4ZI5A

Crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
239
structure length
239
Chain Sequence
GAMTARKVDYTDGATRCIGEFHWDEGKSGPRPGVVVFPEAFGLNDHAKERARRLADLGFAALAADMHGDAQVFDAASLSSTIQGYYGDRAHWRRRAQAALDALTAQPEVDGSKVAAIGFCFGGATCLELARTGAPLTAIVTFHGGLLPEMAGDAGRIQSSVLVCHGADDPLVQDETMKAVMDEFRRDKVDWQVLYLGNAVHSFTDPLAGSHGIPGLAYDATAEARSWTAMCNLFSELFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords P91
publication title Ultrahigh-throughput discovery of promiscuous enzymes by picodroplet functional metagenomics.
pubmed doi rcsb
source organism Metagenome
total genus 81
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2015-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zi5A00
4BRSA 4BP9A 4X95A 5EIAA 5K3DA 5KBYA 5JASA 4KRXA 3VKFA 5C7YA 5IKXA 3HACA 4N8EA 1O6FA 1XQWA 1XQYA 1MX1A 4UBJA 4B84A 4UBOA 2Z5GA 5HF9A 4BVKA 4U2DA 2I03A 3QZUA 2OQVA 1RP1A 1O6GA 2QXUA 3WK4A 3PFCA 3C43A 2XI4A 1G5FA 1CV2A 1GT6A 3I2FA 5ALZA 1MT3A 5JAPA 4OB8A 5SYMA 1LZKA 4G4IA 4X92A 5ALJA 1VKHA 1NU6A 1B41A 3AJAA 1XZLA 3WWDA 5I7UA 3ZLVA 5ALPA 5LKRA 2I3ZA 2IX9A 3G02A 5JAUA 2VATA 2O2GA 2BUAA 3DOHA 1GPNA 1ZD5A 1BCRA 4DSAA 5EFZA 4B83A 1M33A 4ZREA 4QA9A 5JANA 4Y2TA 1TCCA 5ALSA 3QPDA 4GECA 1MO2A 5AK4A 2GBGA 2XUPA 3RARA 4UBLA 4QLOA 4N8SA 4JUIA 3WL5A 2ZJFA 3NOXA 4GBGA 1OXMA 2ACEA 3M81A 3NWOA 4RPCA 2DHEA 3ESCA 3R3XA 2RI6A 1VE7A 2XUGA 2WIJA 2XUHA 4FWBA 4AN1A 5A62A 2OG1A 2IITA 4WFJA 5CH8A 4X00A 4BCBA 5EIHA 4DNFA 5ALOA 2HU5A 1B6GA 2H1IA 1UOOA 3V1LA 1N5RA 3H2JA 1E8NA 5AI6A 3STXA 1W52X 4WFKA 3ZI7A 2FJPA 4HAIA 3V48A 2JGEA 4J0KA 1AUOA 3WWPA 2H7YA 4L3WA 4Y2YA 3D2CA 3GZJA 3EQ8A 5AI0A 1GKLA 1LPBB 4BB0A 2OAEA 4FLFA 3AZQA 4FLMA 5E4JA 3GUUA 4PW0A 3VXKA 5DWDA 2PSEA 3EQ7A 1JT2A 2ZYSA 4UHHA 2XMGA 5LP1A 4I19A 3WYNA 1CUHA 3OPMA 4MYSA 1SCKA 1WM1A 3DYIA 3DS8A 3C6BA 3DNMA 3MVEA 2WUEA 3I28A 2CJPA 2EEPA 5AKXA 4JYPA 4CG3A 1SCIA 1Y7IA 4X6UA 2DQZA 2HA2A 1JU3A 4OUKX 3NUZA 4TGLA 3A6ZA 2J4CA 1VZ3A 4AO6A 1ZICA 5AI5A 2PM8A 4KE7A 4DSZA 3D2BA 2J4FA 4PF1A 3EIOA 2V98A 4U2BA 1UK7A 3C70A 1QIEA 3MUNA 4UBNA 5I8PA 5CT4A 2AJDA 3WK6A 1YAJA 5JADA 1R4ZA 1ZGCA 3ANTA 1WB6A 5T4HA 1EK1A 4KE9A 2RONA 5JZSA 4H7HA 4UHEA 5DNUA 3G0BA 4OD0A 1QFSA 3WWOA 4BVLA 4DYHA 2WJ4A 4LKOA 5DYTA 4TVKA 4D9JA 3H19A 1CUXA 1KU6A 4KR0A 1F8UA 3EBLA 3QM1A 3I6ZA 3VJKA 2HRRA 1GXSA 4KAFA 2Y2VA 1WOMA 3ICVA 5JAHA 2WTNA 5FV4A 3O4JA 1UK8A 5KWIA 2WFZA 1ODTC 5JARA 1QIDA 3AIOA 4X6YA 5ALRA 3AIMA 1T4MA 3ESBA 3DLTA 4S0XA 1NU8A 4K5QA 3VJMA 2ORYA 5AKHA 2NW6A 5E2IA 1YAHA 4J0CA 4QDXA 2XQIA 2OGZA 2JGJA 2V97A 4WCVA 4C01A 1AX9A 1R9NA 3H1AA 2PVSA 4GDMA 2XDWA 5HKAA 3G9UA 5K3FB 3G0DA 1A8UA 4FNGA 4B85A 2VJCA 1Q0RA 5FP0A 5E4YA 3BL8A 5CT8A 3WQHA 4B7ZA 2Y6VA 2J3QA 5ALDA 4DLNA 4OCZA 5HQ3B 1MX9A 4YX9A 4M0MA 1MJ5A 2WUFA 3FCYA 2BGNA 3QVMA 3V1KA 4AO8A 4OSEA 2BUBA 5JZBA 3DKKA 2BGRA 1GPKA 2AJ8A 1XLVA 2PSDA 1CUUA 4BAGA 2XMRA 1YA4A 2QRUA 4ARAA 4LXHA 1BS9A 3DQZA 1K5PA 3I1IA 1SCQA 3IIIA 3I2IA 3HJUA 5BV7A 4W1QA 3OC0A 4W1SA 5CRIA 1FFDA 1X2BA 3WKDA 2VJDA 3AILA 3FYUC 1EDBA 5ALHA 1UKAA 1CUFA 4BZZA 2G63A 5ALVA 2WFMA 3WZLA 1EI9A 1BN7A 4ZV7A 3B12A 4IO0A 5CURA 3GBSA 1ZGBA 1YB6A 3O4IA 5CT5A 3GROA 5CT6A 3AIKA 3IBTA 3Q0TA 5J3JA 3EF3A 4WY5A 5HZGA 1GZ7A 5CT9A 1JJIA 3MGAA 1K6EA 4OYLA 5ALWA 4NS4A 1QIKA 1LNSA 2GZRA 1XRLA 2HA6A 1HLGA 5AM1A 1XFDA 4KACA 5A2GA 3WK8A 4C88A 2JGIA 4RGYA 4FBLA 1ORWA 2OGSA 3BWXA 2HIHA 3VVLA 1IVYA 3WKBA 4DMKA 1CUGA 4ZXFA 3Q8WA 1IZ8A 2ONCA 5JD6A 3D5EA 1VXRA 3HXKA 3F8SA 1Y7HA 5KWJA 5FUMA 3I2GA 1TCAA 3D0KA 4CG2A 4GW3A 4GHWA 1A7UA 2I78A 3WWCA 4G8BA 3QMWA 4H18A 4OU5A 2WILA 2B20A 4PSDA 2O2IA 3QH4A 4AXBA 3AZOA 4P93A 4BAZA 4ZRDA 3L1JA 2QM0A 1QO9A 4FBMA 4CIBA 2Q0XA 3WL6A 4KEAA 4RE5A 1W75A 4LYEA 5A6VA 2C5FA 1AC5A 4K2AA 5D6OA 4QDTA 3IA2A 2QMQA 4FFVA 1G4HA 2WIGA 2HADA 4EY4A 3BXPA 1DT3A 2BUCA 1UKBA 5K5EA 4H7JA 1YS2X 1UFOA 1VLQA 5IVDA 2OGTA 5AM4A 1LPMA 4W63A 3DJYA 5AOCA 3OOSA 4QEKA 4UBMA 3WJ1A 3IDAA 2G5PA 1EB9A 4DNOA 3QYJA 4MEBA 5ALQA 2HU8A 2AXEA 6YASA 2XMCA 2XMDA 2XUDA 2JGLA 5AM0A 1L7QA 1XLWA 4MWTA 1HBJA 3HI4A 1U4NA 2DR0A 1Z68A 3OTQA 5CXUA 1X70A 4QWMA 4U2EA 5CBKA 4W1PA 3M3DA 1EH5A 3FLAA 4FLEA 2LIPA 3KOOA 2ECFA 3G0IA 2GZSA 5H3HA 4X3CA 3HEAA 4OPMA 2W6CX 1CUSA 5EI5A 3BE8A 3H2IA 2XT0A 1MTZA 5AM5A 4HRXA 2JF0A 4BVJA 2HM7A 4MYDA 4F0JA 2XUKA 4MQLA 2PUHA 2WKWA 4A16A 1UKCA 3S8YA 5A7GA 1USWA 1WHTA 2VT6A 5AK3A 1Y37A 3EQ9A 4J0JA 1FFAA 3WA7A 2VF2A 4BDSA 5HFAA 4H7EA 1QIMA 3KWFA 5HK8A 4J3JA 1U65A 1SC9A 2VJBA 4Y2XA 4KAJA 2H7XA 4Q3OA 3O95A 1QE3A 1W1IA 3IULA 5LIPA 4KJXA 4FMPA 5AH0A 1CUYA 1EX9A 4CFSA 4E46A 4TPKA 4Y9SA 2X76A 5EHZA 1JJBA 4DIUA 3RM3A 3ESDA 3R3VA 4UHBA 3X3HA 1K63A 3B5EA 2OPHA 4BCCA 2XUJA 5IVIA 4C4ZA 3LIIA 2OCIA 1XRNA 1J06A 3FSGA 2HRQA 1JFRA 4B9AA 4MXDA 3IUQA 2QXTA 5T4EA 4INZA 3G0CA 1WB4A 3I2JA 3MUOA 1D07A 2OLEA 2EDCA 1K4YA 3O9VA 4C89A 5FLKA 4HRYA 5CW2A 5DYYA 5JYCA 4AN0A 2H7CA 4EY8A 3F9CA 4UBKA 2XUFA 4GXNA 5LYYA 4DNQA 4X85A 5HF5A 4X93A 1FFCA 1XZCA 2C0QA 2O7RA 4UHFA 4X71A 1LPAB 5AKZA 4BE4A 3FVRA 2FX5A 4HXEB 2WLSA 4OU4A 2CB9A 5AKEA 2PX6A 1EA5A 1DQZA 3AZPA 2XQJA 2OCKA 5BOVA 4JNCA 1OILA 3CCBA 4J0HA 1CUVA 1DWQA 3O0DA 