4ZI5A

Crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
239
structure length
239
Chain Sequence
b'GAMTARKVDYTDGATRCIGEFHWDEGKSGPRPGVVVFPEAFGLNDHAKERARRLADLGFAALAADMHGDAQVFDAASLSSTIQGYYGDRAHWRRRAQAALDALTAQPEVDGSKVAAIGFCFGGATCLELARTGAPLTAIVTFHGGLLPEMAGDAGRIQSSVLVCHGADDPLVQDETMKAVMDEFRRDKVDWQVLYLGNAVHSFTDPLAGSHGIPGLAYDATAEARSWTAMCNLFSELFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P91
publication title Ultrahigh-throughput discovery of promiscuous enzymes by picodroplet functional metagenomics.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
total genus 81
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2015-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zi5A00
2EEPA 2PPLA 2GYWA 1QTIA 1CR6A 3G0BA 4FFVA 5DNVA 2WIGA 3DOIA 1AKNA 5CXXA 3F9CA 4KAFA 4JH0A 2XLCA 5AI0A 3FNBA 3ZI7A 3M83A 4X6YA 4EZIA 1Y37A 2ZJFA 3QYJA 4M0MA 4C88A 1CUUA 4NZZA 4B80A 4BVKA 4MEBA 1R50A 1W1IA 2GBIA 3V9AA 1HKHA 1SOMA 3RARA 1UOQA 4UBMA 5LZ9A 2H7XA 3FCYA 3SK0A 3ICWA 3GZJA 1BCRA 5SYNA 4B6GA 1EI9A 3H2JA 1QE3A 4J7AA 2CKMA 5CBKA 3PE6A 4Y9SA 2V9ZA 3EQ9A 1LLFA 3C6BA 3FAKA 2XMQA 1KU6A 1XZCA 3C6YA 2Z3ZA 4HVTA 5IVHA 2XQIA 5HKBA 3ANSA 1XLVA 1Y7HA 1WHTA 5DLPA 2IITA 2JGMA 1G5FA 3G9XA 1WPXA 4WY5A 4X97A 2ZSIA 3PICA 4KRXA 3C87A 1NU6A 2HL6A 5EIHA 3OOSA 4J0KA 5AKJA 3IA2A 3IIIA 4XVCA 4AZ0A 2HA3A 4Q82A 1BROA 1ORWA 1UKCA 1GQRA 3LLCA 4F5ZA 1MX1A 5JD5A 4H7JA 3AZOA 2WFZA 5ALMA 5F4ZA 2W22A 4KE9A 1JJBA 1GKKA 2XUGA 1ODTC 1CLEA 4KRYA 5KREA 2AJDA 3IUQA 4Y7DA 1IVYA 1MPXA 5AM3A 3FOBA 4BB0A 3CXUA 3TJMA 1GXSA 3DYIA 3FLBA 1DWQA 1VZ2A 4S0XA 2J4FA 4JEIA 4AX4A 3G7NA 3DEAA 3AIKA 3I6MA 3WJ1A 1YASA 2VAXA 4BRSA 4Q3OA 3PFCA 2J3DA 4K6KA 1R9MA 4WY8A 5IVKA 3C5VA 1MTZA 1CUBA 1U4NA 1QZ3A 3WWCA 1Z68A 1RWQA 1VZ3A 2QR5A 3OC0A 4ZI5A 1W75A 4BYMA 4P9NA 1YA8A 2RHWA 2Y6VA 4PF1A 4EY8A 4MQLA 4G8DA 4BAUA 3ICVA 2H1IA 2C5GA 3AJAA 2HA5A 3PUHA 2R8BA 3H04A 3OPMA 3WL5A 4X92A 4YASA 2O2HA 2QT9A 1EDEA 3KXPA 5HK8A 1P0PA 1PV1A 3HXKA 1CVLA 1QIKA 4OU5A 3D0KA 4C4YA 4GW3A 4B85A 2XMGA 5E4JA 4K2AA 2GBCA 4FBMA 3G9TA 4Y2PA 1DT3A 1QTRA 1P0MA 2EDAA 4M0EA 3WMRA 1UXOA 1ZJ5A 4W1PA 2JIDA 5DJ5A 4B82A 1QO9A 3BIWA 1LPSA 1THTA 1EXWA 1CUVA 1BRTA 5T4EA 4UBKA 1TRHA 3TGLA 1OILA 5E4TA 4LIPD 4Q05A 3ESAA 3DD5A 3I6YA 2XUFA 4J0DA 2FUKA 3C5WP 1W76A 3DJYA 3MUOA 3VDXA 1CUYA 1R3DA 3RKSA 2WIJA 2XQFA 1FFDA 1FFEA 5K3EA 4X71A 5FRDA 2AXEA 1MNAA 4OB8A 2OAGA 1EK2A 2ZYIA 4KE8A 2VF2A 5FLKA 3PUIA 1XZKA 4KE6A 1DQZA 4QDOA 1B6GA 1SCKA 3K9BA 2WUGA 3D2BA 3QH4A 3R41A 3WQHA 2XB6A 4KJXA 4L9AA 5FP0A 1GPLA 3D3NA 1ZI8A 3OG9A 1N5RA 3OURA 1MAAA 5AI5A 1CUFA 2C5FA 1CUCA 4F0JA 5EIEA 1ZIXA 2V98A 3BE8A 3GELA 4GXNA 2CEKA 1XQYA 4CFSA 1TK3A 1OCEA 1CUDA 5ALJA 1VE7A 2LIPA 2BJHA 3C70A 1JI3A 4GLBA 4N5HX 2JGKA 3ESDA 4BE9A 1UFOA 4INZA 4X94A 5JAUA 1L7QA 4UHFA 1BCSA 5K3FB 4RE6A 5K3AA 2R11A 3R3UA 1XZMA 3OTQA 2P8SA 1F6WA 5FPPA 2WFMA 5JASA 3C8DA 3H1AA 3VJLA 1YAJA 2CZQA 3V1KA 2WHRA 5D6OA 5EHXA 4I4CA 4GDMA 3BL8A 4U2BA 3F97A 3AFIA 5AM0A 4DYHA 2ACKA 4D9JA 2B61A 1FJ2A 4UFPA 1C4XA 4FMPA 1ZGBA 1A88A 1ZD4A 1XRQA 1UWCA 1RYYA 3F8SA 2XUKA 2H9YA 4JNCA 5ALPA 2OXEA 3HC7A 5AM2A 3G02A 1YR2A 1H23A 4MWTA 2VJCA 1ACJA 1J2EA 5LZ7A 3WK5A 3A2NA 5HF6A 1AC5A 1AUOA 1WM1A 3CCCA 2OQIA 2HA7A 4G1FA 5CT5A 3WK4A 3E0XA 3O4JA 1LPMA 5A2GA 1H2ZA 3BWXA 5A7GA 1MJ5A 5ALDA 5FV4A 3NOXA 1TIBA 2PVSA 3R3YA 3QBJA 3QPCA 3C43A 1FFBA 3H17A 4QWMA 1B41A 2Y6UA 2JGFA 1G66A 4P08A 4DMHA 5YASA 2GYUA 1A8QA 5I7UA 2HHAA 5DWDA 3EQ7A 4YX9A 1UOPA 2IX9A 2GZSA 4W63A 1A8UA 3L1JA 3GFFA 5T4FA 2J4CA 1UK8A 2WUEA 2RONA 5IVIA 1LBTA 4EY6A 1XZLA 1BE0A 5K3FA 3ZV7A 1IUNA 5AM5A 1WB5A 1K63A 2YYSA 4N8DA 4Q3KA 5FDFA 3SWWA 2DHEA 1U2EA 1GQSA 2XMDA 2I3DA 3FSGA 4FDMA 1U8EA 4J0HA 5CT9A 4A16A 5JAHA 5AP9A 1CV2A 1CUZA 5ALOA 4BZZA 4DNFA 3H18A 3ESBA 3C6XA 1LBSA 4GWLA 3WKCA 5T4HA 3WK7A 3H2KA 5CH5A 3WK8A 3FYUA 1R1DA 3HI4A 2O7VA 1LPNA 2PSJA 3WZLA 4CCYB 4W1SA 1GPKA 1CRLA 5KWIA 4X95A 3TEJA 5HF9A 5AIBA 5EHNA 5A6VA 3DS8A 1QGED 4H7IA 5ALNA 4C4ZA 1TCCA 3FYTA 5JIBA 3F67A 5ALQA 4Q3LA 3A2MA 4FNMA 3ZLTA 4W9RA 1AZWA 2O2IA 2Y1KA 1PFQA 3W9UA 2XMRA 5A7HA 2OGTA 2JGLA 2XMZA 3EBLA 4C87A 4JUIA 4NS4A 3WLAA 4DLNA 5IVDA 1MN6A 3WYDA 4DIUA 1XZBA 5AJHA 2OCIA 1HQDA 3F96A 3G9ZA 5SYMA 3STTA 5DNUA 2WU3A 1HBJA 5AKEA 3G0IA 3PF9A 3L1IA 1EVQA 5D3ZA 1GKLA 5HFAA 4MEAA 3D2CA 4Y2RA 1QIDA 3C8HA 5JADA 1DINA 5AI8A 1GPNA 4F60A 3C6ZA 2HRQA 4W1QA 2QVBA 4U2FA 4Q34A 1W6RA 1CUSA 3R3XA 3EIOA 2QUBA 4RPCA 4H18A 4L3WA 4X6UA 1EH5A 2I78A 4J0JA 3FLEA 4FWBA 2PSEA 2O7RA 4B9EA 1QIIA 4QDXA 3BXPA 2BGRA 2VA9A 2H7CA 5LLSA 1R9NA 4CCYA 1YB7A 4LXGA 4NMWA 5ALIA 4GI1A 3D7RA 3BJMA 1P0IA 5CW2A 1Q0RA 3LS2A 3WL8A 5HQ3A 1MX5A 4BCCA 5CT4A 1LGYA 2WHPA 4H0CA 2WIFA 3IUNA 1NX9A 4BZWA 4U2EA 3RK4A 1T4MA 1WPRA 3H0CA 5I8PA 1TQHA 3GA7A 4KAJA 5LIPA 4UBJA 1EHYA 3N2ZB 1RP1A 3QPDA 5AI9A 1GT6A 1SCIA 1TCAA 5ALTA 1E3QA 1SCQA 4G4IA 1XQWA 3UUEA 4Q1VA 3E4DA 3MVEA 4FHZA 2WJ6A 2K2QB 1XFDA 3KSRA 4C89A 1H2XA 2OCGA 2QJWA 3I1IA 3K6KA 1EK1A 3O0DA 5EIAA 4AO6A 2G63A 2V97A 1ZICA 3B12A 2WTNA 3N0TA 4DTCA 4EBBA 4PSUA 4WCVA 2G4LA 5AKKA 1J07A 1EA5A 4HRXA 4Y2VA 3IVMA 3DCNA 1HDEA 2RGUA 