2EKPA

Structure of tt0495 protein from thermus thermophilus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
238
Chain Sequence
ERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first crystal structure of NAD-dependent 3-dehydro-2-deoxy-D-gluconate dehydrogenase from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
total genus 85
structure length 238
sequence length 238
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ekpA00
5CEFA 1GPDG 4NBTA 2FZWA 4QSMA 2ZYAA 4AJ4A 3A9WA 4CM1A 3O9ZA 1HRDA 2Q2WA 2JJYA 2PKQO 3OETA 1YS4A 3K96A 2PD3A 4H15A 1GADO 4LVUA 4BNWA 1P77A 1BVUA 4MVJG 5IFLA 1D4FA 4OL9A 4NNJA 3VHRA 1DRWA 1GUYA 1M2WA 2PKQP 1WDLA 1ZK4A 2H1SA 3CTMA 3AW9A 1HTBA 4W82A 3RCBA 3TZKA 4NBRA 4G2NA 1BW9A 4BO4A 1PIWA 3I23A 2B4TO 1J6UA 3GDOA 3F4BA 4MKRA 1UAGA 4BNJA 4DPLA 3ZGYA 1C3VA 1DC5A 1HT0A 5EERA 3D4NA 1ISMA 5BNIA 3NX4A 5JO0A 4ROSA 2WD7A 4J3FA 1DC4A 1H6AA 5KKAA 1N7HA 5T8KA 3JQEA 4J49A 3E03A 2QYTA 2J8ZA 1N9GA 1N9GB 2VHWA 4D3DA 3I6QA 3NT5A 3ZV3A 3BXXA 3JQAA 3O03A 4LW8A 4Q3NA 4ALJA 1B15A 2QQ5A 3AOEA 4K28A 4M8SA 4AJJA 3DMTC 2DVMA 2Y1FA 4TRMA 5CDSA 4CQMD 3FF4A 3H6KA 1M6HA 5K0ZA 4L4SA 4WLNA 4ZU3A 1K3TA 5G4KA 1IY8A 3RWBA 3WSWA 1Z7EA 1PSDA 4R9RA 2VT3A 1YH3A 1R0SA 1NPDA 3CMCO 5BSEA 5I7EA 2F00A 5F21A 4M89A 3RC2A 5AVOA 2EG9A 3JQGB 4RPHA 4RQTA 3SLKA 3LK7A 2CUKA 2QZZA 3ENKA 3FR8A 1KYQA 3GK3A 1AXGA 3A06A 4BMSA 4UUPA 3AUTA 5F1OA 5L4NA 3HNPA 5DP1A 3UW3A 4D46A 2JFGA 4XYMA 2H6EA 2X0NA 4NMHA 1H6CA 3TZ6A 3Q0EA 5CEEA 4E13A 3I9LA 1Q0LA 3HN7A 5DDIP 5T67A 1GYPA 1EE9A 3E18A 4S3MA 4Y8VA 1ZK0A 1Y5RA 2G0TA 4OHUA 4M55A 3BMOA 1Q1NA 1ZSNA 4LCJA 1C1DB 1TT5A 3GEDA 5FWNA 4CQMA 5JCJD 1GEEA 1IYZA 1DIGA 4CM4A 2QG4A 2WM3A 5AOVA 1EQUA 1A9YA 3QQPA 2JD1A 4ZJUA 4DLLA 4J2OA 3PHLA 1SOVA 4PGFA 3A14A 4R9SA 1X1EA 3KTDA 2G82A 4KQXA 2CZCA 1V3VA 4ZICA 5HA5A 2JCVA 2GDZA 3JQFA 3TWOA 4LN1A 3ZNNA 3WGOA 4AFNA 2I5PO 4DIOA 3FPCA 1T2FA 1LDBA 1UDBA 1JU9A 4J4BA 3RFXA 4L76A 2AQIA 1PL7A 3IMFA 4CMHA 1PTJA 5KVVA 2WYUA 1DDOA 3V2UA 3GN1A 1DJNA 2CD9A 3PWKA 4AJHA 5JMPA 3MOIA 5H83A 1KVQA 1V3TA 2Y1DA 3QIVA 3ICPA 4OGWA 4MO2A 1MUUA 1YJQA 1U2GA 2ZIZA 3P5SA 4Z9YA 5JC8A 1X0VA 1LDEA 1X15A 4P22A 3PJFA 2BELA 3QVWA 4FJ1A 1HDZA 2RAFA 4BO6A 5DOVA 1UJMA 3ICCA 2E48A 1KBZA 1E7YA 2FR8A 3HB5X 3KEQA 2W4QA 2CFCA 2WE7A 3DZBA 3KVOA 5DCWA 2TMDA 3PQFA 3DZFA 3GEMA 4R51A 1Z82A 4YJDA 4CMBA 2OBYA 3PWZA 5GMOA 1HETA 4XGIA 4JLWA 4HP8A 5GY7A 3F3SA 2FP4A 4BO0A 1R4NA 3SLGA 3PQDA 3M1AA 4HUJA 5I7FA 3P7MA 3MJCA 3EZLA 3P2YA 3C3XA 1C0KA 4TKLA 4HX5A 3EC7A 3LYLA 5ILOA 4B4OA 4NDNE 2RHRA 1EK6A 3GHYA 3AI1A 2YZ7A 4UVEA 4GX2A 4BNTA 3F46A 2J3KA 2QW8A 2D59A 3D1LA 2JD0A 3ANMA 4RJTA 5L51A 3ZWOA 2OP1A 1QYVA 4B3HA 3D5QA 3C1AA 1MP0A 1JA9A 1IE3A 1B2LA 1CQJA 1NASA 4BGUA 3BTUA 3EYWA 2YDXA 5IXYA 3ZHYA 1BWSA 4CLOB 1ZJYA 1M75A 4G65A 5TSDA 3QWFA 1NHGA 4CL8A 3U0BA 4Q9NA 4UUNA 3GFGA 3GAFA 1L7EA 3HWRA 3ZWCA 4I8XA 4XGKA 2UAGA 1U7HA 1VKOA 2CVZA 3TZHA 4BOYA 1E3WA 4RLHA 5KIAA 3WBFA 3W8DA 4ZQFA 4H16A 4INAA 2F1KA 3MEQA 1KC1A 1R16A 3FNEA 1MXFA 1K5HA 4DBZA 4MOWA 1LLCA 1WW8A 3IDSA 1I3MA 5I7SA 4MINA 2ZKLA 1PJ3A 4XZ3A 3KYBA 2XXJA 1IZ9A 3GAZA 2RH4A 1RM3A 5ILGA 4B4UA 1LLQA 5TIIA 5DOZA 3NRCA 2JAPA 4RZHA 1YL7A 4PRKA 3DTTA 4R16A 4CMAA 4TKMA 5HTOA 3R0IA 1Y8QA 3GR6A 1JTVA 1QRRA 3RU9A 3U09A 5JO9A 1SCUA 4XIYA 1J4AA 1E1KA 1H94A 2PZMA 3AU8A 3HN2A 3AJRA 3R3SA 3U62A 1J5PA 1JWBB 2C29D 3NDIA 4Q3EA 1VI2A 2X6TA 2DBQA 3L0DA 1D8AA 3AY6A 2X9GA 2V7PA 3FN4A 4D44A 5JC1A 4FC7A 4CR8A 4ZHSA 3DR3A 2J5KA 2O3UA 1KIFA 1EVYA 2Y66A 1HDGO 4KZPA 4XDYA 4CQMB 2VZ0A 5F3RA 4L9RA 3L9XA 3ULKA 4PG8A 4FB5A 1P9LA 3HB4X 4YRBA 1NVGA 4O6VA 3IKTA 1IB6A 1PJCA 2BGMA 3GEGA 1W8DA 3PFFA 1L1FA 1GYQA 1PR3A 4BQRA 1E92A 3BMNA 4JX8A 1H9AA 3VKVA 5MDHA 4WCDA 1MB4A 4XQEA 1TVEA 3SXPA 4II2A 2FN7A 1LX6A 4BGVA 2HMWA 3KBOA 1SO8A 5TJ9A 5JDCA 4B4VA 2AMFA 1NR7A 1ZSYA 4XIJA 5JAIA 3WGHA 2A92A 2BF7A 1S7CA 4GX0A 4FOSA 3DHYA 5A05A 1B16A 1PEDA 4FGWA 2X9NA 3TOZA 3OECA 2YHUA 1MC4A 1OOEA 1XEAA 1ML3A 4YAIA 3NV9A 3L77A 1ULUA 3H5RA 4B7CA 1U4OA 2FPIA 4YJHA 3LLSA 3JQ8B 4OXKA 3WFIA 4R4JA 3LF2A 5T5QA 3WNVA 1O95A 4YBZA 5G0VA 3GDGA 2NU7A 2R6JA 4FD3A 4FFPA 3WTBA 2BLLA 2Q4EA 5TT0A 3KV3O 4DLBA 3O38A 4BGEA 4XR9A 1XU7A 3BTSA 5DN9A 2XPCA 3P19A 4TROA 1GV1A 1R66A 9LDTA 4YR9A 3V1TC 3K9QO 3TPCA 1DIBA 2Q50A 3WGTA 4CR6A 1YQDA 2HSDA 1E1MA 3RUCA 3RU7A 4O1MA 1AUPA 1C0LA 1PZEA 4KTTE 1ENZA 4N5MA 1ADGA 1E1NA 2EHDA 5BNTA 3KSUA 3AOGA 4JJGA 4NQZA 5KJ1A 4W7HA 1NBOA 3WMWA 3EHEA 3H9GA 3D4OA 3OBBA 3HHPA 3QWHA 3NAQA 4BMNA 4FCCA 1LQTA 3RUEA 1HE5A 3U4IA 5CDYA 5FI3A 3GVIA 3H9QA 3KSDO 1X14A 1Y81A 3V2HA 1LC0A 3OQ1A 4CLRA 4PLWA 1UXHA 3BMOB 1NVMB 3GVHA 4KUEA 5G0SA 3GGOA 3B1KA 4HXYA 1KEVA 3GH3A 1DHRA 1SB8A 2DBRA 3EW7A 3EAGA 4IUYA 2V6GA 1HZZA 1KC3A 4CQLB 3FNGA 4E5KA 3FBTA 1SEPA 1U8FO 4Y67A 3OF2A 1Y8QB 1N2SA 1MC5A 1YDWA 8ADHA 3O4RA 3GFBA 3NGXA 3DBRB 3RD5A 1VLLA 1PJQA 1PGQA 4IINA 4R54A 3ZW8A 2XOXA 4D41A 3EDMA 1O89A 3UKOA 3C1TA 1YQGA 1H5QA 4BMVA 5T6BA 4ITUA 2HO5A 4NPCA 3QVXA 1SZJG 5BNFA 1O5IA 4MVJD 2QRLA 3ZU5A 1XKQA 3KO8A 4NFYA 1YE3A 1C14A 4JNKA 2C7GA 2CMDA 3WGQA 4CPDA 