3V32A

Crystal structure of mcpip1 n-terminal conserved domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
156
Chain Sequence
DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease ZC3H12A
publication title Structural study of MCPIP1 N-terminal conserved domain reveals a PIN-like RNase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 156
sequence length 163
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v32A00
3V34A 5FT9A 5H9WA 5DIZA 4G26A 3V32A 4G23A 4G24A 4G25A 3V33A 5H9VA
chains in the Genus database with same CATH superfamily
4XRRA 1USVA 2JW5A 5H82A 1OT5A 2JGLA 3PDJA 4PSAA 1M0EA 1VI2A 1ZM7A 4JS0A 5EKTA 4BNJA 4BMPB 3Q8LA 3H05A 3IKJA 4H59A 4YRJA 4ARZB 3F73A 1B2RA 3RSGA 3IEXA 2PGXA 4D41A 3DKIA 4HNVA 3ILHA 3C6YA 3DT6A 4KGZA 4REQB 1XCOA 4WIAA 3F47A 5LYJF 5LQCA 1O03A 2W0MA 1DKNA 5AW5A 1WY7A 2C61A 2JARA 3NORA 1TNDA 4ILKA 3UJPA 3KX2A 2BKVA 3SC2A 4BAUA 1D9XA 1TQ2A 5B64A 1PJZA 4UQLA 1X7ZA 4Z4HA 3U13A 3OZSA 2RJOA 3KWFA 3ZY3A 3A2KA 1DEKA 3GMTA 2ZRLA 4NYIQ 4OSEA 4I2VA 1T4GA 1FBTA 4HTAA 4XSGA 5EIAA 3EFEA 1XJ0A 3NWEA 1C9YA 1ESCA 1U2SA 2C0PA 2DWQA 1OLSB 2OFXA 4LOHA 4MKRA 3ZYZA 4CEHA 2D00A 1BE6A 5BW5A 4UJ5A 4F3NA 1LXCA 4A4DA 3IEKA 3IHWA 2A1UB 4YCBA 2WMOB 2NG1A 1GYQA 5BYJA 5AI0A 4CEJB 1EFUA 1VZ3A 2QTZA 1S89A 1T26A 4JLVA 2B7BA 1AZTA 3NIGB 3QU4A 2FI1A 1Y1RA 3ADDA 1P45A 3PFKA 1G9XA 3PHGA 4OQNA 3VJRA 3B7WA 2ETXA 3OEEA 4KYVA 4UXIA 4L8YA 4N0EA 4TRMA 4H77A 1JHXA 4B74A 1N7HA 1EUDA 3FKJA 1JB1A 3IQFA 3K9NA 3ZD6A 1UJMA 4DLPA 4HNSA 3RBAA 1QS0B 3P9CA 3RYFA 3GLGA 1TEZA 1U2PA 2H2WA 4QBHA 4XPIB 1JUDA 1IFXA 1XNQB 1YTUA 1BC5A 4B17A 4CM4A 2B1QA 5DGCA 2OCDA 2BHLA 4CKCA 1QOZA 1D04A 3UANA 1EQ2A 1YZKA 3IEVA 1TFRA 3BH6A 1HC7A 2XZDA 4CMEA 4DGSA 3TG2A 1G6KA 3WA6A 2OECA 4NULA 2I22A 3FF1A 2OL4A 2NV6A 5FEMA 2GETA 2RGNA 4J7UA 3FTCA 3X3HA 5AVSA 5I48A 4IRXA 4HT3B 1J5PA 1T2NA 3Q1KA 5F73A 2ZJ0A 3TZ6A 5DXFA 4L1KA 2F3PA 1EFDN 1TVMA 1WABA 3HKCA 4LBVA 3GEEA 5E9QA 4ZVMA 1N5KA 4UU8A 5KAPA 4D82A 2C4NA 3L1HA 4MW6A 4GRIA 4KRXA 5K5EA 1UKVY 1Z74A 2QM7A 1UWKA 2XZPA 4OLHA 2ZI5A 1ZQ9A 3L9XA 3WSTA 1L5VA 4RCZA 2CEKA 3GJ0A 3MT8A 2QD1A 4K9KA 2AC4A 4LXXA 4C0SA 4D8TA 1ZJZA 5DN9A 5G4LA 3QVGB 2Q2OA 1TCUA 5C1OA 3CNEA 2BMEA 2BVNA 3FNRA 5J59A 1RU3A 4HAWA 5GZ1A 3DZFA 2QX8A 3T95A 4RA9A 3DE2X 1ZA2A 2B2NA 4QQ8A 1EE9A 4URXR 3E15A 1G8MA 4PSUA 2VF8A 2FN3A 1Z5WA 1CR0A 1Q57A 2AFHE 2J9RA 2OD9A 3AT1A 3CXRA 2N75A 4M9QA 4NCAA 1G8GA 1IQPA 5BURA 2YW9A 5AW3A 1BA2A 2GBIA 3KXKA 2BPOA 3CRNA 3UPDA 4C7MA 3IPYA 2FN7A 2EBFX 3HY3A 4G1EB 5JS7A 1D0SA 2OCYC 2QD2A 4IDQA 2ZJAA 4FX2A 2HQSA 2OBFA 2PGDA 4C6TA 4F93B 3KKNA 4LVOA 1U90A 1R3DA 1GSIA 2PMEA 2H7YA 3BM5A 1USWA 4ZCTA 3FTNA 2IHBA 2G1AA 1A3CA 2DECA 3VNBA 3K2BA 3RC9A 5JR3A 3S2EA 2DX7A 4I9FA 1SUCA 2A5JA 1EFHA 1NMQA 3BQ9A 1K1EA 3CTPA 4PSCA 4PZCA 4HGRA 4X44A 3DMHA 4HWTA 4LGVA 5IBQA 5FPQA 2B9EA 5FF9A 4A8TA 3L6EA 1GAEO 3JD2A 2ODWA 2A33A 3W0LB 3MEQA 1WDTA 1XKQA 2MMGA 5TXGA 4GC5A 4DIOA 4KACA 1GKKA 4GLLA 2YFQA 2DGDA 3H5WA 3MLAA 3PRKE 4QGAA 3CZPA 5J23A 4A10A 1C1DA 4L0DA 1XNGA 4RU1A 4JBXA 1ILWA 2BJWA 4JODA 2D06A 3O83A 3P9RA 4OJYA 1PFGA 1R12A 2OE2A 2ZT6A 2HQ1A 2NX2A 3DZIA 1F3OA 3DYVA 4G81A 4NYMQ 3U7QB 3RRFA 1MOSA 5L51A 4YP7A 2XODA 4M37A 1RTTA 2O20A 2PZLA 3ZHZA 2JLAA 4MGHA 1YONA 4EF5A 1IDN1 3LUDA 1QAOA 2HOQA 1JR4A 1UBFA 2DG2A 5JS2A 2F7SA 2A57A 4LOLA 1OV6A 1SHLA 1SH7A 2Z6QA 1Q0PA 2KBEA 3I6IA 3EEOA 2IQ5A 1V8FA 5AP9A 4E5KA 1NW5A 3AESA 3HDGA 1Q16A 4PE5B 4BFTA 4CV0A 5JNUA 3S70A 1LK0A 4AZ0B 1P60A 4F6RB 4B82A 2HN9A 3MFYA 1Z16A 5LZ5A 4IXTA 1JAYA 5EHQA 2XRFA 1VXOA 2OHJA 2VJLA 1BHQ1 3BWBA 3LD9A 2D5CA 5HK8A 2BFCA 1PNVA 4KAFA 1NBIA 1FRNA 4OXXA 1LV7A 2XIJA 2ZOSA 3AU8A 4FNOA 5DM1A 5BNFA 1DAIA 1TQ4A 5EESA 2OAP1 5AXAA 4LI0A 4NS4A 2WA2A 3DEZA 3HB5X 3HJTA 5CB4A 2ASVA 4H27A 1SCUA 1ZJ4A 4HYYA 5JDCA 1P62B 4R9SA 1RYFA 3DWFA 3PFHA 1YE8A 5T3YA 3KCNA 3W8RA 2P4UA 4NQZA 3DL0A 1UOEA 2GPTA 3H7IA 2CHVA 3FCCA 5CLGA 3FGPA 3QI2A 5EKUA 1TK9A 3AK4A 3JQGA 1FS5A 1N9ZA 1IIBA 4QJ3A 5FOVA 1AHIA 2B21A 3O2JA 1KQPA 3PVZA 1QSGA 1ZINA 5JYCA 3F6RA 4JDPA 4IYRA 5K6AC 5KTKA 5J1SB 3UG6A 5IUNC 4EG6A 1W6UA 3FNHA 3RYIB 3TCNA 2IU4A 3EFOB 3PUZA 2CD7A 3MINA 3UJ9A 3R5FA 4L8WB 4BCDA 1ZUWA 4I1PA 4R7TA 1PK9A 1NKTA 1I3MA 1A50B 2RBGA 3UGQA 3ZQKA 3HKDA 3NHJA 4BNLA 4DWJA 3MRSA 3UG7A 4DAOA 5H4GA 1ZCZA 1IXSB 4WLFA 2HC9A 4S04A 3TRFA 3RDPA 1VBKA 2B78A 2PMDA 1A4UA 3GDGA 3V7FA 3WRXA 1G291 4B48A 5KOJA 2M6SA 2Q49A 4DLAA 5MF6A 2H18A 1T36A 4INOA 1GPMA 2ZRCA 5E2BA 3HNRA 3TRIA 4B44A 1MA3A 5HBGA 4R3UC 3PNKA 2Y67A 1NVWQ 3H2JA 2YN4A 2FSGA 3MJRA 1QVWA 5H7XA 1W6RA 5JYDA 2BWJA 2Q3DA 1X9GA 3EXHB 1YFKA 1G38A 5L3SA 3B6EA 4KLAA 5EMLA 3WYEA 4DPMA 3IV7A 3HU5A 1HE3A 4FGUA 2WU1A 4IMPA 5AH0A 4W7SA 4XUDA 3ZX5A 4TVBA 1AZSC 4TRRA 1G55A 2GHIA 1V1MB 3O3OB 4F4JA 5JMWA 2WT8A 5AVTA 2Q3EA 1WHTA 3CUWA 4FP9A 1B15A 1YZFA 1JXOA 2FR1A 4XR4A 2ADOA 5GVRA 2OCGA 5JPCA 2FPLA 1NQOA 2WOJA 4IEEA 2WZQA 4XWGA 5EZSA 5LWHA 1M5RA 2WJWA 1BS1A 5AKZA 3T06B 1VG0B 1WG8A 1XTUA 3D8NA 4DR4B 3MOIA 4BKPA 2RHOA 1I7SB 4JZYA 4EVRA 1GT6A 3DAGA 5A9SB 4CMEC 1R4MA 1YQXA 5JD5A 1HUQA 1YA4A 