4ZI5A

Crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
239
structure length
239
Chain Sequence
GAMTARKVDYTDGATRCIGEFHWDEGKSGPRPGVVVFPEAFGLNDHAKERARRLADLGFAALAADMHGDAQVFDAASLSSTIQGYYGDRAHWRRRAQAALDALTAQPEVDGSKVAAIGFCFGGATCLELARTGAPLTAIVTFHGGLLPEMAGDAGRIQSSVLVCHGADDPLVQDETMKAVMDEFRRDKVDWQVLYLGNAVHSFTDPLAGSHGIPGLAYDATAEARSWTAMCNLFSELFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ultrahigh-throughput discovery of promiscuous enzymes by picodroplet functional metagenomics.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
molecule keywords P91
total genus 81
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2015-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zi5A00
2QM0A 3W2TA 2WUGA 4FDMA 1N1MA 3WQHA 5KBYA 2HRRA 3BF8A 3X3HA 4BATA 4PQEA 1A8UA 3C8DA 4KAJA 2EEPA 1OXMA 2G63A 3WK6A 2I3DA 4HVTA 5EIHA 2P8SA 1KU0A 3DDUA 3QVMA 2HU7A 2FJ0A 4BVJA 5JAUA 5FLKA 3VVLA 2PVSA 1LPMA 5ALPA 4HXGA 3QYJA 1GQRA 3WZMA 5HF5A 4W1PA 3GROA 5AKGA 1CUUA 1GQSA 2HA4A 5IVIA 3K2IA 1DX4A 4MWTA 4FBLA 5CH8A 1L7RA 3BJRA 5AKJA 4Y2PA 2XUDA 5AOCA 1XRMA 4GLBA 1DWPA 2J3DA 1A88A 2WIFA 4LXIA 2QR5A 4KE6A 3W06A 2BUBA 1X2BA 1J06A 1XZAA 3IVMA 2WHQA 2YH2A 2ZYSA 4LYDA 4W9RA 3JYHA 1HL7A 1XRNA 1KEZA 2UZ0A 4HRYA 3STUA 4F0JA 5AKYA 5CW2A 1GT6A 1TAHA 3WWDA 1IZ7A 1CVLA 5ALVA 2JGIA 3AINA 4WY5A 5T4FA 1WM1A 2Q0XA 1E8MA 3ZPXA 1QIIA 1QIGA 2DHCA 1VA4A 1ETHA 3O4IA 3WK8A 2RHTA 4BB0A 4ETWA 1UK6A 5AKHA 3I2FA 1U4NA 2JIDA 2HHAA 4DNPA 1XRQA 5ALQA 1SOMA 1AKNA 2IX9A 1UKBA 1THTA 2ES4A 4DGQA 3FBWA 1EK1A 4TGLA 4CCWA 4KEAA 1MX9A 2WIGA 4OB6A 2V98A 2OXEA 3E3AA 4IH9A 1QLWA 2VATA 4BRZA 4Y2YA 2XMCA 2RIPA 1N5RA 3G0DA 2CJPA 1WCYA 1CUEA 1VJ5A 4ARAA 1IVYA 2PU5A 5AK4A 4MQLA 3GUUA 3FOBA 4UBOA 4B80A 2XUHA 2O2GA 1MX1A 3V9AA 2I78A 3VJMA 4C4XA 1H2XA 1FFBA 4CIAA 4J0DA 1ODCA 4UHHA 3FLBA 2HU5A 2O2HA 4I19A 4KAAA 2J4CA 5JAPA 3BF7A 1BN7A 3OOSA 1MTZA 4ZREA 4NS4A 1QO7A 4BCDA 5A2GA 3PDCA 5CH5A 2VSQA 2X8BA 1S8OA 1IUNA 5JYCA 4CI9A 5I8PA 2OGSA 1MX5A 3A2NA 5DYYA 3I6YA 5AO9A 5HQ3B 5HK8A 3W9UA 1BCRA 1EINA 3C8HA 4B82A 4B0PA 4L0CA 1XZFA 1XZGA 3FYUB 2V96A 1J1IA 4C89A 3QPAA 4KE7A 1DU4A 1LZLA 1QFSA 4HS9A 5C8VA 3BDVA 1P0QA 5SYMA 5AI4A 5EHNA 4HZGA 3E0XA 3VVMA 3KDAA 3D2AA 5DWDA 2ZSIA 4UFOA 1E3QA 4OYYA 2AJBA 4LYEA 4A23A 2DSNA 1YCDA 1ZJ5A 3PUHA 2JGKA 1W1IA 1YB7A 3IIIA 5DNUA 4K5QA 3F96A 1T4MA 1BE0A 3D5EA 5YASA 1XQXA 2O2IA 2QVBA 3G02A 5CT5A 3WA6A 5ALDA 1RP1A 5ALMA 1AC5A 3CCCA 4Q82A 2VEOA 3IUNA 4B6GA 3WWCA 1Z68A 4UPDA 3NWOA 4DTCA 1DX6A 2WIKA 4JUIA 3AZOA 3BIWA 4IHAA 2C4HA 5K3AA 4O08A 3G0IA 3TRDA 3AZQA 3WJ2A 2AJLI 2EDCA 1P0PA 4UBKA 3C5VA 4OYLA 1XRRA 2I3ZA 3IUJA 1R88A 3VJLA 2C5FA 3STTA 5K3FA 1Y7HA 3A2MA 4F21A 2OAEA 1UXOA 2Z3ZA 2GZSA 3FSGA 5AK6A 2W22A 4DNQA 4KJXA 1BCSA 3WK4A 3CCBA 5LZ7A 4TPKA 4BAGA 1BU8A 1XZBA 3QPCA 2ZVDA 1A8SA 3LIPA 4GI1A 4G9GA 5EI5A 3H2GA 2XE4A 4Q34A 1MO2A 2C0QA 3OM8A 2Z3WA 2WJ6A 1TCBA 1BRTA 2Y1KA 3KXPA 1B6GA 2JGMA 5ALXA 5LYYA 3PICA 1X70A 2CB9A 4C4ZA 4BC0A 3NOXA 3O9MA 3P2MA 2WQZA 3H18A 1XZLA 5ALJA 3BL8A 3O9VA 4XJVA 4H7KA 2DCMA 2CMFA 3G0BA 2OCLA 1R9NA 1AMNA 5BWCA 1UKCA 4J0JA 1YSCA 4UFNA 1CQWA 2XUAA 1WOMA 1W4LA 3H1BA 4DSAA 2HFJA 3VKFA 5FXMA 3EF3A 5AKLA 1IMJA 3HI4A 1QZ3A 3W05A 2OPHA 2ACKA 2XDWA 3CN9A 1MNQA 4J0KA 3VXKA 1CEXA 1O6FA 5BOVA 1ZGBA 5BV7A 2XQKA 3G7NA 1GXSA 1OCEA 4ARBA 3O95A 3U0VA 4DMHA 5DTJA 1UOOA 2PX6A 2YASA 4DSZA 2WLSA 3C43A 2G5PA 3AJAA 4QWMA 3I2JA 2GYUA 1F0PA 1QGED 2H7YA 4MWSA 5AI5A 4LKOA 2O7RA 4P9NA 4BBZA 1IUOA 1AX9A 4S0XA 1VOTA 1L7AA 4E46A 4PSDA 4FKBA 3AIKA 3PF8A 5CTAA 3H2HA 1GKKA 1CR6A 5LIPA 1USWA 3C6XA 2RGUA 4INZA 4K2AA 3EIOA 4X85A 1QO9A 5CURA 5JD5A 3DQZA 3M83A 4U2CA 2OGZA 2R8BA 5E4TA 2QTBA 4QDXA 3ZLVA 2DFPA 2QXTA 1SCQA 3G9TA 5H3HA 4B0OA 1CLEA 3ESCA 1W6RA 3I28A 2QMQA 3KD2A 3I1YA 4BRSA 3WKDA 2CUTA 3C5WP 4X93A 3ZV7A 2JGLA 3O4HA 4NVRA 1JMKC 5IH7A 4N8DA 4UBIA 3CXUA 1U8EA 4AN1A 2XB6A 1DWQA 2O7VA 4CCYA 1P0MA 1HQDA 4U2BA 5FOQA 1TCAA 3GA7A 5FV4A 4PO3X 2CZQA 4H7FA 1F0NA 3H2IA 2XUPA 4Y2UA 5AI9A 2XUQA 1CUBA 3ESAA 3WWEA 2C7BA 2PBLA 3WI7A 3QITA 1FJ2A 1RYYA 3B3QA 5ALLA 3BJMA 3M82A 3KWJA 1K6EA 1IZ8A 4QA9A 3HEAA 1GPLA 5I9IA 2XMBA 4J0GA 1LPAB 3DYIA 4ITVA 1CUWA 4ROTA 3I2IA 1E8NA 4UBNA 2OLEA 4FLMA 1XRLA 2ZYHA 5JD6A 1ZIYA 4BVLA 4UHCA 2WG0A 5ALKA 3T4UA 4C88A 2RAUA 3PUIA 3BWXA 4XX1A 1EHYA 1HDEA 2WHRA 5FKJA 4X6YA 5AICA 4EHBA 5A7GA 1NU8A 3ESBA 1QIDA 2X76A 5AKXA 5ALHA 1YS2X 1SCKA 1TCCA 1WPRA 2BKLA 5C81A 4OU4A 2OQVA 4J0HA 1LNSA 3ZLTA 1XLUA 5EIAA 4OCZA 3CN7A 2WG2A 5AIAA 3R3VA 1R4ZA 3OC0A 1D07A 1YA4A 3UUFA 5ALRA 1TRHA 2WSLA 1JU4A 4BDSA 1W75A 1QONA 2WU3A 4AXBA 4DLNA 1QJ4A 2H7XA 2XI4A 2NW6A 2QKYA 1OILA 5FRDA 1ZI6A 3BIXA 3R3XA 5CRIA 3M81A 1XZEA 2WG1A 3RLIA 4EBBA 4YK7A 1QOZA 3I2KA 1G5FA 4ZGBA 4Y2RA 3AZPA 4AO7A 3H04A 3W9BA 4MYDA 4H35A 4AMYA 3VDXA 2RI6A 3EQ9A 5ALSA 3R3UA 3QZUA 2BUCA 3TGLA 5DNWA 3WWPA 4FFWA 1ODTC 2PM8A 4BCBA 4FWBA 1E66A 1C7IA 2AJDA 1EK2A 3FCYA 3L1IA 5ISMA 5EIEA 2I03A 3IA2A 4DMKA 2VT6A 2PSJA 3QM1A 5JZ9A 4G4JA 1MT3A 1NU6A 1C7JA 4MJ3A 2Y2VA 5LZ2A 5K3CA 4FTWA 4X92A 1UWCA 4H0CA 2XLCA 4DYHA 4GEGA 2H7CA 4G9EA 5LLSA 4QLOA 3DCNA 2B61A 1DT5A 3C70A 