3W04A 4LXIA 1WB6A 2PL5A 3QMMA 2VJAA 2DSNA 4Y2YA 3GBSA 2GYVA 3CCBA 4ZWNA 4OCZA 1UK9A 4LYDA 4ARBA 4QDUA 1MX9A 4EA6A 5C8VA 4CG1A 1CPYA 3NUZA 4UFNA 4WJLA 5BOVA 2DFPA 3QPAA 5K3BA 4JYMA 2XUHA 4Y2TA 1VXOA 4C01A 2OLEA 2BCEA 3I2IA 4GHWA 1E89A 2XUJA 4CI9A 4ZXFA 5KWJA 1BN7A 3R40A 4WDRA 3JW8A 4NVRA 4Y2UA 4B84A 5LZ5A 1JMYA 3AUKA 3QMWA 5HF5A 4K5QA 1XLUA 3G9UA 4L0CA 3EQ8A 1Q83A 1LPOA 2QRUA 3I2JA 5ALYA 5AI6A 5AO9A 1CFJA 3IULA 1YS2X 4EB0A 2BGNA 1XZDA 2UZ0A 3IURA 3Q8WA 4HXGA 2FJ0A 4QDTA 2ZVDA 4J3JA 4BVLA 2CJPA 1SC9A 2XUDA 3H2GA 4DGQA 2BKLA 1TCBA 4TPKA 4CIAA 2X8BA 1X2BA 4PO3X 5AK6A 4KACA 5ALZA 1QOZA 1DWOA 3A6ZA 2XUQA 2VAVA 1XLWA 1XZJA 4ZREA 3QMVA 2JGEA 3VVLA 1T2NA 4WFJA 1ZJ4A 4HZGA 3A2LA 4Y2SA 3V1MA 2WHQA 3LIPA 2B20A 4ARAA 3I2KA 3G0DA 2QOEA 4HAIA 5ALUA 4MYSA 5CURA 4PSCA 1XZHA 4WFKA 1S8OA 1MT3A 4DSAA 1M33A 4B0OA 3LCRA 4QNNA 2ZYHA 4A23A 1BEEA 3DQZA 2BAGA 1LPBB 4H7FA 3O4IA 3SX4A 4N8SA 4RE5A 3WKEA 2VQ6A 3AIOA 3NGMA 2QZPA 1ISPA 5CXUA 4Y2JA 4DNPA 3LIIA 5FOQA 5EGNA 3I2HA 1CUJA 3PFBA 2WQZA 5LZ4A 2RI6A 2C4HA 1W4LA 3JWEA 3WKDA 5HCUA 5ALKA 1YA4A 2XMCA 2FJPA 5CTAA 1XROA 2VT7A 4H77A 2PUHA 1LPAB 2JGJA 1D07A 4O08A 5CT6A 1UKAA 1A7UA 2WIDA 3G0GA 4ITVA 2BUBA 3MGAA 5BWCA 3F98A 1CQZA 5D3KA 1EDBA 2XUPA 2HA0A 2HADA 2JGIA 3STYA 3ILSA 4Z49A 2WFLA 5AM1A 4OYYA 1C7JA 3OM8A 1VXRA 2GBFA 4X93A 1CUHA 2ZJ7A 2HU7A 4QLOA 1MAHA 3FLAA 3S2ZA 3BJRA 4KE7A 5EI5A 1JU3A 4BATA 5DYYA 3SC2A 4W1RA 1J06A 1ZGCA 4UHEA 2G5TA 3FYUB 2XUOA 3D2AA 4GEGA 1LPPA 4UHDA 2D5LA 3CN9A 3IUMA 4XJVA 4H7KA 4UHCA 3W2TA 1TKRA 2HA2A 1O6FA 4FLEA 4OUKX 1CQWA 1XQVA 4UHBA 4BDTA 1EDDA 5EHQA 4LYEA 4BBZA 3M82A 4U2DA 2XQKA 4I3FA 4C4XA 4BVJA 1MU0A 2VSQA 3WJ2A 5AH0A 1DT5A 5C8ZA 2XT0A 1A8SA 4TVKA 3DYVA 4M0FA 2DCMA 3WA7A 5EHZA 2HA6A 5AOCA 1QIFA 4AZ3A 4QA9A 1E8MA 3YASA 2AJLI 4DNQA 2PU5A 4N5IX 3I6ZA 3ESCA 2XQGA 4I19A 3DL7A 2AJCA 4LXHA 2JEYA 3GUUA 2CB9A 2QS9A 3QITA 4U2GA 4KEAA 4BRZA 1XRRA 1TAHA 4ZRDA 1F0PA 4BCDA 4CG3A 3R0VA 5JATA 3FYUC 2H7YA 5EFZA 4HXEB 4C6HA 3IUJA 2ZJ6A 4BC0A 3VVMA 4U2CA 1WB4A 3HABA 1K8QA 4K6GA 2WJ3A 3RLIA 3VXKA 4B7ZA 4OB7A 4HS9A 5HK9A 3D4LA 1WHSA 1Y7IA 2HDWA 3PI6A 1EX9A 4OU4A 3U1TA 1BEZA 5HFNA 4MXDA 3H19A 1FSSA 4FFWA 3WL6A 5DTJA 2XE4A 2CMFA 2Z8ZA 3H1BA 4FTWA 1E8DA 2PX6A 3ED1A 2PUJA 5J3JA 2WSLA 1UKBA 4AXBA 3O4GA 2WUFA 4AO8A 4RNCA 1WCYA 3MUNA 4UBLA 3T52A 1F8UA 1USWA 4DMFA 4GBGA 2YXPX 3V48A 4ZGBA 5HQ3B 3VJMA 2RHTA 1BS9A 2WHPB 1DWPA 1J1IA 3HYSA 1DU4A 2ROQA 4KR0A 5HZGA 2ACEA 5ESRA 2VT6A 2ECFA 3HLKA 3O9VA 2C7BA 5CRIA 3VISA 5C8XA 2HFJA 3WI7A 1JJFA 2QJRA 3WK9A 5AKZA 4G4GA 3U0VA 4EHBA 1ODCA 1UZAA 4BCBA 2VJBA 3HRHA 1ZD3A 1W52X 3NWOA 5IH7A 4H7DA 1K4YA 4X00A 3WWPA 4ROTA 4UBOA 4E15A 1XZIA 4E14A 2Z5GA 1E8NA 2DHCA 2JF0A 2GZRA 5E2IA 1JU4A 3DNMA 4F21A 2W6CX 4IO0A 2ONCA 3V1LA 2OCKA 1JFRA 1THGA 5FUMA 2QXTA 4BTLA 1VA5A 3K2IA 5KBYA 3WZMA 1AGYA 1LZKA 3DKRA 3CN7A 5HF8A 4Y2QA 1CUAA 2XI4A 1DX4A 5BV7A 1R88A 1AURA 1NU8A 1YAHA 4XWGA 2VATA 2BFNA 4X91A 2HA4A 2WLSA 4UPDA 3WKAA 1JT2A 5K3CA 4DSZA 4QE3A 1H22A 2ZYRA 4P92A 2AJBA 5K5EA 1X2EA 4IH1A 4QDZA 1E5TA 3KD2A 1CUIA 2O2GA 1QO7A 4AMZA 2NW6A 1F0NA 1O6GA 4DNOA 2OAEA 4MQMA 2QUAA 2XUIA 5I9IA 3I2FA 2WKWA 2ZSHA 4B81A 3WWDA 3KWJA 4WFIA 4G5XA 2X5XA 5AK4A 3H2HA 3DDUA 1UT6A 1DX6A 2Y2UA 5ALVA 3I1YA 1BN6A 2OPHA 2ORYA 4MYDA 2HFKA 1X70A 3PDCA 1CUGA 5ALXA 1YB6A 1XZGA 3G0CA 4FOLA 5ALFA 4AO7A 4FNGA 4UFOA 1JJIA 2QMQA 5CH3A 5JALA 2J3QA 2Z8XA 1ZI9A 4H7EA 5CMLA 3UUFA 2YH2A 1IUPA 1UOOA 3P2MA 1XRMA 1QIMA 5JAPA 1Q0ZA 2V96A 2PSHA 1G4HA 4CIBA 3QZUA 4XIIA 3IDAA 3BDVA 3WYNA 1VE6A 1L7AA 1PJAA 5CH8A 5JANA 4B9AA 1ZD5A 2D0DA 4FLMA 4RGYA 5LYYA 4J0GA 4PV7A 2WJ4A 5E4YA 2HIHA 2OGZA 4LHEA 2GBGA 3W06A 2G5PA 1H2WA 3AIMA 1BU8A 3QVMA 2PU7A 3QM1A 1CUXA 3KOOA 3S8YA 1SFRA 3R3VA 1EINA 1DQYA 3UMJA 2EDCA 3ZLVA 4QZVA 1YS1X 2AJ8A 2QM0A 4BP8A 1EVEA 5DYTA 3DKKA 5DTIA 3T4UA 2WG0A 3E3AA 1CEXA 1HPLA 4E46A 1XRPA 5AKHA 3RM3A 5C7YA 2C0QA 4ZV9A 5AKXA 4BTVA 1IMJA 1ODSA 5K3DA 3HZOA 1LZLA 5A7FA 4EY7A 3H2IA 4HRYA 5AICA 2HRRA 3BIXA 4GECA 3KDAA 3HSSA 1ZOIA 1HL7A 1U65A 3O9MA 2HM7A 4B83A 4X7BA 2Y2VA 2WFLB 5JZSA 2RIPA 1XRNA 2PM8A 1QIJA 3I28A 1ZIYA 3IBTA 2OCLA 3STXA 2CUTA 3VJKA 3G8YA 5FXMA 1YCDA 5A62A 2WUDA 4H35A 2WILA 4MWSA 4EY4A 2JBWA 2WU4A 4G8BA 5AKYA 2JEZA 5AOAA 1QFSA 2DQZA 4UUQA 1XKTA 3LP5A 3STUA 4MJ3A 1H2YA 3C45A 3R3WA 4UHHA 1Q84A 2WG1A 4AQDA 2YASA 1IZ8A 5JZ9A 4BDSA 3FCXA 4J0IA 3HJUA 4HXFB 1CUEA 4PQEA 3STWA 4N8EA 4OPMA 1QIGA 3ZLUA 5LZ2A 5LP1A 1CIJA 4FLFA 1DTEA 5JAOA 2BUCA 1XZEA 4KYVA 5AK5A 3FVTA 3AZQA 4LKOA 1QLWA 4QEKA 1P0QA 2CBGA 2XMBA 2XDWA 3WIOA 4HTAA 2E3JA 5H3HA 2IIVA 5CT8A 2QKYA 4BC1A 1QJ4A 2VEOA 5ALSA 4X85A 4J03A 3D5EA 5DNWA 1MNQA 1UK6A 2HU5A 4FBLA 3DLTA 1QFMA 4G8CA 3WIBA 3GROA 2C58A 3HACA 5D7BA 5ALWA 4Y2XA 1K6EA 1KU0A 5AHXA 2XQJA 1AX9A 4BE4A 1MO2A 2C0PA 3IB3A 5AM4A 4UBNA 1FFAA 1L7RA 4QWWA 4QLAA 4OSEA 3ZWQA 5A71A 3O95A 4V2IA 2OG1A 4L72A 4B0PA 4AB1A 1LNSA 5AOBA 4G9EA 3AINA 2Q0XA 1XRLA 4E11A 1IUOA 1VOTA 2I3ZA 1KEZA 7YASA 4WDQA 3BF8A 2DR0A 4IH9A 2XUAA 1N8SA 1VJ5A 3B3QA 2FX5A 5ALGA 5JYCA 2OQVA 1OXMA 3HEAA 1I6WA 5LKRA 4AN1A 5ALHA 3FWHA 3L1HA 4UBIA 4J0CA 3M3DA 4ETWA 1E66A 2OGSA 