3V32A

Crystal structure of mcpip1 n-terminal conserved domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
156
Chain Sequence
b'DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease ZC3H12A
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural study of MCPIP1 N-terminal conserved domain reveals a PIN-like RNase
pubmed doi rcsb
total genus 50
structure length 156
sequence length 163
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v32A00
3V34A 4G24A 3V32A 4G26A 4G23A 5FT9A 3V33A 4G25A 5DIZA 5H9WA 5H9VA
chains in the Genus database with same CATH superfamily
2REBA 2BBWA 2EV9A 4XVHA 3VZQA 5BXYA 1G6OA 2FWBA 3R77A 2JFQA 5CDFA 4KO2S 4URZR 4W5JA 3UY4A 4TYWA 4A23A 2IBMA 4ZA2A 2FFHA 3LQRA 4H1HA 4UJ3A 2LCQA 5KINB 2GN4A 3LT1A 1Q6YA 3F98A 3O1LA 3Q3IA 3IT0A 1YE8A 3DDCA 3H2JA 4F2HA 4B3SB 3TQRA 4JS0A 4QTUB 4RAQA 3L4SO 3PNKA 1K6EA 2CL5A 2P40A 4RULA 1Z5WA 1UCFA 1HSZA 2GF9A 1XWFA 5JLAA 5DBGA 5AW5A 2AW5A 3ZUGA 3VZRA 3HGMA 3H1EA 3QXGA 3FNFA 1M8GA 1A50B 5CB4A 4TSKA 1X94A 4QD3A 4BX9A 1G0NA 5IZCA 1LXCA 2CUKA 1CVIA 1F0NA 1GJRA 4MYUA 2D5BA 1VIMA 1XZLA 2XTNA 2II6A 3ZKAA 8GPBA 2P65A 3KQQA 1LLDA 4DILA 4L9AA 4X66B 1WB5A 1H5QA 1Y3BE 2EL7A 3D6JA 1YB7A 3A1FA 1TECE 4DR3B 1Z56C 2WJGA 1E3SA 4WZAA 2MSLA 1IM5A 1JYEA 2NVOA 1ZLXA 2C2BA 2ZUWA 3SEAA 1BMDA 2FP4A 4RY8A 4L75A 2WM3A 3DDUA 3KPUA 1TUGA 3NH9A 3TNJA 3R9XB 4HLQB 2HIMA 1AHIA 2D2FA 2IYTA 1FX0A 2JLAA 1O97D 2Q9UA 2QN9A 5KYVA 4WCFA 4AMZA 4I66A 1KMIY 2BM1A 1LPSA 4J0HA 4G23A 2J32A 2WJZB 3QBJA 3C0KA 1WTCA 3QVTA 4MYSA 4PAGA 1RI4A 1KVUA 1LWNA 3F7OA 3O73A 5B37A 4IKPA 4V0QA 5AXAA 4NAUA 3BL5A 1RRFA 1RZVA 3WADA 1E4YA 2ZJBA 2HMYB 1WVIA 1XXHB 1IZYA 1PU2A 1TMOA 1ZW1A 3N86A 1Z8DA 4QLOA 4RHTA 4YJHA 1IWBB 1ZH6A 1IQUA 3BXZA 3FCAA 3FVWA 4Z4EA 1WR8A 2D5CA 3EBLA 3ZXUB 3RT9A 1UXKA 2C58A 4FHCA 2X0DA 3TBHA 1J0CA 1U1CA 2OUKA 4IINA 2COEA 3TOSA 4MB6A 3JWHA 5L3RA 4QOIA 4C4YA 1E79A 2ZIUB 4GT1A 3CX4A 1XEWY 3WWEA 1QB7A 5IC5A 5LA6A 3KHKA 1NATA 3HPRA 5BR7A 4EJ2A 5CPFA 1UJNA 4TV8B 3E1SA 3M0EA 2HSWA 3CRRA 3V8PA 1P7YA 4IHQA 3A9VA 5AH0A 3VVLA 3MSXA 5CVEA 4GLBA 2ZJFA 5JUWA 1QB8A 3HMKA 1E1QA 2Z08A 4KK3A 5ALYA 2XB4A 2BFOA 3VJRA 3MFYA 1XZHA 2CSUA 2FFRA 3SM3A 4RMNA 4EECA 3KQLA 2IT1A 2Q2OA 3VJKA 4BVJA 4TOIA 4W7SA 1PJRA 2ZGVA 1IHPA 3IQHX 3P27A 3TTSA 1ZIDA 2O8NA 4WNYA 1D0VA 3ONFA 1MAUA 2BKXA 2DTDA 4R2MA 5BV1A 5I8WA 1K68A 1ZJJA 3HZOA 2Z3ZA 3HFSA 3SBOA 1DS6A 3LUBA 3WNZA 3PCRB 1VLJA 1FSPA 3DBLB 1CRPA 4JOCA 2UUCB 3ZHXA 4HR7A 1ZX1A 2Y05A 4EF4A 2WD7A 1XCPA 3G8DA 3CC8A 2C7RA 1B8UA 4IGIA 1T5SA 2TMYA 5FQNA 1E6MA 1AUXA 1V3QE 3EBPA 4JP1A 2GPNA 1R18A 1AK1A 3THRA 4PG6A 4XA8A 1JPNA 3EUFA 4M8LA 3PX2A 3FSGD 4J2TA 4HAWA 1XGKA 1P2FA 4B75A 1EESA 3KBOA 1BCRB 5FKJA 3R8CA 1B43A 3ETNA 5BV0A 4DSTA 3T0FA 1YJAA 1RYMA 2EJTA 2HT6A 3W5UA 2X8JB 3W9YA 3CA8A 3D8SA 4H3HB 4O59O 1JF8A 1YDMA 3VR4H 1UKEA 4E5VA 2ZSHA 2Q3BA 4WZBE 3OT4A 4O4IF 1D0SA 1Q3TA 3BK2A 1JR3A 5AHRA 5FR2A 1WMEA 1UH5A 4Q3EA 2GM4A 2WAOA 4DKJA 5DYNA 5E2AA 1XNRB 3RU9A 1OYOA 1I4EB 1N5LA 3FFTA 1CZOA 3N76A 1W73A 2FOXA 3GROA 4D82A 5KNDA 2JL1A 3WLQA 3P2OA 1ZMOA 3GDWA 3PXUA 3TNDA 2AZTA 3GJ3A 3EA4A 3TQFA 4QXPA 1EFCA 1SN7A 3VPFA 2JNWA 5BW8A 3I5UA 2XYRA 3GZTB 1K0UA 3L7JA 4L6IA 2H2GA 4L7VA 3K09C 2QLBA 4ROTA 5CNKA 4DZTA 3X2FA 3KD3A 4M0UA 1DKNA 4AY6A 4Z2AA 3PYXA 2HV9A 4CGYA 2VDPB 5IASA 3PTAA 2I9PA 2R1TB 2ZTLA 4OQ4A 1R4AA 1YK0A 3FAKA 4YRRA 3KHTA 1VHDA 4ZK2A 2C2ZA 1QGUA 2KB0A 5BR1A 1W76A 3L92A 3FNGA 1E0KA 3MGCA 3GRZA 3SZMA 4LF6B 4EYSA 1E3DA 2WKWA 4LYAA 3CX8A 4I1SA 4EG7A 4PEVA 5KOYA 4C7OB 4L9SA 3BMCA 1ZOSA 4KK4A 2PMCA 1D2AA 2O6HA 3IC5A 5IZ4A 3W77A 5FAKA 2CSXA 2QRZA 4D0RA 1G9XA 3LTNC 2V7VA 2AG1A 3L0ZA 4O4IA 4CKEB 1EFRD 3FPLA 5AICA 2WWVD 2ZSEA 4Q18A 2OO7A 1OXSC 3OZVA 3NHWA 4LQCA 1ML4A 1FDIA 2Q5IA 1K6IA 3CZMA 4K5QA 5AM5A 2FI1A 3UUFA 3DTNA 1RXWA 2R5NA 2NYAA 1PFQA 2D2VA 2RGUA 3ZBPA 1AZTA 3OU6A 1A9XB 3OZFA 4RM3A 4B81A 2NU6A 1L1QA 1HFEL 1SHKA 1IHOA 4U02A 4Z4HA 4NU5A 2IHNA 13PKA 4EBFA 4AZ0A 1QVWA 3NHZA 1H23A 2CZCA 3Q3JB 5EIXA 1F6WA 3GLUA 4L2IA 2NN3C 3R75A 2OP0A 4I1YA 3WQQA 3SG0A 1Y98A 3DCJA 4IS2A 1KEKA 2HJSA 4OU4A 2AN4A 4DBVO 4G07A 1IDOA 2INGX 1XFDA 3EZ9A 4PRKA 2ZITA 1ULHA 3TVYA 2PWBA 1OWMA 5I9NA 3DLHA 2X3UA 1JEYA 4HATA 1IVYA 4RDHA 4DV4B 1NE7A 4OAOA 1L4GA 4CG1A 3UMMA 1AKRA 2OCBA 4Q3KA 1H66A 1Q74A 2O9JA 3ZQUA 1S3IA 1Z12A 5LL6P 2O2GA 3M1AA 1H8EA 4AO8A 9ATCA 4KQFA 1QYIA 5KTTA 1EFTA 4FFBB 3QLUC 1E64A 1X7DA 4EFKA 1C9YA 4MQFA 3G9XA 2VTBB 5I7SA 2CV2A 1T8YA 3SQLA 1DNPA 3H7AA 1DG3A 3OZXA 1QRSA 1SQ5A 2CYCA 5THQA 1ZITA 4TTQA 4YCDA 5M04A 4UCXA 4RMGA 1PS8A 4TZ6A 3AFOA 1U3UA 1CS0A 1AXEA 2QTBA 3MINB 5CXSA 1AGXA 2GPSA 5HOQA 4HBGA 4MV3A 2DX7A 3OT1A 2O0MA 1XU4A 3WGZA 1E2HA 4DJFC 1G3RA 3O74A 1PFGA 4Q16A 1J6UA 1IIRA 3U26A 4BKRA 3ONWA 3IURA 1T0IA 1AKNA 3FSEA 1DAFA 3DKVA 1ZKDA 3IALA 5FUMA 4XYEA 3QKRB 4ZV9A 2IE8A 2AC7A 4YUXA 5BMOA 3OZ7A 1RRGA 3DMTA 4W4TA 3THYB 4ECAA 1IK6A 2VRBA 1QWSA 4OXQA 2JJQA 1S8OA 2BGTA 1WY5A 1OH7A 2GZDA 1N7JA 2H5JA 1XK6A 2EAUA 2WTAA 1B41A 3IIIA 5FYDA 2QBYA 1W6RA 1XLTA 4OO3A 3E8XA 1D6JA 2YV1A 3GFPA 4C03A 1CY8A 4YRCA 2X8LA 