1DAFA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid, adp, and calcium
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
224
Chain Sequence
b'SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
molecule tags Ligase
source organism Escherichia coli
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
total genus 71
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dafA00
2DY1A 1MR3F 2G77B 3V4FA 5AUOB 2EYUA 3RS5A 4P31A 1V5WA 3U61B 3FVQA 1UKZA 2F3RA 2W0MA 1U8ZA 4B6FA 2C9CA 3R9WA 2AWOA 3KKNA 3GLIA 1S96A 2O8DB 1SVWA 3KKQA 4UQOA 2J46A 4V0KA 1JECA 4NBSA 1WXQA 1SKYE 4LHXA 3B85A 4B71A 4B74A 4NPHA 3EAQA 4LYFA 1CKEA 4L8GA 1O3YA 3G5UA 4UJ3A 2ONJA 2MSDB 1U81A 4X8OA 1OH8A 5H68A 4DCTA 5A4JA 3LO5A 5AUPB 1UEIA 3DMDA 4DKXA 4EQ6B 4D81A 1GKYA 3W9YA 3CLVA 5DE3A 4D25A 3FMPB 1EGAA 3BFXA 5J4VA 2IXGA 1XEWX 1TQ2A 2AR7A 1JB1A 2HLDD 1FQKA 1GUAA 2ZJYA 4M4SA 1XCMA 2CLSA 1XMSA 2Z5FA 2ORIA 2XAUA 4URYR 3E2IA 2QROA 1M34E 1NSFA 2BKEA 1VHTA 4QJ5A 2XTZA 1U94A 5L8VA 5DHFA 4FCWA 2CNWD 1J90A 1YR9A 3ZLJA 3CBQA 1LS1A 4MKHA 1UM8A 4IVRA 5DSZA 4ON9A 2OLJA 2ZRHA 4MYUA 3H0KA 2XZPA 1ZMXA 1Q1EA 1KK1A 1HURA 1TUIA 4MKFA 5JMTA 1ZAKA 2IYSA 3ZD6A 1D6JA 2OBNA 3I61A 4TYYA 4YC7A 3B78A 1FFHA 2VLIA 2ZQ5A 4II7A 1P60A 4JLNA 2IYQA 5JI3E 3V4RA 1HT2E 1AK2A 2RHMA 3K0FB 3WRYC 4KBFA 4PC6A 5FPHA 5HZKA 4NYMR 2NGRA 5C46F 1CBUA 2QE7A 2ANBA 2CCJA 2GK7A 2GVZC 3CPEA 3Q7PA 4AWXA 1NLZA 1UAAA 1FNMA 4G0NA 3A8TA 2VP9A 4IDQA 3U4QB 4KLZA 3SNHA 1XPOA 1ETUA 4CT5A 5DNYB 2XNSA 3DM5A 3IBYA 2H17A 5E3HA 4TLCA 3MJRA 2A7QA 2CK3A 2XJ9A 3OAAD 3P32A 4NCNA 3T1VA 2OEPA 4IVPA 3GCGA 2ZUCA 1E6CA 4IW3B 4XWOA 5GJBA 3IEUA 1L4UA 3UKDA 3SN6A 4PAMA 1LY1A 2ZSEA 1G7RA 2FWRA 2IYUA 4JT4A 4JJZA 4R71A 1K8RA 1KZGB 1I4DD 2VA8A 4LJ6A 5LD2C 4AURA 2FSGA 2DR3A 3P4XA 4BLTA 2TMKA 2ZETA 1QZXA 3WBJA 1E2MA 1J70A 1UF9A 1IN5A 1GSIA 2B6HA 1MABB 2AD5A 3O8BA 3LWNA 1R5BA 1XEFA 4WW0A 1XFAA 2GKSA 5C18A 2GWHA 2IS1A 2Z0MA 1Q3HA 2W58A 3AM1A 4QXAA 1PUIA 5FL7A 4NYMQ 4DB4A 4JKYA 4TL6A 4Z51A 2XTNA 3CNLA 5KOYA 5KPJA 3U7GA 3QSYA 2QMEA 3EIEA 1QVAA 4C0LA 1E9BA 1KK0A 2BCGY 4DUGA 4HLUC 2W00A 2ZROA 4HAYA 3B60A 5CIQA 2W6JA 5FUXA 3CF6R 4M9QA 4Z8YA 2Q9AA 1E9SA 3L43A 2QAGA 4BASA 1KZ7B 2VP0A 1K6MA 1RYHA 1G8PA 1JQJC 3VU9B 5EXSA 4B3GA 2Q6TA 1TEXA 3IHLA 1E4VA 2H57A 2J7KA 4TSFA 1J99A 1YR8A 1YZLA 1EWQA 2O8EA 1IXRC 3FGNA 2VP5A 8OHMA 2MSEB 4OHYA 4LPSA 5EUMA 3GJ3A 3RYTC 3SJBA 4A0HA 4L4UA 3EPKA 1FNNA 4Q1BA 1COWD 2K5UA 1CR0A 1EFHA 2RGNC 3NEJA 4Q4HB 2A9KA 2IEZA 1F2UA 4NYJR 3B2EA 4AI6A 1GZSA 3GQBA 1GP2A 3GFOA 4ZCIA 2AX4A 4DSUA 2I1VB 1TL7C 1S1CA 1CJTC 2ZRCA 4CEJB 1G19A 3B1YA 4M1YA 4PTLA 4Q1EA 2XGJA 4LJAA 2WWGA 3TH5A 1DOAA 2A5GA 5SZHB 3MWKA 2GJKA 4JL6A 4BE7B 4EJSB 1N0WA 5TV2A 5FOVA 2PT7A 2DCUA 2GF9A 2GESA 1D9ZA 1VECA 3EW9A 4DCUA 3QXJA 1EFCA 3ZIAD 3F8TA 5CK4A 5D3QA 3A4NA 3T1OA 2VTKA 4O25A 1FPMA 2GEDA 2AK3A 1KSJA 1Z6AA 4KVGA 5CJPA 1CJUC 2C04A 821PA 1E99A 3TMKA 5FPYA 1ZC3A 3OF5A 1TTTA 3CZQA 1N5LA 3X1ZA 1MV5A 5FI0B 3KQLA 1E2GA 2D2EA 2X77A 4A15A 3MG9A 4XSGA 4UNPA 4CT4B 4ITRC 2J7PD 2VO1A 5D3MB 2F9LA 3FYHA 1NMZA 1AS2A 2JJ8A 4EFLA 3LAWA 2IS2A 2DWQA 3X1YA 3MWLA 4MUAA 4N0EA 3TUZC 3PUVA 1SVOA 4JLDA 1DG3A 2A5YB 1A7JA 2NTYC 2IEYA 4I1VA 2EVWX 3FDIA 1T3HA 3QPWA 3VR4A 1GRRA 3CIOA 2CHGA 3KX2A 3M0EA 4IXNA 2R8RA 1SXJE 1P9RA 3L0PA 3BGWA 4GP7A 3ZVRA 4FINA 2I4IA 1G21E 4B3FX 3SFVA 4ZV4A 1DAGA 4Z1MD 3T5GA 4ACAA 3TQFA 1DAHA 4UNRA 3KQUA 2F6RA 5FUWA 1W7AA 1CF4A 3A1VA 3GJ8A 1QHYA 3I62A 1GKIA 4R9UC 4S2EA 4WBSA 1GVNB 1N5JA 3KZ1E 1NKSA 3WMGA 1Z0DA 1UADA 5HE8A 1G3UA 3KB2A 4TQ9A 4ESHA 1P72A 4OK5A 5F9HA 3IQXA 3S1AB 3AVWA 5EXPA 1Z6XA 3K0CA 2W83A 4CEJA 2J45A 1SXJC 3SBEA 2Z83A 1GIAA 1LF0A 5K8UA 2OFWA 3TK1A 3ZVLA 1YVDA 2V6JA 3I8SA 1N6LA 2WWHA 2R62A 2JEOA 1E1QA 2WAXA 3LD9A 3LV8A 4Q4AA 1TADA 4FWTA 1JR3A 4ACBA 3J81k 5EP2A 4YMUA 1NRJB 4PO9A 4DEYA 2ZI4A 1N6RA 4JBXA 3LRPA 3BH6A 4UXJA 1SZPA 2V54A 5SZJA 4F7WA 3MRSA 3RRYA 1E96A 3BFKA 2JGNA 2OZEA 1CJKC 1DVRA 1N6IA 4TYPA 4JBWA 1KJWA 4HB3A 4WZBE 2Q9BA 2JDIA 5EE5B 4QC2A 5CB8A 4DSOA 3KQHA 3ZZ0A 2CMKA 1G3MA 3WYAA 3IEVA 2J0VA 2JIZA 3I32A 4XD7A 1N3BA 3BD9A 4PPFA 1W0JA 3IUYA 1KI4A 3RABA 3L8ZA 1BMFD 4HEJA 4OQFA 1JNYA 1KHTA 3K0FA 4DSTA 1H8HA 3THYB 2H8KA 1NY5A 4AYXA 1KI3A 4DCSA 4HI0E 2GXQA 2CBZA 1D2MA 2A78A 2ZRAA 1ESMA 2FSIA 4HYYA 4C2TA 3C15C 1TX4B 2IT1A 1MO4A 1XD9A 4JLBA 1P5ZB 4JLVA 2OCAA 3A4MA 1QG2A 2CHVA 1IN7A 3NHAA 1II0A 2IYLD 2FN4A 3NVAA 3U3OA 1XF9A 1XZQA 1XXHE 2G0TA 5G3ZA 4DWJA 1JEEA 3BB4A 4BFUA 2BJWA 1CLUA 3OESA 3ECCA 5CDFA 1W1WA 1T8UA 2WAYA 3K09C 2BCJQ 4B6EA 1E2LA 2QY9A 1E9RA 3RDPA 4HDCA 4GNKA 4NCHA 4DB2A 1PZNA 2ZJAA 2IYXA 2GEUA 2JATA 1IONA 4MDFA 1HV8A 1Y63A 2CCKA 5J4HA 2C98A 3WXMA 4YXWD 3RS0A 5CYOA 1E2IA 1RIFA 4JMPA 5LD2B 1EK0A 4Q01A 4ILEA 5B2ZA 4US0R 3AF4A 1GITA 3B13B 1AIPA 2NZJA 3KXKA 4FMCF 4TTRA 2XSZA 4A82A 4AYTA 1XWIA 2ZVPX 1C1YA 4BRWA 3TLXA 4XIGS 4ASUD 1H8EA 1M7BA 3BRWD 2XEXA 1F3OA 4CEHB 2VSOA 2CVHA 2RMKA 4IRUB 3A1TA 1R5OA 3DZ8A 5KSPA 1EXMA 3K70C 4C0KA 4Q19A 4B35A 2RAPA 3AVXA 4GMXA 4JT2A 1ZVQA 1R6BX 1E1RA 3TW8B 3BB1A 4BLRA 1KK2A 1W2HA 2PJRA 