4ZI5A

Crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
239
structure length
239
Chain Sequence
GAMTARKVDYTDGATRCIGEFHWDEGKSGPRPGVVVFPEAFGLNDHAKERARRLADLGFAALAADMHGDAQVFDAASLSSTIQGYYGDRAHWRRRAQAALDALTAQPEVDGSKVAAIGFCFGGATCLELARTGAPLTAIVTFHGGLLPEMAGDAGRIQSSVLVCHGADDPLVQDETMKAVMDEFRRDKVDWQVLYLGNAVHSFTDPLAGSHGIPGLAYDATAEARSWTAMCNLFSELFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P91
publication title Ultrahigh-throughput discovery of promiscuous enzymes by picodroplet functional metagenomics.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
total genus 81
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2015-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zi5A00
1E8MA 4TPKA 1PFQA 4GBGA 2WKWA 4W1PA 3WYDA 1C4XA 4WDRA 2HU7A 5AKEA 5ALQA 1GZ7A 1BN7A 3HJUA 1IZ7A 4QDUA 4AN0A 3UUEA 2VJAA 2OLEA 3IDAA 2HADA 4BE9A 2I3DA 3D5EA 5JD4A 4OPMA 1XZIA 3IBTA 4AX4A 4F5ZA 3D0KA 2AJDA 4H18A 5JZBA 2OGZA 1IVYA 2C0PA 4X92A 1XZCA 1XZJA 4CIBA 4EBBA 1A88A 1ODCA 2ZYSA 1ZI6A 5ALFA 3O9VA 1QIFA 1H2WA 1U65A 3DEAA 4UHEA 1XRNA 4CCYA 1CUVA 4UFNA 3I6ZA 4UBNA 2Z8ZA 4EHBA 5C81A 5AKJA 3K2IA 4DMKA 4KJXA 3WJ1A 5IH7A 5FKJA 4X90A 2YASA 1CUEA 2XQFA 3LS2A 3Q0TA 1JJFA 1UKCA 1QE3A 3H2GA 3WWOA 2ZVDA 1ORVA 2PSEA 2Y1KA 3C6XA 3O0DA 2XMGA 3F97A 3V48A 3X3HA 3PF9A 4P92A 5AK3A 2HIHA 3GELA 1TQHA 1R9NA 4UHCA 2WG2A 4LIPD 1XZLA 5AKIA 1AURA 3AFIA 3VVMA 5CT4A 5CT5A 3WQHA 3HRHA 5ALXA 4A5SA 3CN9A 4Y7DA 4X7BA 5HCUA 1R9MA 3I2HA 1CUHA 1YSCA 3R0VA 4X00A 5AK4A 4E11A 2QUAA 2WTMA 3VVLA 2B4KA 3O4IA 5DTIA 2VA9A 3EBLA 5FLKA 4CG2A 1ZJ4A 5K3BA 1THGA 3I6MA 5HF6A 2GBCA 1GQRA 4H7KA 5DNWA 4JUIA 4B80A 1HKHA 4AQDA 4UBJA 1VXRA 3OOSA 4BTVA 1QIGA 1MAHA 3M82A 3UMJA 1EH5A 2HU8A 4KRYA 1DX4A 3R3XA 4OB6A 2QUBA 1FFEA 4WFIA 3BJMA 2ZJ7A 3HSSA 1TAHA 4I3FA 2H1IA 1QZ3A 3DS8A 4F21A 2QJWA 4Y2QA 1YA8A 4G8CA 2C4HA 4Y2UA 1GXSA 1UOOA 1XZEA 2XMSA 1LNSA 5K3EA 1QFSA 1CUWA 1CUGA 4DNFA 5CH5A 2QKYA 5YASA 2QTBA 2XMZA 4QDTA 3HEAA 1QO9A 3FLBA 4PNZA 4UHFA 5FRDA 3W04A 3U1TA 5ALEA 5CXUA 5ALLA 1LZKA 5AI9A 1LGYA 3QMMA 3GZJA 1CUJA 2ACEA 3NWOA 4ETWA 3FCXA 3ZLVA 1UKAA 3FNBA 1R1DA 2C58A 3OG9A 3IA2A 2PPLA 5JIBA 4EZIA 3QH4A 3C8DA 3I2GA 4BZWA 1QIEA 3BL8A 2I78A 3OC0A 3PFBA 4UHHA 3AZPA 1VOTA 4BC1A 1X70A 4RGYA 4B0PA 3H19A 5IKXA 2BFNA 3ANTA 4PQEA 3NUZA 4M0FA 2WJ4A 4EUSA 2XUHA 4CG1A 3WA6A 2J4CA 4DM7A 3AZQA 4BAZA 1AC5A 4U2CA 1DX6A 4N8SA 3WIBA 1XZHA 5A7FA 2WUDA 1SOMA 4FFVA 3PFCA 2XMCA 3K9BA 1PV1A 1P0IA 5ALUA 3I28A 1FFDA 4ROTA 5E4JA 2RHTA 3PI6A 2CUTA 4AZ3A 1TKRA 4JYMA 1AQLA 2B9VA 2PL5A 3I6YA 3H2HA 1CUCA 1BCSA 5JAHA 4WDQA 4DGQA 4GW3A 3QM1A 2IX9A 4BAUA 4J0GA 1EHYA 4L72A 2WIKA 5ALPA 2ZJFA 3W2TA 3AILA 3HI4A 3I2IA 1ACJA 1UXOA 1AGYA 1C7JA 3QPAA 5AO9A 3KWJA 1Q0RA 3R3YA 4LHEA 4LKOA 4HXFB 4IHAA 5EIHA 1CUUA 2IIVA 1Q83A 1UZAA 4YPVA 1DU4A 3AIOA 2C5GA 2Z8XA 4NMWA 1EX9A 3HYSA 2C0QA 5E4YA 1XZGA 3JW8A 1CQZA 3IULA 4ARAA 1T4MA 5JANA 4KEAA 3L1HA 3Q8WA 1XRRA 3FVRA 4FBMA 3O9MA 4IQ4A 5ALKA 3H1AA 5CT8A 5ALDA 3WK9A 5CW2A 4GXNA 1YB7A 4Y2YA 2PU5A 4EY4A 4YASA 1AUOA 5EIAA 1OCEA 2YYSA 4Q82A 4XJVA 1EVEA 3WLAA 3KOOA 1U8EA 4Q3OA 3H0CA 5ISMA 1K63A 4BVKA 4BE4A 2GYUA 4Q3LA 2VJCA 2V96A 4X71A 3DYVA 2X5XA 3H1BA 4DNOA 3DOHA 4BP8A 2Z3ZA 4DTCA 5DLPA 3BWXA 2PBLA 5AJHA 2WM2A 4CI9A 2JEZA 4QLAA 3ZV7A 1U2EA 4Q1VA 3C6YA 5E2IA 2QT9A 1BEZA 3R3UA 2VEOA 2B61A 4NVRA 4DMCA 5AKXA 1G66A 5ALJA 2G63A 3IUMA 4H7JA 1DWOA 2V98A 5HQ3A 1SCIA 1EK2A 3K6KA 3TGLA 5AOAA 4X6XA 1QOZA 1LZLA 5LLSA 2BUBA 1DINA 1DT5A 2EEPA 2HA5A 4OD0A 1MX9A 1TCAA 4QWWA 2QMQA 5I7UA 4H7DA 2HFJA 1USWA 4FLMA 1ORWA 4H0CA 4RE6A 5CMLA 3KDAA 3STYA 3PUHA 4J0HA 4HZGA 4JNCA 1CUFA 3ED1A 1EB9A 2VAVA 5CT9A 2XMBA 3DYIA 2FJ0A 1L7AA 2H7CA 2ONCA 3G7NA 2HA4A 3BDVA 2BKLA 1S8OA 4QLOA 4RPCA 3CN7A 1ZD3A 4G8DA 4QEKA 4BC0A 5HF5A 2CJPA 2VAXA 4BCCA 4INZA 1BS9A 1NX9A 4BZZA 2ZYHA 3G9XA 2W6CX 3GBSA 3GUUA 2B20A 3MUOA 2WG0A 4FNGA 2P8SA 1TCBA 2GYWA 3WJ2A 4L3WA 3FSGA 1B6GA 2BGNA 5D3ZA 1MT3A 5CURA 2QR5A 1QTIA 3ICWA 3STTA 2VQ6A 3C70A 4DMHA 5FPQA 3ZPXA 4H7EA 4GHWA 5KBYA 1NU8A 1RWQA 3G0IA 4B82A 3F8SA 2GBIA 5AKGA 4CCWA 3G9ZA 1XFDA 4A16A 2PSFA 4BB0A 1X2BA 1U4NA 5JAPA 3EF3A 4OU5A 4AN1A 2RONA 2Z3WA 5HK9A 4BP9A 5LZ2A 1XQYA 5LZ7A 4WFJA 5CH3A 3WKAA 3BE8A 4G4JA 1DWQA 1R4ZA 5T4HA 3STVA 4MEAA 3D7RA 5DTJA 1ODTC 5IVIA 2HA2A 3WK4A 1P0PA 1UOPA 2WU3A 3WKDA 1J1IA 3C6BA 2H7XA 2RI6A 2HL6A 4FLFA 3T52A 5FV4A 3SK0A 4AMZA 3DKKA 2XQJA 1ACLA 1BCRA 1HPLA 1A7UA 5C8ZA 4OU4A 4BCBA 4B0OA 5EFZA 2WIGA 3PUIA 4B83A 2NW6A 3BF8A 2X76A 3CCCA 3BF7A 4KYVA 2EDCA 3GA7A 1W4LA 1FSSA 4MQLA 1YS2X 1HDEA 1QO7A 2HA0A 1CUDA 2OCLA 5AI6A 1WPRA 2H7YA 3WWEA 2ES4A 4H77A 4H35A 5AKZA 3VKFA 3C6ZA 3OTQA 4MYSA 5D7BA 4Y2TA 3OURA 5JARA 1H2ZA 4Q34A 4IH1A 4PO3X 4GI1A 3EQ7A 2XUPA 4PF1A 1MN6A 4E14A 1HQDA 4B6GA 1XZMA 4DLNA 3RARA 4C89A 3SWWA 4L0CA 1QGED 3QITA 5A2GA 6YASA 1WHTA 2WIFA 5E4TA 3CCBA 3KWFA 3IURA 4KRXA 3VXKA 3V9AA 4QWMA 4N8DA 1W6RA 4J0JA 4ZREA 4DSZA 1UFOA 2H9YA 1E89A 3GFFA 1BU8A 1H2YA 3WKBA 5FXMA 1CUYA 4NZZA 4B9EA 4Y2SA 1YA4A 3HXKA 1SC9A 4C01A 1YASA 4BTLA 3I1IA 2HM7A 2J3DA 2VATA 5AKLA 1E66A 1XQXA 1LPMA 2RGUA 3UUFA 4ITVA 5FP0A 2XUOA 5DYYA 