1XNHA

Crystal structure of nh3-dependent nad+ synthetase from helicobacter pylori
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
251
structure length
251
Chain Sequence
YQKLIVYLCDFLEKEVQKRGFKKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPSSVSMPENKTDALNLCEKFSIPYTEYSIAPYDAIFSSHFKDASLTRKGNFCARLRMAFLYDYSLKSDSLVIGTSNKSERMLGYGTLFGDLACAINPIGELFKTEVYELARRLNIPKKILNKPPSADLFVGQSDEKDLGYPYSVIDPLLKDIEALFQTKPIDTETLAQLGYDEILVKNITSRIQKNAFKLELPAIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Crystal structure of NH3-dependent NAD+ synthetase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
total genus 78
structure length 251
sequence length 251
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1xnhA01
4NX2A 1WJGA 5IJXA 1N2BA 1PFYA 5KCMA 3U1VA 3X1MA 1D2RA 2HMAA 3TS1A 4X0EA 2QJOA 4ZCTA 2B7LA 1N75A 5DEOA 1O94D 3ZGZA 4ZT6A 2XRZA 1PFVA 3CLUD 2WSIA 1FFYA 1O94C 3DLAA 1O96A 1KH1A 3TZLA 4L2IA 3IVGA 1EE1A 5J5AA 3TNJA 3KFLA 3ZUGA 1EFVA 2X1MA 4XFDA 4H3SA 3HL4A 4JXXA 3NV7A 1ILEA 4ZCSA 1EUQA 4CQNA 3IVCA 2OQ2A 1MB2A 2YWBA 2BTEA 1OWPA 4MVXA 1JGTA 1T6ZA 3A05A 2CYBA 3RK1A 1I6LA 5IHXA 4JZYA 3TZEA 4JYZA 2DUMA 4MAFA 2A1TS 1NUSA 2D13A 3ILVA 4Q93A 3ELBA 1WZ2A 1XNGA 4UZFA 2TS1A 1F7VA 2JANA 1PFUA 2Z3VA 2QUJA 1TFUA 1P7PA 2A1UB 1EUYA 1FYDA 1DNPA 5H16A 1PG0A 1VL2A 1U7DA 1YUNA 4HJRA 3ZXSA 5HUHA 2A86A 4G6ZA 4U63A 3AIIA 3L92A 1Y42X 1XNJA 4MUKA 2QUKA 3FY4A 4PBRA 2A1TR 1TYBE 1GPMA 4DJAA 4DNXA 1TYCA 1N1DA 4MUEA 4CDMA 3CLTD 4MW4A 2XRYA 4R0NA 1U7XA 2IJGX 2PZBA 5TEWA 3VGJA 3PXUA 5FNZA 1YI8A 1U3CA 2Z08A 4J76A 1WOYA 4U7JA 3CLRD 2BYTA 3ND6A 1EFPA 2I1LA 3L93A 3JXEA 5H7XA 2AKEA 4DDKA 2RD2A 4YP5A 4EG6A 2J08A 1RQGA 3UK2A 3CLRC 1X8XA 4MUGA 3DO8A 1F7UA 1EXDA 4ZCQA 4I6GA 3KT3A 3LOQA 1N2GA 4MW1A 1MBZA 2CT8A 1K4MA 1H3EA 2V0GA 1VLHA 1F9AA 1J20A 3SP1A 5AHWA 2QTMA 4F4HA 1I2DA 5F23A 4WSOA 3ZIUA 4OUDA 4ZT5A 1NI5A 3HMQA 1NUQA 3QE4A 3IH5A 1TQ8A 4RPIA 4AQ7A 1O0BA 2E18A 2ZUFA 2YWCA 1Q15A 3H97A 1NUUA 1G8GA 1YIDA 1EJ2A 3FDXA 1T9GS 4PBSA 4DLPA 1PFWA 1MAWA 4MUJA 4YBRA 1YUMA 1OWMA 5KHAA 5KWVA 2QUHA 1ZH0A 1O95D 4EG1A 1VBNA 2PG3A 2DXIA 1NURA 2J4DA 4EG5A 1KQPA 1H3NA 4PBTA 1MRZA 4XFJA 4GRIA 4QBTA 3GLVA 1T9GR 1SURA 1NSYA 1K97A 1OWNA 2WB2A 1S4MA 2PFSA 3ZJUA 1JEEA 1QNFA 4MVYA 3FG9A 1KP2A 3GUZA 4MVCA 2X1LA 2G36A 1TEZA 3FETA 3SZ3A 4KPUA 1IQ0A 1N3LA 3AL0C 2J07A 4NATA 4I6EA 1WXEA 4QRDA 3KT8A 1K92A 3CLUC 2CV2A 1KAMA 4GU5A 1GTRA 3M5WA 1J21A 1O0CA 3F3MA 3AKZA 2PIDA 4HK4A 4KR6A 1JECA 3A4IA 1H1TA 1M8FA 2CFOA 1OBCA 3QTTA 3CVVA 2CV0A 4CDNA 1JEDA 1OD6A 4FZJA 4QREA 3N9IA 1M8PA 5FO1A 1R6UA 3OTWA 2AZXA 2A84A 2GKSA 4MVWA 1U0BB 3COYA 3HZRA 1VBMA 1Q19A 2J09A 3N05A 3X1JA 2WQ7A 4R2LA 4ZT3A 1QU2A 1OBHA 3IUEA 1IQRA 1A8HA 3AG5A 1YULA 3C8ZA 1JMVA 2CUZA 1YIAA 4MW7A 1NP7A 5JBNA 2CV1A 3NBAA 1GN8A 1N2JA 2E89A 1N78A 3P0HA 1V47A 4MLPA 4G5FA 1JILA 1IVSA 1GZUA 3RK0A 1ZJWA 1NUTA 1KKUA 1XJQA 2PZAA 3DPIA 1I6KA 5K0SA 3A04A 4AS1A 3AFHA 2D54A 5DASA 3PNBA 2WQ6A 3CLTC 4HPWA 2AG6A 4EG8A 2A7XA 4CT0A 3HV0A 2YXNA 1KQOA 2A1UA 3G59A 1G8HA 1MC1A 2ZP1A 3MLBA 3UC5A 4DE5A 4F3RA 1WKBA 3PNYA 4A91A 4K0RA 3CVUA 1IRXA 3D6VA 1R6XA 2QJFA 4E1AA 2O8VA 2O5RA 3PNVA 4ND6A 3IMCA 1LI7A 3MXTA 3N2YA 3QTBA 2A4MA 2NZ2A 1QRTA 1WY5A 5BNZA 3P0IA 3H9CA 4G5YA 4MW6A 2QTRA 1JZQA 3G5AA 4ZCRA 2PZ8A 3IVXA 4MW9A 5J59A 4NAHA 3H05A 1J1ZA 1R6TA 4U8HA 3FIUA 1Q11A 3RFFA 2EL7A 1M1ZA 3IOBA 3A2KA 3RBAA 2J5BA 3LE8A 1KR2A 1GAXA 3BL5A 1KH2A 3OP1A 4XSVA 1JIKA 1UFVA 1BS2A 5LLTA 1WXFA 2JAXA 3TQOA 2R5WA 2CYCA 3UOWA 3KT6A 2QJTA 1MB9A 5EKDA 1T6XA 1GLNA 1H3FA 1IH8A 5FO0A 2A88A 2E21A 2EJCA 3E27A 1O95C 3IODA 3KT0A 3GMIA 3I05A 4EG3A 3FOCA 1G8FA 3IMEA 1LW7A 4MUIA 1QJCA 3HGMA 1O97D 3Q10A 3SDBA 1O96B 1WXGA 1M8JA 2HZ7A 1V8FA 4I6JA 1O97C 3ISJA 4ND7A 1GTSA 1N2EA 4Q16A 1M83A 4YP6A 5TS2A 1JZSA 1QRUA 4ZT2A 4MULA 4MWCA 2PXHA 2H29A 4YP7A 3FI0A 1IFXA 2X3FA 4MWBA 4RUKA 4KR7A 1JHDA 1F4LA 3SEZA 4S1OA 3MLAA 2OV4A 2DLCX 1N2OA 2H2AA 4KR9A 2VTBB 1N77A 1COZA 1QU3A 5TGTA 1O6BA 1TYDE 3SYTA 2NSYA 3MMXA 3CVWA 1JIJA 3CA8A 5LFAA 2V0CA 5K0TA 3ND5A 4K03A 4MW0A 3P52A 4OJMX 3INNA 1JIIA 2DPLA 4EG7A 1T6YA 4MW5A 3CVXA 1NUPA 1NZJA 4MWEA 3H9BA 3FWKA 4JXZA 2C5SA 1OWLA 3CVYA 3IMGA 3SZGA 3UMVA 1MOPA 1PG2A 1N2IA 1WXIA 2RE8A 4DDMA 2VTBA 3ZJTA 3IUBA 2QUIA 3D6UA 5HG0A 1KQNA 3VU8A 4ARCA 1XNHA 3DV2A 2JA2A 1ZH6A 1EFPB 1IHOA 4ZCPA 3IOCA 2HGZA 1WXHA 3FH0A 1Q77A 1KP3A 4ARIA 1ULHA 3IOEA 3G6KA 2DETA 4P2BA 4ZT4A 4JFAA 4EFKA 4J75A 4EG4A 2CYAA 3LCJA 4MUHA 4TS1A 1N2HA 1J09A 3K9WA 3COWA 3FHJA 1X6VA 2YY5A 1B6TA 3VRHA 3PRHA 4OUDB 4MWDA 1VBKA 1MAUA 5HUJA 2ZUEA 2IP1A 4BWVA 2GOYA 2VXOA 1CT9A 4NAUA 2D5BA 3N8HA 3AG6A 1K4KA 1NYLA 2IELA 4HJXA 2E0IA 3TQIA 3COVA 3UY4A 2DERA 1KAQA 1OWOA 3H99A 4MUFA 4YMIA 2DEUA 3Q4GA 3MUEA 1M8KA 4MW2A 1KH3A 1IQUA 1WQ3A 1TYAE 2QTNA 3NBKA 5J58A 4MUNA 2Z09A 1QTQA 1HYBA 1KORA 3RHSA 5TEVA 4PY2A 1O5TA 1QRSA 5DB4A 3HFJA 4EGAA 1QQTA 2DR2A 3CR8A 3FNRA 1J1UA 3CLSD 3K32A 1ZUNA 4KKVA 1U3DA 4WNYA 2X0KA 3S3TA 3ND7A 2CSXA 5DK4A 3CLSC 3ZJVA 1J70A 3RJZA 4NDAA 4R2MA 3X1KA 4EF6A 4KPUB 4NZPA 5LM3A 1I6MA 1M8GA 1MJHA 3COZA 3SEQA 4ZT7A 1LI5A 1WQ4A 3P0JA 2GM3A 4DDHA 3Q12A 4L2IB 4UZEA 4MQ6A 1G59A 1EFVB 3ZXIA 3IDFA