4O3MA 2EFEB 1YU9A 4FMDB 3R9XA 1MO3A 2FFBA 2JLQA 4M8NE 5K8TA 1AA9A 2C78A 1ODFA 4LJ7A 3W5JA 4D4MA 1AM4D 1GILA 1E69A 2ORVA 2YC4C 1OHHA 3GLHA 1FUKA 1IOZA 2OBLA 1OB5A 1UDWA 1VPLA 3Q72A 2VP2A 4D4LA 2DFLA 3WNDA 5KSYA 2OAQ1 2ZE5A 3LQRA 1A82A 1CTQA 4MGZR 5KDOA 5JS7A 3U3RA 2ZUBA 3AP1A 4P3YA 2H18A 3EC1A 1E2FA 1UBGA 4A2PA 1LW7A 1JQLB 4IDHA 4XWKA 2B7BA 3DM9B 3SBDA 1VKJA 1GRNA 1OFIA 3VR5A 1D2EA 2QUZA 2RGGA 3KUDA 1AJEA 3DMNA 4PZYA 4LV8B 2QAJA 4C9BA 3CUEF 4HAWA 4RD4A 1NL3A 4HLQB 2PZFA 1U9IA 2F7SA 2ZS8A 4ZIRA 4OL0A 4C0JA 3D6TB 1D8TA 4NTZA 5FFMA 3WMEA 1W4CA 4EJSC 3MGCA 4KHZA 2ODBA 3IPYA 4M9SA 1NBMD 1EX6A 3HWSA 3PENA 3MMPA 3PEVA 3PVSA 3TVDA 5TMPA 4Q1FA 1WCV1 2G9NA 3K53A 1OH7A 1MKYA 4Q03A 3WYFA 1ZCAA 4TMVA 4K8OA 4NCKA 2BM0A 1GKUB 5FTKA 1FL9A 2OFOA 2XZLA 1ZBDA 1ZCBA 3VHXA 2ZRMA 2A5FA 1CIPA 2QP4A 3U7EB 1X3SA 1ZM7A 2WSSA 3CH4B 2W6ID 2IBMA 3JZAA 1VHLA 1M8PA 3W5IA 1KDPA 1PJRA 1TU3A 2HJGA 2QPAA 2O0KA 3IIKA 1VTKA 4XVRA 4B34A 2C9OA 3CONA 4NZYA 4NL4H 2WPDD 2HV8A 1NNEA 1G7SA 4LYJA 1ZNZA 4MRRA 3SHWA 4GI7A 1A2BA 1OPXA 4QL3A 4P4TA 3DO6A 1Z2CA 2ZAOA 6Q21A 1M6NA 3IKJA 4Q5IA 4Y0VA 4PC2A 4QHSA 3U7FB 3RAPR 3AVOA 3ZYCA 2MMGA 3TR5A 4DIDA 2J41A 3QI2A 1TQDA 1DG1G 4LRWA 4UKDA 4YDHB 3A1SA 2QM7A 4IXMA 3GJXC 3I73A 4RFVA 2W2TA 4BZPA 1RRFA 2DFNA 1RJ9B 3EIQA 2WICA 4PQYA 1VG0B 4D0NA 3HP1A 3OIUA 4XOIA 4HZUA 2PCLA 2FV8A 4KO8A 5JRJA 4HLUA 5FOSA 2F55A 5CITA 1UKVY 3K9LA 4HB0A 3LBNA 1I2DA 4F92B 4TWZA 4S35A 3EARA 3V9PA 4GP6A 5FBLB 3L82B 4TLEA 3I5XA 3PUXA 5CJ2A 3Q8XB 5JS8A 4LI0A 3TNFA 3Q3JB 5JJIA 2A2ZA 2RHDA 1NKTA 4CDGA 4DIEA 4M2LA 2ZUDA 4K46A 1Z3IX 1W47A 2HXYA 4OQLA 1LS6A 3AF2A 2CE2X 2Z4SA 4D0LB 1UFQA 1W4BA 2GETA 2LKCA 2GJAA 4M9ZA 1US8B 1DAIA 4LK2A 5GJVC 2GCNA 1UJ2A 3LX8A 4YMWA 3T61A 1E79D 2UZIR 3CW2A 1AQYA 3K70B 1SKYB 3JVUA 3PR1A 5DI3B 3BH0A 2GZAA 2NOAA 3OIWA 3LQQA 2G3YA 4LSGA 3PEWA 1SULA 2YYZA 3IDQA 3KFVA 3LLUA 4JLPA 5J4KA 4QM7A 3ZGXA 1HQCA 5AR1A 2WBLC 2V6IA 1IHUA 1VMAA 1ANKA 3PV0A 4RD6A 2VHCA 3R7WA 1AS3A 4KSCA 4P32A 3TUIC 2GXSA 2ZSAA 4MRNA 1XPRA 1Z47A 1Q22A 3BE4A 3VFDA 5GVRA 3WY9A 3U60B 2D7DA 2BEJA 1X8JA 4KJZA 4WVFA 3TW4A 4EPXA 1XTKA 1DE0A 1CR1A 3GLFB 2BVNA 4KYUA 4DBLC 3EZFA 4PPGA 5FR2A 3D8BA 1WE2A 1KAGA 2ASEA 2JLYA 4E22A 3EASA 2FX3A 2QP3A 3CRVA 3QXXA 4Q02A 5JFGA 1W4RA 3L2OB 1KJYA 2I1QA 1OXVA 1SXJD 3QF7A 3JZMA 1GOTA 1W4AA 2WMOB 3KB1A 5IRCD 1L7VC 2XX3A 2XXAB 1VYVA 1S3GA 1E9EA 1F2TB 2QRZA 2F9MA 4M22A 4QGFA 1YZNA 521PA 5C4MA 4KSBA 1KAOA 2QQ0A 1X6VA 2QU8A 4A2QA 3IIMA 4CVNA 1OIWA 3QF4A 3DKPA 4XVUA 5B57C 4M1WA 4OQXA 1MRSA 2VF8A 3TKLA 1L2TA 2OXRA 4D82A 5BYKA 5KDDA 3BOSA 2ZR7A 3NDPA 3OZXA 4EPVA 2XJ4A 3W3AA 3HU3A 2QORA 4G5QA 4D4KA 4BRUA 4F4JA 3VKHA 1D2NA 2O8CA 3T06B 4PZZA 3C16C 4FD2A 4DLTA 2VEDA 2VP4A 3I4LA 2XB2A 4DLXA 3V00A 4PZLA 2G1JA 1KNXA 2VL7A 1WF3A 4RY2A 4MDEA 1S4QA 4W5HA 1VCMA 2H5EA 1Q1ZA 3REFA 2RGCA 3TUJC 1ZUHA 2WJVA 2AK2A 5EE9A 4A2WA 2HF9A 3CRQA 4NCJA 2JCSA 1JI0A 1KI1A 1OB2A 3TR0A 2YOFA 3ZZTA 2HDNB 2CNWA 2H16A 4JVSB 4XTRA 1P61B 4A0GA 3C5CA 4GOKA 2FA9A 2OFXA 3H4MA 3GLGA 2XNDD 1KO1A 4ARZB 2WMNB 3DDCA 3AF3A 3H84A 3TBKA 4V0NA 4BUJA 4QHTA 3CPHA 5M04A 1DTSA 4TQAA 3OFNA 3P1JA 1NMXA 2O0HA 4CW7A 5ELXA 3ZH9B 2KI5A 3GFPA 1W48A 4RFSB 4Q21A 1NVUQ 2AFIE 1XJQA 4RKFA 2YWHA 3RLFA 4NCIA 1S3SA 5JEDA 2QE7D 1OH6A 2CLCX 2E9SA 3S1AA 4UJ5A 4URUR 3X1XA 4I81A 1XD2B 2W2VA 1IY0A 3PIRA 1E2QA 1E2NA 4RCYA 1E0JA 2V7QD 1Z06A 4DC9A 4HAVA 5DI9A 3ASYA 1NF3A 3EWSA 2DFKB 3EG5A 1ZRHA 2HYDA 3TVTA 1Z28A 4KVAA 2WWIA 4IFBA 3SYNA 3SE0A 3ZJYA 3VR2A 1U0LA 4D0GA 3D3QA 1KSHA 2ZRFA 4TLBA 3RANA 3Q7QA 3REGA 2Y8EA 5G41A 1AKYA 4URZR 2IYYA 5AJYA 3UMFA 5E4FA 4C3ZA 1XTRA 1YHNA 5F3WB 4TMKA 1WA5A 1BOFA 1HEIA 3RRZA 4MGKR 1K5GA 1W0KD 3QXSA 4WZ6A 4WOPA 2V3CC 2A5JA 5FPSA 1S9HA 4CGZA 2O5VA 3WP0A 4JLAA 3NHBA 1Q21A 1QG4A 1U2RA 4NU0A 3GLHE 3W3ZB 3CRW1 4BFVA 1E3MA 1NVVR 3FHCB 5KUTA 1S1MA 2GCPA 5CYPA 1L8QA 4MKIA 1DADA 2GHIA 2YHSA 4IOKA 1G8GA 1CJVC 2ZYUX 3VR3A 3HU1A 4G1UC 5K8IA 1VG8A 3FFBA 1VCIA 3KKPA 3FHOA 3TGPA 1T0JB 4E07A 4BLOA 2QTFA 4IHQA 5P21A 3LVRE 4YDSA 3X1DA 1U90A 4V02A 1L4YA 5DGXA 2EU8A 2IUUA 4F38A 4FMBB 4OI2A 2BHRA 1HE1C 2SHKA 4Q7MB 5AWFC 4PSAA 2JJ2D 3DHWC 1EG7A 3KTAB 4DSNA 4F4CA 3OE7A 1NLFA 2BDTA 4DLUA 4PR0A 4IEIA 2Z43A 5DN6A 2P5TB 4B73A 1OFUX 4I1OA 4Q9HA 4HZUB 2JLZA 1YR7A 2A3RA 1LVGA 3W6NA 4ESVA 3GJ6A 1KDTA 4WXPA 1NN3A 3NH9A 1FMLA 4DLZA 2KJQA 1N6PA 3I1FA 4I1SA 4G5RA 3SHFA 3SQWA 1E2DA 2HYIC 2FDCA 1T5LA 4LY6A 2QAGB 3GEHA 2PEYA 4W5JA 2IK8A 2ZU0C 3E70C 1G16A 2J5XA 4R2HA 2ZIAA 2VRWA 1J8MF 2ATVA 3Q5EA 1MRNA 3QBVA 4C2UA 1P2SA 4MGYR 3TIFA 1Q12A 3QEJA 1F2UB 2FE4A 1SXJB 1S9DA 3IGFA 1G4UR 4KU4A 1FUUA 4PAOA 3QPVA 2EFGA 5FBQB 2REXB 4JLKA 1XB2A 1E9DA 4MA4A 3GLGB 4MRVA 3R8CA 3AB3A 4IKEA 3CR8A 2EYQA 2D7CA 2VHTA 2R6AA 1JAHA 3THOA 3KJHA 4UNSA 2WWFA 1RW4A 2GDJA 2ODNA 3OIVA 3PCRB 3QKSA 4LHVA 5DLQC 3VU9A 4DCVA 3EZ2A 3PJRA 2QTHA 3NIBA 2QBYA 4P33A 4B47A 1DAKA 1G1MA 1Y3AA 3WRXC 3AGPA 4PC7A 1MH1A 3LNCA 1HYQA 3CH5A 3GD7A 1T4GA 4ZI3A 2P2LA 4Q4JA 4FCTA 5DH9A 5L3SA 2XXAA 1ZC4A 4PPNA 4HUQA 1J7KA 2FFQA 4AYWA 2PCJA 4BLSA 3K0SA 4LBWA 1ZUIA 2O8EB 1LFDB 