1DAFA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid, adp, and calcium
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
total genus 71
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dafA00
1YZTA 1IAQA 4G5OA 1Z5ZA 3FKSD 4B3DA 4NBSA 1EXMA 2JAQA 3GFTA 1G8YA 4LYAA 3EC1A 3VQTA 4AKHA 4Z1MA 1DOAA 1X6VA 2ZS8A 3SYLA 3VR6A 4URWR 1F2UB 2KJQA 2H8KA 3OEED 4M1YA 4BLOA 1KI7A 1PZNA 3U5ZB 4ACBA 4LJ7A 1E2MA 1UKYA 3ZS9A 4DSTA 4CRWB 1E2FA 2AD5A 2NZ8A 4MRNA 3THWA 1S1MA 3RHFA 4KU4A 2Z5FA 3KXIA 5FPYA 1E4YA 5FL7A 1FW6A 3MJHA 4JLMA 4YXWD 1E0AA 2YWFA 4BLQA 5FI1B 4JT4A 1VECA 4TLEA 5CM8B 3KKNA 2FX3A 3GEEA 4Q02A 2G0NA 4C0KA 2ZRGA 5K8UA 3TUIC 4NMMA 4IOMA 4Z1MD 1AN0A 4ZCLA 1LY1A 4TYYA 4RZXA 4D0NA 2O8FA 3LBHA 2ZPTX 4KYUA 3KQHA 1VYVA 3PIRA 2FF7A 3JZAA 4CGZA 5JEDA 5AK0A 3QUSA 1KDOA 2YOGA 1XP8A 3CR8A 1G1MA 1KSFX 3W3AA 2BVNA 1VKJA 4LV6A 4PHHA 3A1UA 5TDHA 4F92B 3REGA 1JAHA 5JHHB 1RPZA 1ZNYA 3FDIA 4GP6A 1VCIA 4GP7A 1F60A 2GTPA 4C4PA 2DYKA 4DIEA 1AIPA 4DEXA 4QBGB 4P4SB 4R7ZA 3NKVA 2C9YA 4LJ8A 1OFUX 3CM0A 5JI2E 2GRJA 3KQUA 1UBCA 5AJZA 3H2YA 4A36A 2RH5A 3UPUA 3W6NA 1G5PA 2MMCA 1NN0A 1NLZA 5F2EA 5AJWA 5B30A 2CCGA 4LK2A 3VNVA 3VNUA 1A7JA 2AKYA 1W36B 1NSTA 5KUTA 4LYFA 4US0R 3CZPA 5FOXA 1W44A 3WMEA 1ZUHA 2FA9A 1CR2A 1T8TA 2BMFA 2SHKA 3HJNA 3O8RA 3CO5A 3O8BA 3CLVA 4YONB 4OHYA 3BBPA 3KJIA 1T8UA 2OG2A 4RD0A 2GCOB 5IT5A 3X1WA 4A2QA 3AUYA 4O2RA 1R6BX 1T0JB 2ZUDA 4HLDA 4HEJA 2VF7A 3QF4B 2JLZA 3TBKA 4TMVA 2IWRA 2N46A 3EPHA 4OI2A 4MDFA 4QGAA 1CJVC 1A5TA 1KO7A 1GNRA 5A0FA 4JSYA 3RANA 3U7FB 4PANA 1KKMA 4WZ6A 4E07A 1BYUA 1UKVY 3VU9A 2JLUA 4O3MA 1N5KA 2QAJA 3A58B 2VP6A 1RKBA 4KO8A 5KYKA 1E1RA 2C9CA 2J5XA 2JDIA 4L15A 1E2EA 1OHHA 3HWSA 3SNHA 1CKEA 1ZYUA 4DB4A 2FDCA 1NLFA 4Q4LA 2BBWA 2BEKA 2IL1A 2ZUCA 2QROA 1JB1A 1G3MA 1AKEA 1S3GA 4IDQA 3U3RA 4LRWA 4C0JA 2IK8A 1TTTA 1U99A 2MMGA 4JIMA 1IXRC 2WKQA 2IT1A 1G7TA 2KBFA 1QHHB 1CRPA 2GEDA 3FMFA 2ZJAA 1E1RD 2JDID 4LOAA 4LUCA 4F7WA 1OHHD 2D62A 4W5JA 2GHIA 4OK3A 4X8LA 3DVLA 1YRAA 4Q4JA 3RYTC 2A5YB 1F2TB 2B8WA 3GJ0A 1T91A 2XXAA 2BC9A 3K9GA 4U02A 3L8YA 4JLVA 1AK2A 2VHUA 1N2CE 1XTRA 1GFIA 3FHTA 2D3WA 1HV8A 2IYQA 1XJQA 5B64A 1IONA 3MJRA 4QNRA 4YDSA 4DSUA 4WW0A 4YMUA 2HT1A 2GETA 2PZGA 3QXCA 1D2NA 3QKTA 4D4KA 4XWOA 1U0LA 1X3SA 3K70D 4HLQB 1P2VA 4JZKA 2E87A 3GFPA 3JZMA 2IEZA 1NBME 2YOFA 3I62A 4RVCA 3RDPA 1YU9A 4UJ3A 3FMIA 1XPRA 2R6FA 3AVXA 5K8TA 2CXXA 3CX8A 4JLJA 3NVAA 4AC9A 3I8XA 1KDRA 3DMDA 4UNSA 4DT1B 1NN5A 2V1XA 3KXLA 4BUJA 4TMXA 3EX7C 2PCLA 4Q21A 2V4ZA 1G5RA 1OYWA 4W9MC 2OBNA 2VP4A 4IDNA 3Q3JB 3QF7A 5K8IA 3WHKA 4EFMA 4QM7A 1KAOA 4EPVA 3AP2A 1WF3A 2NTYC 2ZJYA 4L9SA 4CF7A 2R6CA 4TWZA 5L3QB 3K9NA 1DAMA 1D2EA 3EC2A 3TSWA 4LDJA 4E09A 1QRAA 4LHXA 3N70A 4CVNA 4UNNA 1W4RA 3B7GA 3UATA 2REOA 1PV4A 2QAGB 5JJLA 4BGDA 3P20A 1BMFA 3DZDA 4XVUA 1SXJA 5KHOC 1UBGA 5CIWA 3BORA 4AYTA 1Z6GA 1TL7C 4P4UA 5HTKA 2YWEA 4FD2A 4DCTA 1SVMA 2YWHA 1OFTA 2Z0MA 4H1VA 2G1KA 1AQYA 1ZINA 4C9BA 1Z6AA 2BBOA 4NYMQ 2QG6A 2WZQA 4MUBA 1GDDA 5DH9A 5B2ZA 3PG5A 5HZHA 1LTQA 2E9SA 1S9DA 1JPJA 2HXSA 2ZQ5A 3OIWA 2ZRDA 3PUYA 4W5HA 5E7IA 1N5LA 4PC2A 2EWVA 5ELXA 1SXJD 1H8EA 4HI0E 1JQLB 2AXPA 2FEOA 2ZROA 1XBTA 1VG9B 4ON9A 2GCNA 3M4YA 3ZJYA 3TIFA 2QBYA 3B1XA 1UADA 4LGMA 5FBRB 1XEFA 3VX3A 4LY6A 3GPLA 2R6DA 2BMDA 1KSJA 1XF9A 4NKRA 3U6KA 1Q1QA 2GK7A 4ASUA 2OO7A 1M34E 1R8QA 3KB2A 1X8KA 1UPTA 2WWIA 4NDZA 1O3YA 3QQ5A 1ZNWA 2IBMA 2EVWX 2AFIE 3BIFA 3WYGA 4IDHA 121PA 3RC3A 1H8ED 3RWMB 4TL9A 3UIEA 2XOKA 4R2HA 1KAGA 4NYJQ 3ZZUA 4EAQA 2EYQA 2ZSDA 4TYPA 1NL3A 5A5GA 3B9PA 1YR8A 3O47A 5IK2D 4BRUA 3OEHA 3CRVA 5K8LA 5G41A 3V9PA 1IY2A 2PCJA 4HAXA 4YMTA 2XTMA 2FZLA 5FPTA 3FB4A 3E1SA 1XEXB 3LRPA 4A8JB 1UAAA 1JNYA 1G8FA 4BFXA 4IVPA 3NC0C 4ASUD 2KI5A 5LB4A 1NF3A 2B7CA 2IXEA 2QTFA 3MSXA 4D0GA 2DR3A 1DAEA 4MRSA 2X1VA 1KI6B 1W5TA 5FI0B 2OT3B 2V7QD 4RD2A 5KDDA 4QC2A 4ARZA 1AS0A 2WJIA 1CBUA 2XOKD 3BAFA 2RGEA 4LJ4A 1DELA 5AUNB 4LWZA 5KNBA 2W6JA 4UQOA 3OEHD 4QBIA 3NC1C 4MUAA 4B3BA 4I4LA 1G64A 3PJRA 1W0KA 3NG1A 2GXAA 4FMBB 3BH6A 4HZIA 1W2HA 3R9IA 2QN6A 4B6FA 4LJ6A 3THOA 4BASA 1GAJA 1U0JA 2BIFA 3BXZA 5EJEA 1YVDA 3T61A 2V3CC 2EFCB 4YMSA 1Z3IX 4A15A 1OH5A 2O5VA 2RGDA 2XB2A 1KSHA 2B7BA 5JRJA 3RS2A 3SQWA 4V0OA 3KKMA 2RGGA 1OKKA 4KYIB 3TSOA 1II8B 1CEEA 3QKRB 4D4JA 1AM4D 3IDQA 3PEYA 2W6JD 3P1JA 3BFKA 2UZ3A 2ZRAA 3K8YA 1GRRA 2O8FB 4URVR 3L0SA 1A2BA 2FSGA 5EXXA 1W0KD 2N1BA 3G82C 4PZYA 1G6OA 3IBYA 2ZS9A 5FOWA 4XH9B 2AR7A 3U2QA 1NNEA 4LPSA 5EE0A 3AVWA 2QUZA 3GLHA 1E2IA 4BZQA 1VCNA 4IVQA 3AF1A 4FN5A 4B74A 4RJLA 4P32A 2O0HA 4BFTA 4IKEA 2V8OA 1KY2A 3L0OA 3SEAA 4TYQA 2ZI6A 1OKKD 1U9IA 3MWJA 3EIHA 3RLFA 2XSZA 5JJIA 1GL7A 2P5SA 2QL6A 4KAXA 5GJBA 4RCZA 1AA9A 1P9RA 4MRPA 1UJ2A 5AR1A 2ORIA 3THXB 4Q00A 1TU3A 3W9YA 1XFAA 1ZP6A 4KFSA 3GLGA 1N0WA 2BWJA 1E1QA 1IY1A 1N5JA 2J1LA 3CONA 2GVDC 1OF1A 4KSBA 2YKGA 5TARA 4G3XA 2A78A 2QGZA 4CDGA 1FX0A 1ZD1A 3KXKA 3AM1A 3ADBA 3EW9A 3SU8A 5GADl 4XIGS 1EFCA 1WB9A 2FPLA 2AX4A 4JLBA 4N3NA 3CPJB 2PX0A 4PXAA 4QBFA 1EK0A 1UBEA 1RYHA 4G5GA 4A0HA 4GSYA 2XSZD 3TNFA 