1DAFA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid, adp, and calcium
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHETASE
total genus 71
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dafA00
1II8B 1BYUA 4JS0A 1R5NA 1RJ9A 1QVRA 1M7HA 2AK3A 1DADA 2F43B 4BUJA 2GZDA 2H1LA 1KAOA 4WAUA 2D62A 2NQ2C 2ZRDA 2CHGA 2WWFA 3KTAB 4PAMA 3SJCA 3EXAA 1NJGA 2ZJ2A 2ONJA 4W5JA 3E2IA 3WMGA 1QHIA 2V7QD 4QNRA 4S35A 4PZLA 3ZDQA 1TTTA 4KYUA 4NU0A 4I81A 3U7FB 2O5VA 4RY2A 4LUCA 5HE9A 1KI2A 3TLXA 5CDFA 4DSUA 1A1VA 3S1AA 4BLOA 1HQCA 2H57A 1Z83A 1VG8A 4IDQA 1XXHA 3I8SA 3T12A 4Q03A 1G291 3KB2A 4A92A 3J81k 4HB3A 1YZKA 1ZP6A 2IBMA 4F91B 1GDDA 1DARA 5J4LA 1XJ0A 3QI2A 3CF0A 1WA5A 3GJ7A 1RC8A 2A5YB 3TIFA 1JPJA 1PUJA 3LAWA 4X8OA 1G5RA 1QRAA 1XTKA 2WKQA 2YVUA 1D8TA 1MT0A 1FQJA 3ADDA 1AIPA 4Q02A 2GJSA 3TR0A 4JJKA 1D2NA 1BH2A 2OBNA 1E3MA 1KI7A 4NYIR 3K70C 2IXEA 4M1WA 3P4XA 2HCJB 2ZQ5A 4MGYR 3TGPA 4IRUB 3JZAA 4IKEA 1HV8A 3MWLA 4WZBE 1DAIA 2E9SA 5JEEA 4TL7A 4U5XA 2ZVPX 2GEUA 4M1YA 1JR6A 5EP3A 1ZYUA 2C95A 3ZVMA 3SEAA 5KSYA 2VHCA 2FPMA 1E1QA 1YRBA 4BRUA 3MSXA 4HB2A 1UEIA 1W2GA 2IYRA 4J0QA 4MYCA 3EW9A 5B58C 2FU5C 3GEHA 4O2LA 3K0SA 3KX2A 3R8CA 4DLVA 3NBFA 3KQNA 2ZRBA 1N6LA 1E69A 3CW2A 721PA 2RGXA 3G0HA 1JJ7A 4QRHA 3LW7A 3GJ6A 4ZKDA 5HZHA 1U0JA 4ZDWA 3W6OA 1U2RA 1XXHB 3GCGA 1ZC4A 1IM2A 1WB9A 1KDTA 1KMQA 1S8FA 4WIAA 4QGAA 4NH0A 3H2YA 1MABA 3FWYA 4E5UA 1VCMA 2HYDA 4ZPXA 1KOFA 1ZBDA 3EZ6A 1KSFX 2C9OA 2VBCA 3AF3A 4A6XA 1TQ4A 5HKKD 2NO6A 1UKVY 5TXGA 2W6IA 4G1UC 3FMFA 4LJ8A 4EJSB 4EPYA 8OHMA 4QG7A 1II9A 1NIPA 5EQTA 1KI3A 1OXTA 2ZRIA 1LS6A 1Z0IA 4M9XA 1UDWA 5FTKA 3M4YA 1NVXQ 4IXNA 1AKEA 2O8BA 1N0VC 4MYHA 2DWQA 3U6KA 3TQCA 4URYR 1KIMA 1YR8A 4I1SA 4FCWA 3I73A 1BS1A 2XJ9A 3QXXA 4LOAA 4LV6A 3RRMA 3SE0A 3MWKA 2YOGA 1QHYA 1R0XA 1ZM4A 1YZQA 2AHOA 2ODBA 2PLRA 3CM0A 3EG5A 5AJWA 3VFDA 3Q72A 521PA 2R8RA 4M1KA 3DDCA 2OILA 2IYVA 4I99A 4I1OA 5G53C 3ZZTA 1LV7A 1LY1A 1YZTA 1GKIA 1E1RD 4I4LA 4KFTA 3EZ9A 3SQWA 2B7CA 2YC2C 5AUPB 4BFSA 2UKDA 3IBGA 4YMUA 1E0JA 2P65A 4G5OA 4HLUA 2ORWA 4LPKA 1JBKA 2CJWA 4ARZA 1A82A 3UIEA 1WQ1R 2A78A 2F7SA 1SVMA 4LK2A 1X1RA 1NBME 2W2XA 4P31A 4DCSA 1EWQA 4TLEA 2QBYA 4AK9A 4AY2A 3U3OA 2IL1A 4GT1A 3X1WA 2J87A 3FKSD 4QGFA 5E7MA 2GEDA 1DAEA 1E2HA 3FMPB 4C0KA 4R2IA 5EP4A 2JLQA 2F1JA 2GJ9A 5CJPA 5IHPA 3KXKA 4ZV4A 3DHWC 2H7VA 5EE1A 1AQUA 1FX0B 4TL6A 1F48A 1KO1A 3AKDA 4TL8A 1F60A 1TEXA 4JBYA 1PZNA 2JLZA 4ZDIA 1BIFA 3UWOA 1ZVQA 1TUIA 2MSEB 1JR3A 2JJ2D 4AYXA 2JLXA 1G3UA 5JZVA 2OG2A 821PA 5J4HA 2GAAA 3NC1C 4DBLC 1TUEA 3R9XA 2JEOA 1OHHD 1U81A 4HDCA 1AS2A 1XFAA 4RSGA 2W58A 1ZUHA 2MSCB 1YZUA 4LJ5A 1XJCA 1KJWA 2BM0A 2D4HA 1RW4A 3B60A 5KSPA 4D82A 1W4BA 1C4OA 4Q9KA 2ZRKA 5FR2A 1XTQA 3G5UA 4GP6A 2ZE8A 5FOUA 4DUGD 2UVQA 3B1XA 2F1HA 1Q21A 1CKEA 3FHCB 5DYGA 5BWMA 1KI8A 2PMKA 1R6BX 4OQFA 4O0MA 2X2FA 2V54A 1J8YF 5CK4A 1GSIA 1N6NA 2FF7A 3T34A 5B64A 3LBHA 4IDNA 4JZKA 4WVFA 3QVVA 5JS7A 2A7QA 1W0KA 2ZJBA 2I1VB 1GP2A 2GCPA 2W0MA 1H8ED 3I5YA 2GRJA 3AVQA 4GZMA 2VHQA 3CRW1 3KFVA 4Q7MB 2IEZA 3RS2A 4A1FA 1CJKC 1D2MA 1W4CA 5FBWB 3WYGA 3GLGB 2PCJA 1KDPA 1XP8A 1XTJA 2AFHE 2J0SA 4XTCS 4XSGA 1G7TA 4TYPA 4RCZA 4IOKA 4CYMA 2C5LA 3TBKA 3ETLA 3O8RA 2WJHA 2XSZA 2R62A 4DJTA 3AP3A 5DO9A 4TT3A 1CU1A 3KQKA 3QF4A 1FL9A 4D80A 4AYTA 2E87A 2ZAMA 2CE2X 4B3GA 4AG5A 2C2HA 1H8HA 1P72A 4EPVA 2BWJA 2CLCX 3OEHA 4HLCA 4E22A 5CJ2A 4JIMA 3JVVA 4MH0R 1N6OA 4DEYA 1RRGA 1XPRA 1GKUB 4Q01A 2ANBA 4FWIB 4DCUA 3RS4A 3AF4A 1Z6AA 2GF9A 4UXHA 5KDDA 5AJYA 2WAYA 4RZ3A 4V0LA 4X8HA 3X2SA 3QG5A 1T4GA 3SYLA 5GJWC 3B1WA 5CIWA 1Z08A 3SDZA 3GEEA 2KWIA 3AB3A 3K9LA 4HEJA 1YKSA 4EPRA 5FH9A 3HU3A 1FMJA 2A2ZA 2WJYA 1E2KA 3A6PC 5KHOC 2OFOA 3IQWA 4PQYA 2O8CB 1HTWA 2R9VA 3SI7A 2ZS7A 2HCBA 3EWSA 1CBUA 4GI7A 4M22A 5KNBA 1RE0A 3SOPA 4JBWA 3U44B 2BV3A 1Z0JA 2X2EA 4B2IA 3QG1A 4KJZA 4EQ6A 1P61B 4Z54A 1WXQA 1NMXA 1NY6A 5AJXA 2A5DA 2BMDA 4TQUS 4AWXA 1QG2A 2ZUDA 3GLGA 1E2QA 4D4LA 3VMFA 1JAIA 4I1VA 5GJCA 2O8BB 4HZUA 1N0WA 2NO1A 2GXQA 4G5RA 2QAGB 1OIWA 1ZW6A 3NDBB 1EFRD 1XMIA 2GJAA 3B9QA 3ND9A 4MGIR 4G0NA 3TQFA 3ZH9B 3BORA 3CLVA 3W6NA 3K9NA 4GMXA 2PZFA 3SR0A 1I4TD 3VR1A 1UKEA 2QAGA 3U6BA 4PHGA 2Q3FA 4MUAA 3HYTA 2FSIA 1J2JA 4M1MA 3UMFA 1DAHA 2HT1A 4ZCMA 4TQ9A 2AN9A 2ZI7A 3VKHA 4MRVA 1MO4A 4Q9IA 1N0UA 2FOLA 2JLSA 3KDSE 4C2TA 1CF4A 4BECA 4JKYA 2QPTA 4G5SA 2X77A 4H9GA 4B33A 2ASEA 1GZSA 1R0YA 1KNXA 2QZ4A 2IYWA 4LCBA 1L8QA 2W2TA 1XXHE 4IFBA 2A5GA 3ZS8A 3AQ4A 1KYIA 1NN0A 5FI1B 1T5LA 2V9PA 2XSZD 3U7HB 4FWTA 3F3YA 5BN4A 4XIGS 5L3RA 4P4SB 2OLKA 2OCPA 1KNQA 1XF9A 2QT0A 3AVPA 2PMDA 2YOHA 1DAMA 4G01B 3DM5A 2HF8A 2Z4SA 1OFTA 2WSSA 2AXPA 2X1VA 1FOEB 3P27A 3FFAA 3AP2A 1GL7A 1U94A 2FEOA 2VHUA 3OEHD 4H1VA 4L8GA 1OF1A 2A5JA 3GFOA 3LVRE 1LTQA 2EWWA 2XTNA 1QHHA 4PXAA 4OI1A 3K0AA 5HCIA 2WVJA 3DO6A 3LXXA 3PEYA 1E2DA 1P2UA 4QHYA 1KY2A 1MKYA 2DFNA 3NH9A 1XWIA 4B3XA 2BM1A 5DISB 3SZRA 5JEDA 2F3TA 1N25A 3HU1A 3MAAC 2VQSA 3PR1A 1LS1A 4IDOA 2GF0A 621PA 4JKIA 4EUNA 1UFQA 3TMKA 4R7ZA 4CGZA 1KK0A 1S4QA 5FUVA 2QQ0A 5IDVA 4F38A 3WBKA 4LBYA 