2BD0A 2J3IA 3KHUA 3DBLA 4PLPA 4QUKA 4EGFA 4DIFA 1PJBA 4IDEA 1QP8A 3QWBA 1CJCA 4WNCA 4ZQEA 2AA3A 3PJGA 5IDQA 4A73A 1K2WA 1EMDA 3WYEA 4NG5A 4BNGA 2GZ3A 3QVOA 3F1KA 3E5MA 5AXDA 2LDXA 4CM8A 3QJ5A 3OM9A 1DRUA 1Q2XA 2CDBA 1NFRA 1E6UA 3PP8A 4IZHA 1X1TA 1XG5A 3DOJA 1ZW1A 4XR4A 3I52A 3DO5A 4J2HA 2R00C 1FDTA 3I4FA 3H3JA 5HM8A 1SB9A 3WLEA 3QHAA 5B1YA 4Z0TA 4WOKA 2GYYA 4A03A 3JD1A 4YWJA 5U1PA 4B7XA 2G5CA 3KLMX 4J9VA 5DCYA 1B7GO 5A3VA 1HYHA 3RVDA 2C07A 3ZZNA 3W4IA 2X22A 1R12A 3N7UA 4N18A 2GN9A 2ZCVA 3DAPA 1NFFA 3GRKA 5CAEA 4I9NA 2DTDA 5IDYA 1KEPA 2AEFA 4OOFA 2ZB3A 1LQUA 3ZDFA 4FPXA 4FS3A 1JKJA 1T1SA 7MDHA 4HFMA 5KOIA 1ENYA 1LDMA 4Z3DA 2DQ4A 1B8PA 1DRVA 1FDVA 3VVCA 5A9SA 3WYCA 2EWMA 3GVPA 2HCTA 2UUPA 3ADOA 4QTZA 3ROQA 1P1IA 3WTCA 3F5QA 3AY3A 2OORA 4GWKA 3ROKA 4R1UA 2EF1A 4E4YA 1T2DA 1GY8A 4UVDA 1SNYA 3IKVA 3I9MA 1TXGA 1ZIDA 4UAGA 5AYVA 3U49A 4PVCA 3WWZA 3HQ4O 3FWZA 3TZCA 1I24A 3FD8A 2C2XA 4RQUA 1ZZEA 3ABIA 4I5FA 4TWRA 4XYEA 2WDZA 4BO7A 3JQAD 4GX5A 1M6WA 3RBXA 2C5EA 3PJDA 4WLEA 2HMVA 2OBNA 4YA6A 4A2CA 4MKXA 2HK7A 4E2XA 1JLLA 3JQ7B 2PR2A 4JJIA 1NM5A 1QSGA 3DOCA 2YDYA 3KLPX 4NBUA 4AJ2A 4II3A 1OC2A 4I1IA 2VYND 1YQXA 5JLAA 1ZJZA 3DAGA 1VKNA 3DZJA 2FOIA 5I8WA 4OSPA 4DPMA 4A27A 1KVUA 2CF6A 4HADA 2XXBA 1BMDA 4F6LA 7ADHA 3D3EA 3MWEB 1ISFA 2G1UA 2J5RA 3WGGA 4BO9A 4DA9A 3ZU4A 1BXGB 2H63A 4IBOA 2FY8A 1U1IA 1QYCA 3DBRA 3W8EA 5KWEA 4CV1A 4AJOA 1H93A 5FF9A 4XX0A 3U3XA 3DEYX 1ONPA 3DBHA 4BNUA 3KB6A 1ADFA 4UVIA 4EYEA 1E3JA 3O26A 5COBA 5CFZA 5L4SA 3I9KA 3QRWA 4D43A 1LSJA 2BHLA 3E82A 4ND4A 3H9UA 1V8BA 1EVZA 2YHIA 4S1VA 4JIGA 3PYXA 1T4DA 3PI7A 5TGDA 3TRIA 1Z73A 2VNSA 4OQYA 5COAA 4Q3AA 1XYGA 4MVJF 3CZMA 5EN4A 3F5SA 1R4MA 4NHEA 4BNFA 1VC2A 3OJFA 5IZCA 4NK4A 5IZCC 3EZYA 2NTNA 2AQ8A 1F17A 1E3SA 2A4KA 3LC2O 3RBVA 4ND2A 5G0TA 4ALNA 4QXMA 4RL6A 1DIHA 4QFCA 4DWVA 1PQWA 2VUUA 2BI7A 4DXHA 1QG6A 5G4LA 1HL3A 1A4IA 2GNAA 4Q3DA 3S1LA 3IP3A 5LCXA 1X0XA 2C82A 3G0OA 3WR5A 2Y1OA 4LRSB 3TZQA 1MLDA 4DQXA 5JY6A 2E82A 2BGKA 2Y05A 1CEQA 3GC6A 4TMFA 2VHYA 4GGOA 1R37A 1E7RA 1I01A 2QHXA 3RBZA 2VRCD 5G0WA 4B8ZA 2VWQA 1VJ0A 2DKNA 4WCFC 3TJRA 3W8FA 4XQ9A 2WSBA 3JQ9C 2VUTA 2J3HA 5TF4A 1ZUD1 4N5LA 2PGDA 1A5ZA 1EBFA 1DFIA 2E4AA 1UR5A 2BFOA 4NJOA 3K92A 4TRRA 1HDCA 2NLOA 2CF5A 5HS6A 2UV8A 4KQWA 2NVUA 2QRKA 4IGEA 1KVSA 1DXYA 4ND3A 2FPGA 1DIAA 3NT4A 3SJUA 1GQ2A 1XDWA 2E49A 3PHJA 1DFGA 2VT2A 3K73O 1MGOA 4CV0A 1PGNA 1KVRA 3HUDA 1RPNA 4RPJA 3ZU2A 3INGA 4KUGA 3LF1A 1B26A 3BMQB 4IJKA 4WPGA 5JAQA 4GVXA 2EERA 1ID1A 4YJGB 2HAEA 4BO1A 3ZHZA 4PLGA 2CY0A 1D1TA 5DF1A 3DMYA 3SJ7A 3WSVA 4CV2A 3ZV5A 2DTEA 3HDJA 5CG2A 5ICSA 2V65A 1G1AA 5B4TA 3Q3CA 2B4RO 4TRJA 3PQEA 3GG2A 1SEVA 2YUTA 2IZ0A 4Y98A 2JFHA 3OP4A 1Y9AA 4N7RA 3MWDB 5JNLA 1OAAA 2HRBA 4J7XA 3JQBA 3ZWXA 3GRPA 4HV4A 3PDJA 5JPIA 3PWSA 2Y0CA 2TMGA 3OIFA 2GGSA 4R41A 3KETA 3I4CA 4FOOA 4CV3A 3W6ZA 3MTGA 4BNLA 5ADHA 4BKPA 5K9ZA 1EBUA 4IXTA 2P5UA 1E3EA 5JAZA 4F46A 4EUFA 3AM4A 4GX1A 6ADHA 3OH8A 3Q2IA 1FK8A 2D2IA 3NUGA 4XYGA 2PWZA 5EIOA 4IQGA 4PLCA 1I10A 2DFDA 3TL3A 4EI2A 2AE1A 2HMSA 3EK2A 4E30A 3JQ6A 4IMRA 1DFHA 4Y9DA 4XDZA 4D42A 5ENDA 2OFPA 1SAYA 5GZ6A 4JQCA 5J23A 3Q1LA 4GGPA 2PD6A 2Q2VA 4BNXA 5U4QA 5TC4A 4GSLA 2AEMA 3ZWAA 3UOGA 2AEJA 3WIDA 1MFPA 4PFJA 3PVZA 3EUWA 1GL3A 3VTFA 3HADA 3MOGA 3IUSA 2GO1A 3KZVA 3D4PA 3I9JA 3WOHA 1WDKA 4J4TA 2B83A 2X7HA 1YGYA 1UH5A 3HZZA 3LC1O 4M1QA 4LMRA 3TNLA 1IPEA 3FTNA 3IJPA 4OO3A 5I9MA 3ZW9A 1WWKA 1XSEA 4XA8A 5A9TA 4YJFB 4PZEA 2IYPA 1DHTA 3IC5A 2Y1CA 3VPXA 4WNIA 3WXBA 1SPXA 3BYZA 1LDGA 3ZWPA 3D7LA 3ANLA 3GMSA 5DBIA 4R3WA 1LRKA 1LJ8A 4ZD6A 3UGKA 5KJ6A 4JGBA 1GD1O 4YQZA 3WB9A 1Y9EA 1B14A 1RM5A 3ZNOA 1TT7A 1LSOA 2IEDA 3D5TA 3PFWO 3IAHA 1B0AA 2V6FA 2I99A 2NADA 2O48X 3JQ8A 4FFOA 2Y99A 3S2IA 4TZTA 4Y6PA 3B1JA 1FDUA 1P74A 2BRUA 3UICA 1E1LA 3HDYA 4JP2A 1E6WA 4XQGA 3GUCA 2B35A 3IQDB 3WS7A 1YRLA 3FNFA 3JQ9A 4YAJA 1NAIA 1PJ4A 1U9JA 4C7KA 1O9BA 4XB1A 5B4UA 4AJ1A 4QO8A 5F1KA 1YXMA 1PWZA 5IF3A 1I3NA 1WPQA 1RM4A 1AXEA 4GL4A 3U4CA 4U8GA 1VRWA 3I83A 3KEOA 3UCXA 5CDTA 3LQFA 1GAEO 4GQAA 2OL4A 4YCAA 1Z74A 1KETA 3VZQA 1A4UA 4KOAA 4NU6A 1U7TA 3GOHA 1I36A 3FR7A 1CETA 3DBVO 3C7AA 3LDHA 2YJZA 4LRTB 3PHHA 1YBMA 3ZWVA 1HYGA 1U2DA 3DTYA 4EUHA 4E21A 3PYMA 4XEHA 1WZEA 4OSOA 2EJVA 4E31A 5IN4A 2PH3A 3L07A 4I9HA 1OMOA 2W2LD 3AU9A 4O5OA 3PIDA 2DC1A 4J91A 4WCFA 2VYNA 3ZWMA 4N5NA 2GLXA 3AM5A 3EVNA 4HKTA 4UEJA 5TJHA 4LISA 2EV9A 4W9NA 4J1SA 2O7SA 4XYBA 3DZGA 3V5NA 1M76A 4BKRA 3MJSA 4K9DA 4MP6A 3S2FA 3VH1A 3VZRA 2PK3A 1LBEA 1E3IA 4ALKA 2NUAA 4PG5A 3ADPA 3WGZA 2IODA 2P9GA 2YFHA 1P31A 2FRDA 4LSMA 3H7AA 1IUKA 1HKUA 3EGOA 2HDHA 5CP8A 2X58A 1G0NA 2QZ9A 1P1HA 4PG6A 4ZVVA 5T64A 3MJVA 4RVFA 2FPPA 1NX6A 1AHIA 3ZH2A 2P2SA 3AUSA 1JN0A 3G1TA 3CIFA 2B5VA 3PGXA 3E1KA 4JROA 4M54A 4CLEA 3WNQA 3UAGA 1F8GA 1QYDA 4QEDA 2Q1TA 4EZBA 4CMJA 1N1GA 4XKJA 1QLHA 4O63O 4BV9A 2Z1NA 4D3SA 1P1RA 3CSDA 3M6IA 4XGNA 1VSUA 4BNNA 1LTHR 2W2LA 1PQPA 2O50A 3RAJA 4Z0PA 3OJLA 4CLXA 4FSHA 1X7GA 2A35A 3F1LA 1UZMA 2DTXA 3OMLA 2OP0A 1YOVB 3D64A 5EMHA 1P3DA 3SBOA 1RYDA 1UXKA 3JQBC 3RUFA 3WMXA 4GVLA 3K8ZA 