2EKPA

Structure of tt0495 protein from thermus thermophilus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
238
Chain Sequence
b'ERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title The first crystal structure of NAD-dependent 3-dehydro-2-deoxy-D-gluconate dehydrogenase from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 85
structure length 238
sequence length 238
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ekpA00
3P2OA 5LCXA 2VYND 1QYVA 3DC2A 1LU9A 2VUTA 3LC7O 5AOVA 4PG5A 4HNGA 2P5YA 4XGNA 4RF2A 4IQ0A 1RM0A 3CTMA 1JWBB 3L6EA 4TQGA 4W7IA 5I7SA 1YB5A 2PA3A 3DAPA 5JCJA 3AI1A 2LDXA 2C7GA 4U0JA 1QKIA 1ZSNA 4AJPA 3EK2A 3NTRA 3BMQB 4R3WA 3TDKA 1LI4A 4BMNA 3MOGA 4FIZA 4FN4A 5JLAA 1Q7CA 5ILOA 3VZRA 4CR8A 4UEOA 3COSA 2YFHA 4FC7A 4ND3A 4L4XA 1CQJA 4MP8A 2X9NA 1LDEA 1AUPA 1YB4A 1CERA 1L7EA 3LF2A 4WE3A 1EVZA 2OORA 4WK6A 1GPJA 3U09A 1E3WB 2CVQA 1P1RA 1O94A 5CG1A 3Q6IA 3D0OA 3QJ5A 4HX5A 5DCWA 3UVEA 3ZWOA 2C20A 4BHTA 5C5IA 4IDBA 3WXBA 2YYYA 1I30A 4KDFA 2VHYA 4KUGA 1NQAO 1SMKA 2ZYGA 1DPGA 5DF1A 1DFIA 4PCVA 1Q7BA 2Y1FA 1WVGA 3EMKA 3ITKA 4WEOA 2DTEA 4OXYA 4YRAA 2W2KA 1NX6A 2HK8A 3NT5A 3RASA 1IYZA 3C1TA 2JAHA 4I08A 2D5CA 1C1DB 5IDWA 4E0BA 3F9IA 1P77A 4ZQEA 2Y05A 3OQ1A 3GY0A 4YQZA 1EK5A 3LQFA 2CMDA 1N7HA 1SEVA 4JX8A 4F6LA 1KVUA 2C2YA 1U7HA 3LC1O 4M89A 9LDBA 2VHWA 3D4PA 4RVSA 1PL7A 4CUZA 5F3RA 2IRWA 2HAEA 3O8QB 3H7AA 1X1EA 2ZIZA 3UAGA 3ST7A 5JO0A 1PJ4A 4Z9YA 1T1SA 2EP7A 2EIHA 1A7AA 2JAPA 1I3NA 2D2IA 1E7WA 4RGBA 4IDEA 1P44A 1E3LA 2W2LD 1G1AA 3IUPA 3MJTA 1DFHA 2PNFA 1FMCA 2D5AA 5L3ZA 3I5MA 4GGPA 2VTDA 3Q11A 3VVBA 4CMEC 2Q45A 3ADOA 5A04A 1PZHA 4UULA 5JAZA 4CMAA 2DM6A 1ISHA 4E2ZA 1YE3A 5KVVA 4DMLA 4XJSA 4BUCA 4K9DA 2ZYDA 5T8KC 1XLTA 1VJTA 5B1YA 1NASA 4RORA 1KEWA 1PJCA 1TT7A 1UDAA 1MG5A 2X0IA 2YV3A 4YJHB 5TSDA 2EHDA 2NLOA 1VSVA 5CPBA 4ALKA 1FDVA 2AQ8A 2JCVA 4GWKA 2X6TA 3TF5A 4ITUA 3GEMA 1I3LA 2PGJA 4N5MA 1JLLA 3GR6A 3PQDA 4NFHA 4NG5A 3WMXA 2HMVA 2O48X 2CDBA 4Z0HO 2FN7A 1PJLA 3U4CA 4YT2A 5KIAA 2Y0DA 1RJWA 3HB5X 2FR8A 1KVRA 3PHLA 4O5OA 1HZZA 1T4DA 1E0DA 4IUYA 7ADHA 3HN7A 4YDRA 5HTOA 5T6BA 1N9GB 3ZDFA 3K2EA 1ISFA 3TN7A 4MIOA 4TKMA 1WDMA 2HJSA 4BNVA 1E7YA 3ROQA 4XGIA 5JBIA 1X7DA 5G4LA 5G0SA 3RJ5A 2C2XA 1GZ6A 3ZWVA 3SX2A 3E48A 3WYCA 1F12A 1U3UA 3MWDB 4I5EA 5BT9A 2O3TA 4EUEA 1BGVA 3QSGA 4G81A 4CLXA 3GN2A 1ZSYA 4BIIA 1YVEI 2ZTVA 4R1SA 3KM0A 4UVIA 2UDPA 3ETDA 1U4SA 2HJRA 4WCDA 1OFGA 5JDCC 1GPDG 3ZU2A 3AU8A 1PL8A 4Z3KA 2D0IA 4UREA 1UP6A 3WGTA 1K0UA 3CMMA 1C1XA 2OOSA 5FYDA 3NKLA 4CV0A 3GNTA 2D59A 3PK0A 3RUAA 1ZCJA 3ZCXA 4DBVO 4CM5A 1DRWA 4MVJI 4BO4A 1A72A 2LDBA 4EJ0A 2V6FA 3B70A 3JYLA 2NWQA 3CEAA 2NVUB 2AXQA 3ON5A 3PDUA 4IZIA 3I52A 3LDHA 4AJJA 3RBVA 4E5MA 3VPSA 1DOHA 1U8FO 3L4BC 4IBOA 2VN8A 4YWJA 1JQBA 1V3VA 5IN4A 4RZHA 4IJUA 8ADHA 1I33A 1PIWA 2J3IA 4I5FA 3AFNA 4GLLA 3Q2KA 4XDZA 4BNIA 3ULKA 3LF1A 3GGGA 4AVYA 5C7LO 4BNNA 5ILGA 3DZIA 4I9UA 2O2SA 3VH2A 1ZXBA 3WYEA 5TS3A 3ICCA 1EDOA 2J3JA 3NGXA 3ZV5A 1HDOA 4EJMA 3Q1LA 4FD3A 3AY6A 1RYEA 1P1HA 3OSUA 4O6VA 3F6YA 4XKJA 3GZNA 3F5QA 1QRRA 5TX7A 3EY4A 3ANMA 3LT2A 4PLFA 1Z75A 4O59O 5TIIA 2JCXA 2ZTLA 3GRKA 5JCJD 4NNJA 4RDIA 4E4YA 4II2A 2OUIA 1Z74A 4CMEA 1GFSA 2A94A 1B3BA 2WSBA 3SXPA 1ZVMA 3JQ8B 5BSFA 4WLFA 4OXKA 4D41A 5CEFA 4ZHSA 1LX6A 4PLTA 3ZV3A 1VJ1A 1GY8A 4JIGA 5JO9A 1CDOA 5K0ZA 4AL4A 1WNTA 2GZ1A 3NAQA 1B8VA 2ZTUA 5T64A 3TOXA 3A9WA 4RF5A 4XQ9A 2IE0A 1UZMA 1HDRA 1QYXA 3AM3A 2DC1A 1ZMOA 2FRDA 4CV1A 1EE2A 1K5HA 1LXCA 1ADFA 1MXHA 1DRVA 4WLNA 1F14A 1X0VA 3QY9A 4A7PA 1D4FA 1FJHA 2BFMA 2EKPA 1X15A 1EUCA 3UCFA 1EQ2A 4WUVA 4OOEA 1B15A 5B37A 5L7YA 4JCOA 3KTDA 4JLWA 4ND2A 4CMHA 3WGGA 4J1NA 4DYDA 2BRUA 3GNQA 4RQTA 4BNWA 2Q4EA 2EJWA 3W6ZA 4BNHA 1ENOA 3EC7A 4IIVA 4NU5A 3DAFA 2YV2A 4XWYA 4EYEA 2P4HX 3U3XA 2J6IA 1KVQA 3N74A 4OIMA 2OBNA 5B12A 2SCUA 5COQA 4B7UA 5BQFA 1BWSA 1YBVA 3V1TC 1OC2A 1Y5RA 1TB4A 4CUJA 1RM4A 4DGSA 3LSYA 2Q2QA 2VT3A 3DZFA 4Y6RA 4DQUA 3H9UA 4R1TA 3OECA 5KNLA 3PZBA 5AXCA 1PJQA 3WB9A 5IXYA 2G82A 1E6WA 3UH1A 1LDBA 4BQPA 5DBIA 1O9BA 4BO8A 4EW6A 3QRWA 2ZB3A 3GUCA 2CD9A 1DRUA 1NHGA 1RPNA 1KEUA 1K3TA 1LSJA 1Q1NA 1ZSVA 4B3IA 2CDCA 3SLGA 1KEVA 1H9BA 1QLJA 3VDRA 3AWDA 4XRRA 3U62A 3W6UA 3ENNA 1GCUA 1MA0A 2VWGA 3EUWA 3NJ4A 1NQOA 3JQ6A 4BO2A 2QYSA 4OOFA 1CWUA 3VPFA 5A9RA 1WPQA 2XPCA 4YAGA 2BELA 3AU9A 2EERA 4RPHA 2V6MA 1UXKA 3LT4A 3PRJA 4KQWA 2GZ3A 4CMCA 3E9MA 4E6PA 1MV8A 3ZWCA 3AY3A 2NQTA 1PQPA 2X9VA 2ZQZA 2IEDA 3RFXA 1NFQA 3JQ9A 1NWCA 3U49A 3RQSA 4INAA 1E1NA 3GGPA 3I3OA 4RLHA 4XB2A 4OQZA 5HS4A 3I9LA 3L4BA 3WGQA 1D3AA 1Y9EA 1KC3A 4HBGA 3IQDB 4J2OA 1LQTA 1TT5A 1IULA 1P3DA 3I9OA 4UAGA 4AJEA 1N8KA 4F3YA 1ZK3A 2I65A 4GX5A 1DC3A 4DL9A 2FR0A 3NYWA 4M87A 2EG9A 4GX1A 4CMBA 3KYCA 3PXXA 4YEDA 4YAJA 2D1YA 4XB1A 1YQGA 3GGOA 1ID1A 3ZNNA 3EZLA 5L40A 2Z5LA 3WQSB 3GVHA 2NVWA 3GDFA 1R0LA 2Y67A 3V5NA 4GKVA 3VAZA 2E48A 4NU6A 3UCXA 1JA9A 1PJSA 1I8TA 3T7EA 2P68A 3JD0A 2JL1A 1TXGA 4IXWA 1W8DA 3BTUA 3WGOA 3VPHA 1SB8A 4JXKA 2OP1A 1H0KA 2YQ5A 2NU8A 1E7MA 1SZJG 1V35A 2DFDA 4BO3A 2RHRA 3GN1A 3KB6A 4YYZA 1DBVO 4XR9A 