3WWOA 5AKIA 5ALRA 1UK7A 2RAUA 1QIEA 3WWEA 3WL7A 1VLQA 4FKBA 2ZYSA 2PSDA 4DMKA 4G4JA 3I2GA 3BF7A 4ZV7A 5LZ8A 6YASA 3FSGD 3AILA 3ANTA 3DOHA 4IHAA 2PSFA 4XX1A 4X3CA 3X3HA 4OD0A 3W05A 1YSCA 4IQ4A 1K5PA 2VTVA 3FBWA 5AKGA 3JYHA 2PBLA 4EY5A 1WOMA 3R3ZA 4BAGA 5AK3A 4DMCA 3PF8A 2QTBA 1AQLA 5JARA 2Z3WA 1VKHA 2QXUA 1XZFA 4BAZA 4G9GA 1ORVA 3D59A 1G42A 3TRDA 1QONA 1QIHA 4TGLA 4K6HA 5DYWA 1XZAA 5JD4A 1ETHA 1C7IA 2WTMA 1GGVA 3BDIA 5AI4A 3V1NA 5LKAA 3AZPA 4AMYA 2PKYX 3A70A 2XMSA 3E1GA 4X6XA 3STVA 3EF3A 5IKXA 5ALEA 5FKJA 1ZI6A 5ISMA 1XKLA 2HU8A 2WM2A 3KWFA 4PSDA 2B9VA 3Q0TA 4EUSA 1IZ7A 4H7HA 3FVRA 2WIKA 3B5EA 3M81A 1VA4A 4CG2A 5ALLA 5JZBA 4KAAA 1HLGA 2DHDA 3WK6A 5HKAA 1N1MA 2I03A 4BP9A 4DM7A 5FPQA 5T4BA 2ES4A 4X90A 3WA6A 1XQXA 4CCWA 3ZPXA 5C81A 1JMKC 1GZ7A 1CUWA 1R4ZA 4JYPA 2BUAA 4YPVA 5AKLA 4OB6A 4YK7A 3W9BA 3O4HA 2X76A 2DQYA 5AIAA 1AMNA 4OYLA 4PNZA 1N5MA 1JKMA 1EB9A 2WG2A 1ZD2P 2VJDA 1EB8A 1FFCA 3DL4A 3WKBA 4PW0A 4P93A 4IH4A 4AN0A 3VKFA 5JD6A 1ACLA 5BWBA 2XLBA 2B4KA 4A5SA
chains in the Genus database with same CATH superfamily
1L5HA 4ZHQA 3W3AA 5H9VA 1A7KA 5T8KC 1QLHA 4KGZA 5SZJA 1ZISA 3U7GA 2I4TA 1QTIA 4QULA 3BRWD 4OLJA 5ITWA 4PQYA 3KB6A 3CNOA 4YRQA 5FA8A 2P9FA 3V8RA 5JS7A 1GSAA 3AJDA 3I5XA 5HMLA 1AKNA 1J00A 1SBIA 3FYDA 1Y1KE 2PX8A 3DZKA 4GL4A 4U2KA 2BW0A 4E21A 3CUEF 1RM5A 2XLCA 4JH0A 3FNBA 3VO9A 1MB9A 3K9NA 5DGTA 2DF8A 3I9FA 3ZWMA 1RYNA 2ZUWA 1OLSB 4WXRA 2KM1A 4X6YA 4RJKA 6GPBA 1SULA 5I51A 1Y9ZA 2ZJFA 4UUNA 1O97D 4HADA 2YOFA 4JI2B 3EDOA 3S2UA 2QVCA 2JFQA 4B80A 4BVKA 4MEBA 2ODWA 5NULA 2JKYA 1OB2A 1V7QA 3GGOA 1SOMA 3RARA 4U8HA 3WR5A 3WC4A 2DKOA 4G1VA 4RSMA 5KMGB 1JDTA 4S3MA 4UBMA 3ZHTA 3H7AA 5LZ9A 3RK1A 3PVCA 4TTJA 2H1RA 1IZ0A 2EW2A 3C97A 4GP7A 5JI2E 4NH4A 3ER8A 4RTLA 1DUSA 5SYNA 2LKDA 4OX9B 1E1RD 1Y3CE 1R0XA 3M2TA 3EMVA 3DR3A 3KDSE 2OY0A 3M7IA 4MVJI 4UDNA 1E2QA 4RTJA 4AQYB 1DKMA 3CTMA 1YE3A 3EXHB 4DNXA 3KKQA 1L4MA 4L8LA 3PE6A 4CKCB 2NZYA 5ARBA 3HXMA 1K8YB 2H4HA 1Z6ZA 2JHPA 1G7CA 2JFWA 5TMDA 1UBJS 4Q9HA 1L5KA 3CNHA 1F48A 3ZY4A 4FILA 4HYEA 4QYXA 1XZCA 1KOLA 4JBLA 2H6EA 5E4FA 5HKLA 1YHZA 2GPBA 2XQIA 4DCUA 1HNNA 3NEJA 4JJ6A 3ANSA 3D5QA 4NECA 1XLVA 4OLFA 4EWLA 5AVZA 3U7HB 1KC1A 2CHUA 2IYVA 1JZQA 2PLAA 1YOVB 2JGMA 5DLPA 1G5FA 3WGYA 5JO9A 4YRFA 3G9XA 3T9DA 3S7TA 1RXWA 1P0CA 4IQ0A 1SB8A 3V34A 3PLNA 1IQUA 4RD6A 5ICGA 2NP7A 3DMPA 2PWZA 1DBSA 3PICA 4ZVOA 1RYMA 2J4DA 4JU8A 4OVKA 2JANA 3ZQJA 3NWBA 3O8NA 3CVUA 1VG8A 4JCOA 4Q4JB 2VHXA 1T3GA 1CRQA 5FF9A 1Z4PX 4BMYA 1QK4A 2P6UA 3OOSA 4J0KA 4KFSA 5AKJA 1L7BA 2EW8A 5DTQA 1KH2A 4REQA 3ZHRA 4LY0A 3F5MA 3SYNA 2HA3A 2QW0X 4Q82A 4QKQA 4ZCLA 5JAIA 5E6RA 1DIHA 1E9FA 2G76A 5AVTA 3G5LA 3GRRA 1NBOA 4C4TA 4D4MA 4PO9A 4MICA 1DKRA 1KZ6A 1VKNA 2OOSA 3LLCA 4QAQA 1MX1A 4ZV4A 5MFPA 2P2LA 2BFOA 3C85A 1KAQA 1A9YA 4MWDA 1U9ZA 4A8JB 1MA3A 2OO5C 3R20A 2GEKA 5BN4A 3PD0A 1QF6A 3MBIA 1KJNA 1OXVA 3MXTA 2JH8A 4LOJA 5EPEA 3TDNA 2BMEA 2ZWMA 3DE7X 2YYZA 2PGNA 1MIOA 3SS8A 4I55F 2XUGA 4CMAA 4K6FA 2WQ6A 4JP8A 5CXSA 1USIA 4P82A 3L7NA 1XD2A 1ODTC 4Y18A 5H02A 1CLEA 1ZH4A 2GXSA 4MS1B 1E0JA 2R1ZA 3NIDB 1JQDA 3DM5A 1TT7A 4AWXA 4LV8B 5KZMB 1U2TA 3RRFA 1KFBB 4HAOA 4RVHA 2E1RA 1TM5E 2H2HA 4CZ2A 5AM3A 4Y3UA 3OZAA 2XHEA 3ZOZA 4F9EA 2E87A 4UREA 2J45A 2CCJA 3H99A 4ENTA 1RHRA 4PM4A 3PEYA 3FLBA 4I1IA 3OA2A 1DWQA 1NV9A 1Z0JA 1Z0AA 4A8PA 4FM9A 2QP4A 3UQZA 1VKJA 5EMMA 4AS2A 1VZ2A 1IY1A 2QM8A 4M36A 3QW4B 4DCJA 3ZUPA 1X1EA 3DFUA 5EVJA 3UTCA 3J7AC 2ZAIA 3UMMA 4TZ0A 1ZY2A 3NHSA 5EKDA 1CQJB 1EAMA 5T5QA 2FWAA 1F5SA 4JELA 4NYIR 4AS3A 3O9ZA 4BRSA 1DBWA 3BD6A 1KVRA 3Q87B 3PFCA 2B3DA 4E30A 2SBTA 4HX2A 5F98A 2J3DA 2R751 4X6LA 4XASA 4XUCA 3FX2A 3L7LA 1G2QA 4PRYA 2R3SA 4PU0A 1O08A 4BU0A 3FOCA 3Q2KA 4LK3A 1MTZA 1CJTC 1SURA 2VWPA 3ETDA 3ME5A 4NP6A 4RDIA 1Y4SA 3RFVA 2J48A 1CJKC 4RJJA 3O7WA 3K9HA 1K3TA 5HUQA 4E31A 4H1WA 5CFLA 4FZJA 2OWDA 2QU8A 3PFGA 2D2EA 3PRJA 3USES 1ZXBA 4LC9A 4RTRA 2ZQYA 3DCYA 4UE2A 1L5MA 1QZ3A 3KZOA 1Z68A 1GL6A 4ZAFA 1C7FA 3RQIA 2ZZNA 1MR3F 1FMCA 1VZ3A 1Z13A 4JBYA 3KAJA 4XGKA 4MEJA 1FVHA 4NBSA 1Z34A 3EGIA 4BPBA 1RKQA 3SKVA 1ENPA 3K4HA 1N2CB 5GJCA 1HI9A 1W75A 1XK6A 4OXNA 3UOAB 2FDCA 3RV3A 3UMBA 3F6RA 2AR9A 1ZUIA 4P9NA 1KYWA 1AKWA 1P6XA 2GESA 1DJOA 1IOZA 2FSPA 2JS7A 3SSAA 4R8SA 4EY8A 2R8EA 4JJEA 1JNYA 1KERA 4YRCA 1P4AA 3HBMA 4GX2A 1YBHA 4KIWA 4G8DA 1PUJA 4B45A 3TOSA 3B36A 1RTTA 3B85A 3U40A 1JNXX 2I80A 2H1IA 2VC2B 2C5GA 1BZYA 2QRZA 1X7YB 2XHZA 2GTHA 3D8UA 5FOXA 2CF5A 4EFDA 1MW9X 4ZVSA 2ZT7A 3QPBA 1IAVA 2C29D 3W0LB 1E20A 3WL5A 3OFVA 1CETA 4WGFA 3GNQA 3Q3VA 2O2HA 3I4CA 4AG6A 4KMSA 1OAAA 4TL8A 3IUBA 1J24A 3KXPA 5G4LA 5HK8A 4PFQA 1AQYA 3ROMA 2BZ0A 1MZPA 3ND7A 3RYIA 3RG8A 4XLLA 2NTYC 1YWGO 3GFOA 1B1AA 5KWSA 2K6GA 3RAEC 1D7AA 1UZLA 1BOFA 1CVLA 2HJSA 1AGXA 2JLCA 1JQAA 1XJWA 1ZSYA 2O1WA 2HIAA 1FP7A 3SR4A 1UMCB 4IR7A 4HB2A 2AD5A 4QQNA 2KBEA 3D0KA 2DKFA 3GL9A 5HXAA 3HYCA 3KQNA 1IN8A 2XH8A 4KQGA 1JRLA 5BRAA 1LBEA 3L7DA 2PRKA 3DVLA 5E4JA 3PPXA 2WMOB 4ARUA 8ABPA 3FHJA 1RXUA 1T1SA 2W0SA 3RIGA 2QU7A 4JLJA 2VAMA 3G9TA 3W8DA 4PE5B 1AF4A 3PGLA 3VHXA 4C3VA 1DT3A 1WY5A 1BQEA 1P0MA 3OT1A 3R23A 3TLCA 