4JR1A

Human procaspase-7 bound to ac-devd-cmk
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
247
structure length
223
Chain Sequence
ATYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFKQIPCVVSMLTKELYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis, hydrolase/hydrolase inhibitor
molecule keywords Procaspase-7
publication title Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 223
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jr1A00
3D6FA 3V6MA 2J30A 4QUHA 4EHKA 2H5IA 2P2CA 3KJQA 4FXOA 1RWPA 4QU8A 5IBRA 1NMQA 3D6HA 3DEJA 1RWXA 4JR1A 1I3OA 1RHRA 3R7SA 4QUAA 4DCPA 3NR2A 3V6LA 5IANA 4I1PA 3UOAB 1K86A 1RWWA 2QL9A 4JJ8A 4EHAA 1RWNA 2XZTA 3ITNA 2H5JA 1QX3A 4NOJA 4JB8A 4LSZA 4PS0A 4QUJA 2J31A 4DCOA 3OD5A 1RHJA 4ZVPA 2NN3C 3H0EA 3P4UA 4NBKA 1SC3A 4EHLA 4QU5A 2H51A 2C1EA 3PCXA 1RHQA 4DCJA 5IASA 5LU8A 2CJYA 3D6MA 4D3ZA 1QTNA 1K88A 4HVAA 5IBCA 4QULA 3E4CA 4AW9A 3R7BA 4FEAA 4ZVRA 4NBNA 1SHLA 5IABA 2CDRA 4QTYA 1RWKA 2AR9A 3IBCA 3R7NA 4JQZA 1GFWA 3R5JA 4HQ0A 3V4OA 2XYHA 3H11B 4IYRA 4D3XA 5IC4A 3BIJA 3QNWA 3NKFA 2H65A 4QTXA 4QUIA 3P45A 3SIPA 2HBQA 2FQQA 3S8EA 4N6OA 2QL5A 4I1RA 3DEKA 3DEHA 4PS1A 2Y0BA 2C2OA 4D3YA 3EDQA 1NMEA 2CNKA 1PAUA 4ZVQA 4FDLA 1RE1A 3GJRA 4HQRA 4N6GA 5LUAA 5LU9A 3UO8B 2J32A 4EHHA 2DKOA 2H4WA 5IBPA 1RHKA 2C2ZA 1KMCA 1F1JA 2HBRA 2QLBA 3H11A 5I9TA 1RWVA 4EHFA 4ZVSA 4JR2A 5IAGA 3IBFA 3R6LA 2HBZA 2CNNA 1I4EB 3PD0A 2CJXA 3H13A 2Y1LA 1ICEA 4M9RA 4NOLA 5H0IA 4AWBA 4JR0A 5IAJA 3RJMA 3S70A 2K7ZA 3KJNA 5IARA 3V3KA 4N6NA 4EHDA 4EJFA 4QU9A 4QUDA 2QL7A 4IEFB 2J33A 4JQYA 4ZVTA 2CNLA 1NMSA 3K7EA 4N7JA 3R6GA 1NW9B 2HBYA 1I51A 1PYOA 2FP3A 2CNOA 2XYPA 3DEIA 1M72A 4QU0A 4QUEA 4QUGA 1F9EA 4QUBA 5IAKA 3KJFA 1CP3A 2QLFA 2C2KA 2QLJA 1RHUA 2H54A 4NBLA 4FGUA 2H4YA 2C2MA 5I9BA 1RWMA 4JJ7A 1CVRA 1JXQA 5IAEA 2XYGA 4ZVUA 3V4LA 3SIRA 1RWOA 1IBCA 3GJTA 3NS7A 3R5KA 5JFTA 3H1PA 4NOKA 4NOMA 2XZDA 2H48A 5IC6A 1SC4A 1RHMA 3GJSA 1GQFA 2WDPA 2FUNB 3V55A 4PRZA 1I4OA 4AWAA 4PRYA 4JJEA 1SHJA 4N7MA 1SC1A 3PD1A 5LUBA 5K20A 4EHNA 3GJQA 1QDUA 3EDRA 4ZVOA 1BMQA 4N5DA
chains in the Genus database with same CATH superfamily
1Z6YA 2WZQA 4J0JA 5BSVA 4BQSA 1SEVA 1VSQA 2X1LA 4EQZA 3CKKA 5JFGA 5SZHB 4KK3A 2VEOA 3BXFA 3EEYA 2W6JA 1U3TA 3OZBA 4RPCA 4RVGA 3E84A 3CW8X 3VOSA 5HXAA 1BD4A 4JY7A 4A1OA 1C50A 1N32B 4XR4A 5AVKA 1FIUA 2AHRA 2QRKA 4MVJF 4GGOA 2ODAA 4Z86A 4Q93A 3ZGNA 3IH5A 4PE5B 4LZJA 1P2TA 2AXPA 3ZJYA 4XFJA 2GBLA 2WOOA 4AJKA 1UMKA 3CUEF 3FI9A 3FPSA 4P5PA 4Z0PA 1ZK0A 4CF5A 1TQ8A 1FY2A 4OHOA 3V2GA 4EUKA 1P61B 5AR1A 5HIKA 3GLSA 2Y66A 2E1PA 3ZGYA 1RXEA 4EHLA 1RNLA 5CAEA 2V7QD 2ATVA 1C9KA 2ZI6A 3LQRA 3O4HA 1ECFA 1G2QA 1QTNA 1R0RE 4IIJF 2NTEA 1CUFA 2IHZA 4E1AA 1TFUA 2QUAA 1E1MA 2D5LA 3M82A 2GA9A 3TJZA 4CM7A 1AZSC 2O52A 2P2NA 2VJAA 4XX0B 2VHEA 1RWKA 1EX7A 1N9GB 3ZQUA 1LGYA 1CJUC 1BRMA 1I7PA 5IJ0A 5EP4A 3EFHA 2FFQA 4IYRA 2GJSA 3EXIB 3SS7X 3OQHA 1QORA 3QUAA 1PUJA 2A30A 1V11A 2QENA 3RCBA 4DDHA 5KUTA 3TRJA 3T7JA 1TEXA 2C4KA 3MCAA 1NF3A 2NTVA 5CDHA 4W5NA 1F2TA 2O0LA 1QYDA 4Z8XA 3O0DA 3OZGA 3QQ5A 4MGEA 2D2VA 4NAVA 4D56A 1Y4AE 1GKYA 4H4EA 2AK2A 3U9TA 2Q1XA 2ZSUA 3HBNA 3KHUA 2G72A 4LI0A 4MNTA 3HJAA 1IZ7A 2YRXA 5CJ2A 3GLUA 5CH3A 5FI3A 3H7IA 4BUCA 1ZRSA 3QPCA 1QV9A 3U40A 4O4HF 3WDSA 4EMTA 2JGJA 1KQOA 2VPPA 4GUAA 2OGWA 4EOGA 5IDXA 4TLDA 3HJHA 3L8GA 5GP1A 3DLBA 3ONNA 4TTTS 3CZ4A 3ESDA 2X9LA 3Q8XB 4NP6A 5B3JA 4F7WA 3HXMA 1BXRB 3I58A 3I2JA 1DE0A 5HUHA 4AXBA 1E1QA 2HU7A 3CE6A 2XECA 1E3QA 4C2BA 3O82A 3ESBA 3G0DA 3UJ3X 4RTSA 1NJ5A 1GZ3A 3ADPA 3HFJA 3IJEB 1N2CB 1ULUA 3GFRA 1EFPB 4TSRA 1GCUA 5C53B 1B41A 1XTVA 4LGVA 1Y1SA 1O3YA 3K20A 3NP7A 1M6YA 1T5SA 1ZMXA 4ZVUA 5JNWA 2Q41A 3VR4A 1C1XA 3U7GA 3DZGA 1CUYA 2P69A 4KWHA 3AUYA 4NOKA 3MS4A 2X76A 5JPDA 4PLHA 4N7RA 1O7JA 3DFZA 3PUKA 2DF8A 3EVEA 4DVJA 4OMUA 5L7YA 3VU1A 1E2UA 4J0HA 4PNPA 5I6DA 4B3BA 4O4LA 1I80A 3KKLA 3I9FA 1EB9A 1WA5A 2BFBB 2XRMA 1MDBA 3SG0A 3S3TA 1ZVMA 2N9UA 2BL4A 4CYMA 3G6WA 1AT1A 2VO1A 4KWIA 4Y7DA 4YJGB 3OP1A 2F1IA 4DRZA 2AW5A 3CSUA 3FUVA 2QTBA 3KOXA 4DR6B 5DZSA 2B21A 1JHUA 4F4FA 1XZDA 1NM5C 2CC2A 2JH8A 1T2AA 4O25A 1BU8A 3PS9A 3QX8A 1UJ6A 2E89A 3ANSA 4J3FA 2VJQA 4UU1A 4YWJA 3QYJA 1QFMA 4ZXFA 1YCFA 2RGGA 3RF7A 1FP4A 2OV8A 2Y1DA 1DXYA 4OGKA 4DUGA 2VTBA 2JFOA 3AU9A 2R6GA 2FSHA 5J2TF 5F35A 1IQRA 4M9XA 3VSAA 4FDVA 1SUPA 1UDXA 2JIQA 2NADA 4Y18A 3IQEA 4C3UA 3EVZA 1ZH2A 1HLGA 4L7VA 1DEKA 3OWOA 1JJ7A 4DAEA 3KOYA 1D2GA 1NKSA 2WRZA 3NHFA 4KWEA 3DP9A 4BX8A 2Y9PB 4CGYA 1PRYA 2Q28A 1JDUA 3H5LA 4Q15A 3FTDA 3ISJA 4MR7A 1SOVA 3IJRA 4W5RA 4J9VA 1XMJA 3WSWA 3L1IA 2JK1A 1C7ZA 2DLNA 1NUSA 5L3ZA 4DA9A 3GLFB 3JQ8A 4QUIA 4KLNA 2L18A 4PYQA 4JSRA 4EBFA 1ND5A 4LBZA 3OU7A 4I46A 5AD1A 1P6QA 4ZTBA 4NFLA 1BD3A 1UIMA 1VL1A 1R9MA 2ODBA 4TUYA 5THXA 3RS0A 3F46A 5H83A 3H1AA 1O2DA 1JI0A 3HWWA 1NXOA 1UZNA 2WHPA 4ZU3A 3TRIA 1QPBA 1PBNA 2IYAA 5BRJA 3QLJA 4COKA 4F84A 1I5OA 2AJBA 1DFHA 4K46A 4LYFA 4A7PA 3MSCA 1Z45A 1YQTA 4E30A 4DWOA 1LW6E 3D4IA 3NB0A 4P38A 1Y42X 4G1CA 2RHWA 5A3JA 4OHCA 1JSLA 1PNRA 4YDRA 1JQLB 2AGVA 3IODA 5F33A 2ZZNA 1FUYB 