4TZTA 1GQ2A 3DMTC 2X0NA 1UXGA 3DQPA 4OXNA 2CF6A 1EVJA 3GFGA 3HWRA 1IHXA 2V6GA 4ND4A 3ZWPA 3DFZA 1BHSA 2FMUA 4CODB 2IXAA 3IAHA 3JSAA 4XQCA 5JNLA 2GNAA 3G49A 1EVYA 1R15A 4AJKA 2I5PO 2EWMA 1DEHA 4QSMA 3RSHA 1I2CA 1QYWA 2PZMA 1W4ZA 1PS9A 3A28A 4D3DA 1D8AA 4YTEA 2ET6A 1RM5A 1SB9A 2QYTA 4PLYA 1BXGB 4Y9DA 3NT4A 1HDGO 1VI2A 3R3JA 4RPLA 5I8WA 1QYCA 2WD8A 3VH4A 4YVFA 1PQUA 4KUHA 2WMDA 3X2EA 4ND1A 2YJZA 4E31A 1C1XB 2GCGA 2NU6A 5HA5A 1ZBQA 2EP5A 2HMSA 1YL7A 4GX0A 1K6IA 2J5RA 3D3EA 3RUIA 5DDIP 3I83A 3BZUA 2AA3A 2Q49A 3R0IA 3HE3A 2VHXA 4F46A 1AE1A 2QX7A 1N1EA 1JVSA 1LSOA 2G17A 3SJ7A 4CMIA 2WYVA 1ONNA 2WE7A 3W1VA 4ROSA 1I3KA 1PWZA 2YDXA 4CM1A 3H3FA 4D7AA 5HBRA 3AFMA 4L8VA 1OC4A 3ROMA 4RPGA 3ETEA 5KJCA 4ALIA 4DBZA 2DU8A 2DFVA 3O8QA 4GVLA 3WYBA 2HQ1A 2Q1TA 5COAA 2I66A 1O95A 2B37A 3RAJA 1DJQA 4GLOA 1Z82A 3L77A 4LK3A 2DBRA 4IQGA 5T5QA 4BO5A 1U5AA 3RD5A 1GU7A 2E49A 4NDNE 4D3FA 3GC6A 4CLRA 1K2WA 2QHXA 5GZ3A 1T2AA 1JWAB 3GZNB 2D3TA 1WWKA 3KSUA 5GY7A 2BFOA 1DSSG 4BNYA 4EZBA 1PU2A 4H16A 1EBFA 1HZJA 2WEKA 5DZSA 1FK8A 1MB4A 2Y0CA 3WG9A 3KUXA 3E1KA 3NEPX 4LCEA 3RBXA 4M86A 4YJHA 1VL6A 3H9EO 2FHSA 3DHNA 5H81A 3AUTA 4IPTA 3WFIA 3ZWXA 4E32A 1XEAA 3BXXA 5KVQA 2Z1MA 2X9GA 2PD4A 3DMYA 4Q3CA 3RIHA 5L45A 3DAGA 4ZQFA 2OXIA 3CZRA 2YHUA 4FFMA 4H7PA 3DBRB 5JC1A 1DJNA 1LJ8A 2FPPA 1A27A 2C07A 1YKFA 4RJTA 1C14A 3GQVA 2GRAA 3DBVO 1P9LA 1YB1A 4PLHA 5JDIA 5KTKA 1VKOA 3VOSA 2JD2A 1CYDA 2Y1OA 1QP8A 3JQ7B 3OH8A 4J4BA 3TFOA 1W6UA 3C24A 3T4EA 1P74A 2ZKLA 2JD0A 3GZ4A 1JKIA 1Y7TA 3IP1A 3OJFA 4J7CA 1Z45A 2R00C 3TL3A 4IM7A 3WWYA 3CSDA 4IZHA 1B2LA 1ISMA 1IPFA 1Q7GA 4BKRA 4L9RA 3V2HA 5L9AA 2YUTA 4MVJP 4TMFA 3LK7A 3WSWA 1T1RA 1P45A 2CVZA 1C0KA 2PGLA 3WMWA 4XRGA 2P5UA 2EGGA 1E3JA 1UP7A 4D79A 4Z3DA 1O89A 1A71A 4F6CA 3EZYA 5A06A 4U6QA 3H8VA 3DTYA 2EW8A 2ZJ1A 4MKXA 1LLUA 1DIBA 4Y67A 5K9ZA 1EK6A 1ISGA 1F8FA 3GLQA 3WOHA 5DT9A 1UP4A 1LSUA 4QO7A 2HMUA 3I6IA 2X8LA 4OO3A 3LYLA 3ONFA 3G1UA 5JY6A 1HSOA 3INGA 3KO8A 4J7UA 4DLBA 2HK7A 3QIVA 1BDMA 3OJOA 3C8MA 2HK9A 3B1JA 1E77A 4XYEA 4CM3A 1X1TA 3SC6A 4OSOA 3AK4A 4L76A 2O23A 5COBA 5I8ZA 4BKQA 3KSZO 2NVUA 1QSGA 4K26A 4Z6KA 2HCTA 1OZAA 1ZJZA 2WM3A 4JP3A 4BKOA 3SC4A 4ALNA 3U4HA 5BNIA 2ZTMA 1BW9B 1HWYA 1YDEA 4LGVA 4PLGA 3NJ8A 3HDYA 1LTHR 3VKVA 3OIFA 4E12A 1Y5MA 1U2GA 4TWRA 5ENDA 4Q3NA 1HF3A 1TT5B 1VL0A 1C0PA 1T24A 3FNHA 2UVDA 4IS2A 2I3AA 5A05A 3ONDA 1E6EA 3BA1A 1I3MA 1GL3A 3IJRA 3GOHA 3WQQA 4DIFA 2HMWA 4QXMA 3KYCB 5EIOA 3DBLB 3FI9A 4IGEA 1H2HA 5L4NA 1AN9A 5DN9A 5EN4A 5BSHA 1HYHA 5U4QA 1ZEMA 3U5TA 4D46A 1EQUA 4IDDA 4R5MA 4JBGA 3DZJA 4C4OA 4EITA 3PQFA 5CG2A 2J3KA 1PWXA 4E2WA 2PH5A 1FDWA 3JQ8A 3L4SO 1E7SA 4EI2A 1GDHA 4A2CA 3KHUA 5JYDA 1YJ8A 2ZCVA 4S1VA 5G0TA 2EXXA 4J91A 1DIGA 1E5QA 3OEYA 2QRLA 4NH4A 1VM6A 1MX3A 2X0RA 3EW7A 1XG5A 2UV8A 3AUSA 3JYNA 4BB5A 2DTXA 5A03A 3HADA 3CE6A 3GG9A 1IB6A 4P4NA 4R68A 3VHRA 4D43A 1XU7A 2B83A 3T7CA 2J8ZA 4I1IA 5I9MA 1MC4A 1B26A 2VWQA 1PS0A 3Q3CA 4R5HA 2GDZA 4WOKA 3UCEA 1DB3A 2H63A 1IHYA 2X4GA 4CQMA 5C7IO 5DOVA 3A4VA 5KOIA 4AJNA 5IDXA 2NTVA 5CPFA 3ROKA 1AHHA 4TRJA 4FFOA 1NM5A 3D64A 1JAXA 2BHLA 3WNVA 4WLEA 1JN0A 3WX0A 4ONEA 1XKQA 3OICA 5AVOA 1GUYA 1LDNA 2O50A 3B1KA 5ICSA 4KWHA 1F17A 5MDHA 4MVJE 4WCFC 2Q46A 3AI2A 3ZGYA 5IAAA 2EKLA 1U3VA 3GG2A 4RVFA 1NR7A 2GN8A 2PZLA 2R00A 4GMGA 4A0SA 4IDFA 3EHEA 3NDIA 5ES3A 2X22A 1DIHA 4XYBA 4CMIB 5ER6A 1NFRA 3QVXA 4PG8A 3KVOA 3RI3A 1GEEA 2PLAA 1NTOA 3BMOA 1A9YA 1B14A 4E5YA 3PIDA 2Y1DA 5K6AA 1K6XA 3BAZA 4JP2A 3ZWNA 1P0FA 3JQEA 1HLDA 3PFWO 4RPKA 2D8AA 4XYGA 5TC4A 4BO6A 4CLOA 4TVBA 3K30A 3VZSA 3ZNPA 1X0XA 4W99A 5CDGA 2O7SA 4ZA2A 2I67A 4BNLA 1LLCA 3GA0A 2P4QA 3AM5A 3OA0A 4BNFA 1UAYA 2QRJA 1NVMB 1QYDA 4IDCA 1DC4A 4K6FA 3IUSA 3IMFA 3ZWBA 2HO5A 2BD0A 1Y1PA 3PJFA 4B3HA 4CLRB 4RDHA 4YJDA 4YBZA 2EF1A 1UDBA 4IS3A 4J9UE 3L9WA 3P7MA 4L4SA 1V6AA 3QVSA 2ZATA 4JBIA 1XR3A 5C3MA 3TSCA 3RC2A 2XAAA 1VJ0A 1LC0A 1HYEA 2HDHA 3VKUA 5KJ1A 1NPDA 2ZB7A 3ETGA 3PGJA 4QFDA 3GMSA 4B7CA 2FOIA 1QR6A 2CZCA 2FP4A 1SO8A 3JCZA 3WFJA 3P2YA 3Q9NA 3QLJA 1UZLA 2OHXA 3H9QA 4B8ZA 3C85A 1XELA 1YXMA 4UUPA 4OAQA 2OFPA 3K9QO 3L0DA 1EVIA 5KKAA 3VPGA 4XYLA 4Q39A 3ZH2A 2P9EA 2PTGA 3OIGA 4WNIA 4J49A 2G1UA 4YRDA 4CM7A 3O03A 4XJTA 4K1LA 5DBFA 3PHHA 1E3EA 4AFNA 1NAHA 4BGIA 1MC5A 3D5QA 4B7XA 3WWZA 4GSKA 1IZ0A 1DC5A 4UUOA 4XDYA 1V3UA 5JFOA 1AXEA 4OM8A 4WJZA 1YBMA 4KDEA 3KOUA 2X7HA 3QQPA 4ZD6A 4A10A 3K73O 4B4WA 4ZN6A 4S3MA 1Y8RA 1N5DA 1I10A 1LC3A 1TVEA 5G0WA 3SVTA 1K89A 1YOVA 2P9GA 3NGLA 1BRMA 4D42A 3WICA 3UFXA 3KZVA 4EEXA 3BMCB 4MIEA 1RKXA 1YS4A 3C7DB 4A5OA 2P2SA 2AQHA 4E13A 1BXGA 3QV1A 1PGOA 5EINA 2EKQA 5IDYA 2NU7A 3WDSA 3K96A 1NFFA 3OA2A 3U9LA 2BLLA 3DHYA 3G0OA 4NMHA 2WYUA 4RF3A 4DLLA 3B1FA 1R0KA 2DBZA 3ITDA 2OGUA 4N54A 1P0CA 3L9XA 2EGHA 4IMPA 3H2SA 3BMNB 3LT0A 3RC7A 1I5RA 1DLIA 3GVXA 1LNQA 3EVNA 3QVTA 4AJIA 3AM4A 1KY5A 1Z7EA 1V0JA 4LW8A 4I5DA 2NVBA 2I3GA 1BMDA 5HWSA 3JYOA 4QTZA 1HE5A 3AOEC 4OH1A 1JW9B 3RVDA 1P1FA 2Z95A 4BOYA 2GR9A 2C29D 1M6WA 3PJDA 3PWKA 2GLXA 2DUWA 3FPCA 1B3RA 4PLPA 3WLFA 4P4GA 3CMCO 3M1LA 2E37A 1QORA 4LRTB 1DIRA 5LC1A 