4JR1A

Human procaspase-7 bound to ac-devd-cmk
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
247
structure length
223
Chain Sequence
ATYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFKQIPCVVSMLTKELYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Procaspase-7
publication title Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, hydrolase/hydrolase inhibitor
total genus 82
structure length 223
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jr1A00
4EHDA 5IBPA 4EHHA 1SHJA 4NBKA 2NN3C 1IBCA 3GJSA 4N7MA 4HQ0A 5IAGA 5LUAA 4NOLA 1KMCA 2C2MA 4QU8A 4EHAA 2C2ZA 3V55A 1CVRA 3EDRA 4N7JA 3RJMA 2QLBA 2K7ZA 2HBZA 2H4YA 3PD0A 4FXOA 4JB8A 4DCPA 2XZTA 2CJXA 4JQZA 4QTYA 3UOAB 4AWBA 4NOKA 1NMSA 5IARA 3ITNA 4JR1A 3P4UA 4EJFA 1M72A 1RHRA 4N6GA 4JJ7A 1RWVA 2FUNB 1NMQA 1RE1A 3GJRA 3PD1A 4HVAA 1ICEA 2CNNA 4JJ8A 4QU9A 4ZVSA 1CP3A 4EHFA 4ZVRA 3IBCA 5I9BA 3BIJA 1QX3A 3NKFA 4NOJA 3R5KA 4PS0A 3SIRA 1RWOA 2XZDA 4JQYA 4ZVTA 4QUGA 2H51A 3R5JA 3SIPA 2J33A 4N6NA 1RWXA 1QDUA 1F1JA 4QUDA 5IAEA 4PRZA 1GFWA 2J30A 1BMQA 3E4CA 3P45A 5IC6A 2CJYA 4LSZA 3H11B 1RHMA 5IASA 2Y1LA 1SC3A 3KJFA 4JR0A 4I1PA 2FQQA 2H65A 4I1RA 1RHUA 5JFTA 3KJQA 3KJNA 5IABA 2CNOA 2C2OA 1NMEA 5IBRA 4ZVPA 4FGUA 3D6FA 4QULA 2C2KA 4M9RA 3QNWA 5LU8A 1RHKA 2QLFA 4IYRA 3V6LA 3V3KA 5IBCA 3D6HA 1RWNA 2P2CA 4FEAA 1JXQA 4D3XA 2CNKA 3H1PA 4QUIA 4NBLA 4FDLA 5K20A 4ZVQA 1GQFA 3OD5A 4EHLA 3DEIA 4NBNA 3GJTA 2QLJA 4DCJA 2H4WA 1QTNA 1NW9B 2XYHA 4AW9A 4QUHA 4ZVUA 2H54A 3H0EA 5LUBA 1SC4A 4NOMA 3UO8B 3S8EA 1RWKA 1RHQA 2XYPA 4JJEA 4QUEA 3R6LA 2CNLA 3H11A 1SC1A 4PS1A 1I4OA 4IEFB 3V4LA 3S70A 2AR9A 1K88A 1RWWA 5LU9A 1RWPA 2J32A 3V6MA 3DEKA 2WDPA 2QL7A 4QU5A 2XYGA 4QUJA 4EHKA 3EDQA 3R6GA 3IBFA 2C1EA 4N5DA 3H13A 5I9TA 2HBYA 5IANA 4EHNA 4QTXA 2H48A 2QL5A 3R7BA 5IAJA 4HQRA 3DEJA 2H5IA 2DKOA 1I4EB 4QUAA 3R7NA 3V4OA 3NS7A 2HBQA 1I3OA 4ZVOA 5IC4A 2Y0BA 4N6OA 4QU0A 2CDRA 3PCXA 1K86A 2J31A 4JR2A 4QUBA 3K7EA 3NR2A 4PRYA 1PYOA 4D3ZA 2QL9A 4DCOA 3D6MA 5H0IA 1SHLA 1PAUA 1I51A 2FP3A 2H5JA 5IAKA 3R7SA 4D3YA 1RHJA 2HBRA 3GJQA 4AWAA 1RWMA 1F9EA 3DEHA
chains in the Genus database with same CATH superfamily
3AIIA 4JD5A 4NY1A 3DDCA 4BC0A 3AU8A 4L76A 4HWTA 1J22A 3BWDD 3FPLA 1Z4IA 1OX6A 2OP0A 5BWNA 5BV2P 2B94A 4FLEA 3V48A 3CZCA 1CJTC 4QXQA 2Q5QA 3LQQA 4L4SA 3S0JA 4AKSA 5AVKA 5JCXA 1D2AA 1QOQB 2CZCA 2FJ0A 3DUWA 3I6ZA 1PG5A 2WJ4A 1P39A 3KSRA 5DM2A 5FWAA 1ZJJA 3VR4A 4J07A 3TSZA 2GPNA 1KZ9A 3NHAA 2YS7A 1YHNA 2R8EA 5DBEX 4UHFA 2IH5A 4OGLA 2E89A 2A86A 1L7DA 2X9NA 2RGRA 2R48A 1G4HA 2JJ2D 4IINA 2FY8A 2DFKB 2I1WA 4MV7A 2VLIA 5EAIA 2ZVJA 2V45A 3GRRA 1A9TA 4MV1A 1KS2A 3KQQA 3G9ZA 3LLUA 4OGKA 4OSPA 1H4QA 2CCGA 2J48A 2RDMA 3I9NA 3AJDA 5KDDA 3X1YA 3I52A 3HNRA 4EVQA 1TKRA 1Q2XA 2GTHA 2XNJA 4FCTA 1TLLA 3LHIA 4LRTB 1ZD9A 4UEOA 5DOZA 2FDXA 2OMEA 2Q3HA 1AS0A 2Q9BA 2VK8A 5CLQA 3WQRA 3HBNA 4BFVA 3QTBA 3S8YA 3P9CA 4P34A 3ZD8A 4YWJA 2ZQ5A 2BUCA 2DVMA 2PGIA 1NV8A 2NU6A 2YUTA 3E58A 2V74B 1Q91A 4G8BA 2XDQB 4I6GA 4RIEA 4GOND 3WZMA 4F45A 3JV7A 3GCGA 4Z0PA 3TBHA 2DUMA 2XZPA 2Z3ZA 3NEAA 3ZC3A 3MW8A 1MQ9A 4R8SA 2IZ1A 4KIFA 4YQYA 2AV6A 1QZ3A 2ZWIA 2GM5A 1MORA 3ESQA 4AJLA 5CT5A 4BFZA 2PT5A 4OATA 5FUWA 1M6YA 3RIGA 3K0CA 2P2CA 4E4RA 1EP2B 1XHEA 3REGA 4IVNA 3KT6A 2LCFA 1DO8A 1MG5A 2WE8A 4PO3X 2B3DA 2DPLA 4ZP1A 3SYTA 3FDZB 1V43A 5EY5B 3TR0A 4UTPA 3KFXA 2XB9A 4S05A 2WB2A 2HJ9A 1M8GA 4M22A 3E9YA 4JROA 2C3MA 2PRZA 3KPVA 4M88A 2J9XB 5LQCA 4LS3A 5DFAA 5U9CA 4A2CA 4UU8A 3V97A 3IULA 4MIEA 2V0NA 4I6JA 5LUBA 2QTTA 3Q7RA 2LTAA 1MP0A 2JAHA 1FQOA 4IGAA 4YRIA 3IP7A 5EXEA 3DBLB 5AI6A 3OU2A 4BMDA 3MMNA 2X41A 2OZEA 5B1EA 4WOBA 1FDWA 4R8VA 1CDOA 3REFA 2AZXA 3K2QA 1L8AA 4LJ5A 4CIYA 4Q4JA 2VTDA 1LNZA 4YJFB 2UZAA 3WTBA 3T9AA 9ATCA 3DL4A 4HZUB 3ETJA 2Q3DA 2QE7D 2O8FA 1QVAA 3FNIA 5GWXA 3T3GA 2VPTA 1PL7A 1G8FA 3DE3X 5BT8A 3ZVKA 4MWGA 1TQ2A 3NOXA 3REOA 1IN5A 4WWHA 4E15A 1QHYA 2D7DA 1NUTA 3A3NA 2B36A 1KAQA 3OA0A 3WLQA 2AOTA 1EFVB 2HJWA 3GLGA 4S2EA 4FNMA 2Q0SA 3U7QA 1UPFA 3EFOB 3A0UA 1YHYA 3KT3A 1YQQA 1J6UA 1FQWA 3O1IC 4KRGA 2WSSA 3FAKA 1AG9A 2G04A 2PSJA 3I4LA 2CYAA 4UAVA 4EL5A 3DD5A 4LDJA 3NHRA 4ZJPA 1NJ1A 2ZYIA 5KX5B 1AD2A 3SSOA 1FYXA 2XGMA 4B9AA 3VI3B 1L5MA 1PZGA 2HHJA 2ZSFA 3K0CC 4RW0A 1BD4A 3GJSA 4RA9A 1OA1A 4E5UA 2PO5A 3MJCA 3PSAA 2P69A 3H5VA 4GLFA 5J59A 4F3NA 1Z7EA 4I08A 1DWPA 4LHEA 3I6IA 2JIQA 3NVAA 3PUWA 4X1KB 5EXSA 2ZVPX 5K0NA 2GPWA 2C2BA 1MX3A 5EUCA 3G8CA 4FCWA 1FVOA 1OPXA 3ZW9A 2P91A 2FX2A 2VOEA 2YJ4A 1Y6JA 1A4XA 2HT6A 2OG2A 4FFLA 4IDOA 1LDNA 4TV8B 5DGXA 2NO5A 5ESRA 1VP3A 1YR3A 1BYIA 1JLKA 1ZUHA 2XHEA 4O1HA 4Q7EA 3VM6A 1U5CA 1ECCA 3JPWA 3QIAA 1QR6A 4G5OA 1SUBA 1QFJA 3NHFA 4Z86A 5EI5A 5HF8A 3SQOA 2CFTA 5KUTA 3R9XA 1HSOA 1KDPA 1YS9A 1DJNA 5FLYA 4F9TA 1I9CA 3FCCA 3OJXA 5A06A 2WY2D 3G7UA 1E9BA 3DBRA 1OZFA 1N9KA 2C00A 1SG9A 3D8NA 3QW4B 4UXHA 5JXJA 1QC5B 1FUUA 4LA4A 4XPIB 3VGPA 2OV6A 2QBYA 1YUMA 4CKEA 1G20E 1UK6A 1XTUA 4G89A 2W93A 4V3CA 5DGIA 5KQGA 4BQOA 5LJIA 3N6XA 3OE7D 1DL5A 3PHJA 4ZCRA 1ZHOA 1TUBB 2HU8A 2X14A 4D9KA 3N2GB 5IVPA 4ZV7A 3LX8A 2DFDA 4UXIA 1AHPA 