1HLGA 3C45A 1X2EA 4J0DA 4K6HA 4ZV9A 2XMRA 2VT6A 1CUXA 2OCKA 4FBLA 4OSEA 1LLFA 1G5FA 3FBWA 2ZSHA 3B3QA 4B81A 2XUFA 5HZGA 2JF0A 3D2BA 4P9NA 4G4IA 2XQIA 4AMYA 5AKKA 3HABA 2OGSA 4KE9A 5AK6A 2WUEA 1BROA 2PKYX 1P0QA 4H7HA 5EHZA 1ISPA 3JWEA 4W63A 1XZFA 1YR2A 2CKMA 4HTAA 3V1NA 1K4YA 4G9GA 4P08A 4FTWA 4MYDA 2BGRA 5J3JA 3B12A 1XKLA 1JU3A 1FJ2A 3ESDA 5LKAA 4BRZA 5ALMA 5HFAA 1HL7A 2AJBA 2JGIA 5LZ9A 1J06A 2O7RA 3PICA 5HF9A 2O2GA 3N0TA 4MQMA 3WWDA 5ALYA 4EY7A 4KR0A 3QMWA 2ACKA 4CFSA 1VE7A 4N8EA 2QJRA 4QDXA 4FKBA 3VDXA 1TCCA 3ICVA 4B84A 2HA7A 3HC7A 3FYUB 5EGNA 5JYCA 2WUFA 3WWPA 1GGVA 1L7QA 3STUA 1UKBA 4N5HX 2DFPA 3IUNA 1E3QA 1XQVA 2IITA 5JD6A 4U2GA 2HFKA 2GYVA 5CXXA 1EXWA 4EY6A 5LZ4A 4AZ0A 1EA5A 2BAGA 2BJHA 2K2QB 4M0EA 3STWA 1GPLA 2XUIA 5CTAA 3ESBA 4UHDA 3PE6A 1Y7HA 1XRMA 1FFCA 3FLAA 5FPPA 1WB6A 2DSNA 1VZ3A 4GECA 5AM3A 3O95A 1M33A 5BV7A 1LPPA 4FFWA 1WB5A 1OILA 1CUAA 1YCDA 3JYHA 3TJMA 2XUJA 4DIUA 3FAKA 1XRLA 5AIBA 4C88A 3FVTA 4OB7A 4ARBA 1GPNA 2XLBA 4U2FA 4HXEB 4UUQA 4X97A 2ORYA 2PVSA 4G8BA 4GDMA 2JBWA 4HS9A 4JYPA 7YASA 2D0DA 2OAEA 5DYTA 2AJLI 3RM3A 1MNQA 1VE6A 1FFBA 2W22A 3FWHA 5C7YA 5I8PA 5ALGA 4P93A 1MTZA 1DTEA 3DL4A 3TEJA 2WHRA 1H23A 3G0DA 3L1JA 4LXIA 5AM2A 2WFZA 4WY5A 1EB8A 3PF8A 4X95A 5IVDA 4F0JA 5FDFA 2XUGA 5DNVA 1JJBA 4BDTA 1THTA 3F98A 4UBLA 5ALOA 1XLUA 4J0IA 5ALNA 3H2KA 4IO0A 4A23A 2XLCA 1ZOIA 4LYDA 1GPKA 4IH4A 2CEKA 1DQYA 1YB6A 1CV2A 4MWSA 5AI0A 4EY5A 4M0MA 4UFOA 2Y6UA 2VTVA 3EIOA 3QYJA 3F67A 1RP1A 1SCQA 3RLIA 4WFKA 1JMKC 4XIIA 3RK4A 3BIXA 3DQZA 2XUQA 4E15A 5CH8A 5EI5A 2QXTA 2Y6VA 3STXA 5A62A 5AI5A 1QIDA 3I2FA 4OCZA 1XZDA 3T4UA 5K3DA 3CXUA 5DWDA 2ZYRA 1GT6A 4IH9A 2XUAA 3WL7A 3DJYA 2HU5A 2HHAA 4K6KA 4GWLA 2OQVA 4PSCA 5JAOA 4V2IA 1R88A 1XRPA 1LPSA 5KWJA 2ROQA 1MX5A 3V1MA 2QXUA 3R40A 1GKKA 3AUKA 3WK7A 3SC2A 1VKHA 4O08A 3E4DA 5ALVA 1QLWA 2E3JA 1N1MA 1XKTA 4HAIA 4BRSA 1CR6A 2GZRA 4UBIA 5AKYA 2R11A 5AH0A 1SFRA 3MVEA 1H22A 4ZV7A 3M3DA 1E5TA 2WFLB 2DQYA 4Q3KA 3DKRA 3OM8A 4X3CA 3FYUC 2PSHA 3LLCA 2WQZA 1IUPA 4KACA 1XZKA 3WZLA 3WA7A 2Q0XA 4NS4A 2D5LA 4B85A 1Y37A 5AI4A 4ZI5A 1O6GA 3D59A 1Z68A 2QVBA 2XQGA 3P2MA 3W9UA 3VJMA 5AOBA 4KE6A 2Y2UA 4L9AA 1EINA 4FDMA 3LP5A 3H04A 4G5XA 2WU4A 4PV7A 2OG1A 1O6FA 2ZSIA 3DDUA 1QONA 5T4BA 3ZLUA 2OQIA 4U2DA 5JALA 2VT7A 1H2XA 5AM0A 1A8UA 2CBGA 2I3ZA 2WHQA 5JASA 2J4FA 3ESAA 1F8UA 3F96A 4G1FA 1TK3A 1SCKA 1K5PA 2O2HA 1BE0A 3QZUA 3C5WP 2BUCA 4GLBA 1WPXA 2JGFA 1WOMA 5AICA 2G5TA 4E46A 2HA6A 3BJRA 1BRTA 2WHPB 3IUQA 1R3DA 3IVMA 5JAUA 2ZJ6A 3ZWQA 3H2JA 2WJ6A 5BWBA 5JADA 2C5FA 1VXOA 3B5EA 1W75A 5K3AA 3PDCA 4C87A 1Y7IA 2JGEA 1P0MA 1VZ2A 3DD5A 3WI7A 2X8BA 3DL7A 3MUNA 4YX9A 5D6OA 3RKSA 4Z49A 5A7GA 4QZVA 4FMPA 5IVKA 2UZ0A 4MWTA 4KE7A 1FFAA 1AKNA 2OPHA 1R50A 2DR0A 1QIHA 5DJ5A 2Y2VA 4J0CA 1EK1A 5LZ5A 3R41A 4AO8A 3QPCA 1QTRA 5K3FB 1WHSA 4OYYA 4N5IX 3IB3A 5ALHA 4FHZA 2GZSA 4H7IA 2QS9A 2JIDA 1LPBB 4AO6A 2JEYA 2PSJA 3LIIA 1G42A 2V9ZA 1BN6A 2LIPA 4EA6A 3V1KA 1UK6A 1JT2A 2DCMA 4PSUA 4W9RA 3GROA 4J3JA 1W52X 1KU6A 3DNMA 1NU6A 3W05A 4G4GA 4G9EA 5CBKA 1ZJ5A 1XQWA 3A2NA 3IUJA 5HFNA 3QPDA 5LIPA 2JGMA 1MNAA 3C8HA 5ALIA 2V97A 1ZICA 4K6GA 3FLEA 4X93A 3DOIA 1IUNA 2GBFA 5C8XA 5LKRA 3MGAA 2WFMA 2XT0A 2XMDA 2OAGA 1UK7A 3FYUA 4JH0A 3C43A 2RHWA 1VLQA 4LXHA 5H3HA 4CG3A 1B41A 4U2EA 4Y9SA 4BCDA 3DLTA 1MO2A 5HF8A 4DNQA 4ZGBA 3G0GA 3WK8A 5HKBA 2C7BA 3R3VA 4TGLA 4J7AA 4Q05A 2QRUA 3KD2A 4DMFA 3TRDA 1YAHA 3BDIA 5K3CA 3F9CA 3O4HA 2O7VA 4I19A 1K6EA 2PUJA 1UOQA 3A6ZA 2XUDA 2PUHA 1VA5A 4OB8A 1JU4A 4RE5A 4EY8A 1F0NA 3WMRA 4AB1A 3G9UA 3HZOA 2DHEA 4HRXA 3S2ZA 4BVJA 2RIPA 4MEBA 4ZXFA 4W1SA 1LBSA 1LBTA 3WK5A 4F60A 4WCVA 1ZGBA 5AK5A 3NOXA 2JGKA 1AX9A 2ZYIA 1XROA 3AINA 4BVLA 3O4JA 5DNUA 1CRLA 1VA4A 1F0PA 1XLWA 3AJAA 1CVLA 1EDDA 4C4ZA 1YAJA 1RYYA 5IVHA 3IIIA 4X6YA 4QE3A 4CCYB 5AOCA 3KXPA 5HKAA 1WB4A 5CT6A 1E8NA 2QM0A 2GBGA 2DHCA 5D3KA 1F6WA 3WWCA 3N2ZB 2ECFA 3C5VA 3V1LA 3NGMA 1UT6A 1GKLA 4BDSA 1AZWA 1XZAA 1DWPA 4GEGA 3WKCA 4FWBA 3G8YA 4BAGA 2XE4A 2FX5A 5T4EA 3ESCA 4H7FA 1DQZA 5SYMA 5BWCA 5FOQA 4Y2XA 3HACA 3FCYA 1CPYA 1XLVA 4J0KA 3ZLTA 5JZ9A 5F4ZA 4S0XA 4Y2JA 4U2BA 5AKHA 4UHBA 4MXDA 4XWGA 1W1IA 2I03A 1ZIXA 2DHDA 2WILA 1BEEA 1E8DA 4X91A 3D4LA 4KAJA 1D07A 2OXEA 1JFRA 4C4XA 2CMFA 1W76A 1EVQA 3R3WA 3SX4A 1EDBA 4PSDA 3VJLA 2JGLA 4QDOA 3ANSA 2WSLA 1CEXA 1T2NA 1G4HA 2JGJA 1AMNA 1IUOA 3E3AA 2CZQA 1ZI8A 3R3ZA 4WJLA 3G9TA 3H18A 1JMYA 4HVTA 4AXBA 1QIKA 5A6VA 1CIJA 2HA3A 1UK9A 2WG1A 4RNCA 5LZ8A 3G02A 3WYNA 4XX1A 4EB0A 5FUMA 1EDEA 3HLKA 5JATA 5LYYA 2XUKA 3QVMA 4UBKA 5EHNA 1WM1A 5I9IA 1ZIYA 5AM4A 1QIJA 4J03A 2OCGA 3ILSA 3W06A 3EQ9A 2VSQA 1Q84A 3VISA 1QIIA 4Y2VA 4OUKX 1OXMA 1QIMA 2YXPX 5AM1A 2DQZA 2OGTA 1MU0A 1K8QA 5LP1A 2PSDA 4Y2RA 2WIDA 2WFLA 4MJ3A 2FUKA 3D3NA 3FOBA 4FNMA 4Y2PA 4B7ZA 1CFJA 3S8YA 1LPAB 4QNNA 1IZ8A 5SYNA 1TRHA 3A2MA 4D9JA 5KWIA 3OPMA 3WL6A 3QBJA 1MAAA 2HRQA 1N5MA 1CUIA 2XDWA 2BCEA 1QJ4A 1HBJA 1XZBA 5EIEA 3BXPA 3H2IA 1JKMA 3KSRA 1CUZA 1UK8A 2BUAA 1CQWA 3WKEA 3AZOA 5ESRA 4UFPA 1DT3A 4CIAA 3ZI7A 4HXGA 3BIWA 5EHXA 1ZI9A 4W1RA 5BOVA 1LPOA 3WZMA 2XI4A 3U0VA 1ZD5A 2G4LA 4KAAA 3LCRA 3LIPA 4X94A 