4ZI5A

Crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
239
structure length
239
Chain Sequence
GAMTARKVDYTDGATRCIGEFHWDEGKSGPRPGVVVFPEAFGLNDHAKERARRLADLGFAALAADMHGDAQVFDAASLSSTIQGYYGDRAHWRRRAQAALDALTAQPEVDGSKVAAIGFCFGGATCLELARTGAPLTAIVTFHGGLLPEMAGDAGRIQSSVLVCHGADDPLVQDETMKAVMDEFRRDKVDWQVLYLGNAVHSFTDPLAGSHGIPGLAYDATAEARSWTAMCNLFSELFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ultrahigh-throughput discovery of promiscuous enzymes by picodroplet functional metagenomics.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
molecule keywords P91
total genus 81
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2015-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zi5A00
4HXFB 3DCNA 5ALZA 5AI4A 2JEZA 4YASA 5FUMA 5T4EA 1GKLA 1AQLA 3IA2A 4NVRA 2W6CX 2XMCA 3PDCA 3EQ8A 5JAUA 1L7RA 3WWCA 4P93A 2EDAA 2H7CA 3D59A 2Z5GA 2DQYA 5DJ5A 3PE6A 2CUTA 1DINA 1CUCA 1CUGA 4J3JA 2JGKA 4ZXFA 2FUKA 5IVIA 4DSAA 2BUBA 2Q0XA 2QJWA 2WSLA 5LZ4A 5HK9A 1UXOA 3N0TA 5EFZA 3LCRA 4GI1A 3Q0TA 2RHWA 4MXDA 4FTWA 4U2BA 2CEKA 4DM7A 3HLKA 3O4GA 3KOOA 3OURA 1HPLA 3ICVA 5CT5A 3D3NA 4KAFA 3I2IA 3F98A 1ZIYA 2OLEA 5FXMA 3WK5A 1H2XA 5FPPA 3HC7A 4YX9A 3R41A 1MNAA 1MO2A 3KXPA 5ALWA 1JJIA 5CW2A 4KR0A 3QM1A 4WFIA 3T4UA 5K3EA 1XQVA 3DS8A 5HF8A 4Q3KA 3O0DA 4BAGA 1AURA 2QKYA 4Y2QA 3DKKA 2C4HA 4B83A 5HF9A 3H2IA 2YYSA 3GBSA 1F6WA 3PF9A 2B4KA 1XZKA 1TK3A 5IVKA 5I9IA 4HVTA 4GECA 1SCKA 1F0PA 2Y2UA 4AMYA 5CXXA 4BAUA 2AXEA 4B7ZA 1EA5A 5AOCA 3C43A 4Y2YA 4L3WA 2IIVA 5BV7A 1J06A 5EIEA 3WKAA 2XMSA 1AX9A 3HJUA 2J4FA 4MEBA 4UBJA 1XZAA 1QIKA 3L1HA 4XIIA 1Y7HA 4TVKA 1IZ7A 3K6KA 3D2BA 2VAXA 2V98A 1QJ4A 1LZLA 1XRQA 1Q0RA 3FYUC 1QGED 4HXEB 2XUDA 2XUGA 1LZKA 3QH4A 5AKGA 2RHTA 3E1GA 4Y2VA 1A7UA 4CG3A 1CUFA 2QUBA 4K2AA 4C6HA 2DFPA 1BE0A 4PNZA 3F96A 2C7BA 4U2DA 3QMVA 4N8DA 3W06A 4H7JA 1VOTA 4OYYA 3YASA 7YASA 1LGYA 4GWLA 4QZVA 5T4HA 1JJFA 1E8MA 5D3KA 5ALQA 1ZOIA 3V1NA 2D5LA 4DLNA 4QDZA 4K6GA 1G5FA 1SOMA 2ZSIA 4A23A 4J0CA 3ZLTA 2PUJA 1MX9A 2Z3ZA 2PSDA 1DQYA 1CFJA 3FSGA 3MVEA 4AZ0A 4BDTA 2JIDA 2VQ6A 4H7EA 5E4JA 4KE9A 4Y2RA 1JMYA 2XUAA 3ZV7A 3QITA 2K2QB 2H1IA 1K5PA 2XLCA 1XRNA 4AN0A 5C8ZA 3G9XA 4KAAA 4BRZA 4FFWA 3WA6A 1XZEA 1J1IA 2BCEA 2J3DA 4U2EA 4OUKX 5DYTA 1IVYA 1XZDA 3IDAA 5ALJA 2XUHA 4ETWA 4DNFA 3E4DA 4X95A 4FHZA 3BE8A 1R4ZA 1CIJA 1XRPA 5LZ9A 1ZI9A 5DTIA 1CUZA 2C0QA 1THGA 3IBTA 1W1IA 4LXHA 1CQWA 4UUQA 5FLKA 3NGMA 1GPKA 4X71A 3B3QA 4Y2UA 4EZIA 2QS9A 4BCCA 5BWCA 4ZWNA 4QLAA 1YASA 3S2ZA 3FCXA 5ALGA 3CN9A 5K5EA 1QOZA 2QRUA 2Z8XA 1E89A 4YPVA 2OCKA 3IUNA 2RI6A 4GW3A 4PQEA 4MQLA 2B9VA 2PU5A 5K3AA 1GGVA 4BBZA 3KD2A 3STUA 2XMBA 2HDWA 3STYA 2VF2A 4F5ZA 3QZUA 1YS1X 3B5EA 4C4YA 3CCBA 1DU4A 1BU8A 5A62A 3BWXA 1E66A 5AI0A 4FKBA 1K6EA 3PUIA 4L9AA 3VXKA 4ZV9A 4H7DA 5ALKA 3WL5A 5JAPA 1QIIA 3D0KA 4KAJA 3R40A 4IQ4A 4E14A 3R3YA 4LHEA 2WUDA 3W2TA 5FDFA 3AIMA 4KRXA 3Q8WA 4K5QA 3BJRA 1BCRA 3C6ZA 5EHQA 1SC9A 1UKCA 3C6YA 1WB4A 4K6KA 4IHAA 3GFFA 3ZPXA 4ROTA 4BP8A 4QWMA 1Y7IA 2XMZA 1R9NA 3I2FA 4G8CA 5C7YA 2VJBA 4EBBA 4S0XA 4IO0A 4OSEA 4EY8A 5AIBA 5J3JA 3IB3A 1TAHA 3WWOA 2XI4A 2FJPA 5EHNA 2OCIA 3G0GA 3IULA 5AI6A 4FMPA 4OYLA 4A5SA 3C87A 5FOQA 2XB6A 2XMRA 3V48A 1XLWA 2CJPA 3BF7A 2QR5A 2V9ZA 1MT3A 4AO6A 1THTA 3O4HA 1HBJA 5AM3A 1XFDA 1CUYA 2UZ0A 1R88A 4XJVA 1CRLA 2PKYX 5ALFA 1DT3A 2RAUA 3VVMA 1ORVA 5HQ3B 1YSCA 2OPHA 3VDXA 1AC5A 2GBCA 1Q0ZA 1A8UA 4AZ3A 4HS9A 3QBJA 1OXMA 4X91A 4DMKA 2HA5A 1H2YA 4DNPA 2G63A 2E3JA 1UWCA 1UOPA 2XT0A 3TEJA 1KU6A 4UHEA 4KJXA 5EIHA 5AKJA 1CUSA 2JGEA 2HFKA 2WLSA 4H7FA 5T4FA 3PUHA 5AP9A 3O9MA 4K6HA 3AIOA 4WDQA 2C5GA 5CXUA 4BDSA 4WFKA 4B80A 3ANTA 2PSHA 1ODSA 4RPCA 1MAHA 5T4BA 4GDMA 2WG1A 2QM0A 4EY5A 3ESBA 5AOBA 4Y7DA 2Y6UA 3A6ZA 1L7AA 5HK8A 3TRDA 3CCCA 1G66A 2HA7A 2HA2A 5AM2A 1YB7A 1Q83A 2XLBA 2ZJFA 5JANA 4EY6A 1O6GA 1MJ5A 4MEAA 4X6YA 3DQZA 5AKKA 5AICA 5IVHA 5C8VA 4TGLA 5C81A 2ZYHA 1JJBA 4LYEA 4CCYB 2QT9A 2JGLA 4WY5A 2G5TA 1EK2A 5JD6A 3WA7A 1ZD4A 5HZGA 5AM5A 5EI5A 5KWJA 4BCDA 5JZSA 3WWDA 2ES4A 4KYVA 3OC0A 2ZVDA 2X8BA 3H17A 1UFOA 5IH7A 1GT6A 1VA5A 4CIBA 5DYWA 2XUQA 2PX6A 5AM4A 3SK0A 1E5TA 1N8SA 5AM1A 1XROA 3WIBA 4WCVA 3VKFA 1HDEA 2WU4A 1BN6A 4B81A 3EQ9A 3AJAA 3I6MA 4HXGA 4X6XA 1ZIXA 1FFBA 3HXKA 3IVMA 4BC1A 3RLIA 3FYTA 4E11A 5K3FA 3FWHA 5AK3A 1ZD3A 1LPSA 1YA8A 4KACA 1LNSA 3ANSA 5D3ZA 3FLBA 2PVSA 1ISPA 2JGJA 3HI4A 4H18A 3DEAA 1HQDA 3FLEA 2JBWA 4B9AA 1AMNA 2PSEA 5KBYA 5AKLA 1W52X 4DNOA 3R3XA 1LPBB 4X90A 3BDVA 2WFMA 3I2KA 1N1MA 3DJYA 4QWWA 1ODTC 3S8YA 3WWPA 1EINA 3D4LA 1USWA 5AH0A 4BB0A 1AUOA 3RK4A 5DYYA 3AZOA 2EDCA 3LIIA 3M3DA 3OTQA 3WKBA 5IVDA 2DQZA 4CFSA 3WWEA 2WIFA 1XZGA 2ZYSA 4ARBA 4JYPA 5JAOA 4FWBA 1QZ3A 3O9VA 4PW0A 3WI7A 1J2EA 3DOIA 3V1MA 4UHCA 3WK8A 5CT4A 4UBOA 2OAEA 5AKXA 1A88A 1ORWA 1TQHA 1QO7A 3R3WA 2XUKA 4UHDA 3SWWA 2PSFA 4IH1A 3F67A 4J0DA 4P9NA 2I78A 4UBKA 4EY7A 1VLQA 5LKAA 5ALUA 4DMHA 4OB7A 5EGNA 3WJ2A 4EA6A 1O6FA 3O4JA 1EX9A 3F8SA 1LPOA 4XX1A 2QTBA 3OM8A 1FFEA 2D0DA 2XQJA 3QPAA 2WQZA 1ZGBA 2PPLA 3WK9A 1QIJA 5CT6A 4C4ZA 3KSRA 5EHZA 3L1IA 1YAJA 1QIEA 1VE6A 3HEAA 3STWA 1W4LA 3QYJA 2VA9A 2XQGA 1WB6A 4KEAA 1DWQA 