3ZGZA 2QLFA 4G86A 1QHSA 4HPWA 4HS4A 4I5GA 5KVQA 4RPLA 1L7AA 4U4AA 3MGAA 1JFLA 2DSNA 5K3BA 2YZ7A 4TZTA 2GZAA 3IPLA 1L9KA 1JH8A 2QJTA 3FTCA 3OJLA 3EW9A 5CAEB 2ZAYA 5FL7D 4BO6A 4LDQA 4RESA 1V8OA 1L7OA 4WACA 4AM8A 2DUUA 4HKTA 2P9BA 4CM9D 4Q7QA 4C29A 3A4MA 1WULS 3QSGA 1O97C 2EEPA 1Z7WA 1E0KA 4RZHA 3MPUA 2VDWB 4AZWA 3F78A 2XT6A 3DYIA 4JP8A 3S5UA 1U7XA 4WXRA 3HLTA 1Q1GA 3KQMA 1GY8A 4BU1A 1JDSA 4LECA 1B00A 1WPQA 1S9DA 2IDJA 3KWFA 4O3FA 4Y2HA 3S70A 1GL9B 3LQ2A 3QFHA 4UM5A 3V8VA 5FOSA 5LQKA 1R64A 2ODQA 2O06A 3R3ZA 4PCVA 1HI9A 3HCOA 3HVIA 2PD3A 4F4UA 4QU5A 4HAWA 4DLBA 4IMJB 4GVLA 2AF3C 5HQTA 1MAVA 1JLRA 7MHTA 1RR6A 2Z9DA 3PTLA 1Z6XA 4NS1A 3SZLA 5FNZA 2AOXA 2A1TR 3ABQB 4JBYA 4DG5A 1Q7CA 2GO7A 4PLGA 3PHCA 4GXQA 5KTYA 4IHAA 3TB4A 4CLOA 2G7ZA 2NVWA 1JB9A 3V4PB 3S3TA 4IG9A 1X3LA 1XMPA 1E64A 1PG0A 4NPCA 4P5EA 2J4DA 4WJZA 2FNAA 2F3SA 3ZH2A 3WQSB 4EKEA 1ILWA 3F98A 1SHLA 1X9HA 1YUNA 4W82A 3T5AA 2X76A 3EH2A 3MELA 1KWGA 1CULC 1X7WA 3AWDA 4HWGA 4UVIA 1W0KD 2NU6B 3R9KA 4C0AC 4F97A 1RLTA 3OJCA 1BXGB 1QQTA 4LJLA 4QBIA 3CJTA 4BB9A 4HYEA 4JHLA 2N3ZA 4PSCA 1AM4D 2IPAB 3N0VA 2GTIA 4M0LA 4YACA 2OPHA 4C7JA 2I03A 4FI3F 3ZDEA 2ID8A 1KJZA 2OQIA 3LDUA 3T1QA 3K1TA 4ITVA 2KWIA 2LIVA 2GJ8A 1Z4PX 3ANLA 1FLDA 2CXQA 3B3GA 4KO4S 3H9BA 4FLMA 4MWEA 5GAJA 4XIJA 2D8AA 1B8PA 1PBTA 1FMCA 4LW8A 2P2YA 3MAGA 3RSHA 5HKAA 2DMRA 2F1IA 4RTQA 1O95A 1XJWA 1FYEA 3HCCA 1NYQA 1QPGA 4L2IA 4URWR 5DBOA 4CCYA 3V00A 2O8BB 4PRYA 1MO2A 4FP9A 4M0CA 3VR5H 4JH0A 4RTLA 3VAYA 4X1YA 4WERA 1K08A 3HL4A 4HFJA 2IDZA 1VL0A 1MAHA 4ZVLA 2MSDB 2XTZA 3I09A 1B3BA 2G6TA 4GR9A 1JBQA 3GNSA 4MLDA 5E3HA 2A9PA 3OE1A 3RO7A 3AH8A 1KRWA 1JNXX 4OXXA 3OEYA 2ERYA 3V9PA 4KXYA 3CX4A 4CODB 1XIVA 1GILA 1ZA1A 4Q4JB 5LMZA 2VFAA 3DA8A 1CUWA 1O7JA 3K20A 3U3DA 3UHFA 4D4KA 3TUZC 3O5AA 4PZ9A 1C0LA 1RI4A 1BROA 1IWBB 1X1EA 4L4XA 3QUQA 4J0QA 2OECA 3OZGA 1P6UA 2FKNA 1O4WA 5DBGA 1KI2A 3FLBA 1RKUA 1IY9A 4LJ4A 5HRCA 5C2JB 3U4GA 4UHJA 2QZJA 5KDOA 3GLGB 4JXZA 1EDEA 1E63A 3QGMA 1T2VA 5F2EA 5K0LA 3U7QB 2I6UA 5KJEA 5LJLA 3K0SA 3E1GA 3V1KA 4EB6A 1HZZC 3QX9A 1TCCA 1QRAA 1Z2CA 3BD9A 3CGWA 3HYTA 3IP5A 2Y4OA 5E4TA 3IL2A 2F6RA 2I3DA 4BWFB 1I5RA 2WEKA 4GX5A 2B82A 4LJ9A 2O5EA 2M6SA 4G5QA 5C18A 4NCAA 1YZ3A 3LRXA 4MWBA 2PWBA 1ZC3A 4ZC8A 1SC4A 1FFHA 2OM6A 3FFXA 4MGIR 3VMMA 4D9GA 1ULTA 2BIFA 2MU1A 1RS0A 3BTUA 2QRHA 3GCXA 3KR0A 4BVEA 2DEUA 1G64A 2NZJA 3FBWA 1GU1A 1W52X 3Q41A 3E3OA 1T6NA 3U4IA 3E3NA 5HUHA 1U5BA 2GYWA 2HZ7A 1RT9A 2PWAA 1PP4A 3EMVA 3PC7A 2AR9A 4I66A 1CETA 1J06A 4X3CA 4BRUA 4F5ZA 1O95C 4R41A 5BN4A 5CD1A 1X6VA 1YTLA 1ZRSA 2JFHA 2X15A 4PXAA 4QXAA 4RL4A 4RQUA 1C80A 4UATA 4R3UC 3VR5A 4G37A 2K2QB 2CW5A 2HSGA 1S2NA 1G59A 5AP9A 1XRLA 3Q9SA 1SFRA 3S2ZA 3O4JA 1M33A 2JFPA 3AKYA 4B4UA 2GBCA 1XEXA 2X0IA 3D81A 3PGJA 2XNKA 3BCRA 4M49A 5DI9A 2GVNA 3DBHA 3KPWA 4O33A 5JRDS 3OJ0A 3M70A 2N1BA 1LPSA 1LVHA 2IXEA 4Q9KA 4PFJA 1N0UA 5BYBA 1KDVA 5BR7A 4Q1FA 2P2NA 1OGJA 3R23A 1SOWA 3Q8XB 1ZKMA 2WIGA 3DBRB 2VF5X 3DZBA 3K8QA 2Q2OA 3PEVA 4NF2A 2AFRA 3CX3A 3COJA 2VIIA 1EUZA 1LVUA 3D3KA 4ZYWA 4GD3Q 1Y3DE 3DUFA 1PJTA 2RK3A 4CHTA 4Z6KA 1XQWA 3UF0A 1VE1A 4A0RA 3BTSA 1P2GA 2VAVA 4HSGA 3W90A 5DT9A 2XD4A 3ZWPA 1YFKA 1KQNA 2LKDA 2POCA 3H75A 1UJ5A 3ZHOA 2FCRA 2O4UX 2WV9A 3DV9A 1N3YA 1CVLA 2C0QA 1YSCA 3CEJA 1L1RA 3HS3A 3I12A 3KKZA 2QMOA 4QTYA 5EJ6A 2QEQA 2WTAA 2Q4BA 5IARA 1DUVG 2CCKA 4BZXA 1NXTA 1OPRA 4Q1DA 1IUPA 1FRFS 3CR7A 2I6QA 2LVBA 5KPDA 3W2EA 3GAAA 3RG2A 1O77A 2KMLA 4MGKR 4WGFA 1O89A 2J1LA 2K2WA 4D56A 4GI3A 1EFLA 2AMLA 3WKAA 3HBAA 1DOAA 1RM3A 3FRJA 3ZU2A 3ICPA 2PH3A 1NVFA 3O75A 1PWEA 1QCCA 5IKXA 4IZ6A 4B4KA 3DWEX 1YQ9A 5E7MA 1MQ8B 4ZDIA 2QV7A 5BN3A 1E61A 4BAZA 3D8UA 2FMFA 2BWJA 3LCMA 1QHGA 3VYUB 3BC1A 1MZVA 4TT3D 3KZVA 3ZGOA 5IW8A 2WJIA 5G02A 4CN9A 2QW1A 1KQOA 4R5HA 1ZGJA 4YJGB 3UAWA 5BV1A 2JJ1A 4DY6A 1C3VA 1IYZA 4FIDA 4P7FA 1BC5A 4LRYA 2OC9A 4RQTA 2F8SA 1F6DA 4D80A 3AEXA 4MMYB 3SHFA 1V7PC 4CTOA 2C0PA 3GH3A 4B3SB 1SUCA 1E62A 1BZYA 1K8QA 1VGVA 3K0FA 4S0XA 1WIWA 5SICE 4J0CA 3TBFA 2WBLC 3IPCA 4CLOB 3WGLA 2C5LA 4RD1A 3SDSA 1PJLA 1US8B 2WU3A 4Y2RA 2CC2A 4ZVQA 2VSNA 3CONA 1DBWA 1GQFA 1XJCA 3PRKE 3MRVA 1P4SA 2M1ZA 3PIRA 2GFQA 5TX7A 2R8XA 4HRXA 1D4OA 5BMOA 2WLSA 1HFKA 3ZH9B 2I6SA 2WSYB 2WUFA 1GPBA 1Q1AA 1X7WB 1ZH0A 3BX1A 4C04A 1KY3A 4HP8A 3SS9X 4KWHA 3UPUA 3DNMA 2FMHA 2A1IA 2PYZA 1LSJA 2W2QA 3DAYA 4Y1RA 2AMJA 5LIRA 1D1SA 4H1WA 2E4UA 4WHMA 5DXAA 3HNPA 1WUTA 5CM2Z 1T2AA 3GGCA 1XRMA 1YQUA 1VL1A 3RGGA 1DKPA 1USIA 1F0YA 1JWLA 3BTOA 4GZMA 1QAMA 1JQJC 4H7JA 1QQBA 4LAFA 5BNIA 2W71A 4Q6WA 3L4BA 5LYJA 2PBZA 4RIIA 3VR2D 4BNIA 2D1RA 1X0VA 4E14A 4WNCA 3JQAB 5B7NA 2DWOA 4QIHA 2VHEA 3ZR4B 1I6LA 1FS5A 2D0PB 4U2EA 1KDTA 2QGZA 2IT1A 2WLTA 1GZSA 2N42A 3INTA 1TO1E 3G1WA 3R7FA 2WM8A 4QE3A 2XVYA 1ZIXA 3B6KA 5AW2A 4RLFA 4QYIA 3GQVA 2BEUB 4IUDS 4UUBA 3WKDA 1GPLA 2UYQA 3ISJA 3O8DA 1FVHA 4HWKA 5IAGA 2FPSA 5A3RA 3GGPA 1YCHA 2ZULA 2LR0A 2OT3B 1Z6ZA 5HE8A 3PXBA 1R0LA 1CPYA 2QU7A 2OB2A 4RLHA 4ZAYA 3UXHA 4R1QA 5J1TB 1HKHA 3JQRA 3IAXA 3HB7A 3OF2A 1SHJA 2RJ3A 2NU8A 3E4DA 4BIMA 1DRVA 1UOQA 4KSCA 2ZE6A 2ZJ5A 1LLQA 