1S3FA 5DNEA 3AYXB 4MUKA 2Z1DA 5ITZB 2PV7A 2Z8YM 3NVKI 3DDSA 3FMPB 2YFQA 3N6RA 3V8BA 3QFSA 1UOOA 2I65A 2QXYA 4GI5A 1NW8A 4NBRA 4U9UA 4E07A 1EFAA 5H4GA 1E6KA 2HOQA 4Q9AA 1ZO8A 3L7NA 2V0CA 2JGRA 4M98A 4O4IA 1SXJC 4MHSA 1U94A 2C0PA 4URZR 4BMPB 1TF2A 5K3AA 1J8FA 3VFDA 2J5KA 4W5OA 1P5HA 4HPXB 5CM9C 4UUBA 2I8LA 4RSRA 3IEIA 3AHHA 1YV9A 4ZP1A 4F2DA 8MHTA 3DOCA 3M81A 3JASA 4KLCA 4UVHA 4ZVKA 2A9KA 1OTXA 4RTLA 4WHMA 2Y2VA 4WXRA 3GCDA 4BRWA 1NXSA 1BEEA 3JZMA 1JFSA 4ZQEA 3GNSA 2W71A 2Y8EA 2ZUDA 3ZWQA 3CEHA 1ECJA 5B1SA 3T12A 3QV1A 3BCHA 5THKA 3IVAA 1L4LA 1UWKA 3RJTA 3UA4A 2YJ3A 1N77A 3EEQA 1D0VA 3EGOA 3WC4A 2YHBA 1ORTA 1QDUA 4O4HB 1KZYC 5FI1B 3RFFA 1PZMA 5LYJF 1BH6A 1I10A 1DJLA 3KKPA 4W1PA 1H2BA 4ZANA 4GOKA 3BSFA 4J1TC 3T7RA 1JDNA 3ZK8A 2IYTA 3PL1A 4MP8A 5JSZB 3UCEA 3V8PA 4O8ZA 2RGUA 3PFIA 1US8B 2FLVA 3PHLA 4PHCA 2J3IA 4LV8B 5KQLA 4EJMA 2EYUA 2R1VB 2RHJA 1P3JA 4AKHA 2UUPA 4W99A 2EFDB 4EG7A 2Q4EA 1GPJA 1RWWA 3GLHE 3LSTA 2XNJA 2YX1A 4X93A 6ABPA 1GGNA 1Q21A 3GROA 3I83A 3LY7A 3BGIA 1EA5A 3KOUA 5L4LA 3DV0B 4Z3DA 4P31A 4CRWB 5FLYA 4B43A 3AI1A 3ER8A 1DCFA 3L1JA 4ZYLA 1YJQA 4NYJR 4F6RB 1YB7A 1VKHA 4U6QA 5IJ9A 2C1EA 5ELLA 2C5BA 3AX6A 1DO0A 3P0FA 2KLHA 3HEBA 3EVAA 3HL4A 1A8IA 1H0HA 4MIKA 3IKTA 1BCSA 1DSSG 3WK9A 5BNZA 3RANA 3CJRA 2CCKA 5AW1A 4NXMB 1M1YA 3IA7A 3P9NA 4YJ3A 2V7WA 5E4YA 3PXCX 3CKMA 4KL8S 5DNUA 5CAEB 2QTVA 2WW8A 1ZISA 1JSXA 4BLQA 2AQHA 1LK7A 2BV3A 3UENA 3V4RA 1X9IA 3IFSA 3M34A 3DE4X 3DJFA 1JEAA 4CKWA 2NM0A 4LE2A 2W22A 3ZE1B 1TF7A 3HB1A 3RODA 1TQDA 4ZOLF 4NYMQ 4PS1A 1UODA 5KTTA 3C24A 2VA9A 4B84A 5LZ8A 2QM0A 2O23A 4C78A 3K8ZA 3LD9A 4OXXA 3BMNA 5IJ0B 2C5FA 4IHQA 2AXEA 3IBSA 1YC5A 3KOZA 4OJNA 1A9QA 1MO2A 2FPIA 3OM1A 3BZBA 1D9ZA 1TM4E 1TCAA 1Y1KE 3HCPA 3OOEA 2GAIA 3QW4B 4DNXA 3FCYA 5T4HA 3T9AA 3C6QA 1UWLA 2X40A 5C1PA 4C29A 4CKBA 5L40A 4E5NA 2VWGA 3MT8A 4HNRA 3UPTA 4AS3A 4EH1A 1IMJA 1I13A 1M2KA 2OV6A 3D4LA 1JL3A 4CT5A 3M89A 4ZK2A 5JYDA 3OQ6A 4PIMA 2UUBB 4RACA 3KKZA 3RWOA 3KPUA 4WTOA 3OLZA 4P93A 3DDWA 4RHCA 4Y2YA 1P2BA 4BVJA 2QT1A 5HOEA 1R0ZA 3OUZA 5EUMA 2OYRA 3BXOA 1L5OA 3AGPA 3CCBA 4NZYA 4Z4IA 3IKJA 4JDUA 4YUWA 3PDJA 3R5HA 4P7BA 5AOVA 1QB7A 3L7OA 3G0CA 4G56A 1NF8A 3KEFA 4R7ZA 4WXPA 1JYSA 3ETJA 2WWHA 2FETA 1BMFD 4CG1A 3NKLA 3N8GA 4ZDIA 4LXYA 2B7BA 3H2GA 5EAIA 2VUHB 4KLZA 4BPRA 4FWIB 1XZMA 4NS1A 3HCCA 3WWYA 2XYGA 1JR3D 2XDAA 3U4CA 1SR8A 1TAQA 1BJKA 1TCVA 2VHCA 5HFAA 2KWIA 2WIGA 2XQJA 4REOA 1FU4A 1N0HA 3A70A 3DL4A 4FC6A 4HNGA 3OHMA 4QFBA 4RZQA 4D0LB 4DQXA 2I6QA 4FVTA 3NMUF 3F8SA 2NSYA 4IFTA 1I4OA 4ZI2A 4KMSA 3HLKA 3N8NA 5HP4A 2PMWB 1NDUA 2AN5A 2W4QA 1XB2A 5TC4A 1C1XB 2G0NA 2JH3A 2GVNA 3EA5A 4CQNA 3IKLA 1OOEA 2GPAA 5K45A 4C2AA 4O3MA 4NBWA 1U11A 5ARBA 1EWKA 3O4IA 5HJ7A 5DHAA 4CIVA 1Z4NA 1ZZGA 3HCFA 3IYLW 4IWYA 1MH1A 4KP7A 1OWPA 3W9UA 4BDSA 4HLQB 1NBMD 2NLOA 1IVSA 4KRFA 1CY1A 1DVRA 1BH2A 5I5GA 3VV3A 1KZ1A 1YB5A 3JQ9A 1RPZA 2XB6A 3TPZA 5L7TA 2DE0X 5IANA 1CJTC 1N92A 2GKOA 4M1SA 4RPIA 2FPUA 2W70A 1T8WA 2PFGA 5BWCA 4O63O 3NX4A 3UKDA 1JWBB 2WV9A 2WTBA 1XVTA 1NMZA 4G9EA 5J4VA 2EHDA 1GLVA 3ZCSA 1DFIA 2FMFA 4XQ0A 4QSHA 2N3ZA 3IUBA 3IP1A 1CCWA 1TJNA 4W9RA 1U1FA 3AZPA 3RNOA 1TKAA 2AH5A 2CHVA 3BXPA 1TJPB 1Q0LA 1O97D 1W6UA 3OZXA 4TOIA 3HADA 1K27A 3O2NA 4L75A 4ZDWA 3FPEA 5AJVB 4DV1B 2NXJA 2ZTSA 1JS1X 1FFBA 2OQIA 2NP7A 1YHNA 5LYJB 3U1BA 2IBTA 1W36B 1PJTA 3P5SA 3KR0A 1FL9A 2IU4A 5AKEA 1H1TA 1P7CA 5FHQA 3VVBA 3ZE0B 4CKYA 1C4WA 2FE1A 5TQVA 1XZKA 3V9PA 1XRQA 3IRVA 2EYQA 4MR7B 1T2CA 1ONPA 4TWJA 2R6AA 4X65B 4RENA 4ME6A 3G8BA 1EX9A 2BF7A 2IITA 2Q3EA 4O0LA 4RZUA 3HB7A 3R8XA 3JQ8B 1O97C 3OEYA 5FXMA 2XNSA 3HV2A 4X64B 5D3KA 3RSCA 2XBUA 2F55A 2JLQA 3LE8A 4IQGA 1F3OA 1GZ4A 1YMUA 2OHJA 3RBXA 3RUIA 4TUYB 1HMYA 4DSZA 3PUIA 2SNIE 1MC4A 2EP8A 4KPFC 2HRBA 4GPEA 1YL5A 4H6VA 3DZKA 2F6RA 2RDMA 5C2JB 1Z07A 1SZCA 2VBCA 3SEAA 9ATCA 1DG9A 3RKUA 1UBOS 4BAUA 2DH6A 2QTWB 3DT8A 1DWPA 5H68A 2REBA 2ZUSA 2AZTA 4BASA 2CNLA 5GIOE 5FBWB 4GLFA 2AEJA 2VDUE 3NH9A 3VYVA 3ZG6A 5HRCA 5LIRA 1V39A 2GJ4A 3LVQE 4N01A 1T3TA 4ZAZA 4DLSA 3VZSA 2JS7A 3RTCA 3DYVA 1XPRA 5JYCA 1DARA 3BT7A 5ESXA 4ZO6A 1N1DA 2AFHE 2WYOA 3DB2A 3F8TA 3N6XA 4EGCB 1DQYA 3NEJA 4JC4A 4PBTA 5IDVA 4O5OA 1L5KA 1LI5A 3L4BC 1I2ZA 5FWYB 5CVJA 2O3RA 4OAOA 3QX3A 2NAPA 3I5XA 3IPRA 3DJYA 3TLBA 3DLTA 4K2HA 4MSUA 3WXBA 4DXHA 2VJKA 2CBZA 2DJIA 4FLFA 3SHWA 4ON9A 4EKIA 4EJSC 4D41A 5KU7A 3E05A 2X0NA 3CIOA 1U6KA 2JDIA 3Q9UA 4O8CA 2CKMA 5K3DA 1HRDA 1T8UA 3IO3A 3ZHUA 3PWZA 2CLLB 4F8JA 4YMGA 3JPYA 3DAPA 5DU2A 3EULA 4NAHA 4YP6A 1SK9A 4WXEA 2B8TA 3DDCA 1CTQA 1OX5A 3HZHA 4CDMA 3E1GA 4MKHA 2GK7A 4B4DA 1QRAA 4Q3NA 2FEMA 1UP4A 4JI5B 4R71A 1EHIA 1M8JA 4FB5A 2VZ9A 2JF0A 4A23A 2QL9A 2AG8A 5DYYA 1KKMA 1MB3A 3MYRA 3PICA 4D4JA 4FYVA 2XTJA 2II6A 2ZIXA 3NBYC 1LDNA 3WGVA 1CU1A 1KMIY 5CFMA 2OUKA 4FTWA 3WVNA 5EIOA 2GLXA 4DMGA 1KAOA 4HGYA 4OQLA 5LA6F 5IW8A 5EMNA 3CVXA 1RZRA 2DTDA 1XWIA 3DO6A 4RDCA 5HIJA 3BEOA 3R44A 1W25A 2LGJA 4CLOA 4IRMA 1QG4A 3R40A 1XFDA 2WMNB 1H2YA 4GRAA 4IJUA 1ZYUA 1OTHA 2G80A 5K8LA 4YRCA 2ES4A 2PSDA 3QMWA 1MUUA 3VU9A 4PCUA 5IJ9B 4IO1A 3S2ZA 4MO9A 