4K6HA 4J3JA 4H18A 5SYNA 1XFDA 1VZ3A 2K2QB 4QWWA 1CUIA 3EQ8A 4U2EA 4XIIA 3V1LA 4BP8A 5JANA 4JH0A 4QNNA 5AIBA 2RONA 4X94A 1I6WA 1MN6A 2E3JA 3V1KA 3QPDA 3WWOA 4KAFA 1LPSA 5D7BA 5JIBA 5T4BA 1HKHA 2WIJA 1BEZA 5DTIA 4WDQA 2XUFA 2B9VA 4E14A 2HRQA 3DYVA 3O4GA 4OB7A 5AOBA 3RKSA 3UMJA 3FLEA 1QIMA 1XZIA 4OD0A 3JW8A 1EDBA 5K3DA 5AOAA 2OCGA 4G4GA 4G8CA 1XKTA 2PUHA 4JEIA 4X71A 2BGRA 1GPKA 1FFCA 2C58A 3R41A 3D4LA 1WPXA 1LPNA 6YASA 5EFZA 4X3CA 2EDAA 2Y6UA 1ORVA 3D3NA 3A2LA 2GYVA 4UHBA 3FSGD 1JFRA 5E2IA 1J2EA 1H2WA 1EDDA 4Y2SA 1F8UA 3O0DA 5EGNA 3ANSA 3D59A 2ZJFA 1ZD5A 3FVTA 1EB9A 3SX4A 1N8SA 1WB5A 1XZDA 5E4JA 1PV1A 3FWHA 1XZMA 1A8QA 3H0CA 1XQYA 2V9ZA 3S8YA 1XROA 1DQZA 1DINA 1N5MA 3N0TA 3Q0TA 1MAAA 4GBGA 1ISPA 3ANTA 4UHFA 5ALYA 3ZI7A 4W1RA 1JKMA 3LS2A 4LXHA 2XQJA 2HA7A 1W52X 3I2HA 5KWJA 4QDOA 2H1IA 2XUKA 4FBMA 2HU8A 1ZIXA 2GBGA 3R40A 2ZJ7A 2D5LA 3AIOA 4DMFA 4QE3A 2QS9A 1MNAA 2C5GA 4C6HA 3R3ZA 3F67A 3DEAA 5AK3A 3L1JA 3I2GA 2BUAA 4FMPA 4FLFA 1ZD3A 1MJ5A 1EXWA 3BDIA 1VA5A 4YPVA 5FUMA 3RK4A 1QTRA 2HA3A 1CUZA 4I4CA 3DOIA 3B12A 3UUEA 1CUCA 4J0CA 2DQYA 4UBMA 4ZI5A 4GDMA 2PSDA 4D9JA 3WKBA 1WHTA 4N5HX 1MPXA 1EB8A 3WL6A 1XLWA 3O4JA 3HZOA 4KE9A 4PSUA 2V97A 4QLAA 4K6KA 1CPYA 4U2DA 4CG2A 5LZ9A 4GWLA 4DNOA 4KACA 2B20A 4F60A 4XWGA 2WHPB 4Q1VA 4H7HA 5CH3A 5IVDA 4HXFB 3AIMA 2WJ3A 1JMYA 2YXPX 2QRUA 2DHDA 4J0IA 5AI8A 4UHEA 4BYMA 4K6GA 2CKMA 2OGTA 1CUXA 4RNCA 4M0FA 2XMDA 1XZJA 4TVKA 1ZD2P 5HF9A 2ECFA 1H2YA 4WJLA 2BFNA 3G9XA 1Q83A 2WKWA 1LZKA 2PU7A 3NUZA 1DTEA 2DR0A 1ACLA 3E4DA 4OB8A 3BXPA 3BE8A 4W1QA 4AX4A 5AM1A 4L3WA 4EY8A 1JT2A 1TK3A 1R1DA 1EX9A 3DJYA 4B81A 5A6VA 5FPPA 2VF2A 3VJKA 3F9CA 3HYSA 3WKAA 5ESRA 2BCEA 1XZHA 1W76A 2GYWA 5CT9A 4PV7A 5AHXA 1FFAA 4G4IA 2QUBA 2HDWA 5JD4A 4MYSA 2FJPA 3WL8A 2PSHA 4BDTA 3ESDA 1UK9A 1ACJA 2PUJA 5AI6A 4N5IX 4X91A 5DYWA 4F5ZA 3V48A 2ROQA 4B9AA 3I6ZA 4Z49A 3H1AA 3G0CA 5IVKA 4DMCA 3IURA 4FFVA 4CIBA 1CUJA 1QIFA 4MXDA 4EY4A 1QIHA 4FNMA 3G0GA 2VJAA 4HTAA 4NZZA 5AK5A 1KU6A 4B7ZA 4KRYA 1VE6A 1LLFA 5FDFA 1JI3A 4P08A 4Y2JA 1XZCA 1UT6A 2XUJA 2OCIA 1CRLA 5HFAA 4HAIA 1YAHA 4FLEA 3HC7A 2QT9A 1UZAA 5JZBA 4BP9A 3FLAA 1UOQA 3G8YA 5EHZA 1E8DA 3PF9A 1UK7A 2DHEA 3WK5A 2HADA 3VISA 3FYTA 4LHEA 2GBIA 2WJ4A 2HA5A 4Q3LA 2WFLB 4ZXFA 2WFLA 5BWBA 1MAHA 1XQWA 2PSFA 2WUFA 5HCUA 3AUKA 4YX9A 1FFDA 1THGA 3C6YA 2XMGA 5HZGA 5D6OA 4JNCA 4Q05A 1R9MA 3OTQA 2XLBA 2XUOA 5C8XA 3HSSA 5ALNA 1JJBA 3WMRA 5K3FB 3RM3A 2VTVA 1CIJA 4FHZA 3C45A 2VQ6A 1SC9A 4G5XA 1FFEA 5ALFA 2AJ8A 5A71A 4RPCA 3WIBA 2OG1A 5JAOA 1Q84A 1CV2A 5JASA 3ILSA 2PL5A 2Z8XA 4Y2XA 3EQ7A 4UUQA 4Y7DA 2ONCA 5A7HA 4XVCA 4M0MA 5JADA 5ALIA 2WTMA 1LPOA 5JATA 5JALA 4PW0A 5C7YA 1K5PA 3DKKA 4BZZA 1LBTA 1HLGA 1K4YA 5ALUA 4FNGA 4GHWA 3H2JA 4BE4A 2FX5A 5CBKA 5IKXA 3DD5A 5CXXA 4PF1A 4DNFA 2Z5GA 4IQ4A 4BTLA 2IITA 3ICWA 4HRXA 1WB6A 3DL4A 1EDEA 1AQLA 3ICVA 1P0IA 4WDRA 3FCXA 1RWQA 4Y9SA 3MVEA 4QDTA 3WKEA 5CT4A 1BN6A 3R3WA 2VA9A 5DJ5A 4UBJA 2PKYX 1ZI9A 1QIKA 2JF0A 3SWWA 1VXRA 2XUIA 1B41A 4X7BA 1Y37A 3KWFA 3U1TA 2PPLA 1YAJA 3HXKA 3STYA 1AURA 4X95A 3G9UA 2HM7A 4B9EA 3FAKA 3GELA 2ZSHA 3FVRA 2HIHA 2WUEA 3EBLA 1BS9A 4GW3A 1GKLA 3WIOA 3A6ZA 4M0EA 4AB1A 1ORWA 4AZ0A 1PFQA 3PI6A 3WYDA 3QBJA 5ALTA 4B83A 4WFKA 3MGAA 3QMWA 1PJAA 4B85A 5DLPA 4X6UA 3RARA 2QUAA 3HACA 1ZI8A 2QJWA 1XQVA 2XMZA 4OU5A 2JBWA 4V2IA 4BC1A 4Y2TA 4G8BA 1K8QA 3T52A 5EHXA 4MEAA 2OQIA 2Y2UA 4AO8A 2XMSA 5ALWA 3OG9A 4AO6A 2WM2A 1QTIA 2WILA 4KE8A 4P93A 2D0DA 1XRPA 3Q8WA 2XQIA 3IULA 1H23A 1SCIA 4H7JA 5JARA 4EY5A 1CFJA 1UOPA 3H17A 4RE5A 3GBSA 2QJRA 2VJDA 1EVEA 1DQYA 2C0PA 2IIVA 4E15A 1E89A 1O6GA 5AM0A 3PFBA 4PNZA 4DM7A 3R0VA 4B84A 5KWIA 2Y6VA 5HKAA 2B4KA 4BAUA 1EVQA 3QMVA 5LZ5A 4AMZA 4H7EA 3HLKA 2GZRA 5LP1A 4GECA 5ALZA 2XUGA 1LBSA 3WZLA 2WFZA 4MEBA 1WHSA 2JEYA 4WCVA 3LLCA 4E11A 4L72A 2G5TA 2PSEA 3PFCA 4BVKA 4FOLA 2WIDA 2WTNA 2JEZA 4UHDA 3W04A 1G4HA 3FNBA 5FPQA 1ZGCA 1GZ7A 1L7QA 3DNMA 1G66A 2XQGA 4IH4A 3IB3A 5T4EA 1AUOA 1TIBA 4UFPA 4UBLA 2J3QA 1TKRA 4Q3KA 3QH4A 2JGEA 2XMQA 5HKBA 3OURA 1X2EA 1UKAA 1EA5A 3K9BA 1ZICA 2BAGA 4X00A 3DS8A 4W1SA 5EHQA 4WFIA 5HFNA 3C87A 4CG1A 3D0KA 5DNVA 3WYNA 5AP9A 4EY7A 1XLVA 4AQDA 5KREA 1M33A 5C8ZA 4RGYA 4J03A 5ALOA 2HL6A 3DLTA 4KYVA 1YASA 3L1HA 4NMWA 4X97A 4LIPD 1G42A 5D3ZA 3AILA 3WK9A 5AM2A 4CCYB 3STVA 5I7UA 1HPLA 4ZV9A 1H2ZA 3SC2A 1R3DA 1VXOA 2W6CX 3D2BA 2JGJA 4P92A 4GXNA 2WUDA 3GZJA 2X5XA 3C6ZA 5AH0A 2ZJ6A 4G8DA 3N2ZB 1ZOIA 2ZYIA 2R11A 1J07A 2AXEA 5AKEA 4EY6A 5JAHA 1CQZA 3IUQA 5AKIA 3F97A 4C4YA 2WFMA 3HRHA 1CUGA 3D7RA 5HF8A 4DIUA 1SFRA 5AM3A 2LIPA 3WKCA 4YASA 2ZYRA 4BTVA 4RE6A 2J4FA 1U2EA 1U65A 1XKLA 1YR2A 3F8SA 4QDZA 2DQZA 1DT3A 5CMLA 1E5TA 1C4XA 7YASA 1JJIA 5IVHA 1LPPA 1Q0ZA 3TJMA 3OPMA 4ZRDA 5LKRA 2ACEA 5K3BA 5HF6A 4BE9A 4KRXA 3WJ1A 3C6BA 4C01A 4ZV7A 5AI0A 1H22A 2VJBA 1EH5A 4IH1A 4EB0A 3STWA 4EZIA 2QXUA 1CUAA 5DYTA 5AKZA 2Z8ZA 1ZD4A 2XT0A 2GBFA 2VJCA 4LXGA 4PSCA 5HK9A 1NX9A 4X90A 5FP0A 1GPNA 1MU0A 4BAZA 1TQHA 3KOOA 3HABA 1CUVA 3IBTA 2AJCA 2YYSA 3D2CA 3DL7A 3ZWQA 3MUOA 5T4HA 2JGFA 1QFMA 4OSEA 5K5EA 3K6KA 1CUDA 3I1IA 3ED1A 1BROA 1CUYA 1F6WA 4IO0A 3LCRA 4Y2QA 2QOEA 