5CPFA 4BCBA 1BSVA 2AUTA 3JSAA 1O97C 3HMKA 5F1KA 1F1BA 2AR7A 5K6TA 3NGLA 5BSHA 5JUWA 3RSCA 4N4AA 4TZ0A 2RGNC 3MM4A 4HLNA 1E0KA 4IF4A 1RJGA 1ADFA 1L7NA 2GESA 3TPFA 1X7DA 4EJ6A 4LXIA 5H4HA 3A4NA 4JEIA 5DLEA 2I0FA 2XIQA 3P2MA 4KC0A 2Y6VA 4YRSA 2Q1XA 1Y4SA 2ZU6A 3I76A 3V7WA 3W5CA 1JS1X 4UD6A 3RTGA 2Y66A 1L1QA 1XXLA 3ODGA 2IBTA 1L4YA 1WOMA 2VA9A 2J6CA 3LX4A 1HDIA 4M98A 1LVGA 1USUA 4EPTA 4OUKX 1DKUA 2CC2A 2BC9A 3A28A 3QTLA 1V9SA 3L7MA 1KK2A 1V45E 4L75A 1IWOA 4OSOA 1EFVB 2QTCA 1QYXA 3KXPA 1JG2A 4TSRA 3AI3A 3UA4A 1FK8A 1L7XA 2NOAA 5K2OA 1A8IA 3K7EA 2DLNA 1LNZA 2VHWA 1TCCA 2IS1A 1D6MA 1GCUA 2IYFA 3N2IA 5EIEA 2NO0A 5HZGA 4KXLA 3O73A 2QTVA 4RMNA 3ZVNA 2DXIA 1G0NA 2I7DA 3EMVA 3OUZA 3PQ2A 3TNFA 3VHXB 4A7PA 3FRIA 4QVGA 3RAGA 1UUFA 4TROA 1GLVA 4MYUA 4Q03A 1Y6ZA 3ETDA 3A1WA 1W96A 3TOVA 2WD7A 4LXTA 1JN0A 1RYEA 2P6MA 5DJ5A 3UWSA 2AW5A 1TQDA 3E1SA 4WLEA 3FNQA 4BJ1A 2B2XA 4AMBA 4F96A 1JDJA 5JARA 4GMFA 3WK6A 2UUAB 1N3IA 1CNFA 1Q1QA 1SHZA 3B8HA 3BSYA 4CKYA 4DF3A 4EAAA 6REQA 5K3OA 2ZJ7A 3A1DA 4YUVA 1DBWA 3ZBPA 3TQIA 2IIBA 3RVJA 1H2XA 4HDSA 4DMLA 1CZUA 4RWZA 3IHLA 4B3SB 1ZC3A 2W2XA 3U19A 4Z6KA 3UAZA 1O0SA 3EEIA 4DUGA 1T4CA 1Z4QA 1I4EB 1I1HA 1NKVA 3NS7A 1W1WA 1XTZA 4Y6QA 3EVAA 1E7MA 4KQ6A 5B58T 3EXEB 3LDHA 3JQPA 1A7UA 3ICCA 4HX5A 1N2JA 1OWNA 3LK6A 3QE2A 4CEIA 4HUQA 1AB5A 1CUZA 2A5FA 3R7WA 2JIRA 3KLOA 3S8EA 3UXMA 2B8NA 3UCFA 4IVQA 4YP9A 4A6EA 2QBYA 1A9TA 3H1TA 4UM8B 1CK4A 1QRDA 4C7VA 1FRFS 2ADMA 5K0LA 2XA2A 4OQDA 1MX3A 1A9OA 2DQZA 3SBOA 4WASA 2AFHB 4OQEA 1EDBA 5BW4A 4RF4A 2W2MA 1OFIA 1DBRA 1NLZA 2AX4A 2WJ4A 3KZ1E 5AYVA 4RO0A 2LCQA 5CDSA 3C4JA 2C59A 4DDHA 1I01A 2I3BA 3G5MA 1C8VB 2G9UA 2MHCA 3NDIA 1K08A 4RVOA 4C06A 4D9BA 5ALFA 3GX1A 1ZI8A 2YDYA 4YCSA 1YR8A 1NW8A 2WSBA 4ZVKA 4AJ1A 3LC0A 4NZOA 4TMTA 5EJAA 2CD9A 4J76A 1QK4A 3ANSA 1PV2A 1ZOPA 3ETJA 5AHRA 4EUKA 4MDYA 1G18A 1JSZA 2RGEA 5TPWB 1VLZA 1PHRA 1U2TA 2W6PA 3P0JA 1L7QA 4A8JC 5L45A 3ZWMA 5U4QA 1OH5A 4F5DA 1KI4A 3OWHA 1GN8A 1XALA 2NP6A 1ZPDA 1OW3B 4RTKA 1U3DA 4E09A 2NXEA 4O4HB 2VYVA 1SNYA 2O2YA 5JDCC 2WAAA 3EY4A 2X15A 4W6ZA 4ZJYA 3ZBQA 1ADBA 1GNTA 3UMYA 1P3Y1 2I54A 1CUBA 1M2EA 2X8WA 4CBVA 1JLKA 4MIKA 1YOVB 4PPFA 1E9EA 4RFVA 3RYTC 1GGMA 5KSZA 1YDGA 5DULA 3S1AA 4G0NA 1N2CE 3WLFA 3HGTA 2P9BA 4OAPA 3GP8A 1ZW1A 3AY6A 1S6YA 2QZ4A 2H31A 1YAHA 4WW0A 4EG4A 5B3JC 1F8GA 5CX1B 3G9TA 4QGFA 3ZNPA 5EQTA 4KNWA 4OG2A 3FVRA 4ESOA 3W9SA 1DEOA 4GXRA 1L7RA 3MTBA 3W4JA 3RTEA 4AY3A 1ZDMA 4MI9A 5FQNA 3STVA 5DBIA 3JV7A 1VYTA 4L51A 3UQYS 2A6PA 2YRWA 4AW9A 3M6FA 5BSVA 3GFRA 1FTSA 1HNNA 3LP8A 4NHOA 4RPHA 4RZQA 5AM1A 2J9YB 5HWSA 2COKA 4FSXA 1LLFA 1H8HA 4UNNA 3E7FA 3E81A 3SICE 3GFQA 3LUAA 1Q6ZA 3WRXC 1MF7A 1XN1A 1LPSA 4K9OA 5CH8A 5G0WA 2G6BA 1JJ7A 2ZR8A 3BMQA 3I04A 2ZATA 1DX6A 3ZZNA 4RM3A 4ZIRB 1EWYA 2IYRA 3B9RA 5JECA 5DHSA 4ZVQA 1GAXA 1BDHA 3ZWQA 4MQ4A 4AP5A 5C7IO 3QFSA 2HIHA 3QE9Y 4PIPA 4MUMA 4MVJG 1XTQA 3N2GA 1N6HA 4JVMA 2PCJA 4NFLA 4RK1A 3RS3A 4HI0E 2FQYA 4HEQA 4BNFA 1FY2A 4JC4A 4CI9A 1OMOA 3GEMA 1LPAB 2J07A 4NE9A 1KO7A 2CNOA 1CFZA 4KJZA 5AI8A 5HKBA 1HT2E 5C1IA 3BZUA 1Y7HA 2B82A 3D59A 3DEJA 1Q21A 3I05A 3I1YA 3G8DA 4NU5A 4O4HF 4UXJA 4F3YA 1NUQA 4EJSB 4XDZA 2ZTSA 3WZ2A 3T1HB 4HWKA 1ISMA 3HZRA 4BQFA 4R1QA 3ESYA 2NVUA 3OP4A 2OTCA 4UBNA 2IEBA 4LUCA 4YJGA 4Y9RA 3V2GA 2JEYA 2ZI4A 3JWHA 4UHEA 1AS2A 1RMQA 1Q6YA 2B69A 2XCTB 2PUAA 3THWA 5IJXA 3V7NA 2BBOA 5FTNA 3USZA 1XQXA 2XBMA 3ETGA 3OBBA 3QYAA 2IOQA 2V7GA 1R8YA 1OA1A 3QK7A 4X8HA 5ERYA 2HUPA 2IHYA 3A9CA 1ONSA 2BFMA 1SBNE 5AJHA 4EZBA 4PG5A 2UZ4A 5LZ9A 4PG4A 3UK6A 4BNZA 4BO6A 3O2SB 3IVRA 2RAVA 1F8UA 5IX8A 1A04A 4J0JA 1YC5A 4FZJA 2YC4C 4ZKDA 1MX1A 1GU0A 2Y1FA 5IC5A 1YE5A 1VMDA 3GDFA 2PIAA 1T1EA 4DXHA 3WB0A 4HGZA 4CV2A 2H8KA 3ZWXA 3PCTA 1VJ5A 2D2XA 3H1BA 4UFPA 1Q95A 4ALIA 4QLBA 2J6BA 4Q1AA 5EJFA 1E64A 4DJTA 1XRNA 2FPUA 3IBCA 3PJFA 4QDUA 1SUPA 3L5KA 4V3CA 3BC1A 2ACVA 3O21A 4OHPA 4P3YA 1ISHA 2CDNA 3I2GA 3OKAA 4YMGA 2UXCB 4LHVA 4AJIA 4KXXA 3RNOA 3LWNA 3W2IA 1VL6A 4IJVA 2FETA 2CLLB 4NP6A 3NMUF 1NBWB 2GAFA 1F8XA 3OTGA 4MIOA 1F4VA 2FOXA 2M2IA 4MS3B 5E7IA 2CXSA 3FMOB 4PZEA 3VNQA 2HJRA 4ZQEA 4R8VA 4QO8A 3VTKA 2VWQA 4HK4A 2JHCA 1T2EA 2E1PA 5GWXA 1H4SA 3N0WA 2QRJA 2REOA 3UUFA 4UTOA 5BUCA 1M3SA 1YUBA 2QQGA 3AP2A 2ATXA 3AR2A 1UEIA 2FUG1 3LGXA 3MCUA 4Q4AA 1V11A 5HKLA 1MC5A 3OPXA 3OC6A 4XD2A 3C3CA 1ADGA 3EPLA 3T9DA 2O0KA 5K3FB 2GCOB 3D6FA 2GPNA 1GNPA 1T8SA 4LIPD 2V7TA 3Q3JB 3DOUA 1JHDA 2BMJA 3H9JA 3AFGA 3F3YA 1N5IA 4GI2A 4AWBA 1QV9A 3DWIA 4H31A 2HGSA 2DAPA 2V03A 4MINA 4NNJA 1EEHA 4WGGA 4UTPA 4IGEA 1ZVQA 1G3MA 4FGSA 1SUEA 4D9GA 3AG5A 4MUBA 5JTTA 5DNEA 2XADA 3EDRA 1YA8A 2YZ2A 3VKFA 3B5JA 3RBZA 2HV9A 3UJ3X 4DDMA 4GYWA 1ESZA 1Y6QA 1RRFA 1ZICA 5DFAA 4OHCA 1SC6A 4GR5A 5AR1A 1U0OC 1OLXB 2BBTA 2CYCA 2MYPA 1YJXA 3A6ZA 3PGXA 4GGOA 5AJZA 4CKEA 3A8TA 3K1AA 4DIDA 4DLBA 3G2KA 4CM9D 2I7VA 4BJ3A 5HFAA 1HH4A 2Q3MA 5B6PA 3ZVKA 2BF4A 4MHSA 3UB4A 2PS1A 2H65A 3V1NA 5JRDS 3A2MA 3PL1A 5K6RA 1PJAA 2JANA 4I1YA 4ZCIA 4AO8A 4ZJPA 1G1MA 2VAMA 5I7SA 5KWVA 1E2BA 3G2PA 5HF8A 5CXSA 3B38A 1DVRA 4GZMA 4KAXA 4Q12A 5CMLA 3LFHA 