chains in the Genus database with same CATH superfamily
3ABOB 1WJGA 4QYWA 2DHEA 4KYTA 2H2FA 1N8KA 2BMDA 4YUWA 2XGOA 1ZSVA 1GTL1 1ZOIA 2V7QD 3UHAA 3H5AA 4LHWA 3N8GA 2V4MA 5C1PA 4MVJP 2GF9A 2Q1SA 1IHYA 2R8RA 2ODPA 4AJ1A 3OOEA 1ZVKA 2AN4A 2W2MA 2EZUA 3DG9A 1TCBA 4S0ZA 3AEQB 2ECPA 2ZE5A 2VK2A 3KR9A 4WXMA 3A1WA 2XRZA 4G09A 3PGKA 4I46A 4OY3A 5CG2A 3UUGA 4LNUB 5EG5A 1JA9A 2ONCA 1O57A 2XNHA 4N0DA 1D2MA 3DBHA 2V7BA 3LYHA 4L5CA 3O8DA 4MMYB 1F51E 5G02A 1KY4A 3IR5A 2FEPA 3MS7A 4UHEA 3TTSA 3W1WA 2GO1A 4IOJA 5JSZA 1VI6A 3EGDB 4TV8B 3FVWA 1Y33E 1CY4A 1VE5A 2JEOA 3CF4G 4A2WA 1J8VA 1JWAB 3UMRA 4BKRA 3LYAA 4U6SA 1NQVA 3RVKA 3ZV5A 4V39A 1NNLA 1UCFA 1SVUA 1FEZA 4W8OA 5F64A 1LDGA 1EEXB 3LK6A 3TX2A 4F6CA 4CQNA 2B8JA 2W11A 2FEXA 2ZCJA 3RYHB 3Q7IA 3RRBA 2OZKA 4ZYZA 4K2AA 7REQB 3VKWA 5JARA 2P78A 4CXMA 4DCPA 3HJNA 1BG6A 4NFLA 4RTOA 4DXHA 4ZO9A 3G85A 2NV2B 1SKYE 3A9UA 3BILA 2Q07A 1W0KA 3JV7A 2WNHA 5ESWA 3FLBA 5GJVC 1SCUB 4Z53A 1QAOA 2VBGA 3K0CA 1WZ2A 5EL0A 3RBXA 3QEBZ 2B1IA 2Q6OA 3H13A 3IEKA 1ZS9A 2X8JB 5HZMA 8LDHA 4DDVA 3N76A 4GBED 4BVHA 1NASA 3WB9A 4B44A 5K8CA 1HE4A 4A16A 1ZONA 4Q0MA 1VL2A 3ENNA 4KWTA 1WP4A 3V4PB 1ZI6A 3CN9A 3ZW8A 5TS3A 1W9MA 5BRNA 3HB1A 4QVKA 2D5AA 4RENA 4ZOLB 4CT4B 1CF2O 3WYGA 3EZ9A 4ENUA 5J4HA 1QP7A 1A7UA 1KRHA 2A1TR 2R68A 3TUZC 4EY5A 5CIWA 5BQFA 2YV3A 4HH4A 2Z5VA 2Q9BA 4QOSA 1RSZA 3E53A 3QOYA 2QENA 2VYQA 4O0MA 5KYXB 4O4LA 5TC4A 4PV7A 3ASUA 1ZNZA 2WYHA 4KLZA 2AF4C 2ZATA 2Z4TA 3AHDA 5BOSB 2H59A 2P3SA 4J76A 2DQSA 1O1YA 3FA2A 3LVRE 4H6WA 3I8XA 1UJ4A 1O95A 1M54A 1Q7GA 4RD4A 4H7HA 1T6NA 4XH9B 3B9RA 1LBIA 4G23A 2WY2D 4GRAA 3ICEA 1T4CB 2GO7A 2Q50A 4TXNA 1OB2A 2VAWA 2A5FA 4IF4A 5JTTA 1L4HA 3UVEA 4BXOB 4KGZA 2Y1KA 1KJIA 2C2YA 2VNHA 4D80A 2IA5A 1VLHA 2C58A 4GOJA 5BOVA 1I51A 3SP1A 4B6RA 3R3ZA 3D6JA 2RDMA 3KKPA 2WT4A 2Y92A 4RCZA 4LMAA 4FEAA 2V7EA 4BFTA 4JLBA 5KSOA 1P1CA 2W00A 1N8SA 1DX9A 1R0BA 3A1EA 1CR4A 1SUBA 2BH2A 1SIWA 2FQXA 2VZEA 4C78A 1AQUA 1KZYC 2BR3A 3N58A 3EDRA 4N5NA 4DB4A 1AVTA 1C80A 1DWQA 1NHGA 2E18A 2QTVA 3NHAA 5D7BA 3LC7O 1KQGA 1I9CA 4UCQA 3QYJA 2WMOB 1W8DA 2XX3A 1NHWA 2D5CA 4NQZA 4V1CA 1BX0A 1QKKA 3UAVA 1XJ0A 2FPOA 4BNDA 4WFKA 2E1PA 5MN5A 1FDVA 1SD1A 2OV8A 4RZXA 3SJAA 2JGIA 3L4BC 3OEEA 4PANA 5KWVA 3QBDA 2GFHA 1I01A 3O1JC 3OPYA 2H4XA 2PE5A 5HP4A 3PA6A 2Q5HA 1E2GA 2JGLA 3ZWAA 4L28A 3IURA 3LV8A 5IJAA 2I8CA 2WKSA 5JVDA 4W7SA 1S8NA 4KPGA 3EGIA 4LZNA 4D5GA 1Z74A 2NO6A 5EMKA 5JCZA 4W5HA 3TM4A 3DH0A 1QV9A 5F76A 1I4WA 2FP3A 3NM6B 4KU4A 4INJA 3UAZA 1JEEA 2BFPA 1R0ZA 3PI6A 4F2PA 3ZDYB 3HWSA 1T0HB 3B1JA 3DZIA 3EIHA 4QVGA 1DCMA 2XADA 3IAUA 3JQDA 5DLQC 4Y7DA 3SLKA 3SZ3A 1UZAA 3CR3C 1TUEA 3GI1A 2DLDA 4ALIA 4L6AA 4J1NA 3AL0C 4ND5A 4DM3A 2VHVA 4IW3B 3QPDA 3D5TA 2B78A 3PFIA 4IIJF 4HEQA 3MD0A 3OJXA 1P72A 2QE7D 3C98A 1JIUA 2A92A 4GU5A 4M0UA 2WB4A 3C45A 4IJ5A 4L16A 4PFQA 3CTPA 4YQZA 3TSZA 1A98A 4GX2A 1GTRA 3M3DA 1PZEA 2QRZA 4IZ6A 2HH9A 3QU9A 4HDKB 3SX2A 4BBAA 2GDZA 4HO1X 3WQHA 1W48A 1A9PA 1GZ5A 2WM9B 5H3LA 3DV0B 3KSDO 2ZRFA 2CDRA 3OTQA 4UUBA 1MV8A 4M3NA 3V33A 3UOGA 3ILXA 4A2PA 1AURA 2WU1A 1Z0DA 2CV0A 4L51A 1EFUA 2BEWB 2YV4A 4NYJQ 3HZOA 2HDWA 2PUFA 1YCDA 2ZJ5A 1AF7A 3GR6A 1XZDA 4WKPA 3AXTA 1U0OC 1THTA 1MRSA 1ZG3A 2G1JA 4WV3A 4TT3D 4FFDA 3CZAA 1CJVC 1PBTA 3W8RA 3CIOA 3T5DA 2VP2A 3BB3A 4ZQHA 2H54A 3VO8A 1QE5A 3HDHA 4UM9D 3U3DA 1P18A 2GBFA 3T4XA 4NCXA 1LRKA 1WABA 3L7OA 4TRMA 5KIAA 2EYUA 1GZHB 2YJ6A 4FYXA 5SYNA 3LQFA 1T3ZA 2Y71A 1D3AA 3ZJYA 4OB6A 1M6VA 3LQRA 1YQWA 4HQNA 3AY6A 4L22A 1FYWA 1P80A 3K0HA 4YRCA 4ZVUA 4D45A 1UDXA 3H2JA 3AF2A 4JKYA 2O07A 3W4KA 3FHCB 2YYSA 3PC6A 1XTIA 1ZR4A 1BCSA 1YB4A 3FGZA 4JI6B 5KO2A 3GLHA 1ZGCA 3E7XA 5DHTA 2FR0A 4U7FA 4RIEA 4B3CA 1USVA 5K0SA 2DFVA 3QLTA 2C2KA 1OX4A 4YI3A 5FWAA 4BO6A 2FSGA 5F5XA 1C0PA 3CISA 2WTNA 4Q3AA 1K86A 4LJYA 4OLJA 4UUPA 4CT0A 1W36B 3QE0A 4H1UA 1DMRA 2BCEA 1M5TA 3VJMA 2O8BB 3CKMA 2RHHA 3G59A 2GNAA 3GDGA 5EJ7A 2XYVA 3WWPA 3RAFC 1MC1A 1RJ9B 2ZP1A 1JAHA 3L4KA 3PNPA 4R1NA 4DE5A 1KVRA 1XEXA 2GBIA 1RC0A 2UDPA 1R9GA 4X41A 3C7KA 4X5OA 3IKMB 2QVLA 3IB6A 4KTTE 2HXYA 2X42A 1FLNA 1QRTA 4UPDA 3ROFA 4J0QA 3VC2A 5BNZA 3JRNA 4C0BA 1DIOB 4B3IA 5T57A 2IKQA 1MENA 3HDQA 4CEIB 1M2WA 1EQUA 3G5AA 3K0CC 2IEAA 2ERXA 1NJ6A 1I7DA 1NP6A 2ZIWB 1EVLA 2FG7C 1ZVVA 5T8KC 2PXCA 2WW8A 2RGBA 3NHRA 4HN2A 4KO2S 1KO8A 4OH1A 4BO0A 3AERB 4FCWA 2NP6A 1WLYA 4I5GA 1GCAA 2CNDA 1EPUA 3N0XA 2YZKA 4YAJA 1SC1A 5LNK1 3FSJX 1Y8QB 2IVZA 3O83A 3QJGA 1FRQA 1RQNA 5KJFA 2WIFA 2OCXA 3IQGX 3BJEA 4GXNA 5JI3E 5J5CA 3VOAA 2BP7A 4JU9A 3PDIA 4JELA 4JS0A 3TX6A 4E7PA 1P7YA 4HNSA 1BZYA 4HPJB 2VOEA 3LW8A 3K2EA 1EYZA 3WICA 1BA2A 2AN5A 2JGNA 3NLLA 4F8YA 2QYTA 5A7FA 3HKBA 3I1FA 2VQFB 4HF7A 4UKDA 2DP4E 2FFAA 2OZEA 2QNRA 2WDZA 5I9NA 3AKYA 1DXQA 4IG4A 4IDQA 4ABYA 4RZ2A 4AZ3A 1SHTX 5LIRA 5FOUA 2QUBA 1W88A 1O95C 2A9OA 2QHXA 2EP7A 3L43A 2RI0A 1RRPA 1T25A 2I7DA 3BEDA 4N0PA 4M55A 5I6DA 2BVNA 5TX7A 3LBYA 2HJWA 3W6UA 2VSQA 4FB4A 5J2UF 1QIIA 4WESA 4E11A 2NIPA 1QP4A 2X2FA 1X77A 2V3CC 2BEVB 3LPCA 2CGEA 2W6ZA 1X1DA 1HEIA 2HZ7A 3TW8B 8MHTA 3CWCA 5G3ZA 3JQEA 3TQSA 