3N8IA 3G68A 2H06A 3MQ4A 2CDNA 3HI6A 4FFMA 3P2EA 4X41A 4YACA 1ZUHA 2I03A 4RHYA 4DA8A 4E4YA 3LY7A 4JZKA 2Q6OA 5K0FA 4RF2A 1A7UA 4R9NA 4FD3A 2OZPA 2E55A 4AG6A 5JJIA 2QM3A 4ZP1A 1Y34E 4XTRA 2J7PD 3UWDA 2HRQA 2IZ1A 1F5NA 4KFUA 3BCUA 3QWHA 2BEVA 4M2LA 3ZY6A 4A2CA 4YWJA 5L3QA 2XT0A 3GFBA 1FP7A 2YFKA 1P7CA 3BWYA 5DGDA 5DV9A 4ENVA 1T9CA 3K0HA 4AY3A 2P9TA 4UFOA 1TK3A 2HH9A 1GSIA 5EFZA 2G80A 1D9ZA 4US0R 1E2EA 3CEMA 3WLJA 2AFIA 3CN7A 3KJGA 3VDNB 4B82A 5CCEA 4DUZB 1WW8A 5IT0A 3ABZA 1H2YA 3EWIA 2KMLA 1IC6A 5LMUB 3RK4A 1HTBA 1OMOA 1ZZEA 4L4UA 4Y6GB 1KJYA 2ZT8A 1B16A 4FYMA 3QPCA 3NV7A 4EA7A 2J9RA 2W6IA 3EH2A 4Z7QB 1SWVA 2J0QA 4R31A 2ZRHA 4BEBA 5AM3A 3KZCA 3GBPA 2QB5A 3CUUA 3HG7A 1FQOA 4ZT7A 2OMKA 4Q1VA 3W4KA 2J48A 4HS9A 4TVBA 1GCGA 4KRFA 5DYTA 3OHPA 3IODA 3OETA 5K3EA 3ESAA 2H3EA 1JHUA 3FROA 3PGJA 4JJ7A 3ZH2A 5JPDA 1YE3A 3IDZA 3MEQA 4UXHA 3V8RA 4KXMA 3QY0A 4YP6A 1GRQA 4L22A 4DIKA 5FLKA 1J21A 1RACA 3F5DA 1O54A 3MWFA 4RV9A 5A5VA 1FJ2A 3HB0A 2CEAA 2JIZD 4L4XA 2YWBA 4UM9B 3GNSA 4EUSA 3FA2A 1SVKA 5JXHA 2JASA 2VHXA 4YJGB 1Y3HA 1UP4A 1WV0A 4CVNA 1CBUA 1E98A 1QDUA 1UFKA 1XK7A 2NO1A 3ED1A 1RXYA 4YRZA 5A02A 3R6LA 2PKQO 3LSYA 3F1KA 3EY4A 1H69A 1UEJA 3RYHA 3UAWA 5EWLA 4UDNA 1AOXA 3JATB 2GGSA 3FOBA 1LJLA 4UFPA 3AFNA 2BDEA 5AM4A 2FEAA 1E3TA 2DJ5A 1R4NB 2ZBGA 1Y48E 3OEHA 4XQGA 1Z37A 3HVIA 3KVYA 4P4SA 3V8VA 1ZU4A 2WUVA 2GTHA 1U6JA 2BGMA 1EA7A 4RIFA 3TFOA 1L7AA 2TS1A 4UUQA 1LJUA 1VPTA 4F0JA 3PJRA 1GQSA 1JJIA 1CIPA 1M8KA 2HMUA 3A1EA 3EXFA 5JCPA 1QCYA 2BEUB 4GVXA 2E37A 1Q19A 5C5CA 3UMVA 4CDMA 1D1PA 1UFRA 1ZD5A 4G1CA 4NCXA 3RIGA 3TMKA 5TJ9A 2P2SA 4TKVB 2L17A 4F11A 2O52A 4R69A 3U44A 2BH9A 3BKWA 1JFFA 1L1RA 1NIPA 4W1SA 2BUCA 1E3LA 3LC0A 3NBQA 4D1YA 4JSRA 4X0EA 1J2JA 4MDEA 2XGMA 2B2XA 4NK5A 1W4RA 2BM9A 1XN1A 2FMUA 1T3TA 1Y8RA 1DP4A 3ILVA 4WV3A 3WYNA 4KXLA 1IB6A 9ABPA 2HMVA 2VATA 1OGYA 1BDBA 3FUUA 5BV7A 3MT8A 3FTDA 4V1CI 1ZH4A 3AVOA 2FDCA 4OVKA 1X7HA 3FKSA 2C5GA 3WLNA 2IHBA 3DEAA 4JL6A 1BS2A 3KS9A 3L1VA 1GZVA 3D0OA 2W6MA 1AGYA 4BV3A 2AR0A 4DNFA 2HR1A 3EJ6A 4O4HA 3CEJA 3L1HA 4Z86A 3SYMA 2UYCA 5LZ2A 5AKHA 1EFHA 1II8B 4NPHA 4HOYA 1C14A 2FEXA 2YN2A 3FCYA 4FXOA 4RHFA 4JQZA 5LIPA 3AVUA 1V47A 4WKBA 4BWYA 3HYCA 2JLBA 3GNQA 1MA3A 1ZUWA 4YHBA 3V4VB 1UDWA 2RGAA 3CZ9A 1HH4A 3D8TA 4PG4A 1X42A 2PWPA 4Y9SA 5P21A 4IEEA 1YVPA 4KWTA 4B3TB 1RWXA 1TF7A 2AXPA 4UTXA 9MHTA 3CVWA 2ERXA 4YAWA 2CY0A 2B1JA 4AB1A 2GPAA 4HNRA 5KAMA 3W0LB 1ZCFA 1BVRA 2RHLA 4UHKA 4BO2A 1VBFA 2CHFA 3Q7QA 1Q1QA 1T91A 3DOEA 3V7UA 3QEAZ 3HDYA 3K16A 3GPBA 3A4NA 4O8ZA 3IMGA 4G2TA 4EVQA 5DW3A 3IR7A 3AKYA 5E9WA 4YMHA 5EIEA 5LP1A 2BGUA 4GR5A 3DV9A 1CFZA 3B38A 3CO5A 1AKYA 3SR0A 1DEXA 1BEZA 2GWRA 2YNMD 3F3YA 4RANA 2BHLA 2RGRA 3VR2A 1LB1B 5I9TA 3GZ4A 3H19A 5FWYA 1WUYA 5DNAA 2GH1A 1NRWA 3V4SA 2QEQA 2E21A 4P2GA 1G8JA 4GOXA 4BZPA 4YFYA 1IY8A 2EC5A 5I7AA 2O6LA 3HP4A 2E4UA 4OXIA 2A1IA 2SNIE 3R3JA 2J33A 1LLCA 4Q9LA 5EJ9A 2O2EA 3S0JA 1M6NA 3BMCB 4I19A 2ZJ8A 1BKSB 4YO8A 3EF0A 3QP9A 4ICIA 3B53X 4MHOA 1FTSA 1GTVA 3WQRA 1O9HA 3BMQA 5AI6A 4DIMA 1T8TA 2OGSA 2IIPA 2VFAA 5IM4A 5DVZA 4RYDA 4FNGA 3U4AA 3WRXA 4C0WA 2Z3WA 5DM0A 2PJZA 5EJAA 5AO9A 3SJCA 2JLVA 2A86A 3WMRA 3NUQA 2OYRA 1YTUA 1T5DX 3FR7A 1T5IA 5D3MA 2ZIXB 1JDZA 2WPNA 2BTOA 2X5JO 3QNUA 1MZVA 3H1TA 2CNDA 5LP6B 3NM6B 4CLXA 4D9FA 1RBZA 2A30A 4MUKA 3GLIE 3OG9A 4BO5A 5SY6A 2XKBA 3H99A 5EGSA 4E0BA 5A9RA 3WWCA 3ECCA 3KPYA 1CUJA 3C85A 1OAKA 3HU2A 2ZPAA 1THTA 3PFCA 1FPQA 3T52A 5DSXA 3J81A 4IV0A 4V1CB 4MW1A 3QXHA 1XNJA 1M1XB 3T5GA 3UBMA 4DCSA 4QFMA 4F4DA 1WHSA 1QFSA 5IN4A 1QLHA 3O8OA 2JD2A 3QVKA 4P0QB 2WT8A 4WY5A 1HE2A 1ZM7A 3A11A 4OKNA 4REMA 4OIFA 4D9MA 4CIAA 3U61B 1T6BY 3KYBA 3RC3A 4BLUA 5DZSA 5KNBH 1EVLA 4KPUA 1UPFA 3C6BA 4D8VA 2YXPX 1AV7A 3DHYA 1AY0A 1TVEA 1PJ3A 2CXOA 1B73A 2HHJA 2H0RA 1OLOA 3COZA 3GLTA 2I2FA 1U81A 2OBYA 3K0FA 5EPEA 2PUEA 2QRNA 1XKQA 1TO6A 5IP5A 1XP5A 3RYCB 4ZEOA 4Q0MA 3BAZA 2O0JA 4B2PA 5JV5A 4P4TA 4I9GA 4TSFD 2J9ZB 3MMPA 1JW9B 2B8NA 4ILKA 4NBVA 2B99A 4OU5A 1K06A 1GRVA 1WCYA 2DPYA 1A4IA 1OZ0A 2Z57A 2WKSA 4EBBA 2AN3A 3ZCQA 3PEWA 1DDGA 2QAJA 3UT6A 2NVUB 3GT0A 4MVJD 1MO3A 1R9NA 1L8LA 1XRMA 2ISQA 1N3IA 1TRHA 4JJFA 1JYSA 5JYEA 2JIDA 5EJ4A 2FG5A 2XDQB 2ZBPA 3MVEA 3P9QA 1EDEA 5K20A 4TTSA 5F7ZA 5U1PA 3HP7A 4EO4A 2J0VA 2NQ8A 4BX8A 5J1SB 3DOUA 4HEA1 2GTIA 3ANNA 2CNLA 2FW0A 2F8MA 3N07A 3PJGA 4PFSA 1IHXA 5IN5A 1VG8A 5ALVA 5B36A 1C81A 1XJQA 1HNNA 3I8OA 4F46A 1FLVA 4X54A 4Q4DA 3RABA 4X97A 2PGLA 2GUWA 2QX8A 4ZCRA 1NFFA 4IO1A 4BC0A 3IO3A 3WLMA 1IN1A 5F7OA 1QTQA 3L7BA 3L8CA 4J4HA 3U4HA 1IZ8A 2UUPA 4GR9A 1D6MA 3EMDA 1KAEA 4M55A 1CZKA 5EHIA 4MW6A 4Y1GA 4XUGB 5JJKA 3CUYA 4N5LA 3MMNA 1GNRA 1QFMA 3WDSA 3RVLA 1CUUA 4RNCA 3V97A 4NG4A 4WN3A 4DIOA 5FWXB 1EA5A 2OV8A 3OKFA 1KP3A 2O50A 2YL2A 2DTEA 2VCEA 4JB0A 3N8NA 4M6WA 2XGJA 2BKUA 3IPLA 1EZZA 3VSAA 2DUWA 2BL4A 1Q7GA 3O8OB 4JP8A 5FUYA 4C6RA 5JATA 5GJBA 4JUDX 2PRYA 3JSAA 3OICA 3TG8A 3ZU3A 1RRCA 3TN7A 1NBOA 4AECA 3DLTA 5CNIA 3T7TA 4BNVA 2HMTA 4TGLA 4TROA 3L0OA 4MAAA 3SZOA 1X7XB 3AY6A 4TXJA 1UXHA 1KQPA 3AJEA 1BHJA 2L18A 3O9VA 4UBNA 3URKA 3V8NA 