3LW7A 1W44A 2FZ4A 3CWQA 4JLJA 4C0BA 5AJZA 2FPKA 3N2EA 5J5CA 4BFSA 1XMVA 4MQBA 3LBHA 5HKKA 1HUQA 4OQMA 1G18A 4R7ZA 1VYUA 3U4QA 4AKIA 5EE3A 2XOKA 3KDSE 1CR4A 1RRPA 2AXPA 2P5SA 3HR7A 4A1FA 1G3RA 2JA1A 2ORWA 4A8JC 3NBXX 2YVUA 5C1BA 2CE7A 4E5UA 4DT1B 4M1TA 4KXFB 4Q48A 2P0EA 2JJ1A 2AKAB 4GT1A 2W2XA 3B5JA 3MJHA 3ADCA 3THXB 2FFHA 2R6FA 4ZKEA 3W6OA 2BJVA 2PX0A 3A1WA 3N70A 1IN6A 4TL7A 2GJSA 3ICEA 1TUEA 4QBIA 4AKEA 3ZD7A 2BMFA 4B2LA 1YZTA 4A0RA 4IVQA 2VHJA 2IWRA 3LVQE 4C7OB 2RGAA 1DS6A 1MT0A 1ZM3A 1E9FA 2C77A 4JVLA 5TB5A 3GLFA 1KO7A 2VHUA 2YZ2A 1KI7A 1KO8A 4RD1A 4HDQB 3VKGA 1UBCA 1OJLA 4JL5A 3SI7A 1GNRA 1EFRD 2QNRA 3B1WA 3LH5A 1P9NA 4GFDA 1FX0B 3ND9A 3PUZA 1YR6A 3QNUA 4FW9A 3ETLA 3Q85A 5IT5A 3CKLA 1IAQA 3P4YA 1JR3E 2AL7A 4KFUA 4Q47A 4Q9JA 4C7OA 3T34A 3RS3A 3U3MA 4GRAA 3IIJA 5CB6A 5H1YA 2JLUA 2NO1A 4RJLA 4B33A 2OHFA 4TL9A 5LDDC 1GFIA 1OF1A 3W8RA 4B48A 2FPMA 4BWYA 4DJTA 5B64A 2VH5R 2BBSA 1TAGA 2J3EA 1LF5A 2IF0A 2WWXA 4OJKA 3K0CC 4NYIR 2ZTSA 4FXPA 5HCIA 2AD1A 2NO0A 4KLNA 4A92A 4KFRA 3M4YA 1JALA 2QT0A 4JVMA 2GAOA 1W0JD 1OIXA 4M1SA 4MRSA 1UKEA 1NIJA 2BV3A 1GNPA 2WM9B 4BZQA 1H8HD 1S8FA 2REBA 1OXTA 3LX5A 3H1TA 4RZ2A 2F3TA 1Z2AA 4M9XA 4O2LA 1IN4A 1Z6GA 2QM8A 1C9KA 4BLPA 2NZ8A 5F2EA 3H86A 4KODA 1Q20A 2QPTA 3BWDD 4RD2A 1XXHA 2YOHA 1G8FA 3OHMA 2ZJ2A 4OQNA 4MUBA 1OXSC 2ZS7A 3UANA 3AVPA 3MWYW 1NG9A 4URXR 3Q9LA 1RFLA 3EPLA 3THYA 5IDVA 2ONKA 1SVLA 3HPRA 3MSXA 1Z0JA 4U7DA 1X86B 1SVMA 2QMOA 2ZRKA 3IBGA 4HAZA 5UKDA 1ZINA 1U9IC 1SHZA 2QRNA 1I2MA 1TPZA 5E7IA 5FBVB 4W5WA 1P9WA 1G3QA 3FB4A 2O8BA 1U8AA 4YXWA 1AS0A 1NI3A 4L9SA 1A4RA 1QHHB 4G3XA 4DLSA 2OCBA 5G53C 1MOZA 2ZEJA 721PA 2Q3HA 4A0FA 4BEJA 3QVUA 4OJQA 3A6PC 4PSKA 1KGDA 2CHQA 4QBFA 5FBWB 1NN0A 2C8VA 1ZUNB 2DFTA 4NKRA 2WJHA 5D3MA 2LWIA 5LB2A 1F6BA 3QPUA 2O8FA 4W9MC 1S2MA 2PH1A 5J40A 1MO6A 2DBYA 4Q4JB 2PZGA 5E95A 3WMFA 1X8KA 2ZYWX 3EXAA 4ASUA 2HLDA 1G41A 5KNBA 4EPWA 2ZITA 4JBYA 2B8WA 2AFHE 2P6NA 2EFCB 3RRMA 4KAXA 3LLMA 4JYCA 3QEOA 3RRNA 1KK3A 4TLAA 3CWZA 3P26A 3EIHA 1KY3A 1G3IA 1W2GA 1QHGA 4EDHA 2GA8A 1SVIA 1WDTA 3C14C 2FH5B 1OXUA 3AVTA 2CVFA 1E2PA 1G4AE 5FI1B 2OG2A 4FCVA 2ANCA 4MKGA 2JLWA 4WXRA 1KI6A 1D9XA 1GDDA 4KFTA 5JJLA 3QQ5A 2IYRA 2Z4RA 3WP1B 1WRBA 3B8HA 2HF8A 1A2KC 3BK7A 2G83A 2JLRA 2AXNA 2ZSDA 3K0AA 1DO0A 1G20E 1FMJA 1AZTA 2FU5C 1EX7A 2ZAMA 1KKLA 5CLLA 5C2JB 4DZZA 1W5TA 2J0SA 3G0HA 4ZPXA 3NXSA 5JCPA 4TMXA 3UXMA 2WV9A 1Z5ZA 4TTQA 4OHXA 3K0EA 5EUQB 2ZREA 1ZD8A 2IS6A 4KFSA 4WIAA 4QM6A 1G6OA 4KBGA 2RGEA 2CK3D 2FZLA 4N3NA 3OAAA 2YKGA 4B3CA 2OUKA 2EW1A 4AD8A 1RJ9A 1TF7A 1W36D 1XP8A 4LPKA 3THWA 4E09A 2FFAA 2C96A 1Z0AA 5L3VA 2WJYA 4F93B 4US2R 1BH2A 2ZJOA 1COWA 3ICQB 5FUYA 1OKKD 5IK2D 1DAFA 2IX3A 1II9A 3CPJB 3EA0A 3QY0A 1DO2A 2QTVB 1OFHA 2BC9A 1LB1B 2J59A 3FHTA 3U7HB 3RS4A 2XZOA 2MMCA 3NC1C 2OSBA 5CM8B 1XBTA 4KV9A 1GRQA 3OEHA 3ADDA 4OHWA 4LV6A 3FMFA 4LX0A 3K9NA 4HDOB 2YOGA 3VMFA 2QA5A 4B3XA 4NMMA 1M7HA 2OXCA 4FIDA 3LXXA 2RGXA 3LFUA 5JLJA 1SVKA 2CEAA 4A8JA 2WTUA 4PAQA 4DHEA 1XMJA 4TTPA 2ZJ5A 4HLDA 4I99A 4C0HA 1QF9A 2Q21A 2NO6A 4LHZA 4BECA 2MSCB 2P6UA 4HATA 2Q3FA 4AG6A 3ZIAA 5IF9A 2WIBA 2D62A 1ZIOA 4EPYA 4EKDA 4B43A 2B21A 2X8AA 3UIEA 4BFWA 3C4JA 1UBEA 2WPDA 1N0VC 3GPLA 3THXA 2BEKA 2GILA 1GG2A 3NG1A 5KPDA 2N46A 2ZPTX 1QBKC 3RWOA 2OESA 4TMZA 3T1QA 4A8JB 1G6HA 4V03A 5CM9C 4ZCLA 4PXAA 4IDNA 3I5YA 1E32A 2R2AA 2FGJA 3B9QA 4P4SA 1FTNA 2BBTA 3D31A 2ZE8A 3OEEA 3IILA 4LBVA 3BB3A 4TSFD 4U02A 4Q1AA 1XX6A 4URWR 4EPTA 2X19A 2WWWA 3RWMB 2ERYA 1G9XA 3RC3A 4URVR 1P6XA 4AC9A 2V4ZA 1N0UA 4BZXA 4UXIA 2O8BB 2IXFA 4QGAA 4QRHA 2XITA 1JXMA 4DDUA 1NSTA 4GOJA 1W36C 2BBOA 5EP4A 1JXOA 2G0NA 4O0MA 4Q9KA 5L3SB 1KI9A 3QF4B 3NDBB 4Q66C 1YZQA 1QHSA 1SQ5A 1UPTA 4CIDA 1DPFA 3A36A 2YINC 2VQSA 5KO2A 4FMCB 3BIFA 2F43A 2OLKA 5EE0A 1E4YA 2GBLA 1BO6A 3F0TA 4Z1MA 3QKSB 3UK6A 4MITA 2JLSA 4V0OA 2WVJA 4RD3A 5J4LA 2KBFA 4A9AA 4TL8A 3BERA 1E79A 4B3DA 1IXZA 5JEEA 2Q9CA 2RH5A 4QGHA 2CJWA 2ZI9A 3UWKA 4XTCS 5FOXA 3KFXA 4ZO4A 1KSFX 3FMOB 2RGDA 5JSZA 2HT1A 3GLIB 2O8DA 4TLDA 3FKSA 1XEXB 3R20A 1NJGA 4WZAE 4NE2A 4A6PA 5JWOA 4W7SA 2A5DA 5FTNA 1JAIA 2BKUA 3SFZA 1BIFA 5TARA 3A4LA 3W90A 1KMHA 4LYHA 4B75A 4N1AA 4TZ6A 5FPTA 3VX3A 3KJIA 1II8B 1EFTA 3FE2A 4G5SA 2YV5A 4H9GA 4TN1A 2F1RA 2UKDA 4Q9LA 4ZDJA 2VF7A 4QG7A 1NG1A 2GCOA 1Q1QA 4P0TA 5B58C 4EFMA 3SOPA 3WHLA 3GLFE 2ZI7A 2NMVA 1OFTA 1TMKA 1PUJA 2HCBA 3BAFA 4LHWA 3RS2A 3ZS8A 1F60A 4LGMA 2FF7A 1XEWY 4LJ4A 1FP6A 3T12A 4NYIQ 2FG5A 4KI0A 1G7CA 3CR7A 5HZHA 5EQTA 4PSVA 3SC3A 2ZRPA 1KO4A 1WMSA 2OAP1 3NEYA 1TEVA 1G8HA 2ZSFA 3CRRA 4QGGA 3KUCA 4IDOA 1G5TA 4TT3D 3SYLA 1OH5A 3IHWA 4BFXA 1CU1A 3KQNA 2FPLA 1DEKA 2IYTA 2RCNA 2IUTA 2OE2A 4E03A 2ODEA 2BBWA 3B1XA 2A30A 5TDHA 4TMWA 2ZRBA 3DKVA 5CLQA 1CULC 1VDZA 2QG6A 2V55B 2REOA 4UNNA 1F48A 2YWGA 3TJZA 3VKWA 1FQJA 4FWIB 5GVSA 2EFHB 3SZRA 5FTLA 4GDFA 4D4JA 3EPHA 3HR8A 2IS4A 1ESNA 3KXIA 2IA5A 3AVVA 3QXHA 4M1KA 4AIIA 1IBRA 2XTMA 4DLRA 4DDWA 3EZ7A 4JLMA 4LJ5A 1JR3D 1U99A 2GVDC 4R2IA 1OSNA 2FSHA 5KHOC 3QBTA 4ZDIA 2ZJZA 2YWEA 3LY5A 3ZQ6A 1EESA 2FGKA 1T8TA 1KNQA 2PMKA 2WOOA 3FTQA 