4AMUA 4BKQA 2C20A 4PGMA 2JLRA 2NXJA 3ZWBA 1QRUA 4ZK2A 2HYIC 2ZRIA 4ALJA 4MP6A 1QK4A 1L0BA 4AKGA 1ECFA 3THWA 4JUFA 2B92A 5DV9A 2HHAA 2W93A 3K9HA 4JNCA 1F4LA 2WSSA 3DE2X 3UHFA 1Y9EA 3H8WA 3PXDA 4AU1A 1K2WA 4RMHA 3RCBA 5C7YA 2PY6A 1NE7A 1QONA 3ES9A 4HYYA 3MT8A 2FF7A 4QGAA 1LDMA 4CMAA 2QU8A 5AKJA 4RZHA 4XOUA 3TZCA 1ZGJA 3RNLA 2WVAA 5CXQA 3K0KA 3M89A 3U2QA 3FPFA 3RLFA 2XWQA 5DYTA 2VYNA 3BIXA 3BFJA 3JD3A 3GJ3A 2HREA 3QELB 4KOAA 3KJQA 5HF6A 3W04A 4URWR 1QIDA 2Y67A 5LBTA 3CVWA 4KX5A 1BKYA 1DXHA 1UEXC 2HMVA 2ZSEA 2BMVA 3D3KA 2NUAA 4H0CA 1PQWA 3UYLA 4BHTA 2XXJA 3EGXB 2FZEA 3SR4A 1E6WA 3I9NA 4DIDA 3K35A 3P52A 4U5XA 1YGPA 4A10A 3I4LA 1CZOA 1ESMA 2E4AA 4K6HA 2B7BA 5BYBA 2GFQA 5TPZD 4AF6A 3TOZA 1X7GA 5BY2A 3KCQA 3L8YA 2Y93A 4MWEA 2PNJA 2VJMB 3TB6A 5FAKA 3TYXA 1RKXA 4IIFA 1MFPA 1RABA 2F43A 3LHSA 1E0AA 3CVOA 5K7SA 4GYWA 1Z26A 3MTAA 1PG2A 3BMXA 1D1SA 4OA8A 4ASUA 4CMIB 4R8SA 2R1ZA 1ADBA 3N8NA 4J9UE 1KQFA 1NE2A 5DX8A 4AT1A 4QHYA 3EUWA 3ZE7A 3P2MA 1NNSA 4BS9A 1GKUB 1O9HA 3AHGA 1FU4A 2OLEA 4QNMA 5DXAA 4D9HA 3HSSA 3MSCA 1QZZA 3QU7A 4B3MB 2XQKA 1HGXA 5GPBA 4Q48A 3X1WA 3DHEA 4Z4FA 2VHQA 5CURA 4P4UA 1T1SA 1OIVA 4B3BA 5JSQA 4YMLA 5FBVB 2PT7A 1YQEA 5K6TA 2NWQA 3TE7A 1KY2A 1P81A 4R0VA 4HWPA 4AZ0A 1YDWA 1T9DA 4EDFA 1P6XA 3CWZA 4I9NA 5AICA 3UWPA 1PFGA 1LF0A 3CNLA 2NPFA 4DILA 4DUGD 2VF4X 3NUZA 1TAHA 3CNHA 5ES3A 3GAMA 1SK9A 5ALWA 3E1SA 1QO9A 2HF2A 1CK4A 4BNHA 1L7NA 5JCOA 4EZIA 3QXJA 1GQOA 2OHIA 1S6YA 3H19A 5BO5A 2O8FA 4BWVA 2HOQA 2ZE8A 2EJUA 4DREA 3TTVA 4P08A 3DONA 3AG6A 2FWPA 1GU7A 3MUNA 4NJMB 1Z0UA 2D0IA 5GMOA 4HJXA 3AYXB 1ZDMA 3K0AA 3MJSA 3KWJA 4BJ5A 1WQ1R 4CF4A 3K6SA 3B53X 1ZFNA 4ANFA 3KQTA 1NRWA 1Z0IA 1AM4D 1NTRA 2E4WA 4FCTA 4J43A 5EP1A 5CA0F 3IAHA 4RGBA 5IXJA 4QTZA 4EHIA 2TECE 1WZUA 2BKVA 3GCXA 3NONA 5E2BA 3V2HA 3PYXA 2FZKA 4DMHA 4EJSA 4BNKA 1DXYA 4HX2A 3S8MA 3C85A 2ISCA 3HI4A 1E94E 3E6AA 2WIJA 3EQ8A 2DHRA 3SQWA 2IBTA 3NBQA 2GKGA 5TF0A 3CN7A 4EMTA 1EX1A 1R4NB 2ZB2A 4J3JA 2V98A 1EIZA 1GAQA 3CR8A 4P5EA 1J7KA 4BVFA 2VTEA 3PZRA 1ZMXA 1ZUNA 1LTQA 2CL5A 2WBLC 3O2QB 4ZQEA 4BN4A 3G0HA 1WKCA 1F0NA 3NP9A 5CXXA 4IBOA 4EPYA 3K2QA 5IVPA 4ABTA 4P53A 1TQDA 3MD9A 4NCJA 2V7XA 2JK0A 3HN7A 2EG5A 3VZQA 3CRQA 2Q8QA 2JW5A 1EGAA 3M6MD 4DDUA 5A1TA 5CHYA 5I4KA 2J0EA 4Y67A 1JKMA 3UGJA 4Y6RA 4E51A 5CFNA 4KVAA 4DFDA 2VYVA 2ZPAA 4FHGA 1YJ5A 2Q49A 2ZDGA 2XNCA 4X92A 3P0JA 4CMJA 3LHFA 2VPYA 2YBEA 5ILQA 2P2NA 2O5EA 2FMUA 2QG4A 1TJPB 3THSA 2HU7A 1WB9A 3BD6A 5LKAA 4F4FA 1IPHA 4HVCA 1W0CA 3PXAA 2FK8A 4ZXPA 3ETEA 4EYGA 1C1XB 3OWHA 3NETA 2X6RA 3HYLA 4EO7A 2ZAIA 3O8OA 1PTJA 1Y9DA 4HGQA 5ISMA 3GRUA 1E20A 3H8SA 1R0WA 2Z57A 1L7XA 1DBQA 2VUTA 3D4IA 4HDSA 2P4EA 1OLXB 2J3MA 1GSAA 3ANTA 3K31A 2BZ1A 2G9NA 4KIUA 2XPCA 1U98A 3DAHA 4TPKA 4RBNA 1CQJB 3OIDA 3PXEA 5DNVA 3LGXA 3RTAA 4EM6A 2J0QA 1UKVY 3GGDA 4L73A 3FJOA 1C7QA 4RD2A 1NMXA 4BNTA 5C8VA 4C2UA 3I3SR 5BQPA 1J9GA 2C42A 3Q9LA 4P7BA 4Y2UA 3GAZA 3ROTA 2X76A 2XOKA 3ERCA 2XCQA 4U6NA 2GZ3A 3H11A 2IEGA 6GPBA 2FPMA 2FKAA 4U3JB 3FMGA 4LI3X 4BX2A 4EELA 5C1IA 1R9NA 4UASA 4RHUA 4ADSG 1P39A 1YCHA 2E7ZA 2QIOA 3AW8A 3ORSA 1LDEA 3P9PA 1AUPA 3IQXA 4RV5A 4F9TA 2P41A 1RZUA 3O4FA 2QN3A 1CV2A 3PC8A 2Q4EA 4MYSA 5DISB 1NAHA 1XPJA 1QOPB 3WGHA 5C8XA 3DT6A 2A1TS 4OLHA 3U4MA 4N0EA 1LU9A 2D13A 2UVPA 5FJJA 2PKRA 2J3KA 1NG1A 1JE1A 3FWHA 3VFDA 4D5EA 3UT5B 6YASA 1FFGA 2PS1A 3AILA 3GDOA 1XXHE 3T06B 4MTLA 3RKRA 5IRCD 2ZI3A 4FI3C 4C4XA 3V2GA 4CV0A 2YIMA 2Z3VA 4OHUA 4HZGA 2DOKA 1J9EA 1WNFA 2ODQA 4H7DA 1SFRA 2AOTA 1OX5A 1CR0A 2ZR0A 4EI7A 4N5HX 1MJFA 1G3UA 5JMPA 5F78A 5FHRA 5T3YA 4PLPA 4HJRA 4D9FA 3AHCA 3LBNA 2HBZA 4PX2A 3ZDCA 1L8LA 4LPSA 1VE9A 2QMEA 3M9LA 3BTUA 4YB8A 3QBEA 4L3WA 2XNDD 2SECE 3FY4A 4CQJA 1AS2A 1JSXA 4RVNA 4CN8A 3G9XA 3IFSA 1G20B 4W5QA 5CH8A 5EHIA 1JFLA 2ZQYA 1Y6RA 1COWA 2V7GA 3D1LA 3W2TA 4DNXA 3AW9A 1F0YA 2XRYA 3KD2A 1II8A 2IJGX 1QFXA 3NVKI 1WDKA 3BZBA 3L0ZA 3CH6A 4L3OA 1UDAA 1QUEA 1QVAA 2HL6A 1ZJ5A 2P62A 1TO2E 2X6TA 1K7EB 4QNRA 2GGSA 1DDIA 3AKCA 4TV9F 1GY8A 1EUZA 1FVFA 1SEVA 1Z4QA 2O3SA 3JXEA 3E9ZA 5B3LA 1HLFA 4KXWA 1GTVA 4I5EA 4B7XA 4EG6A 2XF2A 3EW7A 4XIGS 4LCBA 2OWDA 1I4OA 3Q1LA 2FK7A 3GA7A 2WJJA 3OIGA 4BNUA 3G0GA 1DKNA 5CJJA 1XROA 2R5NA 3HSKA 4KQWA 2CJXA 3F7TA 1VJRA 4KZPA 3C3PA 2VDJA 1R50A 4EUFA 3H1FA 2VXYA 3O75A 1CZHA 5EZ6B 2HPZA 3TQHA 1W7AA 1XDUA 3F6CA 4BTVA 1ODFA 3NYWA 3PWKA 4OFBA 3EVZA 5LZ8A 3FCYA 5F23A 4YXFA 2MYNA 2P35A 2MINB 3NG1A 1TEHA 2GARA 5DN6A 5I7AA 1NI5A 5I4BA 5ALFA 4M9ZA 4UARA 4JN6B 3C3EA 1RJEA 3FFXA 3EH1A 2N47A 1SVKA 1N6HA 3RUPA 4CLDA 5CCEA 1BJTA 3E9CA 4JBHA 5KAMA 1MC4A 5JALA 5IBCA 4CTNA 1NUUA 1X94A 3QNUA 1ACJA 1VIDA 1P4SA 4LJ4A 3NAZA 4DR7B 4NBKA 4N7RA 2UYYA 4KXVA 2IOFK 4N0QA 1CERA 2VDNB 3BL8A 3GH1A 3U60B 2ZZNA 4PLVA 221PA 1OWMA 2ZITA 4F4IA 3HCBA 3N6RA 5GONF 3ZQ4A 2C7OA 2DFKB 1NVUQ 3O3MB 1P60A 3FHLA 1OV6A 1YQ9A 1ZWKA 2TMDA 4N3CA 4UVGA 1U5CA 1H5NA 5JCOC 1Z6PA 3LUJA 1VBNA 4UBKA 1QYIA 2DXIA 1Z7BA 2H57A 1NL3A 1BVUA 4DQLA 5K6AA 4XFJA 2XXAA 2G40A 1ZM2A 2DKOA 2GJ4A 3RVPA 1FBTA 4BNXA 2NVOA 3I5MA 2WB2A 3JQAA 4Z1MD 3NMUF 2WIDA 2R60A 3P9QA 2PUHA 3AI2A 3K73O 4II2A 5C8YB 5HVNA 1WCIB 4W1PA 