1CUWA 3D2AA 1ZI9A 5ALGA 4EB0A 1UK6A 4WDRA 1RYYA 4WJLA 5AM2A 5K3CA 2D0DA 2WG0A 1JMKC 4PSUA 3W2TA 2WG1A 4IHAA 5DYWA 4Q34A 5AJHA 4WY8A 2ACKA 5AKIA 1MN6A 2EDAA 4AZ3A 4H7KA 3HC7A 4UFPA 1DTEA 2WJ6A 4ITVA 1XZGA 1TIBA 2JGKA 1JJFA 2WSLA 2QTBA 3KWJA 4FHZA 2PSJA 1YSCA 1IUOA 2CKMA 5ALFA 3R41A 1ZI8A 1CUIA 2H9YA 3PICA 4PQEA 4G9EA 1UZAA 5AICA 1LZLA 4Y2JA 1H23A 3PUIA 5ALTA 4UBIA 1GKKA 1PJAA 1Q84A 4U2CA 3A70A 3RLIA 4F21A 1AZWA 4I4CA 1HDEA 4NZZA 4P9NA 1CUDA 3IUNA 4L72A 1OCEA 1AKNA 1L7AA 3VVMA 3I6YA 4X90A 3WK5A 3RKSA 3H17A 1I6WA 1ZI6A 1VE6A 3DKRA 4J7AA 2HA3A 4Y2PA 1XZFA 2W22A 5C81A 5A7HA 3GELA 1WCYA 5C8XA 3HLKA 3AINA 4LYDA 2Z8ZA 1R50A 3W05A 3P2MA 2RAUA 1LGYA 5EHQA 1RWQA 1MAAA 4AZ0A 2I3DA 1XZDA 1JU4A 3WKAA 3WMRA 5DTIA 3SX4A 3H2GA 1C7IA 3W06A 2WIKA 3DCNA 4B81A 2WUDA 4IH4A 3BDVA 4OB6A 2XMQA 3JW8A 5AIAA 3BJRA 3G7NA 4JH0A 1UWCA 4NMWA 2Y6UA 5KREA 5AKJA 3G0GA 4O08A 3F67A 2WHPB 4BZWA 1VXOA 2XB6A 2RHWA 2WU4A 3I6MA 3T52A 5LZ2A 1CQWA 1P0IA 1XZAA 3WWEA 1F0PA 2AJLI 4M0EA 2WFLB 1J1IA 4BAUA 2DCMA 2YH2A 3KDAA 1FJ2A 4ZV9A 1TAHA 4E14A 3O4GA 5LLSA 4BC1A 1ODSA 2BKLA 4A23A 3WI7A 5LKAA 5AM3A 3TJMA 1WPRA 1BE0A 5D3KA 5HF6A 3STVA 1EDEA 3H2KA 1K8QA 3CN9A 2JGFA 1R88A 2Y2UA 1QIIA 1BN6A 3G9TA 2JEZA 3PE6A 3QPAA 3QMMA 2QT9A 3UUEA 2WG2A 2PSHA 4X7BA 3ICWA 4PNZA 2WHRA 3H2HA 1QO7A 1VOTA 3VISA 2ZSHA 5DJ5A 2BAGA 1LPNA 1NX9A 5CTAA 3WA6A 3FAKA 4F60A 5IVHA 1UXOA 3LP5A 3LLCA 3WKCA 2PL5A 4H0CA 4H7IA 3D59A 4UHCA 2XQGA 4W1RA 4UUQA 3C8HA 4KYVA 4RE6A 1KU0A 1MPXA 4Y2UA 4BC0A 1XRPA 2HFJA 3V1MA 1W4LA 5FPQA 2QKYA 1MU0A 3ZV7A 4X91A 2CUTA 3QPCA 1CUBA 4U2GA 1EB8A 4EY5A 5JATA 2GYUA 2ES4A 1QIFA 5ALYA 4KE6A 2GBFA 4CG1A 1YS1X 4DTCA 2FUKA 3DD5A 3S2ZA 3C87A 3L1IA 3IVMA 5FDFA 4YPVA 4LXGA 2WUGA 4FKBA 1W76A 1GQSA 1EVEA 4FNMA 3V1NA 1E66A 1BROA 4I3FA 1IMJA 3UUFA 3WLAA 3B3QA 2IIVA 4KRYA 1DWOA 4RNCA 3YASA 1ODCA 4GWLA 1H22A 5AI8A 1N5MA 3KD2A 3ZLTA 3FBWA 2QJWA 3SK0A 3E4DA 4QLAA 3HZOA 5K3BA 4PO3X 2WU3A 4XIIA 2HA7A 2XE4A 4W9RA 3TRDA 4WFIA 3T4UA 3FCXA 4AMYA 1WHSA 3N0TA 4X94A 5LZ9A 2VAVA 4H7FA 2JGMA 1QGED 1UOQA 2RGUA 1P0MA 1IUNA 1XZHA 2XLCA 3FNBA 4AO7A 1QIGA 2VTVA 1P0PA 3F96A 1E5TA 3HRHA 5JAOA 1AMNA 1KEZA 3PI6A 2Y1KA 1W6RA 1X2EA 2ZYRA 2ROQA 5HCUA 3M83A 4Z49A 3K2IA 3KSRA 3PFBA 2CZQA 1BU8A 2X8BA 2XUAA 1H2YA 2CMFA 2WQZA 3BIXA 4L0CA 3U0VA 5AOBA 1HQDA 3I2KA 1Q83A 4EY6A 3FSGD 5CMLA 2G5TA 3WJ2A 3D7RA 3TEJA 1UK9A 4BTVA 4UPDA 1F6WA 2WHPA 4J0IA 1LBSA 4UHDA 3ESAA 3ZLUA 1ZOIA 2QUAA 2XUOA 3WYDA 4N5IX 2UZ0A 2C5GA 4GI1A 2OQIA 1P0QA 1AQLA 5HFNA 4Y7DA 5K3FA 1L7RA 1LBTA 2X5XA 1YR2A 3BIWA 5CXXA 4B0OA 4C4YA 3PF8A 3WL7A 5HQ3A 1J2EA 2OCLA 5AI9A 4EHBA 5EHNA 1QFMA 5ESRA 1G66A 4HZGA 4IQ4A 5ALLA 1ZD4A 5ALKA 1XROA 1CPYA 4LIPD 3QITA 5D3ZA 3BF7A 3LS2A 1E89A 5AKGA 3ANSA 1VJ5A 3F97A 3I1YA 4G8DA 4Q1VA 4JYMA 3GFFA 1XZJA 7YASA 1ZJ4A 3BDIA 4Y2RA 2R8BA 3BJMA 2OCGA 1UT6A 1DU4A 4X97A 1F0NA 5AK6A 4CCYB 2O7VA 1DINA 1FFEA 1MNAA 2ZVDA 4DMCA 1CRLA 1VA5A 2V96A 2WJ3A 4EA6A 4G1FA 2VA9A 4QDUA 5LZ5A 2ZJ7A 4EY7A 4F5ZA 4U2FA 3C6XA 3WIBA 2QZPA 4BDTA 5LZ4A 2WHQA 2XUQA 4IH1A 2B61A 2J3DA 2WM2A 2HU7A 4YK7A 3E0XA 2P8SA 1TQHA 2QVBA 1QIHA 2VEOA 5ISMA 4K6KA 5EIEA 5ALNA 5FPPA 5DLPA 1XZKA 2HDWA 4IH9A 3HYSA 5JD4A 1XZEA 1EK2A 4G5XA 4J0DA 2ZYHA 4Q3KA 5ALXA 3M82A 5AKKA 1EHYA 1UOPA 4MQMA 5AP9A 4DMFA 1DT5A 5BWBA 1A8QA 3CCCA 4QNNA 4AQDA 5D7BA 3R3YA 4UFOA 2CEKA 1YB7A 5T4FA 4E15A 2RHTA 4J0GA 3R3ZA 3BF8A 1TRHA 4MWSA 3H18A 4N5HX 1DX4A 1E8MA 5AOAA 2G4LA 4FFWA 3A2MA 4OYYA 4CIAA 2OXEA 1XZBA 4CI9A 1H2XA 3IB3A 3A2NA 2HHAA 4QDOA 5ALIA 5LZ8A 3ILSA 1CUAA 1JI3A 1WB5A 1ORVA 2VAXA 2YXPX 4AMZA 1U8EA 4A5SA 3E1GA 2Z3WA 2Z8XA 2D5LA 5FKJA 2DFPA 3WK9A 2ZYIA 1ZIYA 1CVLA 1R1DA 4B80A 1S8OA 3CXUA 4Y2SA 1QOZA 4EZIA 4BRZA 3AUKA 3SC2A 4ETWA 5LZ7A 1CIJA 3C8DA 3STYA 1QONA 1HPLA 4BTLA 4C4XA 3F98A 1A8SA 3OM8A 1CLEA 5A7FA 3W9BA 4FTWA 5FXMA 3STTA 4BCDA 3IUJA 4G8CA 4C6HA 2B9VA 3G8YA 2GBIA 3AFIA 1XZMA 3NGMA 3R40A 2HL6A 1T2NA 4EBBA 1PFQA 2QUBA 3L1HA 5HK9A 5JIBA 1FSSA 4QE3A 5JZ9A 2PU7A 3C6YA 1TK3A 4KAAA 3W04A 5AKLA 3IURA 2GYWA 1QZ3A 2WIFA 2PUJA 2WTMA 1G42A 3FLEA 4HVTA 4Q05A 4ZGBA 2DQYA 4P92A 3STUA 1QLWA 4XWGA 3A2LA 2JIDA 4N8DA 1A88A 5BWCA 4DGQA 1WPXA 3LIPA 4BATA 3FYUB 1CUEA 4JEIA 3IUMA 1ZIXA 1YASA 4CCWA 5EHXA 4B9EA 1H2WA 4CCYA 1QIJA 4L9AA 1HKHA 4WDQA 1LLFA 4J03A 1MAHA 1R3DA 4ZI5A 1FFBA 5DNVA 2PPLA 4HXGA 1E8DA 2XQKA 4ROTA 3C45A 4V2IA 1SOMA 4QDZA 1GGVA 3R3WA 1PV1A 4HXFB 4MJ3A 2O2HA 4UFNA 1JKMA 1QTRA 1N8SA 1DQYA 3HABA 4B82A 2HA0A 4AX4A 1XRQA 4C87A 3K9BA 4OB7A 3PUHA 2QS9A 1QJ4A 2AJCA 1EXWA 1ISPA 1C4XA 3DEAA 5AI4A 5AKYA 5SYNA 3D4LA 1CUJA 4XVCA 3I2HA 4LHEA 1LPOA 4H77A 2OAGA 4XX1A 5AO9A 3TGLA 1MNQA 2XMBA 3WK7A 5C8VA 1XZIA 3FYTA 1C7JA 1XLUA 3ZWQA 1R9MA 1XKLA 3C5VA 4G4GA 4DM7A 5JD5A 2C0PA 2C7BA 2C4HA 2ZSIA 3C6ZA 1EVQA 2VQ6A 3JYHA 4XJVA 5FOQA 1YA8A 1H2ZA 3W9UA 5AIBA 1CR6A 3V9AA 2HA5A 1LPSA 2PU5A 4Y2QA 2K2QB 3D3NA 2WIDA 3HSSA 1IUPA 5HF8A 1SFRA 2V9ZA 2PKYX 2VJAA 5K3AA 3WKEA 4HS9A 1JMYA 4DNPA 3R3UA 4H35A 4Q82A 1IZ7A 3GA7A 4BYMA 4HTAA 2DHDA 3O9MA 3PDCA 5AK5A 5A71A 3WZMA 4GEGA 2DHCA 4AB1A 3O4HA 2E3JA 3OG9A 1THGA 4EUSA 1EINA 5ALMA 3FVTA 1E3QA 5DTJA 5DNWA 3H0CA 