1N5IA

Crystal structure of inactive mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp) at ph 4.6 (resolution 1.85 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 85
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5iA00
3SBDA 2KE5A 3QPVA 5G53C 4GRAA 4D80A 3LWNA 1JR6A 2ZI7A 2QTHA 2ZRBA 1P73A 4B2IA 1Z6YA 2F1RA 4L16A 4QC2A 3J81k 2VSOA 3W6PA 2WTUA 3KZ1E 1CXZA 3SHWA 1ZCAA 3U6KA 1LS1A 4RCYA 4BUJA 4TQAA 3OEHD 2N42A 1RYHA 1OH5A 1ZD9A 3KKQA 5CJ2A 1X1SA 4KYIB 1E9AA 4RZXA 2HT1A 5CYPA 3FB4A 1UBEA 2FSHA 4V0ME 1M1YE 4EUNA 1P4SA 1AK2A 2BM1A 4JLPA 3QNUA 2PCLA 4AG6A 5EP4A 1IQPA 2IYQA 1KO8A 4BRWA 4ZIRA 4JZKA 1GG2A 4BFTA 2GAAA 2ZR9A 2QGNA 4S35A 1TUEA 2EU8A 1TF7A 2QY9A 4TT3A 4NBSA 2P6NA 2NPIA 1NIJA 4B32A 4KHZA 4RZ3A 5JI2E 2IUUA 4LPKA 1M7HA 3BFVA 1D5CA 4HAUA 3Q85A 5IHPA 4HLUA 4RKFA 3SN6A 3Q5DA 2DHRA 1Y3AA 3AP1A 3RNLA 5KYKA 3SQWA 4CEHB 1VHLA 2J0UA 3CZQA 5AWFC 4G1UC 2C78A 1N6LA 5AUQA 4XTRA 3T1TA 5HZKA 2RGBA 3FMOB 4FXPA 4QHSA 4DHEA 1OF1A 3KTAA 3KKNA 3GQBA 3GLIA 4D0GA 3H84A 3AVVA 2ZI9A 3SR0A 4E09A 4KLZA 221PA 3GCGA 2GWHA 4L15A 2Q3MA 4OQMA 1T3SA 3QIAA 4A36A 2K5UA 4GL2A 2FH5B 3UPUA 4UNNA 1OYWA 2DBYA 2FE4A 2YWGA 4MA4A 2GCOA 5LD2C 3QG5A 3I4LA 5ELXA 3KB2A 5KSZA 2C04A 1H8HD 4ESVA 1DAKA 3QENA 4DEXA 2QAJA 2NOAA 4F91B 1TQDA 1EFHA 1N6PA 4OYHA 1FZQA 4L4UA 1UBGA 5JEEA 2GILA 1XBTA 4LK2A 1LFDB 4R9UC 1KK2A 2BJVA 2F9MA 1TPZA 3UG6A 1W7AA 4EJSB 2ZJYA 3LA6A 2CCKA 3DMDA 3W34A 4O25A 3TR0A 4EPVA 2WSSA 4B3GA 3GLHA 4RZUA 1X8KA 2D7DA 4TYYA 3KQNA 3CO5A 4MUBA 1JQLB 4LJ9A 3TR5A 3E70C 2HJVA 3V4FA 3DM9B 3V4RA 3PJRA 4CGZA 2ORWA 2J7PD 5AJXA 2ZE5A 2VRWA 5SZHB 1AGRA 2UZIR 1N5IA 1PUIA 5EXSA 4C9BA 2NO9A 4OHZA 1U2RA 4UNSA 3K70B 5L3QA 3QEOA 5B64A 1BMFA 3AVUA 1KYIA 3U60B 2C98A 2A5DA 3CWQA 4AC9A 2J46A 2XZLA 2SHKA 3U3MA 3SJBA 1O3YA 4URWR 1CR0A 4IEIA 5FOTA 4TN1A 1KMHB 2F7SA 2PBRA 3TLXA 2XXAB 1OXVA 1JBKA 2HDNB 2CNWA 2GHIA 3GD7A 1OPXA 1CJMA 5GJVC 2H18A 2YWEA 3UIEA 2VHQA 5C4GB 2W2TA 2FEOA 1N6IA 3MWLA 4OI2A 2ZU6A 2RB4A 4QKQA 3PEUA 3T5DA 4E03A 3VKWA 4HZUB 4BECA 3TKLA 1YR6A 1NNEA 4TMXA 1HH4A 1KJZA 5EUQB 2ZJOA 3QXHA 4HAWA 4IFEA 1Q1EA 4URXR 1L8QA 4JLAA 4TMKA 4C0HA 2R6DA 4FN5A 4BEJA 3GJ7A 5EE3A 1A82A 1FX0A 1U9IA 2BCGY 2ZRAA 1Z2AA 3EXAA 3Q7QA 5CIQA 1GIAA 1W47A 1M7GA 4WXPA 3FHOA 1LY1A 1MABA 1DG3A 5KDOA 2YC4C 4KV9A 4QOSA 4CRWB 2IYZA 2XTZA 4NCKA 1G8HA 3C8UA 3KXLA 2FOLA 3EC2A 1XCMA 2AFHE 5DN6A 2V4ZA 3DZDA 4RJLA 2G1KA 2XSZA 2GK6A 2JLXA 3SYLA 4AK9A 1JAHA 1R4AA 2HUPA 5FOVA 3ND9A 1Z8FA 2R6FA 2ZVPX 3QSYA 1GAJA 4LCBA 1GILA 1NBMD 4EDHA 4XWAA 1G3MA 3NVAA 4PPNA 1T91A 3SZRA 3QOFA 1AKYA 2DFNA 4QHTA 3LXRA 3BBPA 4G0NA 4C0LA 4LRWA 3WRYC 4DLUA 2CCJA 5J4LA 2NZ8A 3DM5A 1FNNA 3RDPA 2WV9A 3JVVA 5E7IA 4A92A 4XWOA 2IEZA 3T15A 5CDFE 2GEVA 2IYRA 1XZPA 1MT0A 4DSUA 5DH9A 4DVGA 2ZI5A 2PZEA 1ZD8A 1VDZA 4JVLA 4PTLA 5FTMA 2RKOA 4LC1A 4BFYA 4C0QC 3I62A 2VHJA 5CK5A 1P60A 3W5IA 1U0JA 2G83A 2A3RA 3PEYA 4KBGA 4PHGA 1UDXA 3I8SA 5DNYB 1QBKC 3AVTA 2YVUA 2WKQA 4MKIA 1TUIA 2ZRIA 1QHHA 4Q18A 4QRHA 4Z8XA 2BMDA 1HURA 2IYUA 1Q0UA 4NYIR 2ZYWX 1HV8A 4X8OA 4EPWA 4DEYA 1G4AE 1PZNA 2YINC 4X8MA 5EE5B 3WYGA 4JJKA 4KI0A 2QMUA 3CNLA 5FOUA 5B30A 1BKDR 4HUTA 4B3FX 1HEIA 2OBLA 4C0SA 2AWNA 4GPTA 2C95A 4Q4LA 1Z3IX 1IONA 1P3JA 2CE2X 2RGNA 4JLKA 4DZZA 2QT0A 2Q9BA 2ODBA 1L4YA 2QRNA 1OXXK 4OHWA 3GLIE 5EZ5A 2XXAA 3FOZA 1K5GA 4YMTA 2Z4RA 2QP9X 3AB3A 4YQFA 4A0RA 1E96A 1QZXA 1NVXQ 1P2VA 1BYIA 3SNHA 1NVWQ 5LBIA 3AKCA 2WVJA 4UXHA 1JJVA 2F43A 4ZPXA 2CK3D 3EA5A 4NCJA 3AVQA 5CM8B 3GLFA 4FINA 3AVWA 1G5TA 2HV8A 1IJEA 