3A1TA 2ZRCA 4Q9HA 1NY6A 5E7JA 3FHCB 4HDQB 4MGKR 2AWOA 2PH1A 4HZUB 1ZJ6A 4PZLA 4QXAA 5BN3A 4FCWA 1JR3A 2J46A 2GAOA 1COWA 1BO6A 1SKYB 5A4JA 3P4YA 1IN6A 1Z0FA 5EP4A 2OESA 3FMPB 3TW8B 5JJKA 3N5CA 4B75A 2J59A 3U3JA 1GUAA 3ADCA 2P6UA 4A2PA 2UKDA 5L8VA 5DGXA 1N6RA 3MGCA 2ANBA 1AS2A 3QVVA 4EFNA 4DLRA 4UNPA 1J70A 1ZMXA 5C4MA 3R9XA 2YJTD 4OI4A 3ZQJA 5TY0A 4IHQA 3A4NA 1FMLA 1UKEA 1Z6XA 1EFRA 3PEVA 5H8WA 4HDOB 1E9SA 3K9LA 1VYUA 2R6GA 1NBMA 4B2IA 1JR3D 3SBEA 4Q1EA 1XTSA 4FXPA 1COWD 1KDTA 1TX4B 1CR4A 5DLQC 2IUUA 1ZCBA 3CRRA 3K0AB 3K0CC 4Q7JB 5CB6A 5KDLA 4NCHA 1W4BA 1TAGA 5FBLB 2V1UA 3SN6A 4EFLA 4KLZA 1SVIA 3MD0A 1F5NA 3JVUA 3LX8A 1Q0UA 2NO1A 3QBVA 4NONA 2IS4A 3GEHA 1E9BA 4GT1A 3ZZ0A 4Y0AA 3KQLA 4QG7A 3ZVMA 3SDZA 3SJZA 2WSSA 2NOAA 1P2UA 1Y3AA 1NKSA 4WXPA 4UXJA 3K70C 1Q3HA 2R8RA 5KNCA 2F1HA 3U7HB 3BK7A 1ZCAA 4KCGA 2GAAA 1M7GA 2ZI4A 2VHCA 3DKVA 4DLTA 1XCPA 1ZU5A 4KLNA 4LBVA 4V0LA 4URXR 2GA8A 2VBCA 2VRWA 5FBQB 4RSGA 3NXSA 5JCPA 2IC5A 1CTQA 5GJCA 3CH5A 1OXXK 2V6IA 1T9HA 5FUXA 1P2SA 1J2JA 5JHGB 4XD7A 4PPQA 2VH5R 3MRSA 2D7CA 2WSSD 3KTAB 5E3HA 4V03A 4MDEA 3KJEA 5KSPA 2QP4A 3BFXA 1N6KA 1Q20A 3TR5A 3VHXA 221PA 5FUVA 2DB3A 4MGIR 3KKOA 4CEJB 5AUQA 4NYIQ 1KI1A 1CS4C 3X1ZA 1ZM7A 1VCOA 4JMPA 2C99A 1JJ7A 2BBSA 2QMEA 5H68A 4G5SA 3T15A 3U44A 3PENA 1CULC 2BDTA 2KBEA 3AF0A 4US1R 1GKIA 1W1WA 4XD7D 3LW8A 1W49A 2IYZA 2WJGA 4NYMR 4B33A 4PZZA 2X19A 4TLBA 1GZSA 1HEIA 1U81A 1WCV1 2F1IA 3TRFA 4WAUA 4IJMA 3FPAA 4EPWA 1W48A 3E2IA 5C46F 4A6XA 2G6BA 4AKIA 1T5LA 1GG2A 2G88A 2OEPA 4B47A 2O0KA 4QOSA 3EZFA 2BBTA 1G21E 1SXJC 4JJKA 1OXSC 3AF4A 3FTQA 3W5JA 2ONJA 2IHYA 2CHQA 4ZI2A 2A5JA 5EQTA 3GLIB 2J7KA 3IHLA 2I4IA 5BN5A 1OE0A 2F7SA 2GXSA 4HATA 3TSZA 2RMKA 3AKEA 4LPKA 5SZKB 2ZRLA 5KU1A 3FFBA 1WP9A 4WZBE 1QG2A 2R44A 4Q4HA 1JALA 3B85A 4H9GA 5DYIA 1DBSA 3OAAD 1XZQA 1XMIA 2DPXA 2JASA 1C9KA 2JIZD 2YOHA 2EFDB 4HSEA 4Q9IA 3K0FA 3K1JA 4NYJR 3TH5A 3PFIA 5CDFA 5DI3B 5JI3E 3ZD6A 4O0MA 1TQDA 3AP3A 3QKUA 3T1QA 3X1YA 1DG1G 4RD1A 1P60A 2CE7A 2HUPA 3C41J 4OQXA 4RFSA 4WBSA 3A1SA 4WA7A 3QEOA 2IX3A 1L4YA 1ONBA 2J0UA 1S3SA 3WNDA 4WXRA 4C2UA 4D82A 3QPVA 2CJWB 4FW9A 2WV9A 1A1VA 3H0KA 2O8EA 1MOZA 5CYOA 3LXXA 1OXVA 3NWJA 1OJLA 2ONKA 3DM5A 4TZ6A 1RZ3A 2GJSA 2GZAA 5BYJA 2C77A 2Q3MA 5L3VA 1U94A 1JPNA 4RKEA 1P6XA 1VHLA 2DHRA 5G53C 1W7AA 4DLVA 1ZC4A 2GESA 1NP6A 1QZXA 4KSCA 2MSEB 3HU3A 3IIKA 3I5YA 1OV4A 3IQXA 5EUQB 1SXJE 1S8FA 4K8OA 2GF9A 3NHBA 4HB2A 3WRXC 4LHWA 1E2DA 3QG1A 4NHOA 5TV2A 4D4MA 3CF0A 3QENA 2H1LA 4Q18A 2X2FA 2Z83A 3WNCA 1YZLA 3UMRA 1CRQA 1UM8A 2WKRA 2OAP1 2Z6VA 3BWDD 5CLQA 3W6OA 1KI8A 2ZANA 5M04A 1N6NA 1NMXA 2OBMA 1N6PA 1QHSA 4KBFA 1V5WA 3IIJA 1QDEA 2F1JA 1EX7A 4GRAA 3GJXC 2NPIA 3ADKA 3D31A 2ZJ2A 2CCKA 2CNWD 1NRJB 2G9NA 3T35A 2P6RA 2IYVA 3SOPA 2ZEJA 2JLXA 4CEIB 3SJCA 3IBGA 3P32A 5IDVA 1K5DA 1MH1A 1E0JA 2CLCX 2FSHA 4C7OB 3CW2A 1XX6A 4L9WA 5KPDA 2IF0A 1NMZA 1K5GA 1E2KA 1G3RA 3EA5A 2NZJA 4JS0A 1ZVQA 1LNZA 3FVQA 3C5CA 1LF0A 4ZDKA 3NBXX 2ZSAA 3LBNA 4M9SA 3QXSA 2GJ8A 1NJGA 2ZE7A 1KK2A 1YZNA 2YHSA 1FX0B 3B82A 4D4LA 5FTJA 3I72A 2ZR0A 2YV5A 4NCNA 3CR7A 4EUNA 4BRWA 1VG1A 3MWLA 4S2EA 1U9IC 1Z0AA 2ZJOA 4MGYR 5DYGA 3DO6A 2DWPA 1RJ9A 3VR4A 1OYYA 3L8ZA 5SZJA 4WVFA 2B21A 2FV8A 5JSZB 3LQRA 4BLRA 4G5RA 421PA 2F6RA 2ZRBA 2OM2A 3NTUA 4GFDA 1KI4A 5FPSA 2BMJA 3H84A 2QE7A 3OF5A 2ZAMA 2IXFA 2G3YA 2PL3A 4JLDA 4TLDA 5HZKA 1GRNA 3AF2A 1QHYA 1IM2A 1PJRA 4N1AA 3TUJC 4AI6A 1FZQA 4YMWA 3LWNA 4ACAA 1HA3A 2G83A 521PA 2BJVA 1XXHE 5EP3A 2WWHA 2ZU0C 1RE0A 3TE6A 2FPMA 3SFVA 5HPYB 2QE7D 3JVVA 1NMYA 1XPOA 1P72A 5BQ5A 3THYA 2RB4A 1PUJA 2OXCA 1CLUA 4V0MA 4DLYA 3TW4A 1E69A 2GILA 2V9PA 4A0GA 3B6EA 4EJSA 3Q7PA 1HQYE 5HKKA 1NI3A 2RCNA 1TU4A 3K9HA 2TMKA 3AKYA 3LVRE 1A4RA 1XRJA 4TQUS 4TYNA 5FOUA 3GLHE 3ECCA 3VTKA 2QTVB 4B3GA 4TMKA 4BLPA 4E03A 2IS1A 2Z4RA 3BH0A 4M22A 2J41A 1NIJA 2WJJA 1RFLA 5DIFA 3FGNA 5IF9A 4Q7KA 5AJXA 1CJTC 2VL7A 3ETLA 1R5BA 1XZPA 3MAAC 1N6IA 1LF5A 1ZIPA 5TVKA 3CRQA 3FOZA 1BKDR 1DVRA 3BERA 4D2IA 1II9A 1UEIA 5HKKD 3GLGE 2DCUA 3REFA 2PEYA 3AVTA 1SQ5A 4JBYA 1EG7A 5GJWC 4D80A 1IJFA 4U5XA 3VKHA 2ZRKA 3QI2A 1I4DD 2J87A 2QM8A 2PZEA 1JECA 2NPFA 3K0CA 1JXMA 5KOYA 4MRVA 3GJ4A 4JLPA 1SVOA 1E9DA 2C2HA 2XNSA 2EFEB 4A1FA 2ATVA 4LBZA 1ZBDA 4QRHA 1I2MA 2ODBA 2HT6A 2B92A 1JQJC 4I81A 4NYIR 3CWQA 3RC8A 2QT0A 1O87A 2R6AA 2RGXA 2Q3HA 4B34A 1IN7A 4LJAA 4A82A 4ESVA 2IYUA 4JJZA 2WTUA 1PLKA 3TQFA 5FTNA 3KFVA 1JEDA 1BYIA 5JMTA 2XZPA 2BV3A 1WBDA 4DJTA 1G20E 4JVNA 3TLXA 2JA1A 1JR3E 2Q9AA 2HEIA 3EARA 1E0KA 5FPKA 2F3RA 3WNBA 2X77A 3CIOA 4GMXA 1VG8A 3GQBA 1KNXA 5JEEA 1EFTA 4BFZA 2QU8A 2FH5B 3PUXA 5EZ5A 2F43A 3KQNA 1KMQA 3CF6R 1JAIA 3L43A 3IPYA 2OLJA 1XTJA 4LV5B 4CEHA 1DAHA 4DCUA 3Q5DA 2QQ0A 3J81k 4IFEA 3WP0A 1U2RA 2FEMA 4M1OA 5FR1A 2J0QA 2W83A 2F3TA 1VG0B 4P4TA 1TQ4A 3AB3A 3LLMA 2DFLA 1C1YA 1Q1EA 1SKQA 1Q1BA 3U4QB 1EX6A 2YYZA 1NKTA 4R2IA 4ZPXA 4OI0A 3DL0A 3L0PA 4JVSB 4B3FX 2EWWA 4A92A 4MKHA 3G5UA 2IS6A 2G1JA 3LV8A 2FSFA 2NG1A 4OQLA 2O8DB 3X1DA 1Z0IA 3Q8XB 4DDUA 1HTWA 4Q4HB 3W8RA 1R4AA 3U3MA 1XCMA 1Z8FA 3VR5A 2QENA 