1N5IA

Crystal structure of inactive mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp) at ph 4.6 (resolution 1.85 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 85
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5iA00
5BXQC 4C7OA 5LD2B 2MSDB 1OHHA 1E2JA 2CLDX 4LOAA 2ZAMA 2DR3A 2FU5C 2GWHA 4L5BA 3NXSA 4OK3A 3Q85A 2XXAB 2XOKA 4Q9IA 1XJCA 1W0JD 4PHGA 4DLVA 5JMTA 4NZYA 2BDTA 2ZRIA 1UKYA 5JI3E 4GDFA 2D4HA 4MYTA 1G6OA 3A4NA 3GLFB 4B3FX 3S1AB 2NQ2C 4DSUA 5BYKA 4HI0E 2RGCA 2VP5A 3P26A 1AS0A 2O0JA 2UZIR 721PA 4DZZA 1RZ3A 1QZXA 4A0FA 4DDUA 4TLDA 621PA 2V1UA 2Z83A 4OQNA 2DFKB 2FOLA 1ANKA 3TQFA 1YU9A 2ZRAA 3RS3A 3SJBA 2FEMA 3B82A 1EXMA 1RRPA 2HF9A 3FYHA 4Q7LA 1KO4A 3BWDD 4KBGA 4CRWB 5KSOA 1YJ5A 4DSOA 1G17A 3BFKA 4Q48A 5EZ6B 2LKDA 2J0QA 4GI7A 4JIMA 4LI0A 4E5UA 3TIFA 2H8KA 2V9PA 1YKSA 2BVNA 1U99A 2C2HA 3ICEA 1D2EA 4L8GA 4L15A 4GMDA 4WBSA 2PCJA 2FWRA 1YRAA 3K0AA 3K0AB 4HSEA 4B2PA 4XH9B 5AJVB 4E22A 1XEFA 1YZTA 3BBPA 4LHXA 4PFSA 3KDSE 4TZ6A 1T91A 1LB1B 3THYA 4JSYA 4QGFA 1KI4A 4X8MA 1W1WA 3UG6A 1JXOA 1JEDA 3TAHA 2J0SA 3GEHA 2X19A 2QMOA 3B1ZA 4KCGA 1SKQA 2R6AA 5BN3A 2GF9A 1FX0B 3L43A 4M1KA 4NCNA 4BFTA 3CPJB 4TMWA 2IW3A 5C18A 5C1BA 2VYFA 4DCVA 4BLPA 1OYYA 1K8RA 3CNOA 1C1YA 1N6HA 4CT4B 3LRPA 5K8IA 3N70A 3WNBA 4Q9LA 3K53A 4BLRA 4JKYA 1JBKA 2ZJOA 1MO4A 2ZRNA 1E9SA 1VG0B 2BMEA 4S2EA 5FOVA 5FBLB 1Z3IX 2ZUCA 3KJEA 4D0LB 1CLUA 2F6RA 4FMCB 5B57C 5K8UA 3LW7A 1F3OA 1E0JA 3RHFA 1KMHA 2P5TB 2IYZA 3TSWA 2ZSDA 5JEEA 5EXSA 4NDZA 1LW7A 1EG7A 5FTNA 5ELXA 2DHRA 4JLNA 4YXWA 2WMOB 1SHZA 2EFGA 2QMHA 1Z22A 4AG6A 2IT1A 5L3QB 1C9KA 4LJ5A 3O8RA 3WRYC 2MMCA 1F5NA 4DEYA 4LGMA 3REGA 3PVSA 1M2OB 4DLXA 3F5FA 2GZHA 3PCRB 4EPRA 2RH5A 1NVVQ 4CGZA 4WXRA 2K5UA 4PSVA 2QP4A 3RVBA 3V00A 5A0FA 3L2OB 1AIPA 3N5CA 4AWXA 3JVUA 2VP9A 4N3NA 3FFBA 3ZVRA 1R2QA 5FUXA 1GM5A 1AN0A 1E2KA 3SDZA 1DS6A 1Q22A 5FUVA 3KB2A 4ARZA 4TL6A 1E2NA 1T9HA 1PLKA 3OEHD 4LJ4A 2LCFA 1XDBA 4RZ2A 2JLYA 4P4SA 1P2UA 1OE0A 4TMTA 4B47A 2H16A 3QI2A 1DG1G 4FWIB 3D6TB 3PUXA 2A7QA 4D0NA 1OHHD 5A5GA 1UM8A 1ZM9A 3DHWC 1Q1BA 2VL7A 3M1IA 3WHKA 4CEHA 4G01B 5D3MA 1FTNA 1MH1A 1IONA 2QAGB 5LBIA 3WYAA 1T3HA 3C5CA 2GHIA 4UKDA 1X8KA 3FKSA 2Q9AA 4MYCA 4Q03A 3CZQA 3ZD7A 1M7GA 1QVAA 2GXUA 4XJXA 2VSOA 1DO2A 1WF3A 3VKGA 1XMVA 1KZ7B 5KHOC 4LV8B 2ZAOA 3I8XA 3TH5A 3R9WA 4MRNA 5K8TA 1IM2A 1H8HA 4HAZA 4KAXA 2HLDD 5BWMA 2BOVA 1P4SA 1XEWY 1NBMD 5CJPA 2XXAA 4DLZA 3WRXC 3ZS8A 3I5XA 3LXRA 3W8RA 1W0KA 3BORA 4DEXA 1GNPA 2PZGA 3IKJA 2QAGC 1OIWA 3EZ6A 3U6BA 5DISB 3TW4A 4IFBA 5EUQB 2RGDA 4JSTA 4CZ2A 2AD1A 2C8VA 1HUQA 2BHRA 2A2ZA 1CRQA 3CX6A 1UKZA 3NC1C 4Z8YA 5FH9A 5IK2D 1OH8A 1IN7A 4KLZA 5FBRB 4LBZA 2ATVA 1S0UA 4B32A 3MUFA 5E7MA 3TE6A 1GP2A 5E7IA 2KBFA 2ZRBA 3WYGA 1ZNXA 1J70A 1XMIA 4PPGA 4JVLA 3L0SA 1G5PA 1NF3A 2G6BA 4A2WA 1CIPA 3I32A 1BH2A 2GCPA 1R4AA 2UVQA 1SVOA 2JJ1A 1N6NA 2C95A 1E2IA 1NY5A 4P32A 2ZJZA 1FOEB 1XCGB 4ACAA 5ANRB 1NVVR 1ZU5A 2FF7A 2ZETA 3E5HA 3IO3A 3F0TA 1QG2A 3Q8XB 1NLYA 4LRWA 5CLQA 5EP2A 3WNCA 4AI6A 2Q3HA 3FOZA 5FOSA 4GSYA 1VG8A 2R44A 2VP4A 2NGRA 2VHTA 1Q57A 2YOFA 1AA9A 3A8TA 1X1RA 4BFSA 4MA4A 1S1MA 3ETLA 1SVMA 5B2ZA 2YWHA 2D7DA 1KK3A 1FNMA 1IN8A 3T35A 3KTAB 3KTAA 3I72A 1ESMA 2O0HA 1G7RA 1OB5A 2BV3A 3QBTA 1EX7A 3OE7D 4V0KA 1F6BA 4YQFA 1M6NA 1E9RA 1J7KA 1N6LA 3CO5A 4PZYA 2C98A 1UEJA 3Q3JB 1Z6TA 2RAPA 4OHWA 3N2EA 1KMHB 1ZNWA 1II8A 1M7HA 4V0OA 1M74A 2R6DA 1Z0KA 3ZD6A 4UJ5A 1OXUA 4E03A 4QBIA 3TBKA 1P9NA 2KBEA 3RS0A 2QORA 1E9DA 4TMZA 5KO2A 3I73A 1ZUHA 2G77B 4TYWA 1J8MF 3EG5A 4MRVA 1SGWA 3OIUA 1A2BA 4BRUA 4PHHA 1W7AA 4LV6A 1R8QA 3Q7PA 1LF0A 1D2MA 4QFMA 2D2FA 2ZE8A 3C16C 5H68A 1BMFD 1UDWA 3RNLA 5JEDA 3QKSB 4G0NA 1QHNA 3NTUA 3H0KA 3IEVA 3KQLA 1KMQA 2VHQA 2B6HA 3W6PA 4HZUA 2GDJA 3BH6A 3MFYA 1S3SA 3QF4A 8OHMA 1XF9A 3B60A 2KE5A 4B43A 3I61A 1E0AA 1SULA 1YRBA 4XTRA 4ZPXA 2OCYC 4O0MA 5EE5B 5JBQA 4DT1B 3AVOA 1TF2A 4HB2A 1RJ9B 1W48A 2B8TA 2WJJA 1S2MA 2IF0A 4TQUS 4CIDA 3U4QA 1XXHA 1S8FA 3LW8A 4N0EA 3EWSA 5AWFC 1RRFA 3DOEA 1IN5A 3J81k 4BLOA 1KZGB 1II0A 2ZRMA 4PQRA 1HV8A 1P9RA 2ZYWX 3L0PA 3B9PA 4KI0A 1OFUX 2AWOA 3A37A 3IO5A 1MRSA 2BMJA 4DWJA 2E9SA 4BEJA 3K9LA 4QJ4A 4UQOA 2ZS9A 4C9BA 1E9FA 3ZGXA 4PSKA 4DCSA 4XOIA 2ZJBA 4DIDA 2Q21A 5J5CA 2BM1A 4U00A 4QGGA 2HV8A 5KDDA 3LBIA 1HA3A 1G1MA 2OSBA 2PT7A 3QSYA 2IHBA 1ZNYA 2FDCA 1H8ED 3C5HA 3Q7QA 1T0HB 2ORIA 3TNFA 1P73A 4RD3A 1F48A 2CBZA 3W5IA 1QHYA 2FGKA 1ZIPA 1W5SA 4IOKA 1JEEA 5EXXA 2WTUA 1ZU4A 3KKNA 4HAWA 2FG5A 3TSOA 1HE8B 4KLNA 3GLHB 4Q1FA 1JJVA 3HP1A 2ZE7A 1ZAKA 1KJYA 1S96A 3UKDA 2JIZA 2D2EA 1MRNA 1NBMA 1P60A 1P62B 1SVWA 3K9GA 4LJAA 2CE2X 5F3WB 2ATXA 1AKEA 2V55B 1SXJD 3U7EB 3U3JA 1L8QA 4JS0A 1OSNA 4I99A 1QVRA 2XJ9A 3T15A 1IXRC 4FWTA 1WE2A 1ZCBA 5CB6A 2W2VA 4L16A 4WA7A 2G1KA 4URXR 2N46A 1QHHB 1OJLA 3HU1A 4GFDA 1NJFA 1D6JA 4PR0A 2V6IA 1W44A 5A4JA 4OQLA 1FUKA 1ZW6A 4IXMA 4BLQA 2J1LA 4P33A 3QE0A 2QPTA 2QU8A 4XTCS 3AH8A 1XTRA 1KSFX 4OHVA 2HT6A 3K8YA 4DSNA 2J59A 4EPYA 3CRRA 1G3MA 2QL6A 2QQEA 1R0ZA 3H4MA 4QBFA 4FXPA 4PZZA 4DUGA 1EWQA 2QE7A 3H86A 3WHLA 4OHYA 2WWGA 