2EKPA

Structure of tt0495 protein from thermus thermophilus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
238
Chain Sequence
ERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title The first crystal structure of NAD-dependent 3-dehydro-2-deoxy-D-gluconate dehydrogenase from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 85
structure length 238
sequence length 238
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ekpA00
3DBRB 1CEQA 4RLHA 2HJRA 4FC6A 4BNVA 1UJMA 2PH3A 4QUKA 2UVDA 3IP1A 5AXAA 4E31A 2VRCD 2GF2A 4ID9A 1C14A 2VHXA 1GQYA 4YYZA 4CMKA 4AJOA 1A4UA 1H93A 4UVGA 5GY7A 1ZXBA 1EVYA 3HNPA 2P68A 3WTBA 1LNQA 3VPFA 5HTOA 2OFPA 3I4CA 2I9PA 2ZTLA 3O38A 1ADFA 3KV3O 1UP7A 1WZIA 3BAZA 2HMSA 1EBFA 1GYQA 5COAA 1ZK2A 1PQWA 1R12A 1IB6A 3BTUA 4E4YA 5IJZA 5KOIA 4E32A 4N18A 4LCJA 5CG2A 1NFFA 2D1YA 2X0NA 1KC1A 2X4GA 5DCYA 3UAGA 4E2ZA 4QO8A 4U7WA 4YQZA 3QQPA 3WYCA 3ZGYA 3QSGA 3WGYA 3I9MA 1SB8A 1CERA 3B70A 4EBFA 1QYVA 1B3BA 3V1UA 4J1TA 4I5FA 2I6TA 3ENNA 3FN4A 4PFJA 3B20A 3GK3A 5DN9A 4FFLA 4DBZA 1PJCA 3DBLB 1RYEA 2R00C 1SCUA 2CSUA 1Q2XA 4L76A 2W90A 4YDRA 3AWDA 3QW2A 3GAZA 2JD2A 2HMWA 4WCFA 3DZKA 3LT1A 4R1TA 1UZLA 2YV1A 1ZJYA 4BKPA 1U3TA 3KSDO 4CQLB 1PGPA 3U4DA 3GA0A 3ZU3A 1NNUA 2WYWA 4EI2A 2O4CA 5CAEA 3EVNA 5EJ2A 5T5QA 1B8VA 3TPCA 5I8ZA 3OJLA 4GVLA 3N58A 4IDFA 4LSMA 1QP8A 4UEOA 2J8ZA 3GZNA 2I67A 1C0LA 3EAGA 4XA8A 1PJ3A 4XYBA 3WDSA 5ITVA 1YQDA 2P5UA 4BNNA 5CEEA 3WFJA 1PS8A 2P91A 4G2NA 4YT8A 2V6GA 4JP2A 3WGQA 4NBVA 3UN1A 3D1LA 1A7KA 3H9UA 4CM4B 1DSSG 1PL8A 1VM6A 4KTTE 4ND2A 2PD4A 4BO3A 4MVJM 4Y67A 4TRRA 2C7VA 2AEFA 3W6ZA 5TQVA 4MJLA 2HO5A 4QEDA 4IXTA 4UUMA 3D4OA 4U8GA 3JYQA 4J3FA 1D4FA 3F9IA 4KUHA 2ZB3A 2ZB8A 4P4NA 4I1IA 1X0XA 3UGKA 1K2WA 3ADOA 3DTTA 3JYNA 3L77A 3NX4A 5JDCC 4DLAA 1QYDA 2PZLA 3PJGA 1GR0A 4FN4A 4WLVA 5KKCA 4RZIA 2JHGA 2D0IA 1LLUA 4MVJE 4XZ3A 1WXDA 2DAPA 2JCVA 3M1LA 3WSWA 4IDAA 5JBIA 1NWHA 3PDJA 2EKPA 3VZQA 4FGWA 4BIIA 1XA0A 4L0QA 2Y68A 3WJ7A 1UXKA 3OM9A 4ZGWA 3GNTA 1OFGA 2JD0A 4MKZA 4LVUA 5TJHA 2PA3A 4J90A 3CEAA 3ICCA 2OXIA 2I5PO 5KJEA 3E1KA 2EGGA 3BMNB 2ZYGA 3BMQA 5H83A 4R9RA 4FCCA 3S1LA 5K6AC 2DPHA 4PRKA 5A5FA 4YT4A 1D3AA 1B26A 1Z7BA 4MKXA 3OEWA 2W8ZA 1NAIA 1PZEA 1ZMTA 2CY0A 2IZZA 1U3UA 4XR9A 1B16A 1DHTA 1U5AA 1GL3A 2WD8A 1NAHA 5B4VA 1E1KA 4JCOA 2DQ4A 3ZZNA 1FK8A 3HSKA 5DP2A 4E2XA 3QWBA 4PZDA 1NQOA 1ISGA 1ULUA 1TT5B 5EQDA 1Z73A 4ZQHA 2Z5LA 3AU9A 3SC4A 1WW8A 4CM8A 4YJHB 1I8TA 4J49A 4DC1A 3AUSA 2VNAA 4C7KA 2P9EA 1HZJA 4K28A 1KVTA 4IM7A 3TN7A 1A5ZA 4CV1A 3KYBA 3ZV3A 2CDCA 4U0KA 4W82A 4D0SA 3F47A 2Y1OA 6ADHA 1NR1A 4XRGA 1F12A 1Y6JA 4I5GA 4YAIA 4TWRA 3BMCB 4EUHA 3KHUA 2C54A 4DUPA 5G4KB 4WK6A 3P5SA 4FJ2A 1H6BA 1KVRA 2C2XA 3L9XA 4B4OA 2HMTA 5C37A 4HNHA 3S2EA 3AY7A 2BMAA 3JQFA 3UUWA 1Q0LA 2VCYA 4ALJA 2AW5A 3I6QA 2X9NA 4M49A 1KERA 2NU6A 4IMPA 1E6UA 4AVYA 4CQMD 3OA0A 3GLQA 3JD2A 4PVCA 2DVMA 4RPHA 1H94A 3PJEA 4W7HA 3INGA 2OP0A 4RF5A 3GEGA 2G1UA 2Z1MA 1EQUA 2NM0A 5ER6A 3AOEC 4OXNA 5GMOA 5LDGA 3V2UA 4GWKA 4BNXA 1BHSA 1IY8A 1VJ1A 2R00A 3AM4A 4XYGA 1PX0A 3TJRA 3TFOA 4FDAA 2CF5A 3PQFA 4ZQEA 3OSUA 2NADA 5F1PA 3JQ6A 3OH8A 3BMOA 5IFLA 3VPGA 3AY3A 2J5KA 2YY7A 1HDRA 2B4RO 2OBNA 4H3VA 5KKAA 4M54A 2OORA 2PTGA 4XIJA 4DXHA 2GN9A 5L4SA 1GY8A 2BGKA 2ZQYA 1JW9B 3KB6A 2CDAA 5EESA 3V1YA 4XB1A 3WS7A 1I3LA 1R4NB 4GAEA 3GVCA 1XU9A 2VWGA 2FWMX 4J43A 4E21A 2I66A 3DAPA 4D46A 5KVQA 5DNAA 4EZBA 4TVBA 4J1QA 1AHIA 4DC0A 4BNYA 1M67A 4JN6B 3WTCA 4MO2A 1EUCA 3DZFA 1LRJA 2ZTMA 1YONA 5CDUA 3ZNQA 2YHUA 1JWBB 5TNXA 3ZHBA 2VT3A 1YL5A 3RFXA 4DVJA 2VQ3A 1H9AA 1V9LA 3SC6A 5C7OO 3GVHA 4E13A 1G6KA 4Q9NA 2AE1A 4IJWA 3G49A 3WYEA 3IS3A 5JDCA 1UDAA 1N9GB 4NMHA 3W4KA 3KYDB 1J6UA 4BS9A 4YT5A 4PLPA 3L6DA 2NU7A 3R0IA 3A9WA 4X54A 3KM0A 1KVQA 4B3IA 3HE3A 2DBRA 4FFOA 3C1OA 1EEHA 2H5LA 4ZD6A 2NVUA 2Q49A 3JQ9C 4OM8A 3AFMA 4CQMB 5KJ1A 1DIRA 1Z45A 3JQ7A 1X1TA 1AN9A 4BO8A 3RD5A 4UVDA 1LSJA 3VPSA 4JIGA 2FR1A 3IKVA 5JAMA 1XDWA 2I76A 2PD3A 4PCVA 4FFPA 1EUZA 2OUIA 4GLLA 2BGLA 2W98A 2IE0A 4Q3AA 5K6AA 2NVWA 3V5NA 1JKJA 3W4IA 2Y67A 1UXJA 4MOWA 1B0AA 4Z0PA 2OMEA 3L07A 1C0KA 1VL8A 1X13A 3OECA 4F45A 2GN8A 3D64A 3RU9A 4CLOB 4IDDA 3NKLA 5U4QA 4BNKA 2XXBA 1GAEO 4JBGA 2ZB7A 4NBRA 5JLAA 4YB8A 1WZEA 2ZIZA 3FCOA 4JLWA 3WNVA 3DZBA 1HL3A 2BH9A 5C7IO 3K96A 3C7CB 4TRNA 2DTEA 4EEZA 3BZUA 1O95A 2V6FA 5DP1A 3IP3A 1BW9B 1LA2A 4R9SA 4E3ZA 4LGVA 3H9JA 4MP8A 5EPOA 4D3DA 2X5KO 3K2BA 2FOIA 4BNJA 3RUEA 3WBBA 3AOGA 5LC1A 2P4QA 4BNMA 2FHSA 4BO7A 3NGLA 1E7YA 2FR8A 5HBRA 3QV1A 4R1SA 3MEQA 3V2GA 4UUPA 2HKIA 4B8ZA 4CMHA 2VRBA 1ADBA 3RFTA 1OMOA 4WOKA 2GZ2A 1PQPA 2F00A 1D1TA 5F5LA 2C7GA 4GPD1 3PI7A 1X7DA 2YHIA 3AUAA 3I4FA 3SBOA 2GERA 4KDFA 4O6VA 4RF3A 4LN1A 1BDMA 3RBXA 4ALKA 4B4WA 3VHRA 4Z0TA 3E9NA 3T4XA 2FN7A 5EQFA 1NPYA 4OMUA 5B12A 5FFFA 1L7EA 3AOEA 4GX1A 1GADO 3PIIA 1DIBA 9LDTA 1E6EA 1NHWA 2AHRA 1MP0A 3KSZO 3D4NA 3EGOA 4Y9DA 4YJFB 4D42A 1DRVA 2X1HA 4S1VA 5KVCA 1X14A 2X0JA 3RSHA 1O8CA 2EKQA 1C0PA 2C20A 3ITKA 3UKOA 3QWAA 1EDZA 3GY0A 3TL3A 1IE3A 4RGBA 4NK4A 4EUEA 2V7PA 1QXSA 1IHXA 1HE4A 1R6DA 4Z3KA 3GVXA 