4FOLA 2WHPA 2AJCA 1KU0A 4XVCA 3G0BA 3W9BA 5EHQA 3O4GA 4B9AA 1ZGCA 4ZWNA 3G0CA 4TVKA 2WLSA 2CB9A 4BBZA 2VF2A 5JZSA 5CRIA 4YK7A 2HDWA 4DYHA 4WY8A 3WIOA 1Q0ZA 3VJKA 4KE8A 4KAFA 1N5RA 1LPNA 1VJ5A 3L1IA 2O2IA 3YASA 5HK8A 4LXGA 1XRQA 3D2AA 4PW0A 5A7HA 3QMVA 3H17A 3WL5A 1JJIA 3I1YA 1UWCA 4JEIA 3I2KA 1PJAA 3M83A 1KEZA 3FSGD 4UBOA 5AM5A 3M81A 3A70A 4X6UA 1MPXA 2QZPA 2VJBA 2WTNA 4I4CA 5ALTA 4FLEA 5AHXA 2WUGA 1A8QA 4QDZA 1MX1A 3A2LA 1IMJA 3DCNA 5K3FA 1A8SA 5DYWA 1MJ5A 2XB6A 3FYTA 4C4YA 4BYMA 5K5EA 2AJ8A 3EQ8A 1GQSA 2OCIA 4X85A 1WCYA 4DSAA 4AO7A 2AXEA 2R8BA 3C87A 2WJ3A 2YH2A 3AIMA 1I6WA 2PM8A 4UPDA 2Z5GA 4UBMA 4BATA 3E1GA 4OYLA 5KREA 4HRYA 3WL8A 5JD5A 1J2EA 5ALRA 1CLEA 4ZRDA 4C6HA 4K2AA 2PX6A 1ZD4A 1QFMA 5AP9A 5ALSA 5ALWA 2EDAA 4LYEA 4QA9A 5AIAA 1N8SA 3E0XA 1CUSA 2XQKA 1ODSA 2XMQA 2WIJA 2PU7A 2RAUA 3AIKA 5A71A 1YS1X 3WK6A 1CUBA 2FJPA 2QOEA 5C8VA 4W1QA 3D2CA 5HQ3B 1J07A 3I2JA 2HRRA 1ZD2P 2VJDA 5AI8A 1TIBA 4DNPA 1L7RA 1JI3A 1EI9A 5ALZA 2G5PA 5T4FA 2J3QA 1C7IA 4K5QA 1ETHA
chains in the Genus database with same CATH superfamily
5BSEA 1VE3A 2H11A 1NBMD 1PFQA 2GEBA 2GETA 2IZ1A 2QMZA 2Z5FA 3N8NA 4KQCA 4F72A 2B3DA 2EG5A 3QE0A 4WDRA 4U7TB 5HMLA 1GPWB 2HZ7A 3DFUA 3RFXA 3LZDA 3PCRB 2QN6A 4TWJA 2ID4A 3ZJ5A 4Z4QA 1VP9A 4L6AA 1JDBC 2J5BA 4TMVA 2I4LA 3EA4A 5F5XA 5I9LA 4R2KA 4XOUA 1FMTA 4K6OA 4UCWA 4MDHA 3H5NA 5JZVA 2XDAA 3HFJA 1Q91A 2G1JA 4DLLA 2ZR0A 3QEKA 3Q40A 3R76A 4GQAA 1QKKA 4M38A 2VP9A 5BNIA 4BE9A 1KPHA 1WMAA 4OHUA 3V97A 3Q9NA 4TT8A 5JD4A 1C8KA 1QYXA 1U28A 4PPQA 5B6IA 3OLWA 4UDXX 4YT2A 5GADl 3IBTA 2GESA 1WUHS 4HVLA 3UWDA 4NBRA 5C3UA 3BAZA 4MW1A 5EVCA 1W0JD 1CQIA 5E8JA 3AVUA 4H18A 1GIAA 2HLHA 2W9XA 5IANA 1JH9A 2BDTA 4RZ2A 3A04A 1G64A 2OGZA 1IVYA 4MVWA 2YVUA 2C0PA 2EFEB 2QG9A 4IWYA 4Z9BA 1GAWA 1GP2A 121PA 4CIBA 1V95A 3EUFA 4D0NA 4BUZA 2IYYA 3AM3A 5DYIA 2SBTA 4AKTA 5TQ2B 1O03A 3L6BA 4ML3A 2GERA 1TM5E 1BWSA 1MO4A 3WGVA 5IXJA 2ZYSA 5BUCA 1VCOA 3KZOA 1UQTA 3L0DA 1J39A 2B21A 2F62A 4CT4B 4EF6A 5ALFA 3WQBA 5BR1A 4B8ZA 4KWIA 1XO1A 2ZOSA 3QOYA 4J7UA 4XGKA 3SX2A 4PZ9A 3PDIB 5FWNA 1H2WA 1U65A 4BU0A 3VR5H 5JJKA 1MJNA 2PD6A 4EG5A 4MWGA 3PD7A 2HIAA 2OT3B 5AFSA 5GOZA 5H68A 1LLCA 4XB6B 2OA0A 2ZRMA 4MVJM 4CCYA 4OLFA 4HZUB 1I4WA 1P7ZA 1D09A 1V9CA 1U1DA 2P6PA 2I4TA 3KKPA 1ESNA 1VKZA 3GN1A 2I9KA 1Q57A 4KGXA 2UVPB 1IVSA 3O5AA 4OHPA 3B7WA 3MINA 1DEHA 1JHPA 5MGNA 1MGPA 4AJLA 1IZ9A 1N0WA 5A4MS 1X87A 4L27A 3TDKA 1T4GA 5LB4A 3SXJA 2SECE 3ONNA 2XVAA 3TLEA 3VSCA 1TL7C 3PNVA 4LFCB 5ADUS 1BX1A 2FN7A 2QN1A 1G19A 2YIDA 4TLBA 2LVBA 3D6VA 3OF2A 1W5EA 2CXQA 3GC6A 3PI7A 4NZ9A 3ZE2B 3ZW7A 5JS2A 4RMJA 5T64A 2O3JA 5J5CA 5IZCA 3M4ZA 1CVRA 1QE3A 2IHYA 4NZMA 2QMEA 3DBHA 3P71T 4B3BA 3WWOA 2ZVDA 3KFXA 3IEMA 2Y1KA 3X3HA 2R8ZA 4MJ7A 1G9XA 2E5FA 3EF0A 3NH6A 4E94A 4F92B 3BH7A 1DBSA 2I8AA 3NP9A 3Q7IA 5AK3A 2HIHA 1OAOA 3KE8A 2ZIWB 3OM1A 4X0EA 1LK7A 4PG5A 5E7IA 2HR1A 1CFZA 3C24A 3EVZA 3QW2A 1PJQA 1KH2A 2IOYA 4LIPD 1CZRA 1XZLA 2GCPA 4JAVC 1AURA 1F20A 4QJ3A 3EXHA 1EA7A 5JQGF 5LUAA 3PE4A 1ESDA 4YMUA 3VVMA 1W1UA 5CT5A 4P4TA 1E3SA 2GZ2A 4OHCA 3C7CB 5BPFA 1TZ2A 4GRAA 4ZQGA 5H82A 3AL0C 3CN9A 4Y7DA 4PO1A 4X7BA 2QRPA 3I2HA 1JI0A 3IKMB 4R68A 1Q0SA 2GRJA 2C4KA 2MSWA 3NYIA 1GLGA 3FSJX 2FN9A 4XQGA 4AJEA 1KAOA 4GLFA 1A2QA 1F12A 2WTMA 2PXAA 1P4RA 1FP7A 2B4KA 3BMQA 4R2HA 3ADPA 4TMZA 2JJ1A 2XYRA 3SI7A 1AMUA 1PUJA 1OBOA 3DP7A 3VX3A 2LRHA 1U7DA 3LCMA 3VR5A 1ZOLA 4ZAYA 2QMHA 3LDFA 5JECA 4BMNA 3ZVRA 2WM9B 4EMTA 1FQKA 3SSAA 5KJFA 1NX6A 2C1EA 4LF4B 3S3TA 4K9MA 2M9MA 3FCAA 3PNKA 3OPYI 4FSXA 5DK6A 4WLOA 5G3YA 4G0WA 1THGA 3OE7A 4FVTA 2ZJ0A 1V11B 4LXTA 4EB6A 5IPFA 1CERA 5HF6A 1GQRA 1W93A 1X1CA 3SIPA 1E4EB 4B76A 5BT8A 2BDEA 4FKZA 1NW4A 3SJUA 5EP2A 4B80A 5JROA 1VXRA 3OJOA 4K8OA 2ZAGA 4NG4A 3EEQA 2YX1A 3LYLA 1W5FA 4OREX 4XM2A 1L5OA 1O94C 4TWRA 3UKDA 3BGWA 2BGLA 1EH5A 3SKYA 2ALJA 4B87A 3C74A 2WC1A 5SY6A 2O7NA 5BR8B 1O08A 1F4LA 3W79A 1N1EA 2R1ZA 3R3XA 4L8WB 4UEKA 2O5EA 2HRCA 1UJCA 2IHJA 1XDWA 4FW8A 2PD4A 5DP2A 2RGNA 1G5TA 3FETA 4I6EA 4D9MA 1UQUA 1THZA 3HKBB 4DVGA 1RC8A 5KMGB 1ZISA 1L7OA 2OCXA 2GQ0A 4I4IA 3E8XA 2JZOA 3EHEA 5CLJA 4LMBA 3ZHBA 1CRZA 1NJ6A 2JZNA 4NMMA 4DQDA 2I7VA 5IJXA 4I5FA 4C76A 1HE1C 4F21A 4J4TA 3K96A 1Z0DA 2QJWA 1GFWA 4NP6A 4L8YA 3V1YA 1P77A 1OVGA 2Q5OA 2D2FA 4G8CA 2J7PD 3VR6D 1OROA 2GM9A 1BE8A 1U2DA 5M04A 4XIFA 2ZPUA 3K4QA 4K9QA 1H5UA 4N7MA 4UVIA 1LNSA 4EPTA 1QFSA 2A1UA 2Q3MA 3AR6A 4WECA 2IU3A 1CUGA 3REOA 5FLEX 3M6VA 5DGTA 4A6EA 1YZLA 3WXMA 4KCGA 5LQMA 5EZYB 3GZ4A 5TGTA 4L0DA 5YASA 3T7CA 2FW6A 1OIXA 5K0TA 3ZDYB 3V80A 4NAVA 3JRNA 2V3VA 4C04A 5JC8A 1C80A 1G1MA 1QO9A 2A0KA 4D9NA 4XCVA 4J76A 3U1TA 3PNQA 1KVRA 421PA 1N0HA 2YIMA 5A9TA 1TD1A 2OSBA 3HVJA 5ALEA 2DLCX 1QKIA 4J1SA 2VYNA 3OZFA 1RQRA 3DZKA 1DTWA 5AHKA 4URUR 1LZKA 2GI4A 4U5XA 1LGYA 3OA2A 3QMMA 4YQFA 1LY1A 3TRFA 1VCNA 3MA0A 3WX0A 4ETWA 2B1RA 1N7GA 4F93B 1FJXA 1FC0A 1PJ2A 2BR3A 1ENOA 3SOPA 1PSWA 4H1TA 3A0RB 3K92A 4EHIA 4MO9A 4X41A 5AJYA 1UDXA 2EZTA 2C58A 3ODGA 5IKOA 3OG9A 2XCIA 3PEYA 2PPLA 2IW1A 3G0OA 5JIBA 4EZIA 5A5GA 2EW2A 4R2WA 2JLAA 1JEJA 1WHTB 2Q3DA 3V7UA 2ZJOA 3GFTA 3MWDB 4EGFA 