1OKKA 5J4VA 3ECCA 2ZSAA 3I62A 2VP6A 3PG5A 4YONB 1Z6XA 5HKKA 3B85A 1Q21A 2C9OA 4HB0A 3TSZA 5KPDA 1AJEA 2Z4SA 3VR4A 1EX6A 1KDOA 4CT5A 2QQ0A 3CR8A 5JJKA 2ODWA 4UNPA 1FP7A 5KDLA 2IXFA 2I3BA 3EZFA 1GSIA 1D5CA 4LJ7A 1EESA 4D4KA 3RSLA 2A5GA 1ZRHA 4YXWD 4FCVA 4AIIA 4CF7A 1OXVA 2QP9X 2PLFA 3HR7A 3CUEF 2V8OA 1MO3A 2Z43A 1T3SA 1IN4A 4MQBA 3TR0A 3D31A 4JLVA 5AUQA 2JLWA 2FGJA 3CNNA 1NN5A 2OBLA 1ZIOA 3IIJA 4G5RA 1TTTA 3R9XA 3RRYA 4OJQA 3D8BA 2ZRPA 3W8NA 4DLRA 4PSAA 1L4YA 4JLBA 4LSGA 3QUSA 2WPDD 1LS6A 4LJYA 4POAA 1JNYA 1XFAA 3VFDA 2G3YA 3MWYW 3DZ8A 1CKEA 2Z0MA 3GEEA 2VA8A 4AD8A 3TRFA 2UKDA 1W36B 1G8GA 3THYB 2C9YA 4R2IA 4IOLA 2VSXA 3F3YA 1TUIA 2ZVPX 4TL9A 2V6JA 4DB2A 5FPTA 3DVLA 4QHTA 1XXHE 4L4UA 4B76A 3VTKA 2FEOA 2A3RA 2ZJAA 4RFSB 1N6KA 3UMSA 1KGDA 1E4VA 1OFIA 3FHOA 2ZRHA 4Q4AB 1DAEA 2QBYB 3R8FA 2HJGA 4LYHA 3IPXA 4OJKA 3THWA 3BB3A 4M53A 1BO6A 5FUWA 1KDTA 4QC2A 2GK7A 2H18A 2NOAA 2YWFA 3G82C 3JZAA 4KFRA 4C0JA 1OLOA 1YR9A 5LPNA 2ZI6A 3LO5A 2V1XA 5TDHA 1CBUA 4EQ6B 3CF6R 4F4CA 1XU4A 2ANBA 4TYQA 4HZIA 4B3CA 1Z6YA 4MGIR 4ZIRA 2P3SA 2VO1A 4V0MA 3A36A 4FCTA 3IGFA 1ZYUA 1MKYA 1GKYA 2R2AA 3EAQA 3WMGA 4PANA 1UKEA 2FMXA 1GOTA 2JASA 3SJAA 2ZJ5A 4M4SA 4B48A 2FNAA 1P2TA 3RC3A 5B64A 5L3QA 2XTZA 2GTPA 1RW4A 4EJSB 3M4YA 2HT1A 2V3CC 2B8WA 1A1VA 1Z28A 3FMPB 2G83A 3T1QA 4AY2A 2WHXA 1WRBA 4OQMA 5CM9C 5JLJA 1COWD 1W4RA 1CR0A 5KOYA 2VHUA 1TPZA 5AUNB 1F2UB 3I5YA 1NBME 2DPXA 4IDHA 3AKYA 4MYHA 2CLSA 5FTJA 3OFND 4AYXA 4Q1AA 4Z54A 3CM0A 1NMXA 5FR2A 3CX8A 1DTSA 2J0UB 4B33A 1BOFA 3A58B 1NLZA 3B7GA 4KFTA 2CEAA 3PEYA 1CJTC 2PEZA 2VHCA 3N2IA 4IKEA 2AFIE 2G0TA 2P5SA 2QZ4A 1GNQA 2J46A 2YYZA 4TWZA 3MGCA 2WWHA 4MKHA 5EQTA 3W6OA 2WZQA 1KDRA 1W4AA 2GBLA 1YZKA 4YMUA 4TL7A 1C4OA 2ECKA 3PXGA 2GEDA 1G18A 4JVSB 3X1DA 2OXCA 1ZNZA 1E79D 3P4XA 2MSEB 3I4LA 4NTZA 1BIFA 3TK1A 1E9AA 3SR0A 1WCV1 3RWMB 1ZMXA 3CBQA 2XNDD 5DI3A 1P7CA 2CDNA 4HUTA 4DVGA 2Q3FA 3AKDA 3I3SR 3OFNA 2C78A 2PBRA 3HU3A 5BYJA 5KUTA 1LTQA 2ZI4A 1Q1QA 5FOWA 4HYYA 1Z0JA 4UNQA 4C30A 4C7OB 2YOHA 1P75A 3SBEA 2IYQA 3CPHA 3NIBA 2XX3A 2ZRGA 1JR3E 3UMFA 4AK9A 1KOFA 2ZUDA 4CVNA 2FPKA 2EW1A 4HLDA 3EC1A 4PAOA 1NIJA 3B2EA 4RD6A 4GOJA 4QM6A 3OEEA 5CM8B 1E3MA 3MWKA 2D3WA 2ODNA 4GZLA 2MMGA 3VR1A 4Q9KA 1DADA 1NIPA 2CHQA 1XRJA 3O47A 5FTLA 1RYFA 4Q19A 1RE0A 3GCGA 4TYPA 2IUUA 5CDFE 5HZHA 3GPLA 1EFHA 3ADDA 3CZPA 1GL9B 3QXCA 4NKRA 1I4LD 1OYWA 2X2EA 3WP0A 1GIAA 1KY2A 3CH4B 4M9SA 3VNUA 1R0XA 2R6FA 5JRJA 1VG9B 2BKEA 5K8LA 4M1TA 4DC9A 4W7SA 1UADA 2QMEA 4QOSA 4RFVA 5IHPA 1CF4A 1CULC 4WOPA 3Q72A 2CNWA 4A8JB 1FQKA 1UFQA 2DY1A 1Z5ZA 2XOKD 4IVPA 4C0HA 3WXMA 2F55A 1W2GA 4B3BA 3OF5A 5JHGB 2NG1A 3FMFA 3KJIA 3GLIB 2CNWD 3GLIA 3GFPA 1U98A 4GOKA 1N3BA 3AF3A 3D7MA 4UJ3A 3U2QA 4PO8A 3O8BA 4QXAA 1JR3A 3ICQB 1AKYA 3W34A 3KQUA 1KAOA 5JCPA 5TMPA 2BBSA 3AKCA 1RFLA 2IS2A 2EWVA 3CNLA 1PV4A 1NP6A 4EFNA 2O8CB 4R98A 2EWWA 2YZ2A 2QNRA 1KSGA 4URUR 2UZ3A 3U61B 1T6NA 2PMKA 3EA0A 3EPLA 3BAFA 3VU9B 4M0LA 4WXPA 1OH6A 3W6NA 2C03A 4QNMA 1N25A 4F38A 1ZM4A 2WJHA 1DG3A 2VHJA 5UKDA 3A1TA 1AGRA 1FUUA 4MDEA 4MH0R 2AHOA 3LWNA 1NN1A 1VHLA 3BERA 3LLMA 4V0ME 3NHAA 4Q1BA 4LBWA 5HZKA 2J41A 4JLOA 2WBLC 3KKPA 2Z5FA 5FTKA 2FE4A 1DAIA 2FFHA 4CYMA 2GAAA 1W46A 4I4LA 4CW7A 1GAJA 2IS1A 1E0SA 1RJ9A 1RRGA 4B71A 3NH6A 4JL6A 4EDHA 1CXZA 1E2MA 4M1SA 5FL7A 4GL2A 1IY0A 5P21A 5JWOA 1EFCA 3EC2A 1M7BA 2FSIA 3R20A 4M21A 2I1VB 2RHDA 3CRQA 2H5EA 3IILA 4RCZA 3KUDA 3K0EA 1OV4A 1YVDA 5FOXA 3IDQA 5GJCA 4EIWA 4Q9JA 3EZ2A 1G3QA 2GEVA 3KKMA 4BEBA 3THXA 3X1XA 3THXB 1M34E 2GESA 1JR6A 4YMWA 1G3IA 1PLLA 1HTWA 1KNXA 3NWJA 1TNDA 2JJ1D 5JI2E 1CS4C 2GVDC 4NE2A 1F2UA 1G8PA 4Q1DA 5E3HA 3KZ1E 4DDWA 1NVXQ 2F43A 4PC2A 3I1FA 1EFUA 1AZTA 1QRAA 1KTVA 3DKVA 1WB9A 4IOMA 1RPZA 1CU1A 4B6EA 4IDNA 2O8EA 1QF9A 2ORVA 3PR1A 4JBXA 1G3RA 4TMVA 1KSHA 2IYUA 4A82A 1LF5A 3FMIA 4A0RA 1XMSA 3AVYA 3GFTA 4RZXA 1X8JA 4D4JA 3FPAA 4Q02A 4LJ6A 2NIPA 1IJEA 1OIXA 1ONBA 4PQFA 3X1ZA 4M2LA 5JCZA 3DKPA 4TQ9A 1CJVC 1KDPA 2PMDA 3T34A 3C41J 3E1SA 1E2EA 1KO7A 2X1VA 3QNUA 4HEJA 4LWZA 4OI2A 4RKEA 4A0GA 4O2LA 1U0HC 1AZSC 2XB2A 3T12A 2BWJA 4PXAA 4DIEA 3ADBA 2WVJA 1XTJA 2OLJA 4IHQA 4MRPA 3VR2A 2WSSA 5H70A 3L0OA 3KXIA 4LUCA 5CJ2A 4A36A 2QSYA 5AUPB 1TQ6A 3BH7A 3B5JA 2XJ4A 4GP6A 3VHXA 4JT4A 4GT1A 3A1UA 3CRVA 3QENA 4NH0A 1JQJC 3B13B 4WAUA 4MITA 4II7A 1G7SA 1XD2B 1XEWX 1KO8A 1Z83A 2A78A 2ODBA 1P5ZB 5DNYB 4XWOA 4B34A 2B21A 3T06B 4US0R 3VAAA 2I1QA 2ZRDA 3ZVLA 4LCBA 1PUIA 1VCNA 4A6PA 4C0SA 4EPVA 2QP3A 2XB4A 2O8DA 2I4IA 4NCJA 1JALA 3AQ4A 1JB1A 4YDSA 4ESVA 2ZITA 2O0KA 2ZREA 5CK5A 2JDID 5GVSA 2IYYA 2RB4A 4LYAA 4FMBB 4XWKA 3DEFA 1UF9A 3SHFA 3EPJA 1G7TA 1SVIA 4BASA 1GNRA 1HH4A 3GLFA 5J4KA 2CJWB 2A30A 4C0AC 4AYTA 3EZ7A 1XX6A 4TSFD 2GXAA 1VYVA 1XCMA 2F3RA 4G5QA 5TXGA 2OILA 3IIMA 2NO0A 1NN0A 2C5LA 1IY1A 3QVUA 1GKUB 4GOXA 1YE8A 2OCBA 2XZPA 2JJ2D 1MR3F 2IXGA 3BS4A 5E7JA 4KVGA 4AG5A 2Q3MA 1U9IC 1Z0IA 2WWXA 2W2XA 3FDIA 3NVAA 1B0UA 4B6FA 3A1SA 3LXXA 3BRWD 1A7JA 1KKMA 3EASA 4ZKDA 2HEIA 2NZ8A 1NY6A 1YZUA 3OAAD 4LPSA 1S4QA 3U3RA 4PC3A 4U02A 1U8ZA 4HAUA 4DHEA 2O8FA 