5LZ4A 4OPMA 3KSRA 4ZWNA 5ALGA 3A70A 4I3FA 1YA8A 1Q0RA 4EUSA 1YS1X 3SK0A 5AM4A 1VZ2A 3F98A 2VAVA 3WL7A 5CT8A 4U2GA 4WFJA 3TEJA 1WB4A 4Q3OA 1IUPA 4A16A 3JWEA 3LP5A 4W63A 1DWOA 2XQFA 3V1NA 3QMMA 3DKRA 1BEEA 3YASA 2QZPA 2VAXA 4H7IA 1VKHA 1UFOA 4C87A 1QIEA 5CT6A 1GGVA 2CBGA 1HBJA 1AZWA 5JZSA 2WHPA 1VE7A 3WLAA 4BCCA 5F4ZA 3V1MA 3H19A 3HJUA 3DOHA 5AJHA 2HA2A 5HQ3A 1QIJA 5J3JA 4N8SA 3LIIA 2CEKA 3AFIA 3M3DA 5LZ8A 3IDAA 4X6XA 1EI9A 1T2NA 2BJHA 5ALEA 2HFKA 1K63A 4H77A 5D3KA 3IUMA 5K3EA 3S2ZA 4AZ3A 2XMRA 1ZJ4A 1CUHA 2H9YA 3G9ZA 4JYMA 2OAGA 4QZVA 3ZLUA 1JJFA 3WA7A 2GBCA 4A5SA 1LGYA 4QEKA 4OUKX 3R3YA 4AN0A 5E4YA 4MQMA 1AGYA 4U2FA 5A62A 1XZKA 4CFSA 2HA6A 1YB6A 3STXA 3GFFA 4HXEB 3PE6A 3H2KA 4H7DA 4QDUA 4EA6A 2VT7A 4WY8A 1ODSA 1UK8A 2WU4A 5AM5A 4CG3A 3FYUA 1CUFA 4G1FA 3WK7A 4N8EA 2HA0A 5LKAA 5AKKA 2ORYA 4L9AA 5CXUA 5A7FA 3B5EA 2BGNA 1A7UA 1CUSA 2G4LA 1QE3A 3WL5A 3NGMA 1VLQA 1FSSA 3E1GA 1JU3A 3I6MA 4JYPA 4KR0A 1Y7IA 3FYUC 4BZWA 3MUNA 1R50A 4Y2VA 2OCKA 2FUKA 1LPBB 4J7AA 2RHWA
chains in the Genus database with same CATH superfamily
3CVOA 4M9ZA 2QM0A 1Q7GA 3DO8A 5EJAA 5EEHA 4X8LA 3WQHA 5BVHA 1N1MA 1XYGA 3CZ5A 3BF8A 3GLGA 4AAYA 3EZXA 2G1AA 2PAAA 3LH5A 2G63A 1WAMA 3WK6A 5FR2A 1RTTA 3IP7A 3OZFA 1F7UA 3SEQA 4GUAA 2P8SA 2FOLA 3L18A 3U9TA 4RHTA 3HBNA 4OBEA 4RTRA 1YL6A 3ZGOA 3W3AH 4EL0A 4KI7A 1W46A 2HNBA 2M2IA 1BOOA 4EG5A 2XBLA 1ZNYA 5AK0A 2X8WA 3DXYA 4D74A 5JAUA 2DOKA 2Q1SA 5ARCA 3TDMA 1ODFA 2PUBA 2J3HA 3VVLA 4MQ4A 2JGNA 1YTLA 5DBOA 1KE1A 1I7DA 3K5IA 5ED0A 4BZXA 5K3SA 4I3HA 1I4EB 4UM9B 4A27A 4IZIA 3PJDA 4OLBA 5J2TF 4QQRA 4D3SA 4CMCA 2W2XA 4JT2A 3A9TA 1LH0A 1C8LA 1N9GA 3O31A 5AKGA 4EYSA 1Z2EA 4F5ZA 1D0SA 4MV3A 1CUUA 1WCXA 3W8DA 2O20A 4F1KA 5BMVA 3CUUA 2QT1A 5J58A 3HV2A 2W6NA 5DTMA 4MB6A 4DYVA 3KWMA 1LDYA 4HDNA 1J2TA 4A6PA 1YQWA 3KUUA 4J3NA 2PFGA 3NIDB 3WOVA 1HC7A 5DV9A 4AG6A 4YUAA 4G84A 1XL0A 5CA1A 1L5SA 4PS1A 2G08A 3WAKA 2W2PA 1MOSA 1W34A 4XCXA 1O9GA 1BKSB 1UMBA 1IWOA 1ZUIA 2G09A 2G1JA 4JKOA 1CE8B 1NBIA 2D1FA 2XOKD 2ZZKA 1DWPA 3DMGA 1MOPA 2HK6A 1RZVA 1LSOA 2J3DA 2Q2WA 3KEOA 3Q3IA 4D9NA 2BM0A 3T4XA 4HEHA 4WIAA 4KE6A 2Q5IA 3VSBA 4YYEA 2BUBA 5EJ4A 3IELA 1H93A 4JI5B 2NPFA 4B4VA 3ZKWA 3GPCA 4ZYWA 2TMKA 1QX3A 3RU3A 2RJNA 1MEEA 1Q17A 3D4OA 4EUEA 4I50B 4F7WA 1XZAA 1Y80A 2Z43A 3LKVA 2ZJBA 3P2IA 4AJJA 2O14A 1NHGA 2X15A 2CLDX 3KR9A 4MW4A 2IYAA 1JV2B 2F3TA 1HL7A 2JKZA 3BK1A 1KI2A 1KEZA 1PGNA 3BWCA 3D3EA 1Z0DA 2UZ0A 3IHTA 4ZT5A 3STUA 5CDHA 1V25A 4FFDA 2EW1A 3M4XA 2H1VA 1GT6A 5FJIA 1KO1A 4CIVA 1AKUA 1OZ0A 3DM9B 1G64A 4BIMA 3IVXA 2Q5QA 1RKBA 1IDN1 1YFKA 1NM5C 3GJTA 3NHBA 5C3MA 1W96A 4KLCA 2CFIA 5BRAA 1PJ3A 4RZIA 5IEBA 3WNVA 5ALVA 3ZCXA 5EYPB 3STHA 1YZFA 1NQ5A 2NO9A 4OJNA 1JDTA 3ST7A 4KN5A 3VMMA 1TAUA 1SAYA 3OD1A 1R6VA 2I2DA 2C57A 2JGIA 2VTKA 3AINA 2RBEA 1A9ZA 1C0EA 1Q0LA 4KCGA 2Q0XA 1EVJA 3MTDA 3UK1A 2C3UA 5CNMA 3TPZA 5KX5F 2EQ5A 5H7XA 4DT1A 1Z13A 1E5QA 3IBSA 2DHCA 2FX3A 4TQ9A 3GLFE 1VA4A 1A8IA 3BEDA 4DV6B 1JKJB 3BKXA 4MULA 5KQSA 1I33A 3VPCA 4CRWB 1VB5A 2H2FA 1KK1A 3DHVA 5I7WA 2WJHA 2AVDA 4WW0A 1EHIA 4ETWA 5FYDA 1Z9BA 5KSZA 4KPEC 3FWYA 2A9KA 2HHAA 1L1RA 4F97A 2BFDB 1O0BA 5CHEA 3UMCA 4AY5A 1DKPA 1LVUA 2B6NA 3K35A 4L8GA 2WWYA 4O6VA 5CU7A 4URXR 3EVDA 2H16A 4AY6A 1ODIA 1TIPA 1WABA 2J0UB 3ZJTA 4RY9A 3NBZC 1PV4A 5HE8A 3F74A 2P9QA 2ZYWX 3H0KA 3H7IA 4GI7A 3TUIC 4F9TA 5LOVB 1MA3A 4CM1A 1Z4NA 3OZRA 3GH3A 5H9WA 4ERXA 1TPZA 2F9FA 3TMYA 1JE1A 2ODEA 3LYLA 2IS2A 1THTA 2DULA 2ASEA 3H5NA 3RASA 1WW8A 2ES4A 1Q21A 3VAZA 1ADFA 3IALA 3AERB 1RLIA 5EWLA 4DZTA 3TS1A 2P5UA 5G0WA 4L08A 4EP1A 1X80A 2QX7A 3BWYA 1T0JB 3QK7A 5DM70 4B3JA 1NDQA 4KEAA 1P44A 4OHOA 3I8XA 2VHJA 2WIGA 2ZJ4A 2FFJA 4EGCB 4JLKA 1DKUA 5DCYA 5H68A 4E2ZA 2ALJA 1R4NB 3SCZA 3SSOA 2P91A 3I04A 1OGIA 3E3AA 2VPXA 3E8SA 3IAM6 3GEEA 3K8ZA 2YVLA 1H9AA 1P9RA 1Z6YA 3LFUA 1PTJC 2Z4RA 1ZMTA 5IF9A 3GJSA 4Y2YA 3VOBA 3NBKA 1P5FA 3EDMA 1CRWG 4XX0B 4Y6PA 3AJ9A 3VR5H 4CKWA 4XLTA 1XUOA 2VPTA 4L0QA 5A3VA 3AHJA 1G5PA 4TXHA 5TDHA 3ZOZA 2D00A 3OIYA 5KNLA 3KQKA 3CRVA 1C9EA 1NLMA 3HL4A 5D1HA 1CUEA 1KRHA 1OLXA 2ZR8A 1OFUX 5K0NA 2UV8A 3IBYA 4RKYA 4EHHA 3O2JA 5EZQA 4DR5B 4FMBB 5E6RA 3HGMA 1U1CA 4IHJA 4CTMA 2I2FA 4NAVA 1DHRA 1C8VB 2C8JA 3OX4A 5KDOA 4PR0A 2XUHA 4LQ4A 2YYYA 1G8GA 2O2GA 3EZ7A 3HJAA 1MX1A 1UMCB 3H84A 2TS1A 1LKZA 5L40A 4XSHA 3Q7RA 2B37A 4LF6B 4RL6A 5EKTA 1U0NA 2GDJA 4BNXA 4EA7A 2NU6B 2QNRA 5EC8A 4GVXA 4EKEA 1V9SA 4HAUA 4UHHA 2HU5A 2WMYA 1I36A 3SJUA 2XNHA 5H3LA 1O9HA 1GNTA 5I4CA 3ORQA 4FEYA 4LNUB 3BF7A 2QAJA 2IF2A 3IEKA 1VKJA 3KFXA 2OEPA 3ZW8A 2B0CA 3BXOA 5COAA 4NS4A 3HCEA 5KYYB 1C9KA 1QO7A 4DMLA 4YJKA 5IJAA 2ZPAA 3PDCA 3PG5A 1H6CA 4M7RA 9LDBA 3BMNB 4XIFA 1D2HA 5D5PA 3GL9A 5DVZA 1VGQA 1GCIA 1S8OA 1IUNA 1E9CA 1E3WA 3AU8A 5AYVA 3HCFA 3LYHA 2OPBA 1VRCA 2BCGY 2WVJA 3TCXB 1TZMA 5DP1A 5HM8A 2Y3IA 2R7AA 3DCIA 4P7JA 2BJWA 3DV0B 3KYBA 2CZGA 2XXAB 3A2NA 4YLEA 3TF5A 3IESA 5AO9A 5HQ3B 4LBZA 1NWHA 1TJPB 2L2QA 2BH2A 4L1KA 3QX8A 4YIHA 3HU2A 5SZJA 1T91A 4QUGA 4RNDB 3MS2A 3VR0A 1Q0SA 3U7JA 1X38A 2D3TA 2YFKA 1ID1A 1V3VA 1Q7TA 2RJOA 1ZO8A 2V96A 3H9BA 3HV0A 5ELLA 3CZRA 4P80A 1E61A 1PFKA 