92A 1BGWA 4NOLA 2QT0A 4DREA 2YH2A 2J0EA 4ZOLA 2WDZA 4F4IA 3RSZA 2WWIA 4NBRA 4KGDA 5WRFA 3W7BA 3H5VA 1S2OA 1FFWA 3UTDA 4DYHA 1SIWA 2FWIA 3CB2A 2QD1A 1RYEA 2IQ5A 4I4TA 5TMBA 3WAJA 3NDBB 4K9OA 2D2EA 3H0KA 1XYYA 2D2XA 3ZLJA 3PNQA 4AX4A 3ANXA 2CL0X 3OPNA 3CF0A 4HPXB 2Q4BA 3PDJA 5DOZA 4D4HA 3P1JA 4F5WA 1G4HA 4LNHA 1UWCA 1KYWA 5EEGA 1X9GA 3CE9A 4UOQA 4H7IA 4LZOA 4ML3A 1Y8RA 4HZUB 4OXKA 4LNUA 4AN0A 5BSHA 4B9EA 3U19A 5HUQA 5H59A 5IM4A 2BM9A 4MQFB 2DQKA 3ID6C 5NLLA 3UGQA 4EOGA 2AFIA 3C6XA 3LXMA 1DXOA 1CHNA 1M6WA 2GQ0A 2PN1A 2PGXA 3H9BA 3TM5A 2VYCA 2XUJA 2VDJA 2PRYA 4N40A 1BAPA 2XWJI 1GLGA 3D8SA 3KALA 4XVUA 4WXHA 3VO2A 2FB9A 4ILEA 1FLVA 2Q2NA 4WY2A 1N8SA 4LJ9A 4UU1A 2XE8A 3B2EA 1E7SA 1V5GA 4ITRC 3TNFA 1DEAA 4BATA 121PA 1T1EA 2OB2A 3SF8B 5AICA 3KYCA 1HY3A 5K6TA 2UUOA 3DP9A 3QKIA 4KQCA 4NCBA 2FUG6 1WNFA 1XI2A 3IQEA 4QHTA 1M2OB 3HQ4O 5JCOA 4BKRA 3L6OO 4Q4JA 2HA4A 1AA9A 4WXMA 2F7SA 1Z7BA 1BTOA 2PGDA 2XQVA 3B5JA 1O1YA 5A0TA 3DBVO 5A4DA 3LA8A 5ITSA 1PQ4A 3NYIA 1X39A 2GXAA 3EH1A 5M5BA 4EO7A 2BR5A 4ZOCA 4O2LA 3O75A 1V37A 4H7JA 3WBJA 4EDFA 3AESA 1RYNA 1X7GA 4NH0A 3VPBA 5EIHA 5L53A 4UMDA 3W8RA 2IPMA 4TRNA 2QVYX 1P73A 3N8DA 3DVRX 1MT0A 5DP2A 3DNFA 4RLQA 5FLYA 4BX3A 4G4SO 4EMUA 2B5VA 5EWMA 2B69A 1NLZA 1E9EA 2Q5LA 3AP2A 4IH9A 5C5EA 3JQ7B 2NQ8A 4H08A 1I5RA 2EFCB 2ZW9A 3LQKA 5AO9A 3FYDA 2H9AA 4RL4A 5TT1A 4S04A 3ZQ6A 5F1PA 4O4JA 2LXNA 3BWDD 1JDBB 1O96A 2BR3A 3QPBA 5BW5A 2QTWB 1NASA 5EJEA 1EXMA 2GCOA 4ZDKA 4TWJA 3BGDA 1KVUA 2FTKE 1OCEA 2I67A 4NFHA 4RABA 4RNCA 2RGNA 3ZDRA 2RGRA 5D85A 3WIBA 3NOXA 1EG7A 3FOZA 1HDIA 1GAQA 4AJ1A 1KKUA 3BXZA 3EVFA 3QX9A 5I7EA 2PIDA 3GGCA 3KYCB 2OPHA 1XEWY 3V8QA 4JD5A 2AJLI 1F3LA 3R3ZA 2ID8A 3UK0A 2F1KA 4C0BA 2RC6A 5E6UA 1LDGA 1H6BA 3LUBA 3DR3A 5JVDF 3GRCA 1VLLA 3W5HA 3PNBA 5MFPA 1XO1A 