5IULC 2DFKB 1L3IA 3MCUA 1QG0A 2YQ5A 3MSXA 1G7TA 2ZE6A 4YIKA 4ZMBA 3LX6A 1YKFA 1ZK4A 2A5GA 4W1PA 1J0XO 1G1MA 4GI7A 5CD9A 1U3GA 4ZQBA 2Y27A 3GCZA 2IXDA 2AEFA 1Y9JA 3RAFC 4B3FX 5J2TA 3AJEA 2WYWA 4FYMA 1SZJG 5EE0A 2O8BB 1QP4A 4BGIA 3KOZA 5BXYA 4KXXA 1FSGA 3ZS8A 2CVHA 4EHLA 4ER3A 2F3PA 2ZTMA 3TLZA 4YMLA 1DOHA 4QU0A 3SX0A 2GILA 4RTOA 1TW3A 4N7JA 2R8RA 3PGXA 1NW3A 1G7RA 1TJ3A 2BBTA 4ZALA 3CVJA 2ZUBA 2EFEB 4JROA 3N8NA 4MYRA 3SEQA 3CG0A 3QKWA 1NXPA 1OILA 5E4TA 1KYIA 4GVXA 3ESAA 4PZAA 4RIGA 4XDYA 4C0BA 3I6YA 5LIRA 3PR2B 2B8EA 1IL0A 4LSZA 3EYAA 3IOBA 2Q4OA 1II8A 1KJJA 1OI2A 3VDXA 3F47A 4ZOLB 2UUCB 2XBUA 3HCOA 3PKIA 3EAFA 2WUWE 2IBSA 5HCNA 3HB0A 4FWTA 2MSKA 2W83A 3JV7A 4C22A 4IDFA 3H86A 3RKSA 4DADA 1NUUA 2WIJA 4D96A 4IKOA 2PGXA 3WNQA 4H16A 4OQ4A 2J3IA 2AW5A 4W7IA 3ACCA 4DOMA 1F51E 3IQIX 4IGAA 5TGZA 3X43A 4X71A 2AXEA 2BWJA 1MNAA 4Z4GA 1U2PA 4ISCA 3FB4A 1DX9A 2HH9A 2O52A 1N2CA 3N05A 1E69A 1EK2A 4FR0A 3LKVA 1SBNE 2JH3A 5KC9A 4NZMA 3MHTA 3PQCA 5TNXA 1TTQB 2DY1A 5CYPA 2HKIA 1DTSA 1EHCA 1BQ4A 2Z57A 3D64A 3K9BA 3M3HA 1IOLA 4CF6A 4MB6A 1N9KA 1RYBA 3MWJA 2GD1O 5E2BA 2QA5A 2N1BA 3I61A 3RAPR 1QB7A 3L6RA 3K70B 5FP0A 2AEEA 1P5HA 4HYQA 4D2IA 3IQFA 4DCGA 1EFPA 1TE2A 1WMEA 1ZI8A 4F2PA 2EX4A 4PZYA 1I13A 3GJSA 3OF5A 3E7DA 2HJRA 2R6R1 1N5RA 1P2FA 2HMVA 1D9ZA 3BIFA 4YALA 2ZGVA 3OCXA 3TXXA 3CURA 4W5OA 5AI5A 3OCZA 1KOFA 6ADHA 2D1YA 2Z2KA 4JC4A 1JA1A 4ZQEA 1JDVA 4ZT7A 4QJ3A 1MQ9A 3HXLA 3FPEA 1ODIA 2O06A 3KUXA 4QYWA 1R15A 2C3OA 3KYDB 2IY9A 4A5OA 2V98A 4NCXA 5C5CA 4MSUA 3L0CA 1RPJA 1U2ZA 2G4CA 4ZPXA 1UMCA 3OE7D 4IFEA 1XQYA 4ARSA 1F4VA 3RIMA 1TK3A 2HQOA 4A0RA 1FFSA 2G71A 4ARCA 3T1VA 1VE7A 4MI9A 3WGMA 3E35A 2W6MA 3MJEA 1GZVA 4OHMA 2O8FB 4OQQA 2I65A 2BJHA 3N3BC 2IS2A 1JDBC 2PO5A 1ESDA 3C70A 4HQRA 2Z43A 4Q4HA 4UVHA 2YHUA 2D2XA 2JGKA 2FQYA 5AVKA 1VMIA 4NWIA 3OM1A 1IJBA 4XOUA 4J07A 1SUPA 3LLMA 3QFSA 1A5TA 2DT8A 2FW0A 3KPWA 4LBVA 2MYTA 3I9V6 4X94A 5I3ZA 4DB2A 5ICMA 3OC6A 1Z4MA 1ZL0A 3QI2A 4TKUA 2QMYA 2RHMA 4DHEA 4MCHA 1W0JD 3VDRA 1RKBA 5K3FB 5K3AA 1G63A 2B3TA 2OXCA 5CFOA 2X6QA 5EMHA 2AK2A 4Z7OB 4YV1A 3IOMA 2O8BA 1E0DA 2YNMA 3CLVA 1T5SA 2IEIA 5LCXA 1MHTA 5C4GB 3OZ7A 3IDSA 2VHVA 2WFMA 4MR8B 3X0DA 5E9WA 3MD9A 5JASA 3CWQA 4ZDJA 1TM7E 3EZXA 1YE8A 1E5QA 1WX1A 2UYQA 2YZ2A 5AVOA 5GVRA 2OEPA 1BGVA 4GPIB 4I55A 3VI4B 3WYBA 5EHXA 1YA6A 4FYIA 1O95C 1NT2A 1PR5A 4R2IA 3D0OA 4UU1A 2YHIA 3K1YA 1D6MA 3IR6A 2DM6A 4PRZA 4AP9A 1JLLB 4ENVA 2ONZA 2RH4A 4QZVA 3DQPA 3PDIA 2W2LA 1UFVA 1Z5VA 2LCFA 3F97A 1NYTA 4JFRA 1D4AA 5ENZA 1B4DA 2CK3A 1Z33A 4DYHA 3VYTB 2Q1SA 5FWXB 1RMTA 3ZXIA 4XQEA 1W8IA 4M0CA 4OUDB 4CUJA 4D9JA 1FJ2A 1SBCA 3GEHA 3ELDA 3IALA 1K8XB 4QARA 1M8JA 1PWZA 3NIFB 5F7ZA 3MCTA 3NBYC 3VPXA 3GFGA 4MO2A 5DN6A 3H6GA 4FHFA 1F6BA 2CYAA 2GLXA 3IO5A 2Q5IA 3CG4A 1B74A 4ON9A 1ID8A 3DPUA 3N59A 3IJPA 2WJVA 4XVQA 4EHIA 5AVSA 4W5RA 4WPGA 4CMCA 2BE9A 3WMWA 2IYRA 2VHTA 5LN1A 1I3OA 5G4KA 3SQOA 2VHWA 1BWSA 4KX3A 5J23A 1FFGA 3HVUA 3OLWA 4BUCA 3HC7A 4I8DA 2C9OA 1OIXA 1YR2A 3NVAA 2Q0SA 2B30A 2FVYA 1K7XB 4IJ6A 1H23A 1UQTA 3IPAA 2OQRA 2VJCA 4JLSA 4Q9IA 1GN9A 3A2NA 3RFFA 1KDTA 3D3WA 3MZ0A 2ONKA 5JNTA 3CCCA 1RFGE 4BNGA 4OMFG 3UMYA 4Y6SA 4EI2A 3E0XA 3C74A 4B6OA 3HKDB 3QKSA 3DMGA 2ERYA 2RB5A 4QOGA 4CF4A 2L0XA 3FZEA 4MCIA 1KKLA 4DEVA 5FV4A 1Y33E 2DQSA 1M2GA 1TIBA 3DMRA 3S68A 2JAUA 1H6CA 1BXRB 3OBIA 3EXG1 4RFVA 2EERA 3E5MA 4G26A 3BD9A 3DVAA 2R97A 3R3YA 4B74A 1AJEA 3QPCA 1ATZA 1MFZA 1VSTA 3EZ9A 5CLHA 1T34A 3N2YA 4PCVA 3VBEA 4UUOA 4I4NA 1UOEA 1BDBA 1P44A 2EX1A 4CM4B 3T54A 1GYQA 5JNVA 2Y6UA 3K6SB 3TQFA 1WPGA 4IJWA 2PD3A 3FJOA 4R71A 3SQMA 4UUBA 2CBZA 2VHEA 4J1TA 3ED5A 3O21A 3Q7PA 2IGTA 4GG1A 5BQPA 4AI6A 4YX9A 1HT3A 4QJBA 1GEGA 1E2FA 2GZSA 3K0BA 4W63A 1KAMA 1I4LD 4DM4A 3KNZA 1QFZA 1C1DA 1YS9A 2VSFA 3UWSA 5T4FA 1U80A 1DJPA 1ND5A 2VEDA 1G19A 1Q77A 4JR2A 2RONA 5IVIA 3U0BA 4OXKA 4IZOA 1RPAA 1BXGA 1W2HA 4OP3A 4D97A 2W2PA 5IJXA 4XQGA 1ZWLA 1BE0A 1C2YA 2NV2B 2PTGA 2ST1A 5K3FA 3RKRA 2XF8A 4RKRA 1IRIA 3KCQA 2LPMA 4S35A 1QP8A 2CXRA 3L0OA 4RKWA 2ZB4A 3RS0A 2PQ2A 3OAAA 1ODLA 4ZCRA 4NY1A 4V02A 5ITSA 1RAIA 4Y98A 5TQVA 5J1SB 4LQLA 1N8NA 3KYIB 1TGYA 5LDGA 4Q3KA 4IGFA 1N3BA 2AV6A 4IIYA 1B14A 4LGVA 2CMGA 2I54A 2R85A 5EL0A 1I3LA 4BX8A 1GQSA 2AUNA 2R00C 3T5MA 3LWZA 1X39A 2XMDA 4N3BA 5ENDA 2G67A 3TW6A 1OZGA 5EWMB 1SUIA 4FDMA 3KLBA 1NVAA 4XAQA 4B2LA 4DE5A 5CA0B 3NDRA 2QNBA 5K8JB 3C15C 4S2UA 4BO6A 4BQSA 5JAHA 3IEMA 2E4XA 3V8PA 4X1YB 1PNRA 1BCRB 2ILVA 3D4PA 5HILA 1MVLA 1RI5A 3A10A 4E0BA 1E59A 1ZKMA 3NLLA 4MRAA 1O3YA 1QDEA 1Y63A 3EGXA 3H18A 4IDEA 3T5AA 2ZS8A 1UL1X 2GFQA 2AN5A 3T3MB 4KXFB 3U49A 4OY3A 3I42A 3INYA 1JWLA 2BTOA 4QUAA 2OLJA 3DKIA 5CPFA 3WKCA 1EX7A 2IBMA 4AW9A 5L53A 5LDHA 3FUWA 5JJIA 4CM5A 3FIJA 1IN1A 5CH5A 2VAWA 1E3LA 3W2GA 1US8B 4RS4A 1BE8A 4B44A 1EFTA 1Z28A 3FYUA 1HH4A 4CIDA 1YZFA 2PSJA 3OESA 3ABRB 4MGIR 3V32A 4QXMA 1GNPA 1WPQA 1ZHHA 3RCBA 1WP9A 2BFEA 3ZZTA 3KTOA 1P75A 5HE9A 2YJ6A 1GQQA 4IF6A 4CTKA 5KPDA 1PV2A 1Y48E 3A27A 4OJYA 2CNKA 1V47A 4QREA 4CCYB 4TYNA 3R9KA 1C1XB 4WOKA 4RMGA 5KWIA 5KDLA 4Q00A 2X7XA 1KMHB 1LJLA 3LRXA 4G1MB 4OBXA 3HEBA 4R3NA 1FL9A 4KK4A 