3S1AB 2QORA 4TZ0A 4B43A 2R65A 3BH0A 4DDWA 4W9MC 1E2EA 3HPRA 4HLQB 1XD2B 4B3DA 3T15A 1OH5A 1LNZA 3EARA 4DSOA 1YVDA 3B1VA 5KDLA 4F4JA 4FINA 3VR5A 3U44A 4TLAA 1CTQA 3DKVA 2XNDA 1LB1B 3A36A 3Q8XB 1S3GA 4M53A 1R4AA 2ECKA 221PA 2JCSA 4OBEA 4OK3A 2X8AA 1COWA 4JBXA 4RZXA 5SZIA 2P6UA 4NKRA 3DKPA 2FNAA 3DOEA 4M1OA 4TSFD 5JBQA 3K9HA 3TAHA 1G41A 3A1WA 1N5KA 1P9RA 2O8FA 3HR7A 2FWRA 1RKBA 2GAOA 2OCYC 4TYNA 1NF3A 3ZVRA 1X6VA 1E1QD 3EAQA 5M04A 4Q47A 4NE2A 3KB1A 2FG5A 4UNNA 4ACAA 2OUKA 1FFHA 3CRQA 4M1SA 2XEXA 1EFHA 1VHTA 4AD8A 2CDNA 5TDHA 2KE5A 1G3IA 3ADKA 3B9PA 1JI0A 2ZAOA 4PPQA 2JASA 1I2DA 4OL0A 1U8ZA 4UXIA 5DGXA 3U5ZB 3QEOA 1HUQA 5B57C 2IS6A 4Y0VA 5FI0B 3TVTA 4BQSA 1OIVA 2ZSDA 1SHKA 2G0NA 2PT7A 2OAP1 3K8YA 2ZXUA 3IIKA 4JT4A 3Q5EA 2Z4RA 2QN6A 1G64A 2FSHA 1HE8B 3KXIA 2EFHB 1TPZA 2QU8A 2P67A 3ZGXA 1E79D 3FVQA 3I92A 5TARA 2XAUA 1E0SA 1KO8A 3GQBA 5TVKA 2WM9B 2FMXA 2VHJA 3I1FA 3KKMA 1SHZA 2DCUA 1GITA 3Q85A 4N0EA 2VF8A 5G3ZA 2HLDA 3AVTA 1CRPA 1Q44A 2GDJA 3SC3A 2WIBA 2D2FA 3AVWA 3KFXA 1EXMA 2RGNA 1EFUA 1Z6XA 5AK0A 4XD7A 5FBLB 2WPDD 4JL6A 2F43A 2QEQA 4PAOA 4TQAA 1Y63A 2GETA 1IY2A 3FKQA 5B30A 2GCOB 3K0CA 3PUWA 1E2GA 2YV5A 1EFRA 4G5GA 1CLUA 1P9WA 5TMPA 4DLZA 2ZROA 4ZIRA 2ATVA 4Q1DA 1VCIA 2GNOA 2GWHA 2WV9A 4ON9A 3QIAA 3ZD7A 3BAFA 4LYHA 1JNYA 3RSOA 3FFBA 4Q4JA 3QXSA 1RRCA 1YU9A 1OXXK 1Z8FA 1XEXA 3LX8A 2OSBA 4XWKA 1KZ7B 4JLAA 3OE7D 2ZRMA 5HZKA 4V0ME 5FTNA 3IBYA 5DN6A 4HDOB 5FFMA 4DIEA 3MJRA 3CPHA 2FEMA 2CCJA 1AGPA 2DFTA 3IHWA 5EUMA 2IUUA 1NVVQ 2BIFA 2QSZA 1T91A 2ZUCA 3B6EA 4TSFA 1ESNA 3BB4A 2CHQA 1TF5A 2BDTA 3VAAA 2C03A 2AD5A 5ELXA 4EIWA 5C46F 2Q9CA 1R8SA 2ZRPA 2BCJQ 3KJGA 2KBFA 2WKRA 1HURA 1CXZA 1HY3A 4LJAA 4B6FA 3IILA 3TSOA 1KO7A 3WNBA 1NBMA 1F2TB 3UXMA 5LD2B 4B76A 2ZJYA 1DAGA 1B0UA 2OLJA 3H1TA 4QM7A 2FFBA 5F98A 2KBEA 4US0R 2IYTA 4V0MA 2NOAA 1R5BA 1ZNXA 2J5XA 4JSTA 1MO5A 1M6NA 4BLPA 1G8HA 1HA3A 3GJ5A 4HYYA 4RFVA 4XVQA 1HT1E 3K0AB 4LJ9A 5BQ5A 4KAXA 5DYIA 4BE7B 4ABYA 2ZRHA 4DB4A 2XXAA 1Q12A 2P5SA 3I72A 3UG6A 1IXSB 1TX4B 1K8RA 2ZI3A 1E79A 3JVUA 4FCVA 2JJ1D 4LBZA 4EPWA 1EX6A 5GJVC 2XXAB 4TYQA 1JPNA 4PC7A 1R0ZA 1G20E 1P4SA 2GILA 4TTQA 2IYQA 2CLDX 2ZVQX 5AWFC 3D3QA 2ZSBA 4DEXA 1E98A 1SVKA 2JAQA 1BMFA 1MO6A 2QMUA 4Q19A 5FTJA 1KSJA 4Q9LA 2IC5A 4Q4HB 1Z0FA 4EPXA 1KZGB 1OSNA 2OV2A 3CPEA 3TVDA 1IN6A 4DXAA 4P4TA 1ZRHA 4Z1MA 3GJ0A 3OESA 4IVQA 1T8UA 4Q1EA 4K81B 1DAFA 4C0JA 3I3SR 4JJZA 4F7WA 2O8EB 4MGKR 5JJIA 3IPYA 2IYYA 3VQTA 3C8UA 1E0KA 5CM9C 4WA7A 5FPSA 4NYIQ 1F2TA 4DDUA 4D0GA 3SBEA 4JVMA 1KO5A 4BPBA 4QOSA 4KVGA 5DHAA 3T35A 3AVYA 4YMSA 1UAAA 2NG1A 4TT3D 2XGJA 3VNVA 2JLVA 2PJZA 3IIJA 4KBGA 4PHHA 2ODNA 2AKYA 1N6IA 4QKQA 2QP9X 2XB4A 5SZKB 1PUIA 3MLEA 1VG1A 2GA8A 4ZIRB 5H1YA 5A0FA 2J7PD 4JVLA 4LJ4A 1D6JA 1E4VA 2KJQA 3TAUA 1QVAA 2IUTA 4JLBA 4BLSA 3LXRA 1UBGA 5AR1A 3BFKA 1NLFA 1Z22A 2C98A 4MITA 3THXA 2BEJA 2ZI9A 4TMKA 3QPVA 1J8MF 4A8JA 3PEVA 3E70C 2AXNA 2RAPA 3NBYC 2PZEA 3OF5A 1G8GA 2VRWA 2O0JA 1I4DD 4PHFA 1NBMD 1UF9A 2IYSA 1QF9A 2ZI5A 5FPYA 4NYJQ 4NONA 4E03A 5AJVB 1FUUA 2FPLA 3R9IA 1NN5A 1EWRA 1FX0A 1NG1A 2VP5A 3VHLB 4GZLA 5FOVA 3QQ5A 3ZIAA 4IDHA 2DYKA 5D3MA 5KPJA 5F9FA 2G83A 4Z1MD 1X8LA 4BWYA 1JAHA 2AWNA 1XMVA 2J7KA 4V0NA 1TU3A 1P5ZB 1ZM7A 3LFUA 4ZO4A 1NVWQ 3RS7A 4BZQA 3MFYA 3W3AA 1QHSA 2DBYA 2HUPA 3QY0A 4KLNA 2WMNB 2ZU0C 3L0SA 4F93B 4RFSA 1W7AA 2FGJA 3BGWA 2H8KA 2VH5R 4DDVA 4M21A 1GRNA 4MGZR 2DFLA 4LGMA 4BFVA 4C0LA 1M7BA 5K8UA 1BMFD 1SKYB 2OCAA 3MD0A 2WOJA 3CB4A 1VYVA 5FOWA 2ANCA 3LO5A 4CEJA 1J7KA 1EK0A 3CF2A 1ZM3A 5CLLA 2FH5B 3SFVA 4FMDF 3O8BA 2V1UA 2BCGY 4JVNA 1G6HA 3DMNA 5FL3A 2OFXA 2R2AA 5JI3E 2HYIC 2YINC 1UADA 5J4YA 1W48A 2P6NA 1FW6A 3B5JA 3WYAA 1CJMA 1LF5A 1W0JD 5JHHB 3U4QB 2WWYA 5KPDA 4LC1A 1TNDA 1S1CA 1Z06A 4I1UA 1KDOA 1G6OA 4JMPA 1TQ2A 3FMOB 4LI0A 5CLQA 5AUQA 5TY0A 1Z2AA 2F1RA 2ZE5A 3H4MA 5DI3B 4DLUA 2WJJA 2RGEA 1IONA 3VKWA 2F6RA 4BZPA 2J45A 4IOLA 1JXMA 1RFLA 1NP6A 4IXMA 3EWAA 2FGKA 3THWA 2VL7A 2ZM5A 3LLMA 2G9NA 1YZLA 4ITRC 2KB0A 3C7KA 2ODEA 3KUCA 2HF9A 4NTZA 5IRCD 2JJ8A 4URVR 3TUIC 3LVQE 5EE3A 2YWGA 5BYJA 4CW7A 1UEJA 1OFHA 3WNDA 1DVRA 3GLFE 3T1VA 5DLQC 5C2JB 1MRSA 3Q7PA 2R6AA 4A9AA 1E9CA 2UZ3A 2E1RA 2FDCA 3DL0A 1OXSC 2VP0A 2AFIE 5G3YA 4OJKA 2JLYA 4Q5IA 1OJLA 1MABB 2AD1A 2PEYA 4HDQB 5JHGB 1E4YA 4C0SA 3X1ZA 4A2QA 4YONB 1AGRA 3MUFA 4HUQA 2NTYC 3AGQA 4EFMA 1YHNA 4ILEA 5J47A 3LBNA 5KTYA 1NY5A 4V03A 2BMJA 4PSVA 4NMMA 1KO4A 3MWJA 3WRXC 2VA8A 5LDDC 3KXLA 1IN7A 3SQXA 1CRQA 2WSMA 1C9KA 3L8ZA 4NCNA 5SZHB 2G88A 2B8TA 1GNPA 1E9SA 3REFA 4QBIA 5F3WB 1W1WA 2PLFA 2MSDB 3QENA 4LHYA 4P32A 2O8CA 1X8KA 1COWD 1D9XA 2DWOA 2YWFA 3GD7A 4GBMA 2W6JD 1GAJA 2BHRA 4DCVA 5LBIA 4IEIA 2G1JA 2V55B 3K0FA 3KQHA 1E2PA 1XCPA 3WHKA 1YZGA 2QMOA 2JLRA 4WBSA 2NIPA 3AKYA 2O8FB 2HXYA 1ZNWA 1N6RA 2EU8A 1US8A 4NCJA 2V7QA 2A30A 4MKHA 1SGWA 3TR5A 2EFDB 1PLLA 3RVBA 5BXQC 1VIYA 1ZD8A 3F0TA 3NBZC 3BFVA 2IS2A 4NHOA 4NZYA 1ANKA 4AURA 3R9WA 4QXAA 4HAYA 3EZ2A 5JWOA 3BS4A 2JLWA 1NG9A 2ZRFA 3KKPA 3M6AA 4KVAA 4FMBB 4PC3A 5CYOA 3ZVLA 1YE8A 3LD9A 3GMTA 3P20A 1BO6A 1N5IA 4BASA 2BMFA 