4DLVA 3ZVMA 4QNMA 1M1YE 4X8HA 4KITB 4AKGA 1SVSA 2ZVQX 4L16A 4LOAA 1ONBA 1TQ4A 1U0JA 2WZQA 1NY6A 3AUXA 3UPUA 1E0AA 1W49A 2J0UA 4DEXA 3AQ4A 1P73A 2QZ4A 1CEEA 1DELA 2ZRLA 3GLGE 2DWPA 2B92A 2XSZD 1G64A 4Q7KA 5CK5A 2QP9X 4QBHA 4R98A 3SJAA 5FL3A 1Z0FA 3LBIA 3TSWA 4L15A 1XTIA 3MWJA 2BIFA 2ZR0A 1YZUA 2ZU6A 4XJXA 4DCNA 5FOWA 1FW6A 5B30A 2NO9A 2P6RA 2FJUA 1NIPA 2GAAA 4QJ4A 5AJWA 1CRQA 4PO1A 1E1RD 2Q0HA 2C99A 1X1RA 1P75A 2VYFA 5JWRA 3HU2A 4KYIB 4LCBA 3VR6A 4JVNA 2G1KA 2NG1A 1VCNA 3CRMA 1LTQA 1JJ7A 2F1JA 3GFTA 4C0AC 1KIMA 1KKMA 1QRAA 2GF0A 2GCOB 5FTMA 2WSMA 3WHKA 3PEYA 1OHHD 2NO7A 1Z07A 3CO5A 2IYWA 1R10A 3TRFA 2EQBA 1X1SA 1Z29A 2CDNA 3KKOA 4MGIR 4EFNA 4Q18A 1KO5A 4C4PA 3AVQA 3CB4A 4FI3C 1R0YA 2OO7A 4HB4A 4PHHA 4GZLA 2EFDB 1IY2A 4POAA 1FX0A 1EWRA 3WNBA 2E1RA 2VSXA 4Q4HA 3A37A 4B3BA 3O8CA 2BMDA 1ZNYA 4EAQA 3TAHA 2QQEA 4DRZA 3SJZA 4L5BA 2KB0A 4A4DA 4BFYA 4F4IA 4GSYA 5DHAA 2WJGA 3F5FA 3NTUA 2PL3A 2CJWB 3NKVA 2JASA 3P27A 4QJ3A 2ZANA 3HYTA 3K1JA 1HTWA 4QOSA 5EE1A 3TE6A 5L3QB 2ZI3A 3DL0A 1Z08A 3U3JA 3ZVNA 4PO8A 3L8YA 3NH6A 1H8ED 3BXZA 1GWNA 5KDLA 2QT1A 2QENA 4KCGA 4OBEA 2ZXUA 2V1UA 2PEZA 2CL7X 1I4TD 3B7GA 4US1R 3ZZUA 4CF7A 2ZSBA 4ERNA 3B1VA 1KMQA 2YNMA 2CCGA 1EFUA 4LYAA 3B6EA 4HB2A 1NJFA 2H7VA 2XB4A 2P3SA 2QSZA 1BYIA 2G6BA 1RKBA 4D80A 2J1LA 4B44A 1R0XA 1P62B 1CXZA 1FP7A 2RB4A 1M2OB 3BC1A 1E9CA 4MYHA 1P2VA 1PLJA 4CEIB 1M7GA 2CL0X 1XRJA 1Q0UA 4JKIA 4AY2A 1PVOA 3R8FA 5FL7D 5DN6D 5J4YA 4PHFA 3SEAA 1JBKA 3IO3A 2NIPA 2IXEA 3F3YA 4NDZA 3U6KA 3ADBA 2GK6A 3ZS9A 3C7KA 3EPJA 4DUGD 3NBZC 4HUQB 1T6NA 3UG6A 3LW8A 1GL6A 4DLWA 2W6JD 4RVCA 3SS8A 621PA 2IF2A 2J87A 4XH9B 4M1OA 2QGNA 2WJIA 5FOUA 2OCPA 1F2TA 3DVLA 3G82C 3W6PA 1GM5A 4CEHA 2L0XA 2ZI5A 5EXTA 1VYTA 2JLXA 4Q7LA 1GAJA 4H1VA 4JSYA 2GRJA 5FOTA 1ZU4A 3GJ5A 4HUTA 3E1SA 3MD0A 1TU4A 4G01B 3GEEA 2W0SA 1AGPA 5JHGB 3AKEA 3MFYA 3EZ9A 2R6CA 4OKSA 4Z8XA 4EIWA 1NBMA 1NN5A 1RVDA 2GJ8A 5LB4A 3AVYA 5GJCA 1OT3A 5JBQA 4ZCMA 5KSZA 4PFSA 2PJZA 3HYRA 4TYQA 1DBSA 3GEIA 5GJWC 3W8NA 4CZ2A 2D4HA 3QG1A 3BFVA 4LJYA 3AVUA 1NVWQ 4ZDKA 3RHFA 1J2JA 2NPIA 1VG1A 4RCZA 4LJ9A 5HE9A 2DWOA 4CYMA 2H92A 1Z83A 2X2EA 3QG5A 1XEXA 5SZKB 4DT1A 2O52A 3PUYA 5JJKA 5TVKA 1KJZA 2AHOA 3QE0A 3CF0A 2WSSD 3GJ4A 1XTQA 3AUYA 3O47A 4IJMA 1W36B 3A1UA 221PA 1GNQA 1PV4A 2N1BA 3AGQA 2OCYC 3QIAA 1VIAA 3X1WA 2KBEA 2AN9A 1QHNA 3QKRA 3UMRA 1IXSB 1WBBA 1H65A 1MABA 3MUFA 4ZI2A 4CEIA 1PLKA 1Z0IA 2HUPA 2OV2A 2VHQA 121PA 1OW3B 5BW8A 5AUQA 1CR2A 1ZD9A 5BN5A 5EJEA 4P4SB 3GMTA 4GZMA 4DLYA 4B76A 2J0QA 2F1HA 2R6DA 1NVVQ 1E2HA 4Q4AB 2OM2A 1I4LD 1XPUA 1T3SA 3IQWA 3GP8A 3VR1A 4Q9IA 4BLQA 3QOFA 2O8CB 4OI1A 2J7PA 4NHOA 2CL6X 2PLRA 4PX9A 3K0AB 3QENA 3CNOA 3BBPA 1ZP6A 4LC0A 1G291 1DAMA 1AGRA 3ND8A 1RRCA 1U0HC 1ZNWA 2ZR9A 3KJGA 1HE8B 2QN6A 3RSLA 3N2IA 2ZE6A 4N0DA 1G7TA 1XU4A 5AK0A 3QXCA 2C95A 1T0HB 1Z22A 2V1XA 3KL4A 3X2SA 2ZRDA 3C8UA 5FH9A 3KTAA 2FNAA 3NC0C 3GJ0A 1KOFA 1D5CA 1SXJA 1YQTA 2PLFA 2PX3A 2QPOA 2ZI6A 1QHXA 3AF0A 3HJNA 5DIFA 1GL7A 5DYGA 4G5OA 4RZXA 3QJYA 2PT5A 1NLYA 1EFRA 5L3RA 5ANRB 4H1UA 5C4GB 3T5DA 5GADl 3FOZA 4QHYA 3K9HA 5AJVB 3LXRA 2DYKA 4IFEA 5KSOA 4OK3A 2PMDA 2FOLA 1IY1A 3PQCA 4K81B 4XVQA 1RE0A 2R6GA 4D26A 1AKEA 2X2FA 1PLLA 4XWAA 3O8RA 1FTSA 4OHVA 1ZW6A 1ZIPA 1P2UA 1T3LA 1B0UA 2IWHA 3L0OA 4HSEA 4BEBA 5KU1A 2KWIA 3VNUA 2E87A 4YLGA 1V43A 5DISB 1XD2A 3QVVA 4I4LA 3E5HA 1WB9A 1R5NA 2DPXA 1NP6A 3AKDA 2QSYA 2RGNA 3DOFA 3M6AA 1UBFA 2ERXA 1XZPA 2NPFA 1E1QD 2OT3B 1XNJA 2QGZA 1ZU5A 4MRPA 3FMIA 4RZUA 3ADKA 4ZKDA 1OXXK 4DVGA 1YRAA 2I3BA 3ONWA 3Q5DA 2GZDA 3AH8A 5JHHB 1WBDA 3KJEA 3I8XA 5EXXA 4TYWA 1ZM2A 5DYIA 1N6KA 1OYWA 3ASZA 1YJ5A 4U00A 1MO5A 1N2CE 2WIAA 4RKEA 4MYTA 3U2QA 4JS0A 1SHKA 5FUVA 1ZJ6A 2BWJA 1N6HA 1FOEB 5FPKA 1US8A 2JDID 4FN5A 2FEOA 2VBCA 3FWYA 5TXGA 4P4UA 4LWZA 4YMVA 2JIZD 3UG7A 4G5GA 2XNDA 1IJFA 2WHXA 4BPBA 4XD7D 1X8LA 3EWAA 5G3YA 4ABYA 3I92A 2UZ3A 2X1VA 4V0MA 2ZRGA 5BN3A 1BMFA 1WP9A 3SDZA 4PC3A 3VNVA 1JPNA 1UKYA 3OFND 1LNZA 3W34A 2HXSA 4YMSA 4Q1DA 2HEIA 5FBRB 1XJ0A 3VX4A 1XCPA 3QUSA 1E2EA 1BKDR 3JVVA 1RPZA 2GXUA 4UNQA 1E98A 1JR6A 4TZ0A 2IHYA 3ZDQA 1LV7A 1P4SA 3OIYA 3DZDA 4ZIRB 1JPJA 1NN1A 2H1LA 2ATXA 1R0ZA 2N42A 5LBIA 4NH0A 4EUNA 4C30A 2GNOA 2WWYA 1KI2A 3M1IA 5AJXA 3SQXA 4Q00A 1OV4A 5CDFE 4U5XA 1Z0KA 3PEUA 4JIMA 2D3WA 1ZM9A 3I72A 2D06A 3K9GA 5FTJA 3EC2A 1R8SA 1R2QA 4J0QA 5JWHA 2VP6A 3HPQA 2B8TA 4RFSA 5SZIA 4YMTA 4LZZA 3UMSA 2F43B 1AZSC 5EP3A 3CX6A 2CLDX 3CX7A 4WAUA 1G5PA 1JEDA 1U8YA 2QMUA 3CF2A 4LDJA 1QDEA 2ZM5A 3EX7C 1XTJA 2RKOA 3AEZA 3U6BA 4BGDA 1XMIA 2YC2C 2QEQA 1F5NA 5HCNA 4D6PA 1CP2A 3AP3A 2CXXA 3FPAA 1W0KA 2HT6A 4A36A 4Q4LA 2J0UB 3B9PA 1Z63A 1KY2A 3GLHB 2R44A 1Q3TA 2DB3A 1KTVA 2LKDA 1JJVA 5A0FA 1ZM4A 2WKRA 4OK6A 3ZQJA 1GTVA 3SYKA 5EZ5A 3SU8A 1E2KA 1XJCA 4X8MA 2AWNA 1TF2A 3EZ6A 3H2YA 3SJCA 1Q44A 4JZKA 3AKCA 1XTSA 4RD0A 2IUSA 1T5IA 3CNNA 1KMHB 4O2RA 4PHGA 1OE0A 1KI8A 3SR0A 1DAEA 4HZIA 4F91B 4PQFA 1AQUA 3R9IA 2GXAA 2C03A 4RSGA 5BYJA 4CRWB 5BN4A 1XXHB 2O0JA 1XCGB 2GEVA 1IM2A 4OI0A 2V7QA 4M0LA 1WQ1R 4NP6A 2QAGC 4PQRA 2AKYA 5KTYA 3O8DA 5LPNA 4TQUS 1QHIA 