2GPSA 1JIUA 4KDRA 3BH7A 2JAQA 4DW8A 3C6KA 4OCZA 1BXRB 2ZE6A 5BORA 4PZ9A 2IIBA 4NJMA 3L2OB 3MOSA 2ODWA 5CEFA 1N7IA 3E9EA 3V8MA 3A3KA 3P9XA 4GPIB 1FJ2A 4EO9A 5LUBA 3A36A 3CHYA 3U9LA 2BTEA 4BC1A 3BA1A 2XMDA 2CJYA 5KINB 1PT5A 3M1IA 4P8RA 4KAXA 4OH1A 5TIIA 4QTXA 1T1RA 4PBSA 4LHVA 3L6CA 1HT2E 3BIXA 2F4VB 4ETIA 5IP5A 4BNDA 1IZ8A 2MR5A 1EPUA 2I29A 1CV2A 2W6CX 1KEVA 2NZ2A 3GQVA 4M36A 4Q93A 2YXEA 4PX3A 4U7WA 1TM1E 3U31A 2A3RA 4YXWD 3BGWA 3FGNA 5KQLA 3RANA 1M7BA 4CKXA 2QV0A 1WXHA 5KYVA 3WIOA 4A0GA 2BFNA 2XEXA 2BKLA 1MC4A 1NT4A 4KPFC 1NT2A 1I2AA 2H1FA 4ECEA 5DN6D 3NETA 5JPCA 2JFGA 5HF8A 4Q9IA 1JR3A 2IYNA 3FF1A 4JL5A 1YUMA 1DC6A 3KJIA 2BKEA 1ESMA 4GRDA 3TMKA 1A4RA 3SC6A 3W06A 4A3SA 2V8BA 4HB4A 5I47A 5LQUA 1M1UA 2XYRA 4GNRA 5H7XA 4X0EA 3IKLA 5T64A 2HU5A 1KZ7B 1L7XA 2FETA 3NAQA 3PT5A 3F9IA 4TL9A 3SJZA 4AJNA 1Y1QA 4RCVA 4O4JF 5JAIA 1X8JA 1M2WA 1UJ4A 1JRLA 3BGIA 4I81A 1GTRA 4IG9A 1RC0A 3TR5A 1HE8B 5C1PA 5TPZD 1H4TA 4QNMA 3PJFA 1U7HA 1HC7A 3AR5A 5IK2D 1FU4A 1QF6A 4X00A 2O0LA 2QJWA 2VQFB 3QBEA 4BVHA 4WNAA 2VPPA 3LF2A 4L6AA 3A1NA 3K8OE 1XZDA 4C6RA 5ADVA 2WB4A 3CZCA 1JFTA 1WM1A 1QHXA 1IATA 2GM5A 1QGOA 2VDVE 1P7YA 2PGNA 2RHJA 4QYMA 1SHTX 5J9FA 4QA9A 4TX1A 2GN6A 3FUWA 3HO8A 1THMA 3C97A 3LU1A 2J0UA 1GRVA 3OH8A 2V6MA 4HXGA 4CODB 4B3FX 1LVHA 3V4VB 3O7WA 4BX0A 3M5CA 4XKJA 4MW2A 1JZQA 3QSYA 3F5QA 4DEYA 4I5IA 3IL2A 1BVYF 4GX2A 4Q4AB 1RU3A 4JLSA 5CDHA 3QTBA 5JNUA 3LVFO 4R54A 2ZITA 1RRGA 3EQ6A 1ZRHA 2ATIA 1AKTA 1HV8A 2QP3A 4DA7A 2I62A 1VA5A 3DXZA 3PD1A 2Q49A 4IOJA 2BGLA 4FDLA 5C4IA 1W48A 2XDQB 1VL6A 4LVOA 2B8EA 2UUPA 3FYCA 4P2BA 4RVFA 3ZHVA 1QE3A 5E3HA 4NKRA 3G9XA 1HLDA 4YC7A 5LYJA 4INPA 3HB5X 2DCUA 4D6YA 3E3OA 4D8XA 5KVSA 1I6MA 1ZLXA 4B6PA 3MCTA 5ILGA 2WSIA 4H4DA 3UY4A 5JC1A 1OXTA 5KX5F 3L0SA 2WG1A 1DBVO 5HPYB