4M1WA 4PQFA 3LD9A 5J47A 5CYPA 5FOVA 1YZGA 5IHPA 1RVDA 2LCFA 3LVQE 2FG5A 4GDFA 3W6PA 3GEIA 1QHGA 3FKQA 1TQ2A 4LI0A 4ZCMA 3O8CA 1VTKA 4Q1FA 4AKGA 4OJKA 1J99A 1FNNA 1MABA 4RD3A 4RD4A 3DKPA 2P67A 1R7RA 1KO8A 4PHTA 2ZYVX 1HURA 1Y63A 4AG6A 3RS7A 4D0LB 1TEXA 1Z08A 3KUCA 4WZAE 3F3YA 3RRYA 1EWRA 5D3MA 1OXUA 3RVBA 2OBLA 2Z43A 1G18A 2GZHA 4R98A 2O0JA 4KV9A 3KQKA 1OPXA 4KJZA 4LC0A 1NLYA 2PT5A 4M1TA 1V43A 2ODNA 4PAMA 3QXHA 4KODA 3C5HA 3AUXA 4AYXA 5C1BA 1IXSB 1L7VC 1IBRA 1R0WA 4IXNA 4PC6A 5IK2A 2HYIC 3ICEA 2QI9C 3EIQA 5J5CA 1DTSA 1RIFA 1AS3A 2VPPA 2CLSA 1WDTA 1G17A 2ZE6A 1KZGB 4Q66C 3T12A 1DAGA 3QEJA 1SHZA 2ZXUA 4AKEA 2AWNA 4B3CA 5BN4A 1P2TA 1Q44A 3HPRA 4RFVA 4YDHB 2V7QA 4C0QC 3SJAA 4HB3A 4L4UA 4PO8A 4XTRA 1B23P 1GL9B 1P3JA 1XNJA 3UMSA 2D2EA 1PUIA 2ECKA 4QJ3A 4GOJA 2JJ2A 1CP2A 4BPBA 1KYIA 1TQ6A 2ERYA 2GJ9A 1E2PA 5CITA 2NMVA 3ZH9B 3VX4A 5FR2A 1K6MA 2R9VA 3IEVA 4PAOA 4BQSA 8OHMA 2GZDA 3G0HA 3AV0B 2RGNA 1LS1A 4PTLA 1M7HA 5L3SB 2CVHA 1R5OA 2PX3A 4BEJA 1JR6A 1YRBA 2E1RA 3SYKA 2P6NA 1XPUA 2FFAA 4X8MA 4UXHA 5CDFE 3LLUA 1KGDA 2BCGY 3I4LA 2JJ2D 3OHMA 1QHXA 1FPMA 3KKPA 1GTVA 4DUGA 1G9XA 3GJ8A 4B2LA 3ZVLA 3AKDA 4JL6A 3QKSA 2QSYA 4BFUA 1OIXA 1ZAKA 1KIMA 3THWB 4EPYA 4Q1BA 1YR7A 1XXHA 3W8NA 3LH5A 4G0NA 4MRRA 5LPNA 2AD1A 2JJ1A 3LY5A 4NU0A 2QORA 1KMHA 3VFDA 3NHAA 4PR0A 3DMNA 2EYUA 5JBQA 1NIPA 4HUQA 3GP8A 3IO5A 4MYUA 4ZDWA 1MT0A 3NIBA 1IOZA 2O8CA 2OE2A 3TVTA 3B5JA 3QG5A 1MKYA 3BFVA 5SZHB 4DUGD 1TADA 1XD2A 3T34A 5EE3A 3AEZA 1FFHA 721PA 2YINC 2VP5A 5FTKA 3RABA 5LD2C 2LWIA 2IWHA 3ZVRA 1E98A 2NO9A 1HE8B 4BEBA 3EZ6A 2JJ1D 2H92A 1AGRA 2FGKA 4JVMA 3GLFA 3I8SA 2JLYA 2ZRHA 5CJPA 1UEJA 4JL5A 3MWKA 5CK4A 4E22A 3IUYA 3WY9A 2ZVPX 3IPXA 3B9QA 2IYWA 1TUEA 4Q9LA 2YC2C 5HE8A 3N2EA 2IYXA 3AVUA 5KNDA 2QEQA 2IEYA 1DAIA 1KK0A 3N2IA 3PUZA 3B13B 1QVAA 3I32A 4TSFD 4EQ6A 2CL6X 1YR9A 1Z47A 1N6HA 1R2QA 4RD6A 1KKLA 1N5IA 3PEUA 3OIUA 4MH0R 4Q4AA 1T5IA 1Z2AA 3R9WA 3FFAA 3OIVA 4DCNA 3BE4A 3A8TA 1GKUB 3LQQA 4AIIA 4EJSC 1F2UA 2OAQ1 4TL8A 4F4CA 1KHTA 3VU9B 2ZSFA 3B1WA 4M9ZA 2A5DA 2F1RA 5J40A 3VAAA 821PA 3MMPA 3EAQA 3H1TA 4Q5IA 2CHVA 4S35A 3BB1A 3ND9A 2Q0HA 3HYRA 4M53A 4F4JA 1BIFA 1DS6A 3C8UA 3KX2A 4B43A 4B71A 2BKUA 4I1OA 4II7A 3OE7D 4IEEA 3AVQA 4L16A 1OB2A 3DM9B 3M0EA 1ZNXA 3R20A 2WM9B 1Q22A 4I99A 1OXTA 4NCIA 2FFQA 4XWKA 3TKLA 3TQCA 1NJFA 3ONWA 1NG9A 1UBFA 4M4SA 4DSOA 2QMHA 3K70B 3QNUA 4UXIA 4BE7B 1NVVQ 2PLFA 2ZJ8A 1G3UA 3BS4A 4MYCA 1S1CA 1KOFA 3W90A 1FP6A 1ZIOA 1MR3F 4PHFA 3AVOA 4Q4JB 3B78A 2FSIA 3PXGA 4A9AA 5JWOA 2XXAB 2DFTA 1ZC3A 1Z0DA 2I3BA 4DKXA 4LCBA 4MYTA 5C18A 3T06B 4B35A 2IHBA 2JLWA 2G0TA 4XVRA 4EPXA 3QY0A 5D3QA 3CPEA 4CEHB 3RNLA 3ZDQA 1TEVA 4IEIA 4HB0A 4BLTA 4JSTA 1XU4A 2IUSA 1ESMA 3HR7A 4D26A 2QP9X 2OXRA 2ZRMA 3C16C 4C3ZA 4EPTA 2ZU6A 1Z0JA 2VEDA 2MSDB 4JLAA 4V0ME 4B6EA 2P65A 4NPHA 1Z83A 2ZJBA 5SZIA 2CEAA 4MYHA 5JS8A 2GCOA 1FNMA 5KPJA 2QNRA 3GJ7A 1R8SA 1W0JA 3BOSA 5EP2A 2CK3D 621PA 1PVOA 1PLJA 3QF4A 3Q7QA 2DFNA 1G8HA 4LBYA 4AWXA 5FBWB 4AK9A 3HU2A 1W36D 2WJHA 1XD8A 2J7PD 4Q01A 3RRMA 3CX7A 1I2DA 2BM0A 4ZI3A 1E9AA 4O2LA 1DO2A 2ZREA 3F8TA 2OLKA 1XJ0A 1F48A 1NSFA 2G77B 4IFBA 3ASZA 4D25A 1MRSA 5JSZA 4Q1AA 3ICQB 1GNQA 3T5GA 2H16A 4PC7A 2C98A 4TQ9A 4DC9A 1SXJB 4Q19A 3R8CA 1ZUNB 2EFGA 2QPAA 3SFZA 2JJ8A 2VHTA 4PO1A 1W0JD 2VSXA 2ZRPA 3QIAA 5G3YA 1IY0A 4DDTA 1X8LA 1U90A 3EG5A 3GMTA 4M1SA 2YWGA 2QTHA 5FL3A 5AJVB 1TF2A 4DDVA 4KI0A 2ZSBA 3KL4A 2QT1A 2FJUA 2HJGA 4QL3A 3OAAA 4LZZA 3SS8A 1UDXA 4DCSA 3PVSA 2QRNA 4OHVA 5CK5A 2JIZA 1D8TA 2W2XA 1N0VC 1KJWA 1W5SA 4QBHA 4TL7A 2GEUA 1FQJA 1F2TA 2GDJA 4LSGA 2LKDA 3EPJA 4DWJA 4A0RA 1E4VA 2ZI9A 3EWAA 5FUYA 3BD9A 2QBYB 5CM9C 1GVNB 2Q3FA 3MWYW 2ZUBA 4ZKDA 2FE4A 1YHNA 1XJCA 1ELOA 4LHYA 1JJVA 2A2ZA 2PEZA 3CX6A 4YC7A 4EDHA 1OH6A 1P7CA 5DO9A 2VQSA 1ZUIA 2CMKA 1TUIA 3TJZA 4ZIRA 3GJ6A 1S9HA 5LB2A 3RWOA 2YVUA 1RRCA 2O8BA 4DEYA 2WAYA 3MCAA 2VP2A 3Q85A 3V4RA 4B73A 1FQKA 3HYTA 3SZRA 3UWOA 1HUQA 4DDWA 4DT1A 4QJ4A 3U6BA 2VP9A 2GXUA 5DHAA 1E79A 2ZJ5A 3X2SA 1IHUA 3AP1A 4QHYA 5DSZA 2YC4C 1OH8A 3U3OA 1E2NA 1W4CA 1QHIA 4KFUA 3TR0A 5L3QA 1GWNA 1WXQA 2GWHA 4G01B 4OKSA 1FUKA 5EXPA 1IN5A 1E0SA 2VF8A 3PCRB 1I4LD 4M1KA 4PPGA 2ASEA 4Y0VA 2OSBA 3SC3A 4ARZB 1YR6A 4M9XA 2ZYWX 3WYFA 1NVXQ 3LO5A 3LX5A 4P31A 1SGWA 5IRCD 3EZ7A 1E79D 1AZTA 1E9CA 2YZ2A 3SR0A 3TMKA 1II0A 2VSFA 5EE5B 5GVSA 4NTZA 3LFUA 2CNWA 4JLKA 4EKDA 4GBMA 2RGNC 3EIEA 1EFHA 1Q1ZA 1XDBA 1XXHB 4KVGA 4PSVA 1Z6YA 3CRW1 1OLOA 3M6AA 1KMHB 4KVAA 3W5IA 2XNDD 1AZSC 3ZLJA 4IRUB 5GJVC 5EP1A 1QHNA 4EPRA 1E96A 2JEOA 2O52A 2W2VA 4DIDA 1YZKA 2QA5A 1G7RA 4OK5A 2ZS7A 2AHOA 1DPFA 4IOLA 4Q48A 2NGRA 3AQ4A 1XMSA 2JLQA 5TMPA 3NDPA 2W58A 4A0FA 4RZUA 3F0TA 1ZD8A 2Z4SA 1Z0KA 3L82B 5DHFA 1XCGB 2AL7A 2QGNA 3WMGA 3RSOA 5F9HA 1GL6A 4ZO4A 3KJGA 2VHQA 2F9LA 4OYHA 3GLHB 3IQWA 4BFWA 2JLRA 1VCMA 1N0UA 3OZXA 1R10A 4GOKA 2ZE8A 4MA4A 3RRZA 4IXMA 4Q9JA 1RRFA 1T4GA 2D7DA 2P5TB 2J9RA 4IOKA 3RS0A 2IYSA 2XTNA 1DG3A 2C95A 2ODWA 4M9QA 1Q12A 1VMAA 4KFRA 3C14C 2AFHE 3U3KA 5B58C 3GLGB 2C8VA 1P73A 1XEXA 3UXMA 3B2EA 3AF3A 1HQCA 5BWMA 