1VZ2A 3KXPA 1XQXA 3DDUA 2GYVA 2XQFA 2C58A 2VT7A 2HFKA 1DWPA 4ARBA 3DL4A 1TKRA 3JWEA 5ALEA 1MX5A 1J07A 2XLBA 2XUIA 4K6GA 5FRDA 3ED1A 3VJLA 1AURA 5E4TA 1QTIA 1BEEA 2QR5A 5ALUA 2RIPA 1TCBA 4YASA 1CUCA 4QWWA 1CEXA 3STWA 1U2EA 1LPPA 1BCSA 4H7DA 1XKTA 3H1BA 1VA4A 2PBLA 3OURA 2ZJ6A 1HL7A 2R11A 5C8ZA 3CN7A 3FWHA 2YASA 4E11A 4ZWNA 4PSCA 1AGYA 2YYSA 3N2ZB 5F4ZA 1CFJA 1ZD3A 2BCEA 4MEAA 1ZD2P 3WIOA 1THTA 1DX6A 2AJBA 3SWWA 1GPLA 3DYVA 2BJHA 5I9IA 4B6GA 1XRRA 1N1MA 3VDXA 3G9ZA 3QMVA 4GLBA 1CUZA 4G9GA 4B0PA 5YASA 3PF9A 4FOLA 2JBWA 3FYUA 2XMSA 2XMZA 1BRTA 2PSFA 5CH5A 4PV7A 2Z3ZA 5T4BA 3LCRA 4Q3LA 5CH3A 1GQRA 3ZPXA 4G4JA 2CBGA 1ACJA 5JALA 1BEZA 3FLBA 4Y2VA 4X6XA 3U1TA 2QJRA 3FOBA 1ETHA 5IVKA 1EDDA 4BBZA 2WFLA 3QBJA 5AHXA 1ACLA 3R0VA 3G9XA 5K3EA 4DMHA 5HKBA 3UMJA 3RK4A 3H04A 4BE9A 2QOEA 4QZVA 4K6HA 4M0FA 2VSQA 4NVRA 4P08A 2DSNA 2B4KA 4BP8A 2GBCA 5IH7A 3K6KA 2BFNA 2FJ0A 5EGNA 1XQVA 4LXIA 1YCDA 3C5WP 3E3AA 1Q0ZA 4FDMA 2JEYA 1XRMA 1ZJ5A 3DOIA 4KE8A 1CQZA 3DL7A 3WL8A 2HA4A
chains in the Genus database with same CATH superfamily
1W47A 4OXYA 2IIPA 5DM2A 1JSXA 2VYND 4BRSA 3DZBA 1FJXA 3C7CB 3KS9A 4KI7A 3P5BA 4JVLA 3RTGA 5EIAA 4LJ4A 1H85A 1Y8QA 4RDIA 3CIOA 3IODA 3ZHCA 1IG0A 3ZK9A 5JASA 2YDXA 5BR1A 1DBSA 3VKFA 5IKXA 1YQEA 3IBSA 3L07A 2NQ2C 4N8EA 3EVEA 4MPPA 3II6X 1XQYA 2OFOA 1MX1A 1TL7C 2ACVA 1LDYA 1RAEA 3CXRA 1RU3A 4PX9A 4KH0A 3UFXA 3W1VA 4TXHA 1PJ2A 3CNBA 3P97A 5DGIA 4ZVKA 2OQVA 3M4YA 4QOEA 2QT1A 1AQYA 2VT3A 1RP1A 3EVZA 4M87A 4FGLA 4D0GA 1IY9A 4PYOA 2HK9A 3L77A 5IH3A 3B36A 2DPMA 3BFJA 1IOLA 2ZRNA 3CT6A 2YXNA 3I2FA 4TVBA 5A0FA 4TYMA 5E95A 4RV5A 1FRNA 2R2AA 4OB8A 2GILA 3DBHB 1X19A 3MBKA 4D9IA 5H9WA 3LHFA 4Q24A 4A10A 5JSHA 4B34A 1GUFA 4U02A 4X92A 4LWPA 3SF0A 3LQRA 4ZEOA 4RUKA 3S8EA 1ZHFA 3PTAA 3DO6A 3G89A 1T2FA 4ASUA 4BQRA 1PYDA 3B6MA 3KKEA 2J4DA 2ANBA 2DQSA 3WWDA 1X1SA 2IYUA 4I7EA 2YWFA 3DOEA 5I9BA 2HYIC 1XVAA 1NWHA 1YDGA 3A1TA 1NLUA 3HA3A 2VHXA 3W9YA 2VATA 3KO8A 3U3KA 3GO4A 2BUAA 2GPBA 4KO4S 2FWIA 3P9ZA 1ZD5A 5FFNA 1BCRA 4DSAA 1JHPA 2HSWA 5DCLA 5EFZA 3UC5A 4Z4FA 1I6MA 4RH3A 3UAOA 4DDTA 4B83A 5E1DA 3RIGA 3KPWA 3K6RA 4QA9A 3O31A 3KYCB 1IU9A 1XO1A 4AY4A 3TRFA 4QSHA 4WINA 3GJ4A 1TCCA 1BOFA 2H2AA 2QVYX 4FILA 4P4UA 2BZGA 3UJPA 4M88A 2C4VA 2KLBA 2OBNA 4TUYA 4ZEVA 5G40A 2ZE5A 3DULA 2XVMA 5BQFA 1TTTA 4J07A 3RARA 1EJ2A 1BX1A 4OVKA 5EVCA 4HX5A 5EJ7A 4MRPA 4UBLA 2UZIR 2M1ZA 1QZZA 3FCCA 4AS2A 5K01A 2GESA 3NC4A 3U37A 3BVPA 4N7MA 4A26A 4DQUA 2AOVA 1ZZEA 2Q9BA 4EB8A 4KQ9A 3QF7A 1XTJA 3GRCA 4UATA 2D1SA 3QA9A 1CDDA 1PWYE 3M81A 3KETA 3K5PA 3EYWA 4JJGA 2NO6A 2ZRKA 1J1UA 1NW3A 2P4QA 1L5FA 1SHUX 1YR8A 3U17A 4RULA 3MWYW 3S68A 3KPYA 121PA 3T5PA 2NVUB 2E4VA 3SIXA 1YE5A 4GO1A 3VTFA 4OQQA 1UJBA 1KC3A 2WJPA 1F9AA 3OTIA 4C6SA 3PKZA 4KQIA 1ID1A 1GNVA 3SFVA 5ADUS 3NNNA 4WFJA 5D5QA 2N1MA 4F04A 5BY2A 2SNIE 1NRXA 3G59A 5FTLA 4YWHA 4WPGA 3G5UA 5AXCA 1OXBB 5IJAA 5A3JA 1TECE 4KWTA 5BSWA 2C42A 2D1RA 1U3WA 2JH8A 2X2OA 3GFRA 2YOHA 5JSKA 3IMCA 4QTXA 3ZY3A 1NVGA 2CNOA 3RTCA 1I0LA 4XKJA 1QGAA 1DC8A 2EU8A 1DJQA 2PX2A 2ZETA 5E6RB 3TFQA 3TRHA 1ZYUA 1FRQA 1Y1RA 3RW9A 4RV9A 1H5QA 4IKEA 1JQLB 1PNOA 2KWIA 4GNKA 3TAUA 4ZGGA 4I9FA 2X9VA 4BJ5A 3M9WA 2DMRA 2V4ZA 1K08A 3FDFA 2AK3A 4JUDX 3ZHYA 1MDFA 1RAHA 4DLLA 4ILKA 4S3MA 4J0KA 5AW3A 3WWPA 3V6LA 2FPIB 1ML4A 1C5KA 3GZJA 4BLOA 4RD6A 1G5IA 3EQ8A 4ZCPA 2VH2A 4MPRA 4R01A 2IXFA 1C1YA 2Q49A 4OJQA 3OZTA 3E61A 2XADA 4J94A 4MQ6A 2ZANA 3KZCA 2HRDA 3TW8A 3CEAA 5H0IA 5ICSA 5BV8A 3OF5A 1RXSA 1DPFA 3MJEA 3LY5A 4FLMA 4LDNA 4PW0A 1D1TA 3DDSA 1W0KA 3IAHA 5DWDA 2WQ6A 3CSSA 2PSEA 4QJBA 2QY9A 1N5IA 4LTNA 3D1VA 5K8CA 1FNDA 5JE8A 4AS1A 4BV9A 3MWLA 3W1EA 2XMGA 4BFUA 4U63A 1TM5E 4I19A 4RFSB 1GQFA 4KZKA 4G0WA 4IHJB 3SS8A 1PQUA 1PS9A 2CL7X 3DUFA 5C0OE 3DKPA 3OPMA 3U3DA 4V0SA 2ONJA 2M98A 1E5QA 1AHIA 1TCVA 1M6YA 4D99A 3Q87B 2FW6A 5BYAA 5P21A 3AUAA 3H5IA 2AF3C 3QNWA 1Q0HA 1J9ZA 5E6UA 3QTBA 3ZTYA 2OV1A 5HGXA 3UJNA 1RPNA 2DY0A 2DM6A 2ZB2A 2Q4DA 1NYRA 2EW1A 2LCFA 2P62A 1P2VA 2EEPA 4FYYA 5JHHB 1HRKA 4N3BA 3H1FA 1PT7A 5DTRA 3CB4A 3ACCA 3JAKA 4WWHA 1PW7A 3LCVB 4AP6A 2PMBA 2Q0HA 4JB0A 5IAAA 4RGVA 4KXMA 5FCDA 5IXSA 1XL0A 4LBZA 2HA2A 3G6WA 4CDMA 1JU3A 1X1DA 3RRXA 1RXIA 1TU4A 3NWBA 4TV8F 1T6BY 5H1YA 2VN8A 4MRSA 3V00A 2IPOA 4N01A 1CDEA 1GTVA 2BSXA 2OV8A 4MMXB 4UHJA 5FF9A 4NBRA 3A6ZA 1US8A 1U9ZA 3OIFA 1IZZA 4N03A 4CLOB 4DA6A 5C32A 5J1TB 2VTBB 3AHGA 2ZPAA 2WNHA 3D43A 1M2KA 1O2DA 2G9UA 3HVUA 2WWFA 3K09C 2FOLA 5EXSA 4KE7A 3SHQA 3OQ1A 3T3HA 4M3NA 4NPCA 2J4FA 2IEYA 5DBOA 4PF1A 4EWLA 2JCGA 2VR1A 4AWBA 1UJCA 5K0GA 2VIIA 2FPPB 4TV8A 3LXRA 1I6LA 2NZXA 3KP1A 2XEXA 5EQDA 4NEQA 1UK7A 3EVBA 1FPQA 4G01B 4F92B 2BLNA 1AKYA 1F3LA 4XSHA 2OXRA 5CDYA 5J58A 3K9NA 3C70A 1VP3A 4NG5A 1DAHA 3AJDA 3DGFC 4LWQA 4Y6SA 3WK6A 3G2HA 2XAAA 2C78A 5IUNC 2FP3A 2VSNA 3L6UA 1C0LA 3Q5EA 4C21A 3VDNB 3RRNA 2XB2A 2NU6A 1BWSA 1NHGA 5F98A 5T4HA 2OBBA 1EK1A 1ZM3A 3H87A 4WNAA 2O50A 4Q5IA 2RMKA 2Y1OA 5KNDH 3HKEA 1W87A 4EG8A 1J97A 4D9GA 5BUCA 4ZU6X 4Z54A 1CQXA 1DCKA 4H7HA 3RSLA 3LQYA 1OYWA 1NLFA 1ZMRA 2ODAA 4KMMA 3J81A 3RVOA 5DNUA 1EXDA 2RBEA 4Y6PA 3V4ZA 4EA8A 5LQUA 