2CVQA 1NQAO 4R1NA 5F5LA 4DVJA 3UFXA 1P0FA 1I3LA 2GCGA 4WLVA 4R5MA 3OA0A 4BO5A 3H3FA 1P1FA 1I32A 2PA3A 1VPDA 1TA4A 2ZTLA 5L53A 1IZ0A 3E9QA 4DIBA 3VKUA 4GKVA 2PZKA 5EINA 5JYEA 3HDQA 2E37A 1V3UA 2VQ3A 1C0IA 4JJFA 3ZV4A 3GN2A 4DL9A 1CERA 3RUIA 2Q99A 4WLFA 4RCVA 2ZYDA 2A94A 1S6YA 4EUEA 3AM3A 4RPLA 1KERA 4YRAA 1E7MA 3BTVA 4LMPA 2OO5A 4RO0A 2W2KA 4TZKA 1EQ2A 1UP6A 4Z9XA 3JYPA 3GHHA 4WECA 2X8LA 3TN7A 4Q3CA 4L75A 3FCOA 4CMIA 2OOSA 2PGLA 3PZBA 2Q45A 1PL8A 2O3QA 2ET6A 2X1HA 1SC6A 5EL0A 1G6KA 3COSA 1IULA 1PQUA 1H0KA 2JHFA 4FBGA 3RASA 1ENOA 4O59O 1H2HA 3H8VA 1PZGA 2O4UX 3K2EA 3BZUA 1HEUA 4QO7A 5THQA 4I9UA 1YL6A 3H5AA 3L4BA 4L73A 4YXFA 3HFSA 1FJHA 1HLPA 4DUPA 3RROA 1E77A 3CE6A 3E5RA 3FBGA 5H81A 3RKRA 3UCFA 4YACA 1GQYA 4M87A 1U3TA 3VZPA 3GG9A 1Q0HA 1PJ2A 3I9NA 3L6DA 4IDGA 2DLDA 4FIZA 1YBAA 1PX0A 1AHHA 3CKYA 2YY7A 4IS2A 3JD3A 3JCZA 3TL2A 3ZWYA 2AXQA 4MIEA 1X7DA 4P4LA 4Q3BA 3BHJA 2ZB8A 3HFGA 3MTJA 4OYRA 4BIIA 2UUOA 1JKIA 4UUMA 2J3JA 1GEGA 3GGGA 4FQ8A 1BDBA 2IRWA 5JDCC 1DO8A 2FZEA 2B69A 5MGBA 4FW8A 4I08A 4E3ZA 4MIYA 4A7PA 5T8KC 3QY9A 1R6DA 1T1RA 5IXSA 4GKBA 4RF2A 3Q6IA 5CDUA 1KEUA 1H6BA 4J0FA 1VL6A 3L6EA 1ISGA 3DZKA 1DC3A 2BFPA 2NSDA 2Y1EA 4NH4A 4YJGA 1JDJA 1SMKA 4R1TA 4F3YA 1I33A 4R5HA 3X2EA 2H5LA 4E12A 2JFFA 1U3WA 4EEXA 3QVTA 2P68A 3SVTA 5JCJA 1U8XX 5C5IA 3EY4A 5A03A 5ITVA 1NVTA 2O3SA 1PJLA 5EJ2A 3RUAA 4PLTA 4HFJA 1E6EA 2C59A 1AN9A 2EXXA 5A06A 5EQDA 1I5RA 5CHEA 5BSHA 3PTZA 1XQ1A 4CM4B 2WE8A 3HSKA 4FR5A 2AG8A 4XJSA 4CQLA 5TNXA 1ZNQO 1EUDA 4GWGA 4PCVA 3TDKA 4CL3A 1ARZA 3HE3A 1ZVMA 2Y1GA 4BQPA 4J90A 2ZQZA 4L4XA 4E2YA 1FDSA 4IJWA 5DBGA 1XELA 1HSOA 1LSUA 3BMCB 3LT1A 2Q1WA 1QORA 4CUZA 3JYOA 2RHCA 3NT2A 3AI3A 2XF8A 1A27A 3OHSX 4MVJA 3FI9A 1GQQA 2DBZA 2I67A 2VTDA 4IDAA 4Z6KA 4FDAA 3ZU3A 1MA0A 2X86A 9LDBA 1B3RA 2DUWA 1YB4A 3NJ8A 1EFKA 2P5YA 4FFMA 2X5KO 2Z5LA 4ZA2A 3Q9NA 4A5OA 2EIHA 4D79A 4JBHA 4HY3A 5F5NA 2O4CA 4DLAA 5KNLA 3QSGA 5TS3A 4WLUA 4IIVA 2JKVA 2OGUA 4P4GA 1LDYA 4WE3A 3GY0A 1UDCA 1XGKA 3ROPA 1ZK3A 3QP9A 4JK3A 4RF5A 4BKQA 1V35A 3ETGA 3W4JA 5ER9A 5JY1A 3C24A 3LSYA 2GN8A 4OXYA 4J7CA 1XHLA 2D3TA 4NIMA 4LK3A 1JVBA 1JVSA 3E9NA 4X54A 1I2BA 1VM6A 3ON5A 3HJAA 1Q0QA 4PRLA 3JD2A 3OEYA 3ITKA 4OM8A 4YAGA 3JQ7A 4E2ZA 1GR0A 1OBFO 2IZZA 5KVCA 3WDSA 3FSRA 1M66A 4AJNA 3DHEA 3KYCA 2GN6A 2X0IA 3LVFO 3RJ9A 4DMLA 1Q7CA 2I66A 3JQDA 5KJEA 2JHGA 1NNUA 3V1YA 3JD4A 3LT0A 3L4BC 2OMEA 4TVBA 5I8ZA 1EDZA 1I0ZA 5K6AA 4YAEA 1MG0A 2O23A 2OZPA 1JQBA 3WG9A 1WDMA 1F06A 4JXKA 4W4TA 3NGLA 1XWFA 2QX7A 5C7OO 4IGFA 2NVBA 2PNFA 3QWIA 3OIGA 3WQSB 3B1FA 3PXXA 3H9EO 2DFVA 2HU2A 3K31A 4BL5A 1F0YA 3K6JA 1C1DA 3QW2A 4HNGA 1CRWG 3R3JA 3BHIA 2BI8A 3QVSA 2GD1O 3VDRA 4M86A 3IS3A 3L4SO 2VZ9A 4C7JA 2GUGA 2YQ5A 2OUIA 4IM7A 5BSGA 3U5TA 2GZ1A 1SOWA 3D3WB 3NTOA 1FF9A 4IDCA 5ICMA 3D3WA 3QLJA 5LDGA 4RVSA 1KY4A 4MVJE 1H2BA 4BB5A 3Q2KA 2GR9A 2FR0A 4RVGA 4U7WA 3T7EA 3KYDA 4YYZA 4CMCA 3K5PA 2AE2A 3WGYA 3PEFA 4K6FA 1ORRA 1ZEJA 4KTVE 1GU7A 5L7TA 1PGPA 3WWYA 2H9IA 3S2GA 5L40A 2VNAA 5A5EA 4F6CA 3ORFA 4XCVA 3GGPA 2Y93A 3V1UA 1DAOA 3KYCB 2CNBA 2WWRA 3ONDA 3RUDA 2GRAA 4JN6B 5DNAA 4BO2A 4RF3A 2AHRA 1JAYA 3SC4A 1N5DA 2B37A 5JDIC 1LNQA 4GI2A 2ZATA 4I5EA 4MIOA 2RBEA 4AVYA 4UVGA 1XU9A 3WQQA 5BR7A 2RH8A 4W7IA 4BV8A 1OI7A 1NPTO 2BFMA 4P4NA 1GUZA 4B3IA 4MVJI 2VHVA 4YJFA 3S2EA 2BFAA 4CLHA 4L8VA 1QV6A 1NPYA 4A10A 4KP7A 3N58A 2W98A 1YB5A 2D5AA 1HYEA 1N1EA 1ZEMA 3MJEA 4C4OA 3OJEA 3WIEA 3TSCA 1E0DA 1ZBQA 1K6JA 3GF4A 1WAMA 1UP4A 2QRJA 1WZIA 4ID9A 5BT9A 1UUFA 4H3VA 2JL1A 3AUUA 4E5YA 3VPHA 4IZIA 1Z75A 2PGJA 4IPTA 1A71A 4DYVA 2ZJ1A 2R2GA 3TOXA 4BVAA 1UZNA 5C37A 1CDOA 2NV6A 1R4MB 3WYBA 5BQFA 1EVJA 1OZAA 2IEBA 4FFLA 4WASA 5FYDA 3GZNB 4AJEA 3W6UA 2HRZA 4PVDA 1T24A 4Y6SA 3GA0A 2GN4A 1EVIA 2HLPA 2D8AA 3A4VA 5DBFA 4WEQA 5A4DA 1BHSA 4UVHA 1LDNA 2D4AA 2DBVO 4I5DA 3GVCA 3VC7A 4CODB 3ONEA 3RKUA 5KTKA 4EITA 3ZN2A 4NJMB 3RSHA 5JMWA 5DCUA 1O94A 2P9EA 2VWHA 3WJ7A 4GBJA 2UVDA 4ZRMA 3GT0A 4WKGA 2HKIA 4FFRA 2Y68A 1IHXA 2EKLA 2B5WA 1IOLA 1L7DA 1J49A 4KMSA 2Q4BA 3M1LA 3QV1A 3GLQA 4O0LA 2Y0DA 1ADCA 4BKOA 2VTEA 5ITWA 5A04A 1C1XB 4FJ0A 2O7QA 4Z0HO 3O8QB 3KYDB 3DFUA 3GNQA 5TQVA 3MZ0A 2PH5A 2PFGA 2B36A 3JSAA 1GCOA 2NVUB 4CLRB 1QYXA 3U4HA 5L9AA 2POQX 1GZ4A 5IDWA 5DULA 4NI5A 4RDHA 5U9CA 3AFMA 1YL5A 4OQZA 3VH4A 4L4RA 4TRNA 1IHYA 2ZYGA 5IDXA 1FDWA 2Z1MA 1I2CA 2YV2A 2G17A 1PL6A 1XQ6A 4IMPA 2FSVA 1UDAA 3QWAA 3NYWA 3ETEA 1PWXA 4YDRA 2JCYA 3CMMA 3JQCA 3CZRA 2GPTA 1A7AA 2DPHA 2NVWA 1QV7A 2GSDA 2C54A 1I30A 1VSVA 2EP7A 1FXSA 4J16A 4MDHA 4U0JA 5AXCA 5TX7A 1QYWA 1XCBA 3K2BA 2YQ4A 4YAKA 2EJWA 2RIRA 2W8ZA 3LU1A 4DQUA 2G76A 4PIVA 2HQ1A 1RJWA 3ZV6A 3KUXA 1ONOA 2B0JA 3M2PA 4NBVA 1PGOA 2C20A 3EVTA 4H7PA 4UEOA 3AOEC 5L7YA 2V6MA 4BNIA 4RPKA 4R68A 3MJ4A 4EDFA 4AJLA 3NTRA 3G1UA 3IUPA 1N8KA 5L45A 1EEHA 3ROMA 1Q7BA 1HDXA 1YONA 4MKZA 3NDJA 4J4HA 5JBIA 2RCYA 3I5MA 3E6AA 2Q49A 4PLZA 1Y8RB 3G17A 4Z9FA 4J43A 2NU9A 6LDHA 4FJ2A 4TVOA 1ISHA 2LDBA 2VHXA 3N74A 4RVUA 3O8QA 1WVGA 2DM6A 4PLYA 1C1XA 1CYDA 4NK5A 5KJCA 5FI5A 3MCVA 2Q46A 4YT4A 3IL2A 4IIUA 2E6UX 3KXDA 1W73A 4B8WA 4XRRA 