5A02A 2BF4A 2VT2A 3D7KA 3IGFA 3KKNA 5KSYA 2HV8A 3CWZA 2FJ0A 3G2MA 4H31A 5BP7A 3DPIA 5AW7A 1P77A 2GUGA 3P2KA 1LNQA 1LQTA 1OILA 4LRUA 4NHOA 4Q34A 4WOBA 3R3SA 4YJ3B 5EJFA 4HSEA 5AVYA 1HQDA 3AY7A 4P8RA 2QTVB 5DGXA 3LP6A 1ZMTA 1K0UA 4MUYA 5GVRA 3RRBA 1F8FA 1O77A 2XE7A 1JBEA 1XBTA 1U6JA 3F9IA 2GT1A 4JGIA 4NTZA 1PBTA 1RYDA 4R84A 4URHA 4JUDX 5F1YA 4C87A 4CKWB 5BQOA 2XA2A 4R2JA 3RHSA 4EHFA 3QVOA 5GWXA 1UWVA 2ZRAA 3ZWNA 1Q1ZA 1E63A 1UFKA 1ACMA 3KXLA 2W2NA 4RDIA 2NOAA 3HVHA 1NIPA 3I8SA 4NU8X 5A9SA 4UTRA 2P5YA 4WPGA 4HAOA 1QK4A 3DO8A 1MW9X 1OLOA 2O7VA 1ODCA 5B4UA 5BO5A 2QZPA 3WXMA 4NE9A 3G2IA 5ELXA 3GW8A 1DBPA 2JJ2D 1DU4A 1Z29A 5CGQB 3UWPA 5D6NA 5EIAA 4ZHSA 1A5BB 3ESRA 1K4YA 4MH0R 4CKBB 1LLCA 1I3NA 1WZCA 1P1FA 1JEOA 3KAPA 3ESQA 1YA8A 2DH5A 3P9ZA 5L4NA 3DE7X 1AUXA 1W0KA 1G18A 2GEBA 4EYSA 2EQBA 1Z2EA 2JJYA 3IERA 3E70C 4ILKA 1FBNA 1U99A 2QZ9A 4FGUA 4O2RA 1ETHA 3QYFA 1ZI8A 3C3KA 3L8YA 4GMHA 1M74A 1JXQA 2RI6A 5E95A 3RUFA 2QE7A 2ZBEA 3AETA 3RV3A 3S68A 1MGPA 3TOSA 4CVNA 1IDOA 2ZITA 5HBGA 4IUDS 3U1TA 4B35A 4ZHQA 1P1IA 2PN1A 4L4SA 3OCZA 4PFSA 2VDQB 4N54A 3OTOB 1Z08A 3MTQA 1FCJA 2QJTA 4QVKA 3G2OA 5T6MA 221PA 4V0NA 1UPXA 5AK4A 4BHTA 3X43A 5K20A 3A9RA 3PJGA 2D59A 3ROMA 3RSSA 1HEIA 5GVSA 2J4DA 4XSVA 4RPHA 4C1BA 5BW8A 5E1OA 2QVXX 1XYGA 2DCUA 3H1GA 2E49A 3K92A 2KM1A 3KS9A 4MV0A 5K3BA 4ARIA 4X85A 1XK7A 1DIHA 2YBEA 1LQUA 2Y77A 4B33A 1E98A 3VA7A 2PBLA 1UEJA 3F2IA 3MYYA 1GPWB 1LF0A 4G97A 2ISQA 3SX4A 1XEXA 4IEEA 3TEFA 2E5LB 1ZUHA 1PV2A 1GAEO 2ZOSA 4FYMA 4OQXA 1PFUA 5F78A 5JG7A 2BMFA 3O1LA 3RBZA 4BCCA 1G4HA 3LHDA 3QTTA 4HC4A 4JCOA 2EW2A 2J1LA 3UAOA 2PPVA 3DYIA 1U98A 5F3DA 1LEHA 3RWBA 4DLRA 3PEFA 2FFHA 1LTKA 2HQBA 2P0YA 2R1TB 4LYEA 4XWYA 4G8JA 2H7XA 2I1QA 3PC2A 3RTBA 3AUUA 1M2OA 2INGX 3PDWA 1GEGA 4TWRA 5SY6A 4AG3A 5BWMA 4GH5A 3ZIDA 4BO4A 3KDAA 5JS1A 1T6BY 3ACDA 3BTVA 2V7QA 4K9DA 1KYVA 3UHAA 5BSHA 5I4CA 5IBCA 1FQKA 4OSOA 2O7RA 2EJCA 2ZIZA 3BREA 2R8EA 3I34X 4YI3A 4BVLA 4PXYA 2OCAA 5JYBA 4Z3KA 3PDUA 1DAIA 1EZ4A 3E3LA 4MUJA 4C01A 5KOIA 1Z2OX 2BHLA 4B3SB 3B6KA 5IX8A 5FQOA 3RVNA 5I45A 1ICIA 3KAKA 3N1UA 5TMPA 3VPXA 3CZMA 5ISMA 2PZ8A 1TW2A 2P9JA 3HKDB 5TEWA 1BA2A 3CN7A 1WLSA 4MPJA 3WGHA 4D9FA 3BFVA 3JTMA 4FFSA 5JXGA 1KY4A 3PXAA 1A7JA 1EXMA 4RA6B 1C3XA 1E7QA 3TQRA 4CM4A 4Q7QA 3UBTA 4P34A 1GAQA 2VTVA 1ZC4A 4OGLA 4NQRA 4UEWA 1L1FA 1Z2AA 5G4KA 3V33A 1SXQA 3MUEA 4G09A 2Z09A 4HNHA 4DLZA 4EG5A 3UK7A 4UTVA 3D6NB 1H2WA 1X74A 4GPIB 5FRDA 3UJPA 5KJ1A 2Z2ZA 1XR3A 1WF3A 1LX7A 5BR1A 1D3AA 1T5BA 1RQNA 4MW6A 1PS9A 2OORC 3V8RA 1MR3F 1MPXA 1W88B 1VOTA 2JC3A 3LJKA 4ZXPA 1LJ8A 5LA6B 5G0SA 4BBAA 5DCUA 1AF4A 1JG7A 3IB6A 4IQFA 3RTDA 1ISMA 4MARA 1QAMA 4YRIA 2CLDX 3K30A 2HPAA 4XIJA 3UJ9A 1L7MA 3QVJA 5TMBA 2AG1A 1Q19A 3L6CA 3TTUA 1ZSYA 5CA0A 1J8VA 3A4MA 4OBEA 3B1FA 1V7QA 1Y4ZA 3EOAI 5GAJA 3U4HA 1GPMA 3MS2A 3J81A 1BIFA 2G67A 5HKAA 4BP8A 1DBQA 3QY0A 4FN5A 1ZINA 3GP3A 1YBAA 1ZUD1 3HY6A 4P5DA 1FSZA 2H7YA 3JD2A 2AZDA 2A67A 2C7BA 5K2MA 3MA0A 1YS4A 5EXPA 4C0AC 1JYEA 1VHWA 1JHQA 2IPAB 3SFTA 3W2FA 1GOTA 2WJGA 2YZNA 4B4WA 4X20B 5JAZA 2XTAA 4JASB 2WA2A 2WTNA 3QBVA 1KMMA 2RAFA 3BGOS 1ZNXA 2B83A 1VCMA 1H1DA 3TLYA 1K0FA 4JEIA 4AMUA 5F7XA 1NM5A 1IC6A 4GC9A 2ZRHA 4G0MA 4Y1EA 4FONA 2DPGA 3QOXA 3O03A 3QK7A 3ZK7A 3KEMA 3MXOA 1IRXA 4Q4JB 2OHXA 3BD7A 3K15A 4X6LA 5BWLA 4C5AA 4ZCLA 3H6KA 5CLGA 3I5AA 2J9XB 4LSMA 1EX1A 3F6BX 2WWIA 4NX2A 4Q9KA 1LPPA 4P1ZA 1D4AA 2P2YA 3IEPA 4UATA 4KOEC 3FKSD 4A1FA 3NPAA 5BR7A 2ATCA 2QJOA 1M0SA 5CX1A 2ON6A 3D6HA 2FEAA 3D4NA 4EB6A 5LL6P 2X0DA 1NE7A 1MRSA 2C5SA 4QUAA 3VDRA 3SDSA 2I6GA 3RVLA 4PLCA 4HFMA 3R1IA 3LX5A 4XLTA 1CR4A 3LZ6A 1VYVA 1Y6FA 4ZAYA 5M29A 1WSAA 5AI0A 4RF5A 4B48A 4XEUA 1R9NA 3ZDYB 4UHCA 2O7SA 3T15A 4KR2A 4IAOA 4IOMA 1D1SA 1NAIA 1R12A 2E9SA 2ESRA 2PGXA 1FYVA 2Q0QA 5FBZA 2UXDB 3JQ6A 2JAXA 2ZIXB 3GQVA 1IHUA 4FBLA 4UNQA 1RYHA 1TEVA 3E22A 5E2IA 4ZRNA 1FXUA 4QL3A 5EJ6A 1RXCA 2EP7A 3ZW9A 4K05A 4IIHA 3DHWC 4OOFA 4B79A 4LZPA 1APBA 2PT9A 3IEVA 4QBKA 1MH9A 5JMOA 2G1PA 2L82A 3KQUA 4EMBA 1MF7A 1UXOA 1XROA 4FCTA 3FDJA 3Q1KA 1H2EA 1ZHOA 1Z0UA 2WNHA 1XC7A 2O3JA 5DX8A 4ZGWA 1AS2A 5GTDA 1TOAA 2Y0PA 2BCJQ 2H31A 3CKYA 1CY0A 3CRZA 2V3WA 3EDCA 3ONDA 3VU9B 2XI4A 5A4DA 4E51A 3ZNQA 4N3AA 1XDSA 9MHTA 4Q16A 2VHZA 3LUKA 5DV9A 1XHLA 1W1UA 2XADA 5ENVA 1T5LA 3PQ3A 3TBKA 3IA2A 1SXJA 1A2KC 1IOZA 3FTPA 4I5GA 3JQFC 2WJPA 3NJRA 4ZRMA 4MICA 2WFAA 3IBTA 1C30A 4MI3A 1GITA 3G7SA 4CMIA 1P1JA 1NOIA 2HEIA 3TLGA 5DF1A 1Q22A 5G40A 3WLAA 4YTEA 2WIJA 4U9IS 5J5CA 3W6ZA 5ADUS 1RCTE 3QKSB 2PKRA 1JQ3A 3MBIA 1Y1QA 2NO4A 2WHEA 1TZMA 4L9WA 4PZZA 3TIXB 1FRFS 2CJFA 3CLHA 3DGEC 1XDBA 3OZAA 4RK5A 2G7MC 3BM5A 3S1AB 3CZRA 4HEHA 1TMOA 4GVXA 2FEOA 1KTVA 3BQNB 4MVWA 2RHCA 4P4UA 5AK3A 3PGLA 4J2OA 2I99A 3VDNB 3GK3A 4F9GA 4IHJA 4YBZA 1LCIA 2M6LA 3MJCA 3CU5A 2RH5A 4YR9A 1B0PA 3KOMA 1VHLA 1P3DA 3LUBA 3ZWOA 5KX5A 1IUOA 5AVTA 1XD8A 1BEUB 1VPEA 1IULA 1S0UA 2GF2A 2W58A 3T4PA 4MGIR 2IUFA 3B3FA 3P96A 1N9ZA 3WYEA 2ERYA 4MGHA 4YYEA 1VJDA 1UDRA 2VSXA 2I7VA 1OX4B 4MUFA 4E46A 4R2LA 5HCNA 2V59A 2VJMA 3T0FA 1FS6A 1WDWB 3HXPA 2WDPA 4J16C 4JL8A 