2EKPA

Structure of tt0495 protein from thermus thermophilus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
238
Chain Sequence
ERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title The first crystal structure of NAD-dependent 3-dehydro-2-deoxy-D-gluconate dehydrogenase from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
total genus 85
structure length 238
sequence length 238
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ekpA00
1MP0A 3SLKA 2I99A 4J7UA 1C0KA 5EJ2A 5GY7A 2X0RA 2R2GA 4UULA 4IDFA 2Q4EA 3DOJA 2PKQO 2A92A 4BO4A 4EUHA 2Q49A 3QSGA 4OSPA 3CIFA 3WWYA 1MX3A 2E48A 3ASUA 3I9LA 3K6JA 3OBBA 3RWBA 1PR3A 3WWZA 3HDHA 4BNFA 4NZ9A 4OQZA 2WYUA 3KLPX 2UAGA 1ZSVA 2YFHA 4BKOA 2NVWA 2WD7B 3DBLB 2Q1WA 4PLWA 1IPFA 4E5PA 3QY9A 4A10A 2AMFA 4TVOA 2GD1O 4E32A 2Q2WA 4WJZA 4L4RA 4BNGA 3F5SA 1R37A 3O8QB 2AQHA 2D5CA 4HUJA 1VPDA 3BMOB 5GZ3A 4CMGA 4F3YA 2DPHA 1Y9AA 4HV4A 3E48A 5F21A 3I1JA 4OXYA 1SNYA 3F6YA 1AXEA 1EK6A 1R4NB 3GVHA 1PR9A 4B8ZA 2X0JA 3OIFA 3BMNB 1JAYA 3GOHA 1HDGO 4PLZA 1JW9B 1RWBA 4JBIA 4PN3A 4YPOA 1CYDA 1S6YA 5H82A 1OAAA 1YOVA 2AEMA 2BI8A 3GAFA 5TC4A 3VTFA 4E0BA 3H2ZA 3G49A 3JQ9A 4D3FA 1E77A 2XXJA 2NM0A 1ISMA 3HWRA 3FR7A 4UEOA 3WMXA 4E30A 1G1AA 3UGKA 3RC1A 4RCVA 1MA0A 1H9BA 2GRAA 4UREA 3GH3A 3N7UA 1ZK1A 4QTZA 2B4RO 4H16A 1OBFO 3JQ6A 2IEDA 3A4VA 3STHA 4BVAA 4CM7A 5HWSA 3W6ZA 3KSZO 2NTVA 2VWHA 4ZJUA 2IODA 4Q9NA 3C1OA 2DUWA 1QYCA 3GRPA 1OC4A 3OQBA 1IULA 1ADFA 1TT5B 4OJNA 1U7TA 4GAEA 1ZKMA 5DCUA 1NFQA 2DBRA 3PJDA 4S3MA 3D4NA 3E9NA 4H3VA 5AXBA 4CJXA 2CF5A 3WGYA 3S2IA 3CZRA 1DC4A 4TZTA 3GVIA 4FPXA 4TQGA 2POQX 4PG7A 2X6TA 5IF3A 2DFVA 2Y0EA 1E3WB 4K1LA 4E2XA 1EDOA 1Y8QA 5HBRA 3GMSA 2QX7A 5IZ4A 1XYGA 4DIBA 1PGJA 1RKXA 5GZ1A 4II3A 4RPHA 1PJCA 5EINA 2O3SA 1K3TA 1KY4A 4BO6A 1L7DA 3B1FA 4J91A 5I7SA 1ZNQO 4QT0A 1JKJA 3F3SA 1VI2A 4DPLA 2W2LD 4LCJA 5C3MA 4HX5A 3MEQA 4MIOA 3VH1A 1IZ9A 2ZIZA 4HBGA 1MG0A 3FPLA 5A04A 2VTDA 4QO8A 4XCVA 3PEFA 5JDIA 3VPHA 3AFNA 1M2WA 3UCEA 4BV8A 5I8WA 3DZFA 1HE2A 3WGQA 4B4VA 3JTMA 1X15A 2AEJA 5JDCC 3HN7A 1V6AA 1VL0A 3L77A 1BDMA 5IXSA 2FPIA 3WDSA 2WM3A 3ADOA 3A1NA 4PG4A 1J0XO 4JP3A 1BVRA 4HP8A 5BSEA 4R5MA 1RJWA 1HZZA 3AJRA 2Y1FA 1K6IA 4IDGA 2D0IA 1K5HA 2IZ0A 1X7GA 1TXGA 3A06A 2VHVA 3TOXA 4CM9D 2NTNA 3U5TA 5KVQA 3JQBA 4CUKA 4WCFA 3TFOA 3ZWMA 3TN7A 3MJEA 4CR7A 4BO1A 1HDYA 4R69A 3O26A 2J3IA 2PY6A 3QV1A 4B4OA 4HFMA 4A7PA 5L51A 3QRWA 3GGOA 1YKFA 1FK8A 1IL0A 2EG9A 1U4OA 1NASA 4DWVA 4GBJA 3T7CA 1YL7A 2YDXA 3FWNA 1KEWA 3W4JA 3F4BA 2I9PA 2V6FA 1ZJZA 4Q3BA 3WTBA 3LF2A 4BL5A 1MUUA 1LRJA 2B35A 2ZTMA 1EUZA 4YJFA 2Q50A 5DN9A 2ILTA 1Z75A 4J2OA 1VKNA 3KV3O 1Q7GA 3LC1O 3OJLA 3AM3A 1EQUA 3PQDA 4TKMA 5CEFA 2HO5A 4AICA 4A2CA 4O5OA 2D4AA 4FFNA 1H6AA 4IQ8A 5DBGA 3GQVA 3QVTA 1Z73A 2X58A 2BGLA 4FFLA 3VDQA 3JYNA 4BO7A 2AW5A 5JC8A 1PWZA 4Q3CA 2EP5A 3TNLA 5JY6A 4BO5A 3AUSA 4RVSA 4WLEA 3RUAA 1ISHA 1VJ1A 3ZV4A 3S2FA 3PJFA 3UN1A 1Y1PA 4BNVA 1WLYA 5ADHA 3ADPA 3NKLA 4QX6A 3V2HA 1KETA 3IAHA 4Y6PA 5HS6A 1DHTA 2PKQP 3NEPX 1NR1A 1ISJA 3TDKA 4CV3A 4ZRMA 2GLXA 2EKLA 4OHUA 2BKAA 2NACA 2I6TA 4U0KA 4CM6A 3NJ8A 1UXHA 5C5IA 1X13A 2W2KB 3V8BA 5JAIA 3I52A 5CHEA 2GN6A 2O4CA 2WD7A 4FS3A 3WFJA 3JQCA 2A35A 3EMKA 1JWAB 2Y1EA 4ND4A 1A9YA 4TWRA 3OA2A 3PWSA 4AJLA 1D7OA 3CTMA 3O8QA 5DCWA 5BNFA 3P2YA 4P22A 1GTMA 5L95A 3WQRA 2Q3EA 3ANMA 4GLLA 4DQUA 4RJTA 1DSSG 1GCUA 4BNKA 1QYXA 3FI9A 1P1JA 4NBWA 1T2FA 3C1TA 4GKVA 2JCXA 2HK9A 5G0TA 1W0CA 2HRZA 1GZ6A 4JX8A 1VRWA 1SB9A 1HDOA 2H6EA 2IE0A 3AM5A 4PLPA 1EBFA 1PZEA 5TLSA 2QIOA 4WPGA 4DQXA 4LMRA 1E3IA 3S8MA 2FMUA 4CPDA 1YVEI 1U4SA 3O38A 4J43A 2BLLA 1R0KA 4XR9A 3F4LA 4RGBA 4DLAA 4OYRA 1PWXA 4BNZA 1U8FO 2Z5LA 5T64A 4LISA 1SOVA 3MTGA 2PH3A 1E3EA 3EVTA 4XIJA 5T57A 4NMHA 2H9IA 3JQ8A 4RPJA 1IZ0A 5KVSA 3KRTA 1JKIA 4I5GA 2DQ4A 1YB4A 3QVXA 3H9JA 4I9HA 4L4XA 3WG9A 3AI2A 1Z45A 4PLFA 3T4EA 5EIOA 1YJQA 2IRWA 1EZ4A 3PPIA 3ORFA 3QP9A 4RVFA 4Z3KA 5B4UA 3BHJA 3NV9A 1LC0A 4BQRA 3D0OA 4JJIA 3PHIA 1GUFA 4NJMA 3EY4A 2J8ZA 3JQFA 3E9QA 2NU8A 4A27A 4LVCA 4EZBA 3HDJA 1P77A 2FPGA 3QVOA 4O0LA 5EMHA 5G0VA 1Z7EA 1BXZA 3G3EA 3ZZNA 2JKVA 3PHLA 2WJPA 4YAJA 4D44A 2XAAA 1BW9B 1IYZA 2YY7A 4D43A 3PVZA 3CMCO 4BNYA 4L0QA 4JBHA 5FYDA 3WGGA 2IYOA 1GDHA 3V1YA 1P3DA 3PGJA 3JQEA 2IEBA 2O7SA 4QSMA 5DF1A 2Z95A 4TRRA 1O6ZA 3SJ7A 1BHSA 1PZGA 2X5OA 3K96A 4YWJA 1NNUA 4MJLA 4MVJA 4MP8A 4BO9A 1RYEA 3PDUA 3AY7A 1HZJA 3ZWCA 1UAGA 5JYDA 2O2YA 3TZQA 1Z74A 1JQBA 3T7EA 4A5OA 4L4SA 5BT9A 1YE3A 2VHYA 1ORRA 1SPXA 3TL2A 4R1UA 2DC1A 4CL8A 1PU2A 4LCEA 2EF1A 1PL6A 3H5RA 5TT1A 4XYLA 4FOOA 1HLDA 4E2ZA 1UZLA 1N7GA 3KEQA 5A5EA 4Y6SA 2Y1GA 5TQVA 1HKUA 1LX6A 4FJ0A 5ICSA 3D64A 1B14A 4XYEA 5THQA 2JCVA 3JYQA 4EYEA 4OH1A 3KLMX 5L4LA 1JTVA 3PFWO 2BFMA 4J90A 2VZ9A 4QFCA 1VE9A 1LBEA 4ALMA 3IUSA 3ST7A 3KOUA 4J1TA 3EHEA 3AWDA 4NK4A 4WLUA 3ETGA 3HFSA 3MJSA 4GLOA 3WQSB 3OIGA 3GEGA 4AJ2A 1ZXBA 2VYVD 3JQBC 4YYZA 1E1NA 1XA0A 5B4TA 5H81A 3NUGA 4Z6KA 3FWZA 3OSUA 2AG8A 5KOIA 3M2TA 1X1TA 3GGPA 1XIVA 2RBEA 3RC7A 1LQUA 5U1PA 3W4IA 3DMTA 3EC7A 1GV1A 4Z9FA 3KM0A 1XEAA 4CV1A 1A7KA 3A14A 4CL3A 