2QN7A 1XD9A 2IK8A 4BLQA 4UARA 3JD4A 3WWOA 4CL8A 1GFSA 3AK4A 4DYHA 3DZKA 1UAGA 1E1DA 3FX2A 3BMCA 3ILVA 4N49A 2P2NA 3KC2A 3KKZA 4Y2GA 4LKOA 1TLTA 4TLAA 4UM5A 5JCJA 1ESEA 2HMWA 5I7HA 1R12A 4PTYA 4WFQA 3OZWA 4TVKA 5I9MA 4DR4B 4RQAA 1D2CA 2ZI3A 4C5AA 4YUVA 4CIDA 2VDVE 3A37A 2BE7A 1U5AA 3NOVA 4KR0A 3WLSA 5IJ9B 2D8MA 3LYHA 4MCJA 3VJKA 4U00A 5B1HA 5EE3A 3NETA 2MYNA 2XVAA 2Y2VA 4Q9HA 4DR3B 1URPA 1W4CA 1TT5A 3ICVA 3AG6A 5TGZA 1PNQA 2QPAA 5FBRB 1QWOA 1B00A 1U04A 5C37A 2NYVA 2X86A 3WB1A 2ZYDA 1UAYA 5SY4A 1L4YA 3BWBA 2IV2X 3ZY6A 10MHA 4JU9A 1JFFA 2DFNA 3CVWA 1Y8ZA 3DPUA 1E1CB 4Q48A 2YYZA 3PWKA 4PC6A 3V8NA 2WFZA 4CM5A 5LQDA 3F5SA 3WYEA 1A2KC 1ESDA 5LD2B 2IYLD 2BTEA 1RXCA 4YJ3B 3TLKA 1WDWB 2IF0A 2VQDA 1BKYA 4UCQA 3RUCA 1QR2A 3RYFA 3KZVA 5MFZA 3TNLA 1U6IA 2W2VA 3EEFA 3ESBA 3DLTA 2HNAA 4MRRA 4ZT3A 5EP3A 2NW6A 3NCHA 3U3JA 3BIFA 4QJIA 1Q2XA 1C80A 4GZMA 4QDXA 1BVRA 2F9LA 2B1QA 1KYZA 2NTVA 5B6JA 4C76A 1Y81A 2GJKA 5C1DA 5DH9A 2OGZA 4KI0A 1VMIA 4JI8B 3FCUB 3U7QA 4MCAA 2V97A 4Z7NB 4ON9A 2YMMA 2HQRA 5FA8A 4RENA 1G3QA 3EOBI 1ABBA 2FEXA 2WABA 3NWEA 1FQJA 2C4KA 1BVUA 4JY7A 4LDZA 1IXSB 5EAIA 4INPA 1E9VA 2A3RA 3Q9NA 2JD2A 2BELA 5L95A 4W5NA 2JAUA 3QUSA 1SOAA 3Q8MA 3M3HA 4H15A 3A4LA 3G9UA 1P7WA 3VO9A 1LTHR 2VJCA 3ZG6A 4YV0A 1Q0RA 4D82A 3OX3A 1V1MB 3KKPA 3BTVA 3N0WA 4ZT6A 1LNQA 3EVDA 5CT8A 2H2IA 3WQHA 3OCWA 4RIGA 5EJAA 4WGFA 4PYJA 3TQHA 3K16A 3AW8A 4C0BA 1Z4JA 5BWOA 1KVUA 4UVHA 1U7PA 1Y5LA 2KPOA 5FL7A 4AIRA 2Z8YM 3QBEA 1L8LA 2XXAA 3K09A 5EJ9A 2XQVA 2XWBF 4MQEB 4DLNA 3RVQA 3AY0A 1TCUA 3GLHB 4OCZA 2AOTA 4RABA 4NZPA 5DGTA 4M0MA 3VX4A 4YX9A 4HLNA 2ZSDA 3BD7A 5FQOA 1R74A 3SXUB 5CAEA 1K86A 4R9UC 1A5BB 1PL0A 1I9CA 1Y6RA 2BGNA 1U9IA 4LJ6A 3UMMA 5LQAA 5H4GA 2M6LA 1L8OA 1PJ3A 3UA4A 2VJOA 4W99A 1ZU4A 4EPRA 4TTIA 1VYHA 4NV1A 4OSEA 1JG1A 1VJDA 4L2IB 4HNSA 3GAZA 3GOHA 5JZBA 4RK7A 1OYOA 3GDFA 2I1QA 3NANA 4WKGA 2BGRA 1Y1TA 1JIJA 3A9SA 1OGJA 1W8IA 4PVCA 2XWJI 3IP7A 3GLFE 2JKZA 2CXXA 4UJ5A 2O0JA 1SCDA 3I0ZA 2ZQ5A 1Z4LA 1NE7A 2BFDB 4ZZ3A 2C9OA 4EDFA 3LX6A 3P9KA 1JDVA 1L4GA 2I34A 2J45A 2XNJA 1QK3A 2JBHA 4Q3EA 2GAFA 3DLIA 4MYRA 2WAXA 4FFDA 4RPLA 4LXHA 3M6AA 1Z18A 1BS9A 1NXOA 2XXBA 3QSGA 1QCCA 4JAVC 2QV0A 2TYSB 4OA8A 1K5PA 1FUEA 2GMWA 1X86B 2HEGA 2VTDA 3IIIA 4LY6A 3HJUA 1H5NA 2Q1WA 3C7KA 1AQUA 1NUHA 4FGUA 1ML3A 3IIKA 7MDHA 1O0BA 2MSKA 4W1QA 1U9CA 4N5LA 4YT5A 5FTMA 4ZK2A 1AGXA 4W1SA 4EUKA 5BPFA 1OFHA 1XVLA 3NKFA 3WKDA 2RH5A 1DEOA 1DAFA 1ULUA 4DVJA 1GQYA 5EJ5A 2OM2A 3Q11A 3ABRB 2I4NA 4HKTA 1JNYA 3OOWA 5EEGA 4CF7A 1EDBA 2IU4A 5ALHA 1UKAA 2P0YA 3QLTA 4GZ5A 4WL0A 3S1AA 3BD8A 5KQRA 1CZKA 2LNDA 1GTL1 3F3SA 4M60A 4BZZA 2EFDB 2WFMA 2PTHA 3K0BA 3NHSA 1N7GA 1NG1A 1XJCA 5SICE 1EI9A 3DO5A 3G8AA 2Q3JA 2WP8J 4S0ZA 4OXQA 4EFDA 1RQGA 1MB0A 2Z2XA 3JYNA 5CURA 2XRYA 4PIMA 1E5LA 2AD5A 3TR0A 3GBSA 3RSQA 1HORA 1ZGBA 4MDFA 1J24A 1MR3F 4B17A 1N1GA 3OY2A 3AIKA 2XDQB 4XWYA 2WT9A 4EHJA 2ENWA 2XXJA 3IBTA 2PHZA 1DMRA 5JXGA 3OOYA 3OZBA 3KD3A 3OLYA 2ZSFA 5K0TA 3QNUA 3D4NA 2PLWA 4F6LA 1H2AS 3FZEA 1XIVA 4YC7A 3DKIA 5KOHA 1VKZA 2MJLA 1BD3A 3SSMA 4E88A 4ZT7A 3Q2OA 3A7DA 3NDPA 3D8UA 3CF2A 3V3KA 3KLOA 5LYJB 3FTEA 3MGAA 1EM8B 2CJXA 4YIHA 1O0CA 3CLHA 3KU1A 4OYLA 1EP9A 2QLNA 3W5SA 1G4AE 3HMKA 2X19A 4GZLA 5H9VA 2AQIA 3ECSA 2FSSA 4AJHA 5JQGA 1IXZA 1KE2A 1YR7A 1HLGA 2FNAA 3T5GA 2PQ0A 3NV7A 4I5GA 5AM1A 5ETJA 1LA2A 1M0SA 1WVMA 3GD7A 4BLWA 4U7GA 3CLTC 5IFKA 1WDKA 2OGSA 3AEXA 3BWXA 3IO3A 4L4YA 4ZI7B 4H3VA 4KN6A 1KJJA 5MGBA 1QUFA 2G5CA 4JLDA 3VVLA 2O8EA 3A11A 4CODB 4YMVA 3T5AA 1AZTA 4P0PB 1PRYA 4NG4A 4BWGA 3MJDA 1M67A 3HXMA 2C1EA 2X1LA 4ZXFA 4J3NA 3QW4B 1MQSA 4JODA 2FLWA 1NZFA 2VJMA 2ONCA 5JD6A 3D5EA 1OB2A 1NBWB 2CMHA 1RWVA 3E58A 3VUFA 3WGVA 4RTRA 2Q6TA 3F8SA 3VO1A 1HLFA 2O1XA 5KWJA 1HUQA 1SB9A 8ATCA 4J1TC 4C4OA 3GLGA 1GFIA 3LOQA 1TCAA 3D0KA 5HZHA 2XB8A 4CG2A 5JLAA 5DW3A 5AVWA 2HV8A 1A7UA 4OBWA 4ERNA 5JR3A 4LZZA 2FN7A 4B3BA 4AYWA 3FFXA 5KVAA 5A3VA 3W7AA 4G8BA 2PEZA 3QMWA 5DN6D 1D7OA 3R6DA 1XOIA 4RFLA 4S24A 2B20A 5FJJA 3UJ8A 3H5AA 5LMUB 3G2PA 3CSUA 3FKQA 2O2IA 4Q7JB 1K4MA 4ALMA 3AZOA 4GOND 3R1IA 5CHEA 2HQOA 4P93A 2PR7A 3K9GA 4NPHA 6AT1A 2ERXA 2J9XB 2QL5A 3ICPA 2OTCA 1QO9A 2QM0A 4NR0A 4EGAA 1ZO8A 2JFVA 1R2QA 2Q0XA 3AW9A 4QPDA 2BY4A 3EVFA 5A5EA 1DXQA 4RE5A 4GX5A 2P11A 4NCIA 3GPBA 6REQB 1YR9A 3AM3A 4KLCA 4OM7A 2X0JA 1HE3A 1ECLA 2BFAA 4REOA 4B7UA 4EQ6B 3RR2A 3IQGX 3AJRA 1V8PA 4KDFA 4QTUB 3VZSA 4RZ2A 2AX4A 2C2WA 1O96B 4CZ2A 4PC3A 2RHBA 1E9RA 4XH9B 1J0AA 1TAQA 3OKFA 3GT3A 1Q7RA 1RRFA 2FW7A 3CPSA 3EXG1 3FUTA 3PVCA 3FNFA 2QMQA 1T24A 2JJ2A 1EJ6A 1QHHB 2H59A 3H16A 4QXRA 3WR5A 2HADA 1SCNE 1UJ2A 3IUBA 1XLTC 2C9CA 1JEJA 3EMDA 4GLJA 4H7JA 1X87A 3FFAA 2AFRA 3I4CA 1AS2A 3DE0X 1U3DA 3DOCA 3OICA 5HW0A 4FMCF 1YS2X 3FM9A 2BMAA 1O89A 1UFOA 1BE1A 4FYXA 2BN4A 2NUAA 2DUWA 5IVDA 4AKHA 1T9ZA 3NHBA 4X1KA 1Z0SA 1HO3A 2DPHA 3VZBA 1T3HA 4Q37A 2ZIZA 3CRVA 3WWZA 4E5PA 3E03A 1T1IA 4PG8A 4YPFA 3T3EA 2Z58A 3RYIA 5TVGA 5AW4A 1PVOA 1CCWA 4JYZA 3QGMA 4EFKA 2G5PA 3TQFA 4BGIA 2QN1A 1FRVA 1EB9A 1Q57A 1SC3A 4GE0A 4JXZA 4FT4A 1K5DA 3OZCA 1VRWA 3AUXA 4FGWA 1G55A 5ALQA 1ZRHA 2PJZA 1XNQB 3RH0A 