4JR1A

Human procaspase-7 bound to ac-devd-cmk
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
247
structure length
223
Chain Sequence
ATYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFKQIPCVVSMLTKELYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Procaspase-7
publication title Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, hydrolase/hydrolase inhibitor
total genus 82
structure length 223
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jr1A00
2QLJA 5K20A 1SC4A 4I1PA 3DEHA 4JR1A 4NOKA 1RWPA 1SHJA 2H4WA 5LU8A 2DKOA 1RWKA 4NBLA 1RHMA 4JJ7A 4JR2A 3IBCA 3EDRA 1SC3A 4HQRA 5IAGA 2C2KA 2QLBA 2P2CA 3K7EA 4QULA 2J33A 3GJRA 3H1PA 4ZVPA 1NMSA 4PRYA 4QU9A 3V3KA 2Y1LA 2FP3A 1KMCA 4D3YA 1F1JA 2H4YA 4EHHA 4ZVRA 3R6LA 2FQQA 2WDPA 2CJYA 3IBFA 5IAEA 3P45A 2C2MA 4QUJA 1NW9B 4FXOA 4I1RA 3QNWA 1QDUA 1I4EB 3R6GA 4LSZA 4AW9A 1SHLA 1QX3A 4NOMA 4D3ZA 1BMQA 1RWWA 3V6LA 4EHNA 3ITNA 2FUNB 4ZVTA 3H0EA 5IARA 4EHFA 4HVAA 1K86A 4FEAA 4JQYA 4NBKA 3NR2A 5H0IA 1CVRA 3P4UA 2H65A 4QUEA 5LUAA 5LU9A 1RWNA 4NOLA 3NS7A 4JJEA 4JJ8A 2QL5A 4EHKA 4IYRA 2C1EA 4DCPA 1ICEA 3GJSA 4N7JA 5JFTA 3R7SA 5IANA 1F9EA 4D3XA 3R7NA 4QU5A 3D6HA 4EHAA 2CNKA 3S70A 3SIPA 4QTYA 3GJTA 2J30A 2J32A 3R5JA 5IC4A 4N5DA 2C2ZA 2HBYA 5LUBA 5IAKA 4NBNA 4AWBA 4FDLA 3D6FA 3V55A 4QU0A 2QL7A 1I51A 4ZVSA 3PD1A 4JQZA 3PCXA 5IC6A 4EHDA 2CJXA 2H48A 1M72A 4QUAA 4AWAA 3S8EA 4N7MA 4ZVQA 3OD5A 4QUIA 4N6OA 4N6NA 1SC1A 2J31A 2XYPA 1RHRA 2CDRA 1RWMA 3DEKA 4HQ0A 2H5JA 3RJMA 2CNNA 2NN3C 3PD0A 3DEJA 4DCOA 1RWVA 1NMEA 1RHJA 3H11A 2QLFA 3KJQA 1PAUA 1RE1A 2XZDA 1GFWA 2XYHA 3R5KA 1JXQA 4QUDA 5IAJA 3V4LA 2HBRA 3GJQA 3DEIA 2QL9A 4M9RA 5IBPA 1I4OA 4QTXA 2HBZA 4JB8A 3NKFA 2Y0BA 5IBCA 1RWXA 2XZTA 4ZVUA 1I3OA 2H54A 3V4OA 3SIRA 4JR0A 1RWOA 3EDQA 2H51A 4DCJA 2CNOA 4PS1A 3H11B 1RHUA 2CNLA 2XYGA 3E4CA 4NOJA 2H5IA 4FGUA 3UOAB 1QTNA 2K7ZA 5IABA 4QUHA 1NMQA 3BIJA 1CP3A 1RHQA 3UO8B 4N6GA 4QUBA 4EJFA 1K88A 1PYOA 1RHKA 2C2OA 3KJFA 4QU8A 4QUGA 3H13A 4ZVOA 5I9TA 3R7BA 5IBRA 4IEFB 1IBCA 1GQFA 4PRZA 3KJNA 5I9BA 4EHLA 4PS0A 3V6MA 5IASA 2HBQA 2AR9A 3D6MA
chains in the Genus database with same CATH superfamily
3OD1A 4WZZA 2D7JA 3LT4A 3USCS 4I1SA 1JHUA 3FFTA 1PUIA 3REQB 1Q3TA 4OX9B 2HL6A 3Q3HA 4D42A 2CVQA 2I6UA 5K05A 2HMYB 3AI3A 3IBCA 4PWYA 1VG1A 1UBMS 1RACA 2JB9A 2QPTA 1VIAA 4H4DA 4X93A 4RZSA 4LYFA 3FYTA 1W73A 3HPQA 2IHBA 3N3AC 4Y9RA 1B15A 1V8PA 2Z3ZA 4YWHA 4EEKA 5C2JB 4G07A 2IYWA 3EYWA 2QRVA 2W6IA 3PGXA 3P94A 1KR2A 5BMVA 2A30A 4RDIA 1F8XA 1EUCA 3HY4A 3DXYA 1GQSA 4MRRA 3ITNA 2ACVA 4KE7A 1E4EA 5JD3A 3K73O 3TOXA 3U19A 5CEEA 3VDNB 3GG9A 1DQRA 4GVLA 2W83A 3PPXA 4FINA 3DEZA 3NBFA 1YBFA 3OLQA 4UZFA 4NAUA 4ZHQA 3THYB 3AHDA 5AKJA 3I6ZA 3JVDA 4N7RA 1XN1A 1Z35A 1D7AA 2P79A 5DLDA 1JKFA 2ZG6A 3C3CA 2CW5A 3IQIX 1SHTX 5JNRA 1JLLA 1XQXA 2CWDA 1CVLA 3GJSA 3O0TA 4NABA 5C35A 4DR3B 3IJ5A 5ALJA 1PW5A 4ON9A 4X3PA 2NVWA 3PDCA 2HRQA 3BXXA 3RREA 4DDHA 1IBLB 4KZKA 3UAVA 5I51A 3MS7A 1NUHA 2B61A 4Q9LA 2J0VA 3HUTA 7YASA 1EE2A 4N8DA 2BEKA 1BN6A 4L9WA 4Y1GA 1G38A 1BEEA 1H5UA 4C0AC 3FH0A 2QLTA 3PITA 1T5LA 2ZUUA 1EAYA 4FFLA 4NE9A 5CBPB 2AA3A 4J0IA 2HPHA 1KP9A 4ZZIA 4BDTA 2WUFA 3DG9A 4FKMA 1NT4A 4JLPA 4HNTA 4NG5A 5JCPA 3LDHA 2UUBB 4X8HA 3UPUA 3HKCB 4XW2A 2V96A 3WNDA 5IXJA 2X8BA 3MTBA 5E0OA 3TW4A 4ZT2A 3V1YA 4KN8A 1NZJA 3ZR4B 1P72A 4JK3A 5KJ6A 3DZIA 4XM2A 1PCXA 4K9PA 4XVQA 2FOXA 4CODB 2B83A 3NTUA 4FLFA 2ZPAA 2YV4A 1YI0A 4NFHA 4F8JA 2C9BA 5T8KC 5YASA 4DM3A 3IP9A 3ZY4A 1JRLA 2AQIA 2CCGA 2R8YA 4TYMA 5KINB 3PUZA 4BRZA 4B3GA 3AESA 1QQ7A 1T10A 4MV7A 4B7ZA 4A15A 4YCJA 4NVRA 2I4LA 3O3CA 4OY3A 4WZAB 4AZVA 1FRFS 2CUKA 3RFCA 2R25B 3GLTA 2O5CA 4F2GA 1OJLA 3SJAA 5K8JB 2FV8A 1XDZA 5CXXA 1JZQA 4GXRA 3JWPA 1GRNA 1E2HA 3DKVA 3UMBA 3R9IA 5ICSA 3KAJA 4YP5A 4BNLA 2FW8A 1M2VB 3NHPA 3COPA 1X15A 2SNIE 1QX4A 4QZVA 4KIUA 1Q12A 2PCJA 2I7TA 4HNGA 2IXAA 3RSHA 5THXA 4BGIA 1MEJA 2WHQA 3I3OA 1NI3A 1VMKA 2B6HA 2I8AA 4XIYA 1WTCA 1J8DA 4L2IA 3ABZA 4N12A 2BHLA 2FKAA 2ZRDA 1OV6A 5DHUA 2NVUA 1NQWA 4AMVA 4PLCA 4J1NA 1H66A 4RMGA 3DW3X 3F97A 3O82A 4X6XA 2AG5A 2DECA 3B60A 4M22A 4UD6A 1NWCA 3EEOA 3QM1A 2ZRJA 4DARA 1HZJA 4ND1A 1ZN8A 3CY6A 1XQ9A 3X1YA 4EY4A 4WEQA 5IU6A 4QULA 5F1OA 5FWXB 1AS0A 3CKMA 2WYOA 1A9PA 4RK5A 1UM8A 3H04A 2QTGA 1ZESA 4LMPA 2AVDA 3O75A 2F9FA 3L7NA 3L7LA 1H65A 1P75A 2W11A 3GT7A 3H42B 3H9QA 4FXOA 4MR8A 2GBLC 3UUEA 5JTTA 2RJNA 1ZGJA 3GROA 4H7EA 4KW7A 1UBJS 1B14A 2XB8A 1HBJA 2NUPA 3C14C 3HJNA 2LIPA 3F4KA 4HGYA 3ISJA 4ZO9A 4EPYA 5J4HA 3IUNA 1SN7A 2WWFA 5CM8B 5LB2A 4EJSA 5CG1A 2Q3EA 3PCTA 4Y30A 4JJEA 2ZUTA 1Y1RA 4DR4B 4X90A 2V7PA 3QUAA 2OV4A 3HP4A 3AR9A 3O26A 1S3SA 1MQ9A 1WBJB 4K46A 1Q91A 1HG1A 2FWPA 4PYKA 1YJXA 4Y2GA 1RZRD 1BMDA 2QRVB 4Z0HO 2XTAA 4RF2A 5BMVB 1EUCB 1QONA 1F4LA 1XYVA 3N58A 4XD7A 1KH2A 5DM2A 3C74A 1QC5A 3OT1A 4IL5A 1E4EB 3TE7A 3UJNA 4ESVA 4X85A 1FBNA 2I22A 5KWJA 3PC6A 3DZ8A 5AOCA 4ZEXA 1SY7A 3IUMA 1MEEA 4FJ0A 4HADA 4R2WA 3X1JA 3L1KA 4ZHQB 1ZHHA 4NXNB 5CT6A 2LDBA 2C5GA 2YUTA 1GCOA 3FETA 3KEGA 2WV7A 5EJ4A 1A7KA 3O74A 4Y9SA 2ZOSA 1RQNA 3R6WA 1JLLB 1GAQA 