3OEED 4HDQB 4NHOA 1Z06A 2OHFA 2RGNC 1HYQA 3IBYA 2X77A 5EP1A 2HYIC 2ZRLA 3RRZA 5TV2A 3HPRA 2CK3D 3W90A 2BCJQ 5EXPA 1GKIA 1SXJC 1X1SA 3HYTA 2V7QA 4V0NA 2OM2A 3K1JA 1P3JA 4EPXA 2HF8A 1CR2A 1NVUQ 1U9IA 1VG1A 4A8JC 2SHKA 1HT1E 5JFGA 2RGEA 2ZVQX 3QXXA 1KI7A 2IYVA 2JLZA 1E9CA 2EVWX 2GILA 4Z8XA 1U2RA 2NO9A 1NKTA 4A2PA 3AP2A 1NN3A 3Q9LA 2IBMA 1SXJE 2OESA 3HWSA 1UAAA 3IQWA 4K81B 1T5LA 1KI6B 1N6RA 5HE8A 3CR7A 1KI6A 1MOZA 4IDOA 1D9ZA 2FA9A 4R2HA 3RSOA 2W0MA 2OCPA 2ORWA 1DBSA 4CEIB 1G21E 2F1RA 3DPUA 3IHLA 4JYCA 1JR3D 2IEYA 3OEHA 2WOOA 3P32A 3RWOA 1FNNA 4ZIRB 3CWQA 1YZNA 2JLQA 3BC1A 2IUSA 1NL3A 4M22A 3D3QA 3NBFA 2OLKA 2RMKA 5KNBA 5GADl 1DARA 1JAIA 4LBYA 5H8WA 1YZQA 1NNEA 5FI0B 3WMEA 1O3YA 2HDNB 1PVOA 4LY6A 4OK5A 1W4CA 1KO1A 1Q1EA 1XCPA 2ZR9A 3CIOA 3E70C 2W6ID 2QBYA 4TT3D 1TL7C 1KIMA 2NO1A 1U8AA 2Z4RA 4LBVA 2P6UA 4F7WA 3GFOA 3U4QB 3ZJYA 1ODFA 2WOJA 3Q5DA 4Q7JB 1XXHB 4AURA 1IBRA 4BE7B 4DB4A 3T1TA 1Z63A 3RC8A 1N5JA 3UWOA 4ASUD 1G291 3CF0A 4UXIA 2P2LA 3GEIA 3QXJA 1PUJA 3B1WA 5FBVB 4MKIA 4ARZB 1FMJA 3SYNA 2O8BA 3UWKA 1TMKA 4C0QC 4H1VA 1P61B 4BZPA 1QG4A 3ZS9A 4P4SB 1XEXB 1P2SA 2WKRA 2XAUA 4RD4A 4OQFA 1H8EA 3P4YA 5J4HA 1VECA 2IYWA 3ZZTA 5LB4A 1FP6A 1K5DA 3GJ8A 2QGZA 4A15A 2O5VA 4KV9A 4I1VA 4CEHB 3LH5A 4DLWA 1VHTA 1KI9A 2FFQA 2P6NA 5DI3B 4ZI3A 4MUBA 3AM1A 1ZINA 1DAHA 1LS1A 4Q9HA 2J87A 4LHYA 2QM7A 4RZ3A 1G9XA 4BUJA 5FPKA 3GD7A 5SZIA 4A1FA 4CEJA 5E95A 3UPUA 2JDIA 3HDTA 4N1AA 4TLAA 3K70B 4C0LA 2CVFA 1W5TA 4TSFA 5AR1A 4DCUA 4I1UA 2Q0HA 2H1LA 3LDAA 1OF1A 1ZD9A 2PCLA 1R6BX 2IC5A 1FMLA 1UKVY 3BK7A 1E1RD 3DM5A 3ZVMA 2AR7A 4IVQA 2IUTA 4TYYA 2QT1A 1DO0A 1VIYA 2NTYC 3NEYA 2P0EA 3S1AA 2CHGA 1MO6A 2ZXUA 2CJWA 3LFUA 1G4UR 4HDCA 1II9A 1W4BA 2JGNA 2W6JA 5CIQA 3EARA 3SNHA 2QRNA 3BB1A 2R65A 3K9HA 4OHZA 1WQ1R 5LDDC 4LZZA 2JCSA 4M9QA 1Q20A 3W9YA 4Z51A 2ODEA 2RGGA 1LV7A 4IJMA 3RS2A 2VPPA 4MRRA 1W36C 4GBMA 1QHIA 3WP1B 1P72A 2PZEA 4Y0VA 2CE7A 4IXNA 4A92A 1TEXA 5AUOB 1U0LA 5JJIA 1UDXA 4F4JA 4YMTA 1OIVA 1XD8A 2OBNA 5BW8A 1VCMA 3CKLA 1OW3B 2R62A 1MABB 5F9HA 4M1WA 4CDGA 2HCBA 2OAP1 3K9NA 1NKSA 3PJRA 1DE0A 3PUYA 2OEPA 2QG6A 2ZEJA 3BIFA 4G5SA 1R0YA 4DJTA 5B30A 1DEKA 2F9LA 4Q7KA 4F4IA 3SHWA 4DRZA 1ETUA 3PEVA 1IJFA 521PA 1M1YE 3U44B 3SEAA 1TEVA 1CR4A 4BLTA 1TF7A 3O8CA 3BE4A 1Q3HA 1F2TB 2CXXA 2O8CA 1E69A 3QEOA 4FD2A 4Y0AA 1XB2A 2RGAA 3E2IA 1G16A 2YOGA 3SU8A 4ABYA 4AKGA 4Q4JB 2EYUA 4RD0A 4A6XA 3PEWA 5G3YA 4M1YA 4I81A 2IA5A 1RVDA 2PEYA 4J0QA 5DIFA 1VCOA 2E1RA 2YC4C 2YNMA 2BMFA 1GUAA 2R6GA 3KL4A 1YR6A 5AK0A 5L3SA 4Q4AA 1VIAA 5TY0A 4LPKA 4MGZR 3THWB 4TLEA 2AWNA 2Z6VA 5D3QA 1ESNA 2ZRJA 3C14C 5EE9A 2DCUA 1IXSB 3MSXA 3KX2A 3BD9A 2WPDA 1CTQA 2WIAA 5IF9A 3SN6A 1IOZA 2EFCB 3DDCA 3W3AA 4QHSA 4QJ5A 4D26A 1YZGA 2PZFA 5DYGA 3QPVA 1KI1A 4IOJA 1W0KD 2WSMA 1QHXA 5TB5A 3VU9A 4NBSA 2C9CA 2IYXA 3NDPA 4YLGA 2L0XA 3U5ZB 2XTNA 4QL3A 1E9EA 3TR5A 4D4MA 4MGYR 5FUYA 2GJKA 3L82B 2GA8A 3QF4B 2FFBA 3MLEA 4QBGB 1SHKA 4M1MA 4BQSA 4FINA 1XNJA 4ZDJA 3B1YA 4EPWA 2A5YB 2CLCX 2VP0A 3NBXX 5AJYA 1GVNB 2GXSA 1ZBDA 4IW3B 1UPTA 1A4RA 2B7BA 2BKUA 1VDZA 1Z8FA 3LAWA 3FB4A 3PFIA 1G4AE 5IDVA 3GP8A 1KYIA 3LNCA 2VF8A 4B3GA 3B9QA 5CK4A 1CJMA 2FFAA 3M0EA 1VPLA 1CRPA 1Z0AA 1XEXA 1XBTA 2GF0A 3CONA 2Q9CA 1ZD8A 4XVUA 1IY2A 1Z0DA 5JECA 4URVR 1R5OA 2ERXA 4LDJA 2ZUBA 2HJVA 2LWIA 1WDTA 3A1VA 3X1WA 1HT2E 2QAJA 4JLMA 3X1YA 4GPTA 3RAPR 3AGPA 2F43B 2GETA 4M9XA 5SZJA 3V4RA 4PO9A 1KKLA 1NG1A 1NSTA 4NONA 1TADA 2B92A 1GFIA 3UMRA 3TUIC 2IYTA 4JT2A 4P0TA 1XPUA 1X86B 2RKOA 1XD9A 4JVNA 4Z1MA 3X2SA 2CMKA 1KY3A 4B3DA 4KYIB 1ZM2A 1XTSA 1YR8A 4LX0A 5KDOA 2JLXA 1XP8A 2CCKA 4E09A 1Q12A 3GLHA 4DDVA 4NPHA 2R6CA 4PTLA 1GL7A 1TAGA 4LHVA 3K0FB 1E1QA 2ZSBA 3VR5A 3IEUA 3IQXA 3QQ5A 1U94A 4RD1A 1S9HA 4NYIQ 2WSSD 2OZEA 1UBCA 4TQAA 3DM9B 4UXJA 4KO8A 3AVUA 5JWHA 2GJAA 4LK2A 3MG9A 4QKQA 1QHHA 5KSYA 3ZDQA 3AVXA 2ZI7A 2VF7A 1EFRA 2OO7A 4JLKA 1R7RA 3ND9A 3AEZA 3FFAA 4TT3A 3KXLA 5CYOA 1GG2A 2WWFA 3V4FA 2WWIA 3I92A 4OQXA 3FGNA 2KWIA 2N42A 1SXJB 3VQTA 1E0KA 1W36D 3FHTA 2J7PA 3A1WA 4YDHB 2BJWA 2OE2A 2QE7D 3CX7A 3FKSD 1XZPA 1T0JB 1CJKC 1JPNA 3CLVA 1E98A 3OZXA 1GRNA 2FH5B 5F9FA 1AK2A 3QKTA 3SQWA 1GTVA 5JZVA 3K70D 3DO6A 5DYIA 4IDPA 4PC1A 2CVHA 4D81A 4IFEA 1R10A 3OESA 4I1SA 2X8AA 5H1YA 4PPFA 2ZRFA 5HCNA 2AFHE 4Q1CA 3SFVA 1GDDA 2J5XA 4M9ZA 1WMSA 3EX7C 2GZDA 2NO7A 4FMDB 3SE0A 1UBFA 2YINC 5L8VA 3HYRA 2ZE6A 2JA1A 5AJZA 6Q21A 2XSZA 2PX0A 4V02A 1KI8A 4Q1EA 2ANCA 2A5FA 4WW0A 4BLSA 4LJ8A 5DI9A 1XJQA 1G64A 4LC1A 2NMVA 2OXRA 2V7QD 4FMDF 2VSFA 2WMNB 1A2KC 4JLPA 1DAGA 3AUXA 4M1OA 2REBA 2GJ8A 4KXFB 3GQBA 1R8SA 4HUQA 1N2CE 2DBYA 1J8YF 1ELOA 3CRMA 3LBNA 3RABA 3PUWA 3AF1A 1KHTA 1TX4B 2CL7X 1SQ5A 1AS3A 3CRW1 1FPMA 1VCIA 1TQ4A 1WBDA 3SS8A 1WXQA 5DN6A 2GXQA 2ZU0C 4QGAA 4N0DA 4TL8A 5DHFA 5AJWA 2VH5R 4JJZA 5DSZA 4A4DA 2NPIA 2ZI3A 1BYUA 1DAFA 2ZYUX 4B74A 1G8HA 3G5UA 1T5IA 2WJVA 5G41A 4F91B 1E2PA 1YR7A 2DWQA 2XNDA 4NYJR 3TKLA 3TVDA 4PC7A 3AVWA 2GK6A 3U3MA 2ZI5A 3W3ZB 5F98A 1JXMA 5FTMA 3QY0A 4LHZA 1Q0UA 2CL6X 2JLVA 2QY9A 4IEIA 5G3ZA 3B1XA 5TVKA 5FL3A 3SBDA 2BJVA 