1CUXA 3ZWQA 4CCYA 3H18A 3OOSA 3R3ZA 2JF0A 5AKYA 1CUHA 1VKHA 3LIPA 3WIOA 3VVLA 1BRTA 2WIJA 5CH8A 2WIGA 1BS9A 1OCEA 1XZJA 3L1JA 1CV2A 1RWQA 2WFZA 3W04A 2HU5A 1GKKA 3AZQA 1QIDA 4MWSA 1DX6A 2ZYIA 5AKIA 2ZJ6A 4Q34A 2XQIA 1PFQA 3G0CA 2FJ0A 1CLEA 3QMWA 5JAHA 2QVBA 2WM2A 5LZ5A 4DMCA 1D07A 1LPPA 3PICA 5A7HA 3WK4A 3D2CA 1X2EA 4HRXA 4J03A 2XMDA 2DSNA 3FNBA 3EQ7A 1MU0A 2XMGA 1LPNA 1MNQA 1SCIA 2QXTA 2OGTA 4D9JA 2ECFA 5K3CA 4UHFA 1QO9A 5JATA 1L7QA 1LPMA 3X3HA 1XZLA 2VAVA 1HL7A 3LP5A 3A2LA 3P2MA 1UK8A 4WJLA 2AJCA 1EK1A 1WPRA 3ESDA 4UFNA 4X00A 4WY8A 3FVTA 1EDEA 1CPYA 3FAKA 2WHRA 2VTVA 2ACKA 2OGSA 2WUEA 4EHBA 4H7HA 3G8YA 3D2AA 2WHPA 4DNQA 5DNUA 2WUFA 4BCBA 4ZV7A 3NOXA 1XZBA 2DHEA 2DR0A 5I7UA 5K3DA 4I19A 1E8NA 1UKAA 3A2NA 4BAZA 2R11A 3JW8A 1WOMA 1EDDA 2Z3WA 2HA3A 2CKMA 4NS4A 1U8EA 4UBMA 2WHPB 2VSQA 4P08A 1CUEA 1UOOA 2OQVA 3EF3A 5AOAA 3LLCA 4QA9A 2VJAA 4I3FA 2ROQA 3EIOA 5AK4A 2XUOA 4UBNA 4AMZA 2H7YA 2QUAA 1ACJA 2BUCA 4X97A 3F97A 2WKWA 4GXNA 2QXUA 4DIUA 2GBFA 5DNWA 4RE6A 4ZREA 1CR6A 3HZOA 2O2HA 1WPXA 1WHTA 5AM0A 2OGZA 1EHYA 1R1DA 2WIKA 2HRRA 1XZFA 2WG0A 1LPAB 5ALVA 2O7VA 2V96A 4B85A 4FLFA 4HRYA 4LKOA 4U2FA 1CQZA 1XZMA 3RKSA 1T4MA 3CXUA 3OG9A 1MX5A 4JH0A 3I1YA 5FP0A 2FX5A 6YASA 2B20A 1DTEA 2IX9A 5CURA 5LZ2A 2WG2A 1R50A 4C4XA 1B41A 1T2NA 1EI9A 5ESRA 3BF8A 2EEPA 4A16A 5AI9A 1JI3A 2H9YA 2GBGA 1HLGA 2CBGA 3H1AA 3G0BA 2O7RA 1IUNA 4BE9A 2P8SA 3M82A 5ALLA 2OQIA 4FDMA 3V9AA 4XWGA 1UK7A 1K4YA 4WDRA 1ODCA 4UBIA 2BGNA 1FJ2A 2H7XA 3H2KA 3C6BA 3DDUA 4BVLA 4QE3A 4BZWA 1FFCA 4J7AA 4Q3OA 1VXOA 2HU7A 4X94A 4AQDA 3FVRA 4U2CA 4ITVA 3G0DA 4N5HX 1DQZA 5HKAA 1UKBA 5JD5A 4J0KA 2HA6A 3MUOA 1E3QA 1CUVA 5CBKA 4B0PA 3WZMA 1U4NA 1HKHA 4MWTA 2GYWA 5AI5A 5I8PA 1EB9A 4H0CA 5DNVA 3TJMA 1CUJA 4UHHA 2Z8ZA 1VZ2A 2PU7A 2XQFA 2XE4A 1GQRA 3VISA 1ZJ4A 4ZGBA 4Y2JA 5A71A 5JARA 4G1FA 3G9UA 3IUQA 5AKEA 5FV4A 3T52A 1A8QA 5ALDA 2XUIA 4BE4A 2QJRA 3C8HA 4INZA 4LXGA 2GZSA 4U2GA 2HL6A 4CI9A 4G9GA 3I6YA 4B6GA 4G4GA 1DWOA 1ETHA 1UK9A 2GBIA 1H22A 4KRYA 4BP9A 4OU5A 4I4CA 4DMFA 4LXIA 3GUUA 1XLVA 3M81A 1FSSA 1U2EA 5AK6A 3ZLVA 5LLSA 1QFSA 4DYHA 1XKTA 3UMJA 5A6VA 1EB8A 5E4YA 2O2IA 3W9BA 1ZJ5A 4LIPD 4FBMA 2BJHA 4W1PA 2AJLI 2ZJ7A 3C5VA 3R3UA 5KREA 3G02A 5CMLA 5ALNA 1P0QA 5DLPA 2C58A 3I1IA 5A2GA 4J0GA 4OD0A 3GA7A 4GLBA 3ILSA 4AO8A 3DD5A 1TCBA 5FPQA 3C8DA 1VZ3A 4O08A 4AB1A 4IH4A 1RP1A 3AUKA 3JYHA 1IZ8A 5AK5A 2J3QA 3A2MA 3GELA 4J0JA 1GXSA 1S8OA 1YAHA 5ALEA 2WIDA 4RNCA 1IMJA 2J4CA 2JGIA 3E0XA 4JEIA 4UFOA 5HKBA 1TKRA 1N5MA 1R9MA 1IUOA 3IURA 4TPKA 5DTJA 3QMMA 5C8XA 3KWFA 4G5XA 5AKZA 1W75A 3R3VA 4W1SA 5CT8A 1GPNA 3V1KA 2VT6A 4F21A 3R0VA 2PM8A 3IUJA 2RONA 3PI6A 3WL8A 3OPMA 5JIBA 4OU4A 3HABA 3WQHA 3HACA 2WTNA 4QEKA 3TGLA 2AJ8A 4MYDA 3AFIA 1JMKC 5BWBA 1CUUA 4MQMA 3WK7A 1WM1A 5LYYA 1XRLA 3VJKA 4BTVA 5AO9A 1W76A 2VJDA 4FLEA 1H2WA 5AI8A 1EVEA 1U65A 4PO3X 4Y9SA 2I03A 4HAIA 2WJ6A 4Q82A 5D6OA 1VJ5A 2G5PA 4J0HA 1JFRA 3G9ZA 3EBLA 1NU8A 1TCCA 1P0IA 4LYDA 3WKDA 2WILA 2OCLA 1XZCA 1AGYA 4BC0A 5SYNA 1C4XA 1BEEA 1JU4A 5JADA 4FBLA 4X93A 4W9RA 2C5FA 5LKRA 1DWPA 5HQ3A 1QIGA 2JGFA 2HIHA 4RGYA 2RGUA 1TCAA 4QNNA 3ED1A 2HRQA 2QZPA 1BN7A 3WKCA 1B6GA 5CT9A 5DWDA 4B9EA 2WU3A 5YASA 2HA0A 3H04A 3DOHA 3ESAA 3E3AA 3ESCA 4C87A 3FOBA 4JYMA 1CUIA 4BRSA 5D7BA 5EIAA 1RYYA 5HF6A 3WL6A 4H35A 4ZRDA 1EXWA 3PFBA 5E4TA 4OB6A 2C0PA 5ALHA 1VXRA 4EUSA 4N8SA 3FYUA 2WHQA 4CG1A 2XUJA 3DNMA 1H23A 2B61A 5H3HA 3RARA 3JWEA 4FFVA 2PSJA 5CRIA 1MPXA 1CUBA 1NX9A 3STXA 1G42A 2XUFA 3O95A 2HFJA 2JGMA 3AINA 5E2IA 3IIIA 1JKMA 3WK6A 5AIAA 1WCYA 4X92A 3HYSA 5LZ7A 1AKNA 1VA4A 1EDBA 2QOEA 4NMWA 2HM7A 5K3FB 1YA4A 2O2GA 1EH5A 4PSCA 1R3DA 2VEOA 1W6RA 2GZRA 1XLUA 1JU3A 2JEYA 1QLWA 2GYVA 2AJBA 5JASA 2Y6VA 4E46A 1WB5A 2GYUA 1YS2X 4FNMA 4EY4A 3MUNA 3BIXA 2WFLB 3FLAA 5LZ8A 5JZ9A 3C70A 5IKXA 1Y37A 4GEGA 3M83A 3G9TA 2Y2VA 1X70A 5HCUA 4B0OA 2YASA 1TRHA 2BUAA 3HRHA 5EHXA 4MJ3A 4B82A 2CZQA 4MYSA 4QDOA 1ACLA 1QTRA 3H1BA 4BVKA 4M0EA 3PF8A 4X85A 3I28A 3IUMA 4YK7A 2IITA 1AZWA 1A8SA 4BZZA 5JD4A 2V97A 5K3BA 5F4ZA 1QTIA 4CCWA 4F0JA 2G4LA 3C5WP 4HTAA 2BAGA 4QDUA 1QIHA 4BVJA 1SFRA 5SYMA 3KWJA 1CUAA 4H7IA 4IH9A 3SX4A 4J0IA 4QLOA 4CIAA 1MAAA 5AJHA 4C89A 4ARAA 4XVCA 2XMQA 1ZI8A 4WFJA 3WYDA 3WYNA 3VJLA 2HU8A 3RM3A 3DL7A 2DHDA 5ALMA 1QONA 2YH2A 3NWOA 4W1RA 4Y2TA 5CH5A 3AZPA 4DGQA 1LLFA 1XQXA 1PJAA 3FCYA 5ALTA 1F0NA 2ACEA 4H77A 4ZI5A 5BOVA 4E15A 4AN1A 1UK6A 4AO7A 3GROA 1KU0A 4QDXA 1ZD5A 1H2ZA 1P0PA 1ZI6A 1PV1A 4F60A 2RIPA 2VATA 3B12A 3DYVA 2AJDA 4G8DA 3AIKA 1XKLA 1DX4A 2QMQA 4OCZA 4QDTA 4AX4A 4G8BA 3WKEA 2BGRA 3F9CA 4UPDA 3H19A 3ICWA 3D7RA 3WZLA 3BDIA 1BCSA 1Z68A 3FSGD 2PL5A 2WJ3A 3W05A 4X7BA 1IUPA 3KDAA 4RE5A 2HA4A 3C45A 3I2JA 3FBWA 3PFCA 5CTAA 3SC2A 5ALRA 4Y2XA 2WUGA 1XQWA 4BYMA 4UHBA 3K2IA 4N8EA 2PUHA 4M0FA 4G4JA 2DCMA 1MTZA 1SCQA 4OPMA 3CN7A 4PSUA 2VT7A 3K9BA 4L0CA 2ZSHA 5A7FA 1P0MA 3WL7A 5HFAA 4BATA 1E8DA 1DT5A 3VJMA 2YXPX 5ALXA 2BKLA 5ALSA 1QIMA 2XQKA 3WMRA 5FRDA 2WTMA 3H2GA 1CUDA 1BEZA 1UT6A 2X76A 2I3DA 2XDWA 1M33A 1CVLA 1QIFA 5JALA 5LIPA 2ORYA 1XZIA 3BIWA 4L72A 3G7NA 3G0IA 4KE6A 3U0VA 5AHXA 4B84A 3STVA 2OG1A 1Q84A 