1PLJA 3W5JA 2ZI4A 2WBLC 4BFWA 2J0QA 1YR6A 4GOJA 5KYKA 4MYTA 1GRRA 3PCRB 4Q4LA 1GILA 3ECCA 4RZUA 3PVSA 2J41A 3ZQJA 4Q21A 4D0LB 1FMLA 3IO3A 3LDAA 4L9WA 4XJXA 3N2EA 3PJRA 2FV8A 4R9UC 1NSFA 3P26A 3U60B 4OQLA 3L43A 3ZD6A 1XPOA 421PA 4LJ7A 3OZXA 3A1SA 3QPUA 2FFAA 3PV0A 4BEJA 1H8EA 2RCNA 4AC9A 3WY9A 4FW9A 1M34E 3BWDD 2C78A 3I62A 3V9PA 1E32A 4FXPA 1DOAA 1TQDA 3SNHA 4OI4A 3AEZA 4TTPA 3GJ3A 3AF2A 1SVSA 5FUXA 1L4UA 1XD9A 1O3YA 2CL7X 3F5FA 3QBTA 4OHXA 4HLDA 3DVLA 3A4MA 4PZYA 1E2JA 2WWXA 3B2EA 4K8OA 3K09C 2J46A 3PEUA 3OE7A 4LJ6A 3K70B 3LNCA 2W2VA 1K6MA 1E2NA 3ASYA 2XITA 1WP9A 3CX7A 2J3EA 2ZRJA 1AA9A 1XD2A 2OT3B 4LZZA 5DN6D 2F9MA 1HQYE 3EPJA 2RGCA 4CEJB 2B8WA 2IHBA 1IBRA 3GJXC 4FIDA 3AF0A 4MKIA 4RJLA 4YMWA 3SS8A 2W83A 1NI3A 3QKUA 1T6NA 2B7BA 2OBLA 5DSZA 1KK2A 3T1QA 2VP2A 5EXSA 4B73A 2QBYB 2C04A 1D2EA 3K1JA 5L3QB 1Q20A 2BOVA 1IJEA 2QRZA 2IYZA 2N42A 3A4LA 3WP1B 5KUTA 5HCNA 1KK3A 1AZTA 3NHBA 1VDZA 3R7WA 1IXZA 3RC3A 1JB1A 2J59A 4KFRA 2OESA 4NCKA 4TN1A 4D0NA 4W5WA 2FE4A 5EXTA 2KI5A 4NCHA 2SHKA 1Q1QA 1BKDR 3BC1A 4LHZA 2EFCB 5C1BA 1E99A 1US8B 3AUXA 1L2TA 5K8TA 1NMYA 5EUQB 4MRSA 3W90A 2PBRA 2IT1A 3WMEA 4BRWA 1ZINA 3QKRA 3W5IA 4IHQA 3EIQA 2VO1A 4OK5A 3EPHA 2H92A 2DFKB 2ZR0A 3EA0A 3ZYCA 1E9EA 3M0EA 4GP7A 1XZPA 5EZ6B 3ICEA 4POAA 1TL7C 4N1AA 2REXB 2EW1A 2NPFA 3T5GA 1ETUA 1VG0B 2MMCA 1XU4A 2RGGA 5L8VA 4O3MA 3CNNA 1XZQA 4B74A 1X8JA 1G8PA 4URUR 2K5UA 4Q66C 5KSOA 3BK7A 4TLBA 1SVLA 1NRJB 2ZYWX 3PG5A 3BERA 5FL7D 1DAKA 3PQCA 2QL6A 5KOYA 2IYUA 1T0JB 4HUQB 1EESA 1JALA 1E2FA 4URWR 4QJ5A 5K8LA 2G6BA 4TLCA 1IQPA 1CULC 1S3SA 3WXMA 2GTPA 121PA 3A8TA 5CK5A 1JJVA 2C77A 1M8PA 3C5HA 4TMVA 3SJBA 3WNCA 1R10A 4II7A 4OHZA 5L3SA 3NC0C 2Q0HA 2Z0MA 4MRPA 3IDQA 1MOZA 3CUEF 3B8HA 4XVRA 5DHFA 4DLYA 1E9DA 4DSNA 2NPIA 1G1MA 3R7WB 1CIPA 1N5LA 2VIIA 2ZPTX 1KKMA 1OKKA 1BOFA 3D6TB 4Z8YA 3L8YA 5G41A 1KDRA 1Z2CA 3BH6A 3KTAA 4PO1A 3VTKA 5BYKA 3AM1A 1KK1A 4D6PA 2DB3A 1AN0A 2CNWD 4RD2A 4ZCIA 5JCZA 3AP1A 1KI4A 2JJ2A 3U3RA 4B3FX 1QZXA 4B47A 3K53A 2VSOA 2QE7D 3NDPA 5LB4A 4C0HA 5JWHA 2QP4A 2QA5A 3WYFA 1KSGA 2G3YA 3GLHB 1G4AE 4IVRA 1FQKA 1ZM2A 5FOSA 1E2LA 3K0FB 3THXB 2CEAA 1Z0KA 1KI1A 1SXJA 4A8JB 1XEXB 2AL7A 4GNKA 5CB6A 3OIUA 4HATA 5EXXA 1TMKA 2BJWA 2D3WA 5JMTA 3CIOA 3BJIC 4RZ2A 4Q1AA 4LRWA 2ZUBA 4OYHA 3A1TA 4M4SA 3E1SA 1PLKA 4MDFA 1FP6A 1E6CA 3BIFA 1DE0A 3IGFA 5K8IA 1XX6A 4PX9A 3O8DA 3GLIB 2QSYA 5JJLA 3Q5DA 2WAXA 4EJSA 4WXRA 3GP8A 2GESA 1YJ5A 4US1R 4DLTA 3QXJA 4NL4H 4IDPA 5KSZA 2XX3A 4PTLA 2IEYA 2WTUA 1JEEA 2CL0X 2Q3MA 4WW0A 1GNRA 2WWGA 4FN5A 1NN3A 3BD9A 4Q18A 4RVCA 3RS0A 3CO5A 2GXSA 2WOOA 2WZQA 4CT5A 4MRRA 3AVVA 4NYMR 2I4IA 3W9YA 2FSFA 2ZITA 4RD6A 4FMCB 1F5NA 2OE2A 3ASZA 2QTHA 1G17A 4C0AC 2CNWA 3HYRA 3X1DA 1CR4A 3TKLA 2OHFA 4DT1A 2ZJ5A 4LBWA 3ZZ0A 1FPMA 2ORIA 1U0HC 1G18A 1ZU5A 2OO7A 4G3XA 1J90A 1H8HD 4LY6A 2QENA 1EFTA 4TL9A 3O8CA 1J70A 4O25A 3GJ8A 3U3JA 4Y0AA 3CNLA 1AQYA 4JYCA 1N6KA 4LPSA 4GPTA 2NGRA 3C14C 4CEIA 5JI2E 4Q4HA 3CKLA 5AUNB 1DELA 4L15A 3TSWA 5LD2C 4UKDA 1SVIA 4LHVA 3BH7A 1W44A 1ZUNB 1P7CA 4YQFA 4BFXA 5JSZB 4PSKA 1NVVR 2REBA 3AH8A 2RHMA 3OEED 2CXXA 3B1ZA 1E0AA 3FDIA 1OW3B 2BEKA 2QE7A 3VR6A 2G77B 3EPKA 4JLKA 1ELOA 3GJ4A 2HT6A 4IW3B 3GLGE 3QF4B 1G7CA 2CHVA 1ZUIA 2J0UB 4IOMA 3RHFA 1EFCA 2AX4A 4ZI3A 3SJAA 1YRAA 4R2HA 3LW8A 1WBBA 4TTRA 4IEEA 4N3NA 3P4YA 5A4JA 1KJYA 3OIVA 1N5JA 5ANRB 4MDEA 4A0GA 3W34A 4PAQA 1R7RA 4LYAA 2A9KA 4PO8A 2VLIA 4C0QC 1P62B 3RANA 5DH9A 4UNRA 4GMDA 3THYB 1OH8A 1XTRA 4LX0A 3HP1A 2QT1A 5H70A 1U90A 2ZR9A 5HE8A 3MWYW 4ERNA 3I5XA 1X86B 4GDFA 1IN8A 1LF0A 4AYWA 1NNEA 4D81A 2GVZC 2V6JA 2RMKA 4JYBA 5UKDA 2BVNA 3ZQ6A 4KFSA 2B21A 5EZ5A 3UATA 4EDHA 3ADCA 1IOZA 4TWZA 2PCLA 1G8FA 1XTSA 4M9ZA 2BKUA 4EQ6B 2DPXA 2P5TB 4OHWA 3CF6R 3OIYA 4Q48A 5JSZA 1GVNB 3VR2A 3VX4A 2WJGA 3RC8A 4CEHA 2FZ4A 3PFIA 2CCKA 2O0HA 2YWEA 2W6JA 2OM2A 1Z6TA 1NSTA 4YC7A 1GKYA 5CYPA 4B6EA 2EVWX 2OXCA 4PQFA 3OFND 3OHMA 3QKSA 4LHXA 4YMTA 1WBDA 2ZYVX 2JIZD 1MRNA 1Q0UA 2A5FA 5TV2A 5DI9A 5FPKA 3ADBA 2QQEA 3ZLJA 4P4UA 4CEHB 4A36A 3K0EA 4JL5A 3F8TA 3QVUA 2BMEA 2Q9BA 2QUZA 1VMAA 2V1XA 1Q57A 3B13B 4MKFA 3Q7QA 1ZIOA 1U8YA 1CR1A 3L0PA 2ZYTX 2D06A 3C16C 3DMDA 3ICQB 4KYIB 1D9ZA 1DBSA 2D7CA 1NLYA 3D8BA 3O47A 3H84A 3M1IA 4QL3A 4B35A 3LV8A 2Q3HA 2CBZA 3FPAA 4UNQA 4NDZA 4QBGB 2O52A 2EWVA 3TH5A 2XZOA 1G5PA 4V0KA 5E7IA 5GADl 1R8QA 4C7OA 1W4AA 4GFDA 3GPLA 3IO5A 4DUGA 5HKKA 3K9GA 2IF2A 1S9HA 1XRJA 4PHTA 4PPFA 4DVGA 2EFGA 3K70D 1CEEA 3QBVA 1SXJC 4U02A 2O8DA 4YDHB 4JLPA 2QMHA 1ZU4A 4ESHA 4QBFA 3CONA 2IHYA 1FP7A 1GL9B 3CR7A 4JVSB 4M9QA 1I2MA 4BLRA 2R6DA 1XB2A 1U8AA 4IOJA 3W6PA 4KI0A 1P9NA 4MA4A 3ZJYA 5KNDA 1ONBA 2QRNA 3UPUA 3EZFA 2BBWA 3QF7A 2QG6A 1UM8A 4Q00A 3RS3A 4ASUD 1X1SA 2AK2A 3QJYA 1IXRC 1OPXA 2R6GA 3MRSA 1CJVC 5P21A 3VNUA 2IYLD 3TE6A 2B6HA 5IK2D 1UBEA 3D31A 3RYTC 1HT2E 1G3QA 4RD3A 4ACBA 1WMSA 3ZVNA 2FJUA 1EGAA 2NZJA 3AVXA 2YYZA 3RSLA 4D4JA 1OB2A 2HXSA 5FR1A 4PC6A 4ZI2A 2RKOA 1IHUA 1NN1A 5CDFE 2IWRA 4OI0A 4A15A 2ZYUX 5B2ZA 3R8FA 1Q1EA 1SKQA 3QSYA 2IXGA 1TF7A 4G5QA 2V3CC 2W0SA 4KCGA 4P3YA 