1NW7A 4X5OA 3C8DA 5AJWA 1FRZA 3HS3A 1E0AA 4CM4A 1NYLA 4EFMA 1E6WA 3E9YA 1TUIA 3HGTA 3OC0A 4EP1A 2PAAA 4ED9A 4MPRA 3PXCX 1HMYA 1OTHA 4O4IB 1IHOA 4YIHA 1SVOA 5AVRA 2PZAA 2V4UA 1XHEA 4B0PA 3AP1A 3JZFA 1ZN9A 3A6DA 3FI0A 3AM1A 4F4IA 4PIVA 1NWHA 2Q50A 5BQOA 4F1WA 1HG1A 3BD7A 2FFJA 2DBYA 4QBKA 4YUWA 3QKUA 4MA0A 2R5NA 1H8HD 2CLFB 3NUZA 2E4VA 4LK3A 4R16A 4UVHA 2WW8A 1TU3A 1R12A 3Q88A 3ZE9A 1JLRA 2GCOA 3C15C 3HCFA 3FKQA 3L82B 2X9NA 1T8YA 2IWRA 1Y42X 3PNPA 3WA6A 4RVCA 2OCBA 1Q92A 2D1TA 3AZQA 4PHCA 4BAZA 1HT1E 3ET4A 4NNJA 1PWZA 5J2UA 2B37A 4OQ4A 3C8MA 5A7FA 2RIRA 2HCRA 3RS4A 3QX8A 3HDJA 1G4AE 3ZW9A 5AW4A 1MBZA 1J1UA 1L0BA 4FILA 1WETA 1TTPB 2HWUA 1RZ3A 4BMPB 2Z0MA 3KO8A 2YL2A 5ALUA 4V3BA 2R47A 4ROTA 2W6ID 2RHTA 5E4JA 2PS1A 3IGFA 2HTFA 3PI6A 3WIEA 1R8YA 4JYMA 1CS0B 1GG2A 1TQDA 2M6LA 3GLIB 4DT1B 4TOIA 2VRNA 5DXAA 3GA0A 2I2WA 4NECA 1ZIDA 5HKKA 3QJ5A 3UN1A 5BOSA 1CP2A 3W5SA 4LF8B 4COOA 4GW3A 4LV6A 3QM1A 2O7SA 2F67A 5ICFA 4IIHA 1YUBA 4MHTA 1MQ8B 2KSQA 3LQRA 1OSNA 5KX5F 4XCQA 1MB4A 1DZ3A 4HUQA 2IODA 3S8MA 5IEBA 3B8EA 2PLRA 1CP3A 5CCEA 2GM4A 3USES 4G6ZA 2PANA 4JOBA 4NYIR 4DM3A 3V8QA 3LLMA 4L9WA 2F9LA 3FR7A 3K09A 3OWHA 2D3WA 3KEMA 4BNVA 1T6BY 5AXAA 4HQKA 4N3GA 3W2TA 5DCYA 1B8NA 1P7WA 2YYAA 1FZTA 2WJWA 2HNAA 4IUCS 3C14C 5BWLA 4IZOA 2JI8A 3S2IA 1C9YA 3AEKA 2XWJI 2VPYA 3UW1A 3AJEA 5BNTA 2I0FA 3PNOA 1Y5LA 3JYPA 1AGYA 3SEAA 1X7DA 1C7JA 2I9PA 4IR7A 2O0MA 3NEYA 1FXSA 1ODFA 4YEDA 3NV9A 3R3YA 2C7RA 3RVQA 1QG2A 4O4LA 2AOUA 4TZ6A 1GCGA 3E3MA 4NZOA 1OLSB 3AESA 3I12A 4CGYA 3BUSA 4FDVA 4LDAA 4JI1B 4YR9A 2ENUA 1YDWA 2XNSA 5CB4B 4PZUA 2IEIA 3BS4A 1UZAA 4YCSA 2H00A 1BTOA 1S96A 4I46A 5CJ2A 1A7JA 1SG0A 1XU7A 2PNFA 2RGAA 3AIOA 5AUNB 3OQBA 5HILA 4BO5A 4YC7A 1EX9A 1H2AS 2JFGA 2WMYA 4DRZA 4GC9A 4IJ6A 2WVJA 2WEKA 3KIPA 3RASA 4DHWA 5KOHA 2XZLA 2CDBA 4WK6A 3A9VA 1ENYA 1M83A 4IF6A 4FN5A 4NZYA 4ITUA 3LPNA 5FFMA 3DWFA 1JHVA 1IZZA 1HTWA 1V7ZA 1XZGA 3IP3A 3JW8A 4TT3A 5E4YA 4M0DA 2V6MA 1CQZA 3IULA 2GGSA 4HPXB 1T4MA 5TEWA 4FEYA 4MWOA 2G1PA 5GOTA 1WQ3A 2HSJA 3RB8A 3DFKA 3AVYA 2MSDB 1IDN1 5DULA 2BTQA 4RA6A 1W73A 3GW8A 2I1WA 5K6TA 1YE3A 3LCCA 2PK3A 2CNDA 3H86A 3L1HA 3F7OA 3Q8WA 1Q1QA 2R8PA 3N86A 4NAUA 5T6MA 4TLMB 3LC2O 3O9MA 3QUCA 2H2GA 4IQ4A 3P7MA 5AW1A 2ZE5A 4JXKA 4X9XA 2HHHB 2O54A 2A9RA 2XJ4A 1YBHA 4HDAA 3D3JA 3KOUA 4JUDX 3AR7A 5C5CA 1PSZA 1SXHA 5IM4F 4MHOA 1V1RB 3WICA 1I0ZA 3CMMA 3GEGA 4GXNA 4ENQA 3EH1A 3FF1A 1DJMA 1URPA 1TEXA 3M1LA 1D6JA 1KZ1A 3THYA 2CFOA 2EERA 3IRVA 4EGSA 1LRKA 2OSVA 2WWVD 5KVAA 3C98A 1T34A 5EIAA 2Q7OE 2EP8A 2YYSA 3GJSA 3DL2A 3IH5A 1EVEA 4EPWA 3HFRA 2QDXA 1ADJA 1AKYA 4BY9E 4RKEA 1UC9A 4XKJA 3QKWA 2R1TA 3WGZA 1P6QA 1ZJYA 4DIFA 1JFFA 1U1EA 1FNMA 2IC5A 2GYUA 2VYVD 1XDSA 4MA4A 2ZYUX 4U39A 4BE4A 3HKEB 4F46A 3ER6A 4D02A 1ZEJA 1R6VA 3H1FA 4WN9A 2A2ZA 4CQNA 3S4YA 3DYVA 2B8EA 3DKPA 3IHTA 2RGCA 4FE7A 1ICEA 1FOEB 1GO2A 2XDQB 2P5YA 3PE3A 3DOHA 3IA7A 3MWGA 1RRKA 4DTCA 5DLPA 5EIBD 3BWXA 2O3QA 3GRCA 3HKCA 2R8YA 2DWOA 2QAGA 4AM8A 1M1YB 5BUZA 5SZIA 4Z1MD 2PBLA 3R9XB 5LC1A 2VUIB 3VHXB 4CI9A 4NPCA 2IYSA 4P3YA 3QEBZ 5TQ0B 1Z8DA 3NBYC 2GHRA 3ZV7A 5TF0A 1U2EA 3PNMA 2AL7A 2BKEA 2HOQA 4N54A 4UOQA 2PKWA 4FD3A 1OTXA 3PSAA 1LLDA 4M1YA 3TL2A 2ZEJA 3C6YA 3ROZA 1F9EA 1NIJA 3S5JA 1KAQA 3DL0A 2DR3A 4PLTA 1Z6ZA 1A5BB 1M2EA 1NLZA 1NG9A 3NHUA 3P4XA 4IDEA 4DMCA 1PGOA 4RLHA 5HOQA 2FMTA 3O03A 1G66A 1QGDA 2D5IA 4MQ5A 4MUGA 5KIAA 3PZBA 3M8KA 3O8OA 4PWYA 3IUMA 4UXIA 1DWOA 1ODJA 2JFVA 4WKNA 5HQ3A 1LDGA 5L4LA 2GA8A 3CZQA 5DXFA 3RANA 1HWYA 1SCIA 3W4KA 1B0AA 1NPYA 2CJYA 3JRXA 1K3TA 4JYBA 1S7GA 1P5RA 2ZYDA 2J3IA 4ME6A 1SXJE 4O5OA 4WNAB 1TQ6A 3PWZA 4G5QA 1ECCA 3TGLA 3QBTA 4DCVA 2OGUA 1SU7A 2XKJE 4Z7NB 4IIDA 5AOAA 2PQ6A 3HRKA 5FYDA 3D6HA 3AY6A 1OXSC 3EFBA 3NWJA 1V7QA 4L4UA 5CXSA 5EY5B 1PTJA 2F3PA 3RV3A 5CNMA 3V4FA 2C2HA 3PS9A 4AY4A 2BGGA 1Y6JA 1GZ5A 3NHSA 2ZYVX 4IIVA 4R8SA 2I6UA 4O0LA 4ER6A 1MX9A 4HDCA 1TCAA 2A5JA 2IP4A 2VAPA 3A4MA 3CBQA 3PQCA 4LOIA 5EKSA 5SICE 3VH4A 5ETJA 3FKJA 4LA4A 3EXEA 2DWQA 4TZKA 4DLWA 1UDBA 4G81A 3UMBA 3AFMA 3SZUA 5CPBA 1GL3A 1C3OB 1ZH4A 1RXIA 2DBZA 1KOJA 2EKLA 3BRWA 1X92A 4H0CA 4RE6A 4C0SA 2P6MA 2OC4A 4Q7MB 5LB2A 1LVHA 2XXJA 4DDVA 3RRFA 1KEPA 2X22A 3NRBA 3STYA 4DSNA 3SC6A 3PUHA 4HK4A 1DV1A 3NS7A 4ZCQA 5KYUA 5CD9A 1X1AA 1UFRA 3HXTA 2PMBA 3FYSA 2F8LA 1UFVA 4V24A 5CDFA 3V4PB 3KZCA 1EB9A 2GAJA 2IKSA 2Q46A 2ZJYA 4NFLA 5CT9A 3SM3A 3WGMA 4YR7A 1FYDA 1N6OA 2ZRBA 2WPDD 3ZX4A 1YQTA 1ZCFA 2ONCA 5LQCA 1QJCA 3ZS8A 2HA4A 3NANA 4ND2A 3WOVA 4AJHA 2ZB2A 3AUTA 4BN5A 1D0IA 4RJTA 1S8OA 1A96A 2AOVA 1CF9A 2VDLB 3E70C 4HNGA 4M7WA 4N3NA 4HO1X 3OZ7A 1L5NA 2JH3A 3AR9A 4KR3A 4QEKA 1RRCA 3HKDA 4Q66C 3FB1A 5HF5A 1VECA 3FOEC 2HIGA 2IUEA 2N47A 2VAXA 4Q3CA 4DYDA 3ZZTA 4BHTA 5IN5A 1CJVC 5FH9A 1BS9A 2CXPA 4N1AA 1NX9A 2AW5A 4RYLA 3KKLA 4LXQA 4U6NA 3GLQA 1Z4JA 3GFQA 4IDPA 4F06A 5LN1A 2Z57A 2E89A 3TR0A 4ADSG 4YHHB 4OX9B 1XCPA 1PK7A 1GUBA 1W4BA 2PXXA 3GQVA 3DOUA 3PPYA 4JCOA 4R2LA 3R3JA 3VOAA 3ZZ0A 5IK2D 2DT5A 3N2KB 2I54A 3AF2A 3L7BA 1J0XO 2CKDA 1JQAA 4QQ8A 3UUWA 4J90A 4MW7A 2G06A 5ER6A 1A71A 1XTTA 4LYHA 4FNGA 2W6PA 4DEYA 2WMDA 5TY0A 4ARSA 3NKLA 