1E2FA 2LKDA 1ZUHA 4G3XA 4OJQA 2HCJB 1U8AA 2VHCA 1HQYE 2P5SA 3AUYA 4RKEA 1FW6A 2YWFA 4P0TA 1QF9A 3N2IA 3HDTA 3RS2A 3EPLA 2ZYUX 2WKRA 1VG8A 1NP6A 1FTNA 4ZDJA 3WY9A 1T4GA 1TEXA 3TUZC 5J4YA 2Z0MA 1IM2A 2RCNA 2IS2A 1IY1A 2JIZA 1VCNA 4KBFA 3EWAA 4ZCLA 1FNMA 3BB4A 2OAQ1 1ZJ6A 3EX7C 1KO4A 2AL7A 3C16C 1JNYA 3EPHA 2IS4A 3ECCA 4JVNA 5GADl 1KJYA 3NDPA 2GJKA 3DMNA 1SVOA 4BQSA 1J2JA 4WA7A 2P5TB 2PZGA 4NL4H 4YLGA 3VU9A 1OH6A 4NCHA 4NE2A 1DE0A 1RRGA 1M8PA 3TSOA 1IY2A 2DCUA 3GFTA 4M8NE 4G5QA 4M2LA 2OZEA 1XTIA 1TL7C 1Y63A 4B2LA 5C4MA 4DCTA 2JA1A 1Q3TA 3DOFA 4TTPA 3ZGXA 2QL6A 4DB2A 2X2EA 1AQUA 1E1RD 1OLOA 2OILA 4PSVA 4QL3A 3O47A 2IWHA 2IYSA 1F5NA 3OEED 3FFBA 3BOSA 4Q1BA 3R8FA 2QMHA 3P26A 1W4CA 3RHFA 4MYCA 5EXTA 3GJ0A 3FGNA 1QVRA 1SGWA 4TSFD 1SKQA 3F5FA 2QBYB 4PFSA 3GEEA 5KU1A 1D9XA 2IXEA 1XRJA 5D3MB 2CDNA 3GFOA 1EFUA 3AP2A 2VSXA 4M53A 2IYTA 3IDQA 3I61A 3TH5A 3L0SA 2AN9A 3OFND 5EXXA 2X77A 4OHVA 4C2TA 3QEJA 4CZ2A 3FMPB 2VF7A 2P3SA 5SZKB 3K9HA 4OQXA 5GJBA 3B7GA 4YC7A 1XTSA 1KSJA 3O8CA 2OO7A 2HXYA 2A5YB 1E2GA 1NIPA 1TX4B 4EPRA 4D82A 1QHGA 1Z47A 2OFOA 1Q20A 4PQFA 1UFQA 4X8LA 2O8FA 2OHFA 1T8UA 2QENA 4WW0A 3TW4A 1XDBA 4M22A 4XVQA 3I72A 3NIBA 1QG2A 1RKBA 4JS0A 4RY2A 4TMZA 1Z63A 4ZKDA 1OB5A 5H1YA 1WB9A 1XXHA 1VG1A 3GJ5A 3ZQ6A 4D81A 3LX5A 4Q9IA 4II7A 4KVGA 4F4IA 3ZH9B 1KI6B 5DN6D 5C2JB 4TMTA 4R71A 1G17A 1U9IC 3UMFA 3LNCA 4IW3B 4NONA 2PZFA 2V7QA 4BFSA 4CW7A 1VIAA 5CK4A 1VTKA 3KJHA 2W2VA 1CP2A 1QVAA 1WP9A 3QE0A 1T9HA 3G82C 4K8OA 2KBFA 5JHHB 1XTJA 1U8ZA 4KJZA 2YOHA 2EFEB 3P27A 4H1VA 1W1WA 2WM9B 5CJPA 1D2EA 2BBOA 1N6RA 5C18A 2F1IA 2I1QA 2QBYA 1RYFA 2QE7A 1YU9A 4C0JA 3CRMA 2RHDA 3U44B 3R9WA 4HI0E 1R7RA 1AN0A 3CLVA 2V55B 4L9SA 1IN7A 1YRBA 1OW3B 5H70A 2RHMA 1KO1A 1O87A 3OE7A 1GOTA 2D2FA 3U3RA 8OHMA 3T06B 3QKRA 4P33A 1KK1A 1G8FA 1OSNA 3C7KA 1DAHA 4PAQA 1Z06A 1SXJD 5FBLB 2E87A 4ZDKA 2EW1A 4EJSC 1DS6A 1NKTA 1KK3A 1T0JB 2ZSAA 1X8JA 3U7FB 2N1BA 2HXSA 3BB1A 4JYBA 1G3QA 4Q9JA 4Q48A 2MMCA 2LKCA 5AJZA 5IT5A 5DHAA 3OE7D 4DRZA 1E2JA 1KI3A 4MRVA 3R9XA 4O0MA 4LUCA 1C1YA 1DAGA 5DIFA 1E69A 2NQ2C 3BFKA 1W0KD 1YKSA 1G7RA 2FX3A 4JT4A 4RCZA 3B60A 2GA8A 1ZC4A 5L3QB 3WHLA 4TQ9A 5AR1A 3IIKA 2QP3A 1HTWA 5L8VA 5A4JA 4HATA 2IYVA 4PAMA 1A2KC 3SFZA 3HR8A 2VYFA 4DDTA 1X8LA 3R7WB 3TRFA 1E2HA 4A15A 1XXHE 3SYKA 2V7QD 2KB0A 2JLWA 2CJWB 2OXRA 3DKPA 3L0OA 4LJ7A 4B3DA 2BKEA 3NKVA 2ATXA 3Q3JB 2Q0HA 5FPYA 4XOIA 1VECA 3EASA 4KSBA 4QBHA 3W3ZB 3LO5A 4EFMA 3K0FB 1P6XA 3CR7A 4JLJA 2WZQA 4GOJA 1G18A 1GRNA 2W58A 1N2CE 3WYFA 1QHSA 4A2QA 5DISB 3S1AB 3TAUA 1E9EA 3WNBA 1NRJB 1G4UR 3ETLA 2GCOB 3CRVA 3ZVRA 4OQFA 3KQHA 3LBNA 1W2HA 3VX4A 4WZBE 2WSMA 2QROA 4AWXA 3EPJA 5FUXA 3W5JA 1E2IA 2Q3HA 1II0A 1SXJA 2IF2A 4GMXA 4Q7MB 3LAWA 1W5TA 1Q1ZA 4UKDA 4FMDF 1UF9A 3CONA 1XCGB 3KFXA 3GJXC 5KDLA 3HJNA 1IAQA 1U8YA 4YMWA 5KSYA 1XPOA 1Z08A 5F2EA 4JVSB 1IOZA 3BGWA 4EFLA 1IXRC 2B7BA 1E0KA 3GEHA 3PUYA 5DHFA 2FFAA 2FSFA 2F6RA 2IL1A 1ZM9A 2E1RA 2WJYA 4Q4AB 5L3RA 1SKYE 5H8WA 2QRZA 4FCVA 2ZIAA 5CLQA 2XTMA 4DC9A 4LJYA 4LBZA 2A5JA 2ZJBA 1OIVA 2ZAOA 4DWJA 4OHYA 4BZXA 3GJ6A 1Z83A 1N5LA 4TLDA 5G41A 1E0JA 1K6MA 2FJUA 4ERNA 1RVDA 4IDQA 1XX6A 4MKGA 1G20E 4AURA 1V43A 2P2LA 4QGAA 2PJZA 1NF3A 2D3WA 2ZYVX 2PT7A 3BB3A 3QXSA 2D06A 2O0HA 3GLGA 1P7CA 5KTYA 1EFTA 4LYAA 5DO9A 4ZIRB 1OXSC 2J5XA 1OB2A 2OLKA 3ADDA 4OKSA 2FZ4A 4ZO4A 2IX3A 4YMUA 2EWVA 5F9HA 1S9DA 1ZM4A 2CL6X 1DO2A 3CPJB 2W6IA 4OQLA 4UQOA 3VKHA 4HLQB 3TVDA 2A78A 5J4VA 3VAAA 2P6UA 4DIEA 1HT2E 1MO6A 2OXCA 2VP4A 1RRPA 1KDPA 4D4KA 2J41A 2F1JA 2WJIA 2J7KA 