2LCFA 3L0IB 2VSFA 4UXHA 1FZQA 3UWOA 1R4AA 4IOMA 1OLOA 1Z6YA 2Q3MA 2GTPA 2PBRA 1N25A 1TF5A 3AV0B 2UVQA 1XD8A 3TQCA 2B7CA 4JSTA 4X8LA 3KXLA 2ZRIA 4YQFA 2VIIA 4GBMA 4BQSA 1OKKA 1T91A 2ZYTX 5IK2A 1E0SA 2OILA 5JZVA 3FKQA 4NONA 4C0QC 1RRGA 5BXQC 2BMEA 3RC8A 3TAUA 3T35A 5HR5A 2VPPA 1G8YA 4GL2A 3GJ7A 1N5IA 4GMDA 4LBYA 1P7CA 4DDTA 1SGWA 3B1ZA 3AKYA 1O87A 3OEHD 3PITA 4HAUA 5K8LA 3TSZA 1VIYA 2KE5A 4GOXA 1VCOA 4JL8A 1E94E 3CZPA 1HT1E 1UEJA 1OIVA 3FFAA 3C41J 4LC1A 1YKSA 1HH4A 1G5RA 3UATA 3K09A 4GPTA 3DOEA 1E0KA 1G17A 3U44A 3KKMA 4JJKA 2YWFA 5H8WA 4V0ME 2WKPA 4JYBA 3A58B 4QBGB 4JLOA 5BWMA 3U44B 5JSZB 2ODWA 3AF1A 4TMTA 2IC5A 1KSGA 3GLIE 2JJ2A 1BS1A 1W46A 4Q7JB 4HAXA 1A5TA 1Q1BA 2RGBA 2C2HA 3N5CA 3OE7D 4MH0R 2W6IA 2EWVA 1RYFA 3BORA 4PC1A 2ZJ8A 3MAAC 1ELOA 4QNRA 3L0SA 5TY0A 3T15A 2BMJA 1IQPA 2P65A 3PXGA 1SKQA 1VG9B 2ZJBA 2JAQA 4PANA 5E7JA 3OEED 4WA7A 3PUWA 3HDTA 2WJJA 4QKQA 4HLCA 1R7RA 4ZDWA 3BJIC 1NBME 4I1UA 2FMXA 1AN0A 1UDXA 3EA5A 5F98A 1YZKA 5HKKD 3VQTA 4TYNA 421PA 3MLEA 1N6OA 2Z6VA 4BFZA 5JRZA 4L9WA 4IOLA 2HCJB 4NYJQ 1IJEA 4PHTA 4DXAA 3VTKA 2FSFA 3BH7A 4PPQA 3RVBA 2ZYVX 5JI2E 1KYIA 3DPUA 3NBYC 3RNLA 5HTKA 2QBYB 1Z6TA 2QMHA 3U3KA 4DDVA 1HQYE 3C5HA 4V0LA 1HA3A 4A6XA 5AUNB 3D7MA 2JJ1D 5EP1A 5EZ6B 1ZNXA 4RZ3A 2C5LA 2D74A 4B2PA 5A5GA 4IOJA 3MCAA 1CS4C 4MYCA 2KSQA 1E2JA 5H70A 3WBKA 2EWWA 4LBZA 2ZE7A 5L3QA 1R0WA 4OYHA 1KDRA 1R8QA 2ECKA 5DO9A 3NWJA 4IDPA 1N5KA 1QHHA 2DHRA 4OHZA 4Z54A 1W5SA 2BM1A 2GJ9A 5KNDA 2QI9C 1IN8A 3VHLB 2R65A 5JECA 2QL6A 4LUCA 2OBMA 2R9VA 3R7WB 2IHBA 4B2IA 1Q57A 2J9RA 4D2IA 3FKSD 1B23P 4QFMA 5CIWA 1YE8A 2D2FA 3LDAA 1J8YF 2ZS9A 4EQ6A 5IHPA 3K8YA 3B82A 1A1VA 2GBLC 5FR1A 3VAAA 1CRPA 4BFTA 2C9YA 2O8FB 2PZEA 2IL1A 5DI3A 1CJMA 2HJVA 1KI6B 1XDBA 1YZGA 3NBFA 5J47A 1NMYA 2WOJA 3KQKA 2FEMA 2V8OA 4LJ8A 2BOVA 3QKTA 2P67A 5F9FA 2NQ2C 1N6NA 2G88A 1YRBA 2IYZA 2V9PA 2WKQA 2ZRJA 5E7MA 3RSOA 3K70D 2XOKD 3CM0A 3IO5A 4EJSA 2GZHA 3IPXA 4LHYA 4FMDF 1ZD1A 2ZRNA 1GL9B 1T9HA 4EPRA 4M1MA 3RS7A 4M21A 3U5ZB 3CX8A 4C0SA 1U98A 1OYYA 1QVRA 1HY3A 1ZYUA 3QKUA 4OI4A 1RC8A 2YJTD 1E9AA 5BQ5A 1P2TA 3DEFA 1S0UA 4Q1CA 2IW3A 3AP2A 4AKHA 3WNCA 5KNCA 1BYUA 4AK9A 4LV5B 3THWB 4YONB 5G40A 2F1IA 3BS4A 3I3SR 1Z8FA 4TT3A 1C4OA 1TQ6A 4ARZA 1K5DA 3PG5A 1KDOA 2JLVA 4IEEA 5HPYB 4AG5A 1TNDA 1DARA 3TSOA 4B32A 4XSHA 3QKRB 3WYGA 5KYKA 4Y0AA 1RZ3A 3LA6A 4M53A 1NVXQ 1II8A 1P3JA 3P20A 3PFIA 2IYVA 5JCZA 1M74A 3T1TA
chains in the Genus database with same CATH superfamily
2DY1A 4JH0A 2LDBA 3BGIA 4KQKA 2EYUA 3RS5A 4AZ0A 4F3RA 1YS4A 1B41A 1MGPA 1E3QA 1U4NA 1UKZA 3FVQA 1HG0A 4B6FA 5A3SA 2XW6A 4R1LA 2QD2A 3KKNA 4FFMA 4H7FA 2ZXFA 4GXRA 3GLIA 3ZY5A 3KKQA 1ZMRA 5D2CA 4V0KA 4I08A 4EA8A 3E22B 2YV3A 1LI4A 1SKYE 1HDRA 2IPOA 4B74A 3JD0A 1C8VB 3GVIA 4ES6A 3HWRA 4TPKA 3EISA 4KQEA 3ZHXA 3W2GA 1IWOA 3VYRB 4L8GA 1NSYA 1O3YA 5IKMA 1TD9A 3K0KA 3KE9A 2NU8A 1WZUA 4X8OA 1OH8A 3WLJA 2XTAA 5HUQA 1J39A 5DTMA 4CWAA 5C35A 4EQ6B 2OY0A 1HK7A 2YWBA 3E2MA 3H2KA 2OOSA 3N8NA 4H7PA 4E13A 3CLVA 3JQEA 4OLHA 3JAMA 2A6PA 3TRKA 1EGAA 5AXAA 5J4VA 1G2PA 2IXGA 1XEWX 3IB3A 4A1OA 3NBUA 3JSXA 1SZJG 2ZJYA 4WHMA 2PGAA 2ORIA 2DY0A 2XAUA 5H82A 2P77A 3V2GA 1P5FA 1VHTA 3DXXA 3RFXA 1U94A 4HQ6A 3VPSA 2DWUA 3M6MD 2CXNA 4FCWA 2JGDA 1A9QA 1T2NA 1OX4B 2H0QA 2V03A 3LYHA 4N12A 1PD1A 4QLBA 1GQQA 1TTPB 3IODA 3E0QA 2ISSD 5DSZA 1A8HA 2OLJA 2JAOA 3GZNB 1E66A 3H0KA 2XZPA 5KI6A 4WKGA 1T1SA 2O19A 1Q1EA 1VPEA 2BFCA 4KUGA 1KK1A 3VR6D 3VKVA 1FYDA 1UP7A 2B5VA 3QELA 1OAKA 4N0PA 1TKRA 1Y6QA 1W5BA 3L9WA 3SC2B 2IYSA 5EKUA 2GDZA 1D6JA 4TYYA 1RP1A 4YC7A 3AT1A 5ELMA 4LFCB 4BYGA 3WNZA 4EF4A 1IATA 4TSKA 1YS1X 3K6KA 2VJMB 3QKWA 1DQYA 4X85A 3V4RA 1HT2E 3D1JA 3E9NA 2RHMA 3RM3A 3WRYC 4DLNA 1KZ1A 5HZKA 3PF8A 3GB9A 4QASA 4V3BA 1ZGBA 4X45A 5ALIA 2DR2A 1JTFA 3ZBUA 1Z73A 2QE7A 3NHFA 2ANBA 2QZ9A 4IHJB 5ILQA 3CPEA 3AFNA 2H5JA 4BNFA 3OZSA 5MGBA 3DB2A 4BB9A 2WZBA 4HMOA 1UAAA 2BFDB 4QAJA 4G0NA 4YA6A 5G4KA 1H0KA 1YR3A 2OMEA 2CL5A 2VP9A 1XPJA 4IDQA 2I6FA 4YPOA 5JPCA 1Z4MA 2C9MA 2O2HA 2PKEA 4FEAA 4KLZA 4LCJA 4OBXA 1JQBA 2EF0A 3DTVB 5J1TB 4JHLA 3N1UA 3A9UA 1SURA 2UVDA 2CK3A 2XJ9A 3P32A 4NCNA 2QJFA 5FQNA 4IVPA 2P2ZA 2WWVD 4GMGA 3GCGA 4XWOA 4IW3B 2I9KA 3KE8A 3UKDA 3BMQA 4PAMA 1LY1A 1EUDA 1B3BA 1KH3A 1G7RA 2ZSEA 3F6RA 2FWRA 2HI0A 3LCJA 3L6DA 4FSDA 1YA6A 1ZEJA 5L40A 5JMOA 1A98A 1KZGB 4BNNA 4Q3NA 4EZIA 3RGGA 1I4DD 3UYLA 2CXTA 4ZT7A 1AO0A 3TZKA 2Z2JA 2QM0A 4KIWA 1JV2B 4MVJP 3RK0A 1QTRA 2FSGA 5JRDS 4BLTA 3HUEA 1QZXA 5JYEA 4GYJA 1DFGA 1Z2NX 4NBKA 1J70A 3AI2A 2AV6A 5AI0A 3X2FA 3W5BA 3GBPA 5L4NA 1O6BA 1NQ5A 1XYVA 2V45A 3WQBA 2UYYA 4PLTA 3GDFA 1IMJA 3VNRA 5C18A 3IAXA 1DP4A 1UBOS 1X3LA 3VR3D 2I7XA 2ZIUB 4CEJB 2W58A 3I01A 1WW3A 4ITUA 1O03A 1TE2A 2O14A 4RGYA 3SD7A 3VGPA 3M6LA 5E1MA 2GN2A 5L6MB 2H1SA 1X1EA 1RI3A 4WADA 2V9CA 1W76A 3CLRC 3HRIA 4BV3A 3WB9A 1QVAA 2NSLA 4I3GA 4WOCA 1KK0A 1GY8A 3TPZA 1ZJWA 1XAJA 2OWEA 4MUMA 3IVCA 4INPA 4UUOA 3FI0A 3RYCB 1PDVA 4E5KA 2NQTA 5DX8A 5HUJA 3QHPA 3W5DA 3R4CA 2Q9AA 1N1DA 3L43A 2HRBA 1YACA 4BASA 3P71T 3AR9A 2O2ZA 3L4JA 1K6MA 1KORA 1G8PA 1Q7CA 