3B5IA 4D4IA 4O4IF 5ABPA 5JD6A 1OWLA 3MJHA 2YYSA 1Y7PA 4FYWA 3P20A 2OMKA 2GXAA 2IH2A 1U94A 3FPKA 3JD4A 3WKCA 1ABFA 2XVYA 2PLAA 4IR7A 1TO6A 3IJ5A 5G02A 4LY6A 4HEHA 2Q6LA 3W77A 2YHAA 4B3CA 2HT1A 2EG9A 1AH2A 1FNMA 2X7XA 3VV2A 3VZRA 5E4TA 4HN9A 2Z8YM 3IQGX 5CG1A 2IXGA 4V0KA 2GLXA 1PWYE 3BD7A 2FRXA 2QLJA 3IPRA 1JH9A 2ZW9A 1Y80A 1X80B 2AOUA 3OIUA 3RTAA 2QTGA 2XMPA 1KIFA 3L8EA 1UOQA 1ULAA 2HIMA 4QDTA 5ES4B 2C31A 3F71A 1V2HE 1IHXA 2FW6A 2FZKA 1CJTC 1IXZA 2VBFA 2D5LA 1R8SA 3G89A 3I12A 4ZU1X 3IVAA 4G4SO 1AZLA 3GUYA 3WGMA 2CFTA 2DOKA 2LWIA 4XAQA 1JI0A 1B14A 3SFVA 4WEQA 4D3ZA 2Q41A 4X85A 2AIRA 1BO6A 2R47A 3H17A 4HMOA 1PNRA 5CUQA 2FG7C 4MKXA 3TOSA 3GUCA 1JQDA 2V54A 2Q6VA 4Z53A 1XCMA 3ORQA 4ABTA 3WQSB 3BE5A 4NG5A 3WYNA 4J6FA 4GXTA 2OZKA 2CBZA 4QPZA 5G0UA 3ZKWA 4XVCA 1PT6A 1Z2EA 1TT5A 4KPGA 1YR1A 1PVDA 4MCJA 4MGZR 3V6LA 1B16A 4P0PB 1PR4A 2HIAA 1P7YA 4XFKA 1GLGA 2XA1A 2HPVA 2Q3HA 4GQAA 1UMDA 3ANLA 5JE8A 4KSCA 1UPUA 5LLSA 4AL4A 1KEVA 3CTMA 3AI2A 3CBGA 2HMTA 2BJVA 3ECCA 1V2GA 2XH8A 3DV0B 3L1JA 3MCWA 5EWJB 3WVNA 3LYAA 3NEYA 3P0RA 3ZWWA 2HMYB 2AR0A 1CULC 1UF9A 2PUTA 3M4JA 4QICA 1XZCA 1ACLA 3TNYA 1RI5A 1ZNYA 4FFBB 4PG8A 5C8VA 2JLCA 1FFYA 3KUCA 2BMDA 3V48A 3WADA 3LUHA 4WZ6A 2IODA 5JO0A 4QG7A 3N5CA 1ZKDA 1K97A 2X8LA 4U3JB 1N2CB 4C04A 1NGSA 3AU9A 4P38A 2OAEA 1CUJA 1PYOA 2UYGA 1B8NA 2VYND 4Q1DA 4BVLA 2HLDA 4FE3A 4I3HA 5HIAA 1YRAA 1V4BA 4ZDWA 1RPJA 3ANNA 4U2BA 3M81A 2PMCA 2OYRA 1EVZA 1EP3B 4O1HA 2KQUA 3HYTA 1PYDA 1J99A 2XE4A 2JBAA 4G5SA 1IZ8A 5CVVA 2W70A 1T4MA 2MR5A 3AF4A 3HUEA 3ZGVA 1XTBA 2FZGA 3WGQA 4P6VF 1DU4A 3PNLA 2YOHA 5ALVA 2HWYA 4XJXA 1B4DA 2B0CA 1FQJA 3SE7A 3UK7A 5EPUA 2P0YA 1E3TA 1FJ2A 1P7ZA 4M9SA 2BEVB 2CXXA 3LPAA 4PQFA 1NNSA 3KAJA 4A26A 2ZR9A 4LBWA 1RIIA 5LNK1 4AUKA 4OO3A 4EHKA 1E9VA 3G2MA 3HJNA 1C8BA 4M9ZA 4OD0A 3JZIA 1KEEB 1F51E 3KSZO 1QVRA 1LPNA 3MMSA 1VIVA 4GGPA 4YP5A 5JCJD 2E4YA 5K8UA 2FWJA 2E37A 1AQNA 1KKLA 1N5MA 1CZRA 1Y5LA 2L82A 4WKPA 4BC0A 5C5DA 5ADHA 2JCXA 5C46F 3V5NA 1CDOA 3EWIA 1OHHA 2WBLC 1JNXX 2QLLA 3CWQA 3C6XA 3E4CA 4ZHQA 3IQDB 5DF1A 5BOSA 4OHZA 4RQAA 4NFHA 1O3YA 3UV6A 1KI6A 1REQA 4BWGA 5FKJA 5JWRA 3AVWA 4L2IA 4B6RA 3NTUA 4DHWA 3CFYA 4D3YA 3WIDA 3FMIA 2BDTA 4PYQA 3TLKA 1BEUB 4NENA 3HNOA 4I81A 3V4VB 3U4AA 1XK6A 2GNOA 2X5NA 5HF5A 1EP2B 2XE6A 5ITSA 5AK5A 2HI0A 4ARUA 3EPKA 2CE7A 4DQDA 4CM8A 5SZHB 4JBGA 1EA7A 1F2TA 4EPXA 2ZYSA 3KUKA 5IW8A 4GOJA 4HGPA 3N2NA 4EJMA 1LF5A 1JDPA 2IZ6A 1M10A 2F3TA 4BB9A 3ZNQA 2D7DA 1UP4A 2Q6IA 3VYSB 3KUDA 4LRYA 3ZEAA 1KYWA 3GBVA 4MB6A 1OFVA 4PAWA 2I2FA 5EJ8A 3WLHA 1NBMD 1TYBE 4KFCA 4EA7A 3K30A 3WGHA 3I2FA 2QE7D 2F8MA 1H0SA 3DUFA 3U4IA 1ICIA 1W4RA 3RC2A 3G49A 3MGKA 4IS3A 1ZIDA 2FCAA 2YHIB 4KO2S 4OY3A 3DH0A 4KBYA 3B13B 4IDGA 3UGJA 3GLFE 1IQ0A 3CR7A 2IDKA 2O48X 1YS1X 3ONWA 4PIMA 1HSZA 4J9UE 4D44A 5F2OA 4KMRA 3H7AA 3WWDA 2GN0A 1JR3A 1M1YA 1G5QA 1T6XA 1X15A 2JA1A 3HI4A 1GPWB 3EH1A 3L7LA 2ZRIA 3JQAB 2R1VA 3MCZA 4M54A 4FFNA 1VCHA 3ONNA 4R68A 2XQFA 3KDSE 4ACBA 3A9SA 2BTQB 1C3OB 3T1TA 4EYSA 4IPTA 5DXJA 4AQYB 4KH1A 1I6LA 4C07A 3SZMA 4H1VA 2KM1A 4L0MA 1GCIA 3AI1A 3PX3A 2VYCA 4YXWA 3ZY2A 2ZRHA 4JKIA 2R65A 1DXHA 1R0ZA 1H65A 1R0RE 1R16A 2DFNA 3LNTA 1WCYA 4FD2A 1ZLXA 2MSCB 5DYWA 4RPKA 4UTXA 1ODLA 3WFZA 5CB4B 1SUBA 2OB1A 1GTSA 1EWRA 3F6CA 4MQ5A 2XCLA 1NLYA 3TQOA 4RZUA 1ISJA 1P2TA 1US8B 1GQ2A 3N6XA 4IQ4A 3G8BA 4TLCA 4YJFB 4DREA 2VRCA 4IDEA 2NNLD 3WGOA 4EELA 4GPTA 1G7SA 3IT2A 3W4IA 1BD3A 2O8EA 5LQUA 4IV5A 4RK6A 5E1DA 1GFZA 5H70A 1TU4A 4PG6A 3W6ZA 3HS3A 3B8EA 6CHYA 4IM7A 1FFWA 3KO8A 4KQWA 2PD4A 4BQNA 3ICEA 4M99A 3IBSA 3KL2A 3Q41A 1I3OA 2C2XA 4XVQA 4X1IB 2WUWE 2J46A 1PL6A 3OZEA 3ZCPA 4GNKA 5HCIA 2HNKA 1UINA 5CDFA 4EKIA 2OPBA 4BE7B 1I7QB 4G0VA 1WU8A 1YVDA 2QNIA 4YH1A 5LIPA 2EQAA 1E96A 3P97A 2OV1A 2GM4A 3F6PA 1ZCBA 3LIPA 3IB6A 2QIPA 1RE1A 1SZDA 1D2EA 2XVZA 3CNLA 2JIOA 5L40A 3LDAA 4YJ3A 5HJ5A 4FONA 2ZAMA 2TS1A 3QA3E 3NKVA 3S7ZA 4FU0A 1V47A 1UKCA 2ZRJA 3AEUB 4ZT7A 1N33B 5I47A 1F0NA 4G5YA 1GPAA 5C4GB 1LK5A 3ZPXA 4AMVA 4N6NA 1D2GA 4KVGA 3N2YA 2GA9A 5K0BA 3JVVA 3AOGA 5FBQB 3A9VA 4F3TA 5BWMA 4UU0A 1K7YA 3L84A 3LHSA 3OFJA 4I50B 3E18A 1NVXQ 3Q98A 2GZ3A 2D1QA 4G9EA 3MPUA 4IJ5A 1BJKA 4R1UA 5F1OA 1QIFA 3PG5A 1I80A 3CF6R 3RNLA 3TI7A 4Y2JA 4D92A 4P83A 4V1CB 1NMSA 2ECFA 2H29A 4EA9A 1T25A 2A0FA 2ZFUA 2XT0A 4MWOA 4PR3A 2G9NA 2NUAB 3WY9A 2JHGA 5AESA 4R2MA 2GNPA 2JJQA 5CIYA 1STOA 4D9IA 1KDVA 2JAUA 3A4IA 5M29A 2BOVA 4D0RA 3LT2A 5BN5B 3MILA 3QVXA 4F6CA 3ZBUA 2CZCA 1DBPA 3PUYA 1NUSA 1YR9A 3TB6A 3FI0A 2QKYA 3O03A 1DWQA 3E9RA 3LGSA 2GTIA 4HOYA 2DPLA 3OZVA 3MBOA 3O1LA 2IYVA 4HEJA 3I8OA 1BMDA 1Y1PA 2XGSA 3BL5A 4RC9A 4I1OA 1YRLA 1Q2XA 1K5HA 3F6YA 5JRZA 1J0EA 2A5LA 4DRXB 3OE4A 2VKQA 4B6QA 3AZPA 3ROXA 2EW1A 1KYXA 2XR1A 4MUJA 3D81A 1XCGB 4MRPA 2IWHA 3OMLA 3KJEA 1U7DA 1MABA 3EJWA 3QWBA 4FYXA 2G09A 3CZ5A 4LGYA 4UUOA 3V3KA 1J1ZA 2H1LA 4AKEA 2YHUA 1TKRA 2Z4RA 3KZXA 4HXYA 1LUAA 1GGVA 1EBBA 2OGSA 2PVPA 4TN5A 1AURA 1U7HA 2X2FA 1XPJA 1JYSA 3AIIA 3IP6A 2CNDA 2PFGA 1J0CA 1EEXB 1JXMA 4XGRA 3CRVA 1KAGA 3TMAA 1PWZA 3EGDA 2C2HA 5FV7A 4MQUA 1FDUA 1SBZA 3VPBA 