3NBYC 1E94E 2DWPA 5EE3A 2OT3B 3RS4A 4DBLC 4HATA 1AQUA 3L8ZA 3NC0C 1NG9A 3CB4A 4B73A 2DYKA 1NVWQ 4HLUC 4RY2A 1TF5A 3ZQ6A 5KSZA 1W2HA 2IF2A 4JLDA 1X6VA 4Q4HB 2QI9C 4OBEA 4W9MC 3U7FB 4EJSC 2FZ4A 1N6IA 2F3TA 1ZC3A 1I2MA 5BN4A 1VKJA 3K09C 4P4UA 2PT5A 5DN6D 1IXZA 3KJHA 4JL5A 3EPKA 1YZLA 4OI1A 2QGNA 4NCIA 5C46F 3UIEA 2C77A 5KTYA 2WWYA 1I4DD 3SJCA 4TZ0A 1JAHA 3FHCB 3GLHE 3ONWA 1N0VC 1OT3A 1G19A 2W00A 2O8EB 5IRCD 4AC9A 1SVLA 3EIQA 1E2FA 4TMKA 5C4GB 3A4MA 4W5HA 3MWLA 2ZYTX 1UBEA 1XMJA 1SVSA 3WNDA 4C0KA 1XD2A 3EZ9A 3OAAA 1OFTA 2GAOA 2QTFA 2FZLA 1OH7A 1RKBA 4EUNA 3CWZA 1N0WA 2BBTA 4TTRA 4ZV4A 3K0FA 1XZQA 3A4LA 4FW9A 5JSZB 3LQQA 4G1UC 4X8HA 4JLAA 2VLIA 3QPWA 5TARA 3SI7A 2YHSA 1EWRA 4UXHA 5C4MA 1KK2A 1SKYB 3SZRA 2H92A 1XPRA 4E07A 2BCGY 2GCOB 4PX9A 2GCOA 5DGXA 1KI2A 5EXTA 1T4GA 3IUYA 4HLCA 2PH1A 2QROA 4YC7A 4NCKA 1N6PA 2YJTD 5J40A 2FV8A 1NMZA 2WWWA 3U7HB 3NDBB 2FPLA 1G7CA 1SZPA 2PLRA 3FWYA 2AL7A 4AYWA 3KQKA 5KPJA 2NPFA 4RCYA 4EPTA 3ZLJA 3K70C 2IWRA 2J9RA 3MJHA 4IRUB 4P31A 1W47A 2ZJ8A 1XTQA 3KFVA 3R8CA 5G53C 2AXPA 2ZROA 1NMYA 1Q1ZA 1BMFA 2IXEA 3K0CC 4ZI2A 2J7PD 1FQJA 5FPHA 3TMKA 2OUKA 4WZAE 2Y8EA 2RGXA 4FCWA 2OV2A 3BFVA 4R7ZA 4XD7D 1N5IA 2WM9B 4C3ZA 3LX5A 2VTKA 2ZI9A 4ZKEA 1US8B 1TQDA 4ACBA 4Q5IA 1RYHA 2QA5A 1Z08A 5IT5A 1U0JA 5GJVC 1GWNA 4B75A 4FIDA 4NYJQ 4ZCMA 4DLUA 3Q5EA 4LJ9A 2D7CA 3B8HA 4RSGA 2IWHA 4AKIA 3CPEA 1A5TA 2E87A 3P1JA 3PUVA 3AP3A 4WIAA 1F2TA 4XVQA 1NI3A 2AN9A 1E96A 4JZKA 4O3MA 2XGJA 1NJGA 4F93B 3OE7A 5GVRA 3SFZA 3DOFA 1KAGA 3GJ5A 1ZJ6A 4Q4LA 5CDFA 4NL4H 4JKIA 3QXSA 1JJ7A 1KK0A 2WV9A 3QKUA 2VEDA 4KFUA 3V9PA 4A8JA 3LA6A 3OIVA 1OFHA 2W6JD 4JL8A 1CP2A 2HLDA 3P20A 4MGKR 2IS6A 2GKSA 1Y63A 2FPMA 2OFXA 3NKVA 2JLRA 3QEJA 4S35A 1MABA 4MKFA 4PZLA 2HXSA 5LB2A 2A5DA 1TUEA 3BH0A 3OIWA 1DAMA 2HUPA 2VIIA 3IIKA 3U60B 4HUQB 1H65A 3A6PC 4OL0A 5EUMA 1JECA 5L3RA 5HTKA 2QMUA 3PUZA 3JVVA 3ZIAD 3GLIE 5CIWA 1EFTA 1NLFA 1TU4A 4MYUA 2ERYA 4DXAA 1U90A 4Q4JA 3GLFE 1E79A 221PA 4MKGA 4LYJA 4KSCA 5AJXA 5EE1A 1KI3A 2FJUA 2XITA 5DO9A 1E2HA 4MRSA 3TVTA 4DDTA 1RIFA 4OYHA 3VX3A 3BXZA 4JJKA 2IYSA 2ZM5A 2P65A 4LHWA 1OXXK 2BM0A 5L3SB 2HXYA 3VNVA 4HAVA 4HAXA 4G3XA 4Q7MB 2FSFA 2N1BA 1K6MA 3MMPA 2W2TA 4KYUA 2HCJB 4BFXA 2C99A 2ZYVX 3WBKA 4M8NE 4HAYA 2GCNA 4RKFA 3VR3A 1G8YA 3B6EA 5JS8A 1B23P 1DPFA 1P2VA 3C7KA 4XSGA 2IX3A 1ZVQA 1E99A 4EQ6A 2G1JA 2WKPA 1J2JA 5JJLA 4KHZA 3K0SA 2V4ZA 3AF2A 4NP6A 4P4TA 4V03A 3BGWA 4O2RA 3AF4A 2QSZA 4NU0A 4BRWA 3G0HA 3JZMA 3LVRE 5FOUA 3QVVA 5EP3A 4EJSA 2W58A 1LVGA 4GMXA 5HE9A 2GBLC 1IN6A 3AVVA 3FVQA 3IPYA 5FBWB 2MSCB 1V5WA 4GRAA 3WY9A 3NHBA 3SYKA 5DE3A 2XZLA 2OCAA 2ZANA 1G3UA 2WAXA 4JMPA 1P6XA 4IEEA 3T61A 4FI3C 4A0HA 2QAGA 3REFA 3KUCA 5FI1B 2H7VA 2D06A 2REOA 3L8YA 4G5OA 2EFHB 2BEKA 4QG7A 1FZQA 1G5RA 1QDEA 4X8OA 1YHNA 1W0JA 1ZUNB 4G5GA 4Q01A 3KXKA 2GRJA 5DHAA 3RYTC 5DH9A 3R9IA 4KJZA 4L9SA 2FSGA 2F1IA 3QG5A 4PAMA 4RJLA 5DLQC 3VHLB 4Q00A 2C04A 4EFMA 4XIGS 5SZKB 2IEZA 4B2IA 3PITA 3TUZC 1OH5A 2JAQA 3FMOB 2W0SA 3RS5A 3DL0A 2J3EA 4JLJA 2AKYA 1Z6GA 3OHMA 1I2DA 2P67A 4Q47A 4W5JA 1FW6A 3EPHA 4D25A 1XPOA 2LKCA 5FPYA 3C15C 4BFWA 4B35A 3U3OA 2YVUA 1G5TA 3UANA 3AP1A 3LV8A 4MUAA 4LC0A 1AS2A 1J90A 3KKQA 2D74A 4C2UA 1XJ0A 1RC8A 2R8RA 2V54A 2QUZA 1U8YA 3K0CA 2FSHA 1E2LA 5IK2A 2H17A 4KFSA 2QPAA 3ZVNA 3T1VA 4RZUA 3HU2A 3PIRA 1UEIA 4O25A 4IVRA 2JJ8A 1HQYE 2IHYA 4LV5B 5FOTA 3RRNA 1OKKD 3P27A 2ZU6A 3U44A 1S9DA 3EIHA 4EAQA 1UBGA 3AGQA 3IBGA 4IDQA 4R9UC 5KU1A 4MDFA 1OPXA 1HQCA 2ZPTX 1G20E 1QBKC 3H84A 4GNKA 1ZC4A 1GILA 1KNQA 2OG2A 1L2TA 1Z2CA 2X2FA 4D82A 4XSHA 3AB3A 3FE2A 4PPNA 5JHHB 5HKKD 4TN1A 1FX0A 3QBVA 1KK1A 2B7CA 5EP4A 2WIBA 1G8FA 1R5NA 4DUGD 3SC3A 3DZDA 2IYLD 1IAQA 3HJNA 1E9BA 5GJWC 4DKXA 2AK3A 5HPYB 2QN6A 3NEJA 4US1R 1MO5A 3SQXA 1KSJA 4OKSA 4B2LA 5F2EA 4KODA 3IHWA 5G40A 2PL3A 1VYTA 2DFNA 2OFWA 1JI0A 2IYRA 2BBWA 2JIZD 3THOA 2VP2A 2BEJA 4H9GA 2O8FB 4BFZA 3AVPA 4ZCLA 1BS1A 3B78A 5J4LA 1DOAA 3VR6A 3QKRB 1ZP6A 4NYMQ 3UATA 2OFOA 3GJ0A 3BOSA 3GJXC 3NH9A 1L7VC 2AD5A 1G41A 5M04A 4ERNA 1E2GA 5C2JB 5EJEA 3MCAA 4QRHA 3LVQE 5CLLA 5HR5A 1EFRD 2A9KA 3KFXA 3EWAA 1AGPA 4FMCF 1WA5A 2TMKA 1Z07A 2BIFA 1VYUA 2ZR7A 2VBCA 4BFUA 4TLCA 2AX4A 4JYBA 1KJZA 2VRWA 3T1OA 3OIYA 2QENA 4ZO4A 4XVRA 3U7GA 3C8UA 2AKAB 1HY3A 1Z47A 3PQCA 1ZUIA 4C4PA 2ASEA 1IQPA 4DT1A 2XSZD 4Q21A 2C96A 3LBHA 2F1HA 4YMSA 4B44A 1H8HD 5HCIA 4DCTA 3TGPA 3QF7A 4BWYA 5JRZA 5JWRA 2J45A 3RLFA 4ESHA 5J47A 1D2NA 1OXTA 1BYIA 3CF2A 2EU8A 4BECA 4ITRC 1SKYE 4B3XA 4LYFA 2F1JA 3QOFA 1T8UA 2G9NA 4YMVA 2GNOA 1JQLB 4NCHA 5FFMA 1O87A 2JLSA 2R9VA 5JS7A 4Q66C 2IL1A 1DELA 1GRQA 1LY1A 1EGAA 2XNSA 3HPQA 2CL0X 4JBWA 4WZ6A 1NRJB 2IK8A 2ZJYA 4TLBA 3U3KA 1X8LA 2ZS8A 4DCNA 1G6HA 2RHMA 4K8OA 5CITA 3UK6A 5L3VA 3QG1A 2ZJ2A 1ZCAA 1E32A 5KNDA 1Z6AA 4H1UA 1KO5A 3BFXA 3NBZC 3KQNA 2YWEA 2QM8A 4HLUA 3MAAC 4HDOB 4PHTA 4QHYA 1E2QA 1YQTA 4KSBA 4ZDWA 2FN4A 5BN5A 5LD2C 2HYDA 4K46A 1AQYA 2ZQ5A 1Z29A 2DFTA 2NZJA 3LQRA 2Q9BA 3R7WB 1J99A 2WICA 2WAYA 4UNNA 1I4TD 4U5XA 3K09A 3F8TA 4D6PA 1XTKA 1GL6A 3WBJA 4QNRA 2CCJA 2P6RA 2QTVB 3QXHA 