3FJ1A 1OB5A 1AC5A 1RRGA 1C3JA 2C84A 2VQDA 4HV4A 3H2GA 3R23A 4FVTA 3QGMA 1TMGE 4L95C 5DVZA 5EP3A 4L72A 1RYZA 3AUSA 2YN0A 1J8VA 1ZD4A 2GLXA 4ER6A 2PFKA 3HR8A 3PZBA 2BL4A 4G9EA 1RBMA 2FNAA 2VNIA 1UMCA 4B3SB 4TWBA 4PO1A 4YCLA 1XCGB 4V0SA 3UGJA 4HP8A 5EQDA 1C0EA 1BYIA 1CJTC 5FOSA 1WCIA 3BSWA 1P6XA 3FA2A 4GOKA 5DI3A 1XRLA 2IVZA 5D7NA 3UPTA 1NRWA 4CR7A 3B7WA 2HK9A 4OB6A 4JP2A 4DV4B 3BTUA 5DSXA 3OTOB 3GT3A 2I67A 3LGAA 4NJEA 3RKUA 4XLZA 2R9VA 5FULA 5JSFA 3KALA 4OHZA 5CLLA 2DLNA 2Y3IA 1ES9A 4NNJA 2P6UA 1ZRMA 1AGPA 3F5SA 3I6IA 4N76A 2GNPA 2ZULA 3O7WA 1PDVA 2B9VA 3AESB 1JHDA 1GNQA 1P1BA 1EP1B 2SBTA 2VUHB 3HBNA 1Z38A 3RUDA 1UJNA 2O7QA 3P2OA 3WIUA 5M29A 1MJNA 2Y6UA 1Y3HA 1CY0A 3FNQA 3L93A 3KQHA 3PC4A 2ABWA 2QLJA 1O0CA 1NE2A 2RGRA 5GWXA 1PFUA 2EF0A 2QTVA 1EP3B 4J76A 2WA2A 1WIWA 1Q17A 5TXGA 1VJTA 4MUEA 1OB2A 1AMUA 3AR6A 3ZVNA 1P73A 2AL7A 4UVEA 2VF2A 4EUSA 5BR7A 1QNFA 4KK3A 4J7AA 5KYWA 5JMWA 3C3KA 3Q6IA 1J0AA 1DIRA 3H3FA 5AOAA 2PUFA 1ZPDA 3E05A 1A50B 2Q4OA 1ZHOA 4LWOA 2FZWA 1T0PA 4L2IB 3TTXA 1GVHA 2ZIWB 1SEPA 4G84A 5KYNA 1U28A 1VRCA 1X80A 2B5OA 3KKQA 3ETEA 1HZZA 1V9CA 4MLDA 1BMQA 2NVUB 3WLMA 2FUNB 4Q02A 3QKRA 2V6BA 3HFGA 2G4CA 3Q8KA 5LQRA 4E51A 5JANA 1E7YA 3HQ4O 5FDFA 3PGMA 1NSFA 1WHSA 2UYYA 2E4XA 2X0IA 1L1FA 2IS6A 4BL5A 2EEPA 3UMRA 1Z9BA 4R51A 1A5BB 3COYA 3H1FA 2CYAA 4NFSA 1HSOA 1E5LA 3CLSD 3DE2X 4MR8B 4V0KA 3UKOA 4ZDIA 1UCFA 1YZNA 1QGUA 2HNAA 3HCWA 4MO2A 3DTTA 1X7XA 3TR5A 3UEOA 4JKOA 3VU9A 1KQGA 4IXWA 4LK3A 4TOIA 3WGGA 4BLTA 2NUPB 3EAGA 4DQLA 3LO5A 3WL5A 4JEMA 4X24A 1SUPA 1L5QA 1LNSA 2WAAA 1K75A 4EJSB 3TG2A 1O6BA 1U2EA 2HQRA 4KBFA 1QFZA 1HYEA 3GJ8A 3FTCA 5LYJA 3SEAA 5IX8A 5K0ZA 1U3TA 1W85A 3GEDA 5DHSA 2D8AA 1QH8A 3Q0IA 3DTYA 1RPNA 4H0FA 4QBIA 5DRTA 4EDFA 2ZUVA 3TRIA 3D6UA 3DWIA 3LIIA 1ID8A 1R0CA 2WKSA 2AG1A 3N0RA 4GICA 3FN4A 4HJXA 3WMXA 1A4IA 1C3EA 1PUXA 1QC5B 3OT1B 1O96A 4OLBA 1CXZA 1SCQA 4N4AA 1U3WA 3G17A 2XOKD 2L82A 3FRHA 1DB3A 2JFQA 1S2LA 1NFRA 5CDSA 3OFKA 3V00A 3O93A 3JX9A 1G5IA 1D4ZA 1KVTA 3GRFA 3QE4A 3OHSX 1JIQA 1ODJA 2HFJA 3TNJA 4BV3A 1L9XA 4E46A 2VPQA 3AL3A 3GJ5A 4OMUA 3M5CA 4OHOA 4Q5IA 3NM6B 3I04A 2GGSA 2OE2A 2Q0XA 4AFNA 4CKXA 5I7OA 4KFRA 1I1OA 4L7VA 1REQA 4LSGA 1PIWA 2VBCA 3IEIA 2XNSA 4FKBA 4LI3X 3VPFA 4DGSA 2ET6A 5DCLA 3C3YA 3CB2A 1A1SA 2GUGA 1UMCB 4WMLA 4PNPA 4BFVA 3NBMA 1DG9A 3TQTA 3OEEA 3RSOA 5HYVA 1FVHA 3FFXA 1MO6A 2P91A 1WCIB 1P9NA 2IBMA 3O03A 5JRJA 3CRW1 3T3NA 5DI3B 1GCGA 3DGEC 3QLVC 4FGJA 4PIVA 4E2WA 1VHTA 3M5WA 2QYSA 3G1TA 3V80A 3CF6R 4F56A 4OHKA 4FDMA 2C98A 1TT5A 3D6MA 4NZOA 2YASA 3HYNA 2CMGA 4M0EA 4NJEB 2ID8A 3Q0EA 3A6LA 3R20A 2RI1A 4KGZA 4LUCA 4ZYWA 1RWKA 4QXOA 4YAIA 1N8NA 3D1LA 3H5IA 1W4ZA 3AXSA 2P9FA 3HUUA 3QXGA 2DPYA 3G89A 3WL7A 2ZVJA 2P3LA 3WL3A 4HMOA 4C5CA 1A5TA 4UHJA 3BVPA 3D0OA 3GRRA 3DEFA 3VJRA 2XUOA 2WYVA 4IPTA 2B21A 1T2EA 1W4LA 5DXAA 2GRUA 1TUEA 3NUQA 4E12A 4JP3A 3FVVA 1YNOA 2NXWA 1UKEA 5CGQB 5LM3A 2GF2A 4IJQA 1ZAKA 1IN7A 1YS6A 2EWWA 3K1YA 1CTQA 2QTVB 4JCCA 4HATA 1PZNA 1UT8A 3N7UA 1R4ZA 3GDWA 2WKPA 4LHXA 4IGIA 4OQ4A 1Z63A 4YXWA 4G1BA 3NHFA 2OYSA 5LZ4A 1NF2A 2V8OA 2XHEA 3A9UA 3LZDA 3DCJA 5BQPA 2YHAA 4NBKA 3B6JA 1CYEA 4JP8A 3EVCA 2HK8A 5CNMA 2XA1A 5HF6A 4I6EA 2H57A 2XEXA 4JWTA 3BEOA 4ZOLA 2IP1A 5EE1A 2AW3A 1ULSA 2RDMA 2VCYA 3GRCA 3L1IA 3K32A 4KCGA 2BM9A 2CT8A 1SD1A 3R7NA 1X80B 2EKLA 4DDMA 4HWPA 1OFIA 3UMGA 3X2EA 5JCJD 2JEYA 1RXVA 2EIXA 3QKRB 3VYVA 4BY9E 4DV5B 4QPCA 5KNDH 3ND5A 4IIHA 4Q1FA 1L5WA 1Y4UA 2EFDB 4AJPA 1WHSB 2NX2A 5LUBA 4BWVA 1MJ5A 3BQMB 2I80A 1D5CA 1UJCA 3D2BA 3LOQA 3CKLA 4F71A 2WTUA 4FC7A 3RVNA 3WZLA 3U6BA 1KNQA 1VBFA 2OCXA 3ZEAA 1V5IA 1FK8A 3K8ZA 4ZI7F 1QZ3A 1R8SA 3AP3A 4MWCA 4NYIQ 3ZXIA 1QGUB 1DX4A 4LF6B 1HYGA 1D8TA 1X7XB 2FPPA 1SHZA 2PMCA 3FXAA 3QEKA 4LE0A 4QGBA 2YMPA 4WXMA 2QZSA 1EWTA 2E49A 2FQ1A 3PWSA 4Y6RA 4F12A 1CR2A 3WXBA 1R18A 4IHAA 2GLTA 2VAXA 1ZVKA 4HG2A 2OCYC 3GFFA 3X44A 1T1GA 4IX1A 3TFQA 5GMOA 3W7AA 4V3BA 2WNSA 3JRXA 4L3WA 4LZZA 4F4HA 5LYJB 1W85B 1QH8B 3OC6A 3KSBC 3L7MA 4DUGA 3ZDEA 1E60A 1OASA 5I9NA 1SQSA 1DUIA 4UXJA 5TRTA 4GSYA 2G09A 4YBZA 5DMHA 3QJ5A 3KB6A 1G20E 1GDHA 1O96B 1SUWA 3F6CA 1DEXA 4ZAFA 4BP1A 3U2QA 1I3OA 4YIHA 3K5WA 2OMKA 2V0CA 2XQJA 3BT7A 3IQDB 3DLCA 4IIBA 2QD3A 3NDPA 4ITRC 1UXJA 3P71T 3PUWA 3U09A 2GJ8A 1Q7GA 4D4IA 3V4VB 1ZIDA 4UNQA 4HGZA 5EI5A 3BWXA 3LC1O 3E1GA 4C88A 3IEVA 4N0PA 1J7JA 4KSBA 3NH9A 4JVLA 4TMKA 1GNLA 2Q27A 4KQCA 1RCTE 4ZI5A 1PQUA 4WUTA 2HPAA 4MUYA 4PG5A 4PX2A 1PK7A 1REQB 1YI8A 4URVR 4S0XA 5AKZA 2GHIA 4HD8A 1KZHA 1IHDA 5UKDA 1LC0A 4H1UA 2QTCA 2O2YA 1Q50A 4Z3KA 3OQVA 2ZGVA 1E7RA 1UEJA 5CXSA 3PFFA 3V7NA 1MPXA 1TZMA 1ND5A 2H4WA 5J5VA 3RS8A 5HQ3A 1GT6A 2JIRA 3K0AB 3BILA 2QTLA 3K9LA 2NQ2C 2FOLA 3NP7A 5FL7D 5I9LA 3AUFA 1D4AA 4ICIA 2YY7A 1FDTA 3DZKA 3ELBA 4MRPA 2A3NA 4CRWB 3AU8A 2ZB4A 4J0JA 3RYCA 2WVGA 1ZH4A 2WZQA 4DTCA 3DMTA 3FOBA 3H75A 1VL5A 4PVCA 2V6IA 1GDTA 4R2LA 721PA 1X1TA 4W8OA 4LBVA 1TT5B 4WOKA 2WDPA 3IBFA 3O47A 4FXPA 3K4HA 3G1WA 4II7A 4KNYA 3X1WA 4JROA 5HQTA 1F51E 4AJ9A 2PZMA 2WAXA 4RXMA 1FLDA 1KJYA 1ZEJA 3PRHA 2PR2A 2ILTA 2PUHA 2X4GA 4F3NA 5BSHA 3ECAA 