3ASVA 1MFZA 1QXSA 4OKIA 2VUSA 1HSZA 2IXBA 3DBLB 3RI3A 3LC7O 2ZCUA 5G2OA 4IDBA 4W99A 1OFGA 1K89A 2EW8A 5C3MA 1JW9B 2WMDA 1LRJA 3RC1A 3BMNB 1E7QA 2EKQA 4AJIA 3UN1A 3AWDA 4RV9A 3DONA 3WQRA 1BW9B 3INRA 1HE2A 3RUHA 1DIRA 3UCEA 2ZK7A 4E32A 3H2SA 4KWIA 2NU8A 5JXWA 4WGGA 2VHZA 2GASA 3Q9UA 5LC1A 4AL4A 1J0XO 1F12A 4EEZA 2ZTVA 3AK4A 3GPDG 2EGHA 3VZSA 2D5CA 4RVHA 4HFNA 4WEOA 3VPGA 3M2TA 1ENPA 2YFQA 3HDHA 4CM3A 4QT0A 2I76A 4NU5A 3DZHA 4GSKA 1U5CA 2VZ8A 4A0SA 3JYQA 1RYEA 2VWGA 4QECA 1Y7TA 2NWQA 2R00A 5L95A 1BG6A 3S8MA 5LDHA 5AQ1A 4P38A 4YQYA 3NTQA 1Y8RA 1DB3A 3F9IA 4ONEA 1UXGA 1E3LA 3PGJA 3UVEA 3WICA 1T26A 4DPKA 1HWYA 3DMTA 1DBVO 2C2YA 4CM8B 5EQFA 1BGVA 1VJTA 2YW9A 3A1NA 5HWSA 5KCZA 4IXWA 1KS9A 4BNMA 1DAPA 4PN3A 1ADBA 4IQ8A 4E2WA 3LZ6A 4UREA 1TEHA 1WMAA 2X5JO 1EFLA 3JYNA 4XB2A 4OIMA 3VAZA 3OQBA 3BA1A 3IIEA 1EK5A 5AXAA 1XIVA 1QLJA 2NM0A 2YYYA 1Y6JA 5HBRA 4ALLA 1ZXBA 1GUFA 1Y1PA 5GZ1A 4CM9A 4GH5A 3CPSA 3JQGA 3BMQA 4NFHA 2UDPA 3R1IA 2FMUA 4J1TA 4MP3A 5EESA 1BTOA 2O3RA 2NNLD 3OIDA 4E33A 4E0BA 3JQAB 1GDHA 3OQ6A 4QQRA 4DTIA 2HMUA 2ZJ0A 5JAMA 3L6OO 3I6IA 4R01A 2C0CA 1BXZA 3QA9A 2I65A 3SX2A 2I9PA 4BB6A 4BS9A 2WD8A 3WLFA 1YWGO 2WJPA 4D0SA 4ZQHA 3TQHA 3WFJA 1ZMTA 2SCUA 4ND5A 2PKRA 4PG4A 4ND1A 1ZK1A 4B79A 1ZFNA 4U6QA 4ZQBA 1TT5B 5IZ4A 2WD7B 3DOOA 3H2ZA 2YHIB 1DLIA 3ETDA 3H65A 4IY1A 4P8RA 4FN4A 4ALIA 1E5LA 1PR9A 3G3EA 1DOHA 2B4QA 2QYSA 3K30A 1A9ZA 3ZWBA 3F4LA 3JQFC 2AQKA 4R1SA 5KVSA 4B3JA 2VWPA 4CM9D 3NJ4A 5KVQA 1B3BA 1DJQA 1P45A 2CSUA 2ZTMA 1F14A 4J7UA 1EDOA 3E9MA 3IP1A 4CJXA 3ONFA 3DWFA 4KDEA 5G4KB 5GZ3A 2HJSA 4GLOA 4CLOA 1ZH8A 1V9LA 3DFZA 5KJFA 3PDUA 2W2KB 4QX6A 5I7VA 4FGSA 4M49A 3Q11A 2Y0EA 3STHA 1ZXLA 5F1PA 3ENNA 4DYDA 1PS0A 3INTA 4YVFA 4TQGA 4GAEA 1A7KA 5A5FA 3DC2A 4YT5A 5K6AC 4J0EA 1NQOA 2WYWA 3L9WA 2O3TA 4CUKA 4MVJM 2VRBA 4A26A 3CXRA 4PLVA 4QFDA 1NP3A 3H5NA 5HRUA 3A28A 3GMDA 3ITDA 5KKCA 1WMBA 2O2SA 4NZ9A 1ZMOA 4BGIA 1PGJA 2HUNA 5A3JA 2I6TA 3I1JA 4AICA 2FSSA 1MG5A 3C7DB 1F8FA 2O3JA 2GF2A 3E8XA 4EJMA 1P0CA 3WGIA 4J6FA 1HZJA 2GERA 4OKNA 1UP7A 3VOSA 5CEJA 3AUAA 1U3UA 3NEPX 1MV8A 1NAHA 2X23A 3C1OA 2JCXA 1O6ZA 1XA0A 2WTBA 3VPFA 4GMGA 1KVTA 2DU8A 2VYVD 1VL0A 2X5OA 3RFTA 2NU6A 3X2FA 1ZK2A 2PV7A 3OSUA 4PZDA 1XLTA 4D3FA 1NYTA 4ZGWA 3TFOA 1JWAB 1T2EA 4IQ0A 5JSFA 4U6SA 1GPJA 1E7SA 5THKA 1D7OA 5B37A 4MVJP 2VCYA 2HJRA 3CH6A 3PK0A 1R0KA 5L3ZA 2IZ1A 1RKXA 4E6PA 4YTEA 1P1KA 2Z95A 4YRDA 2QIOA 3BIOA 3JD0A 3WBBA 1R15A 1ULSA 3B20A 1IL0A 3UF0A 2NTVA 1Y5MA 2P4QA 1PZFA 1EUZA 5C7IO 5T57A 1ISJA 1DSSG 4N54A 5COQA 3HG7A 1LLUA 3BAZA 3RJ5A 1BVRA 4R69A 1E7WA 1R0LA 2BH9A 5ES3A 3F6YA 3DAFA 3U4DA 1ZO8A 4RZIA 3DBHB 1TI7A 1PZHA 5IN5A 4EBFA 4XYLA 3OJOA 5JE8A 2OHXA 1GZ3A 4R3NA 3UUWA 5ER6A 1EZ4A 4G5HA 4B7UA 5JYDA 4K1LA 2DAPA 3DZIA 2W90A 2V6BA 3R6DA 4JBGA 2DPGA 4J9UE 4MVJH 3ZHBA 1I2ZA 2FR1A 1VL8A 5CPBA 5B4VA 4E5PA 1HXHA 3C85A 4FFNA 4CM7A 3FTPA 5HS4A 1Q7GA 2PTGA 4W9NC 4YB8A 3RC7A 3LLVA 4KWHA 1V0JA 2GZ2A 3PPIA 4ALMA 3ZNPA 4CR7A 1LC3A 4IJUA 3PLRA 4JP3A 1C0PA 1NWHA 2A9FA 4BO3A 3DXFA 4OJNA 5FFFA 1NHWA 3ZNQA 1X13A 4NFSA 3FRJA 1PJSA 2EEZA 2J5QA 4EJ0A 2VN8A 3VH3A 2BKAA 4U0KA 4BHTA 4KUHA 1ISIA 1D1SA 1JKFA 4ILKA 4NBWA 4EW6A 4WLOA 1UAYA 5DP2A 5IG2A 4RF4A 3SC6A 1LA2A 2OXIA 1YJ8A 4CMGA 3ASUA 1BDMA 3GZ4A 1K6IA 3VH2A 1LUAA 2YV3A 3RC9A 3BTOA 3OFSA 3ZWWA 4DC0A 5C7LO 3JV7A 4OH1A 3KM0A 5AXBA 3SEFA 3VPSA 1KY5A 4GPD1 2UYYA 4WUVA 1U4SA 1DC6A 4WOJA 4UUOA 1NR1A 3GZNA 5IAAA 1U3VA 3IJRA 1HDOA 3VDQA 1QR6A 2HK9A 3UHAA 4WJZA 3MJTA 2WEKA 4CMEC 3T7CA 2EP5A 5JCXA 1WLYA 1MX3A 2AQHA 4ZQGA 1W4ZA 4IDFA 4IJVA 2AW5A 1CIVA 1ZCJA 3C7CB 1H9BA 2I3AA 3DDNA 3EMKA 3WX0A 1H6DA 1GYRA 5DZSA 1A72A 2EKPA 3PHIA 1ZSVA 4BNVA 2C5AA 4I5GA 3PJEA 4YT2A 4BKUA 2Q2QA 1WNTA 1RWBA 4LCEA 5CDGA 2O2YA 4YPOA 4UEKA 1Z6ZA 3CUKA 4HWKA 1KOLA 1U28A 4WCFB 4OMUA 2ZB7A 1AE1A 3FWNA 5A1TA 1QMGA 3OA2A 3ZCXA 4AJKA 4D0RA 1T2AA 4G81A 2PD4A 3GUYA 4BUCA 1ZKMA 4GMFA 1YKFA 2BMAA 3OEWA 2HK8A 4AJPA 5G0UA 1W0CA 2PLAA 1O8CA 5A9RA 1NQTA 3AI2A 3ST7A 2PZJA 1HE4A 2ZQYA 5JS6A 1BXKA 3VTZA 1HLDA 1IPFA 2C7VA 2CDCA 1SBYA 3E48A 4LGVA 1T25A 4OAQA 4Y6RA 1TLTA 5B12A 1LXCA 1QKIA 5DT9A 4BNZA 1VE9A 4DREA 1OC4A 1CQIA 2NQTA 4LVCA 5L7WA 1UZLA 1E3WB 3T4XA 2EW2A 4L0QA 2PY6A 3GPIA 4XRGA 4MPDA 4J1QA 5CPFA 5IJZA 1MXHA 5JW6A 1GCUA 1W6UA 3DB2A 3GDFA 3OJ0A 4JCOA 4PLHA 1CF2O 1HDRA 2VOEA 2XAAA 2J6IA 2X0JA 4K6CA 2IE0A 2Q3EA 4AG3A 2PZLA 2I3GA 1LLDA 3FNHA 2ILTA 2DT5A 3T4EA 4GLLA 4DQVA 4DMMA 1EUCA 2CVOA 3I9OA 1XR3A 1EE2A 2VOJA 4URFA 1JAXA 3JYLA 1NQ5A 5A02A 3F47A 3G49A 4YJHB 3VVBA 1UXJA 1ONNA 1Z7BA 1GZ6A 3PHGA 2IDZA 3ZWNA 1PJTA 5L4LA 2HMTA 3DL2A 2VRCA 3NDRA 3OICA 4YEDA 5TRTA 5JFOA 1K0UA 2JD2A 3V8BA 4BNYA 3V2GA 5BSFA 2EGGA 2Q1UA 3DQPA 4OXNA 2P91A 4BO8A 4CM5A 3S55A 1WP4A 5H82A 3C8MA 2NQ8A 1AGNA 4E5MA 1WXDA 3GNTA 1P33A 3TF5A 4RVDA 3AFNA 3DHNA 1R4NB 3H9JA 1GFSA 4D7AA 4CMKA 1P44A 4EJ6A 4BNHA 2X9VA 4F45A 1YDEA 3PLNA 4ZN6A 4U5QA 4CUJA 4FC6A 4PLFA 4RLSA 3RQSA 3W4KA 4B4WA 1N7GA 4CMIB 2FWMX 4BNKA 4CLDA 2X4GA 3GNSA 4CM6A 5ENVA 4PG7A 2ZB4A 4RPGA 4DBVO 1LU9A 3ZHXA 3KSZO 1BXGA 3JTMA 1BRMA 1U5AA 4J1NA 1VJ1A 