2FWNA 3T1TA 2PYIA 3WGNA 3CSUA 4W5OA 4NXMB 4B31A 3ZYCA 1OXTA 1OWPA 2DH5A 4FGKA 4X8OA 3TIXB 1OSNA 1ZPDA 3PP8A 3AVQA 5CXXA 4XD7A 4OHBA 1MAAA 4J7UA 3IMCA 3FGPA 1ZGHA 4XZ3A 1ZJ6A 2K87A 2MHCA 1JU3A 4TWZA 1KH3A 4JLSA 5ENDA 4NXNB 4HGZA 4WCVA 4MEAA 4Q4JA 1N9KA 1YFZA 3DE1X 3R3SA 4FR2A 4HXFB 4J0IA 4X90A 4ZVKA 3SC3A 4I4TF 1HQYE 4BKOA 2P9FA 1OGJA 1SCAA 2JPDA 5CB8A 4HNGA 3DZCA 5ULLA 1VYHA 2GZ2A 3N8HA 4YN3A 2MDTA 4NONA 1HT1E 1OE0A 1P0CA 1F4VA 2KYRA 4HNVA 2NO6A 3BDIA 2EEPA 1A4XA 5C4IA 2NZVG 1ZBQA 4QU8A 2FN4A 3IOYA 5LVAA 2RHOA 3L49A 2B94A 1I14A 3ICOA 4XAQA 5CM9C 4BO7A 2EWVA 3T3HA 2XX3A 2RSLA 3SY8A 4RAOA 3WI7A 2JGFA 3QM1A 4W82A 4YJKA 4EY7A 1XRJA 1DIOB 4JFAA 3PC7A 4FMPA 4HWGA 1OR8A 3K70C 3TZEA 2HF8A 5BT8A 5DEOA 1AQ6A 1U7OA 3UKOA 2Q6TA 2J9FB 3EZXA 4H6XA 1ESMA 2A7XA 2WNSA 3OQ1A 3PXEA 3WV4A 3KFXA 4KNYA 2EZTA 2QV7A 4IPTA 2QRLA 1RWBA 3HR8A 1DRKA 2X2EA 4IGEA 4DWJA 4PRYA 2A58A 1VIYA 3NUGA 1M6HA 4K3UA 4G1MB 4JNCA 4F86A 3H9BA 1KJ9A 2BVNA 4FFVA 1PD0A 4NH0A 1GLNA 3KYDA 2XYQA 4F3KA 1MDBA 3ASUA 1PRYA 1SUWA 1DSSG 4FHDA 5NULA 2JRLA 5TVKA 4BLWA 3KUCA 1MO4A 3I9LA 4LCJA 4U1RA 4NESA 1C7IA 1SKQA 3M3DA 3ZUPA 4KR6A 4J9UE 5HFNA 3ZJUA 1C4KA 1TQDA 2Z8XA 1GL9B 1FP4B 2ZJ3A 2XMRA 5GOZA 5B2ZA 2PO5A 2SKCA 1AK9A 2JHGA 2LD4A 2Q5EA 2A9KA 5E7JA 1VE9A 4CTOA 1RI1A 2BZSA 4IOKA 2NV6A 1WETA 4WK2B 4OI4A 3AI3A 1A2OA 4RH1A 4DLYA 3I62A 1EFLA 3KKEA 4DCJA 5D85A 1PYDA 2Q5FA 1GGNA 1O96B 2WWGA 4LJ9A 2B2CA 3TTXA 2Q5QA 3O3MB 4MP6A 2V6MA 5D87A 4UBMA 1NJ5A 1P75A 4BRSA 3BFPA 4F2GA 1NPYA 3U7GA 2WUGA 3LQ2A 1LI5A 2OO3A 2V3WA 5BNWA 3QSGA 3R0IA 2CKDA 1RBQA 2ZTMA 2OQVA 4C2TA 2ZVPX 1VI2A 3TL6A 5LOVB 3D6TB 1ZGZA 4PO3X 2CV0A 2IYRA 3RANA 4DMMA 4TM8A 2H4JA 2JVKA 3LM8A 4KLNA 3IOBA 1E1YA 4ZXPA 2DFDA 2BYTA 1KO1A 2G1UA 1UWCA 2WT4A 3AR2A 2QTWB 2CV1A 4O4LA 3Q15C 1YRAA 3LXXA 1WB6A 2I4MA 3AM5A 2OXRA 2XI4A 3HYNA 2QVCA 3PFWO 1GGKA 4K6FA 4YDRA 1CRZA 1SVOA 3K1ZA 3PDWA 3LU1A 2ROQA 1J8MF 1EXMA 3U7IA 4FZVA 3JQGB 2IZ0A 3AVPA 4E09A 3F6BX 4D80A 1XQWA 1JMVA 2AEMA 3W7VA 3SF8B 1Z7YA 3HFGA 2I8LA 2XB9A 2GJ9A 5D7NA 1GPMA 1I4OA 4HAOA 5T4HA 3VJLA 3AKEA 1TTTA 3ROPA 3PEFA 1MX9A 1WU7A 1ZNWA 2HLDD 4HWRA 4M54A 4QOJA 5TV2A 4CI9A 3TJRA 3T1HB 4YDHB 2E89A 3LOUA 1WF3A 1AN9A 3FCCA 4N5HX 4DE5A 3OM9A 3WBBA 1Q1GA 1SQSA 1EGHA 3EA5A 3JS5A 3PHIA 4WXMA 1BX1A 1CB7A 1GL7A 2NU7B 4H77A 1NX6A 2WF5A 2PRIA 1HDZA 3PUXA 1KNQA 4C05A 5ERXA 4H15A 2F3PA 2G25A 2PWAA 2RB4A 3EWNA 3JAKA 4GL4A 4INJA 1VMIA 1W85A 4TV8F 1RBMA 1JLKA 3NHAA 4WVLA 1JHYA 1N2CA 3EDQA 1U2ZA 1TX4B 4ZRMA 5D51S 1IBCA 1LX7A 5SZKB 2X2PA 1RLTA 1T0PA 4M0LA 3MWDB 1V4NA 4C21A 2R6JA 1O3YA 1WXEA 1QHHA 4K2AA 2JAHA 1WM1A 1HPLA 2G0AA 5AKZA 4QJ5A 4KQCA 2BGWA 1DC5A 3QMMA 3VU0A 5EXTA 2H18A 3P9XA 3QPWA 1Y5NA 1GA1A 4FILA 3N8DA 2G08A 4JHLA 1ABBA 1SUEA 1T29A 1NQOA 1PK9A 3GD5A 2PUVA 2HF9A 6Q21A 3HBAA 1Y1KE 2E85A 1N5RA 1QX3A 3EVEA 3QEJA 2D1FA 4H1UA 2ONJA 4J3NA 3WMFA 3JZAA 2HJGA 2I34A 1FXWF 1Z6PA 4JH0A 3ZV5A 4X6UA 3THXB 4EUEA 1E0AA 4HNAA 4MUBA 3VMMA 3MIZA 2CNBA 5IEBA 4JDPA 2GVNA 2VJYA 5DULA 1QF7A 1YR1A 1G20A 4HRAA 2V0CA 3HXPA 5TDHA 4LV6A 4FOSA 1AQIA 1PNOA 3FNIA 1WAMA 3NC4A 4P83A 3RS2A 1EUYA 5IWCA 3B60A 3DFUA 3NDRA 4Y1FA 5I47A 3IVGA 4WVFA 1DX9A 3RFCA 3ECSA 2XV1A 3A9WA 2QR2A 2JFWA 2CMHA 1ZM9A 2V7QD 1N7IA 2H7VA 3NAGA 4IEFB 2Q5OA 2MINB 2YJGA 5DGHA 1YU6A 3U3RA 2C2WA 2Z1DA 3DAYA 4DRXA 4RLQA 1WP4A 4LHZA 1XDWA 3Q7TA 4GYJA 2IHTA 4DRXB 4DMFA 1TPYA 1UC4B 2JI7A 2P5YA 4WESB 1Q0ZA 2C5AA 5FUQA 1YR2A 2P2ZA 1DADA 4EYEA 5ERGB 3EH1A 4JODA 4DDVA 4QULA 3IXLA 2YUIA 1JVBA 4ZCTA 2A33A 1NOKA 2BFBA 4LQLA 2WWYA 3PFFA 3H6KA 1G0OA 4I7EA 4EDHA 1Y8ZA 2HYIC 5JJCA 2NT3A 3SFVA 4F9GA 2NV2B 4C7OA 3O9ZA 4IDHA 4RHCA 4PM4A 2FPIA 4NDNE 2L0XA 1OIXA 1P0IA 4JSTA 1W75A 5JRDS 3RBVA 3KXPA 3AHDA 1FFYA 1E2KA 2GBGA 3B9PA 5KX5B 2I54A 2H2WA 2W2LA 3F6PA 4LZZA 4L78A 3WSTA 1N9GA 3M9XA 2BFFB 2WU8A 4BLRA 3NJRA 2AWOA 4QECA 2BRUA 2IUYA 2WJHA 3RVMA 3PCXA 1A0OA 1OWNA 2CEKA 3BE4A 5FV7A 1GT6A 4C9BA 4FM9A 1L5GB 1GARA 5IAAA 1CRWG 2AA3A 3QTBA 5AW0A 3DFFA 2O2SA 3G2HA 1LS1A 3INNA 3DVRX 4FFBA 2PNJA 4RXTA 4JNKA 4JV5B 4B3XA 1PI3A 2RK6A 2Q7OE 3EZ7A 3PGKA 4KQ6A 5ALHA 3SK0A 1U5CA 3HPQA 3LT0A 4AP6A 3P9NA 2VNIA 4KCGA 3ZXXA 2B78A 2WDZA 1RZRD 2B7LA 5EP3A 3WGKA 2V0GA 1I32A 3O2NA 1TAHA 5CLIA 1BYUA 1UK8A 1Z6YA 3X1XA 1P1CA 2FUG6 3EZLA 4N9WA 2OCYC 2UAGA 4WCFC 3X2SA 4F92B 1HNZB 2HLPA 3FB1A 4OJNA 3WZ2A 3RHSA 3ZZTA 2JFZA 2PRZA 2VDLB 1WSDA 3HACA 1MOQA 3H9GA 3MA0A 4NZZA 4DIEA 3S44A 3KZ1E 2LDXA 5CHYA 4PZDA 3WE7A 3AW8A 3AHEA 3Q72A 4JD5A 3X1JA 1BEEA 2CF6A 1ZGJA 5HIKA 3EYAA 5JXIA 1LQ2A 3LUKA 3GJ5A 4JKIA 3HY6A 2G6BA 3H16A 3KSMA 3LGXA 1FFBA 2YV3A 4EL0A 2HIAA 2QMOA 3R7SA 3AVXA 2FSSA 4G5FA 3KYJB 1JIQA 4H31A 1KDVA 1D6SA 2N0SA 1HZJA 2CE2X 4NYMR 1QH9A 4EY3A 1GN9A 2R2AA 4X6LA 1EAMA 3ZE2B 5A06A 4EY6A 4S0ZA 1OAOA 4WX2B 1TEZA 4LXGA 1XU7A 4GMGA 1EIWA 4K46A 3EIQA 2ZI9A 4Q21A 1FNMA 4EG4A 1A9SA 2HO4A 1UKYA 4Z4GA 3VYSB 1GPKA 3CF4G 1C8VB 2JGLA 2PX2A 1WV1A 3IQEA 4BRUA 1VE7A 2IPLA 3NWEA 2ZLBA 3QKWA 3QELB 3JQ8A 4EGFA 3L79A 4TUYF 3DZKA 2B4KA 2R7NA 2X6RA 1TADA 3QVOA 5EKDA 2Q07A 2BP7B 2QI9F 1KQOA 1RLMA 3QLEA 3KKLA 4KAXA 