3GJZA 4TXLA 1ST2A 3U49A 4D1YA 2OD9A 4JDUA 1GNRA 2F9MA 3GRUA 3Q8XB 5A7FA 3A4TA 2R87A 3RWMB 1ULBA 1ZLYA 3TIGA 2WT8A 2EKZA 2XECA 5MGNA 5ADWA 3EFBA 1GFSA 1NX6A 5AM3A 4A0SA 1KEPA 1RVDA 5HCIA 2YQ5A 4N7JA 2FEXA 3DXFA 4RIGA 4DUPA 1VPDA 1JHVA 4DNPA 4HDMB 3ESYA 3D7MA 2J3LA 3LRPA 2H08A 2B8EA 1X0XA 3HLYA 4AY6A 2J30A 2BM1A 3TVTA 2OBYA 4JA2A 4WSOA 3TR0A 1K66A 1IUNA 1LPAB 1WVMA 3BAFA 1R6UA 1DWQA 4MKHA 1GRVA 4RHCA 4YRFA 3INGA 4NBNA 4EFDA 4ZOLB 1VLQA 2WKWA 4X6YA 1WP4A 3I23A 3LCUA 5T64A 2Q2QA 2Z5LA 4NMMA 4UZSA 4BX8A 1U2DA 2I7VA 5HCNA 1BWSA 4RK6A 4AD8A 2GYVA 2VP6A 3AYZB 3JATA 4BFLA 2W2QA 3ZNNA 2BMVA 5LMCA 3M6AA 2KJQA 2YINC 4IZIA 5AVZA 4TWJA 3U16A 3AONB 5LJIA 1WEHA 2V9CA 4TVSA 1C3OA 3ZNQA 4JUFA 4GZMA 2ZB8A 2AMYA 2ZSKA 4M1EA 2GM5A 4KR6A 1VJDA 5G3ZA 3RFXA 1P5RA 3R3VA 2GN9A 1TVKA 4C4RA 3GPLA 4ARIA 4DG8A 4NZMA 4MUJA 1ENOA 1Q2XA 2ERXA 2FPPB 2Q3CA 1E92A 3QKTA 3G0OA 1CS0A 6ABPA 2YYSA 2YXDA 3V4RA 3HDGA 5B4TA 4QYSA 2FN4A 3PNYA 5LKAA 1C2TA 4C6SA 3N8GA 5F3RA 3N8NA 5CCXA 2GZMA 2GTPA 1EU1A 4IYJA 4LPSA 3RBXA 4YMSA 4QUHA 3GAAA 5SYAA 2R6R1 3K16A 3VUFA 1RQXA 1ZGZA 2APJA 2V9ZA 5AK3A 1KTIA 1UXOA 3GU3A 1XUOA 3FIJA 1DJPA 5BOSA 3EPPA 3TTYA 5DNWA 3T9AA 1JLSA 1QBKC 3NGLA 3L2OB 4QICA 3S4YA 4EGJA 5AUQA 1Z2OX 4F3RA 1SWVA 5CW2A 4ARSA 4C0HA 1PSZA 1V96A 2VWGA 3QOXA 2X4LA 4DZZA 3MLAA 1L8QA 3IBYA 1JYEA 2BT4A 5EGSA 4MVXA 3T7CA 3BULA 1JQAA 4A8PA 2MJLA 4OXRA 4MOWA 2RCNA 4JLWA 3H5VA 4R8SA 3PUJA 3TZQA 4OP1A 4KODA 2O48X 2R4UA 3RJTA 1A71A 1EIZA 1L5VA 1CIVA 4JYCA 3TI9A 3N2GA 2CXUA 2UDPA 4HN2A 5AW0A 1XU9A 1N33B 4TUYA 3JQ9C 3BIOA 3O9VA 3R3UA 4DTIA 3QFSA 4D9FA 5LDDC 5J2UF 5LP6C 1GQQA 2QQFA 3S2FA 5HQ3B 3JWEA 3L6DA 3WBJA 3AFGA 1QO7A 3KSZO 1M67A 4HVAA 4AIIA 1TA4A 1N1DA 4J7UA 3AKDA 4DS3A 1UBUS 3RVKA 1S96A 2XA9A 3EK2A 1QGOA 4MWZA 5ICFA 2XIQA 3KXIA 2HD4A 3DCIA 1GM5A 3EEBA 4F45A 3W04A 1J9EA 2W6MA 5CM9C 3L49A 1JAYA 2DSTA 3GJYA 4KQ2A 2BYTA 1I24A 3V1KA 3ASVA 4X9XA 3RU3A 2FRXA 4DV2B 1CIPA 3S5UA 5AIBA 1D8AA 3GLGE 5DYGA 2GD1O 2V7BA 3DQQA 4GE3A 3GY0A 5CFQA 3U5ZB 3LXRA 3IP3A 1GNSA 3WI7A 1DMRA 4D3FA 4R9NA 4DIFA 5TJ9A 4Q39A 1C9NA 2I2XB 4WBNA 3GMTA 1WCWA 2I9PA 3TSWA 1N0WA 4EG4A 1VP9A 1B0UA 2HJGA 1KIAA 1GAJA 2FR8C 1EGAA 1XJQA 1V16B 2P6MA 3EVGA 1LTQA 4OQMA 2B30A 1UFKA 2C2XA 3A04A 2ZBQA 1XCPA 2JD2A 4Z8XA 2Q7OE 1I10A 1JWAB 2BFNA 4GWLA 4MPJA 2GRAA 2Q4RA 3PXXA 4JUBA 4CKBA 5CNIA 2FEPA 1XKTA 3K20A 1NP6A 1YK0A 4ENQA 4YCSA 4C76A 4Q82A 2YQ4A 4RTKA 1U1DA 4C2AA 3GZNA 2CXNA 5JWHA 3RJMA 4ZKEA 3QEAZ 4I7EA 1VB5A 3KJQA 2B7CA 4GWGA 1IXZA 1GIAA 3ND6A 4P3XA 4XQEA 1E18A 5EFZA 2FDXA 3DV2A 1R2QA 1U65A 3ZDYB 5FB3A 3ANMA 2G36A 1L7NA 4C7VA 4TTRA 2PL1A 4NCNA 4F4DA 1PX2A 4FT4A 5EQFA 2IL1A 3WAJA 3JATB 3IBSA 3UATA 3KQLA 1UKCA 2XZTA 5HIAA 3MWFA 3I9V6 2E18A 1YR1A 3NWJA 5JS7A 2C2GA 3ED1A 1KF0A 4H17A 4DG9A 3C41J 3EEQA 4NBSA 3CEPB 1C3OB 1VA5A 1QYVA 1Y7HA 2AUTA 1SKBA 2XDWA 3BSYA 3D2LA 4LYDA 2GYWA 4DLUA 4R05A 4XUCA 4BEBA 4PANA 1ODLA 3UJDA 3I61A 4D74A 2FN3A 2QPOA 4ZV9A 4Q47A 4CW7A 3DFIA 3FR7A 1TVKB 1UZNA 1SVNA 4URHA 3BWBA 2DEUA 4ZV4A 1OQAA 2HJHA 4W9NA 3TIXB 2VT6A 5A5FA 2IGBA 4K81B 1RHKA 3KJFA 5DE3A 1X38A 1CS0B 3GRAA 3H2JA 5G2OA 2XCRB 3WIEA 3AJEA 1R6XA 1EDOA 1J2EA 4MCJA 4RPKA 4M8SA 5IXSA 1PZGA 1FVOA 4GPEA 4L5CA 1SQ6A 5JXHA 1R15A 3EH2A 3II6X 4YYZA 2Q4BA 4F86A 1YB5A 2XNJA 3VGJA 3STUA 2CFSA 2IEGA 2Y8EA 4OGFA 1A82A 2P2SA 5SV2A 2UXBB 4L28A 4UHDA 1JR3D 5JS8A 4A2CA 5KQSA 3EUEA 5EMNA 1M5UA 3TLCA 2VHXA 1OGYA 4YDHB 3E1KA 1GUAA 1A5ZA 2ZWPA 3R3ZA 1QF7A 3X43A 4UZEA 5BOSB 2VPXA 1VQ1A 3FCAA 4YMHA 2CNWD 2PH1A 5AH0A 1NURA 1PZHA 5AKEA 4B75A 3OLZA 3U7IA 2AW5A 3IKTA 3D1JA 5DK6A 1N6LA 3BDAA 3IB3A 4P7FA 3V8NA 4RD3A 3NASA 2Q1SA 3JWGA 3KWLA 4ZPXA 1K2VN 3REFA 3TEFA 5CDFE 3EC7A 3LWNA 5IKOA 4B09A 3K70B 4MDEA 4J49A 2ZROA 1VIMA 4JQYA 3HUEA 1DO0A 3G2JA 3PC7A 4IFBA 4O0LA 4O2AF 3OY7A 5TPWA 1IONA 4IZ6A 3A4VA 4LBYA 2PYIA 2BCEA 3H6KA 3S44A 3HMQA 2FWMX 4IEEA 5KVVA 1ZSNA 1VDMA 3N2GB 4HRXA 4YNBA 5AI9A 3VR3A 4TUYB 1SWWA 1M1UA 2Q1YA 3OE5A 1Z4PX 3ZDZB 5CDYA 2JIOA 2X5KO 3THWA 2XMCA 1UZUA 2CNKA 2KSQA 4KAAA 5KVQA 3JQAD 4DLLA 4F60A 3FHJA 3IX7A 3OZBA 3ZQUA 4B80A 5IT9A 1E94E 5CIWA 1QHGA 2EKQA 2Z9BA 3GNLA 1CZRA 2PS3A 4Q4JA 1XMOB 3IPYA 3IELA 1QAMA 2C2ZA 1GAXA 4M37A 2XE7A 4RS4A 3SWWA 4ND5A 3CQ9A 1FZTA 3KELA 2RGWA 2YMLA 3PGVA 3FCSB 4MWBA 5CYFA 4WLNA 3WK8A 1CY8A 3SLGA 4MDFA 2EKBA 1J24A 1I32A 1IEWA 3O94A 4DJAA 3CRRA 3LYUA 3UJBA 5EQTA 2RKWA 3KQMA 4BMSA 3HXLA 1M0TA 4IF6A 2BJWA 2IYUA 2W5UA 1LKZA 1JWLA 5FORA 1FMFA 1KAGA 2H9AA 2O6LA 4WBNB 4BFSA 3O7MA 5A1JA 5IT4A 3R7DA 3OFSA 2XWPA 3LD9A 3KTOA 3ZXUB 4G37A 4HB3A 2I29A 5B3AA 5E4TA 2TMYA 1ECGA 1JKXA 2FW7A 2GXSA 3P8ZA 4FNMA 3MHTA 4ESOA 2Z8YA 5B53A 5JSKA 1ZKDA 1MQ8B 3VDQA 4QDKA 5DNAA 4CKBB 1EXVA 1S6YA 1RC1A 4YONB 4DQXA 2A0FA 2WG2A 1KNXA 1OAKA 2DHCA 4O4JA 1MZVA 1QRSA 4F7WA 1OFGA 3GZNB 2XNHA 5FTWA 1Z2NX 4IIVA 2JGJA 4LKRA 5BWNA 4MJXA 3CUYA 5FYQA 1M1NA 5I45A 4HZIA 1NJ2A 1A8PA 2J3HA 2D0DA 4FMPA 4UEWA 1SUCA 5D3ZA 4BEVA 4EG5A 5LMNB 3EIOA 3M70A 4I36A 1HLDA 2VAWA 2QUBA 1CP3A 4QDJA 2CFOA 4RABA 1MJGM 1SC6A 3DPIA 3HBFA 3LFTA 1ACJA 2BE9A 3EPRA 1BDMA 2QJWA 4FX2A 