3O38A 4BV9A 3GAZA 3FCOA 4R9RA 3RKRA 1R6DA 4QFCA 2X5JO 2VYVA 3ADPA 2I6TA 4FFNA 4BNJA 5GZ6A 4J9VA 2E4AA 2OBYA 3C1AA 1ISJA 3LU1A 4W6ZA 5IZCC 2DPHA 4HADA 3FF4A 3F4LA 4GKBA 3FHLA 5F5LA 3P5SA 5B4UA 2A4KA 2C7VA 3NX4A 4GBJA 3VVCA 3UGKA 2OO5A 4YJGA 3E9QA 3RC9A 3S2FA 4M55A 1LLDA 2ZK7A 4XQGA 3PWZA 5HS6A 7MDHA 4KTTE 3ANNA 4ZRMA 1A7KA 4XGKA 1CF2O 3R6DA 4RO0A 5DBGA 4X54A 4ESOA 1LQUA 4MVJH 1A4UA 2YV1A 5I7VA 2BKAA 2NTNA 5T67A 3BTVA 3IOYA 4HP8A 5T8KA 5TJ9A 5TT0A 4W4TA 3KETA 2F1KA 2BI7A 4CQMD 3IKVA 4PN3A 1P1IA 2VUUA 2BGMA 3DBRA 3DWFA 3ONEA 1ZXLA 4NQZA 4R3NA 4Y6SA 1KVSA 1P33A 3AUAA 4L74A 3S55A 2VTEA 4Q3BA 4CQMB 1I0ZA 3RUHA 1QV7A 2BH9A 4YJFA 2HMTA 1HDCA 1D1SA 2RIRA 3D5TA 1SCUA 3JQ7A 4XA8A 1BVUA 5TRTA 1G0OA 1V9LA 3CKYA 3SLKA 2UAGA 4PZEA 1KIFA 3H65A 5IG2A 5IFLA 1Y81A 1ISIA 3DR3A 4R41A 4EEZA 3RC1A 2G76A 4W7HA 1KS9A 2V6BA 1EEHA 1A5ZA 4RZIA 4M54A 1ZH8A 4PLWA 3UN1A 3WGHA 3B20A 6ADHA 3LLSA 2DAPA 3I4FA 1IPEA 4U8GA 3VH3A 2EEZA 2GGSA 5L51A 3FD8A 1BXKA 4NBUA 1GCOA 1U3TA 2YQ4A 3OFSA 2UYYA 4UVGA 3BHJA 3Q2IA 1PS8A 2BMAA 3OF2A 3RFVA 3JD2A 1CETA 4MINA 4PLZA 5JDCA 3BMOB 4BGVA 2V65A 4PLCA 1LUAA 4JJFA 2CNBA 2Z1NA 2DVMA 3PQEA 2CUKA 2IEBA 1LA2A 3QWIA 4CLOB 4F45A 1DO8A 2VWHA 3FWZA 3DB2A 4YXFA 2JFGA 4BO0A 5I7FA 1NQ5A 5C37A 3DOJA 4IQ8A 3E8XA 4C7KA 3ZWMA 4U5QA 4HKTA 5EMHA 4Y8VA 2H1SA 1B8UA 5AQ1A 1XIVA 4CM4B 4UEJA 5B4TA 1DC6A 3AOEA 1BW9A 4MPDA 4ZRNA 4MKRA 1MGOA 3KRTA 3S8MA 4FFLA 4ILKA 5EL0A 4PG7A 1V8BA 3MJVA 2B0JA 1H6AA 3Q9UA 1YL5A 3WS7A 1I2ZA 3QE3A 1HETA 3PGXA 1OI7A 1PJBA 1ZKMA 5F1KA 3PYLA 4ZGWA 2VQ3A 1E7QA 4HXYA 5IXSA 1NBOA 1PTJA 5JYEA 1T4BA 3JD3A 3HNPA 4KTVE 2GO1A 3DBLA 1VPDA 1BXZA 1SNYA 2HU2A 1ZO8A 3TZ6A 5IZCA 1YQDA 2B4TO 2FZEA 4P22A 3O26A 4AG3A 1PGJA 3IP3A 1GTMA 3INRA 3ZNQA 1T2DA 3WJAA 4R01A 2XF8A 5JAIA 3TOZA 3F47A 5EQDA 4HFMA 4I9HA 3ZNOA 2B4RO 3ZN2A 4ALJA 4URFA 4RF4A 5G2OA 4CMJA 4J43A 2WWRA 4PRLA 3HQ4O 2ZB4A 2VNAA 1WDKA 1C3VA 4BO9A 3F3SA 5A9TA 1IOLA 4NIMA 1HE3A 2B4QA 2ZYAA 1J6UA 1Y8RB 2GN9A 2PR2A 3I4CA 3C1OA 3TL2A 4JJGA 1YOVB 3GVCA 5AXDA 2EV9A 4PZDA 2VZ0A 1HXHA 2WYWA 1TLTA 3K2BA 3FNGA 4AICA 5H82A 1OMOA 5EESA 4BNUA 1CJCA 4KUEA 4NBTA 2JFFA 4R54A 3WTCA 5TGDA 1EFLA 4IXTA 3KLMX 2VWPA 5EERA 4NBWA 1C0IA 5F5NA 3RROA 8LDHA 3OJLA 3GVIA 1Z73A 4KZPA 2JD1A 4J2HA 3H2ZA 3JQAB 5THQA 5IDQA 3MJEA 2C0CA 4DPLA 1VLLA 1HT0A 1J4AA 1U5CA 2PV7A 3WTBA 4OGWA 4WCFB 1YH3A 2CDAA 1HDZA 3E5MA 5L7TA 3PJGA 3HDJA 3OQ6A 4YPOA 3AUUA 4FDAA 4LMRA 1KVTA 4RLSA 3MJSA 2VYVD 4CQLB 4WGGA 3CUKA 1GV1A 1P31A 5L4SA 1CRWG 4OQYA 1C0LA 5A02A 3ZU3A 5L95A 3MZ0A 4NK5A 3CPSA 4XX0A 5TLSA 3IJPA 5A9SA 4MVJG 4WLUA 2B36A 4ND5A 5BNFA 2G0TA 1ENYA 3AW9A 1N1GA 3VC7A 2PWZA 3RBZA 1Y8QB 4CM8A 1B0AA 5CHEA 1U9JA 2FSVA 1VKNA 3DL2A 3PHJA 2VRBA 1SAYA 4OSPA 4QECA 5ICMA 4OHUA 1PR9A 3GUYA 3PHGA 5ITWA 5ITVA 4BMSA 1U1IA 2GF2A 3JQFC 4YJGB 5LDGA 3BYZA 3I9KA 3MOIA 2B69A 3ZHYA 4WLOA 4OMUA 1HKUA 4MDHA 4WASA 1GYQA 5TT1A 1E1LA 4ZQBA 3PP8A 2HKIA 1ML3A 4HWKA 3GHYA 3EDMA 4OKNA 5A4DA 4RCVA 4NFSA 4CLEA 4BL5A 3HDHA 2WE8A 3WSVA 1FDUA 1EBUA 4WECA 2YDYA 4WEQA 5JC8A 4MIYA 3WR5A 1X13A 3FWNA 3INTA 1SBYA 3H4VA 4R51A 2G5CA 2IYPA 3FTNA 3ZV6A 1JAYA 3S2EA 1ZFNA 4ZU3A 1TEHA 3JQBC 4IMRA 1GAEO 4TVOA 5KVSA 1I01A 4IY1A 2ILTA 5DCYA 4CMGA 4CMKA 2W98A 1OBFO 2C5EA 4WPGA 2BI8A 5A3VA 4DUPA 3PYMA 4YJFB 2AG5A 3GK3A 5G4KA 4RVUA 3A14A 3V2UA 5JY1A 3JD4A 1MUUA 2B5WA 4RL6A 3RFTA 1VSUA 4DPMA 5B4VA 1DAOA 3K31A 1WP4A 2PD6A 3UW3A 1B8PA 1UAGA 2VOJA 3ANLA 3H5RA 4D44A 1YO6A 3H5NA 4DC0A 3UF0A 3NDJA 5JXWA 3DMTA 1ZUD1 1DXYA 2BGKA 1FF9A 1XHLA 2DPGA 1XGKA 3QHAA 1RYDA 2C82A 3DTTA 3EVTA 4J3FA 2AQKA 2XXBA 2DBVO 4XIYA 1N7GA 3BMCA 3KV3O 4BNGA 1HE4A 3QVOA 1GUFA 1DAPA 1PZEA 3E5RA 4KWIA 2DT5A 4LSMA 3G17A 1UR5A 4PGFA 3ZI0A 3TZCA 1LDGA 3ASVA 4UVEA 3S2GA 5KKCA 1A4IA 1R66A 4B4VA 1QXSA 4IDAA 3OJEA 3RU9A 1WMAA 4D0SA 2WTBA 1Q0LA 1WXDA 3BMNA 1XU9A 1MFPA 5I7EA 1H6CA 3ZWYA 2Y99A 2QW8A 4RVHA 3WGYA 5TNXA 2Q50A 1U8XX 2X5OA 1WAMA 4JK3A 4KQXA 5G0VA 4WLVA 1XCBA 3K6JA 3HUDA 3E9NA 2IZZA 2X58A 3RU7A 1I2BA 1NHWA 6LDHA 2RCYA 1ZK2A 4FS3A 3FN4A 3G79A 5KWEA 5DULA 3WBBA 3FRJA 2POQX 2Y1EA 1JVBA 2ZCUA 4JJIA 1PZFA 3FBTA 2RH8A 1ZW1A 2C54A 3I1JA 9LDTA 4AJ2A 1GQQA 1LSSA 3I9JA 1ZEJA 1LDMA 5EQFA 5HRUA 1F8GA 3GH3A 3FNEA 3RCBA 4IINA 2HRBA 3VZPA 1PGNA 4UEKA 4XZ3A 2X23A 4HFNA 1KEPA 1I24A 2X86A 1GV0A 1H93A 3LLVA 1Y6JA 4TRRA 3TFQA 4ZQGA 3DDNA 3ZWAA 1UDCA 1BTOA 4M1QA 5A1TA 2J5QA 2WD7A 1KETA 3GDOA 3WGZA 3O9ZA 4AJLA 2AHRA 4U0KA 2VUSA 3PHIA 3VTFA 1KBZA 3FSRA 5FF9A 4Q3EA 2JKVA 4A26A 4DIOA 2VRCA 2DUUA 4BO1A 3A1NA 2VHVA 1YL6A 1R4NB 3L6DA 3M1AA 1TI7A 3PYXA 5DOZA 4JBHA 4JROA 5EJ2A 5IZ4A 2A9FA 5TQVA 2NTJA 3DZKA 1PQWA 3HB4X 4YACA 3PTZA 4E3ZA 3CIFA 4PZCA 3CXRA 4RV9A 2BFAA 1P1JA 3T4XA 3ENKA 5AYVA 4DQVA 3JQBA 4MVJA 2JHFA 1IY8A 4QX6A 5I9NA 4HY3A 3M6IA 4FPXA 5L7WA 1HSZA 4MVJM 4BV8A 2FY8A 3K92A 2O3UA 3OQBA 1L1FA 3WQRA 3KYDB 5JCXA 3NUGA 3HZZA 4J4TA 4E2YA 3AOGA 2HUNA 1ULUA 1YDWA 4W82A 2O4UX 1ADBA 4FOOA 4FJ2A 1D7OA 4EUHA 1JKJA 5MGBA 3IDSA 4G5HA 1U2DA 3DEYX 3TNLA 1CIVA 1EE9A 2PGDA 4GSLA 3WIDA 1LRLA 3RWBA 1OAAA 1IZ9A 1LBEA 3PLRA 2FSSA 2JFHA 3JQGA 4NJOA 