3D3QA 1HUQA 4IDOA 1R5NA 4YONB 3B85A 2A2ZA 2F1HA 1II8B 2ZPTX 2GJSA 3BH0A 1KHTA 2FPKA 1CF4A 4HB3A 3LX8A 4C0AC 1NLFA 1SVKA 4DLWA 4QGGA 1GNRA 5AJVB 4V0OA 2P0EA 4TLCA 1G3UA 421PA 4TSFA 4EPTA 5HKKA 1GRRA 2RGAA 2FFHA 2ZJ2A 5DI9A 5FTNA 3FFAA 2BBWA 2IXFA 1W36D 1N25A 2JCSA 4PC3A 2FG5A 4XSHA 3SI7A 4D4JA 2YOFA 3C4JA 4KITB 3GLGB 1Q12A 3LLMA 1FX0B 4I4LA 5IDVA 3TSZA 1OXUA 2UZ3A 1VYUA 2NZJA 1COWA 2RGDA 3X1XA 4AI6A 2ZUBA 4DDVA 4IFBA 4TL7A 4IXMA 1PJRA 4JSYA 1NVVR 3CNOA 1EWQA 4WZ6A 3BERA 2F9LA 4KXFB 3IO3A 1T5LA 3LLUA 2GTPA 2OCPA 1N5JA 4JBYA 5DGXA 1G3RA 1KZGB 1QRAA 1XF9A 2OLJA 5JECA 4Y0VA 4UXIA 3HPQA 2Q9AA 3FVQA 3K0AA 1GSIA 4LJ8A 2WWHA 3L8YA 1J70A 4PPFA 5FL3A 2ZJ8A 1TMKA 3AQ4A 4MRSA 1P9NA 4DCNA 2LWIA 3TQCA 1W2GA 3NXSA 1COWD 4DIDA 3SJZA 5JRJA 1D8TA 3SYNA 1LV7A 1SHKA 2OUKA 3AVYA 2DWPA 3CM0A 4KLNA 3AKEA 4PHTA 4DLSA 3RS0A 1CRPA 1DG1G 1TAGA 3EAQA 2VBCA 2WPDD 4HAXA 3CR8A 2Z83A 1RZ3A 3IBYA 1AS0A 4Q4JA 4P4TA 2GVZC 4TYPA 3K0CA 4YMSA 1N0UA 2IUTA 1NG9A 4BFZA 5FUWA 1WCV1 4CF7A 1VG9B 2CEAA 1A4RA 1MKYA 2JAQA 3CZPA 3Q7PA 4Q01A 5FBWB 5JEDA 1MRSA 2IS6A 5FOXA 1LF0A 3THOA 2A5FA 1XU4A 4TMVA 4ESHA 2ZU0C 2IEYA 3TE6A 1J8YF 2CHGA 3AP3A 3Q72A 5JSZB 3ASYA 4RFSA 2JEOA 2W6ID 5JRZA 4XVRA 4LJAA 4MITA 1M6NA 1D2MA 2WHXA 5HPYB 4QHYA 3VQTA 2J1LA 2RAPA 5A5GA 2F3TA 5J40A 1JECA 4JSTA 5EE1A 1P9RA 2XSZD 2VP0A 1TNDA 2QT1A 3CIOA 4CYMA 3PUZA 3QF4B 2J3EA 2XNSA 4V0MA 2O8EB 3E5HA 2DFTA 2AFIE 4XD7D 2HYIC 2ZRHA 3EZ7A 4B33A 2RGCA 4FWIB 3WP1B 3QBTA 3TBKA 3C41J 5B58C 2RGNC 3CX6A 1R8QA 3O8RA 1YZQA 3MD0A 2XOKA 2ZRFA 2JJ8A 621PA 2DYKA 3L43A 4TMWA 1DADA 1QHYA 2VTKA 2ZJZA 4M1KA 2XNDD 1CEEA 3KJGA 4B71A 4ZDWA 4AKGA 2AX4A 3IILA 3I92A 1R0YA 3QBVA 2C9CA 1P75A 4URVR 4QG7A 4DLRA 2VLIA 1OH7A 3P4YA 2CHQA 3LH5A 4Q03A 2IS1A 1EK0A 2VQSA 3MG9A 2OE2A 3DO6A 2XGJA 4DLTA 4D25A 3TIFA 4PHFA 4MDEA 1B0UA 3ZS9A 2QEQA 5HE8A 4AYTA 1F3OA 4HAVA 1G7CA 2XJ9A 1OIWA 1ESMA 1KI6A 3BH6A 3P4XA 4KFRA 4NCIA 1IXZA 1RE0A 1AS3A 1RW4A 3CH4B 3QI2A 2ZS8A 4AY2A 2H57A 3QKTA 4YDSA 3QG1A 3CRRA 2IYWA 1FFHA 1WA5A 3IO5A 5E7MA 1R5OA 1R6BX 1E0SA 1WMSA 5FL7D 4NYIQ 4D26A 1SVLA 1OFUX 1NN1A 3A4LA 1KI4A 3K9NA 1MH1A 1XJQA 4MRNA 4B47A 3MRSA 1RJ9B 4KVAA 4Q00A 4MYHA 2RGEA 4B3CA 4PXAA 1IHUA 1GP2A 1H8ED 4GFDA 5CYOA 1G8GA 2WMOB 3LBHA 4B73A 3KKMA 1AIPA 3KUDA 1KSGA 3ZVMA 4B74A 3AF1A 1SVSA 3EW9A 2OV2A 6Q21A 1MABB 1NMZA 4R2HA 3ZS8A 2NMVA 2BMEA 3GLIB 1E99A 2WBLC 2DFLA 3C14C 3KL4A 4BEBA 4LBYA 821PA 1HE1C 1NJGA 4N0DA 4Z8YA 4W5HA 3EC1A 3WP0A 2QM8A 3RRYA 1XPRA 2AKAB 4JLBA 4L8GA 1DO0A 2BV3A 2R2AA 3AKYA 1SXJE 4PC1A 4RD6A 1CJUC 3RWMB 1E9SA 3FMIA 4DDUA 4F93B 3IHLA 4PZZA 2B92A 4IOMA 4LYFA 1YHNA 4PC6A 3K0EA 4XIGS 2ZYTX 3BD9A 1KO5A 2I1VB 3EZ2A 3VR5A 5AK0A 4EQ6B 5F9FA 1DARA 1Z6XA 3LBIA 1GKYA 1SVWA 4LSGA 4UXJA 4Q7LA 1CR2A 4WXRA 1KKLA 4TTRA 3LY5A 1NN5A 4B34A 3K9LA 4NYJQ 5TMPA 3TGPA 3REGA 1GL6A 1ZYUA 4JL5A 1ZM2A 4A0FA 5FBQB 3P20A 2CLDX 2YYZA 2Z6VA 4LHWA 1S1MA 4LV5B 4DLVA 2QE7D 1W4BA 3QXJA 1US8A 1BS1A 5CITA 4B35A 3D7MA 4FMBB 2OFWA 1S4QA 1UADA 1OXTA 2EFDB 5CB6A 4D2IA 2J7PA 1QDEA 4C30A 1HQCA 4LZZA 3MAAC 3TJZA 3AGQA 5JI3E 1U81A 2BEJA 2O8EA 1KOFA 2Y8EA 2ZE8A 1N6OA 4GBMA 1GM5A 2D62A 4G5OA 5JLJA 3VKGA 3A58B 4E5UA 1SHZA 3HU2A 5E95A 1DAEA 1UKEA 1T3HA 1DPFA 3OF5A 2B21A 3QXCA 2OCYC 2WSSD 4JBWA 1NMYA 2VHUA 1P2SA 2BJWA 4TT3D 4EFNA 2ZSFA 3K8YA 3VMFA 4CT4B 1T0HB 4E07A 1OIXA 3RABA 4A82A 1W0KA 1MV5A 4KO8A 3KX2A 2ORIA 4XSGA 4EJSA 1XEWX 1R2QA 3AKDA 2R6AA 2O0KA 3BIFA 2YC2C 3GJ4A 5JZVA 4R2IA 1NMXA 1XMJA 2BKUA 2QZ4A 1IN8A 1YZKA 4TL6A 3SEAA 2O8DB 2C03A 3EZ9A 1W44A 