2UVQA 1BVHA 2BF7A 3KYCA 2C03A 4KAAA 1MW9X 4ZCLA 1NJGA 2ZXEA 4G24A 1T2VA 3WHLA 2XTNA 4ZRNA 1JZTA 3DE5X 3G9QA 1X87A 4QO8A 3ZGLA 4EJSC 4C0HA 2AE2A 3GRPA 1DRKA 3DXZA 3ADDA 5BSHA 3AGPA 3CT6A 4KGXA 4D0RA 1JHOA 4WVLA 2MMGA 1IJKA 3NT4A 4CHTA 3HYCA 2GN9A 4WZZA 1SZJG 1FW6A 1A2KC 5CLJA 4QUHA 4EEKA 2QGNA 3PGJA 1G291 4LDNA 1H4TA 1G19A 5DM4A 4UATA 1YB6A 2PQMA 5H8WA 3W3ZB 2F67A 2NNLD 2ST1A 2JBAB 2NO1A 2Y2UA 2ZSDA 3A4IA 4IH4A 4QEZA 2P77A 4Y2SA 4CM4B 2ZJ3A 4RDXA 3CVVA 3AVOA 3Q9UA 1SQ6A 1NRIA 5CYPA 4PX3A 5CLGA 1JVNA 3MCWA 4WY5A 2J0UB 2VG8A 1G4UR 5AW8A 2HJHA 2ZM5A 1K63A 4CU2A 2FW8A 4O4HF 5FYQA 4NE9A 5FB3A 2BTQB 2FEMA 1QFSA 2PMKA 5DHRA 4DDTA 1G18A 2O6LA 1X9HA 2GAFA 5A0FA 5TE9A 3HU5A 3P0FA 4EBBA 2UV8A 4L4YA 1MB4A 5D5PA 1WD7A 4YHHB 1FP7A 5KNBA 3J7TA 2VHZA 4BDTA 3NKFA 1KDRA 3QNMA 4PZZA 3QVOA 4B0OA 1C0KA 2X0JA 1J8QA 3FWYA 3ILYA 4HS9A 4OXKA 3C8ZA 1K5HA 1PTJC 3VZBA 3V3TA 1UBNA 4BE9A 3TL6A 4GKJB 4LBWA 2WM8A 3BQMB 4DLUA 4G4JA 1ZLYA 4ONEA 4WE3A 4CQMA 2OE2A 3VR4D 4OLBA 4N8SA 3ROXA 3D4PA 1JXAA 3RSSA 1DJQA 4YAUA 1M1YA 2XB2A 3QG5A 4FMCF 4G4SP 4MLPA 3PPXA 1GZUA 1Y7TA 3DR5A 1LV8A 2BUAA 3H5IA 1FRNA 1PR3A 4YV2A 3QM1A 1KEEB 4L15A 4C0QC 3DZDA 4LOIA 1CUYA 1G8PA 2FW6A 3UMYA 4QTTB 4LDQA 3SI7A 2OBNA 1L4GA 1Y4AE 1MF7A 5EVJA 4PGHA 1OHHA 3RPEA 5ES4B 2BN4A 4XOIA 3WYAA 4B09A 1T29A 1TU0A 1XFDA 4IX1A 4OMDA 1KFEB 1VGRA 5DSZA 2A1UA 4HX9A 1M1XB 1TKBA 1GYQA 4ZZ3A 4EB6A 3EAGA 4F3RA 1MHTA 4A91A 3ED5A 3T1OA 3D3WB 4V0RA 3JVDA 3O9MA 3K3PA 4ZAYA 1RS0A 4E1AA 2W5UA 4GLJA 3PC8C 3GK3A 1H42A 1NU8A 1P9LA 4NCNA 1TZ2A 4BEWA 2A4MA 4GOND 5EPUA 5KAPA 2X8AA 4G8DA 2HCRA 1TZMA 1YS4A 1UFQA 2ECKA 1BXRB 3PF8A 2WDPA 3H87A 3OQNA 3N6XA 2P69A 1AT1A 1N92A 2A9VA 1NV8A 3G8CA 3SMVA 3E9DA 5AIAA 4OEHA 2EJBA 1FXSA 3T7AA 2OAP1 4HFNA 2ODAA 3PVSA 5GGYA 3V4SA 1PWZA 3ZDZB 4B2IA 4EVSA 1V16A 4LXHA 2QQ5A 4MRMA 1C1YA 3OP1A 4LJ5A 4PQGA 5JJLA 1OC2A 2HHCA 4JLMA 4TQUS 5FA5A 4D6YA 4QDKA 3OFKA 1T2AA 1XEWX 2HMTA 4WDRA 2NUPB 1V8PA 3SF0A 3OLVA 1ISPA 4IL5A 5ADVA 4D8TA 4H7EA 4F97A 1WULS 3HFRA 4WXHA 4LF8B 3P2KA 4YRIA 1PJAA 3CX8A 1GLGA 1E3TA 2C9BA 1W1UA 4BV3A 3BL6A 3QJYA 3ZI0A 1IPEA 5H0IA 4RO0A 1UBOS 4AJPA 4PYJA 5JNLA 2QUAA 3PQEA 1JKJA 4NBUA 4P82A 5SZIA 2WQZA 5LUAA 1GPUA 2IPAB 1RJGA 5T41A 1Y3AA 1MD9A 4MQFB 4I9HA 1ABEA 2IYTA 2OZVA 3WY9A 2I4OA 4BGVA 4CFSA 1Q0RA 1MO2A 1ZJJA 5CLLA 5DZSA 1O58A 1QPGA 1RQXA 2JJ2D 3DOOA 3ZVRA 4AECA 2I8AA 1EJBA 2VPQA 4GPEA 1EUCA 1PL7A 2ID4A 3OQBA 4QLAA 5CK5A 2GAAA 2ZUWA 2JJMA 2QLMA 1XEAA 1U1FA 4J2OA 1L4MA 4JITA 1CDEA 3DW1X 5K8IA 2HHJA 2XSZA 2CBGA 1L7BA 1MDFA 4DLKA 3RIMA 3RTCA 4Z4IA 2I2FA 4LXTA 1IBRA 4M54A 3LF2A 5EKSA 4MDEA 2DMRA 4FD2A 2A0UA 5TT1A 3FTEA 1T5LA 2HDNB 5D7NA 2GASA 4P7KA 5DO9A 3O1HB 1ULAA 2FMHA 4GOOD 4R51A 3ORQA 1MA3A 3MJ4A 4B71A 1OZHA 1A7KA 1E5VA 2Y0CA 4I9UA 4F3KA 3ADPA 2XDQB 3I2GA 3O03A 1OAAA 4O1IA 3L7DA 3OCVA 3JQRA 1YD7A 2NLOA 3DB1A 1Q44A 2XW6A 3NNDA 4NARA 2GHIA 3FYTA 1XK6A 4PHCA 4PC1A 4WECA 4BU1A 1QH0A 4DLRA 4BX0A 4B3FX 1QHYA 5BR1A 3CB2A 1GU1A 1UKEA 2WWGA 1X7YA 1C7ZA 2PA3A 4HAXA 4K03A 4PS0A 3RVMA 1R16A 3O91A 3TNFA 4D9KA 2QXUA 4QBHA 1LJ8A 1SVLA 4X9XA 5K6AC 4QBKA 3KAJA 3DTVD 1PGNA 5DCYA 4BMCA 4EG7A 1KETA 4ZYYA 2ZPTX 3T8YA 2J1LA 5TMPA 2BDEA 4P84A 5KQMA 1E8DA 5GJCA 3WRYC 1S8OA 2BGRA 4NCIA 1QNLA 1AN0A 3K4QA 3OLCX 4BX9A 1KRXA 3OPNA 5AP9A 5EXDA 3CT4A 1HDEA 2GD1O 4BKUA 1AS3A 4XUDA 1ODIA 3GLFE 3W5CA 5J2UA 1POXA 2L19A 2FP4A 1MT3A 3HCOA 2ZVPX 4G9EA 1M34E 4WQMA 3KV1A 3DZCA 3BXPA 3SS8A 4WIAA 2A14A 8OHMA 1N5MA 2XTAA 1AGYA 4A3SA 1J8MF 2JBWA 5HJ7A 3U44B 1XKTA 3IDZA 3HG7A 4RPCA 4QTXA 1YFJA 4JUCA 4DV7B 5BSGA 3WGJA 3U7IA 4O2AB 1ZAKA 1CUBA 5EJGA 1YS1X 1CPYA 4TLBA 3PX7A 1Z3IX 1FSGA 2AN3A 1HYHA 1DZ3A 1D7AA 2JDID 4BGEA 4KLCA 1D8AA 1V39A 4Q7MB 4TWIA 3H9UA 3OOYA 3TGWA 1X2BA 3ZK9A 4HRYA 5KWEA 4YJ2F 3HXOA 3S99A 4EO4A 3R6WA 1X7XA 1DX4A 3AR3A 4M1ZA 3ZY4A 4ENPA 3K9WA 2TMYA 5IULC 5C53B 1Z2DA 1EM8B 1PR5A 1TK3A 4CYMA 4YMWA 2IYVA 1B6GA 5FWNA 4GSLA 3A6HA 1E7QA 3X43A 3L06A 1YRYE 3HCNA 4QFBA 4Z99A 4DIUA 4PHTA 3TK1A 5G53C 2ZB4A 5L7YA 1C50A 1H8HA 1RWPA 3KYDB 1Y8RA 1LTHR 4JBYA 2PEYA 3OY2A 3A1CA 1O03A 2QTZA 2JA1A 5A02A 4XZ3A 3WHPA 3UAWA 3OURA 2I0FA 4A15A 3JAKB 5AKHA 3TQRA 7GPBA 4GKVA 1IM8A 4ZCIA 1Q17A 3DKIA 1W0JD 3MWEB 3RF7A 4GSKA 1UT6A 5KNCD 2ZIAA 4RLFA 4MAMA 3TECE 2YTZA 2VDWA 5C8ZA 3WRXA 1ZR2A 2A78A 3K05A 1ZD8A 4Q66C 2Q46A 3UV3A 4E31A 3ZBTA 1O94A 2ZRCA 1RQ2A 4LIPD 4ZU1X 3VVBA 3HM9A 4LY6A 1PGJA 4WADA 3AEYA 2R6AA 1IY8A 3T3GA 5FR1A 2ANBA 4CKCA 3GEGA 1D2HA 2FR1A 3P94A 4DXDA 2I3GA 1O4VA 2J5KA 5DB4A 2W58A 4EGAA 4YEDA 4XAQA 1CUEA 3QXHA 1L5WA 4JI3B 3ZG6A 1T10A 3BXFA 2VEDA 5LOVF 4P22A 2XHZA 2V59A 1GUYA 1JFVA 3DYVA 4LXYA 1OX6A 4RMGA 1RHRA 2CSXA 2CE7A 2R25B 2W7TA 1TI7A 1YBAA 2ZRNA 5HKAA 3BE6A 3WL8A 1OW3B 2ZJZA 3RJZA 5FFNA 1EVZA 3Q9NA 5AVRA 4KPUB 1TCUA 2OLKA 5I5GA 1I6MA 2C5FA 4D98A 1LLFA 4JASB 1FPQA 3RC3A 3L0CA 3DBHB 4FHDA 5AM2A 4FW8A 1DC7A 2VTKA 3SEQA 6ABPA 3WLFA 3UJHA 1J06A 4X63A 1WQ4A 3P5SA 1HDXA 2FXVA 3DFUA 4KQMA 1XNQB 3N86A 2BHNA 2O20A 2H18A 3C2QA 2Q5OA 1J25A 2E4ZA 4JT2A 3NB0A 3U9SA 3SHWA 1VSBA 2VTDA 2WG1A 3AR2A 5KVCA 3VKHA 1UDRA 1VFPA 3DWGA 3KXKA 4KDCA 3KTAA 4CFYA 