1CQIA 5AVOA 3OIDA 2NUAA 4NQZA 1PJ2A 4U0JA 1EDZA 5TF4A 4WOJA 4PIVA 1T2EA 2G0TA 4IGFA 3GFBA 4E5YA 3FBTA 3IP1A 1B16A 3IQDB 2ZYDA 4W9NC 5AXDA 4Z9YA 4B3HA 1E6WA 3GG9A 4NI5A 1UDAA 2E4AA 3GK3A 4ND3A 4K6FA 4MKRA 2WE8A 5MDHA 1Z7BA 3DZHA 5FFFA 4RVHA 4BGUA 1NFRA 3R3JA 5BNIA 3GNTA 4CMBA 3E6AA 4L9RA 3E5MA 2VNAA 1PEDA 1U9JA 4O63O 5CEEA 4INAA 4M86A 3GNSA 3ASVA 4BNXA 1YH3A 4GH5A 1HDXA 4XGNA 1B3RA 2ZJ0A 2CSUA 2NQ8A 3DONA 4U7WA 3VAZA 4TRJA 3WIDA 1K89A 5KVVA 1ISGA 2NTJA 1EFLA 2CVQA 5C7IO 5CG1A 5AQ1A 4E5MA 3I9MA 4ND2A 1GYPA 4O1MA 1WZEA 4F46A 4XYMA 4DYDA 1RM4A 4AFNA 4DMMA 3DFUA 2V6GA 3LC2O 4PG6A 1TLTA 3M2PA 3GRKA 4N5LA 4DPKA 4YRAA 1B8PA 4PLHA 1PJSA 1I24A 3NAQA 2RHRA 4PZDA 5TGDA 4EJ6A 1PJTA 2BFAA 2VYNA 4IMPA 2A94A 3U0BA 1J4AA 2YHUA 2ZKLA 2BH9A 5HM8A 5KJCA 4J7CA 3VH3A 1O8CA 2GUGA 1WWKA 4RF2A 3ZWVA 3CZMA 1LDGA 4QFDA 1XDWA 1VJ0A 2JCYA 2OOSA 2UYYA 3I6QA 3PYLA 3UOGA 4CLHA 4GWGA 1PQWA 3C24A 3FSRA 4FFOA 1MFPA 4WOKA 1ISIA 1YS4A 2Y0CA 4DC1A 4JP2A 1NM5A 1DAOA 1P9LA 3OQ6A 2VYND 1LU9A 5BSGA 4B7XA 1B8UA 3Q3CA 3IOYA 4GMGA 4LGVA 5A9TA 4IINA 1YONA 3PK0A 3MOIA 4WK6A 5DP2A 1SBYA 3BHIA 3DOCA 2P9CA 4XYBA 1P1RA 3FNGA 3PLRA 5FF9A 1I2BA 3OMLA 3CXRA 3DEYX 4RORA 4CMKA 5I7EA 4BKPA 3KYCB 4BMSA 1U3TA 3GDGA 2VWQA 4JJFA 3AM4A 2DTEA 1VSVA 4JGBA 3JD3A 3MTJA 5I9NA 1M6WA 1BRMA 4RLHA 1JKFA 4KUGA 5ENVA 4DBVO 5DBFA 3VVCA 3MJCA 3K2BA 5CDYA 3SC6A 1DLIA 2FP4A 1M67A 1QLHA 2HK7A 1XQ1A 1YQDA 3GVPA 3DO5A 4U8GA 4NK5A 3LDHA 1XELA 1BW9A 3JQFC 1ZZEA 3KVOA 5HRUA 3L4BC 2I76A 1U1IA 1LDBA 1U3VA 3U62A 4DMLA 1ZW1A 2VHXA 2IZ1A 1O5IA 5U4QA 1M76A 1YQXA 2EKPA 2JD1A 4YEDA 2FN7A 3GDOA 3EGOA 5L40A 4J1SA 1WZIA 4KWIA 2CDAA 1NR7A 1ZK0A 1DLJA 3ETDA 1PTJA 4JN6B 2HAEA 4DREA 2ZQYA 4BGIA 2JHFA 2ET6A 3L6EA 1LLQA 5C37A 3RVDA 3AI1A 3AUTA 1KVUA 1MFZA 1EE2A 1Y5MA 1GL3A 4JBGA 1GQYA 2O3JA 2C0CA 1B2LA 4NFSA 2PKRA 3H7AA 3S1LA 2IXAA 3FCOA 2A9FA 1MXFA 1P1HA 1E7SA 2Y68A 3I23A 4ND1A 5K6AA 4YTEA 1ADCA 5IZCA 4WE3A 3WOHA 3QWBA 5GZ6A 3PHJA 3HADA 1HDRA 2VT3A 2VOEA 1I30A 2A4KA 5DULA 4CLOB 5CEJA 3JD2A 5GMOA 2G82A 1WAMA 8ADHA 4CM8A 4JQCA 1PGQA 2VCYA 2EV9A 4PVCA 2BF7A 5G0SA 1PS9A 2FR1A 4OO3A 3M1AA 1FDTA 1LC3A 1YRLA 3CKYA 3WIEA 4D42A 3WGIA 4MVJH 2D2IA 1BSVA 2AG5A 4QO7A 1B26A 3ZWBA 4L74A 1F8GA 3VC7A 4CUZA 3WYCA 2GDZA 3AY3A 2XOXA 1PS8A 2BELA 2UV8A 3ZV5A 4ZICA 4QEDA 4YACA 3IKVA 2DTDA 1LLUA 4HWKA 2VUSA 1MXHA 2VUUA 4LRTB 3TL3A 4AJHA 5CPFA 4C4OA 3RCBA 1ZO8A 4TZKA 5G0UA 4TSKA 4RF4A 1V9LA 1YJ8A 1T24A 2EW2A 2TMDA 3B1KA 3PP8A 4R9RA 5CPBA 4XD2A 5JCJA 4XZ3A 4B7UA 3EYWA 2ZB4A 3AI3A 1UJMA 3DMTC 4YT5A 3WNVA 5L45A 4KUHA 4HY3A 3ZWOA 1SMKA 1T26A 3UH1A 1PX0A 3DZKA 3P19A 3LC7O 4DBZA 4E2WA 3HNPA 3U09A 3FR8A 3RSHA 1KIFA 5K0ZA 1UAYA 3U49A 1AE1A 1E92A 5TNXA 3QIVA 2X8LA 3WYEA 1B3BA 3H9QA 2QRJA 4MO2A 4FJ2A 2Q45A 2RH8A 4P8RA 2I5PO 4G65A 4DQVA 5IXYA 3JQ8B 1O94A 2HJRA 1IB6A 2DPGA 4NFHA 5JCJD 2IXBA 4CMAA 3OA0A 4II2A 2EP7A 4AVYA 2GN9A 4F45A 2HMWA 3KXDA 1QYVA 3NYWA 5DDIP 3OFSA 5A3VA 2VZ8A 1ONNA 3D3WA 3KETA 2C2YA 4B4UA 2GZ1A 4GKBA 4W99A 4ZQFA 3RD5A 1E1MA 4KQXA 5HS4A 2D3TA 4JLWA 2DBVO 5IDXA 5KKCA 1NFFA 1D1SA 4NJMB 2ZJ1A 4P38A 5B4VA 4D0SA 3QVSA 2W2LA 2HDHA 3QA9A 3BYZA 4GX0A 2RCYA 4TROA 1ADBA 5B12A 2HK8A 4BNWA 2I67A 1ZUD1 1F12A 4BNLA 5JW6A 1K0UA 5DT9A 3GY0A 3HB4X 2P91A 3ZU5A 4UEKA 1EVIA 2GN4A 5A5FA 4ZA2A 5T67A 2I3AA 3PJGA 1V8BA 4WASA 3A9WA 5CDTA 3EW7A 1MLDA 4LK3A 2WTBA 4WCDA 2E37A 4YCAA 1P0FA 4YRBA 4L73A 2P2SA 5JAQA 3Q9UA 2B36A 1PQPA 2AE1A 3QQPA 4I5FA 3MJ4A 4IXWA 4NIMA 4YJHB 4DTIA 1ZMOA 4CM9A 1UZMA 1B15A 4Q3NA 1QG6A 1EEHA 5TS3A 4QECA 5CFZA 1PGNA 1H6DA 3I9OA 3VZSA 3Q9NA 4N7RA 2Y0DA 4RO0A 3RFVA 3G0OA 4IM7A 1C3VA 4CLDA 4PRLA 4R01A 1UXKA 4ZGWA 6ADHA 2C20A 2EJVA 3L07A 3UUWA 2O3TA 3KYCA 4MVJP 1EVYA 2X86A 1GFSA 4CLRA 1E3LA 2B37A 1O0SA 2AHRA 1DJQA 2WE7A 3JQAA 3U3XA 1O9BA 1GZ4A 4DVJA 2CNBA 3FBGA 2EERA 2YYYA 1R0SA 3EUWA 3AOEA 4KZPA 5F1KA 2ZCUA 4JIGA 2R6JA 3ENNA 1WXDA 1VL8A 3W6UA 2OGUA 5CDGA 4WNCA 1K2WA 6LDHA 4FD3A 1J6UA 4CQLA 2DBQA 3LT2A 4B79A 1X14A 1C0PA 4W7IA 3DAGA 3DQPA 3GEDA 3QJ5A 3TZHA 1LA2A 5EQFA 5JFOA 4PLYA 3DHYA 5A05A 3GAZA 5DZSA 1FMCA 5JAZA 5J23A 3JQAD 4FQ8A 3ICPA 2ZCVA 4I5EA 1NQTA 3DFZA 5ILGA 1SAYA 5BNTA 2GSDA 1N9GA 3UCXA 3PIDA 4KTVE 2VNSA 1GV0A 2NU7A 1NX6A 4OGWA 4R68A 4WKGA 1KVQA 1XWFA 1LRKA 1DAPA 4J9UE 4IBOA 4YDRA 2Q46A 4PZCA 3LF1A 1BGVA 1P1KA 3JD4A 3GGGA 1ID1A 3FNHA 3Q2KA 5U9CA 4IDBA 5A03A 1GZ3A 3TZ6A 3OJOA 4IDDA 5JYEA 2X23A 1P44A 2J5KA 5EN4A 3X2EA 4CLOA 1T25A 1ZJYA 3BXXA 3I9NA 3JD1A 5CP8A 4E5KA 5TIIA 2OMEA 5IZCC 3L9WA 4LSWA 2YDYA 2OHXA 3NDRA 1WDLA 4K9DA 3HJAA 4BUCA 2JAPA 4LRSB 2O3RA 3KBOA 5COBA 1OOEA 4FCCA 1P0CA 4PGFA 5A9RA 5IJZA 2DVMA 2OORA 4XB1A 3ABIA 5BR7A 2DU8A 2Y05A 3TZKA 2VHZA 4P4NA 4S1VA 3C7CB 5IFLA 2X0IA 2R00A 1HYGA 4MIYA 3RKRA 3HFGA 4CR6A 4CMIA 1C1DA 1BWSA 3WSWA 1E7RA 2J3JA 4TRMA 2E82A 4GWKA 3HDYA 3OJFA 1O95A 3DTYA 2VHWA 2AE2A 2UVDA 4MP3A 1D1TA 1UXIA 4MP6A 1N5DA 2W8ZA 3WX0A 1DIRA 5T6BA 3Q11A 3RBZA 1RPNA 3VHRA 3GVCA 2DKNA 1R16A 3ONEA 4KWHA 4J9VA 1VLLA 1TVEA 3OICA 1AGNA 4A26A 1U28A 3E82A 4NU5A 3WBBA 2X22A 4DC0A 1ZIDA 4EUFA 2P5UA 3DZGA 3ENKA 3PWKA 2TMGA 