5FEUA 5IN5A 4J6FA 3FTPA 3RUEA 5L53A 5FFFA 4E21A 1Q0QA 2IZ0A 1DHRA 2J5KA 2Y1CA 5A9SB 5F1PA 1NYTA 1PR3A 2PKRA 1ADCA 4QQRA 1F06A 2PFGA 4CM8B 1ADGA 5CEJA 1PL6A 3KEQA 3PVZA 1XQ6A 3CZMA 1PZGA 3PI7A 4Z9XA 4CM4A 5HM8A 4ZVVA 1EUZA 2O3SA 1ONPA 1HLPA 1NP3A 2RBEA 1S7CA 2R6JA 2W90A 2X1HA 4YT4A 2ZB8A 4FGWA 4YT5A 2R2GA 3IS3A 4Q9NA 3JTMA 3TPCA 1HE2A 5KJFA 1Q0HA 1I36A 3CINA 5GMOA 4FFPA 3ZWWA 4UUMA 1UH5A 4FQ8A 4LVUA 4BMVA 4CJXA 4DXHA 4BNXA 1UZNA 2GUGA 3F1KA 4FCCA 4AJ1A 2EJVA 3D3WA 2OP0A 5AXAA 1UXJA 1W73A 3NRCA 1PJ3A 3ZV4A 4PFJA 3GPIA 1AGNA 2UUPA 2Q1SA 3C7AA 1EMDA 2YHIA 4DTIA 3QW2A 4GH5A 2P91A 4NFYA 2NV6A 2GPTA 2RHCA 2V7PA 1BG6A 5G4KB 4NPCA 3PFFA 1X14A 4L0QA 2NNLD 4JNKA 4JQCA 3JYQA 5DNAA 5DP1A 2AEJA 1MG0A 3QP9A 4TZKA 3RUFA 1X7HA 4LISA 1DLJA 5T57A 3IKTA 2PKQO 2QQ5A 5CDUA 1SOVA 1H9AA 2IYOA 4ZQHA 1E3SA 4OKIA 1KY4A 3GVPA 3PLNA 5JW6A 5LDHA 3VPXA 1ONOA 4ALMA 3PDJA 3TWOA 3GPDG 2BF7A 3SJUA 5KVCA 2RAFA 5ER9A 4J7XA 2X0JA 3E82A 4L73A 4UUNA 3CH6A 1GADO 1XWFA 4M49A 2IZ1A 1Q2XA 2Y66A 3WGIA 4HNHA 3TZHA 1LDYA 4ALLA 3DXFA 4PVDA 4Z0PA 2CF5A 4B3JA 5A3JA 2E82A 3JQAA 4GI2A 1ARZA 4E33A 3HJAA 1NPYA 1GZ3A 2I9PA 5IJZA 3C3XA 2O2YA 4FC6A 4YAIA 5ENVA 4K6CA 1JKFA 4DPKA 2FWMX 4NJMB 4WCFA 2GERA 4H15A 2GZ2A 1R4MB 4RQUA 2O3QA 1NVGA 2B35A 1T2FA 5JAQA 3EGOA 4CQLA 1DIAA 1WW8A 1N92A 1WMBA 2TMDA 4U7WA 4ID9A 4FW8A 3NTOA 4NBVA 4FJ1A 1KC1A 2VOEA 4DREA 3VTZA 4U6SA 3UOGA 1GZ4A 3RUCA 5JAMA 4J4HA 4XCVA 4CR7A 3TRIA 4IJKA 1J49A 3QWFA 1QMGA 2Q4BA 4NBRA 4UVHA 1EZ4A 5TJHA 1HL3A 2EW2A 2OL4A 3JD1A 3JQ9C 1Y8QA 5BSGA 1YBAA 1YGYA 3AI3A 4DA9A 2C59A 2A92A 2NACA 3O4RA 3ZU5A 2DQ4A 1HYGA 3UHAA 1HDYA 4XEHA 4J0FA 4R4JA 4A73A 3C7CB 1BVRA 5TF4A 1WDLA 2CVOA 3H9GA 1ZIDA 1JTVA 2VRCD 4B8WA 1E1KA 2I76A 1O6ZA 3R1IA 4YAKA 3DFUA 2WD7B 4M8SA 1T2CA 3F46A 1NAIA 3HDQA 5ADHA 2AE2A 3NT2A 4MP6A 4DWVA 4QT0A 5CAEA 1MFZA 4MP3A 4CV3A 1KERA 3MJ4A 4O63O 3W8FA 3ZU4A 3UKOA 1PGPA 4MVJD 3S1LA 1IL0A 4NZ9A 3WLEA 2AQIA 3DONA 1YONA 5CP8A 2VZ9A 3QWAA 4CLHA 4TRMA 2D4AA 1SOWA 3GAFA 3JYPA 2WDZA 2TMGA 3OM9A 4P8RA 3W4IA 4CM6A 3IC5A 2F00A 5KJEA 1E5LA 2AE1A 4NI5A 1LEHA 4LRSB 2GD1O 3UUWA 1M75A 4OL9A 4QEDA 4G65A 2QIOA 1P1KA 4YCAA 2Q99A 3OEWA 4TKLA 2Q3EA 3W8EA 5J23A 4G2NA 4GAEA 3DBHA 1B7GO 4N5NA 1GEGA 1ZK4A 1RWBA 1M76A 4Z9FA 1ZK1A 1F0YA 3F1LA 1QG6A 3QVWA 1ZZEA 4NR0A 5GZ1A 5AXBA 4WKGA 2FPGA 4BNZA 1FDSA 4N7RA 3NV9A 5CEEA 2AEMA 3OBBA 3KXDA 3JQGB 3IL2A 4DYVA 4DIBA 3PWSA 4N5LA 1S6YA 5DP2A 4H3VA 4E2XA 3I9NA 2W2KB 4P4LA 1I32A 3LZ6A 3MWEB 3ZHXA 5H83A 1QV6A 3JQCA 4YAEA 5JE8A 3GHHA 5FI3A 1PJ2A 1UXHA 2BFPA 4TSKA 3V1YA 3D1LA 4Q3DA 5FI5A 1HTBA 3HFSA 3KSDO 4BKPA 3JV7A 2FPIA 3ZW9A 3HG7A 3OIDA 1HDXA 3GRPA 2YZ7A 2GYYA 1TA4A 1SPXA 3DZGA 4E5PA 4BGEA 4BNTA 4DVJA 1ORRA 2Q2VA 2I99A 4HUJA 3HFGA 5DCUA 3KEOA 4Q3AA 2ZQYA 3QWBA 4IJWA 1X7GA 3M2TA 1EUDA 1NPTO 3DOCA 3U0BA 2O3JA 3GT0A 2H9IA 1Y9AA 3F5SA 4JN6B 3NDRA 1HRDA 3E03A 4AJHA 4NK4A 3TJRA 3SBOA 3GDGA 1H2BA 2JCYA 3F4BA 1R12A 4MVJF 1E1MA 1PGQA 4J90A 1H5QA 3D3WB 4DQXA 2E6UX 3Q0EA 4DLAA 4I5GA 1NQTA 2J3HA 3KBOA 1IUKA 3FNFA 4MO2A 4YRBA 1LLQA 5F1OA 2JHGA 4RVDA 3BTSA 4HV4A 2DTDA 2QRKA 4EGFA 5I9LA 2YHIB 3MEQA 2Y68A 4L75A 3QA9A 3V8BA 1R37A 2Y1GA 4CM9A 4D45A 5F21A 4A03A 3E18A 1O5IA 2Y93A 4MKZA 2QZ9A 2YFQA 4XQEA 3HSKA 1GD1O 3RUDA 2JJYA 3K5PA 2VCYA 3FR8A 1NWHA 3TZKA 1MLDA 1R4NA 4PRKA 4W9NC 3LVFO 3TZQA 1JDJA 4AJOA 5JDIC 4O0LA 4D3SA 4MJLA 3EYWA 4XD2A 4KOAA 3GNSA 4IGFA 1ZK0A 2NADA 2VT2A 5U1PA 3ZZNA 3W4KA 5BR7A 1MP0A 1M6HA 2QG4A 1DDOA 4FSHA 2VYNA 4GX2A 3GEGA 1VC2A 4RVGA 5U9CA 3JQAD 2W8ZA 1E3IA 2AEFA 4OJNA 3M2PA 1CEQA 3BMQA 3GFBA 4KP7A 4LCJA 4YT8A 1Z7BA 3HHPA 3DO5A 1T25A 3H6KA 3OJ0A 3U4IA 4R1UA 4BGUA 4XYMA 3KYDA 4BVAA 4D0RA 1W0CA 4OYRA 4PIVA 4ZICA 1R0SA 4B4UA 3HN2A 3GEDA 3L6OO 4CR6A 2NUAA 1E3WA 2UUOA 4LVCA 4FFRA 4DC1A 2GN6A 1AXGA 5THKA 2PZJA 3ZHZA 1N2SA 1HEUA 3G3EA 2H6EA 4RPJA 4B4OA 4LN1A 4E5NA 4FJ0A 3W4JA 3D7LA 4HFJA 3LT1A 4IIUA 4FGSA 5G0UA 4GVXA 5A5FA 2B5VA 2O7QA 1K6JA 1J0XO 2YW9A 3ROPA 2CFCA 3B6ZA 4FOSA 2OMEA 4MOWA 4P38A 3WBFA 1VRWA 2H5LA 5JMPA 4A27A 3BIOA 1IE3A 3PEFA 2AW5A 4TROA 1C1DA 1ZMTA 1LRJA 2IDZA 3UXYA 1NXQA 1YRLA 4CL3A 2AMFA 4JGBA 3UICA 1V3TA 1LRKA 4GQAA 3TQHA 5JPIA 1DHTA 4PLVA 3L07A 3GF4A 4IJVA 1VE9A 4BNMA 1NVTA 1A9ZA 2P9CA 2W4QA 2XOXA 1KOLA 2Q1UA 5BNTA 3S2IA 4L4RA 3I9MA 1T26A 4CPDA 3MTGA 1DFGA 3H9JA 2GSDA 4XR4A 4O1MA 4AJ4A 1E7RA 3I23A 3VZQA 1UXIA 3OHSX 2PD3A 1M66A 4ZJUA 4XIJA 4DMMA 3PJEA 5C7OO 1WZEA 2QZZA 3LC2O 1SEPA 2PZKA 3RKUA 2NM0A 4GMFA 4CUKA 4BQRA 1G0NA 1RM3A 3ORFA 4KMSA 4Z0TA 4Y98A 1J5PA 2HLPA 3N7UA 2O4CA 3MCVA 1EFKA 3D4OA 3SEFA 4QO8A 2W2LA 4BS9A 1GR0A 2NU9A 3G1TA 5KCZA 2HSDA 4FR5A 4HFRA 1U28A 1Z6ZA 1GYPA 5JS6A 4YA6A 5JMWA 2DLDA 3MTJA 4GGOA 1FXSA 3A06A 5L4LA 2NSDA 3H5AA 2PK3A 1FDTA 1UUFA 1D1TA 4DRYA 3BHIA 1XYGA 4E5KA 4QUKA 2AG8A 3X2FA 1ZJYA 3ICPA 4TRNA 5KJ6A 4R69A 2Q1WA 2OZPA 3N58A 2FZWA 3FR7A 1ULSA 4NHEA 2VNSA 3R3SA 4W9NA 3ABIA 1N9GA 3DBHB 4EBFA 2PKQP 3PPIA 3I6QA 4YQYA 2PH3A 3BHMA 1SC6A 2HRZA 3AY7A 2IODA 3W8DA 1M67A 3RJ9A 1QLHA 4I8XA 5EPOA 1PX0A 5A5EA 1M2WA 4CLDA 3OETA 4N18A 5JSFA 2X5KO 5CDTA 1KYQA 1AHIA 3IIEA 