1K88A 3P8ZA 3HB4X 4UAUA 3ABRB 5GP1A 2OO5A 3B3AA 2WJ3A 3OF3A 4D56A 4X66B 3LTEA 1BXGA 1JMKC 1PHPA 2GD6A 3BS4A 1QWSA 3EVTA 1EWVA 1BG6A 4I50F 2CZGA 2YXNA 4I4CA 4NPCA 4ETWA 4OMUA 4TKVB 3I62A 5K3CA 1LGYA 3LA8A 1IRIA 2PEZA 2YV2A 4G0PA 2V7EA 5E9WA 5I8ZA 1JZSA 1R7RA 4GYJA 4A91A 5BUZA 1YC2A 4JVOA 4C4OA 1BH6A 2CL5A 1CS4C 1TE2A 2QROA 3GRPA 3KQLA 3SD7A 1ZD3A 4P5PA 3UK1A 2IXTA 2IW1A 2BR5A 4BU1A 1ICEA 1OGIA 3I34X 3L77A 3HZHA 5EIBD 3UAOA 3WTCA 3SEFA 4NIMA 1CSEE 1XTJA 1P7WA 1MO4A 3RAPR 4F11A 4MRMA 3S5JA 1AIPA 4OHYA 3FPAA 3KQVA 3R7DA 4HV4A 5LOVA 4B8YA 4DDVA 2NO1A 1VDZA 2QTFA 1Y48E 3OF5A 3QQPA 4JP1A 1M6NA 4DY4A 4QOHA 4TQUS 1KZ9A 2BFWA 3PSHA 4N39A 1KXJA 2F43B 5C80A 4G9GA 1MVLA 4G07A 2RGUA 1JZQA 4GD3Q 1I7PA 2YMQA 2UZ3A 4HKTA 4R84A 5KU7A 2K2QB 3RRYA 2ID8A 4BVGA 5PGMA 5A1JA 3DBHB 5JG7A 5D51S 3TJRA 4BX0A 2VS1A 4E03A 3FVVA 3S81A 3BIJA 1S0UA 1T4BA 2AEJA 3NVMB 3OIVA 1R3UA 3Q9NA 4M0PA 3SHWA 3T54A 3V8NA 1ZD2P 2CZQA 4IZHA 3R6TA 5EERA 3WX0A 5HTKA 3EZLA 2EFGA 2XGJA 5BQ5A 2W2PA 1ZW6A 4F97A 3ASZA 4MIYA 3ROEA 4DR3B 1IZ9A 2XAUA 2F1OA 4BVEA 5ELMA 1IZ7A 1CHNA 3V97A 3MHTA 3VXKA 3FSRA 3FUUA 2DLCX 2JFGA 1KFEB 3VR5H 2ZRAA 3CG0A 1SBQA 1R0SA 2OZVA 4X9XA 4S2EA 4XDHA 5IF9A 1TMKA 1H1LA 2YVUA 3G0OA 1C9JA 5AOBA 4ZVTA 3U1BA 1TF7A 3TLXA 1D07A 1E79D 2AFVA 4AZ3A 4DTIA 3VNVA 2VPWA 1EK6A 4KXFB 3TAXA 2ZUBA 3PT5A 4MI3A 3R7AA 1HMYA 2BRUA 1HX7A 3CEMA 3TQCA 1BXZA 2AE1A 2QVBA 1Q3HA 1XMVA 1LNQA 3PL5A 1C7ZA 2VHZA 4XB1A 3AB7A 3P9KA 4AZWA 1S7CA 4D4KA 4I1VA 4YV7A 2H54A 1EZ1A 1SRRA 4QGBA 1SVNA 4QELA 4D3DA 1ATIA 2PL5A 1RAIA 2IITA 2VDKB 1P19A 2V7VA 3W1VA 1TI7A 2C9BA 2X13A 5KYXA 4FYMA 2ZB8A 3KZOA 3H11B 3FH0A 4KWHA 3UMGA 1AGRA 2MSLA 3DMRA 4MK4A 3GLFB 3G8AA 1JA1A 1EGVB 1P0CA 4FPXA 2WQ7A 4L02A 2OQVA 3KZNA 5BQXA 2P5TB 1FP7A 2OILA 5EWMB 3E61A 5GJBA 1JB9A 2I6FA 3OEWA 3SDSA 4CM3A 1PJSA 4AAYA 1QANA 5JCOA 3PUJA 2GCNA 2CDAA 2B8WA 4UHCA 1KNQA 3AHHA 1QAQA 2HLPA 3U5TA 1T9CA 3C4VA 4KFRA 1OI7A 3CYFA 1Z0AA 3AONB 4N5MA 1HFEL 3LOQA 3SN6A 1KMMA 2XF8A 3QFCA 4Z0HO 4A36A 1AXRA 2EFJA 1NPDA 3VHLB 2H00A 3I9LA 3GVIA 3PKZA 3QXCA 1E1CB 4IWYA 4ZU3A 3C3BA 1KSJA 1SXIA 1WM1A 2FOIA 1LSUA 3QX9A 1V7QA 2NO7A 3LFUA 2WE8A 1QR6A 4P35A 1T0JB 1GD1O 2O0JA 5AVRA 3KVOA 4KSBA 1GUBA 3H0EA 2AOVA 4K6CA 4P53A 3ZVLA 2Q5OA 1S2GA 2ONJA 4PX2A 5IYZB 3WL5A 3VAYA 3DKRA 4BQPA 5CB6A 1UZUA 5T8KA 2ID9A 3IKLA 2FSPA 4C01A 1JFTA 2XCQA 1K5DA 1HV8A 3WL7A 2XSZA 3RUAA 3C3YA 2PL3A 3ES9A 4NXNB 1RAEA 1TZBA 1SD2A 4BGUA 1SPBS 3WGNA 1G8AA 3EAQA 1U6IA 3M8KA 1W4ZA 1QK3A 1R0BA 5AK4A 3DW3X 4X3OA 3RAJA 3C3PA 3ABIA 1SOUA 1U1IA 1ZONA 2H3EA 1NVEA 2CXQA 3ZHYA 2XRMA 1YQTA 4JJ8A 4LK3A 4LRTB 1N2SA 4OXRA 4OXYA 2FA9A 1X2EA 1PD1A 3AF0A 3FOFC 4RDIA 3TJZA 3M7IA 1GPUA 4G5FA 5D3KA 4MW0A 3ETNA 4UPVA 3SC2B 1DTSA 2LVBA 2P9CA 3LUGA 2X5XA 4LTNA 2P8SA 1GSOA 1RNLA 1TYDE 4QO7A 2VK2A 5ELLA 3FCEA 1DXYA 2VL7A 5KYUA 3SPXA 4KFSA 1SR8A 2PH1A 3KJHA 2E4UA 5B7NA 5BP7A 4PZAA 3OZUA 3ZWPA 1SIBE 2FJUA 2GMWA 4I5EA 2WZDA 4JVLA 4MUAA 4CEHB 2HEGA 3KT6A 5GM2A 2P3LA 2NV0A 3ZK7A 4DJAA 2BGGA 4BIIA 4PHFA 3WDKA 2A0KA 5TY0A 2GK4A 2YASA 4X92A 3ZOZA 2OG2A 1ZD1A 3L43A 3QQ5A 3N8KA 5FO0A 4F9GA 5CEFA 1I51A 4ZI7A 4HLQB 3TZEA 2FUEA 1TK3A 1K2WA 4IO1A 4TS3A 2J85A 3EZ2A 2NYAA 3KPWA 3LIIA 1M73E 3FYHA 1L8QA 1SPXA 1KJYA 2OO5C 3IOEA 3PRJA 3VPXA 4YLYA 5LQNA 5HJEA 1ADYA 1XZQA 4Y9TA 1FNBA 2NYRA 1NP7A 1EUDB 1SA0B 5IDVA 5IYZF 1WW8A 3JALA 1P0QA 3LY5A 5JHGB 3T38A 5CDYA 1U3WA 4FGLA 5NLLA 4LNAA 3RYFB 5C8YF 5A0TA 2ERXA 1VM6A 1B8OA 2IZ7A 1O08A 2MYUA 1M2OA 3QHPA 1VBNA 4MMZB 3TL6A 4CCYA 1XNJA 2PD6A 5G40A 1PNOA 4BMNA 3TLGA 4CM4B 4LDZA 4P3PA 4ZDKA 1P44A 1NRIA 2PG3A 2BFEA 2QJFA 1L5GB 1OFUX 4EY7A 4IZ6A 2ZYTX 3UVEA 3PUXA 2J3EA 3PNBA 2QUZA 1JEAA 3FNEA 1RXIA 3OICA 2GX6A 1KWGA 2NW6A 3WAJA 2D13A 3FBWA 5H8WA 4GYKA 2X9QA 5CT8A 3UJNA 2H4XA 1QIJA 1BS2A 1A8UA 3PFNA 4C7BA 2XDQA 3B3FA 2IEAA 2ZI9A 3ETCA 1SXJA 4YHHB 2WV9A 3SQWA 1NUPA 2ZVJA 3SOPA 2DUWA 3G23A 3NUGA 3DOHA 1EXMA 4AICA 5GQSA 1CCWA 3ZG6A 1RQXA 4Q3LA 1RZUA 5K8CA 5KQGA 4JVSB 3FMPB 3I0NA 1P9WA 2Y0DA 4KPUB 2CT8A 5DBHX 1PJQA 4OIMA 2OCLA 3OLWA 2YUIA 5BVGA 3R9WA 1C5KA 1N9GA 5AFSA 1JPVA 5BRJA 2WT9A 1O0BA 4C9BA 2FWBA 1Y34E 1E9CA 1VMAA 3JXEA 3GT7A 4NU6A 4RA9B 2VNIA 3DXYA 2FRDC 3SMVA 2WW8A 2W90A 1PKEA 4DDKA 2H57A 4POAA 4PTYA 2CN1A 3U9TA 4YRLA 3INTA 1O58A 4I7EA 2C7OA 3AFOA 3R77A 4YJKA 3WWYA 2GWRA 5DBOA 2GB4A 3FIJA 5DLPA 1V8OA 3BKXA 3PC3A 4MRSA 4LQDA 3D6VA 5B4TA 1J8YF 1AK9A 1U81A 4C6TB 2XXJA 4ZEWA 3RF6A 1Q5PA 1GPYA 2D7JA 2WKSA 4V2UA 2ZBQA 1F12A 1G64A 4IHJB 1T0PA 2BRUC 5DT2A 3GFPA 2YYZA 1ZD8A 1SXGA 3C2QA 2AZ4A 5C52B 5CURA 2KJQA 3M6WA 4RY0A 4NH4A 4TXMA 3C6ZA 4GO1A 4CG2A 4UEJA 2FFAA 3R5XA 1WB4A 1JWBB 3AM3A 3PUWA 1QHYA 4P4NA 4KR7A 4K9PA 2ZSUA 3CZCA 4K03A 5ARBA 2HT6A 2P6UA 4WJKB 1OXXK 4KV7A 4DMGA 3DHEA 3VU8A 1J0BA 5FLEX 5IJ0A 4S0ZA 2ZJ2A 2NSYA 2ZWPA 3P7MA 4HRAA 1R4ZA 2WFZA 3OUUA 2VUHB 4Q9LA 1C1DB 1XZHA 2HY7A 1TYZA 3C8MA 2REXB 1WUTA 1Y4AE 4U0KA 1FUEA 1VKOA 2ZTLA 3LKZA 4HNHA 5THKA 2F1KA 2VBGA 3OZGA 4JCCA 1P74A 3NFRA 5CA0B 1YMQA 3SY8A 1IHUA 2X2PA 4FHZA 2WWXA 4YLGA 3LSYA 2R87A 3WK7A 1UZLA 1OWOA 2WF5A 1NR7A 3DE1X 