2P4HX 4L4RA 1QSGA 2CDBA 5CDSA 2Q4EA 1UDBA 3DQPA 2NTVA 2O3RA 1RM5A 2Q46A 1BXGB 2UUPA 3R3SA 3NJ4A 3QHAA 3Q9UA 1YJQA 3VDQA 4AG3A 4B7CA 1YGYA 2AG8A 4RPLA 3RC2A 2Y0DA 4R16A 1A72A 2OP1A 3EUWA 2Y1EA 2Y1GA 4JJIA 1ONOA 1JTVA 4XEHA 3IUSA 1T2CA 1DBVO 1XEAA 3JQ8A 3MJEA 1EMDA 1XU7A 1DRWA 1EZ4A 1F17A 5IXYA 1SMKA 5C3MA 4L4XA 3NT4A 5G0TA 3H9QA 4GLOA 4TMFA 4QO7A 3NTQA 4L75A 3K30A 4B79A 3DAGA 1C1DA 4K9DA 1LLQA 1VC2A 2Q1TA 3ICPA 3DOJA 4P8RA 3FNFA 3ETEA 1ZSVA 5F1OA 4YCAA 3AW9A 4MINA 4MPDA 2WD7A 3ASVA 4KUGA 3WGZA 3ZHZA 1YB1A 3AI1A 3GDOA 4MVJI 2FSVA 5H81A 4JX8A 4WLNA 3JQ9A 2IEDA 3GMSA 3D7LA 1XSEA 3GUYA 4FJ0A 2DTXA 1QV6A 3QIVA 2DBQA 1LLCA 4NK5A 3H8VA 1E7SA 1DLIA 4BO6A 3ZWPA 2A94A 4D7AA 2GNAA 4NJMA 1I30A 2O23A 4DMLA 2C07A 4NQZA 3NDIA 4GWGA 4JXKA 4GQAA 1R16A 4OIMA 2A35A 3V2HA 4IXWA 3KLPX 4CLDA 2CNBA 1T24A 3VTFA 1MLDA 4GX5A 4ALIA 4ALNA 3DHYA 1ZMOA 1ORRA 4CM7A 4Q3NA 1MX3A 3MJVA 4NFYA 1ZK4A 1K6IA 3MJ4A 3A06A 5BNTA 5IXSA 3Q9NA 3FRJA 3O03A 4HX5A 3G0OA 1B14A 3FBGA 3VAZA 2BRUA 3HJAA 2PGLA 3B1FA 1B8PA 1TB4A 1MV8A 3GN1A 4AJKA 4RVFA 3OIFA 3ZHXA 1H6DA 4O63O 3WGHA 4NG5A 3S2IA 1DOHA 4NFHA 4TQGA 4J2HA 4PLYA 4CUZA 4OKNA 1GV0A 5FWNA 3RUDA 3FBTA 4B3JA 1PR3A 2EG9A 3L4BC 5THKA 4Q39A 4NBWA 4DMMA 3ADPA 1IPEA 1KY5A 1QYWA 2DBVO 1DIGA 3PP8A 4WEQA 1TI7A 4JJFA 1Y8RB 1E0DA 4BNWA 5FYDA 2PGDA 4CLRB 3F4LA 2ILTA 4UULA 5CDYA 4MIOA 3H2SA 3LQFA 5B4TA 1H6CA 4IINA 3QY9A 4YXFA 2WSBA 5DBIA 3ZNOA 2OHXA 3KYCA 1CRWG 4HBGA 1YL6A 1YVEI 4XYMA 1E6WA 1E3IA 1SAYA 1DB3A 5JO0A 3TZQA 1CJCA 4XCVA 3INRA 3CXRA 1A7AA 1EVIA 2Q4BA 4AJPA 3COSA 2G5CA 1DHRA 3ZU2A 1GV1A 2ZCUA 3G17A 1D8AA 2AQIA 1P77A 3OQ6A 1EFKA 5TX7A 3I52A 4PLHA 5CHEA 5CP8A 4ZA2A 2VHYA 1LQTA 4WASA 4PG7A 1TEHA 5JYEA 3WB9A 4R1NA 2PZMA 3RUAA 4BO2A 5JAZA 3TRIA 1UAGA 3A4VA 1W6UA 4RVSA 3E9MA 4J91A 3UCXA 2Q3EA 2J3JA 1PZHA 2EW8A 3R3JA 3STHA 2CVOA 1PZGA 2GSDA 4M8SA 2HJSA 3KZVA 3IL2A 1NTOA 3F4BA 4FQ8A 2Z95A 3AK4A 4AJNA 4M1QA 2QYSA 3LF1A 5ICSA 3UCFA 4BL5A 3HWRA 2GDZA 3BTVA 4QFCA 4IDBA 4WCFB 3AU8A 2FSSA 1NWCA 5TT1A 2DPGA 1H5QA 1PGQA 2D3TA 4CODB 2SCUA 2O3TA 1MG5A 2EP5A 4BKOA 4BNGA 4EEXA 2VUSA 3HADA 5JY1A 1KEUA 5A9SA 1Y9AA 2EJWA 2EKLA 2W2LD 1K6XA 3GPIA 4XD2A 3UVEA 3GZNB 1ZFNA 1UH5A 1KBZA 1RM3A 5JAIA 1Z75A 4E30A 3K31A 1T4DA 2O4UX 4Z9YA 2J3HA 1LSSA 1NVGA 2X9GA 2IYOA 4Y98A 4PLZA 4BMVA 3ORFA 3ASUA 4FFRA 4IJVA 4I8XA 3ROPA 1F14A 4AICA 3RC9A 4E2YA 3B1JA 1PGOA 4PIVA 4Y8VA 2VZ8A 3JQFC 4A7PA 1UUFA 1GQQA 2H63A 2J5QA 2QIOA 2IXAA 3QWFA 4XX0A 1DAOA 3FR7A 2BFMA 1DRUA 1PJ2A 1SC6A 3I9OA 4NZ9A 4ALMA 2V6MA 1ENPA 1N1EA 4AL4A 4B7XA 2YZ7A 3VOSA 4HFRA 2AXQA 4OH1A 3LC1O 4XIYA 3WGGA 4GMGA 4UREA 1BMDA 1R4MA 3N7UA 4BMSA 3G1UA 4I08A 4EJ6A 1E7RA 3KBOA 4MP3A 3MCVA 1WAMA 3PHLA 2DFVA 3H3FA 1KYQA 1M75A 1IULA 1DDOA 3E8XA 3KOUA 4YAKA 1XQ6A 3C7DB 4O59O 1W8DA 3RUCA 2GYYA 3D0OA 3LLVA 3OBBA 5ENVA 4HFMA 3NAQA 1I3KA 1P74A 1ONNA 4UUOA 2C5AA 3L4BA 4OO3A 3P7MA 4CV0A 4BGIA 4B4VA 1ZEJA 4P4LA 2IRWA 3D3WB 1UP6A 1UXIA 4ZQFA 1PTJA 1WNTA 2PK3A 1QR6A 3BMQB 4PLTA 4D44A 5K9ZA 3E5MA 1HYEA 5BSEA 1CYDA 4W6ZA 5KWEA 1NQ5A 3AFNA 1F8GA 5G2OA 3PIDA 4IS3A 3W4JA 3DBRA 2GASA 4UAGA 1A27A 2O7SA 3F5SA 3KTDA 3I6IA 3RROA 1SB9A 3TQHA 5MGBA 1DLJA 2JAPA 1VLLA 5GZ6A 3U4HA 1Q7BA 3GDFA 2VYNA 3L6OO 3WQRA 4RVGA 1GEGA 4BHTA 4EJMA 3TF5A 4DPMA 1GPJA 3GEDA 5IZCC 3GGOA 1QYXA 3PEFA 2QG4A 4B4UA 1E1LA 3DOCA 1PZFA 2EEZA 4CM8B 1ZH8A 1HTBA 2B4QA 3I9JA 4L74A 5HS4A 3HDHA 3O9ZA 3W8FA 3WOHA 7MDHA 1V0JA 3UICA 1AUPA 3SJUA 3TSCA 1U8FO 3NRCA 1RPNA 4GMFA 5ILOA 3P19A 3RBVA 3M2PA 1IYZA 4Q3BA 2CVQA 3ABIA 4PLFA 1W0CA 4OOFA 4CM6A 1H0KA 5JCJA 3C1AA 1SZJG 1YOVB 1S7CA 1GFSA 3OFSA 2EV9A 3WX0A 5BSGA 1NPTO 3EK2A 3SLKA 3PWSA 2IZ1A 1B15A 4YVFA 1LC3A 1J49A 4LRTB 3VDRA 3JQCA 3RUFA 1WDLA 3U4CA 5JXWA 1HXHA 4BO9A 1QG6A 4GH5A 1OZAA 1SO8A 1JLLA 4DQVA 4HWKA 3UXYA 3ETDA 2D2IA 1AE1A 2JCYA 4PZEA 1VKNA 3O26A 2FZWA 1KC3A 5F1KA 5C5IA 1HRDA 4OSPA 1HKUA 4CQLA 1BSVA 4R51A 2WYUA 5EMHA 3ZV5A 2P5YA 3L9WA 5CFZA 1ZEMA 3I3OA 2ZYDA 3CKYA 3BMOB 1XKQA 4BGVA 2EIHA 4CLHA 5IAAA 4JBHA 1MC4A 1YWGO 4Q3CA 4RV9A 1OAAA 3NDJA 3DMYA 1IZ0A 2J3IA 3U62A 1T1RA 1YL7A 3BXXA 3ONFA 5ICMA 1XR3A 4RL6A 4YTEA 1HF3A 2PH5A 5JPIA 4YR9A 2J3KA 4WLFA 1GYPA 1PJ4A 3EDMA 5FF9A 3Q3CA 4FB5A 4LMRA 2GN4A 3C1TA 4FIZA 2JFFA 3ITDA 4AJHA 1EBUA 3NGXA 2TMGA 1F8FA 1ARZA 3AM5A 5G4LA 1Y5MA 3JQAD 6LDHA 2UYYA 4MVJF 1ISMA 1KETA 3E5RA 3X2FA 4D79A 2YUTA 2NTNA 3PYMA 1IZ9A 1M6HA 3NYWA 4XJTA 3EC7A 4PG8A 5BSFA 3GNSA 2Y0EA 3LZ6A 1UXGA 3L0DA 5DCUA 3IKTA 4U5QA 1N7HA 4K1LA 2O7QA 1SNYA 2HK7A 4LW8A 5LDHA 1KEPA 2A92A 1ML3A 2Y0CA 1LDNA 1VSVA 4FOOA 1B8UA 2GN6A 3L6EA 1T2EA 5JYDA 1TVEA 4A73A 2YV3A 3OF2A 4XGKA 5IDXA 3M1AA 1A71A 2POQX 4CMJA 1DJQA 2EERA 2F1KA 4BVAA 2NVUB 3GVIA 3NT2A 3BMNA 4KWHA 3JQ7B 4W4TA 1LUAA 4NU5A 4ZJUA 2X86A 3IIEA 4C7JA 4O5OA 3HUDA 1N92A 3BTOA 1LDMA 4YBZA 4IIUA 1XWFA 4NHEA 2CVZA 2CF6A 4BB5A 2P2SA 4XQCA 4KMSA 3HQ4O 4NU6A 5L95A 4AJ4A 1J0XO 5U1PA 3WG9A 4M86A 2ZCVA 1U4OA 3E18A 5B4UA 2VTEA 1E3SA 3GF4A 3JYPA 3VVCA 4AJ1A 4XWYA 5A04A 4J7CA 5COBA 4WOJA 3BIOA 5JMPA 1GTMA 4DREA 5C7LO 4FFNA 1E7WA 5T57A 3U9LA 4FJ1A 2YFQA 4J2OA 3ONEA 4I9HA 