2XHZA 3NBXX 3B13B 3A6LA 3DEYX 3THYA 1PR0A 3EFHA 3HU5A 3NEJA 1KYTA 2X13A 3WBBA 4RCVA 1FBNA 4MA5A 1Z7BA 3PX3A 3D0KA 4HZIA 2ZSDA 5EWLB 1CEYA 1L2TA 1W4CA 3GEDA 5BUSA 2MT9A 5EUBA 4I8IA 3ZHTA 1X8XA 2C7VA 2VNIA 2XX3A 1OF1A 1I7DA 1E94E 4FSHA 2E3JA 4KQHA 1ZRHA 1G6HA 1B0AA 1ZQ1A 1EDOA 1ZI9A 1H85A 3PHHA 5A7HA 3GN2A 5KDLA 2WUGA 2UYHA 2ZQYA 2GPBA 3AF4A 3NAGA 5JLAA 4ZICA 5KYKA 2OHGA 1EKXA 5CITA 1FPMA 2QLTA 5T6MA 2J3MA 3VC2A 5DYWA 1EG2A 2EP8A 4JDPA 4ZQBA 3BGDA 1KMNA 2YV4A 2WB4A 4WI1A 4G5FA 4B2YA 4C4RA 3L4BC 4FWIB 3VX3A 1HG1A 1M6WA 2W0SA 3E5RA 2I0FA 1EAYA 4X84A 1OASA 4MQFA 3PNBA 5JQGF 2CBZA 3KKPA 4LDAA 3A1TA 2PGAA 3G68A 1YB4A 4BL5A 1TW3A 5HIMA 1NXVA 4IDBA 1Q92A 1IMJA 5EIOA 2RI0A 2VRCA 3OZAA 1GYRA 1WV0A 2C4WA 3HJHA 2G36A 1HWYA 2Y1FA 2PU5A 2VJDA 3H1BA 1KVTA 3NBMA 4BIIA 2ERCA 2F3PA 1Z5NA 2AX3A 4EFDA 1TF7A 3GGJA 4HG2A 2COKA 1SD1A 2WAOA 4JA0A 1QWSA 5AT1A 1UKZA 4MWZA 4RQAA 5CG1A 5IXJA 1N3LA 1Z25A 4G1EB 4IG4A 4RENA 2O20A 5K0GA 2VPZA 4WZAE 2PCJA 4AQ7A 4RTSA 4DV6B 1EP1B 1TC2A 4AU1A 2HRCA 2I4NA 1F2UA 4Q3DA 1WD7A 1IEXA 1QFSA 1T15A 3N8GA 1XNHA 4EF5A 3F9RA 4US2R 3C2QA 3D8TA 4ZQGA 2Q6LA 1L0BA 2QRNA 4RELA 2G17A 5EGNA 3CW9A 1JI3A 2NZ8A 3WWDA 2WYVA 4MW1A 1LLFA 1R8XA 1W5FA 1YJ8A 4BC1A 3PPVA 1RXYA 2C5HA 5AVXA 1EEXB 2OHOA 1X1BA 5JH7A 2C07A 1JPJA 3D59A 3U7GA 2DH5A 1EFTA 2HBYA 3TCNA 2ZITA 3UBTA 4F5DA 3R9WA 3F47A 1PV2A 5NLLA 1NXOA 4RKYA 4YHHB 1KFJB 1RBZA 3WMFA 4MV3A 1V1MA 1JGTA 1MNAA 2O2DA 3K0KA 1KORA 4GRIA 2J0UA 3KAJA 3PNMA 4J1NA 1V35A 3TECE 4OHVA 5C8VA 3ZJVA 4Y1FA 3LU1A 1A8SA 4RZUA 2UVDA 4B48A 1DT3A 3LQ4A 4EI2A 1EVJA 1VKRA 2ZYRA 3AETB 1Z0ZA 3FIJA 1GNVA 1Y37A 2UAGA 1R37A 3C7TA 3GWGA 1L5OA 5DU2A 3U6BA 1YASA 5BV7A 2ZYGA 1SUWA 5JATA 3DEAA 4PBTA 1H1LA 4KN5A 1J97A 3UK1A 4CM1A 5C8YB 1HE2A 1QQ7A 2PZBA 5K0EA 5C35A 4JJ6A 2H4YA 1IY8A 1I14A 3DVLA 3I01A 4ML3A 1ZIPA 4YMWA 4LNAA 5I9IA 2QQ5A 3HWWA 4BXOA 1QWOA 3GZNB 1M0TA 4AROA 1EX7A 4H1TA 5JMWA 3QEJA 5DO9A 5DISB 2A0YA 1X9GA 3AHFA 2XMDA 3FPGA 3KQVA 1E66A 1KFBB 1Z2OX 3OM8A 3QWHA 2VH1A 4L6CA 4BVKA 3FGOA 3IJEB 3K0EA 3RRBA 4B2LA 4EGCB 3UMVA 3ZDBA 2Y4NA 2BTQA 4AECA 2BDTA 2GN1A 1JKIA 4Z7JA 3KT8A 1R9JA 3K73O 3R4VA 1B42A 4G56A 3W1EA 2C9MA 1JU3A 1ZMOA 3TNLA 3CR8A 3AEZA 1ZD5A 1TU3A 2QUKA 3ND8A 1A3CA 4FNAA 4HMQA 1AMOA 2NSDA 2O3SA 2BD0A 2HTEA 2CT8A 5F78A 4BV8A 2ZM6B 4FTWA 3KSMA 1U8FO 2YIVX 3FDXA 3GUCA 3LWZA 4NYJR 1WA5A 2Z1MA 4EPYA 2WFLA 3D6NB 3DFIA 5HFJA 4O4IA 3RF7A 3C3YA 3CRZA 4BUZA 3D9QX 4HDCA 1QKKA 4COKA 3NIWA 3ODPA 4QULA 4FQ8A 1KERA 1EHYA 5DK4A 4FE4A 1FUIA 1E59A 1R6TA 4JBHA 4YJ3A 5CB6A 2O3UA 1NQTA 3W5AA 4PSKA 1JXOA 4E6EA 2J4FA 3QVLA 4CEIA 4AXXA 3BWYA 2ZJ2A 3DWIA 4PTLA 4UZFA 2DWUA 3BWEA 4JJKA 3O93A 1HFJA 5J1SB 3OCCA 2XMRA 3BFPA 1CCWA 3N0TA 3DV0A 4IUCS 3SQMA 5H81A 3PDIA 1SVOA 2VP5A 3IMFA 3VYWA 4H7FA 1BHSA 2PT7A 1JG7A 4S0ZA 2QUIA 5KPJA 3PUJA 3ESCA 4ZU3A 4O25A 1Z0DA 1E9AA 1DNPA 1POXA 1Y34E 4JOSA 3K9GA 2QUHA 2X23A 2VBCA 5A3QA 1WKCA 5I7WA 2HWUA 2UXDB 2GYYA 2PRJA 2R6ZA 1UZMA 4M1KA 3UBMA 2EJUA 2QMUA 5DE3A 3FNGA 3ZKWB 3IAS6 4D9BA 1IJFA 2NUAA 3PJDA 1OH6A 4CI0B 2YYSA 3IIKA 4TGLA 1R88A 2OWEA 3ESBA 3NYRA 3U49A 1IVSA 5LZ5A 2FFJA 3Q88A 1NBME 1GQQA 1II0A 1VJ0A 1I3OA 2P9QA 4KLCA 4TROA 2I6XA 3L6BA 3HKEA 4TXLA 5A3VA 2IDKA 3TQHA 1MO5A 2C83A 4PLWA 3TOVA 2FW6A 1OWPA 2ZI3A 4U9HS 1G8SA 1MGOA 3NIFB 2Q3LA 3QUCA 4FLFA 2IEDA 3E8XA 1GV0A 1E2LA 2HMYB 3ETDA 3RHFA 4W5WA 3QVOA 3JQ7B 3QXSA 2VNAA 3I2YX 4MQFB 3T06B 3KKEA 4UMDA 2JFFA 4LHSA 2G9VA 2V6IA 3TO5A 4CRWB 4G2NA 5HFAA 2DY0A 4LWOA 1D2RA 1QYIA 2XE8A 3W05A 3SBXA 4ZT7A 1WMFA 5CFLA 2XT0A 2C7QA 2EBUA 1DTEA 4ZEMA 4KODA 4ZPXA 5FA5A 1PYDA 3JU3A 2FDCA 3C8DA 3QXJA 3KYJB 3Q5DA 1F4LA 1OOEA 3CSSA 4HO1X 5AKJA 1FDSA 1Y63A 3WI7A 3STWA 2FZCA 5T5QA 1JDPA 1QHNA 4OI2A 1G8AA 3NGLA 1P3Y1 3N3AC 3RKRA 3D3JA 2GFHA 3CTMA 2EZ8A 1CP3A 4IOLA 1VLQA 5TT1A 4EI8A 1WPXA 4YCAA 1HLPA 2R65A 4ZXPA 1J2YA 1CJVC 1MQAA 2B92A 4FR0A 2VNKA 4CCWA 1SIWA 3BGOS 3ZCTA 4OMFG 1VL8A 1MABA 3TLCA 3WICA 4DC9A 1RP1A 5I4IA 1SURA 1FJXA 3NDRA 4RDHA 3QPDA 5HUJA 2JH3A 3HHPA 4HFNA 5K2MA 5THQA 2PIDA 1KC1A 4K05A 4ZU1X 3TTTA 3UW3A 1RXWA 4NKRA 7AT1A 3N5CA 4QC2A 1IN7A 1DVRA 3IB6A 2HMSA 2P6MA 4P9NA 4RO0A 1EP3B 4E13A 3OCUA 2CJWA 3KPYA 1W88A 4GE3A 4LRWA 2CLDX 2DPHA 3SR0A 3EEIA 3ZU5A 4HNUA 1ORRA 1VFNA 5JNVA 5JH7B 3CUVA 4B75A 4ETIA 1O0SA 2P2SA 3SZRA 1J2JA 3B2EA 3HU3A 2EEZA 4FEYA 4GZ3A 4YUXA 1J0EA 2VH5R 3VSEA 5FOQA 5IAOA 2QYSA 3RFTA 4P58A 1KYZA 4Q9HA 4BLRA 5F5NA 1H4SA 2VYVA 1SEPA 5EVCA 1XVTA 3V1YA 1RI1A 2QLLA 2J0UB 1MIHA 3AIOA 1RRFA 1YO6A 1WV1A 3USZA 1O6FA 4IX9A 5BWLA 4C3ZA 3OD5A 4RMJA 1ODCA 4G8CA 1OR8A 5LM3A 5EHZA 1EFHA 1UBHS 5LP6F 2JCSA 3EFEA 4MAMA 4XGKA 1N92A 4ZALA 4KBFA 1FFWA 2RGXA 2D7CA 1ESDA 1PDVA 4G1BA 4OJNA 4PTYA 5KQSA 4HLUA 4OQQA 1O94C 1H1LB 2BLNA 2CNLA 2HFKA 3RAPR 3TX2A 1XZNA 4UEKA 1XAGA 3CNLA 4BBPA 3LQ1A 1L4GA 4FDMA 4FQ7A 3T7AA 5JSHA 2VT2A 5K9ZA 1WSWA 5J2UB 4BO5A 2P7IA 1QRUA 1EM8A 3ONWA 4IIBA 1KOFA 3HPQA 4OOFA 4H31A 2IYTA 4LZZA 1LA2A 1J9GA 4QREA 5KKAA 3MJ4A 4BXOB 3JATB 3X1ZA 3OKPA 3CB4A 4OM8A 3OIUA 3PPIA 2QHXA 2VZ0A 1JQEA 2X7HA 3CKKA 4HH3C 5AMXA 3F5FA 4L8GA 5K0JA 4ABTA 