2YY7A 4KO3S 5ADWA 2V6MA 4B3GA 4YP5A 3LY7A 1TA4A 2J7KA 3KZVA 4YGXB 4TSFA 3AETB 3CLHA 1VL5A 1PT9A 4GWLA 2DR0A 1WMBA 2O8EA 3MTDA 4ER5A 1IXRC 4M86A 2MSEB 4ZHQB 2WIFA 4CLEA 4Q1BA 1DCFA 1CR0A 1EFHA 1LKZA 2XTJA 2RGNC 3IQFA 4CQMA 2ZTVA 3NEJA 2A9KA 4NYJR 4OFBA 1IEQA 3W9UA 5CFLA 1ZCFA 2IY9A 2IP1A 3BDAA 3GQBA 4KDEA 2HNBA 4A6DA 4CMEA 5ADUS 1MUUA 5K6AC 2VDUE 5A02A 3N8KA 1ZDMA 3AERB 4I36A 3OTIA 1YJAA 3G13A 1CVLA 4A16A 2I1VB 4DSUA 5JAPA 3HO1A 1S1CA 1XIVA 4P38A 4RHCA 4RQTA 4FTWA 4PTLA 4EG1A 3PC2A 3TRIA 1SQ6A 4RNDB 1L5OA 1BWRA 2A5GA 2IKQA 5SZHB 2OV3A 3MWKA 3TQIA 4WV3A 3RIXA 1HOXA 4JL6A 4BE7B 1N0WA 5TV2A 2H6EA 4E5DA 2Q49A 4QSMA 1OLSA 2BGWA 5A9RA 1NU6A 2GF9A 3H2ZA 4XRGA 1SXQA 3A6HA 4FFPA 4PLCA 3WJ7A 1GGFA 3R5JA 2ZYDA 4FP9A 3A2NA 3L9XA 5D3QA 2WU4A 1PFYA 3AEXA 3BT7A 5BVGB 4QJIA 4YRKA 3RYHB 4RF4A 3UYKA 1SBQA 3RFCA 3UUEA 2G7MC 3P2MA 4RK5A 2ZBEA 1K7FB 3IUQA 5TJ9A 1ZR4A 1CJUC 2I2WA 3NNNA 1A5AB 3CW9A 1JIQA 4P3XA 4X1YB 2WU8A 5MFPA 5KWSA 2ZK7A 1N5LA 3HKCB 1RACA 5BSKA 3KQLA 2D2EA 4HO1X 1RAHA 3ROGA 4EWLA 4QDKA 1UXOA 4UNPA 4UTRA 1BDBA 2II6A 5D3MB 1B0ZA 2H52A 3BWXA 3FYHA 4GE0A 4TM7A 5L6LB 1Z2PX 3D6HA 2JJ8A 2AFRA 1DEAA 3QLJA 1SUAA 2DHEA 3LAWA 2IS2A 1XMXA 5AYVA 2DWQA 3TUZC 3ESYA 1B1AA 2H0RA 2W8BB 2A5YB 4ND7A 1A7JA 2QWXA 4X6UA 3ZLVA 4JI4B 3QPWA 3PNLA 1EWVA 1VE3A 2C4KA 3KX2A 3SS9X 3AHGA 1XELA 2WINI 1BQ4A 3KELA 1CJSA 3NEAA 3BGWA 3EVZA 5IC6A 3ZGXA 1OBHA 4WCFB 1YVPA 1UMBB 3M3HA 4FU0A 4FINA 1WXIA 4G86A 3GZTB 5DBFA 2F3QA 2V7EA 2J9XB 4HQLA 3K9BA 4FGZA 3G7UA 4J0CA 4JCOA 2QVYX 2BEVB 1RS0A 3QI7A 4UC0A 1DAHA 1OFGA 2Y0BA 4WKCA 3KQUA 2F6RA 1IB6A 4KIGA 4AJKA 5E2BA 4RMJA 1XJWA 2R85A 2OMKA 3KZ1E 4KIFA 3IMKA 5AVRA 4BBJA 4OXRA 1Z0DA 4BIIA 1R4MB 5GQSA 3UJHA 2FN9A 1UBKS 1YZYA 3FOAA 3WIOA 4MYSA 1CE8A 2VNAA 3FNFA 5I7EA 3RR2A 1G3UA 5BMVA 3HFRA 1P72A 1RQXA 4ARUA 2O3TA 5CRIA 1P18A 3TDKA 5EXPA 3VKUA 3AVWA 1QGDA 2HO5A 3K0CA 5IWCA 1BCRB 5JZOA 4ZQFA 2CUNA 1GFWA 3U39A 1SXJC 2BKXA 4XX0B 3K6SB 4CR8A 4G24A 1P7ZA 5DGCA 3HGMA 2WHQA 5F7OA 3ZVLA 4CF3A 5D5HA 1XDWA 5IJ0B 3EGDB 1U8EA 2PQ2A 3LD9A 1ESZA 1VE9A 3ZU6A 4Q4AA 4BX3A 2X8JB 4J1NA 1LLUA 3MAGA 4J7XA 4MV7A 5FEUA 2VAVA 1F7VA 3KG2A 3D7KA 2TMGA 3OEYA 3FCYA 4JI3B 1O95A 1QFXA 2V54A 4ND1A 1L7AA 3I9MA 3JASB 3BFKA 2P35A 1HEUA 4ENSA 3NYQA 2C2WA 1BXRB 4R1UA 4BKPA 4TYPA 4JBWA 2JRCA 4WZBE 2RI1A 3SBXA 5K03A 3ZKWB 5EE5B 3RBAA 2ISQA 2JGAA 3HBNA 1G3MA 4BDSA 2ZRQA 3PNBA 4EENA 4BNIA 5ESDA 3I32A 4WDRA 1QE3A 2YCBA 3NYRA 4LQCA 3DEZA 2Q3LA 2XWSA 3IUYA 1KI4A 4DR7B 2GEBA 3H1FA 1ONOA 1JNYA 4L4SA 4ALLA 1EA7A 4DSTA 3ENZA 1H8HA 1TZKA 3K5PA 3K8ZA 4AYXA 4H7KA 4MIKA 3ZDYB 1ESMA 2FRXA 2D1SA 1V1JA 5LNK1 4CFZA 3PLNA 4XLZA 4C2TA 3LK7A 2Q0SA 1XD9A 2PKQO 3H04A 1P5ZB 2CYAA 2GEFA 2Q2QA 3MK31 2VNSA 4N6OA 2NW6A 3SE7A 3BN3A 4GICA 4HY3A 1UBSB 2W48A 4MP6A 3U3OA 1L7PA 4FYKA 3IQEA 1DKRA 1XXHE 1XZQA 4DWJA 2H7YA 5CMLA 4EG5A 1A2OA 4KWEA 1NVAA 3OESA 1YJ8A 4I5FA 3U7IA 1LC0A 4CTNA 3QW4B 1D4OA 4IHJF 4MAAA 4ZYUA 5HJ5A 1BX0A 1FQOA 1VKHA 2XVZA 4R2MA 1P0IA 1F38A 3L0YA 2QY9A 4C6RA 1E9RA 3FX2A 3EFOB 1O8BA 3P0EA 2LBPA 2X4GA 3ELWA 4L75A 3UAWA 7REQA 4W5TA 4NCHA 4DB2A 1N2IA 1UQRA 2V7XA 1T43A 2ZJAA 3HP4A 4R51A 2JATA 4R8KA 1R0SA 2G28A 1K97A 1EUCA 3D54D 3AQIA 4GQBA 4QDJA 4TVBA 4ZAVA 3ZCRA 1ADGA 3SICE 4MDFA 1PJQA 3H65A 5J4HA 1P3DA 1XRRA 4I5DA 4JDUA 3FTEA 2X9GA 5DLYA 1VRWA 1D4FA 2FW8A 1T1EA 2FFJA 2EKQA 3JQ9C 1E2IA 1RIFA 1IZZA 3R3WA 1MQ9A 1QOPB 1CWUA 3B13B 1AIPA 1W6RA 2PD3A 1C0PA 2BSXA 3MXTA 4FMCF 4UCWA 5GZ6A 1ZGGA 4TTRA 4A82A 1XWIA 1CY7A 2HGSA 2PU5A 2ZVPX 2XWJI 1C1YA 5G1PA 1F0YA 1I30A 4BRWA 3TLXA 1P1FA 4HDAA 3ZGNA 1Q7RA 4XKJA 4NATA 4ZJUA 1H8EA 3OU2A 1L5HA 3UJPA 1RWOA 16PKA 2XEXA 2CVHA 2Q5LA 3E7FA 1TOAA 3EPPA 4IRUB 1M3SA 4U7WA 4LNAA 3DZ8A 1EP1B 2Z04A 3OFKA 3VBEA 5CG2A 2B25A 1H6BA 1P19A 1KVQA 4L28A 4Q19A 3T7SA 1RYMA 4C0KA 3AVXA 4OLAA 4ZWNA 1ZVQA 1C7ZA 1E2UA 1X70A 1RWQA 1E1RA 1C2TA 1J9EA 1ZRNA 3O1LA 3C1AA 4WKPA 4WKOA 1BCRA 3ITDA 3NCHA 4BLRA 1KK2A 2V4UA 1SIUA 3I6MA 1UOEA 3L6RA 2X6RA 3P0HA 4FMDB 4IZIA 4XJSA 1MO3A 2FFBA 2JLQA 2XGMA 4RIHA 1AA9A 2IYAA 1ODFA 1J24A 1BDHA 4J8PA 5AJTA 3SYMA 4BO4A 1DXQA 2ORVA 2WYWA 2QNIA 3GLHA 4NESA 5F7XA 3HDGA 3TCXB 2OBLA 2FCRA 5B7PA 3R76A 4S1OA 2ZE5A 4UBIA 1UKAA 4PX5A 3HDQA 2WFZA 1MW8X 1WUJS 2QV0A 2BYTA 1Y7HA 3AP1A 1XWWA 4PZPA 4TKUA 4M8LA 4LY3A 5A5DA 3AJAA 4EA6A 4YJFB 5B3LA 1RYBA 1VHQA 5TPZA 3VSAA 1GRNA 1T9GR 4Y6LA 3I39X 1I5RA 1RJWA 1IEWA 3VR5A 2WQ6A 2ZCJA 1CRZA 1EAYA 2GAFA 3LT1A 1P5HA 3DMNA 3BSFA 1KC1A 3O0DA 2Z08A 4NZNA 4RKWA 4C9BA 3CUEF 4GNRA 2HA5A 1MJHA 2HLPA 3LT2A 1WCYA 1V4NA 1FDVA 1SNYA 1U9IA 2YIDA 4HLQB 4EJMA 2ZS8A 3BD7A 3D6TB 4CV3A 2ZDGA 1W4CA 4M7PA 3WMEA 3FOFC 1O6GA 3IPYA 4M9SA 3ETCA 3PENA 3HWSA 2NTEA 3GEGA 3MMPA 4QXQA 3ESAA 1KERA 3TVDA 4YBRA 2PGDA 5F5XA 3ZWAA 3K53A 4F71A 4WSOA 1ZCAA 4FMPA 4U63A 4QSHA 1DJLA 2EWMA 4UUNA 1X7DA 2BM0A 1QDUA 4Z2YA 1KQGA 4FHEA 1FL9A 2OFOA 3CNQS 1ZBDA 2WKSA 3LXMA 1KIFA 3VHXA 4CHTA 5AW3A 4KR2A 1DKLA 2A5FA 3DHEA 4MW5A 2JFZA 2QP4A 3D6AA 1U6KA 3NU1A 4RVDA 3SOZA 3ZU3A 1X3SA 3RYHA 1N2CA 4MO2A 3BQNB 5DASA 3UUFA 3P8ZA 2D1QA 3F3KA 3ZD9A 1LDYA 3Q3GE 