4QU8A 3VMFA 1Q2UA 2JK0A 4RPLA 4URUR 3I0NA 4V2UA 5BNIA 1BX1A 4EPRA 3VTKA 4HXFB 3B1KA 1G1MA 4IZOA 3KXLA 1PQ4A 4R8KA 3HSSA 1KJ9A 2PV7A 3SYRA 4BAGA 4W7SA 4ARBA 1DRUA 2CNDA 4PNZA 1P33A 1DQNA 1L5GB 5CLQA 2FSVA 3CX7A 1SC3A 3N87A 1HQYE 2W48A 3C98A 4MYDA 1FLNA 3QEOA 3W5AA 1H8HA 3PA8A 3PKJA 1XPUA 2B25A 1SPBS 3I76A 2CYCA 2JBAA 3K0HA 3AC0A 3ELYA 1TM7E 3NBAA 5EE5B 5KCMA 4CNBA 2C9YA 4RULA 4FSHA 2VJBA 3MXTA 2A9QA 2GB4A 1G0OA 1UFOA 4BNZA 4B5LA 2C83A 3DOHA 4KI0A 4UBNA 5ER9A 2WFZA 4A2PA 3U7GA 1DARA 5IFKA 3L8ZA 4GIBA 4U00A 2AE2A 2C57A 2RARA 1CVIA 2F3TA 1TJPB 4P86A 5D5QA 3I12A 3IVMA 1VCHA 1TJNA 2XA2A 2NSDA 3MJ4A 4OM7A 3U0VA 3WMFA 1EESA 1V0JA 1CDOA 2PO5A 5TS2A 3OLWA 1K3FA 4XDHA 4HUTA 5KX5A 2WTAA 2ZSBA 3B1XA 1CR0A 1MGOA 1XZNA 2BRUC 2EZ4A 2VS1A 2WIDA 3ONNA 2BGUA 3DDSA 1ZI8A 3PXBA 2ZTSA 4UTRA 3QWFA 4EARA 1O97D 3NFRA 2IH5A 2WHXA 3FZNA 4KBGA 4JI2B 1KKMA 2ODBA 1KJQA 1XHFA 3L0SA 4FT2A 1U3CA 1H1DA 4Y6OA 2J3KA 1B1AA 1QCYA 4L5IA 5TPWB 3LSTA 4C30A 3ZXXA 2VDQB 4BVJA 4F21A 1EX7A 1EWRA 2IYNA 4LGYA 4RJTA 1E69A 2FQYA 4NZNA 2ZIGA 1V1MA 1ZNZA 5HG0A 1EB8A 3A1FA 1JG3A 5KB3A 2MR6A 2O7VA 1YGPA 2CMKA 1V8BA 3FB1A 3L6RA 4KQ9A 5F33A 1CNMA 3TOVA 3WHLA 1L6RA 1UPFA 2IZOA 3QFCA 2C5LA 4GH5A 4L1KA 4DR2B 3OM8A 2PTHA 2ZVPX 4Q4JB 3DQPA 2H5JA 2VAPA 3DXXA 5K0JA 2Q2VA 5DOZA 2IIVA 1PR5A 4AZ0A 5FEUA 4QGGA 5FBZA 4D0NA 1C7JA 4G85A 1U2GC 2HA4A 3ABSB 3OE7D 5B1HA 5SY4A 4IGEA 3V8EA 2RJOA 4ERXA 2VC2B 1QG0A 3KQNA 2OSBA 5AOBA 4W7IA 4V0MA 5DYWA 1XNJA 3IEKA 1H8ED 1GPKA 1AUVA 3ON5A 3ZHSA 1WL8A 3DHEA 1T15A 2J5XA 2REQB 1IN6A 3C39A 3DNMA 4Q21A 2BCGY 3GRVA 4RGQA 5H3CA 3SXJA 3TRDA 3VZSA 3DO5A 3AVWA 1Y5MA 5T3YA 4YJ3F 2ZXFA 2FFRA 1A9QA 1NN3A 1XGKA 3BE4A 4BVBA 3DBVO 4TSRA 3SVLA 3F6SA 5DW3A 2CXOA 4Y9UA 4ZAXA 2JAXA 1R8QA 4R6XA 4AP9A 2OQVA 1HG0A 2AFIB 5EGNA 4LQ4A 3ROPA 1VL8A 3DFKA 1QG4A 3GLRA 2YS6A 3ACBA 3KJHA 2YICA 2C7BA 1N6RA 1CCWA 3ESCA 4O4JB 1WCXA 1XSEA 4OIFA 1SAYA 5MN6A 5KQRA 4UAGA 2AQKA 4ZJPA 3IVAA 9ATCA 1WUYA 2WFMA 2GNOA 4IIGA 4Z9BA 3QI7A 1M1NB 7ABPA 5HOQA 2IYSA 2PZAA 1CFJA 1V3VA 1R0YA 3U3KA 1YXMA 1GG8A 2JLYA 1K97A 2J46A 4HX5A 1GCUA 3CC8A 3OCXA 2WKRA 2VDVE 1JEJA 4RKQA 1HXHA 3AHIA 2AD5A 3GDOA 2D2XA 1C8KA 1N6PA 4IM7A 4MI3A 1BRTA 2Y1CA 4I1RA 1H3EA 1I4EB 1B8OA 3F3KA 5J9FA 1FYXA 3NHBA 2XGMA 4GKAA 3KDAA 1GZ3A 1LJLA 3TLMA 2D5CA 5BN5A 3LUHA 5G0VA 2UVPA 1K7FB 2ETXA 3KWFA 4MCIA 3OA2A 5DHFA 4CM6A 3AL0C 5HRAA 1WP9A 1NY6A 3DE3X 2JBAB 4ENVA 1T9KA 2EJBA 3OKAA 1EHIA 3TSZA 3HVUA 3Q7QA 2AG0A 2NGRA 3KKZA 1ULTA 4LDRA 4EI9A 4IBOA 5AK0A 3RUHA 4GRIA 1UJ2A 1BS9A 1SNYA 2M98A 3GJ6A 3Q72A 3ZYZA 5IWCA 2ID4A 3BGIA 3GYGA 4X7MA 1TTHA 4XRGA 3WK6A 3UENA 3DLIA 3MCUA 4IFTA 1VI6A 1GLVA 4JGIA 4MYRA 1IMOA 4OHYA 3AKYA 1PVOA 5CIQA 2XMQA 2V6FA 2BD0A 4TTTS 3FX2A 3K2BA 2XUFA 3GMIA 5KX5B 2NPFA 1T5BA 4ER5A 1T29A 1KSFX 1TUBA 5HM6A 1EE9A 2E89A 1N2ZA 2XMBA 4BTVA 3CPSA 5HXAA 5KJFA 5KQMA 4OK6A 1KGSA 3T5BA 3IE1A 4URWR 1IULA 2VLBA 5P21A 4KQIA 2N3ZA 1ML4A 4TWAA 1G0NA 1YIDA 5DGHA 4LJLA 2OCLA 3DVRX 3NWEA 1P2FA 2OTCA 3AR2A 1YT5A 4FS3A 1Z18A 3D8TA 4WIAA 2YJGA 2ZRMA 4C6RA 3TZEA 4BEJA 1V1MB 1Y3CE 2DVMA 4LOAA 4BV9A 3KHTA 4ZO6A 4QJ5A 2ERYA 1VIVA 2G0NA 1GG2A 2BFFA 1MT0A 4JB8A 1R37A 3KOXA 2LGJA 1DO2A 3F47A 2WTMA 4L6IA 4EKYA 3LHFA 5EZ6B 1UDAA 4JR0A 4S1TA 1F6BA 2D00A 1UJBA 3JASA 3DDHA 4NIMA 4HWGA 1UQTA 3CB4A 1W0JD 4OFXA 4P31A 4AZ0B 2Z5FA 1BROA 1GY8A 1W25A 2IRWA 2VTEA 4RHFA 4X20B 4YECA 1XZLA 4MUHA 5JQGF 4OHBA 3C24A 4MUBA 4JJ4A 4IDQA 2I6SA 4X92A 4LYEA 2YXEA 4XGQA 5E1OA 3JD1A 3PI7A 2H1LA 5EIBC 4DMUB 5CIYA 1B4DA 1J2JA 2CE7A 2GAFA 1Z13A 1DELA 2VHJA 2ZJ2A 3QUQA 3RC9A 1UQRA 5A4AA 4BLRA 1M34B 2XGSA 2IPNA 5IN4A 5KNDA 1YHYA 5GVSA 1U7OA 1XLVA 1HFKA 3AG5A 2UZ0A 3HFJA 3OIWA 5DP2A 4JLMA 5L95A 1JF8A 3PEFA 1J09A 1I4TD 3CPEA 2J3EA 3T7SA 3CLRC 3VR5H 1JIKA 2DY0A 1YQXA 4NKRA 4UW9A 5FV7A 1T3GA 1GTVA 3MJHA 5J5CA 1Y8AA 4LV6A 1VLVA 1Q84A 1WMBA 4BVAA 1GSAA 4QJBA 1EMDA 3QA9A 2FE4A 4GLJA 4GVPA 1E98A 4KGVA 3SFVA 5LZ2A 3BD6A 4YUAA 1YKFA 4JT2A 1JQKA 1CBUA 1DINA 1NXWA 1Y1QA 2OHJA 2VA9A 3QPBA 3W5UA 3ZGYA 1ZMBA 2I5PO 4GRAA 4ZMBA 2JJ2D 1TZ2A 2XEDA 4KRYA 3ZZ0A 2FEKA 1IUPA 2CJPA 3A37A 3W8DA 3QEBZ 4JB3A 1LW6E 1OV4A 621PA 3J80A 4F6RA 3D4PA 1TKRA 3E7FA 3EZ7A 3NPAA 1E7SA 1YUBA 1Y81A 1UKZA 4CLOA 4MZXA 1J2TA 1VI2A 3C48A 3OZUA 4B8ZA 2J9XB 2JVKA 3K0SA 3HN2A 5H02A 3WLLA 3CWCA 4Q9JA 1DKQA 2ANCA 2EL9A 1N6HA 1VXRA 4XJVA 3VYRB 1XZJA 1F9EA 1QHEA 2OUKA 4GKVA 3ZHBA 1MLDA 3KHSA 4ROSA 4YMWA 1LVUA 3EQ7A 2NG1A 1A9TA 1WCYA 1HT1E 1AZTA 4NSNA 5H7XA 3R5JA 5BN5B 1ISIA 5DGIA 3FD8A 2R3SA 2UVPB 1ODFA 3B20A 3ZU5A 1ICIA 2QN6A 2CD9A 2H52A 3LWDA 5AW7A 4FX5A 4CGZA 1J0DA 2IZ7A 4MMXB 4BASA 3IPXA 4FDTA 4F4IA 4PGMA 4ZHQF 4XX0B 4YRZA 2CJXA 2P69A 4CDGA 2VKQA 2VDMB 1RC8A 1P1RA 3I9OA 4BTLA 4EOGA 4Y1EA 1T1JA 2KE5A 4MYSA 1OHHD 2Y67A 4RXTA 1L3BA 4YP9A 5IMBA 4E31A 2HADA 1LVGA 4H6WA 3S8MA 5JH7A 1IRXA 1I6LA 1P6QA 3EE6A 3M3PA 4WFQA 5J40A 4MLPA 4KL8S 4NCJA 2BGTA 1YU6A 1YZQA 4ZEOA 2DE0X 3O0DA 4ZEVA 5LP6F 3CVXA 2ZS7A 4OUDA 2O5EA 4L0CA 2KLHA 3QWAA 4WRRA 2YTZA 4PINA 2UUCB 3V9AA 3TKYA 1EFKA 1TUBB 3OZAA 3KB1A 1B41A 3LS2A 5EWLA 2WJJA 2P1ZA 4QTXA 