4Q4HA 3RSFA 1NL3A 1NZFA 1RE0A 1RYBA 3KV3O 1QFSA 3N2KB 3P26A 4HS9A 4BNYA 4X66B 3LC1O 4E31A 1AG9A 1O94D 2OXRA 1SIOA 2X8JB 4RD6A 2BVNA 4GD3Q 3UWDA 2HPAA 3BDVA 4WI1A 5JD3A 3OBIA 4JKYA 5EHNA 4ZEWA 4HZGA 4DTIA 5ILGA 3D2AA 1CYEA 2EKBA 2D5CA 2DWUA 1AMUA 4JL6A 4ZGGA 1VBKA 1ZUWA 2ZWMA 5L3ZA 3WB2A 3NYRA 4LJLA 3I39X 1XNJA 3U4HA 2CT8A 4L02A 1B0ZA 1PG5A 1SOUA 3OO1A 4KIFA 4O3FA 4BUJA 4KWTA 4L9WA 4MI6A 2ZPUA 4PC7A 1YB7A 4HQ0A 1E9EA 5DNUA 3GFRA 1HYQA 3RVJA 3NAZA 4CQMB 3V42A 4BMSA 1O6CA 4KH0A 5CK4A 2GRUA 1XO1A 1NBMD 5L3RA 3Q8KA 4IAOA 4Q93A 1R5JA 1RC8A 1KZ1A 2MSKA 2QV7A 1CETA 3N05A 4MWCA 4ZDWA 1QE5A 3MQ4A 5CT5A 2R6AA 3WA6A 3RWMB 5H1YA 1KYXA 5ALMA 1XDWA 5JI3E 5KYNA 1U8TA 3CCCA 1ZUD1 2VEOA 1OFVA 2FV8A 2QM8A 2ORIA 2CNBA 1F51E 1Z68A 2PT9A 3FETA 1U3TA 1VYHA 3NEPX 1ISHA 4YMUA 1DPFA 4LC1A 3KKKA 1I13A 2CJYA 5DYGA 3WL4A 1CJUC 1DX6A 3JYOA 3SSMA 1YT5A 4JC0A 1TTHA 1XCOA 3RLFA 3JVUA 1SOVA 3BCSA 4MIYA 4IGFA 4IHAA 3DF9A 3X44A 3QLVC 1U0EA 2HIAA 1JL3A 3HZHA 4AK9A 1SOWA 4FSHA 3G2KA 4YHHB 5TV2A 3N75A 1JJVA 3LLUA 5F9HA 5GP1A 3ICEA 3T35A 1YCGA 2PMFA 2I34A 5K8LA 4L8WB 4Q66C 3RAPR 3MCWA 3UJBA 1XRRA 1YE8A 1FX0B 3CWCA 3CHYA 1II8B 1DTWB 5TMPA 2M32A 3AHDA 1NN5A 1SQ6A 2C5FA 4KX3A 4OQZA 3A2MA 3QYFA 2H0RA 1US8A 2GK4A 2OAEA 1UXOA 2GX6A 2RI1A 3K9NA 4B2YA 2JIQA 1ISRA 4MS4A 1RAHA 3FSGA 2JKVA 3ZYZA 4D42A 3B7PA 1GIAA 4L74A 3HB4X 3L7BA 4E88A 5EJ7A 1M6HA 3PT5A 4DNQA 4YP9A 1NJFA 2YJGA 3HHPA 3EUWA 4LE2A 1JAHA 4A0RA 4BUZA 2OCAA 4OO3A 1REQA 2HMSA 3R5KA 1YQGA 5LLDA 1GZVA 1BCSB 4QPPA 2VZLA 3OZXA 4OHRA 5BT8A 1Y8QB 4FGWA 4LEIA 3R20A 2AFHB 1M76A 2Q07A 1Z0KA 2QN8A 4TMXA 5HZMA 3IQHX 2FW8A 3QPCA 1N2XA 2BGKA 2ZVDA 3E84A 3LIPA 3SKYA 3SQDA 1Q3TA 4KIUA 3TI9A 2CNKA 3VNSA 1ULAA 3OC6A 1MDBA 4QRIA 4NH0A 4XIJA 2VNAA 5JR3A 1H9CA 2V6JA 3H2GA 4H27A 2ZQYA 2B36A 3LOPA 3K1ZA 4UATA 1ZNZA 1K5HA 3M5PA 1SO8A 3C3AA 4WKGA 4X9XA 2R79A 1RWNA 4FD2A 3FUCA 2ZSUA 4G0YA 1BKDR 1Z83A 3P2JA 2PX4A 3GWZA 2W6JD 1KY2A 2C0QA 1FFHA 2VRCA 3GLHA 3H5IA 3PC6A 4DEYA 3OKCA 1BRTA 1SC4A 2Y1KA 1KXJA 4QU8A 3D3JA 2HEGA 3OWXA 3PR1A 2G4CA 1B6GA 1YS7A 2FSSA 4FDUA 4RK7A 5CPBA 2PZBA 2PUWA 1WZUA 5LYYA 1T1RA 1KNXA 2D06A 3A1FA 3LHFA 4HRVA 4IPTA 3L1VA 5KVCA 2DT8A 4LOAA 2CYBA 3E7DA 3FM9A 4C4ZA 1UMBB 2JZNA 3DVSX 1RWOA 2W70A 3NOXA 3BK2A 3FNHA 4FP9A 3W2EA 1KMQA 2O2DA 1R8QA 4F9EA 3KLPX 4URHA 4NARA 5EQFA 3TB6A 2ORWA 1QYDA 1MG0A 1EK0A 2WQZA 1U9IA 1OWNA 2NNWB 3H18A 4ETMA 2WU8A 5ALJA 4IDQA 2E55A 3RW9A 2TMGA 5INTA 2BFFA 4XJVA 3TVDA 3X0DA 3ZWNA 1OASA 3FDXA 5GOZA 4EW2A 2ET6A 4AN4A 1KI3A 3ASZA 3EEQA 3I23A 5L4SA 2OCLA 4TROA 1ZR2A 1R9NA 3NV7A 4PHCA 3M2PA 1C3LA 2EBHX 1DIHA 1UKCA 2HK7A 1YSCA 1G2IA 3NWEA 1NQUA 1V9LA 3MTJA 3RBAA 1ZNQO 1YRLA 4PZUA 4TL8A 3B6IA 4X3OA 3T06B 2GPSA 3F73A 1GGNA 4FYIA 3H1BA 4MPTA 5G0TA 3BSFA 4PYRA 2WJVA 2J41A 3U6KA 5FXMA 1UAGA 2I8CA 1A1SA 1QVVA 3HI4A 3QUTA 1GGFA 3X1DA 2VOJA 4ZAVA 3HY6A 1I94B 4NXNB 3EGDA 2V1UA 4P4SA 1JSRA 3WSTA 1EFPA 1MJGA 1Z88A 4RQUA 2R2GA 3RHZA 4BKMA 2GPNA 1WDKA 1SZJG 2XDWA 3RNOA 4ZU6X 4ZCPA 1IG0A 3FH0A 4IDDA 3CN9A 1KBZA 3HXLA 4U8GA 2X0RA 2XKKA 4TQUS 3WLKX 3B2EA 3WXBA 3ZQ6A 4PLWA 1SURA 1H2AS 3IAS6 3K2EA 1EE1A 8OHMA 5BOVA 4E07A 4B4UA 4UOEA 2J5QA 4KFRA 4OFXA 2QVGA 3RRBA 2UUCB 2VYCA 1P7CA 2PVPA 2V58A 3PGJA 4JU8A 1W88A 5KOHA 1XFAA 4ZEMA 1A9YA 3QVTA 3E2MA 1TECE 2XDYA 4R1UA 2QLTA 4ZDKA 1UJ6A 4RK5A 4YH1A 1PT6A 4BLOA 3U0VA 1CE8A 1UOOA 2PX6A 2ZCUA 4FMCF 1QC5B 2OGWA 1T1JA 4GM0A 2FEMA 2WLSA 3C43A 3AONB 1KI8A 4TS3A 1DEHA 1UXIA 1IN4A 4PYJA 4QWMA 1RVV1 3I2JA 3R6DA 1SIUA 5K0ZA 4XUDA 3EW7A 4LZAA 1PT7A 3V8VA 3DEFA 2RFLA 5JISA 3Q6NA 1FTWA 4M1KA 4PPNA 4QATA 2O7RA 5AI5A 5KNBD 1AX9A 1JKJA 2GZ1A 1PFVA 1B2RA 2YIDA 3L7DA 2WKRA 4KVGA 4S0XA 5K0LA 3VNBA 4C76A 3UMMA 4QPDA 2EG5A 5M3BA 3WLFA 5BMOA 3F5FA 4P98A 1XPJA 2Q7OE 2NGRA 4FHDA 4HFMA 4ADSG 4FKBA 3CLSD 5EYPA 2GAIA 3K1YA 3AIKA 4J16A 1NQOA 3WAJA 2GEFA 5FO0A 3H2HA 1GKKA 1RDFA 3HR4A 5ENZA 3T7KA 4DLPA 2I91A 1ULUA 3FHOA 3PGLA 5D5HA 1GG2A 1SH7A 2HMYB 5DI9A 3C6XA 1B3RA 3PDIB 1DFHA 1KK2A 4PX2A 2GB4A 2RGUA 2XGOA 3AL3A 3Q3CA 4INZA 4UMDA 1XPUA 2BMVA 3ZE0B 2XSZD 1JI0A 2VJMB 1Q1BA 3EIOA 2VOEA 3OE7D 1PX0A 4ICIA 4MAFA 4B8YA 3TUJC 4YCSA 3I92A 1V1MB 1ZA1A 5CD1A 1YS6A 4QU5A 1JQLB 3ONFA 2VDVE 5E7JA 3Q2IA 4HF7A 1FLAA 5MF6A 1LC0A 1NBWB 2G8NA 3M83A 3QWIA 4G81A 4M49A 2OGZA 1UEJA 4OBXA 3IOBA 3TH5A 5KQLA 2OO3A 1N2CB 2R8PA 2R8BA 4P3YA 3GLIB 1E96A 2YWEA 1KAMA 1LU9A 3H42B 1PTKA 1L4GA 2APJA 4TYMA 1P7YA 3HHEA 5HCNA 4EVIA 2XD9A 2Q9BA 3Q98A 2QXTA 5FORA 2FK8A 1ONNA 1SCQA 1BVUA 3G9TA 4I46A 1I3LA 2HUPA 2N75A 5EPUA 2XODA 1VPEA 1NJ1A 4FFMA 4FQ7A 5DPMA 2WT8A 3I28A 4HEQA 2XTMA 4BRSA 3HDTA 4PINA 1F6DA 2EFYA 1FFXB 3ZJ5A 3D1JA 3G8AA 5FEUA 5DBGA 3OFVA 2BGIA 1N5DA 3OF3A 4NZNA 4HMQA 3NX4A 3RSQA 1DG9A 1DCKA 2VF4X 1EJ6A 2QRVA 2OAP1 3F71A 4RA9B 5FWYA 5J2UF 3O8OA 3N5CA 3SR3A 5K8VA 2E5WA 2Z3VA 2ZJOA 3CZQA 3KHTA 4YRRA 3ZW7A 4E7PA 2F8TA 4P3KA 1KVRA 2DY1A 1J8DA 4XQ9A 4OP2A 2VDOB 3SJBA 4NXMB 3CXUA 3HFGA 1M0WA 4X63A 1CT9A 1LSUA 1SC1A 1U04A 2IKSA 2NXJA 5J2UB 3VR3D 1P1HA 3EXFA 2JDIA 3VDNB 4NNPA 3EMVA 3PGMA 5ESXA 4CCYA 1VPDA 3JAWB 1HQDA 1XMJA 3CM0A 2WWXA 1YHYA 1KJIA 2P6MA 3ACBA 3CLSC 