1EBUA 5THKA 1FDUA 3WGHA 1H2HA 4CM1A 2WD8A 2X7HA 3AU8A 3GEMA 4FFPA 4FN4A 4ZN6A 1ZSYA 4IJWA 1HSZA 1EVZA 1YO6A 1ZEJA 1W6UA 5CDSA 4PVDA 3KO8A 1HE4A 4PG5A 3NRCA 4GGOA 3E9MA 4D46A 3RJ5A 4AJNA 5I7VA 1H94A 2ZYGA 2Y1CA 1JAXA 3SC4A 2RAFA 4CLXA 4UVEA 3JQ9C 3S55A 4GPD1 3MCVA 3H4VA 3CMMA 3SBOA 1BXKA 2YV1A 1DB3A 1BDBA 1J49A 3CUKA 2OBYA 1JVBA 3ONFA 2B4QA 3ZWNA 3KHUA 3UXYA 1CDOA 3QW2A 3ANNA 2PGDA 1SEVA 4JXKA 4IDCA 3IC5A 3FNEA 3HB5X 4MVJF 5A4DA 3MOGA 4IS2A 1W73A 4IZHA 1H9AA 4CMJA 4N5MA 3L6OO 1MB4A 1U5CA 3DAPA 1CJCA 3HG7A 5JSFA 3Q2IA 5IG2A 2O23A 5I9MA 2H63A 4RLSA 4BNHA 3RUHA 4OMUA 4Q3AA 3QLJA 4L76A 4MKZA 4OOFA 4CV0A 4W82A 5A3JA 5IDQA 2WEKA 3KYBA 3AUUA 2BI7A 3F1LA 4GVXA 3WGTA 4GX2A 5L53A 1ZVMA 3I4CA 1OZAA 4MOWA 3V2UA 1EFKA 2AA3A 2PR2A 5IAAA 1N92A 4YJGA 3NT5A 4Q3DA 5KCZA 2GN8A 5HTOA 3GPIA 3AW9A 3DBVO 5L3ZA 1P31A 1ZK2A 2X9GA 3WYBA 1MC4A 2BFPA 3AUAA 3B6ZA 2YUTA 1DIGA 1VM6A 3GUCA 4IZIA 1Y6JA 1DRUA 3ANLA 1SOWA 4YJHA 2PD6A 1KEUA 1VKOA 3VKUA 2EKQA 4FGSA 3ROPA 2P68A 3EVNA 2HSDA 2H5LA 4R3NA 3S2EA 5FWNA 1IY8A 3TSCA 2DM6A 4OIMA 4RZIA 2GPTA 3GLQA 3QWAA 4L8VA 1PJLA 3G17A 3VPGA 3PLNA 2VYVA 3PQFA 4H7PA 4OXKA 4B3JA 4AG3A 4HKTA 5B37A 2PZMA 5JDIC 1MGOA 3PHHA 2D5AA 4D3SA 2B83A 3DL2A 4QXMA 3UW3A 1HLPA 3NGXA 4J4HA 4XRRA 5FEUA 1KVTA 3JYOA 5KJFA 3DC2A 3GZNA 1FDVA 1PL8A 4BO3A 5G0WA 4CM8B 1L7EA 2EHDA 5EQDA 1ML3A 4RL6A 3KTDA 1DC3A 4W6ZA 4FIZA 2HMSA 1GY8A 1LNQA 3OM9A 1CWUA 2IYPA 4UVHA 1DFIA 3MJVA 3RC2A 3JCZA 4WCFC 1QYDA 5AXAA 2VWPA 3LYLA 5AXCA 1ENZA 5BSHA 3MWEB 1KY5A 1E7MA 4XWYA 4AJEA 3WXBA 4BKQA 3L4SO 1NXQA 2RH4A 4R16A 5K9ZA 2GASA 4HNGA 1JA9A 4BS9A 3TOZA 3EDMA 4NDNE 4JJGA 3H5AA 2PA3A 3ONDA 1AXGA 4IJKA 4J0FA 1FJHA 1QSGA 2BRUA 1DBVO 5FI3A 1LSUA 1I5RA 1Y9EA 3GDFA 5COAA 5KVCA 4N54A 4OSOA 3JQ7B 3C3XA 2JHGA 3K73O 2FSSA 1NQOA 3H5NA 5G4KB 2PD4A 3FRJA 3OJEA 1GAEO 2V7PA 2VRCA 3K92A 3WR5A 4FSHA 4KUEA 4XRGA 1R6DA 4XQCA 1Z6ZA 4WLFA 4BNJA 1GD1O 4BKUA 4XR4A 4FFMA 2H1SA 2CDBA 2JL1A 2O4UX 5ER6A 4ITUA 4ALKA 1HWYA 2HKIA 1W8DA 2BHLA 3B1JA 2YV2A 3FPCA 1YDEA 3GF4A 3JQGB 4J6FA 5DBIA 3RJ9A 2GYYA 2DAPA 4BB5A 1N8KA 1A5ZA 5DCYA 4YXFA 2B5VA 4UEJA 4NFYA 4BMVA 1RM3A 4BB6A 1E7WA 5A9SB 1GUYA 3D3WB 2HMVA 2FRDA 1Q0HA 2ZB7A 3PWZA 2PGJA 3K2EA 3O4RA 4OAQA 4DIOA 3Q6IA 1UDBA 4FGWA 4RZHA 4WECA 2VRCD 3U4CA 3H3JA 3C85A 1LDMA 1X7HA 4UUNA 2P4QA 1PZFA 1M66A 3GN2A 3I6IA 3TJRA 4NR0A 2VQ3A 1OMOA 1PL7A 4ID9A 4Q39A 1XGKA 3HUDA 2C54A 1YB1A 4HFJA 4ZRNA 1HE5A 1GPJA 1E7YA 3ZWYA 3JD0A 2EGHA 2OO5A 3INRA 3K30A 3K8ZA 3WGZA 1LUAA 3UHAA 4ESOA 4NNJA 3F9IA 3WMWA 4R9SA 2DBZA 4RPLA 1D8AA 1F06A 1QLJA 2G76A 4YT4A 4UUMA 1UXJA 1I2ZA 1EQ2A 4DLBA 4LMPA 1T2DA 4FJ1A 4HNHA 3QWFA 3RBXA 4EUEA 4ZQHA 4PLGA 4JK3A 3NJ4A 2CD9A 5JAMA 5TRTA 4PFJA 4J0EA 1UDCA 2CMDA 2OBNA 5JE8A 2PK3A 3IJPA 3JYLA 2Q2VA 3PZBA 4ONEA 1PJQA 2D59A 3L0DA 1I3LA 4MVJM 4R4JA 3EAGA 1Y81A 4ROSA 1RM0A 5LDGA 1BG6A 4I08A 2C59A 4ILKA 3KEOA 1U5AA 3UF0A 2CUKA 3ZU4A 3I3OA 4CLRB 1ZEMA 4OOEA 3JQAB 3VTZA 4M1QA 4D79A 1C1XB 2PZJA 1IHYA 1OC2A 3VOSA 3ZU2A 4BO2A 4CV2A 1NPYA 1XSEA 2QQ5A 1DRVA 3HE3A 4FFRA 1KC3A 4G81A 4GMFA 1WDMA 1EMDA 4UVDA 3PQEA 1I0ZA 1IHXA 1A72A 2YV3A 2Q1TA 3ZWPA 2CDCA 1DDOA 3WS7A 5IN4A 3LSYA 4YT8A 3FF4A 4BKRA 1NQAO 4J16A 4LSMA 1ZH8A 4CQLB 1U7HA 3VZRA 1X1EA 5EESA 4JCOA 4ZQBA 4QQRA 1HTBA 4A03A 5FI5A 4I5DA 1ZFNA 1DXYA 3BMQA 3ROMA 2P4HX 2DTXA 3AK4A 3TPCA 3VKVA 4B7CA 2QZZA 4MIEA 1U2DA 1ZBQA 1IPEA 3EK2A 3H9GA 1LDYA 1I8TA 2ZTUA 4MDHA 4MVJE 4PLVA 5IN5A 3DB2A 5F5NA 1PGOA 4YAGA 1DC5A 1DRWA 1N9GB 1ENPA 2Y66A 1P45A 5KJ6A 2DFDA 3NDIA 4HADA 2YW9A 7MDHA 3SXPA 3RUIA 1GU7A 1G0OA 1GPDG 4J4BA 1DIHA 3UCFA 4E6PA 3UICA 4O59O 1XU9A 1T4DA 2OFPA 3COSA 3RUEA 1C0LA 1MG5A 1F0YA 2PZLA 1R12A 2D8AA 2CVOA 4QUKA 4M8SA 2G17A 1KEPA 4E12A 2Y99A 3F47A 2Q1SA 4EBFA 1DHRA 1PJ3A 4TVBA 2XPCA 4WGGA 3M6IA 3VVBA 2J3HA 2NSDA 3FN4A 1PJ4A 1QXSA 2GZ2A 4I9NA 3DAFA 3H9UA 4BV9A 1ONPA 3VH4A 3EZYA 4JROA 3BTVA 4YAEA 3ZHXA 4OQYA 3L6DA 3ZNNA 3BA1A 2I65A 2EW8A 4RDIA 3INTA 4Z0PA 2GGSA 5L4SA 1AHHA 2V6MA 3LLSA 2OXIA 5DP1A 1K6XA 5I8ZA 1GCOA 2BMAA 2RIRA 1UUFA 4AJOA 1G0NA 2D1YA 2C07A 3H9EO 3DBRB 2NU6A 3WGOA 1ISFA 5L7TA 3ZWAA 3AOGA 3U9LA 3WICA 4AJ1A 4NH4A 2IDZA 4ZVVA 4CMIB 1UP4A 1C1DB 1GUZA 1NBOA 1R15A 3L9XA 1LDEA 4RVDA 3G1UA 3V5NA 5ILOA 1GYRA 3PDJA 4CMEA 1KERA 1T4BA 3LK7A 4XX0A 5JBIA 4EJ0A 3NX4A 3KYDB 1WDKA 5C7OO 4ALNA 5F1PA 2J6IA 3IIEA 4GVLA 4H15A 4CQMA 1E7QA 1GQ2A 3ITDA 4C7KA 1FF9A 4NHEA 4CM4B 1EUDA 1ENOA 1ZK4A 5ITWA 2Q99A 1QV7A 1SCUA 1CETA 3VZPA 1J5PA 2BD0A 2EGGA 3JQ7A 1P1IA 3ETEA 3LT0A 4P4GA 1ENYA 3PZRA 3IKTA 4AJIA 2FY8A 1JU9A 3RI3A 5G4KA 4XB2A 2P5YA 4K6CA 3GHHA 1LLCA 3DBHA 3LT1A 2ZK7A 4RF5A 1WMAA 3WJ7A 1XLTA 1DFHA 1OI7A 1R0LA 3GVXA 5LC1A 3OH8A 1T2CA 4GGPA 2HQ1A 3CPSA 2EEZA 2VTEA 4CQMD 2XF8A 1LSOA 5ENDA 2HRBA 4IIUA 1WVGA 2SCUA 4D3DA 1LTHR 2WWRA 2YHIB 3JQGA 3CEAA 4XQGA 1BVUA 4FB5A 3DTTA 1E1KA 3FTNA 1YGYA 4CUJA 4DRYA 2I3GA 1BXGB 1RM5A 1GEEA 2J5QA 1E5QA 4IGEA 5A9SA 3TRIA 1Q1NA 3LU1A 1NAHA 2NVUB 4XGKA 3TWOA 4ALLA 3RROA 5JC1A 1NVTA 3BMCB 1XQ6A 4LN1A 2PFGA 3SJUA 2NQTA 4D45A 5TX7A 2C82A 5AYVA 1HF3A 2HMUA 1XHLA 2PNFA 1E6UA 5JNLA 3P7MA 