4FGJA 3SCZA 1WUIS 1EVLA 5FNVF 3Q3IA 4E1AA 1JA1A 3EGXA 5E0KB 3KCQA 2GLUA 4K88A 5ALTA 1VTKA 2E49A 2FW7A 4ZV9A 3DH0A 4LA4A 4XVRA 2QRPA 4F9FA 2XCSB 4HQKA 3TG8A 3SHTA 2V0CA 2A0UA 2AOUB 2WPDD 5JCOA 4WOKA 1U0EA 5HFAA 2O6LA 5FTWA 4I1YA 3ZHYA 4GI7A 2G9VA 2R8XA 1A2BA 4NENA 3RSGA 4DJJA 4EBBA 5JQGA 4NFHA 4OQYA 4P4TA 2C8KA 5MHTA 4R05A 6Q21A 3DKRA 1GT91 4Q5IA 4PC2A 4LGVA 3EZYA 1DLJA 4CKWB 2VK2A 4IUCS 3D4NA 3QI2A 4HUJA 5TC4A 1EVJA 4D96A 4W5OA 4J2HA 4LRWA 1XNRB 3WKEA 3A1SA 3GOQA 1SIOA 3GJXC 4LQDA 1PHPA 3DDNA 2C7QA 4PQYA 1P9LA 3AEKB 5KWVA 3BG5A 5BMVF 4DFDA 1E4OA 4IGKA 1P1BA 5A3QA 5C5IA 3HKEA 2F55A 5CITA 1VDMA 3CXUA 1X7YB 1ILWA 1D6SA 1I2DA 2A1TR 3N8HA 1FVXA 4NJMB 5CA0F 3IE1A 4XASA 2EQ5A 3HB9A 3V9PA 1HMYA 3KT3A 1KU0A 3OPVA 1C7FA 3DBHB 2E5LB 3VV2A 5CJ2A 4IDDA 1CUYA 5LQSA 2FMIA 1KPHA 4Z2AA 3Q3JB 2PUFA 1KEEB 1N4DA 4ITVA 4CDGA 4DIEA 2ON6A 2BY4A 3RGWS 3M4ZA 1DEXA 3ES9A 4HKTA 4K46A 5A62A 2BEUB 5AKXA 2WRZA 2WD8A 4W1PA 3EMBA 4S1WA 1VLMA 4BVLA 3ASVA 1LS6A 1ZJ5A 2HD4A 4RPJA 5EWLA 2V8BA 4UBMA 1GGHA 2G8LA 5JQWA 1NQXA 4HPJB 1UFQA 2C4HA 2PRYA 3BQ9A 4IRMA 1FFYA 4EY5A 1WX1A 2GCNA 1QTQA 3LX8A 3KUUA 4E70A 3H19A 4N7JA 4YMWA 1OZFA 2UZIR 5IXYA 3CW2A 3KZNA 4F4UA 4BUZA 4JBHA 4MQUA 3K70B 3BH0A 3UK7A 3ESXA 1OZ0A 1F4PA 1N2JA 2EERA 1M8JA 2R60A 4YROA 4EVRA 3BWVA 5IS2A 3KFVA 3CX3A 3K6RA 3SKVA 2QIPA 1DQZA 4QM7A 2DH5A 2V5VA 3STVA 3KOXA 4B46A 4JVOA 1GUBA 4AULA 1G0OA 1IHUA 2F1KA 1H69A 2ZTUA 1WD7A 2PR7A 5ECDA 1T8PA 1ANKA 3TZ6A 4A23A 4R83A 3OQNA 4TVSA 1D0VA 1G21A 3SVLA 1MPXA 4C7XA 1QB8A 1XPRA 4Z53A 1XOIA 1Z47A 2C0PA 3BE4A 3VFDA 2L42A 1UKBA 5AHWA 2OXEA 3PE3A 2BEJA 2D7DA 2FZGA 2O2XA 4LHSA 2G5PA 3O5AA 4MTLA 1PQYA 4PGMA 1GR1A 4QARA 3WGQA 1XTKA 2NUBA 1CR1A 4BE9A 3GLFB 2CUZA 4IDEA 4XR4A 3EZFA 1ND5A 1J1ZA 1HZJA 4NFYA 2ASEA 4WCVA 4GVPA 3NNDA 4K86A 3O2SB 1W4RA 2R2GA 2GYVA 4BNLA 2I1QA 1S8OA 2P40A 3JZMA 1GOTA 3QF7A 1W4AA 1LPNA 3KB1A 3AU8A 2K4MA 1D1PA 1GPWB 2PTGA 1E62A 4R69A 521PA 5K8JB 1F2TB 1UFOA 5IJXA 3KQPA 1YZNA 4UMEA 1RXSA 3GLQA 3T5MA 1I2ZA 2GD1O 2QQ0A 3EIWA 3HB4X 1K86A 1RYEA 2G1PA 2FUKA 3E27A 4CVNA 3V55A 3WGKA 4XVUA 3CZCA 3HSYA 3OPMA 4ZK2A 2ECPA 1Y98A 2ZSJA 3HCCA 4LXUA 4YY3B 1MENA 4TXJA 4NIMA 1TI7A 1XZJA 2CXUA 2VNKA 5A2GA 4PRYA 3V8EA 2JLBA 5I7AA 2GCGA 3AR6A 5JNWA 2E4VA 5IAJA 2VSQA 1TC1A 2OSVA 3DV0B 1JHXA 4FQ7A 3NDPA 4ZZ1A 5AW7A 3L1IA 4FVTA 3WA6A 4IH9A 3HU3A 4WZBA 3QJGA 4L07A 2PZ8A 3LPLA 2P3QA 4BRUA 1L3IA 2O8CA 2RAVA 4J2TA 4KQIA 4JQZA 2J5BA 2YIVX 4DBLE 1XI2A 4LEIA 4MUGA 3HJHA 5CXXA 5FADA 2XB2A 1Z8DA 3JU3A 1C0KA 2WF5A 1S3IA 3IOBA 1O95C 2GX6A 4PZLA 2VL7A 1V7ZA 4BJ3A 3H5LA 3Q7TA 5E9WA 3CLSD 1FJXA 1GNSA 1XDUA 4OCZA 2AK2A 4MVYA 4EHDA 4D3YA 2P9GA 1JVBA 1JI0A 2PAAA 1RIIA 2JVKA 4GUAA 3TR0A 4GKAA 3BMOA 1C0EA 2H16A 4TZTA 4XX1A 4E5VA 3DEIA 1MOSA 2CXPA 4BMXA 3FCEA 1T9BA 2FA9A 4PRKA 2P30A 3L1UA 3H4MA 1KHHA 4FYIA 4F9TA 4C29A 5K99A 4UHHA 2PIAA 5A9TA 2P5YA 4ARZB 1ZK1A 4DCPA 1JHPA 4NFSA 5HQTA 4IH4A 2EIHA 2QG4A 3NIGB 3H8VA 3QVSA 4BUJA 1DWUA 1XZIA 3CPHA 5GPBA 4GI5A 4G0XA 5J5VA 5FBZA 2Q5IA 2RKBA 4R2XA 3FOBA 4CW7A 1HSZA 1QP0A 3IL2A 1QMPA 1HO3A 4J7UA 1YMVA 1O58A 1XO1A 2QJRA 3FFWA 2RIPA 1KEEA 2XGOA 4DPKA 2G6TA 3RLFA 2YWHA 2X7JA 2EHDA 1P2GA 2W2NA 5IX8A 2CLCX 4CKBB 3S1AA 2SCUB 3JTMA 1DQPA 1DBRA 3C3XA 4UJ5A 1Y1QA 4O2AF 4I81A 2YQZA 4XIFA 1IY0A 3X1XA 4DYVA 1E2QA 1Z2DA 4KIUA 3U56A 4RCYA 1VIMA 5LSAA 1E0JA 3DMHA 4UPVA 5HHTA 1IN1A 3PKZA 1Z06A 4X24A 5H9WA 3HDHA 4DC9A 1P33A 5HF5A 1Z5WA 2B4YA 4HAVA 1TK9A 2X0FA 3NHYA 5IJAA 1BGVA 1TTHA 3IUPA 1V16B 2DFKB 4EUHA 4IBOA 2HYDA 5A04A 2WWIA 4MV6A 2ZRFA 2QQFA 4GKVA 3ZNNA 4F04A 2QTNA 5M2QA 4YQZA 1DI0A 4CKWA 4JUAA 4HRAA 1A69A 1Q2XA 2PA3A 4CMIA 4ZT2A 1M6HA 5JARA 1T1IA 3W7AA 1S8AA 2YL2A 1BOFA 5J58A 4PINA 2W6QA 1K5GA 2GTIA 4JR2A 3KSAC 4MKXA 5CB4B 3QXSA 3WSWA 4WOPA 4GWGA 5FPSA 3OQ6A 1Y81A 1S9HA 4CGZA 1ENOA 2O5VA 1OFVA 4XGQA 4XSVA 4YP6A 1ABBA 3HO8A 4O08A 4YX9A 3HJGA 3PTLA 3CVYA 3GLHE 1NVVR 3FHCB 3OOYA 5CH3A 5DXAA 1S1MA 2F1OA 2PX6A 3WX0A 1F8UA 2FY8A 4RVGA 4F5YA 2A0WA 2NUAB 3P0RA 2YHSA 1G8GA 4TXNA 3KAQA 3G0BA 2IW1A 5JMWA 4LF9B 2Q2NA 3HCEA 5JD4A 3S5JA 2BFEA 4YRFA 5A05A 3D4PA 1M1UA 1QGED 1XTUA 2FJPA 1Z15A 2WK1A 2X8BA 4L6CA 1PWHA 5EKSA 5L53A 1GPJA 3FLAA 3TGPA 3DCJA 2GF2A 1H2YA 1I7LA 4IHQA 1USGA 3LVRE 4NVRA 1U90A 1PI3A 4V02A 3UT6A 4XYGA 2IX9A 3SP1A 1PW7A 4HX9A 3L7BA 1KEVA 4UASA 3G2HA 2IUUA 2AC7A 1ZVMA 3HYNA 4J0JA 2BHRA 5AWFC 4Q7MB 3DHWC 1EG7A 4XD2A 1CQPA 5ITSA 3AUUA 1OCEA 2Z43A 3C3JA 3R5SA 4RPHA 1Y6RA 1CQIB 3EFHA 4I1OA 5TRTA 3DS8A 3W6NA 4XZ3A 3UJNA 4ESVA 3GJ6A 4WXPA 1FMLA 4QUAA 1A97A 1FFWA 2Z5GA 1E2BA 2EF1A 5D1HA 4G5RA 1YC5A 2IZ7A 2QY6A 3SHFA 1E2DA 2FDCA 3O2NA 3EEBA 4FZ5A 4AJ1A 2QAGB 3GEHA 4W5JA 2ZU0C 3F6PA 3K05A 3VYUB 1G16A 4KDCA 4UHEA 5E9JA 4MCAA 4UPDA 3LCVB 1J8MF 3HHPA 3QBVA 1I7QB 4C2UA 3TIFA 1GPBA 4WX2B 3W5CA 2K2WA 3R44A 3IGFA 1G4UR 4ND8B 3LDFA 4NHEA 3VYVA 3QOXA 2IYPA 1AKUA 2A9PA 1YULA 3QPVA 2EFGA 4JK3A 3LP5A 3K6JA 1RWPA 5M29A 3D1VA 3WLLA 4K9KA 2BGLA 4RVFA 3LVFO 1E0DA 2BHTA 1HE3A 3OT5A 4MRVA 3BHJA 5IJWA 2F4VB 4YV2A 1JQ5A 3WLHA 1CUBA 1JIVA 1Q3KA 2VJQA 3VZPA 4DR6B 2VHTA 5B6JA 