2NZ2A 2UYYA 3EZNA 4WW0A 3WMEA 3ZDAA 5EJ5A 3HKDA 3M4JA 2Z56A 4IUCS 2DUMA 4C7OB 1E4VA 1O54A 5EHNA 3KYCB 3DS8A 3DWGA 1DC3A 1EFDN 1QGED 3WHKA 4RVCA 4H7IA 2WICA 1Y9AA 1XTQA 2B1QA 3RHZA 5AW0A 2PWBA 3A1UA 1YCHA 5IJ0B 2V1XA 4MKGA 3VYSB 4UAGA 4CMJA 5HR5A 1U5BB 4PQGA 1GL9B 2FQXA 5A1TA 5EKTA 1AZWA 4PG6A 4PPYA 1POWA 4XGNA 4HOYA 2FMIA 2OVBA 3PXEA 1Z06A 5JNWA 2HNKA 1G2IA 1THMA 3DLHA 4JUIA 1ZK3A 3BA6A 1ZNYA 5DULA 4GYYA 3UICA 3NNSA 2JARA 3ONFA 5M29A 4BXOA 4MNTA 4C4OA 1O96A 5T3UA 1R6AA 2C5EA 2NQ2C 4F4FA 1UBOS 5MN4A 3IQHX 2I8AA 1WLYA 2CV2A 1RJWA 4YONB 3H5VA 1GEEA 3UJHA 3VU1A 2VDUE 3WP0A 5BQ3A 4MW2A 1XXHA 1R66A 3SIRA 3CLSC 5JJLA 1DJMA 2PAAA 3VKHA 2HY7A 4JJZA 2DFLA 2NGRA 1XZBA 1SHLA 2VDWB 4P80A 4ABTA 3KUDA 4B5KA 3G9ZA 1JBEA 1GN8A 2NU6B 1MO4A 3E3OA 3M6IA 2I22A 4RQUA 3STTA 1XNRB 4DB4A 4BQNA 2FEPA 3TQTA 1JXMA 3KYJB 1MO6A 1T1EA 2WT9A 2R4TA 3BH0A 4JJ4A 5ES4B 4Y6OA 2L82A 1B26A 1GTG1 2HLDA 3C98A 3CLHA 3WO1A 1MQ8B 4QASA 3U09A 1WUYA 2CFIA 4QSHA 3L1IA 5D3ZA 5HFAA 1OXTA 5I45A 2X9VA 1SC1A 4NC9A 4ZIRA 3TNFA 3HU2A 1BWRA 1Y8AA 1CY4A 1NTOA 2C2OA 2JI7A 1E7YA 1UPUA 2Q50A 3IHWA 4KH0A 3GFQA 2Z6AA 5A0VA 2ZQ5A 3B1FA 4IM7A 5AVQA 4GLOA 1ZAKA 3HBFA 1YBFA 3LXMA 3NNNA 2DWPA 2BY4A 2ZG6A 3GDFA 2XRYA 1ORDA 4C0KA 2ZBDA 4N03A 3UFXB 4UDOA 3MA0A 5DLEA 2B1IA 3KS9A 1P1FA 2E5WA 3H83A 2FFQA 2V6BA 3D3QA 4W1QA 1V8BA 4I08A 4TX1A 5TY0A 2J7PD 3I73A 3CRZA 1L4NA 3AB8A 2EU8A 4PXAA 4GZ6A 4Q34A 4U2FA 4N5MA 4YUVA 1FLNA 1PFWA 3L0IB 2NVOA 1E2PA 4K8OA 4NMMA 3ZBQA 3N0XA 2G5GX 3ECSA 1RDFA 1QQAA 1SVKA 2QTLA 4MUHA 2RGGA 3G7SA 4GFDA 5I7HA 1JV2B 3GWGA 5C35A 5IJZA 3BRWA 1US8A 2HSEA 2X0IA 3CQ9A 1U1EA 4QUEA 3FLEA 3M9WA 4MPRA 1XAIA 2PSEA 3IBSA 1HSOA 3O8OB 1WSWA 4B75A 3K2QA 1JYFA 4P3NA 5A5VA 4Z7QB 1CJBA 2X8LA 1NASA 3DE3X 3ZHVA 2BGRA 2OR3A 4NE7A 2VA9A 3DP9A 4NL4H 4EAAA 4CCYA 4Z54A 1Z75A 2Q1TA 2Z8YA 1G59A 1HMPA 4LXGA 3BX1A 2IE8A 5ALIA 2H2WA 4A8JA 2ENUA 4GI1A 1PR3A 3FFWA 5K0NA 5HM6A 3WSTA 3BJMA 4M38A 5E2AA 3IUEA 3ST7A 2VTDA 3GHHA 3RH0A 1HFWA 2GERA 3LS2A 4IKPA 3ROQA 2WWYA 1HC7A 1DO0A 3UATA 5I9LA 4FFBA 2R6GA 3NPAA 4ZMSA 3LZ6A 3QMPA 1GDDA 2Z98A 5CT4A 2WNHA 3CY6A 4HDRB 4LJ9A 2IU0A 3SZ3A 3ZDDA 1VKOA 2WHPA 1VJTA 1GT91 3E9QA 3IUNA 2WZBA 3NHMA 4TWAA 4BZWA 1G6KA 1E1RA 4EUHA 2BI4A 3DE0X 1U7DA 3ENZA 3D8BA 3H9JA 4IY1A 4KO4S 3I5YA 3IPRA 1RHJA 1B43A 3GA7A 3DZIA 4COKA 4GC9A 4BLSA 2PZKA 4PS1A 3OPYI 1GRRA 1FDSA 2REOA 3O8LA 3KJXA 3PC6A 4GMKA 2VRBA 1N2IA 4RLHA 1EHYA 4E6EA 3VU0A 1EFLA 2XQVA 2I1QA 1K8RA 2CDNA 3QPDA 4NKRA 3VU3A 1SIBE 1C50A 4ZYLA 1K88A 3LGAA 2PFGA 2GJKA 5JMWA 2PYZA 2CFSA 3CNLA 4G07A 1SCQA 3VC1A 4O3MA 4LTNA 1OV4A 3AHHA 3PTZA 1MT0A 4R1NA 4C6TB 4Q4CA 1SKUA 1XQWA 4R8LA 4XI9A 1JTEA 3IJEB 3M1YA 2CE7A 4LQCA 1P6QA 1E2BA 1NFFA 4Q1VA 1V95A 3KDPA 4MIEA 5LQKA 4FHZA 3AUSA 2NU6A 3ILHA 1SA0B 2ZWAA 3CW2A 2YJZA 3AF2A 2PA0A 2WJ6A 1XFDA 3D7NA 4ZANA 5G0SA 4C89A 1GFIA 1N0WA 2P68A 1FCJA 4NK4A 4N5DA 2D1QA 4XR4A 3ZOKA 4ENWA 1RI1A 5C52B 2ZIAA 3HGQA 3C16C 2P62A 3IEKA 1ISRA 2A94A 3CSDA 2H4YA 2ZIVB 3GJ6A 2IYLD 3P0FA 3R5FA 4M21A 2YHSA 2V97A 5CU7A 3VHLB 2IZ6A 1X8XA 2PK3A 4EAQA 4MR7B 1Q15A 2QJTA 4F3YA 4NDNE 4XWTA 1EWTA 3RNOA 5AHWA 4E5UA 3W5CA 3GA0A 3ELYA 3FUCA 2XGMA 3GP5A 4PAQA 1DXHA 5AMXA 5TJHA 1ESMA 2AFHB 3FYSA 4DAEA 1P5ZB 2ZAMA 1KDZA 4ZYYA 2NIPA 5DNCA 1J07A 2QUKA 4Z3DA 4KPEC 2IKQA 4XIJA 3UFXA 1HDRA 4EVQA 1O0CA 2MWMA 3GJXC 5A3RA 2CZCA 2ACVA 4GSKA 1R10A 5BSGA 3DCNA 1HDEA 3IEUA 2RGUA 3LUCA 3Q8XB 3WVNA 4V1CB 4UM9B 2QLNA 2O8NA 2V7WA 1E6KA 3HA5A 2M98A 3KSBC 3BWBA 3NHZA 4NESA 4QUHA 1J0BA 4AJNA 4B73A 4S2EA 2F4NA 2I9KA 4F7WA 2P4SA 3RSCA 4Y2YA 5LC1A 3IVGA 3ZDEA 2YW2A 3QNUA 4NONA 4RZHA 3LFUA 4B87A 4CKEB 1FJGB 4ZC1A 1DDOA 1UXJA 1UWLA 3F46A 4OEHA 3GIDA 4OCZA 4K9QA 1QPZA 2JAQA 1ZMXA 4AUNA 2UDPA 2BR5A 4F3CA 4ARBA 1TVMA 2Q4EA 3VU9A 1ECFA 1MJHA 4QDUA 1PFVA 3LDFA 1LWOA 2XAUA 5B6JA 3DMHA 1NNUA 1ZITA 3ORSA 4CG1A 3KQOA 2DGDA 3NUZA 1NY6A 3NTLA 4TL6A 3TQCA 4XCXA 2DC1A 2C9MA 5K0EA 4UZFA 2BI7A 2R6ZA 1MOZA 2TECE 1T9KA 2FE4A 2XUHA 3I39X 4DARA 4C01A 1YGPA 3I2IA 2BCEA 1E4OA 3DZHA 5B7PA 5HIAA 2ZR0A 5EMLA 3MUFA 1E89A 5DHQA 2FTKE 4ZXFA 3ZHOA 4NXNB 1E60A 3U80A 5IASA 10MHA 1QYIA 1Z0ZA 3AEUB 4WDRA 1SBYA 2IY7A 3JW8A 3ET5A 1A9TA 1UJBA 1RE1A 4J76A 3EGDA 2WUVA 4KO1S 4Y2UA 1KQNA 2DWUA 2Q5FA 4FSDA 2P4QA 3H5IA 4HDRA 4XGIA 2F59A 4BASA 3X1MA 3C3YA 1T6BY 1EEXB 2DPLA 1ZGAA 2GZAA 1YMQA 2R7LA 3A1NA 3EWAA 4JQOA 4K5QA 4LDRA 1SZDA 1SRQA 1U5CA 3OTGA 1V6SA 1XLUA 4OQXA 2JI6A 4R9UC 2QTHA 1UMDB 3LHKA 4B3XA 3EQ8A 1CZRA 3ZHYA 3MBKA 1PN3A 3ETJA 1YQDA 3HVRA 1LPOA 4MVJE 3MM4A 2QRUA 1CZHA 3ID6C 2VPPA 4FJ1A 3RR2A 4XWOA 5L6LB 2QN2A 2ZTHA 3AL2A 4O33A 1EUCA 1OTYA 1YRAA 3M6MD 3ZNOA 5D3QA 1G18A 2XNDD 4UU7A 1VCNA 4G65A 4PZEA 4JC8A 4RADA 3VR2D 1L5SA 2GT1A 1KQOA 3PPVA 1SEPA 1KY3A 1SUDA 1JFFA 2GAJA 7GPBA 4CTJA 2MINB 3ABZA 2W2QA 4GXTA 1Z2CA 2YJTD 2GN8A 3KT8A 1QCZA 2CEAA 3BGIA 3NKVA 1T9GS 2HN9A 2R6FA 1V1JA 3FHLA 1CZKA 4FK8A 4M60A 5T64A 4KQHA 4M37A 4C0WA 3FDJA 4ZZ3A 1I9CA 4DR1B 1JN0A 2YBEA 4JOQA 3R74A 4IXMA 4BRUA 5AW1A 4NBUA 2ZBGA 2V1UA 3VYRB 3TQIA 1DEAA 4QDTA 3MTAA 1BQ3A 1BCSB 5LBIA 5BO5A 3ROEA 4BVLA 4BX2A 4JLUA 1BEUB 1UJ6A 3FPLA 4NJEA 