3QWHA 4C7JA 2VHZA 4IDGA 3VDQA 3PIIA 1PJTA 4UVDA 4Y6PA 1UJMA 1L7DA 2Y0EA 3OMLA 1MXFA 5CFZA 1R16A 1EDZA 1H6BA 4BNKA 1O8CA 4NJMA 4PVCA 1GQYA 3WNQA 4WOJA 1U4OA 1R4MA 3WJ7A 4R9SA 3P19A 3E6AA 1WLYA 4BB6A 5K6AC 1YWGO 3WIEA 1T2EA 3U4DA 4GPD1 4YB8A 2FR1A 3PZRA 1XSEA 3JQDA 4R1NA 1E92A 1ZNQO 1XQ1A 2IXBA 4EUFA 4J1TA 5BSEA 3FPLA 2VZ8A 4CL8A 3EAGA 4R16A 3V2GA 3ZHBA 1OOEA 1GYRA 4I9NA 5CDYA 4J1SA 4LMPA 4WNCA 4EDFA 4FB5A 3GMDA 4E30A 4EJ6A 2WJPA 1O0SA 3KLPX 2GN4A 3DZBA 4B79A 1GUZA 4CV2A 1H94A 1WZIA 3MJCA 2RH4A 2CY0A 3DOOA 1NNUA 3BTOA 3NTQA 3DZHA 4PG4A 4FBGA 3DHEA 1XA0A 4LSWA 1U7TA 2ZJ0A 3ASUA 2PY6A 4J16A 4BO7A 3ZW8A 1E6UA 1NR1A 2GASA 3V1UA 1YJQA 1ENPA 2NQ8A 3D4NA 3KYBA 1XDWA 4CM9D 2BGLA 3OP4A 4BKUA 4GWGA 3STHA 2DKNA 2XXJA 4GL4A 1BSVA 2CSUA 1YQXA 1U3WA 3JQFA 4YR9A 5FWNA 1H6DA 2DBQA 2YY7A 4J0EA 1PSDA 4K28A 1CQIA 1PEDA 4PG6A 1BDBA 3AJRA 1G6KA 3K8ZA 1ENZA 4J1QA 4II3A 1JU9A 5CDSA 3H3JA 1VL8A 2O3RA 2Q2WA 3FBGA 2C5AA 3VH1A 1B16A 5IF3A 2A35A
chains in the Genus database with same CATH superfamily
1XCJA 2JDID 3P2OA 2XRYA 5LCXA 3DC2A 3T38A 5LA6F 1IWOA 3B7WA 4M0CA 4HNGA 4XGNA 5KQLA 5EZ5A 3R7AA 3VR6H 1SUEA 3U6KA 1RM0A 1JWBB 3A1SA 5K2OA 1BJTA 4L8FA 5ES4B 2QTRA 4U00A 2D8MA 2GRUA 4DG8A 1SCDA 1RWMA 1GL6A 1YZVA 3HO6A 4MLPA 1XJCA 5LM3A 2C7GA 1YVRA 1QZ3A 2IXGA 2XYHA 4IZ6A 4U02A 4AJPA 3EK2A 3NTRA 1JL3A 2FJ0A 3UAOA 5DCLA 3UK6A 3BMQB 4C08A 2CYBA 4R3WA 2Q3CA 1U5BB 2NMVA 4L6CA 3G2LA 4FIZA 5JLAA 3AILA 1Q7CA 2CMFA 3NI2A 1W44A 4QBFA 2Q3MA 2M98A 2CJXA 1KJIA 2IGBA 4UEOA 4Y9TA 2Q8QA 4B3FX 2XUPA 3ZLTA 1CQJA 4ARVA 5FOSA 1TFRA 3RKSA 1N77A 1YB4A 1L7EA 4GI5A 3RAPR 4D9KA 2NUBA 2WHPA 1D8TA 1EVZA 2IY9A 2OORA 3FB4A 3KXPA 3LX6A 1AK2A 1QVVA 3D8RA 3AEKA 1DJPA 3BZBA 1T1IA 1TM2A 1O94A 1T35A 3V42A 5JYBA 3QI2A 4C0KA 1BYUA 2CL6X 1ZM4A 4BHTA 3AR5A 5C5IA 3RQIA 5B7NA 3F9RA 2C2GA 2Y92A 4TV9F 1N2CA 4KUGA 1NQAO 2ZYGA 4ARBA 1Y4DE 3OZRA 4X6YA 3HZRA 4TKZA 4U9IS 2ZRGA 4RHXA 4GXRA 5DMXA 1WVGA 3EMKA 4C2BA 3OTGA 1KDVA 2CDNA 4DNOA 2W2KA 1QLWA 3D31A 2OXTA 1JI0A 4ZP1A 2G67A 2OOKA 5CJ2A 3N2ZB 1W48A 4CWAA 4KQ1A 5JSQA 4LFBB 4I08A 2GH1A 2I3DA 1G5IA 1GL9B 4G0NA 3UJ9A 1RI5A 5GGYA 2Z2JA 3PUXA 3TPZA 3GRYA 4HRXA 4ARIA 3QKSA 5L3SA 2PX6A 1XL1A 3TSZA 4MRVA 2R6AA 2VHWA 3D4PA 2YUIA 2RJNA 4RVSA 1DG3A 3A9RA 3KK0A 3MXTA 4PS1A 1COWA 4KLCA 2Q4DA 2REBA 3FPKA 4KRXA 1NLYA 5JO0A 1PJ4A 1ZU5A 4AYWA 2EP7A 4CM4B 3OIYA 2QGNA 4FLMA 1L5VA 1KP3A 5B53A 1A7AA 2P4EA 4HNUA 3F4KA 2D2IA 4OBBA 1E7WA 4RGBA 2NG1A 2ZR8A 2WT8A 2VUIB 4HZIA 4TLDA 1E3LA 4ND8B 3G2HA 1UIMA 4NONA 3MJTA 5AHRA 3FKQA 3DGEC 4LX0A 2Q29A 1UEIA 1OXBB 2JH8A 1CUZA 2QRHA 2ZDHA 3OQJA 4FIDA 4HS4A 4LWZA 5KB3A 4TYWA 1Y1RA 2WDPA 3M6XA 1G8KA 3OTQA 4OQ4A 4EO4A 3JW8A 1WDWB 2VXBA 2E89A 4HPJB 4ZT4A 1BKYA 1UL1X 4S1PA 5FWXB 5IVHA 2DHQA 1ISHA 2AYXA 3I04A 4AYTA 1GIAA 2Q5FA 4DMLA 4IUBS 2VH2A 3DZ8A 5JSYA 3LBYA 3TX2A 4BUCA 2BDUA 4MHTA 1YMUA 2C3UA 3SQWA 1XLTA 1NMQA 1IVNA 3COPA 2DHRA 4G37A 1FQOA 2WZQA 4OY3A 4RV4A 5AOAA 4YO8A 2SKEA 2X0IA 2YV3A 4YJHB 1OGYA 3ZWQA 1RYHA 1QHYA 2GAIA 2NLOA 5FA6A 2AC4A 3SLRA 4EARA 4EZIA 5CPBA 4JZYA 3ZVMA 1LBHA 3K5WA 2JCVA 4OJQA 2X6TA 5AVVA 1AIPA 3TF5A 1H05A 4S04A 1I3LA 2WU0A 1KR2A 2BPOA 1JLLA 3PQDA 1FQJA 4HLUC 4NFHA 2NOAA 2HMVA 3SJBA 3C45A 2QLMA 4IZOA 1Y5NA 4TGLA 3R7DA 1FNSA 3MCAA 1PJLA 4UNRA 3U4CA 5KIAA 2ZAMA 4RGVA 4JYPA 3CHYA 2VSXA 3PHLA 3EVEA 4FM9A 1E0DA 4BFCA 2XF2A 4K46A 1OD6A 2W93A 4YDRA 4ENVA 4W5QA 2H0AA 4O33A 4D98A 1N9GB 3U3OA 4MPRA 1ISFA 3RV4A 4D6PA 3SXJA 2HGZA 4TKMA 2HJSA 3ROQA 3SDSA 1UZAA 1IJFA 1T4MA 4TMZA 3IE1A 1DX4A 1OXTA 3N2LA 1EUYA 5CD1A 1E5VA 3SX2A 3GEPA 1JG4A 3RT9A 1J33A 1BEZA 2D62A 1N6NA 5EHIA 2ORWA 2WQ6A 2BR3A 2O3TA 1AMOA 3UG7A 4MR9A 1BGVA 5FUWA 4EUEA 3RAGA 4G8CA 3QSGA 2D74A 3ORHA 4I3FA 3RJTA 1Z0AA 3ICOA 4CLXA 1F4VA 1VHQA 2JFVA 4KQ2A 1YVEI 1V45E 4BIIA 2ZTVA 1GA4A 2QAGB 3KM0A 4QNNA 4EHHA 4UVIA 3LHFA 4YUWA 4FNOA 1FS5A 1M2VB 2UDPA 3H16A 1A7UA 1E2IA 4KBGA 4O3FA 1U4SA 1OWOA 2WILA 3IILA 3T5TA 4MS3A 4R2LA 2WSLA 4RWZA 2XGMA 2A86A 3AHDA 2VP9A 5TV2A 5U4XA 4D8YA 2WM8A 4L78A 3KOYA 3CMMA 2OOSA 4XIGS 5FYDA 4JI5B 2HYDA 2YJTD 1KJ9A 3KVYA 2CUZA 3CW9A 4CV0A 4JC4A 3GNTA 3H2BA 1D2CA 3ZCXA 2PMFA 4P5EA 4E5DA 4CM5A 2BMDA 2BP7B 3T5AA 2LTAA 1A72A 1MIHA 2QN2A 4Z2AA 1AKWA 1E58A 1L5FA 3BDVA 2NWQA 1MV5A 1RHRA 2WV9A 1KQPA 3CEAA 4YPFA 3ON5A 3PDUA 4IZIA 1B42A 2IVFA 3LDHA 2LE0A 3OZCA 4AJJA 3RBVA 1K08A 1MX5A 1DOHA 1U8FO 1YCDA 3L4BC 4TZ6A 3U4QA 1UJ5A 4Y1FA 1JQBA 3RU2A 1GUDA 1U0HC 2JIOA 3LUBA 1XXLA 4EECA 5F23A 3BXPA 5GVRA 3RDPA 2F3SA 5F35A 5BQOA 1YZNA 4B6JA 3AFNA 4DVGA 3WLJA 1QKKA 3GGGA 3MWKA 2IU4A 4LJ6A 5K3AA 3CPJB 3WFZA 4JU9A 4AVYA 2J09A 5GM1A 2YMQA 3BWDD 3DZIA 4I9UA 2K5UA 4EAQA 3O8OA 4KR7A 3CE9A 4JI7B 3WYEA 1V1MB 4DV4B 3ICCA 1AKRA 5DIZA 1EDOA 1Z7WA 2J3JA 2AN4A 2XOKD 5FOXA 5AW5A 1SXIA 2C5BA 4EJMA 1YVPA 2DWCA 1AQYA 3DO8A 4FD3A 3ZTTA 3UGTA 1LPAB 2O0LA 4Z9AA 3G68A 4XKJA 1FMLA 4UXJA 2EU8A 5CH3A 5TX7A 3EY4A 5E6UB 3GCDA 3EMVA 3LT2A 4G0UA 1FRFS 1T0JB 1Z75A 2X9QA 2FMKA 3CF4G 3FYTA 3GRKA 2ZTLA 3K0CA 1IB0A 4O59O 3HBLA 4RD6A 1AB6A 4PGGA 4RDIA 4QXPA 3SP1A 4WJLA 3GCWA 2VDRB 3MWYW 4II2A 2Z30A 