2NTJA 4R1QA 1GPAA 2JHAA 3JQPA 5EE9A 3OM1A 4TGLA 4ND3A 1TLFA 1MB0A 2G9RA 4BQFA 1WSWA 3TS1A 1NQUA 2DTDA 5COAA 3UJBA 2PUGA 1YF3A 1LVUA 3QFCA 3R40A 5DEOA 3LPAA 4DCNA 1O08A 2FUEA 2RJOA 4J9VA 1CLEA 1Y9ZA 5H5JA 5CA0A 2IV2X 5BVHA 3RS9A 3TFOA 5DBHX 2G9UA 3A9RA 3BWVA 3GFOA 4OQXA 4HADA 5IN5A 2DFDA 3SGLA 1A5TA 3UAOA 3HLTA 2HXSA 3RTBA 4LN1A 2IP4A 4AUEA 3V34A 1EE1A 2OAEA 2YOFA 1S0UA 1HRDA 4LDZA 4F85A 2Z2IA 3BE8A 1ZYUA 5TQJA 2WUDA 1SJ9A 3ECSA 5E0OA 1LB1B 3NBYC 3RO7A 4CQLA 4NKRA 1MORA 3R3XA 1T9AA 4DAOA 2O8CA 4OXIA 3GIDA 3M7IA 2VSFA 4ZCSA 5B58T 3AP3A 4EMUA 5JRJA 3DF7A 1L7PA 2R8BA 3RDPA 1DADA 3O4IA 4MVJF 2C4MA 1U3GA 1GFWA 1ZN2A 4X90A 5H9WA 2IDMA 2YFHA 4AURA 3X44A 3AC0A 4O4LB 4TZTA 3VJLA 1K4YA 2GTPA 3LQKA 1QGYA 1Z8FA 2C78A 4FJ0A 2OKGA 3K1AA 4WCDA 1P4JA 2BIFA 1SOVA 5FBRB 2E2WA 3SVZA 2WT9A 3DEKA 4H6PA 5DBFA 3REGA 5FNVF 3W3AD 2H4JA 4B4DA 4RTQA 4ROTA 1P7PA 2W8ZA 1GVNB 3K9FC 1K2VN 3L6EA 3DLHA 4R5HA 1BWPA 3C5WP 2JD2A 4J1SA 5LA6A 1VHDA 2VP5A 4RNCA 1MABA 1H22A 4TUYF 2L0XA 2OSVA 4NPHA 5G1PA 4E07A 2NYRA 4PAQA 4Q12A 4GKKB 2JAWA 4BX3A 2KW5A 5DKFA 2QUKA 4UUOA 1QC5A 2NTNA 3ZLTA 4KNYA 2OHJA 2VRCD 1DFIA 2GBLA 4OHWA 4M53A 3FTNA 3O8CA 5IH7A 1J39A 3CONA 3DM9B 2GRUA 1XE3A 3HYRA 3Q6NA 1Z5WA 4GOXA 2HLPA 4Y1EA 4DV2B 2RHCA 2GUWA 2QAIA 2HK7A 5FPKA 4FN5A 1L5QA 2AKEA 2PEZA 3ISTA 1P0PA 1IK6A 5A4IS 4BLWA 1EVEA 4I4NA 4I4IA 4TSFD 2GN8A 5LPNA 3ZZTA 3FDIA 3PE4A 2Z0MA 4UTOA 1OT5A 1DQSA 3OUZA 4LXIA 3N28A 5JJKA 1FU8A 4BNDB 1EUDB 1Z2CA 9GPBA 1LK5A 1F3OA 2XVMA 1Z33A 1FYFA 3ZHXA 1NUHA 5EE5B 1QVWA 1SC4A 4I5FA 3GGGA 1SG6A 3FDJA 3CEJA 4JMPA 3FPEA 3ZD7A 2PWBA 4CEJB 3K9GA 1J49A 3F2IA 4WKOA 3RE1A 2OYSA 3HR8A 3WL7A 1Y89A 4INOA 3L6DA 1LH0A 1SCDA 4JLAA 2QP4A 1KE2A 2IZ0A 4YUAA 1E1QD 3SKXA 3U61B 5JVDB 3AUFA 2COUA 5D01A 1N3IA 1TQ8A 2MSEB 3E3NA 1OQAA 1OYOA 3AL3A 1ZNQO 4IDDA 2VJBA 3S5JA 3AETA 4D9GA 4EHAA 1LX7A 4MIKA 3GLFB 1AKUA 3EZLA 3K0FA 3GRCA 1YS9A 3I2YX 4XUEA 3OICA 2FN8A 3X1XA 3B12A 2P30A 3MOIA 1EJ2A 2BWJA 1MO5A 4CL8A 2F6RA 3C3DA 2B4KA 3FPHA 1KO4A 4FIZA 1DV1A 4OXQA 1ID8A 1DBWA 1E3MA 1KU0A 3DWFA 4M86A 3DTTA 4GDFA 2B4QA 2YIJA 5AW5A 4P1ZA 3OZFA 2UXCB 1DLIA 2HMWA 4E5DA 5EHNA 4Q1DA 4D99A 2R2GA 4JYPA 2FMTA 2RKBA 1CVRA 4YRMA 2K4MA 3JYLA 5HPYB 5TQVA 4ER7A 3DLTA 1NYTA 4C7KA 5KNDA 1NURA 3KE8A 1ADCA 1J0AA 3FPGA 4O8ZA 3MRXA 2IOHA 2JVKA 2PSDA 3GLVA 5IT5A 2R4UA 1GNPA 4LRWA 4TV9A 4LRYA 4GC5A 5HYVA 4DV5B 5FOVA 4BZZA 5E8RA 5KKAA 4X65B 4FM9A 1J7JA 3GUZA 3KL2A 3KEGA 4C76A 5LYJF 1PV4A 4P9NA 1IN7A 1QE3A 2ADMA 2J07A 3M34A 4NATA 2CVFA 4GT1A 2IX3A 3F8SA 4O2LA 1SPXA 2O8EA 4M9RA 3LQ2A 2FCRA 1OPRA 3SQDA 3VTFA 5I9LA 1EG2A 5I7SA 2UZ1A 3IQIX 3ZY6A 1NBAA 2QSZA 1EG7A 3ZHOA 2DC1A 1RI4A 1IJEA 3GJTA 4L78A 5AM0A 5T4BA 1HDCA 3GP3A 4EX6A 3NUQA 5BN3B 3IT2A 3C15C 3I6ZA 1B00A 3UCEA 2ZYTX 4QTYA 3J80A 2OGSA 3T95A 1H1TA 2CHEA 2WVGA 3MOGA 2H9AA 4AKSA 3H1EA 1OD6A 4X1KB 4QVIA 4LVOA 1SHLA 4RQTA 3OE5A 2A9KA 3FJYA 2GZDA 3FZYA 4DVGA 3U4GA 1BCSB 2O7NA 4OXXA 1KARA 1XTKA 1E6MA 1YU6A 2GH1A 2JVJA 3GLHB 4YT4A 2AC4A 1NXPA 2BW0A 2JAPA 2ATEA 1BE6A 1EDEA 1YVRA 1Q19A 2FSVC 2UUOA 2ETVA 3CJQA 4H4DA 4RLQA 4S2EA 4ARUA 1JHRA 2I2WA 1KF0A 5DBGA 1ZKMA 2AN1A 1OX4B 2AG1A 4R2LA 3KVVA 4B4OA 2WQ7A 3I37X 2CK3D 4NJEB 2PMFA 5DM1A 4ZPJA 3D8RA 4MR8A 4BQPA 3RFXA 5KYKA 4L8LA 1TTHA 2VA9A 2Q1WA 3A6LA 3IDOA 5DXFA 2IW1A 3VOBA 3ULKA 5HTOA 2B99A 1YIAA 1I30A 2NVUA 3D1VA 1R4ZA 3Q87B 1CR1A 4CMKA 2OK8A 5C3UA 3T7TA 2OBMA 3LZCA 1UQRA 4JP8A 4RIFA 5CFQA 2YFYA 1DC5A 4PLWA 2H9YA 4RA6A 4UBJA 4MDYA 4OHOA 4YUXA 3B1KA 5B30A 2GN0A 3WNCA 2VNAA 4QSMA 5KU1A 3N7UA 4YCDA 3L8MA 1ZM7A 2CLMB 4EW6A 4F4JA 5AXBA 1HX7A 2ZB7A 4B34A 1HURA 1KWGA 5BN4A 2X7JA 1AGNA 3D8UA 1XTZA 5KVQA 1JU4A 1N25A 2Q3MA 4IWYA 4Q01A 5FUXA 1PSWA 2MSNA 2R7AA 4IAOA 4DA7A 5J2TA 1TVMA 4QOGA 4EK9A 3WBKA 5TRTA 1GZSA 2NSJA 1T24A 1VMIA 1U0FA 4DLBA 1HDZA 2B2XA 2RFLA 3UK6A 2KLHA 3HMKA 2HHLA 4OSPA 1TO6A 1N0UA 2EFGA 2X40A 4YX9A 3PNYA 2ZRLA 1IUOA 2O2IA 4RMIA 4YRSA 2E4YA 4BCCA 4BATA 4V1CI 2FAXA 2BP7B 3PDIB 4K9LA 2FPPB 2WPDA 4INZA 1WPGA 3OFNA 4OL0A 4R4JA 2L82A 2C7GA 3NDPA 1P9OA 2EXXA 5EIBD 1NAIA 4K7JA 4Q1EA 2W37A 3STVA 1QS0A 4HB2A 1EWQA 3E7FA 4CTKA 1KFBB 2IHKA 3OPYI 1Z47A 1BX1A 2QTRA 5J40A 1U8UA 3M4XA 2G9QA 5EIBC 2HRZA 1NVMB 3D2LA 1U9YA 1XZNA 2B21A 3ICQB 3CCCA 5BVGA 4CI0B 3WL3A 5JMOA 2QI9F 1OGYA 2Y1DA 4B4WA 4FFVA 3OIVA 4N65A 4NABA 3MCZA 4DR2B 2QRUA 3PVCA 4U2DA 3UG7A 1ZJYA 2C9MA 3AJDA 4WESB 1UBFA 4YUZA 1BDIA 1OI4A 5ALXA 2Q45A 2X7HA 1O9GA 2O3RA 1TC1A 4FFWA 4RPKA 2P40A 3KLPX 1U3FA 2H2DA 2SKCA 4R9UC 4A8JA 4WTOA 2UZ3A 3N5CA 1WR8A 3SQXA 1MC5A 3HP7A 4GNKA 1SBQA 2GBLC 2IU3A 1MB9A 2VDOB 4RSRA 4ZEMA 4BVEA 3R0IA 4S04A 1W5AA 4U7TB 4XWOA 2OECA 4W9MC 2A2ZA 2NU6A 4A27A 5DLDA 2G17A 2BGMA 1G5QA 4BRUA 2GPBA 3AM5A 4EJ0A 3PDUA 2PK3A 3THWB 2ZJ7A 3I23A 1P31A 1WX1A 3Q72A 5BUCA 2WM2A 3AR9A 1U31A 4ZO6A 4MJXA 1X7WA 4AMYA 3L1HA 4HAZA 2FG5A 2GN2A 4NBRA 2IF2A 4PZPA 5FUBA 1A3CA 3M6LA 2QN6A 4G5HA 4KV7A 4Y0AA 3WLEA 4UU8A 1OXUA 2VUSA 2GM4A 1SCQA 1WMSA 2X9LA 1DSSG 1RYFA 5FPPA 4B2LA 1EE2A 3RRNA 4I6JA 3NP7A 4C0KA 5L7TA 1LPNA 3REOA 2XVYA 5DHQA 3V8VA 1JN0A 4MKZA 2YVAA 2BH9A 2CJYA 2WLSA 3BE4A 1YMQA 3D3NA 