3DE5X 1P1FA 5A3RA 2ZWVA 3L6EA 2Z9DA 5CIQA 3QU5A 1VLMA 4EZEA 1KYYA 2JANA 4X8HA 1Q7GA 1DFIA 1DEHA 1Z6AA 4Q93A 5L40A 4C4SA 1TD1A 2W2OA 4MR8A 4XQGA 4GF5A 1V5WA 2B37A 2Y71A 1QRTA 3HI4A 1NZJA 1U4NA 4D4IA 2DR0A 1V71A 1Z68A 3N2KA 4KQWA 2BMDA 3GQBB 2YJ6A 3QJYA 4QU8A 4D81A 3OTQA 3U4AA 3THYA 3HFJA 1X70A 1QRSA 4X63A 5E0KB 3GL9A 1NVAA 3LQQA 4U2EA 3GRVA 1XDSA 4B3GA 1Y4AE 2TMGA 4W1PA 2C4WA 2ZT5A 2DTEA 3OO1A 3TBFA 4PU0A 3W6ZA 5CM9C 2QYSA 1EH5A 1TW3A 1CTQA 1Y34E 3BAFA 2LIPA 3BJZA 3F9IA 3FOCA 4TT8A 4X44A 3RBZA 1FY2A 5AVQA 2BDTA 3EDMA 1VP9A 1S96A 3B78A 3E9NA 1N0HA 3SLKA 2HXGA 4E08A 4U5XA 1U31A 4NAVA 3OJWA 4J8PA 1F4PA 2EKQA 3P52A 3H6KA 1W7AA 3T7SA 1L4MA 1ZH0A 4BO2A 1Q22A 5KTTA 3TNDA 2W6CX 4OPMA 1YIDA 3H2IA 4NBUA 4WLVA 5I9NA 4XM1A 1SXJB 1F14A 3RUHA 2OHOA 2ZS8A 1A76A 1FZTA 3GB9A 3LU1A 5LR6A 1MTZA 1QWSA 3LSTA 3QLVC 3UJDA 5CDFE 1QVAA 3AR5A 4HRXA 2JF0A 4TKLA 3ZQ6A 4BVJA 1CW2B 2WJIA 3CJQA 1JG6A 4IOMA 1ZXXA 1N6NA 3ZWMA 2HM7A 3BWYA 4QM7A 4QELA 4RSGA 4WA8A 4WCFB 5ECGC 4QXMA 1JXAA 1WCXA 1XZNA 3PC3A 1SURA 1TVKA 3SSNA 1KMHA 4CLRB 5B7NA 1RACA 4XQCA 5DRYA 2WB2A 4ES6A 4F0JA 5K51A 1Z47A 3H84A 3GJYA 3LHIA 4EA9A 1QFJA 2WKWA 3MGBA 4MS1B 4DIMA 2H06A 4TTAA 3MWDB 1HSZA 4EX6A 1NW6A 3C7TA 5EHIA 1OJ7A 4BQIA 4TV9F 4M9UA 3E5NA 3A32A 1USWA 3PEEA 1WHTA 3BB3A 2IUUA 3L0ZA 4DLAA 4OLFA 5LQRA 4M1ZA 4OMUA 3QEMB 3P9IA 4ZEXA 2VT6A 5AK3A 3PSHA 1YJBA 1ZM4A 3ZH2A 3BCUA 1PZFA 1L4KA 1U5BB 2IRWA 2O2ZA 5B58T 2DWQA 1XJ5A 3HP1A 3ZKAA 5EJ4A 5TLSA 1EFPA 1JG3A 1QIMA 5HK8A 1RYMA 2D1TA 4AMBA 1U65A 1W73A 1V5EA 4I1OA 4TV9A 1GZDA 4DREA 3NDBB 2GEUA 2VJBA 4Y2XA 5DI3B 4TT3A 3EIXA 1M6NA 1K97A 1GA6A 2O3UA 5CYOA 4UE6A 5BW8A 3DE2X 4ALIA 4ESOA 1ZG3A 4I5FA 1V6AA 1NNUA 3GPCA 4CJXA 5K45A 1RLMA 4E94A 3I9JA 3NVMB 3BWMA 4URFA 3HJHA 4PANA 3ZZMA 3EA5A 2H11A 2PT7A 5AH0A 3ZW8A 4NV3A 2OWEA 3C1AA 1QK4A 2XCRB 1JXQA 3SQMA 5KOJA 1GDTA 2VUIB 4IJWA 4TPKA 2ATEA 4EJ0A 1J22A 1B16A 4QOSA 3LQKA 5EJFA 4CMIA 1JJBA 4KWIA 5JH7B 4DIUA 2G76A 1YMUA 3TSWA 3Q9SA 3Q12A 5BSRA 4X20A 3UG7A 1K63A 4MV4A 3S2GA 2A4KA 2PS0A 3BL6A 4BCCA 1QH9A 2F1RA 2XUJA 4JKOA 1XPOA 4NESA 4XAQA 4ZYYA 4MUXA 2VZEA 3TTYA 4C4ZA 2F8LA 1F5SA 1XRNA 1O9BA 1YR1A 3ZKWA 3R3JA 1R5NA 4BLPA 1JFRA 1KJWA 2JAHA 3SYKA 5BOSA 3IYLW 4MXDA 2Q7OE 4Q4AA 5T4EA 1SC1A 3B3GA 3I42A 2QI9C 1IFXA 3I2JA 5EPEA 4F3YA 3GMIA 5CCEA 1NM5C 2OLEA 2X3UA 3CPHA 2LVBA 1K4YA 2EKDA 2D1QA 5KDLA 1E3DA 2OUIA 1HEYA 3U4QB 1KFJB 1EUYA 2HTFA 3AP3A 4C89A 2JFPA 1XP5A 4HRYA 4KXUA 4X24A 2DHRA 1KR2A 2JVKA 4RH0A 1MC4A 2RGEA 4D8WA 1RRGA 1J2JA 1G8SA 3IQFA 3WSVA 4ECAA 3DEHA 3UMRA 2OP1A 1Y3FE 3NO4A 4L0MA 3TWOA 4RA9B 1JE0A 5EWLB 1E9CA 5ILGA 2NZJA 5BP7A 1SQFA 2QMZA 4NPAA 4UBKA 3K20A 1KPHA 3B1XA 4URYR 2FU5C 4X85A 1VG1A 2X9GA 1M6VA 2R5FA 1HV8A 1NFRA 2H2WA 4M9ZA 1C4KA 2QQFA 4UHFA 1M8PA 4PZEA 3HXTA 2DLDA 4X71A 3V2IA 3M6IA 5AKZA 1Q1EA 3GXBA 3FVRA 1F8YA 1JN0A 1HK7A 4BE4A 1D5WA 4M21A 4HXEB 1GUZA 4OU4A 3GRAA 4X54A 2ZJ2A 1P7CA 2W90A 4XUCA 3RU7A 1RYFA 4GT1A 5JBIA 1H5UA 4Z4EA 4MWBA 4OHMA 4HI0E 3MNFA 2C8KA 3AZPA 1UBNA 4TMYA 2E21A 3FPHA 4MKXA 4O2BF 3T3IA 3Q15C 1T0BA 3E9QA 1W96A 3EISA 2QU8A 3B1WA 1FA9A 2QJTA 4S2EA 3MD0A 3UC9A 4FGZA 3ROGA 2BFCB 2CSUA 1I1NA 2X9LA 2JGDB 3BQ9A 4LZWA 3TW6A 3KZ1E 1M2WA 1U6JA 1W49A 3A6HA 3O0DA 3ZZ0A 1JDZA 1GPUA 3EAQA 1M83A 2VWHA 4WGGA 5ALGA 2NU9B 3ZE6A 1RYYA 1VL5A 1YR6A 3HO8A 4RHCA 4WJLA 1LTKA 3IT1A 1BHQ1 5IG2A 3R5JA 1KH3A 4O2BA 4D2IA 2NP6A 3GDWA 4Q1DA 5KO2A 4JDPA 3L5KA 4CETA 4IVPA 4MV6A 1NBEA 1SBYA 4XCXA 5KHOC 4UE3S 1DJOA 2GJ8A 2H1WA 2WG1A 4BO0A 1YMVA 2G9VA 4JYCA 1GCAA 3ES9A 4LXXA 1GAXA 1EIWA 1ZK2A 3AFGA 5AJHA 3OPNA 1B7GO 4KN5A 1AMUA 5AKIA 4PYMA 4B87A 2J5QA 1Z0DA 5ICEA 1OVMA 4WXHA 3B6IA 4CF4A 4JT4A 4H7KA 4OGGA 4R1QA 1DTEA 1QRUA 1Y5RA 2FYTA 2JJ1D 4YLGA 2BH2A 1CS4C 4PYQA 1KZHA 5EP2A 4MDEA 1TIBA 3C3AA 3HCPA 3ZNNA 2JGKA 3PFFA 221PA 3MOGA 1OWPA 4B46A 3BSWA 3I53A 5LXTF 3TAXA 1DEAA 4FHZA 3GHYA 3CUTA 3INRA 5CB4F 5ALFA 3M8KA 4LQCA 5H82A 1SEVA 3K4HA 3A1WA 2EG5A 5E2AA 3VI3B 4JP1A 1ZI8A 1S4MA 5C52B 3M4XA 3GEEA 5C9ZA 5KX5F 1E98A 1KO4A 2RBKA 4G9EA 3S5JA 1TO1E 3D6AA 3GG2A 3M49A 5AICA 1DV1A 3T9EA 4EK9A 1LZLA 5LM3A 5LXTA 2X58A 5FTKA 4Y2JA 3KHTA 1QYCA 2CVHA 1S9HA 1H3FA 1H23A 2VQEB 4UQPA 1TQDA 1UQRA 3IV9A 4MV8A 5ED0A 2I99A 3SJBA 5CB4A 2P4HX 3OJLA 3SX2A 1FFWA 3BHJA 1P6QA 3D0QA 2QF7A 1CQIB 3EUWA 2RE8A 3A70A 2MSNA 3FPLA 3TLZA 2WKRA 1GFZA 2RH9B 4EFLA 5KX5A 3RLIA 5G3YA 3IP5A 3NPMA 1MRNA 2OESA 3FR8A 4ZVTA 3UK2A 4GMFA 4JQOA 2FQQA 3DGEC 1ZIPA 4P9NA 4C29A 3EXFB 4Z51A 2I4TA 4IDQA 4LJLA 3QUTA 3CEPB 4JQSA 1AKNA 1JEYA 1BCSB 7GPBA 1RCTE 5U1PA 1N3YA 1T9AA 1DC4A 3SVTA 4WKPA 3GLIE 3I6YA 3B3JA 3OZRA 3RKSA 2XTMA 3SC6A 4DAEA 3WG9A 2J32A 2HN9A 3QU2A 2W42A 1E9AA 3HB5X 2W6JA 3E7WA 3G0OA 2HA3A 3LP6A 3MTQA 3UGKA 4GSLA 2WWYA 1SB8A 1YL6A 2OFPA 3ZBTA 2ZBRA 4LXYA 1VKNA 2HRZA 5LNK1 2REQB 2AE1A 3DVAA 1AKQA 2PUDA 3QXGA 3ZU5A 1Y89A 3IQDB 5FA5A 4H16A 2G77B 1R50A 3DWIA 3O92A 5F7JA 3TGWA 5L3VA 2G9QA 2ZI4A 4MVJG 4P81A 4QUJA 4KG7A 1FDUA 4OLAA 3PUKA 4YT4A 2BHLA 5LQJA 4O29A 2RAUA 3UV7A 1VFPA 2HZBA 3U3OA 2VK4A 2CJYA 4UNNA 1RWQA 3WS7A 4CLDA 1J2RA 1FFXB 1JHQA 1KARA 1MAAA 2B8NA 1P8JA 3KKKA 4YO8A 5E7QA 