4KBFA 821PA 2JEOA 2QPOA 5SZHB 1N6OA 1Q3TA 2ZSEA 4QBHA 3RANA 1COWA 4PPQA 4BFYA 3KKOA 3RRMA 3KQHA 2CK3A 3VKHA 4AKHA 4OI0A 4ON9A 4NMMA 4BGDA 1E1QD 2WJYA 3ASZA 2A5JA 3M6AA 4FN5A 2ZS7A 3QJYA 1PJRA 1QHGA 2ZTSA 2DWOA 3GJ7A 3WMFA 4KITB 1A82A 4JVMA 2IS4A 3EA5A 4U7DA 4NYIR 3GMTA 1K5GA 1MV5A 1KJWA 4XD7A 4CEJB 1EK0A 4QJ3A 1HE1C 1NSFA 1TU3A 4D0GA 2QEQA 4R71A 1RRCA 3KB1A 1VMAA 2O8DB 4DLTA 2F7SA 5JSZA 5KYKA 1IHUA 1D8TA 4DSTA 2NO6A 1T8TA 3WYFA 1N5LA 4AKEA 3DMDA 2KI5A 2EYQA 4URYR 1HURA 3MD0A 2ZRKA 4URZR 1F60A 3MJRA 4C2TA 1E4YA 2CCGA 5J4YA 1PZNA 3QIAA 1US8A 3EIEA 4D80A 1V43A 4PO1A 3SYLA 1T3LA 3AV0B 3AVQA 4BZXA 2PJRA 2RGNA 3CW2A 3ADCA 3LX8A 3TJZA 5EZ5A 4C0BA 3UXMA 1SXJA 3T5DA 1GRRA 5FPSA 3ZIAA 2O52A 3FTQA 4ZDIA 4HB4A 3SJZA 2GEUA 1CEEA 1Z0FA 3LY5A 4US2R 3GLGE 3LLUA 2G0NA 3TAUA 4WVFA 5BQ5A 3T5GA 4DLSA 3GJ6A 2EQBA 3C4JA 2REXB 1DAKA 2BBOA 1BKDR 4A9AA 1MT0A 1U81A 5FL7D 4ASUA 4OHXA 1S1CA 3LD9A 2D62A 1II8B 1W49A 3RDPA 2OAQ1 3ND8A 4ZDKA 3QKRA 2G88A 4P3YA 1D9XA 2DFLA 3ZYCA 3VMFA 1WBBA 2DB3A 3ZZ0A 3RS7A 2VQSA 1AM4D 2W6IA 4OI4A 5KNCA 3PV0A 2EFDB 2EFEB 1QHSA 2YC2C 2J0VA 2WJGA 4NYMR 4PHFA 1XTIA 3O8DA 4BFVA 1XWIA 1LNZA 4KVAA 3QKSA 4OK6A 2WJIA 2ZE5A 3ZQJA 2PJZA 4RFSA 4TTPA 1N0UA 2GJSA 2KB0A 1FL9A 1M8PA 5CYPA 5E4FA 3SOPA 3TLXA 5CB8A 1GITA 3HR8A 4Z1MD 2AK2A 1R0WA 3MWJA 4PC6A 1E2DA 1P9WA 2YWGA 3W5JA 5GJBA 3FKQA 2BMDA 1SVKA 1HEIA 4EKDA 4JBYA 1Q44A 3NG1A 4V0LA 3TQCA 1OXSC 3ASYA 4HLQB 3L0IB 3GLGA 4DLYA 3GLGB 3EW9A 4CEIA 2XTMA 4RD2A 4D4LA 1CJUC 2YV5A 3I8SA 5EE0A 4BZQA 2F9MA 2QT0A 1R5BA 2AXNA 2ZIAA 4ILEA 4TTQA 4XWAA 4UNRA 1ZM7A 3U6KA 3AF0A 2GVZC 5FR1A 1PLJA 3GJ4A 1FTSA 3VX4A 2XZOA 2JLUA 4A2QA 2YKGA 2QRZA 4KU4A 1WP9A 4UNSA 4D2IA 4HZUB 3B1VA 2KJQA 5KSPA 5FBQB 3GJ3A 5B58C 4X8LA 4W5WA 2RGBA 2WKQA 3AVTA 3TUJC 1TQ2A 3H2YA 3MRSA 3QPUA 2ZRCA 2J7KA 4I1OA 4TYNA 121PA 3EXAA 4WZBE 1S3GA 2XEXA 1L4UA 3ADKA 2PX3A 3PENA 2W83A 4GP7A 2J0UA 4URWR 3BB4A 1GZSA 1JPJA 3DMNA 1LFDB 4PAQA 4Q4HA 4RVCA 2O8BB 1N5KA 3R7WA 2QTHA 4GZMA 4F92B 1E6CA 2FX3A 4QM7A 2KSQA 2Q6TA 3ZZUA 2ONJA 1Y3AA 3BJIC 1DVRA 2BC9A 3AUYA 2ONKA 3ZH9B 3VKWA 2ZR0A 3KJGA 1VTKA 2JATA 1X3SA 3AKEA 4BPBA 4TMXA 1FFHA 3CH5A 1ZD1A 4HB3A 1E1RA 3H1TA 2ZSFA 5D3MB 1Z2AA 421PA 4QGHA 4Q18A 1OB2A 4ZCIA 2GJ9A 2GZAA 3PEUA 2RCNA 2CHVA 4PQYA 2OBMA 2JJ2A 4L9WA 1CR1A 2H57A 1ZM3A 1UJ2A 4EFLA 3TW8B 3UG7A
chains in the Genus database with same CATH superfamily
2ZATA 3IBSA 4C01A 2MSDB 3DOHA 4X63A 4LOAA 3ANMA 1FMTA 2ZAMA 3O26A 3RSSA 1TKBA 3DFMA 4RXMA 1E3JA 3R1IA 3NHLA 2EJWA 1LDGA 2C8LA 1J20A 4EFDA 4LF8B 1BHQ1 2GD1O 4QRDA 3E9NA 3Q85A 4Y7CA 2QZZA 1IRXA 2RKBA 5JMTA 1BGXT 1U2ZA 4NZYA 3A26A 3LOUA 1P18A 3P2MA 3Q3GE 1CUAA 4P84A 1LLCA 4MQFB 1CEXA 3EY4A 4XCXA 3JASB 4LOHA 5JI2E 4MYTA 1G6OA 2FHPA 2GM4A 5DU2A 3IV6A 3GLFB 4B3FX 4YA6A 4ZARA 2V59A 3S1AB 3AHHA 2WJWA 1WXIA 4WKGA 3PDIA 1X9IA 2HDOA 3R3SA 1JTEA 4DSUA 1MG0A 4R9SA 2BGJA 2P6PA 1WHTA 2CLLB 2QK4A 5BYKA 2I6UA 2RGCA 2PRYA 721PA 5DHRA 1TKAA 5IEBA 1ISSA 1ZQ9A 4MTLA 4DZZA 2BEWA 1F4LA 5IDQA 1QRUA 2XWQA 4XUDA 1EGQA 1CEQA 5FF9A 3TQFA 2Y9PB 4FP9A 3BMXA 4AB1A 5C5EA 4FNOA 3D9QX 1NI4A 1RM3A 4C7JA 1O94A 2ZJ3A 3RTBA 2PTHA 3FR7A 1ODLA 4CRWB 4RL4A 1HZZC 1X7HA 5L7YA 4DSOA 3EPRA 1G17A 3BFKA 1E3LA 1C3EA 1X9GA 5EZ6B 3U49A 3TE7A 4HGZA 3ZCUA 4I55A 2J0QA 3A1NA 3T9DA 4U0JA 4QARA 2H8KA 3UJAA 3PI6A 1VHJA 5KQGA 1ZKDA 4QIHA 2J33A 4DF3A 4L15A 4GMDA 4HC4A 2WKSA 1AVTA 5CVJA 3H1AA 1V45E 4WBSA 2LBPA 3K0AA 1YRAA 2RI0A 3RAEC 1QGAA 4E22A 1QH8B 1YZTA 3LYUA 2QM3A 3K4PA 3P96A 4YJFA 5FWXA 3HEAA 4YJFB 5IYZA 5K8JB 4I2VA 5CCBA 1T91A 4HXFB 4JSYA 4QGFA 1K66A 2BELA 4YRSA 4TKUA 4N3CA 4HGNA 1W1WA 4JGGA 1JEDA 2J0SA 4P6VF 3AJDA 3DXYA 3OA0A 1U63A 5HA5A 1K75A 1JAYA 3WWYA 2XYRA 4LOIA 3UXHA 3V42A 2G70A 3HFJA 4L0DA 4M1KA 4M0EA 3V3TA 4R8LA 5C1BA 5C18A 2FKNA 4B6SA 1THTA 2GAIA 3M5PA 2XE7A 4DCVA 1EDOA 3VPCA 2X41A 3QLTA 1K8RA 3AY0A 2WLTA 3N70A 3DWFA 4Q9LA 1L5VA 1PDOA 1TM5E 1JBKA 2YL2A 2ZRNA 5IYZF 2WQ6A 1VG0B 2BMEA 2WJ4A 4KO4S 4NDAA 4S2EA 3H5LA 1BXRB 1BFUA 3CW9A 5ENVA 5FBLB 3ROTA 5CIYA 5HOQA 1R74A 4A8TA 4Y6RA 3LW7A 1CPYA 3B52X 4BNFA 5COBA 1T8WA 2XUAA 3HBFA 4HVTA 3KKLA 3SZUA 5I9NA 4HNSA 5JXWA 1XELA 2JK1A 5HMMA 1LW7A 4GXNA 4WN9B 4FKMA 1EG7A 1V8FA 3GB9A 2XCIA 4XJVA 1GQYA 1Z0UA 2B2XA 1ZN8A 3DUFA 3DLPX 3DUFB 4R69A 5DX1A 2PGXA 1SHZA 5K9ZA 1U9ZA 3U1BA 1Z22A 2ODQA 2OHXA 1TLTA 2WUEA 2O4UX 4AZVA 1BX3A 3PQ8A 5FWYB 3O8RA 4RTPA 2MMCA 2FEPA 5DBOA 1DGQA 3D1JA 3DKIA 1NUPA 3ME5A 1UWVA 2FEKA 4CMAA 4EEZA 4DLXA 5LQJA 1PT8A 2DHCA 3F9IA 5K0SA 1I2ZA 3PCRB 3U9LA 1Z4JA 1XLTC 4ZK6A 1L5KA 1W1UA 5C5DA 3HV2A 3QWIA 4K9NA 4HRYA 2QP4A 2UDPA 3RVBA 3V00A 1YASA 4F3KA 3L2OB 3VDXA 3NHZA 1N5MA 5C1DA 1JHXA 3FUXA 1Z62A 1JMVA 4RPKA 5IPFA 1ATZA 1QF7A 3SDZA 5C0OE 1CQIB 5LP6C 1DS6A 1Q22A 3WLOA 4EHKA 4DC0A 1Y33E 2XUPA 5ALZA 4BKUA 5H5JA 4LJ4A 1QGOA 3QEBZ 1RQRA 3DMFA 2B3DA 2VQ6A 2FZ5A 4MV9A 1XDBA 5CG2A 2ZVJA 3SJ7A 2JGFA 4E5SA 3I9OA 1GCAA 3H6KA 3IHTA 1REQB 1PX0A 5JDCC 3KVRA 2FMHA 1OHHD 1ZIYA 3S2SA 4KWTA 1JIQA 3O9MA 2VDOB 4I9NA 4QULA 3KSBC 2PUDA 4PZ9A 2JK0A 2ENWA 2FW1A 4G01B 1HMYA 