2YNMA 4I1OA 1W4AA 1G41A 1ZM7A 5LDDC 1VCIA 2VH5R 3RC8A 4QJ3A 2YWHA 1KGDA 2YKGA 4US0R 5JWRA 3U3OA 4BFUA 2QTFA 4MGZR 4C0BA 2QPTA 3MJRA 2XB2A 2J0VA 4JIMA 3NWJA 2C8VA 2R65A 2Z43A 2CL7X 4B2PA 1QHHB 4PPQA 1LS6A 3KTAB 5IF9A 3DPUA 4CEIA 3M4YA 1HE8B 3ND8A 1L4UA 1Q21A 1T8TA 1EX7A 2OAP1 2FMXA 4LOAA 1U94A 2B8TA 5CM9C 3EG5A 5FUYA 4DSNA 3OEEA 1H65A 1YJ5A 5TVKA 3THYB 2VHTA 1T3LA 1FUKA 4YMVA 1KSHA 1XD2A 1G19A 3IPYA 1TF5A 1UKZA 3IHWA 3P1JA 2V6IA 4XVUA 1SZPA 1XCPA 4FWTA 4PQYA 1ELOA 2H92A 2WIBA 3CPHA 3CF2A 1YZNA 4O2LA 3ZQJA 5B2ZA 4ZI3A 2VIIA 1I2MA 4F4CA 1Z0KA 2NO1A 4EPXA 4ASUA 4US2R 3FE2A 2FU5C 1KY2A 2REBA 2VEDA 4HYYA 4M9SA 4IDPA 2FSGA 1HY3A 1CBUA 3W8RA 4YDHB 4LJ6A 1E2MA 1EGAA 3GEIA 3IQXA 4TLBA 1KIMA 5LB2A 4BLSA 1UBFA 1RRFA 2D4HA 4FD2A 4EAQA 1ZC3A 3M1IA 2ZI6A 1IN4A 3LXXA 1U99A 4QJ5A 2V8OA 2GK7A 1KNQA 5JJLA 3SBEA 4GT1A 1BYUA 2ZRLA 2ECKA 3I3SR 2XX3A 3Q8XB 1AJEA 1GKUB 2FWRA 3BH7A 2PT5A 4KODA 2WMNB 3OFNA 2ZR7A 3TUJC 2IHBA 3CRW1 3LW7A 4PHHA 3DEFA 4HDQB 2HCBA 4HEJA 4A0GA 3THXA 4JKIA 3LFUA 2J0QA 2IUSA 3IBGA 1P9WA 4PO8A 3U7HB 4MH0R 3ICEA 3PR1A 2Q21A 3NDBB 2XNDA 2IT1A 4TLEA 4A6PA 2C9YA 4P4SB 5E3HA 2W0SA 3NEYA 3T1VA 5GVSA 3RVBA 1KZ7B 2YHSA 5TV2A 1LW7A 3HU3A 1VYVA 2D2EA 2NGRA 2OBMA 3QQ5A 4GDFA 3B5JA 1E9RA 1Z6GA 3CX7A 1NSTA 4O2RA 3EARA 3MLEA 5H68A 2GXSA 3IIJA 1Z0FA 4AIIA 1UM8A 2ZRMA 5D3MA 3CRQA 3UANA 4BGDA 1YZLA 1ZRHA 2OCAA 1IN6A 3F0TA 3NH6A 3RYTC 4DCSA 2ONJA 3ADCA 2H8KA 3CNNA 4UJ5A 3KXKA 2ZJAA 4XH9B 3U61B 4KAXA 2CLSA 3KQKA 1XEXA 4JVMA 2V3CC 1E9BA 3R20A 1QHXA 5KPDA 4V03A 3LVQE 2A7QA 1JPJA 1CULC 1ZNWA 4FMDB 4NYJR 4BLOA 5EJEA 1OT3A 3MUFA 4KYUA 3FPAA 4HLCA 1S9HA 2ZS7A 3ZYCA 4KU4A 1CJVC 1ZINA 2ONKA 5EUMA 4ZCMA 5FI0B 2QNRA 121PA 4ZI2A 5JCZA 3B9PA 3REFA 1Z2CA 2W83A 3N2EA 4P32A 1CLUA 2CK3A 2VP9A 1ETUA 2A9KA 3X1YA 4DB4A 3U2QA 4Q4HB 3THWA 2CL0X 3KQUA 4JL6A 2WPDA 2WWFA 3MWYW 2FPLA 3LDAA 2R62A 2IW3A 3W6OA 1SQ5A 4IXNA 2ZSBA 2J59A 3VNVA 4FI3C 1NVUQ 2VPPA 5EP3A 4G5GA 4A8JC 3Q5EA 4DT1B 3K1JA 5KSPA 5KNDA 3R9IA 5CIWA 3V00A 3TAHA 2QAGA 3Q9LA 1U98A 3OIVA 5KNBA 1OV4A 4Q1AA 1EXMA 1SXJC 1ANKA 1TEVA 2DFKB 3H2YA 2DB3A 2ZRDA 3UATA 2ERYA 5FR1A 3VHLB 4C2UA 3QXXA 3VR4A 3WYAA 2ZUDA 1QHIA 5DLQC 3SQXA 4ACBA 3L2OB 4MRRA 4PX9A 5G40A 1U90A 1J90A 4K46A 1TU4A 3N5CA 4LJ4A 2G9NA 1E32A 2BCJQ 4ZCIA 1UDWA 1FOEB 5P21A 4GOXA 1CJKC 4RD4A 5FBRB 4F38A 4Q7KA 1XPUA 5JMTA 2FPMA 2NO7A 1W49A 4NH0A 2OG2A 3M0EA 3N70A 1XEXB 2BDTA 1EESA 2Q9CA 1G1MA 4NYMR 1KDTA 2P67A 3EIEA 3KUCA 1E2QA 1E9CA 2QSZA 3I32A 2QSYA 1S96A 2J0UB 3PFIA 2DWQA 4IDHA 3KJEA 4V0NA 4B44A 5CDFA 1MO5A 4LDJA 5K8TA 2EYQA 2GXQA 1D6JA 3IIMA 3MGCA 4Q9KA 4B6FA 2ZM5A 3BAFA 5JBQA 4KFSA 1AZTA 2IA5A 2CMKA 3FKQA 1JAIA 3A1VA 3OZXA 3WMGA 5D3QA 1AZSC 4QM7A 5HE9A 3A1SA 3C5HA 2OM2A 3GLFB 2BIFA 5FI1B 2O0JA 3A4NA 3GLHB 4D6PA 1LF5A 3QKUA 3UWKA 4EKDA 3NBXX 1Z0JA 1NG1A 3PUXA 1M7BA 3AVOA 5JWOA 2GCNA 2XZOA 2FEMA 1X1RA 4IEEA 4C7OA 2V1XA 1F6BA 4BE7B 1KJWA 3X1ZA 3U7EB 4N1AA 3FKSA 5BXQC 5HCIA 3W8NA 4M9ZA 4BZQA 4B48A 1NI3A 3V9PA 3BE4A 1FMJA 2BWJA 3QKSB 5E7JA 1NL3A 3TK1A 5JS8A 3B1YA 3RC3A 3EPKA 1Z6TA 2NIPA 3UXMA 4WAUA 2D74A 3ZZ0A 1P5ZB 2KSQA 1DAIA 1FPMA 2E9SA 4U02A 1G16A 4IOLA 4Z1MA 1FP6A 3TNFA 4URUR 3D6TB 1GRQA 3D8BA 1I4LD 1G6OA 4FW9A 4M9QA 1Z29A 3WMFA 2IYLD 4OBEA 1M34E 1US8B 4KFTA 1F48A 1NN3A 1OH8A 1XEWY 1Q57A 2UVQA 4LHYA 4U7DA 5TXGA 2PLRA 3K70C 4BFXA 1IY0A 2ZJ5A 1JR3A 2YJTD 4Z54A 1DAMA 1LVGA 3VR6A 4GNKA 4U00A 1JXOA 4OI1A 4L5BA 2ZRGA 3UMRA 2GVDC 2ANBA 1I2DA 2FA9A 4MGIR 2JLSA 2AD1A 2R6GA 1U0HC 1F2TA 1MR3F 4IKEA 4CEJB 3U3JA 4MYTA 4G01B 