2RGCA 2BEJA 2WPDD 1RRPA 2KE5A 3QXXA 4PX9A 3LXRA 5EE9A 2IW3A 4EQ6B 3AVVA 1KI6A 3RRNA 1CXZA 2UZIR 4Q4AB 4RZ2A 1VIAA 1RYFA 4GPTA 2QZ4A 4HAUA 1G8PA 4JYCA 2VP0A 5JWHA 3K0EA 3U61B 2JCSA 4TTQA 5CLLA 1VPLA 2XB4A 4TLAA 4NZYA 3D3QA 3SI7A 5DISB 2NO0A 1T3LA 2GXQA 5CB8A 1E3MA 3UWKA 4AG5A 4IVRA 1T3SA 3SBDA 3NH9A 4UKDA 1X86B 2C96A 2WWXA 3CKLA 3RAPR 5L3RA 5EZ6B 4XSGA 4Z8XA 3SQXA 3B60A 4DLWA 1CF4A 3SJBA 2BOVA 2FN4A 3CBQA 1SVWA 4D6PA 3A36A 3FWYA 4FIDA 4PSKA 1JEEA 1KNQA 3AH8A 1II8A 1TPZA 2RGAA 1B0UA 2WJVA 3PV0A 3QKRA 3NBFA 5JWRA 3HU1A 3ADDA 3IHWA 2HV8A 1NVVR 4XJXA 4POAA 1M7BA 1G291 3H4MA 1W2GA 5EUMA 1XB2A 4CIDA 5JECA 4ESHA 1NN3A 4Q47A 1E6CA 2GK6A 2WBLC 5F3WB 2X8AA 2ZIAA 5C4GB 3BH7A 3S1AA 1OSNA 2BMEA 5FL7D 1C4OA 1LV7A 2W0SA 3F5FA 4TTRA 4O25A 3AGQA 4MQBA 3O8DA 4A2WA 3TVDA 4YMVA 4EIWA 5UKDA 3ND8A 4GI7A 2HYDA 5FPHA 4BLSA 3THXA 2VSOA 2ZR9A 3K0SA 1E2HA 2BKEA 1XTKA 2REBA 3K53A 5G40A 1LS6A 2FZ4A 4BECA 3GLFE 1L2TA 1GRQA 1P5ZB 3HDTA 3PUVA 1OIWA 2LKCA 4UNQA 4DZZA 1G41A 4HLUA 2ZRFA 4BWYA 2FU5C 1EGAA 1OIVA 1IJEA 1G8GA 5FUWA 5E95A 2K5UA 2WIBA 3WBJA 2GJAA 2A3RA 2PBRA 3SHFA 3UG7A 3UG6A 4B3XA 4FINA 1NY5A 1RC8A 3TAUA 2H17A 2I1VB 1P75A 4LBWA 3CUEF 5FFMA 1W36C 1G5TA 2WIAA 4GZLA 2JLVA 1AJEA 1AKYA 1LVGA 1G16A 4HZUA 3MG9A 4TMTA 1TNDA 1L4UA 3BRWD 4OQNA 5KSOA 1ZM2A 1ZRHA 2ZI7A 2V54A 4RZ3A 1U8YA 4FMCB 2GEVA 1G3QA 1A2KC 1T0HB 3A6PC 2OHFA 1JXOA 1WBBA 3WXMA 4KBGA 4XSHA 3IILA 2F9MA 2C5LA 2OFXA 2VHJA 2F55A 3U44B 1A82A 2H5EA 2IYYA 1OW3B 1UKZA 2H7VA 4ILEA 5TB5A 3Q9LA 2ERXA 4YLGA 4KFTA 1BH2A 2C04A 1YZQA 5JFGA 1G7SA 2ZETA 2ZRNA 1AGPA 2RAPA 3SYNA 3CH4B 4JYBA 2ZRJA 1D5CA 2JGNA 2OFOA 4TMWA 3VR1A 2CE2X 2HJVA 4I1SA 2REXB 4JBWA 1XTQA 3QSYA 5EXSA 3W3ZB 2JLSA 4A4DA 4DSNA 2EQBA 1K8RA 4LC1A 3CNLA 1Z6TA 4C0SA 2HLDA 4WOPA 2DY1A 3WMFA 4P3YA 3I73A 3K0AA 1DO0A 1VIYA 3AVYA 4JL8A 3I3SR 3U7GA 5F9FA 1KO5A 4QHTA 2HXYA 4LHZA 3DHWC 3NDBB 4KHZA 3R7WA 1G4AE 3EZ2A 2CVFA 3RS4A 3QE0A 4QHSA 2RKOA 3FYHA 3D7MA 1WMSA 4OK6A 2OCPA 4CZ2A 4C2TA 1G7CA 5BYKA 3QOFA 5F98A 4DVGA 2RHMA 1KDPA 2ZYUX 3K09C 1KI9A 3I1FA 2PMKA 3GD7A 2RGBA 4I1UA 4PAQA 1T3HA 2HLDD 2RHDA 2W0MA 3LNCA 4OHZA 3AKCA 4ZIRB 2O8BB 2AXNA 1Z22A 4OL0A 3K0FB 2IS2A 3E5HA 2Q9BA 4A6PA 2ZR7A 1Z2CA 4JT2A 1M74A 1E94E 4RFSB 5KSYA 1WA5A 2D4HA 1GOTA 3CF2A 2JATA 3PR1A 3KTAA 2J0UB 1QBKC 2BHRA 3KZ1E 2QQEA 1KY3A 2BM1A 4XOIA 1Q3TA 1ZD9A 4G1UC 2WICA 1KZ7B 2FGJA 4URUR 1M8PA 1XTIA 4CEJA 2O8EB 4XTCS 4FMDB 4JKYA 4Z8YA 5AUOB 4DHEA 1QG4A 3C4JA 3A1WA 3WYAA 2XAUA 4B48A 4HYYA 2CHGA 1CR0A 5HR5A 2UVQA 1TMKA 2ZRIA 4C0BA 1NG1A 3FE2A 2CBZA 3NBYC 5FOSA 2CL0X 5FTLA 1GKYA 1HT2E 4IDPA 4Q1DA 1MV5A 3IO3A 3PUWA 4K81B 5BW8A 1DE0A 4PQYA 2QP3A 2Q21A 1AQUA 3BC1A 1UFQA 2C03A 4LX0A 4XWAA 1W47A 4RY2A 2PLRA 1J8MF 2QAGC 4OBEA 1SVSA 3GJ3A 3P27A 4ABYA 3GFOA 4UNRA 1BMFD 1BS1A 1US8A 3EXAA 1P61B 3GLIA 2H57A 4JBXA 3QJYA 3FHOA 1G6HA 4DCVA 1U8ZA 2GNOA 2QSZA 2BJWA 3RS3A 3I61A 3EASA 5JLJA 2IUTA 1EFUA 4JVLA 1KK3A 1ODFA 1RRGA 1OT3A 1P4SA 4D81A 3I5XA 4CT4B 2FOLA 3B1YA 1EESA 4DXAA 5TXGA 2HF9A 3VR3A 3CB4A 4M0LA 2XZOA 1Z63A 4J0QA 4PPNA 2OUKA 4V0KA 4ZDJA 2XJ9A 2PT7A 1L8QA 4QGFA 1OH7A 2QY9A 1KO1A 3QXJA 5J4LA 3I92A 2ZJZA 1GILA 1LB1B 5DI3A 2HCJB 4TL6A 4PPFA 4URYR 3P26A 1GM5A 1SHKA 1GNPA 3GCGA 3KFXA 3PITA 2EFHB 1EWQA 1WQ1R 3T1TA 5JCZA 2D2FA 2QM7A 2WWGA 1XMJA 2WWWA 4F91B 2ORWA 2OZEA 3A4LA 4RKFA 5HE9A 1SULA 4FMCF 2WMOB 2CJWA 2QMOA 2OCAA 5G3ZA 2GBLC 2WJYA 4TQAA 4BFVA 5J4YA 2WOJA 3E70C 3BB3A 2N42A 3Q72A 1RJ9B 1VYTA 4BFSA 2AK2A 5LD2B 3CNNA 1IN4A 4M1MA 3D6TB 1H8HA 2KWIA 4HAZA 4L8GA 4NCKA 1Z07A 4LYHA 5FBVB 3EWSA 1G19A 4TYWA 1M1YE 2BCJQ 3KDSE 1S0UA 4IW3B 4A8JC 2B8TA 5AWFC 2WHXA 3ZQ6A 6Q21A 4GMDA 3ZS8A 3T1VA 4TN1A 5KO2A 1SZPA 3T5DA 2W2TA 1KI3A 1GITA 3SE0A 3ZZTA 5JZVA 1XMVA 1Q21A 2ZI3A 4NE2A 5CJ2A 2WMNB 3C15C 1KJZA 4TSFA 1H8HD 1DEKA 1N25A 4Q03A 2IYLD 1OFHA 2A30A 2NO7A 2B6HA 2GJKA 2J3EA 2R65A 3TUZC 3OIYA 1CJKC 1YZUA 2V6JA 1ZW6A 1S4QA 4AYWA 3GJ5A 4NL4H 3THYB 5LBIA 1OB5A 1G3IA 4ZDIA 4HB4A 1KTVA 4CEIA 1I4TD 2CDNA 3OFNA 2QRZA 3S1AB 3TK1A 2ANCA 4EJSB 4Z51A 1H65A 4C7OA 4JKIA 3H86A 2EU8A 5CIQA 5GVRA 4MKGA 2NIPA 3LDAA 4QNMA 2XX3A 4HLCA 4C0LA 4DLSA 3OE7A 4Q9KA 3UK6A 3CRMA 4GZMA 4XVQA 4GOXA 4W7SA 4I1VA 1NN1A 1TF5A 5DN6A 2ODEA 1GP2A 1MO3A 2FPKA 2J0VA 3KKQA 3AGPA 3L2OB 4QGGA 4CYMA 1HYQA 3OFND 1DAFA 1E99A 1F3OA 4FMDF 1IXZA 5KDOA 2XJ4A 4F4IA 1P62B 1IN8A 4MITA 1VHTA 2OCYC 2HCBA 4MKIA 1MO6A 3AVPA 2AK3A 1Q57A 4B44A 2WSMA 2IYTA 4MGZR 1U98A 2J0SA 2WOOA 4TTPA 1MO5A 3VHLB 1R0ZA 1JI0A 3X1XA 1J8YF 3A37A 2ZVQX 1QVRA 3VKGA 3BJIC 1ANKA 4CT5A 1XEWX 5DN6D 3WBKA 4OHWA 2KB0A 1E1QD 3BGWA 4U7DA 4HLUC 2L0XA 1HH4A 1ZNZA 1U0HC 4HDCA 1YKSA 1YJ5A 4PC1A 3PQCA 2FNAA 4P33A 4Q7MB 4U00A 3SHWA 2CL7X 2GKSA 3V00A 4B32A 3RSLA 4MKFA 2GF0A 2IA5A 4PC3A 2XGJA 4BZXA 1ESNA 3D8BA 3MUFA 4L5BA 5EE1A 4FCTA 4Z54A 2P0EA 4N0DA 4OQMA 3NBZC 2XTZA 3ZD7A 1SVLA 2OV2A 3DPUA 1MRNA 4P4SA 3MLEA 3V4FA 2F43B 4OI1A 4H1UA 2ZYTX 1NVWQ 3UMFA 3IEUA 2CK3A 2A7QA 2XZLA 4PSAA 1WRBA 2QPOA 4HAYA 3ZVNA 1N3BA 3B8HA 4C0HA 2OILA 4HAWA 4QM6A 2KSQA 2W6IA 5KSZA 2J7PA 2D06A 2IF2A 