2XXAA 3PXBA 5F7XA 4CBVA 3W5DA 1C7FA 3ZW8A 2P2NA 5CYFA 4NZNA 4YRTA 1PL8A 2Z1NA 5JDCC 3VOTA 1ZSVA 2Q1TA 3EVBA 4WLVA 4EK9A 1KTIA 2D5IA 4MWGA 3WWPA 4RX1A 3GZNA 3KZXA 2C4VA 1JKJB 2AEJA 2F7SA 3BHMA 4TS9A 3N7AA 4W6QA 3D59A 1FX0B 4CLEA 2CCKA 4PSDA 1ZVJA 2HQ1A 3LL4A 4DM4A 4EG1A 2RJ3A 3GAZA 4ALIA 3SSOA 6YASA 4TLMB 4YRLA 3EE6A 4MVJM 3JQDA 3IE2A 3KU1A 3NX4A 4LJLA 2GFQA 3OUZA 3UYLA 5KZMB 5MN5A 1C80A 4XGRA 1G6KA 1K9VF 2H2AA 2V5UA 4OI2A 4NX2A 3TPZA 4HPXB 5FA6A 4ZWNA 1W93A 3HEBA 3IILA 1HEYA 4LTNA 4O4HB 4R1UA 4Y7DA 1E1DA 3EEBA 5HHTA 1GV1A 3K7EA 3RHFA 3G85A 1JG1A 4FUQA 3ZW9A 4GUAA 4CHTA 1YFLA 2Y6UA 4ARSA 1MP0A 4BKQA 3X44A 1DLJA 3QHQA 4RNDB 5AJVB 4MW9A 5HP4A 3QLVA 4BX0A 2P67A 2CL7X 4LOAA 3COPA 3QU2A 3N5KA 2D7JA 3IUQA 4JI6B 2XZTA 3DW1X 5C8YB 4EQ6A 5JAMA 2VXOA 1TZMA 1BXRB 1R8XA 3MMZA 2O8CB 3JQ7A 2JGNA 1UKCA 3DDHA 4RV4A 3JPWA 1MQAA 3G0HA 3JAWB 4CKWA 4EB8A 1MX1A 4LVOA 5HZHA 4JCCA 1PWEA 2XMDA 2FOLA 4DCOA 3HYLA 2ZW9A 1I36A 3FGNA 2YWJA 2HLDA 5BRJA 1XD8A 2FE4A 2CXTA 1KMNA 2GT1A 4JBLA 4MWOA 1U3DA 1HYHA 1W2HA 1UBJS 3LYUA 1S2MA 3MCZA 1J8DA 1UOOA 2JF0A 2GBCA 2JEOA 3D4LA 4Z3OA 5AVOA 2J6CA 4RUKA 4P92A 1U0TA 4MLPA 3TL2A 5KO2A 5H9WA 1XALA 2XGGA 3O47A 4C07A 3RSCA 4RM2A 1P5HA 1VTKA 2AJTA 1E1CB 4FYKA 4RE6A 2QDXA 2IPAB 4ZCSA 1MMFB 4BL5A 2ZI5A 4RVUA 2IELA 3GBSA 1OKKA 4YNBA 1XTIA 4LYHA 4P5PA 3WC4A 4KH0A 3ABSB 3TOZA 5IVIA 3LS2A 2AD1A 4RD1A 4AZVA 2R8EA 2VXBA 3VYUB 3I58A 1XAJA 2RCYA 5C0OE 4HYYA 1W9MA 1D4OA 3OOSA 5DM60 1IUKA 3CEPB 5B7PA 3GDGA 1KIMA 3LVFO 3LYAA 2BONA 5LBUA 1GOTA 4PRLA 1HE8B 4M60A 4RKEA 4JBNA 5CW1A 2UXBB 2R8PA 2XEXA 1QOZA 1IH8A 3P2IA 4JB8A 5I4BA 1EX1A 3N2YA 4PSVA 1P5FA 1CTQA 2W4QA 3KYDB 4FKBA 4L28A 2V7TA 5DM2A 4OP3A 3ZGYA 1ES9A 3IVCA 4WFJA 1BGVA 1VLQA 1YRQA 2WLSA 4MGZR 4M76B 4RACA 4XYMA 1EXNA 1KI6B 3NUZA 4OBEA 4Y2JA 1RIIA 4WJLA 3WGLA 2IFTA 3GCXA 5DPMA 4KR2A 2RE8A 1Y8AA 2IA5A 3EG9B 2AFIB 3FLAA 4LI0A 5CH3A 5AW2A 1IOLA 3LXUX 1JX6A 1YD7A 3VKFA 3ZQ6A 4BJ6A 1ORDA 4BEJA 3MHPA 4H7FA 4D97A 3VKGA 2B5WA 4EENA 1AB5A 2W70A 3R9XA 4GVPA 4YBZA 4EI7A 3NIBA 1Y80A 2KX7A 3IKTA 5HDBB 4M1TA 1ZJ4A 3DV0A 1ZINA 3H1FA 2HF2A 2XCUA 3GAMA 4D5GA 4OQZA 1KPGA 1E1CA 1EEHA 4UULA 4BNWA 1K75A 1I7PA 1T26A 1WL8A 4A0GA 5ICFA 1JHAA 2QP4A 4XLLA 4UNRA 3J80A 1XA3A 2BJVA 5THXA 2BMFA 1TD1A 4JUCA 5K0ZA 2GEDA 1MJHA 1RAIA 1UZLA 3UMCA 3HR7A 1L7QA 1Y3DE 5ABPA 2PZBA 3KL4A 2ZWAA 4RKFA 5GZ1A 3D6NB 1XXLA 3MCUA 4TTPA 4W99A 1H6DA 3AG5A 4E51A 4O4JB 4IDOA 4LYDA 5KPJA 2ECQA 4BY9E 1T24A 4M87A 3B70A 4ML3A 2FPGA 3R7DA 2E1PA 2HIGA 5BNIA 8ADHA 4PQYA 5BN1A 5ECGC 3ZDAA 1GR1A 4JVOA 5C1DA 1AH2A 2VUUA 4YB8A 3LC7O 3LDFA 4PINA 4U0KA 3H84A 5DYGA 3SYNA 3LTEA 4DEXA 3TG2A 2X0FA 4QYSA 1J8QA 3I09A 2J59A 4DLPA 2J07A 4AI6A 3FPSA 4LPSA 1IFXA 4QYTA 1C3OB 3IAFA 4ALNA 1G5RA 1Y4ZA 3LVQE 5BPFA 5E0OA 4O1IA 3UOGA 2PXXA 1POXA 2BOVA 2AE1A 4X8MA 3VDMA 2XQIA 1QP0A 4BFTA 1U0RA 1VSQA 2V74B 3GYBA 2R1UA 5LZ9A 5ALLA 3DZDA 2AX3A 4MRMA 2XQKA 3R5HA 3AQIA 2JFYA 3HJBA 2PPLA 3F67A 1DFHA 4QVGA 4ZPXA 3GAFA 4R2WA 3NT2A 1EU1A 4MWDA 4TYMA 4TL9A 3RREA 4G84A 3WK9A 2XCQA 4R2JA 2J7KA 4Z7OB 4YA6A 3L84A 1DC7A 2VSQA 3KR1A 2OBLA 4PSUA 5DASA 1DBVO 3W8DA 5E4FA 1AQNA 1U3FA 1UUFA 2WILA 5D5QA 2C2YA 3T4EA 4BLQA 3KXIA 3BQMB 4KFSA 2BLLA 4WD3A 3F3MA 1PR2A 4ALKA 1Z5PA 4NZ9A 7MHTA 2IHZA 2VTDA 2YV4A 3ZBQA 1U0SY 2A9PA 5AOCA 4G5OA 1DE0A 1Z0ZA 2VUSA 4LHEA 1I94B 3GXOA 1PAUA 2PH3A 3FGOA 1L8AA 2V6FA 3ZI7A 4C3OB 1RXUA 4RTQA 1Y7LA 3FMPB 1JJAA 3UHJA 5HDQA 3H11B 3KAQA 1G2QA 4ZRDA 4EUHA 5CVVA 1RXSA 3OM8A 4Y2TA 4XVCA 1XZPA 4N5IX 1F2UB 3L6EA 3X2EA 4L9RA 5F9FA 4PZYA 4DC1A 2V98A 1MTOA 1CF9A 1N7HA 3WLRA 4Y30A 3B1WA 4FDAA 4B87A 3EAFA 3I2FA 7ADHA 2D1TA 3GGPA 2PA3A 4IX1A 5LCXA 1F7VA 4GMFA 5F4BA 2O1EA 4ZYTA 2VQ3A 3W5AA 2P9ZA 2QVLA 4IQGA 5J2TB 4CIWA 4AJ4A 3Q3HA 3LDAA 1PV4A 1E5DA 3UJ8A 2DE0X 3I9NA 1LDBA 3OFSA 5CLFA 4RVOA 5KYWA 3FG9A 3NGLA 3TTTA 1GPUA 1C8BA 3EXHB 2EW1A 4BX3A 2GCOB 4CR6A 5LQNA 4QIHA 1TO2E 2XKKA 3L41A 2UYOA 5ESRA 3NCTA 3DT6A 1ZR4A 1DBRA 3ESXA 4FEGA 1KPHA 2FEOA 1P3Y1 5HG0A 4ARZA 4B48A 1ZCBA 3B1JA 1MH9A 1ZD1A 1QYCA 2K2WA 3ZCVA 3K4HA 4XX0A 4P58A 1WXGA 3ODGA 4I8IA 1GUYA 4F7DA 4ZCIA 1I9GA 1MO6A 1NI4B 3DPIA 1UJCA 1C7RA 3NPAA 4EY4A 4MKIA 1OFIA 3CZQA 3TZKA 3HCCA 4TMZA 3OQNA 2ZJZA 1OX6A 3LXRA 2OORC 4KLAA 3VPHA 4CCAA 5KHLB 1SQGA 3TIVA 3DXXA 3HSSA 1N1DA 3ICVA 1GPWB 1JHPA 5CLGA 3ITEA 1IPHA 1Q16A 5CIYA 1CEQA 1YHNA 4NCNA 2NGRA 3D54D 1GR0A 5MN6A 1ZCAA 3NHRA 1NQ5A 1Z83A 1TA4A 1IVNA 2O3UA 1PJ2A 1PN3A 3PT5A 5DM4A 1RC8A 3DW3X 4DRZA 1EM8B 1CDDA 2QTRA 4I2VA 3E4DA 3OY2A 4QEKA 3ZDEA 1A97A 4MGYR 3B6KA 2FXVA 1OLXA 3F7TA 4PX5A 3GPIA 4DQ0A 1W36D 3JVDA 4AJOA 1TT5B 4MRPA 6LDHA 5C1OA 4DG5A 2TSYB 1H65A 2PFGA 2ZIXA 1N5OX 2QJRA 4OM8A 4E31A 1L6RA 2RK4A 3I01M 2VPYA 2X22A 4M8NE 1R9GA 2OHOA 3C45A 2GAFA 3C43A 3H2BA 3SJZA 1N0VC 4KPFC 1SVUA 4OGFA 3ACCA 5JFGA 4JEUA 4X65B 3GCDA 3RBXA 4Y1EA 2ANBA 5EE5B 1QHIA 1OUMA 2FJPA 3UCXA 2A14A 3EMBA 2YV2A 1EDOA 2YR0A 3M6IA 3N2LA 4IQ8A 2GZAA 4KYUA 4C29A 4FDUA 3U6KA 4INPA 4O4JF 4EHLA 3Q3CA 1DELA 3D6UA 3TD2A 4TZTA 4WLFA 3OC6A 3P5SA 4US2R 1TT7A 2C4UA 1WF6A 1F6BA 2DPMA 2PEZA 4W8GA 3A1TA 