4TSKA 3BMCA 3TFQA 1KEWA 3U9LA 3RFVA 2WYVA 2P4HX 4PZCA 2NACA 1T2CA 2FHSA 4K26A 1NFQA 5I9LA 3FPLA 1DEHA 1GV0A 2Q1SA 1E5QA 3G79A 1O0SA 1RM0A 4RDIA 4MP8A 1T4BA 1YO6A 3ANNA 4IS3A 3W1VA 1YOVA 1HF3A 4RGBA 3I3OA 3UXYA 4LSWA 3WJAA 1I3KA 4W6ZA 3PZRA 4DC1A 3H4VA 4ESOA 2ZTUA 3LT4A 5TT1A 1M67A 1PU2A 1B8VA 2VYVA 2P9CA 2D0IA 4CMEA 2Y67A 1B8UA 4KDFA 2BGLA 1BSVA 1HE3A 1YBVA 4XD2A 3P2OA 4DGSA 2NTJA 3IOYA 4HFRA 4XQCA 4UULA 2D1YA 3D0OA 3CINA 4IDDA 3QE3A 4JBIA 1N92A 5JDIA 1G0OA 4RORA 5A9SB 3PIIA 1DLJA 4HBGA 1HDYA 2AG5A 1TB4A 1I8TA 2IXAA 4XWYA 1PS8A 1YB1A 2CDAA 4HNHA 1Z45A 1LI4A 1PS9A 3UH1A 5CG1A 1P1JA 3ZI0A 4Q39A 4DRYA 3CEAA 1NTOA 3B70A 3GQVA 3BHMA 4NJMA 3AY7A 5FEUA 2DUUA 2IYOA 3FHLA 4L74A 5EPOA 1D3AA 2JAHA 3B6ZA 1GTMA 4Z3KA 5I9NA 4YT8A 8LDHA 1CWUA 1LEHA 1LRLA 2X0RA 4OOEA 1YVEI 1NXQA 3PRJA 4XJTA 4NR0A 4ZRNA 4D45A 3KOUA 3LT2A 1UXIA 4MJLA 4E5NA 1K6XA 3RIHA 1V6AA 3PYLA 3KRTA 1X7HA 4WK6A 1DPGA 5TLSA 3GVXA 2YV1A 1FMCA 1LSSA 3NKLA 1NWCA
chains in the Genus database with same CATH superfamily
1FA9A 1HG1A 3SQXA 3UMCA 2D62A 2Q3MA 3AF4A 1TUBB 4IEIA 3U7EB 2ZQ5A 5EZQA 3WL3A 4EARA 1KO4A 2AN5A 3OETA 1YS4A 3X43A 6GPBA 2QXYA 4FE3A 3IQXA 3LVRE 4FWBA 4LVUA 1G2QA 3CRVA 4XLLA 4LIPD 4IZ6A 3PRYA 1M2WA 4RXTA 3W04A 2VJDA 3PFGA 1W6RA 3DEIA 4CRWB 1VFPA 2N1MA 3REGA 4AF6A 1MO5A 1UODA 1WDLA 1ESDA 1Q2UA 1VOTA 2B2CA 4HDCA 4MZDA 3F49S 1DV1A 1KE1A 3NV7A 5FA6A 4HH1A 5FDFA 2RGRA 3AW9A 3DB1A 1RWOA 1FJGB 1BW9A 4TMXA 1X7WB 1PIWA 1F8UA 3V4FA 1J6UA 2II6A 4G0WA 5B1DA 4MCAA 1SU8A 3BT7A 3MMPA 1RZVA 1JFFA 2ZJBA 3H3XA 4DPLA 3W3AA 1DC5A 1Z08A 3U7HB 4TV9A 1IOZA 1T4CB 2WYOA 4L8LA 3D4NA 3F8SA 5KYTA 4HQ0A 4LECA 3O8BA 4XUDA 4US1R 1GCIA 5KTRA 4RDXA 3NHMA 1DC4A 1H6AA 3G82C 4KLZA 5DNUA 1SVWA 3JVDA 4N49A 6YASA 4GOLD 1QIFA 4J49A 5FPHA 3NM5A 3GJTA 2EDAA 4KJXA 4HWGA 3Q3JB 1G4UR 2AFHA 3H4IA 3USZA 2BJVA 1SOMA 3E03A 1KPHA 1L8QA 3JS5A 5FOTA 3KJZA 1N9GA 3ZDYB 2ZSBA 3AF5A 4G5YA 4KOEC 1N9GB 1T3HA 4D3DA 4URHA 3JQAA 1M9NA 1N2XA 2P75A 1CFJA 1EFVB 3BK1A 3H87A 3AJDA 1D09A 3HSYA 4BLSA 2JLXA 3A0RB 1V16B 3U9SA 2DVMA 4F5WA 2PR7A 4IXMA 4C0QC 3TFWA 2GETA 1WHSA 1C30B 2JFPA 1JHZA 3KALA 1CR4A 1WCWA 4H7KA 4YYEA 1K7SN 3A1FA 3HSSA 4NEQA 3EJWA 3NVKI 5BR4A 5K0ZA 1BE0A 4OEHA 2E1PA 4L4SA 1NBAA 1V41E 2RGYA 1K3TA 3BWVA 5G4KA 4GPZA 1IY8A 3V97A 1C29B 4ABTA 2R9VA 1PSDA 3LIIA 4R9RA 3PRKE 5BSEA 5I7EA 1WBBA 5F21A 3HKEB 2W42A 1NBIA 2D0DA 3WGKA 3KKMA 3WIUA 1A69A 2VEDA 5BSUA 3C14C 1A77A 2EG9A 3EQ9A 3CBQA 4RQTA 4RZUA 4UMVA 4MEAA 2QZZA 3ENKA 1GTG1 3DTNA 3FMGA 3HNRA 4RK5A 3MJHA 2PGAA 2PT5A 5CAEB 3EVZA 1TZBA 4U3JA 3SDSA 3WL5A 1JAZA 3DAOA 5L4NA 3PU6A 3BDIA 1N1DA 4OHCA 2MWMA 5K3OA 4G4JA 3UW3A 3VR0A 4D46A 2H92A 3FE2A 4GKKB 2Z8ZA 3CN7A 1H6CA 3Q0EA 1BD4A 1DXQA 2VP3A 4KN8A 2GQ0A 3E7PA 3HN7A 4MAFA 3ABOB 1L5FA 2XODA 1GYPA 5FPTA 3E18A 4CU5A 2PX4A 1JECA 1ZK0A 1Y5RA 2G0TA 2WB4A 4M55A 2OBLA 3KZOA 2V7EA 2WG0A 1C1DB 5DK6A 3CM0A 3WGNA 1U80A 3WWOA 3NIFB 5JCJD 1IYZA 1DIGA 1OZGA 1DMSA 1SURA 1X80A 2H9AA 2IXFA 3IMEA 4MW9A 5ALQA 5AOVA 2UZ4A 3A7EA 1YZKA 1XDDA 4ZJUA 4J2OA 3PHLA 4XTCS 3O4JA 1QK4A 2J08A 4R9SA 1STOA 2MINB 4HZIA 3X1KA 4F5ZA 2D7DA 4A0FA 1Y6RA 4Q4JB 1EXDA 1VTKA 2D1QA 2QMQA 1BRTA 1G9TA 3JQFA 4F8EA 5E4FA 2OB2A 3FW1A 2HTEA 1OYYA 5BVHA 2X40A 3IEIA 4G85A 1WVMA 1Z4PX 4J4BA 4WXRA 3UJAA 4L76A 2IBTA 2ONJA 1EX1A 2AQIA 1GGEA 1QCCA 4UM7A 2NV0A 3R7AA 1QTNA 5CNJA 1SUAA 4YUXA 5BWMA 1AZTA 1EX7A 3PWKA 4KACA 5AW3A 4PPNA 5TF0A 4REQB 2F8MA 2X15A 5CFQA 3P2JA 2OG1A 2VYFA 1KVQA 1XDGA 5H83A 3S6JA 4P3PA 3ICPA 1FSFA 3I9V1 1IJBA 5KNDH 4MO2A 1KU0A 1YJQA 4IV8A 1RHJA 2EW1A 1Q0UA 2WTNA 1DINA 4EHBA 4P22A 3FLMA 5F7ZA 3PJFA 4KE6A 4R40A 1DG1G 2BELA 2VUIB 3QVWA 1HDZA 4FJ1A 5DTMA 5CA0B 4DA4A 1UJMA 3CF4A 3HJRA 4O4JB 1TK9A 4WBNA 1QZZA 4G0QA 2JZCA 3G9QA 1ADYA 2W4QA 3BWMA 4CHGA 4QGSA 2BGTA 2CFCA 2HA0A 3IHTA 3KNZA 5LZ7A 3JQQA 4JUDX 5ERYA 3RJMA 2H16A 5DCWA 2TMDA 5JQGA 1IU9A 1AS3A 1U0FA 2XUKA 3DDOA 3GEMA 4R51A 3WGJA 1SXIA 2EAUA 3N8DA 5J4YA 1BX3A 2HTFA 1TA9A 1CUGA 4MCHA 1HETA 3FWPA 3L7NA 3NEYA 4XGIA 4ZI7F 2HCRA 1AKEA 1L5HB 4HP8A 4OP3A 4Z0NA 2ZUBA 3S27A 4KH0A 3DZDA 1KI1A 3QNWA 5A5GA 4W1PA 1W7AA 1R4NA 5K0GA 4GI1A 3M1AA 3AHDA 3OKAA 1CJSA 3P2YA 3EZLA 2VDWB 2AYZA 2NAPA 3OPVA 4Q9IA 1UC9A 3RLFA 3EC7A 3M3DA 3LYLA 3W1WA 3IKJA 1USGA 4Z4CA 1KR5A 2DLNA 1JEYA 2ZI4A 2QDXA 4NDNE 4WFJA 4HQLA 5P8WA 3Q7IA 5FTLA 1JFSA 1K5GA 1I9GA 1S1CA 1SCKA 3L1IA 3U37A 5BVHB 3GLFA 1E9EA 2N47A 2HZBA 2CLMB 2WSIA 2YJ6A 3GPCA 2HIAA 3M70A 3NRBA 4AO7A 4R0MA 1NVKA 1Z5NA 2OP1A 3EIQA 5DVZA 4RJTA 1W36C 1ZM7A 1QYVA 1XLTC 2N46A 4DXDA 3ZJUA 1M2GA 3D5QA 4I6EA 2ZRLA 3RJZA 4QLAA 1GNLA 4QDJA 3IP7A 4RK0A 5DGHA 1OKKD 1EX6A 3ESXA 3GFPA 3LXXA 4UFPA 3EIEA 1Y98A 3C3KA 3P8ZA 5DHTA 1OLUB 2GPWA 5B2ZA 3A32A 1ZINA 1BWSA 1YR2A 3K5WA 3WDMA 5JNRA 1L7OA 1ZJYA 1M75A 4G65A 2JFQA 5EVJA 1NHGA 4XOIA 1B6RA 2W2MA 3ND5A 2I6QA 4DHEA 5HHTA 3ANSA 3GFGA 3GROA 3A9UA 1CNFA 1JMVA 1L7EA 1LJLA 3ZTWA 1P7CA 3ASZA 4EEKA 4ZK6A 3I2IA 4NX2A 3V4OA 1G17A 1SC1A 4XGKA 2UAGA 3VKGA 2BGUA 3ZK8A 1JHOA 3TZHA 4DV3B 4LTNA 2ZPAA 2GZAA 4RLHA 3VOAA 4ZVSA 3ZHUA 1V4BA 2WU8A 4QUJA 3Q10A 1CR1A 3W5SA 