2G5CA 1ARZA 4ZU3A 4IIVA 1EE9A 1NAIA 3PHGA 4B4WA 1KC1A 4M49A 3H8VA 3A28A 3ZH2A 4R1NA 3W4KA 3M1LA 4PRKA 5JLAA 4YJGB 2JFGA 5BSFA 1HETA 5B1YA 2Q4BA 1JVSA 1R4MB 4BO8A 4YAKA 1UP7A 1F8FA 2JFFA 2X0NA 5BQFA 1AUPA 1KVSA 1SC6A 5G2OA 1Y8RA 2AQIA 3T4XA 3RU9A 1BMDA 1EVJA 3HSKA 1YQGA 4I9UA 1CRWG 3PTZA 2WYWA 2JD0A 4YQYA 1XG5A 1XR3A 2QG4A 1V3TA 4CR8A 1DEHA 4WEQA 4R51A 3N74A 4XA8A 4NBVA 3S2GA 3PYXA 4I1IA 4UAGA 3LQFA 2Q1UA 2GR9A 5ER9A 4Y67A 4PZEA 3E8XA 1K6JA 4O6VA 3DOOA 2QW8A 4NBTA 1I3KA 2ZATA 2NV6A 3P2OA 3RU7A 3ZWWA 2JJYA 5JS6A 1C1XA 3ZNPA 5JCXA 1LJ8A 3P5SA 3K5PA 3QVWA 4M55A 2OZPA 5CDUA 3D3EA 4MKXA 4OL9A 4D7AA 4WEOA 5COQA 2HMTA 3FTPA 4ZQEA 4XDYA 3GZNB 2YFQA 3PXXA 3ZI0A 1C14A 1E3SA 1HT0A 3BIOA 4Z3DA 5JXWA 4FBGA 4AJPA 4BNNA 4GI2A 2FZEA 3G79A 4IUYA 4DPMA 4J1NA 4ND5A 4E2YA 4AJJA 1CEQA 4XJTA 3UAGA 3AU9A 1QORA 1YBMA 2PD3A 5ITVA 2FWMX 3OETA 1NYTA 3F5QA 3MZ0A 3LLVA 2I66A 3JYPA 1AHIA 3D5QA 3RAJA 3IUPA 2YJZA 2UUPA 7ADHA 1AN9A 4GQAA 5A06A 4J1QA 1E6EA 2C7VA 4XIYA 3GNQA 1W4ZA 2W4QA 2C5AA 2DLDA 4GSLA 4KP7A 4LVUA 3SEFA 4ZHSA 3BTUA 5KJ1A 4WLOA 4WUVA 2HJSA 1LI4A 1XKQA 2CFCA 2EXXA 2OP1A 4K26A 4UVIA 2DT5A 2CZCA 1RYDA 3RFTA 4A0SA 3B70A 5DOZA 5KWEA 1ZMTA 3OECA 4FR5A 1NHGA 2ZYAA 5KIAA 3VPSA 5L7WA 1T1SA 1A27A 2ZB8A 2Y67A 3ZU3A 4IDAA 1QV6A 3GFGA 3VDRA 3O03A 2OL4A 3IP3A 3OF2A 4F6LA 5JO9A 3ZDFA 3VZQA 4YT2A 3QWIA 1NVGA 4D0RA 2LDBA 3CINA 1GADO 1B7GO 5TJHA 3GUYA 5L9AA 2B69A 4W9NA 1XCBA 5IDWA 2QRLA 5K6AC 3DDNA 4RDHA 1XU7A 3PFFA 3C8MA 2VWGA 3GPDG 1LXCA 3DR3A 3HN2A 1V35A 2AQ8A 4BOYA 3BZUA 3ZW9A 3WQQA 2VUTA 4HFNA 1PSDA 1TB4A 2BFOA 1FDSA 2FR8A 3DWFA 4XJSA 3TQHA 4KMSA 1MV8A 3DBRA 2PH5A 2X4GA 1UXGA 2YQ5A 1H6BA 3U4DA 1D4FA 1DPGA 2O3QA 5IDYA 1YWGO 2AXQA 3WFIA 1A4IA 1NWHA 3IL2A 2F1KA 3GZ4A 1YBAA 4F6CA 4PLTA 3KYDA 2LDXA 3KSDO 1T1RA 1E5LA 4NG5A 3VH2A 2FZWA 1WPQA 3NGLA 3UFXA 4CM4A 3ROQA 1U8XX 1P33A 4CMEC 3V1UA 5ICMA 2W90A 1HSOA 1ADGA 1X7DA 2Y1OA 3F46A 2J3KA 2Y1DA 4CMHA 1HE3A 4MVJG 4XDZA 3ZGYA 5KNLA 4G2NA 3DBLA 4YA6A 2NNLD 1UZNA 1H5QA 3I9JA 3KUXA 5T8KA 4RQUA 3WTCA 2C5EA 4RPGA 3PJEA 3MWDB 2PWZA 3JQDA 3E5RA 3MJTA 1SO8A 3JV7A 3PGXA 4XQ9A 5CAEA 4Y6RA 4FOSA 2ZQZA 4BGEA 3BMOA 3CE6A 4RVUA 3NTOA 4WLVA 3WSVA 3Q1LA 5LCXA 1R4NA 4UVGA 1CQJA 1B0AA 1EK5A 2YHIA 3BMNA 3W8FA 5KKAA 1I32A 9LDTA 3H65A 4CMCA 5L7YA 3NT2A 1BXGA 3HZZA 3OQ1A 2C7GA 3R0IA 4CLEA 5C7LO 3U4HA 2QZ9A 2AEFA 2C29D 4MVJI 5KTKA 1E0DA 1QMGA 3ZHBA 5TT0A 4ZQGA 2NVUA 4YQZA 2G1UA 4DGSA 4BO0A 1D3AA 4DLLA 1VC2A 2Z1NA 3BMCA 3LVFO 1Q7BA 3RKUA 1Y7TA 4E4YA 2B4TO 4FW8A 3GG2A 2PV7A 4B3IA 1HYEA 3DXFA 3KB6A 3NTQA 4KOAA 1GQQA 3WB9A 4M54A 2VZ0A 2X9VA 2V6BA 2OUIA 2PLAA 4TMFA 5H83A 1PIWA 1TEHA 1Y5RA 3GN1A 1KEVA 5LDHA 3GR6A 4GSKA 2RHCA 1YL6A 3IS3A 2QYSA 3BMQB 4Q3EA 4U5QA 1TT5A 4DIFA 1R4MA 3V2GA 3HDQA 4E21A 4IJVA 1HDZA 1I3NA 4OKIA 3RBVA 4NU6A 3F1KA 2GO1A 1E3JA 3L4BA 2W98A 2HUNA 2VOJA 3C7AA 2VT2A 3QHAA 3E18A 3ON5A 3SLGA 3W1VA 4G5HA 4R1SA 4ALJA 1WW8A 1ZSNA 4Y8VA 1E3WA 1Q7CA 4Y9DA 4AJ4A 2X5KO 4A73A 1WNTA 4R54A 4EDFA 5AOVA 3EZLA 1DIBA 4D41A 4DXHA 3H2SA 3I5MA 2J5RA 2BGMA 5MGBA 1A71A 1I10A 3GA0A 4GL4A 4KTTE 1I33A 2Y93A 4ZD6A 1X0XA 2GERA 3NT4A 4BNMA 3CSDA 2OP0A 1I36A 2NLOA 3RQSA 4HXYA 3D4PA 1ULUA 2DUUA 3IJRA 1UP6A 1VSUA 4FC7A 1A7AA 2FR0A 4IXTA 1KBZA 3BTOA 1UR5A 1HRDA 1Q0LA 4XGIA 1NP3A 2NADA 3ULKA 2ZB3A 4XEHA 4E3ZA 3D7LA 4IQGA 1Z82A 2UDPA 1CF2O 4NJOA 5EL0A 4BNTA 1NTOA 1G6KA 2O50A 3AOEC 1F17A 1NPTO 4EI2A 1HYHA 1TT7A 1WP4A 3DHNA 5JO0A 3D1LA 3W8DA 1LEHA 1N7HA 3INGA 3LZ6A 4J49A 4YRDA 2X9NA 3WJAA 1DJNA 4E33A 3H6KA 1YDWA 1IUKA 4YR9A 4NBUA 4MVJD 5DNAA 3RUDA 1TI7A 2B5WA 1KOLA 1PZHA 2FSVA 1Q0QA 4IY1A 1IOLA 1ULSA 3GHYA 4OM8A 3OP4A 2WYVA 2CF6A 3RUFA 1N2SA 3K31A 2WMDA 4Z0HO 1PGPA 2WDZA 4CQMB 3G1TA 1QR6A 1MC5A 1V3VA 4RPKA 4GX1A 3ZHZA 3WNQA 2FHSA 4CODB 4CM5A 3UVEA 3SVTA 4R3WA 1F14A 4WLNA 3C7DB 5TJ9A 3I9KA 2FOIA 3RC9A 4EITA 3VPFA 1PQUA 4B8WA 4LW8A 5TSDA 4BHTA 4R41A 1ONOA 3VPXA 2ZTLA 2JD2A 3FNFA 1YBVA 3TFQA 1ZXLA 1HXHA 3FHLA 2WSBA 3DBHB 4EEZA 3AY6A 4AJKA 1P74A 5L4NA 5G4LA 1H93A 4BQPA 1SEPA 4URFA 3R6DA 4OKNA 3ZNOA 3WLFA 4U6QA 1S7CA 2YQ4A 4J3FA 3WLEA 2QYTA 3ZV3A 1NVMB 1DFGA 1LQTA 3GT0A 4KDEA 1H2BA 4BNIA 3X2FA 3BAZA 4P4LA 4E31A 3KZVA 1LSSA 1QYWA 2NU9A 1NQ5A 3RUCA 3KSUA 1FDWA 1YOVB 1LRLA 1Q2XA 1QKIA 3GMDA 1HDCA 1QP8A 3B20A 1T2AA 4M87A 4AL4A 1U3WA 2FPPA 3PYMA 3E1KA 4NPCA 4IMRA 4RF3A 3DHEA 3IMFA 1KYQA 3GC6A 1V3UA 1DC6A 3FD8A 1N1EA 3OEYA 4J2HA 5T5QA 2Z1MA 3IDSA 4HFRA 1VJTA 4GX5A 1JLLA 2UUOA 3R3SA 5F5LA 4WNIA 2R00C 4XYGA 3DMYA 3ZCXA 5A1TA 3C1AA 4BNUA 1JDJA 4J7XA 1L1FA 4IJUA 1TA4A 2GCGA 3ZHYA 2BGKA 2W2KA 1JWBB 1NPDA 4Z0TA 3ZV6A 4W4TA 3RASA 2Q2QA 3DZJA 2QHXA 1DO8A 4BGVA 5HA5A 3E03A 4L75A 4NBRA 4IS3A 2PGLA 4YJDA 3SX2A 1KS9A 2CY0A 3K9QO 4UUOA 3PRJA 2EJWA 4CM3A 1O89A 1PJBA 3OJ0A 4K28A 5T8KC 1I3MA 4Z9XA 4MINA 4DYVA 3QWHA 2PTGA 1Y8RB 4EW6A 4W7HA 4R1TA 2GF2A 5EERA 3N58A 1R66A 2E49A 1ZCJA 2EIHA 1PS0A 1UH5A 3ZN2A 3CH6A 1H6CA 1Y8QB 1JN0A 1EUCA 1NWCA 5I9LA 3I83A 3R1IA 1LSJA 1HL3A 3OHSX 1B8VA 1SB8A 3NTRA 2JFHA 5F1OA 1ZK3A 2ZTVA 3QE3A 1P1FA 3RIHA 3OEWA 3NDJA 3H3FA 1IE3A 2PZKA 1QRRA 4TKLA 2X1HA 