3DAYA 4MV7A 5FPTA 3PGKA 2OK7A 5DYTA 4N3GA 4O1IA 3UEOA 3AETB 5JCOC 5FT9A 1T15A 2QPLA 4JT8A 2JI4A 1WPXA 2I80A 3HVRA 4OX9B 3JWJA 4ENSA 1RXVA 3FIUA 2HNBA 4ZOCA 4UEOA 5BMVA 5J4LA 4JLVA 1W44A 3DOUA 1M0WA 3DZFA 4MRRA 5AW9A 4OI2A 3T8YA 3HZOA 4Z7QB 3WHLA 3B9BA 5DI3B 3U7JA 1T9GR 2XUDA 3PFBA 4NZZA 1V7CA 4WCFC 3RADC 2BHSA 3GUYA 1YBFA 4EFDA 4P3XA 3BA1A 4KIJA 2PSSA 1F38A 5KTOA 2CUTA 3F6EX 1LTQA 2I4RA 1P74A 2ECKA 3Q2OA 3Q6MA 4U9HS 3IDZA 5TPZD 3TCKA 1B73A 3V7NA 2JI8A 3TYXA 3DAFA 2VRCD 2ZRDA 1KDOA 3M6VA 4R8KA 3HO6A 3BD8A 3AF3A 1XEXB 5JADA 3VC2A 4P0QB 2GZHA 4BGUA 1NTRA 3L6DA 4UDOA 3U0VA 2F67A 1HC7A 1A95A 3O8BA 4L50A 4FSXA 4MJ3A 5A5DA 2X15A 1N25A 4IFEA 3RS3A 1N78A 1VL2A 4FMCF 5C37A 1ADBA 1BO6A 5AYVA 4RULA 4BV2A 3BD9A 2DWPA 1QK3A 4POAA 3LT5A 4GOOD 1T8YA 2O2DA 4BB6A 4MIYA 4EKNB 2GEDA 4B9AA 2Y3IA 1FLAA 2IIQA 3VYRB 4I4IA 4M0UA 4F60A 1Q44A 3M4YA 3NDRA 4LDQA 2XUGA 4UUOA 2VAPA 3UMGA 4DKXA 5KWEA 2H0AA 5DGTA 1GTG1 1AXRA 4BUJA 4E08A 3CV3A 3PXUA 2WF5A 3H1BA 4HPJB 1E7YA 2X58A 2Y6VA 4S1WA 2O07A 2YVAA 3ACCA 1ND6A 2CL6X 4LHSA 4TL6A 1TJ3A 3MNFA 4D3YA 3EXG1 3IKVA 4FILA 4L57A 4JUFA 5HA5A 5IC5A 5LU9A 1Y8RA 1JT2A 1NAHA 2ZK7A 1S7GA 1WF6A 3HYSA 3RU7A 3UXHA 3ZN2A 2L17A 1EI9A 1XD2A 4B6JA 5DT9A 3GF4A 2GNOA 4NG5A 1ZXLA 4JU9A 3QF7A 4ID9A 4KIGA 1T25A 1AKEA 3FKQA 5ENZA 4CM4B 1Q83A 2I6FA 4FUTA 4B73A 4LZLA 4DUPA 4NOLA 2O2XA 2NUTA 3K2BA 1DAOA 2WVHA 3JYHA 4FT4A 2Z6VA 1GO2A 3OF5A 2XKKA 3LZCA 2WM3A 3AR4A 3LOQA 1A9PA 1LB1B 1JVSA 4CG0A 3T5GA 1N6RA 3VO8A 3K7EA 2BFCA 5A4AA 2P1RA 3PRYA 4EMUA 1U2SA 1AQIA 3ICOA 4QUEA 3NRCA 2HRRA 2I66A 1VKJA 1ISJA 4FZJA 2ACEA 5AXAA 2CVOA 1G291 3ESYA 1EK0A 4CQLA 2Z3ZA 2ZJ3A 2BH9A 4NG4A 2GMWA 3FOWA 4Q18A 1MX3A 2AR0A 3UGQA 4YALA 1QPZA 1V8OA 5I9BA 1IEVA 4J7CA 1A2OA 1K2WA 2FXVA 2PA3A 3LFTA 3M9XA 4WZBE 4DY6A 1POXA 3R5KA 4HDSA 3AY0A 1IY0A 4DMCA 1L4GA 2ZI4A 3N59A 5CFRA 1G5RA 1DBIA 1V1JA 1W96A 2PSFA 3TS1A 1UEIA 4GW3A 3I4FA 1I24A 4F2WA 4KR3A 4MQ5A 3BJRA 3LIIA 3IUEA 1YA6A 1NRWA 1PJAA 2K6GA 3GVIA 2Z08A 4M9UA 4H3HB 1Y63A 3I12A 4KH0A 3RFVA 3COYA 2EW8A 5TNXA 1NVBA 2CCGA 2R8OA 1SBZA 3ZBPA 1GY8A 2JGDA 3ICWA 1SQ6A 3D64A 3KWFA 3ST7A 1KZ9A 5BVHA 3S2UA 3HVIA 1FNSA 3MJFA 4MP6A 3KJZA 1L1RA 5T8KC 4IJ6A 3LNCA 4G1VA 5KS2A 3T1HB 2QR3A 3FDZB 2C57A 1JZTA 1ESZA 2A94A 4KTTE 1ZVQA 2N1MA 2VWHA 4ISCA 4QU8A 1NBMA 1VI2A 5JARA 3KVYA 3HWSA 3G9XA 1Y3DE 2IE0A 4YRNA 1NUUA 1OLUA 2YJNA 3IEXA 4Y6GB 3JYLA 1ZIYA 3R3UA 3OQ1A 3L4SO 3RJZA 4D0NA 2C4NA 1E6LA 1MU0A 1P9NA 1FVXA 1Z4MA 2BKVA 1A5ZA 5AM1A 4C4AA 2C95A 4F1WA 4R69A 5CX1B 3FHTA 2ECQA 1N7HA 3BILA 3HS3A 3ESCA 1KEUA 2DM6A 2ZSBA 3RVKA 3ZV5A 4D8TA 3FWKA 3OESA 3EOZA 4Q3DA 4LGYA 3TL3A 4L2IA 3T1OA 3O2QB 4EO7A 1IAVA 2GM4A 4Q00A 5K9ZA 1H2AS 1HG1A 2ORED 2JCXA 2RK4A 2V4ZA 4ROSA 1U0OC 2BKXA 3CC8A 4K6HA 4P6VF 4ABTA 4TYQA 2DPLA 4NESA 2PPLA 1K1EA 2AOUB 2WSIA 3T7IA 1GCAA 1NASA 1SVUA 1KI6B 2PJUA 4FR0A 3OZSA 4Z7OB 5K8UA 4OATA 3MAJA 1I2MA 3K32A 4PTLA 1JMYA 1W35A 2HRDA 1AQUA 4BMOB 3BTUA 1NZFA 2YY7A 3A0RB 3R24A 1WSBA 4RMIA 1S5PA 1AKWA 2PU7A 2GEKA 3I6MA 4YFVA 2O3TA 4KN6A 5T41A 3SIPA 5HQTA 3LUCA 2QDKA 2XEDA 5BN1A 3OIVA 3QXSA 4L85A 1U9YA 3BHNA 3SR3A 3JAKA 3BN3A 4NLLA 1UJNA 1JG2A 2V4UA 3FCUB 3VR2D 4KNYA 2I2DA 4IZIA 1D2HA 4YPFA 3I0NA 3ZCRA 3T3MB 3SOPA 1FC0A 3KC2A 5EKSA 4QYTA 3AONB 3RC1A 1XO1A 1O1YA 1RWVA 3PCTA 4XDZA 3V00A 3RVJA 2I8AA 4JJGA 4C4OA 5A5FA 4UQLA 2LNDA 4KWCA 4Z7JA 5CM2Z 1DQSA 1I01A 2BUBA 3J7AC 4DSAA 3QVGB 3H1TA 3JQDA 3P32A 2F1OA 4RYDA 4C76A 5L53A 1OVGA 4MINA 5KDLA 1O6ZA 3B1ZA 4S1PA 3L4BA 1SXJB 2GI4A 1YS6A 1PEKE 4UNNA 3WGJA 1UJMA 4Y2HA 4IGFA 4NS4A 1KEZA 2WB4A 4TKLA 1C30B 4Q9LA 5EMKA 1ZJ5A 1RI1A 4ZI7A 2HBYA 2GM3A 2PX3A 1K5DA 2MSLA 3EARA 3KYIB 3TUIC 1ZSNA 3IR7A 3O93A 5A0FA 5BW6B 5HPYB 3VKVA 1FTGA 4U7DA 1UQUA 2Q6OA 4BFXA 2Q4RA 4AIRA 3OA0A 5JC8A 1SD2A 2TYSB 3C3PA 2A14A 2C9MA 1J0EA 1ZQ9A 4ZVLA 4WY5A 1YZFA 3I53A 3P0RA 2JG3A 3M9WA 2JLSA 1ILEA 1YT5A 3FCEA 3VMFA 1WDKA 3VSBA 3ZE2B 1G20A 2IHYA 2NUAB 5A5VA 4X1OA 4AJ4A 4IHJB 4BFZA 3KKQA 2G8NA 5EOVA 1WB6A 5FR1A 4L6AA 3SX2A 3K05A 3M2PA 1QP0A 3V7UA 5J2UF 2R8ZA 2Z95A 1WAMA 2KPOA 1OT5A 2GXAA 3HUDA 1R2QA 3PIIA 5D86A 4EKEA 4UVIA 1VYHA 3IVRA 5CU7A 1Q0SA 2XJ4A 4EA6A 1VCIA 4WCDA 4EUSA 1OZ0A 2FPGA 5FA5A 3U7QB 1X2EA 3D2BA 4MWOA 3LQFA 3NBFA 1E7WA 2WTMA 5L3SB 4B3TB 1UKZA 4TMVA 4D9NA 3N2EA 4WEOA 1YKGA 5PGMA 4CV3A 4ZV4A 3ZEAA 4B4KA 2BJWA 2I6UA 3DTNA 1N4AA 1KARA 4JLMA 1EJBA 1V26A 2OOSA 2VQ6A 3RUEA 3ZU6A 3T5AA 2CDBA 1CR1A 4CDGA 1BVRA 3PUZA 3DT6A 1FBTA 1SJ9A 2Z56A 3I73A 3ZNNA 1GUBA 2B1IA 3HJBA 1IIBA 3AHEA 4BVFA 1SKYE 1ULTA 5IAOA 2P0EA 1UFQA 3ORYA 4ZOEA 1W5BA 2EL9A 3IO5A 4N3BA 3D6MA 1KYQA 1E2DA 1K6IA 2EIXA 1UJBA 4KE7A 3R09A 4CN8A 5HIIA 2QGZA 3GFTA 4KR7A 1H4SA 4ZVNA 3ND5A 2B94A 2NYUA 4JZKA 1M1ZA 3B85A 3QIAA 3SDBA 5I9NA 1UZLA 1JHYA 2QY6A 2V3VA 3RQIA 1K97A 4LE1A 2AVNA 4Q82A 4ZRDA 1NUTA 3TEJA 3MG9A 1KOJA 1NF9A 1ZH0A 2P9ZA 2RJOA 4CL3A 4LEIA 3AIKA 3LWBA 3HLTA 1QYIA 3VC3A 2O8FB 2OGSA 5HGXA 1E79D 2O1WA 3E8SA 3ZIUA 2Z1MA 4GOND 3NI2A 3GRFA 1DPFA 2GZRA 3CG0A 3KV3O 3PQ6A 1NQUA 1DG3A 2HBRA 3OLXA 4OHMA 1RSZA 1L5FA 4MIOA 4XASA 4FGLA 1DC5A 4O0MA 2RKBA 