1J2EA 1GFSA 2WSBA 1EINA 5E1BA 3LW7A 2PV0A 2LKDA 1R27A 3JQ8B 5DWVA 5HXAA 4WLFA 4C4PA 4BB9A 1TZKA 4OXKA 1OFVA 3HLTA 4D41A 1VJ1A 5K0ZA 3TG2A 1OYWA 1D6NA 1HG0A 1P9RA 1WNTA 5T64A 2OHIA 1Z4IA 2HSWA 3DZDA 3A9WA 3I5AA 1LTKA 2ZR0A 1HDRA 5K6RA 1DCTA 4KPYA 5C1BA 4BQFA 2DC1A 1NP7A 3RTAA 2VBGA 3Q3GE 2O2EA 2PEYA 4RFSA 2IV3A 4H35A 3WGNA 4Z4FA 2G9ZA 2OVBA 1Q21A 4WLNA 1XTJA 4MIKA 4FE4A 4D4IA 1F14A 4D5EA 5C8XA 1UKCA 5IVPA 4B46A 1FJHA 2BFMA 2OPBA 4FFSA 1X15A 1PUJA 3UCFA 3GJ7A 4OOEA 3ESYA 5AM1A 2EFDB 5B37A 2X13A 4H7FA 1KAOA 4HSEA 1AUXA 4JLWA 4B5KA 3USCS 1EIWA 4DUZB 3SICE 3SVLA 5B1IA 2UYHA 2JKZA 2EJWA 4IX1A 3U0VA 1JEJA 3R6WA 4JV5B 4K2AA 4IIVA 4NU5A 1BAPA 3DAFA 4MW9A 2P1RA 3RNOA 3VR2D 2JLCA 1UMDB 2J6IA 1DUIA 1JU3A 3ZUPA 4EAAA 5KTMA 3N74A 4OIMA 5BVHB 5B12A 2BFCA 4WKCA 4ZAYA 5HK8A 3UNXA 2A9RA 2SCUA 1P2UA 1T8SA 2VG8A 2OTCA 3LVQE 1A9TA 4UBNA 1FP4A 5COQA 2UYCA 1NUHA 3RHSA 4HXGA 1IN8A 3LSYA 3OEEA 1P8AA 1RFGE 2Q2QA 3DZFA 3IXMA 1KSFX 4D3ZA 1RC8A 3V33A 3OECA 2VATA 3EDCA 1DCMA 2HWUA 1VHLA 1YR1A 3E8MA 3B5IA 4W6QA 5HCNA 1JJFA 2D1RA 3GX1A 3WL5A 4B2PA 4BQPA 4N3AA 4FHDA 2W2QA 3AR8A 4LNUA 4DLZA 3CRRA 4X63A 2IHJA 4BAGA 2ATVA 4KE7A 3H18A 4XVHA 3HR8A 2A2ZA 1VP9A 1NHGA 4PQGA 1KEUA 4C6HA 5PGMA 4P7GA 5F52A 5EWLA 3TMAA 2CDCA 4REMA 1I1NA 3VDRA 4XRRA 1HGXA 4DDUA 3U62A 7MHTA 2YV4A 3ENNA 2W11A 1GG8A 3EUWA 2BSQA 3MFQA 5KX5B 4H4DA 3N0TA 2EX0A 1ZD9A 4KWEA 4OOFA 4MO9A 2FU5C 2DFLA 4FCWA 1YA6A 4IO1A 5AKIA 1Y8AA 3AU9A 2O8CA 1C7IA 3EZ7A 1LKZA 2R5FA 3VJKA 1KO1A 1QQ5A 2Q41A 3OU7A 3UHPA 1UFOA 3PDIA 1J97A 1MJNA 3CGWA 3S8EA 1IEXA 3AY3A 3KJGA 4DKJA 2CFSA 2FMTA 1PQPA 3T7KA 3HY6A 3VI4B 1X38A 3PQ6A 4HTAA 2IV2X 1NWCA 3R9KA 2YNMA 2IL1A 1E18A 1E1NA 2J0EA 2WJ4A 3GGPA 4XWGA 5AKKA 3FHJA 4H60A 4XB2A 5KC9A 4OQZA 2ZRIA 3I9LA 1JAHA 5HS4A 1X7WA 1D3AA 2I34A 2BEWB 3IQDB 2QP3A 5FQOA 2N1BA 5FOWA 4F4CA 4NP6A 4ZZ1A 2PG3A 1IY9A 3CG0A 3I9OA 3UK7A 3VISA 4GX5A 1FFSA 3W2GA 1X86B 2ZR7A 1BE1A 5FLKA 3C39A 4DL9A 1U9YA 1X2BA 2BBSA 2EG9A 2MMCA 4MB0A 4G0VA 4JOCA 3T41A 2ZBUA 5CBKA 3BK1A 2IS4A 1XKLA 2FP4B 3A1WA 3UB2A 2ZEJA 5IKMA 1WPGA 4HNAA 3SNHA 4KB5A 3ZZ0A 5B6JA 3NP7A 1NMSA 3DJYA 1M34A 3GVHA 4ZZ0A 2HQBA 4XDGA 5I7RA 2FPMA 1WS6A 2FE1A 4GKVA 2E48A 4UEWA 1I8TA 2P68A 4IDHA 3LYHA 1TXGA 2H9YA 1W8DA 4BRSA 3BTUA 3WGOA 2GZHA 1MO5A 1RAGA 1TZBA 1YI1A 2OP1A 4EHJA 4DLYA 1P75A 5B3LA 4BO3A 1SZJG 1V35A 2DFDA 2HYIC 3JPWA 3GN1A 3HA5A 4CG1A 4D26A 2H8KA 4XR9A 4M46A 4X3PA 4NE9A 1NQWA 1QCYA 3OZWA 1DBIA 4BUZA 2QPLA 2IBTA 1K92A 1JQEA 1E9SA 2I2DA 3HWRA 2J85A 1U5BA 4ALLA 1EXNA 2JJ2A 4L3WA 3U1BA 1A9XB 2Y76A 2GT1A 1QHSA 5AJTA 2RGCA 3K7EA 5A4IS 1QQAA 3CRMA 2GEDA 2WIDA 3VZDA 4BJ3A 5HFJA 4L8GA 1FLVA 5M34A 1R0XA 2P78A 3DW3X 4C43A 2GNAA 1R15A 2RGEA 4FFVA 2VT7A 4EVIA 1AHPA 1POXA 2Y0PA 4KODA 4QSMA 1FFEA 2PZMA 5DTEA 4FBLA 3CX4A 1Z6QA 2HSJA 2YCBA 5F51A 4YTEA 2WWYA 3WIOA 1G8AA 2ET6A 4QASA 1RM5A 4MYCA 1VZ3A 4P7JA 3CISA 4PLYA 4IIGA 3UMGA 3AM1A 3ZJUA 1HDGO 3AIKA 1VI2A 2NU7B 5I8WA 3T3NA 4U1RA 4BGDA 3HCFA 2Q27A 1RRPA 3VH4A 4MCAA 2IEYA 4MRAA 1L5OA 4KUHA 2WMDA 3X2EA 3WVNA 1QIIA 3HMQA 4E1AA 2YJZA 3KP1A 1C1XB 1G6OA 2D0DA 2DECA 2J3EA 2P3LA 4FZRA 5I9SA 5HA5A 1ZBQA 3AUJB 2IS6A 1QIKA 2EP5A 1QTNA 1YL7A 4GX0A 1O96B 3N2EA 2X0DA 1TKCA 3D3EA 3Q4GA 3KT3A 3MYRA 3I83A 4Q1CA 2AA3A 2HPVA 2EL7A 2Q49A 1M3SA 3AY0A 4MUFA 3GIWA 3D02A 4L22A 2WVJA 2VHEA 4ZTUB 3W9YA 1SRQA 4YRNA 2IHUA 1ONNA 2DULA 1GDDA 5CCDA 1JXAA 3EXAA 3K9BA 4E46A 1TVKB 4C0AC 4GKKB 4KH0A 1IJKA 5ALRA 1PHRA 3AFMA 1OC4A 1H85A 1T9ZA 3U48A 5KJCA 4QUJA 4TWAA 2WK1A 1CZLA 2RKBA 3F5FA 2DFVA 4DLSA 4JLBA 3WJ1A 4GVLA 5H0IA 5AIBA 4C2UA 2H1LA 2XBUA 5COAA 3U6BA 2I66A 2CMGA 3AGQA 1NIJA 4P4SA 1YR2A 1DJQA 3QF4B 3E23A 3R0XA 3IFSA 2FPKA 2XQGA 5ANRB 3TNYA 5KSYA 4TXHA 1SCJA 2Z57A 3OPYI 5AOBA 2WMNB 2QAJA 4X41A 1U5AA 4P3YA 2OGWA 2OSBA 4YMSA 4NDNE 4JL8A 2BKVA 3I9FA 1RCFA 2QHXA 3LWZA 3O3MB 1T2AA 4DA0A 4R81A 5J4HA 1S3SA 5F78A 4DR5B 4PX3A 2ISSD 1T4CB 3DNPA 1WWKA 3DDWA 3KSUA 2ACWA 5D6OA 5FWXA 1DSSG 1NGSA 1QS0B 4BNYA 3THOA 1SXQA 1KNQA 1QDUA 2RGXA 4FNAA 1A8IA 1OFIA 1DWUA 1ZLXA 1JLRA 1RJ9B 2W6NA 2WEKA 3AEUB 1BOOA 3GCGA 4GOOD 1MQAA 5A0FA 4MH0R 3WG9A 3MJDA 4B75A 1TQ2A 3T3OA 1GFIA 2ZSDA 3NEPX 1RJDA 5FHRA 4M86A 3VGJA 3I42A 4YJHA 1VL6A 3O3CA 3ZWXA 3ANXA 3BXXA 4DFDA 1PN3A 1KYYA 1V2HE 1ECPA 3WLQA 2E85A 2ZSJA 2ZPAA 3QG5A 3NOQA 3RVMA 3VHQA 5LQKA 2R79A 4L4ZA 1SC4A 2WTMA 5IHXA 4FHZA 1X8JA 2IPLA 3QZUA 1SXGA 2B8EA 3G6KA 3PB3A 3N8IA 3U13A 1DJNA 2I7TA 2VSFA 3U5ZB 3QX7A 1C7RA 2D1QA 4G0QA 3PUKA 4FX2A 3TDNA 3VX4A 4MQEB 1HL7A 3HA3A 3K9HA 1NM5C 2ZROA 5EGNA 3FCSB 4PLHA 4C7OB 2VJAA 5JDIA 1VKOA 3ZHOA 4GQIA 2UYQA 1CQWA 2I80A 2A30A 4MAAA 5K0JA 1CYDA 1FRQA 4KXLA 3ZI4A 4F12A 4ETIA 1JIQA 5CX1B 3UH0A 4QUEA 4J4BA 4HGPA 3TFOA 1LBQA 4M8NE 3T4EA 5EUQB 3U31A 1C8BA 2P7HA 4XEUA 4PO3X 2FPUA 2GKOA 4R3UC 3HXQA 4JLKA 2XNDD 1Z45A 2DJIA 1DTEA 2R00C 3DVAB 4M1YA 3TL3A 1WBBA 5JNVA 2JIMA 1N6KA 1JXQA 3AR4A 4G84A 4IZHA 4KNVA 4B33A 3DEIA 1Q7GA 4J0KA 5ALSA 1B73A 2O05A 4L9RA 4P58A 2IU6A 3C74A 5L9AA 1VOTA 2YUTA 4TMFA 4PU0A 1K27A 3D2BA 1UBUS 1OLOA 3G2PA 2CNLA 3IAAA 4J3JA 4XQ0A 1M2VA 4LJSA 3MD9A 