5AVJA 2CV0A 2AN3A 3GA7A 2VK2A 3D0RA 4QUDA 5FV4A 3UJ6A 4IOLA 2WYUA 4WZAB 4U6SA 5DNYB 2R3SA 4IOMA 3O8NA 1F0NA 4WKCA 4L4SA 4BFZA 1MIOA 5B4TA 1U3VA 2FQYA 1VLMA 2XUPA 3EIXA 3EXIA 4O4LB 1MAUA 5C1IA 2QL7A 2AE2A 4GOMD 2B1RA 1NI4A 5AI9A 2XT9A 1A04A 3QSGA 2HF7A 4BO3A 2WYWA 5A04A 4YAWA 1T24A 2IYSA 4JLAA 4WCDA 4ZFNA 4FWIB 1O0SA 4I8DA 2HU2A 2CNOA 2NUPA 2OHFA 3NHFA 1MEOA 5B1SA 5UKDA 3SZGA 4ME6A 3NIGB 3WLSA 3R9XA 3GPLA 1MVOA 2BEKA 1JHDA 3QU2A 5ALLA 2VDKB 4LOHA 3AU9A 1ICIA 1W25A 1A9PA 4NEHB 1IUKA 1K6IA 1E20A 1WSDA 3BCRA 3HEAA 3KQMA 3OFKA 4LSZA 4RAOA 4UXJA 2QJOA 2XMBA 4J0GA 4PCVA 2QYTA 4HDKA 2C88A 2ZKIA 3DYIA 4S12A 3PLAE 4G5SA 1CCWA 1SUCA 2MR5A 1D0IA 2G67A 2WJZB 4V0SA 4ROTA 5DH9A 3ENWA 3I2IA 1HDXA 5ES4B 3M33A 4K9PA 2D2IA 5CLLA 3TSWA 5JJ5A 3A6EA 4LQCA 1E8NA 1HE4A 4EG6A 1FBTA 3MTQA 2OLEA 4FCWA 5KQRA 2H9IA 4JC4A 3SC3A 2ZYGA 1U0SY 1XB2A 1WMFA 2P2YA 1QZXA 3C97A 4B3FX 3LUAA 3FMFA 4PY2A 4DFDA 3DLAA 4POAA 1WTCA 3PKZA 2D4AA 2Q2NA 2Q3JA 3FX2A 1QQTA 4RSGA 1XELA 3V4ZA 1WQ3A 2RBGA 1YC5A 1E5DA 3CX4A 4YCLA 4UNQA 2LE0A 4HUQA 1LC3A 3O2QB 1E9VA 3PUIA 5HIAA 3O84A 1T9HA 1MQ8B 3PUYA 3GT0A 2KI5A 3ZK7A 3I6QA 1PE0A 1TVKA 3KSMA 4EJMA 1IB6A 4F92B 4MLZA 3H2BA 1N2OA 2XCTB 4IVRA 2ZAGA 4R2KA 4XDGA 5A9SA 1NU8A 1L7OA 1UKVY 3A25A 3ESBA 4IUDS 4DCNA 3Q8MA 3B9QA 5EZYA 4XPIA 5AKXA 3KZCA 1QR2A 4TTJA 1RMQA 4MKFA 1V1MA 3GW8A 4PU0A 2Z09A 1ZK0A 2VF8A 2BKLA 3LX6A 4KQFA 5HPYB 5C81A 2LP4Y 5EMNA 1RS0A 3CVJA 3PXAA 2CVOA 3VAYA 3DWIA 1X6VA 4J0HA 4A03A 3ECCA 4MKHA 3MCUA 1DFGA 2WOOA 2YNMD 1LNSA 3E7PA 4WK0B 4Z8YA 1NVFA 4E12A 3DMTC 3FUVA 5EIAA 5IDVA 5K2MA 1XCPA 2JH3A 2N9UA 4BQOA 3GD7A 5HZHA 3IAAA 2OBYA 2WG2A 3DE6X 1VB3A 1JNXX 1YHZA 5AIAA 3JQQA 1XHEA 5CA0B 4Z0HO 2RE8A 1XU4A 2GZ3A 4MVCA 4II3A 3SY8A 3LC0A 5ALRA 4IDEA 2QPOA 4PIMA 3GT3A 2Y0PA 5JCPA 2BC9A 2ZIZA 1JU4A 1NFFA 2JJ8A 3L0YA 4X84A 1UWKA 2C42A 3ZZ0A 4MDHA 3PIDA 4H1HA 1K08A 2CLOB 3HCOA 1QONA 4KOEC 1KSHA 2OCBA 5CYGA 1C1DA 2HYIC 1IBSA 3A3YA 1K0UA 2QTTA 4JQOA 4R31A 2VXBA 5IJXA 3VOTA 5K0EA 1P3Y1 4NONA 1T9DA 1C0IA 1H05A 1S7GA 3K9FC 2QKYA 4RLQA 1AUQA 1PJSA 5JMPA 4WECA 4C21A 4U8HA 3IGFA 1IEQA 1N3LA 1S2LA 3B36A 3MC1A 3WC4A 3JS5A 3RV4A 4H3VA 5CRIA 4DRXA 1OLSA 1LS6A 3UENA 4Z7OB 4YLYA 1ESNA 1I3CA 3ET5A 5BN5B 1RPTA 3A32A 4HAZA 4B4OA 2A58A 3RLIA 4Q16A 1OBCA 4HWKA 1RYFA 1G2PA 2FMXA 3I2KA 5U4XA 3TVYA 3K9HA 3QLEA 4XDYA 4NAHA 4G1VA 3OZ7A 2XGJA 5T5QA 2ZEJA 2ZW9A 3A2KA 3WNQA 2XE7A 3AZPA 4X7PA 4AO7A 5FBRB 4HB3A 3IDFA 4LCEA 4MYDA 5D3QA 1NNSA 4NZOA 3M8KA 2ZYVX 4F2PA 3KG2A 4RHYA 1JFSA 4S1VA 1NW9B 4YRFA 5ALSA 2PL1A 1EUZA 4AUKA 2IZ0A 3VDQA 4B43A 4XWOA 1HDOA 3OX1A 4B8ZA 4KMSA 5DN6A 5BQPA 4ALKA 2YJ3A 4RJLA 5L3SA 4OHPA 4CF5A 2QMEA 7REQA 4IMJB 2H65A 1USIA 3P0FA 1E66A 3KM0A 2R1TA 5KNDH 2AJDA 2CUZA 1GPH1 1J2RA 3QEKA 3OBBA 1JQJC 1EK2A 1ZOSA 2CMGA 2JASA 4KDEA 2PLNA 2WWFA 1XF9A 1Y1TA 2J3JA 3LQFA 3PC2A 4UE2A 1TF2A 4YAFA 1WU7A 3UAGA 4LX0A 1RQGA 5AVXA 5EIEA 2WJIA 1WR8A 1M67A 4EHDA 1W5FA 4BFVA 2IKQA 4ND2A 1DV1A 4H15A 1E7WA 2O8VA 5F3RA 2H59A 2XB9A 5LP6C 2O8CA 3TECE 3K2BA 3JVDA 4RK0A 3R3SA 4ZOBA 3CEJA 3JQ8A 4MR9B 1SKUA 5IAKA 1FJGB 1NU6A 5IRCD 3DE1X 5DT2A 2E4YA 3RO7A 1KI6A 3LQ2A 4PRZA 4XR4A 3D2LA 3KVRA 3LCVB 2WFAA 3O8QB 3V1UA 5LZ2A 4FVTA 2N42A 3QEBZ 3E7XA 3ZTTA 1Y9JA 2PR2A 1RM3A 2YFHA 2IHNA 1SHUX 3CIFA 3W4JA 3U4GA 1DC7A 3CRNA 4FTWA 4EEZA 4NK4A 2BFCB 4NCHA 4INAA 4ECAA 5H0IA 1IBMB 4YEDA 1U8YA 1RI5A 1UWCA 3QFFA 4S3MA 4H0CA 2XLCA 4QQ8A 2I2WA 4E4YA 3F49S 1ZNXA 1VPLA 4O2BA 4YRIA 2HSZA 1R37A 2Y1XA 2LVBA 3I32A 1HFKA 3OCUA 2XV1A 3U56A 2CDAA 4YTEA 3PEFA 4WBNB 1I80A 1S4MA 4LV5B 4TZ6A 2I62A 3QE0A 4TS4A 4DCTA 1JG7A 2F1KA 1DT5A 2M1ZA 3OQBA 3QVUA 4LZOA 1J9EA 5HS6A 4EYOA 1T13A 2OT3B 2V3VA 3IQWA 4H18A 5HKOA 1A77A 2LKCA 3OWOA 4IX1A 1DBWA 1MF7A 1ZUNA 3K0AB 4RKRA 5EE1A 1M8GA 3LHSA 1XJ0A 4TUYB 1N3YA 2XJ4A 3QFHA 1Q5PA 5A0FA 2VP0A 1YU6A 2JJ1D 1ISIA 5J9FA 3EQ8A 3PS9A 4HLCA 3SX2A 4OY3A 2H2DA 2PZAA 5FHRA 4A3SA 2L18A 2CDRA 4EDHA 3LW8A 4ZKDA 5K4HA 4KOAA 2FUEA 5FLEX 2YRWA 4HWOA 4F6LA 4Q4LA 2R8EA 1CC1S 1A98A 3IAHA 3QF7A 4MGIR 2YWXA 4MSUA 4XIIA 3ZOKA 3V1LA 5K8IA 3B7WA 5ITZB 1YK1A 1Z17A 4QNNA 4JT4A 1KS2A 4J6EA 1SKYB 5GWXA 5CYPA 1R5OA 2FPIA 4AUMA 4R2XA 1I6WA 3CO0S 5FD8A 3R3JA 1WDTA 4M1SA 3DAOA 4RHFA 3V3TA 2ISCA 4UMVA 5I9MA 4AT1A 4F5DA 1NXSA 3PNOA 4JBHA 4S1TA 4MHOA 3V1KA 5FB3A 1EX7A 1ORHA 5ED4A 3B6ZA 6ABPA 4EG7A 4ZOLB 4TLDA 1Y8CA 3AHFA 4Y6GB 4BLVA 4RQBA 1ZZEA 1G38A 1I1HA 1HKHA 1Z26A 1EFKA 1FPQA 3N74A 4DJAA 2RK3A 4YMLA 1EFVB 2IZZA 4WDQA 3RVPA 1HE8B 1G60A 3ECSA 1XSEA 1DEOA 3FBGA 1OXKB 3U81A 4DXDA 3QF4A 2XOEA 4L3OA 5B3KA 2HWWA 1RRVA 5JSZA 4KR6A 2GD6A 4RZXA 2XDAA 3O4GA 1YQQA 3PUKA 1J6UA 4AWBA 4IGKA 2TECE 3L4KA 4ARCA 1JHVA 4DZZA 4OX9Y 2CLIB 3E3NA 4LE1A 3UMJA 3ROKA 4YRNA 3W7VA 1TRKA 3LBYA 3JQRA 2WF8A 1QIMA 3UK0A 1Y3CE 3OEYA 4D9HA 3TLGB 2ZT7A 1JW9B 2GT1A 3JW8A 3NGLA 1L2TA 1BAPA 1XQ1A 2NO6A 3K9CA 4A4DA 4UDXX 3X2EA 2OCGA 4G8CA 2W2NA 5KQGA 1S2NA 3N0XA 1L4HA 1XKTA 1Z6AA 2QRGA 1CDEA 1JDJA 4WK6A 4XWWA 4X71A 4L4UA 5EOVA 4GMHA 1LBIA 2AFIA 4NU8X 2O3JA 3F6EX 3ND7A 4NBKA 3TBKA 1BQ3A 1N5OX 3RPEA 4AZSA 5KPDA 3DPUA 4YP6A 2G72A 1PS8A 3R41A 1NBOA 2H4HA 4P4UA 