1EGHA 2O2SA 2ODAA 1F7UA 3GC6A 2WWFA 2ODNA 3OIVA 3IKTA 3EDOA 4MI9A 4RJ2A 6NULA 4LE0A 3A2KA 3EZ2A 3UN1A 4LOHA 3WLRA 4FKBA 4FR2A 1BGXT 1X39A 2V7BA 1YJQA 4X1IA 1ADYA 4M0KA 1EZ4A 3AGPA 3O9MA 3Q7EA 4H7JA 3KO8A 1T4GA 3NV9A 1FK8A 4ZI3A 3WJ1A 4Z9XA 4BGEA 2P2LA 2QX9A 3QMVA 5E4JA 4AL4A 5L3SA 2XXAA 3HJRA 4D5GA 1X7GA 3L0DA 1T35A 4UUMA 3BGSA 2BAGA 1M1XB 3BF7A 1DTWA 3HB5X 4GYKA 4AYWA 1FSPA 2AEJA 3CNEA 4MX8A 1E3LA 3GV0A 2CFIA 1ZUIA 1HR0B 4RAOA 4V1CA 2N47A 3RRJA 4CR7A 1ISIA 1LFDB 2FZ4A 2WT4A 3FKJA 3LW7A 3U7RA 5AJZA 4KC0A 5KOHA 1XMVA 3FPJA 2HK7A 1HUQA 1COZA 4RSRA 3OJCA 1SQSA 3PL1A 4AN0A 5ITZB 5CGZA 2XMBA 3D2LA 7MHTA 4JUDX 2Q45A 3LKDA 4PX2A 4BO6A 3GF4A 1PT7A 1RRPA 4UDXX 4EZEA 1G3RA 1KWKA 3NBXX 2YVUA 4ZQHA 2OQIA 3AKZA 4GI1A 3NAQA 1IPEA 3B2NA 4RD4A 4E5UA 1G38A 3IR5A 3CINA 4UHJA 3GRRA 1QRTA 4N4AA 2C8LA 4UU8A 5JQGF 5JBNA 2QZSA 2AKAB 3ETGA 3EXFA 2W2XA 3B5JA 3ADCA 3THXB 1QHFA 3D3NA 1W4LA 3E23A 3GRVA 4HFNA 4ZKEA 2R6FA 3B7PA 1BS9A 2FSVC 4M49A 1SIBE 3N70A 4ENUA 3CVVA 3PZBA 4O4HF 2AJ8A 2POQX 1LRLA 1ORTA 3P0FA 3EVBA 3WBBA 1PK7A 2YV2A 1ZGZA 1TUEA 1ZSVA 4PYQA 3S6JA 3TO5A 4B2LA 1FFAA 1WY5A 2CXQA 3LNTA 2HNAA 2MIIA 5DJ5A 1SA0A 2IY8A 3LVQE 1DT5A 4W82A 3TDMA 5TB5A 1DS6A 1R00A 1ZH4A 2Q6KA 1DGQA 2P9EA 1ETHA 1TCAA 2C1ZA 2E4YA 4JP5A 3VZCA 5LBTA 2FP4B 4AN4A 2PPVA 4RD1A 3V4ZA 2X5XA 4AB1A 5EOVA 2D6FA 5K3CA 1MV8A 3DVAB 2QTCA 1QGUB 3JQBC 1GNRA 4PYIA 3UA4A 3B1WA 5I4IA 3OLZA 3J7TA 5J3JA 3ND9A 2A1TS 4KOEC 1EM8A 3V1TC 3V5NA 2PZBA 4GLFA 3ETLA 1XC7A 3Q85A 1T8RA 5LA6F 1NP7A 1GPUA 3H6GA 1V11A 3CKLA 3KS9A 4Q9JA 1U0RA 2AL7A 4KFUA 1NVBA 3RREA 3RS3A 3U3MA 4F4HA 4YCLA 2UZ4A 2J9GA 4NV0A 2ODQA 3HBJA 4AKSA 4WJLA 2R79A 5F51A 1DIBA 1FUYB 2QRGA 3ELYA 2C3UA 1PR3A 4BNGA 1I36A 2HSDA 1BD3A 4PFQA 4BO3A 1AE1A 2FUG1 2H31A 3MIZA 3NC4A 1F20A 1CHDA 3WWYA 4BWYA 2AI3A 1I4EB 3E9ZA 1LF5A 2OVFA 3TJMA 3TPCA 4KXVA 1Y6GA 2G4CA 4I9NA 2PUGA 4MJ3A 1EXDA 2F64A 1Q0LA 1W94A 4ALMA 4IHAA 4DY4A 4BY9E 3IP1A 3O4JA 3WK4A 4BE4A 1Q0HA 3VR0A 4U2EA 4BCBA 2EZUA 3QP9A 1H94A 1NZJA 1XG5A 2PBLA 4FW8A 3ACBA 3DXFA 2DLCX 2BGUA 2XDYA 3BQMB 1QKJA 1W0JD 1WHSB 1Z26A 2ZBRA 3PGVA 1R9GA 4TROA 4E7OA 2M6LA 4BZQA 3OQPA 4MIEA 5A06A 4KUHA 1HL7A 1F0KA 3BAZA 3FR8A 3A26A 3JQ8B 3O9VA 3PXXA 1HWYA 1MXFA 2I29A 2OL4A 4CKEB 4EHNA 2QE6A 5D51S 2C5AA 5BOVA 1O6CA 4JHXA 4IIBA 4ZYXA 2DPGA 3DC7A 3LKZA 2QPTA 1H3EA 1NAHA 4X61A 3OHMA 2ZJ2A 4OQNA 4E5MA 1FVFA 4J07A 4MUBA 1ITZA 1L5VA 2PSHA 4O1IA 5GV7A 1NG9A 3EBPA 3LC0A 5CUQA 5CVCA 5IDVA 4RMNA 3MSXA 5IXSA 1X86B 2WP8J 3IBGA 3ABQB 3A32A 3H5WA 3K71B 1P44A 2C94A 1EFVB 1JEAA 2QRNA 2I3GA 1I2MA 1TPZA 3IMFA 1KQNA 3SK0A 2FWJA 4N41A 1FSFA 5EXEA 5KTOA 2I87A 5FBVB 4I9GA 3RLIA 4LJSA 2RHOA 2GN4A 1G3QA 2EDAA 1DIAA 4PIVA 4DREA 1YRQA 2PYDA 3UK1A 1EIWA 1YJCA 4KDFA 4L9SA 2BR4A 2YQ4A 1QHHB 1OFUA 4G3XA 2H9AA 5DKFA 4GECA 1LV8A 3JX9A 4IG4A 1YCDA 3U31A 3WLEA 2JHAA 1QPZA 5AKLA 4OJQA 1ODJA 3T5BA 4PSKA 2CHQA 4QBFA 1SU4A 4MUEA 1J2UA 1NN0A 5D3MA 5FBWB 5LB2A 1IVNA 3U4HA 1TB4A 1RZUA 3DE1X 1F6BA 2UZ1B 4RHXA 3RUFA 4EKIA 1MO6A 2DBYA 3W1WA 4P4GA 4AF7A 1X8KA 3VUEA 2IUFA 3D81A 4LGCA 4Y98A 4ASUA 1DU4A 1R4NA 3DR5A 4EPWA 3EIFA 1SEPA 1Q92A 1U9CA 5TMBA 4KAXA 4L2IB 1ECCA 2B69A 4NNOA 1F4VA 2LIPA 3NB0A 5CA0B 3QEOA 4OHUA 3TX6A 1XYYA 1BMDA 4OQPA 2F67A 1IIRA 3QUBA 3CWZA 3P26A 4TLAA 3ITNA 1E1YA 1KY3A 4RETA 3PDWA 1FF9A 2QX6A 1W2GA 1Z0ZA 3WZ2A 3C14C 3H9JA 4NRDA 1E3DA 4X3CA 5D8DA 1E2PA 5FI1B 1ZK2A 1JDBC 4R7GA 1DX9A 4EYOA 4OXYA 2QN1A 4Y6SA 4HDMB 5K3BA 4CTKA 1SUWA 1R8XA 4DE5A 1S6YA 4KLRA 2IYRA 5KYYA 1WRBA 2VJPA 3B8HA 2IOYA 2NSYA 4H18A 4IZ6A 3T3OA 1PDWA 4H6VA 2AXNA 1PR0A 4FPXA 4DQUA 1YDWA 1TCVA 2KYRA 1U1GA 3F4BA 3NKLA 1UJMA 4R2WA 1MFPA 4EZBA 1R66A 1NW3A 2GN0A 3W2TA 2ZAMA 2NTVA 5JFTA 5JU6A 4DZZA 1KMMA 3HRKA 2J0SA 5ALZA 3EULA 4ZPXA 1LPOA 4MDHA 4CL2A 3CLKA 4CIYA 4A03A 4KNYA 1H0RA 2OVBA 4H7DA 4TTQA 4OHXA 3K0EA 4Y2PA 3B36A 3DT9A 3OOJA 3HFGA 3PGXA 3HCPA 1UEXC 2H51A 2PWAA 1EXNA 5DCWA 1JIKA 1G6OA 4OUDA 2FZLA 1EE2A 3O7WA 2OUKA 4B3CA 5KBYA 2EW1A 4YQYA 4TV9B 4AD8A 1CCWA 1TIBA 4LPKA 4WINA 1Z0AA 1TQ8A 2JK1A 5ERXA 5L3VA 1ZN9A 3P45A 4LZNA 1V1RA 5K51A 1THMA 4Z4HA 4LN1A 4BO7A 1TYAE 3DVQX 1JDUA 1P0CA 2GFIA 2QLTA 1R9NA 4W5RA 1SCQA 2HJWA 3OX1A 5DYNA 2I6XA 3EA0A 3MVEA 3TDNA 4DR3B 4I8IA 2R8ZA 2CJFA 4XQ9A 3WNVA 2BC9A 4YAKA 1Y7LA 3GA7A 1R12A 3GFQA 4COKA 5BRAA 3NC1C 2HXGA 2C4UA 2Y67A 2A9VA 4WEQA 3P5SA 5AD1A 1Q0TA 5I5GA 1GRQA 1YNOA 4AJHA 2VCHA 3N5KA 3WB1A 2ZT7A 3R3SA 4OHWA 3I2HA 3N8GA 4C76A 4AUMA 2FN3A 1GGKA 4EYQA 1ZMBA 5AI8A 1TJ5A 4XQEA 1M7HA 1R4ZA 1E6MA 1KWGA 2RGXA 1C7IA 1ZIXA 4CTOA 4FOOA 1SVKA 1XROA 1HDCA 1ZRSA 5AMXA 2F8SA 2HJRA 3MILA 4KXYA 2OZVA 3HBMA 3KLNA 4HLDA 4R84A 3IOYA 4ROTA 4AZTA 4CT0A 2Q21A 4LHZA 4R1PA 2MSCB 3A06A 4NFLA 1NMSA 4YV0A 3ZIAA 3C1OA 2CHEA 2WIBA 5IF9A 4PIMA 2VCEA 2W8ZA 5A7FA 3BWBA 3GBSA 3GEMA 2XUFA 4MK4A 4A3SA 5A0VA 2BEKA 4I8XA 4FFOA 1I7SB 4P4LA 3MTGA 3RWOA 2OESA 1U5AA 1P31A 1U65A 4V03A 5CM9C 4PXAA 4IDNA 3RODA 3WSVA 2O5EA 5B6PA 2FGJA 3B9QA 4PYMA 3L46A 3TI7A 4UREA 1N0HA 2XUAA 2W4MA 3QE4A 1KDYA 2QSUA 3IILA 2M1ZA 3BB3A 3OEEA 2EZTA 4U02A 4URWR 1C9JA 4ERXA 5TIIA