1BXKA 1M2WA 2GR9A 2PD6A 4OGWA 2B83A 4R3WA 3EYWA 1CF2O 5IZCA 3BTSA 4NI5A 4WJZA 1G0OA 3HN7A 3DWFA 5IDWA 1VSUA 1T25A 3QWHA 2Q2QA 4KZPA 4DLLA 4URFA 4LSWA 5FEUA 2FPIA 4RLSA 1P9LA 3C7AA 2NSDA 2XF8A 3A28A 1LTHR 4ZQGA 4CM1A 4XYEA 3JQAB 1PU2A 1QMGA 1Z74A 2IEBA 3RU7A 3TDKA 1WVGA 1MB4A 2G17A 1X0VA 3E6AA 1CDOA 4ND3A 3E82A 5CG1A 3F5QA 1NXQA 1GU7A 3H9GA 3WNQA 1ENOA 5HRUA 5IZ4A 1WMAA 4CPDA 2GLXA 2TMDA 4RVHA 2BGMA 1MA0A 4QTZA 1U2GA 1U28A 4ILKA 4DQXA 3JD3A 4TSKA 2YHIB 2NNLD 3DFUA 1PGNA 1TT7A 1DXYA 4II2A 1LDBA 4K6FA 4RPGA 5DBFA 3VZPA 4IZIA 3X2EA 2ZQZA 3LLSA 4BNUA 1DPGA 1H2BA 4RPKA 2AE2A 3BA1A 3VC7A 1AXEA 4R69A 4RF2A 1EE2A 3PRJA 3JV7A 3LC7O 3FSRA 1OC2A 5L53A 1PJTA 3RVDA 4L9RA 2B69A 2VZ9A 2BI8A 1FDSA 4YJGB 1T26A 1LDYA 5I7SA 2O48X 4RDIA 1ZNQO 4OKIA 2NTJA 3KSUA 1E3JA 2RAFA 3LK7A 1RM0A 4BV9A 3VH3A 5BT9A 2BI7A 2GUGA 1P1HA 4PLVA 4PLGA 1P1FA 4FS3A 4BV8A 3ST7A 2YDXA 3TL2A 2HMVA 4K26A 5HS6A 4II3A 4FC7A 1I36A 1DO8A 5J23A 4CMBA 1NM5A 4DPLA 3TOZA 3WSVA 1C1XA 3ZWVA 2GRAA 3RFVA 3I9NA 2OGUA 1EDOA 3W1VA 2X7HA 5JCXA 2PGJA 1XHLA 2JHFA 3MJCA 2J6IA 1HDCA 5JFOA 5L7WA 1VI2A 4MP6A 3KRTA 1Z6ZA 2UAGA 3CSDA 4K6CA 4AJJA 1VPDA 3HHPA 3EHEA 1P31A 1N9GA 3PK0A 4U0JA 3D5TA 1IPFA 1DFIA 4ESOA 3KYDA 4Z6KA 2QRJA 4KDEA 4Y6RA 5U9CA 2C2YA 4MDHA 1L7DA 3OJFA 3UH1A 3OETA 1E7QA 2JJYA 4TVOA 2B5VA 3VZRA 2J5RA 3Q11A 4RVDA 1C1DB 4OYRA 1Y8QA 3CUKA 3U0BA 1Q7GA 4BNHA 3ENKA 3VH1A 2BFPA 1V3UA 1I10A 4CQMA 4O0LA 2HRZA 4HP8A 2O3SA 3ROQA 3NV9A 4YEDA 4BOYA 3NUGA 2ZATA 2HLPA 1ISIA 4N54A 2E82A 2HK8A 3C24A 1RJWA 1O9BA 4MVJD 1V8BA 1EUDA 3WLEA 4CV3A 3HFGA 1SEVA 5DT9A 4XB2A 3B6ZA 1ZZEA 3WLFA 3PQEA 5F3RA 1Y5RA 1E92A 2VUUA 4NJMB 5G0WA 4EUFA 1HE3A 1O5IA 3ZV4A 4IQGA 3L4SO 3U5TA 5JE8A 4J1SA 3MWEB 4E5PA 4L4SA 3SEFA 3ZCXA 1JVSA 1J4AA 4DQUA 4YRBA 1N2SA 3DL2A 3WR5A 1ZK3A 4WLEA 1Y9EA 4OXYA 2I3GA 4RVUA 2HAEA 2O3UA 4PVDA 1HETA 4IUYA 3ZWYA 1DJNA 2NLOA 4YWJA 4WUVA 2PY6A 3NDRA 3JD1A 2PZJA 3E9QA 1MFPA 4Q3EA 4D0RA 3SXPA 3AM3A 3IAHA 4BO5A 2VWHA 2PZKA 3VZSA 4YPOA 3HFSA 1O89A 1GZ4A 2FRDA 5DBGA 3HG7A 1E7MA 3H5AA 2ZTUA 1VL6A 1E3WB 1R0KA 2B0JA 4A27A 4NBUA 4IY1A 5B37A 3ON5A 1ADCA 3AUUA 3GGGA 3JQGB 4CM9A 3FD8A 4B8WA 4E5NA 2GD1O 1PJLA 5IF3A 3MZ0A 1LDGA 4A5OA 1ZW1A 2DM6A 3DONA 3ZW9A 3ZNPA 1JDJA 4RZHA 3RAJA 3K9QO 2B37A 5L7YA 2CMDA 2DC1A 4A0SA 1UZMA 4MVJP 4NFSA 2C59A 1YXMA 3P2OA 3DBHA 4GGPA 5HA5A 4BKUA 2Q1SA 2R2GA 4KUEA 5HWSA 4DPKA 3FF4A 5F5NA 4BNTA 5IN4A 2HSDA 3T7EA 4PN3A 4RPJA 1HDXA 3FNEA 3PPIA 4J0FA 4KTVE 1YB5A 3PFWO 3DMTC 3WQSB 3PVZA 2DU8A 4PG4A 2AQHA 5T8KC 3DZGA 1NQTA 3VPXA 1G0NA 1R15A 2IZ0A 3ZU5A 4LMPA 3KYCB 4OQYA 1JKIA 1GYRA 1HYHA 1PS9A 1T1SA 1LU9A 3RJ5A 4CMIA 1H6AA 1HWYA 3KEQA 4Z3DA 4AFNA 5TT0A 4E0BA 1BDBA 3WMWA 4BNFA 4XGNA 1EVJA 3I9LA 4TKLA 2HDHA 4FPXA 1ZK1A 5ES3A 2B5WA 3VVBA 1WDKA 3DAFA 3OJEA 3WJAA 1FXSA 2GCGA 2HCTA 4OQZA 3RQSA 3PZRA 4EJ0A 4E33A 4H15A 1BXGA 4IDEA 3V8BA 1V3TA 4ITUA 4D45A 5K0ZA 1ZIDA 1I0ZA 4RO0A 2VWPA 1PQUA 5JS6A 1KY4A 3WGTA 2PNFA 5IDQA 4RQUA 4FSHA 5TGDA 9LDBA 3EZLA 2JKVA 3DHNA 3GC6A 4UVEA 3WWYA 2Q2VA 3UOGA 3GVPA 2ZB4A 2Q50A 3OQBA 5JY6A 2JD1A 3F46A 2IDZA 3RIHA 2R6JA 1IL0A 1CWUA 3HZZA 2FY8A 4YQYA 4CR7A 4JP3A 1JN0A 4QX6A 5DOZA 3IMFA 5T67A 1NP3A 1FMCA 2V6BA 1JU9A 4M89A 5KIAA 2PWZA 5BNIA 4EITA 3ROKA 1LX6A 2X8LA 3PHJA 3WFIA 3DBVO 3PGJA 4XKJA 1U2DA 4GSLA 3T7CA 3ZWWA 2RH8A 4TZTA 2AEMA 2ZK7A 2W2KA 3OIGA 2NVBA 3QWIA 2X5JO 3WIDA 2DUWA 3AI2A 2CFCA 3KEOA 1R0LA 1YQGA 2QZ9A 5BNFA 3DB2A 3C85A 2CD9A 4CUKA 4CMEC 5FI5A 4BGEA 4J9UE 1DAPA 4F6CA 2I3AA 2BELA 4KP7A 5AVOA 2VHZA 4R5MA 1XG5A 3ANLA 1UZNA 2CZCA 3ETGA 4BO1A 4IMRA 4NBTA 3VH4A 2VYVA 2ZTVA 4Y6SA 4UVHA 3EW7A 1P3DA 4E6PA 1P0FA 3TWOA 1JAYA 3JD0A 3H5RA 4E12A 4YAJA 3WQQA 1AGNA 2Q1WA 3A1NA 2G0TA 5TLSA 3RI3A 2B4TO 5A5EA 4I5DA 4TZKA 3QJ5A 1WDMA 4DIFA 4NNJA 5JCJD 1YH3A 3MTGA 1KIFA 1MC5A 2VUTA 4XDZA 1VJ0A 2OOSA 2JFHA 4N5LA 2G76A 3ROMA 2P9CA 3DEYX 4YRDA 3G79A 4CR8A 4YRAA 1WP4A 3FWZA 3Q2IA 1FDUA 1R4MB 2YYYA 2Q1UA 5L4NA 4UEJA 1BXZA 3S55A 3NEPX 1CETA 2JFGA 2NWQA 4Z9XA 3TZKA 2HRBA 3FPCA 3FR8A 3ZI0A 4TRMA 1AXGA 2I99A 4YA6A 1IUKA 4OL9A 2AEJA 1LXCA 4LK3A 3AI3A 4GSKA 3RKRA 1MFZA 2X23A 3OEYA 4W99A 3R1IA 2W4QA 3O4RA 1NVTA 1RKXA 1ID1A 1UR5A 3PWKA 1EFLA 1CIVA 2HU2A 3SVTA 4OHUA 3KUXA 1XQ1A 1GUFA 1DEHA 1KOLA 4ALLA 1Q7CA 2LDXA 4WCDA 3D4PA 1R66A 1ZO8A 1KS9A 4CJXA 3FWNA 1ISJA 1I24A 2QW8A 3DO5A 3JYLA 4TROA 3WWZA 5CEJA 3IQDB 5DF1A 4WECA 5I7VA 4ZQBA 5KVSA 5T6BA 1UXHA 4WNCA 3DMTA 1PJSA 3HDYA 3CPSA 3ULKA 4J1NA 2E49A 5IN5A 3F1LA 3DZJA 5AXDA 5T8KA 1QLHA 3WGOA 4GBJA 4RCVA 2AA3A 2QYTA 4FGSA 5A02A 1PJBA 4GI2A 5CDTA 3DR3A 1GZ3A 3F6YA 4JQCA 5A03A 3CIFA 2QX7A 2Y1CA 5CPFA 4DBVO 5A06A 4J4HA 4FOSA 1MUUA 4ZICA 3MTJA 4AJIA 4AJ2A 1UDCA 3RBZA 3RCBA 3TOXA 1PIWA 1TLTA 1Q0QA 1NQAO 3VKVA 1YDEA 3FI9A 2IXBA 3PWZA 4HY3A 1GQ2A 1G1AA 3M2TA 1DFHA 2D8AA 4FD3A 1VKOA 4I5EA 1N8KA 1U3WA 2GGSA 4IQ0A 4OJNA 1P45A 1T4BA 3HN2A 1LLDA 1K6JA 1FJHA 2RHCA 1K5HA 1YO6A 5DCWA 3S8MA 2FP4A 1BVUA 5BSHA 1P44A 3MJTA 3O8QA 4R4JA 3TZHA 5ITWA 3F1KA 3OMLA 1LEHA 4DA9A 4GGOA 4OXKA 4EDFA 1T2AA 1WPQA 2DKNA 4EW6A 1ZXLA 2O3JA 1NBOA 3RJ9A 4I9NA 3W6UA 2E48A 