5TPWA 3UQZA 5B2FA 4MB0A 1W1IA 4G9EA 3WICA 2LCFA 3A1SA 3I32A 3UO8B 1RHMA 1T8RA 1W5EA 3TE6A 2GPBA 4COOA 1DHTA 4OB6A 5HZMA 1Z6GA 3GJQA 5E6RA 4P7BA 4BP9A 2X5XA 4CT0A 4F96A 1CG6A 3NAZA 1GG2A 2ZKLA 4XWAA 4C6TB 1I2CA 3EAGA 3FVTA 2JK1A 4D6PA 2BPOA 4XR9A 5FO0A 1C9DB 1U8TA 1Y8CA 5FOUA 3CM0A 1I30A 1W6UA 4MQ5A 1EK1A 3BTUA 4ZOCA 1C8LA 5CDSA 2AKEA 4B4DA 1XVIA 1HTTA 1V7PC 1XF1A 3PUZA 3KUKA 5DYYA 5FUWA 1ZD2P 4DLBA 2DVMA 4P5EA 5FTMA 4B2YA 3RRNA 5LWQA 3CVUA 4XLTA 5JJLA 3VR2D 1R4NA 2ZAGA 3BSFA 4NCHA 2NYVA 5DMHA 4PV7A 4F2WA 2B5OA 2NZWA 2GILA 2GZ1A 2I80A 3NHKA 4DDMA 1BS9A 3DE4X 1JMKC 3S2UA 4WOKA 2ZRNA 1EZ4A 4D96A 3DHEA 3GJXC 5HIAA 4KHPB 2ZUBA 5GM2A 3EMKA 2GVDC 2J0UB 3GOQA 5FR1A 1HX7A 5BOVA 2FN3A 1R8SA 4NIMA 5EHXA 2C9OA 2BZ0A 4RTSA 4RTJA 2AUMA 2IQIA 3JQFC 4HBZA 2OCDA 3Q2IA 1YZYA 3PPWA 4XXHA 3OPYI 3HGQA 5FJJA 5KREA 1NVEA 2QJTA 1N1GA 3P19A 3VTZA 1MUUA 1Y0BA 2O7RA 2PO7A 4UQPA 3DKIA 1NC3A 4FFNA 4OQEA 1XCMA 2VF7A 3O8DA 2O20A 3PQ6A 1Z25A 1PJLA 4OM7A 5H5JA 1KE2A 3RYFB 4DDHA 5EEHA 1YRLA 1VSUA 1DO0A 5JWHA 5C8VA 2WDPA 4G65A 3WNDA 4M1WA 1CUGA 4RVCA 4Q9AA 1VLLA 3FH0A 2HCFA 3ENVA 1H22A 1ONOA 2HLNA 4UXIA 3SHFA 2KLBA 2W6JD 1ESEA 2F17A 4GEGA 1ORIA 1WCWA 2JGIA 4NAHA 4C4RA 2OWDA 2JA1A 4K9SA 5A5EA 2EL9A 1RYFA 3JQPA 3E1GA 3FKSD 1FFXB 2QQ0A 1JFRA 4YAEA 2OT3B 4BNMA 4JUIA 1SRQA 1OXMA 4DFDA 4HWTA 1OX4B 3TQOA 3RUCA 3O8BA 1QIGA 2PT9A 2X86A 3WWYA 3AIOA 2DZDA 2AD5A 3AEQB 4ND7A 1DC6A 4FBMA 4FEAA 4MAMA 3EUAA 2X76A 5IKMA 2ZBVA 2JLCA 4ZVSA 4KPYA 1XMXA 1M2OB 1GQ2A 1NLYA 1HORA 1ECGA 1QOQB 2CUNA 3B3AA 1P1BA 2GA8A 5JIBA 3O4JA 3ESDA 3VO9A 1Q0RA 1T8UA 2H85A 3KFLA 3QLVC 2VHVA 2KS6A 2CJWA 3OPYB 4GQIA 4JBXA 4MO2A 4RGQA 1I10A 5CX1B 5KYYB 3HBMA 4GG1A 2FX3A 4BCBA 1SC3A 4Y2HA 4UOEA 2FPGB 1KEPA 4O5AA 2ZRPA 4H6VA 1R0SA 3ASYA 4WFKA 1M54A 2V65A 3H05A 2IOHA 3K96A 4IRUB 4ONEA 1A3CA 3RIMA 3EGVA 2YVUA 1A5BB 3DMDA 3E3OA 1R0RE 3GJYA 2BTQA 1U8ZA 4QVKA 4PLPA 2QTCA 3OEHD 5FPTA 3C24A 1M6EX 1FTGA 4JGGA 3VKWA 1UMBA 4P53A 3JQ9C 4BVHA 1E61A 2Z5FA 3A27A 1UXJA 1PNTA 2X0IA 1PEAA 2XR1A 4HLUA 3LK7A 2C94A 3R40A 1EI9A 1L6IA 2FPKA 1PNVA 2YOHA 3D2AA 4PHGA 5CK5A 2EGUA 4EHNA 4K9QA 4ITRC 4X63A 3ROZA 1D2EA 4GFDA 4Z7JA 5KQGA 1QLWA 3GHHA 1TM4E 2OGZA 2Q45A 4X1KA 1GGMA 1TU3A 2OAEA 4HZGA 2JIZA 4NU8X 4W1RA 2ZAMA 3MUOA 4RLHA 1J39A 1H1LB 1IXYA 1NXQA 1Z38A 2RFLA 2ZUVA 4NBSA 5FPQA 5U4XA 3AEKA 4JI8B 1PK8A 4PC2A 2O0LA 2VJQA 3LECA 3JD4A 4PNZA 5F2OA 2XVMA 1XTKA 3C3PA 2Q0XA 5GONF 4CV0A 3PFBA 1MQSA 2UYGA 2ZIVB 4R16A 5A3VA 2F3SA 2CJPA 1T2DA 4DPMA 3DM5A 2JRCA 1NJ8A 5CBKA 1C9NA 1XE3A 3ESCA 1CYEA 2ZB3A 4DR2B 1X86B 4R84A 2C97A 2N9UA 4HN2A 3IESA 4RIEA 4KPEC 1MHTA 3KEMA 1NVWQ 1TE2A 2Q21A 3FPHA 3IAAA 2UVPA 4X20B 3S28A 5T4EA 2IUEA 3F8TA 3I6MA 3QOXA 1EK0A 3AB7A 3RHZA 1YB1A 4E4TA 2GMWA 2G7MC 2JANA 5IZCC 4B7ZA 4GMKA 4LXHA 4QOFA 5LZ7A 2VQ6A 3GJ6A 5A5FA 3QE9Y 3B2EA 5K3SA 3KAJA 4LBZA 4Q1AA 2WHQA 3WL5A 2EERA 3K6SB 4LMPA 4PHFA 4ZCPA 4DLWA 5HJ5A 4V0RA 1SC4A 2YYZA 3M5DA 4CIDA 3V7FA 4CNBA 2O8BA 2P4EA 3CRW1 3TCKA 2J7PA 4PLGA 4U7TB 4BVBA 3NHLA 3AC0A 5EPUA 3TEJA 3S4YA 5FYQA 4KWEA 4BNTA 1GTRA 2JIQA 3WB2A 1ZOLA 2QUJA 4EGJA 5DI9A 2GUGA 1K6MA 1UOPA 2AQHA 3TLGA 3EODA 3PRKE 5CITA 5K6AA 1HY3A 1KMHA 2BGJA 4KOAA 4IDDA 2QXUA 1YFJA 2VQEB 4QUJA 1IHUA 2ZPUA 3NT5A 4HSEA 5HPYB 4FQ5A 4IIXA 4ZVNA 3RF7A 2Z95A 3UAXA 4XWGA 4OFBA 1OW3B 2EZ4A 4JQCA 5DGCA 2C9CA 3HU3A 4M1QA 2AB0A 3DWGA 1UJBA 3AHCA 4NE2A 1XRLA 2HYDA 3RWOA 2ZREA 3AF4A 3VNUA 2VI5A 4YFVA 4UM8B 3LC2O 3L43A 4FSHA 4QXRA 3AUUA 3KEGA 2CDAA 4G4IA 5K0EA 2OFPA 3AUFA 2P9CA 3LVRE 2F62A 2WSSA 4EB0A 2XDYA 4X3PA 2WJ4A 4Y6LA 3WFIA 3V4RA 1EK5A 4HAVA 3QK7A 4HB2A 3UFXB 2H16A 5AOVA 2X9LA 2MT9A 5KNBA 3ETDA 3IP5A 4XDGA 2QY9A 4HDAA 1QZZA 2V1XA 1NG1A 2YXDA 5EVCA 2AOUB 5B7QA 5ICMA 1RBYA 3GWGA 1Q1NA 1NF2A 4OHZA 3B82A 2Z04A 2A9FA 1X19A 1I1NA 5BSWA 3FIJA 4CEHA 3WGHA 4IV8A 5DEIA 1PZGA 3DDWA 3RYFA 4KH1A 5I4KA 1YS6A 3P4YA 2F67A 1RJGA 2EATA 1QV6A 2PX4A 4GZMA 5L7YA 3N59A 1LEHA 2QK4A 1WUIS 2R11A 4INAA 1YR6A 4QQNA 5AT1A 2BMVA 3R4VA 4PPQA 4L6CA 3HO8A 2REXB 1JKJA 5LP6A 1Y9EA 1PGOA 1KEEA 1UDRA 3B7GA 5KYUB 4I4NA 1UPAA 2D5AA 2J6IA 3GI1A 3Q98A 4XJSA 1X77A 2YXLA 5HBGA 3G5TA 2EIHA 5CJPA 1POWA 3ITDA 2VDRB 3DO8A 4EH1A 4HMQA 2G9UA 1B6RA 1CR2A 2EJVA 1CD5A 2D0PB 1Q50A 1SCDA 2VWHA 2QSZA 3DJYA 4PYMA 4IFBA 5B1YA 1ZG3A 4QT0A 4RU1A 1E7RA 4LISA 1V4BA 4DXDA 4XUDA 3HCNA 5LYJA 2NG1A 1Y3CE 3BH7A 2IPMA 1TQHA 4PANA 1G98A 3TTWA 5HQTA 4IJKA 5IC6A 1UJ5A 4QSHA 4C87A 4DLRA 4YAFA 3P9KA 3CB2A 2XCIA 1E3MA 4A91A 3DEFA 2X9NA 4UQOA 2BTEA 2IS4A 2PZJA 2FETA 1RC0A 2R86A 3QKTA 4RDIA 3RH0A 1X7YB 2IU0A 2O8VA 4FKMA 4JU9A 1Z7WA 3ELUA 2V5AA 1U11A 5GV8A 3JTEA 4LEIA 4UUBA 3PC4A 2VG8A 2OFWA 1OI4A 3FWZA 1CQPA 1Z4KA 2NVUA 2SCUB 5EKXA 1PD1A 1QZ3A 3PC6A 1NAIA 3CINA 2IYNA 1FVXA 2PG3A 2N46A 5K03A 3B6EA 4GICA 1YRHA 3CV3A 5FQOA 4AJJA 3DAOA 4G86A 2F4NA 1EFRA 3GUZA 2X4GA 5H59A 5JYCA 3CLTC 4ARUA 1WVMA 2JAUA 4OLJA 3HB5X 1U63A 1RFGE 1N34B 2VH2A 3FWKA 2H2IA 1GQYA 4O8CA 3U16A 3DG9A 4WXYB 4K6CA 1QGAA 1R15A 4IRXA 4JUFA 1QF6A 3PLNA 4ZJZA 4LHVA 5KNCD 4HWSA 3BMOA 1NVTA 4FHZA 1J0DA 1Z2DA 4YVFA 2HXGA 2A1UB 1P81A 2ID8A 