2LW7A 3ZI0A 1XMVA 2AD1A 1GHTA 3K09C 3AZQA 3PJGA 4L75A 2Y1OA 1VMEA 4XI9A 3WGKA 4TLEA 1N5KA 1TEHA 4CMGA 4E09A 3E48A 1E1QA 3EDQA 4S1OA 4KJZA 2D74A 2JFZA 3RS2A 2YWGA 3P5BA 4WECA 1XC7A 1JZTA 4PC1A 5JTUA 1HNXB 2YZKA 2HMWA 1W44A 2X1LA 2J07A 3QF4A 4IIDA 2RGCA 2HA6A 1G6KA 2JCXA 3P20A 1R8YA 1K63A 4P53A 4BX2A 2QG9A 4WQMA 4M87A 5BV8A 1GA4A 4HDQB 4E11A 5FOUA 2V1XA 1EUZA 2AE1A 4PBTA 1NQ5A 3JASB 5ALOA 3BEDA 3JD0A 1T35A 3MAJA 3SS9X 2J59A 3BH7A 1WY7A 3X1ZA 4Q3CA 3H9JA 1F1BA 2PXCA 4BZZA 3BHMA 4NMHA 4YDSA 4FFPA 4LPKA 3OZIA 2DTEA 4G5HA 1QORA 4DQUA 1QO0D 1I0ZA 1T9DA 1UBHS 1JNYA 2ZBPA 4PIMA 3UZUA 1PZEA 4P3YA 3GEGA 5EJIA 3WWEA 2AYXA 1KL7A 2FZVA 1D2HA 1GT91 2G72A 4LYGA 4OLHA 5C3UA 3ZLBA 4WGGA 2WFLA 1OJ7A 1SULA 2PBRA 4HXGA 4MVYA 4NENA 3ZI4A 5ADUS 1E6KA 3RTCA 2CVPA 3LWZA 3QU9A 2G1AA 2P9TA 4E88A 5C9ZA 5DTJA 4QJ3A 1Q0HA 4E4TA 1YB2A 3KVOA 2BGWA 4YRTA 3DE5X 1GYPA 4GOMD 2YZ7A 1NASA 4QELA 2BDTA 3NRJA 2IHNA 2A59A 5CUQA 4JFRA 4CWAA 2IU0A 1ICEA 4Y6SA 3AJ8A 4LY9A 2A0YA 2Y1DA 4J6FA 5EHZA 1UKBA 2VSXA 1VPVA 4RTRA 1QDEA 1SQGA 3PQCA 4YRQA 2GHRA 2XYQA 1XHEA 4ZQIA 2YJ3A 2ZRGA 4YO8A 3B82A 3F7OA 2ADFA 2RGNC 1DOHA 1IBSA 2F90A 2CCJA 3DDUA 2VVTA 4JJAA 2PBLA 1MKYA 4K5QA 2EGGA 4F6RB 2R1VA 2VJKA 1D6SA 3UT6A 2I7XA 4LIPD 2VA8A 3GO4A 2DR0A 4I8XA 4PQEA 3NTRA 1IM8A 4M98A 3R74A 2XQGA 3FJYA 1NIJA 3LQ2A 1ZM4A 4KXUA 4PV7A 5CJ2A 9GPBA 4I1UA 2VQ3A 4L50A 3Q0TA 5C81A 4WAUA 1EHCA 3O6VA 3LHSA 1M2EA 1VE5A 2XB9A 1FOEB 4MQ5A 5FJJA 3CEMA 3MLEA 5DIFA 3I0ZA 3NTLA 2Z8XA 3FPKA 4LVOA 1KOLA 4PYQA 4UKDA 4BWFB 2B6NA 2PZEA 2J31A 4URZR 2BUCA 2CDRA 1KO4A 3HI4A 5E95A 2JDID 3TH5A 1XA4A 3H11A 5WRFA 5TJHA 4LXQA 3LDFA 2Y27A 4MQLA 2Z98A 4MVWA 1RI1A 1DAMA 2DPMA 2PKEA 1OIVA 2QUKA 3CNNA 4D4LA 2G67A 3KT0A 2GPAA 2WP0A 4BE9A 3A3PA 4C4PA 4G0UA 1IOZA 1XMXA 3I5MA 4AT1A 5JZSA 1KETA 4MYTA 5JH7B 1ISPA 2Z1NA 2IEBA 1E2KA 1CUBA 3GFTA 2QQGA 1WXFA 1I3NA 3D3KA 1T9ZA 2VUTA 2ONKA 3F9CA 1HQDA 3PX3A 1YFLA 4NH0A 1BWQA 4D6PA 1Q20A 2I66A 2IELA 3C87A 3KZMA 3Q7IA 1DTWA 2JFFA 4ID3A 4OUDB 1QPBA 4TL8A 2GEVA 2P5YA 4E1BA 5E6SA 1MHTA 4EGSA 4GDFA 1XCBA 2W2OA 2WD8A 3RANA 4NYIR 3RFUA 2GAAA 5EWLB 5CLGA 3B1FA 4GR4A 5JG7A 2RGXA 3TGWA 1WO8A 4RJIA 4YYEA 4AKSA 2OC4A 2NLOA 2ZBUA 4XDGA 1G66A 1UJ6A 5CJPA 3EDYA 5TT0A 3KKPA 2XMRA 3AY3A 4PSUA 1SCJA 3LAWA 2JLQA 3WL6A 2BR4A 4UTNA 3D1VA 3AI7A 2DKOA 2H92A 4RH1A 5HRUA 4AS1A 3IVRA 2C7VA 2X2EA 4Z6KA 5KQPA 4XUEA 3QF4B 1JLHA 1X19A 4BX3A 5TX7A 5CVTA 1UBCA 4W1SA 1AKNA 1B3BA 1VM6A 5ALKA 3S0JA 2I6XA 4WASA 4EGCB 4ZVPA 4UOZA 2HMTA 4C21A 4NZYA 4Z9YA 4LI0A 4RL4A 3WR5A 3MD9A 2XJ9A 3CONA 1OTXA 2OCAA 1YVEI 1LX7A 3CKYA 3U1VA 1N3BA 3BIWA 3G5AA 4IJKA 1B8NA 1K7XB 4JLSA 4O08A 4PLTA 4NYMR 4RWEA 3CZ9A 5CTJA 3HCRA 1BW9A 3BMQB 4OQLA 2EWVA 1SVIA 3DKKA 4LJRA 2XUQA 3IQGX 3E5NA 1A96A 1YUMA 2QZJA 3MMPA 4HDCA 1JLRA 1N5LA 3P4UA 4MVJM 1P7PA 4L85A 4UVGA 5ENDA 3RRYA 1PJLA 4Z2YA 1KA9H 2QQ5A 4PHHA 3UYKA 3HVIA 3D6VA 1NY5A 2CJFA 4NE2A 5TMPA 4W5NA 1PVDA 3VNBA 3GX1A 1TYBE 4YAUA 1V4BA 3CTPA 3K92A 4MW9A 1DKPA 4MYCA 5C8ZA 1Y8CA 2WFLB 4NENB 3WYBA 2F62A 5KC8A 5ALNA 3DHVA 2IQ5A 3D0RA 3MJTA 2Y1FA 2CKMA 2I76A 3M9LA 4FHEA 4IXNA 4L6AA 4TXHA 5PNTA 1RZRA 3HYRA 5FPTA 4RFSA 3JQQA 2G6BA 1WZCA 4U63A 2GZ3A 5JAIA 1XEWY 3K1TA 5AVJA 3AEXA 1U90A 1RXEA 3BORA 4V0NA 1UOEA 1K5GA 1XEWX 1Y7TA 3TG8A 4NCIA 3PCXA 3RVMA 5TVKA 1RXYA 1HDEA 3B9RA 5BWOA 1EVEA 2HLDD 3PNSA 1FU4A 3JQDA 5T7BA 2G40A 2IY8A 4C03A 1A5AB 1AQ6A 2O2HA 3MOSA 3LRTA 1K8ZB 3OKCA 4F6CA 4TZ6A 2P5SA 5EP1A 6YASA 5HKOA 1YVUA 2O2SA 2RI0A 2R1VB 4G1EB 1DBVO 4FYIA 4GPTA 2QTFA 5M3BA 5JZBA 4PO8A 1V1RA 1H2EA 1LWNA 5C18A 1M2JA 3C1AA 5EUCA 1KGDA 1NR1A 2PKCA 3KAPA 3ZK8A 5EHIA 2HT1A 3L5KA 4MRNA 3TZ6A 5B6IA 5KKNB 4FTWA 2H4ZA 3HEAA 2H1IA 2JGMA 2IE0A 2Z09A 4IVRA 1T5TA 2O2DA 3WX0A 3L8CA 1Q5PA 2XTNA 2PMFA 3QPAA 2YVAA 4UU8A 5F1KA 5JSUA 1NVBA 1FL9A 1A2KC 4KDEA 1ZXBA 1Y6JA 3W6ZA 4CEHA 2UVDA 1XE3A 4TLAA 5HFNA 1MB3A 2GZRA 2IOFA 1R1DA 3H11B 4D4JA 2PUGA 3BCSA 4KOAA 4Y6PA 4II3A 3LECA 4EMBA 5JAPA 1UP7A 2RGYA 3GBVA 3TLAA 4E30A 3C0KA 2G8LA 3SOZA 3IIKA 5CLIA 3HBAA 4CF7A 3MWDA 4K6FA 4WNIA 4PHTA 3P9KA 4XD2A 3LHIA 5D01A 5FI5A 3ND9A 4KG7A 4LC9A 1M2NA 2NZ8A 1TRKA 3OPVA 4ND7A 1VXOA 4QQRA 3STYA 5JNUA 2ECOA 4DR5B 4I1PA 4KPEC 1PT8A 1IZ7A 3A28A 3CMCO 3E82A 5CA1F 5KJCA 3ZCTA 2DTXA 1I3MA 2RHJA 2ZBRA 5EXXA 4PFKA 4XIJA 1DTWB 1GZ7A 1XOIA 2VJCA 3D6JA 4JBLA 2OO3A 1P8AA 4YFVA 5E6SB 4DHWA 3FMGA 1V4NA 5ENVA 5K0LA 1HKHA 5KYUA 3FPLA 1NV9A 3F7MA 4W8HA 5EJGA 1QRTA 2FPOA 4MX8A 1C5KA 4DW8A 1I5RA 1E79A 2ZRNA 2H2HA 5EIOA 1VLZA 3VR4D 2FFQA 3MCWA 4U6NA 3SLKA 4ID9A 2RHOA 3HJBA 2I34A 4TS4A 1MPTA 3NVDA 4G5OA 4F11A 2W2VA 5B58C 1ZLXA 3HV2A 1DSSG 2VP9A 4US1R 3STTA 4EYOA 2PWYA 4CIBA 1U8UA 1UBLS 2XMZA 3GNTA 1Y4AE 2ZIEA 3HNOA 3OZSA 3QV1A 4B84A 1JILA 3TNYA 4C1BA 3ELUA 3EJ6A 3L06A 3X1MA 3GUUA 4Q93A 5DT9A 1ZD1A 2HDNB 3WGUA 5DJ5A 5TMBA 4TLBA 4Q3KA 4FQ8A 4ZVKA 1NW5A 1V4VA 3H65A 1T8TA 3KQSA 3B1ZA 1KARA 2VXYA 2PQ0A 4LYJA 1V47A 5E8JA 5CXUA 2OZLA 4JAVC 5LXTF 2NADA 4JX8A 5DU2A 5CM2Z 4EPTA 2GNAA 1BW9B 2C9DA 3V8QA 4CM8A 4UXHA 2ZBEA 1HMPA 2FJ0A 3ZQJA 1E0SA 4OLAA 2EYQA 3SF8A 3NATA 5JS1A 4QYTA 3IQZA 