2I6FA 4B4DA 3HR8A 5I7EA 2RARA 3IE2A 2D3WA 4PYIA 5KOYA 2CV0A 4HD8A 2OFWA 3H5AA 3H2GA 5GZ1A 2GM5A 3U9TA 2QP3A 2VHCA 1KZ9A 4JBWA 5FJIA 1YQQA 3VYWA 3TIIA 5JXGA 3PFWO 4MWGA 1W4RA 2KHZA 1PT7A 2XWBF 3DE5X 3ZHCA 2R5WA 4PO3X 3CJQA 1SPBS 3A31A 1I7PA 3I05A 1R8YA 1GPMA 3EODA 3N58A 4M9SA 1URPA 1T29A 3ISTA 5ALZA 3O83A 4FUQA 4WLFA 1QOZA 4UASA 3WB1A 4DQUA 1F2TA 1Z0SA 1XMJA 1XT6A 2GAFA 3B6ZA 3BK1A 3NV7A 1DEOA 3O91A 4P3KA 1GR0A 2YVQA 4ALNA 4DBLE 5HS4A 1JHPA 3HL0A 5K20A 1WBDA 4BBPA 4XIGS 2WSIA 4OKNA 3W4JA 3BGWA 2PXCA 3B8HA 5GV8A 3OKCA 1XDDA 4WBNF 1FB5A 1VKRA 5LU9A 1E18A 1YFZA 3FYCA 2XGOA 2JGEA 1M2WA 1T2NA 1QR6A 3Q41A 4CM1A 4DSNA 1ZJ4A 3UHJA 3BWCA 1PP4A 2QNIA 2P6MA 1D03A 1XDBA 1X38A 3HE3A 3PX2A 3A2LA 4XE5A 3BE6A 2QQ5A 3N5CA 1M6YA 3MNFA 4RTPA 3M1LA 4Y2SA 1U1DA 2JNWA 3TBKA 2WHQA 3LIPA 2X42A 4TLDA 2IXFA 4JV5B 1I2DA 2ZIXB 3KSUA 1XL0A 3JTMA 1BD3A 2C7VA 1C41A 5DCYA 5EQTA 2ZUEA 3SIPA 1SCBA 2V7QA 1FF9A 4TLMB 3EIFA 4HAIA 2I87A 3R7WA 3FOEC 3THXA 5D5QA 1GNSA 3GRFA 1GUFA 4JB8A 4MYSA 2QPOA 5CURA 5HTOA 1INLA 1T8WA 4F1KA 4F91B 3EC7A 1XZHA 2V4MA 2PEYA 3H84A 1L5YA 1P1BA 1M1YE 3R0JA 5ICEA 3ZE2B 4DRYA 1MT3A 3C4VA 4OK6A 1M33A 2IYQA 3ZVLA 3GMDA 5LMNB 3LCRA 1KY4A 4TKLA 1UPCA 4KYIB 1L1FA 3TAXA 1BEEA 2C57A 3DFMA 2PAFA 3DQZA 3RS2A 3VQTA 2Q3EA 3AI7A 1JJ7A 1C3EA 1U9IA 2ZI6A 1U1IA 4WL0A 1XRSB 2A57A 1DC8A 2J6CA 4YCNA 3DEZA 2ODEA 1VMKA 3AETA 4C20A 4EKNB 2PUAA 4A26A 3T4PA 4M1YA 2FFAA 3AIOA 3VZCA 1RJ9B 3DAOA 1RXEA 3H8WA 3AV0B 1Z6YA 3IP9A 4H1UA 4LXUA 2UXBB 1P72A 1QH1B 2VT3A 3C24A 1A97A 1NJ1A 3JASA 4LF4B 2I1VB 3O3NB 5CXUA 3MOIA 4J91A 3RLFA 3VZDA 4DNPA 1ONBA 3LG2A 2GNAA 2ILTA 4RLSA 3D7LA 3W5BA 2YNMC 4IMIB 1RRCA 1VKZA 1JHQA 1L7NA 1DOAA 1PHPA 2IPLA 4D9NA 1KI1A 2X9QA 3ROKA 2EYUA 1DC7A 2A6PA 5KOIA 1CUJA 3PFBA 5LZ4A 4LF6B 2RI6A 2I6UA 4PR0A 3UK0A 4C6SA 5KNCH 3GNLA 3ZWOA 2BCGY 1W4LA 5HZMA 3OLVA 4ZAXA 2W6ID 3ZWPA 3JWEA 3WKDA 3K31A 4YMTA 4D9KA 1UJMA 1VJCA 2Q1WA 4OOFA 1ANKA 4K9LA 2DPHA 4GOKA 4ESEA 1T9DA 4K87A 2VT7A 3I9MA 3VPAA 4MDYA 2PUHA 1LPAB 2JGJA 1D07A 2ORED 2QD3A 1UKAA 1WUJS 3Q7RA 5CT6A 4ZVRA 5KVCA 4DSTA 3UT6A 2VOJA 4GKBA 4ITVA 2BUBA 4EABA 4HMQA 3SS9X 1GPUA 2VR1A 1EDBA 5EE9A 1L4UA 1M34E 4AJKA 5CK5A 2ZRJA 4DQXA 2BM9A 4QFBA 3S8EA 1FFXB 1I1HA 2JGIA 3TXYA 3I3SR 4I81A 4RH1A 3STYA 4Z49A 2D7JA 2H06A 1KDYA 3ZCPA 2BEKA 2Q62A 2WEKA 2X0JA 2WFLA 1KZGB 4K28A 1YZ3A 2FZEA 2V6IA 3KVVA 4JCCA 3W90A 4ZT3A 1C2TA 5GGXA 3UV3A 4NAVA 1VXRA 2GBFA 3TTXA 4M53A 2QN9A 1NRWA 1R7RA 3N0VA 3OHMA 2VDKB 3GLHE 1E6UA 2NO1A 4POOA 3FJYA 1H05A 2Q6TA 4HLDA 3OE7A 1VIDA 3G17A 4RTNA 1MVNA 2B92A 4UEKA 4Y1RB 2ETVA 1V45E 1JU3A 1YU9A 1DRVA 3A4VA 1O5IA 1WCIB 3AL0C 1YUNA 1G8KA 1D4FA 2ZTUA 5IM5A 3EEYA 4NE2A 5B37A 2RK4A 3SC2A 3GRYA 4W1RA 1J06A 1Q7GA 1H5QA 1ZGCA 5DHTA 3SC4A 2D00A 4BKOA 1XCPA 3P9NA 1S89A 1EP2B 1NVDA 1JA9A 2ZIXA 4IUBS 4W7SA 4EMTA 2H18A 1T1IA 1E94E 1N7HA 2XUOA 3AGQA 2FUG1 2XYGA 4KRGA 1W0JA 2HF7A 5EKSA 4GEGA 3A8TA 4OJMX 4NENA 3M5PA 4PNEA 3WYCA 3A9RA 4UHDA 5F1PA 3AEXA 5G02A 2DPMA 3CN9A 5D84A 3R8CA 4WLUA 3PCRB 2RCNA 2J09A 1L4YA 4XJVA 3TVTA 1WLSA 4U7FA 2G7MC 4UHCA 4FT4A 3HCEA 6CHYA 4UNPA 2C2HA 5G1PA 3DUFB 1GUBA 4YQFA 4J1TC 4A7PA 4LC1A 4Q1CA 1PS8A 5A9SA 1VJ1A 5KVQA 2Q0HA 2YICA 4UHKA 4MQFB 4QGHA 1HOTA 1CQWA 1OXBB 1L3CA 4P0TA 1ZXLA 4UHBA 3RS4A 3WNVA 1S2IA 3BD8A 3FMFA 5CYOA 1TU4A 1L9XA 4BBZA 4HQ6A 2CZGA 2XE7A 4RZXA 3NFYA 5AHOA 3JVEA 1QQ5A 5L3SA 1RJ9A 3U3XA 3MAGA 3WIVA 4EELA 1TCUA 4DT1A 5FFMA 3DV0A 3IT0A 4GBJA 1QH1A 3GLGE 2EQBA 2AF3C 1MU0A 1CY6A 1JQKA 1M1NA 2D3TA 2VSQA 4NIMA 3SZUA 1V39A 4Z86A 4XVUA 1OVGA 3BAZA 2HREA 3LGXA 3CMMA 3BKXA 2RC6A 1L3BA 5KJFA 3IMKA 3TCXB 4B32A 4FHCA 3NRJA 1IBCA 1SZPA 5EXPA 5LQNA 5GWXA 4M0FA 2EIXA 1CR4A 1RC0A 3F4BA 1D3AA 1PLLA 1RXYA 3AR9A 4P36A 2W7TA 1ZSVA 5EJIA 4IOLA 1G5TA 2KSQA 4BNXA 5KYVA 5L3QB 1QIFA 4IV8A 4AZ3A 1ADGA 4XRGA 1HLPA 1HMYA 3BUSA 4D8TA 1EKXA 1FDTA 2AJLI 3YASA 3AM3A 5FLEX 4DNQA 5BORA 4ZAGA 4JJAA 2WAXA 2CXOA 2PU5A 4DTIA 5B64A 1P7ZA 1A5AB 1KOGA 3UKJA 2J5RA 3OFKA 4YAFA 4E5PA 4F6CA 4JI7B 1VIVA 1J33A 2BHLA 1JR4A 2IYNA 1JG2A 1KEWA 1TT5B 1A3CA 4GZ3A 3HZRA 3ZXUB 3GUUA 3CNNA 3WLTA 1Y5NA 2CB9A 3G8DA 3NM4A 1OJLA 3WE7A 3FRHA 3EZ6A 3GGPA 4KZKA 4EVSA 1SXJD 1RJFA 4YPFA 3SJ7A 3JAMA 2CFTA 2GZHA 4QFCA 1KQ3A 3C3PA 1WWKA 3PQ6A 2IEAA 3E3NA 3FYUC 3MAAC 4ZQFA 2NVUB 1ZMBA 2RGNA 3GO4A 3IUJA 2QVXX 5CNIA 1QGOA 3LOUA 4DQLA 2HCJB 1JDJA 1G21E 2ZJ6A 1M54A 1QG2A 3HB9A 4WOCA 1EBBA 5CITA 5FEUA 5H5JA 4C2AA 4ZVVA 4ZK2A 3SICE 1ZD9A 1NQ5A 1J0CA 3CINA 3SMQA 3SEAA 2W42A 1WB4A 3HABA 1MRSA 3ZCUA 3EULA 5CYFA 2HCBA 3HV0A 4BYGA 3KPVA 3T9AA 1RR6A 2FW1A 4HGZA 3WRYA 5H4GA 2VBCA 5KYXA 4WXMA 5JDIA 3KL2A 1U3CA 2FSVA 4KQFA 1JH8A 2HMWA 4WX2B 3RLIA 5JY6A 1L5RA 4QBIA 3DEIA 2WYOA 4DJTA 4GPBA 1Z16A 5KJCA 5HK9A 3AKCA 2HDWA 1EX9A 1W1UA 3EW9A 3GUYA 1QVAA 1BEZA 3GDOA 2II6A 3TRJA 1F20A 1WU8A 4LJ7A 4X84A 1T5OA 2V7EA 2A78A 1DKLA 2ZBFA 3K30A 1HZZA 3WL6A 1XPJA 4ENRA 2XE4A 5F76A 4ZYVA 1VMDA 4CKWA 2FN8A 3H1BA 1ENOA 4TSRA 1OH8A 4YJ3A 3ED1A 1RQ2A 4K9SA 3W6UA 3VZBA 5ERXA 3AFMA 2W6ZA 1N8TA 1VPDA 1C0KA 1F2DA 3G3EA 4JITA 2Y9PB 2BMJA 3OJ0A 4KZPA 3UJDA 2O20A 3NAMA 3V33A 4EYSA 1LQUA 5KSZA 1F5NA 