4OD0A 3LWBA 1J9ZA 2YH2A 2IYOA 4MRNA 3GA0A 4K6KA 1RLOA 4A9AA 1L7OA 5HK9A 1ZHFA 1XEFA 2QQ5A 2VP3A 2R66A 3PDIB 3L8EA 4HZUA 4HDSA 1BS1A 2PTHA 4YIHA 1L5LA 4ZYXA 3WBKA 3WL3A 2QS9A 2VLIA 1GPH1 1VCOA 4TRJA 4KODA 4AJIA 5EUBA 3UNXA 4BNYA 4KO8A 3ZY5A 4AZ3B 5AUNB 1PJCA 3PGXA 2PX0A 2FCAA 3T3NA 3PI6A 2BF4A 5KNDD 1IVSA 3IUSA 2DR2A 4RIGA 4MKFA 4L50A 2C82A 2OCPA 4OQMA 1GYQA 1K08A 1A95A 521PA 1W36B 1TM2A 2G9VA 1NXOA 3AOEC 1VL6A 1DLIA 2G77B 2RIRA 3FMOB 2R6DA 3HJAA 3WIBA 1V1JA 1XF9A 2IEBA 1P73A 2OM6A 3GLSA 3ND7A 4HLUC 3PXAA 1T6ZA 4XVRA 5AKGA 5A7HA 3MQ2A 2PZLA 3RRBA 3F4LA 3S27A 2UUAB 1B3BA 5REQB 4PS1A 4S1TA 4FTWA 4JROA 3V4PB 2H54A 2V8BA 4F5DA 3I2YX 2VJBA 4TYPA 5B58T 4U7GA 4ZHSA 1BCRA 3AHHA 1GPBA 4AY5A 3QPVA 4BLOA 5GOTA 3GFQA 3I9FA 4MCIA 1GZ6A 1JVNA 4OY3A 1Q91A 3IKVA 1YHYA 1RVV1 3NBKA 1SUFA 3PNPA 4QA9A 3HN2A 3IVAA 3LDHA 4KBFA 5FH9A 4CUZA 4KTTE 2HB6A 1ENYA 3JCZA 2E4WA 1EWYA 2YWXA 3EZYA 1WY7A 5CAEB 4X61A 4N82A 1LSOA 1SK8A 3Q87B 5AVXA 4A2WA 4LSGA 4Z53A 1U1IA 3GLIB 2VCHA 1E3IA 4LF9B 1W19A 2G9ZA 1N2OA 4M99A 4MHSA 4B7XA 4REQB 4Z4IA 1PZFA 3H75A 1C9MA 3IIJA 2WE7A 4LV5B 4ZQFA 3GLFB 2HRDA 1VBMA 1SD2A 1QGYA 3DLPX 3CLUC 2WU0A 5G0SA 1U8CB 2X23A 2CVZA 2ISCA 3DDOA 5L7TA 1XELA 2XVYA 5K0GA 4GYWA 3G88A 4G0PA 1QH8A 2JHCA 3O7MA 6AT1A 3I34X 2FVYA 4F4IA 3O9MA 3W9SA 1ZH8A 3ZZ1A 4PYRA 2CWWA 1P2SA 2OBXA 2RAVA 2WU4A 3KPVA 3L8ZA 2A5GA 2JIBA 1ISMA 3IOMA 4I5FA 2WHEA 3VNAA 3SVTA 2ZUFA 3PC8A 3U3JA 2PMDA 2OE2A 3VH4A 3ADCA 1EWKA 2P79A 1Z16A 1T1GA 4HMOA 3WKCA 4FGSA 1EFDN 4D4KA 1JG3A 1JG2A 3OQHA 1E79D 1U3CA 3KNZA 3PRJA 3RV4A 2V7XA 5JVDF 4BXOA 5DLDA 2O23A 1HYQA 1N77A 2NT4A 5KOJB 1EFVA 2XNSA 5H0IA 2HA3A 3DMTC 5TQ2B 4DTCA 3UBTA 3ZDQA 3BM5A 5IRCD 3ZDZB 4K88A 3QG5A 1U2QA 1VKHA 3TJZA 4BASA 2XUHA 1MG0A 1JEDA 4M0PA 5AKEA 3GG2A 2WSBA 3IOCA 2FN7A 3B1FA 4QM6A 1XZCA 1X2EA 3BGOS 3MLBA 2D54A 1ZBDA 3EA0A 3UMFA 1X9HA 4B3HA 1EUZA 3IP1A 4DV7B 5JS7A 4G2NA 4JLPA 3G2QA 1D5CA 2NADA 1IHDA 3QEMB 3WWDA 3ZE0B 1U9JA 2R3SA 4PWYA 4XWTA 5T8KC 4KSCA 1K3TA 3EGDA 3GNLA 4YH1A 5TARA 4V0ME 2EJWA 4TMTA 4AP5A 3PXXA 3WHKA 4K7JA 2Z58A 2HCJB 5FORA 2AHRA 3LYHA 3QFFA 5T6BA 2R1VB 2Y1EA 4D3FA 3TSZA 5K4GA 3R9WA 2OCKA 2H29A 3W9UA 5JSZA 4JVNA 5HQ3A 3ED5A 3JTMA 4MTCA 4KWIA 4BMYA 4MW5A 2UZ4A 3DE5X 4DZRA 1V5IA 2J31A 5SZHB 2X58A 6ABPA 4MCAA 1P9OA 1NPDA 4PAWA 4KI7A 4OOFA 4KQ1A 4O3MA 1JNYA 1QK5A 3TX2A 2I8AA 2C3OA 1Z5ZA 3PFIA 1B7GO 1PJSA 2E4YA 4I99A 4RJIA 2ZOSA 4XGKA 3AETB 4XEUA 3FDJA 1S7GA 3P45A 3RS5A 3T5TA 2RB5A 1XCBA 3K15A 1EJBA 1SVWA 1VHWA 3Q8MA 3L8HA 1JWBB 4HAZA 2SCUA 3S8MA 3SF8A 5K01A 3MPUA 1H4TA 5H16A 2C0QA 2X4LA 2OQIA 5IDVA 5SYAA 1P8AA 4KWCA 4AZTA 3V1TC 5HW0A 1HFJA 1Y3FE 1ZXBA 1RYNA 4F97A 1I7LA 1C30A 2C8JA 4J8PA 4QFDA 5CFLA 2NXEA 2OM2A 2ZJOA 1JI3A 3OPMA 7GPBA 1JFLA 1OH8A 2JLWA 5A4DA 4P4SB 1IRXA 3TX6A 2EFJA 1KAMA 1ZSNA 1BOOA 4B7UA 5IJZA 1XMVA 2VL7A 3RW9A 1OXBB 2EKBA 1B0ZA 2FSUA 2XOEA 3DOCA 2H65A 1UPCA 3ILSA 3QZUA 2DYKA 4Q34A 1FUUA 3PC3A 4RETA 2UZ1A 2VF2A 1X1BA 2PZ8A 1B1AA 3B7WA 4KMOA 3ZHSA 1WLSA 1OC2A 1PLKA 1BN7A 1ZD3A 4P80A 5AVQA 1H4QA 2PZGA 2IITA 3M5PA 1ISIA 2O4UX 3MTJA 3QYFA 2XCRB 2PY6A 3GJ4A 1SB9A 4OB8A 2PGOA 3C8MA 3FYUB 5DO9A 3FPBA 5FEUA 1NXPA 2Y6VA 1LK0A 1F3LA 4XWOA 2ZRFA 5FWNA 3Q6NA 3H7IA 1P7PA 1XI2A 4EFLA 4OJMX 2FX2A 1DRJA 1G6HA 1AV6A 1V39A 4CMBA 4KGVA 5G4KA 5THKA 1KK1A 5DN6A 4ZQIA 2QJOA 3G9QA 3PKJA 3VU8A 1C1HA 1REQB 2FQWA 4AVYA 3Q2OA 2DKFA 1ZIOA 4CG2A 3T3OA 3GT7A 1J70A 2OBFA 4K86A 4PO8A 4B3BA 1II9A 3CNHA 1SGWA 4NMLA 3OCJA 1XPRA 4IDBA 2PANA 2A7QA 3R6DA 4DARA 1PZXA 4QAQA 5E9JA 1B42A 1K89A 1DEAA 1R3UA 2ZIEA 4EW3A 4R2XA 3QXSA 1VPLA 4I4LA 1L5SA 4QWWA 3CKLA 3IB6A 4MTLA 3W3ZB 2GM5A 2QNIA 4K8OA 3F4BA 1RM3A 1W49A 3QE3A 4KJXA 4AF6A 4AG5A 3WGQA 3W1VA 1KWKA 1L5YA 4M89A 2DFTA 2VBFA 3HBFA 5DNEA 5EY5B 2VHYA 2BCGY 2FUG1 1DBQA 2BSXA 1JWLA 3QVMA 1C5KA 3M6AA 4FOOA 1KQFA 1R1DA 1GRNA 1U1GA 1PK7A 1ZRSA 3MERA 4GMHA 1PEDA 1XAHA 1CY4A 2ZR8A 3H5RA 3MWYW 1G8PA 4LDZA 4NV3A 5EXDA 1RTKA 1R88A 1KMHB 1O94C 5AESA 2W8BA 1CDOA 1VKZA 1IY1A 1ODTC 2OZVA 2ZIAA 3CEAA 4YS6A 3UXHA 4CCWA 2HCRA 3LQ1A 2OFFA 4ZOQI 2JLSA 3E9DA 2LZ0A 1P2UA 1D2GA 3K5PA 4U8HA 3F1LA 5TPZA 3DBHA 4ZMSA 3AEUB 3LI2A 1RHUA 4O4LB 2Q4RA 3QJ5A 1OH5A 1Y4SA 1Z2CA 4I5DA 5HMMA 1JG7A 2ILVA 1BO6A 4ARVA 2O1SA 2O19A 2WNIA 4EUFA 1OTYA 4J0DA 5D6OA 4G6ZA 3B5JA 1WABA 2NLOA 3EEOA 2MYNA 4CTNA 3ZTTA 3FJOA 4YRDA 1EXVA 3L1JA 1GG8A 2HU5A 3FZYA 1EXDA 1VHQA 1X1SA 3KEQA 4TRNA 4XIYA 3TIGA 2MR6A 3HKCA 5HRUA 3KQHA 5KYNA 4Y2UA 4BAUA 3MS7A 4PGHA 4F2DA 4DGSA 2DLNA 3DP7A 1Z4QA 4CW7A 3ZCTA 5JH7A 1OZHA 3L6DA 4KGDA 5FBKA 3H5VA 1NHGA 5BVHA 4GOND 1SBTA 4DV2B 1I33A 2RGNC 1QYRA 3RLIA 2YBDA 3F2VA 1CUEA 3L6CA 3O3NB 3P26A 4NY1A 5K3AA 4EO9A 5KSWB 4JWKA 3OMXA 4V24A 5KHAA 5C8DA 3ET4A 1SOMA 4HDNA 3UHAA 1EFVB 4OXXA 4E22A 4JFRA 4CQJA 1UIRA 1Y3AA 1GL3A 3CZAA 3QUQA 1G21A 1L9KA 1SXJA 2BP7A 2RAPA 2VT6A 4QJ3A 1ONNA 4CLHA 4IQ4A 3B6IA 5DTJA 4RCYA 1JHMA 4CODB 1E8NA 3L46A 4MDFA 1H1LA 3QHAA 3OIWA 1BH6A 1QE5A 2PR2A 4AMYA 5JNLA 1QE3A 2LE0A 3GZNB 3MMSA 2HK7A 4UM9D 2DETA 3KX2A 4QEZA 3DO6A 3O4FA 2OA0A 1DAGA 2P1ZA 3LWNA 4QUBA 2DHDA 3RG8A 1OY1A 