1KAMA 1YFLA 2FRDA 5IJ0A 4BQEA 2BTQB 1TXGA 1ZO8A 1H2WA 1OIVA 2QJWA 2WHPB 4Y3UA 3VC1A 2IHKA 421PA 4AMGA 1RYMA 1YMVA 2QGFA 3EN0A 3NR2A 4UULA 4G0VA 2RC6A 1ZK2A 3ENVA 1P9LA 3UN1A 3B1FA 4GH5A 4IV5A 1E2GA 4KACA 3WA6A 4R9SA 4GO1A 5BRJA 2D74A 2QUZA 5IF3A 5AH0A 4PGGA 1GTL1 3G5TA 2WVJA 1UM8A 4G4GA 4IIJB 1KR2A 3K8ZA 4MLPA 3TAHA 3SIRA 1JMYA 4PAMA 2WFLB 4EUKA 1P18A 2I9PA 2QTRA 4GMKA 4BASA 2OLKA 5CJPA 4TLBA 4O4IB 5F7ZA 4J0FA 3RYFB 1JQ3A 4PAOA 5KYYA 1G4AE 1MFZA 2CWDA 3E48A 4LXXA 3GP8A 2OXTA 2A9KA 1K3TA 3HADA 3PYLA 4ZYUA 3M6LA 1R3UA 5PNTA 4E3WA 3NH9A 4QBTA 4GEGA 2BHNA 1HLFA 5EHIA 5CXUA 4RK7A 3M9LA 2II6A 3NTXA 4R69A 1JZTA 2NX2A 4PN3A 3GJRA 3CIFA 4XR9A 2YV3A 2J3HA 3QEKA 1RZRA 1MXHA 5IDWA 5JAOA 1IG3A 2PNFA 4HLUC 1VE9A 3RU2A 2EL9A 1AN0A 5ISMA 1ZGZA 1P74A 4PZUA 3K70C 1Z37A 4OQZA 3WGVA 3D7NA 1KJQA 2XRMA 3H18A 3TWOA 3ZQUA 1Q6YA 4P31A 4Q5IA 1S4QA 3BM5A 4MKZA 4CMJA 1E3QA 4UC0A 1APBA 1Y3CE 2BEKA 4FX5A 4JKYA 5CM9C 3T52A 4I1PA 2AG8A 4INPA 5LOVB 1OIWA 1DAHA 1J90A 1ZIDA 2ZBEA 4NQRA 1ZM2A 5BWMA 1NUQA 2ZYTX 4O0MA 3C6MA 2L69A 4RSMA 3GPIA 2C3OA 3FVQA 5CVDA 3ZHXA 1AV6A 2Q6TA 2PKYX 1VMIA 4G0QA 2BGMA 1WZ2A 3IUQA 2EQBA 2AW5A 3PFWO 5T3UA 2NUAB 1K7EB 2WWVD 2JGEA 2R8PA 4PY2A 3SIWA 1DSSG 1DOHA 3TLJA 3D1JA 1SGWA 4XB1A 1OXMA 1P17A 1UDWA 2BP7B 1C3OA 3KL4A 1MRZA 2JCXA 2WWGA 3RC2A 4ALLA 3DT6A 3HKEB 2I7VA 4AJJA 3T5MA 4NV1A 1VIMA 1PN3A 3DW3X 1DKUA 2OBYA 5EERA 1NNI1 3R9IA 2GWHA 2KBFA 2QV0A 3FUVA 4FBMA 1NVEA 3C7DB 1PVDA 3CPHA 4BVHA 4EA9A 1H9BA 2VDOB 4JQOA 4AIRA 4ZO9A 2HV9A 4WECA 3ETCA 5E95A 4PNHA 3AUYA 4M3NA 2Q27A 4D74A 1EU1A 1J7JA 1XU4A 5HCNA 1R4NA 3SFVA 2X58A 2DFVA 4DLKA 3V80A 4QBKA 1JPVA 1TQHA 1ENPA 3TR6A 1YRYE 3RYCA 3V7WA 2A0XA 3FUTA 3PFFA 4GOMD 2B1GA 1M76A 2P3LA 2YV2A 3AR5A 4MUHA 1LFDB 1DBRA 1LF5A 2WF5A 3O7WA 1P7YA 5DXFA 4KITB 1P8JA 3GRPA 2P68A 2ZSAA 4Q3EA 1UPUA 2NT4A 1QQ6A 4NPAA 1WLYA 3R75A 2ZUTA 4GBMA 4DDMA 4Z4FA 5IJAA 9MHTA 1KI4A 3E7XA 4F0JA 1QM5A 2AN1A 3R3HA 3GJ3A 2VK4A 2VJPA 5AKGA 5FV4A 2VP6A 1CZRA 2JGAA 1X7DA 4Q03A 5D3MA 2FP3A 1GSIA 4FOSA 3IEXA 2D2XA 3DJFA 4K6KA 3RSFA 3TCKA 3TQCA 3IH5A 4BZZA 1I24A 5JSKA 1WZEA 1Z35A 2JI6A 3EEBA 2OEPA 2VSQA 4R1NA 1E5DA 3VHRA 3ENKA 5AQ1A 4R2HA 2Z6UA 3KVYA 2V97A 3H6KA 4ENUA 1UWLA 4LMAA 2C2ZA 5JPDA 1H4TA 3B6IA 4FMCF 2GILA 6AT1A 2JFQA 1SCUB 1K27A 1FX1A 1E7QA 3IKJA 4NP6A 1D1TA 5L9AA 4PN7A 2YZNA 1ZJ6A 4FGSA 1G60A 4G09A 4DTCA 1E1YA 3VJMA 4JJFA 4OA8A 4BVLA 1WB4A 4EG4A 3AKZA 4LE0A 3CN9A 4KE6A 2QKYA 4F84A 2BR4A 1KXZA 5AXCA 4A8TA 4UAJA 4DNPA 1O6CA 1QZUA 2DH6A 3EG9B 4TYMA 2JLCA 2KBEA 2QS9A 2H0AA 3L0YA 3PP8A 1Z68A 2BCJQ 1B73A 4MUXA 1CZKA 3OCJA 2O0LA 3C3AA 3AUJB 5JFGA 2BISA 5K6TA 5F51A 4TYNA 3C5WP 3D5TA 4CEHA 4GGMX 3ZGXA 3IP6A 1MH1A 5EQTA 2H29A 1L4BA 2C2XA 4V0NA 1I1HA 2W2MA 3VYTB 1F0NA 1CLUA 1EM8B 1XCMA 2Y1GA 3OTHA 3PRJA 4XI9A 5EXDA 1YMUA 5JSYA 5HPYB 3VNUA 3DONA 5AUQA 5J4KA 1N32B 1DELA 3HBFA 4P22A 2XNSA 1GU7A 2QDXA 2PXCA 1AHNA 3HSKA 3JVVA 2ZE7A 5HF5A 3U2QA 2FPRA 5JSZA 2I66A 3X1MA 4NZOA 2QD4A 4R1PA 2Y71A 1XQYA 1UAAA 1E5QA 5M29A 3BTVA 2O7VA 4G0XA 3I9FA 3MWKA 2FWRA 3AILA 1S2OA 2AEFA 1NAHA 2V7UA 1UK8A 2XVXA 3BIWA 3IJPA 3L93A 3O3OB 4P98A 1GG9A 1YD7A 4FXPA 1C5KA 1YZTA 3DXYA 4LRUA 1O08A 4RORA 4UUOA 5FR2A 1UC5B 1E9CA 4KHZA 4KXLA 4TT8A 1HEIA 1DLIA 1F17A 2Y1KA 2YY6A 4LY9A 2Q7OE 2QSUA 1IXYA 1PR5A 1M0SA 1DEXA 4RLSA 5ALEA 3HA7A 1I80A 3DZFA 3HQ4O 2BGRA 3LHSA 3R3JA 1NXSA 1JAIA 1V39A 1YOBA 1I13A 3JYOA 5T64A 3QTLA 1C0EA 1TZ2A 2BZ0A 3VHXB 2VUSA 4EFKA 3ASUA 5KYYB 1L4HA 2GF2A 5EJ5A 1SR8A 5TGDA 1SCJA 3TSOA 4B35A 1ZCAA 1SXJB 2Z5VA 1PJBA 1FS6A 1QHIA 2W2TA 4FK8A 1MO6A 3K5IA 3GGDA 2I99A 3X3HA 1KARA 1H2BA 2V7EA 1V71A 1XCGB 3MMSA 4XDGA 1Y42X 2E7ZA 5EN4A 1E99A 3PJRA 1UODA 2I33A 3CNQS 3HXTA 2ZS9A 3IT0A 2H31A 3NUQA 2A8YA 4RVUA 1GPWB 5EP2A 2ERXA 4B1FA 3U44B 5BQPA 2WSSD 2WZCA 1PSWA 3RU9A 3ZWWA 4EEKA 1UOPA 4ZHQF 1JG4A 3LQFA 3E1SA 2G88A 3TX6A 4CMEA 3LPMA 4N0QA 2GM3A 4KGZA 2AOUA 4WGGA 4R9VA 2X5NA 3H5OA 3TXXA 4BVGA 4NLLA 2IEYA 3DZHA 2YJGA 5B4TA 1PDOA 2ENWA 2VXBA 4XXHA 1H8HA 3R7WA 2CZQA 1V5FA 1TKAA 2PRSA 4NBKA 4D4GA 3C3JA 1L4EA 2ZYAA 4MW4A 1EA5A 3OX3A 4A27A 2ZIEA 1P1KA 2YYAA 1D6SA 4TUYB 3AQ4A 4J0GA 2NSJA 4E5KA 4WJLA 4X92A 1N2XA 5CFMA 5BSGA 5LLTA 3EJ6A 3S2IA 4XYGA 4ZKEA 1IM5A 5AKLA 4Q3AA 1C3OB 2PX5A 1RHRA 1T1EA 1RM4A 2Q6KA 4EW1A 4I3FA 5B37A 3B85A 1K98A 1L5HA 5IJWA 3W5JA 2EYUA 3DKPA 3B7PA 3E61A 1GRRA 2HMWA 4L08A 1TJ5A 2JGIA 2PZMA 1SCIA 4LF9B 5LCXA 5GZ1A 1GNLA 4QDKA 4OYYA 5G1OA 3G0IA 3I2FA 3Q8LA 3L6DA 4K81B 2OMKA 3R09A 2V3VA 5HBGA 3JX9A 1R0SA 4AJ2A 2IXDA 1NUAA 4DLWA 4EH1A 2CUZA 3KJFA 3EWSA 3M33A 4CLRA 2JZNA 5C32A 3HZRA 4MUBA 3KJQA 3ND5A 5LN1A 4R7GA 2C9CA 3NC1C 1TVKA 1Y3HA 1T3TA 4P3XA 2Q8PA 3FSGA 1NHGA 3RYCB 4QTTB 3ZBUA 3ER8A 3H8WA 4C6HA 1XZEA 1VG8A 2IPLA 3PICA 1PKEA 4YO7A 4E03A 2XCTB 1NM5A 1IHXA 2O5CA 3Q7SA 4GMHA 2FXVA 1NVBA 1OYWA 3FBGA 4O4LF 2Z57A 4QRDA 1ZWKA 3GRZA 5DNVA 4XAQA 1YUBA 4EHLA 5L4NA 2QQGA 4EA8A 1LZLA 5TEVA 5FBVB 1D0IA 4YCJA 3K92A 2Y9MB 1K63A 2Q49A 2Z08A 1N2HA 5D3MB 3PUIA 3SM9A 3HJUA 5JNUA 1PJCA 3BEDA 1Q7TA 2PSSA 4OJQA 4D9JA 3AVUA 2J6HA 3UHAA 1EK2A 1NRWA 1IK4A 2Y76A 