2XB2A 2GK7A 5EXPA 3IEUA 3EA5A 2HDNB 4AG6A 2D7DA 5J40A 1TU4A 1ZCAA 2HV8A 3GEIA 4B34A 4DT1B 3SHWA 1SQ5A 1G16A 2YWHA 5JLJA 2ERYA 2ZR7A 1KSHA 1FZQA 1OE0A 4HSEA 4U00A 4DHEA 2G1KA 4IJMA 3PUVA 4Q4AB 1OHHA 5F9HA 2ZIAA 5JWRA 1GG2A 1MV5A 2GKSA 2O8DB 1OV4A 3C4JA 2ZSAA 2IWHA 4CF7A 4IFEA 4CDGA 1IAQA 3HR8A 1MO3A 1E2IA 2V6IA 4D25A 3QXHA 2ERXA 1ZAKA 4AI6A 3DM9B 4DDTA 4BLQA 1DO0A 1JXOA 3BOSA 2CK3A 5BN3A 5CB8A 1ZM9A 3LWNA 4DSTA 3WBJA 4TYYA 4LV5B 2HLDD 4B3CA 2J0UA 4KLZA 4W7SA 3I8XA 3NXSA 5FBRB 4MYUA 3CRMA 4DIDA 1GWNA 2WHXA 4OQNA 4JSYA 2W00A 3LLUA 3C5CA 3B7GA 3CX6A 3EIHA 3U3KA 1VYUA 1LFDB 1WRBA 2Z6VA 4ZDKA 4YLGA 1GUAA 3N70A 3VU9A 2F9LA 2NO9A 3A37A 4UJ5A 1FUKA 2KSQA 1CJTC 4DZZA 4M2LA 4TMZA 5BN5A 2WIAA 5L3VA 2OAQ1 5DNYB 2YKGA 5CITA 1VIAA 1HH4A 4A0FA 3N5CA 1KJZA 1GOTA 3RAPR 2VPPA 4KITB 3VX3A 3DEFA 4HB4A 1O87A 4HLUC 3THYA 5FL7A 2I3BA 4OQXA 1HEIA 2LKCA 3SJZA 4HI0E 3TW4A 2ORVA 3PIRA 2GZHA 4JT2A 3ZIAD 3RDPA 4BFYA 4LWZA 3QKTA 2I1QA 4EFLA 2VF7A 3MGCA 3P32A 1E96A 2Q6TA 2HJVA 1NIJA 1VECA 1LW7A 2IF0A 5KNCA 3BB1A 1HE1C 3FOZA 1AJEA 1XNJA 4P33A 4HAUA 1ZD1A 2AWOA 2NMVA 4AKGA 3FE2A 4HUTA 2ZS9A 5FOXA 1S0UA 3RRNA 2YOFA 3P1JA 3ZS9A 1ZIPA 4DB2A 2R6FA 1KMHA 5IF9A 1K5DA 3QKSB 3IIMA 2FFQA 3U7GA 1HYQA 4QHSA 4U7DA 2CK3D 2VYFA 3NEJA 4RFSB 5BW8A 1DPFA 4M1TA 2GEVA 4KO8A 1Q1ZA 1RJ9B 1G3RA 2GBLA 3PITA 2QI9C 2GVDC 4KSCA 1SULA 4HZUB 1XBTA 5E3HA 1V5WA 3RWMB 3EX7C 5HPYB 1U9IA 4D26A 2ZE6A 1XCGB 2QMEA 3GLHA 3GLIE 3BBPA 3D7MA 1A5TA 1F2UB 2DWPA 4YMVA 4LBVA 1OLOA 2JJ1A 1SVOA 1SXJB 4M9SA 4PR0A 4F92B 1QDEA 5JFGA 1M74A 2ZRGA 2JDIA 1C1YA 1W0JA 4DWJA 1ESMA 3LA6A 3I61A 1M1YE 1XEWY 3RLFA 5EE0A 4HB0A 3LH5A 3SBDA 4BEBA 5JS8A 4S2EA 2P2LA 1SXJE 1S9DA 2J1LA 1CS4C 2ZJ8A 2FA9A 2EYQA 2VP9A 1VG9B 3K0CC 2BC9A 2ZJAA 4WXPA 2JGNA 1KTVA 2RH5A 4ZCLA 1G21E 3HDTA 4EKDA 1XJQA 3V4RA 4DLRA 1KGDA 2GHIA 1YZNA 5FOTA 5L3QA 4UJ3A 4WZAE 1U98A 2DR3A 4TZ6A 2QPAA 4HAWA 4TMTA 3CBQA 4BFTA 1IY0A 4OHVA 3UKDA 1TADA 3SYKA 1S96A 3UMRA 1U0LA 4XD7D 3W8NA 3LQQA 1A7JA 1AS3A 1QHGA 3EIEA 2GJ8A 5FPHA 1P3JA 1QHHB 1SKYE 3WRYC 2L0XA 1OH7A 2OBMA 1XTIA 5AUOB 4DKXA 3WHLA 3G82C 3THOA 4B3BA 4GL2A 4MKGA 5IT5A 2QGNA 4GSYA 4JL8A 4FCTA 1CP2A 2QAGC 5FUYA 3ONWA 2QM8A 2ZRCA 2XJ4A 3CH5A 5GVSA 3CPJB 1G3MA 2IUSA 1FNMA 4B48A 2ZSEA 3BB3A 1FTSA 3CZQA 3E5HA 4HZIA 4C0BA 5C4GB 4LHWA 3A4NA 5FTMA 3UWKA 2H16A 4QHTA 5EE5B 1UJ2A 3QUSA 1RZ3A 1TF2A 2P3SA 3PUYA 4DLXA 2XOKA 4OQMA 4CEIB 3NBXX 3GFPA 4MUBA 4Q7LA 3KQUA 2OCBA 1OB5A 3HU2A 3T1OA 3FGNA 1UKYA 5EP1A 4NYMQ 1XDBA 1JR3D 4N0DA 3L0OA 3BE4A 1W47A 1UDXA 1PJRA 2ZRAA 2VSXA 5KU1A 1VCNA 1ZC3A 2RGBA 4E07A 1KMHB 2LCFA 2XZPA 4L16A 3U4QA 4XVUA 2YJTD 2IW3A 1E9FA 4PC2A 3FB4A 2EFEB 2HJGA 2VP4A 2B92A 4Q9JA 4CIDA 3VR4A 4P0TA 3KKQA 5A5GA 2GZAA 1RRFA 4PQRA 1XEWX 2QROA 1W5SA 4NBSA 1LVGA 3VR3A 2CCGA 1DG3A 1UKZA 1Z47A 3UMSA 1MR3F 1UBFA 2D74A 3SN6A 2IA5A 1W36D 1CR0A 4BFZA 4KHZA 3NTUA 1J99A 3CWZA 1OT3A 4YXWD 1PV4A 3N2IA 4XOIA 4UXJA 1T0HB 3I32A 3KJEA 4HAVA 4PZZA 4DRZA 1IY1A 4QBHA 4X8MA 2DY1A 1Y3AA 1U99A 4JLJA 3REGA 1R0WA 5JRZA 2VSFA 4Q1CA 5J5CA 1NL3A 3VU9B 3C15C 5L3SB 3KL4A 1NLZA 3KQLA 3T1TA 4FMCF 4P4SA 3MJHA 3NG1A 3OAAA 5AJZA 1M7GA 2OEPA 3PXGA 4LJYA 3SHFA 3NH6A 1YQTA 1WF3A 5FBQB 4BGDA 1T3SA 4H1UA 3AGPA 2GK6A 4B32A 3PEWA 3HPQA 4K46A 1GM5A 2QY9A 3DZDA 3T06B 2NO7A 1KI9A 2GBLC 2ZJZA 5LB2A 4TYWA 2ATXA 4R98A 5JCPA 1Q1BA 2WMOB 1Z29A 3MCAA 4EJSC 3U61B 2ZE7A 1GNQA 1GL6A 4R71A 3FMIA 1II8A 2J0VA 3CRRA 4V0OA 3SFZA 1XMJA 3HWSA 4A8JC 1NKSA 2JA1A 1N6HA 2BKEA 4M8NE 1KI6B 5FPTA 4CT4B 2C8VA 2BBSA 2ONKA 3H86A 2J9RA 4ASUA 3I4LA 3NEYA 2J7PA 4A82A 2P6RA 1T5IA 4QFMA 1NJFA 3VHXA 4JLMA 1W36C 3CH4B 3IUYA 4KSBA 1W4RA 4CVNA 2FN4A 1M2OB 2RHDA 4L4UA 5E7JA 3TW8B 1VYTA 1ZD9A 4US2R 4B2PA 3K09A 2X19A 1R5OA 1F3OA 1ODFA 5EP2A 2IK8A 2ZI6A 4RCYA 2Z83A 2JDID 4RD4A 2QGZA 4JLNA 1L4YA 2ZEJA 3U7EB 2XZLA 3EC2A 5CM8B 2WWHA 1FTNA 1G8YA 3QXCA 1S1MA 1ZNYA 1Z6GA 1TAGA 1OFIA 2UZIR 2ZRLA 3DOFA 3KUDA 4Q9HA 1N3BA 4KFUA 2QTVB 2MMGA 3LY5A 2CMKA 1W0KD 3X1XA 4UNPA 3Q9LA 2GJKA 4RD0A 1G7RA 4HAXA 1ZJ6A 3A1UA 4DCNA 3IQXA 2GXAA 1S2MA 3QKRB 1AS0A 2F3RA 4NYJR 4QJ4A 1Q3TA 4Z51A 2IX3A 1YR9A 2WPDA 2QNRA 1A2KC 1G5TA 1WCV1 4O2RA 2A3RA 5JECA 1XEFA 1OH6A 1OKKD 1DG1G 3GLFA 4F4CA 1XD8A 1GFIA 3T61A 1JQJC 1I4LD 3H0KA 2PX3A 4QGGA 3CZPA 3CRVA 5KO2A 2QAJA 3TNFA 1JECA 2QPOA 5HR5A 1PVOA 1TQ6A 4Q4AA 1P6XA 3WP0A 1T9HA 3B78A 3TSZA 3FHOA 2WJVA 3L0IB 5C4MA 1RPZA 3TJZA 4LSGA 1FNNA 2C9CA 3AKCA 4C4PA 1MH1A 1GRQA 3V00A 2WSSD 4RD1A 3CX8A 4WOPA 1Z28A 1DTSA 1V43A 2PX0A 4C30A 1QHXA 1KY3A 4C3ZA 1NVUQ 4XTRA 1KHTA 2XNSA 5TB5A 5JRJA 1KAGA 2CL6X 4CRWB 4KODA 2REOA 1XMSA 2NZ8A 2RGDA 1A4RA 1UPTA 2C99A 2VEDA 4TMXA 3LX5A 2IS1A 2PH1A 3NWJA 4GOXA 1RIFA 5DI3A 6Q21A 2V4ZA 2IS4A 4XWOA 1E9RA 4DLWA 3CR8A 2ZJOA 3THWB 4AIIA 4W5HA 1N6PA 3Q3JB 1AZSC 4TMWA 3PUXA 1SVWA 3OFNA 4DC9A 3BRWD 3KJIA 2WWIA 2PZGA 3QEJA 1Q22A 3RRZA 1E1RA 2CJWB 4ARZB 4EAQA 4XH9B 1QBKC 1IJFA 1XCMA 2Z43A 2WICA 3QOFA 2F55A 2GXUA 3V4FA 2QTFA 4FMDB 4PPNA 1AM4D 1T3HA 2W6ID 4PO9A 5EE9A 1E9AA 1DS6A 3DPUA 4L5BA 4PSAA 5J4KA 3RABA 3HJNA 4KBFA 1X3SA 