1NNEA 1TCBA 4JR2A 1RHRA 2P9GA 2ZUSA 3RJ9A 4DQUA 1IE3A 1POXA 5JD3A 2IYPA 2JJ2A 2AN9A 3ENQA 3Q7SA 3SR3A 4BMXA 4BPBA 2PAFA 1YJBA 2EZUA 2EZ4A 4K81B 5EQTA 3KBOA 3CKLA 1Y89A 3VAAA 1EBFA 1WW2A 4LYYA 2W6JA 4CVNA 1RADA 2DUJA 1KZ4A 4YCMA 4NH0A 2JATA 4FFRA 4L4RA 2WUVA 1DUSA 3FTNA 3KJXA 4LTDA 1KS9A 3MT9A 3Q7EA 1JSCA 4HAUA 2VQ6A 3TNFA 1SRQA 2X8WA 4MWEA 5EE0A 2WSSD 2AQKA 3SLKA 1HY3A 5BN3A 3PD0A 2HV9A 1Z2OX 2O3UA 4KQEA 1E1QD 1VL0A 1RWQA 1AO3A 4MUKA 5K4AA 1IG0A 1C9DB 2V7PA 3IAAA 5AKGA 3G9ZA 4RV5A 1XC7A 3QVGB 5GAJA 4J0EA 4A16A 2ZRGA 2K4MA 5I8WA 4BNNA 1V26A 4LC9A 4YBZA 1E6MA 2PSFA 3FJYA 5F7ZA 4DJAA 1OZHA 1RAAA 4EG7A 2DM6A 4MS1B 2OZKA 4OJMX 2EFDB 3P4YA 3DXXA 1G8PA 3C97A 4JKIA 5HJ5A 2RONA 2O0JA 5DNYB 2FE1A 2Z3WA 3RVPA 2JFBA 4WXYB 4BLTA 3VNQA 2RBGA 3WSVA 1XQYA 2W48A 1PR4A 4WLNA 2CVPA 2UZ1A 4RJ2A 4OP3A 9LDTA 2HEGA 4U00A 5FWXB 2RD2A 3PC4A 4L0QA 3C3DA 2X4IA 3RK1A 4EELA 1QBGA 1QYCA 4H9GA 3WKAA 3T3NA 2KS6A 3BE8A 4FWIB 2YQ4A 1G7CA 4NULA 4Z9XA 3EN0A 3K9WA 3P26A 1N5DA 4B09A 2JIZD 1AKTA 4ODIA 3UJ8A 2FKNA 1G8JA 1AK1A 3QMPA 1CY0A 1SBCA 3E0QA 3VNBA 2ZJ4A 3ZGLA 1HL3A 2HA2A 3BE5A 3INTA 4Z53A 3CRQA 2EL7A 3RF7A 1DP4A 3ZQUA 4U7DA 4S3MA 4AWXA 3WA7A 5DPMA 2VF4X 2JVIA 4QFBA 2FZGA 2P2LA 4TTSA 3S70A 3SZOA 2G0AA 3WKDA 5CDFE 4U3JB 3UGJA 1IQPA 1PBNA 3C6BA 4E03A 1KR2A 2H7XA 5B30A 4L2IA 4RXTA 2ISCA 1AA6A 2HL6A 3A9RA 3MJCA 1P0CA 3SC2B 1RM5A 2NO9A 1NWCA 2PLAA 1JLKA 3FHCB 3G5MA 4PBRA 3RUEA 5CJJA 2HJSA 1TJ4A 5KJ6A 1OLOA 1YJ8A 4HZIA 1E9DA 3DKKA 2XQJA 3OHMA 2G71A 4D9KA 3L9XA 4DIDA 1T15A 2W8ZA 1WUJS 3HNPA 5CCDA 1KYXA 1U0NA 1U0RA 5JJCA 4MVCA 4P98A 3I4LA 2I91A 1GNTA 1P72A 5TS3A 2ONZA 2O19A 3OKFA 4KODA 4OHZA 2D0OB 4CL0A 3QE9Y 1U3DA 1IY8A 2CF5A 1SPXA 1X7HA 2BPOA 1W48A 4BV9A 3B1VA 1D4OA 4NU0A 4NYJR 1ZGGA 1RHQA 5EL0A 1IXSB 1R4NA 3EJ6A 3MTQA 4MR8A 5C0OE 1G5QA 1EDOA 2EDCA 4QARA 5CK4A 1Z5WA 1IBRA 1W4AA 4ILKA 5CHYA 2W98A 2V3WA 4ZI2A 5GPBA 3IHWA 3KLPX 4P7FA 1RP7A 1SUCA 2HA0A 4GWGA 3ROEA 3S1SA 1RJEA 3CRRA 3O4VA 3TFWA 1ZUHA 1CUDA 3HI6A 1WZNA 1H8ED 5DHAA 1IULA 4F4JA 1E1RA 4LJLA 5J2UF 4H77A 1KARA 2EQAA 3DP9A 3T38A 2NO6A 2RCYA 2A7XA 5EG5A 2X40A 3VKFA 4D45A 4QOIA 3C6ZA 2RG7A 1RKXA 1V2HE 3A6GA 3OT1A 4Q4JB 4XQCA 5ANRB 4MUAA 5IARA 1Q74A 1YKGA 2QT0A 3I9FA 4PCLA 3TM4A 1ZIPA 1O0SA 5CXQA 1JFLA 2WM8A 4Y2TA 3LDGA 1YR3A 2ODPA 3OURA 4MW0A 1H2ZA 4PTYA 4Q34A 5FPHA 1QRSA 1QAOA 4WQMA 5AVTA 3UMMA 4JLNA 2CCJA 4Z2YA 1C7RA 1E2KA 3EQ7A 2YJZA 4Z7QB 4CF7A 1QH0A 5M7EA 3I5YA 1HE8B 1R37A 1CR1A 1TF7A 4PYIA 5F3RA 3QTLA 4ZVQA 5T8KC 4B2PA 4QGSA 2MR5A 1W4ZA 4JGBA 3AVXA 1AN9A 4B6GA 3BMOB 1XZMA 2ZTLA 5KNDA 2HDOA 5M2QA 5IT0A 2FK7A 1HQYE 5A06A 5KQSA 1VJGA 1FTYA 4ZVMA 3SF0A 1QLJA 4L0CA 1WY7A 4G5FA 1YVUA 4HAOA 2FFBA 1D1PA 5FI0B 5FBQB 1T4CA 4DJTA 3GLKA 5M5BA 1L5RA 1EYZA 1JR4A 1KJZA 2GJAA 3NH9A 4BJ6A 1VL5A 2NU8A 3G2LA 2P4EA 2INGX 3CCBA 3G17A 3CNBA 3FYDA 4EDHA 4POOA 2FZCA 4C6RA 4KRXA 4KP7A 1OAKA 4JJ8A 2JJ8A 4D0LB 3R5JA 4R54A 1WXWA 2ZYWX 2VF5X 3WLLA 1VPEA 1O97D 3KLNA 2O8VA 2P2DA 4YAUA 1UMDB 1IK6A 4DCSA 2QNRA 2WFAA 3THWA 2XGJA 1AB5A 4O1HA 4UMFA 4WZAB 1E2PA 4CR8A 1CBUA 3MSXA 1JAZA 4RQTA 1CZNA 3KQVA 1H2YA 4TLDA 1XT6A 2V5VA 3H3XA 2XD4A 2WYHA 3CW2A 4MO2A 4YMIA 4O4LF 2FR8A 1FMFA 4MV4A 3AM5A 3L7MA 1UAGA 2Y0DA 4AQ7A 2VL7A 4BP3A 1I4LD 1QHNA 4R9NA 3HXKA 1SC9A 5EP4A 4ECAA 2G6TA 4BTLA 1V71A 2DRIA 1W5AA 3DEYX 4JUAA 1ECJA 1Z5PA 3MB5A 4TS9A 2BZSA 5ER9A 2O2YA 1L7DA 4RM2A 4WNCA 2VATA 3N1UA 1OREA 2WMOB 4CM7A 2QD3A 3GP3A 2NO4A 3BMCB 3P9YA 2QVLA 3AVWA 1OKKA 3HB4X 2EJTA 1UBEA 1NOKA 2RGUA 3UUFA 4ALNA 2XUOA 3GQBB 3HMKA 4ZKEA 2NSYA 2JDID 3EDRA 3TRJA 1X2EA 2GUGA 4N03A 3BH6A 5EXDA 1N5OX 1YDEA 3ETEA 1PNRA 4J0DA 4MV5A 4H6PA 2ZS7A 1JPUA 1LW7A 2PYIA 2OBNA 3DHVA 3DE4X 4TLEA 3WFZA 1SR8A 4DREA 2ODAA 4OQLA 1FQWA 3HH8A 4BNKA 1IXZA 3RWOA 2OCKA 2ZUWA 4FBLA 4MLPA 1OIVA 2NPOA 3F5DA 3VC3A 1KO8A 1MIOA 1PW5A 3ADOA 3ZHVA 3DVLA 3OQMA 4E32A 2QENA 1KZ9A 3FOAA 1LSSA 2HSEA 2AZTA 3B3QA 1V43A 4JI6B 4B81A 3BPSA 3GARA 2V1XA 4BNDB 1WUKS 4QLBA 1E3IA 1QH8A 3JALA 1ZUWA 4NE7A 1XJWA 4UTRA 3ONFA 4KR7A 2A30A 4FX5A 1BHQ1 1CF2O 1XKQA 3H5VA 3KQSA 5AKKA 4KZKA 4OGWA 2CVQA 2JKYA 3U16A 1GG5A 2W2LA 5TVKA 1Q0TA 2VP4A 4AY3A 3SHFA 1BROA 1TC1A 4EF5A 1FDVA 3HNOA 1P4SA 1T8RA 3PZRA 4H7HA 5IEJA 3HRIA 3THYB 3HA3A 5I7SA 1WHSB 2J3LA 2FSSA 5KU1A 3GD7A 2CNLA 1MUUA 4NWIA 2H3HA 4HTAA 3K9LA 5BN4A 4FCTA 2VRCD 4PRYA 3FFWA 4UD2A 1NVVR 1X3SA 4FTWA 3DBLB 3SGLA 5J3JA 3NEJA 1XCGB 4X20B 1I3CA 4KPUA 4AU1A 4FXOA 2XCTB 2XAAA 4OA5A 5LKAA 5A3RA 1P2TA 3QEAZ 1I1QB 2DAPA 1FX0B 4U1RA 5F2KA 3K2BA 2YRFA 3ZWXA 3NBQA 4F4HA 5JAIA 2AJBA 3EC7A 3QVVA 3WMGA 3A2KA 3AH8A 4TRJA 3GFRA 4RHEA 3AC0A 1DE0A 5CAEB 1Y9DA 4B44A 4ZJZA 4K9SA 2QR2A 4EGAA 2ZYTX 4YP6A 2YBEA 1YBVA 4BFYA 2BFWA 1TZCA 1RXUA 1ISIA 2VNSA 4RWEA 2PJRA 3ANXA 1W49A 3E9RA 1L8QA 2O2GA 2V8BA 4PLGA 1DAGA 4R8RA 2UYOA 4R41A 5BSMA 4ZMBA 1OBVA 3EIXA 4JLPA 4ND4A 2O23A 3GRZA 1PZFA 4DMLA 4DA0A 3BCRA 5HTOA 5JJBA 5B2EA 1OYWA 2ZAMA 3S28A 5C5IA 1W4RA 3OKCA 4JP2A 3DMTA 3K9GA 2QR3A 3DLAA 3MWKA 1WTCA 4FMCB 5H02A 2H2AA 4CQMD 3VNRA 1DRVA 4E5DA 3E05A 2Q5QA 4QDXA 1PO7A 4AS2A 2O2ZA 1M0WA 4FGSA 4FKBA 3FPLA 3VDXA 4HX9A 1DRJA 2QRHA 