1D2EA 2F2TA 3DJYA 2J3KA 2DGDA 3K8OE 3KAKA 4PHTA 2DECA 4UBOA 4DCCA 1A9SA 4DRXA 2D1FA 3OTGA 4A1FA 4GG1A 1FTYA 2JGLA 4HVLA 3I2KA 1WPGA 3BDAA 2PZ8A 2V58A 4IVQA 3SXUA 4EUHA 2Y6VA 3CEHA 3A6DA 2IPXA 1FYFA 3FUWA 3PYMA 3QKRA 2H1CA 3QF7A 4TMTA 3Q3CA 5G3ZA 3SC3A 3H83A 3UV6A 1QKJA 1KEWA 5H4HA 1JILA 2CHFA 2Y1EA 4M99A 2G6BA 3H9JA 4QJ5A 3WRYA 3W06A 4H1VA 3AI3A 1VL5A 1EE1A 2IY7A 4HF7A 4HX5A 4LQCA 4AVYA 4W5JA 5AJWA 4C4YA 5FJIA 1UBCA 1F4VA 1JQLB 3PK0A 5FP0A 5SYNA 4H59A 3U3RA 1QO0A 1YVEI 3FPSA 2UVPB 3PWSA 2E4AA 4QFMA 2C5GA 5BSKA 4FW9A 1B16A 4PX5A 3L7CA 4YS6A 4TS4A 3L8FA 3CW2A 3PFCA 4GI7A 5KTSA 1XPRA 4GKAA 3I1YA 3ENZA 1Z6QA 5KTPA 2IXFA 1Q1EA 1HRDA 5F3WB 1IJEA 2H1RA 1TM7E 3C16C 1F8FA 3EPPA 6REQA 1DKNA 1OXSC 1O8CA 2M9MA 3C70A 3AFMA 3TIIA 3WP1B 2HLDD 4YJKA 3VPXA 4CEHB 2I3GA 2YV1A 1P9NA 4IJ6A 3C7AA 2GCEA 5IEBA 1IB0A 4Q0MA 3NETA 4RFSA 1S0UA 3TL6A 3NG1A 4AZ0A 4BWVA 1NM5C 1QHEA 2E49A 4Q39A 1RYBA 3IDZA 3JQ6A 3UY4A 4YCNA 4W1SA 3IIIA 3OX4A 3ZDDA 4DCNA 4Q4CA 5DRTA 5LZ4A 4DWJA 4KXVA 4M76B 4HUJA 3SF0A 4AC9A 4P7JA 1SCBA 5DTEA 4NENA 3WWPA 5K45A 4EPRA 1XMVA 1YF3A 1O95D 3JZIA 4AG6A 3SKVA 2GN0A 3FPAA 1X1SA 4YALA 4KPUA 4R84A 4OHMA 1JIJA 3EUWA 2HHAA 4Q12A 1N25A 4WUTA 1X7YB 3U81A 3VUEA 4AO7A 3LVBA 4YRPA 3RWBA 4ENTA 1JYSA 2A5GA 3TZBA 3OLWA 5JSFA 2GA8A 4ALKA 1HNWB 1ZN8A 3L4JA 3ZHQA 1T6ZA 4LHVA 2QU8A 1XMQB 4UUMA 3MYYA 2H52A 2HRDA 3FF4A 3TLEA 5IVDA 2ZYVX 4QOJA 2X3UA 1GFSA 2R1ZA 2ZG6A 3WRYC 1J0BA 4URXR 2H7CA 3TE7A 4Q18A 2VNHA 3L8DA 4NCIA 4DM4A 4YUWA 1PI3A 3AV0B 3CKLA 3G8BA 3MT0A 1XRRA 3DMHA 4N54A 5FPQA 1V9LA 2DFPA 2YNMD 3AM5A 1W8DA 1XRSB 4OD0A 4IFEA 1VOTA 3VVCA 1E2JA 1XK7A 4MIKA 5ENVA 4FWTA 3GFOA 3WLPA 1H1DA 5H9VA 3MD0A 1P5HA 3GQBA 4IVRA 3V8NA 4Y67A 1LUAA 3U48A 2ZPTX 4EYEA 5BO5A 1HDEA 5J63A 2WUDA 4L16A 3SFZA 5F2OA 1P1RA 3PRHA 3EHDA 1MC5A 1ESEA 3U56A 4KP7A 3TRHA 3DHNA 1ZGHA 5E0OA 1VSUA 3IUSA 4HAVA 4OUDA 4TWJA 3EXEB 1U2EA 1VL6A 1P6QA 2ZKLA 3C41J 3F2IA 1CUJA 2AJBA 2QZ4A 4UHCA 1G38A 2H4HA 3GA7A 3FKJA 3X0DA 4QXRA 1WEHA 5G4KA 2Q3EA 2HCFA 2AWOA 3C8UA 3IQXA 1E0JA 3VR5D 5FAKA 1OLXA 1BX3A 3M1LA 3MERA 2IUEA 3DLTA 1UXHA 4JZYA 4Y0AA 5AHWA 5FAXA 1HKUA 1F0KA 2V96A 3EIEA 1YU6A 3RHZA 4BJ3A 4DL9A 5REQB 2Y9PB 2XTJA 2XUZA 4OFBA 1GUFA 2XVZA 3JQCA 4HR7A 1QB7A 1MOZA 3SR3A 4IFBA 1L7MA 1PR6A 4A92A 1GPMA 5CNKA 2YW9A 1XEAA 5JBIA 4PO1A 4HDRA 1H9AA 5ULLA 2A4KA 1SUPA 1G20B 4Q4LA 5KHAA 2GB4A 2GLUA 1KNQA 1QF9A 2WSIA 2ENUA 2ZJAA 3MYRA 4DTIA 2MDTA 5IZ4A 3FOEC 1UEIA 3ELWA 3A9RA 4QRIA 5KS2A 4IJ5A 4JLVA 3EZ2A 2NADA 5HM8A 1YRAA 5ITWA 1U2QA 1YRLA 2X4LA 3Q3IA 2RGDA 3E18A 2BI8A 1EBUA 3G2JA 4CLRB 5I45A 2ORVA 3UK2A 2HK9A 4CV2A 2YWEA 4TL8A 1T4MA 3RGWS 3ZY6A 4TKVA 2IHJA 3OHPA 3WGHA 1C1HA 1QGYA 5CLFA 4Z4GA 4M1ZA 5DM60 1R5BA 4ZOLF 2DUNA 1A2BA 2F17A 3FB1A 1OH8A 4BPBA 2GBPA 3A1SA 2AJLI 2ZGVA 3VZRA 1AF7A 4O4JF 3L8YA 1E3IA 2KB0A 3OZDA 4RGYA 5FOWA 4X8OA 1J8MF 3ADDA 2JIZA 1V16A 1C50A 1TUEA 3GJ0A 1OFTA 1UBLS 2FP4B 1ZIYA 4PYIA 5H3CA 3OIFA 1YL5A 3O84A 5C4IA 4Q3LA 4C7OB 1CY6A 5JNWA 1XI2A 4PLFA 3L6EA 1P6XA 1LS1A 4E2WA 4HJXA 4EUFA 2JFXA 4F7DA 4PSVA 3K2EA 4K9SA 1Y6QA 2PAFA 1V37A 4W8GA 4EOGA 1RC0A 3EGXA 4J6FA 4NZMA 3WFJA 1W36C 2CJFA 3O91A 2IYLD 5C0OE 3RC7A 2CLMB 1MNQA 4YJHA 2I76A 2UUPA 1CQWA 1IRXA 3AJRA 4Q24A 3V33A 3S29A 2CLKB 1RRVA 3VVMA 2XKKA 1R5NA 3OE4A 3QKSA 3B9PA 2WINI 3KZNA 3QKRB 3G2HA 4IP0A 3RREA 1M2GA 4HGYA 3WKBA 4RV5A 5COQA 1RXCA 2H3EA 4KUGA 2BPOA 1CEXA 2R0QC 4CMIA 3B7WA 1GNRA 2JDIA 2QT1A 2P3QA 5DMHA 3FVRA 3EEOA 3VZDA 2XDWA 4FYPA 1MOPA 2NZVG 3TMAA 1SUAA 4L8LA 4TLCA 3TQSA 5JAZA 5LVAA 4FDLA 4LGVA 1UFQA 3ACBA 3N8DA 1UPBA 1NI3A 2VS1A 1Y6ZA 1NZJA 1MIOB 3BRCA 3DEIA 1AN9A 3ISVA 1NC3A 3T61A 4AN4A 1AU9A 5JDIA 3GG9A 3HUFA 4FZVA 4A26A 2JKZA 5D00A 4OAPA 5CLLA 4BKRA 2VUIB 3AP3A 2YC2C 3UWDA 1X80A 4TWRA 4F3CA 1Y48E 4AZ0B 1NVVQ 2NYRA 3I64A 2G0NA 4NMMA 8MHTA 2BFBA 2PS1A 1EX1A 4CBVA 2GKOA 1WCIA 4XCQA 1E7SA 3W4KA 5LKRA 3PFNA 2AH5A 4MVWA 2WDPA 2GDJA 3D1VA 1TU4A 3Q9LA 4MMXB 4NENB 4X20B 3KELA 4WD3A 1R0CA 4DNXA 1RI5A 4A10A 2FMTA 2CFSA 2PZJA 4L15A 3P20A 4AY2A 2RD2A 1VJCA 3SMVA 4ZKDA 5CB4F 1UMKA 3GUHA 5TB5A 3W4JA 2HJHA 3SX0A 2YCLA 3D7MA 4AX8A 3Q1KA 2AG0A 1CUYA 2V6GA 2REXB 4FCVA 4QO7A 4Y7CA 5KB3A 3PGVA 2XRFA 2CDAA 4TVOA 4UAGA 3WL5A 1ZOLA 4C7MA 1H2XA 3E3MA 1XTBA 4XYEA 3TIGA 4ERNA 1I9GA 3H4MA 2D54A 3FG9A 2F4NA 1MR3F 3KQOA 2AMYA 4PE5B 5F4BA 1G55A 4US0R 4MGYR 1GUBA 2PWYA 5DM4A 3ZHSA 4CTMA 3H19A 1L3IA 1JR2A 2Y67A 2I8CA 2WZDA 5JEEA 1BVUA 5FTJA 3RC8A 4GKJB 3ZGVA 2XOKA 2VOJA 4QZVA 1PX0A 3KEQA 3SLGA 2PY6A 1A4IA 1NUHA 2O2YA 3QQ5A 4R68A 5DIFA 4RVGA 5HZMA 1SKYB 3VR3D 3DLPX 1EXVA 5EE1A 1HOTA 1BRTA 4MKIA 1EUCB 1OV4A 5K4HA 4LBYA 3A2NA 3FMPB 1W76A 5JDIC 4FXOA 1WQ3A 2Z1NA 3KUKA 3DQZA 3GQBB 5F9HA 1WUKS 1CEEA 3LK6A 1A8HA 2PSHA 3ETNA 2J45A 2AJTA 2CK3A 3OEWA 3GRAA 3P8ZA 1UJMA 3QJYA 2ZUCA 2H18A 4LCBA 4Z9BA 2FUCA 2IXGA 2BHRA 3UWOA 3EBOA 1BXZA 3CVJA 4IF6A 4ENRA 4MARA 4P3KA 3DXFA 2QZSA 5BSMA 1WVMA 3TNYA 1QCDA 4L5JA 4JBXA 3VXKA 1UBGA 5L45A 4HRYA 2YY5A 1PUIA 3WOVA 1AQIA 2IU3A 3DF7A 1ODTC 1SMKA 2GCOA 2DFTA 3TK1A 2B4QA 2I6GA 3TSYA 3O94A 3EXIB 3MRXA 1AQNA 1JBEA 5LDDC 3HA5A 