4AYXA 5K8LA 2QG6A 1Q22A 1YZUA 2CLCX 4M0LA 2ZRNA 1XTQA 2BVNA 4DUGA 1D9ZA 1GITA 5L3VA 1G9XA 3RAPR 3GJ3A 4LPSA 4P4SA 3D31A 1FQKA 5EE0A 1ZCBA 2QN6A 3AF4A 3X1DA 2I4IA 2VA8A 1CR4A 1KAOA 3B8HA 3S1AA 2Q6TA 521PA 4YXWA 3ZIAD 3HYTA 2GXAA 3AVPA 2WJGA 2ZRCA 5AUPB 4TYQA 1CR1A 1KDOA 4LC0A 1JQJC 1DEKA 4HAZA 2OBNA 3NBYC 4AD8A 5JS7A 4GI7A 1A7JA 2G0NA 2PMDA 3T35A 3L8ZA 4JBXA 2AD5A 1JPNA 2V9PA 1JEEA 4D4LA 3A1TA 3I5YA 4IDNA 4WIAA 2PCJA 4CIDA 4DKXA 3BFXA 1RPZA 3VNUA 4F92B 2WJVA 3QUSA 4IVRA 1YZTA 4M1OA 3TQFA 3MMPA 4LJ5A 3PUVA 3DL0A 3VX3A 2AWOA 4Y0AA 3CF0A 1K8RA 4QNRA 1E94E 3FDIA 4B76A 3AGPA 3SHFA 1XTKA 1T5IA 3ZZTA 1XNJA 3OIUA 3K0CC 1W0JA 2FF7A 5EP1A 4RZ2A 1TQ2A 1XTRA 2JLQA 1Q1BA 4N3NA 1AQYA 5KDDA 5KHOC 1J8MF 4RFVA 1JXMA 3ADKA 4MGYR 2D7CA 2YOGA 3W9YA 5C46F 5UKDA 1LNZA 4XWKA 1E1RA 3QY0A 3SJAA 4A2PA 2FNAA 4NDZA 1E2EA 1SKYB 3KJIA 4I1VA 1ZM3A 1GFIA 2QMEA 3VR1A 2BMFA 3T12A 4Q5IA 4XD7A 2MSCB 1JB1A 1G7TA 2GJAA 1RRCA 2ANCA 3B2EA 4PR0A 1ZIOA 3DOEA 3IUYA 4AYWA 2C96A 2JATA 2CBZA 2O8DA 1XD8A 3EIHA 4DLYA 1IJFA 1GDDA 1NLZA 1R0XA 4AKEA 3QKSA 5KPJA 2BM0A 3FHTA 3B1VA 1XJCA 2GAOA 4OQNA 1QG4A 2FFBA 5FPSA 5TB5A 4DLZA 4WZAE 3BK7A 1ZUNB 4ABYA 3SFVA 5JSZA 3I5XA 1DBSA 1SULA 1P72A 4NKRA 1R10A 1ZBDA 4V0KA 1B23P 4I81A 2WWIA 1W48A 2IBMA 5JJIA 3LRPA 4F4JA 2AKYA 1PLJA 2H17A 1E1QD 2ZRKA 5KSOA 3W6NA 2GDJA 4HDOB 4RFSB 1RJ9A 1DOAA 4Q4JB 2QUZA 1UBCA 1ZU4A 1W5SA 5GVRA 3U4QA 5EE9A 3FYHA 1AS2A 2ERXA 1BH2A 1Q3HA 2FSIA 3CH5A 3CUEF 3W3AA 4CDGA 5BQ5A 1E3MA 3VR2A 3VFDA 2O8CB 3BC1A 2H7VA 3LV8A 3RS5A 4GP7A 2PEZA 1NN0A 4DUGD 2GZHA 3AH8A 5SZJA 1GUAA 1PLLA 2VL7A 4HB4A 4I1SA 5DI3A 1VKJA 1IN5A 3BORA 2ZQ5A 4W7SA 3HYRA 1WQ1R 3K70D 3KKPA 2WWXA 2FDCA 2ODEA 4TQUS 2KI5A 1PV4A 1G8PA 2G88A 3L0IB 3LVRE 3ZVLA 4I99A 3IEUA 4BZPA 3PCRB 4HAYA 4LHZA 4NPHA 1EWRA 1KDRA 1BIFA 1ZVQA 1FUUA 2HF8A 3OIWA 4G5SA 1XD9A 4DSOA 4PC7A 1E2LA 2OEPA 3CPEA 4PANA 2FGKA 3FHCB 4PZYA 3DZ8A 1FL9A 3ZDQA 3VR3A 3LD9A 2O8CA 4NTZA 4P4UA 4LYHA 3SC3A 4PZLA 4BLRA 1E2DA 3EIQA 2JASA 5FOSA 5ANRB 2A30A 2CVHA 3U44A 5L3SA 4B43A 1F60A 2YZ2A 4M1SA 1ZNYA 2FV8A 1CS4C 2JDIA 3U5ZB 1IBRA 1KAGA 2EFHB 2VP2A 2W00A 3KKOA 4PPGA 1N3BA 1UEIA 3P32A 4KCGA 3WNDA 4FIDA 5J4HA 1XMVA 2WWWA 3KXIA 3GLFE 2JJ1A 3K0FA 2X1VA 1II8A 3ZD6A 1Z5ZA 5DYIA 1G5PA 4DCUA 2ORVA 3X2SA 5FPKA 4M1WA 1E79A 2QORA 3LW8A 2QTVB 4GMDA 3AF3A 1NBMA 1AM4D 4JJZA 1E4YA 1UJ2A 2CJWA 2ZI3A 1M74A 2QPAA 1AKEA 2DR3A 3L0PA 4RD2A 5E4FA 4DBLC 1Z0AA 2ZRPA 2Z5FA 4WOPA 2AK3A 4QFMA 3JZAA 1W4RA 1XB2A 1YRAA 3TVTA 2KWIA 5DE3A 3U6BA 3E2IA 2GJ8A 3NEJA 1E79D 4Q21A 3QF7A 2ATVA 2GETA 4MKHA 2V6JA 2KJQA 2FFQA 1P62B 2ZR0A 2ZITA 2W0MA 3PUWA 4C0KA 2MMGA 5EXPA 5BN4A 4JMPA 3T1QA 1Z0DA 3A6PC 1NVVQ 1S0UA 3B9QA 5LD2B 3CBQA 4MRPA 1VCMA 3OIYA 1TU3A 2WKPA 1Q44A 2DWOA 4IHQA 1EFRA 2JJ2A 3DVLA 4A1FA 4IVPA 3AM1A 2CE7A 2BEKA 2WWGA 3KDSE 3GP8A 5HCNA 4TYNA 2W6JD 3BRWD 4QNMA 2JDID 3RSLA 1VHTA 1VMAA 3C15C 2FZLA 1R0WA 4GP6A 4B75A 1A5TA 3KFVA 2JLYA 2ZROA 4NYMQ 4Q7JB 4MDFA 1PLKA 4OK3A 2AK2A 1MO4A 3THYA 1ZP6A 2QQEA 5BN5A 4V0LA 3MWJA 1S3GA 4S2EA 4QGFA 4PO1A 3TUIC 3ZD7A 1SXJB 4JLOA 4EIWA 3NTUA 5HR5A 2R8RA 2PX0A 4FMCF 3ADBA 1XP8A 1EFCA 3U7GA 4JLVA 1G6HA 5EP2A 4OK5A 1ZD1A 2JLRA 1ZU5A 4Q9HA 1UKVY 2H1LA 3CF6R 1LTQA 4TYWA 1P2UA 4GZMA 3RS7A 2AR7A 4CVNA 2REXB 1M2OB 2REOA 2VO1A 3EZ6A 3UKDA 2OSBA 1WXQA 2G0TA 2QGZA 3A1UA 3UWOA 3C5CA 4X8HA 1KI1A 3U4QB 2EQBA 4KFUA 1X86B 5GJCA 4PAOA 5KUTA 4OI0A 1S1CA 3F3YA 3QJYA 1AA9A 5FOWA 4DDWA 1ZNXA 1E98A 2CCGA 2G3YA 1E9DA 1JR3E 4MGKR 3B6EA 3SJCA 1DTSA 4BWYA 1FTSA 2JJ1D 4Q9LA 3RS3A 4OJKA 