1T9HA 1EVJA 1UMKA 5GZ6A 3VAAA 2GERA 4KPGA 4DWWA 3FAKA 3K05A 2ZS8A 2A14A 3H19A 1XTPA 3MRTA 2CC2A 4O1IA 4QXPA 4E5SA 1YKSA 4G4JA 2VTBA 4WY8A 2C59A 5CG2A 3O2JA 1Z25A 5IJ0A 4BFYA 1UMBA 4MKFA 1OCEA 3EF3A 3TAHA 4RTSA 2QN3A 4RFSB 3MBOA 4KO3S 5EJ9A 4EFLA 4O4LB 1G3MA 1IN8A 2BKEA 3OQHA 2YJ5A 5HKLA 3V4FA 1F06A 3DL0A 2AXNA 3RU9A 5AVTA 3UW3A 1E9BA 2CUNA 4ZAZA 1JG4A 1G63A 2XOKA 4HFNA 3VPHA 3W4KA 3WNVA 4DCSA 4EB3A 3JAMA 1M0WA 4B45A 4FYYA 3E7PA 5DBGA 2G17A 4IUBS 3T61A 5FV4A 3T5AA 2Y0BA 4D80A 2OENG 4I1YA 4YLEA 2QJFA 2Q0HA 3VKFA 3B2EA 1BKDR 2QOEA 4PGFA 4AMBA 4RLHA 1TCVA 4M0UA 1V1RB 2V8BA 3WXMA 2FSHA 2WUDA 5T67A 1E7MA 1RSZA 3HJTA 3PHCA 4UJ5A 2O7SA 4AVYA 1PJ3A 2HUPA 3EGIA 2NZVG 4ZWNA 4D8YA 5JNTA 4RU1A 5DBIA 3CZ5A 2OK8A 4XCQA 1V41E 1N5DA 2IU3A 1ZZEA 4O3FA 5H3HA 2QRGA 3SGLA 3G3EA 2IS2A 2DULA 4IDAA 1D6MA 2C0PA 2W2TA 4U7FA 2EFHB 3A32A 3S2UA 1N2BA 2RHMA 3ZVLA 3R7AA 3WRVA 3UK7A 1RJWA 5JSHA 4B3TB 4QFCA 2ZB3A 1XZHA 4UMFA 1JPUA 3WGVA 4PGGA 1AKRA 4CEHB 3DOOA 3PLAE 1N1MA 3PXGA 3DVSX 3HB5X 3OTHA 3T1TA 4Q4LA 3OQBA 3NC0C 3S55A 2ZE8A 1Z4NA 4NBTA 3VNRA 3SFTA 3CSDA 2YDXA 2GWRA 3QSGA 4H7KA 4XYEA 3NOOA 4MP8A 3V2GA 3WYEA 3FLAA 3DE1X 3MUNA 3NO4A 4B87A 1L6IA 2GF0A 3MWDB 4P84A 1RFLA 3KZKA 1T9CA 3AY0A 3R7FA 3JYPA 3TBHA 1O94D 1II9A 2RC6A 2FP3A 2ATEA 1RP1A 1CHDA 1I80A 2X3YA 2O8FA 1RLJA 1RXUA 5H9WA 2PWZA 3ZZNA 5EWMA 1ONPA 3EARA 5IKMA 4YJ2B 4EVSA 1YQQA 4MW1A 3AM1A 3DEYX 2OV3A 3FLBA 4R0VA 1GPBA 1XZAA 4F2WA 4Y1RA 3W5DA 2YHIA 2BE7A 3HZZA 3ZVKA 3NHZA 1BMFD 1NF3A 2NSHA 5KYUB 2IY9A 4JLAA 1GGMA 3QH4A 2RB4A 2AXQA 3ROGA 5JZ9A 3C3AA 2J0QA 3ANLA 4A26A 1Y1SA 2HQSA 3OICA 4HQOA 4IIXA 1XB2A 3WJ1A 4JV5B 4TLMB 4JXZA 1XF1A 3M3DA 1R9JA 4REQA 3PKIA 1Y4ZA 4IH1A 4ZEWA 3ZE9A 1NTOA 1QIDA 5T6BA 4D45A 4INPA 4X95A 2BBOA 2OCKA 3A3OA 4FYVA 5HJEA 5DF1A 2HU5A 2ACKA 5K2OA 1T24A 1WQ3A 1E1CA 1V1JA 1CDDA 2WE8A 4FOOA 3VKVA 2Q21A 5BVHA 3ID6C 3MA0A 2EU8A 4FFNA 1P4HA 4GM1A 5C1DA 3BMOA 3HC7A 1NL3A 1S3FA 1UBKS 4QM7A 2C9OA 5JCJA 4LF4B 2NM0A 5CA0B 3PHBE 4IIYA 2ODTX 1FMCA 4ZGWA 3OOHA 1E4YA 6NULA 1KO7A 3NNSA 2FEAA 1FP1D 2VP5A 3FSJX 5IC6A 4MSUA 2VYQA 1DAFA 2OZLB 4FS8A 4M0PA 3HGQA 4LN1A 2GX6A 5BW8A 1OX4A 3QIAA 2COEA 5JADA 2CV1A 1EUQA 3BRSA 4CM8B 1ZD2P 1QKIA 1T8RA 3U7EB 6PFKA 1RMQA 3FZQA 2QVXX 3D3EA 1MG0A 3ETCA 4WK0B 2WZBA 3EZ6A 3GXOA 3SF8B 1PR9A 2C4KA 4J3FA 1PK9A 4JELA 1GVNB 4LCJA 3V1UA 4AYTA 2COUA 5IN5A 4Q4HA 3VPAA 5ELMA 1X8LA 1Q57A 3BF7A 1VRWA 3IP6A 4HUQA 2QM3A 3G2NA 4BRSA 2FEWB 3LT1A 4BB6A 3P0IA 2VTBB 3TM5A 4OHCA 5KNCD 2D54A 4NP6A 4RVNA 4ZV7A 5IJ0B 3MERA 2GM9A 1UMBB 2WSMA 5KYXA 2GXQA 2BKVA 2HR1A 2PUBA 1PK8A 1W52X 1XKQA 4KLAA 3SK0A 2XTMA 5BYKA 3S29A 2QIPA 1RHUA 1JDNA 1A0OA 2HRCA 2ODQA 2NO7A 3B51X 1E3WB 2EKPA 3JYHA 3OQMA 2FZKA 3DLAA 1JLMA 2AYYA 4I3FA 1VE9A 2RBGA 1XA0A 4TT8A 4P83A 2L0XA 1SO8A 4TLDA 4FFWA 3K31A 2O4UX 2WF9A 3MCZA 3G6KA 4AQYB 3H13A 3NJ8A 5A2GA 1QQBA 1QJ4A 1EWQA 4RBNA 1TZJA 4LHWA 2FN7A 1S8FA 1ST3A 3A1VA 5M5BA 2DX7A 4S1NA 3TOSA 2CXXA 3CFYA 4IV5A 1H0KA 3DBIA 3LUAA 1P61B 2R60A 4J0CA 2GASA 4J4BA 1ZOPA 4JMPA 4P5PA 4BLQA 4B76A 2Q6VA 2O2GA 1LLUA 3WNBA 1MB4A 1BCRA 1PTKA 3HR7A 4B2PA 3IVXA 3T6KA 1DL5A 3DDOA 4G65A 4JJKA 5A4FS 1DT3A 3SQLA 3G5TA 1GV0A 4WZAE 3H87A 2HRRA 4FYWA 4QHTA 4Q1CA 3W3ZB 1LH0A 2DZDA 3WV4A 5AI4A 1LI5A 1T5OA 1GUDA 3WIOA 5FL7A 3CO0S 1YMUA 5AVXA 2IHZA 3KFLA 5ERXA 2XPCA 4LZOA 3O91A 4AY2A 1NXTA 4LOJA 3QPDA 4MIEA 2QZ9A 2YV1A 4QOIA 1KOGA 5DN6D 5JEDA 1N78A 4JKYA 1FE8A 1I14A 3UTCA 4MWOA 1SCUA 4RVSA 5ALVA 3R7WA 2A9RA 2WSBA 3WKBA 2WWVD 1N5IA 3EGEA 5BSVA 2PT5A 3ABQB 1MO2A 5DIZA 4D8XA 4NS4A 1YA4A 1VPLA 1FRVA 2OCBA 4J4TA 1U0LA 3I8OA 5FLKA 5L4LA 2Q5QA 3L8HA 5EWMB 1JWBB 3ZE2B 1O3YA 4NL4H 1U0BB 1YE5A 2A5JA 2HHLA 1ESDA 4U0JA 2W7TA 2KBFA 2LD4A 2WUGA 4R1LA 5DEIA 1DCFA 1ODIA 1PGJA 1T36A 4Y1RB 2J32A 3RB8A 2YHIB 3I9V1 4YRJA 1TO6A 1S4MA 2VRCD 1UZLA 1JFVA 4XLLA 2GPTA 1TCCA 3CEJA 1M2KA 2DR2A 2C5EA 4RVHA 4EFKA 1Z33A 2O8EB 3CW2A 4YWJA 2X8LA 5FI0B 4AXXA 4D7AA 2Q9AA 4AROA 2JLWA 4D9KA 3IIMA 1LRKA 4OSPA 3OWXA 4REQB 1ABFA 3F8SA 2H48A 5DGCA 3VC7A 3AVOA 1OW3B 4LY6A 2I8LA 3VR5A 4BQSA 2J9GA 4YJ2A 2KW5A 2HUNA 3LQ1A 3RE1A 1TIBA 5BVHB 4AKGA 2ISQA 4ESHA 1Z62A 2OGSA 3GA0A 3TQQA 2QX9A 5B6JA 1X7YA 4A5SA 3BMOB 1ZA1A 5C7OO 2I2CA 1N0VC 3ZWKA 2QLLA 2XNDD 4B3HA 1MORA 4BO1A 4ENPA 1VLLA 1E99A 4RGYA 5DLYA 2E5LB 3NHSA 1N8TA 3BWDD 4H7FA 3C45A 3T7EA 4M46A 3I53A 2QT1A 1AOXA 1DAGA 4IEIA 4QBTA 4EUEA 1OX4B 1FF9A 4JEHA 3O8OA 4RDXA 4NATA 3NANA 3QV2A 4I50F 3OZEA 4N9WA 4TV9A 3IXLA 4ZODA 4X71A 1RWOA 3GCWA 4FMCB 1ONSA 2OHFA 4Q7QA 1QRRA 2OG1A 2IVFA 4QO7A 4ZVMA 1V95A 2FRVA 3Q4GA 1T8UA 1W6UA 2FEMA 4Q4HB 3N6VA 3UOAB 1ZD5A 4Z1OA 2PSEA 1VBNA 4YJFA 4RTMA 4HUQB 4B46A 1M75A 4HTAA 4KQJA 5B7QA 1C80A 1RKVA 2BZ0A 4Q19A 4BVLA 1KS9A 3WFZA 5J4LA 5JISA 2IDKA 4M38A 5KBYA 1PYOA 1R3DA 1TJ4A 4C08A 5KYXB 5KSWB 1NQVA 2C07A 1MHPA 2P9GA 3V6MA 4QPDA 4N5DA 3ZWDA 5IUNC 1POWA 2XSZD 3KFXA 4KN6A 3CCBA 3AR5A 4AZWA 4X62B 4R9RA 2V7GA 3M33A 1L7BA 5DM60 3T0IA 1FUEA 4LJ9A 1VHWA 4MHTA 5F7OA 4PLYA 4P2GA 3WFJA 4ND2A 3E15A 1E61A 1NXOA 2QTBA 3DMDA 5KYVA 1O57A 1OLUA 1XRQA 2EW8A 2I99A 4G2TA 1LJUA 