3OJOA 4FOOA 1PNRA 4LXUA 4B82A 4NG5A 5L53A 5AM4A 3UICA 2CVZA 5I7AA 2VRCD 1W36B 4ZK2A 4OK6A 5FTKA 1Z4NA 3TLGA 1EMDA 3BL6A 4KXMA 1GEEA 1OCEA 2IZ7A 4TQUS 3M81A 5FXMA 5BSTA 4GGOA 2AK3A 3O8CA 3VSCA 2C5FA 3HHEA 4WZAA 3HCFA 2ZBGA 4JC0A 5L3VA 3Q1LA 1VLMA 4HN2A 1EVEA 2A1TS 4KMSA 4WCDA 5CBKA 2GN9A 4GUDA 2MJLA 4OHKA 2YRXA 4R4JA 2ZSUA 3FWKA 4ESHA 2NVOA 4HDRB 3R1IA 5JS6A 1A96A 2G9RA 2JIPA 3GK3A 2C7OA 2P6PA 2HJGA 4GX1A 3WO1A 2XGJA 2AEJA 2APJA 3K2IA 2NXJA 1GVNB 1C3XA 1OZ0A 1XEWX 4BE9A 2Z56A 5BSFA 4KYTA 4XIIA 5T4EA 5MN5A 2ZRGA 3LCRA 5CA0A 3ZVNA 1XZMA 1YL6A 5I01A 1E77A 5K8CA 5FR1A 3T38A 4Q9DA 3PPYA 5K8UA 5AW8A 2JEOA 4TKVB 2ZUFA 2BFAA 4WKCA 1M83A 3QY9A 4Y18A 4BGIA 4CW7A 4QUKA 3B9BA 3R76A 2FF5A 2AYYA 4R9NA 4CM4A 5KTRA 2ZIAA 1N3IA 3BZUA 2LKCA 4IEFB 3EZLA 1MOQA 3K16A 1F5SA 3E9ZA 4FNOA 5LDGA 3WBFA 2ZBFA 1AHHA 4NESA 2ONKA 1B8UA 2G71A 2PGLA 2VJKA 1WPRA 3O2SB 4ONEA 3RSGA 2OHJA 3UFXB 4O0LA 2I91A 2YWJA 3OIGA 2AOWA 4WBSA 4XWTA 4TTTS 1V16B 5I7HA 1FP6A 1VYUA 4GOXA 3FCEA 1UR5A 2DPXA 4AY5A 4TSFA 5SZIA 3DO6A 3T0FA 4MOWA 4LDRA 3UGQA 2OXCA 2BEWA 2OYSA 2EFCB 3O38A 5DSTA 4E30A 4WK6A 1FBTA 2O57A 5UKDA 1Z8NA 1MO4A 3B60A 3MPOA 4OHPA 4G24A 4QUBA 4Y2GA 5AM5A 5EYPA 5LQNA 3JASB 1C30A 3ZIUA 2VBGA 2R8RA 2FWNA 1GCIA 3R5TA 5B57C 3IJRA 4WVLA 4YJHB 5HCUA 2JW5A 4JELA 4LXGA 1T9DA 4QYXA 5CVUA 3KQKA 3QKSB 4IJKA 4RH1A 4MGHA 4A5OA 2HH9A 5AW1A 4BO4A 2OGTA 4DR2B 1Z0UA 2L0XA 4V0MA 3GB9A 4RVOA 4C3OB 3SQDA 1XLUA 2BKEA 1C9KA 1LY1A 1XKLA 1H93A 4TV9A 4X95A 2GJSA 3Q7TA 2HBZA 3N0RA 4FFBB 1ESCA 2H63A 2XZTA 3IP3A 4GXTA 3LYUA 1A5BB 4I8DA 1G5IA 4MA4A 2ZYWX 1LBEA 4N6GA 2C7PA 3E2MA 4RWZA 1M8PA 3FTDA 3PD1A 1YR2A 2VWQA 4KMMA 1EXNA 4O2AA 5TMDA 4L5AA 4W8OA 5CU7A 4UMFA 2Y1OA 1Q0PA 3C3KA 2RHWA 3CQ9A 4OL0A 4TRMA 5F1OA 1T91A 3E84A 4IWXA 1KMHA 1NJ5A 3OECA 1NUSA 1I1NA 2J33A 3KUDA 4C89A 1G291 5GMOA 4YMHA 5BR4A 4G67A 5HGXA 2BMDA 3HB4X 3ODGA 5JQGA 2WF6A 2JLZA 5IAEA 5CFPA 4DJ5X 1RQNA 2WTBA 1U0SY 1S3GA 2AVNA 1ZOOA 2BFBB 1IB6A 1PGPA 3QE9Y 3FMFA 1Q14A 4JASB 3TRFA 1ZR2A 2FCAA 2O2HA 3RVDA 1DJMA 3NPMA 3F5QA 4MQEB 2IUFA 2Z8YA 1C9DB 4XB6B 3DP7A 5G41A 3C3PA 3GLTA 1NA5A 4GT1A 4P4UA 3QHAA 5ANRB 3DZJA 3PTZA 1RNLA 1ONBA 3WZ2A 4ARBA 4IFTA 4FKMA 3KR1A 3VH3A 2YCBA 2C4HA 621PA 5FTWA 4IYRA 4UUNA 5TE9A 4DT1A 5HQ3A 1IM8A 4DQKA 3WYCA 2PS3A 3JQGA 2AF4C 4WRRA 3E9NA 1R74A 3DBVO 3OESA 3PXCX 2HIGA 3DPSA 4Q00A 5AVVA 1NP6A 3RI3A 1V4NA 2HYIC 3RIMA 3MLEA 5KU1A 1NRXA 1YCFA 3DXXA 1MAAA 1R4MB 3OIVA 1JHZA 4RS4A 2RAPA 3H0KA 4NBSA 3H5TA 3P32A 2TMDA 1LEHA 4MHSA 3DG9A 5PGMA 4LBVA 3QXCA 4BKUA 4E0BA 2M98A 4LYEA 2MYTA 3WP0A 3PQ5A 1OD6A 3FSRA 3I58A 4RXTA 4JVNA 4J76A 2HAEA 4N4AA 2N47A 5LD2C 1CR1A 3OQ6A 4DABA 1NBMA 2GS9A 4ZZ2A 2WK1A 4DB4A 1CIPA 3I2GA 3UK6A 1H0RA 4BLPA 2H8GA 5ARDA 1U6JA 3HJCA 3OT5A 4EEXA 1K3FA 2BGUA 1NT4A 3FKQA 5AK0A 3U13A 1W1WA 1WX1A 2ZRFA 2Q1TA 4G5SA 5KJ6A 4PINA 3KQHA 5I9TA 4BNYA 4DUPA 3HKBB 4CIXA 2IZ0A 1YONA 3JD3A 3NYWA 1XAJA 1MC1A 4ZQHA 1WMBA 2G3YA 1C14A 2ATIA 1Y81A 2AJ8A 3BXGA 4REQA 4WLNA 3SEQA 1VBKA 5TQ2B 5IYZA 2ZBPA 1L7NA 3BL8A 3FYTA 4PG8A 2NO1A 1NGSA 2GCOB 5F35A 2PXHA 3COVA 3PS9A 3MFQA 3RLIA 4ZYLA 4MQLA 2X8JA 4JZKA 2ORYA 3T5PA 1T8YA 2BJHA 4FFDA 4TXHA 4CF6A 1DU4A 1JHAA 1U3WA 1GWNA 3R8FA 1V9SA 5EMHA 4RWEA 4IS3A 1SCAA 3FWNA 4CIVA 2JCYA 4AAYA 5JCJA 1RRKA 4ZI7A 3NWJA 2P67A 2YXEA 4OFWA 3TLGB 4C01A 1NV9A 1TLTA 1JAZA 5CNJA 2NUPB 4BB6A 1XXLA 4KWEA 1CVRA 2WM3A 3A1CA 4WZAB 1ZA2A 1TM5E 1WS6A 1TIBA 1HORA 5KKCA 1HTWA 4BRSA 5K3DA 2EYQA 5ALWA 2BBOA 2VJQA 3CLUD 4KNVA 2FQWA 1LLCA 2VT6A 5HIIA 1K4KA 3N5KA 2R4QA 2CDNA 1BAPA 1DDIA 4EVIA 3WL6A 1K3UB 3HCDA 4P3OA 4EO7A 2DJ5A 4HL6A 4KDCA 1ILEA 1ARZA 1IZ8A 2OFXA 2WP0A 4PIPA 1SBQA 1DEOA 3HUTA 3L5KA 1ZG3A 4IZIA 5FTLA 4CM4B 4I2NA 3P0HA 3TBKA 2WM2A 4NFLA 3K1YA 3R5XA 1U0NA 4N47A 4HEA1 3ULKA 4B5KA 3VA7A 2H5EA 3PFHA 2JZOA 4G4JA 4Y2YA 3C14C 5CA1F 2N75A 2IIPA 4K2AA 5EXTA 3LTNC 1W35A 5ESWA 4BBAA 2A59A 2VYVD 4UMVA 4KQCA 5KYUB 3B70A 2BUBA 5I8WA 2BL4A 4Q3KA 3ZZ1A 1SOVA 2IA5A 3K1JA 4YT2A 1L5SA 4YV1A 4WN9A 1NLZA 2BEWB 1BCSA 1NL3A 1SN7A 3BK2A 3OCXA 3SG0A 1BHJA 1MQSA 4EHIA 3NVKI 5EYPB 2P1DA 2VHCA 1IVNA 2GD2A 4OV6B 3E82A 4CQJA 4O8CA 4IJMA 4C3UA 3K6SA 5EMKA 1SEVA 2X2EA 4NAHA 2GBGA 3JAWB 4K3VA 1WRBA 1GZ6A 2ZRIA 2J09A 2X4GA 2NV6A 4JHXA 5AO9A 3JPYA 2FPOA 1RYHA 4QARA 1GGVA 1LH0A 3KB2A 3V3TA 4DJJA 3LZCA 4H6PA 5U4XA 4FGWA 4ZDKA 4CXMA 3K70D 3B5IA 2Z3WA 1QTRA 7YASA 3NBFA 2KJQA 4JB0A 1WF3A 1FUYB 1U3VA 2AG1A 2PEZA 4KVZA 5COBA 1NVGA 1CY8A 1Q0UA 4PZYA 3RAEC 3UATA 5E6UA 1V5IA 3K15A 3CRQA 1MUUA 1KETA 4BEJA 4X8MA 2O2EA 1UDBA 4A03A 1RFGE 3CZ4A 1L5FA 4TM8A 4D1YA 5LD2B 3AK4A 3N7TA 5AD1A 3PF8A 3FTNA 1QH1B 2FEKA 3HKCA 2ACWA 2PVPA 3OCWA 4DJAA 5JISA 2AB0A 4YJ2F 2G09A 1KMHB 5BW5A 2YVUA 3AVXA 5JQGB 5LQDA 4L72A 2Q46A 2WJ3A 2F48A 2PT6A 2HWXA 3MAAC 4I99A 3W8RA 3FWPA 1KY5A 1QRRA 2FPLA 3PDWA 5JARA 2W11A 3IIMA 2ZPUA 3WYBA 3B51X 2VJNA 1S5PA 4NYMQ 3CT4A 3RS4A 3BPSA 1W9HA 4P86A 5AK5A 4DVJA 1Z13A 2D0IA 2JLYA 4UPDA 5IBPA 5TS2A 4BRWA 4MWOA 4G0YA 3FDJA 2FUG1 4HADA 3TW8A 5CDYA 3ANNA 1PFVA 2C8LA 3IXMA 3KNZA 4CYMA 4KVGA 2YHUA 1ZM3A 3H2SA 4NEGA 5K03A 2BHTA 