2ZR9A 2VHYA 3KELA 4KI7A 5EE9A 3WYGA 1NXXA 4N01A 2PUFA 1LB1B 2JI6A 3MUFA 3TB4A 4PLVA 1MC4A 1REQA 3O3CA 4Q7JB 1IONA 5IG2A 2WUFA 1VHTA 2YFQA 3KUXA 5EIBC 4CTOA 2CL5A 2ZRDA 3L8HA 2QLLA 4PG6A 5BMVB 1NC1A 2VUHB 4OXQA 1FFXA 2OBXA 3OFVA 2Y05A 3EZFA 4Q00A 4TKUB 1KJ8A 1VYTA 5DNAA 3ETNA 2FX3A 3C5HA 7AT1A 1PVVA 2I4MA 2IHUA 4KXFB 3GGOA 3IUNA 3LPMA 5JSZA 2IITA 1ZOPA 4ISBA 1ZH6A 2DQSA 3EPRA 4MQFB 4OHXA 3L0YA 3PU6A 4JS0A 4IIBA 4NU8X 3S8EA 2PO7A 3ZOKA 1E3MA 4ZT6A 2CUZA 5CXXA 4Q39A 3ABIA 1NFQA 3GFVA 1DIGA 1VB3A 2DFKB 1VHWA 1EA5A 4YV0A 4BKOA 2R751 4TVBA 5ENZA 3MQ2A 2K2QB 3PPWA 5AT1A 4US0R 5FD8A 13PKA 1VI5A 3MGKA 4PZEA 4QTXA 3QKIA 2PSSA 2AOXA 4HADA 3JQDA 3B6JA 4BVBA 3ZWKA 2XUIA 5DHFA 3EDCA 5AVZA 4UHDA 3X0DA 1Y7HA 1QVZA 1R0SA 2EP5A 2GHTA 4NLLA 1BDIA 2WVAA 1FFCA 5I7AA 1HT3A 1LWOA 4ACAA 3H9QA 2R66A 3FLAA 1IXKA 2DT8A 4IEIA 4JA0A 3KPVA 1BG6A 2H0AA 4L4ZA 1SMKA 5FPPA 2BJVA 1TYCA 1C3LA 4FIDA 2NP6A 1ZN2A 3RBVA 3U4QB 4I5GA 2I7CA 3GN2A 4X62B 4YP0A 3B6EA 2V7GA 1TJ5A 3M89A 1MVNA 1UPBA 3ORRA 3SQDA 4HGQA 2QTLA 2NXEA 4CEIB 4LOLA 5GJBA 4I8IA 5D85A 4BBPA 3KAJA 1LXCA 1E59A 4UTPA 1VL1A 2J30A 1N8KA 3LOPA 3I58A 4JMLA 1OILA 2RMKA 2AEJA 2ZTUA 3V7WA 2FMHA 3PPIA 4OBBA 1FPMA 3CUTA 4MS3A 4TKMA 4YNBA 5IDXA 5JJLA 3RIMA 3ZWDA 1E2UA 2DFDA 2BMWA 1SCUA 4I4TA 4LTNA 4YXWA 3T12A 3AW8A 2PA3A 4NFHA 1YS9A 1I0IA 5C8YB 2ZPTX 4M1EA 1KFJB 2C0CA 3EEFA 4URWR 1Z22A 4GH5A 3IAM6 4KZPA 1SAYA 2GO7A 1P6UA 2AFHE 3KL4A 3O8CA 1I2BA 3W7BA 2QLMA 1D1SA 1S8AA 3P96A 2ILVA 4G8BA 1O89A 5JXGA 2F90A 2ZR8A 3AERA 3I39X 1U1CA 3UXHA 3PT9A 3X1XA 7YASA 3MJSA 3FZEA 1I4OA 3F8TA 4XDGA 3ZVKA 2XB9A 1WXFA 2CLHB 4ABYA 5AM3A 3UOAB 1A9QA 3CVUA 2J46A 2RAFA 1KGSA 4PLZA 1MNQA 2NV0A 3S68A 5KTTA 4AN4A 5CX1A 2CLLB 3EOAI 4W6QA 4L07A 1YZYA 2W22A 1NLFA 1E1LA 1X7GA 2DG2A 2ZBRA 4AS3A 1E6UA 1N3IA 6AT1A 2Y99A 1FVXA 2ORIA 3WAKA 4YMHA 4M7OA 3SR4A 3A1DA 1N2CB 4GOOD 3DL4A 2MJLA 3G23A 2A5FA 2FFAA 3FG9A 4MVJA 1RYEA 1MABB 1NAIA 3FLMA 1RQLA 5I3CA 4FBGA 1Q16A 2C4MA 5AM2A 3HBFA 3G8AA 2WFZA 1GTMA 3WYFA 3OCVA 2NNLD 1SCNE 4Q1FA 1ZM2A 3S7TA 4C4SA 2ZAIA 4MB0A 3OAAA 1R74A 1VKOA 1QX3A 2ZBGA 4R1NA 2ZB7A 4ESHA 1TK2A 1ADCA 4BQSA 3DHWC 2JIOA 3B1WA 1F17A 3TF5A 2H3EA 4PYLA 4MLDA 4K9KA 1J8YF 2H1VA 2P9HA 3RKUA 3OM9A 1RMQA 1V45E 3E2MA 3PQFA 3QWHA 4ID3A 3ZY2A 5FHQA 3GX1A 3U1VA 4KKXB 5HNKA 2AKYA 3ESRA 1ZHFA 2A14A 1QXSA 5ALNA 2NSHA 1A2OA 4GKBA 2F3QA 3ORFA 3EGXA 2DBQA 4IO0A 1TCUA 2C83A 2GK3A 4JC0A 2W2QA 4OQXA 4S1TA 2XLCA 4Z4GA 1W88A 3BREA 5ES3A 1U5BB 4AKIA 3NXSA 1FBNA 1GPKA 3E3NA 1UCFA 1K06A 1VJ1A 1YB6A 4HNAB 5A03A 5EJ9A 1PVOA 1U9JA 1UPCA 2CL6X 2XBUA 3GCWA 1R8JA 2ZT7A 4EYEA 3DV0B 4UFOA 2AC7A 2AW3A 2Y6UA 2H2DA 2CWDA 3EIOA 4MNTA 4N3BA 1QANA 4WE3A 3RU3A 3V6LA 4ZEVA 4D4JA 1RYMA 3SZGA 4YMLA 1RTTA 2CXRA 2RI1A 1PX2A 2YWDA 3RLIA 4MP6A 4XIIA 1SD5A 3QKSB 5FTKA 3RK4A 3PEEA 2FPRA 4HWKA 2OV6A 3DQZA 4NDNE 3W3AA 3BXHA 5FBWB 2XUQA 4E15A 3IQXA 3OX4A 4KDCA 1FY2A 5CYPA 3ZZUA 4CQMB 2B7BA 4CF5A 4D5GA 1XYGA 2QXTA 2W2NA 5EI5A 4BNTA 4UHKA 2Y6VA 1ANKA 2WYIA 3CGGA 3LQYA 2BH2A 3T1OA 1OE0A 3VO8A 1YXMA 1PR9A 4TTJA 1YF3A 3SS7X 2Q21A 3R6LA 4E2ZA 1UINA 1EXVA 3O2JA 1YV9A 3SKXA 1G3RA 2FWRA 3NT5A 5C4IA 1YCHA 1GKIA 1XTRA 2BRUA 2EP7A 2VT2A 3F6BX 4HEJA 1N9KA 3MBIA 3LWDA 1WS6A 3IS3A 4V0NA 3RWBA 3ID6C 4ZKDA 3UIEA 3DNPA 1NASA 4RZIA 1KP3A 3DZJA 3U4HA 1Y7TA 3ITDA 3PFWO 1RZVA 3FWNA 3I5UA 3VPCA 2WWXA 3X2EA 2P35A 3HSKA 3GOQA 1AK2A 3WLKX 2IDKA 3HY6A 1QVAA 2PJZA 2JAOA 4LE2A 1QGYA 5K03A 1YQ9A 5JXWA 5FFNA 3I01M 5B2ZA 5K8JB 4FB5A 4QHYA 4PSCA 3A6LA 3P5SA 2OO5C 3PKZA 3D5QA 2BHSA 2Y68A 5JAOA 3H5TA 1SBQA 4JC4A 1NLYA 4C2BA 4RETA 1SHJA 3AEQB 3KU1A 5JH7B 2ZI5A 5EJFA 1LPSA 3NV7A 2B2NA 2GD6A 1NDUA 2FPWA 1M2HA 2ZJ8A 3E8MA 2YWRA 3L0IB 4OBXA 3WMFA 1DC4A 4EMBA 4D4IA 4JVLA 3VTZA 1E4VA 4PTZA 3ST7A 3TQCA 3KNZA 4H0NA 1NRXA 3KXDA 4RV9A 3EFEA 1SC1A 3B36A 3R40A 4NJEB 5T67A 4OA8A 4DLAA 2PLNA 1AXRA 1BXGB 2N0SA 5ED4A 5FTNA 1NJ8A 3GLTA 4I1PA 3F2IA 1KQOA 2E85A 3GZTB 1ESZA 4BX9A 3Q3HA 2B4AA 3JVDA 5B58T 4XR4A 4ZOLA 4QNMA 3ZU4A 4M0CA 1QYWA 3KZNA 1WXIA 4QSMA 4QTZA 4JQZA 3QTTA 4TWAA 2PMFA 4RMGA 2X8AA 4GZ6A 3KZXA 1T36A 1YK0A 2JVJA 3NC1C 1XKTA 1Q3HA 2C42A 3LDHA 4HAIA 5NLLA 2VTBA 3D0QA 3ZE7A 1DO0A 4K6CA 3A36A 4MA5A 4RVSA 1E64A 1RWWA 1UWVA 1U8XX 5HUHA 5FUYA 4CCSA 3GEMA 3VSAA 5E6UA 1KBZA 1UDRA 1ZLYA 2ATXA 2BZ1A 5JVDF 4IVRA 3UAWA 4FQ7A 2ILTA 2FR1A 1SFRA 4L5BA 4URZR 3W9YA 2NU7A 3T3MB 1I1NA 2EKPA 1E1CA 1AS2A 3WO0A 4DHEA 2QORA 2G3YA 1HE3A 2RHRA 4RV4A 1JG6A 2M6KA 2CC2A 3OM8A 2BFEB 4DILA 3PHLA 5IX8A 4MI6A 1CW2B 4JKYA 1MH9A 4M99A 4Q1AA 3ZTTA 2PJUA 2ZUUA 4M22A 2I2BA 5LDDC 1AZTA 3K35A 1O7JA 4NS4A 1GTVA 2QT1A 1ENPA 4OFZA 5JAQA 2J08A 4M21A 3ZXXA 4ZI5A 5JAMA 1G7RA 2FUG6 4LHZA 1NRWA 1L2TA 1KQFA 2QVBA 2HNBA 2RGXA 2QTRA 4BNZA 5AESA 2VIIA 3N58A 4YRFA 3W9UA 5DM60 2HMVA 3DDWA 4NONA 1YOVB 3FHJA 5EKDA 3M5PA 4JLVA 4EKYA 1BD4A 3BD9A 3H04A 1NY6A 4G5XA 3DBRB 3JQCA 2ZWOA 2WU4A 4HGZA 2OG1A 4NU6A 4PV7A 5DF1A 5A0FA 3ZYZA 2ZSIA 5FPKA 3GV0A 1CE8B 3AM4A 3H6KA 4HQNA 5HQTA 5KSPA 3TVTA 3HG7A 3ZLUA 1UC4B 1XXLA 3C7TA 3JAWB 1JR3D 5JALA 2C8LA 3HA5A 3VU0A 1XCLA 1YRLA 3HXLA 1J09A 2WICA 4HAYA 1A8UA 1Z5GA 2CBGA 3D31A 