3DYBA 4WADA 4XOUA 2H4XA 1NW8A 3N8KA 1CNMA 5LBIA 1TOAA 4Q3DA 1Z5UA 2YY7A 5EIEA 4MYCA 1UPAA 2PUCA 2HPVA 4X6YA 1XZGA 1BRMA 5EMKA 1M7GA 1QVAA 4XJXA 3UOWA 5C7IO 3ZD7A 2OY0A 1WF3A 3PQ4A 1C30A 4QUKA 5CXSA 5AK4A 1KZ7B 1J0BA 4A5SA 4LV8B 3AXTA 4E5VA 5HRAA 5KHOC 2ZAOA 2G04A 1YJAA 4Y2VA 4D9CA 2OKGA 2LV8A 4E6EA 1QZTA 1KFBB 5MGBA 1WZIA 4MWSA 2BOVA 1XEWY 1NBMD 3JATA 2WAAA 3WRXC 1JP7A 2QJWA 5JW6A 2PHZA 2XADA 5ITVA 3E58A 3P19A 4ZVRA 3BORA 1JDUA 4X00A 2Z6QA 2PZGA 2Q29A 4CN9A 1B73A 2QAGC 1BGWA 4D9JA 3GOHA 5DISB 2R8ZA 4GICA 3LY8A 2C8VA 5EIHA 5L6LB 1N4DA 4CODB 3CX6A 5AH0A 5FH9A 1QP7A 3EJWA 2WTAA 3JTMA 5FBRB 1NDUA 3QFSA 2YV4A 1RXYA 2GSWA 3GT3A 4ND1A 2PO5A 1S0UA 2WYUA 3SKVA 3TQQA 5JT1A 4B32A 5HKAA 3ID6C 1DFHA 2REQA 4OTZA 1EBFA 1K0UA 3K16A 3MGBA 5E7MA 5GY7A 2GYUA 3TE6A 2H63A 2C7BA 2VK2A 4S1WA 2IOYA 4OGWA 3LTNC 4ZCQA 2VJOA 2NNLD 4FHDA 4NOKA 2OQ2A 3RNOA 2X58A 4JWTA 1J70A 3UMGA 2FPUA 4X0EA 2OK8A 5TQ2B 1O97C 1FFBA 3SQDA 4JVLA 4JKOA 1NF3A 2G6BA 4A2WA 1ZLXA 1UL1X 5CVTA 2W2LA 1AT1A 1BH2A 3ENWA 3IFSA 4MULA 5K1ZA 3A2LA 2GERA 3JZFA 4HLNA 2AYYA 4FLFA 2YYYA 4Z9YA 4ZGGA 1HFJA 4EMSA 2VJPA 1NY5A 3R4VA 1TZJA 4WCVA 2ZQYA 4ALNA 2FF7A 2MSKA 1XA4A 2ZETA 3Q40A 4P8RA 3F0TA 1Y8ZA 5F7OA 4LRWA 4FKZA 3RUFA 3UICA 3W5CA 4V2IA 1N7JA 5EZYF 4CIVA 2JIQA 1AXGA 1T43A 1TW2A 5B4TA 2ES4A 4MV8A 1W9HA 3A8TA 1XKXA 1AA9A 5K3DA 1KFKB 5BNZA 1F20A 1SVMA 5DIZA 2YWHA 1ZH8A 5AI5A 3WYNA 1J4AA 3KTAA 3GGCA 1B8OA 1E7SA 4QDXA 2H08A 4KNYA 1OB5A 2BV3A 1EA7A 3Q1KA 3OE7D 4V0KA 4URFA 4DSAA 1HETA 1R5JA 4XJTA 4X60A 4YQFA 5KNCD 1DKOA 3SCZA 3AEUA 3EGEA 2RAPA 4EG0A 5TGDA 2BFNA 3FF4A 3N2EA 3ER6A 1ZNWA 2R6JA 1J9EA 1A2OA 3M89A 3CLRC 3NYRA 1M74A 1Z0KA 4EABA 1HNZB 4QBIA 1P9NA 5FNZA 2KBEA 4AULA 1OLXA 4RTJA 1VJRA 2QORA 3F7OA 2V7XA 5KO2A 3D6NB 1ZUHA 4Z2YA 1DEOA 2Q3LA 3AZOA 1NBHA 1SGWA 3QVGA 5KYWA 4PHHA 3C3EA 3Q7PA 1NUHA 1UP7A 3TFWA 4MR9A 3FBTA 1X7XA 3OJ0A 5EIBC 4B9AA 1BMFD 1UDWA 3MEQA 4MXDA 2HJHA 3AYXB 1AKQA 3H0KA 3DFZA 4C4SA 2B6HA 3A6KA 2GDJA 3MFYA 3OTWA 3W1WA 1E0AA 1YS1X 4ZPXA 4O0MA 3QMWA 1AF7A 4TMFA 1CUCA 3OJCA 5EE5B 5ESWA 4DV1B 1YF3A 1N36B 2UUBB 2Z4TA 3ELBA 3FI0A 2B98A 2G40A 5DHUA 3OWHA 3RKUA 4DT1B 4YO7A 5JBQA 1TF2A 2W98A 2PS0A 1GTSA 3AVTA 4AJNA 1VA4A 1GZDA 5E4YA 4BQFA 1E7WA 3EWSA 4MKRA 1UFVA 1IN5A 1INLA 1VBNA 4BLOA 1KZGB 1BH6A 4B31A 1HG1A 2ZRMA 4PQRA 3L0PA 2RIRA 3WLRA 4C20A 5AW9A 2YIDA 4KI0A 5HVNA 3FTFA 1JA1A 3G6WA 3KPWA 2Y66A 4QTYA 5J5VA 3PPYA 4L4YA 3K9LA 1E9FA 5KYVA 1VSBA 2GBPA 5BWNA 3WQBA 4DSZA 5LZ2A 4ZQIA 2EP7A 1PR4A 2ZJBA 3NAMA 2P6MA 4HMQA 1JEOA 2O7RA 4I1RA 4XASA 3GXBA 5HF5A 5TF4A 2PUFA 2BM1A 4FQ7A 3BSWA 3DE3X 1IATA 1JX6A 4U7HA 3QSYA 4S2UA 5T67A 5CB4B 1RKVA 2VAVA 1EGVB 3HWWA 3ZHOA 3CE6A 3IDSA 3ZXUB 1CUBA 1DXHA 1T0HB 3EXEB 2JAXA 2ORIA 2MT9A 1QVVA 3ODGA 1OAKA 2CBZA 2P9JA 2JZCA 3A14A 1FZTA 4BIMA 1V3UA 1W5SA 4JB2A 2M32A 4RMJA 5SYAA 4BJ6A 1SUBA 4JJEA 4BMOB 2VDKB 3LQ1A 3LYHA 1JHRA 3AJ9A 3U4CA 1L4EA 4P98A 4Q1FA 3BL6A 1L4FA 1ZVJA 2OCKA 3TDKA 4GWLA 1SQ6A 4QUGA 4FU0A 3IKTA 3VH1A 3U0VA 1KJYA 4MPDA 2I3AA 2ZJ1A 2NV0A 4FNMA 3K9GA 1SVWA 3JAMA 2WHPA 2WF8A 5GTDA 2CZCA 1XRMA 3N74A 3U7EB 3U3JA 4NBRA 5JAUA 5G0WA 3HL4A 2BL4A 4QXPA 5TRTA 3M1YA 2XJ9A 3T15A 3UA4A 1ZCBA 4E3ZA 1DKQA 2JZOA 3ILSA 2N46A 3HU1A 1OJLA 1NJFA 4FFBA 5BSTA 3T3EA 4LMAA 1X1EA 4X7RA 4QUHA 2L82A 3IP9A 3BTUA 3EJ6A 4OCZA 4OQLA 3S2GA 3ZHUA 2G4VA 4WOBA 1XQ1A 4HK4A 3VYTB 2I2FA 1C0KA 2QU8A 4HPXB 1XTRA 2OQVA 4B4WA 1H6DA 5JNLA 3IEVA 3WIDA 3HKDB 1FXWA 1U1FA 2AHRA 3H8WA 4XW2A 4EPYA 3FUTA 4UFNA 1G3MA 1FK8A 1H85A 2QL6A 5E9QA 5J1SB 2O2ZA 4ZCRA 5JD6A 1EFDN 2ZIXB 3CZCA 4XX0A 4HPWA 4N41A 3H86A 4OHYA 1QR2A 2WWGA 3HEMA 5HSGA 3ECCA 3H9QA 3ER9A 2QE6A 3KNZA 3PG5A 1CG6A 4YONB 4DNOA 2OSVA 5IT0A 1GGEA 1GPMA 1LBSA 4DYVA 1LLQA 4XUGB 1NP3A 2AGVA 5D1HA 2OXIA 1AJEA 1G5FA 4FNGA 1AHHA 3AR4A 4FVTA 1KDOA 1ZXXA 4L50A 1ZVMA 3NYIA 2W42A 2EATA 5JJKA 2FN9A 3CR8A 2Z6AA 3WIUA 3H2KA 2IXFA 4E4TA 5AT1A 5HJ7A 2I3BA 1D5CA 1WB5A 4R8RA 4J0DA 1EESA 4BGVA 3VDNB 5I9LA 2A5GA 5J43A 4YXWD 2ODTX 4MVJF 4C3VA 1OXVA 2AZ4A 1KP9A 4DDMA 5CD1A 3HR7A 3CUEF 3FRIA 3SLGA 2XGGA 1U6IA 2V8OA 1NR5A 1MO3A 1P7WA 2VDWB 4MQBA 5KKAA 4BJ1A 4JJ8A 5AUQA 4BO9A 1QP0A 2HF2A 2FGJA 5ARCA 3LWBA 3WL6A 3OZGA 4ZI7B 1NV9A 1WHSB 3EQ7A 3ZYZA 5IFKA 5K03A 1U3UA 2D8MA 3SFTA 5B1YA 1FRFS 2IIPA 1TTTA 3ZK9A 3D8BA 3W8NA 1MMFB 3RQIA 2OZVA 1QH9A 3F2VA 3N58A 1MOQA 4JLBA 4LSGA 4IICA 5AVKA 1M8JA 2JKYA 4LJYA 1LS6A 4CFZA 2QYTA 4M98A 1UJ6A 4QXMA 1W0CA 4V24A 2HMSA 2ZJ0A 2IOQA 2VUSA 3AJEA 5IM5A 5LA6B 1KOGA 4ND7A 1MJHA 3ZWBA 3K6RA 2UKDA 3OETA 4BVBA 4WNCA 3THYB 5DSXA 4FFRA 4IOLA 3FNBA 1DKLA 3I2KA 4TZKA 2AXEA 3OUTA 1EK1A 2DTXA 2XECA 2W70A 3TTSA 5FPTA 4DPMA 2OCIA 3EW7A 1XXHE 3JD1A 4JYMA 2OK7A 3Q7TA 4L4UA 4QHTA 4NCXA 1EWKA 3VTKA 1E20A 5EQDA 1KZ1A 2A7XA 5K6AC 1PTJC 3TZBA 2I3DA 3EXHB 3IAM6 3AU9A 5ALVA 2J30A 4ZOQI 2ZRHA 1DAEA 3ICPA 5IC4A 2HJGA 3TD9A 3THWA 1Q7EA 2G6TA 1GD1O 3BB3A 3O8OA 3N3AC 5BYAA 5AW5A 3P0IA 2Q1TA 4C0JA 4KFRA 4DA7A 5B4UA 5DWVA 2Y67A 3S2ZA 1QH1B 2PXXA 2V1XA 2QLMA 3GWGA 4EQ6B 4FHGA 4IDGA 4NQZA 1QBGA 1GGVA 1Z6YA 4ZQFA 1D1SA 1MD9A 