4H16A 4INAA 2OK7A 3V4ZA 4B48A 1KC1A 3FNEA 3G7NA 5DISB 1MXFA 1H1LA 1K5HA 6REQA 5JZ9A 3M3PA 1Y3DE 5CVJA 3DNFA 4ZCIA 1MABB 1NLFA 1CW2B 3PE3A 1Q1GA 4XZ3A 5EKTA 1SC4A 3FRHA 3X1XA 4PZYA 3TMKA 3M4NA 4L2IB 4HAYA 4QVIA 1Q1QA 2XE7A 1FMTA 3DPUA 2RH4A 3PCXA 1IUPA 2RI6A 2X41A 3HKBB 5ILGA 1LLQA 4DRXA 3S8YA 3L6RA 3NR2A 2ZGVA 3K1ZA 1YL7A 1GUBA 4RMIA 1OWLA 3DTTA 5CXSA 4UFOA 4CG3A 2Q5QA 3R0IA 3DF7A 3IKMB 3AZOA 1JTVA 4OFBA 1DKNA 3TIVA 5EJEA 1B73A 1QRRA 1J1IA 3GLUA 4GT1A 2AHOA 1BYIA 5FBZA 1AHPA 1YCDA 4WTOA 1N2CB 3X0DA 1P18A 2QNIA 5C1PA 4R0VA 4XIYA 1RC1A 3PKJA 1G6Q1 2WA1A 1H94A 2PZMA 3AU8A 2AW3A 3R7DA 3U62A 1BMFA 2PJDA 1SZPA 4A8TA 4CL0A 4I50A 5KYVA 4YUZA 3KYIB 2CD7A 4NNOA 1V8DA 5EUBA 4RTNA 5JC1A 4G5SA 1L7PA 2FEPA 2J5KA 2LW7A 5DLQC 5F51A 3OTQA 1EVYA 1G4HA 1MQAA 4KZPA 4RENA 1AURA 2C7BA 4TT3D 1ZM3A 5LDDC 2JK1A 2QTLA 1GSHA 4L9RA 5TVKA 3ULKA 5TDHA 3UOAB 3WHIA 1P61B 1ACJA 1JBQA 3QHPA 1P9LA 3HB4X 2IJGX 1M2NA 4O6VA 1XMJA 1Y89A 4DLUA 4IIJA 5AW7A 4YP1A 3NNDA 1GAXA 1W8DA 2J0UB 2WW8A 2H7YA 1PEKE 3M1YA 4FE7A 4YN3A 1BKYA 4CEHA 3QLJA 3IP6A 3Q98A 3A3NA 4ZT3A 2OQIA 4D9FA 3MHPA 2FCAA 3RSZA 4XQEA 4F9FA 3ZXUB 2OK8A 4LAFA 8GPBA 3K72B 1NVVR 3PPYA 3LHFA 5DTJA 3T9AA 4NMLA 2IQ5A 4YRSA 4RMJA 2H4HA 4KL8S 5JDCA 5JNVA 1CR6A 2WSLA 2I3BA 1IVNA 2ZRGA 3C6KA 4E6EA 3CUVA 5LQAA 1W5EA 4IZOA 4PNHA 1P6QA 1BYUA 1P7VA 2BF7A 2CUTA 3QIAA 4FOLA 1Y9JA 5FHQA 2W8BB 4HWPA 1UADA 3TR0A 4DEYA 3B36A 5FBQB 3DHYA 1T13A 1OLSB 3IMKA 3PPXA 4UCXA 3W5CA 1EZ1A 1XJ5A 5KSZA 5HF8A 4PXAA 1KOFA 3HXKA 4RUKA 4W5NA 3PD0A 2OTCA 5KTYA 4LC1A 3EX7C 4YJHA 1W9MA 3JQ8B 3TRJA 1LBHA 3RKSA 3U39A 5BNZA 3LF2A 2YJ3A 4HATA 1QIMA 1O95A 3G5LA 3ZJ4A 3GDGA 1DE0A 3BXGA 3QPUA 1CLUA 1FS6A 4K9NA 4UHJA 3LWDA 1IRIA 1CZHA 3KV3O 4RNCA 1O97D 4EHFA 4XR9A 1IVSA 3E5NA 2RJNA 2IIQA 2VBFA 3FOEC 1LVHA 5B7GA 4HC4A 3P19A 3DH0A 1Q6ZA 4UE3S 4MRRA 1GV1A 1B1CA 9LDTA 3ROZA 1KKMA 3A6ZA 1D5CA 3IULA 4I4CA 2O9JA 2H29A 3O0TA 4I8DA 4JT8A 4NDZA 3SHOA 4D82A 2QRHA 4JXZA 3BFVA 3DTVA 2WHYA 4FI3F 3QV2A 2O1WA 3U4MA 1DAEA 3VC2A 1YQDA 3ECCA 4BIMA 1E1CB 2G5TA 3O2JA 1AMOA 3E0QA 1YJ5A 2P4UA 3AUJB 3VX4A 5A7HA 1ENZA 1U1GA 5LZ8A 2AC4A 4LOLA 1H3NA 3RT1A 3FWYA 4HYEA 4F84A 1NBOA 3CUYA 1MTOA 4FT4A 5A71A 4ER5A 4W5TA 2XTAA 1MT0A 1FXWA 1B6SA 3S99A 4OH7A 3P52A 4BMNA 4C43A 1FX0A 2D5LA 1HLFA 1E1DA 1M1YE 3H9QA 1X14A 1XXHB 1OX5A 1PAUA 1ESZA 1Z68A 2H4YA 2KBEA 2XUQA 3OQ1A 4CLRA 4JJ7A 1B43A 4KUEA 4RU1A 1G59A 2B30A 1JQ5A 5JJCA 4LNUA 2WUEA 3DYBA 1DHRA 2CNKA 4ZOLF 1NOJA 1Q0PA 2DBRA 1AJEA 3K1AB 4TWBA 1UKZA 2WUDA 4IUYA 1KZ1A 3ZZ0A 3STYA 1KC3A 5FAKA 2BMDA 4E14A 3AVUA 1OI2A 2M9MA 2QM0A 1SEPA 4Y67A 2IHUA 2IXTA 3GEHA 2Z3WA 1NW9B 3EUAA 4G8BA 4IIJF 4ZI7B 3DULA 1E8NA 3ERCA 4G0NA 1Z5ZA 1N5LA 2LUOA 4DR4B 5H1YA 4N82A 1XPUA 1AVTA 1W2WB 3A1CA 3NGXA 3DBRB 1VLLA 4NYIQ 1L7VC 1PGQA 1WZ2A 4IINA 3RSSA 1NVBA 3WMRA 1HFKA 2XOXA 4D41A 3EDMA 4Z99A 4ZI7A 1O89A 4CT4B 2QD5A 1L6IA 3B2QA 2FUKA 2OO3A 3GCDA 4HDNB 1H5QA 1FB5A 1VMEA 4HNTA 4NPCA 4I55F 1V4NA 4HSEA 3UATA 5IDVA 5F1YA 3VYVA 4MVJD 1F60A 2WIFA 3KO8A 1LQ2A 1PG0A 2O5VA 3AEKB 4HEA6 5LLTA 3A36A 1IY2A 4AN0A 4QUBA 4TMTA 1GKLA 2J3IA 3VU3A 3PDCA 1RHKA 2C9MA 3DBLA 4OHWA 4EGFA 4AMGA 2R3SA 2YINC 1EPUA 3QWBA 4TKUB 4HJXA 4UNNA 3NWOA 3EXIB 3DMHA 4EO9A 1QS0A 2ZPTX 3M83A 3DDUA 5J4KA 4M38A 4NG5A 1OQAA 5FNVF 3GT3A 2XNHA 2B1JA 3A4MA 2GZ3A 4FHDA 1GG5A 3F1KA 1M7BA 2GWRA 1KDOA 3FNBA 2CMKA 3PSHA 4MV4A 3WZ2A 1DRUA 2CDBA 2IXGA 2OV8A 2P3QA 2ZAOA 4IFEA 4CN8A 3PP8A 1IXKA 2H0QA 5CFLA 2DHDA 3CW2A 1W9HA 3D6UA 3DOJA 1KIMA 3ZJTA 1SIWA 4JI0B 1M1NA 3DO5A 4J2HA 2R00C 3H3JA 3T15A 1SB9A 2WQ6A 1JPVA 2YVQA 1YRYE 3IEMA 4YMTA 2R8PA 3DEJA 4RH0A 5JJLA 3DXZA 5B1YA 2YFYA 4MUEA 3IUMA 2EU8A 4Z0TA 2GYYA 2J3DA 1QP7A 3JD1A 5DTEA 3RARA 2FSVC 3SIXA 4J9VA 5A3VA 5KNDD 3EASA 3D2CA 3PNLA 4LF7B 3RGWS 1R12A 3N7UA 5L3QB 1V1RB 2HXYA 2ZTHA 4N47A 5HPYB 2GN9A 1Z4KA 1CP2A 2OV4A 5EXSA 4W5JA 5IDYA 3ZU6A 1KEPA 5JTUA 4GICA 3KEGA 3AR3A 1BX0A 5FTWA 2QQGA 2I4NA 2X6QA 3KR9A 2E5WA 1ZUNA 1JKJA 1T1SA 1UL1X 2XB4A 5KOIA 1WOMA 5JQGF 1J97A 4Z3DA 1GG8A 1AG9A 1US8B 4E07A 2EWMA 1NJ2A 2BGJA 1I4EB 4DABA 1U3CA 1RLTA 1ZD1A 3WZLA 2W8BA 2JK0A 2UUPA 3N1UA 4XEUA 1G7CA 1SWWA 4BMOB 1P1IA 3WTCA 4B2LA 3AY3A 2FEXA 2OORA 4Z4EA 3LO5A 3ROKA 4R1UA 4E4YA 1T2DA 2ABWA 3DKPA 3FROA 1E1CA 4RLFA 1SNYA 5DHAA 3TNDA 4C0XA 1TXGA 5C8YB 3M9LA 1DJMA 1XJCA 3T12A 4LY0A 3WWZA 2RHLA 2I6XA 1I24A 4G97A 1ZZEA 3TPZA 4WQMA 1VLHA 1RQPA 4CTJA 2GMWA 4GX5A 4B45A 5HKBA 4LBVA 3U80A 2H2FA 4ZVOA 4P53A 3LUPA 2OFXA 4EOGA 1SHJA 4YGYA 2JI4A 1PHRA 1MX5A 3IQGX 4OU5A 4EWLA 4MCIA 4Y0VA 4LDAA 4IG4A 1G1MA 1Z2OX 1NLUA 3L43A 3O1JC 3S3TA 4X7MA 1H42A 1QSGA 1BN6A 1DCMA 4RGQA 3RB8A 4G1BA 4EMSA 4EPVA 1T9KA 4AJ2A 5CTAA 5BUQA 2NSHA 4I1IA 3LY5A 3CXUA 3NNSA 5ENZA 3DAGA 4LSMA 1QDLB 2ZRCA 2YWBA 2DH5A 5I8WA 1RLMA 2NP6A 4MVWA 4LXQA 3A2LA 2AUTA 1SVUA 3HRIA 1DZIA 3AESB 3SOZA 3SR3A 4YS6A 4A27A 4ZGGA 2JJQA 4Q66C 3MUNA 3NIBA 3RREA 1QVWA 1W1WA 2Q9UA 3SDBA 3WGGA 1KEZA 1G5PA 4U3JB 3ZWQA 2PEZA 1C4WA 2ZIXA 4QELA 3WY9A 3B1WA 3TTSA 3DBRA 3WDLA 1QYCA 3HI4A 1H2EA 2LWIA 5AUOB 5E8RA 3ZWDA 5E38A 1T9CA 5FF9A 4AJOA 2IHNA 1ZESA 