3P9PA 5CW1A 5JCOC 2PJRA 2CLMB 3ITNA 2I1QA 5I3CA 3LNCA 1FTYA 5AOCA 5CFRA 1T6YA 2R25B 5JI2E 1ISPA 3OFNA 4TSFD 4GPZA 1QVZA 1IHOA 3DYBA 3RYCA 3OCVA 1UBGA 1H2BA 5LC1A 1YBMA 3FDIA 5ILGA 3VJKA 2ALJA 2GEVA 3K6SA 2YHBA 2P2YA 4FYIA 1QE3A 1QQAA 1TT7A 1IE3A 1J42A 3G79A 4HQ0A 4MB2A 3ZJUA 3R23A 1V48A 3C6MA 2RGCA 3PXUA 5TE9A 5IVHA 1NJSA 3I9KA 3LT1A 3FNBA 5F9HA 4RE5A 1TQ6A 5CM9C 1UK8A 4I1RA 1RCTE 4N8SA 3Q4GA 4TZKA 7MDHA 1GRQA 1DUVG 3B1KA 1P61B 3Q12A 1QO9A 1I5RA 4I9HA 2ZDHA 1H66A 1Z35A 2BFCB 2IWRA 2WJAA 3OJEA 1L3BA 1RACA 3H5VA 1R74A 5FOQA 2FQQA 3IILA 1NOKA 5E4JA 3DNPA 4A0FA 3QYPA 2ANBA 4D45A 4CTJA 2M9MA 4UBKA 1RAFA 3OQHA 4H6XA 2OCAA 1X7WA 2XMCA 1JQ5A 3SNHA 1V0JA 3X43A 3CH4B 3L7IA 2G17A 1KQNA 4KYUA 5ALMA 4JLBA 4RANA 4TWIA 3NGMA 4C6RA 5LQKA 4BNUA 3EX7C 2O8BB 2FQ1A 3K2QA 4X20A 1W1UA 1VPVA 3AF3A 1WEKA 1Q1GA 3DD5A 1QQTA 3FLAA 4FFLA 4LJKA 1M7GA 4MUHA 4R05A 5CYPA 4ZQBA 1QHEA 4HO1X 4ANFA 4XH9B 4D9CA 5ED4A 4WKOA 1KI9A 4FFDA 4IOKA 3Q7TA 4EB6A 4W7HA 4QREA 5C4IA 5KNBA 2XMDA 3WKAA 4LYYA 2SBTA 4DV4B 1MX5A 1NBHA 4RPLA 3FG9A 3I42A 3JYHA 5CA0F 3MINB 1L5FA 2MU1A 5FYDA 1E94E 1M54A 3DOFA 3STHA 3UHPA 3V8BA 3CZ9A 2HRZA 1KAQA 3HKDB 3NYIA 4WOKA 3RKSA 4A0QA 1X1TA 1KDZA 3DDWA 7YASA 2VJKA 4R1NA 3ZEIA 3CQ9A 4KCGA 1QBGA 4BNMA 4WV3A 1SUWA 4MO2A 3GCDA 4XTCS 5JI3E 3NDPA 3ZWDA 3ID6C 5KOJB 3CBQA 5IT5A 2Y2VA 3AUAA 3PS9A 1T0IA 5K03A 2HWUA 3B3QA 5L7YA 5TX7A 2E87A 2F8SA 4HNGA 3HO1A 3ELYA 4Q1VA 5BSTA 2LR0A 5LB4A 5HPYB 5BMVA 4RVSA 3ZYCA 1ZJYA 4YCDA 5J4YA 3OZWA 4BBJA 3RANA 4XVHA 5JAUA 1Y7TA 4H3VA 1FFAA 1V3VA 4BNTA 1UBLS 1DRVA 1AT1A 1YU9A 4JFRA 3KSAC 3ONVA 3GO4A 3RRMA 4ENSA 3SHVA 3U26A 2H2GA 2JI4A 3BGOS 2EAUA 5GONA 5AUPB 4HAXA 2FE4A 5KNCA 5B37A 2ICAA 2HH9A 1GUZA 2GWHA 3WS7A 2HJ9A 1WHTB 2R60A 3FGZA 4NCNA 1CVLA 1NXWA 1T3TA 2EEZA 3BJIC 1TTTA 4A23A 3AR6A 1J39A 1NT4A 2F2TA 2O2JA 4JH0A 4ZXPA 1J00A 2C9ZA 1T2CA 2N46A 4ENPA 5CB4F 2V3CC 1N9KA 1FYDA 1PAUA 3K0AA 5AKXA 1HYBA 4DT1B 1ZEJA 3ZU3A 3AR4A 4K3UA 4UZEA 3DOOA 2WSIA 2FQWA 3IP8A 4YV0A 1HRDA 1IC6A 5KMGA 1V7PC 2O2GA 3GGCA 2W58A 4WEOA 2IH5A 4R54A 3LK7A 1LTKA 2C3OA 4KIJA 3F3SA 2VWGA 1JPNA 4IJMA 1NN3A 4FYYA 4S2UA 1NYLA 3AVXA 2E4WA 4O0MA 3OOYA 4ZAZA 4IKEA 2VPTA 1SXJC 3HLKA 1NP3A 1QDLB 4GI3A 1KXZA 4UATA 4H7IA 4X3PA 4B46A 2A5YB 1JJBA 4XIGS 2ZJBA 4MXDA 1LS6A 2RIRA 4AN0A 1IY2A 1JAHA 1JIUA 1VJRA 1NG1A 4JT4A 3T5PA 4V2IA 3V42A 1BFUA 1L7EA 2NM0A 2OLEA 3E5HA 4X45A 4BQQA 2JB9A 4NPAA 3EIWA 4P92A 3VR5A 2E4XA 1T8PA 1YL5A 1W0KD 2PKCA 3H5TA 4KQ9A 4PO1A 1VJ0A 1Z6AA 3RCBA 1E4YA 3A3KA 5DNUA 1P7VA 1E9FA 3T7DA 4Q16A 1GTRA 1R9JA 3IR7A 5KTSA 5AHOA 2QTVB 2CL7X 2H7VA 5M34A 4H6WA 4TTIA 1DZ3A 3J81A 5JNRA 1L4LA 3TTWA 1XMOB 1E2LA 2QNBA 2YHSA 1QCDA 3ORSA 4WLUA 3C24A 5D3QA 3SEZA 1QF6A 3WHKA 3F1KA 3BRQA 2RFLA 3GARA 1CF9A 5ILOA 1XJQA 1L9KA 1E5XA 1O94A 2O0HA 3QLTA 4NFSA 3MUOA 3O92A 4FD3A 4XGNA 3SYNA 1QG0A 1GGNA 4E7PA 3BTSA 1H69A 4Q9AA 3DFZA 4TYPA 1W75A 4H1UA 3BL6A 4PX3A 3VC3A 6REQB 4X65B 3EBOA 4HRYA 4MCAA 4YA6A 3NBZC 1W52X 2WD9A 3ST7A 3OH8A 3VR4A 3A36A 2JFYA 2PZFA 3IIEA 1RWXA 3TEFA 3FPSA 1WKCA 1TD9A 3H2ZA 4Q4JA 2HF7A 1T4CB 1KZGB 2J5QA 4W6QA 3RHSA 3VAZA 5KEIA 4B76A 4NEQA 4YY3B 4JXKA 4IWXA 4WBSA 2VHTA 3BGIA 2ZPAA 3T3DA 5DYTA 4CDNA 4EKEA 2AYYA 2ZYVX 4P9NA 1A1SA 16PKA 4CEIB 2B83A 3JSXA 3R7WB 1K2VN 1C8LA 4CQNA 4CIBA 3JQAD 2QBYB 4X6LA 3WK9A 4CT4B 2N0SA 2ZT8A 4WMLA 4CETA 5I7FA 3A3PA 4BQEA 3DWEX 3ADPA 3IUSA 1YCHA 1ND6A 3OCZA 3NT2A 4MQLA 2B99A 3ZVMA 2R8BA 1PEYA 1U2GA 2C58A 3IIIA 1XQ1A 3PHIA 5LLTA 1Z8NA 4X41A 4ZOBA 1FC0A 2QX4A 2UZAA 1L5HA 4B1FA 5JAHA 4MVWA 4TM8A 4X93A 1O87A 2QJOA 3C7KA 3IAXA 1QBKC 3UMFA 4DM3A 3ZTWA 4MAAA 3QEAZ 1SHKA 3DJYA 1GDDA 2QENA 1BNCA 3HWWA 2ZIUB 2JH8A 5EJ4A 2H0QA 4RBNA 2GASA 4XW2A 1H0KA 5BSRA 1XA4A 3IT3A 5LPNA 3FDFA 4ARSA 1S8AA 1WBDA 1L5SA 1ZM4A 4J0CA 1KZ1A 1RKQA 2ZSJA 1Y5MA 4J4BA 3E7XA 3EIFA 4JEUA 4BWYA 2BH2A 1QHGA 2AN1A 2RHBA 3T3GA 2QU8A 4EAQA 2YVLA 1W5TA 1PFKA 1Z6XA 2PX6A 1AY0A 2V55B 5KREA 1AQ6A 3AUSA 4N0PA 1IBSA 2O2SA 4MQ6A 3PUVA 5K0GA 5TJ9A 3S1AB 4Z9XA 3HXQA 2ECQA 5LJIA 4FNMA 3UBTA 5TGDA 1X1RA 2P9TA 5CGQB 1O95A 2C5GA 1KBZA 3FDJA 1YB5A 3BTOA 4KQJA 4NZMA 3TOCA 1BRMA 1SKQA 5C8DA 3TE6A 2G04A 1JR2A 2MYNA 2P9GA 421PA 4DSAA 1RXEA 2GBFA 2OBBA 4URWR 4G56A 4HYQA 1SKMA 3IYLW 1WCV1 3G9UA 1NRJB 3F9RA 3S28A 3LPMA 3ANXA 1JIQA 1IVYA 4BRSA 1OUMA 4XGQA 1YZYA 3WZMA 3AVUA 1C3XA 3I2YX 2IX9A 2ESRA 1PR3A 3KYBA 3UF0A 1C7QA 2NYUA 4KG7A 3J7TA 3L40A 2QVYX 2IYEA 4IIVA 4F4HA 2WU4A 3TOXA 5BN4A 4G1VA 2R7NA 3P9QA 5FTLA 4UDYX 4YJ2A 1GGEA 4AJLA 3BMQB 4ZKEA 3TMYA 1XKTA 3EG9A 3Q5DA 4PBTA 3TKAA 1JDBC 1H2RS 1AS0A 1TW2A 1PZEA 3USES 2WTUA 3ELDA 3PDWA 1GG9A 5LYYA 2O05A 5IVKA 2PZJA 2PN1A 1Q15A 1MTZA 2V45A 1I7DA 4NBLA 1PT8A 4HQ6A 3EOAI 5TS3A 3L7BA 2YR0A 5ERGB 3GQBB 3ZV4A 3DTVA 1H4QA 1H6CA 1CUVA 3QLVC 2YFHA 4FILA 2XOKA 3GLSA 4W5WA 4H7EA 1XE3A 2PKRA 3E2IA 4IDBA 1NTRA 4RENA 4H16A 1CLEA 3TS1A 4H1TA 4HMPA 3QMWA 4CCSA 1VKNA 2FUG6 1V5WA 2H52A 1M0TA 4TMXA 3VRHA 4HH1A 1N25A 2IUSA 3B85A 4UOQA 1NNI1 4ISCA 1TAGA 1XYYA 2NVUB 2I8CA 3G88A 3LWZA 4HAOA 1ZSNA 4E3WA 2XNSA 1SC9A 1LCIA 4OI0A 3O84A 2XTMA 4KUEA 