2O20A 4PSAA 2WVJA 1JEDA 5AXAA 1FDTA 4FEAA 3K5HA 1M2JA 1FLDA 3LKVA 5HOQA 1J5PA 4QM6A 5DTIA 1Q92A 1EWQA 1RZVA 2VKTA 2BV3A 1QK5A 3W06A 2O5VA 2WIKA 4UDOA 1PFVA 2JDIA 1VGVA 2QN9A 2WUDA 3E23A 4FHDA 5A06A 2ZT6A 3BDVA 4HDCA 4IEIA 1JR3A 4ZQGA 2I9KA 5FBQB 1SUDA 2BMWA 2JA1A 2HTEA 2OBXA 4I36A 3O2JA 3KSZO 1YBFA 4C0AC 5EP1A 4A2CA 5DBFA 3RT9A 2E4WA 1CF2O 1UWCA 4CR8A 3L1UA 5AKJA 4KB5A 2XKJE 2A57A 1E2QA 3F67A 2WHPB 4F97A 2QAJA 3EDYA 3KVYA 1CR4A 1VXOA 2XB6A 4Q1BA 3WGMA 4PRLA 2RHWA 3ECAA 3HKDB 2WU4A 1RI3A 1Q91A 1XDWA 1ZRSA 3URKA 3V9AA 4YP0A 4MB6A 5JYDA 1T1GA 3E7XA 1ACMA 2COUA 3E15A 3PC7A 1CJBA 1D4OA 1NFQA 4BP1A 1XZAA 2R5WA 3DZHA 1F0PA 4FJ2A 3KYCA 2HLDD 2PX8A 3U56A 3LH5A 3L7LA 4BNKA 2WFLB 2BFMA 2Q8NA 4PPNA 3HBLA 1PKXA 2Q4RA 4R84A 2I87A 4M36A 1FJ2A 3G17A 2NZUG 2PGJA 1OI2A 2XKBA 1IYZA 3IJPA 3QUBA 4BC1A 1SG6A 3NT5A 1MB2A 1TYAE 3MOIA 1NE2A 4Z1MA 3NWPA 4FFNA 2Z04A 1NNSA 4YXWD 4WA7A 2ZYVX 2ZBGA 4WRRA 1SWWA 1DKUA 5GGYA 3LBNA 1FNCA 4IFBA 4E31A 3ZVNA 4A82A 4QSMA 1ESNA 4HAYA 3VOBA 5C3MA 1WXWA 3BXOA 4MNTA 4BHTA 3H2KA 1E18A 1K8QA 2FV8A 3FJYA 16PKA 1IY0A 3BAZA 4OK5A 3CN9A 2J7KA 3P0IA 2JGFA 5JV5A 1J8MF 5T41A 1Z5OA 4OUDB 4M9RA 2EZ8A 2LE0A 2QV7A 1LVUA 3GBPA 1X8XA 3GR6A 3KQUA 4MV1A 3UPUA 1BMFA 1UBGA 2POQX 3MD9A 3BXHA 3GVIA 2JEZA 2O2CA 2IEZA 3CSDA 4JLPA 5C1OA 2HJVA 1KQGA 2WY2D 1BYIA 1V95A 3LT1A 4WTOA 3UUEA 3K9QO 1W36B 2HT6A 3KJQA 4NFSA 1PR9A 3DFKA 4UNRA 4I1IA 3Q41A 4PNZA 4HP8A 4PFSA 1JI0A 1T3ZA 2EKZA 3K15A 1EKXA 4M1EA 1UMCB 1G7CA 4S1WA 5B4TA 1C8LA 1TZBA 4JYBA 2ZJYA 1A96A 3RU9A 1QU3A 5IJ0B 1E1MA 4PG6A 5IX8A 5FOVA 5HGJA 2QORA 4CG0A 2ZSHA 4DIKA 1N6OA 3CKYA 1I33A 3VR5D 2HXSA 2F3RA 3U09A 1N5KA 4CF3A 3X1WA 4AFNA 4WZAB 2VPXA 1I5OA 1II0A 4R7TA 1NL3A 1UXOA 3OQHA 2O3JA 4MR7B 3ZZ1A 1D1QA 2RGRA 1N8KA 4FHCA 5E6RA 1S3IA 1NMSA 1PBTA 2C5BA 2GZ1A 2PL5A 2Q6OA 3OIVA 4H0CA 5FUQA 4DUZB 4PZZA 4H7IA 4MZDA 3VPXA 3D59A 1F2VA 4FYPA 2Q5FA 3AOEC 2UYYA 2R97A 3JALB 3VKHA 1U3FA 2XQGA 3CMCO 4MI6A 2RGAA 4W1RA 1OH6A 4UUQA 1G38A 1E32A 4RE6A 1ZNYA 1MPXA 3HDVA 1T10A 2XNKA 1GKIA 2J30A 3ZWWA 5A4AA 2E9SA 4QXPA 2G1JA 5LBUA 3L7BA 2GK3A 1AF7A 3C3EA 2FQYA 1G7SA 2XRFA 2CN1A 3QF4B 4JEMA 3GT0A 4G26A 4IHJF 3KLBA 5BNZA 3ZYCA 2JJMA 2QKYA 5FPQA 2ZI7A 4J2TA 3SNKA 5AJZA 3T1HB 3M3PA 3ZV7A 4DJDC 1KIAA 3C41J 3VNRA 1T8SA 3DP7A 2G9ZA 3MFYA 4WKCA 1CUBA 4GYYA 1ZUD1 5LD2C 3TG2A 4GQAA 1X92A 1DSSG 3B60A 3R5SA 3K92A 1UZUA 5JATA 2YHIB 1QIFA 1W4RA 5JU6A 4KE6A 2JIRA 2UVPB 3LHDA 4CG1A 1Q3TA 4PZCA 4RFSA 1F0KA 4DTCA 1RAIA 1Q1NA 4IHJA 3BTUA 4JLAA 3DD5A 1KSJA 4BLVA 3EPHA 4C0LA 3R6TA 5FADA 4NQZA 5GM1A 1AZSC 3H86A 1GG9A 1H1LA 2GPAA 2X22A 4O4HB 2IU3A 1LK5A 4KIWA 5A5DA 3DSRA 4NMHA 4AJ4A 5D7NA 2DKOA 3I9KA 4M1MA 1JE1A 2QXYA 5ESWA 1KAGA 2WUGA 4FKBA 1W76A 3L6OO 4EYSA 1I7DA 4V3BA 2I3BA 1RJDA 1P2DA 1JWLA 2X41A 3JU3A 1UIRA 1A7KA 2UYGA 3NTRA 4C3OB 4GXRA 3VHQA 3AEKB 4FNMA 1WA5A 3ZVLA 2AKYA 2QMUA 1VE3A 2FEAA 2FOIA 1KEPA 5CLLA 4PO8A 2H17A 1K7CA 3SQOA 4CTKA 3GFQA 3SS7X 3WLAA 1VPEA 1XPRA 2JLRA 2OLJA 2DTXA 5LMCA 4AY5A 1JHVA 2IIVA 4UQOA 2ENUA 1SUPA 4FSXA 4I1UA 5BSTA 1PZHA 2IKQA 2VCHA 3PKJA 2PKWA 3VYVA 4HEHA 3FDJA 2F55A 1EZ1A 4KDEA 2VTBA 2JCSA 3QTLA 3YASA 1JG2A 2L19A 1U8ZA 2B8EA 2XD9A 3PNPA 4RJKA 1GYQA 1FTYA 3OZDA 4AN4A 4KITB 1NBOA 4FCWA 1MH9A 4GWLA 4M83A 3UXYA 1XZPA 1N5MA 1ECBA 2I4LA 2P91A 1EHCA 2X0RA 4US1R 4X5OA 1SVLA 1E6CA 1K7EB 2QLTA 1P18A 4PRZA 2GI4A 2FPPA 3AFMA 3COYA 4CT4B 3U9SA 1A9TA 1Z36A 5C1PA 2YXDA 4QLAA 5K3BA 4ISCA 4UDYX 2WU3A 2QTMA 4XIIA 5K6TA 3HYNA 3GEIA 2IUYA 4UXIA 2FFRA 5JJ5A 4V38A 4EF5A 2ID9A 2M1XA 1UBMS 1ZN9A 4UEOA 3QLJA 1JHAA 1OF1A 2R8ZA 3AKYA 1QDEA 2ATIA 2C31A 4B4KA 2B82A 5EUBA 4X94A 2EXXA 2VAVA 3FAZA 3TSZA 4S1NA 4IIBA 1RMYA 1G6Q1 1OY1A 1QGED 3FFWA 3DZIA 4AULA 2RGUA 3CNEA 1P0MA 6PFKA 4LCBA 4COOA 5TMPA 1QVWA 5JMOA 4GOLD 1XZHA 1ST2A 1Z5ZA 3E7FA 2RDMA 1RE0A 2VHZA 3QX7A 4AO7A 4ZYVA 3T1VA 1EVJA 4HD8A 4MIKA 2DT8A 1U81A 1R0XA 3ZIUA 4JASB 1RABA 3KDPA 1N2OA 4I5DA 4LQDA 4BQNA 2OAQ1 2AYZA 2UZAA 4V0MA 2JI8A 2PKCA 4QVGA 2I6FA 2X15A 1YRBA 2C3PA 1NW9B 1AMNA 5A0VA 3HU2A 2Y1KA 4ME6A 3U7EB 1CYEA 3ETHA 4A8PA 3NX4A 4O4IB 3T3NA 1YVPA 4R83A 3NRJA 2WAYA 1K27A 3TZHA 5HCUA 5HRAA 2R6GA 1RZ3A 3GAFA 3IX7A 2A1TS 4XD7D 1W30A 5DHUA 2H9IA 2YMQA 5TPZA 3IQIX 4MGYR 3WLEA 5IJ9A 4JJ7A 5KCZA 2WWGA 3K8QA 3VV3A 5GVSA 4Y2HA 4YJ3F 2Q9AA 2AF4C 2X5JO 3PFBA 4QUDA 4DRXA 2P9JA 1BU8A 5IJZA 2JJ8A 2YJNA 1CY6A 2P4UA 2X8BA 3WP1B 1ZW1A 4OIMA 2XD4A 4YJ2F 4LK3A 1G20E 2PAAA 2CV0A 3PLAE 4Z99A 5CA0B 3MW8A 5J2UB 3O74A 1E1CA 4E4YA 4FR2A 2L0XA 3PPYA 2IY8A 4ZTUB 1WXXA 3EF1A 2PKQP 3TRIA 4Q7MB 4Q9AA 3WQSB 5JW6A 4YJ3A 4WERA 4OXNA 3P4YA 1E99A 2GH1A 3T7IA 1K75A 3SKVA 3OIDA 1GSIA 3FSGD 2LUOA 1A9ZA 1KETA 2CLIB 2G5TA 3JZAA 4RETA 1T2VA 4YJ2A 1HE8B 5CA1B 1ONSA 2O1SA 2I8CA 3LX4A 4XPIB 5EMMA 2QPLA 4GNRA 1G9XA 3SBDA 3EXIA 4R7GA 1DRVA 2BFFA 2GFHA 4XOIA 2Q5EA 2XT9A 3FUXA 1AUQA 3ZLUA 5KNBD 1L7MA 2QUAA 3WYDA 4N5IX 2UZ0A 4A8JB 3KEOA 3BFVA 2QRZA 1GGFA 3MRXA 3NDRA 3MCAA 3R6GA 4IPTA 1XEXA 3ZWNA 1GRQA 1I2AA 1P0QA 1UM9B 1WW2A 2CDAA 1AN9A 3BS4A 4WT7A 3WDMA 4ACAA 5IASA 1GGKA 2WYHA 3I0MA 5C3UA 4XVQA 4Z9BA 2AG6A 2J1LA 1AS3A 4C6TB 2O8FB 2G71A 