4FNOA 4MUFA 1Q7TA 4M46A 1ZRSA 3E9RA 1NNSA 4JVOA 4C4PA 3WNZA 4UVIA 2FYTA 1H2YA 3H42B 1E3JA 3O26A 5COBA 1O95C 1WU8A 5DI3B 4AF7A 2X19A 4D43A 2BHLA 4LNUB 1XZKA 2YS6A 1EVZA 3QMVA 2UKDA 2UZ1B 4IEEA 4NECA 3R77A 3W2FA 4ARAA 5A2GA 1W5AA 3BFJA 4U5XA 1XPOA 1T4DA 4P6VF 3MJRA 5LBUA 3AFHA 4H31A 2PUAA 1CYEA 1PEAA 2VDQB 1RRPA 4QOHA 3VSDA 1VA5A 4II7A 3D8TA 4AY5A 1RYHA 4E5SA 3Q8LA 1IK6A 2D74A 1XX6A 2XRYA 4Q3AA 3F5SA 2ID4A 1YRBA 3Q3HA 4URVR 1VC2A 3B13B 2ES4A 2QP3A 2XD9A 3OJFA 3WYGA 1AKMA 1XEXA 4FFDA 1COWA 2AQ8A 5A5DA 1PG5A 2RGNC 5ALXA 2A4KA 2CHFA 2AFHE 3G8DA 4ZTUB 3R5KA 1HNZB 4YH1A 1VCIA 5JS1A 1MOQA 1U7OA 3B1XA 1P3Y1 3PFIA 1FTWA 4ALNA 2VZEA 5AVVA 1H1LB 2BZ1A 1W5FA 3RYTC 1EX9A 1YQEA 4H7HA 4K9PA 4MUBA 2VUUA 2OPHA 2BI7A 3TB6A 4B7AA 4DWVA 1NR5A 1U9CA 4WT7A 4EK9A 4CKWA 1HL3A 5AI0A 1N7JA 3DM9B 3G2IA 4Q3DA 1DKMA 1P9WA 1X0XA 2C82A 1P62B 2VPQA 3CIOA 1VIVA 1NN1A 4G8CA 5M3BA 1E1RD 1MLDA 1SR8A 4DQXA 1N1MA 4M0MA 2OD7A 4DCMA 2Y05A 4RBNA 2IYEA 1KJZA 1ZQ1A 2HQRA 1R8JA 3RBZA 1H0SA 2BW0A 5G0WA 5JUWA 5CRIA 4Q4JA 2VP2A 2IDMA 2DKNA 1RLUA 2W0SA 2H9YA 1E2MA 4PQGA 3AR9A 5JAOA 4H0FA 4EPRA 2PPVA 1ZUD1 1V45E 4YROA 5E95A 3KIPA 4S1PA 3ZQJA 4Z54A 5M5BA 1JILA 1UBGA 2BFOA 5BY2A 3FLBA 5HXAA 4NJOA 1QOQB 1XHFA 2NZYA 2WWHA 4ZMSA 1ZD2P 2UV8A 2AX4A 3L1VA 1KVSA 4ND3A 3TIXB 5IT5A 2R96A 1F7VA 4HEJA 4TTQA 1JAIA 5EIEA 3SJUA 2QVCA 1F3OA 1GQ2A 2ODPA 1U2DC 3ODGA 4KO1S 3GJQA 2P9FA 3OIUA 5BUCA 3LBYA 4Y2JA 1GTL1 1TFRA 4RPJA 5K0JA 4BCDA 3HO1A 5J5CA 3G9ZA 4FDMA 1HEYA 3BMQB 3GYGA 3ND7A 4GVXA 2OGWA 3G59A 3T3EA 2NN3C 1ID1A 3AF3A 3B6IA 3HU2A 3H86A 3TKLA 1M6NA 4PC1A 3JU3A 2J9GA 4PLGA 4KGVA 4GMKA 2CY0A 2OO7A 3DMYA 3KE8A 2B82A 3KFVA 4CV2A 2RD2A 4J0DA 1EHIA 5CG2A 4ZZ2A 1MDBA 3QJGA 4ZDIA 5ICSA 2H1WA 4ZO4A 4MR7A 3U3KA 5B4TA 3R74A 1YR6A 2OO5C 1DWUA 4FE4A 3CS3A 2B4RO 3THYA 1SEVA 2YUTA 2IZ0A 3ZG6A 2BMJA 4Y98A 4MW6A 4YUVA 1YAHA 3L7DA 4OK5A 2C58A 3PC8C 5FFMA 5AMXA 4TL9A 4TUYB 3BS4A 2HRBA 1RWKA 4M9RA 5K3FB 1UZUA 2XZPA 2QR3A 3EA0A 3OE7D 4LTDA 4REOA 5D00A 2QWXA 1KF0A 5JPIA 1IBCA 1E9VA 1PZXA 1L5OA 2GGSA 1F0PA 3BXFA 4FONA 5TEWA 2VK4A 2ZRKA 5ADHA 3IP5A 3ILSA 1ABBA 4JFRA 4MUGA 5ISMA 2P5UA 2YWCA 1R0ZA 3HBLA 4NCHA 2L18A 1ULZA 3LW8A 1D8TA 3K0HA 4KN5A 4RAQA 3T7DA 3WO1A 5EMMA 3IMCA 2HT1A 3OH8A 5BQOA 3NC1C 3DEZA 4JL8A 1H8ED 2PWZA 3DWGA 2PX2A 4L08A 4PLCA 1WV1A 1H4QA 1C3JA 1PLLA 5G1PA 5KQSA 4EI2A 3EDYA 2PBZA 2AE1A 3C3PA 3K09C 4F1WA 5FULA 2ZI3A 4E30A 3ESBA 3JQ6A 3SQDA 1E9RA 1W30A 1R6XA 1PF7E 2O57A 4XDZA 1DTWA 2VDPB 1XMPA 2WIDA 5AVKA 4X64B 4PSUA 3AR4A 4HAUA 4L5BA 4TUYA 3H0KA 3O91A 3E4DA 1Z3CA 3TSAA 1V5GA 2AEMA 2HJ9A 3Q2OA 1GPNA 4JZYA 3EXEA 3T1OA 1MFPA 4MWEA 4UXIA 3EUWA 1DX9A 3A1WA 1F2TB 2ZIVB 3KZVA 4Z1MA 5IAEA 3UWSA 4BMCA 2B8JA 2C7PA 3D4PA 3PEYA 1QKJA 4QICA 3I9JA 3D6HA 3RT9A 3L40A 2QP4A 2GCOB 2JIRA 4FFVA 3WLLA 2A14A 3RQIA 1H8EA 4M1QA 4F04A 1A9PA 3LQRA 4BJHB 4F2WA 5LYJB 1IPEA 3VAYA 1AGXA 3EDOA 4GFDA 1WWKA 1XSEA 5DSTA 1U63A 1NDQA 3AO0B 3VMFA 1WXEA 2BEVB 2EJCA 5BW6B 3CLKA 4B73A 4CHTA 3IC5A 3THYB 2QT9A 4AB1A 4EA9A 4JBYA 3WXBA 3KR2A 4GOMD 3ZWPA 3IBGA 2HSGA 4CIVA 4O33A 1L5GB 4TPKA 3U7GA 3P97A 5KJ6A 2G6TA 4JGBA 1ULBA 4DR1B 5HIIA 5HRCA 4GEKA 1ZI8A 2Z2YA 4QU9A 3H0CA 3ZNOA 4EMBA 1INLA 5TPZD 4BECA 1I1HA 1QHHB 1R6AA 2GT1A 3IAHA 5TGZA 5BN5A 1B0AA 2HHCA 2V6FA 1USKA 2I99A 2NADA 2X8WA 2XB6A 5JZBA 2Y99A 3S2IA 4WZAA 2LIPA 3CNHA 1SULA 4Y6PA 4BCCA 4O25A 4PO9A 4EH1A 3QMPA 1QZUA 2OESA 3WS7A 1MO6A 4WXEA 1NAIA 4Z9BA 1U9JA 2GPAA 3CVYA 2QGNA 1RCFA 2QRVB 3PD7A 4HF7A 4K9QA 4XB1A 5HE8A 4AYWA 5B4UA 3O8LA 4DSZA 4KITB 1JH9A 3KB2A 5IF3A 3OZWA 1WPQA 2C9BA 3DE2X 4JEUA 2YWJA 4DA6A 2C5FA 3H2IA 3L6UA 4KFCA 3U4CA 3UHJA 1MO2A 2CYCA 2D3WA 4EHKA 3T95A 2H1HA 5C8ZA 1NURA 4YMHA 3N07A 5JFTA 2OL4A 4YCAA 3F6PA 4LYAA 1Y9ZA 4NMMA 1A4UA 3LZDA 2IZ7A 3GOHA 4H6XA 4INZA 2QMUA 4MJ7A 4C29A 2WNIA 4GP6A 4WVFA 3EXIA 3IUBA 3LDHA 1HMPA 4JLPA 4PHFA 3DWIA 7GPBA 1OV4A 2WLSA 1K4KA 1F0NA 1S96A 3FDIA 3QELB 5JXJA 1BN7A 2AJLI 4QXAA 5C5DA 2GDJA 1RPTA 5DIFA 3T94A 4H1TA 1PX2A 3EOZA 5KWVA 1Z17A 3F97A 3GFSA 4E31A 5IN4A 3T7KA 4AY6A 2DX7A 2FG5A 2W2LD 3OBIA 3FOCA 2XQIA 1Y80A 2E4YA 1ZLXA 4DCCA 5D3ZA 3K9HA 2JKZA 1VJGA 4UAJA 3Q7PA 4ZVPA 5TJHA 5REQB 3VNUA 1Q95A 4PC6A 3ZDEA 3GYBA 3KEMA 1PP4A 2O7SA 2PS9A 3R3VA 4OYYA 5EXXA 4D2IA 1M76A 4BKRA 1OB5A 2H1OA 2OCPA 2C84A 3AHGA 4E46A 3NWBA 1S1MA 1E3IA 3AIIA 4R9VA 5BSWA 2OENG 2V3WA 4ALKA 4C4SA 2B1RA 3OPNA 3AKYA 3HCOA 4WESB 4G86A 3ADDA 3NUZA 2OV1A 2VH1A 4P5PA 3STXA 1HKUA 3EGOA 1W48A 2BWJA 2HDHA 3GJRA 3I04A 3N2GB 4RXMA 1OX4B 2Q4DA 2X58A 2JFUA 1Z2AA 2QD3A 2QZ9A 2WIJA 2V98A 5F77A 4KLCA 721PA 3SCZA 2WWIA 3HCCA 4ZJYA 1CSEE 3G1TA 2P8JA 1XEWY 2B5VA 4JROA 4M54A 5FEMA 3WNQA 1KFBB 1S8AA 1WE2A 2XDQB 2ZSKA 3EAFA 3QUSA 4O1HA 2Q21A 4UTZA 1C3OA 5F2OA 4A3SA 5AESA 2NO6A 4DILA 5CXUA 4OFXA 4XKJA 4FD2A 4X3CA 4AZ0B 4KXVA 3CSDA 3HBJA 4AURA 2SKEA 4DQ0A 5BR8B 1OT3A 1NW3A 2NGRA 1E98A 2WIAA 2ZE8A 1LGYA 4FX2A 4O2AF 3TSWA 2IW3A 4Z0PA 2FMFA 1IIBA 2WJ4A 2A35A 3M89A 4AYXA 5EHIA 2DQZA 2DTXA 1UZMA 1P7YA 1YOVB 1U0OC 5JZSA 1TD9A 1EUYA 1BHJA 4JI6B 2EX1A 2WG1A 1UXKA 4LV5B 3RUFA 1Q83A 2ZT8A 3NHWA 