3R5HA 4WLVA 4JL8A 4YRZA 4WBNA 2B7LA 2P9ZA 4JC5A 1AKVA 4OK5A 4ZCPA 1VYHA 3TZKA 3V48A 4WN9A 3UAWA 5HW0A 3VJMA 4B40A 3LO8A 4RTMA 2X5JO 3NHWA 1I0IA 2XE8A 4JLVA 4Q93A 3V7YA 1NDQA 1NN1A 2ZJ8A 2HCTA 3FNQA 4PLFA 4QX6A 2OB2A 4N4AA 1RIFA 3V55A 3IR5A 4H0NA 1CBUA 13PKA 2PXHA 1CEQA 2HV9A 3U7QB 1K89A 3AUAA 3V2UA 3HYSA 2ROQA 5HZGA 1A7JA 2ACEA 5ESRA 1H6AA 2ONYA 2ODQA 2Q49A 3OFJA 5FTKA 3SLRA 1KKUA 1YR8A 3OZDA 4EHFA 2QBYA 1MB0A 1VI5A 3LFHA 2ZANA 4CDRA 1XTTA 4OQFA 2ZRIA 4LZWA 4MWBA 3VISA 3HCCA 2QIPA 2FPGB 4WNAB 3VO1A 2AKAB 3CUVA 4PRKA 1M1YA 4C1NA 3NBXX 4G5SA 3ABQB 2FZWA 3LHSA 1MJGM 1MUUA 4JBNA 1PK7A 1S3FA 2CWWA 4DUGA 1K4MA 5B4UA 2W8BA 1IBMB 221PA 5LDDC 2HXGA 1KMCA 1P60A 1S8FA 4MQ4A 4NS1A 1J8VA 2WYVA 3HDQA 1Y4AE 4RABA 4FX5A 1ZJ6A 4UTOA 1HNZB 3NI2A 2OK8A 1CJCA 2OKCA 4Y6GB 1S2LA 1T8TA 3FROA 5FBLB 1E63A 3VNUA 3W5HA 2K5UA 4BKPA 2FWPA 4ZGGA 5J4YA 4BMZA 1M2JA 5HJ7A 4ROTA 2WJJA 2BGWA 2I34A 3K0SA 3HUTA 1D5CA 5AJWA 4E15A 2I7VA 1C5KA 3PJEA 1TMYA 1W5EA 2NYRA 1OA0A 3U7FB 1NVWQ 1PVOA 5LPNA 4R1PA 1Q95A 1PZXA 2VSOA 2Z5GA 1E1CB 2DHCA 2X9LA 5D87A 2CDBA 4FCWA 4F21A 1H4TA 5EUCA 1VLVA 4AF6A 1CZLA 1YONA 2EWWA 2ONCA 5JH7A 5DXJA 4JSTA 3HLTA 2CVQA 1GNRA 4FW9A 2CXHA 3EIWA 1J1ZA 1THGA 3QOXA 4WCFA 1SXIA 1P1CA 2FXVA 1XCOA 1VA5A 1EESA 1Z4QA 3Q40A 3AR3A 3O82A 4NJMB 3WZMA 4MINA 4YTEA 2XW6A 3CN7A 3QVVA 4WOPA 3PLAE 2FUG6 1USKA 4F06A 4ND3A 3AR5A 4OL0A 4A8JC 1O97C 4EL5A 2HYDA 1C9MA 5EINA 2CD9A 2JI9A 3QEMB 2W2VA 3H6HA 4PZUA 4W9NA 3V1TC 5DK6A 4ETIA 1DFIA 1X86B 1OIVA 2ZRPA 3K1ZA 4KBYA 1ZH8A 1NU8A 3HSKA 4M7PA 2G0AA 3NANA 2WRZA 1MDBA 2FEMA 2Y93A 3U4DA 3VU8A 5JCXA 4LOLA 4O4JF 2ZSEA 3IEIA 4WKOA 2HUNA 4DPKA 4RL6A 1RW4A 2BFNA 5BV8A 4BFTA 5E6SA 2PN1A 3P0EA 4NEQA 3M1AA 3M70A 2GD0A 3PEUA 4PTLA 4DREA 2O5RA 5K3SA 4BP1A 3DA8A 1V1RB 4GBMA 4QE3A 4W8GA 1NMQA 2ATEA 3QVWA 4IHJB 1QFJA 3TE7A 3GLHA 2JB9A 2O4UX 1H1TA 2ZBRA 4CJXA 2HX1A 2ZYRA 4P92A 5BYJA 5K5EA 4UNQA 4ZQCB 1E2LA 4G09A 2X0FA 1J2TA 4BV3A 3HL4A 1CF4A 3IGFA 1QXSA 4QL3A 2Q4RA 1E79D 4HEA1 2HWXA 2PVCA 1VBNA 3HTXA 4ZYWA 1TL7C 1UP6A 1MX3A 1WKBA 1Z26A 4Q7KA 2IV2X 3HXTA 1Y8CA 1C8LA 3RVRA 2GN4A 4MQMA 5DCWA 3UH0A 2HQSA 1ZK1A 3O94A 4PYOA 3ZWCA 5I9IA 5EEGA 4QPCA 2OBBA 4GF5A 4OO3A 1GVNB 2J7PA 3O4RA 3O3MB 4U4AA 2LD4A 4KQMA 1R6UA 3V4PB 3ZWXA 4D56A 5M5BA 4IGEA 3GPDG 3T5GA 4WFIA 4Z9FA 1NVBA 1P3JA 4WNAA 1ZQ9A 2V0NA 4NXMB 1B8UA 2A0KA 4G5XA 2G9NA 1Y1SA 3SDBA 2Y0BA 4O3FA 2JJQA 3T41A 3HA7A 4X41A 5AK4A 4DEYA 1APBA 3KXKA 3THWA 4E2YA 1YULA 3NS7A 5LMZA 2GS9A 1XMQB 3I1YA 1N7GA 4U3JA 4C07A 2UVPB 4DHWA 1SQFA 3TLEA 2G9ZA 2L69A 1U3WA 3RGGA 5JXIA 3L8ZA 5FI5A 1C3VA 2ORYA 2ZAYA 3VOBA 3E2MA 1X70A 2PKQP 3PDCA 4M83A 4HAUA 2EIHA 4BVEA 4XOIA 1XLTA 3CE6A 2QLLA 3FF4A 2F48A 4UM5A 3OMLA 4F56A 1C4KA 4Y1GA 1RLJA 3BJZA 3M34A 1OX6A 4UKDA 3GLGA 4FOLA 4HDQB 4NBVA 3HVIA 4QYIA 3UCEA 5JG7A 4OGLA 4AO7A 3D8NA 3MJ4A 2R8OA 4EPVA 1P19A 2AYZA 3NFRA 1EE1A 4RF4A 3EGEA 2NXWA 2AVNA 1JJIA 1E1CA 5JALA 1ISSA 2J3QA 3ZBTA 4D0NA 1VTKA 2B34A 2XNSA 1Q7RA 3OIWA 4IZIA 4KSBA 3UBTA 4Z4EA 2Y4OA 3ENKA 3U7RA 3UUFA 3LT2A 1IUPA 1EE2A 4GKKB 3EB9A 3ITDA 3KR1A 5LWQA 1XRMA 3IH5A 4EG7A 4Y8VA 5HIJA 5JAPA 4TV9B 3PEWA 3TD6A 1QGAA 1QQBA 3LUKA 1SQ6A 3A32A 3DF7A 5FI1B 2Q2OA 4L8YA 5M3BA 3DFKA 3BGVA 4OAPA 1N75A 4G0VA 1RWNA 1YFLA 4BS9A 3E2PA 3U1BA 4TXLA 3EPHA 2IW3A 2VO1A 2PX4A 2GHRA 1DHTA 1I36A 5M2QA 3DCJA 4ZK6A 4URWR 2JHCA 5EE3A 3GLIA 1JKJA 4B9AA 4BNNA 1ZD5A 2VDJA 3AYXB 1ECCA 1FX0B 3PE4A 4QUDA 5JLAA 3BWYA 1ESEA 2EX0A 2F64A 4TM7A 3VRHA 1WD5A 4BIMA 3PJFA 5KOHA 2EZ4A 4AS1A 1HY3A 2WWFA 4FLMA 1JQEA 2BEVB 1GDHA 5G0UA 1WY7A 3HHPA 1QVVA 2FUEA 2FHSA 3AB3A 1XMIA 1N2XA 5JSYA 4GI2A 3DV9A 2QRNA 3LY5A 1ZUNB 5E4YA 2L18A 3EG9B 3CEMA 1JAZA 4Z1MD 3PJGA 3RSZA 1BX3A 1K2VN 5FUBA 4RD1A 1EXNA 1PDVA 1Y81A 1R0LA 3FXAA 1E0KA 1HLFA 5JCOA 4IVPA 3I01A 4YLYA 4DLBA 2PS3A 4JZKA 1EK0A 3WP1B 1AV7A 3PS9A 4AY4A 3QVMA 3B3FA 1KO7A 4O4IF 4EG6A 1MV8A 2EHDA 2EKPA 3E22A 3UHAA 4JR0A 1RPTA 2H9IA 1JIVA 5DF1A 1J56A 2BSXA 1QKKA 3ZI0A 3Q0EA 1GUZA 1NVUQ 5EZSA 5HM8A 1CUXA 1OH7A 1N5IA 1NE2A 3UJPA 1U7XA 1E92A 1QMPA 4QOFA 1GAEO 3AY6A 3Q8MA 1FFHA 3O03A 1OX4B 3R3VA 2B8NA 1DQYA 5E8RA 4O4JB 3LPMA 3BXGA 1BVYF 2C1ZA 3MINA 4IJ5A 1OLUA 1SHTX 3N8IA 5DTIA 2GPTA 3PC2A 5HRAA 4UQLA 3K73O 2RJ3A 2VNHA 3CSUA 3HBNA 5CGZA 1JTFA 1P2VA 4O0MA 3VAYA 4R2WA 4CTOA 1GYRA 3A28A 3USZA 4LJ6A 2ENWA 1HPLA 3OBBA 4CIXA 2VCHA 3UG7A 2YOGA 2IPMA 2FJUA 4LXTA 2YV1A 1T4BA 3OIYA 4F9TA 2P90A 4HB3A 1C0PA 3EEFA 4EM6A 4A0GA 1GZ5A 4NJEB 3BWEA 3TBHA 4P4LA 2FMHA 5A7FA 5AQ1A 5K6RA 3CEPB 3KLMX 4FXPA 4R6XA 1S2NA 4G23A 4N0DA 4S12A 5CLGA 1UKVY 4CIVA 3H2IA 4HRYA 3QJ5A 1N2JA 3U4QA 4B3MB 5FR2A 2HRRA 3OEHD 3GZNA 1ULHA 4GECA 3QQPA 3KDAA 4DFDA 3HSSA 3G88A 1G8SA 4EGFA 1RLTA 2CD7A 3UM9A 4EKEA 3O9MA 2IUTA 1SU4A 4Z6KA 1UXGA 1WVIA 2HM7A 2V65A 3LBIA 3QV1A 2HDOA 2Z58A 4Q7LA 4PS0A 1V5EA 5EJ6A 2Y2VA 4XRRA 1EDOA 1VSUA 3QVGB 3VKUA 4ZT6A 5JZSA 2JVJA 3IHLA 2YDYA 2HIMA 1XRNA 1YDHA 3BMXA 2ZJ5A 3INGA 1LLUA 4PYRA 4XSGA 3SSOA 3EZYA 3V4ZA 1RJEA 3RFUA 3E70C 4URHA 2R5FA 3DP7A 2MTBA 3ENQA 3KLNA 3TQSA 4YUZA 2DWQA 2GDJA 1XTBA 1RM3A 5TF0A 2QZSA 1GG8A 1YIOA 2WSSD 3R3HA 4IRXA 3Q8LA 3LCCA 