3B9BA 3E82A 1P80A 3OZGA 5HFNA 1M7HA 1PBNA 4YAWA 2I91A 1NMZA 3LPCA 2QX4A 1OWMA 4W5JA 1BDHA 5IT5A 2QL7A 4GZ6A 3R8FA 1N7IA 2CHQA 5MN4A 1WBJB 1V1MA 2X5XA 1U1IA 3HM2A 1YR2A 1VBFA 1S8AA 4F5DA 1XTZA 5GAJA 3GRRA 1DBQA 4BV8A 2ID4A 2FRVA 5TS3A 3CLUC 1NATA 1RD4A 5K6AA 4MQEA 4M55A 4YY3B 2YNMD 3CMMA 1TYZA 3LYUA 4OHCA 1Z6ZA 4XR9A 3GFOA 4JJ4A 1J2EA 2OCLA 3OUZA 3C3KA 2BEWB 3HVHA 1X1EA 3SXUA 1SHZA 3CE6A 5AI9A 4EHBA 1SIOA 3MWJA 3TIXB 2VKQA 4B73A 2FN3A 1R0KA 5E7IA 2VNIA 3QKRA 4DDVA 2N42A 1YRWA 4L2IA 4PSVA 1XROA 1LBHA 9LDTA 3RTAA 4CUKA 3DOUA 4BJ1A 2FDCA 4V24A 1RZRA 1RRKA 1W0KD 4BBAA 4FFMA 4K9SA 2BHRA 2Z0MA 1AE1A 5KJFA 2I2XB 2A7XA 4GXQA 4ARSA 4C0SA 1XXHA 4RPGA 1XJQA 3HWSA 1VJ0A 2WSYB 3OU7A 4G8DA 4IGAA 1GCUA 4Q1VA 3RS7A 1OH8A 3AL0C 1S2NA 4M86A 2DJIA 3T7KA 3FTPA 1CZUA 4GSYA 1X7HA 3NU1A 5CD1A 3L7MA 4DC9A 1RWWA 2QR2A 1ISRA 2YIJA 2JFHA 4UCFA 7YASA 2ASEA 4Z4HA 1HT1E 1X77A 1GXSB 5BW4A 1PGJA 1S02A 4DV5B 2RG1A 2E1PA 2PWAA 4C78A 3DE1X 3MERA 4FD3A 4MGKR 4Y2RA 3LRXA 3WMXA 3DAHA 3AVVA 2BGMA 4N39A 3NHRA 3TLGB 2OR3A 1DU4A 2YWJA 2DBYA 1F0NA 3P1JA 5DASA 1Q20A 3H11B 4CCYB 3Q2KA 1GL7A 2WT4A 4KEAA 3MB5A 5K0FA 3EEQA 5L6MB 1DC6A 1CRLA 3OFND 5DYIA 3RB8A 3QUCA 1O0SA 2FK7A 2YW9A 2WJ3A 4GP9A 1KYWA 2GOYA 3GLFB 3DZDA 4MGEA 5EZ6B 1PJRA 2XYQA 2GAOA 1G6OA 2G1KA 2VA9A 1ZOPA 3ANMA 1YU6A 3L82B 2ZAMA 4EY7A 1L9XA 4F5ZA 5JISA 1ESMA 1KSFX 3KYBA 4HX9A 3RJTA 3KKOA 3RVDA 2QZPA 2XDQA 3AF0A 5JS2A 3VKVA 2B83A 1FTSA 1YKSA 4BDTA 4DA7A 4LNHA 1UPUA 1NXSA 2QTLA 4IWNA 5LZ4A 2E18A 2YVLA 1EK6A 3KLMX 5A1TA 5LQNA 2UYCA 1WUIS 4QRHA 1P75A 4OHXA 3IMGA 4HNUA 2G6TA 3NNSA 4XYLA 1SD5A 3PFNA 3U60B 1QQ5A 1ODJA 2GK6A 4NZNA 3DW1X 3LUAA 2ORIA 4ZI7F 3K70B 4ZYLA 4KIGA 3WIVA 1G5TA 2HU7A 3P4XA 1EM8A 2CFOA 4JKIA 4YK7A 4U1RA 3TSYA 1UBSB 2YWBA 1SPBS 2OCPA 3ZDFA 3UXEA 1H8ED 3NJRA 5AJTA 5E9AA 4O2RA 4RVCA 3H9QA 3ETNA 4BUJA 2RGCA 2QM8A 1B93A 1KH2A 1M75A 3MBIA 1XL1A 3GYGA 3B82A 4JX9A 2ZKIA 5E4FA 4PYIA 4ENTA 5EIEA 2QBYB 3R7FA 1NN3A 4ZA2A 4ZI7A 5FPPA 2DAPA 1N0VC 2P78A 4KPUB 4PS0A 5BN5B 5A5VA 2HDWA 4G86A 4MHTA 3MGKA 2HWKA 3VC7A 4G5XA 5CJ2A 4IQ0A 4YV2A 3PLRA 4F06A 9ATCA 4Z3OA 4FIZA 1K6XA 1SXJD 3RASA 1Z6PA 4PEVA 4ZJZA 4W7HA 1CD5A 3HJRA 5EY5B 4UOZA 5E0OA 1WBDA 2M6SA 1HNWB 4MA0A 4GFDA 1LBEA 1JPNA 4O2LA 4A6PA 5LQMA 4DKXA 1M0WA 3LF2A 1YNOA 1Y8RB 2YL2A 4Q3KA 4BMZA 1LW7A 1SVNA 1T5DX 2WI8A 4C43A 4IL5A 4B4OA 5DCUA 5AP9A 4LC9A 4MV7A 2PZGA 4DMFA 1SXJC 1DT5A 2FF7A 3JRXA 3TKLA 1CXZA 3ASUA 4HZUB 5HG0A 1XTQA 4OFBA 2W48A 4QNNA 5TT0A 4AQDA 3QJ5A 5D7BA 3R7SA 3R3YA 4TLBA 3NBMA 2OYRA 2IYPA 1KQ3A 4WCFC 1E7MA 4DA9A 2PT5A 1HA3A 4J9VA 3R3HA 4F4HA 5ENVA 3PX3A 3ZJ5A 4Z0TA 4I4LA 4Q03A 4LWZA 5T4FA 4ZMSA 4KLAA 3CYFA 3GNTA 5ITZA 2PN1A 2IYSA 2W98A 2D13A 1SOWA 4AIIA 4ZAZA 2I1WA 4JS0A 4UPVA 3D3WA 3DMTC 1KS2A 3P27A 1FLVA 4D9FA 4TKUA 3KR0A 2ECQA 2GKOA 1IZYA 2AV6A 2GN8A 2OAP1 3BRWA 3H5RA 3IQZA 1E8MA 1M8KA 2JA2A 3N1UA 1D9ZA 3HVJA 4DEVA 2BZ1A 2G4LA 5IAGA 2ZRCA 3GH3A 4K9PA 6REQA 1ZUIA 2P2SA 2V1XA 3K3PA 4EQ6A 3QVSA 5SZKB 1NJ8A 2GCEA 2QMHA 4YDQA 1INLA 5BSUA 5DX1A 1H2XA 3IB3A 2P27A 3IAAA 5ER9A 3H1GA 4ESHA 3UIEA 2HMUA 5C31A 1KL7A 4AKIA 4E5NA 2CXOA 3G2LA 4QO7A 3MJ4A 2XRZA 2LPMA 4MYTA 3ILSA 1SPXA 4HDNA 1D2MA 1YCHA 1NTRA 1JLRA 5FQNA 3TLYA 3VR2A 1JI3A 3QX3A 7MHTA 3RTDA 1ORVA 1EPUA 4B6QA 5JQWA 3LO5A 3HJAA 1YULA 2D62A 2PG3A 5J59A 4AMZA 2GSDA 1Z4OA 2GCGA 3LGXA 2OQ2A 2X7XA 4A5SA 5CDSA 3Q8LA 1SKUA 1IOVA 2CJWB 2Z3WA 1CZRA 1BVHA 3NEYA 1PFUA 3EB9A 4F2DA 1KI6A 4J75A 2GM3A 3A6LA 3GGSA 3E6AA 3QVJA 1YB5A 2P5SA 1RWBA 2VDPB 4J2HA 3WK9A 4D9EA 2PRZA 1LD3A 1PTKA 5C8DA 1LSSA 1MC8A 3AVWA 2CYBA 3PYLA 4B80A 2G8LA 5EE5B 2XGMA 3B20A 3QE0A 4KMSA 2N75A 1RYZA 4YGXB 2IS1A 4Y2SA 1QH1B 4XE5A 1MG0A 4AKEA 4RIHA 1OREA 2RHMA 5ULLA 2CC2A 1Q14A 1B43A 1AN0A 1SD2A 2G82A 1A72A 3HBAA 4JLKA 4ZVVA 1X94A 1WD7A 2OB2A 5U9CA 2F8SA 1R4NB 1MENA 1O7JA 3KJZA 3C8DA 3KZOA 4MULA 1R6DA 3LKBA 5A05A 1RAAA 3OCCA 4QODA 4YDHB 1HPLA 3K05A 3GJ5A 4N54A 1M0EA 1ZSNA 2O6LA 1OJLA 4IGIA 5JAIA 3A4NA 3B6JA 1A8SA 1QFYA 5KYGA 1G1MA 4L51A 5JS6A 2VBGA 4MAMA 4OP2A 1QVVA 3U4CA 3IE1A 2BFEB 2C0CA 1NY5A 3STTA 4X7PA 2QW1A 4BQSA 2CHGA 3OCJA 1PX2A 5FFFA 3K8YA 2VNHA 1P7VA 3GIWA 3K0KA 1XSEA 4L16A 3OMLA 4TMZA 3RBXA 3RC1A 4ZCMA 4CM6A 2UVDA 1JDJA 1TZ2A 4Z1OA 1JSRA 3KWMA 1EWKA 1EYZA 4TLEA 1FNSA 3EQZA 3MQ2A 3KSMA 3NTVA 4L8GA 3OP4A 5IHPA 2XSZA 1G8JA 1T2NA 4BWVA 1FQWA 1YK0A 5L8VA 2ZBUA 2OT3B 1ZOSA 1IL0A 1IUKA 3GCZA 3A6JA 1FSSA 4US0R 3W2GA 3N5KA 5BUZA 4MI1A 2X0NA 1SOVA 1VMEA 1OYVA 4LK2A 4QE3A 5JUWA 2D54A 1RM0A 1MC5A 5DISB 3P26A 1X3LA 4HUTA 1YVEI 2BRUA 2GERA 4NYIR 3ICEA 4BNGA 3BWDD 5L4NA 4B6RA 1JFTA 3I72A 3D02A 3WYCA 3W04A 3ZUGA 1GSAA 4S05A 3EW7A 3LL4A 1Q1ZA 1QGOA 3NAGA 2HF2A 3FBTA 3QPVA 1L5KA 2AZ4A 2GYWA 4MW7A 4YXFA 1LU9A 1V37A 1NNEA 4TMVA 3AP1A 3U6KA 4L02A 2P2LA 3FLEA 3ZHSA 4HVTA 4DZTA 3TM4A 1KSGA 2GEFA 3N59A 4CLRA 4TZ6A 1KEEB 1PWZA 1SNYA 3CEJA 2Q0QA 3EGDA 4XWGA 1IPHA 4F4FA 2PK3A 4ZVMA 4MS1A 3T5MA 2NQTA 2JIDA 3NIFB 3ZWPA 4WEQA 3JQFA 4IVQA 5D85A 2XE6A 5I7RA 4RF2A 1O9GA 2IW3A 4FMDF 2FAXA 3KJXA 1M8JA 1J49A 4PYKA 4F72A 4ZCIA 1RM4A 2Z9BA 4L5YA 3B1KA 3M4JA 3HPQA 4WSOA 3IUYA 1RKQA 1WPXA 