1V16B 2P3SA 4V0MA 2FMKA 2H9IA 4WLVA 1MX3A 1ZYUA 2FPRA 2R85A 3IGFA 1GKYA 4PF1A 4DTCA 5AIBA 4YN3A 2XDAA 3ZCTA 2FWJA 1UKEA 2JASA 1W34A 3HHPA 4GKBA 1UC5B 2ZJ5A 4NOJA 5B64A 1SXPA 4WFIA 1RW4A 3R3WA 3JSXA 3IDOA 2VPWA 3HDJA 5DNVA 3RPEA 1F1JA 2IHUA 3KELA 3FMPB 3O1IC 4OYRA 4CFSA 5IP5A 1IMJA 3KBOA 4AY2A 3QPDA 4CNBA 1XZMA 1HPLA 2G63A 2NADA 3C3XA 4IILA 4HO1X 4OQMA 2O1WA 4ZOEA 5F5XA 4OHRA 1CR0A 2A0KA 2RC6A 2VHUA 5C3MA 5KOYA 1WXDA 1P4AA 2JI9A 1XEAA 3ZWOA 5DFAA 2X15A 5E6UB 1T9BA 2WDZA 3ZI4A 2GMWA 5IBCA 2BRUC 4R81A 5FTJA 3OFND 1Z13A 5FR2A 2JB9A 1UBJS 4JZYA 1V5EA 1BOFA 3A58B 4WCDA 2W4IA 5BQ3A 2VUIB 2HBRA 1GRVA 3JQPA 1CJTC 1JE0A 3PHGA 5HGJA 1GQOA 4IKEA 1Z2PX 2I65A 2P5SA 4ALIA 1GNQA 2J46A 5MF6A 4L28A 1ZH0A 1ZRSA 2IDMA 3VH2A 1W4AA 2CNOA 3P2YA 4XAQA 4YMUA 3FOAA 4NJMB 5HIMA 4K6GA 1D6MA 2ECKA 2XT6A 2PV0A 2GEDA 2XTJA 3CX4A 4BEWA 1G18A 4JVSB 3IEIA 5J2TB 3P4XA 4R54A 3IIEA 1BN7A 2VT2A 4NTZA 5HS4A 1EJ0A 1DUIA 1YNSA 2Q49A 2D5IA 4MI9A 2Y68A 3C5EA 1D6SA 3GCZA 4BNDA 4DVGA 5L40A 5GQSA 1CD5A 2C78A 3E3MA 3U3ZA 1WHTB 4MCJA 4A5OA 2I7DA 5KUTA 5FOWA 3S29A 4JEUA 3ZHCA 2CMDA 2IP1A 1RJEA 1RWBA 3JWEA 1Z0JA 3LX6A 1Y0BA 1IZ7A 1GQSA 3HY3A 3IDZA 1P75A 4DLAA 1LSOA 4RLHA 3SBEA 3FTDA 3VTFA 4KMOA 1CUUA 2XX3A 2WRZA 2ZRGA 3EDQA 1JR3E 3GVCA 3LA8A 3RVDA 4AK9A 4XVHA 2ZUDA 4OM7A 4CVNA 4L3WA 5FV4A 3OMLA 3EC1A 1J1ZA 4HQFA 4RD6A 5DTQA 3WISA 2KW5A 3L7CA 3I9LA 3OQMA 1DT3A 4V1CB 3VDRA 1MG5A 2H06A 4GZLA 3C3PA 5BNFA 2AZDA 4Q9KA 3OQJA 1TRHA 2CHQA 1XRJA 3O47A 2H3HA 2HLHA 2JL1A 1FU4A 5KYXB 4IHKA 4PZ0A 3WKDA 4N54A 1RKXA 3KTFA 3MBKA 4NKRA 1P45A 3HUEA 3T7DA 4DAEA 2FWBA 2VRCD 2H4FA 1DT5A 1M6EX 2PS9A 3EGVA 3KXPA 2AMYA 4BCCA 3VC1A 4NEQA 4LFBB 1R0XA 3KHTA 2VAPA 2BKEA 2XVAA 1XNRB 3ZHXA 2YMLA 1A7KA 1JFLA 1H2FA 2IELA 2QMEA 4KX3A 2FOIA 2H07A 1UQRA 4A8JB 1FQKA 2XOKD 4Q7QA 4DDKA 3LWDA 3IAEA 2DHQA 3MS4A 4X66B 1P0FA 3H1BA 1M54A 3FMFA 2CNWD 1XNGA 3I2IA 4MAFA 4OMCA 2DR2A 3JCZA 5GAJA 2Y1XA 1VPWA 5K3FA 4PO8A 3O8BA 4QXAA 5D7BA 1XDGA 2BYTA 4HG2A 1AKYA 2H00A 5KNBH 3FPEA 2IS2A 2BBSA 4ND8B 2ZGVA 1KH1A 1USVA 2AEFA 3D3EA 5PNTA 1NP6A 5BW4A 4W1RA 4EFNA 1HDCA 1VCHA 3IAM1 3L41A 1KQFA 3C3AA 3T3DA 2IVZA 1KSGA 3RSCA 3JRXA 1CRLA 1T6NA 4G81A 1BE1A 5C8YB 5KYTA 4ZT7A 3RIYA 4G0UA 4PG4A 3BAFA 4XYBA 1TAUA 2C20A 4WXPA 1E89A 5L53A 3T54A 1XA0A 2W7TA 5C80A 1DG3A 4G0ZA 2HA7A 1QE0A 2VNHA 4HH3C 5A1TA 5DHQA 3DQQA 4LEIA 1FUUA 2B0CA 4BX3A 5KNLA 3FPLA 2BEVB 4HFJA 1A9ZA 1EU1A 1D1TA 3LLMA 4V0ME 5HK8A 3WZMA 4Q1BA 3IXMA 4DABA 5DSTA 1XDWA 1RNLA 3KKPA 3IEPA 3ADPA 4RA6B 3NGXA 4UUNA 3KT0A 1M3SA 3DAGA 1FNDA 3CEHA 3C97A 4I4LA 4WOKA 3FRJA 5AK3A 3TO5A 3SC6A 1GAJA 1NXOA 1RJ9A 1A98A 3QQPA 5FLEX 3OD1A 2Z8ZA 3QV1A 4CU5A 4BO0A 1WW2A 4DCPA 2W48A 3IP3A 5FL7A 4EDHA 1Y98A 2QLBA 4O4LA 1HDXA 5ES3A 3CCFA 1IY0A 4HDMB 3RIEA 2P9GA 3V6MA 1GPWB 2OFPA 1DEXA 2RHDA 2P4QA 1WABA 4OF4A 3IILA 1IY8A 3KUDA 1YUBA 3MB8A 3N2GA 1CUSA 3BXHA 1R4NA 3HS3A 4LVCA 4YRRA 4CKWB 4EIWA 4Q9JA 5CEFA 1PJTA 3BT7A 1UMDA 3DHEA 3R6DA 4LN1A 1QNLA 3X1XA 4OYLA 2AOVA 4BFCA 5A9SB 1KNXA 5EL0A 1U8FO 2LNDA 3PL5A 1TNDA 4QASA 1A7AA 3QVOA 1CS4C 2GVDC 3DTYA 1F2UA 1G8PA 3RSFA 3EEFA 3JD4A 3O7WA 3OCUA 1OA0A 1IOVA 2OCLA 4HFRA 4PC2A 3FCYA 1PWEA 3BL8A 3HZRA 1DTWA 3TLGA 1KTVA 1K98A 1RPZA 3CH6A 4IDNA 4B6EA 2O8EA 4TMVA 1G3RA 1KSHA 3AVYA 3FMIA 1AB5A 1XMSA 4YAWA 3NYQA 4RZXA 4D4JA 3WOVA 2ETXA 1SG9A 5DRYA 5FNVB 5FYQA 3FWKA 1IJEA 4KQXA 4X93A 2IXDA 1UM9A 3C7DB 1ONBA 3INYA 2WKWA 5AVOA 3ZWMA 5FHQA 1QP8A 2O6HA 3UAVA 5CNJA 4O2BA 4ZCTA 1NKVA 2FQQA 1TXGA 3C41J 5AOVA 3QNUA 4HEJA 2BMVA 1JJBA 3L7AA 3I01A 3COJA 2WFLA 3JQ6A 4X84A 3T12A 2QTVA 3TZCA 4K6KA 1FFXA 1U3WA 4XCVA 4KR2A 2XTAA 4KW7A 4LS3A 1LQTA 2OLJA 3PNYA 3H05A 2IY9A 4CM3A 4HNQA 1F4PA 3KXIA 4KHPB 1F7VA 5A06A 5CJ2A 1D7AA 3NO4A 2QSYA 4NE9A 3NGMA 1VE5A 1TQ6A 1QGUA 2H4YA 2R00A 3B5JA 3BH7A 3EWNA 4BC0A 3HYCA 4JT4A 4D9BA 4RKWA 2VLBA 3QOXA 4Y1FA 5LU8A 4JT8A 4C06A 1G7SA 1XD2B 1Z83A 1DZIA 2ODBA 3V34A 4U63A 4B34A 2QL7A 4UEJA 3RW9A 1JHPA 2PZJA 2ODPA 3TW8A 3UB4A 4LJKA 4B81A 3CLTD 2I71A 3L6OO 5KQRA 1MIOA 1K6EA 2WTNA 1RYDA 1YUNA 1N1GA 1OWMA 3AG5A 4M6WA 2XB4A 2PUTA 2ZBGA 3FNRA 2I4IA 4RE5A 3I9JA 1JALA 2FN8A 3AQ4A 3NNSA 2P4HX 2VHVA 2Y4OA 1DJPA 2ZREA 2ZITA 3G2NA 3LQ2A 1DX4A 4JQOA 2L18A 1ZA1A 3MJEA 4P4NA 3V46A 4ZJYA 1GAEO 4G4JA 5LZ9A 4JDPA 3K5PA 4LYAA 2CYBA 3AUTA 4XWKA 5ENZA 4AN1A 3HP7A 3RIMA 3UMYA 1UF9A 2R8YA 3FDZA 1SVIA 1GNRA 1VLMA 2ZKLA 5J4KA 1FSFA 3B3QA 3BIWA 4I4TB 2G5CA 4B8WA 4C0AC 5KOHA 2GXAA 3HLKA 2P3OA 1CE8A 1VYVA 1XCMA 4DC1A 1U2PA 5TXGA 1GGNA 1E4EB 2OILA 3Q0EA 1NF2A 4N47A 5IFLA 3VNQA 1WR8A 1FFCA 1ONOA 3F4KA 4C6TA 2V74B 1IY1A 3M34A 5CBPB 1JDSA 3CWCA 2F59A 4GOXA 4OBXA 2XUGA 3GH1A 1APBA 3BCUA 3OQVA 3P2EA 3BN3A 5DTMA 1MR3F 1B3BA 2PQ6A 3AESA 5DX8A 4JC4A 5E7JA 4DMCA 2GYYA 1ZICA 3LF2A 3N7TA 2XOXA 3PYXA 4AJJA 4L3OA 2CXSA 3NM6B 2GZMA 3OZFA 4BUCA 3IUPA 4RLQA 2IOHA 3EASA 4ZHQF 2VZ0A 1T2NA 3AWDA 1UBOS 3PBKA 4O4IA 3DKRA 3BWMA 4CLRA 2AJDA 1CY1A 1V5IA 2D1SA 3OAAD 2YV3A 1JA0A 4LPSA 3REQA 3UHPA 1NI5A 5KNDH 1JH8A 3NEAA 4PC3A 4UU8A 3SQOA 4HAUA 4D46A 1BE6A 1H4VB 2NXCA 2DGDA 