3Q3GE 2PR7A 3PLRA 4LWOA 2IV7A 4B5LA 5F1OA 4DG8A 1FDUA 1P9WA 1H0KA 4FYPA 2HA5A 3RVQA 3BHNA 2H1FA 2XCOA 3QP9A 4PX9A 3VKVA 4TMFA 2Q4RA 2A8YA 3DOEA 2BGLA 5EIAA 4DPLA 1CUWA 2F43B 1ZXLA 4WFIA 3GH3A 3WADA 1SBTA 4D1YA 2Q3CA 4MINA 3TD2A 5JE8A 2ORYA 1U94A 3D0RA 2G82A 3HKCA 1DEKA 1WXXA 2BMWA 2HSDA 1U1IA 1RPAA 1ZD3A 1N7GA 3ZDQA 2QYHA 4EHJA 1N77A 3B38A 1QU3A 4Y2PA 4XQEA 1TYDE 1NJ5A 2I7XA 1B0ZA 2CMHA 2GEVA 3D1JA 2Q9AA 3JQCA 4DWOA 3W9SA 1LQ2A 1XYGA 3I9FA 4X85A 3ZV3A 4MS1B 1RQLA 4YJHB 2IXDA 2R9VA 5E6UA 2QMHA 3AUXA 3V7NA 4IDOA 2UZ4A 1VZ2A 1ES9A 1SXGA 3BD8A 2HA7A 2A59A 3FMFA 3OEHD 3QVUA 4HAYA 5EWMA 4TMKA 3UB4A 1PEKE 2Z43A 4AZ0B 4D4HA 4F71A 2NO4A 1G16A 1RWVA 4X93A 5BYKA 1P1JA 2ERCA 2IITA 1T5HX 2FWBA 1Q1BA 2C4HA 3GB9A 2EW8A 4HRXA 2G25A 1VXRA 4CL0A 2WYUA 3I6MA 3F1KA 1K8RA 4C7MA 1Z2AA 4RS4A 1IBKB 4XGQA 4MEBA 1VL0A 3ZE1B 4EKYA 3B13B 5EUBA 4PRYA 4CEHB 2EAUA 3C5HA 1IHOA 2C2OA 3WK7A 4AP5A 1WXHA 2I87A 3ZZNA 2CB9A 4YRLA 4BUJA 1ULHA 2WVJA 3HEBA 4WI1A 3NI2A 3CF6R 1S2LA 4R6XA 4TT8A 1O5OA 1UPXA 2VP3A 1XRLA 2ZUCA 5AVYA 4LYGA 4DB2A 5IVHA 1NONA 3CKLA 3OLYA 3E3AA 1XVUA 1V1RA 2P9HA 3UC9A 2FV8A 1EHYA 4RK6A 1XCLA 2ZTVA 1QFZA 1KAGA 3CLKA 3P9XA 4FPXA 4EY4A 5IJWA 1GNTA 2I4TA 4EJSB 1DIBA 2JHGA 2AJBA 3FDZA 5ALDA 1WCV1 4MPJA 5EZSA 1E79A 4BPBA 2PTHA 3BGIA 2IHNA 4U2EA 4QXAA 1E8MA 4GPAA 1ZIOA 3UCXA 5JD5A 1XCJA 5HUJA 3L82B 2XTJA 3MC1A 2FFHA 3G5TA 1PNQA 1UIMA 4U9HS 4KPYA 3OFJA 4KR2A 3ZE2B 3QMVA 4C5BA 2FZWA 4UDNA 1S89A 2JEYA 5DHUA 1FQKA 2YMLA 3DSRA 3QVTA 4GI7A 1CDZA 1QSGA 1E3LA 1JQAA 3IRVA 1YASA 3B1VA 3G0CA 1T1GA 3MWDA 4B84A 3FNFA 3LT4A 4JEHA 1NVKA 4Z9FA 1ZD9A 2PRKA 3G82C 4TMTA 4ZV7A 1WMEA 5HRUA 4RF4A 3FZNA 2G1UA 2OO7A 2IYXA 2O2ZA 4MUNA 3ONNA 1KJZA 1HNWB 1JE0A 1JAXA 4U7HA 3VYSB 1CY2A 3GFBA 1RXCA 2C4TA 3EVFA 2QT9A 1T4GA 5KNLA 5BUSA 5CA1F 2G70A 5C46F 4DWVA 1KQ3A 2CF5A 2HFKA 4YMGA 3IJ5A 2BZGA 3WDLA 3ZXYA 3O8OB 1NKTA 1P33A 2VT2A 3KWMA 3ZCQA 4BZPA 3FR8A 4WMLA 3OESA 1QH1B 1SBIA 1TGVA 2OFFA 2EV9A 1YQGA 4HDSB 4W82A 4WVFA 3VR4H 621PA 3KQHA 3A6EA 2EVWX 1F48A 5L3QB 4JLWA 3GLQA 4NZPA 4M1MA 3ZHZA 4BY9E 3USES 1ZEJA 1V8BA 4E5UA 3HCEA 1ECBA 3BQ9A 3GA5A 1TCAA 3I6BA 4NFSA 4WNAA 2IV3A 4AJEA 4WBNB 2Q5LA 4UAUA 3PYLA 3Q2KA 4E2FA 3SIXA 4IDFA 3ZWWA 1KVSA 3RRXA 4XUGB 2LIPA 4KIGA 3SF8A 3A3KA 1SB9A 1CNMA 3I0ZA 3H5OA 4G1CA 3N0VA 4DCOA 3D4OA 2BCJQ 3B3JA 4LJRA 3MUFA 5BT9A 1MO6A 4F8JA 1U65A 2GK3A 3H11B 3ROPA 3HP4A 4J0CA 1D4AA 2C95A 3FF1A 1L7VC 5IC6A 1D2RA 2B4AA 1JAZA 2D4HA 2Q6KA 3PB3A 2PL3A 4OHVA 2B5VA 3KDSE 2JGFA 5FRDA 5M29A 3AH8A 3EPJA 5C7IO 2IUSA 3ZTWA 1FZTA 2IEYA 4IFIA 3RUAA 4GYJA 4HZIA 4I1IA 3R7LA 5JJ5A 3ZGZA 2GPSA 3AUTA 3F5SA 5GJBA 1IU9A 3QUQA 1J5PA 1BA3A 2E9SA 1ORVA 2EX4A 4B3DA 4JY7A 5ICMA 3IPCA 2OXFA 2F7SA 1E2BA 1XMJA 4IDEA 1CBUA 1HLPA 1HV8A 4D3SA 2DPMA 1IDOA 2R8XA 4UEWA 1XRPA 2WU8A 3PLAE 5EIEA 2AOTB 3KBBA 3LCUA 4OAQA 1JIXA 2YXPX 2LTAA 3LDHA 4OQZA 4CW7A 2OUKA 2QLTA 4JC0A 4ML3A 5L3SA 4YCLA 1E2DA 5LXTF 5ITVA 4C9BA 4G1UC 2FE4A 1ISMA 4XW2A 4G2TA 2LIVA 3OLWA 4GQBA 1UKBA 5BSUA 5LZ4A 2IZ5A 1JGTA 1T34A 2NTEA 3A05A 1FLDA 4NPAA 3C7TA 1D1TA 3WLPA 3P71T 4DRXB 3RJTA 3IBFA 3NTVA 1EDBA 3C70A 1SKMA 1XQ9A 5B36A 5IUNC 4MAFA 4DMLA 4LJLA 4O3FA 4PNHA 1SQGA 5BYJA 1II8B 4RY2A 1JHAA 4HDOB 4IHQA 3ICVA 3PKIA 2ILTA 4PZ9A 5BURA 1G60A 1UBKS 1A04A 1U5BA 5K8TA 4UZFA 3HVRA 3TIFA 2VR1A 1W96A 4RADA 2VP9A 1EUYA 2YWGA 1DKLA 3L5OA 1YUNA 3UTDA 4OI4A 3KRTA 1I2MA 3MRTA 1KTIA 3P7MA 3EY9A 2EKPA 1QHIA 1JHQA 1NZDA 3HGQA 2QX8A 5FUMA 4TS9A 4WCFA 2R96A 1YTUA 3CW9A 1E0DA 4D9NA 5C4IA 3RVDA 3IBSA 2B1JA 4MW4A 2ZKLA 4NULA 1XKXA 3TQFA 4NMWA 4ZYWA 2RHMA 2VHXA 2GTIA 1M5RA 1A8UA 3L7NA 3WOVA 2PZKA 2B2NA 1U3CA 2GM5A 3W8NA 4OB7A 4B43A 1WOYA 1QYXA 2FWAA 3V8NA 1J0CA 3ZS9A 1T43A 1JALA 2I1LA 4OQMA 1XD9A 3HQ4O 3MEQA 2Y3IA 1ZAYA 4WZBE 5TQ0A 2QV7A 5AJTA 5BQOA 4BX8A 2VK4A 1TCCA 2CDBA 5JPIA 3WV5A 5AVXA 3B1XA 2PRJA 3B5EA 3MJTA 5LDDC 1CYEA 3B60A 3LX8A 1DBPA 3WIVA 4RHFA 1N2GA 3SYLA 3UFXB 4N18A 1AA9A 3RU7A 1U0NA 3C74A 4CM9D 1A9SA 5FTWA 1A9OA 3WMWA 4CNQA 1Q83A 4MVJA 4Z3DA 1I32A 2I33A 2WF8A 4IOKA 3RSQA 1V7QA 1U0EA 1H2AS 4RF5A 2UUBB 1W35A 1GAEO 1ZK2A 4NK5A 5IJZA 3U49A 4F86A 3SVTA 2XXAB 5CGQB 2IEZA 2QZZA 1JYEA 3C5CA 1SXHA 3KR0A 1IY0A 3IHLA 3OTGA 2GESA 3JQAB 5FNVA 5FP0A 3NPMA 3S8EA 2CLHB 2Q3DA 2ZR8A 2I6XA 1YIDA 1UBMS 3EGVA 3N7TA 3OT4A 1XZMA 2QY6A 1CY0A 3ANXA 4IIGA 1A4UA 2JEZA 2KPOA 1BN7A 1CB0A 2YN0A 2B2CA 1MAWA 2FQQA 2RBKA 1E59A 2CNNA 3DUWA 4GFDA 2X3UA 3M6AA 5DP1A 2X58A 4YBRA 5D84A 4XWWA 2EKBA 4YJGA 2FZ4A 4CM1A 3EXEA 4UFOA 3CUTA 4WBSA 3SJUA 1YFLA 4HN4B 3BF7A 1R0KA 5EMJA 3T7JA 1ZCFA 3CEPB 4R1SA 4HLNA 3E9EA 4LF9B 2H2IA 2HA3A 3MTBA 1M10A 4B48A 4JC5A 3UWMA 5JDIA 3NWJA 4Z4QA 1MXHA 4ENSA 1RI3A 3MQ2A 4O63O 4M76B 3T0FA 3IAFA 2OAQ1 3HKEA 3MAJA 3H18A 3KEMA 4H7PA 5LQCA 2OBLA 2TMKA 1SC6A 1UMKA 1B43A 1JQJC 2HB6A 2R1TB 1K5DA 3MWYW 1BU8A 2QX6A 1XTPA 2FVXA 4DLAA 5A0VA 1CYDA 4MVCA 4RHEA 1UC4B 4DT1B 1KZ6A 1DUIA 3Q3EA 4DQ0A 3U3MA 3PKZA 4P3YA 3EOAI 3T54A 5DNEA 1F5SA 3LUCA 2MWMA 4GICA 9LDBA 2CJWA 4IRXA 1X80A 1APBA 4F5ZA 4FNGA 5DTIA 1W9HA 3AHJA 1YE5A 3FN4A 1T3HA 1B41A 2XUIA 4RXUA 1XTVA 3JWGA 1J2RA 5J63A 3DMHA 3QY9A 3AUUA 