4PFSA 1D9ZA 5DE3A 3NH6A 2AKAB 2PZFA 4DRZA 1X8JA 4JLOA 1GIAA 1P9WA 2ZI5A 2NO6A 1HT1E 1XWIA 1MO4A 2P2LA 4M21A 3R7WB 1J7KA 4LJ9A 3WRYC 1XEWY 4X8HA 1ZM9A 5E4FA 1HY3A 3WP1B 4QFMA 1EFRD 1KI2A 1IQPA 2X2EA 1NBMD 2D74A 1S96A 2HDNB 1ETUA 1R5NA 4DLZA 2W6ID 3QVUA 1G4UR 4K46A 4P0TA 2OCBA 3OESA 4LHVA 1R0YA 3EA0A 4LJ5A 1X1RA 4NCJA 5ANRB 1FP7A 3ZYCA 5B57C 2CCJA 5KTYA 2R2AA 3LBIA 2QMUA 4Q7LA 5BXQC 3W34A 2A9KA 4ERNA 4ITRC 1MABB 1ZU4A 2R62A 4TMZA 5H1YA 1FMJA 1YQTA 3HP1A 2VLIA 4GL2A 2GCPA 4M2LA 2YNMA 3CZQA 1ZM4A 4URZR 1M2OB 4FI3C 1E32A 4ZV4A 1Z06A 2IYRA 3WHLA 4B2PA 1X1SA 1N6LA 5D3MB 1QHHA 4G5QA 3P4XA 2ZITA 1KSGA 1E9FA 1KO4A 3NEYA 3MFYA 3K09A 3A4MA 4DBLC 4FWTA 2IXGA 1D6JA 4HAVA 1SKYE 4WIAA 4OHXA 4X8OA 1E2QA 5J4VA 3TGPA 1Z29A 2A5FA 2WVJA 5C2JB 2C78A 4Q1CA 3PEWA 3A1VA 4FWIB 2HF8A 3QBTA 1NVUQ 2FMXA 4PO9A 4ZCIA 3U7EB 1FTNA 4TZ0A 1CIPA 2DFKB 4BFYA 4RCYA 1E2LA 1P9NA 2WWYA 2DWQA 3EPKA 1M6NA 1R0XA 3NEJA 1E2JA 2Q9CA 3U4QA 3U60B 1US8B 3ZIAA 3BB4A 1E2GA 5JRZA 1TF7A 3HPQA 2FWRA 4R71A 1JBKA 2ZM5A 2FFHA 1LW7A 3LW7A 4IDOA 2O8DA 4DLXA 2VYFA 4BZPA 4JLNA 1Z28A 3VMFA 4R9UC 3B1ZA 3DDCA 5E7MA 4AD8A 2CLDX 5LDDC 1D9XA 3KUDA 4KXFB 1DAKA 1VDZA 4PHGA 2WWFA 3KB1A 2J45A 2XITA 3TAHA 5P21A 1CU1A 3CWZA 2QPTA 3UKDA 3DZ8A 4N0EA 4V02A 2MSCB 3IIMA 2Y8EA 1BOFA 3ZIAD 3UANA 2I1QA 2XNDA 3HR8A 2QAGA 5J4KA 1CJMA 2DWOA 4V0NA 4DLUA 4OJQA 1RW4A 4OQFA 4KITB 1T6NA 1FOEB 5DI9A 3Q5EA 4B76A 3DEFA 1N6OA 4FCVA 4M8NE 5AUPB 2H18A 4NP6A 1FUUA 1S2MA 3CNOA 2XEXA 3QKSB 4ZKEA 4QJ5A 1J90A 3DOEA 4NH0A 3VKWA 4UJ5A 4PQRA 4F38A 4DB2A 2VTKA 3QPUA 1W46A 2ZTSA 2ATXA 5FOTA 2GVZC 1FL9A 4IOJA 3QPWA 2V55B 4HUQB 1UDWA 2A5GA 5DNYB 1DADA 2PJRA 1DARA 4TT3A 1UF9A 5FTMA 2AN9A 1YE8A 2O8CB 5AJYA 3RS5A 1WE2A 4GNKA 1FTSA 1W4AA 2PJZA 1E9EA 1XD2B 4US2R 3EPLA 1D2MA 3VR2A 5J4HA 1XD9A 3DOFA 2W00A 3CPHA 1CR1A 2C9OA 4C30A 1KJYA 2VIIA 3FMOB 4AURA 1PLLA 3ZGXA 2WPDA 2ZAOA 3M1IA 1CJUC 2ZSEA 5JS7A 2ZE5A 2GBLA 4AY2A 4QGHA 1SVKA 4LYJA 3GLFB 2ORVA 4LV8B 4E5UA 4TT3D 1KK1A 3FKSA 2WAXA 1U8AA 3IKJA 3L0IB 3IGFA 1LFDB 4HUTA 4LJYA 4W5WA 3GLIE 3R8FA 1OFIA 2P3SA 3LA6A 3T1OA 2OFWA 4F93B 2FFBA 3C7KA 3LAWA 2VO1A 3OEEA 1F6BA 1E9RA 1HE1C 1QF9A 2Q6TA 1ZM3A 5HCNA 4A8JA 3ASYA 2WKPA 3EZ9A 5HCIA 4QKQA 2PMDA 4YQFA 2NQ2C 3B1VA 4C0AC 4CW7A 5H70A 1GSIA 5EXTA 4TLCA 3KJHA 2DBYA 5L3SA 2EW1A 4YXWA 5FH9A 2VA8A
chains in the Genus database with same CATH superfamily
3RKSA 2O2CA 1YZTA 1MXFA 2BFPA 2RGRA 1Z5ZA 5DBEX 4YXFA 2ZBUA 2JAQA 1KS2A 1G8YA 3VQTA 3EC1A 4Z1MA 1JZQA 1DOAA 1EFAA 5K3AA 2DERA 2XBMA 4JEIA 4LCJA 1W8DA 3VR6A 2F67A 2X86A 4IYJA 5AKJA 4ZI5A 2NV6A 2TMDA 2BZ1A 1NXTA 1P1HA 3MILA 3OEED 1TJYA 3PGVA 3DNPA 2QYOA 3PKJA 4BLOA 4D9NA 4DIUA 1J0EA 1XQYA 1XZGA 1UKYA 5HJ7A 1X7YA 4MRNA 1CQZA 2B4TO 2AQIA 3B6KA 2HK7A 4QO8A 1E4YA 4JLMA 1PV2A 1NFQA 1E0AA 3LCJA 2I9KA 3UUEA 3H5IA 3WVNA 1VECA 4DF3A 1KU0A 3UB4A 5K7SA 2QN7A 3IX7A 2HSZA 4QU5A 4EYSA 4C0XA 1U0GA 4Q02A 2G0NA 4C0KA 5ES4B 4ZVQA 3IT0A 2I80A 4I3FA 4R6XA 1UBMS 2OXIA 4ENTA 5K8UA 3S1SA 1TUBB 3DBVO 5I7EA 5J5AA 4EEXA 1PSZA 4D9IA 2V65A 2O8FA 5I8PA 1VYVA 1LDBA 2OV1A 4QWWA 2PUAA 1L6RA 3AIKA 3BJZA 4CM1A 4BO6A 1E89A 4N40A 1G1MA 4OMDA 1AUXA 1RIIA 6ABPA 3W3AA 2BVNA 4NMXB 5TDHA 3HCOA 3A1UA 3TD6A 4RIFA 4YN3A 3REGA 1WY5A 3DHVA 3GMSA 3VR4D 1Z7YA 1VCIA 4PU0A 1F60A 4C4PA 3W5AA 2DYKA 3E3NA 4FQ8A 1AIPA 5CB4A 2QZZA 1V3VA 2ZIEA 3TG2A 3NTLA 1KGSA 1UBCA 3A06A 4J8PA 3KYJB 4BVHA 3U1BA 5ARDA 1KYXA 1FYWA 3AEXA 3BHMA 4Y2PA 4BNMA 3OTOB 4ZAXA 2MMCA 3FFXA 1NLZA 4Y6RA 5F2EA 5AJWA 5A02A 1YB7A 5B30A 2CCGA 1XTUA 2A0WA 3D7SA 4LISA 2AKYA 1W36B 5K0NA 4HGOA 1WV1A 2PUBA 4LYFA 4US0R 4L0MA 1SUDA 2DX7A 1JE0A 1ZUHA 2FA9A 1JIQA 1U04A 1IH8A 3HJNA 1GPBA 2D1QA 4G07A 3O4HA 5K0BA 1CUYA 4G2NA 3O8BA 2QJTA 1WZ2A 3KJIA 1DJMA 4RMIA 1ZK3A 2O2HA 2J32A 3ELYA 3ZW8A 5IT5A 2GCOB 3X1WA 3OM8A 3AUYA 3PHJA 4EVIA 4Z9YA 2FW9A 1D6NA 2FMIA 4O2RA 5K3SA 4EFKA 2WABA 1NSYA 2FG6C 3B6ZA 3EDOA 4C22A 2GDZA 4HEJA 2VF7A 4HLDA 3QF4B 3E9ZA 3TBKA 1HG0A 2A0XA 1I7DA 3F9IA 4QGAA 4KE9A 5A0FA 1KO7A 4NMHA 1AHIA 4PANA 1Y3DE 2GX6A 3QITA 4CDRA 2YWBA 3KDPA 4O3MA 4F2GA 3RARA 1M8GA 4HGNA 1WHSB 5IT4A 4YCMA 4AN0A 2C9CA 4L15A 2NP7A 1WDWB 3OPQA 4PZ0A 4BY9E 5IDQA 4BP1A 1RADA 1RWQA 1VLJA 4B7UA 4CKXA 1VHWA 4QUBA 1JB1A 5JD5A 3ANMA 2I4OA 2VOJA 5TRTA 1GGNA 1CUIA 1VHDA 5COBA 2YHBA 3S27A 3ZDCA 2PXAA 2EERA 2XI4A 3ODGA 4OBBA 1ZBQA 3C70A 4LFBB 3GJZA 3H9JA 1C29B 3QX8A 2W2PA 3ED1A 3F5DA 4YRGA 1WMEA 2X13A 3OTHA 2WKQA 2IT1A 4GLLA 1HK7A 2C1XA 4XQ0A 4AKTA 1BJTA 1GSHA 1ZGJA 1U4SA 4V38A 5HILA 2NAFA 4HVTA 4TSRA 5EHQA 3P4UA 3WGQA 2EDAA 1E1RD 4LOAA 4HDRA 5ALQA 4B3IA 3KZVA 3M6UA 4HQ6A 5JSUA 4LX8A 2GHIA 1KJ8A 5CA1A 4OAPA 2FSVC 2FZKA 4I5GA 3GJ0A 3GWZA 4FFRA 4WDQA 3ZK7A 1UOQA 1GNSA 3PT9A 4JLVA 1EFVB 3H99A 3IP6A 4ZAYA 1AHHA 1VFNA 3VNBA 3HDHA 5F7XA 4MS1A 5ESDA 2D3WA 1P39A 6NULA 1SCDA 3FR8A 2W4IA 1SD2A 4MQ4A 2C2ZA 3AZQA 2F64A 3MJRA 3UWMA 2VTDA 2WE7A 4Y3UA 2C59A 1W59A 2CNKA 3PKZA 1USWA 2VQ3A 1U1CA 5SY4A 4B6SA 3QKTA 5C3UA 3OKFA 4LRXA 1U0LA 1X3SA 1YMQA 4GL4A 2GLXA 4MS4B 4JZKA 1ADJA 4CKWB 1K08A 2XVYA 2IEZA 4RSHA 3CJQA 