4KXNA 3WMXA 4DUZB 3ZVKA 2PJRA 2LE0A 5HNKA 1BFUA 2F1OA 3BK2A 4BTEA 5KNCA 2K7FA 4WLVA 1YVRA 5H5JA 3RYCB 3TZLA 3H3FA 2ECFA 1R18A 1VPDA 2V0CA 2O6HA 1M5RA 3M5WA 1V26A 1G291 2FFAA 3MMZA 2OCYC 3EIWA 1UPCA 2PZKA 4C89A 5I7VA 2XNCA 2COKA 3HDQA 1QTRA 2QVYX 2VYQA 3CG4A 2VQ3A 3KQQA 5L3RA 4EI8A 1C0IA 1YNSA 4JJFA 2R8ZA 5E4TA 4C3VA 3T9BA 1SA0A 1AIPA 2C2KA 2DUNA 2IIVA 3RUIA 5T7BA 4NCBA 3UWDA 1R0CA 3D6TB 4RCVA 2RGEA 3C0KA 2FEKA 1BCSB 2GRJA 3B3JA 1T10A 3IP9A 1KERA 3VHQA 4W1SA 1BIFA 5HMLA 5HRAA 2OO5A 4V0ME 2CV0A 2Q3JA 4RO0A 2W2KA 2ZWAA 4Z9XA 1SN7A 2NUPB 4YHBA 4GI3A 1VLZA 1T43A 3R0VA 4U7FA 1O4WA 4WECA 4YQFA 5B58C 2X8LA 3TN7A 5B55A 4FTWA 1UEIA 4L75A 4Q3CA 2JVKA 5AW8A 2O8DA 2PYIA 2AOVA 2DWPA 2OOSA 3KHKA 4GZ6A 1V7ZA 1Y3FE 1WZUA 1IN8A 2PRIA 2AZDA 3DEAA 3MS4A 1H05A 1JEDA 3Q3VA 5EMJA 5FA5A 3V46A 5JH7A 3GCWA 3PC3A 5HOEA 1SC6A 4O4HA 1OJ7A 4ZO9A 2PRJA 1YFKA 4MWOA 1IULA 2DKFA 1NF2A 2YH2A 1PQUA 3IR7A 4OBWA 2C42A 4N12A 4U2KA 2NQ2C 3VI3B 5AIAA 4YMUA 1CB7A 1ENOA 4O59O 4KYTA 2O4UX 3O5AA 4NPHA 4UMDA 2Y92A 3QG1A 5CDFA 5THQA 4WDRA 1D9XA 1J23A 1NM5C 3HFSA 5K0LA 2P2LA 5AM5A 3RROA 1E77A 3RKRA 5F2NA 2FF5A 4GG1A 1N9ZA 1Q7RA 5CUQA 4Y2YA 1U3TA 2P7IA 4IL5A 1NUSA 3KXIA 4R84A 4OLAA 4PRYA 3BERA 2C9DA 4FIZA 4RD0A 1IOVA 4QXOA 1Q0ZA 4NC9A 3A1EA 3CKYA 4GUDA 2YY7A 4B6OA 1RJFA 1WO8A 2WC1A 4IS2A 3WGLA 4FU0A 4LCBA 1E2BA 2AXQA 2BF4A 2JFZA 2BFWA 4X62B 3BWBA 1T5TA 4CEJA 1Z28A 3EULA 1FFDA 2ZB8A 3K4PA 4Q00A 2XKBA 4FNGA 4N3AA 3NFRA 4Y30A 3FCEA 4UUMA 2Y1WA 1NW7A 2J3JA 4OHXA 3OD5A 1KP2A 5KYYA 5AK3A 3V4SA 4BBAA 5MGBA 4I08A 1TO2E 1YZFA 2W6QA 3R0XA 4XWAA 3Q9SA 1QQ5A 1K4MA 3UC9A 3AVXA 4RF2A 3Q6IA 1WA5A 4MEBA 5CDUA 4G36A 3HDVA 5ALFA 5MHTA 4V3BA 2XCSB 1CVIA 2NSDA 1JDJA 1XLUA 4HMQA 4U9HS 4Y9UA 5AVUA 5HGXA 3V6LA 1MD9A 2SHKA 4FMBB 2ZUDA 3JWIA 4XIIA 1K5PA 1ZN2A 1FP7A 1HNNA 3F73A 1X8XA 2CWWA 4R5HA 4RZ3A 3DDCA 4CKEA 1O3YA 2C2BA 4D6YA 1T9GR 4J75A 5JNWA 1VJDA 4LHVA 4RKEA 5JCJA 3OZEA 4ZKEA 3EY4A 1TQ2A 4E88A 2O3SA 3C4QA 1WUKS 1H22A 1PJLA 2FEAA 2XTMA 3CWQA 2R97A 3COYA 3OLYA 4LEIA 4N3NA 3ZY3A 1WHTB 2YJGA 3HTXA 2C59A 4B75A 5A06A 1NT2A 5BSHA 3L4EA 4IICA 4M1SA 2DUJA 1Q15A 3ER6A 3H6HA 4QOFA 3TLZA 3WOVA 3HVUA 1JDPA 3HSKA 3I2HA 3LOUA 5LA6B 5CFPA 4FR5A 5I7UA 3I37X 1OWNA 1ZNWA 4XJSA 2GYUA 3L18A 4HI0E 5TNXA 1JWLA 1ZNQO 1EUDA 3R6GA 1PR2A 1A2BA 1ELOA 1U8CB 3USCS 1KJJA 1XZDA 2VBCA 2VHQA 3ETLA 3THSA 3JPWA 1RYYA 2ZR7A 2BDEA 2HMAA 1E4OA 4FZ5A 4ZANA 4D4HA 4ENSA 4US2R 1ZNYA 1GGHA 3HE3A 4EB6B 2Y1GA 4E2YA 3OT1A 3QOWA 4V0RA 4CKEB 3IVXA 3QYPA 3TXAA 4GVPA 1T0IA 5H3CA 4I4LA 3LT1A 3TXXA 2ZJ7A 3VNBA 1QORA 1FVFA 4M8IA 3JYOA 3W9BA 1SQSA 1RI3A 3G2OA 4FNMA 3UEOA 1BQ4A 1WVIA 2GCNA 2N75A 2XF8A 3AI3A 3NT2A 3OHSX 3G0HA 5LP1A 3R7FA 4YRNA 4FDAA 1SXJE 2IWRA 1C8BA 3RV3A 4FUTA 1YB4A 3NJ8A 3ANTA 1I6KA 4FFMA 1RYMA 4DF3A 1NUPA 5AUQA 4B3GA 3K9WA 1J8YF 2Z5LA 3GUVA 4ZA2A 3Q9NA 3AJAA 4KFRA 1LPOA 3MPUA 1QIGA 4JBHA 1ADJA 5F5NA 4A5OA 2ZRBA 2VAPA 4COKA 1DUVG 1ZNZA 3AHCA 1BU8A 2C9YA 3T5BA 2B1QA 4IRMA 3ZCPA 4CKBA 4IIVA 3KAKA 1DBRA 1KGSA 2HA7A 3GY0A 1XGKA 1Q12A 4HDMA 1ZK3A 4JK3A 2NZUG 4M1KA 4KBGA 3BBLA 5CDHA 4PN7A 2ZP1A 5JY1A 2YHSA 3C24A 1EXWA 4OA5A 3KUDA 4EB0A 1IBKB 5C1OA 1KYWA 3A0UA 4NZNA 2A9RA 3KPUA 3EVEA 4AIIA 1H4SA 3MB8A 1XMSA 2D3TA 3NMUF 3H2BA 1Q5PA 1JVBA 1BDHA 3IBCA 2EF0A 3CPHA 3IFSA 1I2BA 1VM6A 2B8NA 3DW1X 3OZSA 1Q0QA 1RHUA 4UFNA 5CMLA 3UAZA 4BVKA 2IOHA 1NZFA 1IQRA 4OM8A 3T9FA 1OBFO 2ALJA 2IZZA 5I48A 1GGMA 1VL5A 4GO1A 4L6AA 4JLUA 2MSWA 4XDGA 5DIZA 5FNZA 3IQIX 4DWJA 1KJQA 1SG6A 4RX1A 5B1HA 4OJQA 5BWCA 4S35A 2YYZA 1PHPA 2FE4A 1T1JA 3FZGA 1U0HC 3JD4A 4AM8A 3AB7A 1P29A 2OMEA 3BDAA 3L4BC 4TVBA 3U26A 5LKRA 5I6DA 5I8ZA 2YVAA 5EZYF 2J0EA 1JQBA 2ZE6A 1PVDA 3EXG2 1C4KA 1WXIA 2QA5A 3GIDA 4ZPJA 1UEXC 1ODTC 2QX7A 3NH6A 4IGFA 4X1OA 1P17A 1L2TA 1JFRA 3PXXA 1WCXA 1ZVVA 3DVAA 3UAWA 1UK8A 1Z2EA 3BJZA 2HRDA 4ENWA 1OFIA 4UHEA 5IS2A 2Q4TA 1KAGA 3E3AA 5AI5A 3IQFA 3KQOA 1JT9A 3ED1A 3MERA 3C3WA 2WSMA 3R3JA 3V1NA 2MSDB 3RG8A 1XKXA 1UQUA 4G4SP 4GKJB 2O8EB 4OB8A 3OM8A 2C2OA 2VZ9A 4C20A 3FPEA 2B1GA 2GUGA 2YQ5A 2JG3A 2YKGA 3QEJA 2YWXA 1X1AA 3GLRA 4OL0A 3TJZA 3U5TA 2GZ1A 2XGJA 5JZVA 4LHSA 1FXWF 3R6LA 4NOMA 4WK0B 3UBTA 1TJ3A 4ZHQB 1G55A 4YRRA 2C96A 3KPJA 2ZRAA 3B9PA 3I72A 3UTCA 2FUCA 3ZZUA 2ID8A 3WIOA 4G1UC 3OC0A 1TC1A 4RVGA 4U7WA 3T7EA 4YYZA 2EZ9A 2JGFA 1BGWA 3K5PA 1TDJA 4US0R 2AE2A 1GRRA 2BFBA 3WGYA 3PEFA 3LUFA 3UK1A 4ETMA 1ORRA 1G3IA 1VRCA 3LCMA 3GRCA 1MABA 3IIJA 1A2OA 5CT4A 1L4BA 1FZQA 1JG1A 1TADA 2H9IA 1OLUA 4HGOA 3WWYA 5A5EA 5L40A 3SHWA 5JPDA 4X7BA 3GGPA 4PC3A 2J87A 5CK5A 1Z4NA 3REOA 3UJNA 3TO5A 2GA8A 3AETB 5TPWB 1DAOA 3O8OB 4KQIA 4PO1A 5EMLA 3SPXA 5LUAA 1NLYA 4KI0A 1W59A 2VF8A 4JYBA 1VHJA 1QGUA 4JN6B 4UAUA 4BO2A 1JVNA 1XMXA 4FZRA 4HAWA 4QTYA 4HLNA 1V37A 3SC4A 1N5DA 3ZI7A 2B37A 1LNQA 3OU7A 2WAYA 4WNYA 5F76A 4GIBA 4RVCA 2RBEA 2W4IA 3O75A 5G3ZA 5BR7A 4S04A 1JR6A 4FILA 3KDPA 4W7IA 1OI7A 2GN0A 4JKIA 4P4NA 3DL0A 2PV0A 3H9CA 2QSUA 2YHBA 2VHVA 3R4CA 4MVJI 1H8HD 1AUQA 1SHTX 5ELLA 2BFAA 1ZDMA 1E1RA 5ELMA 4E1BA 3ZK7A 3GEPA 1TU0A 1Z6GA 4L8VA 4FYKA 3C8HA 1YB5A 1N8SA 5FPPA 4TTAA