2Z1NA 1VRWA 3I9KA 3ZWAA 1DFGA 3PHGA 3K8ZA 5F21A 2A4KA 5L40A 4DYVA 3FNHA 4QFDA 3ONDA 1O6ZA 3MJSA 3RUHA 3GFBA 1ISHA 4W9NC 1LRLA 4J9VA 2AMFA 4CMEA 3PGXA 4NDNE 4RDHA 3RC7A 1MXHA 1L1FA 1EQ2A 1KEVA 4BMNA 4CMGA 1P1JA 3GN2A 3MWDB 3PYXA 2VN8A 5I8WA 4CL3A 5EL0A 3C3XA 4DLBA 4M55A 3CZMA 3PLNA 2G82A 4ONEA 3ZWNA 1HDOA 1N7GA 4IQ8A 1GPDG 2EF1A 2NQTA 1WWKA 2VOJA 4MVJG 4PG5A 4D3FA 4BQRA 2FR0A 1H9BA 4B7UA 4NJOA 3DBLA 3EY4A 3KVOA 2VTDA 3PZBA 4A03A 1Y81A 4Y6PA 2B35A 1FDVA 1BG6A 3F3SA 4CMAA 3VH2A 1A9ZA 1YBVA 1YQXA 2E37A 1ZJZA 3ZWMA 1E3EA 2I65A 3QVXA 4JBIA 3FPLA 2Y1FA 1X1EA 3FTPA 1P1RA 3LVFO 3Q1LA 1FF9A 5DULA 5JAQA 3HDJA 4F6LA 4WNIA 1JAXA 2WE8A 4JJGA 1P0CA 3QVOA 4ND1A 1Z7EA 5H82A 1YDWA 2WWRA 4RORA 2XPCA 3INTA 2OZPA 3D3WA 1U7HA 3NT5A 1LJ8A 4TKMA 1DC5A 2EHDA 5TF4A 2YQ5A 3QVTA 2FPPA 3K2EA 4GX2A 3TFQA 3CINA 2AQ8A 4JGBA 5JO9A 4J16A 2VRCA 1X7GA 2EGHA 2EJVA 3LT4A 1YE3A 2NUAA 4BGUA 4DTIA 1J5PA 2FZEA 2C0CA 4CM4A 1H2HA 1N1GA 3OQ1A 4R3NA 1BWSA 4F3YA 4IDCA 5ADHA 4J4TA 3GRKA 2W2LA 3NTOA 4R01A 4CLXA 2HQ1A 1F06A 2WYVA 4LVCA 1YJ8A 2H9IA 3P2YA 2VHWA 4R5HA 3ZV6A 4QSMA 2BFOA 2FPGA 4WE3A 4BO4A 2OBYA 1U4SA 4RJTA 3CMCO 1LBEA 4HV4A 4QQRA 3IUPA 1PGJA 2O3QA 4R54A 3H6KA 2Y99A 2BD0A 3DFZA 3ZN2A 1YOVA 1MXFA 2WMDA 2C82A 3E03A 3H7AA 5TJ9A 3AUTA 1ZSYA 2BKAA 3UF0A 2VT2A 1QLJA 4XGIA 1SOWA 3B1KA 5L7TA 1SPXA 1A4IA 4H16A 2PR2A 4KQWA 1RWBA 4DRYA 4NIMA 2D59A 4GKBA 2PV7A 4E5KA 2X0RA 1I2ZA 2YQ4A 1YKFA 3U3XA 5KJFA 3QLJA 1DC3A 2NQ8A 4OSOA 2YW9A 1XYGA 1LSUA 1M76A 2E4AA 3G1TA 3GDGA 4BQPA 5AXBA 2BLLA 1E5LA 3IJPA 1MGOA 3D3EA 1HYGA 1OI7A 5GZ1A 2PKQO 1V3VA 3JD4A 3QA9A 1N5DA 3PJFA 5KTKA 4G5HA 4INAA 5MDHA 2D5CA 4CR6A 1T2FA 1TT5A 3OHSX 1HSZA 1PR9A 1SBYA 3BHMA 4M87A 1QYCA 1LI4A 1U3VA 3PTZA 2RBEA 3GR6A 1E3LA 4ZRNA 4YJHA 2RHRA 4LISA 1NPDA 3H65A 3GUCA 1UP4A 4D41A 2Y66A 3TZ6A 3QVSA 1I5RA 3I23A 3H3JA 5L51A 1NR7A 3R6DA 4W9NA 4WPGA 1DIAA 5JDIC 4MKRA 4IS2A 3ZWOA 4OAQA 4XQ9A 3GHYA 1PWZA 1U5CA 3Q2KA 4C4OA 3BMCA 2BFAA 1XIVA 3KO8A 3GEMA 3ZWCA 5G4KA 5JSFA 5KVVA 3PHIA 2HUNA 3AJRA 3ZHYA 2VZ0A 1HT0A 1C1XB 1V6AA 4DIOA 5I7FA 2PKRA 4N7RA 5TC4A 3S2GA 2QRLA 3PDUA 5A3VA 2GZ1A 3UW3A 5KJCA 5GZ3A 3GQVA 1PJQA 4CM9D 2JCXA 1HDGO 5TS3A 1QORA 1W73A 3GG9A 1Y7TA 4MVJH 4NR0A 2X6TA 1Q1NA 3GNQA 2XAAA 3HDQA 2RIRA 4WLOA 4CM3A 3NJ8A 4P22A 4TRJA 3KXDA 3I5MA 2Q45A 2Y05A 3G3EA 2WTBA 3QP9A 1Y8QB 5L4LA 5LCXA 1DIHA 1HLPA 4NPCA 4N5MA 1DC4A 4DGSA 1E5QA 1HLDA 1VJTA 4ZHSA 1IHYA 3M6IA 5EINA 3GG2A 3V1TC 4BB6A 3WXBA 4AJLA 5TIIA 2P9GA 4P38A 1PEDA 1D1SA 5AOVA 1WMBA 4Z0HO 5G0SA 3W8EA 3ZWBA 3RUIA 2DLDA 2PKQP 4S3MA 3OICA 3TZCA 1R4NA 3N74A 4QT0A 2X58A 3JQBC 1GZ6A 3RKUA 1S6YA 4IGFA 1YBMA 2O2YA 2X9VA 5A4DA 5L45A 1LRKA 2WJPA 1TXGA 2JL1A 4WEOA 3C8MA 3OP4A 1LDEA 1NASA 4WKGA 4CL8A 3MOIA 5THQA 4EYEA 1M66A 3W8DA 2RH4A 4Z9FA 1DC6A 4Q3DA 1I01A 2CUKA 5EIOA 2VWQA 5A1TA 5L3ZA 3CE6A 3CH6A 1OBFO 1NX6A 3UFXA 5FI3A 2AQKA 2YV2A 2ZYAA 4LCEA 5CDGA 4HFNA 5JNLA 3JQ8B 2H1SA 1SEPA 3JSAA 2UV8A 1BRMA 3K92A 3RC1A 4B3HA 3TNLA 3GFGA 4W7IA 2DFDA 3JQAA 4HKTA 4J7XA 3WICA 4HXYA 4LRSB 3K73O 3DDNA 1NHGA 3ZW8A 4YAGA 3JQDA 5DZSA 4R68A 1FDTA 3RASA 1PL6A 2X0IA 5DDIP 2H6EA 1A9YA 1CQJA 1EK5A 4IPTA 4WLUA 2WD7B 4XDYA 5HM8A 5I9MA 3PQDA 2XXJA 1F0YA 3JQEA 4I9UA 1O94A 1JWAB 4FR5A 1KVUA 2FMUA 1QV7A 1ZBQA 1O0SA 2IODA 3DBHB 3UHAA 1K0UA 3WBFA 4D3SA 1X15A 3GZ4A 5ER9A 5I9LA 1YRLA 4L73A 5I9NA 1EK6A 2C29D 1QKIA 5JC8A 4J4BA 1P1KA 3DZHA 4ZVVA 1LQUA 2UUOA 4CLOA 4YJDA 1R37A 1U8XX 3ZU4A 1ZCJA 4ND4A 4BNLA 3DZIA 3U49A 1LSOA 2VYVD 4PG6A 4YJGA 1P33A 2IYPA 4XQEA 1KVSA 3GOHA 4AJEA 1GEEA 3Q0EA 4CMIB 1HE2A 3GAFA 5BR7A 4YT2A 3PXXA 2GPTA 2WM3A 1GCOA 1I3NA 1Q0HA 2VOEA 2YFHA 4PLCA 3QVWA 1BW9A 3S2FA 3KLMX 4DL9A 1JQBA 2WDZA 3QRWA 1U7TA 1ISFA 4QXMA 1JA9A 2QHXA 4HUJA 2VHVA 4FBGA 4IJKA 4HADA 2C5EA 4KQXA 1HZZA 1Z82A 4KOAA 2D5AA 3PLRA 1I2BA 4OOEA 5AQ1A 4FW8A 5JDIA 3H5NA 4JROA 4IJUA 4BKQA 2BF7A 4R1UA 4CUJA 1OOEA 2OO5A 5TRTA 4NH4A 3T4EA 1YB4A 5G0VA 4CLEA 4A2CA 5KCZA 1NYTA 3HB5X 3ANNA 4H7PA 3KETA 4JK3A 4UEKA 3LT2A 1WLYA 3WGIA 2O50A 1GD1O 4RF4A 5TSDA 3JTMA 5IDYA 4BO0A 4D43A 2DBZA 3VPHA 3NTRA 3U09A 4N5NA 4QECA 3OIDA 2Y1DA 4J6FA 1FDWA 2UDPA 4XJSA 2GO1A 5T64A 4E2WA 5JW6A 3GPDG 3EVTA 3LF2A 3MOGA 2EP7A 1ZKMA 2HMUA 3WYBA 3E48A 1XLTA 4BKRA 4KWIA 4IIVA 4GKVA 4YJFA 3UCEA 5L9AA 1B3RA 3OJ0A 2W2KB 4O1MA 4BNZA 3OA2A 2WE7A 5A9TA 5DOVA 3ZH2A 2Q99A 5IG2A 2Q2WA 3GRPA 4L8VA 2V65A 1YS4A 4PLWA 4FFMA 3OJOA 4BUCA 4GVXA 4G65A 4JNKA 1ZUD1 4YAEA 3SLGA 1W4ZA 3CZRA 4J0EA 4J7UA 1E1NA 2LDBA 4ZU3A 1QRRA 4DWVA 4IBOA 3ANMA 2ZKLA 3LDHA 3GHHA 4F46A 1HE5A 1K3TA 1ULSA 3JQBA 4CV2A 1GUZA 1C3VA 1VE9A 3CTMA 1D7OA 3D5QA 3FTNA 3BHJA 3GGPA 1GUYA 4HNGA 1U1IA 4EGFA 1I32A 2O2SA 1HSOA 1BGVA 1AHHA 2NACA 3Q6IA 1P1IA 1KEWA 1CQIA 1PL7A 1R0SA 4PGFA 1T2DA 3QE3A 1HDZA 3FHLA 3LT0A 1U9JA 3A14A 4YACA 4XYLA 2A9FA 1E3WA 4A10A 2DUUA 4XR4A 4MIEA 4WCFC 5I7EA 2VNSA 1B7GO 1ZK0A 3JQGA 3I1JA 3WIEA 2WEKA 3DOOA 4ZN6A 4GX0A 1ZVMA 3JCZA 2B36A 4XQGA 3JYOA 3FNGA 2ZJ1A 1NFQA 1GCUA 3IJRA 3PJDA 5KNLA 2GZ3A 3CMMA 2EW2A 1BVRA 2X5OA 1X7HA 1ADGA 3LSYA 2EWMA 4E5YA 3LU1A 1TA4A 1OC4A 2YJZA 2YDYA 2AG5A 