4C87A 4QJIA 1Z06A 2GUGA 4MVXA 2HFJA 3QJGA 3GAAA 3RRZA 4L95C 3CU5A 4QUEA 4WXYB 3OG9A 5HIIA 1M8KA 1A5BB 1EMDA 1ZMTA 4RK7A 3W90A 3BE5A 1FS6A 1SCQA 2QXYA 4QBTA 2V7QA 2YWBA 1T1SA 2RHTA 4XE5A 3HEBA 5I7VA 3K1JA 3LHSA 5K7SA 3W2EA 3PGA1 1IUKA 4INPA 1E5DA 5CT4A 5BMVB 5KX5A 2JCBA 1CR2A 1U9IA 2CVQA 3ECAA 3PWSA 1E3TA 4A8JC 4EYSA 1HT1E 4CQMB 5JALA 1I5OA 3GVIA 4G0YA 1KI7A 1WQ4A 3C3CA 1KORA 4WKNA 2IJGX 1SUPA 2ISQA 3BWVA 4RTOA 3EVDA 1R4MA 5ICFA 3JTEA 2C59A 2II6A 3PXXA 3H5IA 1NN3A 3GFQA 2Q3DA 4WOCA 4HQ0A 2DT8A 3QWAA 5AYVA 1GLNA 3IQWA 1HNXB 5B37A 5AKYA 4U2GA 1SCUB 4Q39A 1VLHA 5HE8A 4BGEA 4QVIA 1KI6A 4IDOA 4ARBA 1C0EA 1KEVA 3RSOA 2W0MA 3PQDA 3JQ7B 4J91A 3WI7A 4UOEA 3JQ7A 2D8AA 5CFZA 3KKEA 1W94A 1G21E 1Y1QA 2F1RA 4ILKA 4N40A 3TLCA 1ZNQO 4LXXA 2WOOA 4Q37A 3T7IA 1PR5A 1GG5A 3OJLA 1FNNA 1JQDA 2H1RA 9ATCA 3QM1A 1CVLA 2JLQA 1QGDA 2Z95A 1ULUA 4Y2RA 3PR3A 3D3QA 3NBFA 2OLKA 3GZTB 5F76A 5I5GA 5CLFA 4EY7A 4L02A 4Y6GB 3SYMA 4RVCA 5FI0B 4B3HA 2Q2QA 4EB3A 2Q5JA 1MB3A 4Q0MA 2QTCA 2CDBA 1W4CA 5CR9A 1Q1EA 1EUDB 3MMNA 5EJMA 1EUDA 4J76A 1L7EA 1WD5A 2QBYA 1P5HA 2NO1A 2ID7A 3PUKA 4IS2A 3GNSA 4H7JA 3UPDA 1VHQA 1NYLA 3IAUA 2GNAA 3GFOA 3U4QB 3ZJYA 1U8EA 2WOJA 3Q5DA 4Q7JB 5FO1A 3VI3B 4WKOA 1IBRA 4UBJA 1HFWA 4UAGA 5I7AA 2W2KB 3T1TA 1PAUA 1JHMA 3GCXA 5MN6A 5F21A 3RC8A 3LUGA 1G291 1PS0A 4UXIA 4GRIA 4ZVPA 4DLBA 5GM1A 4DJFC 2WU8A 1LSUA 4IXDA 5ALFA 4ARZB 1FMJA 1KYTA 3SYNA 3NOVA 5GMOA 3W2TA 3ZBTA 3UWKA 1TMKA 2O8BA 1V41E 2R5FA 2VF5X 3L5OA 3WB9A 4LZJA 1U2DA 1TYAE 3O75A 4L78A 4XQ0A 3SHVA 4YCCA 1QZ3A 3ZW9A 1I94B 1E61A 3DE4X 3P0JA 6ADHA 3M9WA 2ISSD 3E2PA 4P86A 1VKHA 4N0PA 4MIEA 2IYWA 5JD5A 1AZWA 4QX6A 2XMZA 5LB4A 3N6XA 5BURA 1K5DA 2VHZA 3GJ8A 4ED9A 4I7EA 2QI9F 4F3CA 2O5VA 5I5EA 4A15A 3SG0A 1E8DA 1WS6A 3ANLA 5DI3B 5J5AA 1D6NA 2J6BA 2Y1GA 4FUQA 4I19A 1N1MA 3RFUA 5LQCA 1E2BA 4C05A 1O03A 2J3HA 4MUBA 5AVYA 4JFRA 1DAHA 3C1AA 3ZPXA 4Q9HA 2XUKA 4J4TA 5LBTA 4UDYX 1G9XA 5DM4A 1I7PA 3TYXA 2PANA 2O0MA 1DPGA 4AQDA 1YB7A 1K5HA 5E95A 2FCRA 2DOKA 3H9UA 3AG6A 3TLKA 2IHVA 3BL5A 2FZVA 4N1AA 1K3FA 3DT6A 4DNPA 1JWLA 2QJRA 1W5TA 4OGKA 5DM70 1LCIA 1PQWA 3OHPA 3Q87B 4F85A 1B14A 2CKDA 1H4SA 2JJYA 1SC3A 5KYNA 5K09A 2WHPB 2AJ8A 5CA0F 4FOSA 2HY7A 4Q24A 3ZCQA 3EF3A 1KZ4A 4QFCA 4CMJA 5TPZD 1RXVA 1QLJA 3DM5A 2AR7A 3GY0A 2ATIA 4J7UA 4LXHA 4MQFA 4O29A 3VDMA 2VJNA 2NO4A 3PNLA 1JT9A 4JX8A 3GUCA 1MO2A 2WUFA 1VIYA 1SUAA 1N3LA 1PJ2A 3NEYA 5GOTA 2ZXUA 4J1SA 1A50B 1UFOA 2CJWA 4XDYA 2AZXA 3M70A 1IRIA 1P4HA 1W4BA 1NWCA 4LDPA 3H11A 2DULA 2E4ZA 3BB1A 3K9HA 5TQ0B 1YR2A 1WQ1R 2OLEA 2V7GA 5TQ0A 2WIGA 1Q20A 3DPIA 3ZQ4A 1DFIA 4NAUA 4RJTA 2C83A 5JNUA 2QIPA 3TW0A 4LDRA 3I5MA 4MDYA 4MRRA 3L07A 5H3CA 3VHQA 2IPLA 5HF8A 3WP1B 1P72A 4IXNA 4WY8A 1FTQA 2NYAA 5HYVA 1XMXA 1UDXA 4DREA 4F4JA 2CSXA 4WLOA 5BW8A 3ISJA 5BWOA 1CF9A 1UC8A 4PINA 4E30A 2NW6A 1XRRA 2VZ8A 5C34B 4AN4A 4M1WA 4I55B 4CDGA 2OAP1 1CIVA 3JQ8B 3L5KA 3URMA 1Q0RA 1YL5A 2R48A 1LQ2A 2QG6A 4G5SA 1PR2A 2WM8A 2F9LA 3ZV4A 1GADO 3SHWA 2JKZA 1CJSA 2JI7A 1QH8A 3DC2A 3SEAA 1K8YB 1A5AB 4HFMA 3O8CA 5GV8A 3LGSA 4AF8A 4YJHB 2CXXA 2XYPA 3VZSA 3UCXA 3SU8A 2RGAA 5K0FA 2YOGA 1XAIA 4AKGA 3IVRA 3CB2A 3O3OB 2X0DA 1DXOA 1NNSA 1AXEA 1U7WA 5ESDA 5L9AA 1Q0QA 1YU6A 3LT0A 1VL0A 1MJGM 4D56A 3HCOA 3VU3A 1XRSB 4J0QA 2PMEA 1CVRA 1CY6A 4L22A 3P9RA 3NHFA 2YNMA 1QHFA 3OH8A 3N8HA 3UWDA 3QFFA 4JJGA 5B3LA 5K6TA 5KYYA 3TD2A 1SU7A 3V1KA 3RARA 2RHHA 2YYAA 4OHKA 4RZSA 3JQFA 3TB6A 1YB2A 3WLPA 1ZK1A 4B87A 2DSTA 5AW3A 2DX7A 1PQ4A 2ZRJA 5C1OA 3L1IA 1QGZA 1JFFA 2DCUA 3V1MA 1IXSB 2VK4A 3F6BX 5CDTA 2O2YA 3O0TA 4UM7A 3CLTC 3KX2A 4HP8A 5ALSA 3S2IA 3BD9A 4M76B 1C1XB 2C4UA 1MH9A 2WIAA 3EYWA 5IF9A 3SN6A 3U19A 1ULHA 3W3AA 4RIGA 4QJ5A 1RYYA 1SZCA 3TLJA 1ISGA 3D8TA 3VR0A 2WSMA 2XDYA 4NR0A 2FF5A 4HFNA 5TB5A 3VU9A 3WV5A 5FA8A 4XB1A 5IZ4A 2QAIA 4YLGA 1HORA 3OP1A 3PTAA 1IXKA 1LWNA 2SCUA 1ZRNA 3ZDFA 4BNVA 1YB6A 4OP2A 2HBQA 4QEKA 5FUYA 3AHDA 2Y0PA 4G0VA 1T13A 1C8BA 2YJNA 5T5QA 1Y3CE 3HJHA 4FGZA 4LRXA 2GA8A 4MVYA 1QM5A 4N3GA 4F3NA 3NFYA 4QXOA 4QBGB 2HPHA 2JZNA 2Z9CA 5YASA 3TZKA 1SHKA 5CT9A 3NBKA 3TG2A 4FINA 1WY7A 1L6RA 1XNJA 2H85A 3B1YA 3M3HA 3RSZA 3E3NA 1NQ5A 3NBXX 1AU9A 1LRKA 1R9GA 5AJYA 4ZCSA 2CUKA 4EENA 2EDCA 2D59A 4KPGA 4E15A 5H9WA 1EIWA 3NWOA 1P6QA 3VSCA 3UWSA 2B7BA 4HS4A 1Z8FA 5IDVA 3VSBA 4DTIA 2QQFA 2DJIA 3NDIA 3PK0A 2G9QA 2R751 2RG7A 3LNCA 1IM5A 1JDTA 2JD2A 2W90A 4H3KB 2NSYA 3N0RA 1Z16A 1CJMA 2VJDA 2FFAA 3M0EA 3DZBA 1Z0AA 5KWJA 4BNKA 4E70A 5FAKA 2GF0A 3PQ6A 4NNJA 4YP5A 2Q9CA 5EUCA 1ZD8A 3H99A 3LMKA 4WEOA 1WVMA 2P90A 3GNLA 4Y2QA 1LBTA 5JECA 1D7OA 4LDJA 1R0SA 3GBSA 3L3BA 1WDTA 4JEHA 3W4KA 3DBLA 4X20B 4C4XA 5IX8A 4H6PA 4JLMA 2DU8A 3X1YA 3G1UA 2GETA 1IE3A 4LF4B 4F9EA 4UHJA 4HN2A 1TADA 4X9XA 1GFIA 4P9NA 3TECE 2SKDA 1Y8QB 2Q41A 4JT2A 4JN6B 4RW0A 3WDSA 1WDKA 4JJFA 2RKOA 2Y2UA 2AQHA 1RTKA 4UHDA 1VM6A 3FMVA 1MB4A 3FSGD 3T8YA 5JJCA 1QANA 4R7GA 2C9DA 2CMKA 2DTDA 3U9TA 1KY3A 2B61A 4KYIB 1YR8A 1JQ5A 4LX0A 5AI0A 1V11A 5DBHX 3GLHA 3O8NA 3TTTA 4NJMA 3PJEA 4PTLA 4KRYA 4QUAA 3QU2A 3NP9A 4LHVA 3I5UA 3R0VA 3VR5A 3QQ5A