2VUUA 3UIEA 4JQZA 5JJIA 2GD0A 6YASA 3I9LA 4KWCA 5I9SA 2P1DA 4DB4A 4QXRA 3U5ZB 2HSDA 1ORVA 4PLGA 1OI3A 3S4YA 1O94C 1D2EA 4LZJA 1RAFA 4QYSA 2EJWA 3DAPA 1N2IA 5DLEA 1GFZA 1U80A 2GYVA 4JELA 1ACMA 4I6EA 4UHKA 4MAMA 1PL0A 1H2WA 1J2EA 2A94A 3DTVD 4KXQA 1GUZA 5GGYA 1S0UA 5T3YA 4A9AA 3CF4G 5BPHA 2PCLA 1BMDA 3FJ1A 4D4JA 3ERCA 1FTYA 3IQEA 1IXYA 3R0ZA 1P18A 4YUZA 5IMBA 3TFWA 1TMKA 1RTKA 2V45A 2Q8PA 2OBFA 4IJQA 4BO7A 1G6OA 1WULS 3CC8A 2Q9CA 2CLFB 2IY8A 3FVTA 1EB9A 4G23A 5HKKD 1VPWA 3B7GA 4AURA 4JJ4A 2AQ8A 4QQFA 1YJ5A 2R44A 3EISA 3QE3A 3X1KA 4B3BA 2X41A 3M5DA 5C8ZA 5KMGB 1I2DA 5LD2C 4RFLA 1IQ0A 1BIFA 3AXTA 5E4JA 4DIOA 1F9AA 3WYFA 3RQSA 1XZMA 2FN9A 4S1WA 4XFDA 1XQYA 2V9ZA 4AJHA 2C0CA 5TQ0A 2DKOA 4NMXB 4YJFB 2VPWA 4OHFA 1YFJA 2R97A 5EESA 5EL0A 4EGAA 5DCLA 4KR7A 1X1EA 3KVNA 4L2IB 4ZVVA 1MB4A 1FUIA 1DINA 3BHMA 1IZZA 1N5MA 1WKBA 1Z5OA 2UZ1A 3BRQA 1NMYA 4M0PA 1C30B 1KTVA 2FY8A 4HQRA 3K72B 3QOFA 3DDCA 4J49A 1UBTS 2BFWA 1Z22A 1KAHA 3KVVA 2C1ZA 2FUG1 4M1MA 5F2NA 2OHVA 4QJ4A 5IT9A 4Q4AB 4J29A 2O7QA 4UHFA 4UD6A 4CN9A 3TGPA 2DMRA 4OLJA 4HB2A 5EE3A 1II0A 1Q6YA 4FB5A 2IIQA 3LS2A 3AXSA 4Q7KA 3P9XA 4MH0R 2CHVA 3T54A 4A2WA 4HAXA 4BWVA 4R71A 1IVSA 2HK9A 4S2UA 1CU1A 1KMHB 1ZMRA 4FFNA 4ITUA 4PLVA 2GK6A 1T9CA 2Q45A 4TS9A 2YMMA 2AI1A 4IFEA 4GVPA 4LUCA 5LA6A 3NT4A 3NXSA 1RWPA 3AR5A 1OFGA 3QEOA 2FKAA 1XRSB 2VDMB 1XVTA 3RIEA 3C4JA 3CNQS 5EJ8A 1GQFA 2CD9A 2K4MA 3M1LA 5KWJA 4WLNA 2H1IA 3PXUA 2XUKA 2RH5A 2QAGA 3WICA 1BRMA 3D6VA 1FVXA 4XPIB 1YF3A 2IGTA 2H8GA 5FBKA 1NSYA 1E9AA 4OMUA 4JEUA 4XOIA 4FWTA 4JLOA 2D5LA 1HXHA 1SUBA 2FEAA 1GPJA 3DOOA 5JLAA 3VOAA 3M4JA 4QE3A 2IXAA 2QJFA 2QS9A 3DUWA 3L2OB 2IYUA 3C6KA 3E2IA 3CA8A 1J70A 2QRKA 2QW8A 2HBRA 1ZDMA 3ROZA 4R1PA 1SXJE 1N2HA 1QFXA 4UVIA 3I76A 3MPUA 4A1OA 2COEA 2JJ2D 2C61A 1JUDA 3BYZA 3I2GA 5TVGA 5FT9A 4JUBA 4FMPA 3IP5A 3CGGA 3E1SA 1HL3A 3EEYA 1QG2A 2V54A 4CIYA 3NHRA 4A6DA 4EL5A 2NO0A 3IP1A 3HZRA 1VA5A 1EK5A 4KV7A 4YS6A 2YVQA 4DLYA 4OAQA 1J7JA 2QLMA 4LRQA 2VH2A 3EQZA 3RK4A 4C6RA 4CT4B 5JEDA 1KDVA 1H5UA 4CLDA 2CV2A 4EJ6A 1KL7A 2ZUSA 2A0YA 1Z2PX 1OAOA 3GT7A 3DOIA 3T7EA 3ZNQA 2BSQA 3OQ6A 5IM4F 1YR8A 4R1LA 4RC9A 2AC2A 1Z0FA 1YR9A 4GIBA 1RIIA 3N2GB 5PGMA 3F7NA 2HJGA 3ZHXA 3H13A 4WNAB 1HQCA 1WHTA 4PXSA 1UKYA 4HDOB 2VN8A 1TMGE 1EB8A 4CYMA 4LYFA 2GAFA 3S29A 1XLWA 3O4JA 4KE9A 5LM3A 3KB1A 2AG8A 2F48A 3AEZA 4I2VA 4O4HF 2ZM6B 2C7QA 1FJXA 3AW9A 4PSUA 4R8KA 5IJ0A 2GCPA 4QLAA 4W4TA 3KO8A 3OM0A 2WZQA 3ISTA 1X1CA 3QU5A 4LK3A 2PIDA 1COWD 2OO5C 4JJZA 4U2DA 3TIGA 1NJ8A 1NN1A 1VMKA 3NORA 3FZYA 4IV5A 4D80A 2R6JA 2VBCA 3IUBA 4EF4A 5EPEA 4N48A 2B20A 2ZE6A 4EVSA 4XWGA 4F60A 2WHPB 1Z4JA 2ATEA 3OZVA 3VX4A 1W4ZA 1HM5A 4HXFB 2PKRA 4RMJA 2QRUA 4IDOA 3CKKA 4K05A 2OMKA 5LQNA 3LFTA 3UEOA 1EXDA 5B3JA 1AZSC 2DU8A 1GCGA 2NTVA 2RAPA 5I7SA 4TOIA 3ZD6A 1LRJA 3KHSA 1JAZA 2WJAA 5DXAA 2CKMA 2OGTA 4P33A 2ZUCA 3ENZA 4KO2S 3DVRX 1D1TA 3VNAA 3GUVA 3HVJA 3OT5A 4MUBA 1XLTA 2BFOA 3ND9A 4ILKA 4TVKA 3RQIA 3UF0A 4OUDA 3ZCVA 3LT0A 3I8OA 5F1YA 4R8LA 5HF9A 1PUIA 3S5UA 4UAVA 4Z2YA 3W3ZB 3HK2A 1H2YA 4C20A 4M9XA 1ZEMA 1T6XA 1CS0B 2GGSA 3ESQA 1BCRB 3F2VA 3KQYA 3VU9B 4EG0A 2Q8QA 3KB8A 2H4YA 3L40A 4LXQA 1O8CA 4B76A 3LWDA 1LI4A 1LV7A 3NIFB 1T9GS 4RX1A 3K15A 5B53A 4B31A 3V2GA 5KQMA 2PU7A 3ROFA 1XDGA 5DWVA 4ZTBA 3FCOA 4JBXA 4EFDA 3ZHBA 2HLDA 1X92A 1WX1A 3L4SO 2EIXA 4TRMA 1XXHB 1O57A 2PGJA 4ZI2A 5JAMA 1WXFA 5IAJA 3RNLA 4JB2A 5DK4A 3L7CA 5JDIA 3VTFA 3K1AA 3O90A 4URWR 4EUFA 2ENWA 2ZJZA 1MD9A 4JP3A 2ZBRA 1AN9A 2AF3C 3BE8A 3H5WA 3ONNA 1WD7A 4QBHA 3F6RA 3U4IA 4YJ3A 1UBCA 4UDNA 3TWOA 4KDFA 2JRLA 1T8PA 4KNVA 3TZEA 3HADA 1ABBA 4XTRA 3D4IA 4D5GA 1OH7A 3SHFA 3MJEA 2YIVX 5ITSA 4C0KA 2WYIA 3WDMA 3EX7C 3NDBB 2EJVA 2HWUA 2ZJ1A 3ZLJA 2P2ZA 4R1MA 2VF2A 3HWX1 3MN1A 2V6IA 5B57C 3D6JA 1TT7A 3PWKA 3UKJA 3DT8A 3SYLA 2I1LA 2XVMA 3LQRA 4PZLA 1FTNA 5E0KB 1RQPA 2BCEA 4J4HA 1XZHA 4DLKA 3G7UA 4B71A 1DARA 2GYWA 2RH4A 4I81A 5KTPA 4GZ3A 5CVDA 4PV7A 1PWXA 5AHXA 3E9YA 2X2FA 5TPWA 4QOGA 3TD9A 4NZPA 2Z2XA 1TYDE 3G3EA 1AQ6A 1U1GA 1V16A 4KXVA 3VYTB 3AQ4A 3T1VA 2BI4A 2IYVA 4LFAB 5NLLA 3SZOA 3NHWA 2HDWA 4OVKA 3F5QA 3ZGLA 3KFLA 4ZYYA 2EKDA 4FXPA 2FMIA 5JD4A 3AL2A 3PDUA 4BX2A 1KVUA 4REOA 1QB8A 2KQUA 3E03A 4GKBA 4PHTA 1PZFA 1CZKA 5EJMA 1UK9A 2PUJA 5HILA 4ER6A 1BVRA 3GUCA 1MPTA 3QLUC 1RJEA 2DFTA 1ZMBA 3A37A 3KVYA 3IEPA 1GLGA 5AI6A 3I3OA 4FFSA 2WB4A 3ISVA 4N5IX 1RFGE 1Z5WA 1NPTO 3HR7A 2Z30A 2ROQA 3JAKB 1TCVA 3GVHA 4IFTA 1X7YA 3F3KA 3RK1A 3NP9A 4XD7D 3T3DA 3ZWWA 5C8YF 3GPDG 1ZMOA 4GYKA 2IUSA 4LHYA 4Y0NA 1NDHA 4L8LA 2O8FA 2X6TA 3Q7PA 4YJHA 3TSCA 4HNHA 2Y1CA 2Z95A 4Q19A 2X4LA 2BD0A 4LISA 2BFDA 1YU9A 2IXTA 4EHLA 1QRTA 1Y5MA 1A2BA 1DRUA 4IXDA 4CIBA 1ZITA 1PVDA 3FBTA 4R9VA 4YFVA 2ZSKA 2OVFA 5I7HA 4XFJA 1D4AA 3U7HB 1NRJB 1WV0A 4FNMA 5HKKA 2TYSB 3LPAA 4UE6A 1FDVA 2ACWA 3ZDDA 3NHZA 3ZVLA 4GP6A 4GOLD 1O8BA 1LJ8A 3P96A 5CCXA 4NZZA 5CX1A 1KU6A 4UAJA 4ES6A 1XTIA 3PQ6A 3QWHA 2PUEA 3T4PA 2M9MA 4D0GA 4E5MA 1VKOA 5CB8A 3EODA 3ON5A 4RFSB 3DCJA 4W7SA 5JSUA 1VECA 1U6IA 4KRYA 5FDFA 1DO0A 3ZY3A 4Y2JA 2F8LA 2P0EA 1XZCA 4DT1B 3IAFA 4FFRA 4I99A 3K53A 1CRLA 1H0KA 4GZ5A 1IM8A 7REQB 