1NBEA 3BZWA 1HH4A 2LRHA 1TMYA 5EERA 3F47A 4UNSA 4C6TA 5JO0A 1UK7A 3MBOA 5IUNC 1TIPA 2Y67A 2FB9A 1HE3A 1XD2B 1YJXA 2KBFA 1Z7EA 2B0JA 3WMWA 4HX2A 1VM6A 4L08A 5EHQA 3D43A 3RGGA 1M33A 2ZDQA 3GVXA 4MTCA 7REQB 4L0QA 2JJ2A 3MHTA 2RCYA 3ZHOA 3GLQA 2ENUA 3GFFA 2QVGA 2JI6A 1XA3A 2BFEB 2HY7A 3R77A 3V7WA 4JCCA 3KALA 2B99A 4LK2A 4OLBA 2BMJA 2FCRA 4BC1A 1QOPB 2B4YA 4B1FA 3PA8A 3WLRA 4D4HA 4BQFA 3FGZA 2RH9B 1EJ6A 2QT9A 3SMVA 4EITA 1UXIA 1YCHA 1C8LA 2QXTA 3ELDA 1E1RD 4NOMA 1M9NA 2H63A 5FUYA 2JFUA 1H66A 5CNMA 4Z9FA 3KB6A 1ONBA 3ASUA 3ZI7A 3LL7A 1J0BA 3ZWCA 1A27A 4IICA 4TSKA 4AY3A 1N7IA 3O8OA 3KJIA 5JMTA 4TMWA 5K0CA 5L6LB 2CHEA 4F5ZA 1YNSA 1XAHA 3WGOA 2R85A 2J09A 4CM1A 3V34A 1VBMA 3ZZUA 1K7CA 2YTZA 4OQNA 2GDJA 1V4VA 2E7ZA 1QRDA 4NCKA 1XMXA 2D2XA 3W8NA 1PJ2A 2PUAA 5LQSA 2E48A 3OZRA 3WGZA 3E81A 1HMPA 3IIEA 1DRVA 1NUQA 1D8TA 4HGOA 3LHKA 4JENA 2Q99A 3L06A 1QDLB 1IU9A 2QJRA 2GK3A 4ZO7A 3TXAA 1KRWA 5KNBD 3HDGA 4HH4A 2JGDB 4MVJM 4DWJA 1OIXA 4ND2A 4WZAA 5C8YA 4UAUA 3OZUA 4AJLA 3TNDA 2C2HA 3H7AA 3K2EA 3BK7A 3SFVA 4F04A 5FORA 2IYVA 2NO1A 3WJ7A 2WAMA 3V1TC 1RI5A 5B6PA 2Z4SA 4KVZA 1X3SA 2V74B 3I9KA 2GPBA 2NYAA 2ZUEA 4B6PA 4TSFD 4RCYA 1GAWA 3QE0A 1CUVA 5WRFA 1IRIA 5KYYB 1OLUB 2PZBA 3BXEA 3LX8A 4IVNA 1EP9A 3OMLA 3QWIA 3JYQA 4RGBA 1H8ED 5KYTA 3IUYA 4MEBA 5E1BA 4Q4AA 1FYXA 4U7GA 4OCZA 4C0XA 3MJ4A 3CG4A 4KQIA 4OFZA 1NX9A 3E7FA 2WU1A 4ZOBA 4B85A 4IXMA 4BIMA 3N39C 1V16A 2W6QA 5F5LA 3ZQKA 1U3FA 2GJ8A 2QTZA 2X9VA 4B80A 3GLIE 3CBQA 2OORA 4L2IB 4ER3A 5DM1A 4B3GA 3EC2A 2DFKB 2EV9A 1DJOA 3NKFA 2H3EA 4JBLA 3OURA 3A3OA 1VBKA 5G0UA 1QG6A 4DY4A 3V2IA 2JLWA 2V7TA 5HW0A 1Y6GA 4I5IA 2FDCA 1UAAA 3AVUA 3FSJX 2OXFA 4NKRA 4QD3A 1Q0ZA 1QZUA 4QLAA 4IF4A 4RADA 4HG2A 1FTYA 3QI7A 3PDHA 4KYIB 4O29A 4UVDA 3HDVA 4Z0NA 3B2EA 3BX1A 3ZCVA 4B0PA 1NFQA 4DLTA 2X1MA 1II9A 1C2TA 3A3YA 2HWXA 3HBLA 4PGAA 1R88A 4UD2A 4Q3KA 1RQLA 3ZE7A 2DC1A 4WBSA 1JIIA 2ZDGA 1GNLA 2GYVA 1DBVO 1KY5A 4DPKA 3OA2A 1ODLA 1AK1A 1XALA 4XCQA 4XIIA 2H2IA 4AP9A 4DXDA 2JFHA 3BXGA 4UMFA 3KTFA 3F5MA 2A1UB 1LQ2A 1BE8A 3LK7A 4WLOA 3TOCA 2P27A 1P9LA 2PGIA 3FRJA 5JECA 4UE3S 2VK2A 3HR7A 1DCTA 1QU2A 4UDXX 3MTDA 5IVPA 2MOKA 3LDAA 1MP0A 2K5UA 3TTSA 4BWVA 2R11A 1HG0A 2ADOA 4BFUA 1CR2A 2YN4A 3KJFA 3N53A 3QXCA 2BTQA 1BXGA 5AKGA 5LJIA 1KH3A 1VYTA 4IWXA 2FUG6 4LX0A 1IXYA 5AUQA 2GZ1A 1FMCA 3BFXA 2QRJA 1HYHA 2X4LA 3W2IA 1E3TA 1EVKA 3LIPA 3QITA 3SIWA 1X7XA 1MXFA 2VT3A 2O8VA 1PCXA 4I4CA 1DO8A 1E3WB 2DT8A 2JATA 1C1YA 4I4TF 1CBUA 4IXTA 1WE2A 3EGDA 4H6WA 3SIRA 5A4MS 1CF4A 4ZU6X 4OGGA 1K75A 3M33A 4FGZA 3HKCA 3L0IB 5T4FA 4G5SA 2I7TA 1FRVA 3HB9A 2HK7A 1RLTA 2ONKA 3E7DA 1DP4A 2Z30A 3OUTA 4K28A 4LSGA 2P6NA 5DM4A 3TZ6A 2AMFA 4CM9D 4LRYA 3ZXXA 2QTRA 4RMGA 4ATNA 4B3DA 5IXJA 3LQ4A 3VNVA 1MNQA 1UCFA 2FV8A 2H8GA 1C1HA 1UC4B 2HLHA 3P2JA 4HT3B 1Q0HA 2WY2D 1N2XA 1DBWA 4Z7NB 2CXRA 4N47A 4BBZA 4BMDA 1RMTA 3P27A 3KZCA 1NI4A 5LM3A 2YHAA 4A8JC 1RCFA 2IU3A 2Q45A 4ARZA 4ETMA 1X1EA 1O9BA 4LE0A 4RJJA 3LHSA 5AI5A 1I4LD 4PX9A 2GSDA 5IMSA 1XELA 2ZU6A 1HLFA 4R5MA 2VR1A 2C83A 3FGOA 1RMQA 1JFFB 3D9QX 2FPGB 1ORHA 1QXSA 3B51X 2EWVA 2JJ8A 3DXFA 421PA 5JAIA 3KLNA 2FE4A 4H16A 4QREA 2XVXA 2PBFA 1FFAA 2H11A 2J41A 3GZTB 4KQJA 4JJ4A 1U1IA 3VR5D 2ZYGA 3EXHC 4UTNA 4BNHA 4F06A 2O14A 4JBHA 1O87A 2XCQA 3VI3B 3SIXA 4ITVA 1KETA 3GRCA 3LLVA 2XT0A 3LP8A 5H9WA 3EF1A 1OR8A 4A10A 2HCFA 5BSFA 3JQFA 1ZOOA 1A8PA 1E4VA 1YZNA 3HY4A 4AO8A 1C1DA 2VJCA 1ZRMA 2ZB3A 4XQCA 4S12A 2OSVA 4L78A 2V65A 1DRUA 1OVMA 3NH6A 4TKMA 3RKSA 4I1OA 3R8FA 2OQRA 1PKXA 3ANYB 3GJ8A 5AVRA 2ZYRA 4Q47A 4OPMA 4LVNA 2YHUA 3S40A 5AUPB 2ZJ6A 5LQMA 1TU0A 1XMIA 2NIPA 1LNZA 2FPPA 3CIFA 4LY6A 5FNZA 3OQIA 1RLOA 4LQ4A 2P8SA 4YAIA 2PSEA 3QI2A 1CVLA 2ALJA 2IDZA 1G8JA 1XTPA 5DCYA 4W4TA 4GYWA 2W90A 3R6LA 4AM8A 2MHCA 3CHYA 5C18A 4FUQA 1PL7A 3BPSA 4X45A 1YA4A 2Q7OE 3S99A 5BQXA 1RZVA 3I05A 3R9XB 3JYOA 4BFVA 1T5HX 4KXYA 3UQYS 1JA1A 2EZUA 2VJNA 2VZ8A 4MUHA 3RC7A 2O5EA 3BICA 5IZ4A 3NWOA 1G9TA 2JIZD 4J16A 1W4BA 2GPNA 5AKJA 3TQQA 4ALMA 5A4JA 1DRJA 3G1UA 3HPQA 3OJCA 3GVCA 1ADFA 5GMOA 3LAWA 1WNTA 3I6IA 3M6UA 2TS1A 2Z8XA 4P82A 4MPRA 5JCOA 3COZA 1J5EB 5AJZA 3AR3A 3SQMA 2IHKA 4J1SA 4Z0TA 3W5HA 5MDHA 3PHIA 2OCDA 1KH1A 1EGHA 2UUOA 2R60A 4NU0A 1H6BA 4L0DA 1XWFA 3QUTA 4WCFA 5BN5A 2BM8A 2Z98A 1HRKA 1TUGA 4KQHA 2RHLA 4GF5A 4IUCS 1UAGA 4Y2JA 2JNWA 1HTTA 2VRNA 3C1UA 3RNLA 2IQIA 3MLEA 3D0QA 3D6AA 4ZCMA 3QBEA 3OM0A 1UT6A 4AK9A 2OQ2A 1QLWA 2PLRA 2R8BA 3KSRA 3PNQA 4PLWA 1XXHB 4EA8A 1MFZA 1G8MA 3JPWA 4DLKA 2WU0A 3PEEA 3OT4A 4XQGA 2ADFA 1FPQA 4LFBB 3R0XA 2JAUA 3QTLA 3O8OB 4MW7A 2BBOA 4L6CA 3T3GA 3NTVA 2W6ID 3DM5A 3EZ6A 5K03A 1PI3A 3JR3A 3ET5A 4DIOA 2C4HA 5F12A 6ADHA 3NOQA 3NR2A 1QONA 4G4IA 4QDZA 5GM2A 3OIFA 2B4AA 4FJ0A 1EPUA 1LSJA 3VAAA 1P0IA 4IIUA 2APJA 2GF0A 4AP5A 3CX3A 1EFHA 4HD8A 5AVQA 1MENA 1J21A 3PXXA 4KV9A 4QFDA 2BMWA 2VZ0A 3B60A 2VRCA 1FS5A 1WV0A 4XIYA 1YULA 2R86A 5KTNA 4N48A 2BEVA 3DW3X 4WZAB 1UC8A 9ABPA 1GPH1 2HTEA 4Q66C 4BC0A 5JASA 2AI3A 3RS7A 2FUEA 1C3EA 5AI9A 1OLSB 5CCEA 4EI8A 2B0CA 4PTYA 3ZVKA 1UPTA 2V97A 1QG2A 3PFCA 4BV3A 4EG6A 3PXEA 3LMKA 1LS6A 1J33A 