4KMSA 4RVCA 1MENA 1NBWB 1QYCA 1A4UA 1A95A 1KFJB 1V3TA 3CX8A 2J9XB 3NVAA 1TAQA 4RE6A 4UNSA 3WIBA 3D8UA 1JSLA 4BUJA 4F71A 4TMXA 3EX7C 4H59A 2Q2VA 2V4ZA 4IF4A 3BXPA 1OZ0A 1OYWA 3KUKA 2X1HA 3DR3A 5EIAA 3TCNA 4W9MC 2BYTA 10MHA 1ZRSA 1U28A 3WHKA 3EPRA 5I3ZA 3EZNA 4XCVA 1WF3A 4TWZA 5C0OE 1DAMA 1JDVA 3WDKA 4R40A 4FHZA 3RUHA 3N70A 4CVNA 5KCMA 4C3UA 5CDHA 2JS7A 2G5PA 5FBKA 1M1YB 3PX7A 3OTGA 2VG8A 4GAEA 3Q88A 5JJLA 2ICAA 2WHRA 4LE2A 5FYQA 1C0EA 3KHUA 2C00A 4W8GA 3D7KA 4PVCA 1Z6GA 1RLUA 4AYTA 4LSMA 1BE8A 4GI1A 5HTKA 2YWEA 4FD2A 1KMCA 1L7BA 4P7BA 4CKCA 4XRGA 5KOJB 4ID3A 3ZGZA 1SVMA 4H1VA 3AHEA 4L50A 1AQYA 1RWPA 2E37A 2BBOA 1AXEA 2O1EA 2QG6A 4FQ7A 4BO1A 5G0TA 3DWFA 1UXGA 2D4AA 3DMFA 5DH9A 5HVNA 3PG5A 4HEA6 4BO8A 3NRJA 1LTQA 3OA0A 2FB9A 4NOJA 3T1YB 2JGDB 2CDCA 1LBSA 2FMFA 2ZQ5A 2W70A 2E2WA 3R09A 3MWDA 3PUYA 4W5HA 4WSOA 1N5LA 4PC2A 3UOWA 3F4BA 5IH7A 1UBNA 1QR6A 2EWVA 2Q62A 5ELXA 2ET6A 1H8EA 1VDMA 1JQLB 2AXPA 3DBLB 1U8TA 4HI0E 3SP1A 2RAVA 2ZROA 3ZHVA 4C05A 2PAAA 2ZWOA 1QTQA 4X61A 3V7FA 2FEPA 1DJQA 2GCNA 1EK5A 1H6CA 3M4YA 3E8XA 5G0UA 2WU4A 3TIFA 1Q7RA 2H54A 4BWGA 5F1OA 2G4VA 1YC2A 4Z0HO 1Y9JA 4NULA 3V2UA 4JCOA 1L4FA 1MC4A 2BMDA 4HKTA 4Y6QA 1QP0A 4NKRA 5AVSA 4F56A 2FZCA 2HRZA 1Q1QA 1RWVA 4LGYA 4K8RB 4QU8A 2IYNA 1GKLA 4MPJA 5ALXA 2HOQA 1UPTA 2WWIA 4LVOA 4OXIA 5DOZA 4B7CA 5H80A 4PG8A 2DRIA 2PL5A 1KVUA 2GK3A 2Z6QA 4MVWA 3HKDB 4IDHA 5LNK1 4FBLA 4BLUA 3VOBA 2BZ0A 2OV8A 1N0IA 4YJ3B 4CM4B 1RAIA 5LMCA 3UH1A 3DP7A 4X3OA 4RKQA 2AKEA 4KPUB 1NL3A 2I54A 3B9PA 4O59O 1YR8A 3WI7A 3FPHA 4DJDC 3BCSA 4QPCA 3V9PA 5KS2A 3PD0A 4FBMA 3RTBA 4P80A 4GM1A 5LMNB 3JQ7B 4IIYA 4A8JB 2CBGA 4RPJA 3F5MA 2QX4A 1JNYA 2WYWA 5EZYB 4LFCB 1ECFA 1I6WA 4IFTA 3D6FA 3D6AA 4D0GA 4BP9A 5C8XA 1GUBA 2FKAA 1XAJA 2X1VA 1ZS9A 2YV4A 3WQQA 4L72A 3SDSA 2XVMA 2AOUB 2Z04A 4RD2A 2CXPA 2VWQA 2CC2A 3B7WA 3FIUA 3HEMA 4I0WB 1CBUA 1RXVA 3OE4A 1DELA 1PG0A 2Q2OA 2YXDA 4LJ4A 2PA3A 4LWZA 3TFWA 1BGXT 3VI4B 2ZB4A 2IHVA 1KQGA 1FFXB 4CIYA 4UQOA 3OEHD 3MK31 5ABPA 1QUEA 1DO8A 1XTBA 2O2DA 4I4LA 4IV0A 1AQIA 5IAOA 4HZIA 4DA8A 1W2HA 2Z3VA 1HMYA 2PKEA 2QN6A 3EA4A 2QM3A 5DWQA 4KG7A 4LXIA 4MIYA 1N92A 2J9FA 2XUJA 3BXZA 4PSUA 1YVDA 4W9NC 4NG5A 4JBLA 3NMUF 1FDUA 1WVMA 3IQIX 1Z3IX 1YB1A 1PNTA 4G1FA 4UHFA 3M6WA 3RS2A 3BJRA 1RWMA 1ECLA 3IA2A 2QTBA 3QWFA 4GUDA 2QVZX 3RYFB 4I08A 5IT0A 2O14A 4RJ2A 3QKRB 3PEYA 2P4EA 2W6JD 2EF0A 3JAKA 2ZRAA 2IXAA 3VSEA 1GRRA 1NQAO 2O8FB 1A2BA 2FSGA 3VH2A 3DDSA 4CTMA 1QFSA 2YMPA 4ZHQA 3D4BA 1G6OA 3IBYA 4W1QA 5FOWA 3PNVA 3ZCQA 4A26A 2FN3A 4LPSA 5EE0A 1GHTA 1EJ0A 1OY1A 1MJHA 4FNGA 4HTFB 3VR0A 1UBRS 2AJ8A 3KXDA 3VMMA 5AQ1A 1VCNA 5JVDA 1FFYA 4DRXA 2X15A 4IVQA 1TCCA 2V98A 4FN5A 1PX0A 3RTAA 2O0HA 4HPJB 2QRPA 4IKEA 2Q6IA 1PT9A 5D85A 2CJYA 3SEAA 1U9IA 3JQDA 2OYRA 4EJ2A 3UWSA 4Z2AA 1W73A 3H5LA 3ND6A 5F3RA 1W4LA 2PFGA 5K2MA 1D07A 2X42A 2I4LA 3EGIA 3H2GA 1LPAB 3UK0A 3THXB 4MI6A 4Q00A 4XDZA 3ZIUA 1ZP6A 2DWUA 2NU6A 4KFSA 1FJXA 5ERYA 5FO1A 2BWJA 3B7PA 1N5JA 3SPXA 1OF1A 4BVFA 4WK4B 4QECA 1TZCA 1KEUA 2WTXA 1FX0A 3FR7A 4NBVA 2A9RA 3ADBA 4UPVA 4TOIA 3I5UA 4KAJA 2FPLA 1V3QE 4JLBA 1NDUA 4G4IA 1WB9A 3QSGA 2GZMA 2C9ZA 1HDYA 4S2UA 3H4IA 4K26A 1RYHA 4BV8A 4MWZA 1CY7A 5B3KA 4FW8A 1GZDA 2R7AA 2Q1XA 3A1TA 2AG8A 4R9NA 2QLMA 3UA3A 1QYRA 1SPBS 3QTBA 4RYLA 4AKSA 3DXYA 1NY6A 1CUFA 2I78A 2PLWA 4WKCA 3TL6A 5L6LB 1Q15A 1Z35A 3RTEA 2BM9A 5BN3A 4IR7A 4W9RA 4C5AA 4LMRA 1IOLA 1JR3A 2P9QA 4MV4A 2OB2A 4DILA 2G4CA 4I55B 5ES3A 2JZOA 4X24A 3H3JA 3NFYA 2E4WA 2YN2A 1WCWA 3U3JA 5L7WA 1N2CA 3DB2A 5A3JA 2UKDA 4IUCS 1ENZA 2HLPA 5IC4A 3JD2A 1TTPB 4EUSA 5JLAA 1UBJS 2JB9A 1CY2A 2XCIA 5HIIA 4B2YA 2FHSA 2EQ5A 4R9RA 4W5NA 1J70A 1YB6A 4DWOA 5T4EA 2YJTD 4BEVA 3SNKA 4EZBA 5TY0A 1EVEA 1LSOA 1U3GA 1WZEA 3GO4A 4JUAA 1CERA 1Z6XA 4L6IA 3TRHA 1N57A 2ZXFA 1XL0A 1E9SA 2MSLA 3K9LA 1SOAA 1NBMA 1JQBA 2R6GA 3NIDB 1LI5A 4IH1A 4R69A 2HA5A 4MQ6A 4UHKA 3T3GA 1TX4B 2NQTA 3BXXA 2RSLA 2CJFA 3PQDA 1ZCBA 2IUUA 4IX9A 3U37A 1Y5RA 4HDRB 3PPYA 4HYQA 4Q7JB 4QGBA 5KDLA 2OPHA 4D3SA 4EI7A 1AK9A 1O0SA 2WDZA 4RIHA 4EFLA 1SVIA 3MD0A 1F5NA 3JVUA 3LX8A 2NO1A 4NBKA 4AY3A 4YV1A 1LI7A 4MUNA 3ML1A 4GT1A 1QZTA 1WY7A 2AEJA 3KLMX 5T7BA 3ZVMA 4QG7A 2QTVA 3R3XA 4MS1B 3QRWA 5F9MA 1X42A 4P2GA 3SJZA 4CETA 2CF6A 3IT3A 1L7DA 2NOAA 3ODPA 5KQSA 4LDZA 4UHHA 2IU3A 5HTOA 4D3XA 2F1HA 3SYTA 2C5BA 3QKWA 2ONCA 1WDKA 2OTCA 2RJ3A 3L8GA 1AO0A 2ZI4A 4LDQA 1ZD2P 2VHCA 3DKVA 3R77A 4FJ2A 1XN4A 1XCPA 5J1SB 1VL5A 1ZU5A 1CUXA 3NHYA 4J4HA 1KZ6A 4LBVA 4Y2RA 4KPYA 1JPVA 5T57A 3WWZA 4U7GA 3TR6A 5BW5A 4URXR 1B8PA 4J0CA 4AMUA 3DOOA 5JCPA 1RQ2A 5KVAA 4DPMA 2BFBB 2IHZA 3D4LA 4RWZA 1NDQA 5K0EA 2J3DA 4KN8A 4NBTA 5A05A 3ZQKA 2XCSB 2V6IA 3TW0A 1T9HA 1HNNA 2FQXA 3ITNA 3LL7A 3BCRA 4WZAA 4YLEA 1J2JA 1A0OA 1Y4UA 2R85A 3WSTA 5T67A 3RVPA 4FE4A 4PPQA 1XRNA 2VH5R 3E81A 2D7CA 3EGCA 3KTAB 2I2XB 2H48A 3MRSA 3SBXA 3WWOA 3KJEA 3I6BA 4BNLA 5E3HA 1QYDA 4MPRA 4UVGA 2PS1A 4M9RA 2OOKA 5GM1A 4KQFA 4L7QA 4W5QA 221PA 3X3HA 4AZ3A 2Z8YA 2C4UA 2CNNA 4MGIR 1AG9A 2DHQA 3A3OA 5KOHA 1IVNA 2DU8A 5AUQA 1UBLS 1E6KA 3AEQB 3X1ZA 