1EFRD 2D54A 1M0TA 1GYRA 3UA4A 1T3SA 4C7JA 2VYND 4CDNA 4FLEA 1DDOA 4EMTA 4R0MA 4BNKA 2PUVA 2RGWA 3H99A 5FBHA 3UHJA 3EGWA 4BP9A 5C5CA 2FETA 2QLJA 2NU8A 1FJHA 4CGZA 2ZAYA 4L16A 2BE9A 3W9YA 3ZK9A 5LBUA 2HT1A 1S9DA 3G8YA 5H80A 1HFWA 5DK6A 4EENA 2G6TA 4EI2A 2AEMA 3O83A 5C5IA 5DN6D 2VTBB 5EHZA 1V3TA 4KTTE 4BB9A 1E8DA 3PF9A 1UK7A 2DHEA 3RRXA 1GLNA 2EX0A 3O8DA 2J9FB 2OL4A 3ETJA 4R9UC 3C1AA 2PJUA 5AVYA 1JHOA 4K2HA 1MRSA 4PICA 2X86A 3PHCA 5BUSA 2W6ID 1Z2DA 4KSYA 5IKOA 4D98A 2JK1A 1VLLA 1EGHA 2VQDA 1A7KA 2ADFA 3OM9A 1VBNA 3VFDA 4BKOA 3OE4A 3V34A 2P27A 2PDAA 2Z5FA 4H1TA 2GH1A 2SCUB 1M7HA 1WPQA 1Z4QA 1L5GB 4HPJB 1Y81A 4R01A 5BWBA 3URKA 4D43A 2L0XA 5BURA 1YDMA 1BDIA 1P8AA 1REQB 4ZVSA 4GS5A 1FFDA 2G1UA 4JZKA 4DHWA 1JAIA 5A4AA 2XMGA 5HZGA 4ZI7A 4BMYA 1Y8QA 5TSDA 5EIBC 3LVFO 3ZWOA 3PX7A 2VJKA 4XVQA 5J2TB 3G13A 3UMSA 3ZQKA 4CI0B 3IB6A 3N6XA 1NVVR 2YVAA 4OH1A 2XA9A 1PJBA 3CNOA 4C3OB 1Z5NA 2A6PA 3M6MD 3IVGA 3BWEA 2VUTA 3BOSA 5KOYA 3EA4A 4KXUA 4OM7A 4PQRA 3BRWA 3EEFA 1JHZA 3A4IA 4IYRA 1UP6A 2IUEA 1U0FA 3SFTA 3HSSA 4PRLA 5ALNA 3ZZUA 4EITA 2JARA 3SVLA 4HFJA 3J80A 1RW4A 1SVIA 1NJ5A 4MCIA 4JFRA 4YRMA 1BA2A 1WG8A 1KP2A 2BONA 2CZCA 4MV6A 4LWQA 4RF5A 3RM3A 3RYIB 2YNMC 3T1OA 3RADC 1W87A 3I5MA 3B3FA 4NLLA 2JI8A 3QUBA 4QTXA 3C45A 1NR5A 1NVVQ 4E1VA 2X9QA 1FFEA 2PRIA 2RGAA 3CINA 2PH5A 4LNAA 2YY5A 3MWLA 2JFGA 2P75A 2JIMA 3WIBA 3I5YA 1Q6ZA 2JFOA 1VI5A 3CB4A 2Z08A 5IT0A 4KQ9A 3KEGA 1JIVA 5JAOA 3HQ4O 4QBKA 1DRWA 2NU9A 5E1OA 2BFMA 3W8FA 5JASA 1BFUA 3ILSA 3Q4GA 1ZL0A 3JD3A 4P0TA 3JZIA 5JV5A 2PIAA 5IJZA 3E0QA 4B6OA 4RH0A 3UG6A 3UOWA 1QZZA 3EQ7A 1P7ZA 1C2TA 2F90A 5TQ0B 2XCSB 1H3FA 4UUQA 3OQMA 2ONCA 4GMXA 5LC1A 2EZ4A 3EZGA 3HPQA 1T34A 1Y4UA 3NMUF 2WRZA 5JSFA 1KEWA 4LCBA 4P58A 5TVKA 3U3XA 5JALA 5JATA 3JARA 4HPWA 5C7YA 2ZXEA 4CT5A 5BT9A 1R4AA 3ESYA 1ZN7A 1K5PA 3OMXA 1Y4ZA 1DPGA 3Q3EA 1LBTA 1ZWLA 3HEMA 1K4YA 4GHWA 4U4AA 4Y0AA 3TMAA 4C08A 3H2JA 1V45E 2KMLA 4XJXA 2IZ1A 4Y7CA 3RIXA 4O25A 4P3XA 4FZVA 5CXXA 4CHTA 5FUWA 1HR0B 1BQ4A 2H1RA 5FBQB 2HNAA 2QUKA 4E2XA 5IANA 5T7BA 2NOAA 4DNFA 2DCUA 2HRDA 3KKZA 4YJ2F 5FH9A 2WAXA 2YQ4A 5EIBD 4IQ4A 3UAOA 3UV6A 3ZGXA 5DRYA 5JDCC 4FSXA 2C82A 1EQAA 1O97C 2HMWA 3DL4A 2SECE 4L9RA 1PLLA 2B9EA 4TKUA 4UW9A 5EEGA 5EJ9A 5IXJA 1UAAA 2GPYA 3DTVB 2QM3A 4FE3A 1ULHA 1IN7A 3E05A 2FE1A 2HK8A 2FN8A 2P6UA 2H29A 3Q0IA 4Y9RA 3ET4A 2ZKLA 1IYZA 3LY7A 5AW3A 1BDJA 1KJNA 2XB4A 1UQRA 1B8UA 2CF6A 3PEEA 3VPAA 4TT3A 4R4JA 1VLZA 2H3HA 2YHIB 2GF0A 3MVEA 4QDTA 2B5VA 1F48A 2W2KA 2XCQA 4JL8A 4FGLA 3V8QA 1GAEO 1YBVA 2AUTA 5AW6A 2Q4RA 4V38A 4C4AA 2VK4A 1FMTA 1MHPA 3WGOA 3DAYA 3S7ZA 5AD1A 3RFTA 4BN5A 3KOWA 4W5RA 4AYWA 1P6XA 3OLZA 4KBFA 3KETA 2PKWA 1H3EA 4TWAA 4HZUA 4D1YA 2XXAA 1VXRA 4UPVA 2HDOA 2XUIA 4I5GA 3OQPA 3OOJA 2YYZA 1AKYA 5FOVA 3L6BA 3T5TA 4AQ7A 4LJ9A 1GZ3A 3GCGA 4GLOA 5JMOA 2FK7A 3V3KA 2BHLA 1WHTB 2HM7A 1PNTA 1MBZA 2HREA 3GPIA 1YZHA 2NU6A 2IE0A 2W2VA 4QHSA 1IAVA 4ZOLA 4ZAYA 1XR3A 4B9EA 1F6BA 4ENUA 3U1BA 2BTQB 3N6RA 1QVAA 4JEHA 3RT9A 4DDVA 2BRUA 2Z0MA 3G2OA 3IBGA 4ZARA 3AP3A 1Q0PA 3ZDXB 1T9BA 2YZ2A 1P5ZB 1RLTA 3HO8A 1UJMA 4O2LA 5EINA 3FPEA 3MAAC 1BWSA 3THOA 2WUEA 1C9MA 4DC9A 1IN5A 5GTDA 1BS9A 3TR5A 3F4KA 4GW3A 2WTUA 3HYTA 3PITA 2ZAIA 1GA1A 1R8JA 4N5DA 4AB1A 1GZ6A 1L5OA 4ZCRA 4OMCA 4TYWA 1KP9A 1XDZA 4BNGA 5CCBA 3B60A 4NENA 4ZTUB 5DNDA 1QWOA 1LDBA 4QXPA 5ALTA 5JY6A 3OEHA 1A7JA 4GFDA 1DKLA 3I6IA 4LDQA 3RREA 3OM1A 1ARZA 4IHJB 3G6WA 3N86A 1JR3A 1NAIA 1WCIA 4IIJB 1G16A 1PJ2A 5SICE 1O97D 2RC5A 1DTWA 1WCWA 3NFRA 3FWKA 2E21A 4X44A 2MSWA 2WNIA 5JS1A 1CD5A 4CKEB 2QUZA 4DUGD 2JHGA 4J75A 2BR3A 1BC5A 4X6UA 4CETA 2AFHA 3FTPA 1ZI8A 2QJWA 1SXPA 3ILVA 2N47A 2JFZA 2NZ8A 2JBWA 4IOJA 1DEXA 1D5CA 1YBMA 2XOXA 4IDGA 4OQ4A 2KWIA 3PRYA 4YR7A 2CFTA 2B7CA 2C5SA 2Q6TA 2PX0A 5K03A 4EEXA 3R9WA 3ICQB 2XCIA 1R4NA 2EU8A 4MEAA 5EHXA 2OQIA 2YXLA 1Q50A 4ND8A 1M75A 2Y2UA 4YRGA 2WE7A 1WZEA 5ALWA 1YONA 1QPGA 5EWLB 5BV1A 3EEIA 2VPIA 5DWQA 4KE8A 4E5KA 1SQ0A 5CB0A 3K70B 1XRPA 1AS2A 4FC6A 4L5CA 4WVFA 3OX2A 4NJEA 2F4NA 2OUIA 1UMKA 3Q8WA 3LYAA 4WZBE 3KP1A 1G9XA 2XF8A 3C6QA 3H6KA 4EA8A 4E2WA 1MQSA 1DO2A 4RHXA 4UU0A 2R8XA 1FLNA 3UCFA 2UVPA 4H7JA 4ZJZA 1QP0A 3QE2A 1E1RA 1GG8A 5KTYA 5LMCA 3L7KA 5KSPA 3V4RA 2BOVA 2ZBPA 4HY3A 5DHAA 4QODA 1KI6B 3GEIA 3OFNA 4INJA 4G41A 3NZEA 1VIYA 3GBSA 2O2XA 1LFAA 2QRLA 3OX3A 4GZ6A 3GFGA 4REMA 4MQ5A 1EWTA 4U5XA 1C29B 2QJRA 1IVNA 5EMHA 1IJKA 2H4XA 2PO7A 1O9BA 1RHKA 4O1HA 3ABRB 4UTVA 5KYGA 3FI9A 5G4LA 2F3UA 3NOOA 3Q7EA 2A5YB 3GK3A 3HKCB 4RGQA 1E89A 1G7RA 5DF1A 4UTRA 5I7RA 3JVIA 4HR7A 3AFNA 4GWGA 4B48A 1GFIA 5CDFE 1IPHA 3ANNA 1PNQA 5CLQA 1JIIA 3DFIA 5KWIA 3FNGA 1X7HA 5IBCA 1VLJA 2OTCA 3A1EA 4C7BA 2G8LA 5HKAA 1QFJA 1TVCA 3BB1A 1U7DA 1YRAA 5K01A 2DHRA 2A0KA 2ZS8A 4X7MA 3H11B 5LZ5A 5KWEA 1BDHA 4MWBA 3SS8A 2E7ZA 3AVWA 2AA3A 3N3AC 3ZU6A 1JHRA 1WQ4A 2COKA 3FPBA 4MMXB 5FFFA 4EJSC 5JZOA 1LXCA 1N0WA 1MIHA 3OKAA 3R1IA 3U44B 3VMFA 1WZNA 5LP1A 1HA3A 4ZAGA 4J2OA 5IFKA 3IDSA 5ALZA 4GU5A 2W37A 5KYUB 1T2UA 4HGNA 4OMDA 2WLTA 4TVBA 4PZYA 2WFZA 2OFOA 4S1PA 2H4FA 2Z6QA 3WO1A 2JEYA 2HJSA 1UC8A 1ECCA 2AYZA 4ZN6A 4H2DA 1W1WA 1RADA 2PSEA 