4Y18A 1GGEA 4B1FA 3UCXA 4K6FA 2WHQA 3OC6A 2J4FA 4P5EA 3UATA 3UMSA 3G79A 5JASA 1OB5A 4O63O 2CSXA 1CY7A 1GZUA 3MHTA 3NIFB 3F96A 1QOPB 3A26A 2YWJA 1O97C 1T0HB 2A3NA 3FCOA 3GRYA 4F5YA 4ZEXA 2QTMA 2ZWAA 1F2TB 4HQLA 1O6CA 1QV7A 4L6IA 4MQ6A 5AVXA 2IV3A 1Z5NA 3WRWA 1QQTA 4P81A 1LVGA 2PRYA 1QRDA 3QOXA 2BGWA 4LN1A 2JGFA 2OE2A 4RFSB 5BW8A 2C2YA 3IQDB 2NAFA 5AICA 1N6RA 2H2IA 2IYWA 3IAS1 2NVWA 1M5TA 2YC4C 1LFDB 1EE2A 1BD3A 1UC5B 2HA6A 4KXNA 4BQEA 3PNBA 3V8EA 1BRTA 2HWWA 2ZIXB 3PRYA 3TPCA 1VGRA 3K0SA 4H7PA 5ECDA 1B0UA 2OORC 3ROKA 4DR3B 1C3XA 3AHIA 2DETA 3D6JA 3IUQA 4KRFA 4LHSA 1B0PA 3IVMA 1Z75A 1PT5A 3PC7A 4GVPA 2W2KA 4KH0A 4QOEA 4URFA 3NRCA 3WISA 3ZWQA 1T25A 1Z4MA 1NN0A 2W8BB 5EKUA 1YBMA 3H5IA 3CUWA 1KHHA 3JVIA 3D4PA 1A9YA 2ETVA 2RC5A 4JOSA 3GUYA 3TOXA 4E22A 2C5LA 3T5AA 1XEXB 4N3CA 4B3TB 2FW9A 4BFXA 3UENA 4HQOA 2C5FA 3IBFA 1SXGA 3NX4A 1VSBA 2FV8A 3F9RA 4ZAVA 2R6R1 3DE7X 3ZCTA 4FFLA 5F3WB 2O6LA 2GPNA 4PNPA 3VR2A 4E33A 4ZCMA 2JLZA 4DV7B 3I92A 4N3AA 2HEIA 4YJGB 4BXOA 5LQKA 1P1FA 4MI1A 3VC1A 3HCWA 4OY3A 3GCDA 3EVFA 1GKUB 1GD1O 4A0RA 3R7WB 4EFDA 4Q7QA 1P0MA 1SCBA 3OJCA 4MV8A 4ZANA 5JLJA 2R1UA 1PFWA 3DEHA 2J3EA 1D0VA 3MUNA 4B6JA 1Q21A 1QKJA 2HGSA 2FY8A 2FXIA 4OXKA 3ZG6A 4DCTA 1MHPA 3JQAA 4GPTA 1G5PA 3RKSA 4CF6A 4F7DA 1TJNA 2X15A 2FMFA 5GINE 3WP1B 5D51S 2IUTA 1FSZA 1Z13A 4RS3A 4YROA 4KXWA 4ENSA 3UCFA 4FMPA 1A2BA 1VG8A 2C95A 3I5XA 1Y3AA 3U31A 4HH3C 1H2HA 2VP2A 2QTAA 4KE7A 2A5YB 2ZR7A 5LM3A 5HXAA 3KKQA 4WLVA 2G25A 4IG9A 3TZQA 1R66A 4HCJA 1NBEA 3B48A 3M5WA 1QIHA 5DJ5A 3NUGA 5K1ZA 4RD4A 3BM5A 1HEUA 1M8PA 3F3MA 4QRHA 4HKTA 4G09A 1KOFA 2C2KA 2QTZA 3Q11A 3JQFC 4CR6A 3H9CA 5LZ5A 1D7OA 3M3HA 4AI6A 4CQLA 5DTRA 3TTXA 1W0KA 3B1XA 5AD1A 4TSKA 2ZUDA 3O82A 1QTRA 3NASA 2HY7A 3MMZA 3OQVA 3OUZA 3TTYA 1JEQA 3BA1A 4JX8A 1PNTA 4PSVA 3SU8A 4D4MA 1L4HA 1VIDA 2DUWA 4QREA 3R8XA 5KKAA 3KK0A 3PL5A 1OZAA 1HDGO 1SIBE 2C03A 4ZAWA 4X54A 2AR9A 3RYFB 4YFVA 1S02A 5KX5B 2XCRB 2NZ8A 2VZ9A 3S44A 1U98A 4H7IA 1R5NA 2JIDA 2YS6A 4LXUA 2HLDA 3U3OA 4X65B 4EBFA 2JLYA 1CEEA 4F2PA 2NPFA 5BVHA 2RK3A 3GGCA 3T6KA 2DKFA 1D5CA 2FZ4A 3O93A 2V9ZA 3GYBA 4FXPA 3SYKA 4BKPA 2V7EA 3LHDA 3OLXA 4QDKA 1BN6A 4RVFA 1I3NA 1S2LA 2AMFA 3BGSA 5IDWA 4J3NA 3SJAA 3JQRA 4D4LA 4F8EA 1N36B 2JAHA 1JT2A 1QAMA 4BMSA 3GROA 3PYXA 4J3JA 1W52X 5DHPA 2EW1A 1KU6A 4UEQA 2ZITA 1NU6A 4P84A 3W05A 5GIOE 4G4GA 3CF6R 2FN8A 4HAXA 5CBKA 1CT9A 4Q6BA 4NCAA 1I5RA 4EX6A 2VA8A 2BFFB 1ZJ5A 3I6QA 1NLMA 1PLKA 4Z8XA 2DFVA 5CPFA 3N28A 1ZP6A 3PGMA 1XQWA 4HSEA 4KX5A 1KI9A 4RD2A 3EQ2A 3LC7O 2MSNA 3QJGA 2JJ1D 1L1QA 3BSWA 1LS1A 3I04M 1ZY2A 3JD3A 4M7RA 1NBME 1GU7A 5CHEA 5FTMA 3VR5D 5JJIA 3LW8A 3C8HA 2HPVA 1QF7A 2AI2A 3VX4A 3LP6A 4NV0A 4BE7B 3IPRA 4XUEA 2XCOA 4K6GA 2IV7A 1NBIA 4GGPA 2P1DA 3FLEA 3IHLA 4X1IB 3OE7D 3OQNA 4N0PA 1B1CA 5LKRA 1DBQA 1W0CA 4F11A 1EM8B 2WFMA 1FDRA 3KB8A 2QY6A 4JYCA 4RTNA 3H1PA 4Z4FA 4ER7A 6PFKA 2YY6A 4BWYA 1DLJA 2OAGA 1UK7A 3FYUA 1NR5A 4I4TF 3F5MA 4Q4HA 1UBNA 4XD2A 1YQQA 1MRZA 1TJ3A 3AKYA 4KHZA 4WY2A 2QLTA 2ZBPA 4DJ5X 3O8QB 2R97A 5H3HA 4I6JA 6REQB 1QQBA 3QUSA 1ZC4A 4EPVA 4Y9SA 2EQBA 4RTJA 1FS4A 3DMYA 4P86A 4CKZA 4BCDA 2PVCA 1T5OA 3H9JA 3NHJA 4A27A 2H4XA 1OLXB 3GMTA 4DNQA 4OOEA 4BZXA 4F6RA 1JDZA 2VF8A 3W78A 1L7NA 4R0MA 4ZGBA 4PIMA 2SHKA 2LNDA 2GN2A 5FAXA 2NXJA 5HKBA 4PZAA 3VZDA 2C7BA 3D6UA 3GRFA 1WCIA 3Q5DA 3R3VA 4QYSA 2YHIB 4TGLA 2H08A 1G38A 2PZLA 3DVAA 3EZ9A 3UT5A 2PBZA 3JZAA 4LPKA 3DR5A 3HVHA 3O8DA 3BIOA 3OZAA 4KKVA 4D3YA 4DMFA 1NUAA 1YAHA 3BDIA 1VBKA 1ZNQO 4OO3A 1MG0A 1XYVA 1J4AA 1L7VC 2Q5EA 3EG9A 5A1TA 3KOMA 4Q21A 2OO3A 2PV0A 3ETCA 2PL3A 5F2EA 1PR1A 2EGGA 3RVOA 4C0KA 4BUJA 3MHPA 4ZCSA 3U9TA 5HUQA 1EP2B 3A6ZA 7ABPA 3O1IC 4IXNA 4MVJF 2FN4A 2IPMA 3B1KA 3A4TA 2H1RA 4OB8A 3C8UA 1PJ8A 5G1OA 4GGMX 3PC8A 3LQFA 3WFIA 3ZDXB 2B4TO 3AR5A 2TMDA 3DKIA 3GVIA 1R18A 1TVCA 2AD1A 1TFUA 1T35A 2V54A 2HK6A 2BLNA 3PHHA 3TCNA 3QVKA 2GRUA 4D46A 2E87A 3SYMA 1KMIY 5EPUA 4QU9A 1G9SA 1E2NA 5FOUA 3S2ZA 2RIPA 4BVJA 1M8GA 2ZDHA 4DEVA 5KAMA 1GYRA 1WKVA 3PC3A 2VYND 4JVOA 1P31A 4Z7OB 3T15A 3ZWOA 1JIVA 4RSHA 4WA7A 1E0KA 4KREA 4F60A 3OJFA 2H2WA 621PA 2VJYA 1NVXQ 1JQLB 1ZGBA 3D5TA 1VFPA 4LC1A 3OPYA 5AK5A 2NO5A 5JRZA 1JBKA 5BV1A 3NFRA 1VLJA 4B6PA 2CJWA 2GTPA 3ZHRA 3AINA 4WKCA 2YFKA 5J4LA 5E3IA 4HI0E 2QQEA 5A05A 1XTKA 3GGSA 2CB0A 3OQHA 1H05A 1E92A 1F0PA 3VMFA 3AUAA 1M6VA 3RS9A 1QAQA 3B89A 1WULS 1CVLA 3LT1A 4C4ZA 3EPPA 2FZEA 3FW1A 3PXXA 3M33A 4FUQA 4Z0PA 3WL4A 2E5LB 2N46A 3IIIA 4X6YA 3T9EA 1G41A 3NTXA 1G3QA 2I8LA 4CCYB 3GLIE 2FLKA 1E1NA 1RHUA 3EC2A 1WB4A 4M76B 5CT6A 4UUMA 4TQGA 4ZZ2A 3UGKA 2Z4TA 2GOYA 1O87A 1B8VA 2Q4RA 1NVDA 2XRZA 2GBGA 2DHCA 2TSYB 3DCIA 3MINB 3C7AA 4G89A 2JCVA 3LH5A 1AS3A 3C5VA 5K7SA 1NIPA 1Q7EA 1UT6A 2ODEA 3OPVA 1NJFA 4R8VA 1WBDA 2ZRLA 4DCMA 3IO3A 2HJ9A 4GBMA 3H9BA 1CG6A 5LDGA 4NXNB 1ZM3A 1G8SA 3EVAA 1AZWA 3AHCA 4ZXPA 3WKCA 4KV9A 4EZBA 2FSVC 3EGEA 5A9RA 2XYPA 1GG9A 3G8YA 5F64A 2FDCA 4E5VA 4DVJA 3DBHB 2WAOA 4ZT5A 1B2LA 3B1ZA 3KQNA 3HHPA 2HJVA 1X6VA 2AMLA 5G4KA 2IXDA 4YRLA 4FDAA 1ZR2A 1PQPA 4FMBB 4Y2XA 5FNVA 4ZEOA 5KYKA 1KMMA 5MN5A 3HCAA 1IN4A 3LVQE 2Y1WA 1PWXA 3T41A 