1IZZA 5H68A 1JJ7A 1QLWA 2QMEA 4I4TA 3T15A 4Y2UA 1VHQA 4A5OA 3PENA 3HBFA 2B20A 2HFJA 2BDTA 2KBEA 5CA0A 3GEMA 3RFFA 2OKCA 4MWBA 1SIWA 3BQMB 1EWKA 2IE8A 4KQIA 2HWUA 4QDOA 2G04A 3WGHA 1HEIA 5IUJC 4X20A 1WCV1 5GV8A 4AX8A 3WFJA 2YN0A 2B1IA 3H2KA 2WTBA 3ET5A 3MS7A 4II3A 5GZ6A 4BN0A 4D9GA 4KLCA 4QXRA 1M0EA 2PU5A 1T5DX 4QYMA 4MO9A 5F33A 4A6XA 5H3CA 1T5LA 2G88A 1GA1A 5CEJA 2J3KA 1OTHA 4QOSA 4LTDA 3JALA 1YL5A 3RVJA 1LU9A 4MQUA 3ZWBA 3AX6A 3D54D 3FPJA 3V7UA 3OCVA 4CF4A 5K0SA 1PS0A 4I4NA 3ZCXA 1J23A 1CX9B 3NDIA 3PQ6A 5EQTA 1Z7GA 1CS0A 2ZUUA 4GZ3A 1RHQA 1P1RA 3HACA 1NQOA 2IY8A 4OLHA 4KWCA 2RE8A 2JIBA 3TSZA 1MNQA 3KELA 5THKA 3QX3A 5TSDA 5KU1A 1Q0PA 3RAFC 4GRIA 4ZYVA 1C30A 1NNI1 1WXWA 4IHJF 5K0FA 3B85A 2JAWA 2QTAA 2FAXA 3Q41A 2G63A 2P4UA 1JXAA 2E82A 3H75A 3CF4G 4ZOAA 2CFSA 4GPIB 4GO1A 4RORA 4HSEA 3T94A 1WPQA 1UWKA 3EAGA 3KQWA 4Q9IA 3WLQA 2D5CA 3OOYA 4FOPA 2IIBA 2GR9A 3PFIA 1DCFA 5IAEA 5EI5A 2CDRA 4WLEA 1SJ9A 5JBNA 2G9UA 5K05A 2XWBF 5CH5A 2Y77A 2ZAIA 2ZIZA 4HQLA 4RD1A 2AN3A 4B3HA 1SUEA 2CE7A 4WBSA 5DRTA 5IBRA 1AUVA 3LF1A 5D3KA 4KR7A 1GQYA 3HZZA 3D1JA 4OB8A 3T4XA 1YR3A 3PDUA 3IYLW 3ONFA 1ONBA 1YZFA 3STWA 5BV8A 3IVAA 3GCZA 1GDHA 3ETCA 5A9TA 2WY2D 3FSGD 3ZBQA 4KVFA 2O2GA 1YF3A 1Y3FE 1Y82A 3VC3A 3KYIB 5E8RA 4U5QA 3UJCA 2CJWB 4XXHA 2WV9A 4DMUB 1TZMA 3I1YA 4KK4A 4TTSA 1S5PA 1OTYA 5CYOA 5I8ZA 2X9GA 1GQQA 1OXVA 1NGSA 1ZN8A 3B53X 1EIZA 5BV2P 4J0GA 5CXXA 4FGUA 3CU5A 4MYRA 3FUCA 4IQFA 4ALIA 4ZC1A 3BHJA 2H7YA 3D3EA 3DEJA 3HWX1 2A94A 3K8QA 5AW6A 2A58A 1P6XA 1IHOA 1VHLA 5G53C 1W7AA 5DLDA 2XB8A 1ZC4A 2Q0SA 3CZAA 3UYLA 4ZA2A 5E9WA 3OZUA 2YMLA 3CSDA 4QEKA 1HNWB 1DEAA 4HV4A 1BDIA 4S12A 2VTEA 1TOAA 1OV4A 1B26A 3JR7A 3BKXA 3NHBA 3WRXC 5H4GA 3DBIA 5J2UA 5IKMA 1E2DA 3QG1A 5HK9A 3CF0A 3QENA 1P9LA 1DC8A 1XKLA 1QH0A 3TL2A 2IVZA 1NYTA 4C7JA 5HJEA 1ITZA 1CRQA 4X3PA 1FC0A 3HJHA 5EPOA 4LHEA 3QFSA 1L5GB 3WLEA 1ZKDA 2PKQP 3W6OA 3ZC3A 3W4IA 3R44A 2P41A 1TLTA 1CDOA 2N75A 2W2QA 3IIEA 1VSBA 3D1LA 3EG9B 2PT6A 3BL5A 1ULTA 2IPOA 2B5WA 2VJLA 4OA8A 5FWNA 3IIJA 3K92A 3PD1A 4M1ZA 2CCKA 1EDZA 1NRJB 2G25A 4PZ9A 3RCBA 4J29A 3H83A 4BMYA 3P32A 3C45A 1U2SA 1YQUA 3T9EA 1Q2UA 1ZPDA 4H31A 1GG9A 2CLCX 2QRUA 1CEYA 1SKAA 1Q6YA 5E0OA 4C7OB 1CY0A 2GBCA 2IF0A 4LNAA 1FEZA 2HU7A 4W9NA 3N2KB 3D3KA 1M66A 2VT6A 5CGZA 3G0IA 5DV9A 3R24A 7REQA 2O7NA 4X85A 2ZQYA 4HF7A 3G5TA 3FVQA 5DIZA 3C5CA 3DYVA 1LF0A 1Z5GA 4ZDKA 2Y71A 1M6WA 5AK4A 3V4LA 3LBNA 3N74A 4M9SA 2GN8A 1PT6A 3SX0A 3ZKWA 1YR2A 2V9CA 4CQMA 2GJ8A 1JLKA 1NJGA 1KDYA 1KK2A 2D54A 2BFFA 1YZNA 2GBPA 3IXQA 3O84A 3ZZ1A 2G1PA 2WF5A 4JI8B 1UPCA 2YHSA 1FX0B 4MV9A 3B82A 5HQ3A 5K09A 2ZR0A 1SEVA 3CZMA 3FBWA 4XX0A 3ER8A 1VG1A 3MWLA 4AX4A 3PWZA 2HA0A 3RG2A 3E3MA 5TPZD 1ZCZA 3L8ZA 1VBKA 4W5TA 1XLVA 4I5FA 4IGAA 5I9NA 4INOA 1NXXA 1E3DA 2GN6A 2ZYDA 1Z13A 2F6RA 3LGAA 3KKEA 1FNCA 2ZRBA 4BLRA 1MPXA 2OM2A 3U4AA 2YHIB 4OOEA 1JKJB 1B74A 4MMXB 4GKKB 4C6TB 2LE0A 1EHIA 1JKMA 2BMJA 2V5VA 1VGQA 3IP8A 3IOEA 1J56A 3G2QA 3OF5A 1XHLA 1CWUA 4R3WA 2DMRA 4XE5A 4BU1A 1U2TA 1V2HE 2G3YA 2PL3A 5A6SA 3AF2A 2GCGA 1JG4A 1H94A 4MXDA 3ASUA 4L6CA 4N12A 5FA8A 8GPBA 5TX7A 4LGCA 4BNFA 2Z5LA 3DONA 1N2CB 5E6RA 3WOHA 4G0YA 2G83A 3JQGA 1U63A 4HGYA 4C29A 3AWDA 3EXFA 3W2IA 1YBHA 4NSNA 5I7WA 2QW0X 5EP3A 4LIPD 1HEUA 4NBWA 2WR8A 4RK0A 2POCA 1RE0A 4LF8B 1WCIA 2P1DA 2YDXA 1MGPA 2Z2ZA 3Q11A 5JTTA 2ZYGA 5HPYB 4WERA 3A10A 5EMLA 1XPOA 3SZ3A 2V6FA 1JQDA 3L0YA 2B3TA 4L5IA 3HMQA 1PUJA 3KJNA 4E30A 3BTVA 1Y37A 4OHCA 4YEDA 4AO8A 1ZJ5A 4DLYA 1JTVA 1E69A 3PNQA 1P0MA 3M83A 4A8PA 1RQGA 1HQYE 2NAPA 3TOCA 5HKKA 2RCNA 2VDVE 3T95A 2DM6A 5BR8B 1A4RA 3BM5A 3NUZA 4EF6A 2CXRA 3W2TA 4XZ3A 1UFRA 1EM6A 2QTVB 2YJGA 5KJEA 3TG8A 2AZXA 2VNAA 4UHJA 1CY8A 3BSFA 1Y89A 4UM8B 3REQA 3T7SA 3V4PB 2WT9A 2WJJA 2J5RA 1AD2A 1D1PA 4L5YA 3FXAA 1XQVA 2ORED 1AQ6A 5DIFA 5FL7A 5IF9A 2PZLA 4GE0A 3ETLA 5LUAA 1JA0A 4IBOA 1UC5B 1YHYA 4BQPA 3OTQA 1N6IA 1NXWA 1F51E 1OLUB 1ZIPA 5KJFA 1MEEA 3NHFA 2LW7A 1E3WB 2VT7A 4P6VF 2Y9MB 3U4CA 3ZOKA 1CFJA 5JC8A 3FOZA 3DMGA 3TECE 2SBTA 5I7UA 5U4QA 3REFA 2OK7A 3TTXA 4G97A 1SQ5A 3GNTA 4JBYA 1EG7A 2J6BA 3OVMA 3BFPA 4U5XA 3VKHA 1IMJA 3QI2A 2QM8A 3GNLA 4JI2B 3BTUA 4KBYA 3RC9A 4PLGA 5KOYA 1EA7A 2ZGVA 4K05A 4QUIA 3UHJA 3IOCA 1R0RE 2C2HA 1BCRB 2XNSA 3COSA 4RJIA 4HAIA 4TVSA 2HR1A 2EFEB 2ATVA 4LBZA 4QRHA 1I1NA 3SF8B 2ZIXB 1FDRA 1XQWA 3GVHA 3X43A 3CWQA 3O31A 3DKIA 5EINA 4AZ3B 2L42A 3RC8A 3WZLA 3BWCA 3JZIA 3I4CA 4DW8A 1OXKB 2F1KA 2ZTLA 1Z4IA 1XNGA 3SSNA 5KOHB 2BFCA 3HM9A 1NONA 2WTUA 1PLKA 4YBZA 5FTNA 1F12A 1BYIA 5JMTA 4IZIA 2B94A 2HMWA 4DJTA 4JVNA 4IH9A 3TLXA 4B84A 1QAQA 1NI4A 1A3CA 1SEPA 2EHDA 2Q9AA 4DS3A 1G6Q1 2WVAA 4IDBA 3I76A 2XIJA 3GQBA 5JPIA 4XKJA 4O4JA 2NP6A 5JEEA 1EFTA 1T1GA 1T4CA 4MIOA 2BI7A 4E31A 2FH5B 4I50B 1ULBA 5EJMA 2E4VA 1QH8A 1YK0A 2Y0CA 3I0NA 4X20B 3KJFA 4XUCA 3WNZA 1JAIA 2I99A 1IHXA 3L43A 1KZ9A 1XTJA 4UNIA 4LV5B 3V4SA 5AXDA 2JI7A 2ZW9A 1QB7A 4DCUA 1EGMB 1LX6A 1VMIA 3L01A 3WP0A 4ZK2A 1T4MA 2J67A 3SEZA 1FDIA 3ZNQA 5JNVA 2GFQA 2WD7A 4EBBA 3QLEA 3OJCA 4Q3KA 2DFLA 5BWCA 4CI9A 1CUZA 1SKQA 