5HF5A 4G9EA 1KEZA 3STTA 3I2HA 1UZAA 1XRMA 4W63A 2WJ4A 4PF1A 2OCGA 3A70A 1I6WA 2Y1KA 4HZGA 4C01A 2OXEA 3V1LA 3ZI7A 2LIPA 1XRRA 2XUPA 4X6UA 4EB0A 1CUWA 4DTCA 5KWIA 3D5EA 2PBLA 4GBGA 3C6XA 3H2HA 1JT2A 1UOQA 1C7JA 4X3CA 3I6ZA 1J07A 5HFNA 3LS2A 4Z49A 1GZ7A 1LBSA 3DLTA 4CG2A 3QPCA 1X2BA 4PSDA 4H7KA 3UUEA 3N2ZB 1K63A 1LBTA 1YB6A 5ALYA 1QFMA 1F8UA 1GPLA 3DYIA 2NW6A 4PV7A 4KE8A 2WFLA 4OB8A 1G4HA 2ONCA 4Y2PA 5ALPA 2HHAA 2CB9A 3DL4A 4GHWA 5ALOA 4KE7A 2R8BA 5CH3A 3I2GA 2BFNA 1MN6A 1YCDA 4Q3LA 3QPDA 5JZBA 5A7GA 3WJ1A 4UFPA 1XZHA 1YR2A 2I3ZA 1GQSA 4Q05A 2HADA 1K8QA 4P92A 1NU6A 1XQYA 1FFDA 3GZJA 4W1QA 1ZD2P 1WHSA 3O4IA 4N5IX 3UUFA 1CEXA 4DSZA 5ALIA 4JUIA 4FOLA 5FKJA 1N5RA 4NZZA 4C88A 4AXBA 4Q1VA 5JYCA 4JNCA 3ZLUA 1C7IA 3W9UA 2DHCA 3BJMA 1ZGCA 4UBLA 1BROA 1MX1A 3BL8A 3H2JA 1FFAA 4G4IA 1QE3A 1ZICA 3WLAA 1EVQA 3FYUB 3AILA 3U1TA 2ZYRA 2X5XA 3H0CA 1OILA 2VJCA 2CMFA 4FNGA 3HSSA 3DKRA 5ISMA 1VE7A 5AKHA 3NUZA 2OAGA 5LP1A 4Y2SA 2W22A 3QVMA 1TIBA 4FLMA 4BTLA 4V2IA 3BXPA 4M0MA 3MGAA
chains in the Genus database with same CATH superfamily
1H2RS 5D86A 4EPXA 4TLMB 1X13A 3WX0A 1Q1EA 1NWHA 5KCZA 3EEQA 3BJIC 1CZOA 1GKLA 3WQSB 1D2MA 2AX3A 2ZAIA 4OJQA 4F3KA 2I1VB 1VYUA 3KQWA 1HZJA 4AMGA 5KWEA 3OY7A 4QNRA 2NU9A 3V8PA 2ZIXA 2W6CX 2EL7A 1P6XA 3AVOA 2NYAA 3ZWKA 2PZMA 1M74A 1DQNA 3N6RA 5JECA 4FMCB 2HLPA 1E7SA 3GW8A 4I2VA 5BR8B 3IMEA 3TAXA 3QFTA 5JAUA 4UQLA 4D25A 4DF3A 5DT2A 3WWCA 3D59A 1P9NA 2GM9A 4FGSA 4P58A 4Z4FA 1B8UA 4F4IA 1OBHA 1XD8A 2DQYA 4UASA 2LR0A 4Q4HB 5CDGA 2I6XA 4O4LA 1N0HA 3SHQA 1DINA 3OE1A 3T9EA 1E0AA 1F9EA 5LA6A 1K7CA 2PGAA 4LZOA 1SZCA 1U28C 2JIQA 4RHEA 3OLWA 3WVNA 5AJTA 2J9RA 2RGGA 1T2DA 1K98A 1J49A 4KL8S 4R05A 4ZXFA 5HXAA 1U8ZA 4CTMA 2HDNB 721PA 5KS2A 2IEAA 3Q2IA 1XFAA 2SKEA 4MVJF 4I55B 1KYWA 4AICA 1JQLB 5H82A 2GN4A 1NPDA 2AKEA 4UNQA 5LP6F 2EIXA 3A9VA 4CMGA 5FFFA 2FSUA 1JUDA 1WSAA 2EAUA 2PMWB 3RI3A 5HK9A 3SQXA 1SQGA 1IEQA 3B6MA 4Q6BA 4W99A 2DR2A 4MW6A 1UXOA 1BVHA 4YC7A 3HJBA 3F7MA 4UMEA 3AW9A 4R01A 4ND6A 1U4OA 3JQPA 3MJHA 3B6ZA 3OU2A 2N1BA 2W5UA 4IKOA 1L5HA 1U8YA 4JT9A 2QRJA 4U2KA 5ESDA 4O3FA 4DM7A 3GUYA 2NZ8A 3Q7RA 3OURA 2FWIA 1XDUA 4XJXA 1YVDA 3EIFA 5T4HA 3UJHA 3W2GA 4PC2A 3ETEA 3L49A 5ABPA 3SPXA 3W5VA 2VHVA 1GEEA 1RM4A 2HJSA 4C6SA 5CB4F 4LI3X 3ZHYA 2A33A 5J4YA 4MRMA 3EA4A 5JXIA 1GRVA 4QRHA 5FTKA 5ITWA 4RY8A 5KYYB 1Z2OX 2C9ZA 3WK5A 4E3ZA 4YJDA 1W34A 2WWWA 4R7GA 3UA4A 3VKGA 5FPPA 3CNNA 3HC7A 1OLXA 4N5NA 3JD0A 2JAPA 3ZY6A 5LXTA 3ZCSA 2A84A 1E1LA 1I5OA 4QELA 5DW3A 5LQSA 1UFKA 4Z53A 1W88A 3C3KA 4EG1A 5ALWA 4XX0A 2VLBA 2IJGX 1QYDA 4TKUB 3FB4A 3T1TA 2FUEA 4AUMA 4EJSA 1W0CA 2R8XA 4Q1BA 1L7PA 5DCUA 1U0GA 3QM1A 2IYEA 3CEMA 3C39A 2XEDA 3PNKA 4WFIA 2P6UA 1KS2A 4FT2A 4XM0A 5K51A 1YB1A 1FFXB 1N2JA 2JHAA 1NATA 2V45A 3KEOA 1QG4A 1O2DA 3GQBB 3KE9A 5G0SA 1KRWA 4JBIA 4L76A 5ARCA 4R2WA 3F3MA 4KVAA 3E3LA 2F9FA 1JLLA 1G9SA 1M8GA 2P11A 1E59A 4BUZA 4DJDC 3SOPA 5C0OE 4FFPA 2IVFA 1LI5A 1WZNA 3K9LA 3G88A 5WRFA 3PF9A 2O5EA 4AKEA 4LFCB 4D99A 3UB2A 5MN4A 1XZKA 4YCNA 3FETA 1JQ3A 3X2EA 4OLJA 1ZP6A 2CNBA 2CUNA 1JHYA 2O57A 2PYIA 4GWKA 5AOVA 5I9IA 4HVTA 3KKNA 5BPHA 2NYVA 3OZ7A 3SEQA 3JYOA 1CU1A 3H9CA 4AMYA 5CM2Z 4ZEVA 2FFRA 2R00C 1E32A 1J9ZA 1U6KA 1QZUA 5IUJC 2AXEA 1WDWB 2XGGA 3HV2A 4C4SA 3I04M 4KBYA 1PQYA 1Q0TA 2RG1A 4QOJA 3DAPA 2FR8A 4RV9A 4ER6A 2O8BB 4J0EA 4A5OA 5T6BA 3C43A 5F77A 4ND1A 3K5IA 4Y2YA 1MG0A 4YAGA 4ARCA 2HYIC 1PDWA 4KZKA 5CU7A 5BV7A 4F12A 5K99A 3COJA 3GGCA 2W9XA 5J2TA 3TINA 2CLSA 1UXIA 1ZGJA 2R2GA 1Y8ZA 2DMRA 2JFWA 5TPWA 1QIKA 1SXJC 5EZYA 2Q5JA 3L1HA 3A1DA 3OHMA 1ADGA 1GTG1 2AN4A 3TKYA 9LDBA 4XIIA 3UMCA 1V9SA 1G1AA 4BMXA 4O4JF 2GJAA 1S02A 3D2BA 3CPSA 3P19A 4JKYA 4OYHA 3RU2A 1G5QA 3SYLA 2PYDA 4GX1A 4ZYXA 1P5HA 1XCOA 1I2CA 1QJ4A 4JXZA 1Q0RA 3LU1A 2XUGA 1FTSA 2P6MA 4TLDA 1K86A 1EEHA 2CLHB 2OCBA 3O1IC 3OU7A 1FE8A 1FX0A 4KXQA 2DBQA 3BFPA 2VQFB 1GSIA 4B3GA 2DFVA 1U5AA 3A9RA 3AWIA 4JBXA 4JJKA 3DDWA 5AXAA 3T35A 3T5CA 3VNSA 2JATA 2DFPA 3IAM6 4B17A 2JD0A 1Y5RA 2A1TS 4X60A 5FJJA 2ZR0A 2NPFA 1F1BA 1Y1QA 3TYXA 4RD0A 3H9EO 4U00A 2IW1A 3KJXA 1IPFA 4C1NA 3F96A 1RI1A 3AF5A 3CVYA 1MHTA 2RKWA 1PZEA 4U2DA 5CGZA 1T29A 4ZYZA 5B30A 1Q2XA 2B5WA 4CTKA 2UVPA 3IP5A 4LRTB 3W06A 2ZIZA 5CVJA 4AWAA 1SG9A 1VPVA 4LHVA 3NZEA 3G5MA 1XJ0A 1VOTA 4QARA 4F06A 5KYWB 1T0BA 1LGYA 3W3ZB 2XTNA 1CCWA 4QZVA 5JTTA 2YV4A 3M5CA 2CFIA 2DUMA 2SICE 5EKDA 5JXGA 5AUOB 1JJFA 4RTJA 3HYRA 4B3RB 1PG0A 1MZPA 4PG8A 4C0SA 1ZRSA 1H6BA 1SHTX 5BYAA 2A7XA 3IJPA 4N49A 4DLNA 2Y1DA 4QDZA 4K6GA 1RLIA 4P4SB 4J0CA 5K9ZA 1LTKA 4LDPA 3T3HA 3Q85A 2J33A 2PUJA 1U81A 3QI2A 1LVHA 1UBLS 5BUQA 1T9ZA 1IM5A 4UDXX 4R2IA 3WB9A 2ZVJA 5L3ZA 2YIJA 3GA5A 3R6LA 4J7UA 4I3GA 2H5JA 4JK3A 2Q6VA 2IH4A 1SHJA 1Z7EA 2QZSA 1NVGA 4NONA 2JIDA 1Q57A 2PIDA 4H7EA 2H7VA 3RFUA 1QB7A 3KYJB 4WZ6A 3L6OO 3R8CA 5E4JA 4W8OA 3WDMA 1Y4UA 3O4RA 4Q4JB 3ZV7A 1X80A 3QITA 1O97C 3SNHA 4BKPA 4KU4A 3DW1X 3GEIA 4LDZA 2D3TA 3T9DA 2NADA 2HT1A 1E1CA 1JR3E 5JWHA 2DY0A 4YB8A 3S2SA 4RHXA 4AN0A 4KAAA 2D74A 1NBMA 2J07A 4MS4A 1OGYA 4PR0A 5BXYA 4MP8A 1C8BA 2OPBA 1PS0A 1DRJA 3WR5A 1NC1A 1M6HA 3MT8A 2JCVA 1Z07A 3O31A 