4RLQA 3F7MA 1E3JA 4QNRA 4RMHA 3T9CA 2P3OA 5D5HA 4ZAZA 1O89A 4Z3DA 4F6CA 2QL5A 3PNBA 3ND5A 1M5UA 2W0SA 2NZVG 3NUZA 4JLUA 4J3NA 4MKXA 5YASA 4P34A 5K9ZA 2R4QA 4L7VA 1C9KA 2R25B 3WOHA 5DT9A 2RBGA 1LSUA 2A4MA 1NLZA 2WPDA 1A2BA 4K9KA 1GNPA 1LWNA 3QJYA 3LQYA 5KQSA 1QIMA 5JY6A 2XDQB 1F7VA 4DLBA 5K0FA 3I01M 2HK7A 3TR0A 2DH6A 1PVDA 4Q93A 3C8MA 5BMVB 4M1WA 1P1BA 4S1NA 4MVXA 3WAJA 5AW8A 1NVKA 5HX7A 3W7VA 2FX3A 1XQVA 1M6VB 2X7XA 3H2YA 4MV5A 3KSZO 4KVZA 3MS7A 1T1GA 2O1WA 2HCTA 4FHGA 3B8HA 3LOQA 4M60A 5ITZB 4YV1A 4NOKA 1JILA 4BKOA 4BLTA 3ROFA 2QP9X 3O84A 1EP9A 2RHTA 1BW9B 1TRHA 2ZJ2A 1T3TA 4BWFB 3H1PA 1NN3A 1ZIYA 1NJFA 3IMGA 4HEA6 4PLGA 4LGVA 3QFSA 1LTHR 5PNTA 1TCAA 2FW7A 3OIFA 4B3MB 1D07A 2GVDC 3PUVA 4TWRA 1ECFA 3VPBA 1L4UA 1TT5B 1VL0A 1C0PA 4B48A 2C3MA 1V1MA 3E2PA 5F7ZA 4G86A 2QY6A 2UZIR 2ZSIA 1T6YA 1NW3A 2IU3A 2HMWA 1Y1KE 2I1LA 4Y6LA 2HWWA 4NBLA 1Y1LA 4AM8A 2J0UB 1NBHA 3DBLB 4CKEB 5J1SB 4Y30A 1HQCA 1ZOPA 1K7CA 2YJNA 4HQ0A 2H1RA 5E6UA 4ZZ2A 3QXGA 4OU4A 4O8CA 3U39A 4PQRA 4ARZA 1CUFA 4NCKA 3E81A 1ZQ1A 4EITA 2ZIGA 3PQFA 4ON9A 2PJUA 3TAHA 4CTOA 2E5WA 3C8ZA 1APBA 3F97A 4DLVA 5M3BA 1FDWA 1NT4A 2PZ8A 3IEPA 2RHMA 3JQ8A 4LJ7A 2QD5A 3P2KA 3KPJA 3NBXX 4IVRA 2P7IA 1YJ8A 4ZFNA 2JKYA 4AP6A 1COZA 1NLFA 1C4XA 1DIGA 2EXXA 4ZVNA 4NYIR 2XVYA 2QRLA 4OREX 2WTXA 5HQTA 4WKOA 2X0RA 1Z2DA 4TWIA 3UK1A 4B47A 3AUSA 5I7HA 1E8MA 3I2HA 3SFTA 3N2KA 5A4DA 5HP4A 2OK8A 3VHRA 3BILA 1XU7A 3VXKA 1FTGA 2FLKA 2J8ZA 3BVPA 3ZDDA 1B26A 3DVLA 3O3NB 2ZDQA 2VWQA 3CX6A 1VDMA 2OPHA 3UCEA 1YRYE 2NZUG 3BSFA 5HFAA 2X4GA 5IKOA 5C7IO 3W5HA 1OU4A 4FFLA 3SKXA 3A4VA 5CFLA 5KOIA 1GZ5A 3QQ5A 2PT5A 4I55B 4IQFA 2NTVA 5CPFA 4BJ5A 1AHHA 4Q4HB 3OX3A 1P4GA 2H1HA 1K86A 5AT1A 2H1OA 2CHEA 4WBSA 3ZDYB 5I5EA 5IWCA 4TLLB 3NKFA 2XDWA 1JN0A 1VG0B 2MR6A 1QHNA 1UMDA 2REQA 3OICA 1LDNA 3GT7A 4HWSA 3V9PA 3ZWKA 5ICSA 3AP2A 3E9DA 4XCQA 5MDHA 2Q46A 1J90A 3N2NA 5EE9A 2PZLA 1TJ5A 2KBFA 3ZXXA 4BTVA 3PIRA 1BJRE 3FWPA 4BMCA 3M5CA 3WLPA 3FHTA 1M2KA 1NJ5A 9ATCA 1BD3A 1WXIA 3O90A 1KYWA 5IF9A 2JJ8A 5KYXA 4GT1A 2J3MA 4K0RA 1RQXA 5CT9A 4PG8A 1A8QA 2QL7A 3KVOA 1NJ2A 1QPGA 2W00A 1B8NA 1NBAA 2X8BA 1CR1A 2A33A 3UYKA 1P0FA 3JQEA 3TEJA 4RCZA 3A6EA 4AMBA 2ZVQX 2KI5A 3K30A 2XRMA 3VYTB 1TAQA 1U0GA 2O7SA 2P0AA 1UK9A 2L19A 3E27A 3KG2A 2NSJA 1LLCA 2RGYA 4BNLA 5HIKA 2UZ4A 1C9MA 2VS1A 3K0AB 1YZ3A 2QMHA 4F3CA 5JEDA 4CN9A 1ODJA 4U2GA 3DP7A 3AINA 4F2HA 4N7JA 1D2AA 1KOGA 2BD0A 3PGA1 4F1JA 1N2HA 4B3HA 4CLRB 4MGYR 2PMCA 2PXHA 3KQOA 2QTVA 1N0UA 1RYFA 2YJ5A 2EF1A 3U3JA 5HMLA 2QORA 5KHAA 3H13A 4ZK2A 2CNWD 2R68A 1FFCA 4CF3A 4O2RA 2ZATA 5C3MA 1GGEA 3QK7A 1SHUX 3C3YA 3K16A 1AKUA 3C7TA 4OB8A 1RWPA 3RC2A 3UJPA 1VCHA 1GAXA 2YWCA 4DLWA 5KJ1A 1LPSA 2FTKE 3B3FA 4QFDA 1I4DD 3GMSA 3BD7A 3ZXUB 2F1HA 3BWYA 4B7CA 1QR6A 2A5FA 3O83A 4D9IA 2FP4A 4X7RA 1IY0A 5JD3A 3JCZA 4KV9A 4D5GA 3P2YA 3H9QA 2C4NA 2C7BA 1YR9A 5C18A 2CJYA 4YI5A 5FAXA 5AI4A 1EVIA 4GR4A 4KZKA 5FLYA 2PX8A 2R1ZA 4P53A 1OI2A 1ESDA 4OFWA 4TLMB 5CXQA 4WNIA 1BOFA 4X20B 1VB3A 3EH2A 3LMKA 2Z6VA 4BN0A 5CVJA 2L82A 1WY5A 3PHHA 2ZAGA 1NAHA 4B6GA 2DBYA 3P9YA 3EOZA 4B7XA 4KO8A 3WWZA 4K5QA 3S5UA 4EG8A 1IZ0A 1N8SA 1DC5A 4PNPA 2V9ZA 2ODTX 3HYCA 2XQIA 4Q9LA 4OM8A 2Z98A 4B3TB 1I5EA 3M0EA 2VAXA 3I92A 3M6FA 1IOVA 2DPMA 3ZE6A 4ZD6A 4JI6B 5JROA 5EMNA 1IQRA 4Y2XA 3WNBA 4H3HB 4KKXB 1LC3A 1N5JA 5HQ3B 3KPUA 3KHSA 4JD5A 2HA4A 3LKDA 1UBGA 2WYHA 3IVGA 3MWJA 2DGDA 4QAQA 3WICA 4DJEC 3H87A 1HG1A 1T3SA 1JLHA 4BU1A 1VIYA 4EEXA 1U90A 1Q5PA 3ETCA 1Z7GA 3C7DB 2P2SA 1OHHD 3KQHA 1NQUA 2OY0A 1XCOA 2NU7A 1GXSB 2Q5IA 3DTVB 3LXUX 5AFSA 3T15A 1W47A 4A6PA 3EDQA 4DGQA 1QDEA 5IBPA 5J40A 3HUTA 3DL4A 4DLLA 3ITDA 4URVR 5BWOA 4N54A 1WCIA 3VM6A 1Z38A 3L9XA 1LH0A 2EGHA 3HZHA 1O96A 3L8CA 4DCJA 2OLKA 3BMNB 5GJCA 3UEOA 2AN3A 4B09A 1YKGA 4FZJA 2NO1A 1SKUA 1I5RA 4TUYB 5TMEA 3GVXA 3QVTA 4U2CA 3RO7A 3RYIB 3HYRA 3BICA 4BECA 1V0JA 2O7VA 5I48A 4I5DA 2NVBA 1HOXA 2PKXA 4YLEA 4D3XA 5BUQA 2NO5A 2L2QA 3AOEC 2IQIA 3PJRA 1CZKA 1JW9B 4HO1X 3RVDA 3M6AA 3V6LA 3GBSA 2GR9A 3FCEA 2C29D 3NORA 3C4JA 2GLXA 5ESDA 2D5IA 3AEXA 1K8QA 3WLFA 1WB5A 3CMCO 1I5OA 1MRNA 3O38A 4WNAA 3ZK8A 3FCOA 4R9RA 4BZZA 4QFCA 2VYVA 3ADPA 2QLJA 5I9BA 4TKVA 3LP5A 4QG7A 1V5GA 4JXJA 2YIVX 5GZ6A 1V8ZA 2A7XA 1YBHA 4W6ZA 3A2LA 3SR4A 3IPRA 1H2RS 4HADA 2LW7A 3NGMA 3ZE7A 3WK9A 4EELA 4KPEC 2H51A 1Z2OX 3F4LA 2OD7A 3ENZA 3LDFA 3FHLA 1QF6A 3AGPA 5F5LA 2JI7A 3N8GA 3ID6C 3P5SA 1T3ZA 3STWA 1NUTA 2Q62A 1U0SY 1BWRA 1NF2A 3E9QA 3RC9A 3F74A 1S8AA 1CVLA 3S2FA 4M55A 4D4MA 1QS0A 3DYBA 1L5RA 1FX0A 1LLDA 3EAFA 1S7GA 3KLNA 3QBEA 2X8JB 4UJ5A 2G1KA 1G3QA 3ZKWB 3AEUA 4KFUA 3L7CA 3PWZA 5HS6A 5FOVA 3N6RA 5D7NA 4JJEA 1KF0A 2AZMA 3Q7SA 2GJ9A 3HPQA 1LQUA 2BY4A 3OO1A 3QMMA 5E0OA 2FZCA 4EA9A 1RD4A 1Y9JA 1TE2A 3CRQA 4YNBA 1HNWB 2BZ1A 3ENWA 5JWOA 2BI7A 2VHJA 4CQMD 4PN3A 2VDKB 4ZXPA 1AF7A 2BGMA 3GA5A 1B23P 1V4VA 1ZXLA 2Q6TA 4R3NA 4I4TB 2PUBA 3NBKA 1ORVA 2AOUB 5HUHA 3K0EA 4HK4A 3VR0A 1GHTA 3BXGA 3LO8A 4OHPA 5EEHA 3DVQX 3JATA 2XE4A 3OZUA 1WMDA 4L74A 3T3EA 1N75A 4EG6A 2NXWA 3HEAA 1VYUA 4C7OA 4IG4A 2QRNA 7GPBA 4YJFA 5AVUA 1SUSA 1RIIA 2W6PA 