2XNDD 2CVFA 4URXR 2ZETA 2FX3A 3EZ7A 1AK2A 1TEVA 1AKYA 1WDTA 3PENA 1ZNZA 3W3ZB 1BYIA 5GVRA 1N2CE 4MQBA 4B44A 2FFHA 4BZXA 5HTKA 1RYHA 3NIBA 2BJVA 1XPUA 4D4KA 1W5TA 2F1IA 3B1YA 2R6CA 5GJBA 4PFSA 1JR3E 1ZMXA 1OXUA 2OZEA 2N46A 2EYUA 2H5EA 2TMKA 1P2TA 4QNMA 4ESVA 5J4VA 3AV0B 2FZLA 4LYJA 3OEEA 3TUZC 3LBIA 2Q21A 3KKNA 1Z6YA 4UNSA 2ODWA 4XWAA 1E9BA 3FTQA 4PANA 2RGNC 4KU4A 2G0TA 2O8EA 4QM6A 5JJKA 1P73A 5D3MB 2HEIA 3SU8A 5FBVB 3LQRA 4E09A 4V02A 1Z0AA 5FUWA 3BXZA 2JLUA 1E2MA 2WKPA 4RKEA 5F2EA 3TK1A 4D4MA 3UK6A 5H8WA 4M0LA 5EJEA 1Z07A 2P0EA 5DIFA 3NKVA 2WJIA 1F2UA 2OXRA 1CR2A 1JEDA 4B71A 3NHAA 2XTMA 1T8TA 4Q4JB 2FSGA 3FYHA 1IN5A 4JLOA 2EQBA 2V8OA 4Q7KA 3OIWA 4KXFB 1KI6A 2ZSFA 3LRPA 4QC2A 4LC0A 3B82A 3L2OB 4MRNA 1VTKA 1OFUX 1G19A 3C41J 2BBOA 1NKTA 4YDSA 2RB4A 4A0RA 2NO0A 1F6BA 4EPTA 2LKDA 1KKLA 1H65A 2FPKA 4Q7JB 2H18A 1OXVA 4PC1A 1GTVA 3ND8A 2BBTA 3RS5A 3MG9A 1L7VC 4GRAA 4Q1BA 4QGHA 4A4DA 2O0KA 3MMPA 3IHLA 3RRYA 3TUJC 4XSHA 4QJ3A 2N1BA 4A2WA 4BFUA 4OJQA 4LV8B 1RVDA 3UANA 2AR7A 1Z5ZA 2Z5FA 5E95A 3GFTA 5FTLA 4OKSA 3CWQA 4A6PA 4B75A 3U2QA 2JATA 2ZANA 1CJUC 1SZPA 4X8LA 4A2PA 1A2BA 1Q3HA 2DHRA 1EX7A 1W49A 2ZU6A 1QG4A 4IVPA 3AUYA 3R20A 3KJHA 1W2HA 3X1YA 3RWOA 1P2VA 1U9IC 1IN4A 1DEKA 5LPNA 1G4UR 5KDOA 4BLTA 2JIZA 2D2EA 2IYXA 3ZZUA 4UQOA 3GLFB 3KZ1E 2ZREA 4NPHA 3AF1A 4OK6A 5DE3A 2CVHA 3IKJA 4B2LA 3VKGA 3PUZA 5CIQA 2PT5A 4DCTA 1W36B 4KV9A 1VHLA 1SXJD 2PEZA 1G9XA 3WMFA 4CZ2A 1B23P 3L82B 2XTZA 3AKEA 4D2IA 4GOKA 3U3MA 2CLSA 2XOKD 2PJRA 1NMZA 3KKOA 4OHYA 2YNMA 4DLSA 4F4IA 3JZMA 4JLVA 3NVAA 1RRPA 2Y8EA 1VPLA 5G40A 1Z63A 4NP6A 4AKHA 2QM7A 3EPLA 1D5CA 2YC4C 4C2UA 3A58B 1Z3IX 1WE2A 2QP3A 3A1VA 2VTKA 2C96A 1OIXA 3AVOA 4TLDA 2ZRNA 3EC1A 3OAAD 4JLDA 5E4FA 3DZ8A 4EFNA 4HAZA 1QHNA 1DO2A 2R44A 3AVUA 4AKIA 2H17A 3QPWA 1GIAA 4C9BA 1VCOA 4PPGA 2OFWA 4Q1FA 5H68A 3RNLA 2PL3A 4ZKEA 2ZS8A 2IXFA 2GCNA 3T5DA 4LYFA 4A0HA 4C7OB 4Z8XA 1EG7A 3IPXA 3FHTA 1II0A 4OI2A 1K5GA 3TRFA 1Z0DA 3CNOA 1OYWA 4YXWA 2GCOA 1P60A 2LWIA 5SZJA 3BFXA 3B85A 4FI3C 2VHTA 3EASA 2WWWA 1W46A 3IEVA 2C9YA 2RGAA 4RKFA 1R2QA 3SYNA 1RYFA 3UG7A 2ZTSA 2YZ2A 1YR7A 1UBCA 1JQLB 1P2SA 3QNUA 3FKSA 3GLHE 5D3QA 5C18A 4L9SA 3GLIA 4WZ6A 1P75A 4AKEA 4FD2A 3W8RA 1VKJA 4NCIA 2AKAB 2VP6A 2CE7A 4LDJA 3QE0A 1T3LA 5IK2A 4URZR 1ZCBA 2YHSA 1OYYA 1E94E 4ZDJA 1G7SA 2Q9AA
chains in the Genus database with same CATH superfamily
1II8B 3FMGA 5KMGA 1PL7A 2IJGX 1ZD5A 4AS3A 1M7HA 2CFOA 2GQ0A 2F43B 1XVUA 2QJWA 2RHGB 3AOEC 5F2OA 1ZISA 2XUKA 3FZGA 2UYCA 4N39A 3JRXA 5I9TA 1KAOA 1NHGA 5HGJA 1T8SA 3DT9A 5LKAA 2OO5C 4PYNA 3DFFA 4WAUA 4ZVTA 2D62A 1U0BB 1YDHA 3VAYA 3SJCA 1YB5A 4UVHA 5DXJA 4TN5A 1CUXA 3SM9A 4B1FA 3Q6MA 3ED5A 2GAIA 3H13A 3ZDQA 4MS4B 4O4LA 1F7VA 1ZO8A 1K89A 1M6YA 3ZPXA 4I81A 4CM8A 2QNIA 1R66A 4BPRA 3U7FB 2GM4A 4LUCA 3ZG6A 3TLXA 5CTAA 5CDFA 4DSUA 4YT4A 2FHSA 2FPPA 3U0BA 3RU2A 1URPA 1QTNA 1BWSA 3OD5A 1N9KA 4G1CA 4GAEA 4IDQA 1X7WA 4Q03A 1QFSA 3OM8A 1U5BA 1G291 3NJ4A 4BBJA 4HB3A 4WADA 1YZKA 2G4LA 4PTZA 5D3KA 2IBMA 4P0QB 2BGJA 2YY5A 4H4EA 3V97A 1XJ0A 3KVRA 1WA5A 3OM0A 4K6CA 3HI4A 3NTQA 1F06A 2A5YB 4MJLA 4QLAA 4W9NA 3AY6A 3L04A 4WY8A 1QRAA 4XJTA 3RTCA 1UPUA 1MT0A 5FWXA 1EK5A 1NMQA 3KXPA 1AC5A 1AIPA 4Q02A 2R5FA 5ALRA 4ENQA 3NV9A 1ZESA 3MYRA 1D2NA 3H2SA 1KI7A 1JEQB 2EL9A 2C3YA 3RIMA 5C1DA 4XDZA 1WHSB 3FROA 5DM70 2ZUSA 2X8JA 2F9FA 3TGPA 4HMQA 3JQGB 4IRUB 2AMYA 4YROA 1H0RA 3JZAA 1PWHA 4AS2A 4B4UA 1NKVA 3NNNA 4TL7A 4BAZA 2ZVPX 3WYCA 5K0SA 4EA6A 2FPUA 3D9QX 1QYXA 5EP3A 16PKA 4GYWA 1QH0A 2YUTA 1SCIA 3OM9A 3PKIA 2QR5A 4M0CA 3ZC3A 1M0WA 2VHCA 1QGAA 1BW9A 2CL5A 2FPMA 2GHTA 2Q0XA 3HWWA 3PC7A 5BURA 4HB2A 1RXWA 1W2GA 1M2JA 1XZFA 4MYCA 4MQ4A 4Y1FA 1PJ4A 4FX2A 4BCCA 2FWNA 2QL7A 3K0SA 4DV7B 3KX2A 3O8QB 1YS7A 2Q3JA 2BKVA 4DLVA 1D2HA 2ZRBA 1VLHA 4BGUA 1F9AA 3CW2A 721PA 1DDIA 2YVQA 2RGXA 3ISJA 5AKLA 1QGUA 1YQUA 4PHCA 4PWYA 2VF4X 2RFLA 4NBNA 3F74A 4O02B 1GT6A 2RGUA 4E1BA 2B78A 3WGZA 4EHIA 3HM9A 5CFZA 2B1IA 4PNPA 3OLXA 1X38A 3AIMA 4BAGA 1JDSA 2OAGA 3M2TA 1WB9A 1P81A 3G59A 2XA2A 4LVOA 3MJEA 4ZOEA 5ALZA 1CPYA 5E3JA 4QGAA 2ZIZA 2GN6A 4YFVA 1YTUA 4JR2A 1MABA 2ACEA 2PTHA 3FWYA 3A4VA 5DB4A 1BH6A 1H1LB 2IQIA 1ZBDA 4NICA 1ISGA 2EFYA 3TX2A 1I4WA 1RLJA 3GGPA 1LDYA 2FDRA 3AUSA 3QHAA 4AJEA 3LBAA 3TX6A 1FLNA 1UKVY 1QYCA 2VDPB 2W6IA 3O92A 4G1UC 4Y2TA 4CQLA 4QG7A 1II9A 4F5EA 2NO5A 2G82A 3OUTA 5EQTA 4Z0NA 2VCEA 2ZRIA 4X24A 3FIJA 2PYZA 1NVXQ 2PA0A 3E27A 4IXNA 3U6KA 3BDAA 1OBVA 3BMCA 3UCEA 3GN1A 5BWBA 4MYDA 2J85A 2XLBA 4QJIA 4QIHA 4YJ2B 1WTCA 2P79A 1BS1A 3QXXA 2QHXA 3G68A 4J90A 4LV6A 1E5VA 1YRWA 1A04A 5FFNA 1KQ3A 3AINA 3H8WA 4FGWA 2YOGA 5EIBD 2I2AA 1QHYA 4TXJA 4Q3BA 2OBXA 5AJWA 3UJCA 3VFDA 1SXPA 3B1JA 4CM5A 1DB3A 2IYVA 2WU8A 4HWTA 4I1OA 1LV7A 1LY1A 5FWAA 4MA5A 2QRKA 3PXXA 3SQWA 2B7CA 4JLSA 3TXXA 2YC2C 1T0IA 1BU5A 4BFSA 1O96B 2X0RA 3H2ZA 1AZLA 1SU4A 1YFZA 3EGOA 1PSWA 2QVLA 5I7AA 2CJWA 4WY5A 2VAPA 4BMZA 2F7SA 2A78A 2X4LA 3P4UA 5B6IA 1F8GA 2RI1A 3PLAE 2WE7A 2XHEA 3I01A 1OMOA 1GQFA 2XKKA 2I99A 4IIVA 1GGVA 4AJ9A 1NBME 2HM7A 4WE3A 3RAFC 1HE2A 