4YT2A 4CQMA 1GQ2A 1ML4A 5TB5A 1TU0A 2WTEA 3RUAA 5D1NA 3UFXA 2D1SA 3SZOA 2BSAA 1IVYA 3HCWA 2G5CA 3IDAA 4US0R 1P2SA 2CZCA 3QVVA 2XUHA 2X4IA 2RJOA 3LX4A 1HQYE 4RVNA 3K0CC 1T34A 1V16A 1J5XA 3NGXA 2W70A 2DQKA 4KLZA 2QTWB 2GHTA 3JARA 5J23A 4HKTA 2PZKA 1Q91A 4FHZA 4OMFG 4L6CA 5EXDA 3RG2A 4BNJA 2DFKB 1RWXA 4IRUB 3RO7A 5FX2A 1T3ZA 2ZITA 3VNRA 4E12A 5LZ9A 4ZA2A 2C0QA 2DJ5A 3AB3A 1A7AA 4H3VA 2YXDA 4K86A 4PRZA 4N4AA 1N1GA 5DTMA 3HXMA 1MO3A 2IY7A 2WWTA 3NGMA 5EWLA 4DXDA 3CONA 1EGHA 2I6FA 1GPKA 3B2NA 1Z16A 5JCXA 1L7OA 2IEBA 3G5AA 2REQB 1ZONA 3M1YA 1VLVA 5FTJA 3E3MA 2AOWA 4ZC8A 2DPXA 5F5NA 2P41A 3IDFA 5KKCA 1BNCA 4CGZA 1C7QA 2OENG 2R85A 4XD2A 3S55A 3F5DA 3JVUA 3PIDA 4BFUA 4Y2GA 4C06A 4CV2A 2FE4A 3WLPA 3FD8A 2HPVA 1RTKA 4PC3A 2BC9A 4LOLA 1M1YB 3KTOA 2BH2A 1SKYE 3EEYA 3OPYA 2X8AA 5F1PA 1FMFA 4ZN6A 1ZMTA 4CM3A 4IVQA 1MFZA 2QRUA 4H0NA 3WYCA 2QQGA 4WNIA 4ESOA 5E1OA 3N8IA 2YINC 4R6XA 1N2CE 2OCKA 4YPVA 3GBVA 2GFIA 2HDOA 3EAQA 3AL3A 4PAOA 2FRDA 3TTYA 1NXXA 1PJBA 2OVBA 4QC2A 4A36A 3ZWYA 4DIEA 3RS7A 1J22A 1S2DA 2W48A 2PU5A 1OWMA 5KDLA 1T36B 2W2TA 3R7BA 1B8PA 4W7IA 4BBZA 3GOHA 5JMPA 1GRQA 2B2CA 3TE7A 3STUA 3U48A 3NATA 3SVTA 1SKQA 4TKLA 1WBDA 2HDWA 4UVEA 1V35A 1Z36A 1NNUA 3D1VA 3STYA 4F5ZA 4ZOLA 1II8A 2DTEA 1XJWA 2HF7A 1YS1X 3BIJA 4NWIA 2PKQP 3BCUA 4IRMA 2BFBB 1IUKA 3QUTA 5IARA 3TLBA 2IDJA 4GQBA 4C4YA 3MAGA 5EKTA 2ZUWA 3RFFA 3CX3A 4L1KA 3VC3A 3BG5A 4OKSA 5DN6D 1GNRA 1WKCA 4OLBA 3UN1A 4AL4A 5BOSB 2G1PA 2Z3VA 1PT9A 3F5FA 2B7LA 3RC7A 3QE3A 1NNSA 1PR4A 4YONB 1DKUA 5AW2A 1BHJA 1SQ6A 2GJ8A 1O0SA 5AI0A 2PZEA 3D3WB 3E8MA 3G2JA 1NKTA 2P9JA 3PUIA 5KIAA 2BTOA 2GZ2A 3NO4A 5AJZA 2ZYAA 1GXSB 1R0SA 4I66A 2C03A 2B21A 3HKDB 3PUJA 1DBIA 4MLDA 3SCZA 5CB6A 2QUHA 2AE1A 1QIIA 2BN4A 1VTKA 2GKGA 3FSRA 4KAJA 1RKUA 1RLTA 5JSKA 4IQ4A 4GKJB 2O8FA 1WCV1 1TYCA 2H1VA 1NW6A 1RQLA 3UM9A 2GSWA 2EBHX 1W5FA 1XL1A 3R3YA 1ZK1A 2J59A 4OLFA 4B3HA 5LQRA 5KNLA 2WAOA 1Q0HA 4KKXB 4O6VA 5CLQA 4C0LA 1LKZA 4PZ0A 4G0ZA 4K6OA 2PX2A 1VBFA 2FP3A 1E9VA 3E3NA 4K5QA 1LFDB 1ULSA 2AWOA 4CF3A 3ITKA 3VR5H 1P81A 2O8VA 4WHMA 4X65B 2C5EA 3L4SO 1AE1A 4B3CA 5JSZB 1SC9A 1UKCA 3QX7A 3DZFA 2Q4BA 2IV7A 4JOCA 1DHRA 1FP1D 4XAQA 3B36A 1ZCJA 1CVRA 3H9UA 5DN6A 1AO0A 3GFFA 3HYTA 1SA0B 4LOAA 2H1WA 1ENPA 1KOLA 3O38A 4P7BA 4ZHQF 1AB6A 4G2NA 4UEOA 2Q6TA 2OXCA 3MERA 1LF5A 1RLJA 1C7RA 3TK1A 1FCJA 1C1DA 3CUSA 4QWMA 4W9NA 1XRSB 4BP8A 3L6EA 4NBVA 1Z4LA 2WQ7A 1JKIA 3AERA 2OFFA 4E31A 4P3YA 5KJFA 2QN6A 1QYVA 1AUVA 4N82A 4MW9A 4MA5A 5C7YA 4O8CA 1W8DA 5C1IA 3VPXA 4HBGA 2P4SA 5FTWA 2JB9A 1PV2A 4IJ5A 4WKPA 3ZS9A 2QX8A 3KUCA 2PLRA 1VI6A 2VJBA 1ZIPA 3H65A 4S0XA 4HYYA 1LFAA 3K0FA 1KFJB 2Y4OA 3LLSA 5HTKA 3DMPA 3R7FA 4UTZA 5J3JA 3AY7A 3NHMA 1KEEB 5G40A 3CLUD 4DJAA 4E7PA 1TAHA 5FWXA 2PRKA 2FJPA 3DFFA 3PC8A 3ZI4A 4C2UA 2WJYA 1MB4A 1YZLA 2X42A 3HEBA 4YGXB 3RVJA 4LXQA 1CF4A 3G0GA 4UM8B 1YV9A 5JQWA 5KOJB 1F5SA 3NBKA 3TUZC 1NM5C 2QGFA 3P0JA 5FB3A 2LV8A 5IJ0B 2I2WA 1H5QA 4AU1A 1RWNA 3ODGA 4L5IA 3Q0EA 2C82A 3H3FA 1N9KA 4OYLA 3THXA 1LXCA 3BTVA 4MJ7A 4Q7KA 3L7OA 3OKCA 4WK0B 2VJNA 4G63A 1JAXA 3MNFA 1H1DA 4RH1A 5GVRA 3NHLA 4F92B 4KRFA 4H4CA 1O87A 2A4MA 4CYMA 4DIBA 3GLHA 4E7OA 3GGDA 1KJ8A 2RK4A 1V5GA 3E53A 4ZO9A 1WZ2A 4KBGA 5L3RA 3OIVA 4MR8A 5HRCA 2AOUB 2O0KA 1QG6A 2W83A 5KQPA 1MX3A 2PS1A 1KAOA 3AQIA 1KO7A 3C6KA 1Z7BA 3QLUA 1R88A 1Y8RA 3OM0A 4IIBA 4BNLA 5JW6A 4Z4IA 1CRLA 1UMBA 3OBIA 2PKYX 2PSSA 2MU1A 1DKRA 1TK2A 4YMIA 2R8EA 2HJ9A 3FCCA 4HDKB 3KXLA 1DT3A 1JU9A 2NO1A 3OCJA 1P17A 2GRAA 1XHLA 4XIJA 1QC5A 1ORVA 1YSCA 4FYHA 2HSZA 3GJ5A 2C5HA 4O1MA 5JS8A 4OX9Y 3MTBA 1F4LA 4IR7A 4HGPA 5F78A 1AC5A 3PJDA 4JUFA 4MI9A 4CRWB 3TS1A 1X1DA 3H83A 4DW8A 4NJMB 4L57A 1R6VA 1SOVA 3HO6A 1WL8A 2X5KO 4P7JA 4PM4A 4QQRA 2VPYA 3I6IA 3KQQA 2XVZA 3G85A 1MABA 1J42A 3I92A 1W5EA 4DMKA 3KSUA 4IO1A 3VC2A 1KARA 1TLFA 4OHBA 1UBSB 4YALA 2D7CA 3RHSA 5DHSA 1QYWA 4JIMA 1UWCA 4NE7A 1IHDA 2GERA 3MELA 4ND8B 2C2ZA 1V3QE 2XT0A 3GHHA 4OOFA 4LCJA 5SY9A 4KJXA 4F72A 1YZYA 3FGZA 1B43A 3ZE7A 4B6SA 1OH7A 3OKFA 4WEOA 4WV3A 1ABEA 2OD2A 5KVSA 4PGHA 1JQDA 4TTQA 4QUBA 2HFKA 2WLSA 2OXFA 4CM9A 3KP1A 5T4FA 2V6IA 4GPEA 5CAEA 5AP9A 4MVJA 3ILVA 4WDQA 4WY2A 2C5GA 4RESA 1RAEA 1QE5A 1T9KA 2FSIA 3DT6A 4B6PA 4BDSA 1EE9A 1QV7A 5CXUA 3LGAA 1MIOB 5CDSA 4C2AA 3ANTA 2IKQA 1QGAA 5D5HA 1ODSA 2ZAOA 1NY6A 4GU5A 3G59A 3SXUA 4A3SA 3HM2A 3EDQA 3DG9A 1PZHA 1K6XA 1X0XA 1X42A 2DPYA 2QY6A 4YRPA 1LBHA 1U11A 3A6ZA 3EVBA 8OHMA 5L3QA 5HK8A 4BZXA 5LLDA 3P71T 2YR0A 5DHAA 1W96A 3WB0A 5A6SB 1NQOA 3WGTA 1U0OC 1AVTA 2FZEA 3CSDA 4MK4A 2F1HA 4MDFA 1YB7A 3MBOA 3HR7A 4F2PA 4BKMA 3LOUA 2HUNA 4NNPA 2V6JA 4BYGA 3HB0A 3ND8A 2GN2A 1L7VC 2X19A 1N1EA 1MJ5A 1RMYA 2SECE 3FFTA 3GLVA 3OVMA 3AVUA 1HDIA 3PQ8A 2CLFB 4N7BA 3Q7EA 1SCBA 1XI2A 2OHJA 4B47A 4DSNA 2PV7A 2BTQB 4IG9A 3VV2A 2A9KA 2IIBA 2X8LA 3LW8A 1SK8A 3RTDA 3T5BA 4FYVA 4H9GA 1D2HA 3GLTA 5C8VA 1N9GA 4TGLA 3VHXB 3W8NA 2OHOA 4EI7A 4DC1A 2ZYHA 4LYEA 4M0KA 3IEVA 4R3WA 3NV7A 1JHOA 2VTBA 4AJ4A 4M9CA 3TNYA 3HWRA 3DA8A 3IMGA 4B46A 2JIRA 3MA0A 4A0QA 1QHFA 1PR6A 5HMMA 1AUQA 2BP7B 3IPCA 1RT9A 4HAYA 5KMGB 2F43A 4Q18A 2J3EA 5H02A 3W5AA 4JI8B 2Q7XA 