1Q1BA 3CGGA 3WGMA 2ZJ4A 2VDJA 1JIJA 4BNYA 2DT8A 4QAJA 3OZ7A 3HSYA 2HBQA 1NKTA 2X3YA 4Y9UA 5EPUA 5JCOA 2VK2A 1DBVO 3L0PA 3IA7A 3Q3HA 5D7BA 4P4GA 4OQPA 3TOSA 4E5MA 5JS1A 3DLAA 2XMQA 3A9RA 4MKHA 5A5VA 1YL7A 2O8DB 2H4ZA 3CVOA 2ZSUA 2EJBA 3OZWA 5COQA 3U3MA 2Z5VA 3HZRA 1Z8FA 1USIA 4REMA 1YIOA 2VF2A 3AJEA 4XLZA 1PWHA 5G1PA 5CYPA 4OHRA 1GGHA 1YZGA 3D0OA 4ZQGA 1RVDA 4C01A 4Z5XA 5IHPA 2LCFA 4EL5A 3M4XA 3PC2A 3H5RA 4EHHA 1X7ZA 2BFDA 4B3MB 1AY0A 3GEIA 2VKTA 1K2VN 3AUKA 4Q1FA 2W98A 3TTVA 3EVBA 4CKYA 2FUG6 2CGEA 3B3QA 3DAHA 4UCXA 4TS4A 1DC7A 4FCCA 1E5DA 1JT2A 1ARZA 3QWIA 1SC4A 1SCKA 3D0QA 5FPQA 1NV8A 4PLHA 4GLBA 2Y05A 3DL2A 5AM2A 2ZYVX 1Y63A 1M2OA 1XCLA 1T2CA 3AU9A 4G84A 4IJUA 4UM7A 4NIMA 2UV8A 3QVKA 4FFWA 5CX1A 2JAUA 3F3YA 1M2GA 3CKYA 3BXGA 4V1CB 3OQHA 3B6JA 2PH3A 3R3JA 4DXDA 3PGLA 1FRFS 3GOQA 3O2QB 4HUJA 4QDTA 4P81A 5EIHA 1OXUA 3L1VA 4U63A 1WB4A 3OZVA 4KV9A 3UVEA 1OPXA 3CJRA 4FZ3A 4TTTS 4RDXA 2G40A 2J0EA 2PT5A 1RPJA 1GAWA 1V43A 2AE1A 1SH7A 5IVKA 5I7RA 1ZI8A 4N9QA 1BCSA 3E9DA 1F1JA 4HH0A 1IXSB 2J3QA 4Q37A 2Y1WA 4M7OA 5TMDA 1YVEI 4H7EA 1R0WA 2Y1OA 3HFJA 4U8GA 5IK2A 3DDZX 2HYIC 3ICEA 5J2UB 3RC1A 1LZLA 4J9VA 1UWVA 3HVIA 4F2WA 1FYVA 3ZY3A 4X54A 4E1BA 2O3UA 1ISJA 4LEIA 3T4PA 5CLJA 4AQYB 2EKPA 2GM9A 1GGVA 3K9BA 1NLMA 1SHZA 2W6NA 4WFIA 2AWNA 3OFKA 1P2TA 4JI4B 1Q44A 3FDFA 4MJ7A 4NJMB 3FJYA 4UM9D 1N1GA 1YNSA 2A59A 4PO8A 4XTRA 1B23P 1GL9B 4J4TA 3ZV6A 3KWFA 1LLUA 2BISA 2D2EA 2QQ5A 1PUIA 1NBIA 1OAOC 4GF5A 4D99A 2JJ2A 2JVKA 1TQ6A 2A14A 2ZWPA 1Y9DA 3IEIA 3MTAA 2JCVA 2AQKA 3MQFA 4GI3A 1JEOA 1AGNA 1E2PA 4PONA 5DYTA 4WBNF 4WY5A 2MSNA 5CITA 4MVJA 1GGEA 5FR2A 1K6MA 2ROQA 4FM9A 2AI2A 3IEVA 4E88A 5LQCA 2ZUTA 3HR4A 8OHMA 4FFBB 2GZDA 2PRSA 2GHQA 1Q6ZA 2JFHA 4I3GA 1EWTA 1HFEL 2CFCA 2D0IA 4PCLA 3UAVA 1LS1A 2RI1A 3HYSA 4JJAA 4P35A 5ENVA 4BEJA 4MDYA 1JR6A 5AM1A 7REQB 2R87A 5ERGB 1IIBA 4JODA 1HNZB 3FJ1A 3H1BA 5IP5A 4RDHA 4YCAA 5ITWA 1AZLA 1VKOA 5B7NA 2JD1A 4AP5A 2BCGY 1V9SA 4FWBA 4CGYA 1QHXA 1T2DA 1P31A 2NXEA 3KTOA 3R0IA 3T1NA 5DTQA 1YS7A 1UKAA 4JEUA 4B2LA 5KQLA 4RE5A 3V1KA 1Y80A 2HA3A 3A6FA 5HQ3B 5MN5A 5MN4A 2ZDHA 3OP1A 2XQVA 4YPFA 3VPHA 1TXGA 1BHSA 3HVHA 3CURA 4L08A 3I39X 3TZHA 3UJBA 2AD1A 2JJ1A 4MWOA 4UOZA 1A77A 1XZAA 2AQ8A 2QQGA 3K20A 2JCBA 1RXYA 1NNLA 1VLVA 4FYJA 3ZEIA 1NIPA 3L7YA 5JBQA 2QTZA 5EN4A 1D6MA 2WHPB 4MARA 5DDIP 4WHMA 3OP4A 2C1EA 3COVA 4ZDWA 2R25B 1MC1A 1ZHFA 3NIBA 3ROGA 4JP1A 1IOZA 5DM0A 2OE2A 4DQVA 4YMHA 3WFZA 2BGUA 1AKQA 2J4FA 3BFVA 4DUGD 4MEBA 5A6SB 5M7EA 2Q1SA 3T34A 3QV2A 4LAFA 4YFYA 1FFHA 4G1EB 4AY4A 2C2XA 3RABA 5LD2C 2I8AA 4R51A 2IWHA 4JU9A 3WK6A 2DULA 4BE4A 1YBFA 2NO9A 2C8JA 1MGOA 1LPMA 3EXFB 1A96A 4WZZA 4B4UA 3A4VA 2FGKA 3I6ZA 4GWGA 4ZZ3A 2GZSA 2ZJ3A 1WJGA 4PYRA 4IDCA 5C81A 3T1HB 3GLFA 1RPZA 4G65A 4FC6A 4IMRA 3OO1A 4A91A 2AFVA 2FZEA 5CTAA 2VCHA 5FOQA 1SN7A 1OVMA 4W8OA 1C1HA 3SKYA 3HRKA 1S3IA 4RPGA 1RMYA 4N3AA 5DM60 5HOEA 2XB9A 3WY9A 3UK1A 1W5EA 3H42B 4D6XA 1ESDA 3B9QA 2IYWA 1QQBA 2OO5A 3WAJA 5K1ZA 1GCGA 1Q74A 2IYXA 3FTNA 3GRKA 1Q1AA 1SELA 1U0FA 3FRHA 3HXTA 3D4IA 1DAIA 1KK0A 3OF2A 3PUZA 3UGQA 1C7QA 3A6KA 3HHEA 2CL6X 3KHSA 1N6HA 1WMDA 1UMDA 2G70A 4HFRA 1KKLA 1MX5A 1UIRA 3DXZA 5EQJB 3NOQA 1UZAA 4D44A 1RM0A 3IAXA 1K63A 1M2EA 4D3YA 1PEDA 4UZFA 3R9WA 1R3DA 3FFAA 3JRWA 3OIVA 4ECEA 1V8BA 3ZWWA 4RTQA 1PZFA 1SA0A 1GKUB 3VBCA 4K5QA 3HL4A 4AIIA 1F2UA 2XNHA 2A1TR 3TF5A 4TL8A 4F4CA 1PRYA 2HH9A 4LYGA 2ZSFA 2ACVA 5J40A 4YDQA 2F1RA 3VAAA 5A4FS 1ECPA 3E2PA 2Q7DA 4EW3A 3O9MA 3MMPA 5T8KA 821PA 4DR5B 3K73O 3KJXA 1A1SA 3C3PA 3ND9A 3HYRA 4F4JA 2ZM5A 3MOSA 4B43A 3DE0X 1JDPA 1Z56C 3SF0A 1SR8A 3DZKA 3VNQA 4G8CA 1GADO 3T9AA 3R5HA 4BNJA 1OB2A 5AT1A 3JQEA 1ZNXA 1YFJA 3R20A 4QUAA 4I99A 5HP4A 2XRZA 1DDGA 4AJNA 4CI0B 3DFIA 3TQCA 2CB0A 3GDWA 3ONWA 1CY4A 1E8MA 2PGXA 3CX4A 4M4SA 1T9GR 3VZRA 4DSOA 1WZUA 4WY8A 4B46A 5BW4A 4IG4A 2V3VA 1SOUA 4U1RA 3S5JA 3O26A 1JN0A 2RI6A 3BS4A 2H4WA 3DE5X 3AR9A 1Z15A 4AJHA 1FP6A 3CW9A 4JOCA 2OFFA 1MR3F 3ILSA 3PFCA 4PHFA 2BFNA 4PO3X 1TZ2A 2XXAB 3G8YA 3K2IA 4DKXA 5KI6A 1YMVA 1T4CB 5C18A 1DWOA 5I5GA 3DFMA 3ETEA 2JLWA 1QH8B 3DZIA 1TCAA 2PLAA 4UPDA 1VBMA 1TO2E 1NJ8A 2JGIA 3CPEA 3ZDQA 3K05A 3PNLA 4PLWA 2ORYA 1VI2A 1XZMA 1UJMA 1KFKB 1PHRA 1XU4A 1QTNA 4JJGA 3RTGA 4BLTA 5BSKA 3ZK8A 1RZRA 1NKVA 2JEZA 1ZGCA 4ZEMA 5DCYA 2G17A 2J4DA 2NTVA 1XCOA 4UARA 1BE1A 4C3ZA 1GNLA 1OA0A 2R60A 3HBJA 4RACA 4WKBA 1Z0JA 2ZRQA 4R84A 3FGPA 3N2YA 1Z0UA 4URHA 1FBTA 3PIDA 4V0ME 1Z83A 1DNPA 1NE7A 2HEGA 2ZJBA 2CEAA 5JXJA 5DNAA 1EEHA 1WS6A 2UZ1B 1C0LA 3WIUA 4EAAA 4RVOA 3I28A 5EP2A 4MPDA 5G0WA 621PA 2CK3D 1OBVA 3TZCA 2NYVA 2X0NA 2RHRA 1Y1TA 2YMQA 3ZDAA 2Z56A 3COWA 3Q7QA 1LUAA 2NUPA 3DLTA 1KPGA 1C7RA 2V6GA 3OE1A 5TQJA 3LCUA 4R8VA 5DB4A 4PIPA 1UXOA 2EARA 2WJHA 1XD8A 3H04A 3N7AA 4MICA 2PZMA 2QX9A 3RRMA 2H1IA 3LQKA 4C03A 2O7RA 4EF4A 1TZKA 5BUQA 2X2PA 2BFDB 4PN7A 3F8TA 1F48A 1PD1A 4F5ZA 3MPUA 1MRSA 4DYVA 3ICQB 1GNQA 5G4KA 2H16A 1RI2A 3OM0A 4TQ9A 4QSMA 2CV2A 3HJTA 2QWXA 3VZBA 3M4ZA 3ZGLA 7ABPA 4PO1A 1ZD3A 2VHEA 4EELA 1UQTA 3DVSX 5EXDA 3V4OA 2NVOA 4JKOA