4CMKA 3EEBA 4S05A 4C43A 3DLHA 4B09A 4EJ6A 1IL0A 1I4EB 5ALNA 2Y6VA 1BGXT 2O07A 4GT1A 5EIAA 2IKSA 2D5LA 2J87A 3E8MA 3FKSD 4ZVRA 3WC4A 5BV2P 1Z13A 2HWUA 5E7MA 1HT3A 5LLDA 4IGKA 1LLDA 3HO6A 1CYDA 3K92A 1ATZA 2FPWA 2QVGA 3G6WA 4RF5A 3ORSA 4F4HA 3F90A 4RH0A 3LZDA 1EK6A 1MC8A 2E48A 1M8JA 2F1JA 1PJLA 2JLQA 3KXKA 2PMEA 1IATA 1NATA 3DHWC 2H9YA 3MCTA 3DEJA 5EE1A 1FX0B 4TL6A 2O05A 3GPDG 1LTKA 4QYIB 2OHOA 5BNZA 1ID1A 3FOCA 4YCSA 4MS1A 2I8LA 3FYUB 1JG1A 2PX2A 4LXGA 3MJCA 3KUXA 5DLYA 1NAHA 1ZVQA 5A0TA 1CV2A 1QBGA 1JR3A 1JKJA 4FS3A 1SCKA 4TWIA 1JQDA 1PNRA 1NVAA 3O21A 5AW2A 1G3UA 2P9ZA 3E4DA 3GRYA 4M38A 3S0JA 1GPLA 3ODGA 4GIBA 1TUEA 1WZIA 1ZRSA 4Z4EA 2ZCUA 2VCHA 1UMBB 2JEOA 4HDCA 1XFAA 1VLMA 2E4ZA 3IHKA 4YV1A 1WW3A 1MMFB 4NARA 5CLGA 5K45A 5ALSA 3RJTA 4U3JA 3RYCA 4ZODA 2IEGA 4BNHA 3I05A 2WAOA 3RBZA 3KWJA 3BWEA 3HB0A 2FZVA 4RPKA 4YGXB 1Y0BA 1Z16A 3K1TA 3OZAA 3WLNA 1KOJA 3CVOA 1XTQA 3FVVA 3BBLA 5FOUA 2PQ0A 3DZFA 3H2GA 4NBKA 1OVMA 5BWMA 3B1XA 1VSUA 1Q21A 2V6BA 5DYGA 5EIWA 4KDEA 3U0VA 4FQ7A 4GC9A 2MHCA 1C3OA 4OQFA 4C6RA 2V54A 1ML4A 2FW8A 4N54A 1AV6A 3T34A 3H11B 3I0MA 1JDPA 5C3UA 4YFYA 1W2WB 4MLCA 4PCLA 1U2TA 3QVVA 1NQ5A 4P54A 4ND4A 5JS7A 1CHNA 1XNHA 5JAOA 2GCPA 4YALA 2W0MA 3ABQB 4RK5A 4C4RA 2ZJ0A 5KU7A 3J7AC 3HB1A 4TYMA 2PG3A 4PX2A 3RS2A 3W79A 4EPRA 1D2MA 4RGBA 3WYGA 2O8EA 5IKEA 1E9VA 3U31A 5CB4F 3BJZA 2J48A 3C5VA 5GMOA 2C5LA 2E21A 5IW8A 1RTKA 2XSZA 5E1OA 2IDKA 2R62A 2XH8A 4MR9A 5DO9A 3SICE 3VH2A 3HZHA 5DK6A 3KQKA 4UHBA 2YXDA 1A88A 1KFCB 3CUSA 2ZAMA 2CE2X 3N8DA 3V33A 3WGNA 4B3HA 3CUYA 5KVSA 3H4TA 4AJNA 1CNFA 2DBRA 2BWJA 2CLCX 2RARA 3BD6A 3KAPA 3OEHA 4JIMA 5FQOA 1N6OA 2C4MA 3UOGA 4Q01A 5HZMA 2JIDA 3AI2A 1UXKA 2GF9A 5HFJA 2FXVA 1ECJA 2Z95A 1TC1A 3N87A 4V0LA 5IH3A 2VXBA 4X8HA 1QPBA 3QG5A 4ZMBA 1T4GA 1J1IA 2AEMA 2XB9A 3U4IA 2YIJA 5ED4A 3FLMA 2ORYA 4EA9A 3OZEA 3UV3A 1Z08A 4KX3A 5J59A 3B3AA 1QV7A 3GEEA 4MGEA 4HEJA 4NZMA 3PPWA 2OV4A 3ONEA 3Q6IA 4YRKA 1FMJA 5HWSA 1XZNA 3VGPA 4DZTA 1GPJA 2VS1A 1O6CA 3I9LA 1W8IA 3PQFA 4MO9A 5KHOC 4NU8X 3IQWA 3A6PC 4TV9B 3JZIA 3AB8A 2ID7A 4RJKA 2LGJA 3AY3A 4OLJA 4DJJA 3URKA 2HCBA 1YB6A 4AP5A 2IOFK 3QPDA 5HGXA 2BFBB 3CNHA 2X3YA 4L4ZA 3WWDA 2BV3A 5AW8A 3U44B 2X2EA 2QV0A 4B2IA 2Q5JA 4EQ6A 2GH1A 4LZWA 4Z54A 2B36A 3K4PA 1TIKA 3QFHA 5K2OA 3NYQA 1P4HA 4TQUS 4YP1A 1M73E 1QG2A 1C3XA 1TM5E 1M6HA 4RTSA 1BDJA 3FZNA 5LZ8A 4B87A 1V6CA 1JAIA 1PT6A 1QV9A 3MTEA 4ZO7A 2VDWA 2AG1A 3G2MA 4QXQA 1PR1A 1UT8A 2V4UA 2XMSA 5EWMB 2REQB 4WDQA 2DUUA 1K7XB 1X70A 5EHQA 3CEPB 2QAGB 5IARA 3HL4A 3ITKA 3VYTB 1EFRD 5T3YA 2WLTA 4MGIR 1FDIA 3TIIA 3E05A 2JFGA 3K9NA 2X41A 4RQUA 5B3JC 2J5KA 2PZFA 1SXHA 3BMXA 3TJRA 4BB9A 2QAGA 3AFOA 1D07A 1KS9A 2Q3FA 4MUAA 5TPWA 1EX9A 2ONYA 4IEFB 3HYCA 3HXMA 3QSGA 1UWVA 1DEOA 1MOPA 1QKKA 2VT6A 2HT1A 1P80A 4TQ9A 3VKHA 2UVPA 2QRHA 3OZFA 4GRIA 1E6WA 1N0UA 1WM1A 2FOLA 2JLSA 4WXYB 1T6XA 3KDSE 1S2NA 2QL9A 4ZYTA 1PG5A 2QPTA 3ZI4A 4C5BA 2YZKA 1WKVA 4N40A 4XM1A 1GUZA 2FAXA 4EI8A 1S8OA 4BC0A 3SHVA 3MBOA 3DEAA 2J32A 5IABA 1MH9A 4UFOA 4BIMA 4A3SA 4RL4A 4PG4A 4NJMB 3LQ4A 4GL4A 4IFBA 2A5GA 3GDGA 2BISA 3ZS8A 5TIIA 1PJCA 3A28A 5HF9A 2V9PA 3U62A 1F0PA 3C8DA 4P7JA 5C9ZA 3F3YA 4K87A 3FCUB 4XIGS 3VI4B 3SBXA 2OLKA 2X9QA 2HIGA 5KC9A 5TF4A 1XF9A 2ZT6A 2QT0A 5E6RA 5BYBA 3WA7A 2PMDA 3LK7A 4J0JA 1LLUA 1DAMA 4G01B 1G9TA 2HF8A 1G8AA 3UW3A 2ZIXB 4P6VF 1E5LA 1O4VA 1LPSA 1FOEB 4RGVA 3FFAA 1AH2A 1NM5A 3AP2A 3GL9A 1GL7A 1U94A 3H5AA 2IXBA 3OIGA 4H1VA 4UHHA 5KQGA 1P3DA 4BQEA 3LVRE 5ICGA 1LTQA 1QHHA 4D8TA 5HCIA 5IWCA 1KC1A 2PAFA 4GECA 2O2GA 3DC7A 1XZKA 1FFXB 3LXXA 3RYHA 4E88A 4YWHA 3WKCA 1C7ZA 2PRIA 3R5JA 4C4SA 1P2UA 2PBLA 3LYUA 4QHYA 1KY2A 3OC0A 1GGHA 5LXTB 1OWOA 1MKYA 2MINB 5HDQA 1RABA 4B3XA 4ER6A 3ZE7A 1Z4IA 4PZ9A 3AI1A 4Q15A 4NF2A 3TZKA 2DC1A 3PR1A 1LS1A 1KEEA 621PA 5LOVA 4F97A 2PNFA 1Q0RA 4E6EA 1D0VA 3HJRA 5BSHA 5HJ5A 1S4QA 3TZQA 1VSBA 5IDVA 1WDWB 1VZ2A 1JLLA 2H7YA 5LUBA 3WBKA 4TZ0A 1NRIA 4KQ6A 1YFJA 4EYQA 1U5BB 4U2GA 3ZY3A 2YHUA 2WUFA 2X3UA 4HLQB 5CA0F 1N8TA 1XD2B 1N57A 3A9UA 1W6RA 2Q45A 1NUHA 4P80A 2DFVA 5COQA 5FKJA 2DUWA 3T15A 2B69A 4FINA 5HMMA 4DUYB 3NMUF 1ZK3A 2J0EA 3EH1A 3DKVA 2XLCA 1LB1B 1Y9JA 2OGZA 5BUZA 2FWPA 2WD7A 4H7DA 4WOCA 1JT2A 4J9UE 2JIPA 3ZLTA 1R4AA 2ECKA 2W2OA 3D5TA 1NQWA 3FLBA 1EUQA 4RZXA 2IOFA 1COWA 4XYLA 2WI8A 3IBCA 3R3WA 2H4HA 1J9EA 1R74A 2XA9A 1NASA 2CMFA 3DKPA 3DOEA 3OIFA 3IL2A 1JJBA 1Q1NA 3DEYX 2X13A 3K9HA 1K1EA 3PRHA 5EI5A 4RTNA 3A1WA 4XB6B 4N48A 4D3SA 1ZH2A 2FWRA 2CNNA 2E85A 2GAOA 2WSBA 2WTBA 3MT8A 4HH4A 3MQFA 4ID9A 4JBIA 3OKFA 1NF3A 4K05A 1L5GB 3ZVRA 4TYNA 1ITZA 1GZUA 1HG0A 1L4MA 1NDHA 4GYJA 4G4IA 1LBSA 1VL8A 4HWRA 5L3ZA 3VU1A 3KB1A 3TMAA 2BMWA 2FG5A 3A6GA 4MQFA 4UNNA 4ACAA 2QYOA 4JK3A 4MVJG 4HDKA 2PLNA 4YP5A 4JGGA 3DE2X 3K94A 4FJ1A 4WZBB 2KE5A 4LKRA 3IXMA 3K3PA 1P2GA 3OPVA 4IXDA 3U7IA 1WY5A 4UXIA 2O5RA 5C1PA 4GXNA 2EOAA 1IHOA 4Y0VA 1SBIA 3SYRA 4BQSA 1XKLA 5ESRA 5CA0A 4MIOA 1J22A 3ZTWA 4GUDA 4E4YA 2G0NA 2PT7A 4A8TA 4AROA 3KCQA 2OAP1 3K8YA 3ORQA 4RACA 4LGCA 5KYXB 3C97A 2FOIA 1VGVA 3D8SA 3Q5EA 1RYMA 