5DB4A 2H4JA 2WJIA 4IDOA 1L7QA 1Q7BA 2F3PA 3IQEA 5EMJA 5IK2A 1LBQA 3ICVA 3PP8A 1WXHA 3E6AA 1OZ0A 1QDUA 3CF4G 4L02A 4A91A 5TNXA 3ZK9A 2HCJB 2XMGA 3E0XA 3KOMA 4UASA 3GUVA 1BCRB 3PSHA 3RS0A 4DJ5X 2JLUA 1G5FA 1NT2A 3R1IA 4J0GA 4KXYA 5A5VA 1TTPB 3A4YA 1SUEA 2QENA 3E8XA 2ZFUA 3ZGXA 1QIIA 2Q45A 1WVIA 1DQSA 2EEZA 3F67A 4B83A 4Z9FA 3G8CA 1YRBA 2QS9A 1Z75A 4G8DA 4IZHA 4OFBA 3WLIA 1AO3A 4YRIA 2XKKA 2PE5A 1JH9A 3C8MA 3JTEA 2PMDA 5JBIA 2B8WA 3H84A 121PA 4UPDA 4LDPA 5L3ZA 2VKTA 1B8UA 1ZA2A 3DJFA 4BDSA 4C3OB 4BLWA 3U17A 3T9EA 5L7TA 1XJWA 3HXOA 3U3ZA 2OBXA 3WK9A 4B17A 1W34A 1Z2AA 3A1EA 1SCUB 2MYUA 5C37A 3R7WB 2QSUA 1E6EA 3AIOA 3HL0A 3ORRA 5AJXA 4QT0A 5FI1B 4BVGA 2VQEB 3RIMA 3IC5A 4RGBA 2EOAA 2QU8A 4LJSA 4WLVA 2FYTA 4ZCSA 2PNJA 4AB1A 2ZBGA 1TW2A 2ZETA 2G9QA 2ZYGA 1F0YA 3CLUC 3LSYA 3N7TA 4TWZA 5COAA 3TEJA 4G25A 3FNFA 3DMTC 4MH0R 3KYIB 2D1FA 4E5KA 1LX6A 1LK5A 2CLMB 3FPJA 2TSYB 5LQCA 1QZXA 2Z4SA 1T36B 1N36B 3T5DA 1QHHA 3I1JA 3KJGA 3DUFA 4OXXA 4BNMA 2O14A 2WT9A 3WQHA 1WETA 3R9XA 1E0KA 1PG0A 1QVAA 4HPJB 4IQ0A 4S24A 2HB6A 2HK6A 4U9HS 4BU1A 3C1UA 2OAQ1 1C9YA 2GRJA 1I8TA 5LIPA 2XLCA 1OBVA 3GF4A 4CKEA 3CX8A 3GJQA 2IXGA 2VF5X 4N18A 3EGDB 2JIZD 3EAFA 1I4OA 3ISTA 4HY3A 3H5NA 4GP6A 4XSGA 3TTVA 4MV9A 3RVJA 1TJ5A 3IAAA 3WYDA 3HRHA 3MWGA 1YR6A 3EHEA 4IHJF 1TYAE 4D41A 5BUSA 4PPNA 4YAJA 4I4TA 3CNBA 2XUZA 5AR1A 3BKXA 1X7YB 3WKDA 3T35A 1WZ2A 4PSAA 2X86A 3IRUA 2VDKB 1EAMA 3OJXA 1P7VA 3WGLA 1JSRA 1TAGA 1L5YA 3QBDA 3T1OA 4CHTA 1UFRA 2REOA 3IXQA 3I64A 3B5EA 4YK7A 1GR0A 1ABEA 3JZDA 3KVNA 4GKJB 5DV9A 1ISFA 1JHAA 1PD0A 3O8OB 2FWRA 4TV9B 3EZ9A 4FIDA 4RHXA 1B0AA 2H1FA 2YJ4A 3AJ9A 4V39A 4G0QA 1U2DC 4MROA 5C53B 1GA1A 4JR1A 3PNOA 3GRKA 4O4HA 4XUDA 2ZUBA 4MGIR 4HEJA 3DAPA 4J75A 1MCZA 3LGXA 3U7JA 4LXYA 2ASEA 3W1EA 5BQ3A 5IF9A 4X3OA 4KX3A 4EKDA 1VGRA 3EEYA 2N47A 4R7GA 5BMVF 4LQCA 1BS1A 3HXMA 1U0HC 3WRYC 3NIFB 4E2ZA 4GLOA 1W49A 3HKEA 3INRA 4OIMA 1RAGA 8ADHA 4KFSA 4WN3A 4PQYA 1ZL2A 5DZSA 4JP1A 1JR3A 3SJBA 2PJDA 1Z2DA 4QUJA 3M1YA 3VV2A 1O89A 1W2HA 2UYGA 3A27A 1ZUWA 3M6FA 4QD3A 3RU7A 5LWQA 1D9ZA 4QFBA 1M6NA 2IUTA 4EPWA 5A03A 2DU8A 2CNWA 2VT3A 4TL6A 2JFNA 3A1WA 4N82A 5CK5A 3RO7A 1BEZA 3I9JA 3RWOA 5EOVA 3DMPA 2GZ2A 1TF2A 2JJ1D 3PDIA 3WAGA 1JQJC 1OLUB 1GAEO 4ZT4A 4S1VA 2GETA 4HAWA 1DIGA 2AFRA 1BH2A 3D3QA 1LLCA 2J5RA 4HAVA 1CEEA 1XQYA 2Q4DA 3J7AC 4G2NA 1EBFA 3ZLVA 3GFGA 5JAHA 4F4FA 4XB2A 3IVGA 4G0YA 5LA6B 4ZP1A 3VTFA 2UVQA 5DSZA 1KZ6A 4N0DA 1SQ0A 4WY5A 1IUKA 3DZDA 2YC4C 1AHPA 4BKRA 1J5XA 4OI1A 1XWFA 2FSFA 2RK6A 1P2SA 2ZJ5A 3VVCA 3LC7O 2XMPA 3JQAA 2E5FA 4A9AA 4P4NA 3E3MA 4EVRA 5BW6B 3STWA 3GEHA 2W70A 1PJSA 1ADJA 3ITDA 4EFMA 3X1XA 2VLIA 1VMIA 2YXLA 4FEEA 2PRYA 3LYAA 5B58T 2V9PA 5BQOA 4WEOA 3K15A 4BNDA 3VHQA 1YCGA 2M6RA 3G7UA 1XMQB 2CK3D 1X9GA 2WFAA 1PFVA 4Q3AA 1Z5GA 1JVBA 1NFFA 1UBOS 4F3KA 5KREA 1VZ3A 4MZDA 4RK7A 3CNQS 2R0QC 1H4QA 2YXPX 3L9XA 2B92A 3FPAA 3THXA 3AUXA 4XKJA 2XQVA 1AS2A 1ETUA 4C0KA 1NNUA 3UN1A 1YC5A 1YMQA 3W8NA 3OF5A 2DH6A 1VMDA 4YALA 2FWNA 5EZQA 4MXDA 5K0SA 5IM4F 2YY5A 2NP6A 2LR0A 2HKIA 4ZPJA 4AZSA 1NN0A 1A7JA 3NFYA 4HEA6 2X9LA 1CUUA 5HM8A 5F9FA 1QHHB 1XV5A 1OBFO 3DUFB 2QAIA 1PQYA 3LP5A 1P6UA 1RYEA 2FPUA 5HF9A 1JFRA 2V59A 4CLHA 3R9XB 1VGQA 3ELWA 1GN9A 4EKNB 1Z17A 2ODWA 2FUEA 4NOJA 4TSFD 1ZU5A 1UH5A 2FHSA 4CKEB 3ZBPA 5C8YB 3B36A 4PYOA 1U6KA 3WIVA 1QFMA 1SG9A 3IJRA 1AX9A 3PUKA 3BIJA 2QLNA 3SEZA 2J9ZB 4QXRA 4KIGA 2H4FA 4CPDA 3R7BA 4CTOA 5LUAA 5I7WA 4MV1A 3ME5A 5AOVA 1KDRA 5COBA 1C7EA 4IEFB 1KE1A 3L43A 2EBWA 5IASA 3P9ZA 4DABA 4PS0A 2P6PA 4I4TB 5KSPA 3WB2A 1O08A 2E85A 3AQIA 1K89A 3PEUA 5NLLA 2ZSEA 3EW9A 2IPOA 1WSBA 3VR2D 3SS8A 3FNBA 1YVRA 3OEYA 4NE7A 2QTMA 3L0OA 5DPMA 3L7KA 1Z2PX 2XVXA 4OJYA 1QG2A 4IS2A 1ZNWA 4AJ1A 4D0RA 1VP3A 3RT1A 1TPYA 4KDCA 3GUYA 3GGPA 1K27A 2QVYX 2PHZA 3OTGA 4YUWA 1QE5A 2HFKA 1LF5A 2IHJA 4M1MA 4CUJA 1IWPB 1SCBA 2NV2B 4R83A 2KM1A 1W19A 4CR8A 3DCYA 3AR7A 4LQLA 3V2IA 2INGX 2YR0A 3VAYA 2JGDA 5B64A 1QPGA 3TRKA 2V4MA 1WPGA 1V5WA 2BR3A 3FE2A 4TRJA 1ZJ4A 4Y9DA 4YI5A 4R01A 2AXEA 4D9HA 3IAFA 4QRIA 1E4VA 2ZRCA 1UMDA 1XLWA 3L3BA 1H93A 4X41A 5G40A 1HLFA 1NNSA 4M83A 3WMEA 5C4IA 2AHRA 4H4CA 1XZBA 5DTQA 2FPRA 1AQLA 3CSUA 1HDIA 5FHRA 3Q6MA 2XVYA 3GCXA 2D5AA 1X2BA 3N86A 1AKEA 3JYLA 4QPZA 2QIOA 2EFGA 4W9NC 5AI5A 5ECYA 1KSGA 3SZMA 4B6QA 3RBVA 4S0ZA 1L7PA 3OURA 4UHHA 4C78A 1BA3A 3QU2A 2JLAA 2ZRFA 3T9FA 3ILSA 1VPWA 4I99A 2GBGA 2WWXA 4UQOA 1DE0A 1PV4A 3FYSA 4QSHA 2QTWB 4E94A 1I30A 1PS8A 4K6CA 1BGXT 3RVQA 5AVSA 2H16A 2Z8ZA 1EK2A 1BOOA 1OXTA 1DUSA 4ZQFA 3TKAA 2WSIA 2EGUA 4LY3A 4FR5A 4MJ7A 4QFMA 2V54A 4DANA 1PWHA 4AKHA 4BLSA 3SC4A 1Y63A 4OQFA 1RYFA 5AUOB 3N2LA 2VR1A 2QY9A 4FPXA 1R50A 1RWQA 3MCTA 3IR5A 3TRFA 3M6IA 3CBQA 3G2IA 3S28A 5F4ZA 1WSDA 3GBPA 1RYDA 1NMXA 5EWJA 3CF0A 3TUZC 1ML3A 2WKQA 3C5CA 5M34A 1OH8A 1T8SA 4JYZA 4M7RA 1V37A 1KDOA 1T2VA 3TQRA 1N8KA 2E6UX 3DEJA 4YGYA 4B3CA 3L77A 1KY3A 1ZAYA 1XWIA 2QLFA 3A9TA 3JQAB 5FNZA 1KFCB 2PWBA 4BC0A 5K8LA 2Y05A 3QX8A 1CS4C 3TSAA 4LOLA 4AJ4A 1UFQA 6GPBA 2C5BA 2RE8A 4M9CA 4XJTA 4G5FA 4BNDB 1A9YA 4EKGA 1X1BA 5JPDA 2ZP1A 2QRJA 4KLRA 