5FTKA 2X19A 3HPRA 3LQRA 2QMOA 4M4SA 2PLFA 5BYKA 2IYYA 3PV0A 2ZEJA 3H0KA 3B1ZA 1W46A 4HDCA 5DYGA 4Q47A 1Z22A 4Q1FA 5F3WB 2WAXA 4TLAA 3PXGA 1KSFX 3FMFA 2B7CA 2HLDA 2O8FB 1ZW6A 2IHYA 1F2TB 2N46A 5BWMA 1OFIA 4A6XA 1E1QA 1OHHD 1RIFA 3B13B 4HLUC 2WOJA 4B6EA 2HT6A 2QU8A 4NMMA 1W36B 2ZE6A 4N0EA 4HLDA 4M1TA 5KOYA 4A0HA 3F8TA 1TADA 2ZS9A 3DDCA 2EYUA 2PMKA 3BS4A 4UNQA 4UNPA 1VYTA 3MFYA 4CEIB 4K81B 1ZMXA 4U5XA 3CW2A 1R5BA 4OK6A 1WF3A 3MJHA 3CB4A 2RGGA 4M21A 4HSEA 4ZKEA 4P31A 3MCAA 4UNRA 2GCPA 2P6RA 4LX0A 5JFGA 4ON9A 2O5VA 5KNCA 2ODWA 3SS8A 4EQ6A 5HTKA 4DCVA 4B3BA 3QPWA 4GSYA 5J4KA 1BMFD 1X6VA 2ZSDA 1WRBA 4Z51A 5FTLA 4EPYA 4CEHA 4TL9A 4TWZA 2BOVA 4BLQA 3K0SA 5LPNA 4C3ZA 1OFTA 4US1R 3NHAA 1HYQA 3NH9A 2R9VA 3SOPA 2O8BB 4LY6A 2C77A 4AKHA 1HT1E 4O3MA 1G8YA 2ZSEA 2FN4A 3I8XA 3K53A 4L9WA 2ODNA 5JJKA 1D2NA 4FMCB 2EFGA 4PSKA 1WBBA 1W0JD 3L82B 2ZRJA 3B82A 4M9XA 1L7VC 2G77B 4RD3A 2NPFA 4C4PA 1ZAKA 1JEDA 1KMHA 1KI7A 3RRNA 2QQ0A 4BRUA 2W2XA 4Q4HA 3THWB 2GF9A 3GLHE 2RGXA 3WNCA 2O52A 2X2FA 1KNXA 2R44A 2ZETA 3R8CA 1KTVA 1C9KA 1KO7A 3CX8A 1UEJA 1GL9B 3FTQA 2EWWA 3O8BA 2DPXA 1JJ7A 2B8WA 3K9GA 2O8BA 2GEDA 1N0WA 1XXHB 3K09A 4BASA 5B57C 5KO2A 4ITRC 3BXZA 3HR7A 3PG5A 2OT3B 1J99A 5IRCD 3SE0A 1XZQA 3NG1A 4BFVA 3H1TA 4OL0A 5FPTA 2Z4SA 5HZHA 2IC5A 3ASZA 1K5DA 4E22A 4ASUD 1HA3A 2GEUA 5EZ6B 2ZREA 1SVIA 3KB1A 3NC1C 2JLZA 1NY6A 1P2TA 1I4TD 2G1JA 1BO6A 4NHOA 3VHXA 4DLXA 3AF0A 2PL3A 1E4VA 3A1WA 1F2UB 3ONWA 4JKYA 3KQLA 3ZVNA 4CT5A 3TW8B 4LYJA 3K0AB 1Z0IA 1N5KA 3WXMA 2OCBA 2QI9C 2J45A 4Q19A 3OESA 1WE2A 1KI9A 4BFWA 3BWDD 1TTTA 4HZUA 1JALA 4TTQA 1NKSA 1ODFA 3E1SA 1GNPA 1MO3A 4LHVA 1XMSA 4PSAA 4QJ4A 1ZIPA 3A4MA 3SU8A 1FQJA 4DSTA 5BN3A 1BOFA 2HEIA 4BLPA 3EZFA 1YQTA 3T1OA 3WRXC 4RD0A 4BLTA 3A8TA 1XFAA 3IQWA 1E2NA 2H16A 3UG7A 1GZSA 1II9A 4H9GA 3O8DA 1G291 1CIPA 2GXUA 4R7ZA 3RRZA 1A2BA 1L2TA 1NSFA 3T5GA 4Q1EA 1I4DD 5C1BA 3THXB 3T34A 4D4MA 3GLGE 1GWNA 1GVNB 4Q1DA 3PIRA 2J9RA 5A0FA 5AUOB 2JIZD 3OEHA 1NLYA 1ZNZA 4IRUB 3QPUA 1A1VA 2GRJA 3PVSA 3ZZUA 3AV0B 5K8UA 3U3KA 2QPOA 1NJFA 4Z1MD 1KI8A 4R98A 1OYYA 2HLDD 4A4DA 3ZIAA 4YXWD 4IJMA 2BBSA 3NHBA 2XITA 2G6BA 2ZXUA 1E6CA 2WJHA 2DY1A 4JL8A 3PENA 2AHOA 2WICA 2WAYA 1YR9A 4OI4A 2AXNA 1Z6AA 2JLUA 4LHXA 2GBLC 1SVMA 3FKSD 1QHNA 4GOKA 1T6NA 1U0LA 3DKVA 3WHKA 3PEVA 2CXXA 3IPXA 1FMLA 4NU0A 2NG1A 4PC2A 4RD1A 1CJTC 3AUXA 1VCOA 4A9AA 1VG0B 3MWKA 2PJRA 4V02A 1KKMA 2TMKA 2R6CA 4RSGA 4KSCA 4QBFA 4QM6A 3GJ8A 1VIYA 3B1XA 4MYUA 4LV6A 5FUVA 4XJXA 2GJ9A 3B78A 2BMJA 2ZVQX 1CTQA 2PH1A 1YE8A 5K8IA 1JR3D 1V5WA 4BPBA 4Q4AA 2IWRA 3PITA 3IEVA 5L3SB 3OHMA 5CLLA 3FWYA 5JWHA 1C4OA 1G64A 2WIAA 2GF0A 2H5EA 1GTVA 4JT2A 4MUAA 3H86A 4DXAA 2C2HA 1R0ZA 2ZE7A 1OHHA 1TQ4A 1R8SA 4QGHA 5DI3B 5IK2D 4D0LB 4PQRA 1RFLA 1N6KA 3TMKA 3H4MA 3VU9B 4ZV4A 1VPLA 3WBKA 1N0VC 2V54A 2QAGB 2C9OA 2WOOA 4JLDA 3PEWA 4WVFA 1E2KA 3G5UA 4LGMA 4JLMA 3CKLA 1PVOA 2QM7A 4A8JB 3HU1A 1P61B 1H8EA 2IYXA 4M1MA 4UJ3A 1NY5A 1PUJA 1XMIA 3WBJA 4JLNA 2XAUA 1UPTA 3UMSA 4W5JA 5TDHA 1UAAA 3NBZC 1OKKD 3ICQB 4AKIA 2XTNA 2ZAMA 1XEFA 1Z07A 3A37A 2KBEA 2F55A 2IF0A 1KY3A 1UKYA 3HWSA 4HZIA 2LCFA 1DELA 5FL7A 3TSWA 4QBIA 4JYCA 4LBWA 3W90A 3OAAD 3R7WA 2OESA 1NBME 4MQBA 4I1UA 5JHGB 2VP6A 2C5LA 5AJYA 3MSXA 4H1UA 1EG7A 2XZPA 3AEZA 1XWIA 3RWOA 4NZYA 1AGPA 1G5RA 3LQQA 5DSZA 3ZJYA 4B3XA 2QP4A 5M04A 1OJLA 3VTKA 4A2WA 2A5GA 1G21E 1J7KA 1RC8A 2EVWX 3B1WA 3EA0A 4F7WA 5CB8A 1CRQA 2QA5A 2MSDB 5FH9A 4TZ0A 2X8AA 2L0XA 2UKDA 2GBLA 3QVVA 2JGNA 4OHXA 5LB4A 3UK6A 4LV8B 4MKFA 5FR2A 3GMTA 2ZTSA 2HF9A 3RLFA 