2J3IA 3NQ41 4Q3OA 2R66A 4Q9IA 4YJGB 2IP4A 3ZH9B 3GEPA 3BHJA 3R0XA 4N3NA 3HE3A 1Z0UA 3RIXA 2XNJA 2IOFA 4FFSA 4B3FX 4YCNA 3EIEA 3N75A 2ZM5A 1LEHA 1NV8A 2J9XB 4H4CA 4EEXA 2G80A 2Y4OA 5KTOA 3HBAA 4O2BA 3WLPA 1TX4B 2OOSA 4JHLA 4TXHA 1ZEMA 3D5TA 5JWHA 1RW4A 3Q7IA 3R6GA 4DCTA 4YMUA 1SM4A 4RX1A 4AS1A 5ADWA 1U28A 2FW7A 4II2A 4MA0A 4B2IA 5JSYA 1VGRA 3HYSA 1JDZA 3ZWOA 4BVJA 2OXTA 1CE8A 1ODSA 4FOTA 2O2HA 4BP3A 4C14A 4KAJA 2YS7A 4WLVA 5AOAA 4PGHA 3RR2A 3LT5A 4Y0NA 4K0KB 4CQMB 1Z36A 5LMNB 1FSPA 4BNYA 2KBFA 3PHCA 4QGGA 2HO4A 4L57A 4FW8A 1ZS9A 1L3IA 1M1YE 1KGDA 2AKEA 2EG5A 3RODA 3T94A 3GGPA 5ADVA 2F1JA 1O5TA 2W6JA 1NVAA 1DKMA 1ESDA 2FUNB 3HYRA 1WXGA 1T5OA 3GUHA 4L50A 4OHRA 4QPJC 4ARAA 4FXPA 2M6RA 4FJ2A 4HWPA 4P08A 4P7JA 1E58A 1VLMA 2P77A 2Z3VA 2Z56A 1RYBA 1Z3CA 1UWCA 5ARDA 1JKIA 2J5RA 1W4BA 2W22A 3DLCA 2PUEA 2J3LA 2PYZA 5BV7A 4BFXA 3H13A 1R8QA 1O94C 3JU3A 4IMRA 1TJYA 2VWPA 4KO1S 3UCEA 2B3TA 1I10A 2DTEA 4A3SA 2YUTA 4COOA 3U4DA 3IE2A 2DR3A 4GWGA 1Z4NA 4CV1A 1YCGA 4O33A 3A32A 3ZY6A 2LIPA 3B9BA 3KYDA 1LQUA 4MW5A 3LLMA 1T5SA 1E1LA 3I9JA 4N7RA 4Q4AB 5D00A 3TD2A 4CTMA 5I7OA 4L4XA 4FFVA 4B4UA 4JLMA 1J5EB 3BCSA 4N65A 3G0DA 4YBRA 4CIAA 3VH3A 4ER6A 2FB9A 1DCFA 2QTWB 5EQJB 1CUCA 1PJBA 1Y8CA 2JPDA 5ECGC 2B30A 3II6X 4MVJA 4BO9A 5L7WA 4MR8B 4BO3A 2TMDA 1WSDA 1OFHA 5KKAA 1SELA 4BMXA 3DPSA 3CE6A 1W49A 3BWEA 1XWWA 3FHLA 2W6QA 2GO7A 5I7UA 5J43A 4QUBA 1OGJA 1EP1B 1KI2A 1MEEA 2AFIE 1P3DA 2C1ZA 4FX5A 4YCAA 4EO4A 2FX3A 3AG6A 1JECA 2PU5A 3CC8A 3I0MA 2PWPA 3VR1A 1AQJA 4P86A 3F7NA 3R0JA 4C05A 2GJAA 4F0JA 2X9VA 2ZRKA 1UT6A 3HP4A 1U2GC 3I5AA 3K1AB 3MD9A 3ODPA 1DOZA 2ON6A 4I08A 1MAAA 2H92A 2OM2A 4LJAA 4UREA 3HCCA 4QDJA 5CK5A 5BQOA 2FSHA 4E0BA 3ERCA 3GLTA 3QVVA 4LV5B 2ZUEA 1JLLB 5CCXA 2Q0HA 4OL0A 5K99A 4BGDA 2ATVA 3FWYA 5ER6A 1VL5A 2A7QA 4IVNA 3GJYA 3M0EA 5FI3A 5C81A 1H2FA 2FZVA 2P9FA 4A03A 3E27A 2GTHA 2I03A 4NONA 3QVJA 1FFEA 1BOOA 2X9NA 5A4AA 2BIFA 3M6UA 1FE8A 5KHAA 3PC6A 3MPOA 4LZOA 3LFTA 4EY8A 1OT3A 1ZBQA 1NHWA 2R8RA 3KR2A 3PC4A 4G4JA 5IAKA 5TGTA 2CXPA 3ZE2B 1F4PA 4HDQB 1W8DA 2YIJA 4QLOA 1ZAKA 2OBYA 3CVWA 2EW8A 4WCDA 3MTAA 4GDMA 4Z1MA 3IR5A 3U9LA 1OIXA 2CL6X 2H1FA 4EI7A 4N76A 3GJ4A 3R44A 1L2TA 4CM1A 2AOUB 4E4TA 3WHIA 1WRBA 2EP8A 2NZVG 5D3ZA 3OKCA 3I4LA 4HJRA 1CKEA 4HVTA 2VPYA 2XOXA 3LC2O 1GQFA 5JT1A 5LLDA 2UDPA 4L5JA 4QBTA 3CIOA 2O2CA 1O95C 1U8AA 3JQRA 2CFRA 2NVWA 3L6DA 3L7CA 1B1AA 3NHMA 4MKZA 1NYQA 3OAAD 1DQRA 1T3SA 2L19A 3CPHA 3LKBA 3VYUB 3OX4A 4QU9A 3LHDA 4L22A 3R1IA 3H97A 5LNK6 1KR2A 2PDAA 3VZBA 2BGMA 4GIBA 1HRKA 1AUQA 4H15A 3VYRB 2XTAA 4W9MC 1DWPA 1CJVC 3IPLA 5A5EA 4ZZ1A 1DRWA 4MWEA 1S02A 3A05A 2NO9A 3CW8X 5TMEA 2IPAB 3RRJA 5K3EA 3RS7A 4KYTA 3ZHOA 3ZKWB 1TT5B 3VPDA 1C29B 1ZVJA 1Z2NX 2WKRA 3EWNA 3RHFA 3TINA 4BFYA 1MHTA 1KE2A 2CK3D 1UMDB 1KY5A 1E2MA 1W1IA 3NJ4A 2QRMA 2XBLA 4KR0A 3Q9UA 1Z38A 3BHMA 3ABZA 2YNMA 3FPHA 3UWPA 1HE1C 3TSOA 3UHJA 3I9FA 3FCSB 2BR3A 3TBKA 3ZXYA 3NI2A 4K86A 5HRAA 1SG6A 3NOQA 3PSAA 4OJMX 3NYRA 5DWQA 3ZHUA 2FP4A 2Z3ZA 4V0NA 1BTOA 2H5JA 3U09A 4JLJA 5FI1B 3Q3GE 1U8ZA 1YJ8A 4N49A 3KC2A 4TTPA 1OBOA 4YX9A 3A06A 1COZA 2ZJ1A 3DE6X 4EWLA 1IQUA 2RBKA 3LP5A 1QIDA 3N5KA 4DSNA 5LU9A 1MORA 2WUGA 4RD2A 4C0AC 1TLTA 2POQX 5KYWA 1PBNA 4JC0A 2H2IA 3GJ7A 1FB5A 3ZD9A 1GTMA 4BAZA 3IVCA 1G2IA 3DEAA 3G59A 4AKTA 2DB3A 3U1TA 3EGCA 3K6JA 4JC5A 3IAM1 3U2QA 3BXEA 3UICA 4RHEA 5B1IA 2JBAB 2GEKA 1K66A 3ROQA 2DT8A 3AB8A 3PNPA 5IU6A 3DMFA 1J8DA 4MUEA 4FDMA 3RC1A 2QYSA 4CM5A 4P82A 4RABA 5J2UA 2H5EA 4I1UA 2NT4A 4K28A 4L72A 1C0IA 4LWQA 1E0SA 5FPKA 3SC3A 3TPCA 5EIXA 1RMYA 1G20A 1P72A 1OZHA 1BYIA 1MC8A 1X0VA 2GBGA 1JI3A 3DGEC 4A92A 5B5SA 4QL3A 4IIJA 3UH0A 1RHUA 1U28C 3INNA 5F77A 3RGGA 4F8JA 4IVRA 3X1KA 3HCWA 3WWZA 1HOTA 1HFKA 2HWXA 2WUVA 2W42A 4C0QC 3S55A 3OEED 3WBJA 4OM7A 1K06A 1PIWA 3UXYA 4ARCA 4BRUA 1HPLA 3QLJA 3A9TA 2DFTA 5DGXA 1L7MA 2D1RA 4ZHQB 3A6JA 1CQIA 2CWDA 1VCIA 4W5QA 1MFPA 1KI6B 1REQB 1M67A 1ZISA 2PD3A 3HH8A 3I64A 2WAOA 3WBKA 3Q7QA 2VQSA 3TNDA 2QWXA 1U8EA 2MCFA 2RKBA 2RB4A 3A10A 2CJPA 3IP3A 3OM0A 6NULA 2G28A 1H93A 1Z75A 1JG7A 4NENB 5E3IA 4U7TB 5DW3A 1O97D 2VTEA 4TWJA 1XLVA 2RC5A 1D4AA 3K15A 3R0ZA 5G1NA 2CMHA 4AMUA 3UUGA 4CM8B 3AF2A 2ABWA 5IPFA 4XASA 3RG8A 4OAQA 1A5BB 1F2TB 2DUMA 4M9RA 4CGZA 1T0HB 3WLOA 4CTNA 3EVCA 1ZK4A 2EJBA 2GCIA 3JASA 1XZAA 2EX1A 2D62A 1NJ8A 3UMRA 1PL8A 1Z68A 4NCHA 3H83A 5E7MA 1FFBA 4Q93A 1R88A 5G2OA 1F0YA 2FZLA 4D8UA 3GBSA 1ZITA 5HX7A 1MZPA 4C4TA 3INYA 2CNLA 4KYIB 4ZOQI 2AYZA 2PRZA 4H7HA 4I4NA 1VYHA 2BONA 3QM1A 3DUFB 4YREA 2ILTA 3A70A 3DEHA 3BPSA 2VTBA 2H48A 3L1KA 5GVSA 3AKCA 2QZPA 1ODFA 1I6KA 3Q87B 4BZZA 1N57A 1WL8A 4YK7A 5JVDA 4A0HA 1EKXA 3KDPA 4JBYA 4LC9A 5KKCA 3IQXA 1GR1A 1M1YB 3V4LA 4EKYA 2R1VB 5DSTA 1OSNA 3IJRA 4L0CA 4QJBA 5DOVA 5A0FA 1G0OA 1WF3A 2QX6A 3P9SA 1PQUA 4AJ2A 2UYHA 1SK8A 3URKA 4FLEA 4TM7A 4U5QA 1EJBA 1A4XA 1ZIYA 3H3FA 1FVHA 4U7GA 3S29A 1EVEA 2VJBA 2YV4A 4X94A 2WHXA 3LT4A 4R9VA 4V3BA 3T7TA 2FR0A 2H2DA 4ZHQF 1ABEA 3WDMA 2YJTD 5CR9A 3MAGA 3U31A 3L7JA 1AOXA 2E5LB 2QQEA 1ECCA 3C48A 5KDLA 3GJQA 4M0KA 5AHKA 2P1DA 3S5UA 1WTAA 3KSDO 