1G3QA 2HNKA 1E3LA 2O2ZA 1KXJA 4L5BA 1BHQ1 3N2ZB 4NJMA 1QYCA 2MSKA 4IMIB 1SKUA 2VDOB 1TD1A 3OPVA 5BW5A 4M86A 2GX6A 2RH4A 1WJGA 2G07A 1GNRA 1T4CA 2FG6C 4M9QA 2V5UA 2XAAA 4FFBA 1M2HA 1YWGO 1J1UA 1QANA 1QC5B 1DFGA 1DKMA 1YD7A 5IYZF 1CERA 2YYYA 5EPUA 1DCMA 1Z2CA 4GPZA 1V16B 3OCCA 5CEEA 3RFTA 1ZCFA 3RARA 2ZRIA 2FH5B 3GLHA 4BNIA 4DYDA 2ZCVA 3CXRA 4RPGA 3COPA 1TCBA 1HKHA 3NEAA 3QJGA 3TSAA 5CFPA 2IYWA 3F2VA 3HHPA 5CT8A 3QA9A 2CN1A 3EODA 3DBOB 3VVCA 5KHLB 2EFJA 1U5CA 1RRCA 4N12A 3HNRA 4YCSA 3KSMA 3DBVO 3FUUA 4ZT3A 4YUAA 3T1VA 2VUTA 3CUVA 3Q87B 4NEHB 3UUFA 4CKCA 3RYCB 4X7BA 2K7ZA 3CNQS 3NBAA 4FU0A 5F1KA 1RAGA 4GI1A 5JD3A 1R4NA 5P21A 1NXWA 5H82A 1U0HC 4GBJA 3O4JA 3GQBB 4RF3A 2XOKD 1YC2A 2EZ9A 4IIYA 2QN7A 1PFKA 2PR7A 2WJZB 4PO9A 4EHNA 1PL0A 3W6OA 4Y2VA 1XZLA 2CLIB 3KHTA 3LY5A 3IT0A 1PD0A 1JHXA 2D1RA 4JC5A 4OUDA 5JXWA 1CZHA 1RW4A 1WMAA 4XWKA 3DLPX 4P08A 3ZJ5A 1GNQA 3B1VA 4CKXA 3PXDA 4HDKA 2Q21A 1OW3B 3D54D 5ESDA 5IUKC 1VI5A 5T8KA 2QRUA 1UT5A 4EO9A 2UAGA 5K51A 1PR5A 3NHPA 3IUPA 3KQPA 3VHXA 4EEZA 3OIGA 4RK6A 5JJCA 1GCIA 1BXGB 1OPRA 3MLBA 3I32A 3ANLA 2VOEA 3DFMA 2R1ZA 4V0ME 3A1SA 3RC9A 5KNDD 5FYQA 5M5BA 1NLZA 2W42A 2WU8A 5ICCA 3RVSA 4R9NA 2WTXA 4CMEC 3VNAA 5T4EA 1R0BA 1WEKA 3DE3X 1DC8A 1WY5A 2FQWA 4LXIA 4UC0A 3TQIA 4II2A 3VISA 3EGDB 5ICEA 1PZXA 5H80A 3T52A 3X1MA 5ALVA 4FINA 2K2QB 1IXSB 4AJ2A 1RWQA 1YIDA 2IODA 3HKCB 3AFOA 5EN4A 3CUWA 3DXYA 4KR0A 3JZDA 1E2IA 2AN1A 3PITA 4G24A 4GM4A 1KI8A 3LRXA 1G5FA 2JK0A 4EFMA 5C9ZA 1UIRA 2GHTA 2EFHB 2PZAA 3ZI4A 2XXAA 4MWBA 1YSCA 2DP4E 3GLTA 1WKBA 1LXCA 4LJKA 4JLBA 5KYKA 2OXEA 2I4NA 3EFBA 1F5NA 2YY5A 4Q1BA 5HFNA 1ESEA 1QO7A 3ABRB 4AZTA 4NR0A 1NT4A 4J0CA 1P7WA 4L16A 2EQAA 4BWGA 2FN8A 2IDMA 3HCWA 4ARZB 4E7OA 1TT7A 4DV7B 2PUBA 5DPMA 1UC9A 1JW9B 4WN9A 3WQSB 3WIBA 4JQSA 1SXPA 3EIFA 4B3FX 4R6XA 1GG5A 1GNVA 3FAKA 2D0PB 5EWJA 3EH2A 3CQ9A 2XCUA 2VAVA 4QXRA 1F06A 3TSCA 3GRKA 5HK8A 1XNRB 2C29D 3KG2A 3ZGOA 3EFEA 4Q1EA 4E4YA 4G4JA 1QQTA 5ADVA 1Z35A 3R3HA 4WE3A 2IKQA 1P0QA 4RQAA 5LBUA 6REQA 1Q12A 4IHAA 1ZI6A 5IC4A 1XZBA 3NTQA 1MQSA 3IQXA 5KVVA 2QXUA 1VGQA 3AIMA 2QL5A 5MHTA 4PX2A 3KT6A 2FWJA 1ZRHA 1JSCA 3RSZA 4UU8A 3ESAA 4Z2YA 1C1DB 3ROFA 1MB4A 5HFJA 4F2PA 4WOCA 3WLJA 3ASZA 5C8XA 5JSHA 5DLEA 1CY4A 3FPLA 1XHFA 5TB5A 2IXFA 4OU4A 5F9FA 3NYQA 4JR2A 5MGNA 1QUFA 1N3IA 1ZK1A 2YIMA 5T67A 4AJEA 1SKAA 3JX9A 3SYKA 3JAWB 2B7CA 3U3JA 5ICSA 1QV7A 3L92A 2LCFA 4P81A 4XWTA 5FP0A 3MAAC 1GXSA 4NCIA 5FUWA 5ILGA 4D1YA 2ZYSA 3CEMA 4EJFA 1K5HA 1CNFA 3IBYA 3QELB 4WBNA 2OWDA 5CJJA 4XH9B 1JQJC 4JT4A 3HDTA 2IEDA 4BKMA 5UKDA 2C61A 2PL3A 2Z6AA 3T0IA 2V6IA 4MPTA 2RAPA 2NUPA 2P2GA 3QLEA 4LWQA 4MMXB 4GBED 4RU1A 4ZPJA 3DVAA 1YB4A 4XWGA 3GB9A 4MQ6A 2ZR9A 1JQ5A 2OYSA 4RFSA 3T41A 4BEBA 1KU0A 2PRKA 5HX7A 1DGQA 4ZQGA 3FOBA 4JLJA 1UFOA 1NR1A 2SKEA 4I81A 2ANCA 3AFIA 4FHZA 1YE3A 3ZI0A 1SQ0A 4H1VA 3EXEA 2B36A 3DCYA 4QWMA 3C3BA 3AV0B 3LLCA 4HDCA 3BJMA 1WM1A 4AMGA 3L43A 1KJNA 2WV7A 2C98A 4RTRA 1YF3A 2XKAA 5ER6A 4QYMA 2ZWIA 1YJBA 2HSEA 4IX1A 5C5EA 3A04A 2KMLA 1YHZA 2XRYA 3W79A 2PFSA 4YMUA 3YASA 5JDIC 1WXEA 5ULLA 1A7KA 1E61A 4ZV9A 4DWVA 5FHRA 3FJ1A 2PGAA 3AXTA 5BN5B 5IXYA 3H2KA 4WBXC 4KXLA 5ED0A 2P7HA 2PX5A 3VNUA 1L7NA 2OENG 4NMHA 1SCDA 4A82A 1RADA 4S1VA 2EZ4A 2KW5A 3B6MA 2HDWA 1Z73A 2HUNA 2YZ2A 1PQPA 3GFBA 3DL0A 3R8CA 1X14A 4CMCA 4LC9A 4EW2A 5CM8B 5CEJA 2QPOA 2QUHA 4U7JA 1SCQA 1FDWA 1N5RA 4MR8A 5SYMA 1FLDA 4BO8A 2H9IA 5B3KA 1X7ZA 2BFPA 3JTEA 5NULA 1EK1A 1NX6A 2AK3A 4MCAA 1FMLA 4GS5A 5EHXA 2AZXA 4MUIA 5JSUA 2AFHA 4OYYA 1QIHA 2B5OA 1HSOA 3THYB 2CVQA 2XAUA 4OHFA 1GPKA 3GAFA 3HXOA 2VP3A 4LF7B 2DUMA 1XKQA 4C4PA 3DTVD 3JAMA 1GV0A 2VDJA 3B78A 1G6HA 1YRHA 3O91A 4IMPA 4ZAFA 5LLSA 5TGDA 1OAOC 5IFKA 2E0IA 3ZWMA 5BURA 3IMGA 2QX7A 4HWRA 4U7FA 4BMVA 1QQ5A 1VGRA 2K87A 3EG5A 4ES6A 2CT8A 2V55B 2CB9A 2IA5A 3BOSA 2BEVB 3PK0A 3BE8A 4GVLA 1DRKA 3HCRA 1JH9A 3ROPA 4J76A 3LCUA 4KYVA 2BGUA 3KXIA 5KOJB 4BNLA 4CCYA 4YJ2A 2C3PA 3MTJA 1SKQA 4RSHA 4BO0A 3O4GA 1QH9A 1X92A 2O2CA 4RK0A 1Y37A 4MZXA 3LBFA 1GADO 3DOJA 4NJMB 3GPLA 3SYRA 2BVNA 5J5VA 2WMYA 1R0CA 4LXGA 2X41A 4PPQA 3ZH2A 3VKGA 3N07A 1F8XA 3UVEA 4YLEA 3C3CA 1T4CB 5CMLA 3LYUA 1XZ8A 5IPFA 4I1SA 3EWAA 4U2GA 1NKTA 4OTZA 2GEVA 3EF3A 1KAMA 2VKTA 4CFZA 2GHRA 1CY6A 3KTAB 1QHSA 3GLHB 4FS8A 4TMTA 3J7TA 5FQNA 3IAHA 1JR2A 5T5QA 1AZWA 1MKYA 4MI6A 1WZNA 1HPLA 3O21A 3S0JA 4AJJA 2Z4TA 3COSA 1L5YA 2QIPA 2QD3A 3EUWA 2FRVA 3O4RA 2DULA 2DBVO 3HJTA 3UC9A 1PGPA 3DTYA 4QHSA 3WKDA 3AY6A 2VJPA 3L7MA 3QFCA 4CKCB 821PA 1JDPA 4BZPA 3ADBA 1Y6RA 2J0UA 2GERA 4WRRA 4OQPA 3MGGA 1R4NB 1LDBA 3EG9A 2WSSD 2JFVA 4HSGA 4OQ4A 4R7GA 5FOXA 4RZIA 5BYAA 1MIOA 4MV5A 3GXOA 4CKZA 2P4QA 3AF0A 2TMKA 3K5IA 3M6WA 5KSOA 1U8UA 5CHYA 4BE7B 1IHYA 1SH7A 1UR5A 3A6FA 3H1PA 1JHZA 1XKLA 3EISA 3FDIA 1FXSA 3OE7D 4OUDB 4PVDA 4XTCS 4QOFA 1E1RA 5A62A 4Z4CA 5G3YA 1TKCA 4GR9A 1RRGA 4HDKB 4IDHA 2YV5A 3EA4A 3FFBA 4WK2B 1ARZA 3SC6A 2IU0A 2V5AA 3MTEA 3VHXB 1KJ8A 3KPVA 4JH0A 1XU7A 4PCAA 4UAGA 2HKIA 1T6NA 3AUXA 2DUNA 1HDZA 2IHJA 1NPDA 4E5DA 1KR5A 1LFAA 2D3WA 1NP6A 3D7RA 3GUUA 3OKFA 4IV5A 1F8GA 1G5HA 2YASA 