3OE7A 1E1MA 1JVNA 4LDAA 4EO9A 3CNHA 3KHKA 4HO1X 4BBJA 2BHRA 1WLYA 1G9SA 1Z5UA 4UBMA 3AM5A 5MDHA 3U9TA 4ZCLA 5JYEA 3THXB 1Q19A 1H8EA 3PFCA 1DEOA 1OD6A 1OKKA 4H2DA 4QFDA 3O8QA 5AJYA 4OL9A 3VSAA 2P62A 4TYWA 1TKAA 4LTMA 4YJHA 1JHXA 5E4YA 1MFZA 2VOJA 3JYNA 3RAPR 2RD2A 1P2DA 1AK1A 1CF9A 3PT9A 5CW1A 2MSWA 2VJAA 3E1SA 2FX2A 4YAEA 4H1WA 2PD3A 2P6RA 2OGTA 4NONA 5HWSA 2C4NA 4RVGA 4YRLA 2V5VA 4KR3A 1FRZA 4G0ZA 4Z7JA 1MXFA 4LOHA 4LCBA 3ROZA 2RFLA 3GXBA 1RDFA 1OSNA 3CJRA 4LHVA 4LQDA 3GIDA 3HY6A 4M1TA 4CU5A 2BH2A 4PM4A 5ILOA 4NBLA 4RZXA 1IZYA 1AXRA 2ZI6A 1BJKA 3H4VA 4DLZA 1U0TA 1SQFA 3CHYA 1LD3A 3NYIA 4QWWA 4Q37A 3RT7A 4D0GA 1QHYA 1P77A 3AETA 5ALFA 1WW2A 4IHQA 1TO2E 2GZ1A 2QSZA 3R3SA 3CG0A 5LQDA 4DLKA 4DKJA 1WXEA 2A2ZA 3N7AA 1PNVA 2CJYA 1ZR4A 1DADA 2OAEA 3RIEA 1D04A 2DR3A 3I28A 1EDEA 4PTLA 4CM1A 1M6YA 1G8MA 4X61A 4DF3A 3D4OA 4AO8A 2C5FA 2O0LA 3OAAD 4HB2A 3T1HB 1BQ4A 2C00A 4AJ2A 1L7RA 1NQXA 4RW0A 1YA8A 1CUZA 3TNDA 2WAMA 1XDUA 2ZJ3A 3EULA 1OXKB 2ALJA 1UIMA 5KNCH 4DCPA 4D82A 4E15A 2RH5A 3HJRA 5ALQA 3RAEC 1PF7E 4DRYA 2R62A 5CDGA 3DBLB 4B8WA 4BNWA 4I19A 4KUEA 3PICA 4MDYA 3HXTA 3BRQA 1XALA 5EJ6A 2JGDB 4JZKA 4EGQA 3K6RA 5EHGA 4EQ6B 1LPOA 4CMCA 3NU1A 4BNJA 2G82A 1JDSA 2CY0A 4K05A 1FIUA 1S9HA 1UMDB 2GUWA 3EPHA 4ZYZA 5TY0A 4ZOBA 3KU4A 2WJVA 5BSKA 3PL1A 1A4RA 1P3DA 4UOEA 4OO3A 2FSVC 3A05A 1JEQA 4R2MA 5CYPA 3VR6D 4XE5A 1J4AA 4HYTA 2JI4A 4XWWA 1TQ8A 3DL7A 4TS3A 1E6LA 1SKQA 4ZDKA 1N5MA 2RCYA 5HRCA 3U61B 1TE2A 5BUCA 3G9TA 3JQ8A 1R16A 4PIPA 3UWDA 2F00A 3IPCA 1QKKA 4L27A 3B1VA 5FWYA 1UC4B 2C03A 1A77A 3PQDA 2VTKA 1AXGA 4I4CA 4NPCA 4AMUA 3D8BA 5FA5A 2VJPA 3K0CA 2VHUA 3KQKA 2G5GX 3IP1A 3KDSE 1JXQA 2CVOA 4B85A 3GJ4A 5BSTA 3Q7EA 2FRDA 5H82A 5IYZF 3QUBA 1FFXA 2BM8A 4FGKA 1SOAA 1YS9A 3UT5A 3SQOA 2P0YA 4DRZA 1Z2EA 3C5VA 5EWJB 2TYSB 1AV7A 4F9EA 2N1BA 4IMJB 1DZIA 1ZGAA 2I7DA 3DYVA 1N2XA 1T6YA 4B6JA 4DJFC 1N34B 3VO1A 4DBLC 2HJSA 4D9JA 1U0EA 1RAIA 4OCZA 2A9KA 2VYVD 2AFHA 2Z2KA 1P19A 2QW8A 5KKCA 4H08A 3COSA 4MHSA 5C7YA 3W05A 4OKSA 4FR2A 5ESDA 2M2IA 1PZFA 1KTVA 1DRJA 1QGZA 1DAEA 1OI7A 4L0QA 4PLZA 1EGMB 3HWSA 4JX9A 5FWDA 3L8FA 4Q66C 2KPOA 1DJLA 1BXKA 3U3MA 2QF7A 5DFAA 4PRZA 3OJEA 5ALWA 3LUPA 4FGZA 3M2TA 3V34A 4FN5A 5EC8A 3V2HA 2HYIC 1NJFA 3FWZA 4YP7A 3TD2A 2X9VA 4FYPA 3O8QB 1NC3A 2B7LA 3T7TA 4D2IA 5ECWA 1L4UA 1KQPA 3G8DA 3VOAA 2YRWA 4MQEA 1IJBA 1FPQA 2A5FA 2QLBA 3K5IA 1GGNA 3N3BC 1OAOA 4CN9A 3E9CA 3B78A 3AGPA 3D6NB 3SYTA 3F6EX 1P18A 3TUIC 1PEKE 1GPYA 2VNAA 4JLJA 2IW3A 1A9RA 5DHPA 4DAOA 4ZYUA 1ZH0A 1JUDA 4EL0A 3A1DA 1DQYA 2FA9A 4XRRA 4E2XA 2K2WA 1NM5A 2OZKA 2WIFA 3URKA 1JA1A 2JFUA 4RAQA 4A16A 1JS1X 1ISMA 1E89A 1RT9A 1U9YA 2CE2X 4ZQBA 1EZ4A 4ZAGA 3UJ3X 4MVJF 1X3SA 4GLLA 1G6HA 1JXOA 2FVXA 2OGUA 5EIHA 2HEIA 4YREA 4DUYB 1XX6A 2BMWA 2PMKA 3AETB 4YBRA 4FWBA 1EQ2A 3BC1A 3P4YA 1R5BA 2JJ2A 3AB3A 4L0DA 4O4IA 3A6PC 1RIFA 1ZC3A 4JN6B 5IVDA 2WD7B 3PJRA 4KMMA 1X86B 3FY4A 4UEKA 3QVSA 3UMYA 3HXKA 1UOPA 4LECA 2ETVA 1IIRA 3I2IA 2P90A 5BY2A 1Q1GA 3D3JA 1FNSA 2PKRA 2B82A 1U0SY 2X0KA 1P9OA 3CCFA 2Q99A 3F5MA 4HLUA 5BO5A 1QVZA 1DEHA 1B16A 2B98A 3IUQA 1L5MA 3ETDA 3IAS6 3R5SA 4DT1A 1V8ZA 3ODPA 1G2IA 2MSDB 2W43A 3PFWO 4QPJC 1JU9A 2BEVA 2PDAA 1LY1A 4JUAA 3UJ9A 3TCXB 4BFXA 2R68A 1SCNE 2A9FA 4Y6QA 4JNCA 3RCBA 3B6KA 3KXKA 1O4VA 3P0EA 2AR7A 3OEED 5ALSA 1N7JA 1VBKA 2GH1A 2V7WA 1MTOA 5LZ7A 3EQ9A 4Y7DA 1NUQA 4X7RA 4O8ZA 2XVAA 4XVRA 1YMVA 2PIDA 1Q1QA 5M7EA 3L18A 4PG6A 2PSJA 3ZPXA 3AFMA 1SQ5A 4ZIRA 2I0FA 1ZM2A 5DTMA 1IEVA 2IUYA 4NEGA 2WDZA 3PLNA 1PR6A 2B4RO 4GOJA 3QE3A 1SU6A 3MM4A 3WC4A 1OHHA 1YZ3A 1VHQA 1DNPA 2Z6QA 1JEQB 1SKUA 2M6LA 2ZSUA 3C8DA 4DJTA 1LW7A 1U4NA 1VE1A 1ZITA 4LYYA 3FVWA 5DNYB 4JVSB 4FGLA 3JQ8B 2IYYA 3G2OA 5KI6A 5KWSA 2WLSA 3WLPA 2F8MA 2H8GA 2IJGX 5FWYB 2JLBA 4MR9A 3FPHA 2BV3A 2O1WA 2YUIA 2DXIA 4QBFA 2YYAA 4KNWA 4WK4B 2EX1A 5P8WA 5JJKA 2WWGA 4NNPA 4YJGA 3ZJUA 4GL4A 2XDQA 1EX9A 1KEVA 1DXHA 3A6EA 4EPXA 1FFXB 4RV4A 1NI5A 4RMIA 4KXXA 3UT5B 4OFWA 2DTDA 5EJ7A 5IKXA 1YQUA 2W6QA 1QH9A 4RVFA 1WE2A 1SBYA 3DB2A 3IAHA 3KVVA 2II6A 5EMMA 4CYMA 2PJUA 5DMXA 4NICA 3LPCA 3OIFA 4XQ0A 2XCIA 3RAFC 4OXKA 5TT1A 2AFHB 3IAEA 1OE0A 4QGFA 2I4NA 1Y3DE 3AR3A 3RRBA 1JDBB 4U7TB 3DOFA 3L8GA 1J33A 4B44A 1CQWA 5F51A 3WQQA 1K5DA 4IVQA 2FFHA 4AURA 5AUNB 1JHRA 1UJMA 3GJRA 4YACA 3S2EA 3ZV4A 1II8A 4EJMA 4YRBA 3CVWA 1K68A 5LNK1 3KU1A 2XZOA 3C7CB 2FCAA 1HV8A 4RV9A 1IPHA 3DZFA 1SVMA 5FLEX 1Q74A 3CJQA 4MVCA 3KT6A 4H15A 3D59A 1VCMA 4JP5A 4LHZA 1USWA 3VHRA 1JZSA 1KC1A 1USVA 3MGAA 3W8EA 3PKZA 3ED5A 2M32A 4NZZA 2I6GA 3A14A 3C8ZA 4MQEB 4D46A 5GM1A 2WAOA 3GDGA 4W1QA 1R0XA 1PBTA 3UB4A 4BGEA 2QHXA 2BTQA 1ZBDA 2UUOA 3LNTA 1KZGB 5T3UA 1Z22A 1FSGA 1H6AA 2F1RA 2VWQA 2ZSHA 2YYYA 3KZVA 4FCTA 4D4HA 1INLA 3HNPA 4XGKA 4OLFA 5CB6A 2NYAA 4S1WA 5TQ2A 1P39A 1IK4A 1FTNA 1WDMA 1T6NA 1Y34E 2J6CA 1QYCA 4JOCA 5DSTA 3RYHA 3HWX1 3ECCA 1RBYA 5JSZA 4WI1A 1D0IA 2DGDA 3ESBA 2VNKA 4O4IB 4JC4A 1HE5A 3M6MD 5B3LA 2WJYA 4Q3BA 1U9JA 4BNIA 1ZK0A 3UHPA 4M88A 1J2RA 1N77A 4TTVA 5B4UA 1YZHA 2ZJ7A 3N53A 1PR4A 2QG6A 1NPYA 5C4GB 1KZ9A 3KKEA 1ECBA 4QC2A 1S02A 4WFIA 3ZZ1A 4PG8A