2Z4RA 2MT9A 4A5SA 1B8PA 4KQEA 2FSHA 4RTMA 4MXDA 3TIXB 3BD8A 3V34A 5DM0A 4F3TA 5TVKA 4HFJA 4DADA 4WX2B 5TS2A 1AQ6A 3UHJA 2FMXA 2HY7A 2VHJA 4QLOA 2KPOA 2DCUA 5KJ1A 1NJ6A 3CJRA 2BI8A 3IIIA 1DX6A 2BFPA 3FBTA 4N0EA 5A1JA 1KS2A 1Q44A 3TOXA 2R6ZA 3SC3A 4MUHA 2WIBA 4X6LA 1KMNA 2VYND 3KRTA 5FORA 2YRFA 1Q0SA 4R2WA 1WNFA 4CV0A 3AVWA 1EXMA 2GBFA 3UK2A 1EFUA 2CLMB 5K6AA 1LNSA 1CIVA 1MEJA 5CCEA 1QZ3A 1UK7A 2JRCA 3KC2A 2HSDA 5GZ3A 4R2KA 1SVNA 3I9MA 3QVJA 1BHSA 3K0BA 1M1ZA 4TQAA 5ADVA 2GETA 1JKFA 1IY2A 4JQSA 3FKQA 1RMYA 2AB0A 5EZYA 3S2EA 2XQKA 1E2GA 2YV5A 1EFRA 4G5GA 1F0YA 5E2AA 2ZSHA 5AXCA 1G59A 5ULLA 3LG2A 1WXFA 4DY4A 1QOQB 2ZIWB 4BRZA 5KYNA 2GWHA 1IVNA 2HTFA 2WV9A 3PGJA 1LWNA 4DXDA 3RSOA 2R47A 1YU9A 1OXXK 3E1GA 3VR5D 2Z2IA 1XEXA 1DC7A 3LX8A 1CYEA 1WHTA 1T6ZA 5EEGA 3UWSA 4M8LA 2PUTA 2RH8A 5DN6A 4HDOB 5FFMA 4NENB 3MJRA 4XLTA 2FEMA 2CCJA 4IYRA 4DG9A 4HNVA 3IHWA 4K2HA 4KTTE 5EUMA 3DD5A 3E61A 2HMTA 3KSDO 2IUUA 5EJ9A 4XWYA 1E1KA 2BIFA 2QN8A 2QSZA 1K3UB 1T91A 3DQQA 3QXGA 1UC4B 4HADA 3F2VA 4HXEB 1JJFA 1TF5A 3G9UA 2C03A 5JYDA 4QUEA 5SV2A 1NBIA 4L51A 4MPTA 4E3WA 1QM5A 1U9ZA 1E8NA 4NPAA 4B84A 3L1VA 3TRIA 2H2HA 3BEOA 4G63A 3TNDA 5F76A 1HY3A 4XIJA 3IILA 4E6PA 4LRYA 5DP1A 1VHQA 1Q0PA 2X6TA 1RWKA 5LD2B 5JS2A 1LLQA 4B76A 2OLJA 1I2BA 3LTNC 3SF8B 2VWQA 5L6MB 5C51B 3JD4A 4C6SA 2QPLA 2YFHA 2J5XA 5HIAA 1PFYA 3JWJA 1MO5A 1M6NA 1JFLA 2FJ0A 2VYNA 4XVQA 3AUTA 1W76A 4JJGA 4WZBA 5BQ5A 5A02A 7GPBA 2B98A 4DB4A 3MRVA 1YS4A 4QUGA 2H59A 3TEJA 2XXAA 2JGAA 2FEPA 4WASA 3O03A 1NYQA 2Q0QA 3I72A 5F21A 2ST1A 1K8RA 3IT0A 5EJIA 3PC2A 4EPWA 1E61A 3FTDA 3RGGA 1EX6A 2WIJA 1RTTA 2DVMA 3FSEA 3PTLA 5GJVC 5FPQA 2XXAB 5JAMA 4PC7A 1QKJA 3HI6A 1G20E 4KQMA 5LJIA 5JR3A 2VPXA 3U9LA 1NYLA 2O20A 2WNHA 2QN9A 4GLJA 1A9SA 2JAQA 5DX0A 5CH3A 4Q19A 3JQGA 2JGFA 2EGGA 1GJRA 4KBYA 4ATNA 3OHSX 4RZHA 1SWVA 1NUPA 4AG3A 2CWDA 1GZVA 2BDEA 3GEBA 4Q4HB 4HNHA 1H6BA 1X9HA 2RHRA 1O03A 2VRBA 4HGPA 4J0DA 4UU8A 3TVDA 4FB4A 1U1DA 3TR6A 1GCAA 3GJ0A 3OESA 2ADMA 1QNFA 4K81B 4WJKB 4BNYA 3I3SR 2HWYA 2Z5LA 3FB1A 4JJZA 2QYSA 3MXOA 4DVJA 1A50B 1WO8A 3C8UA 3DW1X 3LIIA 3G2NA 1DKOA 5FPSA 4Z53A 4OGFA 4NYIQ 5AW6A 1F2TA 1WVMA 4DDUA 7MHTA 1TLLA 2Q1XA 4KVGA 5EJ4A 1TAQA 1H9AA 2YWJA 4CG1A 1OU4A 2ZWPA 1KRWA 5KYYA 2JLVA 4WTOA 3CNBA 1IAVA 4RADA 1UC5B 4AMGA 2I33A 1YULA 4I6EA 1EMDA 1P31A 2O0LA 4OHRA 1L7BA 4BBPA 4JI7B 1AGXA 4H6PA 1YCFA 2ZT7A 3N3AC 4F6RB 3CUVA 3V6LA 3HKCB 1BD4A 2J7PD 1NLUA 3TAUA 4B45A 3O2QB 3FI9A 1C9NA 4JLBA 3VTFA 4G2NA 2Y68A 3BE8A 2YYAA 4JI1B 2Q4EA 4ZQEA 1I0LA 2L2QA 3BFKA 4FBGA 1Z22A 4RGYA 5KJFA 2C98A 4MVJI 2NSYA 2ZUTA 2GK3A 2P6PA 2IKQA 3SVZA 3L77A 3HBFA 1A8SA 3P9XA 4GXQA 4MITA 2MCFA 2BEJA 4D02A 2O0MA 2PKQO 2SKCA 1U9YA 3G7NA 4BP9A 5KWJA 3HUDA 3NZEA 4ZTZB 2WNIA 2FMIA 1NXVA 1MB9A 1G8GA 2XUPA 1I4DD 4R9VA 1NBMD 1EP2B 2JFFA 2JIQA 1EB9A 4I4TA 4URHA 3SC2B 3OPXA 4RV5A 3L01A 1LX6A 1V41E 3UYKA 3H97A 3DKKA 2P6OA 3N0WA 4JZYA 5FPYA 3I9KA 4E03A 3OZVA 1FX1A 4A26A 2WHQA 3IBTA 5HMLA 5F1YA 3A6EA 3R9IA 3OZSA 3S8EA 1OI3A 5B1DA 3R7SA 3KD3A 3QOXA 1J24A 2V7XA 3VHLB 5FOVA 1F8FA 1K3TA 1T24A 1ADFA 2D0IA 3R7FA 4IDHA 2DYKA 5D3MA 3C1UA 1D2AA 4PSCA 5F9FA 3RRJA 1UBMS 1A5ZA 3JYOA 1XMVA 2BUCA 2OKCA 4CIYA 1ZM7A 2EHDA 4ZO4A 3HZOA 3IJPA 3R4VA 4M0PA 3S1SA 4YCNA 3MFYA 3PPXA 4PFJA 4Z3KA 5DBHX 1SQGA 3HBLA 5DIZA 1SEVA 4BMVA 3PNBA 2FPXA 1K98A 4KLNA 1OI7A 2WMNB 5EPUA 3KJNA 1GSOA 2W2LD 3WO1A 5KQRA 1W7AA 1QRUA 4YQYA 3O3MB 2NAFA 4FR2A 2H8KA 1E1NA 1P5RA 3B48A 4Y6LA 3A2KA 3VU8A 2BFCB 1UP7A 4LNHA 1XQ6A 1ZOSA 3W8DA 4FGLA 3NUGA 4TTJA 3IPAA 2OCAA 2Q29A 4I7EA 4NY1A 2XUDA 2YDYA 1CJBA 3CF2A 4IM7A 1WDLA 3GRCA 2X1HA 1HZZC 4IBOA 4ZQIA 1M1YA 3SFVA 1FDRA 1XAJA 5FNZA 4DL9A 1B3BA 5FD8A 4JVNA 2OQ2A 3NAMA 4PZCA 1WCIA 4BN5A 5P8WA 4LF8B 1Q19A 3DMNA 3P9YA 1C0PA 3HJGA 3P9KA 4JD5A 3IDFA 5JI3E 2VWGA 2JEYA 3OOSA 4TTTS 1WLSA 1UADA 4GKBA 5LP6A 2XCRB 4QTTB 4UEOA 4X1KB 2BKLA 3ZHQA 4BU0A 2DLNA 2B1RA 2BEWB 3GJTA 4FZ5A 4K0RA 3DLPX 3OZUA 1XTBA 3U4QB 3EFBA 1C9JA 3NYWA 1MIHA 4LC1A 4CV3A 5KPDA 5IPFA 4XX0A 3QNMA 5LXTA 3FMOB 5AUQA 3I4FA 2I6SA 1L7RA 1HBJA 2ZE5A 3AR6A 4DLUA 3ZWMA 3W5UA 5T41A 3LDFA 4GRDA 1L9KA 2ZBDA 4KNYA 4RZIA 1UP6A 3B12A 3B38A 1RFLA 1NP6A 3EWAA 1EBFA 4UULA 4RO0A 5DHQA 2VL7A 3IVMA 2Y4OA 5T7BA 3OU6A 2ZM5A 2M1XA 1TZJA 2VUSA 3HV2A 3HZZA 3C7KA 2FZWA 4IO0A 4ZVNA 3NP7A 2HF9A 3L8EA 4NTZA 4MV5A 4N8DA 2JJ8A 2X6RA 4M55A 4CW7A 2FUNB 2YWGA 3GLFE 1UEJA 1XZJA 3TPCA 5IJ0A 3GFRA 4AZ0B 3FPHA 4RSHA 8ABPA 5TF0A 4RTKA 2FY8A 1QK4A 1LBEA 2E1RA 4MV8A 1S8AA 3BRCA 4R3UC 2FDCA 1QLJA 3SYTA 3PL5A 2J5BA 1NUUA 1G98A 2CKMA 3M6MD 3ZWBA 4JI5B 4AZ0A 3HFGA 2HD4A 3ROZA 1SQSA 3L18A 3SFTA 2AS0A 2Y1LA 3F2IA 3T7EA 4C5AA 5JHGB 1YBAA 1VE1A 3EXHA 4KOAA 4Z4QA 2KW5A 1YQEA 4J4TA 4NNJA 1AGRA 1YIOA 2WHEA 1XQXA 2Y67A 1WIWA 3QELB 2BGUA 2D3TA 5HILA 4EFMA 4H7PA 4ILEA 5CLJA 5J47A 5KTYA 3WKAA 2FVXA 4V03A 3REQA 5KNLA 4TTAA 1YUNA 3BFPA 1KO4A 5JE8A 4G65A 3WRXC 4R1TA 5JZOA 1MOQA 5LDDC 1SXQA 1IN7A 2O2YA 2VT7A 3A3OA 3DONA 2WSMA 3VOSA 3EGDA 5SZHB 4EGSA 4QUBA 2G88A 1CE8B 1W88A 3ABRB 2B8TA 1P8AA 4I5EA 5HCUA 3HDGA 