3U4IA 4IGEA 1ONPA 1I33A 1IOLA 4GL4A 1GDHA 3H2ZA 3ZNNA 3DHEA 3K6JA 7ADHA 2VYND 5A9SB 1EVZA 3RWBA 3K5PA 3PFFA 4DYDA 4R41A 4UVIA 1PWXA 5EN4A 2ET6A 4U6SA 5KJ6A 4P4GA 2QQ5A 4A26A 1K89A 5AYVA 3LYLA 4MVJA 5ILGA 2DTDA 3IC5A 3ZWXA 1JKFA 3BYZA 5CPBA 4ND5A 4RQTA 2OL4A 1YBAA 3DC2A 5A3JA 1NFRA 2QZZA 2RCYA 3DXFA 3ZDFA 4ZRMA 1Y1PA 5G0UA 4U6QA 5BQFA 3WMXA 2EXXA 3I83A 4IZHA 1PS0A 3GH3A 2Y93A 1BTOA 5JC1A 4WGGA 3PHHA 4MIYA 2E6UX 3IOYA 2QRKA 1I2CA 1MG0A 2NU9A 2PLAA 4XRRA 4HFJA 1V35A 1ENYA 2DT5A 3H9EO 2D4AA 4E5MA 5A9RA 8ADHA 2NV6A 2ZJ0A 1HEUA 1RYDA 3AY6A 8LDHA 1EE9A 2NU8A 3EMKA 1XGKA 1XELA 4PZCA 1B2LA 3VKUA 1I3MA 3LC2O 1C0IA 1E1MA 1ZSNA 1RM4A 5AXCA 5EERA 3GMDA 1UAYA 4G81A 3VTZA 3SJ7A 1HDYA 1VL0A 1PSDA 1ENZA 3DTYA 3IDSA 5ENDA 1Y8RA 3SX2A 3BHIA 3O8QB 4CMCA 4CLRA 4ROSA 1M6WA 3GT0A 4CM5A 3PYLA 4DIBA 2XOXA 3EZYA 1NVMB 2JAHA 1JVBA 4PRLA 1E77A 1LC0A 2BHLA 5A05A 5B1YA 3H4VA 4UUNA 2X22A 5COQA 4IDGA 3HB4X 5CEFA 2HK9A 4BNIA 1XCBA 2PFGA 5JMWA 1SOVA
chains in the Genus database with same CATH superfamily
4RLHA 5I3CA 4O1HA 2KLHA 4FC6A 1J8QA 1UJMA 2GYUA 3P96A 4LX8A 1HEIA 5AXAA 4GOOD 4E31A 2HJWA 1YQUA 3BCUA 4DRXA 3MK31 1WXHA 2X0FA 3ME5A 4UU1A 4N41A 1VE5A 2RGNA 1OLOA 1GQYA 2VHXA 3FSGA 1B43A 1L8OA 1YCDA 3EVDA 4RGVA 3FRIA 4N7JA 1AKEA 5FL7A 4G4GA 4PYIA 3B2EA 3HNPA 3IESA 4ISCA 4EABA 1LNQA 1V8ZA 2FXVA 4M1ZA 2DPMA 3LHIA 3WJ7A 3AKZA 3I4CA 2QI9C 1BDIA 3SS7X 1XB2A 2DHEA 2R4TA 5P21A 2QZPA 1E32A 4R7GA 1UP7A 4JLMA 2HMSA 4YPFA 1FRZA 3HU2A 4EA9A 5IT5A 2R6AA 1R64A 3QKIA 4E4YA 3VR6A 2V7TA 4RX1A 1T2UA 2QE7A 4D4HA 4DCCA 4DIDA 1SIWA 3NWPA 3C3EA 1ZRNA 2W2TA 3EBPA 1KAGA 1NFFA 4LCJA 1SD2A 4B4DA 3THXB 4C7MA 2DEUA 1BN6A 2N42A 3D8BA 4ZI5A 1H05A 3WMFA 4CNQA 2O2HA 3KTOA 3T94A 1CERA 3TAUA 4EBFA 2LP4Y 3ZDZB 2MDTA 1IZZA 2RK4A 1Q91A 3MIZA 3FDXA 4HQLA 4ZAVA 1KDTA 2G63A 1KFEB 5DNUA 2FX2A 2H4HA 5J40A 1ZR2A 4UATA 4FFLA 1PJCA 3OLZA 1KZ9A 1T8UA 1XJCA 2TECE 3T9DA 4EL0A 2IEGA 1S96A 2GFQA 3DMPA 2X5NA 1P73A 3DTVD 2EC5A 3MVEA 4FU0A 1A4RA 3MJHA 4MJ7A 4TS4A 4Y3UA 2FUEA 1SR8A 1LW7A 3GAZA 4Y1GA 1YDHA 1NR5A 2HMWA 4WCFA 3PFNA 5SZIA 5CA1F 3TJZA 3QMPA 2ERXA 4R1TA 2CUTA 3RE1A 2YV1A 3D1VA 5LQAA 5JADA 3QJYA 4XLTA 4BKPA 3TW4A 3KQHA 1PW7A 3U4DA 1VJDA 2IDJA 2IPOA 4WADA 4C1BA 3U44A 2C5BA 1NNUA 2XUIA 2I6UA 3DVLA 3ZU3A 2I8CA 4G8JA 4B74A 4LTMA 5JAHA 1LTQA 5CAEA 4QFMA 1L8AA 1S01A 2I33A 5T5QA 3KWMA 3WRVA 3IMEA 2F3PA 1PEAA 2X14A 1TC1A 4GVLA 2CLEB 3BGVA 4HG2A 5I8ZA 2BDTA 1RPAA 1KSJA 2J8ZA 3AEUB 4N0DA 2P67A 1ZDMA 1PJ3A 3COYA 4XA8A 3RK1A 3WDSA 1N78A 3MUEA 3ZY6A 3QPCA 1OY1A 5ITVA 1ILEA 2JFQA 2I4IA 1AV7A 1SURA 3B89A 3O1LA 2QUAA 2WYOA 3CCBA 1D04A 2V6GA 3HY3A 1P0MA 4Y2QA 4YT8A 5LIRA 4QARA 1M8FA 5KYWB 3ES9A 4NBVA 1YT5A 3LDAA 1N9ZA 3H9UA 4JHXA 2ZRKA 1RKQA 4KXXA 2WPNA 1E79A 2H5EA 3Q87B 2J9YB 4R9NA 2BGWA 2C7VA 2COEA 1K27A 2HA4A 4IDPA 3FLEA 5JWRA 2F1OA 4KACA 2YY5A 3OZ7A 1KHHA 4BFTA 2Z4TA 3RHTA 1DJLA 2ZB8A 3RR2A 1OW3B 1K2WA 3ADOA 4KAAA 3L77A 2QUIA 1RLTA 5BN3B 4WFIA 4DLAA 2D1SA 4G24A 4JQYA 3TQRA 1U7XA 5ABPA 4CQMD 5KKCA 2JHGA 2IHYA 3SMQA 3BS4A 3QE9Y 4RTJA 1P0QA 1P75A 4F3TA 4TKUA 2ODBA 1FLVA 4MVJE 5JSUA 5GJBA 4XZ3A 1WXDA 1Q57A 2JCVA 4N9QA 1T2NA 5JBIA 4AROA 1CS0B 4NU0A 4EF6A 1QWOA 5IUJC 4LRWA 4BECA 3EFEA 1TQ2A 4CDNA 5K8JB 3VU3A 4LHEA 4DMHA 1IB0A 2IYVA 3IQZA 4L0QA 2RCNA 2JJMA 4IIXA 4PYNA 2DPXA 3OM9A 3VUEA 2F8MA 4HAZA 1N5LA 4X8HA 2CHEA 3EG5A 2J5XA 2ZQ5A 3QF4B 3WRWA 4CF3A 2OXIA 4ZHQA 4ZK6A 1VOTA 3JAKA 2FLVA 3WZLA 2IUEA 1L8LA 1NBIA 3CJTA 4A36A 3WAKA 4KSCA 2EGGA 2A1UA 3AESA 3DFIA 4M9CA 3LCMA 2I7TA 5GQSA 5A4IS 3BFVA 2DPHA 3F7OA 2RGEA 2XNSA 1MENA 1KAOA 4LOHA 3W2GA 3WLIA 4CCSA 1G3UA 1P0PA 3DUWA 3TDNA 1AS0A 3O4VA 2IZZA 4E2FA 4U00A 2E4XA 1U3UA 1XF1A 3UJ3X 1DHTA 5SYMA 1GL3A 4WZZA 1GO2A 1NAHA 2WJIA 1JP7A 2AX4A 2BGNA 2D2EA 3E0QA 3MQ4A 4JCOA 5H4HA 2G4CA 4E32A 4E2XA 1ZCBA 1XUOA 2UYOA 4GSYA 4BQOA 4ZO9A 3I04A 3B9QA 4CKEB 4UHBA 5AI6A 3FSJX 4GDMA 3AU9A 3GH1A 5DYWA 3SC4A 4UFPA 1EESA 1EWQA 1UPBA 1X1CA 4CM8A 4NRDA 2RH5A 5BSUA 2FB9A 3AUSA 3IAM1 2VNAA 3FM9A 3RJTA 2P9EA 4UBKA 2CXRA 1KVTA 4K28A 3MCUA 2YHSA 5IW8A 2CDCA 2IS6A 1BN7A 1YB2A 2Q9CA 1SHUX 3VM6A 2WSMA 1NJ2A 3WL3A 1BDHA 2PEYA 1B0UA 3LL7A 2G9VA 2Y1OA 3MT9A 3R7DA 5ITZB 2FPIB 3GB9A 6ADHA 1Y9ZA 3Q8WA 3SOPA 3U5ZB 1NR1A 1V37A 2FEOA 4YAIA 5D5HA 4D8XA 4KAXA 1T3SA 3BMCB 4HDKA 2Z3WA 4EUHA 4UQLA 5EJ4A 1C4KA 1W4AA 4DUPA 4IZ6A 5G4KB 3EVZA 3EYAA 3P5SA 2DR2A 3G89A 4FJ2A 2NO4A 2II6A 3DLPX 3MAJA 5AVSA 4LF7B 3V33A 1A8HA 1DXOA 1U8AA 4Q19A 1F7VA 3E81A 4EZEA 5CITA 2CJYA 2OV3A 3KV1A 4NNOA 5C35A 3BREA 4ALJA 1GTL1 2ZAOA 3I6QA 1RYHA 4I1VA 1KMQA 4M49A 2G4LA 1KERA 1VPVA 2NU6A 2NXCA 3F78A 3BXGA 3M4JA 2EBWA 3OA0A 1OV6A 3UMSA 4AVYA 4I9FA 1UBOS 3USES 1E66A 1VGVA 3LRPA 2XX3A 4E09A 3IXMA 4W7HA 2BBSA 4G0NA 5IM4A 1TRHA 3R4VA 4RF5A 4WX2B 4MS1B 3SF0A 2EWVA 4DBLE 4H31A 4R9UC 1RSZA 3BRSA 3U7IA 5D2CA 3KZ1E 1IY8A 2P2YA 2NV2B 3AM4A 3OOYA 4KU4A 4PZ9A 3V1MA 1X3LA 3WVNA 4ZCIA 4C4XA 5FBVB 3TFOA 5EPUA 5BT8A 3PQFA 2PS1A 4MLZA 4ZQEA 3OSUA 4ZC1A 5UKDA 5F35A 4YREA 3DKKA 2IUUA 3BMOA 3IAXA 1OLSB 3UG7A 5F7OA 3AY3A 1JAHA 2G5GX 2OBNA 4B6QA 3K5HA 5GJWC 4O33A 