3AKZA 1AMOA 3IEUA 3G0BA 2HQOA 2IYSA 4PO8A 1RYYA 3L1VA 1Q7EA 1GKLA 2CFOA 2JGEA 1OBCA 2QL5A 3ONFA 4LMRA 4EARA 2J30A 1N2CE 3JWJA 4FZJA 4CQMB 3ZCPA 1W47A 1XF9A 5E4FA 4I7EA 3TLKA 2GS9A 4K46A 2FWNA 2NXWA 2Q9CA 3MF4A 4XYGA 3THRA 1DX6A 5H4GA 5IC4A 3DXFA 2C59A 4AZWA 1VE3A 2P3OA 5CXUA 2KI5A 4E15A 3RT9A 1Z8HA 2W2LA 2PD6A 3JRWA 1PFQA 1CFZA 3S44A 3PUHA 1UBGA 3JY6A 4NESA 4ERXA 1EHIA 1A96A 4IIJB 1XF1A 1M5UA 1R4AA 5BSTA 1HYGA 2J5QA 3OD5A 2ISQA 1J00A 1KXJA 4OP2A 1IQRA 4MEAA 2IWHA 2CLKB 1IC6A 2ZREA 5K99A 3L8CA 5MF6A 1KMHB 1I9GA 1CE8A 1WNTA 2MYUA 4U2CA 4O2BA 4NFYA 2PS3A 2XY4A 1LSSA 4EB6B 4HG2A 2XMPA 4J7AA 4PAOA 1GDTA 3A6JA 1IATA 3G49A 3MJCA 2C4UA 4CT5A 1C29B 1X92A 2O1EA 2Z1DA 4CV3A 4FSHA 3FRHA 1ZMRA 1I7PA 1JSRA 3GAAA 2QMZA 4ZAGA 1DWUA 3P0HA 3SIWA 3SJCA 4BLQA 1GGHA 1FFEA 4TLCA 5LYJA 4Q9IA 2H7YA 4JU8A 4MHSA 4LX8A 1DAKA 5J4LA 5JO0A 2YCBA 1NIJA 1NMYA 2C9DA 4A7PA 2Q3EA 2FX3A 3H5TA 3NHBA 4ZU6X 1WCYA 5T3UA 2B6NA 2R3SA 2ONZA 1Z35A 2RB4A 4HBZA 4X8HA 3WJ7A 1CF4A 2QSUA 2WAAA 4BC0A 2Q6TA 1DT5A 1Z6GA 1MKYA 1WF6A 4TKVA 4U4AA 1I3NA 3MLBA 4QX6A 1XZ8A 3PIRA 4KQ9A 1XTTA 3F7NA 4GUAA 4MRMB 1IRXA 4B4VA 1P45A 4R2KA 2VQEB 3WG9A 4HCJA 2RK3A 2I4IA 2BHTA 1P2FA 4TTSA 3TBHA 4JR2A 3MNFA 1NMQA 2PD3A 2Z4SA 2ZRKA 1R6AA 4DNOA 2PQ0A 1F2UB 4NV1A 3CVJA 1E1RA 1TJNA 2CL6X 2P9ZA 1RP1A 2I76A 3FTPA 1EXNA 1NOKA 4LZAA 1PQYA 3SM3A 1V25A 3D6TB 3W7AA 4ZCRA 3OFVA 5FUYA 1K75A 1JKJB 1H6CA 2J67A 3IVXA 1NWCA 1Y82A 2ZWPA 3D7KA 1RKQA 3H05A 1AUVA 3GFTA 3K5IA 4RLSA 5AFSA 3K70D 3ZVMA 1QZXA 5I47A 3NCTA 3OJOA 3UV7A 5K6RA 5HCNA 5CFMA 3FPCA 121PA 4AL4A 3PU6A 2JI7A 4H7KA 1XI2A 1X8JA 1L4EA 1PZXA 3QUTA 3PGA1 1LZKA 1VDZA 5CIYA 4EB3A 1I94B 4WFQA 2WJPA 4GR5A 3ZBUA 1V4NA 3NKVA 4TVOA 2WM3A 2XYHA 4M46A 4WCFC 3ZY3A 3G8BA 2BOVA 3O4RA 2CYCA 4KJXA 2ZUBA 3C7AA 2G76A 2NTYC 2X0IA 1L5YA 1FDSA 5EKDA 4WUTA 1JI0A 4Z0HO 3EA4A 3T3EA 3W3AH 3AR6A 2J8ZA 3CW8X 4BMXA 5JUWA 2ZI4A 3RVNA 4BO3A 1CD5A 4Z1OA 1SUFA 1SHZA 1VJDA 2WMYA 4I50F 3FKSD 3KBOA 5KINB 5LLDA 4D8UA 1GGKA 3CX6A 3T3MB 2ZR7A 1VJ5A 1Z4MA 3L0SA 1JPNA 2XGJA 3I39X 1Y1SA 4CU5A 3EYAA 3GT0A 4FGWA 1AKRA 4IYJA 1FMLA 5IZ4A 5EE1A 1S7CA 3AK4A 4YMUA 1HYEA 4IVPA 2O0LA 3O3CA 4JUDX 3KUXA 4TKMA 1KMIY 3QSYA 3OEWA 3FLMA 3H6GA 3RQSA 2EJVA 2V4ZA 4UDYX 2JFUA 1VYUA 2GZ1A 4XYMA 5AVSA 1HSZA 1XJCA 4Q6WA 3SXJA 3U17A 1AHPA 3G9UA 4BWGA 2Y9MB 3B7WA 2XZLA 3JALB 4Q47A 3VVCA 3K20A 3IILA 1RQRA 1JZSA 1X7YB 2VQ3A 3H2GA 1WUYA 2MSKA 1URPA 2B8TA 2DQ4A 2I22A 3CG4A 1K8QA 3QHQA 2JI4A 4RUKA 4B3XA 4C06A 4EYSA 1AQ6A 2I29A 3IESA 4HGNA 2W83A 2YHBA 3RYIA 3KJHA 5TR9A 3P8ZA 3KZMA 4QHTA 1ZGAA 3E82A 3FMIA 4JSRA 1W30A 3U40A 3CRW1 4US2R 1P19A 1TKAA 4NU6A 5J2UB 5CFRA 2FP4B 3I5AA 4MQBA 2BF4A 2QTLA 4DLTA 4NE7A 1O6BA 1VCOA 1ZMTA 1N7IA 3CUVA 4JBGA 1R5BA 4UDXX 1IWOA 3UXMA 4Y2GA 4D57A 4PGGA 1TAUA 2D74A 4JJ8A 4JLKA 3IQEA 3KEQA 4LRUA 4FFMA 1JIJA 1NVTA 2W8BB 2QL7A 1AGXA 3HBJA 3HNOA 2Q7XA 4YPOA 3H3XA 5LFAA 5JDIC 1H85A 2PANA 5IDQA 3QE9Y 1KYTA 1YZGA 2OUIA 3TLCA 1LEHA 3F98A 1RXSA 3EDYA 4CV2A 1RT9A 2DF8A 4B6FA 4B46A 1NUPA 3F0TA 4UCWA 1KIAA 2Z1NA 2OD2A 4LGYA 1X7XB 2I2DA 3AVQA 4D7AA 5JCJD 3VU9A 4K6FA 3C24A 2XUAA 1RMTA 1NMSA 1E5LA 1SCIA 2N1BA 3FSGA 1WXIA 5F98A 4ITUA 2CXHA 1BDBA 2O2GA 3AKDA 3ML1A 4QULA 4DDMA 2DKNA 1LUAA 1YUBA 2P65A 1ZWLA 5JNWA 4Q4LA 1PCXA 4YIKA 1B3BA 2XNKA 3QU5A 1BKSB 1IJBA 1ANKA 2CXUA 1Y8RB 3VPFA 4DJJA 1EZ4A 1NY5A 3O8LA 4DIOA 2FN7A 3CKYA 3D3JA 1PYDA 1R1DA 1JR2A 1YZKA 2EFCB 1JDVA 3TNLA 1B14A 5G0VA 2D3WA 1G1MA 1DAFA 1Q57A 5AOBA 3WWZA 3UIEA 4XLTA 1W1WA 4JP1A 2NZVG 5FBLB 5C7OO 1PR0A 4RD0A 2PLAA 3FM9A 3RHZA 1DZIA 4EJFA 4HTAA 3SR3A 3RK4A 2C9OA 1IYZA 2INGX 2NT4A 3EF1A 3RSHA 3S2EA 1Y1KE 4MPPA 4AO6A 3GPCA 1JG2A 5GVRA 1PLJA 3T99A 1XKLA 1WKVA 3YASA 1HFJA 1GPYA 4JD5A 1YA8A 3LC0A 4CKCB 3VHXB 4RQBA 1Y5NA 5TB5A 3FW1A 3KB1A 4K6MA 3DZGA 3WHIA 4CM8B 1N2CB 3S55A 4UXHA 1ZP6A 3VYRB 3PFKA 2D5BA 2QN2A 3CJTA 3WP1B 1PLLA 4WOCA 1TAGA 1HZZC 3DMPA 2CDAA 1YL7A 1ZN8A 1MAVA 3E8SA 3TLZA 1KPIA 2DVMA 2C8LA 3IV6A 2DERA 3QPWA 2Q3BA 4UBNA 3JSXA 4F2HA 2IX9A 3KJFA 2NVBA 2C1XA 1FYVA 1W5FA 2R86A 3NQ41 4HWKA 4P5PA 2COKA 4G26A 2HF8A 2BMEA 1E2IA 1HTBA 3EZ2A 2IP2A 3F47A 3RUDA 1TADA 2CKMA 3WQQA 2OCLA 1XHEA 2VP6A 2BFAA 2D5LA 3HO8A 4HDRA 1XXLA 3NHYA 4M8IA 3DCNA 2AX4A 3QX9A 1UXGA 5B1SA 1TF2A 5E7JA 4UUQA 4AF8A 1Z29A 4RK1A 3VMFA 3JATA 4RY9A 2GX6A 4H31A 1TE2A 3KTAB 2YOGA 4RAOA 3HSYA 1FMCA 2FWMX 1WXWA 3IBTA 4KKVA 4RAQA 5KOJA 3OTHA 4D0GA 4PZUA 1WW3A 4GI5A 1Y4UA 1YA4A 4IJQA 5DXJA 2F2TA 2H65A 2HBQA 3OA0A 1O8BA 2G83A 2VVTA 4I66A 4EKNB 5I7RA 3KX2A 5CA0B 2ZYVX 3TSAA 2RARA 2YJTD 5BVHB 2A57A 1E4EA 5J47A 2FPGB 2JAOA 2J46A 4U9UA 1RD4A 3FRJA 5TVGA 1U3TA 3D6FA 4NNOA 3FOEC 1CLUA 4M7PA 3PL1A 3WIEA 4DDHA 5C81A 4D42A 1KO1A 4WOJA 4OI0A 1DEAA 1XL0A 1IXSB 4UMEA 5IVKA 2C2BA 2Y1LA 4W8GA 3RIXA 2RCNA 3ZBPA 1UQUA 1KMCA 3GLUA 4CQLB 1SN7A 4II7A 2O8CB 2PL1A 5IT9A 4DDWA 1QLHA 1HDIA 3ONEA 4R0MA 3U1BA 5FBKA 5L4SA 4MRNA 3IEPA 2RHTA 3NVDA 1P4AA 2ZS9A 1U1CA 2QXTA 4OA5A 4DWWA 3OSUA 1TD1A 2RGWA 3NGXA 3UPUA 1HT3A 2LDXA 2WA2A 3OZAA 3GCGA 3KSRA 3FLAA 3LKDA 4P3KA 4S35A 2JLWA 1TTQB 2M6SA 1YJCA 2RONA 1RP7A 1FFXA 4NE2A 3QY0A 1OXKB 2VBIA 3SBOA 