2GUWA 3VDRA 4F4IA 2QVLA 3RB8A 2GCNA 2JIMA 4O4HF 4PEVA 1PJ4A 2FI1A 3IODA 4CDRA 4OLFA 3JQGB 1BA3A 2OFFA 5L40A 1RZRD 2CYBA 1KMIY 3LH5A 2FZEA 4IQGA 4M1SA 3OPVA 4B9EA 3H6GA 3FPKA 1NMQA 2CVHA 1E2IA 2RARA 3DT9A 4GKVA 4MIYA 3IQHX 2EBFX 1T2EA 1EX9A 2W2KA 3JALB 1Z6TA 2CHEA 1ZH2A 3ZD9A 4DMRA 2D3WA 4AJNA 1YZGA 4Q7MB 5CCBA 4OI1A 1KDZA 4KO2S 3O03A 2CHVA 3R74A 1AQUA 4WESB 5FOXA 1DZ3A 1IHUA 1PLKA 1QH8B 3VR0A 2FFHA 1AS2A 3BFKA 3OI7A 3OM0A 1HETA 3ANXA 4QATA 2BFNA 4PTZA 4EARA 1RBQA 4XVHA 1IN8A 2ZU6A 4M8IA 1H2HA 2CXTA 3PVZA 3O82A 2IBSA 1WTCA 4ZCSA 1VPTA 4M1EA 1SXGA 4DUYB 3KZCA 3IKTA 2X2FA 4ESEA 1E5TA 4FFRA 3MTAA 1E8NA 2EBWA 4OKIA 2PYIA 4HNRA 2RGEA 2XJ9A 3H9QA 4TL7A 1Z3IX 4HGQA 4JNCA 2O3RA 3L82B 3S40A 2Z2XA 1NASA 4HQ6A 3D8RA 3NNNA 5LP6A 2Y6UA 2AQHA 4MRAA 5BQXA 3C24A 3AWIA 4I9FA 2ID4A 3UHJA 1H2AS 1PG2A 4YECA 1K5DA 1OU4A 2PX3A 3QI7A 4IIFA 5JD6A 1QAQA 3K94A 3JD2A 4IDNA 1UBFA 2R7AA 4MQ6A 2C61A 5AHRA 1X0XA 1BG6A 1NSFA 1E1QA 3HP1A 5ALQA 5EZQA 2NVUA 5JLJA 3DR5A 4RVSA 4F93B 5LQJA 3QUSA 4N0EA 3B82A 1U11A 3DOIA 2JIDA 1K8YB 4HB4A 3JQ8A 4TQAA 4UM7A 4KRFA 4YNBA 4E2YA 1K0UA 1T29A 1VCMA 1NIPA 4F3KA 3G0OA 4PSDA 1CE8A 4F72A 3NVDA 4V2IA 1RKBA 3OZVA 2WV7A 2WIDA 3NTOA 5D3QA 3UKOA 4TQGA 3L7DA 3ORFA 5JXHA 4BJ6A 3OQBA 2C92A 1SRQA 2CNBA 1XTTA 2A7QA 4UPEA 5JVDA 3OPXA 4W4TA 4WOPA 5HMLA 5GY7A 1FDOA 1R4ZA 1TVEA 4R1LA 5KSWB 1M54A 1KHHA 3E03A 1ZD2P 3ZNNA 3UAVA 4F6CA 2W0MA 3OM9A 2HBQA 1U0JA 1WCYA 2IBMA 2OCKA 3IA7A 3PJFA 4PGHA 5DHUA 3ZWAA 1VIAA 1AJEA 1QG0A 2A30A 2ACKA 1X7XA 3FNRA 4R81A 3KDAA 5BWOA 1Y5MA 1C4WA 2PZKA 4HUQA 3W9SA 4P5PA 4YCMA 5BVHA 4LSGA 4MEAA 4FFNA 2JB9A 3BJZA 3ETHA 3GVPA 1KYWA 4OJKA 5CT6A 3ZXUB 3MOSA 1ZEMA 5M04A 5DBFA 1FSPA 3KWJA 4KYUA 2NP6A 5CPBA 1X7ZA 1V0JA 1O6ZA 2WOOA 3L1IA 1K6EA 2IP2A 4G9EA 4ZA2A 5LP6C 3MS4A 4HNTA 4HYTA 3BXEA 4NXMB 2BF4A 2CLIB 4HAXA 2ECQA 1Q3KA 2PGXA 3A10A 1HYQA 2AC2A 3OMXA 3UAZA 4QYTA 2ZXUA 4EUSA 1LD3A 2VP3A 4WN9B 1C9NA 4Y2TA 1BCSB 4ZQIA 1W5SA 3Q6MA 2OORA 4RK6A 1T9GS 3THRA 1Y1KE 1EFRD 3K6SB 1JZSA 1U3FA 3BIOA 4NOJA 2G06A 5J3JA 1BVRA 1L1FA 2XCUA 4BRZA 3C3MA 3LPAA 3MNFA 5H7XA 3PFKA 1I4TD 1ZLYA 5B3LA 2FUEA 2QUBA 2XUQA 3C4VA 5DGTA 1KTIA 4NBTA 3I34X 5G0TA 3E4CA 4YVFA 3T4UA 1ZN2A 4QDZA 4NE7A 2FSFA 2B0JA 3ROQA 1TZCA 4TSKA 4B43A 2NQ8A 2Y0CA 4FKZA 1OBOA 4RUKA 2B35A 1QHFA 5ARCA 1V7ZA 3PR2B 4LXYA 2FZ5A 1WW3A 1RKVA 4WE3A 5T57A 4JOBA 3H3FA 2W8ZA 5FCDA 1RAAA 2I4IA 3AO0B 2JHCA 1T9KA 4TMZA 3LDFA 2QN8A 1T2DA 5JMPA 3O74A 4DV2B 3RYHA 4CMCA 3S2GA 1T1RA 2F43A 3GU3A 2BGIA 3HKCB 2XRZA 1HLGA 1NYTA 3WHKA 1L7PA 1N2JA 4UOQA 1HDOA 2O7NA 3QEOA 4TXJA 5AQEA 2VPYA 3KHTA 4OQYA 2G5PA 2NWQA 1NFRA 2CUNA 3LT2A 5FFFA 3CYFA 3NDBB 1KJYA 3BB3A 5K4AA 1L4UA 4FGZA 1WHSA 4MYCA 2MHCA 1P31A 3SC2A 2W4MA 3V8BA 4MV4A 2EF0A 2J3DA 1XKTA 3A37A 2EKLA 3ICQB 3UO8B 3QKWA 4O1IA 3IOBA 3CFYA 1CJMA 1UADA 4WKGA 4A0HA 3UWSA 4RE6A 2QLNA 1JJIA 3HJFA 5TVGA 3O3MB 3NASA 2O07A 5GONA 2OORC 2GNPA 1AUPA 1Z8FA 3NI2A 2J32A 1RMYA 3OF5A 1FB5A 1ZZEA 2YIJA 2JIOA 3BQMB 4AKGA 3LT0A 5AJTA 2A9JA 4QHSA 1FP4A 5HK8A 3B7GA 1KQGA 4JX8A 1Y8AA 1U7PA 4DSOA 3QF4A 3EGVA 4PZAA 5TF0A 4EG3A 5E0KB 2QM8A 4N0MA 4F1KA 1A9XA 1R0ZA 1MRNA 2AC7A 3M2PA 4D81A 4G5HA 1L5GB 1E8DA 1IEVA 3WVNA 3ZTYA 4IH9A 1YB5A 5JHGB 2L2QA 1J5XA 4QYSA 5KNDH 4IH4A 4ETNA 1ISMA 1CFJA 3HDQA 5BQFA 4BY9E 1BKSB 5IHPA 1Y3FE 1UDAA 3NCTA 4LV5B 4JLAA 1QANA 5A1TA 1H8HD 1BOOA 2OQRA 1QS0A 3AV3A 4KMRA 1KYVA 3FPFA 3FRHA 1OVGA 1XOIA 1LPOA 3KLMX 4G5GA 4K8OA 4A23A 2Y68A 4R71A 4TMFA 3UYKA 3CG4A 2DQYA 4GW3A 3IXLA 4JJGA 2WWTA 2C04A 3MN1A 3PUKA 4KXFB 4DEXA 2ZIXA 4BZPA 2QOEA 4KGDA 4W5OA 3DZIA 1GZDA 2XYQA 4QOIA 5JAIA 3DLIA 5K8VA 5KWJA 1XWWA 2A58A 4YP6A 1R5OA 4IILA 4QYMA 5DNYB 1P2BA 2VAWA 4RDXA 1T8SA 4Z4QA 3WS7A 5BSHA 1OFIA 4RVHA 5LP6B 5BRAA 2XCLA 3TDMA 3A8TA 4CQMA 3NOOA 1ZMTA 3GWZA 3DVQX 3EXHB 1G6KA 1N2IA 3A32A 1DO0A 5HMMA 1MGPA 4XVQA 2FVXA 3MXTA 5JG7A 5I8ZA 5JDCA 2J0QA 2Q50A 5DP1A 5L7TA 5JD5A 4TKMA 3EMDA 3KU4A 3U5ZB 4Z53A 2JJQA 3MJSA 4KVFA 2J9ZB 3AP1A 4LC1A 3SK0A 1GR1A 2UYOA 3AHJA 3QHPA 2VDMB 4UCFA 3SOZA 5IF9A 3QWBA 5A0TA 3KS9A 3O7MA 1JNYA 1O87A 2I55A 2EHJA 2R47A 4ENWA 2V03A 4P2GA 3ISTA 3ZY3A 1U8ZA 5LKAA 1ZM7A 3CWCA 5DX8A 3FSGD 4V03A 1RPAA 1F20A 1KDRA 1MJGM 4Z3OA 1Z2DA 3DWGA 1U9IA 1I4DD 1C8LA 3BXHA 3OFJA 3OICA 1VCIA 4TTQA 3R3SA 3UNXA 4AO6A 5C8DA 2H1LA 4C1NA 5JPCA 1Z2PX 1Z6YA 5F7XA 3P9XA 4DADA 1NQXA 1Z6GA 1R0XA 3HWSA 1ENYA 4EKGA 3DCJA 2HIAA 3OA2A 4NEQA 1BGXT 2VT7A 1XF9A 4MWTA 1JLSA 3LGAA 4HMOA 1G7TA 2ZJOA 4MRMB 4PR0A 4X85A 2GCPA 2FN4A 1JE0A 1VCOA 3HZHA 3ZOZA 3EK2A 3MWLA 3ABSB 3WQHA 4BGEA 1JLLA 4ES6A 3TJMA 3CUEF 3NWBA 5BVHB 2OCGA 5DI3A 3S28A 3TTVA 3VH4A 2W6JA 2O3QA 4HXGA 4OHUA 1SQ6A 4CKCA 3DT8A 4JFAA 5D85A 1BCRA 1I1QB 3RVNA 3K9WA 4DFDA 1D6MA 1RC1A 2DPGA 3ED1A 3I76A 3JS5A 4MB0A 4BAGA 3G23A 1ZAKA 2J59A 4ZV9A 2Y99A 4DXHA 2PUFA 2HADA 1ORDA 3LI2A 1HBJA 1L1QA 1U8CB 1TD9A 5DB4A 5HF6A 4YRCA 2BFEB 3TG2A 5JDCC 1A72A 3G8DA 2BEVB 2F1HA 2R8ZA 5A71A 3LQRA 1Q16A 5DSXA 1FYVA 2CVQA 3EAFA 4ZHQA 3IT3A 3K5HA 3CT6A 2BGNA 1D8AA 2EFEB 1WZUA 3LLMA 1D03A 2QAJA 4FFPA 4RC9A 3VKUA 1JXAA 4BGUA 4EPXA 5BVGB 1Y8ZA 