1RWWA 1PL6A 1QNFA 3LYHA 5AM5A 4EFLA 5EI5A 4KKVA 1HUQA 3KQNA 1HG1A 2A3NA 2C8LA 2JW5A 2Z5VA 4BCDA 4EABA 5JZSA 1OLSB 3IP7A 1YR6A 5E6RB 3V9PA 2ES4A 3EN0A 2N42A 1T4CA 3KHKA 4ENTA 3WGOA 1ZAYA 1QH1A 4DUZB 3ITEA 3JAWB 1Z2EA 4NECA 4BBAA 3OFVA 3R0JA 3EIWA 3F5MA 5H0IA 2HZBA 3RQSA 1XTJA 4JJ8A 4QL3A 4CKCA 3IEMA 4QUDA 3O2JA 3I30X 4HEJA 4ARUA 1AG9A 2H59A 2IX3A 1GT6A 3QKSB 2FOLA 4DR4B 4NC9A 3HP4A 1TFRA 5IC6A 1YFJA 2XUQA 4OHUA 2PX6A 4Y0VA 1Z56C 5HEKA 4RACA 4PNPA 3I9V6 1N8SA 2A1TR 5AM1A 4RGBA 1M7BA 2Q1SA 4TMTA 2KPOA 4C3VA 1QP0A 3ADBA 3CMCO 3KWLA 1L7MA 2WYHA 2WU4A 1Q3KA 1BN6A 2CJWA 1T9GR 4B81A 4E30A 1U7OA 4JLWA 1HQCA 4TV9A 2VJQA 5JNWA 1GUDA 5EXEA 1AZTA 4L73A 2P77A 4EG3A 3KAQA 1EFRA 1WCWA 2QD2A 3B6IA 1ORDA 3HXKA 4DA9A 5LDHA 4YRNA 3GQVA 1Y1KE 4BC1A 3RLIA 1INLA 3GJZA 4E11A 1RI4A 3EASA 4KIWA 5K3FA 5J2TF 1QO0A 4YV2A 2W37A 1Z6AA 4F8YA 4R8VA 3JQAB 2Z9DA 1HDZA 2NO7A 2ATXA 2NZXA 3ANSA 4K87A 4DUGD 2OUIA 1ECGA 2ET6A 4BQEA 4BVAA 4YEDA 1ISPA 2V7GA 3BA1A 1Z13A 4LOJA 3NHSA 3PR3A 4GIBA 4H18A 4ANFA 2VXOA 2QQ0A 3EGCA 2EFEB 1KMHA 1CWUA 3FLEA 3PIRA 3A8TA 1WXWA 2RFLA 2HEIA 2C2MA 4CIWA 3MMNA 2PSEA 3OZRA 4BVFA 4X7RA 2XBLA 2QVGA 1NPYA 5KJEA 1H8ED 2F3UA 5J4VA 3GLFA 3K31A 1GSHA 3R3XA 3MFQA 3I1JA 3UKDA 3DP9A 2P78A 1A2QA 3BDVA 2NU6A 2VJPA 3NASA 3SLRA 2YZ7A 2CXTA 3V2UA 2GXQA 4IIEA 5DWVA 4MRSA 5TMPA 4MRVA 1FVXA 3OCZA 3GT4A 1SELA 2GJSA 1YRLA 2JGDA 3D4LA 4OKNA 4ND5A 4HMQA 1KQGA 2FCRA 2IPNA 5AH0A 1F8FA 1RM0A 3E61A 4MWGA 2X41A 1YS6A 2BMEA 1GM5A 2A5DA 4LDNA 3H9GA 2DR3A 1GG8A 1L4YA 1LS1A 4DKJA 3QFCA 2XB2A 1EP1B 2G7ZA 4ZO4A 421PA 1ADCA 1NBME 3RKRA 3NKFA 2JI8A 3OJLA 3OUZA 4D9IA 4LISA 2VN8A 1P1BA 2BFDA 2CMKA 1NYQA 2F48A 5JU6A 1RW4A 2QLNA 4HTFA 4QU9A 3GFOA 3MT0A 4JR2A 1H6CA 1NBOA 3PC4A 4FOOA 5T6MA 1YGYA 2O1XA 5TEVA 1E3DA 5C1OA 3OE5A 3DO8A 4DQLA 1D1SA 1QRUA 3VPDA 4C29A 5IAAA 5F3DA 4D8XA 3E23A 2QMYA 4ARBA 3GU3A 3HCCA 1QZ3A 2D8MA 1T3SA 3UJ7A 2PGNA 3BEOA 4J4HA 4G37A 4PW0A 2ZM6B 2XXAA 4YUYA 4EWLA 2NLOA 3AETA 4M21A 4Z2AA 3E82A 4K46A 4E6EA 4QASA 3PRKE 1WUJS 3JYPA 4AX8A 3HL0A 3UH1A 1WUHS 2MSEB 1OWNA 2FSHA 1ZNZA 4GOKA 3K0AA 3T0IA 3ZBQA 3O3OB 1D8AA 5CT4A 2OAEA 2NVUA 4BU0A 2XCIA 2HMVA 3ANLA 3MK31 1HQKA 1TQHA 2J9FB 1QO7A 1VLMA 4KUEA 1G8FA 4ZVSA 2QRPA 3SWWA 1NG9A 5B1EA 3QFSA 1A27A 1Z6TA 3W5DA 2MINB 4G0MA 1KH3A 3TB6A 1NAIA 1O57A 2NZJA 2ASVA 1E5LA 1U7XA 3F67A 5GJVC 2P6OA 2W8BB 5ARBA 1TQ8A 1GTSA 3G79A 3L9XA 3Q3HA 2IXBA 5SV2A 3WLNA 3PNSA 4ZGWA 2D54A 2COKA 4P9NA 5ITVA 4MAAA 2JLVA 5LDDC 4DIKA 3KJZA 2G06A 3ZU6A 4OI0A 3O8BA 2R7LA 1TA4A 2A94A 3I83A 2NAFA 3O7MA 2O8DA 2FF7A 5TPWB 4NCKA 4LZPA 1G21A 3A04A 4WASA 1R74A 3HCPA 3I32A 4BNNA 3IRUA 2P2YA 4IHKA 5PNTA 4FR5A 3F5QA 3L5KA 5EGNA 3W1WA 1JHRA 2VUSA 4KIUA 3UHAA 1QP4A 3Q87B 4BFCA 4E5PA 4R8RA 5U9CA 1G6KA 1JTEA 3PXDA 1OXSC 2HWYA 1YMQA 4EA6A 1PR0A 5HM8A 1EX9A 1QXSA 4XR9A 4WT7A 3W6UA 1NSFA 1ZXXA 3PFHA 4US2R 3EF1A 4MCIA 1M66A 3W5SA 1LTQA 3EZ2A 1KP2A 2QTBA 3GGPA 4FR0A 2ZAYA 4EIWA 4WA7A 1ST2A 3TNDA 3NQ41 1PK9A 2B92A 2RHCA 4C76A 1HT2E 3SSAA 5K0NA 1QCDA 4ON9A 4M86A 1NP7A 4RFSA 1P9OA 3T9FA 1K08A 4QG3A 3ETCA 5BWLA 3UJNA 1GARA 1P77A 4HAWA 3TBHA 3GT0A 5I7OA 1BDIA 2A8YA 2JD2A 5EIWA 4GPD1 1E5XA 3PFNA 4P84A 4EJSC 3CVXA 1WVIA 3PWZA 4XEHA 4AJPA 4TT8A 2V7WA 3L1IA 3WP0A 2O3TA 3IOBA 4L8VA 1P7ZA 3R5KA 4C0BA 2AZ4A 2VA9A 2X9LA 2XQGA 3G23A 3IJ5A 3UMYA 1VHQA 3QE9Y 4EM6A 4GPAA 1Y8AA 3GLIA 4F91B 4CCYA 1R8XA 5JPCA 2BCGY 3H18A 3V8NA 3BREA 4KVFA 1DUIA 2HJWA 2V65A 3AP2A 3M5DA 4HPXB 4WUVA 3WIOA 4KCGA 3EEBA 3L06A 2YCBA 4J0FA 1BRTA 5DLDA 4CV1A 3V4RA 3AB7A 3DPIA 2WIJA 3EC2A 1BS9A 2J6CA 2DH6A 3OT5A 3L1JA 5B36A 2P7IA 2C95A 4RIIA 2TS1A 2ZUFA 1BX0A 5CNIA 4D9CA 1BMTA 4AUKA 1RWQA 2WFZA 1UDAA 4CMJA 1OH5A 5B1IA 3A3NA 4MDYA 2QNIA 2HU5A 4TN1A 2XNJA 2ZDQA 1ZAKA 3OIWA 3LHSA 1V1RB 5PGMA 5DGIA 1KXJA 1TO1E 2OXIA 2PWAA 1EE1A 16PKA 1SUSA 2GPYA 2IT1A 3FWNA 4NRDA 5GWXA 3UAZA 2FJ0A 4ZOLF 3ASZA 1M72A 1JLRA 4RZXA 2J0QA 1SRQA 4NY1A 1AQ6A 4ZJPA 4TRMA 4YQFA 1FDRA 4DMCA 3PR2B 5JMTA 4ZT7A 2BW0A 4DVJA 5I4IA 2P3LA 1IM2A 2WJPA 1WBJB 4PX3A 3BKWA 4G85A 3ONFA 1A5ZA 3CT6A 1L1FA 2Z5FA 3ABZA 2VUTA 3VC7A 4R2XA 1T2VA 3DT9A 2XAUA 4MKZA 2OLJA 3EZYA 3WGIA 1YB5A 3FMIA 2XCQA 4NE2A 1CQJB 4HEHA 4D56A 4HGNA 5JY6A 1VRCA 3ZH9B 1A8HA 3IERA 3FPFA 4MW4A 2XMDA 4MV5A 3EGDA 2VHUA 2MWMA 1N2EA 1OXVA 3FTPA 3DZJA 3ZLJA 3UBMA 4KQ1A 4QYWA 2HLNA 2GQ0A 4AROA 1H8EA 3OCYA 2VXBA 3LWZA 1JAIA 2QXTA 1MG5A 2OGTA 3AJ8A 3BEDA 4HCJA 4TMKA 4PYRA 3KR2A 4IDQA 5AWFC 5K3CA 4UTNA 3COSA 1NL3A 4IHQA 4JBNA 5A9TA 4PHFA 2NP6A 3O3CA 1O9GA 1L7QA 1YCGA 2GOYA 3K1JA 5M04A 4BQSA 1P19A 4WXHA 3M6IA 2WSBA 1HL7A 4PCVA 2OYCA 3V8RA 7REQB 4TL9A 1J4AA 5MFZA 1N6HA 1RC1A 3QWIA 2C1EA 1WV1A 3EWIA 2NU7B 1UK8A 2VJKA 3GUVA 2GZMA 1T2EA 4N7MA 2QU8A 5K0TA 2OOSA 5FV7A 3OT4A 4TTAA 4FGJA 4K40A 1KOFA 3ESDA 1M83A 1C0LA 1E98A 1FLDA 5B4TA 2HWKA 4FUTA 3AR2A 3Q8XB 1JJVA 1CX9B 3IOMA 4WY8A 4Y9DA 4FXPA 1UEXC 1K2VN 2J9FA 3EVDA 3I12A 2XSZD 4I2NA 4KZPA 4A26A 3WWYA 3FAKA 1EFVB 3FLMA 2WHRA 2VTVA 2QL7A 3PQDA 3MC1A 1IAQA 4S1WA 2F3RA 3BD8A 4ZVTA 2LXNA 4HVCA 2CE7A 3OTOB 2I1QA 5EP1A 3UA3A 1N7HA 1OI2A 4EVIA 1IY0A 1XMJA 2VHJA 1RR6A 3WGYA 4E6PA 