3H6GA 3EGIA 2LP4Y 2YWJA 4R8MA 2GR9A 4A73A 4EKDA 1FRZA 4Z4FA 4L5JA 4OK5A 5K3SA 3UAVA 1KR2A 1ZCJA 2J9RA 4PFJA 3OQNA 3ITKA 4R3UC 2BC9A 4A91A 4IM7A 1VBNA 1U0LA 2VXYA 3P52A 5KNBA 3HCEA 2NQ2C 4R41A 3I2YX 3LUAA 1CJSA 2HSDA 3FF1A 1UOPA 1V4NA 5KDDA 5AK0A 3FKJA 1QP7A 3PJFA 1OXKB 3REQA 1EGQA 3AEKA 3OBIA 4BL5A 4TWIA 3OD5A 2XXAB 13PKA 4ZQCB 3DB1A 1ETUA 4IR7A 3Q8KA 4TSFA 5COAA 3HDHA 3STWA 2GCOA 3FYCA 3DOHA 1G7SA 3VZQA 2VBIA 1WW3A 4GLJA 1N1EA 1EQ2A 2OHGA 2B2XA 1DXOA 2I3ZA 5F4BA 3U1VA 2QSUA 2IC5A 1H8EA 4HJXA 2BFMA 4N49A 2EDAA 4LV5B 3NP9A 2I0FA 4ED9A 4Y8VA 3T3PB 4DNQA 1NJ1A 2DQZA 1V1MA 4CMHA 5FBKA 4X8LA 2I2CA 2P4HX 4PNEA 3T5DA 3ROKA 1WPGA 3ZWPA 2KE5A 2AMVA 1U1EA 1VKZA 5EWJB 4NZNA 3LT4A 4CI0B 1PV1A 2Q4BA 4EF5A 3LG2A 1TYBE 5DBFA 5AKYA 1ZD1A 3EC7A 3UB3A 2O9JA 2HBQA 1KK2A 4AWXA 1YBHA 5KTMA 2QPAA 2Q0SA 2WG1A 3JQRA 4HX9A 3RW9A 4YVFA 2CB0A 4AY2A 4XJXA 4DCNA 2FWMX 5KOHB 3RK1A 3IQWA 5BW4A 3P8ZA 1FP7A 5K8TA 2WF6A 1B3RA 1BOFA 3DTTA 5ICMA 1P4JA 2DBZA 2YCBA 2BJVA 2YR0A 1TK3A 4JB3A 3DLCA 4NFHA 2W11A 3AYZB 1QHXA 2FUG1 4RLFA 1JFRA 2YFKA 4BYMA 2HJWA 4M8KA 5FNVF 3PXGA 2Y71A 4Z1OA 3KR1A 2BGLA 1R6TA 3UT6A 4CCSA 2BBSA 1ZM2A 4U2DA 5JNLA 1Y4DE 4WGGA 2W6OA 4Q3BA 4MUAA 4JLPA 2W2TA 5JWRA 1UBKS 1ODTC 3EPRA 3ND7A 4FI3F 1VSVA 2G9NA 4CDNA 4IILA 2W2LD 1WMBA 2W0MA 3MHPA 1OXBB 3INGA 4JT2A 4JYMA 3RM3A 1KI9A 1F7UA 1GXSB 2V45A 1Y7HA 2BMAA 4UAJA 1JH8A 2PDAA 4RQUA 1IOWA 1GFIA 1RHUA 4WBNB 1DUVG 1MEEA 2ZYVX 3G2KA 1QCYA 5TF4A 1S89A 2PK3A 4B2IA 4OMFG 3OCYA 2BD0A 4U8GA 1AQLA 1X77A 1TVKA 1YMQA 5MF6A 2NUPB 4A8JA 3DVAB 4C6RA 4FPXA 1A4RA 2G76A 4G2NA 1WD7A 1FXWA 4KQXA 5HWSA 1GQOA 4IOLA 1EE1A 4L8VA 1XNHA 3CRQA 5SY4A 1NLYA 3UICA 5BVGA 2Y4OA 5TPWA 3WFIA 3GGJA 2WYWA 3Q7EA 4QXPA 5DRTA 1KAGA 3IESA 3EXEB 1BW9A 1WP4A 4CM9A 2C5LA 1HL3A 3DVSX 1QKJA 2DBQA 2MR5A 2YOGA 4LHVA 4OK3A 4QGAA 3ZZ1A 1EVQA 1JIXA 2AI2A 3L1UA 2BMDA 2ODEA 2XR1A 3HCAA 3PR1A 3QPVA 5CYFA 1JLHA 3CB4A 4C06A 4F97A 1WY7A 2FJUA 4UPDA 5DHUA 3JWEA 4YC7A 2P2CA 3EXHA 4HADA 3OOSA 4RH3A 2VPQA 1W34A 2QY9A 1BHO1 1SO8A 1I3OA 2J6BA 4X8MA 1QHFA 3VU8A 1OZFA 3EBPA 4EEXA 3KQKA 1LPSA 5EGSA 2QLNA 2FFJA 1VJ5A 2J45A 2COUA 1GQSA 3AF4A 2WVGA 1O6CA 2WLSA 1ABBA 4PANA 3UMCA 1VB3A 2OBNA 4RHYA 4JJFA 4PU0A 2B6HA 5JC1A 1UC5B 4M22A 3VPCA 3G82C 3MINA 1X7ZB 4HUTA 3E18A 1UMBA 1KZHA 1X1QA 3U7IA 1GUYA 3GIWA 2W6NA 3IHKA 3NCTA 2AFHB 2XIQA 3EVDA 3VR5A 1VL0A 2B3DA 3DGFC 2H2AA 3E82A 3VOTA 2VNAA 4EVQA 1XJ0A 4LXUA 4H7IA 4CPDA 4HQ0A 1SBHA 3HR8A 3ZZ0A 4Z4HA 2TSYB 3Q11A 4K6OA 1O9GA 2JJMA 3G9TA 5DX1A 1FDUA 4ND8B 2WFMA 3KD2A 1P1KA 1MORA 1EAYA 2NVWA 2PUDA 3M8KA 4JI8B 5LP6F 4QXMA 3C97A 2OM6A 4Z9AA 5K8JB 2RHDA 1PAUA 5HG0A 4A2QA 4CR7A 3I01A 5IWAB 4GP9A 3B82A 4OX9Y 4CCYB 1U7WA 4YJ2B 1GNTA 3G02A 1IQ0A 3HN2A 2H4WA 4KKXB 2Z43A 5D5QA 5DN9A 2EGHA 4PGMA 2NPFA 1Q84A 1I5EA 1T5OA 2VHTA 4HGNA 4OFWA 3X2SA 5ALQA 4Q6WA 5K6AC 1SOMA 5CVUA 4YJHA 2R7KA 3ZOKA 1PTKA 5B1DA 1UEXC 5DNYB 3FPAA 5EKUA 2BH2A 2PWAA 1CJKC 4DXAA 1JQKA 2QW0X 1O6FA 3L4JA 4N0DA 3A9SA 4MV9A 3RYFA 1AM4D 1YO6A 3W4JA 5FA8A 3V8VA 5JV5A 2V7EA 3HB5X 3HQ4O 3LHIA 1FVHA 521PA 5BV0A 5C8DA 5CFLA 2ANBA 1I32A 4RETA 4C08A 2RBGA 2JIZA 2SCUA 3IIKA 2M6KA 5LZ2A 1S3GA 4O3FA 2Z8ZA 3ZE6A 4G81A 2IS1A 2P9BA 4UZEA 4PICA 1T3HA 1CJCA 1WHTA 3SKXA 3G17A 1JIJA 1K8QA 2OP1A 4ZU1X 3UTCA 4D9KA 4L4RA 3JVDA 2NZ2A 5CDGA 5EUBA 3U13A 1EIZA 4HDRA 4C0HA 4FWBA 3C4QA 1RDFA 5L3QB 1PHPA 2DECA 1MVNA 3D1VA 1XZNA 3OH8A 4K5QA 2NTYC 4E5YA 3I9NA 3HU2A 5BQFA 1BU5A 3ZY5A 3EG9B 2VT7A 2G9UA 2W2XA 1S2NA 4L5IA 1MIOB 1I0LA 1RLMA 2ZANA 1YDEA 2A1IA 4LHZA 5LB2A 1DT3A 5LUBA 3K53A 3OETA 5M7EA 3BD6A 2JH9A 3DFFA 4BKPA 1DTEA 3VZBA 1SCUA 4B7ZA 2HCTA 4Y0VA 2ZJFA 5D6OA 2RC6A 2AYZA 3BKWA 3QQPA 2O54A 5AHKA 5KJFA 2IYYA 1D2RA 1R18A 3CT4A 1N3YA 3PNMA 1X80A 4M46A 3HA5A 2NXNA 4TTRA 1NLFA 1U0BB 3CR7A 5E9AA 1L5MA 1E8MA 3NBUA 1DIRA 4V0KA 3FVWA 1EYZA 1KXZA 1W4LA 1XRNA 4OQDA 5DBIA 2AC7A 1VA4A 1AD2A 2KLBA 4ZEVA 2XUKA 3BERA 2XUPA 1G42A 3IMEA 4D9GA 4PQYA 3EZ2A 4P7FA 2B78A 3IAM1 3OHSX 2A0WA 4LZWA 3KIPA 5I7UA 4ZMSA 1BFUA 3VH2A 4D45A 5FFNA 4DCOA 1H2ZA 2AFRA 4RS3A 2OWEA 3CYFA 5E2AA 1K8ZB 2G5TA 3T3EA 2OKGA 1UBRS 4A15A 3G0HA 3T4EA 3CVWA 1SUBA 3RHFA 2VNJA 1BJRE 3FVQA 4L28A 1XVIA 1C8VB 4MR9A 4ZT2A 1PQUA 5B7PA 1DAKA 1VIYA 5HDBB 3BWEA 3S5UA 3GGOA 3QKWA 3AEKB 3QWAA 4YDSA 3REQB 3TQOA 5L95A 1CRPA 1G2OA 5HDQA 4V38A 2CEKA 2WJHA 2HZ7A 4RTMA 1PR3A 2OP0A 3JU3A 4NFYA 4MV3A 4Q4HA 5DEOA 1L7VC 2Q2OA 4HNTA 2B69A 1JDVA 2H2DA 1ZUNB 4L9AA 3WOVA 3PTLA 3PIDA 4I14A 1YDFA 1VIMA 3ENZA 2MMGA 5EMMA 3TQCA 3CLTD 4LY9A 4Y0NA 1V1MB 1E66A 3RAPR 2UYCA 2XMGA 2NV2B 4IZ6A 4K0RA 3UOGA 3GRRA 4B0OA 1BXZA 3MILA 2YQZA 4UPVA 3KOOA 4AI6A 2C0QA 4CFYA 4YT8A 4F1KA 1GRQA 1RBZA 1VTKA 4RKQA 4UXHA 3V97A 2CVHA 4WJKB 1GUZA 3PP8A 4REMA 3E3MA 1K7YA 1MVOA 1BSVA 4BLPA 2Q2WA 1C4OA 5SZIA 2JVIA 4Q5IA 3A4YA 3VUFA 4CIXA 5C81A 4A36A 5TV2A 3E5RA 3KJNA 1XIVA 3K0BA 2IUUA 1PV4A 3FAZA 2QM7A 4EW3A 3I2IA 4Y1GA 1UPCA 1EP3B 3TAHA 1Q1EA 4URYR 3M5DA 1KS2A 5I5EA 4I2VA 1R16A 2BBTA 1YOVA 2C1XA 2HLDD 3A36A 3DVRX 1I51A 3DEIA 4LYYA 1OU0A 3LL4A 1UJCA 4CMEA 3AB3A 5BUCA 2XOKA 1PDVA 4GG1A 4AT1A 