3W8EA 3D4OA 3ITKA 3ZNQA 4J4TA 1A9ZA 2B0JA 1N1GA 5KJEA 1BTOA 3PIIA 1FXSA 4IPTA 3UKOA 4XKJA 2V65A 1YB5A 3LT4A 4YB8A 5EPOA 3DZBA 5JDCA 1CERA 4KDFA 1YXMA 1HEUA 4YVFA 5JPIA 1YL5A 4EGFA 4EJMA 2O3UA 1SZJG 2HLPA 2JAHA 2QRKA 5JY1A 1E1LA 1WMBA 2YZ7A 4DL9A 1NHWA 4RVGA 2XXBA 1GR0A 3D5TA 2NWQA 2HCTA 1X0VA 2X5JO 4X54A 4DUPA 1KVRA 5F3RA 1H0KA 4OXNA 4PG8A 4PLCA 3WBFA 1C0IA 2VRBA 3PI7A 1CIVA 9LDBA 3ICCA 5JMPA 1DOHA 2E6UX 4WCFB 4E5NA 4IQ0A 4E13A 4PCVA 4UUPA 4BMNA 8LDHA 1LDNA 2F00A 1A4UA 3HQ4O 4DA9A 3I4FA 2IZZA 1I2CA 3TF5A 4FC6A 4IDEA 4TRNA 5CG2A 5I7FA 1GYQA 4RQTA 4U6SA 1M75A 2GZ3A 3JSAA 4BIIA 1I01A 2O7QA 2HU2A 3Q0EA 5DOVA 2P9EA 4YJFB 2EWMA 2AQKA 2NVBA 4N18A 1DIAA 4ALIA 3ZW8A 5A02A 5JMWA 3ROKA 3TZCA 1LLDA 1GEGA 2O48X 4Y98A 1M6HA 3U4IA 2VN8A 4RV9A 2CVZA 3BTSA 4R5HA 1VL6A 1V0JA 4FDAA 4N5NA 5ES3A 4KQWA 1OFGA 4C7JA 3O9ZA 4JNKA 3AFMA 3BHMA 4YAIA 2O2SA 4XQEA 4M89A 2GNAA 3HHPA 1U2GA 2C2XA 2P9GA 4I8XA 4EEXA 4MPDA 3RFXA 3ZWXA 3V1TC 3DZIA 4YBZA 1U3UA
chains in the Genus database with same CATH superfamily
1MAAA 1WULS 3V8NA 3QK7A 4QYXA 3UATA 5IK2D 1E9FA 2AG0A 1UPTA 3K0BA 1HFWA 2Q28A 4O08A 5HE8A 4Q18A 4BCDA 2ST1A 4KK4A 1G8MA 1N0WA 2C4WA 4NG4A 1YZLA 4EUHA 4DR1B 3NTVA 4OSPA 3UAVA 1RI2A 3FMGA 1AKYA 1D2RA 1MX3A 2R87A 1DCTA 1L0BA 2IUYA 3M0EA 3TPFA 1E2DA 2B6HA 1R0RE 2IEGA 1CXZA 3EXAA 3OBBA 5EIAA 4GDFA 4R1PA 2AJCA 3HDHA 1MZPA 1Z16A 2GBFA 4NZ9A 3LMKA 1PFGA 5D8DA 1ICEA 1LLFA 4U7TB 4BKOA 2KS6A 2NVWA 1R2QA 2ISQA 3BK2A 1M2FA 1NG1A 2R5WA 4LOAA 1MEOA 2BSXA 1Y3FE 4TVOA 4E32A 5AFSA 2ZYVX 4MLCA 3A10A 5B3JC 1CBUA 2FN3A 3O8QB 4GSYA 4CZ2A 5EZQA 5C81A 2BKXA 1XTIA 3DH0A 3FAZA 2UZ1A 3BMOB 4UDXX 5JQGA 1NBME 2VPIA 1H65A 4W63A 4CMGA 1GUAA 4YCBA 1RXWA 1Y9AA 1CZHA 2D4HA 3E48A 2Y92A 3I1JA 2FE4A 4UM5A 1L5ZA 1SNYA 3ZKAA 3ZGZA 2RD2A 4CE6A 1AJEA 4N3GA 3SBEA 4QHTA 1CTQA 1M2VA 1E2NA 3EGDA 1VGRA 3BMNB 3P52A 1HDGO 4PLZA 1FVXA 4O4LF 1C8BA 5ILQA 4KVGA 4HT3B 4XIFA 3E9EA 4EPRA 5H82A 2HN9A 1JJFA 2H8KA 2BI8A 2Z04A 1GKUB 2W00A 3BDVA 2H65A 4PC7A 4DLVA 4E0BA 3AXSA 5BV2P 2YZ2A 3B53X 2EU8A 4ZKEA 3S8EA 3PNBA 5BSVA 2JVKA 3SHQA 2JJ2A 1TM2A 2VDLB 4EPWA 1Q17A 4M3NA 1K8RA 3D9QX 3A6GA 3WMXA 2JIPA 1U99A 1GZ7A 4G5XA 2WA1A 3AQ4A 4UDYX 3NVKI 1NIJA 4FDTA 3RC1A 2ZM6B 3GP8A 1WBDA 2FVYA 1MA0A 2PT6A 3DHVA 2FUCA 4UREA 3PL5A 1MJHA 3ODGA 4X1KA 3WB1A 2Q6VA 4YUXA 4OI1A 2YKGA 3MUFA 4H16A 4MUBA 3RGGA 5GAJA 3UBMA 1E1CB 3CO5A 4G26A 2QK4A 5B3KA 2YTZA 1XDUA 3LRTA 4Z8YA 4N1AA 1GRVA 1P2TA 1UJNA 3SXJA 1RKBA 3RVJA 5DTEA 4KPUB 1FFHA 2IODA 1KH2A 3D2AA 3KAJA 5F77A 4FGUA 3OQBA 1IULA 1O9HA 4MV0A 1SJ9A 4DOMA 5A0VA 1HOTA 1TT5B 2IP1A 2HREA 2JJ2D 2R8RA 3NV7A 4PR0A 4A3SA 4EELA 1BGXT 5HKKD 1Z6QA 2VP9A 4F12A 1T6ZA 3LHFA 1TM4E 3PJDA 4UE6A 4HDAA 4H3SA 4P32A 3U61B 2MDTA 3H2YA 4IYJA 4CCYA 1STOA 1ZAKA 4H1HA 4FLEA 3X1DA 4CJXA 1GDTA 2HGSA 3A9SA 3B38A 5HKLA 2VHJA 3L84A 1Z18A 4ENPA 2P5SA 4HB4A 4BYMA 1XTKA 4LMBA 1CY6A 2QMZA 1PZMA 3IULA 4FPXA 5KPJA 1CUGA 1QV9A 3B5IA 4OP2A 1DQZA 1OWLA 2DFVA 4MW9A 4DHWA 1E3WB 1H4TA 2VJCA 2IUUA 4JI1B 4E2XA 1G8AA 3TW8A 1RCUA 1Q0TA 5HBRA 3RS8A 1VE6A 2YRWA 1T36A 5TEWA 3GAMA 4KNYA 2WIFA 5KYVA 4N0QA 4OREX 1BO6A 5ALSA 1RKXA 1N7IA 3CNEA 4YRJA 3RYHB 2JHCA 3KZMA 4HGQA 5FWDA 5DM70 5EINA 3ZG6A 1F20A 2O3SA 3M4NA 4BO6A 1RIIA 4K6GA 1ZIYA 1L7DA 1Y3HA 1YAJA 3RSGA 5I7SA 5IFKA 4QT0A 5JR3A 3IESA 3S70A 1VI2A 1DE0A 4FKMA 4WN3A 5LNK6 4B9EA 4QDTA 4QXPA 1QOPB 4N03A 3LH5A 2IPNA 3KSMA 3ZE0B 3P96A 2Q5LA 3U44A 2GPBA 5K3AA 2EFEB 2JBWA 1PFYA 3MEQA 3DF9A 4MIOA 3SM9A 1IZ9A 3VV2A 1V2GA 2CJWA 2FJ0A 4ABYA 4UPEA 5FOUA 4BXOB 3NR2A 3ZZMA 2A78A 3I0ZA 3WL5A 1MO4A 5I8WA 2G1JA 1J00A 1HE2A 3WGQA 1X15A 3C2QA 4RTMA 4ZT6A 5JDCC 3HN7A 5AKGA 1YVDA 4DDWA 4OYYA 2IHUA 3IXMA 1FQJA 3CSUA 1FTYA 2YWEA 4PG4A 5DX8A 3AHHA 4JOBA 2QTWB 3WDKA 4YDHB 5BSEA 2CYCA 4EY4A 5HUHA 1UKBA 3I34X 4C4TA 5K8IA 1DV1A 3AJRA 1JG2A 1ZJ5A 3C43A 4UNIA 3HYCA 3RTCA 4IDGA 2RGRA 2O8FA 3VTKA 1TXGA 3KDAA 2VF8A 4WXMA 1RQ2A 4B3DA 4NYJR 3L8HA 3O3MB 4YREA 1B1AA 3A9TA 4RD2A 1QHNA 5K2OA 3MJEA 1LF5A 4F4HA 1HDYA 2J4FA 4XJXA 5CDFA 4OMDA 3UWOA 5JMOA 2O2EA 2GBIA 2B9VA 1ZA1A 3EHDA 1Z26A 3EZ7A 4HFMA 4KXFB 1FJ2A 4QTYA 2E4ZA 4PS1A 1WVMA 1FK8A 4PGGA 3IXLA 3OF3A 3BJZA 4NVRA 2EG9A 4MI3A 4WKCA 4A0GA 2WFMA 3VX3A 1YL7A 2YDXA 2J9ZB 4YPVA 3R44A 3FWNA 4P7GA 2GJAA 1A88A 4PX5A 3F4BA 4QEZA 1ZJZA 3EUFA 4Q3BA 2C9ZA 1DJMA 2Q4OA 2L82A 3QNUA 1GAQA 1VMAA 4BMYA 2Q50A 3KB1A 3LS2A 3IDQA 3OX4A 1HQYE 4JFRA 1Z75A 2IPOA 2OXCA 1DBRA 2Y4NA 2Q29A 1JEEA 4MB6A 5CM9C 2WVAA 1VCOA 3N07A 1ZM9A 1KTVA 1L5HB 4NZMA 2XZDA 5F4BA 5H16A 4HS9A 3VV3A 2GZHA 4FT4A 3GOQA 2LGJA 3ENVA 5K03A 1MBZA 4B35A 2C83A 1DAIA 1H6AA 4FFNA 4EHFA 4IQ8A 3GQVA 4XSGA 1Z73A 1HE8B 2PJZA 3G7NA 4GFDA 3VNQA 3G0IA 3ENZA 3V8VA 3PBKA 5JC8A 1GCAA 3EVCA 3IAEA 2ZT6A 2WWGA 1XZNA 5JY6A 2FJUA 1VG9B 3BDIA 3FDIA 3PVCA 4FGLA 3RUAA 1ISHA 1SBIA 3GGDA 3OE4A 1P7VA 3RU2A 4BNVA 1E2PA 3UV6A 3VO8A 3ADPA 3W79A 4H7FA 2GVZC 5AI0A 4QUDA 3AVYA 1DHTA 3VOTA 1SCBA 5F3DA 4ZRMA 2GLXA 4M53A 1SUWA 4RL4A 2OYSA 4CCWA 3ZJ5A 1DMRA 3JQPA 3QLEA 4HTFB 2YYAA 1MO6A 3RLIA 1A9XA 4N8SA 3DE2X 4C4PA 1UZAA 4BP9A 3OCJA 3RGWS 4CTOA 2D0DA 