1ILEA 4GXQA 5D8DA 4Z0PA 4PR3A 1QGOA 4XGKA 5IU6A 3UHOA 2HOQA 3G2NA 3WIVA 2ZJ0A 3N0WA 5DNUA 2YCLA 3MQ2A 5GONA 4DLLA 4DR1B 2C7QA 2ZYUX 4QGAA 2OR3A 1W48A 4FCCA 3GBPA 2M6SA 1JB9A 3DDNA 3NOXA 2ZVPX 3UXYA 1PJ4A 1Z0DA 1H85A 1N25A 1XZBA 2DHEA 1WLSA 4K9MA 3KU1A 4Z0HO 3S4YA 3NAMA 1BXZA 4EG8A 2DP4E 1FF9A 5I7UA 2QE7D 4DM3A 1N8TA 2QE7A 3BMCA 3N07A 1IFXA 4EX7A 1WOMA 1N8NA 1ENOA 5KYNA 2PA0A 5IK2D 4W5TA 2HA3A 3N2GA 4NSNA 1ZK2A 2Q3JA 3EW7A 4GL4A 4S12A 4QYIB 2QVCA 3FF1A 5DBGA 4X61A 5IAGA 2XE6A 4M9RA 4EBFA 1C4WA 3MBKA 4OQDA 5K8LA 1WQ1R 3WO0A 3C4JA 1UBMS 4O59O 5AUNB 1P0FA 1XN4A 3N2LA 4X8HA 5D6NA 1RXWA 3VSCA 4D96A 3SE0A 1ETUA 2CCKA 3ZCQA 2BFFA 4YJKA 4EAAA 1UOOA 5JCOC 2NU6B 3CRRA 3JRWA 1AKWA 1GSOA 1T5TA 2GM4A 5A05A 2QZJA 3L41A 2W8ZA 1QRRA 2AN3A 2JLQA 3EQ2A 4CR7A 3AR5A 4DSOA 5GADl 4DV7B 2BGKA 2GPAA 2RKOA 3A05A 3A1FA 1QS0A 3EPRA 4LBZA 2VJAA 1F6DA 1UODA 2PJZA 4UUAA 3EIOA 5A3RA 2PRIA 3V1TC 3UATA 1YQEA 3TZLA 5FUYA 1K92A 4DG5A 5JFTA 1K3UB 3GZ4A 2XUOA 4LZJA 1PO7A 5EN4A 1NJ2A 1SG6A 4NJEA 1NM5A 3BTOA 3CGGA 4LJRA 2P9BA 4MQ5A 2PQ0A 1NBIA 3TLJA 1CJBA 1EG2A 2IP2A 1OLOA 1X7ZA 4TL7A 3HKBB 5C8YF 1NLZA 2W93A 2YVAA 3ED5A 5T67A 3IV9A 2MYUA 3JS5A 4UNRA 1Z5WA 3I62A 4E09A 1VSBA 1B6SA 5BNIA 1BYUA 1YI8A 5JNTA 1BCRB 1EVLA 2XV1A 3JD4A 2REBA 2AR7A 4W5JA 2JZCA 3KQMA 3JASB 1A5AB 5I01A 3TW6A 3U4GA 2BZ1A 1JHQA 2WJAA 2GS9A 4C4OA 4BNWA 1KORA 2I3GA 1IATA 3LP6A 5DNWA 5IHXA 1I7DA 3C5EA 4XLZA 4NE9A 2J6HA 3HDYA 1N34B 3KV3O 3QU4A 3RAPR 1NC3A 2ZYGA 4YYZA 5BP7A 1NLFA 1BXKA 3QTTA 1ZIOA 5FI1B 1N6LA 2C77A 2PRSA 3NUQA 4OMUA 5DGHA 3OF2A 3EXIA 2BF7A 3IJRA 2WVHA 3NUGA 3QKSA 5DM70 1N32B 2IHYA 2WIKA 3T1OA 1SKBA 1OX4B 1D9ZA 1Q92A 1R12A 3H5TA 3NEJA 3FNHA 2PZBA 2QZZA 3AF6A 2HRRA 2C31A 1A97A 5LMCA 5D1HA 10MHA 4UTRA 3UK7A 4I50B 4LY6A 3LCJA 4B4KA 2N9UA 3LL4A 4UCWA 2HB6A 1RXCA 5J4LA 3BMNB 3BN3A 4LKOA 3CZ5A 4NNOA 5BW6B 1CQZA 2Y77A 3FPBA 1CF2O 1JSRA 1T4MA 2RI1A 2C04A 3OG9A 4XM2A 1EIWA 4CN8A 4RYDA 1MX5A 3S3TA 4JROA 2ZS9A 3MJSA 4NAHA 4L8FA 4Y6PA 1I5RA 1UZNA 2YXBA 4JH0A 4IIUA 3TQIA 1KS9A 2GNOA 1HK7A 1ZZGA 2SHKA 4KXUA 1JEQA 1DTEA 1JGTA 4TLCA 3PGLA 3AC0A 2UV8A 1N0IA 5CX1A 5TARA 2JLXA 3KFLA 3UWPA 1PEKE 4B5KA 2IXDA 1RRFA 2DH5A 2HMTA 2XD4A 4II7A 5LZ2A 1VL6A 1V5WA 3LYUA 1YI1A 1KI4A 4HJRA 4NBTA 4C4XA 3IIJA 3PKIA 3L8YA 2W6ZA 1E5QA 3AOGA 3H11B 5ESRA 3ABQB 2A1IA 4AJIA 1YU6A 1NI5A 2MSLA 3RADC 4MUXA 4K7JA 3VYWA 2HGZA 3AF0A 4ASUA 1U9YA 2A30A 5ADVA 4BFLA 4NZPA 2G8LA 2D8AA 3OZSA 1R16A 2PMFA 3IV6A 4WKBA 4JVMA 4RQUA 5AJXA 3AKZA 4EGJA 4EKYA 3PHBE 5HFJA 4CNQA 3T7KA 4DQDA 4JBLA 2W42A 3LRPA 1HRKA 1VLJA 2E87A 4QULA 4D8VA 2CBGA 1NW4A 5DYIA 3G0BA 5TR9A 4BJ1A 4DS3A 4JLSA 2DBVO 4TWRA 1SZPA 2G9NA 3L4BA 1IUNA 1U3GA 2OCAA 1CJVC 3HZHA 3MILA 3P9SA 4G07A 4JITA 5TV2A 5ALLA 5JV5A 4UD2A 4PIVA 4BNDB 3OMXA 4UU8A 1Z2CA 2ISCA 4I9GA 2PE5A 2CNNA 4LQDA 4B5LA 3Q3VA 1Z4OA 2AMJA 2AI3A 1ODCA 2GK3A 3U0BA 5HIJA 3R8XA 1RXIA 3U6BA 3MG9A 4XDHA 1I80A 4M22A 4PTZA 5ERXA 1FJ2A 1L5VA 3PHHA 3QBDA 4PZAA 1PGJA 3EVCA 4RKEA 3FOCA 3WYFA 3N7UA 3C6BA 1CFZA 4U7FA 2W4QA 4XIFA 4CQLB 3N28A 2ECQA 4NR0A 2IQ5A 1D2EA 1EEXB 2R97A 2CK3D 5EZYF 1VLZA 3GLQA 2SBTA 2EZ8A 2QI9F 2W2NA 3OJOA 4FB5A 4N39A 5K6AC 1OFUA 3F6PA 4DTIA 3FVRA 4EEKA 4U2CA 4HDAA 3K72B 3S1LA 3R5FA 4N5HX 1OXTA 2C2OA 2F8LA 4MUMA 3KTAA 1SU8A 4EKNB 4WJZA 5JD5A 5EP3A 3H86A 4IDGA 1X7WB 5KNCH 1GAEO 1JG7A 1F14A 1ZUIA 3T15A 4DR2B 4JLVA 2HCTA 3V8VA 2DSTA 3SE7A 3ZH2A 5CBKA 4JSYA 4NJMA 1ESCA 4EPWA 5GGYA 4WADA 2BFEA 4C0QC 1U4NA 4DA6A 1HKHA 1MA3A 4I5FA 1RZ3A 4EA8A 4Q3DA 1RE0A 1JB1A 1YUMA 4P3OA 4HFJA 3SSNA 2VRCD 1CERA 1JKFA 1ECPA 1M8KA 4QPPA 1H4TA 4UHKA 2HLHA 2Z8ZA 1K0UA 1VZ2A 2FZKA 3I9JA 5E2BA 5EJGA 4AY3A 3P32A 4DRXA 4RD3A 1YBMA 4MJXA 3AUSA 5JC1A 4M9XA 2XQFA 3OWXA 1GV0A 1HRDA 1KI6A 1ADJA 1OKKD 4HL6A 4Y30A 3TTSA 3WLOA 4A10A 1K5DA 6AT1A 2P2GA 1EYZA 1HYEA 1ZITA 3T5TA 1FP4A 1LJ8A 1NJ5A 3GJRA 4XXHA 4OHPA 1CYDA 1VSTA 3DUFB 4FHDA 5JDIA 1CDZA 4G1FA 4DZTA 4NMMA 2H1SA 2EJUA 1M2VB 4EITA 5DEOA 2HCRA 3NM6B 5ALDA 3PEEA 2J0VA 3QE4A 5JJ5A 1X77A 1LV7A 3IUYA 2AQIA 2QJRA 2RH5A 4XLTA 1F8YA 1NXWA 1NW9B 4LTDA 3OEYA 3PLRA 1MB2A 2C9YA 2EX0A 3K8QA 4H4DA 3PQ2A 3QENA 4TN5A 2VPXA 2J0SA 2WDPA 1V5FA 4ETIA 1RM3A 1Y8QA 3I9NA 3JXEA 1F7VA 2HQSA 5FF9A 3ZHSA 3JQRA 3VR4A 4JYZA 4M53A 1U02A 1HYBA 1PD0A 2B1RA 2CL5A 3QLJA 2QVYX 4N7RA 3JPWA 3AR6A 1I10A 1I1QB 1NVKA 3ZE9A 1PZMA 4L8WB 4HDRB 4DMFA 2CXXA 4UOQA 4HUQA 2GHRA 4X7MA 3VYVA 4TXNA 4PBSA 1LLUA 2YZKA 3MLEA 4MVJP 3DHVA 1N92A 4L27A 1XPOA 4AP9A 2VP6A 1XTRA 1H93A 4L4ZA 5TRTA 3T94A 2LDBA 3GAZA 2ZRHA 3UJBA 3HNRA 4HAOA 3EGVA 2IXFA 5KNDH 1G98A 2J3LA 5EMLA 2HJVA 3HXLA 2NTYC 2ZJ2A 2FB9A 2BFEB 4LIPD 3VH4A 3NJ8A 1SA0A 4FBMA 5TVGA 4GKAA 3NEYA 3O91A 4B2IA 2JIZA 4DUGA 3RWOA 2JLYA 4EMUA 5FCDA 2AJLI 1T1IA 4NI5A 3D0RA 3R3UA 1B3BA 3G02A 1JG6A 3NOOA 1UFRA 3KSAC 4XVUA 3N6XA 3SBDA 2V03A 5ALNA 4WOBA 1LVGA 1RPAA 1R4MA 1W8IA 3ONWA 3I2YX 5A5DA 4DC0A 1VBMA 3D8NA 5EAIA 5A2GA 1RDFA 4J0GA 3DYBA 4KR6A 2JPDA 1G17A 5JJBA 3UJCA 3D6AA 1A77A 3AB8A 4U9IS 3I8SA 4GLBA 1L9KA 3DD5A 1A7JA 2IYPA 1VB5A 2OD9A 1HFJA 3MF4A 4YV7A 4RD4A 3AUKA 3JYHA 4YCJA 3B3AA 3TX2A 3ZXXA 3ZWBA 2Y0DA 1YVUA 5ES3A 