3AV3A 1ILEA 2M6LA 3MTDA 4PCUA 5GAJA 3OU7A 4IIFA 5C31A 1YIAA 2A9RA 3C3YA 3A6GA 3BWMA 4CF7A 1EFUA 1F51E 5C7IO 1FP2A 1P4GA 1R50A 1J56A 1DKPA 2CLCX 4B4KA 2FLVA 1C0IA 3AO0B 3HQ4O 1Z9BA 2BJWA 2FAXA 3KIPA 3KKQA 3MS2A 2IEIA 3EVFA 4R5MA 4RF4A 2YRXA 3FF1A 1YS4A 1VGRA 4QREA 1J8FA 2I6GA 4QT4A 3EXIA 3LRXA 1NBME 2X19A 3T12A 2XQGA 1M2GA 1NXTA 2OY0A 4YAOA 4MW0A 1HE5A 2FV8A 4I4TA 1NJ6A 1PG5A 1KY5A 1QG6A 2GRUA 2PK3A 1KR5A 4OF4A 3WWZA 5KBYA 4N0MA 1ZMBA 3UUGA 1K7SN 1NW8A 2EF1A 2X1VA 1JG4A 3ESRA 3WYCA 1VJ0A 4TWRA 5KUTA 3D4NA 4N3BA 1C4XA 1UZAA 3B9BA 4UVGA 3VU9A 4UTRA 1D4FA 2R62A 4QDOA 1E0JA 1I4TD 2OR3A 2FQXA 3C3BA 3IUBA 4N49A 4HQ6A 4WI1A 3A6KA 1L5QA 3RTAA 2EZ8A 4OUDA 3F7MA 4LV8B 3GEDA 1GLGA 4N47A 4I55B 2RMKA 3BFJA 4UM7A 2CXQA 4E21A 3BMNB 3V8BA 1YWGO 2QTVB 2B20A 3FHJA 5B3JA 3KU4A 4RTMA 3BGDA 1T4CB 4ND6A 4A1FA 1JTVA 4CLRA 5JI2E 3N0RA 1PUIA 2UYYA 1V45E 2G5CA 2JJMA 4EDFA 5KKCA 2FSVA 2VHJA 2CDRA 3HV2A 1WHSB 4MQ4A 1G21B 1SXJB 1V16B 4MYCA 3VU1A 1WA5A 5H4GA 1AMNA 1U9IC 3W2FA 5DHRA 2Y3IA 4KN9S 2FR8C 1E59A 1JDPA 2X5OA 2XNCA 3O2QB 3F9IA 4GBED 5I9SA 3WAJA 3ZZNA 2WKQA 1CSEE 2ZSJA 2E2WA 5FPYA 4ZO7A 1TT5A 3P8ZA 4IDCA 4MQUA 4ZYUA 3IBTA 4MWCA 4C7KA 4D92A 2WW8A 2R5FA 3DVLA 3KSZO 3O4GA 3PL1A 3DYVA 3A36A 3SIWA 2B4YA 4GKAA 2J30A 1KY3A 2A84A 2Q50A 1HDOA 2XE4A 2O57A 2RGWA 2HMWA 4KMSA 5AI5A 5AWFC 2NU8A 5ITZA 4ZI5A 2MSEB 4C0AC 1T0UA 3RAEC 1TU4A 3S6JA 4GSYA 1MLDA 3LO8A 1RCTE 1WLYA 2X8JA 2H5EA 4G97A 3DXFA 4O2AA 3R76A 2G1JA 2VDVE 2VTKA 4URFA 4XWKA 5CCXA 2K7ZA 4M1MA 4Z9BA 1P1FA 3L8FA 2Y1LA 1L0BA 3CSDA 3DZ8A 3Q88A 2PU7A 5C9ZA 5CB0A 4MRVA 4OQDA 4UXJA 1WDLA 4RMHA 2PXAA 3C8ZA 5CVJA 5DHFA 2CXHA 3C1AA 5FA8A 4EYKA 2B9VA 1N2XA 1S96A 1XEXB 1OBVA 2C2KA 3HJGA 5CEEA 3WLOA 2JLUA 5AVKA 3IP8A 3HDJA 3KTAA 3RBAA 3CG4A 4MDYA 4QU9A 1GPNA 3PITA 2HIHA 5KKAA 4S04A 3OA0A 5AOBA 1DMSA 4YRBA 2XDQA 4GPBA 4NULA 5A7FA 1QAMA 1GU7A 3OOYA 4JA0A 3RCBA 2DPHA 1KBQA 2JLRA 4I50F 3VKVA 2ACVA 2Q29A 4JXJA 4YJ3F 3G9ZA 1XRNA 1JYFA 1BNCA 3ZDYB 3F97A 1B76A 5ITWA 1NKVA 4BMPB 3I4FA 2WF6A 4LG1A 4BNGA 3WNQA 3CLRC 3FOWA 4BO8A 4CTJA 2EW2A 3JZDA 2ONYA 4MQEA 1L7DA 1U0HC 1MB3A 2DFKB 4Z8XA 3BXFA 5E8JA 4KFCA 3LY9A 5KJCA 1VCIA 5FD8A 4Q12A 3IHWA 3OWOA 5FPKA 4XIJA 2CYBA 5T4BA 1H5NA 2I2AA 3RWMB 1TEHA 3E6AA 3MGAA 3IDQA 3I9KA 3DMYA 4C22A 3N87A 2GRAA 2H63A 2QX7A 3OZUA 2ZCJA 2FP3A 3QKIA 1CULC 5G1NA 4NC9A 2J5RA 4DL9A 3W2GA 5JS2A 3WXMA 1WMSA 3E15A 1UKVY 2I29A 3EGOA 1PLLA 2QX4A 5BNTA 1ZNQO 2FUCA 4PLZA 4Q47A 3A2LA 5KWEA 4CM8B 4UBJA 3THXA 5ARBA 4AN1A 2HJWA 4OQYA 1UANA 3ENKA 4KE7A 2NSJA 4RPHA 2I6XA 3V34A 4N3NA 3ONDA 1XXHA 2MSNA 2ZE7A 4G8DA 4WLEA 4ZRNA 5SYNA 1QZXA 4CT5A 3ACDA 2A3NA 2IP4A 1UM9A 4L5YA 1M7BA 4MRMB 4BKMA 4N12A 3DS8A 4WBNB 4OQNA 1OPXA 1MT0A 3OOJA 4ZPJA 3U60B 2V5VA 1NBHA 4ZK6A 3U9TA 3L04A 3WDKA 4L5BA 1XLUA 4GLFA 1W4ZA 3GRVA 4DMHA 3K0CC 1ONSA 4W8OA 1BSVA 1O8BA 1NKTA 1YASA 3C6YA 4F12A 4YV0A 3GG9A 4TMKA 1RT9A 4XFJA 3GUCA 4GXQA 2Y4OA 1N2CB 1QKKA 4GWKA 1WNTA 4KU4A 4LYJA 3NBUA 1RXCA 5F1OA 4E70A 5IFLA 1P0FA 3C3MA 2IK8A 2WFLB 3MT9A 5DBEX 2CL0X 4HG2A 4D3ZA 5CDTA 1LPPA 3C1OA 5DTEA 2DPLA 4GKVA 3UJ6A 1U0NA 1WZUA 1DOAA 3IP7A 1E3EA 3FYCA 2XNHA 4GSKA 4ND8B 1GAQA 3ZHQA 5CA0B 5TX7A 3CJRA 5JXWA 1UBRS 4YRGA 5F21A 4KBGA 5ENZA 5EE1A 3VOSA 1G8AA 1JKXA 1U9CA 1E2LA 4X44A 2G4LA 2NYRA 2W6PA 4URYR 1XQ1A 2O2JA 3D6AA 3EIXA 5ICSA 3OTIA 3OZEA 4OHXA 4IJVA 5EJGA 3SCZA 1T2NA 1Q0PA 1OBOA 2QU8A 2J41A 3B1YA 2A4MA 4IF4A 3V48A 1AHHA 2W98A 1E8MA 1BX3A 3KOZA 4ZI7B 5B64A 1RI2A 1LJ8A 1Z3CA 1E58A 1N0UA 4JQSA 5ERYA 2PUHA 1KF0A 2QMHA 3VNBA 4C4PA 4L4YA 2IEYA 1CZHA 1V37A 3JAWA 4KBYA 2C4TA 2P68A 3AP2A 4HD8A 1H8HA 4FIDA 2WUEA 3M9LA 1ZOOA 4LY6A 1MKYA 5B4TA 4PBTA 5CB6A 1DJMA 1I5RA 2M9MA 4W8HA 1KVTA 1XPOA 4UZFA 4WY8A 5JC1A 4HB4A 2XKAA 4NHEA 3UIEA 1ZXLA 1VHLA 1E7WA 4HDKB 2K2QB 1NVVQ 3T6KA 4GPTA 1YJCA 4P3YA 2YYSA 4KUHA 5FB3A 2C04A 1NOJA 3EPJA 2OK8A 2P5SA 3RS8A 3ZY3A 3HCWA 1F0PA 2P91A 1HEUA 1HLPA 3KZOA 5DH9A 5BSMA 3CNNA 5I7EA 1AA6A 5K8TA 1KI6A 3AFIA 5LYJF 4DDTA 4U0JA 1UMDB 3LK6A 4NL4H 4AICA 1TVMA 2OO5C 3HYSA 3EFEA 3LRPA 4J7XA 4JOSA 1K88A 1HSOA 2E87A 3AEKB 1N6HA 4YXWD 5KYKA 4F3TA 1NN0A 3UJ3X 5KYXB 1YZQA 4ENRA 2HV8A 3PF9A 3SKXA 4S1OA 4IIHA 3U62A 2LV8A 1BC5A 3H8WA 4QPZA 4KX5A 4AMBA 1FYWA 5KHOC 2VYCA 3ROTA 1PZHA 1B0PA 1Z0DA 3HHEA 2XCLA 1IOWA 2W71A 1M74A 1EK6A 3CLTD 3F5SA 4ZC8A 3EPHA 5LUBA 2PUFA 2J9GA 4WNCA 1K92A 5EJEA 2XTMA 3H9JA 5DIZA 2CB9A 3EHEA 3EGXB 3LE8A 1ISHA 1CZUA 4ZIRB 3GJZA 4I50B 4QPPA 3ZXIA 3GF4A 4DEVA 3QJYA 4FK8A 2PUJA 2PMBA 3NTVA 3OEYA 4MVJH 3ULKA 3BCSA 1TM1E 1VIVA 1G8MA 2O06A 3SC2B 1UJMA 2RGCA 3EF3A 2FSGA 3PT9A 2ODTX 3VAZA 4ZC1A 4CQMB 1OFUA 2WFZA 4OLBA 2HA2A 2PQ2A 2O8FA 2P3OA 4BNDB 5E8RA 1JTFA 7REQB 1NU6A 2B1RA 1E89A 3KD2A 3Q6MA 5JEEA 4ER6A 1PSDA 1C30B 3CTPA 1P45A 2YNMC 2X8AA 2CK3D 3L93A 3ZTYA 1CHDA 2QROA 1HGXA 1GGVA 3VX4A 4CMEC 3RS7A 1BFUA 4OQFA 4KN8A 5FP0A 5KQRA 3QUTA 4BP8A 3STXA 1C2TA 4EY8A 1ZHOA 4PZEA 1QIIA 1VP3A 1TEXA 4M1EA 1QAQA 1E5VA 3AW9A 1BN6A 2FOIA 3Q8XB 4IKEA 3V8EA 5DI3A 3A05A 2AFVA 1V25A 1YVEI 1MXHA 4TKMA 3QKRA 4XFKA 2WVGA 3I4CA 3OA2A 1Y5LA 4NE7A 3IDOA 3GN2A 