2O4CA 2GVDC 2FYTA 2WD7A 3C15C 4J8PA 4UBLA 1HT2E 5JBQA 4X61A 5BWNA 5J1TB 4F85A 1W4CA 3DT6A 5BNWA 2IS6A 1MRZA 1E99A 4X95A 1ZUWA 1WDWB 1TJ5A 2A0YA 2F6RA 3E1SA 4LXGA 4AJLA 3CTMA 4DA8A 5LIPA 1ZR2A 2W58A 2W2VA 4P22A 1C5KA 3F7MA 2GO7A 5BSTA 1DSSG 1GCUA 1QAQA 1AVTA 3PICA 3EPKA 4PAQA 2WYIA 4NBWA 1ESZA 3AB8A 4K9LA 1IJEA 2ACVA 2HK9A 2HRZA 1N6HA 2IEIA 2JZOA 3GMIA 2BGIA 2ZVPX 3C5EA 4G89A 4JX8A 4AMGA 3NJRA 4MV4A 4AD8A 1O6CA 3LSTA 3R9WA 3AM5A 1RE1A 4IHAA 2FCRA 3O2NA 3WNBA 4EYSA 3ZDCA 1SKYB 1UC4B 4I5IA 1PZEA 5FNZA 4EO4A 2QIOA 5LMZA 1VI6A 4ZJYA 5KYUA 4OM7A 4BBJA 3PTAA 3WE7A 2KMLA 4X93A 5M29A 2HPAA 3BL5A 2QN8A 3PGLA 2X8JB 3KVRA 4GEKA 3S8MA 4CPDA 1YVEI 5SV2A 1U4SA 2JG3A 1KP3A 3D4IA 3F4LA 4MGYR 3ZD7A 2ZYTX 4GMHA 4OYRA 2V5VA 1BWQA 4LISA 2GPWA 1SOVA 2J09A 2PZBA 4KC0A 2GFQA 4DDKA 3VSDA 3ETLA 1NQXA 5CFQA 3BK7A 4I5GA 2PUAA 1DCMA 1ZIPA 2CHUA 2R1TB 2HHLA 3KAPA 2WJYA 4I9HA 3SZGA 3TGPA 1YNSA 2JGDB 2XW6A 2AW3A 2D2VA 3FZNA 4L5CA 3IEMA 1CDEA 3WLPA 1WE2A 2X7XA 1NJ5A 4XGQA 2X3FA 3N0VA 1QAMA 4B46A 1U0LA 2QTHA 3G88A 4AAYA 3ECCA 1PN3A 3NHBA 3OIVA 3PPIA 4GKAA 1HFJA 2HHCA 4Q7MB 1KDOA 2C0QA 4FXPA 1DAEA 4QDZA 4RVFA 4X60A 1WCIA 3FG9A 3SKVA 1KDZA 5KYWB 1FS5A 3ZY3A 4BQRA 3UENA 4KKVA 3PHIA 1T3ZA 3HXLA 2ZETA 2G1KA 3JQFA 2AI1A 3E9QA 4A27A 1F51E 1QVAA 1RRVA 2I03A 4TTAA 3AFIA 3VGJA 3BXPA 5IT4A 4OHCA 5EE5B 1DP4A 3HDJA 4R1MA 3RYFB 3P9CA 2OHJA 2VP4A 4C05A 2WSIA 3IPLA 3IQZA 2XAAA 3IQWA 2FRXA 3ZCVA 3GWGA 2O0JA 1ZA2A 5FL3A 3GLRA 1D9ZA 1SUCA 1GTG1 2IYOA 2KBFA 4LQDA 4C0SA 2WJVA 2B4YA 4G25A 1P3DA 4OGLA 1KSFX 3KFXA 1P4SA 2F1HA 4NENB 4YJ3B 1L2TA 1Z7YA 1Z29A 1VTKA 2HPHA 3RVBA 4QSMA 4Q4CA 3G5LA 3HI6A 4HATA 3ETCA 5CFOA 4UBIA 3W2FA 5KMGA 2DUNA 1E66A 4JP8A 4DS3A 1PJZA 4TRRA 5B2ZA 4AWAA 2YZMA 2I0FA 5JNRA 1W35A 2X5OA 1PZGA 10MHA 4M0LA 3P9KA 4PSVA 5AJHA 2PR7A 5ADVA 3BXZA 4MP8A 4BO9A 4YMLA 1OFVA 2REQA 1RYEA 1CVLA 3DCJA 3PDUA 4U02A 4Z4CA 3F9RA 1EGHA 1YRYE 4JX9A 3WKCA 1GSAA 1UAGA 2OLEA 2O2YA 5JYDA 1Z74A 3FI0A 1JBKA 3T7EA 4A5SA 1H2EA 2QVBA 4FD2A 1HEYA 1YQTA 4DLKA 4L4SA 5BT9A 3T3HA 4DV3B 1YE3A 1SCQA 4PZ9A 4YHBA 1ORRA 1SPXA 4R1UA 3A3OA 3E3LA 1EK1A 4FONA 2PUFA 5HTKA 4H4DA 3TBFA 3PC8A 4IX9A 3PF8A 1KO1A 4NOJA 5TT1A 4XYLA 2XX3A 1HLDA 3BZBA 1SKAA 1UZLA 1ZH4A 2ETVA 2AXNA 2H17A 1UIMA 2WF9A 1N7GA 3OIWA 4N5IX 3RV3A 3TDMA 3KEQA 3DPUA 4ARIA 4OBXA 1RSZA 2QNBA 3K2QA 4K6OA 5EIFA 5TQVA 3W5SA 5BN1A 4NONA 5ICSA 1T8PA 2QG9A 3CLSC 4XYEA 2JCVA 1OT3A 1K68A 1NNLA 4XPIA 3KXLA 1XVTA 3DKPA 3E27A 1VOTA 3EWNA 4DLRA 3PFWO 3FNRA 2HTEA 3V1MA 3KHSA 4ALMA 4JUCA 2G09A 1ZQ9A 5BRNA 2GVNA 1M1XB 3K5IA 1ZQ1A 2GK3A 4NK4A 3NATA 1TM5E 3CU5A 3SSMA 3WQSB 3OIGA 1CRLA 1D7AA 2XB4A 2ZIUB 3GEGA 3GI1A 4GS5A 4HEJA 2VYVD 3JQBC 5TQ0B 3GLIB 5K0JA 2JLUA 5H81A 3Q87B 1KZ4A 3T0GA 1OE0A 2AG8A 2NTYC 5LA6A 3GLTA 2ZSAA 4JLBA 1X1TA 3FKSD 3OLCX 4HWSA 4UHJA 1Q21A 4G0OA 1JR3D 5TR9A 2X0EA 5LYJA 3QJYA 2V74B 4P4SA 2R6CA 3CVXA 1MC1A 2HLDD 3DMTA 2UZ1B 1I6MA 4M9ZA 1BMFA 4CKZA 2QG6A 1GV1A 5I9TA 4Z9FA 1EZ1A 4AMZA 5JQGB 4IIJF 3EZXA 5LJIA 3FYHA 3OIDA 3SY8A 4DQKA 3HM2A 1CE8A 2KSQA 3SYNA 5IXJA 2BGRA 2OC9A 4HB2A 4QHYA 1QRUA 4WOJA 4PIVA 4W1QA 3ESDA 1PVDA 2G0TA 3OJCA 2HPZA 2EYQA 4DR2B 4G5YA 3U3OA 1B16A 1T2VA 1T9GS 4HAZA 2ZJ4A 4WJLA 4ND8A 3N2GA 2GKSA 4NI5A 1UDAA 4OHPA 3GK3A 2GNPA 4N6NA 4P5PA 3VOAA 2CUNA 2WE8A 2OXEA 1D9XA 5E7IA 3E3OA 1BEUB 4L5JA 3E6AA 1POXA 1ZVKA 5EFZA 4CMBA 3H3XA 4JYAB 4BQIA 1PEDA 1U9JA 3CCFA 4G5GA 4O63O 3T38A 2ZU0C 1CJMA 2IYAA 4INAA 2FCAA 1JHYA 1I9GA 1TQ6A 3PD1A 3SC2A 3UYLA 1AKRA 4GH5A 1HDXA 5LB4A 4JXXA 4MI6A 1B3RA 2ZJ0A 2NQ8A 3DONA 4JCCA 2V0GA 4MVYA 2B3TA 4HGNA 1OKKD 4HTAA 1K89A 4LXQA 2CVQA 4BO4A 3R5TA 1W4LA 3GJ6A 4YMWA 2GRJA 4E5MA 2EBFX 3I9MA 1GYPA 1GNTA 2HF2A 2XKAA 4FN5A 4DIDA 1WZEA 3M3PA 3LTNC 2OQIA 1GM5A 5AUQA 3DUWA 1Z6XA 2ODWA 3OLWA 1RM4A 3N8GA 4OA5A 1IUNA 5E6RA 5FWXA 4DMMA 1SHJA 2BONA 1N6OA 1MO5A 4KZKA 1BH6A 3LC2O 3OHPA 1NUTA 1R6BX 3TNDA 2CFTA 4MITA 4OHXA 3PDIA 4KGXA 4YRAA 4Z49A 1Z56C 4PLHA 3RTEA 1AUVA 1I24A 2PRSA 2RHRA 1EX6A 1PJTA 3KTAA 4NKRA 5F78A 3SX4A 2M1ZA 4IMPA 4CCYB 2A94A 3U0BA 1QO0D 2DHEA 2OM2A 5G1NA 2SBTA 3PGKA 4ZEOA 2ZKLA 4HJXA 1UPCA 1RIFA 1VE3A 1G5QA 4TN1A 4UFNA 1IN8A 2BH9A 2WF5A 1TOAA 3DQZA 1O8CA 2GUGA 2OHGA 3BULA 2EIXA 4UTZA 1JJIA 1TLLA 5EWJA 2BEUA 4UZSA 4QFDA 1Y4AE 2OOSA 2IPAB 4B85A 3AEQA 4JLKA 1IMJA 4S1PA 2ABWA 5FFMA 1Q7EA 4D98A 4FFOA 3JATA 5DHPA 1P18A 4PN7A 2AMLA 4BFUA 1AGYA 4BLWA 5K8CA 3PGVA 1MRNA 2WABA 2X8WA 4HZUA 1J25A 4JP2A 4UW9A 3KL2A 4L8LA 1XTRA 3OQ6A 2QMOA 4JJZA 1XRRA 2CZGA 4RV5A 4V38A 2GFHA 2NSJA 3N6XA 4KSYA 2ZZNA 1B8UA 4B4KA 4LGVA 4FZVA 1S9DA 1XMIA 1DKUA 4ZVUA 4IINA 1QGYA 2J9GA 2I7VA 4LRQA 2PBRA 3CLUD 3OZCA 4FEEA 2CJWB 3MOIA 4BCBA 1YZTA 1CY4A 3RG2A 3CN9A 5HZMA 3LLMA 4PC3A 2CUTA 2QMUA 1X42A 2QTRA 4WZ6A 4J03A 4G1BA 2PKXA 4D9MA 1SU7A 2P9CA 1MH9A 1E2GA 2MSNA 4XYBA 2ZI3A 3FNGA 4YMUA 1AB5A 4IRXA 1I2BA 3A8TA 5FF9A 3ILXA 1Z2CA 3BJMA 1JQDA 1ZAYA 4R9NA 1XVLA 2VPZA 4CMKA 4C7OA 1I4TD 2PN1A 4QOSA 1PW5A 3KQUA 2Y1WA 3NFYA 2A5DA 1UOOA 3QXXA 4S2UA 4H08A 3RK4A 4TYQA 1BRMA 2XZPA 4G1MB 1ZN7A 4RLHA 5DM2A 1JKFA 5ENVA 4DBVO 5DBFA 3VM6A 3AR3A 