3HO8A 4L7QA 4LOAA 5I7OA 2V74B 4XIJA 3LFUA 5IAJA 5JQGB 3FAKA 5AK4A 3STYA 5DHPA 1H8EA 3K0FA 1JW9B 1X70A 2CC2A 4RMHA 2JFNA 4XXHA 3ESBA 3PC3A 4QDJA 3BWMA 3GAMA 5BUQA 4E03A 3TO5A 5EHGA 3M70A 2MMCA 3DAPA 3VDMA 1D0IA 1J9ZA 1GLGA 1E62A 4TVBA 4C4TA 4EZBA 4BJ5A 4DC0A 2Z9CA 2QM3A 2YFYA 2VA9A 2CYAA 4MQMA 4JN6B 4OBEA 2HRRA 2PUAA 5FH9A 4JJ4A 4MICA 4S1NA 4QXPA 3ZK8A 5LJLA 2D06A 3IELA 2FMIA 1QKJA 1W87A 5F2EA 2KB0A 2ZTMA 5AI4A 1EA7A 3OQIA 4MW5A 4G8CA 5H16A 3M6FA 2B2CA 1JWBB 1JJ7A 1FQKA 2X13A 3NM5A 2KW5A 1R8SA 3CJQA 2J7PA 4YP6A 2IX9A 1EVEA 2IIQA 3GVHA 2QWXA 5K3FB 4E13A 4QZVA 3FW1A 1Z4NA 3IS3A 4GICA 5C4IA 1RPJA 3KYDB 3OZTA 4ZVTA 4YT5A 1J9GA 4DJAA 3G0BA 1KFKB 1NN3A 3A9WA 4X54A 3PKZA 3A1CA 2CVFA 1QAMA 3C1OA 1EEHA 5MN6A 1RCTE 2FQYA 2J3DA 3ETLA 5B58T 3UUEA 2A9RA 1T0IA 2ZBRA 4ZD6A 1EJBA 2FSVC 2HY7A 2NVUA 2JJ8A 1TZKA 2Q49A 2VPXA 3IEIA 2RH9B 3P9NA 2DY1A 1IUPA 2V58A 3Q7IA 3KLNA 2A88A 1CQJB 1AN9A 1AM4D 1B1CA 3JQ7A 3MS2A 1XU4A 3HSSA 1FTWA 1YIAA 3TQOA 2R9VA 3VPSA 1JEQA 1EWKA 4KGXA 3RRZA 4NESA 1VLMA 5JAPA 5HK8A 3O8LA 1XDWA 2FWBA 2NSLA 2B20A 4IOLA 3NHZA 1EUZA 4FFPA 4Y2YA 4L9SA 3LOQA 4P86A 3ZCRA 2BGLA 2W98A 1CY2A 4J0GA 1B73A 3I73A 3V5NA 3OX2A 2NZ2A 4IL5A 2GPWA 1UXJA 3CUVA 4IDHA 3HVKA 1B0AA 1ZUIA 3L02A 1EKXA 3O4GA 4BZXA 4EPTA 5PNTA 1HYQA 1S2DA 2FPUA 2GN8A 4IDDA 2GZRA 1YUMA 2XXBA 1URPA 4FFWA 4QPDA 1T9GR 3NBKA 2YY6A 1Q3TA 1U1EA 1AGXA 2C4UA 1CUSA 3BSSA 1Y4ZA 4JLWA 2GEDA 4B44A 4B3DA 2FVYA 2JI4A 1M83A 4CTNA 4ZCRA 5C4MA 4B5KA 1T0PA 3DZBA 1Y34E 2WIGA 5KYXB 2QDKA 5AM1A 3K96A 2BRUC 1G5HA 1HBJA 3L1IA 4OA5A 4GW3A 1JTFA 1S3GA 4YXWD 1OX6A 1O95A 2V6FA 4RSHA 1BW9B 1N2XA 4E3ZA 2H8GA 4MP8A 4FXOA 2NYRA 1PR1A 2FOIA 3RUEA 4UMVA 1QVVA 4D8WA 5CW1A 3AOGA 1H0HA 3CB4A 3K53A 2BP7A 2P4QA 2CT8A 3T1VA 4BQQA 4DYHA 5A5DA 4C4RA 3NGLA 2FR8A 2WAAA 5ALTA 5HBRA 4JJ6A 1F3LA 3AYZB 3L0OA 4N03A 4R1SA 3V2GA 3BJIC 2H2GA 3CVUA 1A9TA 4L0CA 1HLFA 3LC0A 4C78A 4CMHA 1K1EA 4YP5A 4DILA 4EMSA 4Q0MA 5DRTA 1IHPA 1Z15A 3RFTA 3FYCA 4RY0A 4Y30A 2YNMA 3PUKA 2R751 1N8TA 4FP9A 3M3DA 2ZIGA 1WXGA 4XPIA 1ATIA 5EHNA 1X7DA 2Q4RA 1V6SA 3JVVA 1UBKS 1XL1A 2O8FA 1LY1A 1KYZA 1Q20A 2PBFA 3AHJA 4O6VA 4OH7A 4Y6GB 4ITVA 3QPAA 4LN1A 1UK8A 5HIKA 1RU3A 4B4WA 3CCFA 4G1EB 4V38A 5FOSA 5KYVA 3EC2A 4RTPA 4Q4AB 5B12A 5FFFA 1L7EA 2ARKA 1SCAA 2NZXA 1KP2A 3LNTA 1ZM9A 1IY2A 1CY1A 1SZCA 4MCJA 5DEOA 3TCXB 4E5DA 9LDTA 3VX3A 3AFOA 4JT9A 3QNWA 4YJFB 3H8WA 1QBKC 4GI5A 1X14A 5EP1A 2VUHB 4UFOA 2FPLA 3ZY5A 1O8CA 4WBNA 3NM4A 2BZ1A 1C0PA 2C20A 2EJUA 4NZZA 3ITKA 3UKOA 3L6CA 1Y4SA 1TMKA 4GIBA 5E7MA 1OZ0A 3R20A 4RXMA 4NK4A 2WVAA 1D7AA 2V7PA 1WPGA 2RG1A 1HE4A 2ACWA 4LYGA 4Z3KA 1YMUA 2LPMA 2P4HX 3MLAA 3L7NA 1QSGA 1MIOA 2ZAGA 3DP9A 1JJVA 3H8JA 3CZPA 2Q4EA 1TVKB 4H7DA 4N82A 5ALOA 4EG3A 2A33A 3G2HA 3U6KA 1RM5A 3GGJA 3VHQA 1RQLA 2XNDD 4LQ4A 3RRMA 1NRIA 1X2BA 3AW8A 4B7CA 2QTLA 1VIYA 1YRHA 3MF4A 3UHPA 1KJYA 1YR1A 4N76A 1YGYA 4RPLA 3LH5A 4JJ7A 3PEWA 7MHTA 2Y1GA 1XXHA 2Z3ZA 3LUDA 5ELMA 2JVIA 1ESNA 2OZLA 1T2CA 2PUCA 2PX4A 2Y76A 4LWOA 5EJ7A 3S8EA 4PC7A 4JZKA 1XU7A 1KAHA 2IYQA 2QJWA 3TINA 4OLAA 4L4XA 1IK6A 2C84A 2QJOA 4JJZA 5EZSA 1AKUA 1GLNA 4EI9A 5HR5A 4B3TB 5JJIA 3NAZA 4Q4DA 4QO7A 4UHHA 3RT9A 5HIIA 3DAGA 4CT0A 2B98A 1LLQA 2ZPUA 1VC2A 2Q1TA 3AEZA 3CUTA 3O4FA 4K6KA 1UFRA 4UNIA 3WK7A 1FNMA 1QE5A 3ICPA 1A8PA 3DVQX 3K0CA 5E4YA 2HNBA 2RKWA 3FNFA 1N8SA 3CR7A 4QRHA 1BKDR 4IFTA 2CMFA 1SC4A 4AF8A 2VF4X 4RK0A 5M04A 3ASVA 4BVGA 1ZGAA 5I01A 4E7OA 3PGLA 3O93A 1DKNA 1KAEA 5E1DA 4DLZA 3AI1A 1YV9A 4J3JA 1RS0A 1E1QA 1EZ1A 3L01A 4P32A 4RHTA 1F1BA 1JZTA 3QEJA 4C0JA 2M9MA 1SD5A 1P62B 3QMMA 2VDVE 2XXAA 3PC8C 1X80B 4I81A 2XUFA 4V2UA 1UPCA 3QBJA 4LMAA 3IGFA 5HOQA 4WW0A 2BMEA 4TTPA 4AY4A 1YZVA 4D7AA 1M2KA 2ZIAA 1UM8A 2HLDD 1BH6A 1I30A 1JB9A 4YRQA 1U9IC 3DZCA 3NQ41 3GJTA 4IFEA 2YWRA 1J20A 1DX9A 5EJAA 4TS9A 1Q22A 4UXHA 1NP6A 4TTRA 4NXMB 4QPZA 1QC5B 3VTFA 2QLLA 1MLDA 4ALIA 3B1ZA 3EHDA 4RAOA 1G60A 4ALNA 2UYHA 1ZMOA 2AOUB 1TIKA 3UG6A 2VAVA 3MJVA 2OB1A 1I7SB 1ZK4A 1K6IA 3R5XA 5BNTA 5IXSA 2ZCJA 4Z4HA 1O4VA 5DW3A 3EQ6A 1G63A 3A10A 4LY9A 2F90A 1B14A 3FBGA 3LPAA 1ADYA 1YD7A 3P9CA 3QGMA 4HJRA 4J6EA 3RFCA 2CVHA 3B1FA 4HAUA 4GP9A 4LY3A 3DM9B 4OJKA 4AJKA 4HZUA 3OIFA 3ZHXA 4O63O 1XOIA 3WGHA 4OP3A 3S2IA 4RK4A 3EGIA 2ZT5A 3SJBA 3NHUA 4NFHA 4J2HA 4PLYA 4CI9A 3P97A 2ZROA 2ANCA 2Q1XA 2Q3CA 1CB7A 4O3FA 1EXNA 1R10A 4YV1A 1RJEA 1PR3A 2EG9A 2XWPA 2NYVA 1QS0B 2FKNA 4HCJA 2RGBA 4MX8A 4Q39A 1PI3A 1JT2A 2OAQ1 3V6LA 3UXHA 4NBNA 3P2MA 3ADPA 5E8RA 2ZREA 3LUCA 3PP8A 1YVUA 4WEQA 4GS5A 4ER5A 4KFSA 4F91B 3C6KA 5EJIA 2GLUA 1JFLA 2H7XA 2NZ8A 3L05A 2ILTA 4PHCA 2CKMA 4UULA 4F56A 1NIPA 1V4NA 1KO5A 4NMLA 4AY5A 2PBLA 1YMQA 4C43A 1ZD4A 3C5CA 2F1RA 2M6KA 5KTOA 2B8WA 1ZL2A 4Q9HA 1YKGA 2QRHA 2HMAA 3C1UA 2PZGA 1YQQA 1DQRA 1CRWG 1YZUA 4N1AA 1JEDA 2MYTA 3PFIA 1KJ8A 1Q14A 4GMXA 1L9XA 3IALA 1XVTA 1E2DA 3PQ4A 1H4QA 2GN2A 3A25A 4C08A 3EXIB 3INRA 4B32A 2W6JD 1EVIA 3AZPA 3IEPA 4UPVA 1G291 1MKYA 1JQEA 4ZTUB 3VVLA 3RM3A 5IFKA 1YFJA 4KGVA 1NVBA 1GV1A 2ZCUA 2H59A 3FGNA 2AQIA 3G17A 3OQ6A 1ZR4A 3W2HA 1VKRA 3QFTA 5TX7A 3I52A 4U2KA 1Y1SA 3BWYA 