4RK0A 1E9SA 3DZKA 3WL8A 2AG8A 4ZV9A 5ALQA 4BO6A 5AO9A 4EBFA 1RRVA 1JJAA 2GR9A 1KTIA 4LHYA 3SVTA 5FUBA 1X1DA 1QHEA 1C7FA 3L0DA 5WRFA 2YWFA 1COWD 1DV1A 3GD7A 4B6JA 5E4JA 5B7PA 1WLYA 4IMPA 3Q3HA 3A9CA 1T1EA 4KRYA 2O3UA 4GPIB 2QDKA 1SU8A 1J6UA 5LBIA 2OV6A 2DBQA 3IMEA 4J49A 3ONNA 4JYPA 3GT4A 4MKZA 4Y9UA 3SEFA 1QR2A 1T43A 3WHKA 3IVXA 2QMOA 4HGRA 1M72A 4JY7A 2ATIA 3AR9A 4R31A 4MWTA 5BSRA 2O8FB 5ITSA 1N6RA 2CGEA 3LQ2A 3UJBA 2QJRA 2EU8A 3ZJVA 5J1SB 4MKHA 4MEBA 4E5NA 3LHFA 4QPCA 1PL6A 1LJLA 4B6OA 4UVEA 3ZGNA 5AVVA 5BXQC 1GTSA 1X94A 3LZCA 3MCUA 4ZYVA 4AB1A 1UDCA 5JWOA 4IS3A 2HHAA 2OV1A 3T54A 3DAGA 3QLJA 4WK2B 2X9VA 2ZRFA 3KKPA 3KSRA 3E3MA 2HBZA 3QV1A 3SXUA 1FS4A 3LD9A 1ZCJA 4WINA 2XVAA 1OR8A 1QZTA 2DPGA 4IIEA 4C01A 1UOOA 3UB2A 4OIFA 2VBIA 4ZO8A 2UDPA 3L6EA 3W5JA 4BFWA 4EJ0A 5KYXA 2F8LA 1YR6A 1JQBA 4GC5A 4GOJA 4MZDA 3ILHA 5DLPA 5E3IA 1FNCA 1GRRA 1Q17A 1XAHA 2HA6A 4K40A 2O2IA 1KP3A 2V45A 2EGHA 3HMQA 4GNRA 4YB8A 5LYYA 5AHRA 4YUZA 4ZYWA 3HM2A 3L7AA 3BXPA 4JEUA 3WRYA 1NMEA 4P5DA 4XQEA 5LVAA 4JJ4A 4J0KA 4XJXA 2RHHA 2D1TA 3E48A 4JBNA 4B3MB 3P26A 3DXZA 1ZL0A 2KHZA 4BKMA 2GD2A 4TRMA 1N2OA 3WQSB 2R4UA 4OQLA 3OZIA 3ZD6A 1XP5A 3FDZB 1K6XA 3FTPA 5JNSA 4UM9B 4CUKA 4E12A 2Y71A 1Q74A 3A1SA 2VTEA 3EAFA 3RKRA 1DJMA 1YI1A 1QIIA 3IPCA 4BEJA 1SD5A 1EFLA 2HV9A 3K15A 3GCXA 3WY9A 2B4KA 2HNKA 5SY6A 2PUDA 4FLEA 2C58A 4MUMA 4YRPA 1VSTA 1TQDA 4PF1A 3WOHA 4HG2A 4OI4A 3DMPA 4LEIA 3H05A 5FUXA 1D1QA 2VJKA 1KOLA 3T1HB 2E3JA 1CZOA 1O3YA 1SBQA 3LTEA 2TRSB 3A4MA 4IUCS 3B2EA 5LA6B 3K09C 2QW0X 5KQPA 4I9GA 3PEUA 4QZVA 3A3PA 3ECSA 1KH2A 3D54D 3LNCA 1LI7A 5BYAA 1D4FA 1UJCA 3ABOB 3I4CA 1M2OA 3CWCA 3JQ7B 4DMKA 4FD3A 8ATCA 3G2OA 3K72B 1L7PA 3FDFA 3EPJA 2F9MA 2ZUUA 1KU6A 4CEJB 3N0RA 4D45A 2IHBA 3PDIB 3ZXSA 1M83A 1Z8DA 3LQFA 4FIDA 4JT9A 3MW8A 3EF1A 5KCMA 3H11A 4MKIA 4YMWA 1NI3A 3ET5A 2E4YA 1WMEA 2DHCA 1X1TA 4HEQA 1JGTA 1KK2A 4NOLA 2VP2A 3E3LA 1SXGA 5LDGA 3OQOA 1D2EA 1A4IA 2QX9A 3F5SA 2OHJA 4OHOA 3E5MA 1NDUA 3ZY2A 4WJZA 2N42A 2JGRA 3LX6A 4GMKA 4FB5A 1RJDA 2Z04A 3QVKA 4ARSA 4B7UA 1AZTA 3UAGA 1UBUS 2HA7A 1BHJA 4GLFA 4UMFA 1EP9A 1WD7A 1G5FA 4KFRA 2J59A 4G25A 3OX1A 2QSJA 2PGIA 1SK9A 5EXTA 1K7YA 4MYSA 4NCHA 1CQZA 3MTJA 3NKLA 5D7NA 3AESA 1N9ZA 1I7PA 2CWWA 3W78A 2EFCB 1PKXA 1B8NA 3W4IA 3AUXA 4LYEA 1NMYA 1LD3A 4HDKB 3RUEA 3TDMA 1OV6A 3ANLA 1RSZA 3IUNA 4MRSA 5KJEA 3W90A 2CBXA 2PBRA 4L0CA 1E92A 1ZINA 3QKRA 1FFEA 2YHIB 1ESCA 2VO1A 4Q24A 1P0QA 1XRLA 1JKJB 3B51X 3EA0A 3OE5A 4M7OA 3AL0C 3M0EA 4YV7A 4MUEA 2QRMA 3OMWA 4LFBB 2IEIA 4BX3A 2REXB 3RUHA 3TOCA 1NRXA 1AGYA 2Y1EA 4XUGB 4KRFA 3P0JA 1UXJA 1G8PA 4BMPB 3FW1A 4IHJA 4K9MA 4OXNA 3WGIA 1IXKA 3FSRA 1NOKA 3BK7A 3ANNA 3BZWA 4ZANA 1XL0A 1V3TA 1DAKA 3PQCA 4Z4HA 5KOYA 3II6X 2YQ5A 1LA2A 4HUQB 2GMWA 1B6GA 3AHJA 5JNLA 3WJ2A 4QJ5A 2CJXA 4KQWA 4RCVA 2ZAYA 3WXMA 4EK9A 2GTPA 5B4TA 2IHZA 1MTOA 1RLOA 3GP3A 4F2PA 2OORA 2ICAA 4OREX 1B6RA 3B9RA 4JENA 6NULA 4G4SP 3C5HA 1IPEA 4JOSA 4TMVA 5JSYA 4PIVA 3WNCA 4OHZA 1FIUA 4JLWA 1MX3A 1IDN1 3IDQA 1NDQA 2PXHA 2NNLD 3X2FA 3GMSA 5EJMA 1CS0B 1T0BA 4NJEA 4DSNA 3GLKA 2DY0A 2YVLA 3QUAA 3RWBA 1WXWA 1CIPA 4NWIA 1OKKA 4Z8YA 1IBSA 1WZCA 5G41A 3NBMA 4Z0TA 2IH2A 2PZKA 4JWKA 3ZWQA 1L8XA 2G5PA 3FUTA 3PFHA 2CNWD 1GYRA 1EU1A 1NJ8A 2AQ8A 1SUFA 3CTMA 1USVA 4TM8A 3FGZA 4E2FA 1VPTA 2JB9A 1QZXA 2VJBA 2A9QA 2ZBGA 3LY9A 5F64A 3ZWWA 4EEKA 1XT6A 2H11A 4Q3CA 4YHHB 6REQA 4C0HA 2W2KA 4BX9A 1MQAA 2FRXA 3WYFA 2HSZA 1SM4A 2FMKA 1WZEA 3DEZA 3EVDA 3GR6A 4L50A 2VAXA 2VBGA 5J1TB 1O89A 1GQYA 3HE3A 5C80A 1KI1A 1SXJA 1A27A 4CKCA 1BXZA 1DMRA 2B83A 1OWPA 3EZXA 2PT9A 5EXXA 2ZVDA 4MR7B 2O3QA 2G04A 2BJWA 1EVLA 2JFVA 2D54A 3GLSA 1C1XA 5H59A 4RZ2A 3OOJA 1NVEA 4LRWA 4BVLA 5DTMA 1TK9A 5CLFA 4HQKA 4G85A 4C04A 5HF5A 4HL6A 3A14A 4OYHA 4N8EA 3WVNA 1YNSA 4FONA 3K1YA 1Y9ZA 2W8ZA 5AI4A 4BJ3A 1KQPA 4G1EB 3SBOA 2M6SA 3GFSA 4YCCA 1JA1A 5H82A 4P4LA 2RD2A 5IU6A 1FP6A 1QYRA 1DE0A 3BIFA 3DV0B 5BWCA 4PX9A 5KJCA 1U0NA 3L06A 4YI3A 5FLXA 5EGNA 2D0DA 5KWVA 4WZAB 3ZWNA 2EC5A 4EJSA 3GP8A 4DA0A 4B3IA 3TOVA 1ZH8A 4JC0A 3QXJA 2AN5A 2Y6UA 4NL4H 2GI4A 2N47A 4IDPA 3NHKA 1NR7A 2P5UA 2WTUA 2BR3A 1CS0A 1JEEA 1TCAA 4NJEB 1GNRA 3RUDA 1T2CA 2WWGA 3BG5A 4FN5A 1WXEA 5IANA 1NN3A 3F7OA 4LDPA 4B4VA 3G9ZA 5E9AA 3C39A 2WMYA 1U6JA 4R0MA 1HNZB 1TO1E 2B0CA 3A7DA 1Y8AA 2FSVC 3LY8A 3ROQA 1QDLB 2YMQA 3BMNB 4NYMR 2PX8A 3FG9A 4G5FA 1IEVA 3CLSC 5G0SA 2R1VA 1ZIXA 4J91A 3I12A 3K31A 1WVIA 4E46A 3DUFB 3OWXA 4BO0A 2QTHA 4DM3A 3E2MA 3WIBA 1NC1A 2CNWA 2I4LA 1O6ZA 4DT1A 3ZZ0A 2Q4OA 2LIPA 4RA6A 1ADJA 3SAJA 2ORIA 2R7LA 3SZUA 1CVLA 2OO7A 4G3XA 4ME6A 3JASA 3PGVA 4GWGA 1P7YA 4TL9A 3O8CA 3D0RA 1J2EA 1J70A 4YRMA 3KTDA 4MDYA 4WA8A 3T9FA 1F8YA 1NNSA 1AQYA 4RPGA 3IE1A 4YT8A 2I67A 4BO5A 5FJIA 1SRRA 3BEDA 2PWPA 1E5XA 1KQOA 5DCLA 4A16A 3MF4A 5I9SA 4UKDA 1SVIA 1THZA 4LHVA 5L51A 3V42A 1P7CA 4PYKA 4MWBA 2CMGA 1P4RA 1EP3B 5JC8A 4PSKA 1NVVR 2REBA 3LGAA 3AH8A 3ZI0A 2RHMA 3OO1A 3PX3A 2CXXA 2MSWA 3MOGA 3K32A 1ZXXA 3C45A 3IOBA 4D9IA 1R6VA 1XVTA 3VR6A 1DKQA 1LTHR 4KGVA 4E51A 4ND2A 3EPKA 2Y9MB 1AY0A 2OWDA 2DH6A