2HT1A 5KSOA 2XCRB 1S4MA 3N9IA 1RCFA 2O8FB 3UFBA 2HNAA 2PBLA 2C92A 3WHIA 1QFMA 1MC8A 1QLHA 1X7XA 2OVFA 2VT7A 3E9RA 4O2AA 4RS3A 4EHJA 5JCZA 3ZGXA 3VKFA 3DS8A 4U8GA 4NK5A 4Q15A 1FMLA 1XTPA 3WWDA 4Q03A 2P9FA 4TLCA 1XELA 1J24A 1JALA 4LJYA 3ZZUA 3WC4A 3O4HA 4AXXA 1ZZEA 2QVZX 5TMDA 5HRUA 3R0XA 1KK3A 1WOYA 1R10A 1GGVA 2Q8PA 1U1IA 2QOEA 2YVUA 4KCGA 5ALHA 5K2MA 3UT0A 2CT8A 4H4CA 1ZW1A 5AIBA 2IEAA 5DNVA 4C5AA 3FRIA 4RENA 4QQNA 1O5IA 3ORQA 2WWVD 2EKPA 2JD1A 2ZRCA 2IYZA 2NVOA 2GM5A 1M10A 2W93A 4QGAA 1T1EA 3CNNA 1WZIA 3MTIA 3JR3A 1APBA 1NR7A 4ASUA 2C9MA 3BGOS 5D3MB 3W1WA 4DREA 4O4HA 2VH1A 1LD3A 2VP2A 5FOVA 1DKLA 1FA9A 4ZTBA 1Z3CA 3AVPA 4UXIA 1VHQA 2OB1A 4XASA 1J2JA 5LN1A 2C3UA 1XTVA 1GZHB 3LUFA 3WLMA 4CCAA 5C37A 3MCZA 5BPHA 4GLFA 2E5WA 4BRSA 1S7GA 2FW6A 1KVUA 1W5BA 4QLBA 1KO8A 2DYKA 2JK0A 1Q22A 2OYRA 5F9FA 5H5JA 2YCBA 3TOVA 1E63A 1P39A 2F43A 3NCTA 4OXQA 3H2HA 1RWWA 2C8KA 4LKOA 3SICE 3EA0A 4H1WA 2E4UA 3ZVLA 2BVNA 3SIPA 4ND1A 3I23A 1XZPA 3KVNA 2PSFA 2YOHA 2Q8NA 2XHEA 221PA 1JG4A 2X13A 3RIMA 5JS2A 1W5FA 4GL2A 2W8BA 5ARCA 2VBCA 3IDZA 5EIXA 3SPXA 2I6FA 4PPNA 3TZBA 1NONA 3BC1A 1I30A 3IQIX 4ASUD 3N3BC 4I50F 4CLOB 2QUJA 1KSHA 3H9BA 1BA2A 2Y1KA 1HLGA 1WAMA 3ME5A 3IGFA 4JQCA 1S3SA 4WXEA 1T3TA 5FPSA 1HMPA 4ZYUA 1PEAA 4PHTA 2QTGA 1JIIA 1L4MA 1PS9A 1N0UA 1KIMA 4OO3A 1UJ4A 3M1AA 3MLEA 1L5MA 3ABQB 1Y6GA 3VR2A 3PSHA 3N53A 3V8MA 3ZHQA 4P2BA 1Z6PA 3DT9A 4V0QA 4AKTA 4QO7A 2PVCA 3UJ6A 5AVYA 4YRQA 2GJ9A 3RRMA 2WJ4A 3KNZA 5DK6A 4CUZA 3RIEA 3BQ9A 5HF6A 4US2R 1FX0A 2J32A 4MWZA 3SE7A 4C21A 1NXXA 2ADMA 4LQ4A 4C7XA 2HL6A 1T5BA 3CT6A 4ZEXA 1W9HA 3BSYA 3HB9A 4QHSA 1ORDA 3IKVA 3NH6A 2OCKA 4TS4A 3TL3A 4ENQA 2VUSA 1MXHA 2VUUA 5I7UA 4IIGA 3T95A 3FFXA 3CS3A 2TECE 3Q9LA 4HDNA 4DLZA 3M9WA 5ALUA 3RCBA 3SFZA 4U1RA 2QTTA 1GU0A 2OZVA 2XLCA 3AYZB 3CWQA 3P4YA 4JNCA 4RF4A 2PX2A 3M82A 3O8BA 4B76A 5BY2A 1V4VA 3B1KA 1LQ2A 4BY9E 2HJVA 5CPBA 3M6VA 3I2GA 5IT0A 4B7UA 3VR2D 2ZB4A 2A33A 1EFPA 1M8JA 2ZDHA 1TO1E 4GXNA 2FQXA 1ADJA 2TRSB 3MXTA 4P35A 5EZSA 5L45A 2X1LA 5I4KA 3SYKA 4NCKA 1GIAA 2Q6KA 3IKLA 3RJZA 3ZDZB 5AW2A 1UIRA 1OGYA 2GK7A 1XMXA 2ZSJA 1XAIA 3NHYA 4E2WA 3FR8A 6Q21A 5IRCD 1NXPA 1JDPA 4IJMA 1BMTA 1AE1A 2JFZA 2RH5A 2G08A 3F2VA 4HX9A 5E9AA 4OK3A 3KK0A 2G9NA 1BCRA 1C3OB 1YRQA 1GARA 2MSLA 3C8HA 4YHHB 3ED5A 1HY3A 4NOLA 2QRJA 5K8UA 2RH8A 2I5PO 2A9KA 4Q48A 1EX9A 3G9TA 1IB6A 4NFHA 4W5QA 5ABPA 4CETA 4GZ3A 2AFHE 2IXBA 2BTEA 3DDOA 3BPSA 3D8UA 2H4YA 1E96A 1QYVA 3FOCA 5DDIP 4L95C 2VF5X 1GAXA 3L49A 3D3WA 3BD9A 4HOYA 3GLHE 1Q1BA 4FS8A 5C53B 3F8SA 4PIMA 2IY8A 2SICE 3ETHA 4PSCA 3J80A 3K20A 4ZQFA 4DWJA 3TG8A 1E1MA 1AM4D 1ABFA 5HS4A 2UUCB 2OZLB 1SA0A 3T06B 2C97A 5TEVA 3WP0A 3RYIA 4YMHA 4ZAYA 1Z83A 1IK6A 3HGMA 4DHEA 3L0OA 4D8YA 3SSAA 5TGTA 4FZRA 4I9GA 5B4VA 3LVQE 4OHVA 1QP4A 1II0A 4M8KA 4ODIA 2QL6A 4GX0A 2RCYA 1R7RA 2B9EA 4OHYA 1I6WA 1KJNA 2G67A 3H2BA 4KHZA 3U81A 3MWGA 2RHDA 5NLLA 5BVHB 4KXUA 4JD5A 3PENA 4ZTUB 3D7NA 1L1EA 4KJXA 2JGKA 1P7PA 4L15A 4F1JA 1QG4A 3AW8A 4OQPA 1KDTA 2QMYA 4NNOA 1EVIA 4UEKA 4OHZA 3G1WA 4TXLA 1UJ5A 3IRUA 1SK9A 4B6EA 1YIDA 4ZA2A 1EGVB 3PJGA 3QMPA 4L2IB 3ZE7A 5KMGB 1JXAA 3A9WA 4RH0A 5P8WA 3UMGA 4BFXA 1C9NA 4M8IA 5BN5A 2YUIA 3CX3A 7GPBA 4WCDA 4F5EA 4LJKA 1P0FA 1P4RA 2R48A 4DZZA 2BKEA 3A25A 5JAQA 1ZNWA 2REQB 3FVQA 1P73A 2YIJA 2FW0A 3TLZA 4DTIA 1JH8A 3IEUA 4CM9A 5HOQA 1SIOA 3SN6A 1QG6A 1WXIA 1L5YA 4X1YB 3OEEA 2G70A 5H7XA 3I9OA 4PXAA 5KQGA 4RO0A 4PRLA 3ICQB 2BN4A 3SZRA 2PUCA 1WV1A 1F0KA 1Z4JA 4YN3A 1KJWA 3TLJA 5JWRA 2EGUA 2N46A 1CG6A 1QLWA 2D13A 2O3TA 5FA8A 4MVJP 4QBTA 1RZVA 2X86A 2J0QA 1GFSA 1E3LA 1O0SA 1KGDA 1DJQA 2WE7A 5IAEA 1JG7A 4MUGA 2CNBA 1EP9A 2MOKA 3GLGE 2EFJA 4G63A 2OY0A 3VMMA 3E8MA 3S1SA 3CYFA 4W9MC 1AKMA 2IXTA 2BKUA 5F1KA 1DXQA 3WDMA 3WIUA 2CHGA 2WIAA 2ZS7A 2R6JA 2B34A 1MAUA 3ENNA 1JKMA 1VL8A 3E9CA 2OGUA 2C9DA 1NW3A 1K2WA 5C8DA 1P8AA 3FPJA 4NPAA 3TPZA 4FNAA 2BISA 3JWEA 1GGJA 4B79A 1WMEA 3OEHD 4X1OA 4RSRA 2WA2A 2WJHA 4IH9A 5HG0A 4RIFA 4ZOEA 2V03A 2WQZA 2VS1A 3I6ZA 4IDQA 3GEDA 2XQJA 3DQPA 3FZQA 5D1HA 1VMEA 4RFVA 5INTA 3ZVMA 5MN4A 3AH8A 3GAZA 1WABA 2F8MA 1FMCA 1O1YA 1GA4A 1I0LA 4DSOA 1TTQB 4EPYA 5LA6B 4F93B 1ZJWA 2BL4A 4ZCPA 3ES9A 3JVIA 3DFZA 2ANCA 3LFHA 1W0JA 1MVLA 4BMDA 1N9GA 1TUEA 3FNQA 3UCXA 1GV0A 1N75A 1Q20A 2NU7A 3QYFA 3HCEA 4X6XA 3K09C 2XTJA 5TS2A 1P75A 2VPTA 1YZHA 3ZLVA 4R68A 2IW3A 4B3XA 1JJBA 1PR0A 4HI0E 3DDSA 3T7IA 1VE5A 5B30A 1A04A 1CE8B 4QJ4A 2V97A 2Q46A 2GWRA 3Q8WA 3SM3A 1XJ5A 3LF1A 1BGVA 3A4MA 3JD4A 1B42A 3VYSB 4G8JA 4E08A 5IMSA 1AQ6A 4W5NA 3T3NA 4A91A 4ISCA 3A4YA 3AR2A 3UTCA 3GD7A 3Q2KA 4LXUA 1UMBA 3E84A 3GYBA 1ZONA 5CX4A 5T3YA 3VR4H 3QKRA 4IDDA 1MD9A 1P44A 1PYGA 4LNAA 4Q34A 4TLBA 3OPYI 4Z7OB 3QU4A 3RO7A 3D8TA 1F3OA 4BQFA 3IPXA 5H9VA 5K0BA 3ETJA 4Y0AA 4XM2A 1K5PA 1T5LA 4DR5B 1M74A 4JEHA 2BEWA 2OMEA 4MUJA 3UBTA 3GW8A 4M38A 1ZU4A 5JASA 1GNSA 5T3UA 3SC2B 4LDJA 2YQZA 2OHXA 2QTCA 3V9PA 2JAPA 2WQ6A 1CZRA 2H2IA 2O3RA 1JSRA 4EK9A 5I4CA 1JQLB 1OOEA 3R77A 4FCCA 4G6ZA 3C8DA 4JT8A 3BEDA 2RK4A 1I3OA 1P0CA 4PGFA 5FA6A 4AG6A 2QUIA 2M6RA 2DVMA 1QDUA 1CY0A 1P81A 2WU8A 2MCFA 