4MI1A 3BB4A 2QRQA 4XPZA 3P1JA 3TD6A 4X97A 2FSGA 1AKRA 1HURA 4KUEA 3QOWA 1MA0A 3R77A 4YP9A 4IOKA 4IO0A 4OOEA 3C87A 3X1JA 2HIMA 1GU0A 3L6RA 4ADSG 5KTMA 1UT6A 2POQX 1P2VA 1U3DA 1RE0A 2XMQA 2N0SA 2W58A 2X22A 4Y9SA 2GK7A 1WU7A 1U9IC 2JVIA 3F5MA 1J8YF 1K7SN 3L84A 4QICA 4CNBA 3MCTA 4RV9A 1EJ6A 3RNOA 3E9MA 5A5DA 3HB1A 5IVHA 4FNGA 3WLEA 4CN8A 1IK6A 2PMBA 3GJQA 2VBFA 5HQJA 2P4QA 2D4AA 2PK3A 3NALA 4K1XA 4KQ9A 1MVOA 1U8AA 1HT1E 4HC4A 4XIFA 1NTOA 1KYQA 2JBHA 2XE7A 5BMVF 3T15A 3KJIA 2HU5A 3OEHA 1C4OA 2XUPA 2FW8A 1SCDA 1HTBA 4LRSB 5FBHA 1IXZA 3UB3A 3E7PA 5A4MS 1IJKA 4RADA 3JQDA 4GGPA 2F43B 4TKUB 2O1XA 2KLHA 2QJFA 4L9RA 2PRKA 1PF7E 2EZTA 4ZO7A 2B4AA 2MMGA 1RAFA 1XPOA 4MPJA 3F6PA 3GLVA 1I6WA 2G5TA 2HQSA 4URUR 4D8TA 3HEBA 2OV2A 1Q0SA 2R1TA 3IUYA 4U3JA 4WPGA 4ER3A 1IY0A 4CKXA 5M34A 1KRHA 1KC3A 3MOIA 1T5BA 4IIYA 4ME6A 2HR1A 1P61B 4YYEA 3TG8A 2FPKA 4PZEA 4KLAA 3Q2IA 1TL7C 2QZPA 1T5LA 4KI7A 5EFOA 4UFPA 2NTYC 3LUFA 3VNVA 2BKUA 5JQWA 2IHUA 1KVUA 1Q7RA 1TZBA 2BVNA 3K9LA 4N8EA 3N28A 2KI5A 3OMLA 1ITZA 3PEUA 2OAGA 1FP4B 5D8DA 4RTPA 4E5PA 4LBZA 4NYIR 3BBLA 4QGHA 4MXDA 3QF4B 3CH5A 5I7FA 3F2VA 5EUMA 3TQIA 1MPTA 1A9XB 3LPCA 1UBMS 4G2TA 4IKOA 3I8XA 5CT4A 2OO5A 1P2SA 3BMCB 1NPYA 3KZXA 3QG5A 4Y30A 2IP1A 4CQNA 3PE6A 4KWIA 5B5SA 4IQFA 1AKUA 2I3ZA 1A9ZA 2VCEA 3IKVA 3L41A 4ZGBA 1K2VN 1TKBA 2LXNA 4UJ3A 1OAKA 4J8PA 4BQSA 3QVMA 3LDAA 5CHYA 3FUUA 4BMXA 1QS0B 5EHNA 3MVEA 1ECJA 1XA0A 2I4TA 1K66A 3ZV5A 3OTOB 4NHOA 4FMCB 1QF6A 1TEXA 1KH1A 1JDUA 2A88A 3HY6A 5DXJA 1ZWLA 1RLMA 2JEYA 4ZDWA 4RH3A 1KSHA 2IOHA 1Q7BA 2I4LA 4H4EA 4I50F 1WBDA 5TVKA 4ZYYA 3LKBA 1IMOA 4TYWA 1LX7A 4DB2A 2VPIA 2X2OA 4E6PA 6NULA 1U7ZA 3A4VA 3L4KA 1BHO1 1ZISA 1AKEA 3OZXA 4GSLA 3B2NA 2AKEA 4G0WA 1C3EA 3H99A 2OGWA 3P9QA 4INAA 4CQMB 4AQYB 2PANA 3PHLA 4DRYA 4TYYA 5H1YA 5CMLA 4Y8VA 5BY2A 2FN8A 4DSNA 3ZQKA 1C7FA 2O3JA 3RVKA 2GPTA 4LDZA 2CUTA 2ZETA 1TU0A 2PKEA 3LUJA 4TS9A 1IM2A 2QWXA 1I2DA 4S04A 3RRFA 3OIYA 2QG4A 1T2CA 4NCJA 1DB3A 3R41A 2WVHA 2WYUA 3PNQA 4OL9A 3SY8A 5JMOA 1UXOA 1WDMA 2MMCA 3VSDA 4DLYA 3QX3A 3O2QB 1I5OA 2DC1A 4MYSA 3QV2A 2X0FA 3EUFA 4OMCA 5JCPA 4A1OA 1EUQA 3DM5A 2ODBA 4OUKX 1IONA 2ZYDA 3FF1A 5C5IA 2AFHE 3K0AA 4JITA 5NULA 4C7VA 4DIUA 2C97A 1WABA 2OO5C 4BP3A 1JEJA 2E4VA 2O48X 4OCZA 1EDBA 3OFKA 3WXMA 1Z2NX 5DNWA 1T4DA 2ZB4A 2JIZD 1BE6A 1MVLA 2PN1A 2W7TA 3LNCA 4LTNA 3RUFA 3VTZA 5TMBA 3BJMA 1EP9A 4GECA 4AXBA 1N5JA 1NMSA 1LC3A 1Q1NA 4O63O 5CH5A 5E9QA 3OQMA 2IWRA 3U4HA 1N8TA 2Q6IA 2QTMA 3GUZA 5IKOA 2XGGA 2XE4A 2GQ0A 3R3YA 4F2PA 5GM1A 2PFSA 4CIAA 3GPCA 1NVDA 1Y82A 3LOQA 3WMWA 1U1CA 3PYXA 1AE1A 1ORHA 1M1YE 3FRIA 1ZAYA 1GTMA 2O05A 5DI3B 5JS2A 2IYPA 5TPWA 4C4XA 3SIPA 5JWOA 3FLAA 5EQJB 2OCYC 4CKCB 2EWWA 5G2OA 1BCRB 4XD2A 1U0TA 2OKGA 4H6XA 1SC9A 3UAGA 2LPMA 1HX7A 4D43A 1CQPA 2IC5A 3QVGA 4WN3A 2A5JA 4EYSA 2BR3A 2NU7A 4AKHA 4M9XA 1YDFA 3IEMA 2PMFA 2GR9A 2P35A 2BFFB 3ICEA 3GZTB 2FZWA 3I0NA 5ITVA 1UBSB 5HK9A 3TLMA 1ZVVA 3WNQA 1OXVA 1TYEB 3AYXB 4JLMA 4N5IX 4R31A 2P9HA 4M9QA 4N0DA 4ZHQB 3OQIB 1CZHA 5FLEX 3RJZA 4C06A 4DA0A 2CXSA 3BORA 5AVTA 2QVGA 4OLJA 4P7BA 4EVSA 5YASA 1UBJS 3A70A 2DHCA 4NSNA 1UC9A 3FMOB 3FTPA 3EGDA 3MSCA 3RM3A 2UZ0A 3UK0A 3LF1A 1PSZA 5HOQA 3H5WA 5KVVA 3ZX5A 4TS3A 1NBOA 3TH5A 4RHUA 4Q05A 1GZ4A 4C20A 4FUTA 2P2LA 2QN7A 4P33A 4TLAA 1TO2E 3TZLA 1HYEA 4DY4A 5B6IA 1DV1A 3HBMA 1NRJB 2FRXA 5IS2A 4OHRA 4GKKB 2AR7A 1V6SA 5CK4A 4BEBA 1QV9A 1GGHA 1T9CA 3OMWA 1PVOA 3P0IA 2IKSA 4QQNA 1D4ZA 4ZZIA 1QGDA 3KAPA 5AXBA 3ONNA 3EVAA 2H85A 1WJGA 1ZK1A 2P8SA 3PLNA 1Z34A 3LFHA 1KJJA 2JHGA 4I9NA 3F8SA 4F38A 1E3MA 4XE5A 4AF7A 3ENQA 3SICE 1ZW6A 5LU9A 1KP2A 2ADFA 1W1UA 3KOYA 3O90A 4BUJA 1K06A 3DTYA 4I1IA 1C0IA 1F6BA 1N0WA 3DZCA 3EVBA 4L4UA 4UTRA 4KN6A 1Z06A 3DM9B 5EWMA 5ELLA 3JZDA 1E3WA 5DGCA 3HJGA 1OU0A 2RCYA 4G4SP 3E2PA 1OXBB 3KJEA 1LW7A 4FVTA 1XRNA 3PG5A 4RAOA 1ZUIA 4QGFA 5L6MB 2GEDA 4F4JA 3TQRA 4XD7A 2H2HA 1S8NA 3RIEA 2A0KA 4UBLA 5JZSA 5ETJA 1VZ3A 4V02A 3UJBA 3UOWA 2R44A 2PX0A 4L0MA 1CZOA 5DLYA 3GLSA 1GXSB 2XOKD 4UARA 3KCQA 4I5EA 4NU6A 4JCOA 5ALSA 1XU7A 5IAKA 2GZSA 2DFLA 2JLBA 3V4FA 1RHJA 4YCBA 4BO1A 5KINB 3OVMA 4ALIA 1XN4A 2G63A 5M3BA 4YR9A 1F9EA 1GTJ1 2WHQA 1KK0A 4O4JA 3INYA 4U2KA 5A4JA 2O2XA 4MVJF 2LNDA 4O4LB 5JYBA 4JYAB 5ICFA 1QZXA 2W2NA 2GK4A 2YWFA 2X0RA 3L7YA 1D7OA 3NV9A 1BXRA 1IWOA 3HDGA 2O6LA 3UJ8A 3FNFA 3P71T 1AUXA 4BX8A 1BVHA 2D5CA 1N2GA 4ZVVA 3ROKA 1KYYA 3VRHA 4Q37A 3V8QA 5C1DA 1P45A 1PFKA 2QT0A 5BN5B 1Q20A 2FUNB 1K6JA 2YFHA 3ZOKA 4E31A 1JSXA 2C8JA 2NV2B 3NGXA 4R2KA 5GPBA 3AF2A 2FG7C 7GPBA 3J80A 4P36A 1T3LA 3MG9A 5IN5A 3EQ8A 3HO1A 3H5AA 1SCNE 3I9LA 4ZT5A 5LYYA 1DPGA 3TL2A 1ZD1A 4X7MA 1JKFA 5JE8A 2XIJA 2ZDHA 4EQ6A 2DAPA 1ISHA 1SA0A 1PZHA 5CNMA 3G2MA 3ZVLA 4HCJA 2KE5A 2EX0A 3BMQA 1B15A 4NZNA 4OF4A 3W6UA 2JAOA 1BEUB 5JFOA 1U1FA 1A7JA 1OYVA 2J9FA 1TYZA 3I04A 1CW2B 1U7WA 2WHEA 3MCVA 4M0UA 1RM0A 4RHYA 2H2AA 1BFDA 1QHHB 3FAZA 3GN1A 3RTBA 3KQPA 3VNBA 1XWIA 2EHDA 2A57A 4XRRA 4P93A 2ATXA 1IG0A 5IU6A 5LWQA 4EHBA 2HA5A 4NXNB 3NOQA 4J49A 2QLMA 1Z5WA 3WJAA 4E70A 2ZS8A 3LIIA 1VPWA 1F2TA 3F46A 4C0SA 3Q40A 1UKVY 1QG6A 3DMFA