2HJGA 4ZDIA 2WJJA 3JVUA 2W6JA 2ZUCA 5GJWC 2XOKD 1FP7A 2RH5A 1XJ0A 2XB4A 3NC0C 4Q66C 3ZLJA 5J47A 1GNQA 2JJ2D 1EFRD 3HP1A 4XTCS 4Q02A 4LI0A 4Q1CA 2ZANA 2GNOA 1S8FA 4HUQA 4FCWA 3PQCA 2VF8A 5EQTA 1LB1B 1X3SA 3BJIC 3CWZA 5F98A 2CNWD 2XEXA 4LBVA 5BYJA 3OAAA 2AXPA 1Q1QA 2B6HA 2MSEB 2NO0A 1OE0A 3I73A 1EX6A 2BBTA 2VP5A 3A36A 1YZGA 1ZUIA 5FBVB 3AVXA 4P3YA 4URZR 1YVDA 2GZAA 4IOKA 1YR7A 2GZDA 1OKKA 2PX3A 3JZMA 1N6HA 1TQ6A 1CKEA 1Z28A 3GPLA 4PO9A 3IGFA 4C7OB 5TY0A 4DT1A 1ONBA 2BC9A 2OFXA 4QBGB 3T61A 2J0SA 2F3RA 2FGJA 5G3ZA 2GESA 5FTJA 4FCTA 2F43B 1GL7A 1KMQA 4G5RA 3GFPA 4IVQA 1MRNA 4J0QA 2EFCB 3RRMA 2I3BA 4RVCA 1E9FA 2NO6A 4IOJA 4LWZA 2C99A 3NBFA 4QXAA 5IK2A 3IKJA 5FFMA 1JI0A 2GKSA 3X1WA 2Q3FA 4ACAA 1DAFA 2J87A 3DHWC 3SDZA 3WMEA 4HB2A 2VSFA 2V1UA 1XD2B 1H8HA 4ILEA 3G0HA 1WDTA 3M6AA 3RS4A 5JCPA 1E0AA 4TZ6A 4DJTA 1N6NA 4M1YA 5J5CA 1G3IA 1F2UA 4POAA 1DVRA 2CVFA 1CU1A 3RSOA 2XJ4A 3AF2A 4HUQB 1E2PA 1MOZA 5AJWA 4A8JA 2YV5A 3QKRB 4NCNA 4ARZB 2QAGC 1S2MA 4TL8A 5G3YA 5BW8A 1KK0A 3EWSA 2JLVA 4W5WA 3QVUA 1WBDA 2IXGA 4NP6A 4D0NA 4HB0A 1OFHA 2IK8A 3K09C 5TARA 1IXSB 1S3SA 3I1FA 2NTYC 3QF4A 2P65A 2BHRA 2CHVA 2PEYA 2WWYA 2RMKA 4URYR 2HYDA 1G7SA 1TF2A 5SZIA 4AG5A 2ZI4A 4CEJA 3RANA 1GKIA 4WBSA 721PA 1YR8A 1W36C 5HKKD 5FPHA 1ESNA 4W9MC 5AUNB 4ARZA 4GZLA 1KI2A 2ASEA
chains in the Genus database with same CATH superfamily
2JD2A 1YQGA 1O6FA 4KPUA 5ALPA 2VOJA 2CFCA 2X0EA 4GRAA 5JNSA 3LWNA 5ER6A 5B3JC 2I80A 3JWHA 2QTHA 4PICA 4M7RA 4WADA 4CF6A 2Y66A 1WU7A 1ICEA 3H1EA 1N5OX 5BYBA 3DVAA 1IU9A 4XB6B 2VSOA 5H81A 3J81k 2WTUA 1HNZB 1CXZA 1IG3A 2GN9A 2ZWVA 4P92A 1VLMA 2E4WA 4TQAA 3VNBA 1RYHA 3EDRA 4C4TA 2AF3C 4OFZA 3UH0A 2RI6A 1H2RS 1SHJA 1XN4A 3A1NA 4C4YA 3AFOA 4KYIB 1HPLA 2R8ZA 4R1PA 2AFIA 4RZXA 4TN5A 3JQ6A 4UDYX 5ERYA 2HT1A 4OP1A 2ZTVA 4V0ME 4GDMA 1B26A 2GPSA 1P4SA 2BM1A 3H2HA 4JLPA 4REQA 3JY6A 3MJSA 3A4TA 2D2XA 2Y6UA 3LBYA 3UAYA 4AG6A 3ZV6A 5EP4A 1IQPA 4MO9A 1VRCA 4QIHA 3U7QA 4B6RA 1SKAA 4GPD1 4MP3A 2C7RA 2ZQYA 4RVUA 4EGAA 1HE5A 2JFVA 3K9CA 4O4LA 3KVOA 2QY9A 3T0GA 1I8TA 5EJFA 1EUQA 4KHZA 4RZ3A 1Z75A 3GOQA 2Q8NA 1IZYA 4HX9A 5LXTB 1QYWA 4GKVA 4LPKA 4GLJA 1M7HA 4CN8A 1FE8A 4JI1B 5IWCA 3WIBA 4KFCA 5IHPA 3JYNA 1CY8A 1FYXA 3PRKE 1FP4A 1N5DA 2AC2A 3L7BA 3SN6A 3VZSA 3KVRA 2AJLI 4LC9A 4YA6A 1VHLA 2JAUA 1PI3A 5KWEA 3GBPA 2BFNA 3IJEB 2YN4A 4IP0A 3V8PA 1K2WA 4NRDA 3MXTA 1X92A 4BXOA 2BFAA 3INGA 2A6PA 2PGXA 3NIFB 4XFKA 4L95C 3K1TA 2DLCX 1OF1A 1UOQA 3KTAA 2HAEA 3U31A 2CYBA 5HW0A 1E5TA 3GLIA 3AVVA 1VE5A 1D04A 2R68A 1ZZEA 2ZI9A 1YQWA 3SR0A 4E09A 1NUSA 3HUTA 3OECA 1MAVA 2J3JA 2RK4A 4I7EA 2D8AA 4S1NA 2GWHA 2QQGA 3N2GA 3P2IA 2O2HA 3QIAA 4N7RA 1V3VA 4OQMA 4TXLA 4A36A 4G9BA 4GL2A 4UNNA 3WNQA 3CNBA 3VR5D 1OYWA 1GTRA 2C2WA 1DX6A 3CE6A 3OQMA 4JNKA 2FE4A 1GUBA 4HH4A 2CT8A 4GXNA 3Q1LA 4QQNA 4DG5A 1MD9A 1O2DA 2DPGA 3PYXA 3DE7X 4HSGA 2C04A 1H8HD 2BT4A 4BZWA 1JG7A 4DQKA 5ALZA 4AJ9A 4DEXA 1CVRA 3ASUA 4TVOA 3TQIA 4D1YA 1OZ0A 3LP6A 1Y8RB 1RYEA 2IPNA 3O8QA 1I3KA 1UBGA 4FFDA 5JEEA 2JFBA 4COKA 1ORVA 1CUJA 1XBTA 4LK2A 4LVCA 4BO7A 1LFDB 1GAWA 1KK2A 1NBIA 3R40A 3UG6A 4X24A 3RKRA 1W7AA 3TXAA 4EJSB 2ZJYA 2ETXA 2VSQA 2Y1FA 4DA6A 3TR0A 4EPVA 2WSSA 3GLHA 4O1IA 3TJMA 2ZIVB 1JFRA 4L6CA 4A0RA 2IV2X 4TYYA 2ZBEA 4KRYA 1G55A 1TK2A 3IJPA 5ECWA 2X4IA 2GPAA 3E70C 3N0TA 4CGZA 1ZZGA 3K7EA 4LDPA 2J7PD 2ZE5A 3PQ8A 1XQ9A 2UZIR 3I1JA 5FWYB 3I9MA 3LGAA 1DJMA 1LDNA 2MIIA 2K6GA 5EXSA 1I6LA 3UXYA 4C9BA 1U2RA 3SLRA 3FR8A 2OV6A 2P11A 3TLGA 1KYIA 1JQEA 2Y92A 3U60B 3DCJA 1RACA 2UYCA 3IAXA 1Y0BA 