2H9IA 3U39A 1DO8A 1RE0A 1UPXA 5JSUA 5F98A 1SPXA 5K0BA 2WKPA 3CG0A 2ABWA 3QF4A 1JEJA 5J5CA 1PYOA 3KQTA 1VI6A 2TMGA 2XOXA 4AN4A 3ICEA 1PWHA 4ZQGA 4C7XA 4B35A 1DTEA 3QMVA 1GADO 1UFVA 4F3CA 1JJVA 4M9RA 1COWD 3HSKA 1HEIA 1EBUA 4S1PA 2KHZA 2OESA 4UE3S 2QRUA 1X92A 4DXHA 4R5HA 2PLRA 4Q4HB 5FUXA 4AW9A 4BBAA 1H1TA 2ZM5A 3AU9A 3BJRA 2ZT6A 5GY7A 2IV7A 3B3FA 5IXJA 4UQLA 1TQ8A 3KSUA 1J23A 1Z18A 3P71T 2JAWA 1YB4A 2Q28A 3CUKA 1LRLA 1ZM3A 4Z4FA 3AWIA 1L4KA 3L6RA 3AOGA 4NJMB 3DJFA 2DOKA 1DO2A 2IHJA 3NHMA 1SBNE 3Q7PA 3FTQA 5JNWA 4HFJA 1JSCA 1X14A 1D2HA 1H93A 3JYLA 1KVSA 2Q3CA 2WTNA 5IJAA 3U0VA 1YONA 4CCSA 3MJDA 3Q5DA 2DFPA 4XGNA 3MN1A 4ND5A 3CPEA 1SXJC 3T7EA 1P4JA 1IZ7A 4NZYA 4OHRA 4PBRA 3ZWMA 1E7SA 1Q1AA 2OZLA 2UZ1B 5LXTF 1GHTA 3WKAA 2AFHB 4WK0B 4J07A 4BO3A 4R6WA 4MVYA 3AFHA 1K8RA 4HL6A 5LMNB 5KTNA 1QQ6A 2DXIA 1ECPA 2H7CA 2AN5A 2ID4A 3KWJA 4L9WA 3Q3VA 3MTAA 1PTJC 4FC7A 3T9AA 1FE8A 4HNUA 4LYYA 1RI5A 2FHSA 2I67A 2P3QA 5CH5A 4EG5A 1WQ1R 3AJRA 3B1KA 5EN4A 3QU4A 2WY2D 5AXCA 1P3JA 1TCUA 2ZQYA 2F48A 1NX9A 3I9OA 1SBZA 5JAUA 5F3DA 2QXTA 1C3EA 4MV0A 3HDGA 5K6AC 3DHWC 2WHPA 3BIOA 2CXXA 3LA6A 3AMVA 3P4XA 2ZDGA 1NDUA 3PC2A 5JWRA 5EJMA 3LCUA 4PG8A 4R8SA 3DA8A 1LU9A 1ISRA 3QVJA 4C6TA 2P77A 2PU5A 1NLMA 2E82A 2FSHA 2RHTA 3IPRA 3GLHE 1N9ZA 1YT5A 4JYBA 4BFSA 3KJIA 5CJJA 3KCQA 2ECOA 4D9IA 4G8JA 1SCUB 5IKPA 3OIVA 2RG7A 1SBHA 1ITZA 1MRZA 3NDJA 3OE7A 5B1SA 5K9ZA 4HJRA 4XGQA 2SICE 4OFZA 3T1VA 3IA2A 3ICWA 3ORFA 5KVCA 1RMYA 2D1RA 2YCBA 1TI7A 4MR9B 1D2RA 4P33A 4RKYA 1CUYA 3MAJA 1QO7A 2XE6A 1NNEA 1OXKB 2HPZA 3L0DA 1HMPA 4IH4A 1CQJB 5LZ5A 3ZU5A 1TNDA 3H1BA 1Z0KA 3A1VA 1KZYC 3NTOA 1F2TB 1W0KD 5C80A 3C5WP 2FQ1A 4Q37A 3AK4A 2XNKA 4BQFA 1EP3B 5HKKA 1YB2A 3AOEA 3FYSA 2E1RA 2V58A 3LIPA 4DVGA 1RADA 3SPXA 5B4UA 2FZEA 3MT0A 3K0AB 2WIFA 3SXJA 4M4SA 3IJ5A 5KPDA 3QBTA 1UBHS 2JFXA 1XJCA 2BHNA 2YIVX 1AGPA 3EDCA 3HZZA 3M2TA 4LC1A 3WAKA 2G40A 1B8VA 2PBRA 2VNSA 4LJ8A 3OOEA 2W11A 4WA8A 3TM5A 4CM4A 1G291 4P7KA 1I1OA 3MRXA 1U0LA 4AZ3A 4GOLD 3A4IA 1GVHA 4MYTA 4EJSC 4PCLA 3K92A 3L5KA 2H48A 1DGQA 3RRZA 3A04A 4CDNA 1K4YA 2BFFA 3S1LA 2OEPA 2IJGX 3AVTA 2CBXA 2C5FA 3OCVA 1JEYB 1KSFX 1W0KA 1G1MA 1DT3A 5BV2P 4PLYA 2JH9A 1OLSB 4B5LA 3CJTA 1AGRA 3K6RA 2GAOA 1XPJA 1ZK0A 5EJFA 3W34A 3JW8A 4ZHQB 3AVYA 3DFMA 2VP4A 1L5HA 1E18A 1Z5NA 4L16A 3KYCB 5ALGA 1YRWA 1AXRA 2J3HA 5K0TA 2FU5C 1YO6A 2ONZA 1IY2A 2AJBA 3OE7D 1BQ3A 1JHXA 2NYUA 4BB6A 3WLPA 1G7TA 3IH5A 4G0NA 2Q2WA 4L4ZA 3F78A 3GLRA 3CRVA 3UCEA 5E4YA 5JFOA 1TOAA 4G5YA 1W88B 1L4UA 3BBPA 2ZU0C 2E4VA 3I5AA 1Q0TA 1MA0A 2AHOA 2IVZA 4II3A 5KDOA 4XB2A 2V97A 3MGKA 5KQPA 4GGMX 4QNRA 4YMLA 1KJNA 3GFRA 5DNVA 3PVZA 4JL5A 5D5PA 4C6SA 4YK7A 4W9NC 3L0PA 1ZK1A 5ELXA 3NEYA 2GJKA 4OA5A 4XLZA 3R8XA 1T1JA 3D7LA 3DH0A 3O4IA 3EHDA 4Y6OA 1NQVA 3WISA 1G9SA 3SJUA 5KKNB 1K3UB 2LKCA 2CLSA 4MPTA 1D0IA 1QOPB 2BFDB 1R5BA 2Q5JA 1WCIB 3GRYA 3NETA 4FB4A 4LXIA 3RSOA 1Y1PA 2GCOA 1OD6A 2BE7A 4FCCA 2IYYA 4QUEA 4R81A 4ZAFA 4XYLA 5BQFA 4P7JA 4JLDA 3DVQX 2VJCA 4J0FA 5G0WA 4AROA 1KJWA 4RPIA 3TO5A 2IXGA 2NZYA 4B7AA 4R0VA 1T43A 4AULA 2CLOB 1MJFA 1U7ZA 3OECA 1E2MA 1YQWA 4B6EA 1NBEA 4NATA 1YQXA 2VC2B 2OO5A 1X6VA 3WP1B 5TGTA 2REQA 1V6SA 4RK0A 4J2HA 2JHAA 4PPYA 1LPOA 1ULAA 1TAQA 3PK0A 4LS3A 3G5LA 4N40A 4NYJR 3MRTA 4U9UA 3DBVO 4F60A 3SHTA 4RV5A 3L5OA 4R9UC 3BZWA 1KEEB 4F84A 4AN0A 3V00A 1NL3A 1V11B 2HZ7A 1DEOA 2QQEA 3JZMA 4I9NA 2XUDA 1AMOA 2DWPA 1DRWA 4AJ1A 1XVTA 1M2HA 3FPFA 4U2FA 4WKCA 4LWOA 2QORA 1E2DA 4ZKDA 1VG1A 1FQJA 1SD5A 1Y1LA 1FP4A 1XWIA 1NURA 3ELDA 3NWJA 4G89A 2GESA 3SZ3A 3AY0A 1COWA 1VKOA 2G76A 2AOUA 3UENA 1I7SB 4FOPA 2OLJA 4WOCA 5KX5A 2VNKA 4UHFA 3LPCA 1U7WA 5C18A 1KZ1A 3SC6A 2ZATA 2PS0A 3CBQA 3CF0A 1US8B 2FN9A 1B8OA 3GP5A 4R3NA 4YT5A 4JGIA 3W7BA 5LLSA 3UK6A 2O7NA 1DJNA 4HNTA 5K8UA 4I5EA 1UC5B 3HCAA 5K8JB 4WZAB 1PHRA 2QTAA 1YBVA 2Y77A 3M34A 5FTKA 1V7QA 2ZRLA 1GKUB 4AM8A 3MUEA 1P61B 4R8LA 3O93A 4PW0A 3IERA 4MQBA 4TWAA 2YMPA 4NEQA 1KI9A 3FPEA 2YHIA 3PGLA 3L0SA 2O3JA 2JCBA 3GRUA 1JQAA 2CHEA 2P6NA 1NGSA 3GC6A 1O6BA 5G1PA 5KJ6A 4NMWA 1W5TA 3C7TA 2P6MA 3OOWA 5HMLA 1Z29A 5EZ5A 5TIIA 2EBUA 1A8HA 1SWWA 2ODPA 1JIXA 1YQDA 4L76A 3LOQA 2RHJA 2JB9A 3O38A 1YMVA 1QVAA 2B1GA 1FP6A 2J5KA 3BSWA 3FR8A 5EHQA 2QMEA 1XQ6A 1PZEA 1C7ZA 4KO4S 1BMFA 1UQRA 1FBNA 2G5PA 4DG8A 5CX1A 1I0LA 3BFXA 4RABA 4QPDA 2VAMA 1CF2O 1CR6A 5BXQC 4BV9A 1JJ7A 3HJCA 5JD3A 2RARA 4FFPA 4X7MA 3CFYA 3PCTA 3Q3GE 5EWLB 2ZI6A 1N5DA 2J3MA 2VP6A 3HUEA 3SDSA 4Q24A 4QRDA 3JRXA 3UTCA 3W5SA 2E5WA 4IIBA 1PEYA 4RH0A 3HM9A 1LFDB 4MUXA 4G8CA 2H0AA 2JLXA 1AKMA 4B3MB 5TC4A 3QUCA 2HNAA 2W2MA 2RKOA 3E5HA 2ZTVA 1MHPA 2JH3A 2ZE6A 3GRFA 4MJ7A 2Q3MA 4NYIQ 1U2DC 1O6CA 1UMCA 3A6ZA 1GPDG 1VL2A 3KKKA 1A7JA 3K30A 4INZA 1OYWA 3IR5A 1JAYA 4H60A 4JKYA 3VAAA 4KPGA 2WJJA 4YXWA 4AURA 3EG9A 2IXBA 1X1DA 5CM8B 3T3EA 3G0OA 3EC1A 1J0EA 3MWJA 4HSGA 2MMGA 3PXCX 1EX7A 4LF7B 1UMDA 3GCZA 2WIDA 4HDNB 4EFMA 4UPDA 5EKUA 4LRXA 1WQ3A 3SHQA 3JRNA 4TLLB 1M73E 2IIVA 5TR9A 4I0WB 1L4LA 3FE2A 3LUFA 4B0OA 4WDQA 1BE6A 2QJWA 3I64A 4KWHA 4KYTA 4MVWA 2QRHA 4OHCA 1MV8A 4UHEA 4ZREA 3VM6A 4F56A 2F90A