4H3SA 1O1YA 3L7AA 1CVIA 4KWEA 2A6PA 2FUNB 1RJGA 4K9QA 4WASA 1N2EA 5J59A 1YBHA 3COWA 1GIAA 5JYEA 1GVNB 2CK3A 1RE1A 1XT6A 1EXVA 3LOPA 5EIXA 5ARBA 1P4AA 4HNRA 3TRIA 5BNWA 4ARCA 4HPJB 3HRIA 4PZZA 1QDLB 1C5KA 4C05A 4KXYA 3NHYA 4J91A 4EVSA 2ID8A 3UCXA 1OBOA 1QGYA 4LK2A 1IXYA 2XYHA 1JXOA 2J3JA 1E1RD 2RMKA 1WU8A 3KQVA 3ODGA 1ZX1A 2AB0A 3P94A 4Q1VA 4BMXA 2OWEA 1V7PC 2BFNA 5C80A 2GYVA 2HJSA 2YMMA 1H0RA 4N49A 3IL2A 3ZDCA 1S1CA 2Z95A 7REQA 2AFVA 2ZT7A 1ELOA 4N39A 4AJNA 5I7WA 1H1LA 3OZUA 4JLUA 1GJRA 1UWCA 1II9A 3HP1A 3R3HA 5LA6B 1VLJA 3FTEA 3B3QA 4YUYA 4XVCA 1ODKA 4D9CA 1MB9A 1E5TA 1MX1A 3VXKA 1L4BA 2Y1KA 1OT5A 3M1YA 1GZSA 1I7NA 1K7FB 1L5WA 1OLXA 1TJ5A 2FX5A 4QXAA 1H5QA 2D3TA 4QU0A 3QA3E 3TD6A 4O4LF 1PP4A 2I1LA 3N5CA 4G67A 5LQUA 1EGQA 1KMIY 4GEGA 4C7OA 1R4ZA 2XDWA 1TOAA 1B6RA 2HM7A 3K8QA 5FKJA 4GM0A 5CH8A 2IY8A 1VRVA 1K6XA 4DLUA 2GI4A 3GZNB 3UWMA 5TVGA 1ZFNA 1UH5A 1KBZA 1RM3A 4ZDJA 1V11B 1FP6A 3GFOA 4RADA 4W5WA 2IH5A 1UADA 4UTRA 1V41E 4IHAA 4M46A 2NNWB 3WLKX 5IVKA 1ZM3A 2GHQA 4DQ0A 2RI6A 2XQGA 1Z6TA 3W6OA 1XMJA 4I8XA 5AESA 1F14A 4JASB 4X90A 2HHAA 3N05A 3B1JA 4M9ZA 3WLOA 4AULA 3CHYA 1H69A 2WT9A 1SVKA 3HO6A 4H7EA 3HJHA 1UKAA 2J5QA 2NO5A 3HN6A 3MSXA 1L5VA 5FPYA 3KJHA 4XX0A 5HILA 3SJCA 5HXAA 1N5IA 1RQPA 2B34A 2R8XA 3I9OA 1J8YF 2YZKA 2ZSEA 1JEOA 1PHPA 5AJTA 3V8VA 4ALMA 1R50A 1N1EA 3RADC 4B7XA 5FQNA 2GBGA 4CU2A 2B3TA 3K9NA 4G37A 3BAFA 3L1JA 4NDZA 1M2VB 3ZQ4A 2WF9A 4HEA1 2AXQA 5GIPE 3EFOA 3LC1O 1O6GA 2ZWPA 5HZKA 3C3MA 1L5HA 1WVIA 2YJ3A 2DYKA 4F9TA 4MV8A 1SA0A 2O20A 4BMSA 1ULBA 3K15A 3DDSA 3QUTA 4I08A 3W90A 1E7RA 1HT1E 3KBOA 3B38A 3CLRC 1U2SA 3BICA 5I9BA 1WAMA 3W5JA 2DFVA 1BDJA 1M75A 2ZBVA 2ZE6A 2WTMA 3B51X 1YACA 1QIFA 2O5RA 1C29B 3OBBA 4ZOAA 1JFSA 3AVWA 4DIUA 1TNDA 4GUAA 5TV2A 3D8TA 3VKHA 3OUZA 3W04A 1NF8A 3ZKWB 2DFNA 1P74A 3HA7A 4LSZA 2C5AA 5LMCA 5FBLB 3FWYA 2AK2A 2HDWA 4OO3A 3P7MA 1DBQA 4GYYA 1K97A 4NECA 3V3KA 4CV0A 1G20E 1G8PA 4ZQFA 1UP6A 1UXIA 2RHMA 1DDIA 1PTJA 4M53A 2PK3A 1KRHA 2F3TA 1YRAA 3BMQB 4PLTA 3KDPA 2AT1A 2WKSA 2IDMA 4PE5B 2OKCA 3NC4A 3AFNA 3PBKA 1US8A 2I7VA 2XE4A 4O2BB 3NFYA 1MX9A 1LPBB 3PIDA 5K6TA 1F2TB 3DBRA 5M7EA 2Q27A 3GA7A 4RTOA 3ZJUA 2O7SA 2OQVA 1NLYA 3I6IA 4C9BA 3AGPA 3RROA 3TQHA 1EG2A 3PF8A 2XA9A 3LX6A 4RVGA 3WQRA 4BVHA 4WKPA 1X1DA 2FZVA 2FMFA 3LQ1A 4XSHA 1QYXA 3PEFA 4LQLA 4Y2JA 2REQB 3DNPA 1FBNA 3DOCA 4QG3A 1SU6A 3ZHVA 2B4QA 3I9JA 2RI1A 3MXOA 5ECDA 4I46A 3AP3A 2WT8A 1TF7A 3PNKA 1V0JA 1GSHA 2OD2A 1AUPA 1QRTA 3I8OA 3NRCA 3WB1A 1XD2A 4P0PB 3P19A 3DOUA 3FDIA 3M2PA 1T1JA 4F9EA 1Z4MA 2J09A 4HXGA 4ZZ0A 2CVQA 5JH7A 1J25A 1FXUA 3FDZB 4DSZA 2PANA 3EXEB 2VPQA 4TV8F 4HRXA 3MRVA 2SBTA 5FPQA 1FX1A 1SZJG 1T3TA 2HX1A 1PFWA 3FKSA 5FPTA 1NBME 3SHOA 1J5EB 2OFFA 4B75A 2DLNA 3WRYC 2BKXA 1RXUA 3SLKA 1U28C 2PJZA 4GPBA 4G89A 1E2EA 1SCIA 1ZM2A 2I3ZA 4PIMA 2IZ1A 2KSQA 3C4QA 4F12A 4YVFA 4IV5A 4JYMA 1LC3A 4REQB 1J49A 4Y9RA 4BVEA 4ETWA 3JQCA 3RUFA 4CFYA 5ILQA 2FRXA 1WDLA 2Q5HA 1L1EA 4B71A 4BUZA 4GH5A 3CF0A 1A50B 1OZAA 1UKBA 1JLLA 4DQVA 3BOSA 4HWKA 4XVHA 3TE7A 5J2TB 4NOMA 3G2KA 3M0EA 1AE1A 3PNQA 4IKOA 4CCYA 3O26A 3TZEA 2FZWA 4EAAA 5JMOA 1HRDA 2ZI4A 3DD5A 4FGZA 4OSPA 3DZDA 3F7NA 4IYRA 1DCTA 1NMXA 2CUNA 1Q44A 1PYGA 5EWJA 2GPBA 2WYUA 2IZ5A 1XWIA 2Q29A 4EHLA 1JR3D 1SRQA 2VP3A 4LYHA 2P3SA 3PU6A 3I3OA 2BM9A 2WAMA 2ZYDA 3KHSA 1ESMA 1XKQA 3QMVA 1BRTA 3N59A 3QI2A 1TD1A 4C2AA 1YWGO 3L8CA 1OAAA 1U0JA 4AD8A 2HNAA 3NDJA 1H0SA 4G9BA 3WXMA 4COKA 3VYUB 1G98A 1Y3DE 4HRAA 3R0XA 5KX5A 4TTAA 5AQEA 4YTEA 1ACJA 1J21A 2BWJA 2VLBA 3DCIA 4YR9A 4L3VA 2YJ4A 2QBYB 5KNDH 2H16A 2ORED 2A84A 1AKTA 1HM5A 3NC0C 3Q3CA 4JB0A 4FB5A 1DAIA 4KBFA 5LLTA 3IVAA 1QLWA 1A96A 2KPOA 1SZPA 3OQMA 5CT4A 4EG7A 3WJ2A 1A5SB 3O7MA 1QPBA 1SXJB 1GL6A 4TTQA 3BB3A 3GELA 6LDHA 3CX6A 4RPIA 4YI3A 2CFIA 2B30A 5FP0A 5HZGA 3UB4A 1KETA 1CYEA 2YUTA 1FP7A 5BYBA 4P2BA 2KLBA 2ERCA 3SZGA 1XX6A 2ZRDA 3BK7A 3ND6A 3VGPA 3VDNB 4ETMA 2LIPA 2C4VA 4MR8A 4MV1A 5AJVB 3C74A 3GNSA 3IIKA 3OZDA 1GLVA 2Y0EA 1UXGA 1AK9A 3GARA 3KZMA 4FR2A 1NBAA 3B1VA 1EK0A 4MB0A 4EECA 2UYCA 5LDHA 2JAQA 2Z2JA 4K1XA 5EKTA 3TQIA 3JZFA 1X8LA 2C1EA 1B8UA 4FOOA 2Z2YA 3M5DA 1IDOA 3U7QB 3ZD8A 4EQ6B 1JZQA 1WB4A 4P2GA 5F7JA 1FZTA 1XDDA 3ADDA 3NIDB 2BUAA 1TVEA 2FEWB 4UE3S 2XWJI 5EGNA 5IDXA 3GLSA 3JRXA 3OF2A 1M2GA 5AK3A 1A71A 2POQX 4KKXB 3UO8B 3DTVA 1RHRA 4I4NA 5I8PA 3E70C 5U4XA 1T3GA 1D1PA 2FMHA 3VYRB 3BD9A 4W4TA 1AOXA 2CFTA 2RI0A 1HG0A 2XJ9A 2XKKA 4ECAA 3K70B 4CT5A 2ZIEA 2PRYA 3U4MA 1YZTA 1DKMA 1N92A 2Y8EA 1LDMA 3QVLA 4XJXA 1XWFA 2CF6A 4BB5A 1WG8A 1ZYUA 2UUBB 2QRZA 4WKCA 4KMSA 2ZGVA 1CP3A 1UMBB 2FYTA 4AJ4A 3IHTA 5U1PA 4O2AF 1GXSB 4YASA 3G2OA 4EBBA 2Q9UA 3GLFE 4DA7A 2IUTA 2JBAB 3PE6A 3W5IA 5EZYB 5A4MS 3O4HA 4EY5A 1E3SA 2Z08A 3GF4A 1ZS9A 1HKHA 2A5FA 2ODPA 3Q72A 4XWYA 5JMPA 1DX6A 1GTMA 3G8YA 2ZRMA 2CXNA 4FFNA 3ER8A 3U9LA 1CJUC 4DV6B 1A77A 3KU4A 4BU0A 3TQTA 2ABWA 2GZAA 3QE2A 1FL9A 4MXDA 2Q0SA 1I0LA 4X97A 5G1NA 5C34B 3TLEA 4C7BA 4HTAA 5EIEA 1Y6FA 3ICQB 1CF2O 5E3JA 5IZCA 4WJZA 3FTFA 3HN7A 3DWFA 3G2QA 1WCIB 2FRDC 4DLLA 1IZ8A 4NP6A 4YCSA 1QCYA 5IVIA 2XV1A 2Q4TA 