4IG4A 1SXJE 4ASUD 1K7CA 2C54A 2CUTA 4EYKA 1DQNA 4HUQB 3HDHA 4GQBA 2OG2A 4RGQA 1EDZA 1Y8RB 3E8MA 1Y6ZA 3L0BA 4FFMA 3VFDA 1K7SN 5B3LA 1KQGA 2JRCA 5ICSA 5KTMA 1HDOA 1YVPA 4RZSA 4KGDA 2WILA 4RMHA 1D9XA 3MMPA 3N53A 3NONA 4KXVA 4QJ5A 3ZVMA 1FX0A 1RQNA 2WWGA 1U9IC 2EKBA 2FEWB 5AOAA 3HNOA 1AMUA 5HIMA 1QFSA 1JEQB 1QHXA 3BH7A 4YY3B 2TMKA 4UUQA 2JIMA 1LDYA 4B6JA 1Z7BA 1GKYA 2NXEA 4KFUA 1S1CA 1TIKA 4MJ3A 3DT9A 3TOVA 3BZBA 4ME6A 2Q7DA 1IHUA 4RK4A 4XLTA 4CKBA 1XKQA 4IIUA 3R3WA 4UHHA 4CWAA 2JCGA 2ZJOA 4D81A 3GAMA 2WJPA 3KXLA 2H16A 2IDKA 4E2FA 4ILKA 1U1FA 3IT3A 1D7OA 1ENZA 3V4LA 1IZ8A 1E9DA 3TZQA 1T8PA 3J7TA 3NHBA 1XWIA 1KP2A 1YT5A 4BDSA 1YRHA 4X1OA 4AP5A 3FCXA 4F5YA 2AS0A 3IOEA 4XWKA 1QUEA 4OGWA 4CEIB 3C14C 1YI1A 3QNMA 3HM9A 1O57A 3OMXA 4DMGA 2Q5QA 1U0TA 3STWA 2GKOA 2D1SA 4N8EA 4IFIA 3WLNA 4N1AA 2HW8A 3A3KA 5KINB 3L04A 3RJTA 1Z9BA 2JI8A 4PZZA 1KYXA 1AUXA 1WMAA 2KQUA 3OFND 3DVRX 4IDHA 3LH5A 4FLFA 2BUCA 4M7WA 3GPLA 1I7SB 3L7KA 2QPAA 2GF9A 3KQVA 3WMGA 1A4RA 1S3SA 1QLWA 4A91A 4QEKA 1PJSA 1Z2DA 1QPBA 2NSLA 1A69A 2H2GA 2EV9A 3LQRA 3TZBA 5JC1A 1YZVA 3L92A 4NOKA 3BC1A 4DIFA 2FPUA 2W6QA 4MWEA 5H3HA 2OECA 5FB3A 3CR3C 1OAKA 2ZSBA 3KSAC 2GF0A 1P29A 1TIPA 3UA4A 2G1KA 2Q3CA 3FPSA 3VDQA 4BC1A 4HNSA 1V37A 2DLCX 5ADHA 3RPEA 1YIAA 2X14A 1NLZA 3E5HA 1Z82A 2R0QC 2FWRA 2QW1A 3VZPA 1S2MA 2WQ7A 3EOZA 4XH9B 4EHJA 4J03A 4HQNA 3JXEA 5D51S 2B4QA 4O2AF 3B3GA 2VQ3A 3E6AA 1CQIB 2OHXA 4MKIA 4OHXA 3WICA 5B6PA 4ZTUB 1S0UA 2WF5A 2NSHA 3R7FA 3FVWA 4D45A 4D41A 4BQRA 1KMIY 3DLTA 3IXQA 4Q1FA 1FNBA 5EQJB 2BKEA 4OIFA 3CZCA 5DGIA 3RS7A 1PZMA 3IDQA 2QB5A 1D2RA 2E85A 3GROA 4MJ7A 2C58A 2Q3FA 5A0FA 4K0KB 3F49S 2G0NA 3GP8A 4GMXA 2QRPA 1QR2A 2Q9CA 3N39C 2X4GA 1K6EA 1MLDA 3PDJA 2C5SA 2O7SA 3ESQA 4XX0A 4BB6A 5AHXA 4I9UA 1EZ4A 1M2VB 2XQJA 1F0KA 3FE2A 5IS2A 4BE4A 1XL1A 2C0PA 1WKVA 2VXOA 1IOWA 2A4KA 4FYHA 1CYEA 1FFAA 4BMDA 2QTVB 2Z5VA 4JI6B 1ISHA 1DTWA 3ELBA 5IWAB 2EFCB 1E3MA 5HHTA 5CVCA 1K08A 1JB1A 5IPFA 3O95A 2PV7A 4V2IA 1U02A 4DZRA 2YZNA 4L72A 1Y8RA 5KIAA 2DHRA 3H4TA 4MYCA 1EVJA 1ITZA 4AB1A 4TWBA 2BGTA 4V0RA 4KGVA 4JGIA 2AIRA 4NZNA 1ZJWA 2B0CA 3GV0A 3IODA 3AJ8A 3JR7A 3F6EX 1ZA1A 2VH1A 3PYLA 3DW1X 3NTVA 2PS9A 2ZPUA 2YWBA 3K9LA 5DSZA 5EEHA 3W4IA 1DIGA 2W6IA 1MOSA 1T36B 2XZPA 4PX5A 3CM0A 2V54A 1LFDB 1E2UA 4E11A 3BMCB 3G2PA 3Q7TA 2WAYA 5B7QA 4O59O 2WFAA 1UUFA 1WCWA 5BMVB 3DHNA 1RWXA 3LQ2A 4BMVA 4U7GA 4HXYA 4WDQA 4FHGA 3VA7A 2PMFA 2ZDQA 2UKDA 3Q98A 4G5RA 2BL4A 4IH9A 2PGIA 3S70A 1WETA 1Q3TA 3B82A 1MTOA 3WNDA 1CHDA 2MHCA 4MP8A 1VJ5A 1PEDA 3B3QA 3UWKA 5ALGA 2P7IA 1JUDA 1GPYA 2WMYA 4G67A 3OTHA 2CSXA 4J16A 1GTSA 4JODA 2OUIA 3KB2A 4W7HA 1R27A 1OIWA 3RAGA 2FWJA 3DAFA 4LK2A 2Z9BA 3NOOA 5ALHA 2A9RA 1X42A 4J0CA 4JJFA 3DLPX 2OESA 3IIJA 1U63A 2JLZA 3OD1A 5IN4A 1Z8FA 4A2WA 3ER6A 1KZHA 2VLIA 3VSAA 1Q6ZA 4R3UC 5EXTA 1NBEA 3K0AA 1Y1TA 1EGAA 1MD9A 1UK7A 3BB1A 4YV2A 3E05A 3LPCA 3G5AA 1P81A 3IX7A 4P31A 5D85A 1KORA 4ZVKA 1SXGA 1N33B 1KYZA 4MZXA 3VR1A 3WWEA 3MQ2A 3A3YA 2ZYSA 2D1FA 1JI0A 3R6GA 4PR3A 3WADA 1DXYA 3EARA 3QWIA 4G4JA 4F4JA 5F23A 2JDID 2WVHA 4I4TF 4JOSA 2WSMA 2J3MA 1QZTA 2JCSA 3PWSA 3F5DA 2PS1A 1LU9A 3QVSA 3BF7A 2PZJA 3QYFA 5DE3A 5KVSA 1R37A 3K16A 3ZGZA 1NY5A 1Z74A 4RIEA 1M5TA 5LA6B 2FX3A 2AOUB 4JOCA 5CNKA 3S2GA 1ISIA 3FSGD 1QE0A 3IC5A 2BSAA 1PX0A 1LDMA 3QLJA 4RKEA 1LI5A 1GL7A 3NGLA 1XI2A 4O4IA 1YNSA 2RGNC 1D6JA 3OZVA 3OZXA 2PSFA 4IHAA 2DB3A 2NU9B 4MWOA 3FF1A 3H11A 4YS6A 1E6EA 3RYCB 2H3HA 4UTXA 5HTKA 1NVVR 3G23A 1U0LA 3GLFE 1T0BA 2I4NA 5C46F 2B4AA 1Q50A 3EUAA 1NBWB 1Z07A 3GJ3A 1JZSA 2OFPA 5BSKA 5FBHA 1X7ZB 2DG2A 4A15A 1K5PA 3WRYC 4I6EA 4H6VA 2CJWA 4AT1A 3JYHA 4P4NA 3W9YA 1VP3A 3I0NA 3THYB 2PMCA 3R3ZA 4AJPA 4JJ8A 2GPWA 5AK3A 1XTUA 2PMWB 4LGCA 3MG9A 3BREA 2QZ4A 4CL2A 1AQLA 3ZDZB 2ATCA 3ASZA 5C1BA 1HZZC 1Z0DA 4FZVA 5LUAA 2ZCJA 3K2BA 5AJUA 4IQ8A 2V45A 2QTVA 4KTTE 2G0TA 1ORVA 2B1GA 3H4MA 1G42A 2P35A 3TRDA 5CW1A 5JMOA 4E1VA 4WECA 1SZCA 3IB6A 4D42A 1LS6A 2V0GA 3H5NA 1XZAA 3H2BA 1JGTA 4GX0A 4X45A 1ETHA 1C7IA 1Y5IA 2XX3A 2P79A 3Q12A 1TYAE 3GARA 2JLYA 4U7TB 5FA6A 4AMYA 2X19A 5D00A 2BDTA 1NNI1 1TU3A 1T36A 3A70A 3EVFA 3MPOA 4FMCF 3V8BA 3E1GA 1Z4KA 1Z7YA 4AMUA 1XMPA 3BMOB 2BMDA 1UBEA 2R25B 2GBLA 5BQXA 1HQYE 5JAMA 2FB9A 4DJDC 1ZI6A 2V3WA 3QU5A 5J2UB 4I1YA 4CR7A 4OA5A 5F78A 2NZWA 3KWFA 4ERNA 4KPGA 2IEGA 5DBOA 1OH6A 2IZ5A 2P2YA 3Q0TA 1NMEA 1X7XA 1V5WA 1Y42X 2JLAA 1ZH2A 1AKYA 1BSVA 4MRSA 3FVRA 4QECA 4YRSA 3B5EA 3PGMA 3FW1A 2QG6A 1VBFA 1HYEA 1VA4A 4F85A 3LLSA 1DIAA 5ALLA 5GQSA 4JI4B 1T8RA 1WSAA 3K5WA 3SBOA 1SXJA 2DHDA 1M6VB 4L5BA 4NZYA 3PSHA 1WHTB 3F3SA 3QBDA 4CBVA 1TK2A 1XVLA 1JLKA 1I4OA 1AXRA 2FFBA 5GTDA 1J4AA 2YW9A 3Q3EA 5CAEA 3RUIA 2VUIB 4JBXA 1R0SA 5EQFA 1MABB 2PFSA 1DDGA 3DD1A 4K1LA 3RB8A 4KODA 4AF8A 5C8DA 3NQ41 1SCUB 1YCFA 1H0KA 1V71A 3OOYA 2YZKA 4HAWA 2ZR8A 3LWBA 2W48A 2A3RA 4D3DA 4F1WA 2JLXA 1FYVA 4X63A 3GAAA 1VJGA 3GDWA 1Z2NX 1WS6A 5F21A 1KY5A 3FDXA 2HDHA 2PR2A 3OJFA 1NUPA 5DM60 2IYUA 4RH0A 1M6HA 2VF4X 4UMEA 3HSYA 4PHFA 3SHWA 1JF8A 1NW9B 4OYLA 3HO8A 4TRMA 2TMYA 5BR7A 4BWFB 3RTAA 1KR5A 4PNZA 1N2BA 2EBHX 3P2IA 2GZDA 1EB9A 4R0NA 1JDZA 5GAJA