4BLUA 4MDFA 3UH1A 3O75A 3KJHA 1L7OA 1YACA 1DEAA 4UUQA 2D7CA 2W43A 4C7OA 1XEWY 4WH0A 2XGMA 4J0GA 4KPUB 1UMDA 4MQBA 4BX9A 1TQ4A 3NS7A 3KQLA 2ZG6A 4LJAA 1CQJB 2WIDA 3DV2A 4O33A 5FADA 5KJEA 3RYHA 4H1HA 5KNBH 3INYA 4YRRA 5GJVC 2NT3A 4H7DA 4M1ZA 1P4RA 2JBHA 5KNDA 3AKDA 4QOHA 1QGDA 5I8WA 4PLFA 3WBFA 1RI4A 4M0KA 3EDRA 3X1ZA 3LUJA 4EFNA 4A26A 2TMDA 4ZQBA 3CZQA 5EP2A 1ZBDA 5KINB 3OQOA 1AY0A 1N0UA 3C3WA 2ZE6A 3OX1A 3PQEA 1NVAA 2G6BA 3T5TA 1Y5LA 5DISB 1A9TA 1H8HD 5TPWB 4DBVO 5BVGB 2R8RA 3A27A 3NHMA 1P7PA 3OT5A 3U56A 1YDGA 4HN9A 1BZYA 2PX8A 1BW9B 4Q4DA 3ZGVA 1T5IA 1Z39A 5D2CA 2ORYA 3RAEC 3VTZA 5L45A 2UXBB 1C81A 3FVVA 3OIDA 2F4VB 2X7JA 3QSGA 4QJ3A 3MTIA 5G1PA 5GJWC 3UHOA 2W2VA 4KSBA 1PG2A 3K6JA 1S3IA 2M98A 4XR9A 2BY4A 4EUNA 3JS5A 1EUDB 1JJAA 1E3EA 4WZBA 1SVSA 2CD9A 4BUZA 4DZRA 3N0WA 1WUYA 4F91B 4GDFA 1TZBA 1JHDA 5AWFC 1DPGA 2PNFA 3H83A 3JSXA 3K9CA 4Q0MA 4ZJYA 3EA0A 1YIAA 1MABB 1ZESA 3F4LA 5CT6A 1DTWA 2X8LA 2CJWA 1ZP6A 3B20A 2JHCA 2ONJA 5HKOA 4PO8A 4WY2A 1DC6A 1CUUA 2BFDA 4GR5A 5BUQA 1PDWA 1I7SB 2AR9A 1UMBB 2E4YA 1Q95A 2ISSD 3KYDB 4FQ7A 5ALJA 2QRLA 4Y2RA 3QWBA 1R66A 2QKYA 4KC0A 1YRQA 5J63A 1QH1A 3F9RA 2YMQA 2YRFA 1B6GA 1XE3A 2VSYA 2BR5A 3SVZA 2QQEA 4EYKA 1ESCA 2GFHA 3H84A 5K4AA 4EW6A 5E0OA 3GOHA 3NAZA 3VOAA 1JDBC 3UJBA 1BX3A 5D3QA 2YWCA 4F4CA 2DWUA 1N2JA 1XQYA 1N8KA 3Q2KA 4TTIA 4V03A 4C0BA 5KEIA 4KRGA 1MPTA 2ZE5A 5AW8A 3GP8A 2XWJI 2QRVA 1Q14A 2Z04A 4V0SA 1AKMA 1RRFA 1ZJ6A 5A7FA 4ZMRA 2CYBA 4HDNB 2JJQA 4J49A 4C7BA 4XXHA 1JPNA 1JILA 3DOIA 5JH7F 3REGA 3E2MA 1EDOA 3P0HA 2C2BA 4X71A 4BGVA 3ZUPA 2A0YA 3U4DA 2GCGA 4JP5A 3HSKA 4ARBA 3SZ3A 1SC6A 2COKA 3C3MA 3WLKX 3D4PA 4YJHB 5KAMA 1D4OA 3CSDA 4GI2A 4MYUA 4CQMD 1Z12A 3ZJVA 3WMEA 2WUEA 3PF8A 5JYEA 5JDIA 1RACA 3I1YA 3TJMA 3BSYA 4HK4A 3W2HA 2G4VA 4BCDA 4P35A 4R8LA 3VSEA 3RYFB 5CT4A 2RGAA 2H4XA 2B5VA 4WXMA 4E94A 1GNSA 1VDMA 2CF6A 3WR5A 4A2WA 4YGYA 2JCSA 3A4IA 2NAFA 4HOYA 5J1SB 4WVLA 1VCHA 2SCUB 4BEJA 1QWSA 3AQIA 3DVLA 1MDFA 3KHKA 1ONNA 2ZJ4A 5KTSA 2Q8PA 2JA1A 2YOFA 1LY1A 1WHTB 2ZTLA 3LPAA 4AAYA 4RMNA 4UOZA 1U9ZA 2G9RA 3AUSA 5IVHA 1AHHA 3QBDA 5AH0A 5TLSA 5CX4A 1PLKA 4RKWA 2RJNA 4FYHA 4JK3A 5AM0A 3NJ8A 1PL8A 3EEBA 2IS6A 5MN4A 1TA4A 3MOSA 3EBOA 4LPKA 4OD0A 4UMEA 3KD3A 5BOVA 3EEOA 1YJ5A 1C9DB 1KHHA 3K0AA 2J3KA 1KY3A 1IIRA 4DOMA 4TROA 2ZRQA 4YGXB 5FDFA 3FETA 2D4HA 4J0DA 4AY4A 2F8TA 3VR5H 1P45A 3P0IA 2E82A 2ZAIA 4WLVA 4PYOA 4HGZA 4F4DA 4B7AA 2C2WA 1EDBA 1N9KA 1UBHS 1OAOA 2YIDA 3KJQA 1E3IA 4JKOA 4WK6A 2GQ0A 4XDGA 3S8MA 2O8EA 2EJWA 2RK3A 3QLVC 1KYXA 3JR7A 1P1RA 4Q1FA 1G5TA 1QV6A 4TXHA 3ZS9A 1ZHHA 3NHRA 4LOHA 5FUMA 4JJ8A 5JSQA 4UAVA 3KWMA 3ITNA 1KE2A 3JZFA 4CM8A 1FQWA 4Z3OA 1KC3A 2Y27A 3U16A 3JV7A 1BGXT 4TQ9A 2OSBA 2GETA 3SXPA 1KOLA 3P2EA 4L76A 4QU5A 3WB2A 1I3MA 3DTVA 3TL2A 4OREX 1VPDA 3VPFA 2G1AA 4CMJA 2UYGA 3DMRA 5CG1A 3ANNA 2FEKA 4C4ZA 2IZ6A 3NTRA 2PUVA 2KI5A 3Q3VA 2SHKA 4CNQA 2FMXA 2FR8C 2YZKA 2B1RA 3VAYA 1W87A 3U17A 1HZZC 2Q1UA 2ZDHA 2CV2A 1KI3A 5CVDA 4F4IA 2Y1WA 1ZGCA 2ZSKA 3PU6A 1STOA 5CITA 2P9TA 1U2GC 2HM7A 2WF9A 4MR9B 5B2ZA 2Z9DA 2HCRA 3BIJA 2F59A 2HHJA 3ZXIA 4B76A 2VWQA 4O02B 3VPSA 2YN0A 2QZ4A 2CDAA 2QBYA 3I72A 2R6DA 4Q4HB 1F4PA 1P5ZB 4K6CA 1BGVA 1C8KA 4KQEA 4FR2A 1KJWA 3LBAA 5DBGA 1TT5A 2OZLB 4BIIA 1UF9A 3H04A 2EAUA 1FFDA 4ZVMA 5EINA 3IDOA 1SA0B 2E4AA 5KKCA 2CNNA 1NOJA 2IXEA 1QIDA 4KH1A 3PI7A 5U4QA 1Z7WA 2IX9A 1W2WB 4HQOA 2LXNA 1KMHA 1TM5E 2UZ1A 4JXJA 3PT9A 1H5UA 4DR1B 7MDHA 4LSWA 1VLLA 1WKCA 3ESZA 3FCXA 3F73A 1P80A 5TGTA 1OA1A 2YL2A 4M21A 1SBCA 1RRVA 5IF9A 1LX6A 2ZRBA 1MQ8B 5CIQA 4C3VA 5A4KA 2LPMA 1E2NA 1GHTA 1U5BA 2C42A 3UTDA 3HGTA 4IJKA 5A4IS 5CA1F 2ZRCA 5E7QA 1AGYA 2WLTA 4A5OA 4CEIA 3RUHA 3DO5A 2EKPA 4LVOA 1ZLXA 4IDDA 4W5JA 2CXOA 1PFGA 1YOVB 2WSSA 3L9XA 3TZKA 4XM0A 2PQ0A 3IAS1 4XWWA 3A6HA 2P6RA 1HQKA 1IVYA 1II8A 1R8SA 4UEJA 2IXBA 1OH5A 3W5AA 4UUPA 2CXXA 4GQIA 3REOA 3OE7A 2BTEA 1B0AA 1C7QA 1XUOA 1FW8A 1PKEA 3ICPA 4KE8A 4QPCA 5FAXA 2FTKE 3A6PC 4C7OB 1Y5MA 2GO1A 2N42A 1UMDB 2FFAA 1L8XA 3AR7A 3HRKA 3HYCA 3N7TA 3AR6A 2ZJ5A 2CMHA 4C7XA 4LF9B 3RG8A 3GJ7A 3RYHB 3WGIA 3DPSA 3U3OA 2NNLD 1FDTA 2I2AA 1TUIA 1ZGAA 2UVPA 3C3JA 4J0EA 2OBBA 4I8IA 2HYIC 1BG6A 2CXNA 1K4MA 3ENNA 3OP4A 1KDVA 2QRNA 1PNOA 2YMLA 1N2EA 2JRCA 4JFAA 2IZ1A 3IKMB 3C45A 4X91A 1E5DA 1U90A 1YS1X 2BIFA 3H9UA 3GNLA 3SF8B 3C8DA 1I1QB 3AO0B 1SD5A 3V6LA 4AYXA 1R5BA 4WWHA 4I3HA 3VYWA 2K2WA 1NVFA 1PK8A 2X2OA 2MINA 1PIWA 4JVSB 4B6RA 4BO9A 3E9QA 2B6NA 1X94A 4AJNA 5LDHA 4JHLA 1Z4OA 5I7FA 4FW9A 3WBBA 2ZS9A 3C15C 3OJXA 3P4UA 1UM9B 9GPBA 5H59A 5CD9A 2M9MA 4CXMA 3UT5B 3Q5EA 4HYTA 4E2ZA 1NG1A 1AKQA 2Q2VA 3GJ4A 5CCXA 2FP4A 5F2OA 5AESA 1UZUA 1YS7A 1H23A 1XN1A 2BUCA 3GT0A 3NHLA 3O73A 1PD1A 4G5XA 1VHQA 4K9LA 5AOAA 4ZARA 3H3XA 4B8ZA 4WZBB 4PLZA 4BVBA 2VQDA 1F4LA 1XL0A 3CNHA 1E2QA 3K0CC 1R8QA 2CZQA 2ILTA 5JAMA 1BDMA 2H2HA 4M49A 3ZY3A 2XGSA 1F20A 3AEUA 1ZKMA 5F7JA 4NU5A 3IT1A 3ZDDA 2HMSA 1WG8A 5HKKD 4HDQB 1DTWB 3DF9A 4KYTA 3W5IA 2B92A 2DRIA 2GNAA 1Q7BA 1V3VA 2CJWB 2JIRA 5DSZA 4OI0A 1JU4A 4V1CI 1MZVA 3IMKA 1KTIA 4RV4A 4U7TB 1NE2A 4C0JA 3U60B 1M8KA 4WOPA 4JYAB