1YACA 2ZSJA 4LQLA 3UJHA 2O2XA 1U0OC 1R8QA 4I9HA 1M0TA 3OOJA 3CNLA 1CUEA 1Y1SA 3NTXA 1XWIA 4JBXA 3WOVA 2I8AA 4MR9B 4F6CA 3IUMA 1U5BA 4CQLA 1V3TA 3L8CA 1HNNA 4GKVA 1RBZA 1V2HE 4H0NA 4J49A 5LNK6 2I6TA 3FFTA 2C2XA 2RGBA 4PZ9A 2C2HA 3KEFA 1VPTA 3SJZA 3BH7A 4B9EA 4CCWA 1FUYB 4DN6A 2I33A 2PL9A 1H2WA 1YC5A 3KRTA 1NVDA 1QF9A 2J0EA 5B4UA 3GVXA 5DI3A 2YRXA 4WADA 5ABPA 5AW7A 1P81A 4LGCA 1MAHA 5G02A 4EAQA 4X41A 3SI7A 5JH7F 2O54A 4B3RB 4I4TB 3L7OA 2V4MA 3KQMA 3EXG2 3C3WA 3MUFA 4QBGB 2XQKA 3C45A 1P39A 5EIFA 1ZKDA 4EP1A 2QLBA 4H08A 3IBYA 4KO1S 5KQLA 5A9SB 1GGVA 3GQVA 2D7DA 1R15A 3OSUA 4EVRA 2ZROA 3VR3A 3OM1A 1FTQA 2VDUE 4XVRA 2NVWA 2O2HA 3KQQA 4FONA 3P4UA 4BVFA 2FOXA 1RYNA 2HBRA 4ZIRB 2R6CA 5JH7A 2FR0A 2ZT8A 1RC0A 3L41A 4B82A 3UW1A 4KPFC 4XIGS 3ZXYA 4YLEA 4ZVLA 1DELA 4U4AA 4D8UA 1JWBB 3WHKA 5AVTA 4U2KA 4G23A 4DJFC 1GAEO 4DCTA 2R00A 2XNDA 2V7UA 2QZ9A 4YJHB 1THZA 1C1XB 3ZE9A 1P9NA 2E87A 2GEVA 4H31A 1C8BA 5AKYA 4HEA1 5F76A 5SYNA 1T8PA 5CJPA 4PLZA 4LHEA 1XMIA 1FDVA 2ZJZA 1DBIA 4O25A 1LPOA 1KWKA 4H77A 5LIRA 5H81A 1J2TA 3D3QA 2HK8A 2VI5A 2PFSA 4K1LA 1LTQA 3CNOA 4W6ZA 3MCTA 3ZDYB 2JLVA 1MNQA 3GEGA 4DJAA 3OETA 1SKBA 2C5LA 4Q7LA 2B92A 4IFIA 3D2LA 3U4QA 1PGPA 1NJ1A 4OHPA 4DXHA 3SOZA 2Q3HA 2LKDA 4Z9FA 3A25A 5E1BA 3UATA 4RM2A 4JWKA 2FMFA 2PLAA 5IM4F 1C7JA 4PLVA 3AI1A 1M72A 4GL2A 4B4VA 3INNA 2E6KA 3C5VA 4HQFA 3CWCA 4RA9A 5EWLA 3IMKA 4G4GA 1YBVA 4EKIA 1AHHA 3UWPA 3HNRA 2O2JA 4HNGA 4J76A 3RS0A 4DCVA 1BD4A 3ZGYA 4N9QA 1WMSA 2ZSIA 5DU2A 4NZOA 1PN3A 4LJ7A 4JUAA 4CHGA 1Z38A 4B09A 4ZOEA 2VQ6A 5I7AA 3T15A 2MSDB 1WMDA 2FPKA 4IZHA 4Q01A 2Q3DA 4Q6WA 2X7JA 4J4BA 2VK2A 5IN4A 2I2WA 3DA8A 1TA0A 1FYEA 1KEVA 4K3UA 4QDJA 3WNQA 3MQFA 4LW8A 1ZP6A 3U4IA 6ABPA 5EWMB 5FI5A 3W9UA 5AIBA 1J8QA 2R1VA 4MUJA 4NX2A 2XGSA 1UPXA 3NHWA 4I8DA 4AG3A 3IPCA 4RY0A 4Y2QA 4BFSA 1H65A 1PJTA 3H8SA 2H48A 1H3NA 3A05A 2BCJQ 1E0SA 4WBSA 1JHYA 1M73E 8OHMA 4CMCA 3HSSA 3SR3A 3OM9A 1IUPA 2YY7A 2TMKA 3AP2A 2BJVA 4MQ5A 4DTIA 5KVSA 1SXPA 4TL6A 4EEZA 1SFRA 4HDMB 4LMBA 4MWOA 4RVSA 3QWBA 1NRIA 5HKKA 2O06A 2NU9A 3ZIAD 3UO8B 2VJAA 1MHPA 4HS9A 4JBLA 1JMYA 4DNPA 1ORIA 3L8DA 1F5NA 5BXYA 7ADHA 4I9NA 1A9RA 1SJ9A 5I45A 2AMJA 2HMVA 4FCTA 3TCKA 3KV1A 1IK6A 3OLCX 3RK1A 2PMEA 3CRRA 4A6XA 2R68A 3GA7A 3EE6A 5IJWA 4MA5A 5IDWA 3A4MA 2DHDA 3IB6A 1YKGA 3O9MA 4HK4A 3UV3A 1FIUA 4Q3CA 4X6LA 3L8YA 6CHYA 4R2JA 1HZJA 1VKRA 3L5OA 3E84A 3GZNB 3MXOA 2HHHB 4DEXA 3LLUA 3PXBA 4GEGA 4DWOA 2NPFA 2R87A 3SP1A 3PDWA 1IJFA 4AB1A 1NVXQ 2FEPA 1EWYA 1II9A 2DPYA 2FE1A 2GPTA 2RSLA 3VU3A 4B3JA 3MF4A 2AZXA 1Z4MA 3JQQA 3TVTA 4C06A 5I4BA 2HDOA 3T9FA 1M6EX 3DKVA 5EIXA 1MLDA 2FUG1 1V4NA 1E3QA 4KQ6A 3T1NA 1GVHA 5EOVA 4BB9A 1BJKA 1WSWA 3GEDA 4JDUA 1EFUA 2V7VA 2W6ID 5K0CA 4O1IA 2ZJBA 2UVQA 1Z2EA 1UM8A 3SS9X 1TAUA 3S1LA 5K0ZA 4QPNA 4QGAA 2Z1DA 4P3NA 2W0SA 3SY8A 4WKNA 3BD9A 4HYTA 4ZAWA 1DWPA 1N3BA 1XELA 4XZ3A 3JWEA 2P35A 3GJQA 2ZRGA 1XDBA 3CJTA 4EL0A 3UMJA 5K0NA 3VNAA 3AF5A 4IGEA 1MX5A 1DJNA 1CY1A 2AZMA 2IHVA 1EP2B 4LI3X 3NHLA 3WYGA 1WY7A 3B6KA 4HGNA 3T9CA 1D6MA 2KSQA 2PRYA 5FHRA 1V3UA 1CQIA 2PL1A 4C2TA 2Q3CA 1FSFA 2PJUA 3JQPA 4PE5B 2AVNA 2CLHB 4EB3A 1BEEA 2JJYA 2QR5A 1X7ZA 1N5JA 1DJLA 3OCYA 4MJXA 1FLNA 3N2EA 3X0DA 1W36C 4G24A 1ULAA 4QWWA 3WLPA 1OC2A 1W85B 1CEXA 1E94E 4II7A 2JCXA 1U2EA 1RJGA 2Z6VA 1I30A 3PTLA 1BCSA 1XKTA 2AW5A 2CNLA 1IWBB 2YVQA 3RO7A 2Z4SA 3OZVA 2FZVA 1T35A 3FJOA 3H1BA 4UMEA 4HNHA 3TR6A 5JNWA 1KJZA 4QRIA 1VBMA 3OURA 1T25A 3RTEA 3P0EA 3PC8A 3K9FC 1FW8A 3EPJA 1HXHA 1T1EA 2WJJA 2FUNB 1GU7A 3KSAC 1T2CA 2W11A 4L5CA 4Y9DA 5G0SA 2ATCA 2R3SA 2YBDA 1JDUA 1TMYA 5IN5A 2VWQA 3GJXC 4E11A 3THWB 4M0LA 4AKTA 2IUSA 1IEQA 3ABQB 2VJPA 3ETGA 4HDKB 3U62A 4QYSA 4LF7B 1T5IA 1V5GA 2WFAA 1O94D 1ZD3A 3A3PA 5HIIA 4EOGA 5DYNA 3D6VA 3SWWA 1FFXA 2AJBA 1DX6A 4F6RB 2PQMA 1KFBB 4L4ZA 5LBIA 3T54A 3FTFA 2P9BA 8AT1A 5C7OO 3B1FA 5IT9A 1E3MA 2W2PA 1V9CA 1I2BA 3GT4A 2B5VA 5KQSA 1N1MA 1CJCA 5IUKC 3KQVA 3PDJA 2XKAA 5FBWB 3NUGA 4ARVA 5H16A 4DSTA 4Q4LA 5BSEA 1NVEA 4NAUA 4TWJA 1ZNXA 1RHRA 2FDXA 1JAZA 2L18A 5GQSA 1UBUS 4XIJA 2TS1A 1ZX1A 2C97A 4YRPA 4JT8A 4AZ3B 4EHIA 5K99A 3PEUA 2PSFA 3IKVA 5AVVA 4AUMA 4CKCB 3B53X 3O8LA 2A0YA 3GZTB 1E1RA 2CXPA 4L5BA 2VH5R 3IELA 3BUSA 4WECA 1ENYA 2V6MA 3LDHA 4ARCA 2Z3ZA 5T4BA 1B8PA 2EYUA 3LCRA 2HH9A 3HDGA 3MWFA 1I4OA 3NZEA 4INAA 3D3KA 3WAKA 4DUPA 1GQRA 3EVNA 1QGUB 5ADHA 3HKDA 4FQ7A 2CBGA 2GX6A 3JTEA 4JGGA 1N9KA 1ACJA 2VYQA 1Y1KE 4QBHA 1GADO 1JT9A 1GLNA 1XNHA 1WRBA 4V0RA 3H99A 4BQPA 5F5LA 5HBRA 5LDHA 1I3NA 3TLAA 2ZI5A 3TOVA 3PNSA 5DWQA 1Q0UA 1G5PA 1GD1O 3ZX5A 3FYSA 1T0HB 4B3SB 2RKOA 4IOJA 2A9FA 4EKGA 1KH1A 4ZCRA 1OH5A 4P31A 5IVKA 3CF6R 1ODKA 2BGLA 1UBCA 2H1OA 3OZIA 1ABFA 3BFXA 3K96A 2WFLA 4J4HA 3KB6A 4AW9A 1QHFA 4Q4CA 4RA6B 1AUVA 3EJWA 1PEDA 2GZ3A 2BR5A 1CNFA 4QJ5A 5D3MB 1T5SA 1VE1A 3CUYA 4EGJA 1PK9A 3OO0A 4NMLA 1P1BA 2R1ZA 1ULTA 3CZCA 3RGGA 4YAKA 1QGYA 1NXVA 1A5TA 4J43A 3TQOA 1L5QA 3ISVA 4GBJA 3H04A 3QEKA 4CKZA 4WNYA 4L95C 2MINB 1HDOA 2VSQA 4M7OA 4HDAA 4PC1A 3WB0A 5KS2A 2CHVA 1YD7A 4MIEA 5T64A 4BP8A 4G65A 3OFJA 1U8CB 4MKHA 3MHPA 1AXRA 2BKUA 4GOJA 2NV6A 2QMOA 3H3XA 3E1SA 3LUBA 4GUDA