2E9SA 4BB0A 3WGUA 4GICA 3BB3A 1HFJA 4U2KA 5KYTA 4R0VA 2GM5A 3P9XA 3EISA 2DCUA 1QHNA 2JCBA 2P30A 2J5XA 2O8EB 2AEMA 3A6PC 2WUEA 2DMRA 2Y05A 3IAUA 2AEEA 3CX8A 4GKVA 4KLRA 3T7JA 2QX9A 2PH5A 4IVPA 4UM9B 3K94A 1J33A 2PAFA 3ET4A 3OIGA 3PPYA 4R2KA 4RKRA 1SQGA 3ABQB 5THXA 3BXZA 2VDRB 4BMDA 1IOVA 3LQKA 4EVSA 2G4CA 1GG8A 3QX7A 4BDSA 2XDYA 3R5HA 5IASA 2I9KA 1HETA 4BEWA 3EGWA 2I2XB 2AFIB 5DCLA 5FORA 8GPBA 3WGIA 1L4GA 4RXUA 1P2VA 4NV0A 4YV1A 4JUCA 3REFA 1C7IA 1J09A 1PJ4A 3AEYA 4O59O 1YFJA 2LZ0A 3CF0A 3D8TA 4YJ3B 5LSAA 5K3BA 4D46A 1Z4IA 5HQ3A 2ZPTX 4K6HA 3KKQA 4ND8B 1CUAA 1JVSA 3VU1A 1FU7A 3KTOA 3N2LA 3ZHVA 3K9QO 2LTAA 2JJ1A 4XLTA 4IDFA 3TIGA 3R24A 5L3RA 4QDKA 3IDQA 2JK0A 4RUKA 2IZ1A 3QOWA 4IXNA 1Y81A 4IWNA 3SZOA 1U7UA 3BXPA 2R9VA 3BORA 4FE7A 3G68A 1NC3A 2PUHA 3F67A 4S3MA 4DMFA 3MA0A 5JQWA 3U16A 1NF8A 2YCLA 5ERXA 4LF8B 1KRXA 2EHDA 2VIIA 4DKXA 4F4UA 3GFOA 4LGMA 3TRKA 3G2QA 2JDIA 2WD8A 2O8VA 2YNMC 3HCFA 1YR3A 1RBZA 2WU8A 4BX2A 3MGAA 5TMPA 2CSXA 4DFDA 5U9CA 1OXVA 1N92A 1RPAA 6LDHA 3SEQA 5HYVA 4ZCRA 1YFZA 2I67A 2JIDA 2QYTA 3AUFA 3L0DA 1CDEA 2C98A 3HEBA 3PNYA 2G67A 4I8XA 4Q7LA 5BY2A 3CA8A 1HNZB 2ZE7A 4WBXC 3C8DA 5ALDA 4JIGA 2FDCA 1E89A 3Q7EA 1OE0A 3UO8B 4WVFA 3ZQ6A 1GPDG 3AUJB 3P0IA 3WMEA 1FP6A 1UXKA 2QLNA 5J47A 3R3HA 4P0TA 4PM4A 4FUTA 1QK5A 2O14A 1UC9A 3CLVA 2FXVA 1KI7A 4PRZA 3RU3A 5FIUA 1V25A 1XZBA 3B1WA 1S96A 1DJQA 3H2KA 4M0UA 3IX7A 3OT1A 4QPNA 4ZAGA 3TLBA 3FUVA 4BNGA 5C1PA 1TA0A 3O8QA 1YQUA 1PR0A 4FLFA 4DZTA 1MABB 4M1SA 4P4LA 4CG1A 3WLKX 5IDWA 4IKOA 1KVUA 1TQ8A 2X0IA 3HL0A 3CU5A 5GGYA 1PU2A 2RHHA 3E84A 4WERA 4JNCA 1YB2A 4JGBA 2J32A 4YJ3F 4CL0A 2YY7A 1CQWA 1C7JA 1UQTA 2GHQA 1WPRA 2AH5A 4GVXA 4PQGA 4TL6A 5CEJA 4TT3A 4LVUA 2ZS7A 2OZLA 1MCZA 2G40A 5A3RA 3ZU5A 3DD1A 3ROPA 1AF7A 3EGDB 4FGZA 4TWAA 3D7LA 2QN1A 3WV4A 2QRQA 2E4VA 1H2EA 2OQIA 1VE9A 4QXMA 4U7FA 3SQDA 2J9FA 1BXGB 3W7BA 4YCJA 5K7SA 4IXDA 1QOQB 5JXJA 1HI9A 2EF0A 3I8XA 1MRSA 2FLKA 3PLNA 1KFKB 1E2QA 1RT9A 1T10A 2QS9A 4X91A 3U6KA 3VVMA 1B41A 4L08A 4QYTA 1I0IA 1XU4A 4G67A 1YS2X 4HDNA 1MLDA 1P5ZB 2HRBA 2DZDA 2LNDA 5KPJA 2RK6A 5EJMA 4TMFA 2PU7A 3FOBA 5TB5A 2NXJA 1ZESA 5C5CA 8ADHA 4BVKA 1CF2O 1E4EB 2BI8A 4YDHB 3QLEA 3UMCA 3CMMA 3SYTA 4GSYA 5EUMA 2OGUA 3JVUA 1L4NA 1E5DA 3OC0A 1Q0ZA 1DBSA 1E77A 2Q5HA 3I2IA 4FQ5A 4QEKA 1R0WA 4GDFA 1HQCA 5LOVB 3GV0A 2MSDB 5C18A 1MQ8B 2RGGA 4QNNA 4YRRA 3A4VA 3DB1A 3S2SA 3ZBTA 1FYWA 4AZTA 1QR2A 3LU1A 3QPVA 1CRPA 5HBRA 4RW0A 4S1NA 4X95A 3A9RA 2OFFA 5C3UA 3B5EA 2H4ZA 1ULTA 5JH7A 2OQRA 1GNVA 3JQ8A 1V9LA 3P4XA 3M6MD 1Z5PA 4LG1A 1XPRA 5BRNA 1E69A 2XMZA 2Z5GA 4HZUB 3ABOB 3DBVO 3KVYA 4D6YA 3B1ZA 3OWOA 3OPYA 3Q11A 4Y2QA 5CIWA 4BO5A 4DCMA 3RQSA 4RF2A 1ELOA 1F14A 1TM7E 1DMRA 2OT3B 3HVJA 5KSPA 1EVQA 4KE8A 4DB4A 1H4TA 3MTQA 2CBGA 3TVYA 4EG1A 4PIVA 1NVTA 1S2DA 1Z12A 3IBFA 3GP5A 4JLUA 1P0FA 1VB5A 4KWCA 2FLWA 1BCSA 1N2GA 2H1CA 5EUCA 3ZDYB 3JQCA 5CX4A 1H1LB 3WJAA 1JQKA 2CL0X 2X2EA 3QPAA 3H5IA 3IT1A 2R11A 1ECLA 3EQ8A 4AZ3B 4J90A 1ZHOA 1Z7EA 4MV7A 4JL6A 2GA8A 4YO8A 2FPXA 3L4SO 5A9RA 2DBRA 3RAFC 3PKJA 4FW9A 1MH9A 4YT8A 2PT7A 3H87A 1JXQA 1DO0A 3CJQA 4D9EA 4I6JA 4XVUA 3QW4B 3V8RA 4LNHA 1IBKB 1IN1A 1I4LD 1HTWA 1SVWA 4JYAB 4ZRNA 4DUGD 4PQEA 4RVCA 1RBYA 1H94A 2ODEA 4G5HA 4P58A 1A7JA 1KSFX 3D4NA 3KWLA 4OP3A 3ZLVA 3S2YA 3A3YA 3HADA 3VZDA 1OZFA 1TW3A 5KYXB 1FL9A 3T52A 3EFBA 3HRHA 3UOWA 1WXHA 2DFVA 4FQ8A 4H0NA 3TZKA 1WXQA 5LOVF 3HN6A 4KIFA 3VOBA 1T6ZA 2GD1O 2RGWA 4GM1A 1GXSA 3VSBA 3DHWC 2QMOA 4DLTA 5TT1A 4ZVNA 3ROKA 4TSKA 3LX8A 3VX4A 1JSCA 2PIDA 4BJHB 3PP8A 1J25A 4P4TA 2BZ0A 4BEJA 4Q1BA 5TQ2B 4E88A 2FX2A 3E5NA 1W88A 4J0GA 2FF7A 4JX8A 1UZMA 1MEJA 1QLJA 1X86B 2ZXFA 3GNSA 1NUHA 2PK3A 4HFNA 1ZN8A 4I8DA 4N3BA 4HQOA 2C92A 3SJUA 4AJEA 2QNRA 2GVNA 4IFEA 2HDHA 4KUHA 5ESDA 2C82A 3SIXA 1HURA 4V24A 5EE5B 3PJRA 2P9ZA 3ACDA 3R7FA 2WWGA 2PCLA 2LDXA 1ZJWA 5JC8A 5L6LB 3K72B 4RVNA 1PVVA 1G7TA 1OTHA 3H2HA 2R6FA 2WY2D 3V34A 2ILVA 1YB4A 3DL4A 3DV9A 4G5RA 1BVUA 1MZVA 1SCQA 3KZCA 3V46A 4C87A 2ZBDA 1V3TA 2I29A 3QOXA 1ZLYA 3RD5A 3ZGZA 3V4SA 5J4VA 5MN4A 4BS9A 2VYVD 2FVYA 2YMMA 2GR9A 2ZB4A 2GYWA 3RS2A 3NHUA 4RK5A 4B45A 1SGWA 3LCCA 1NBAA 1PE0A 2C03A 1RIFA 5JNLA 1HM5A 2ACWA 4J49A 4DQVA 4YASA 5ITVA 2PAAA 1OBHA 1V6SA 3F5QA 1KTIA 3F97A 1U8YA 4NABA 3T12A 1GY8A 1R6TA 1ZWLA 4HX2A 5E9AA 2VHVA 3GEIA 2FFHA 1VRCA 4ZMSA 4K1XA 1E3DA 2G0TA 3ACCA 2P3SA 3UFXB 3D6AA 4EA6A 3NB0A 3OPQA 4OUDA 1QX4A 1QGUA 2VLBA 3MRTA 4MJ3A 3FPLA 1FDOA 1KMNA 1YAJA 3R6WA 2QR5A 4WPGA 4D42A 3LXUX 3VISA 2I4NA 2YMLA 5AJWA 4C0BA 4CN8A 4YRAA 3NXKA 2QSJA 2EGGA 2JF0A 3AEQA 5JJLA 1BAPA 4X7MA 4W9RA 2VTKA 4AZSA 3PBKA 3IMEA 1H8HD 2INGX 5KYUB 1RHKA 5TR9A 5CG2A 3PV0A 2QTBA 3V8EA 4TMVA 1QFZA 3UOGA 4XIYA 3J81k 3WWCA 1Q0RA 2H1WA 4DR5B 1TGVA 1L1FA 3OMWA 3VNUA 2IDZA 1PT5A 1FU4A 2HF2A 4DARA 4JJEA 4FJ1A 4QBIA 3QXSA 5AJYA 3RVLA 3BRSA 1XMIA 4FKMA 3ZDXB 4YAOA 1V16A 1UJCA 3NEPX 3CEHA 3TSWA 1Y1QA 4ZI7B 4JA2A 3KKOA 1F9EA 2FMHA 3CXUA 4MWSA 1ITZA 1LDEA 2YV1A 4BL5A 2DSNA 3MJSA 4ZEOA 3W7AA 1UBRS 4GEGA 2PR7A 1SZJG 1DBIA 1HQKA 4DR7B 4FZ5A 3CLRC 3CLUC 3GA5A 3KKLA 4KXWA 2I8LA 3H2IA 