3K1AB 2OFOA 4R1PA 1KH1A 9ATCA 3F4KA 1C9DB 1G21E 3U1TA 4C2AA 2FOXA 3IA7A 2CFSA 3MPUA 2DUUA 1PHRA 4Y6GB 5K0CA 1DUSA 2QD1A 2FEAA 5ICCA 4MI6A 4MS3B 1UZNA 5ECYA 5FQNA 3VYTB 1H9BA 5CA1A 1ILEA 5G1OA 1JNYA 4D9EA 3PE3A 3I42A 4BFUA 1PJ2A 2BTEA 1M9NA 3L7CA 5B12A 3OEYA 3RK1A 4PM4A 4AKEA 3L8EA 5CGZA 3KKZA 3C4QA 3K8YA 2W4QA 4GYYA 1GTJ1 4JZYA 3U7QA 1AXGA 2QQGA 5T4EA 2QRVB 4JYZA 4NNPA 2ZJ1A 1SO8A 2WHYA 3KOWA 1LVHA 2ZJ2A 1Q0ZA 2ILVA 1OXBB 1WHSA 1XP8A 2GVNA 1H8ED 1E9EA 4RTMA 1DAOA 3ELBA 3QLJA 5DW3A 1Q3TA 2TS1A 4JJ4A 2JANA 3FOFC 4XX0B 4H3KB 1U0RA 1JBKA 2GN6A 5TGDA 2XVXA 1U80A 4QSHA 1G17A 3SYMA 2CLIB 2QRMA 1BFDA 4K6KA 3KOZA 2PGOA 4B8ZA 3B1WA 1W5TA 3DYIA 1A9YA 5CB4F 3OQ1A 1GZ7A 1S7GA 2PZLA 3CJRA 1FOEB 3H1BA 4KLNA 4LBYA 4MYHA 5P8WA 5DYNA 5A9SA 4J3NA 5LQSA 1DG1G 1NMEA 1THGA 1Y42X 2V5VA 3BXXA 4W9RA 4KUHA 2QI9C 2ZJ6A 3O5AA 4RJKA 4WZAA 1CF9A 5J4KA 2EZ9A 5EGSA 4DJAA 4RU1A 1CEQA 3CZRA 3P2EA 3CLTD 3H8JA 3KZKA 3MJFA 3FYSA 3NASA 4RKWA 1PVOA 3HL0A 3U7EB 4LHVA 3T5CA 5LWQA 3UICA 3ECAA 2B3DA 2KS6A 3PSAA 4PQYA 5FNZA 1TZJA 5G41A 3M82A 3T3NA 3GG9A 3A70A 3ER8A 1GSIA 2DQZA 3CLRD 3QHPA 5TPWB 2QLLA 3E9MA 1ILWA 1L7RA 1Z75A 2GQ0A 2NNWB 3NNSA 4BBZA 1C9EA 3RS8A 3OF5A 1X1SA 5DWVA 3BD7A 1XELA 1X8XA 1YNSA 3CLRC 4MUGA 5FX2A 3GCWA 3V55A 3B6JA 3VV2A 5B2FA 3KT3A 4KE6A 1PD0A 4BRSA 2CT8A 3HYNA 2DUJA 2GF0A 5PGMA 4C08A 4AS3A 4GX0A 4QASA 4XIYA 2G5TA 1NXQA 1PR1A 2POCA 4LQ4A 3S2FA 3BH0A 3KKNA 4FYHA 1O3YA 3C1AA 2I6SA 4HOYA 4RK7A 4C6RA 2XYGA 2ZWIA 3HVUA 2JGAA 3HJHA 4F7WA 3NC0C 2C99A 2QPAA 3R6LA 4RPIA 4MVJG 5B7NA 5JS8A 2B3TA 1LPSA 4TV9B 5DRYA 4AY2A 3R7NA 4RWZA 5EXSA 4B6SA 4E7OA 3EF0A 2WILA 1GPH1 2LVBA 4E21A 4RH1A 2IYYA 2QR5A 3MCTA 4MO9A 4OQDA 3BRWD 1I8TA 4YAOA 4A2CA 4B6EA 1C0EA 3HXQA 4ZZ2A 5DHPA 4L7VA 1CETA 4EF5A 1VP3A 4IF6A 3CRZA 2QUHA 3GA0A 3LUPA 6NULA 1ESEA 4LRXA 2GXAA 3Q15C 3HWX1 5AXAA 1NLYA 4EIWA 3A36A 2BZ0A 1UZMA 1QRDA 1IUNA 3Q6IA 3CQ9A 5HIIA 1KQPA 3S29A 4IQFA 4YT2A 5HJ5A 1SOAA 2E82A 3G2NA 2AB0A 4RD3A 3WWCA 4FN4A 4QBTA 4B85A 3MT7A 2MHCA 3V8EA 1T3GA 1S4MA 1SVSA 1G6OA 1KI2A 4A0GA 1N4AA 2V9PA 4JFRA 5LP1A 3HCFA 4JYMA 4KO1S 2GF2A 2UYCA 1MHPA 2GA8A 4PYQA 3JTEA 1OFUX 4GXTA 3NHSA 3TIXB 2WEKA 1E2NA 3V1YA 4LDPA 3IKVA 4TL6A 2JLXA 1T3SA 3SKYA 4B1FA 1N3LA 1DJMA 3R3HA 2YYYA 1DLJA 5ERXA 1SUPA 2WD7A 3MTDA 5GONB 4Q21A 3JPWA 5F5LA 3KUCA 4MQLA 4D8XA 1MEOA 1N3YA 1V5FA 1OGIA 4MR8B 1DOHA 4PAMA 3DCYA 4ARAA 5DLEA 4REOA 3U37A 4AKHA 4E46A 3P19A 3CMMA 5AW1A 2WJGA 3LM8A 4JSTA 3AINA 1LCIA 3ZE0B 4AN0A 5FUQA 2DFTA 4RVDA 1JECA 1OROA 3P97A 5ALLA 4AG5A 1D2EA 2NYAA 2Z30A 4M0FA 1Y8AA 1LF5A 3TINA 4N5LA 2D7CA 3UBMA 1OTHA 2XB6A 2C3OA 1C3OB 1YR3A 3DVSX 3LP8A 4P6VF 4A1OA 4JB3A 3ZQ6A 2YS7A 1HKHA 3BKXA 3KLNA 4ZOAA 3ZHTA 2QLFA 1ZW6A 4ICIA 2V7UA 4U2BA 1XVVA 2WTUA 5T4HA 1I4TD 1XZHA 3ORYA 1N0WA 1AG9A 1VBMA 5KTKA 3STTA 4L74A 3AUKA 1SA0A 1XBTA 4IQ4A 4N3BA 4RXTA 5F7ZA 3S1LA 2CD9A 4G1FA 2K5UA 4TVKA 5SZJA 3Q8MA 4R2WA 2V6MA 2CMDA 4GZ3A 5IKPA 2OP1A 5P21A 3T41A 4S1PA 2AMJA 4TKUB 5DIFA 1PJBA 2GMWA 3IP1A 4RZQA 2D2EA 2AFHA 2I4LA 2MMCA 3E2IA 1N1EA 4LHZA 1KAHA 3NDJA 2VH1A 4MR9A 4BVAA 2OP0A 3FB4A 1E9CA 3B1FA 3VR3D 2HR1A 1D6JA 1HFKA 1N2JA 4XCQA 5MGBA 3UK1A 1JIQA 1ODLA 2WT8A 5JMTA 3MTIA 4I14A 4BASA 4MCIA 4DIFA 3EFEA 4LK3A 4Q4CA 5LQRA 1V47A 2Z3WA 4PAGA 2IYNA 2F64A 5IC5A 4DA0A 5BWNA 1ESZA 1XRMA 1VPEA 2BY4A 1PR2A 1R0LA 4O4HB 4F2WA 3ECCA 2KX7A 5CX4A 4Z7NB 2BD0A 4I3GA 3FFWA 4EGQA 3VH3A 2AYXA 4ZI7F 1GEGA 3OCUA 3GGCA 2DECA 4HPWA 1CJSA 1PTKA 2OCYC 3CINA 3KS9A 4W9NA 5BVGB 2EFDB 3ME5A 2X1VA 2V7VA 2ZYIA 2FEWB 2RGEA 3WLNA 1BHJA 1ISGA 4M0LA 1KFKB 4M83A 1CXZA 2QZJA 3LECA 3RW9A 3V9PA 3VO9A 4DBVO 1MGPA 1G3MA 1G21B 1WKBA 4CDGA 4EW1A 5CB6A 1GQRA 3ZU6A 2I65A 4D4JA 3V4ZA 1WY7A 1DCFA 4Q39A 3A6FA 4ENRA 1NVAA 3OCZA 5G2OA 4ZIRA 4QFMA 2SKDA 3U39A 4C0WA 4ERNA 3SIRA 1C9NA 1Y3CE 4HXFB 4NOKA 2QEQA 3QTBA 5K3OA 3RG8A 2D2VA 2B0CA 3PNSA 4PG8A 3AONB 3LWDA 1AKVA 4FMCB 3EZYA 2JIZD 2J6BA 2NU6B 1RI5A 2Q3HA 2DAPA 5AW6A 3QVGA 1NBHA 2BGKA 1VE7A 3NV9A 1XPRA 4JK3A 4RLHA 1G8KA 2JHPA 4NAHA 4M36A 2ORED 2WV9A 2JD0A 3PQ4A 2YBDA 2FFBA 4NR0A 4FHEA 2XNJA 3M6VA 1SKAA 2GZAA 2ZM6B 2CD7A 1F8UA 5A3RA 5ITZA 1XDZA 1PZHA 2HDHA 3SJ7A 5IUJC 4PONA 521PA 3TMYA 2PZMA 1F6BA 2F3UA 4EYQA 1Q0UA 1XC7A 4X64B 3NBXX 1Z13A 1XALA 2D3TA 4BFXA 1P0FA 1DRVA 2W6QA 3QLVC 1ST3A 5CDFA 4PIVA 4IJMA 2FSPA 2P7HA 1KO7A 2XCIA 3BKWA 5HIMA 5NULA 5C5EA 2JIOA 3EWIA 1F2TB 1HTWA 1KZ7B 3IJPA 4ZQIA 3ZCUA 2I3AA 2M32A 3L7YA 3REQA 1I13A 4E22A 2R8YA 1TVEA 1G4AE 3A06A 4QYMA 1D6MA 2R1UA 3RLIA 3H5RA 5FPYA 4K6GA 4O4JF 1L5MA 5A5FA 4CE6A 1XLWA 3E3LA 4Z4EA 2B34A 4EHFA 1D2CA 2CMGA 5JS6A 3ROGA 5D51S 1W94A 1T9ZA 1E3JA 3C39A 2JZOA 4D9JA 4L3VA 1TMGE 5JT1A 4HVLA 5CEEA 3K09A 3QENA 2HRBA 1FNCA 3AVPA 4F5WA 1YXMA 5J1SB 1P9RA 3SDBA 2Y05A 3O47A 3GFPA 4Z4GA 3GEBA 1MFZA 1C3JA 3LLCA 1EU1A 3NC4A 4TSKA 4YUVA 2F55A 4DBZA 3QRWA 1IXYA 2ZBVA 2TSYB 3AJ8A 1M2OB 4IUDS 5F21A 1CQWA 3OCYA 5LSAA 1P7VA 2YY6A 1C7EA 3BWDD 3P0EA 4GWLA 4PG7A 5E6UB 3NANA 2HBYA 3LOUA 1VXOA 5EWMB 4LFAB 3QX3A 1K8YB 4BGDA 4U8GA 1X7HA 4BGIA 2W22A 4BB9A 1VL8A 3D7SA 3NW9A 3RD5A 2PR2A 2ZYUX 3BWCA 1LJLA 4HLUA 1ZW1A 1WUKS 2DWPA 2ZTMA