4ZQEA 4RVHA 3A2MA 2YWDA 5AVOA 1GP2A 3CINA 3F74A 4GVLA 5B6PA 3IIKA 4J0JA 2CNKA 1ZGGA 1X9GA 4ZU1X 5KO2A 1P80A 1YAHA 2ZE8A 4RDCA 1KJYA 4RNCA 1P9LA 1CIPA 3AKEA 3I45A 2VCEA 3UAOA 3WLRA 3ZVLA 3VR6D 4BNVA 5KSWB 2R8OA 4R0MA 1O9HA 4U7JA 5CVCA 1NV8A 1JVBA 1Y4ZA 1N5DA 5T8KA 2NYUA 3TDMA 1CF9A 4AP5A 4Y6LA 1UT8A 4JEIA 4WL0A 4UFOA 3S7TA 2D0PB 4PZZA 3TZKA 1ARZA 2XTMA 5A0FA 3CLRD 1YO6A 2O2CA 1R9MA 1VCIA 5JYDA 2GF2A 3IURA 3HM9A 1JKJA 1SXJB 3GT3A 5DTJA 1W4CA 4GBED 4ZOLB 3UXMA 4FDVA 3BXHA 1WW8A 3A6JA 5AKZA 1GPDG 3IOYA 4G3XA 4I9NA 4QTXA 4Q24A 3HYCA 3R3VA 3HLYA 1Z75A 3TLGA 4MTLA 2Q9UA 3U7RA 3MHTA 1EWKA 4DIOA 3N70A 4IF6A 4DV2B 4A2QA 1ODKA 4M7PA 2Q5LA 4M7WA 2X2FA 1LWNA 2YVKA 3RSHA 2VT6A 3FHOA 4X0EA 4JEUA 2AVNA 5DASA 3NT2A 3R0VA 1SVSA 4OHYA 4G5FA 2VZ0A 3G2QA 4PLZA 5CX1B 3T4PA 1U2QA 1UBRS 2QTLA 2RONA 3PI6A 3WL8A 3ZHBA 1SUWA 4TKVB 3TLCA 1J5PA 2DQ4A 5IKOA 5KVCA 2Q5EA 2QLTA 1N2GA 3DXXA 3LC2O 1YC2A 2I4LA 1UCFA 3OPYB 5E9AA 5LOVF 4XKJA 2RH4A 3LBFA 3ITNA 3BWYA 1KBQA 3AFIA 2BOVA 1SR8A 1TU3A 2ZIAA 1DDGA 3CH7A 3INNA 2GH1A 1GRCA 3WK7A 1ATIA 2Q2WA 5JH7A 1WM1A 2VC2B 3NMUF 5EQJB 4RK7A 5KU1A 1FTWA 2O2DA 4R1PA 1XRLA 3BZWA 3VHLB 3WNBA 3CXRA 1BIFA 3VSDA 1W76A 2XY4A 4NEQA 5KOHB 4PC1A 3L7DA 4MV0A 3V8QA 2VJDA 3IPLA 1NF3A 3Q8KA 4OM8A 1KBOA 4DMUB 4LJ5A 3LDUA 4YH1A 3HDVA 4MVJD 2AV6A 4BZPA 1XMOB 4GG1A 5FPHA 1Y4SA 3O2QB 2ZYDA 4XGIA 5IRCD 3M6LA 4RHCA 4MIYA 3SGLA 3IEUA 4Y9SA 4F2GA 4AJHA 2FMXA 2FMUA 1H8HA 4NCIA 2WK1A 3TOVA 1XA3A 3OT1B 4JLAA 1P4RA 4GGMX 3UPUA 4LZWA 1PR1A 4Y6QA 1JFRA 1U0SY 2I1WA 2IDKA 3PYXA 4H6XA 3EBLA 3V6MA 2YJ6A 1U9IA 4TLEA 5DHFA 3WLTA 3W34A 4Z7QB 2BKEA 2GLUA 3CH6A 2OGWA 4ZHQA 1TCCA 2VHXA 3CSUA 2MR6A 2EF1A 4REQB 1XTTA 3OZIA 4L08A 3HVHA 1X7ZB 1XZCA 4CPDA 1Q6ZA 4BC0A 1C4XA 1PT7A 3KOYA 4JHXA 3LH5A 1BEEA 1JU4A 1AQYA 1P3Y1 4PGMA 3WY9A 1FS5A 1GZ3A 1PF7E 2I7TA 1SXJD 3CKYA 4KXYA 4OQYA 1KK2A 4X93A 4EL0A 2VLIA 4OVKA 1E61A 3MD0A 3LJKA 5BVGB 4X1KA 2VYNA 4FT4A 5KUTA 1MKYA 3W6OA 1M2OA 2WPDA 4UXHA 1Y3FE 5IKPA 5HQ3A 2Z5LA 2GPJA 3FGOA 2MYNA 4MS4B 1QIGA 4ZRMA 1WNTA 1PL0A 4P6VF 4IDOA 2HIHA 3KJNA 1Z06A 3M89A 4PVDA 1N75A 3NBAA 1PSZA 4OBEA 4Z7NB 1L2TA 2XVYA 5E1BA 3ED1A 1LSUA 4QNMA 2BEKA 1D6NA 3CO5A 4WNYA 3E5NA 1VYHA 5DYNA 5KSPA 4F6CA 5U1PA 2HN9A 4MWBA 2FPGA 4B9EA 2ZUEA 4YI3A 3H04A 3TZQA 2GNAA 3KL4A 4CKXA 1M54A 3K09C 4BMPB 3O8CA 2CXUA 1QSGA 4XJSA 3ZXSA 2AI2A 2GXUA 5KTPA 2BM9A 5FOTA 1V7PC 4QYIA 1WOYA 3HB5X 4Y18A 2NX2A 4BRSA 1HSZA 3L0OA 3RR2A 5HF6A 1YJ5A 4AXXA 3F47A 4MVYA 4BTEA 2BDEA 1G8AA 3PFBA 5D3QA 1RJ9B 4OB6A 4DE5A 2IYUA 2ZRLA 2D0OB 5DNCA 2GWHA 2FZCA 2VO1A 3ANXA 3ABSB 5ALHA 1VXRA 1UMCA 3LPDA 1AGPA 2YYZA 4HADA 3IS3A 5LL6P 3GLUA 1G8YA 2XTJA 5H3CA 1CQPA 4S35A 3DNMA 1PS9A 4GXTA 4DY4A 2PLAA 3ASYA 1QPBA 3DBHA 3RARA 2QMOA 2WF9A 3A28A 3MWYW 4FYPA 4YMHA 1NZFA 3EMVA 5JNVA 5TQJA 4XCVA 2GXAA 4C7OA 1I2AA 4L9SA 1MPXA 1CUBA 4BZQA 1EG7A 3GLKA 3TNFA 3CH4B 3OLQA 1JDNA 4D9HA 1M1XB 2VJMA 2XUFA 4R98A 3OCXA 4DR3B 5E95A 2JGMA 3AINA 1QFYA 1REQA 2HC9A 1OAOC 3RJ9A 3FJYA 4MAFA 1JH8A 1U2RA 2OV8A 3FDZB 1Q50A 2GPBA 3CLKA 2IYVA 3C5HA 4WN9A 5DSZA 5L6MB 2QJFA 2ZETA 3VPFA 4RFLA 3IQXA 5FWAA 4LFAB 5JO0A 4JENA 5HCIA 3TTXA 3IIIA 2IQIA 4IVRA 1QANA 3VR3A 2BZSA 1FX0B 4UATA 1YVEI 2JIPA 2WYUA 2EU8A 2PKWA 3ZDDA 2B34A 3ACBA 3AOEC 3IOCA 3OUTA 1Q7GA 5LZ7A 1VA4A 2J41A 2ANCA 1ZGZA 3KE8A 3QPBA 4G41A 3ETDA 1X38A 4ZQIA 1SUIA 3PUXA 1Z5GA 4N9QA 5CCXA 3SMQA 1OY1A 1WMBA 1YRAA 3WOHA 4HAUA 2QX6A 3F9RA 1RFGE 1ZH8A 1Y80A 4DLTA 3MGBA 5EVCA 2WF5A 3Q3GE 4WXYB 1IHXA 2I4IA 2GN6A 2PUTA 2D1RA 3CNHA 1LQUA 2O2GA 3PEFA 3QVGA 4F5DA 3KEGA 3KYBA 1V71A 3P2JA 3SHOA 2QENA 5GJWC 3QYFA 3T7EA 1UXGA 1MPTA 1XCBA 2H29A 2WC1A 2Z9BA 1JU3A 1V48A 2JEYA 3FNEA 1MGPA 1NVVQ 3ELWA 3NWPA 1QLWA 5GM1A 2GYVA 3ZU3A 4CKBB 4ER5A 4YECA 4DV1B 4J75A 4LC1A 3R7WA 2FQXA 2Z98A 1W0KA 5JASA 1SCAA 4G1BA 2OBLA 4NOKA 2GYUA 1XK6A 1VCNA 5BSWA 3EPKA 3JZFA 4B2PA 1Z17A 3KJGA 5C1PA 4NFLA 3BTUA 2R6GA 1FXUA 3MMXA 3C7CB 4YHHB 4RF3A 3K8OE 4JA0A 4QGHA 5LZ8A 1OVMA 3ZD8A 4AT1A 4TMZA 2VRCA 2HYDA 3E5HA 4IUCS 4GEGA 5TJ9A 2O1SA 1L0BA 2RAPA 5HBGA 1SC1A 5A4DA 1GILA 5EUMA 1L4MA 4WKCA 2QW0X 3IAUA 5CYGA 1VRVA 3OF5A 2ZJ5A 3IT1A 1GNLA 1LV8A 1G2QA 3OD1A 2XWQA 4EUHA 1TRHA 2BUAA 4R84A 4Z6KA 5HDBB 1MENA 2PGIA 3I39X 3HRHA 3QX9A 2QRQA 2W4MA 3GQBA 2ODAA 3BVPA 2CZQA 4MYSA 4YCAA 4QDOA 2XE8A 1GY8A 5FYQA 2CNWD 4QUAA 1FRQA 5KAPA 2CD7A 4WLFA 2OD7A 1D5CA 2W2KB 3AHGA 2PNJA 1HEYA 4YJ3B 5P8WA 3HV0A 3WGGA 3ORSA 2Q3FA 4X85A 3QE2A 4YO7A 1LTHR 1P75A 1X74A 2C97A 1M3SA 1AZWA 4BZZA 2FEAA 2QYHA 4LBYA 4NBWA 4NEGA 4YACA 4DRYA 5LOVA 2HSWA 1NN3A 2ZTLA 3FRHA 4LV6A 4PSKA 5DULA 3WTCA 1QTIA 2EFDB 2AX4A 1H66A 4OOEA 3GWZA 1SEPA 4HTAA 4IFIA 4M60A 3CJTA 1QIHA 4BVJA 5JH7F 3IE1A 4OUDB 3ORQA 1P2BA 3A1VA 4J1TA 4JA2A 1P62B 1SFRA 2IIQA 1DAPA 2CHEA 2KM1A 2ZOSA 1TEZA 4G0PA 5EJMA 4K8RB 3EVEA 4XD7D 4J0IA 1SWWA 4KMRA 1JVNA 1DMSA 4B32A 5LWQA 1U04A 3FM9A 4QX6A 2FG5A 2AK2A 2NTNA 5LNK1 4ARAA 1I1OA 5CA0A 5JYBA 3M1LA 3PUVA 4RFSB 3WE7A 1SKMA 1E4OA 2JCXA 3SZMA 2YJ5A 4N5DA 1X8KA 2P6PA 4I8XA 3V3KA 4TRRA 3WYNA 2YV2A 2HU8A 4L9RA 3VJLA 4EAQA 2DHDA 4XCXA 1CDEA 2M1ZA 2H8GA 4Z54A 3OZEA 5H9WA 4OH1A 3U4IA 