3QVMA 4E4RA 1P2UA 3HC7A 3C7CB 4AMYA 5E6RB 4D9KA 3VPAA 2YNMC 2DPYA 3KTOA 2EYUA 5HW0A 1F48A 3MXOA 1AUOA 2EZTA 4MJ7A 4OQ4A 2R1VA 4W7HA 2NO6A 3B3GA 3CLKA 3H87A 3HDYA 2WTMA 2O54A 1O95A 2QAGC 3EIFA 3KTAB 1D1TA 2C1EA 2VUIB 4B74A 3K72B 3Q15C 5JXIA 1QDEA 4KMRA 3T3EA 5DW3A 1C29B 1JFFB 4O4IB 2XUIA 3RBZA 4A8JA 4J9VA 2B21A 2WRZA 4RA6B 3NQ41 1J8DA 4Z4HA 4A6XA 1X94A 4LZOA 4XH9B 3GFQA 2BEUB 3TINA 3CG4A 5ITZA 3WBBA 4DC0A 4D5EA 4FNOA 3ORRA 2P5UA 5AKLA 4S04A 3BB3A 3AEQB 3ICWA 4WZAE 4C0LA 1FDUA 1H2HA 1MB0A 3PHCA 3KSRA 3JATB 1KE1A 4DUZB 1IJBA 5DRTA 4FN4A 4KQEA 4OMFG 4ZN6A 1AQJA 4QOIA 4FLFA 3EF1A 1HSZA 2JZNA 1YO6A 3NBYC 3C3BA 1CZOA 1W6UA 4A2PA 5CDSA 2OHIA 5JAOA 1HE4A 2QW0X 1X80B 4PG5A 1NXOA 1BDJA 3UB2A 4BWGA 3E58A 3E9MA 2C31A 1WF3A 2XDQA 1PZXA 4B47A 1MDBA 2Y1CA 3AZQA 4XUDA 2BCGY 3ESQA 2GEDA 2RAFA 4K9RA 4UVEA 2HQRA 4CLXA 4LGCA 3U37A 5BR1A 4ZYXA 4YRKA 3CMMA 2P8SA 1NT4A 1C4OA 2YV1A 1DB3A 3NRJA 4ZAFA 1T6YA 3IT1A 3ONFA 1M1ZA 3WIBA 3ZWNA 5H4GA 1XZDA 5HJ5A 1Q1AA 3FE2A 4LVOA 2ZIFA 2A0UA 3W3ZB 1U9CA 3EG9A 3IC5A 1QHHB 1Z68A 2XITA 3GIWA 3T3IA 2YS7A 3MOGA 3VR5A 2ON6A 1LPNA 3O74A 3JRWA 2QV0A 1GRNA 3H6HA 3SHWA 1U5CA 2ZEJA 5JSFA 3G9ZA 4FI3C 3FCYA 3Q2IA 1KRHA 3HVUA 5IG2A 3BF8A 2NYRA 4CEIA 3HXKA 3HL0A 4XB6B 4LJLA 2PLRA 2OCPA 4X24A 4KPFC 3RUHA 4K46A 2ZQ5A 4DWOA 2ECFA 2XGOA 3B9BA 1X7XB 4PBSA 3G85A 4MKZA 4J75A 3KYBA 2BI7A 2QT0A 1C7EA 4GVXA 4IO0A 4P7KA 5G1PA 5HJ2A 4UUAA 3WGTA 4CU2A 4OI0A 2OBBA 1KK2A 1OZAA 4AKIA 3CBGA 2PR2A 4OLJA 3B6IA 3RVRA 1BXRB 4AXBA 2KQUA 3CZCA 3E9ZA 3F6RA 3VR5D 3LPCA 4IOLA 5HTOA 3V7YA 1EGMB 3NOXA 2F3QA 2IBTA 3KEGA 2X9GA 1KK0A 4B44A 4FYJA 3P1JA 1DIGA 1VM6A 3GUCA 4IZIA 4Z9AA 3W5HA 2CGEA 3ORSA 4CTMA 2JLBA 2VPQA 4UTOA 2PL3A 4O4HB 1JHUA 3LWZA 3ANLA 1SOWA 2FTKE 2HWXA 2XMCA 4YJHA 4G0QA 2JLVA 4HG2A 1RPJA 4RIIA 2ZDGA 2JCSA 3Q41A 1YS6A 4TM8A 2H8GA 3A6LA 1IXZA 4N65A 1BQ3A 4C22A 1CUWA 1AQNA 4JI8B 2V3VA 1AZLA 2H5LA 2P3OA 4POAA 3IO3A 3PL1A 4R3NA 1MQSA 3OLZA 4UE2A 3C4VA 3V33A 2BTQA 4B32A 2GPTA 1XZAA 4L8VA 1XEWX 3OO1A 3VPGA 3CVVA 3RAEC 2B1GA 3PLNA 4GPIB 3GFPA 4H7PA 3N2EA 3TMYA 2MYNA 4HKTA 4BWVA 2OXRA 4TMWA 1MX1A 5LZ8A 3K6SB 3RTGA 1MGOA 1E62A 2BDUA 5ALPA 2D5AA 2GEFA 2NZYA 4N3NA 3B7PA 1DEAA 3RR2A 3NGXA 4J4HA 4WN9A 5FEUA 1KVTA 5CW1A 2E4VA 3DC2A 3GZNA 3HZOA 4BO3A 5KJFA 3LHKA 4IHKA 4OXRA 1NXWA 3NC4A 4TLAA 4B5LA 5LKAA 3ZH9B 4CKEB 2I4LA 1IWPB 3H5LA 1OU4A 2P2CA 3KT6A 5EQDA 2ECOA 3V1NA 2F8SA 3G02A 1HZZC 3KTDA 1YKSA 2VO1A 4EECA 1DC3A 4W6ZA 1TEVA 2HX1A 3DLAA 1Q0RA 4BQNA 2AOTA 4N0PA 1V1RA 3OM9A 1U0SY 1KAOA 4JHLA 1S4QA 1USKA 3QF7A 2PX5A 4WCFC 3ZWQA 3M83A 3LYLA 4WY8A 5F1YA 2VQSA 4R8RA 1XRPA 3CSSA 4CRWB 1OZHA 4KR3A 2NAFA 4BKQA 4HNAB 4B6FA 3QPDA 1IRIA 5K9ZA 4HNGA 1ZCAA 1C8KA 4XX0B 1IEVA 3IMCA 4L3VA 3UA3A 3T3OA 3G0DA 4EY5A 3S44A 5LD2C 4LE2A 4G0ZA 4RKFA 2PA3A 2ZRLA 3SKXA 4A6DA 5BOVA 1FJHA 4E1BA 4HZGA 1EUDB 4MARA 1QSGA 2X2FA 2QT1A 5BV7A 1LSUA 1I5RA 1QVVA 3PIRA 4IO1A 4O2BF 4Q5IA 5EVCA 4OSOA 4QNMA 1CNFA 2SHKA 2IYWA 1FTNA 3BMXA 4KSBA 4K87A 4RLFA 3LJKA 4YJ2F 3WLOA 4CDNA 5AUNB 4KPYA 2H31A 1E64A 2Q1XA 3JASA 4OUDB 3VNSA 3ZEIA 1NQOA 1TKAA 2IDMA 2XV1A 3AEXA 1X7YA 4LXIA 5FCDA 3V7WA 1GGHA 3H8SA 1GNVA 5ICGA 3VJKA 3KPUA 3OY7A 5J2UA 4UNPA 4NEQA 4JSTA 4ISBA 4L5AA 2V3WA 2ZDQA 4UBNA 4XRGA 3FDZA 1NYRA 4H1TA 4HDOB 1BCRB 3U4MA 4WLFA 4Z1MA 4BKUA 3MYYA 3C6QA 5G40A 5A1JA 1ORTA 1JA1A 1Y33E 2VDNB 4XD7A 2O4UX 1VIDA 2JL1A 4KXQA 1NBMA 1PSZA 3PGA1 5KYXA 4D56A 1W96A 3P32A 4J0JA 2FUNB 3FPCA 3GF4A 1XKXA 1YDEA 2BI4A 2BM1A 2UYGA 2XA2A 3IAFA 3PTLA 5EKXA 3EFHA 1WDTA 1K8QA 1Z4NA 1KMIY 2DAPA 4JGGA 4L50A 5DXFA 4DA7A 1A5ZA 1OH8A 2ONKA 2H18A 4NFYA 1T4CB 4AN4A 4FNMA 1MIHA 1GUYA 1KZ7B 3D3WB 4K40A 5A9SB 3LNCA 5IAOA 3GRAA 1Q0HA 2RHHA 4UD2A 1QIIA 4HMQA 2Z83A 1E59A 1QBGA 3LQRA 4Z2AA 1D4AA 1JWLA 3KG2A 1E1RA 4WKBA 4HVCA 2PVSA 5E7MA 3VUFA 2ZUTA 3QU9A 2C4VA 1LDMA 1X7HA 3SMVA 1KTIA 1SA0B 2P69A 2OHOA 3SEZA 1P0IA 1TO6A 2QI9F 2WT9A 3TJRA 4YRSA 4NR0A 3KAKA 1QG0A 3HO1A 1NBMD 3PUKA 3MD9A 3LQ1A 1VDZA 1TVMA 3AG6A 3C41J 2IYYA 1NBWB 4UQLA 4HFJA 1VSBA 2XD4A 1HE5A 1WUIS 4HRAA 3L40A 1E7YA 3L82B 4HVAA 4TMXA 5G1OA 4N47A 3WK9A 3D7MA 3INRA 2H4ZA 4FYHA 5AESA 4US0R 1LUAA 4LEIA 3Q72A 5L3SB 1DINA 4OFBA 3LQQA 4CIWA 2WTXA 1FCJA 1F6WA 1HDEA 1P6QA 1SUDA 4R9SA 4RPLA 4IV5A 5CMLA 1YRAA 2ODEA 1E1RD 1F06A 3I2HA 1WMFA 1M9NA 4HRXA 4YX9A 2WI8A 3F4KA 3VQTA 2XF2A 1MCZA 1EAYA 4M7RA 2R25B 1D2NA 4K1XA 2A30A 2V55B 5D5HA 5J2TB 4F91B 3O9VA 4F3KA 1N5OX 2CD9A 2D3WA 1M6VB 4C0KA 1J09A 3MJHA 4IJ5A 4F96A 4IGKA 2DBYA 2OBNA 4DIKA 2GYUA 4R31A 1TU0A 1CX9B 1OH6A 1OXVA 4PTZA 2EZ8A 1PT9A 2UYOA 4R4JA 4E7OA 4ROSA 1SUBA 3DE7X 4QKQA 2C59A 3UGJA 2JLRA 1T8TA 1U5AA 2LZ0A 2CUKA 2VI5A 4YCMA 4AO8A 7REQA 5JSZB 1B23P 1ZEMA 3VTZA 1E9DA 3SHFA 1OC2A 3HJRA 1ISRA 1VPLA 1JZTA 1NPYA 4G5SA 4LBVA 1D0IA 1XZBA 3HE3A 1KBOA 1KH3A 1ST3A 4GMFA 2XCIA 1I0ZA 3NBAA 4H27A 2BUAA 1O2DA 2VKQA 4JZYA 4OFWA 1ZITA 1QKKA 3A31A 4JT4A 5AHWA 5F2NA 5LP1A 2EHJA 5BUQA 4JXZA 1CUJA 2H54A 3BWVA 2IX3A 3WS7A 4RHFA 3VR4A 1N0HA 4OBEA 5E2AA 1QQAA 3OE7D 2WWHA 5IJXA 1N0VC 4C4AA 3EZGA 5I7AA 1U7HA 1ACJA 4QBIA 4FT2A 2G9VA 2V7UA 5EESA