4KYUA 5D6NA 2RB5A 4RLSA 3ZDQA 2Q0XA 3H2GA 4YCMA 1LF5A 4KBYA 1HE8B 1U7UA 1LTHR 3B60A 4K6OA 4XYEA 4ZQGA 3RQIA 1LS6A 4BJHB 5HW0A 5KNBD 3M89A 1QHFA 5CJPA 2HWYA 2LRHA 1TZBA 4EY3A 1J0DA 3G2IA 1MB4A 4LJ5A 4LV8B 4IGIA 4Q9KA 2OV6A 2BFDA 1CDOA 3PEVA 1I6MA 3BIWA 4GDFA 3L8EA 4YRKA 2R6DA 1NIJA 1T9KA 1U9YA 2RFLA 1UL1X 2JDID 4TQUS 1MABB 5IZ4A 5JCOC 4S2UA 4LGYA 2P11A 4X64B 1LZLA 2H7YA 4KMMA 3V2IA 4DVGA 5L3QA 9ATCA 4Z49A 5KOYA 4QTZA 5E9WA 1U2GA 4WTOA 2DJIA 2VJNA 1RVV1 3HP7A 3OMXA 3Q3JB 4ILKA 4DQXA 4U2CA 4JX9A 3JD3A 1JG6A 5BOSB 1ZKDA 3A7DA 5DTQA 3KJGA 3B3FA 4TSKA 2F67A 1L7NA 3RB8A 3M4ZA 1DXYA 4II2A 2D0OB 3AG6A 5IKXA 3FMVA 4DMKA 4FSDA 3LLSA 4RQBA 1H2BA 1Z18A 3UJ7A 5I9IA 3ZDBA 2XHEA 1Z4PX 2QMQA 4LNUB 4I55F 1CC1S 1R5NA 4RF2A 5GJCA 3VC7A 1N5JA 1N7IA 1F48A 1J2YA 4PSUA 2MSWA 4N40A 4I5IA 2O8EB 1R0XA 1RLOA 2VZ9A 4OJQA 2BI8A 1U1GA 5KQRA 5G02A 4YJGB 1SRRA 3CRQA 1LKZA 1VZ2A 3D3QA 4RDIA 1ZNQO 4JOBA 2W8BB 1VA4A 3E8MA 3KSUA 4UM7A 5BWOA 3VU0A 5J2UB 1RM0A 5IJ0B 2BR5A 1KDRA 1Q7RA 4I6EA 1EM8A 1OSNA 2HEIA 4NCJA 4PLGA 4DR3B 3VMFA 1B6GA 3E27A 1ABFA 1DQZA 4ZCQA 3TSYA 1MB3A 2QM8A 4EA7A 2GAIA 1RMYA 1TYCA 5K8CA 1DBSA 3A1FA 4K26A 1VMEA 4R2IA 4EG5A 3Q8KA 3WGMA 3FX2A 1Q0ZA 1DO8A 1ZGBA 4O4JF 2F9FA 5IYZB 1NM5A 2J41A 2YH2A 3TOZA 1ORDA 3T38A 1Y3BE 4HQNA 3JAMA 3WSVA 1QQ6A 3ZWVA 4MR9B 4FD2A 1WS6A 4KPUA 2WWXA 4EB6A 1L4KA 2OGUA 1EDOA 3KQKA 2WMYA 2D2VA 4OPMA 1PQYA 2XZLA 3GEHA 2JFBA 1HDCA 2ZSFA 5H5JA 2WWIA 3WKCA 5L7WA 4HLNA 2OFXA 1BE1A 1Z6ZA 1C9EA 1ANKA 5B2FA 1GN8A 2WSSD 1QDEA 3CU5A 3HHPA 3EHEA 3NEJA 3FG9A 3OWOA 1KO4A 3G2NA 4WWHA 5EIAA 3SSNA 1IPFA 2QKYA 2OZEA 3BG5A 1AS3A 3WMRA 1YJBA 2NO9A 3EOAI 1EXWA 1ULTA 4ON9A 3OETA 2JJYA 3RRNA 3UH1A 3BSFA 1AMUA 4KYIB 2J5RA 1P7CA 3Q11A 5EC8A 2WILA 1GPH1 2MCFA 1Y8QA 2H5IA 1Z35A 3U0BA 3ENKA 5AI9A 1P5HA 2RARA 2BFPA 1RJ9A 4CQMA 4ENTA 4HP8A 4MGIR 1TW2A 3K09A 1Z7WA 1LBIA 4CTKA 4RCYA 1V5EA 3FCCA 4YRGA 3A7EA 2ZBFA 4TPKA 4X65B 4DR5B 5ALNA 3VU9A 2BV3A 4Q6BA 4ARVA 1RAIA 1ND6A 2HWXA 1RJWA 3GP5A 2AWOA 4MKFA 1V8BA 1EINA 3R41A 1FMLA 3WLEA 1NLMA 3V9AA 3AYXB 4DDHA 3WK9A 4CFZA 1CJBA 3GXOA 4DCSA 1GHTA 1OVGA 1L3CA 5LLSA 3EXHA 5GWXA 3TLGB 5F3RA 1Y5RA 3OG9A 4EZIA 1D0VA 1EX9A 3D0KA 2VUUA 1N1DA 4NJMB 2C03A 3DLBA 2W43A 1L3BA 4A6EA 1XEWX 1G21E 3NBQA 4Z53A 3LFHA 4IQGA 3L4SO 4RVOA 3OZXA 3LLUA 3W06A 3EA5A 3U4QA 3TR5A 3MWEB 4DWOA 1NMEA 3SEFA 1EFDN 4DQUA 1JVSA 1J4AA 4KHPB 3DL2A 4DQKA 5BN4B 2HBZA 3ZJVA 1GGHA 1Y9EA 3IAUA 2I3GA 4QHTA 1Z4IA 4RD6A 5K0FA 3G8DA 1T8YA 2O3UA 1ODIA 3P26A 4Z1MD 2V96A 1DJNA 4Y9UA 1EUYA 1ODJA 3GJXC 1IN4A 4WUVA 4P53A 2O54A 3AIKA 3L7IA 3ZTWA 5C8YB 2I71A 3LP6A 5EUQB 1J2TA 3E9QA 5FQOA 2ONCA 3SXPA 4RY9A 4B7AA 3VZSA 2Y9MB 1O89A 3HG7A 1E7MA 1M6YA 1R00A 1ZCAA 5CTJA 1Z06A 3OE7D 1UOOA 4AYXA 1R0KA 4UD6A 4A27A 4CF6A 1X42A 2ZBEA 4NBUA 3WL8A 3EBLA 1IIBA 4YS6A 1QIJA 1S3SA 4N01A 4OUDB 1PRYA 1Z2EA 1NKVA 1Y5LA 4UM8B 5B37A 3JQGB 2RJ3A 3FD8A 4MUEA 5CNMA 1I80A 5CCXA 1J8MF 4N8EA 4OHXA 4EP1A 3P0EA 1LDGA 1IUNA 2DM6A 3DONA 3UGQA 1UBHS 1UT6A 3ZNPA 1V16B 4CKCB 2XYVA 4RZHA 4EHHA 1LV7A 2BL4A 2VZLA 2B37A 3N2ZB 3W7BA 5LXTB 1LBHA 2WMNB 1TVMA 1A0OA 1UZMA 3A4TA 4MVJP 4NFSA 5CT9A 4ARZB 3OP1A 2OCKA 3LY8A 2N1MA 4BKUA 4BQEA 4DV7B 2FUG6 4JDPA 2Q1SA 3I28A 4K87A 4G0XA 4Z7OB 3P2KA 2PZBA 3FF4A 1CQWA 4MVWA 4XUGB 2EX0A 4GZ6A 2YKGA 4P3PA 3ZIAD 3ELYA 1IATA 1TIBA 4RPJA 5AHWA 1KZHA 5C1OA 5IABA 3BL5A 5LBUA 1Q95A 2FQQA 3TUJC 3TTXA 1NQTA 3MTDA 1G0NA 4X44A 3OTIA 3BULA 3OO0A 4BPRA 2W2NA 4UQOA 4P0QB 1SCKA 4O4IB 3R9IA 2PGOA 4ZVRA 2VDRB 4CMIA 3KEQA 3TGPA 2O8CA 3ETHA 2OPBA 3WMGA 3BJMA 1YR3A 1W4RA 2FRVA 1Q77A 1UDWA 2LWIA 1SELA 2VPPA 2WKRA 2ZSUA 4RCZA 3A27A 4QQKA 2XB2A 2I4NA 2JLUA 3DAFA 1DQPA 4PSVA 2ZE7A 3L49A 2HCTA 3PZRA 1BYUA 1G20A 1XP8A 2I22A 3HUUA 3VPCA 5KOHA 3R9WA 1BXGA 5TQJA 1GPBA 4WOPA 3PXCX 4D45A 3IODA 1ZIDA 1I0ZA 2ZJ7A 3HVJA 4HMPA 3U1VA 3D6NB 5REQA 2JGIA 5IJXA 3WGTA 1RHMA 1QH1B 3MGGA 5IDQA 4D9MA 1C2YA 2QD5A 2ZI5A 1XZMA 4FSHA 5TGDA 4YONB 9LDBA 1I14A 3LP8A 4JAVC 3EZLA 2ZYRA 4JMPA 4LWQA 5TMDA 3ZXUB 2CYBA 1NN0A 2ZEJA 3GC6A 4UCFA 2JFOA 4UVEA 1KEZA 2XUQA 1QYRA 1JR3E 1KKLA 2ODEA 2ZB4A 3GLGB 2JD1A 3F46A 1P5RA 3RIHA 3J7AC 2R6JA 1PVDA 4JUFA 4YQYA 4M8NE 2J45A 4S04A 1JN0A 4QX6A 4NJEA 1W5AA 1IM2A 3PHCA 4F1KA 1RT9A 4FI3F 2PWZA 4KE9A 2N3ZA 1Y3FE 3ROKA 3FTDA 3PHJA 5CFOA 3DBVO 3ZD7A 1FU4A 4RDXA 1U2DA 2CCGA 4GSLA 1PFGA 2JH3A 4O2LA 2GZMA 2C61A 4N8SA 5K4AA 3Q12A 2BMFA 1ZJ6A 3CB2A 3UTCA 2H1OA 3IEXA 1J07A 2W2KA 2R5NA 4UHKA 2QUJA 3ESXA 3QWIA 1PFVA 4K03A 4TVSA 1J00A 1V48A 2GM9A 1SCQA 1KI7A 4EG1A 3SD7A 4DNFA 5SZHB 1R0LA 3WLPA 1NBMA 1SXGA 3C85A 4U9UA 5IC4A 1JSXA 5FI5A 3ZDRA 4D92A 2C5FA 2I2WA 1BO6A 3VHXA 5IEJA 1P8AA 2I3AA 4OQNA 1PK7A 3MSCA 1OBVA 3G02A 3V97A 2VHZA 3ANLA 4H7KA 4J75A 3ETGA 4NV3A 2P3LA 4NBTA 3E3NA 4QD3A 5IXJA 2QSZA 1FXWA 4OQXA 3HGMA 4KXVA 4ZAFA 3REFA 4B8YA 3ZGNA 2JH8A 1CVLA 1JPUA 3H6GA 3RWOA 3RT7A 3NC1C 1C1HA 3NVKI 2F6RA 2XYGA 2BEWA 3TPFA 1L9KA 5FIUA 3UJPA 1PKXA 3LGXA 1F51E 4INOA 2O2CA 4F60A 1Z6PA 3CLVA 3I72A 4P92A 3QJ5A 2ZFUA 4DIFA 2CXOA 2JASA 5JCJD 3FCYA 4CEHA 3GEEA 4R84A 4M0LA 2OGWA 1JZSA 4I1SA 4C2TA 4DQDA