1G17A 1Y3HA 1TUEA 2NO0A 3EUEA 2MJLA 2RGBA 2L18A 4XA8A 2LXNA 1ZH4A 5CX1A 2YN4A 3NHSA 3W5SA 1OXKB 1SHKA 2CEAA 5BSUA 2QUAA 3CKYA 3KSRA 4L95C 3MILA 1QGOA 1KIFA 1QUEA 2MSEB 3O2NA 5ESRA 3T5CA 3BGWA 4CF4A 3QXCA 2PL9A 4C04A 4R41A 1NVXQ 3P0EA 4KQFA 3UOWA 3GJ6A 4EEZA 4R1MA 2H8GA 1J7KA 4NCHA 2FRXA 1WCWA 2PQMA 1KAQA 4QHSA 4YUXA 1Q3KA 3G8AA 1J09A 5C51B 1A5ZA 1AS0A 5LMNB 1XPUA 1ZH8A 2CKDA 5T4BA 2PSFA 3F6SA 2DAPA 4KR3A 1YGPA 3ZVNA 3PDCA 1J0AA 2W6ID 3PWTA 1G3UA 3FD8A 3F67A 3FRIA 3BL8A 4JYAB 2IX9A 4NBUA 5HKLA 1U3TA 1R88A 1X94A 3BHJA 4KN8A 3UAYA 1PS8A 1M0EA 3COJA 5AVKA 1ZIPA 7ABPA 2RSLA 1SVUA 2PT9A 3K2QA 4MINA 4MKHA 3S28A 4CKWB 4HN4B 3BMOB 2M6SA 1YE8A 1S1CA 1LUAA 3NPMA 2Z1NA 5ISMA 2XDQA 4P5PA 2IEBA 4CFSA 3IAUA 1TYBE 3ZBUA 4IVPA 2YXDA 1E9FA 3GRCA 2X1VA 4RJ2A 2FSVC 3FWZA 3NKVA 1TA9A 1WXFA 4INJA 2ABWA 4YXFA 1N2BA 2JFGA 4MVWA 4O29A 4BO0A 5HCIA 5I7FA 5IABA 5C37A 1EFCA 3LFHA 3NBUA 5CIYA 1XP5A 2XCLA 3PXAA 3U9SA 1U4NA 5J2UB 3SXUB 4YMLA 4JSYA 2ZWPA 4ZCPA 2DHCA 4Q6BA 1UOQA 1XIVA 5AQ1A 3I0MA 3WGKA 4WKNA 3D8SA 4MPDA 1BW9A 1RC1A 2HQRA 2WB4A 1S8OA 2JASA 3R5HA 4N01A 4YCBA 2MDTA 4ZRNA 5KNBD 2J08A 2NP7A 3AI7A 1ZWLA 2UZAA 2C2BA 2XNCA 2ENUA 3GEIA 3PCRB 1J06A 1V8BA 2BI4A 3Q9UA 1H6AA 3QU4A 1I2ZA 3QE3A 3OLYA 3PGXA 1PJBA 3FPAA 3PEUA 4MA4A 1CUDA 3PYLA 3RT1A 4ZGWA 2C7OA 3V46A 1TF7A 4UJ3A 2VQ3A 2PUEA 3CVYA 2Z3VA 2C83A 1WV1A 1P6QA 2HN9A 4HVCA 4IKPA 4CCYB 1SZCA 3DBLA 3L41A 4NMXB 2HU2A 1POWA 2AUMA 2IYZA 4R98A 2X2PA 3DLBA 3BN3A 3EA0A 4WBXC 1YQDA 3UANA 2XODA 4P22A 5H5JA 4AG3A 2PH1A 3FSJX 3EFBA 1ZJWA 2WYOA 6CHYA 1T2DA 3WLIA 4RMGA 4RHYA 5E7IA 1U1CA 4GG1A 3WJAA 5TPZD 4IIJF 2XWPA 1FZQA 4D9HA 2QT9A 5JAIA 3T7IA 4HDKB 3BBPA 3RC3A 1QGED 1SRRA 2H3HA 5GOTA 4TZ0A 4PZYA 3CF0A 1SOUA 4Z7JA 4E5VA 4ENWA 5IANA 2P9QA 4BDTA 3CZ4A 3HR7A 3MRTA 4CMJA 4J43A 1Z6AA 3BEOA 3DKVA 1CIJA 1VG9B 2ZB4A 4PHTA 2BGIA 3T5DA 4BZXA 1IOLA 1HE3A 4ENSA 1X8XA 2Q5HA 3WISA 4ZEOA 3AVQA 1EP1B 3H2GA 2PR2A 4F85A 1JB9A 1E60A 4INPA 5GJBA 2DPXA 2OQ2A 3CUEF 3GVCA 2EV9A 2PAAA 4HNRA 4IGAA 2VZ0A 5FWDA 3MAGA 1HY3A 1H2AS 3Q8XB 3K2BA 3VR4H 3U26A 1USUA 1U2TA 2GJSA 1UKBA 1Y5LA 2HEGA 1XVIA 2O6LA 2QVXX 4BNUA 3KSMA 3CLKA 4NBTA 2JFFA 4R54A 1ANKA 1MW9X 3A0RB 1S3GA 2FWNA 1G2QA 1U2RA 1WXXA 4KLZA 4KXVA 2Z2KA 3AKDA 3E3LA 2GCOB 2O8NA 5KTOA 3O93A 4ACBA 5B55A 3RS4A 1L7NA 4OU5A 3RRMA 4D4JA 2JD1A 1H4VB 3FWYA 4J2HA 2B4AA 2IHNA 1L8XA 3JQAB 5THQA 5IDQA 3SJCA 1WPXA 5ESWA 2C0CA 4CTMA 1TMYA 2XDAA 4F2DA 2IUYA 4OB7A 2PV7A 1U0TA 5ILQA 1CE8A 5AKLA 2W2NA 1HDZA 1G63A 1WVIA 4XTCS 1XCLA 3E5MA 2E2WA 2GN2A 3BE8A 4HAZA 2YVLA 2YZKA 4V0MA 3FLMA 4X1IB 3KALA 2R2AA 5FIUA 3WLEA 1OF1A 4BTEA 5AM0A 4COOA 4IUDS 1ZAYA 3ZOZA 5KAMA 3ADDA 3J80A 1ZISA 3ILHA 4L02A 2G07A 1GV1A 1P31A 4FKBA 1W1WA 1C0LA 1DWOA 1WX1A 2CLKB 2CXRA 1ULTA 4Q15A 3LY7A 2PL1A 4UKDA 5LZ5A 4NESA 3CB2A 5A02A 3F6EX 3ZU3A 5L95A 2C5FA 3F7OA 5TLSA 3M4JA 6YASA 1FMFA 3IJPA 5A9SA 1JX6A 3RS2A 1IN5A 3L1JA 5EHZA 3AW9A 3R7NA 4P0TA 2RG7A 4UAVA 3K70B 1PV4A 1XMSA 1Y8QB 2ZZMA 5EP3A 2WMYA 1KY2A 2PUTA 5LQMA 2KX7A 1RE1A 1SAYA 4QECA 5TXGA 5CIWA 2JGRA 4BMXA 3B1YA 5LFAA 3IXLA 5ITWA 4HAWA 3IALA 4BMSA 1U1IA 1JFTA 2GF2A 1C3EA 3IVAA 4IXDA 4OBEA 4YJGB 5LDGA 5F9MA 2ZJOA 2OQIA 2P90A 4KXNA 2OESA 1DT3A 4L5YA 2ZRHA 4WLOA 3L8DA 3D7RA 1H22A 1OXVA 4UZFA 2WTEA 5F2EA 3M70A 1DC7A 4BLVA 5A5GA 2HKIA 3HL0A 4U7HA 1C7QA 1B6SA 1JQKA 3UC5A 3T5MA 3GJZA 3JXEA 3OM1A 4RETA 2IYUA 2G80A 2W9XA 4NFSA 4CLEA 1QIDA 3PHBE 1NTRA 1Q84A 1A98A 4WECA 1KTVA 2ZT5A 2YDYA 5JC8A 1FFXA 3WA6A 2C97A 5HSGA 4PHHA 2H85A 2PFSA 4ZMRA 3FWNA 3LUGA 3H4VA 3T06B 4QUDA 4BATA 4Z54A 2AX3A 3ZV6A 1I51A 4ZU3A 2D1TA 2GK4A 2FAXA 4X20A 4P08A 2ZJ4A 3PT5A 1E2KA 1G8PA 4O1IA 1B43A 5DCYA 3RW9A 4DMRA 4XVUA 1I4TD 2FEOA 2W98A 1OBFO 1OLSB 2C5EA 1J56A 1JJ7A 3IRVA 1Y3DE 2B25A 3GD7A 3PYMA 4UU1A 2AG5A 4LXIA 3V2UA 3DJFA 2E7ZA 2WFLB 2OZLB 3JD4A 1KRXA 2PKCA 1DARA 1MUUA 1OX4B 2B5WA 3X1YA 1VSUA 5CTJA 2OFWA 1PNTA 1WP4A 1IWBB 2FFAA 1TQ8A 2QROA 2LWIA 3C8DA 3HCDA 3UW3A 1B8PA 1M1NA 3H5RA 1QO7A 3KFVA 4D44A 3H5NA 1JEQB 2H11A 2JFPA 3UF0A 5JXWA 5HNKA 3F73A 4I1PA 3V80A 2IHYA 4JUBA 4Q9JA 3ED1A 1UKVY 2FI1A 1WBJB 3PFGA 4V02A 2H48A 3TZLA 1NVWQ 3QW4B 3W90A 2AVDA 2BGKA 2YRWA 5JAOA 1Z5VA 3B6JA 1XGKA 3QHAA 4GE3A 1JWLA 3EVTA 1A8UA 4JC8A 1QHXA 3OFND 4I4NA 4XIYA 1KFCB 1WSWA 4IH1A 5DHSA 3TTTA 3KV3O 3I5YA 1CUGA 2I2CA 1U0RA 2YICA 1QZXA 1UMBB 3BCUA 1U2QA 3QVOA 3JWEA 1K6EA 1L5ZA 3E5RA 1TK3A 1PZEA 3JZDA 4F5ZA 1SVOA 3DTVA 1GXSA 1QHIA 3FPHA 2NNWB 1IY2A 4RK5A 4AROA 2X6QA 4CKBB 2M6LA 4MEAA 1GPUA 3WXMA 4UVEA 2BLNA 2WOJA 1A4IA 4HZUA 4QU5A 2AR9A 3S2GA 2NT4A 5GQSA 5B2EA 1O9GA 1OTHA 3OJEA 1J8FA 1TNDA 3A6DA 3DQZA 1RU3A 3NC1C 1HV8A 3PXEA 1JQAA 3BMNA 4XJVA 3DD1A 2QD3A 3W8RA 2WC1A 2CGEA 2GD0A 3M5PA 3RYIA 4RVHA 4N65A 1EVQA 2FWBA 4MW0A 1U8XX 1IBMB 1Z5OA 1Y7IA 4QPNA 4UNIA 1QHGA 1OZ0A 5H59A 4C20A 1FSGA 3L4JA 3BWCA 2CB9A 5GTDA 1CZNA 3COZA 3TIVA 2B21A 5FPKA 1YQWA 3URKA 1QH0A 3A2NA 5HR5A 3M6MD 4RGYA 4UEQA 3ES9A 2FX2A 1O9HA 1RRVA 1I2BA 1F60A 1FRNA 2WQ7A 1IBLB 6LDHA 2RCYA 3IUJA 4N9QA 5DXJA 4X66B 1BDJA 3AERB 1JMVA 4UBIA 3G79A 4C30A 2RBKA 1O0CA 1ND6A 4OI4A