3VZQA 1IDOA 4I4IA 3QVWA 2E6UX 1D2CA 2DUUA 2AZTA 3C87A 3N0TA 3WDLA 4V02A 2QRVA 5LQSA 4KZPA 3ADBA 4HXGA 5G1OA 3WRYA 1H2YA 2BM1A 4QXOA 1M2OB 3AINA 3K31A 4MRVA 3VTZA 3WNZA 3U44B 4PG7A 4XLLA 1BQ4A 2XV1A 4I99A 2NXCA 1CQZA 1TA4A 2BFEB 4CF5A 3WGTA 1VIYA 1VBFA 4IFIA 4ZYTA 1NM5C 3EVEA 1JLMA 2W98A 2GFQA 2XMQA 4GPIB 4NBNA 1QH1A 1ZI6A 4OB8A 5HCNA 4AIRA 4J7CA 1DRKA 3UIEA 5JFGA 3BL8A 3GLVA 1OFUA 2GAJA 3WLAA 1W94A 4GZ6A 1Q7TA 2ET6A 2XDQB 4BP9A 3LY8A 1PEDA 2ZWOA 3QKSA 1WMSA 4FFMA 4HLUA 5CXXA 2C5HA 3B6IA 2HCBA 3DOJA 1SKAA 1GCOA 4U2GA 2EBHX 1U5BA 3CRRA 3C8HA 2GKSA 2JJ2A 1GA6A 3FOCA 3QIVA 1KJQA 2Q2NA 3PQ5A 3E5MA 5CHEA 3UCXA 1KBOA 2XE7A 2R00C 4QUIA 4OFZA 4R31A 3SLRA 3A6FA 4CQMD 4N3GA 3T5TA 2P8JA 3JR3A 1RQPA 3USCS 3T9FA 3HM2A 3WB9A 4W5TA 4UEQA 3NUZA 1RWQA 1N9GB 3QBDA 5K9ZA 1FW8A 2IX3A 5A6SB 4GNRA 3ZDCA 1MO6A 2GH1A 1G9SA 1ZR2A 3HJFA 1AU9A 1QIGA 4LWZA 4JEHA 4OH7A 4RTPA 2L69A 3ZCTA 4ZI7F 2AT1A 2QL7A 4N9WA 3GIDA 1Y3HA 4NDAA 2HA3A 4RD4A 5HIJA 2DERA 1EIWA 1TPYA 2RHJA 3IUYA 5DM60 5DZSA 4LF5B 2OKCA 1XMPA 4DVGA 3WLNA 2RHLA 1YF3A 1UXOA 1W5SA 2O5EA 2R6AA 2QGFA 2Y77A 4XM0A 5JAOA 1M2VA 3L7DA 4D4LA 2C84A 3H2GA 1MC4A 2JEOA 4KTVE 4JD5A 4I36A 3V2UA 4E5NA 2O57A 1LDNA 4I5DA 1KIMA 4HXFB 3WGLA 4NOMA 4ZOLA 2JCGA 3DR5A 1NMYA 4UBLA 4DE5A 5C7LO 3D7RA 1TJ4A 5EHZA 2NTYC 4F45A 2BE9A 1Q12A 4OGGA 3KBBA 4C4PA 5C8XA 2RD2A 3I9MA 1X87A 3BF8A 1CQJA 2G1KA 2HZ7A 2ZTUA 5CFLA 4LISA 5IDQA 1ULSA 1C0LA 1YK1A 1T8TA 4HFRA 4Z99A 1Z34A 4LGCA 5MN6A 4K9DA 1QDUA 1XWIA 3QA9A 4NV1A 4RPCA 3AVTA 1MB4A 1A0OA 1RJWA 3B9QA 1LLDA 3BX1A 3EBLA 2YRXA 1ULBA 4LSMA 4DYVA 2PFKA 2A5DA 1KAHA 4YDQA 4P33A 1X8KA 3VSDA 3OE7A 4JU8A 2XD9A 4PINA 1C9DB 4UMFA 3EYAA 3HG7A 4XIJA 5E6SA 3T5CA 4C4AA 2H4FA 3L4KA 1RYDA 3KXDA 4B32A 2UZ0A 3F2VA 4B3BA 1F5SA 3MQ2A 5T6MA 3VH2A 1RAHA 1ZUNA 3L6BA 4PX9A 4R81A 3T7KA 4AKHA 3DTNA 3RYCB 1PI3A 1QE5A 3TUJC 3K6SB 1UBJS 2V1XA 3IL2A 2C4KA 3B20A 1O8BA 2ZYGA 4Z5XA 3AH8A 2CLSA 3DT8A 1A2BA 2V6FA 2JFNA 4WHMA 3FWZA 4E2YA 1N2HA 4RLFA 3OJWA 1HLPA 1C7RA 3D8SA 2IUFA 3MAJA 4GL4A 3VKUA 3VQTA 1O6FA 3PI7A 4B3DA 1S1MA 1JKFA 1LFDB 2JBWA 4AS3A 3KYCB 4DAEA 3SKYA 2YQ4A 2ZAYA 4DLLA 4WADA 4ZO4A 5EEHA 4ZANA 1GLNA 4J16A 1XNRB 1X9IA 3GUZA 1IZZA 1UJ5A 2EARA 5AVUA 4Q0MA 1GZDA 1X7YA 2WVAA 4NAUA 1JZTA 3VYTB 1MAWA 2D4HA 5IN5A 1XCBA 3STTA 1XMQB 4JB8A 2NGRA 1FS4A 5HILA 1A9PA 3G02A 4UAJA 2W2TA 3RIYA 4WOCA 4YPFA 2XLCA 1C8KA 1MW9X 4KGVA 1JF8A 2NU9B 3C3EA 2G77B 3EDCA 2PWAA 4Q47A 1INLA 1MJNA 1P1RA 3OKFA 3PGLA 4BFCA 1LS1A 2QG4A 5BWLA 1MUUA 4M60A 4EB6B 1P9LA 2X14A 4Q3KA 5AW7A 1Y3AA 4ZOEA 2Q2WA 4KIWA 2DWPA 3QG5A 821PA 4P0QB 2GDZA 1BJRE 4EJFA 4X6YA 2A4MA 2DH6A 1AKMA 1DUIA 3PEYA 2PL1A 2CF5A 3TSCA 3VMMA 1JHYA 2F90A 1H9CA 1W9MA 3BSSA 1I7NA 3GLQA 2BBSA 4IFBA 4BECA 4HDKA 3AUTA 3S27A 2HHLA 2PMWB 1RDFA 2ZIWB 3CLHA 3TTUA 2ERYA 4JB3A 4OOEA 2BZ1A 5DNVA 1EUCB 5JNWA 2ZBUA 2ZI7A 3COZA 4D6XA 3R41A 1DV1A 1JDBB 3H1FA 2O8DA 4GZ5A 3CF4G 1VIDA 2EWVA 1VOTA 1BN7A 2HK8A 2QL9A 4DQXA 2F64A 4YV2A 2J0VA 3UYKA 5BMVB 5KC8A 1E2KA 3ZZTA 4TTJA 4TTQA 3U39A 1EK5A 2ONYA 2EWWA 5AK3A 3ZY4A 1QB7A 1YR7A 1FTGA 3LUFA 4DJDC 1QV6A 3IDAA 1LRKA 1T3HA 3UYLA 3A1EA 3SMQA 2AF4C 5GONB 2HLDD 4BMOB 4NOJA 1Q0UA 5B55A 2B35A 1Z5GA 3JYQA 3GLRA 3NTQA 5E6UA 5ULLA 3TW4A 3WRYC 1XD9A 2X6RA 2IYAA 4EG8A 3IT0A 3IXMA 5GADl 2CKMA 4HZGA 3U60B 2HBQA 2QLBA 3K0AB 3WB2A 1CZLA 4XE5A 1UDWA 3KQSA 4DEYA 2D1FA 1LW7A 3JD1A 2V98A 4S1TA 1JU9A 3AYZB 1V5IA 4MB0A 2KSQA 3JRXA 5BSMA 5KMGB 3THYB 1IVNA 1T4DA 3PX2A 2A94A 1I1QB 3MJEA 4KSYA 4YAWA 4Z3KA 3NW9A 1M0SA 3N28A 2IGTA 4NYIR 5K3SA 4ENQA 1OCEA 3KQMA 4E3ZA 2X8JA 3FJYA 2AYXA 5F3WB 4G65A 1W9HA 3IP7A 3O93A 5JMPA 4ZI2A 4LJRA 1YDEA 3D7MA 1GKYA 1GG2A 1O9HA 2QZZA 4Y30A 1Z2CA 4WDRA 1RC1A 3ZD8A 2PKEA 3LCJA 4C1BA 2J4DA 3BWCA 4NDZA 5H68A 2Q27A 3P2EA 4U63A 4EHAA 4EMTA 1VMKA 4E5SA 5KYYA 1FMCA 2P62A 4DPKA 5F78A 2ZAIA 5YASA 5LMCA 1W48A 1TPZA 3I9OA 1OHHD 1S9DA 2V6MA 1FTNA 2ZM6B 2R6JA 4M7WA 2HSJA 4EB8A 4LY0A 2YH2A 2AKAB 3K6RA 3ZLUA 2JH9A 2ZRFA 4GOLD 4C89A 2YWXA 5HSGA 5BMVF 3AUYA 4PO3X 5KTYA 3NC4A 5LBTA 3AERA 3T3HA 4TQGA 4BVHA 3EA4A 2AX3A 3QMMA 3RKUA 2OLJA 1KQ3A 4TKLA 4UCWA 3ZI7A 5KOIA 2P2LA 5GONF 1Z33A 3B6ZA 4AJ9A 4YRIA 1JDTA 3DHVA 4L6AA 5CYFA 5KSYA 3BGVA 3T1OA 4XARA 5F2KA 3T9EA 2P2DA 3HDYA 2VXOA 3ZIAA 1XEWX 3U3OA 2RI6A 4QU8A 1KTVA 2DWOA 1ZMTA 3HLTA 4L3OA 4LZZA 1K7SN 2WJGA 3SDZA 3PEWA 3TTYA 3M6AA 4ZD6A 3TDNA 4Y18A 1I5OA 2XB8A 1I4OA 3LS2A 4F6LA 5BYKA 4HDMB 3W2EA 4AY2A 1U4SA 4KKXB 4E11A 5EGNA 5FBKA 1GG5A 2QX7A 2QSZA 1TO1E 1BX3A 1HQDA 1KPIA 1JR3D 3WWPA 4G0UA 1E60A 4YT4A 1CB7A 2QD3A 4FDUA 1QZXA 3PHJA 3NDJA 4O1IA 5DLQC 4P7KA 4EIWA 2LD4A 1NMZA 3CRMA 3C7AA 4L73A 3QNUA 1Z8FA 5AD1A 3N7UA 5JAZA 1C7EA 2L17A 4MQFA 1DJMA 3N6VA 4AKSA 4YRQA 3C85A 1X1CA 3MMNA 4E1BA 4B8ZA 1IUPA 4MCHA 5E0KB 4LSGA 2X3UA 2RG7A 3QEMA 3U3ZA 1ADJA 3GLKA 1XTSA 4J0HA 4JUIA 4YXWD 1M6WA 4NK4A 1Y9DA 3KEOA 3F9IA 2AJTA 2QXUA 3FFXA 1TRKA 3I2KA 4PZLA 3PXCX 4TTTS 4EQ6A 4EGCB 1DBQA 4RHUA 2AFRA 2H2FA 4WNIA 4YDSA 3D4BA 1MO3A 2FFBA 3F4BA 4JOQA 2BGUA 4EL0A 2AMVA 3T34A 2VRCD 4JOCA 3ME5A 3HBFA 2I4OA 1RWMA 3ANYB 2AA3A 1JEQA 3OZBA