4NYJR 4EFMA 4BVKA 2WTNA 1X42A 1ZPDA 2JANA 1PZHA 1CDZA 2QTWB 3KBBA 4OI4A 3W04A 4E5VA 5A5DA 1TUEA 2PX2A 5FPQA 1BE8A 2BDEA 3VQTA 1JLSA 1PQWA 1CX9B 4GSYA 4Y9UA 1GZ7A 1GXSB 1L7QA 5DEIA 4NDNE 1JG1A 1QHHA 3EJWA 1YR6A 2KE5A 2XQGA 1BHO1 3IJ5A 4GPAA 4KPGA 5J47A 1AUOA 1YO6A 3ZCPA 4WXPA 2GEUA 1GP2A 3AUXA 3OAAD 1NN3A 3L8DA 2XYVA 2XTAA 4E4TA 3SQWA 1PL8A 3QA3E 1IEVA 3OQVA 1T5TA 2J3QA 5CVCA 1FDOA 3TCNA 3DEKA 1X2EA 4NPCA 4BJ6A 1EA5A 1PFWA 2W0SA 3UA3A 4FXOA 1LDGA 3PZBA 1XCLA 3F78A 3FW1A 3TRKA 3DV0A 3DP9A 4RPHA 3LKZA 1BQEA 1DOAA 1CBUA 2JI9A 2PRKA 2QTFA 4IUBS 1SHLA 3AR2A 1U0TA 1IFXA 1TM3E 1HNNA 4HDSB 1U8XX 4PRKA 4WFIA 5WRFA 4BJHB 1G4UR 4D79A 4EKNB 3EWAA 4CG1A 1CNEA 1VL6A 2O3QA 2IPLA 5DNVA 4ABTA 4LDRA 1CERA 1F60A 5DLDA 5DW0A 1XMVA 4UUNA 2GNPA 2X13A 3VHXA 4N3AA 3ZXXA 3MCTA 5I51A 3KQLA 1W5TA 2YINC 4PSVA 5JMWA 1XTVA 2IH5A 4W9NC 3GT4A 4CV2A 1LLQA 2HTFA 3R75A 2FG6C 4URZR 1M33A 2B1JA 2LR0A 3O94A 5DULA 4P2GA 3VKGA 5EPOA 3QVWA 3AVYA 4XYGA 3HLTA 4MVJF 4Z1MA 1N0VC 2IOFA 3U7EB 1N75A 3DBVO 1RZUA 2IYLD 4KO3S 4EHNA 3UV3A 4EAQA 1WBJB 2AVNA 2JHCA 4G2TA 2Q6LA 2R6DA 2VI5A 3E9CA 1X8LA 3WK9A 4PPYA 4CCYB 3ONWA 3PGXA 3STVA 4A8PA 3EBOA 4KLAA 5AM2A 5I7UA 1OIVA 3RAEC 1D1QA 2OWDA 3L7IA 4ZZ2A 3IBFA 3RJ9A 1HYGA 4B7UA 3OE7A 2DPGA 2IZ7A 2WAYA 1AF4A 3H4IA 1E4VA 1YR3A 2YHBA 5J23A 6LDHA 2DKFA 3C16C 3ZXSA 3FY4A 3C7KA 4JJKA 2FWPA 3EXFB 1W6UA 1NJSA 3JVVA 1M2EA 2ZRPA 5CDSA 4TRJA 3C6ZA 4M87A 4WOPA 4G8DA 1UXGA 2N0SA 2O6LA 3QX9A 4P4GA 3KLOA 3LUKA 1YIDA 2ZUWA 4IR7A 1DWUA 3LXUX 3GJYA 3T7JA 3DPIA 1E2KA 4GXTA 5TLSA 1X13A 1FA9A 4IJUA 5CLIA 3T0IA 5FBVB 1RPNA 3HVUA 4LZNA 5KDLA 1XXHE 2R11A 2C8VA 3FOFC 2AXEA 1VG0B 4QTUB 5JE8A 3T4EA 4CM5A 5JAHA 2QU8A 3IUQA 4YV2A 2WBLC 3F97A 4OGLA 4KQIA 4TTAA 1X0XA 1CUGA 3PX3A 3BGVA 4HO1X 4M21A 3QKIA 4QJIA 4PVDA 1BGWA 3CVUA 1N5LA 2BRUC 1Z8HA 3L0DA 3EUEA 4U7FA 3DAHA 3N7AA 3K2QA 3RYFB 4RF2A 4DW8A 4TV8F 1DGQA 4YASA 4NECA 4QELA 5KWSA 2QQ0A 1CQIB 1NVAA 1Y6JA 4MPDA 3UJPA 4BTVA 2I6XA 4EABA 3JQBA 3OPYA 5ENVA 1IN1A 3RYCB 4IIHA 1GKYA 3F8SA 2OLKA 9LDTA 1DAPA 5BV8A 4BLQA 5IJ9A 2Y99A 3NDRA 4F8YA 3GNLA 2DQZA 4DDTA 3VZCA 2Z8YA 2WZDA 3V8MA 1TZ2A 2PGAA 3P0HA 5FIUA 3WY9A 3ETEA 1GQYA 2DFKB 1K98A 4LJRA 4EX7A 4WZAA 2TSYB 3UWOA 3KYJB 1C4XA 2QGZA 3LBAA 4QC2A 2IY9A 1KMMA 3HYNA 3FLMA 1DG3A 4YUWA 2IOFK 4K81B 1WMAA 2PA3A 1Q0ZA 2C2BA 3NM4A 4WZBA 5REQB 2QZJA 4N6OA 4JJGA 4KRXA 4Q24A 4LWOA 3TJRA 4BKPA 4CM3A 2GZMA 2QIPA 3GHYA 3C0KA 4CKYA 1YZUA 3UK2A 5KDDA 1ECGA 1NUQA 4Y3UA 5KU1A 4Y98A 3WXMA 3Q3VA 1BKYA 2JCXA 2NO7A 4MKXA 5IK2A 4KPUB 3GJ5A 3BH7A 3OESA 3OQJA 4N3NA 4A6XA 4EB0A 4NDZA 1W1UA 3GCZA 2QXUA 2QTAA 2AI3A 3BKWA 4JSYA 1ST2A 4L27A 5DM2A 1Q57A 5DYIA 3WP0A 4F3CA 3R09A 3W0LB 2EBFX 4K9MA 2AIRA 3T3NA 4IG9A 1LFDB 2GBFA 4LXGA 2I7VA 3WWZA 4IKEA 4A73A 3K0AA 3ZWBA 2QX8A 3EFEA 4JX8A 5HK9A 1V11A 1NPDA 3I45A 2D2FA 4FYJA 4DAEA 1Q77A 7ABPA 2A9PA 2IOYA 3OAAA 2IXBA 2A5LA 3CXRA 1RHMA 4II2A 3UT5A 1TC2A 1XP8A 1TTTA 3OQHA 1KAQA 2A0XA 2JFWA 3NXKA 5CLGA 2C7RA 3KJXA 4Z0TA 2CY0A 3UICA 4M9SA 5JCJA 4BUCA 2XXJA 1I2CA 3NTQA 1FFWA 5CLJA 4B3CA 1NRWA 2OHHA 3PD7A 4W7HA 4EF5A 1YZVA 3B51X 5LQKA 1JIUA 1NT4A 2ZXUA 1VHJA 1ZVJA 3KOOA 3X2FA 1GPWB 4PLZA 5EMMA 3LRTA 5I8PA 2E48A 1CUVA 1RI1A 1MGOA 2MMGA 1TMYA 3C1UA 3HH8A 5D00A 1TTQB 3EPHA 1FMFA 2VT3A 4PNEA 3ENNA 3DL7A 3TQRA 3W7AA 2QYSA 4H1UA 1M6VA 2JGFA 3WHKA 3CF6R 1FDUA 3TXXA 2GZHA 2FG7C 2RGGA 1CUDA 2XCLA 3H5OA 5HM6A 4OHZA 3L4JA 4JXJA 1ISGA 3IT2A 2W90A 1BROA 2Q1UA 3HB9A 2WPDA 521PA 1QYXA 3HO6A 5F7ZA 3FR7A 5JFTA 3NHPA 4I08A 3HUDA 1JAYA 2O2ZA 2VHXA 2ZRGA 4MWEA 4RESA 4IRUB 5EIWA 1E4EA 2VHEA 2FAXA 3LQYA 5BQOA 1NVXQ 4OPMA 2QI9C 4WE3A 3HP7A 4N0MA 2VHZA 4ZANA 1QRUA 1EXNA 4DLVA 3IIJA 3NC0C 3AVXA 4EUSA 1O5OA 3EGXB 1E3LA 2FJUA 2XDQB 3DBRA 3GH1A 4JIGA 1O1YA 1VZ2A 3GLFA 1GA6A 4Q1FA 4DV4B 4MIOA 2WDZA 1XVVA 4HNAA 5CPFA 1WXGA 4GUDA 4IDHA 4JJAA 2FMHA 3PXXA 2JEOA 4JLJA 4JLVA 4M1EA 3FUTA 5KTTA 2IEBA 2FFRA 2P40A 2Y1WA 5CBPA 3SE0A 3WL7A 3VR1A 5CT8A 3COWA 4WFJA 4XD2A 4MB2A 5KYKA 1A69A 1VHQA 4MR8A 1B6SA 1ZH6A 4NCIA 4Q3OA 3G7SA 3KXIA 3VYSB 5J2TA 4A16A 1GGHA 4XGQA 3LP5A 4CLEA 3AM5A 1GGEA 3L01A 1QQAA 4MRAA 4W63A 1OPRA 4WRRA 2XA1A 3V1NA 5IU6A 1OAAA 1M2JA 3HB7A 1WLYA 1T26A 4MW0A 4ZT7A 5JROA 2HSEA 2PY6A 3KAQA 4H7IA 2VAXA 3I01A 3T5CA 1VKHA 2ZRKA 3MMXA 5GOTA 1JHMA 3CRMA 4G5QA 4WEOA 1QIEA 2NN3C 2RC6A 1XIVA 4WOJA 2PZGA 1QVZA 1I10A 4MX8A 4RQTA 3P52A 2H0AA 1AZWA 3PTZA 4BKRA 2PKEA 5F98A 1X9GA 1BH6A 2AG5A 2H17A 2IYYA 3C8MA 3V1MA 4EG3A 2JGRA 3HVHA 3OMWA 4PBTA 2VPYA 3V5NA 4LOJA 3F4BA 3F6SA 4FJ0A 4O8CA 3Q5GA 1XNGA 4LX8A 4KH1A 3DE5X 5HWSA 1PCXA 3FYCA 4NZMA 2D6FA 1EEXB 1R0BA 2Q4BA 4IWYA 4Z9AA 3EY9A 3BZWA 3NFYA 1JEQA 3PUXA 3A6FA 5JNRA 4TM7A 4I8IA 4RFVA 5A05A 1EI9A 2X9LA 1KJJA 3PJFA 2EGUA 5ALEA 3QY9A 4XOUA 3IP3A 2KX7A 1DCFA 2FOIA 3ZNPA 4QOFA 4AZ3A 5AUQA 5HNKA 4WLEA 4RLSA 1EG7A 2DBYA 1NWCA 2OAGA 1I7NA 4JYMA 3V8EA 1C4OA 3EYAA 3HNPA 3MYRA 4LZPA 3WO0A 4QZVA 3T7AA 3FOAA 1M54A 4CKCB 4F96A 1JJFA 1D8AA 3KKNA 1HLFA 2XADA 3D4PA 2GILA 3JD1A 1A9OA 1T35A 1KPIA 1X8KA 2P6PA 4B47A 4A5SA 4C7XA 1LGYA 4QEKA 4CXMA 1T5SA 2YUIA 4GKAA 2VLBA 3EXIB 1RLOA 4O4LA 4OQLA 3QTLA <