5CXQA 2AZXA 1JTVA 1VPTA 4Y2TA 1W0JD 2QGNA 3ICPA 3NCHA 3RSSA 1SC3A 3SBXA 3U7JA 1GZ6A 1C1XA 1VE5A 3ISTA 1V6SA 2D5BA 2GD0A 3U7EB 1O58A 1KMQA 4N54A 3UOWA 4HUJA 3COWA 3LLVA 4TOIA 3ZQ6A 4BVGA 2VAMA 1RAHA 1MQAA 3FCYA 3OJWA 3ZNPA 2ACEA 2JI9A 3UC5A 1GAWA 1RI2A 1U0JA 5K0EA 2XYHA 3AESA 1KNQA 3LX6A 3MMPA 4UU0A 1Z3IX 4FIZA 2PTHA 4TRJA 5AJVB 3AUUA 4B3DA 4E15A 3IVCA 3AKCA 3PB3A 4PYNA 1KEUA 2FFBA 1Z6XA 1Q17A 4AKTA 5EJ4A 2WYVA 4ZVNA 5GV8A 4Q4HA 4UAVA 2VYND 3E9NA 4FWIB 1XPRA 1ZXBA 2W6MA 2XGJA 3X43A 4R8MA 2CLKB 3QEMB 2VATA 2HHJA 2QM7A 4X24A 1D2GA 3B12A 3DYVA 3P9CA 3SEFA 5KQLA 3ZCUA 1MRZA 3TQHA 4RJIA 1OYWA 2VTKA 4E5YA 4CM4A 4CT5A 1Y6GA 4BFXA 3AM5A 1TQ2A 1ZVQA 3CUVA 3ITDA 3H6KA 3KPUA 2C54A 4NS1A 3LKDA 2JA2A 1YUNA 4KI7A 4F97A 5HP4A 4F84A 1XP5A 3WKEA 2CYAA 4DREA 2A1UA 1T1SA 1P29A 2GZHA 1N6NA 1UFVA 1YHZA 3LBAA 4KGZA 4WCFC 3OTWA 1RI5A 4KYUA 4RM2A 2R8PA 4DQVA 1CB7A 5LU9A 3WZLA 2VZLA 1XX6A 4L0MA 3UGKA 2BGMA 2V9PA 5KZMB 3KPYA 3VZRA 2FXIA 4G5SA 2PAAA 3RS5A 4ADSG 1A76A 4EDFA 3CZ4A 2QAGB 4IV5A 4PHTA 1F06A 3KYDB 4QEDA 2K5UA 1ISFA 4LS3A 4CM7A 1ZJ6A 2YV5A 5FTNA 4IQ8A 1AS2A 1JYSA 1Z5VA 1PWEA 4IP0A 4CMAA 2BDUA 2JS7A 5KVVA 1URPA 1GYQA 1QB8A 1N0UA 4JQZA 5C80A 1QH0A 4M6WB 3QWFA 2NZYA 3CUUA 4D9EA 1B2LA 3EVGA 4M88A 3TCKA 2UUCB 5H59A 1X3LA 1AK1A 4QT0A 5JBNA 4MUNA 3SXPA 1KQFA 2IHKA 1UPBA 4EHLA 1E2EA 4JVNA 3N2EA 2EXXA 3O2SB 3PGVA 3PTZA 2JGNA 4YMUA 8ADHA 4YLGA 1QGUA 1TADA 2OB2A 1N7IA 1YL6A 3Q9UA 3VO1A 5REQA 1QR2A 1FEZA 1BD3A 1IZ0A 2H63A 2GUWA 1IM8A 3DBVO 4D0NA 1ZJYA 1PSDA 3DKIA 4OPMA 4C0XA 4OV6B 4K9QA 3CN7A 4JODA 5FOSA 2JVJA 1TJPB 4FU0A 1NI3A 3FHLA 3CZMA 1TDJA 4PU0A 5CLGA 1DC8A 1SBQA 1NVWQ 1EFVA 4KG7A 4EB3A 1G7SA 5CITA 2XNDA 5LP6C 3OZVA 3I6BA 1YI0A 4GZ5A 4ZARA 4R7TA 3U39A 1NFQA 1R2QA 3ODPA 3TECE 4LMBA 3P1JA 1M2OB 2EBUA 3PC8C 2GWRA 1DT5A 2C3PA 3QFRA 4OG2A 2BKLA 3QX8A 4FOSA 5ALSA 1E1RD 4O4LF 3RYIB 1U2DC 3NHYA 5FRDA 1HE3A 1KDPA 2VNSA 4K0RA 1TGYA 4HNRA 4BV2A 4GKVA 3QEMA 3NTUA 3MCTA 1CUDA 2X76A 5E38A 1J6UA 1HTBA 4ZAZA 4CM8B 5KKAA 2XDWA 1Z6YA 2A0YA 2YWFA 3EXEB 3JWJA 5DHQA 3PVCA 3ZQ4A 3ZVKA 4E88A 3C0KA 1GUFA 1KQNA 5LIPA 2OM2A 1XZIA 2FMFA 5TE9A 5LP6A 1H3EA 5I4KA 3B1YA 2YJ3A 3G7NA 3OZUA 3UWOA 1YVRA 3AESB 4LVNA 3ZHTA 4IHJF 4INJA 3C7KA 4E4YA 1LQTA 2FNAA 3PCRB 1C9DB 2OG1A 5AQ1A 1ZGHA 5JHGB 2C2YA 2HXGA 2OM6A 5HF5A 5I3CA 2ZBPA 1I51A 1VIVA 3ROMA 4Q03A 1LJUA 1XRMA 1T9DA 1YDFA 4NOJA 1CEYA 2CE2X 2OCGA 3U3KA 5BNFA 4ES6A 5F9FA 3G7SA 1IBCA 1XTUA 4HYEA 1TYBE 4MMYB 1Z15A 2PL1A 3H1GA 3QEOA 1E6KA 4HZGA 2HRZA 2BEWA 1DX9A 1LWOA 2YJTD 3GEGA 4RE5A 1PJ2A 3JAWA 1K6IA 5G2OA 4GYJA 3D3EA 1T4CB 3GHYA 3SS8A 4K2HA 2O5VA 4DTCA 3GRYA 4Q5IA 3B3JA 1L8LA 3RH0A 5JH7B 1LVUA 3J7AC 4IZHA 4ERXA 3G7UA 3TEFA 2PQMA 1Y3HA 1ISSA 3FMFA 5JO9A 1MDBA 4GBGA 4MQFA 2EYUA 4RDHA 1JAHA 1U3FA 3PXBA 1YGPA 4XSVA 5DYGA 4DLVA 1PNQA 2R1VA 2NVBA 1U3VA 3B60A 3G13A 3GFBA 3OIGA 4JMLA 4WGGA 3ZUPA 4C0JA 1DEAA 3CJQA 3NTQA 1RKQA 3SAJA 1FU7A 4YJ3F 3D0OA 4MLPA 5HFNA 3ND5A 2KHZA 4D6XA 4Z49A 3QLEA 2QL6A 2O54A 3UYKA 3IKMB 1T0PA 1OA0A 5LOVB 4L5YA 4GC9A 1GZ7A 5EJEA 5JAZA 1GUBA 1MO6A 3UMMA 2X1HA 5SZJA 5K05A 1X7GA 4H59A 5K45A 1HWYA 3HA5A 4OXRA 4H0FA 4NJOA 2XZDA 4CEIB 3FOAA 3L6DA 4G65A 4H2DA 4QSMA 3H5VA 9LDTA 1AKMA 3S68A 3VRHA 3U1VA 3IQIX 4LBWA 5B1DA 1K63A 4ZO6A 1LBTA 1QJCA 1CZNA 4C0HA 1YACA 3BCHA 3E70C 1L5NA 2P4EA 3NVMB 2C7GA 1TVKB 1QFMA 2GN9A 5CA0F 2NMVA 1F8UA 1YKGA 2ZJZA 5K0CA 5H4HA 4TTJA 2PX3A 1KPGA 3EEFA 5T8KC 5TY0A 1C30B 2J5XA 3I76A 4H6PA 1WMAA 1LD3A 1P4JA 1RLMA 4JJZA 3PLAE 3C74A 4HQ6A 1AJEA 2PD6A 1K9VF 3MWDB 3NWBA 1G19A 3QUBA 4L74A 3T7JA 1IJFA 2GLXA 2O0HA 3CFYA 4P3PA 1EBFA 3ZEAA 2LKCA 2QTVB 3GV0A 1HYGA 3EARA 4R1TA 3S81A 4OB8A 1G4HA 4TSRA 3HDQA 4GOOD 4FMBB 1IQPA 4KI0A 2SNIE 1AU9A 1FZQA 1XZNA 2WNIA 2Y1FA 3VU3A 1LNZA 4XW2A 3LNCA 5ALPA 2BFPA 1KZ7B 2EZ9A 2F59A 3CZQA 5EMHA 2ERCA 3AKDA 2HHAA 1R0BA 3RRZA 1OAAA 1XSEA 3QGMA 2AHOA 5A4KA 3DL4A 3RRBA 3FDFA 3WGNA 3ZNQA 1FLVA 1IRXA 1CXZA 1K1EA 2JDIA 4A8PA 4KE7A 4QAJA 5JPIA 5B7PA 2W2LD 5CH3A 5AFSA 2DWUA 1LCIA 4BMVA 4LQCA 4O4JA 2VUUA 5E6SA 1MN6A 2ZCUA 3FTDA 4Q3LA 4QBKA 5FI5A 4DN6A 2PUWA 5JZBA 1ULBA 1KMNA 4C4RA 1P1JA 1OXXK 3T7TA 3TW0A 3O82A 3L8DA 3DL2A 1XZHA 5JAIA 1YR2A 5F7OA 1QUEA 1UWVA 2CNOA 1SBCA 4TTVA 4KSBA 4CLRA 4FNAA 1N6OA 1NNLA 3N87A 4KQIA 1OYOA 1IB6A 4P92A 2VTDA 5K01A 3K6RA 1GZSA 5TQ0A 4TWJA 2M6KA 1ZWLA 2BKUA 3GZJA 3WS7A 2CFSA 2FUNB 2AG1A 3JVIA 2YYAA 4TMFA 1WQ4A 3H99A 5FULA 1F4PA 3E4CA 3NALA 4Q7MB 1JJAA 3UH0A 3W2FA 5FTLA 2C84A 4E5NA 2KWIA 3B1ZA 3B89A 3PUZA 1NBWB 1Q7BA 1NVBA 1XU4A 1Y98A 1U2PA 1NJ8A 2NG1A 3JATA 2O3JA 4PTYA 4IJ6A 5ALIA 3VSBA 1ADFA 2I7VA 2FPPA 1BFUA 5BW8A 2BR5A 4EY3A 1N5RA 4BLVA 3L43A 2XT9A 4C88A 1NR1A 4DADA 2R25B 6ABPA 4Q1VA 5HR5A 1BU5A 1C7IA 1DEKA 3KG2A 3REFA 1P9RA 1HM5A 2OFOA 4KFSA 1A9SA 1MT0A 4EO4A 3BJMA 4Z9YA 2HO5A 3ZBTA 5CHYA 1ZGCA 3JRNA 4UBLA 1BROA 1MX1A 5FHQA 3T9CA 5L3VA 1SPXA 3H2JA 4IOMA 5IHPA 4B33A 4KWCA 4C7OB 3CF4G 2O1EA 3GLHB 2G80A 5LBUA 2JFXA 3VZBA 3WLAA 3PUWA 5B58C 1EVQA 2IE0A 3RBXA 1WSBA 4GLJA 5JS2A 3FFAA 3I0MA 3AILA 3MJFA 4L8YA 3ML1A 4JWKA 1Q0QA 4JP3A 2NVOA 1W5AA 5BN4B 2H57A 4HTFB 2CMFA 5CB0A 2WTXA <