1R00A 4L95C 2PH3A 1SK8A 2OTCA 3BTUA 1XLVA 3H6GA 4H3HB 4YWHA 5TGDA 4CDNA 2A0YA 4CLEA 3M6MD 1I1HA 2HJGA 1AT1A 2CE7A 2O1XA 1LDMA 3L7JA 3MIZA 5F4ZA 1DJQA 2JK1A 3GRAA 4UHBA 2HMUA 1OI4A 3FDXA 3DUFA 1IN7A 2I03A 1JSZA 1VJTA 4O4HA 4DV2B 1YZFA 2DHDA 1GUAA 3PD1A 2WILA 3B60A 3V4RA 2Y1DA 4N6OA 3VV2A 1PR2A 3P9PA 4Y1GA 2OXEA 4Q9DA 2R6GA 1BYIA 1SCDA 3BMQB 4U8HA 5TF4A 1RDFA 4GZMA 4K1LA 4E5YA 3COSA 5A4DA 1DBWA 4ZOLF 3MSCA 1Y4AE 1GGMA 2BN4A 2HRDA 4KYIB 4MX8A 4RF2A 4RK0A 2WVGA 5B53A 1EFUA 3DDZX 1HH4A 1VI6A 3P9CA 4W4TA 5JVDA 2O5CA 4JN6B 1WUYA 5EOVA 5JYEA 3PDHA 5A6SA 5DI3A 2VDNB 3COZA 3ES9A 3A05A 1AMNA 2MIIA 2UYQA 1IUOA 2A35A 4XDZA 4QSHA 4U63A 4QGAA 2PKQP 1DIRA 2YVLA 1YZUA 5JCPA 1ONNA 1YR6A 2H18A 3G9TA 1XEWX 3H18A 1JMYA 3LPAA 4HVTA 3OZDA 4XTRA 5DCWA 8OHMA 2QZJA 3FYCA 3HUUA 4IG4A 4KUGA 1CIJA 1GPH1 3M4YA 4U0KA 2HA3A 4TN1A 4L73A 5E2AA 5CBPA 1Y63A 4E5KA 2XTZA 5CW1A 5M29A 2ZJZA 4OHMA 4CM9D 3W90A 3BMNA 1KK0A 1NUUA 4UD6A 1VIYA 1MAVA 2YRXA 4MAMA 4NH4A 4XX1A 4QUGA 4EB0A 4JB3A 3ZNNA 3WR5A 4EW6A 1BKYA 1DQRA 4TT3D 1IUKA 1P81A 3ITKA 4JI4B 1YDFA 1M2JA 2Z6QA 4B4UA 2BF4A 5LYYA 2GX6A 1RJFA 3UJ7A 1T24A 1YT5A 5EHNA 4EO9A 4O3MA 2PCLA 1B73A 4Q01A 3FZNA 2Q1WA 3QG5A 1M1YE 1IHDA 3KVNA 4BN0A 5HG0A 2R25B 3ND5A 2VHJA 3QEJA 2VBGA 4YPOA 1T43A 3UFBA 3I05A 2VOJA 2D54A 5DGDA 4UTNA 2Z8YM 3VM6A 4BJ3A 3H9GA 5T57A 3U7GA 4RIGA 3WLFA 5HMMA 3ANLA 3BXZA 1VDMA 4L0MA 1WEKA 3EEYA 1PDVA 3UQZA 1SK9A 2KJQA 4POAA 2A1UB 3IP8A 1FF9A 3RPEA 4XLTA 3LUGA 5IJZA 5HP4A 1IWOA 3DGEC 2DE0X 3VPXA 4QJBA 4XPIA 4F7WA 1I5EA 2W2MA 1H2BA 1ZVQA 1P19A 2O2JA 4CV0A 3ASYA 3ESXA 4RX1A 1X8JA 1P2GA 1Z28A 2ZRIA 1OBCA 2CFRA 1ZXLA 4YCDA 3W5JA 4AYWA 1KDTA 3WRXA 4I99A 2YXPX 1KEVA 2ZTHA 3D4BA 1NXQA 1MIHA 3NKFA 3LJKA 4Q3DA 2H52A 1Q7TA 1K8QA 1Z12A 2QUJA 2ZJ2A 5IJ9A 5TMBA 1DTWB 3COYA 2IHVA 2O1WA 1XDDA 1LX6A 4F9FA 1VE9A 1DKRA 1OPXA 2R5FA 1GTZA 4Y2PA 2PR2A 2QK4A 4J1NA 2OZEA 4L22A 3ELUA 1CFJA 4KYTA 3T8YA 3LTEA 1QQ6A 3T3GA 4F4FA 4HRAA 3DCYA 1I36A 4C5AA 2X3YA 4UU0A 3BIJA 1U5AA 1IQ0A 3TIVA 2WAYA 4PAGA 3DPSA 2P77A 5SYNA 1KY4A 5C2JB 1BZYA 2VH1A 3PKJA 5A4FS 3VKGA 5COAA 1EVKA 2Q6VA 3S2FA 3OPMA 4DNXA 5A5FA 3WL6A 1Z33A 2N42A 3K0FA 4LGYA 3RSCA 1C5KA 4A2WA 2JFFA 3TOSA 1QYRA 4FR2A 2GHQA 4B71A 2JI7A 1FQJA 3IPYA 1QWSA 1WUIS 1E99A 3HM2A 3DG9A 2R6DA 4CG0A 3P9QA 4IZHA 4KXMA 4G1CA 4LQLA 3IODA 1OPRA 2LD4A 3CNQS 5ERXA 4MW6A 1AB6A 1CDOA 2BCEA 3JTMA 3T7JA 1NF3A 1H66A 2IIBA 4JU9A 1Y9AA 1S1CA 3H2IA 1C1HA 3HN6A 3IR5A 3LHIA 1NDQA 4Z51A 3ZGOA 4G9BA 1G5HA 3ISTA 1PAUA 4TYNA 5KQGA 3R5HA 3PXGA 3A9SA 1CQPA 1IH8A 1XSEA 5DX0A 2W00A 1CUZA 1UK8A 3ADCA 2HYDA 3ZTWA 2PH1A 2H1WA 1NVFA 3FVWA 2GCOB 4PYQA 1N9GA 1C3JA 2ACWA 2YFHA 4KLRA 3WKEA 1YGYA 3CF0A 2JI9A 4BMVA 4G2TA 2PIAA 3LCVB 3OEYA 4OQMA 1KMCA 1U9ZA 1X77A 5J2UB 4HXGA 1F6DA 1NBAA 3QLUA 4GP7A 5C32A 3DGFC 2V3CC 3W5CA 4EVIA 4LBVA 3SDSA 5EHXA 1XZPA 2CY0A 3PIIA 1Z0FA 1LPOA 3KYDA 3BVPA 4YQEA 721PA 4G0NA 5FA5A 4MPPA 2GZ1A 5LU8A 2WT8A 1YIAA 3TYXA 3A28A 4UPVA 1RS0A 3D0RA 4IIJA 4YUZA 3BRWD 4Y2GA 4K9LA 5LQRA 1QYDA 1ZD5A 3Q98A 3TD6A 4QUAA 2ZW9A 4GU5A 1PK9A 4L57A 3DMNA 4L7VA 2JFNA 5DYGA 2RH4A 1OXXK 2X5KO 2AKEA 4NNPA 3DXFA 3NJ8A 1UWLA 1DPFA 5BOSB 1KU0A 1XALA 3G0BA 4IDAA 4KXQA 5EHQA 2E18A 3O4GA 1JDSA 4LC0A 4HLUC 2D13A 3DVRX 4JLMA 3QU2A 4ZWNA 2DUNA 3E8SA 3I4FA 4TVKA 4ARCA 3THXA 4O6VA 2QJFA 1O0CA 4RDCA 2QXYA 1XJ5A 4LGMA 3GGPA 2XXBA 4BBZA 5JZSA 3PA8A 4HUQB 5CRIA 1HC7A 1Y7PA 4LHXA 5HRAA 5IJAA 1T10A 4JSRA 3L0BA 4EKNB 1KS2A 2HDWA 3HNRA 1NRJB 4EPRA 2YVAA 3EZYA 4WCFA 4KE8A 4NXMB 3WB2A 4ZYVA 3EWAA 5HTKA 2J6IA 2CHGA 3FVQA 3OPQA 4JJZA 2VVTA 3EPJA 1NF9A 3AEKB 1L1FA 3NUQA 2P2NA 1YWGO 2HV8A 3P94A 4TQAA 1VCHA 1DEAA 2GXUA 4XSHA 1X7XA 5EJMA 1PGNA 5HK8A 1E79A 4LXGA 2ZRFA 4W5JA 2PNJA 1QUEA 4QUHA 4O4LB 2AOUB 4CN8A 1M8JA 2DHRA 1QHFA 1XRQA 2RG1A 3AESB 2X0EA 3QMVA 4L4XA 2AVNA 2BONA 3TCKA 5C1DA 4WUTA 2O07A 1IPHA 3WL5A 5I48A 3GT3A 3AYXB 3G2KA 5JISA 2XX3A 3CS3A 3HBNA 5FOSA 3LUHA 1R16A 1UWCA 4JEIA 4JITA 3NDJA 4ZVVA 3ROFA 4GMKA 3VZSA 4EH1A 2H0RA 3LF1A 4YCCA 3GLFA 3V32A 5FPTA 1PJAA 4GLLA 3CIFA 3M83A 1M72A 3DWEX 1H0RA 3FNHA 4CFZA 2CNWA 5IZCC 1WDWB 5KOHB 1XV5A 4E2YA 4M49A 1YRYE 1MPXA 4M60A 5THQA 3BIFA 1KSHA 3QKRA 1KI3A 1RM3A 1EFVA 2NO1A 3IP6A 2VP5A 3AR4A 5FUXA 4FLEA 2CHUA 2VKTA 2WUGA 4F9EA 3KJNA 2W6JD 1OAOC 5MDHA 1A72A 2B69A 4EHNA 1LW6E 2SCUA 5FEUA 1A8QA 3AVVA 2W58A 2BTQB 1MX1A 3OT4A 4RA6B 4WTOA 1FUKA 1X7ZA 3AETA 3AY3A 3SPXA 4CM3A 5KTNA 4KV7A 2DLDA 3Q1KA 2H7VA 3UICA 5DHUA 1U2GA 2C82A 5DLYA 1JG2A 2C9DA 4C4YA 1R5OA 1W36D 4XWYA 1SZCA 3HP4A 3OCUA 4WVFA 5K5EA 3VC7A 4IFEA 3IO5A 2AJ8A 1MW9X 1IOLA 3CUKA 2QRQA 1C50A 3A14A 3ROMA 3ZHCA 5CYGA 2OCIA 3KKNA 2TYSB 1WCYA 4BV2A 3IIEA 4ZHQA 3A11A 4AO7A 2G7ZA 1DQSA 5EZQA 1R2QA 4WLEA 3WGQA 4DABA 3ELBA 4K8RB 1HZZA 5DT9A 3R4VA 1VJ0A 3LY7A 4KU4A 1KOGA 2AXEA 3TECE 2KW5A 4HZUA 2R8BA 2Y4OA 5BRJA 2R1TB 2WJ3A 2ID7A 4HLDA 2FNAA 4PCUA 3SP1A 3OSUA 3AIMA 2PM8A 1Z6QA 4ZVTA 3RS5A 4ZARA 5FLXA 4ZJYA 1ATZA 2AVDA 1T2VA 4UBMA 3SZMA 1Y8ZA 1JDNA 2BMJA 2E4ZA 4WN9B 4OYLA 2E55A 1RMYA 2Q4TA 4IOMA 4UMDA 2GBLA 4PNHA 4Y6OA 1CLEA 2VEDA 3GVHA 1VC2A 2O2CA 2CDCA 1KK3A 5I9SA 5IM5A 3DD1A 1JIKA