3ZWAA 2SHKA 3U3MA 1XK6A 4ZV9A 4BUCA 4TN1A 4RA9A 1PF7E 2CYCA 4Y9SA 2A9PA 2FETA 2MHCA 2CNWA 2GHIA 3QVXA 2BP7B 1NUQA 1OPXA 5FUQA 2HRQA 2ZJFA 2VHQA 2BN4A 5C4GB 1GDHA 2W2TA 2YMMA 3JV7A 1CY0A 1RYYA 2FZKA 2IU4A 3C8DA 1JMYA 3OLZA 4H3VA 4JOBA 4NI5A 4XXHA 4IJ5A 1Z2NX 3CW8X 4MV4A 1WEKA 4BBAA 4PYMA 1DFGA 2A94A 2ZJOA 1QQ5A 4F1WA 3MPOA 1GLGA 2Q4TA 4QU5A 3UHJA 4IFEA 2DH6A 2J07A 1E6EA 1L8QA 3BSSA 3NRJA 2Z9BA 3QUAA 4JLAA 1QIFA 4YCCA 5BSVA 4FN5A 1QX4A 1URPA 1DAPA 2A0YA 2DKNA 4FIZA 1LLDA 1U2GA 1A82A 2M1XA 2ZRAA 3NVDA 2XUGA 2A9FA 2QRGA 2X9NA 3DL2A 4RQUA 1W47A 1NZJA 1F0PA 2E49A 4WXPA 1EJ0A 2JLCA 5KOHB 2OHHA 3R77A 1ZRSA 2AMFA 4Y7DA 1MABA 1WCIA 1H2HA 1ZQ9A 4E51A 1KZ4A 4CRWB 3G8AA 4ZAZA 1Z4MA 4OYRA 2VPYA 3CS3A 4M0PA 4NCKA 1LPNA 3C8UA 3RC7A 2ZSHA 1SG9A 3KXLA 4M60A 2NP6A 2FOLA 1F1BA 3OKFA 2CYAA 4PCAA 4E2XA 2ZJ4A 1NGSA 2VTEA 3E2MA 5EWLB 5TQ0B 4FWBA 5E9WA 1HYGA 2QLLA 4G0QA 3PQFA 2WFMA 4RJLA 3UMVA 3ZY3A 2OORA 3IQDB 1YBFA 3PGXA 3W9SA 4X92A 5B37A 1JAHA 1KMMA 4OGWA 5FOVA 5KYNA 4HNAB 1JIIA 3KQPA 4LJSA 4UPVA 2GBFA 4D8WA 1GAJA 1P7ZA 4RK5A 4LCBA 1YRLA 3WICA 2BKXA 4RJ2A 4M86A 1NBMD 1X7XA 4NE7A 4ER6A 2KM1A 3LZDA 1G3MA 3NVAA 4QO8A 1S7CA 3HCBA 4ENTA 4O2BA 3P19A 1C8KA 1J0BA 1FQWA 2HREA 4XIJA 3WO0A 5KJFA 3FTDA 3HJFA 1R37A 2VNJA 3BFJA 2MCFA 5KJ1A 2DFNA 3LXRA 1KY4A 3CH6A 3RHZA 1H2WA 1WCXA 1LBEA 3LHIA 2XLCA 3LCJA 1Y89A 1QIDA 2I7XA 2NZ8A 2ZPUA 3DM5A 3RDPA 4A73A 2WV9A 5J4LA 3JVVA 3HKCA 4TS1A 3REQB 4NOJA 2IEZA 4JQYA 3EUAA 1JV2B 1XZLA 4BVLA 1PJCA 1EXWA 3GJZA 1Q3KA 4B3HA 4II2A 1XZPA 2A1TS 1X39A 2IODA 1KVTA 2HQ1A 4DSUA 3C3AA 4TWIA 1QHEA 3ZDEA 2WU0A 2POCA 2ZI5A 5H4HA 4EI2A 2N1MA 3JPYA 3GPIA 3JQCA 1FJHA 4PTLA 3IQGX 1NVBA 2RKOA 1BRTA 5FTMA 4O3FA 4BLWA 1TJPB 2VHJA 3U80A 1P60A 3OTWA 2N75A 2Q7DA 2A3RA 3PEYA 1ILEA 4RIHA 3PNBA 5H9WA 2XZDA 5DVZA 5ALWA 5IBQA 2ZRIA 3NIDB 3K92A 4IIGA 4U2GA 2IYUA 2NYAA 1JHZA 3CEJA 5EWJB 4U0JA 4X8OA 2VUSA 2H07A 3IOBA 2Z2JA 2JHAA 2YINC 5EE5B 3TTSA 4QPPA 2BZSA 5DBFA 2C1EA 2QW0X 2VJMA 5FOUA 4BVBA 1BKDR 3ISTA 5CDUA 2OBLA 2O2IA 1SUCA 2AWNA 3H2KA 5FWNA 3RVRA 5AK4A 3K9FC 4L7VA 3H17A 1B8PA 2XXJA 3OZCA 4JLKA 4AJ1A 1QE3A 1P7VA 3MMZA 2BFWA 4RSHA 2O9JA 3V34A 3BDVA 3I23A 1VMIA 1J25A 4Z4IA 2QRNA 2WVGA 4KR0A 4OHWA 1UMBA 2I6GA 2WVHA 1EINA 1UINA 2XXAA 2WSLA 1L4KA 3FOZA 4GSKA 3R23A 3N2LA 2RHCA 2Q6LA 1TGYA 3AB3A 4YT4A 4TXHA 1PZHA 5JAIA 2X7JA 4NNOA 4TLLB 1NR7A 2AR9A 1A2QA 1RXSA 2XXBA 4EGFA 3BZBA 5AVSA 3CURA 1QANA 5IABA 5DNAA 3UOAB 2CK3D 4NCJA 4OU4A 4WXMA 5M7EA 3V6LA 3AVQA 3P5SA 3SZLA 1MQSA 4K9MA 1KJ8A 3AVWA 4MGEA 1DBWA 1IJEA 4XCVA 1F8GA 4R1UA 1ZUHA 1V11B 3GYGA 5T6BA 3USES 1DGQA 2C8LA 2VHCA 4A8JA 3AUYA 3LDHA 3KSUA 1VA4A 1P17A 3NW9A 3DHEA 3Q7EA 4ZTBA 3LL4A 3MHPA 5KX5A 3EPLA 2ZYUX 2L18A 1RM5A 3O3NB 1WULS 3FOWA 4B6SA 2A1UB 3NCTA 4ZDJA 4HDMB 3AJAA 3I1IA 2G8NA 3TSYA 3TX2A 1IM2A 4D9FA 4R83A 4BNZA 5K0EA 1TLFA 4AP6A 2R5FA 1P2BA 4ER3A 2REQB 4IV5A 4KO4S 1Y8AA 1KO4A 4LCEA 5J1SB 2AL7A 1NA5A 3HCPA 5HIMA 5IAJA 2ZLBA 3WLLA 3ANLA 5JJBA 2X9LA 3NDPA 4DR4B 1XK7A 2WLSA 1J1UA 2P5TB 1YC2A 5AHXA 4G1FA 5L95A 1FVXA 1USUA 2Y05A 1F4PA 1OLXA 2Y76A 3PQ5A 4KXVA 4Z9XA 4JEUA 1RRGA 1M8PA 5A62A 1IY2A 4WKOA 1UQUA 2OZEA 4MVJG 2D4AA 1X9HA 4NZZA 4DCTA 5BW4A 3TIGA 5KYYA 3NAZA 4ZEVA 5B58T 1E1RD 1UXKA 4XGIA 1OLOA 4PSVA 5AVXA 1SKBA 3GGSA 2ROQA 2IWHA 3BOSA 4Q1BA 2BRUC 4RV9A 5A3SA 4J76A 3EULA 3LXUX 3ZHVA 4XJSA 1VGVA 2BUAA 4WX2B 1XZEA 2MYTA 1SKQA 2AMVA 5I7RA 5CW1A 4JP2A 1DFHA 4CBVA 7ADHA 3EGEA 4GO1A 4DIUA 4EG1A 2IXEA 2XVZA 1XRJA 2DBZA 4NOLA 3GFOA 1EFUA 3AX6A 3KLPX 4M53A 1HDYA 3DAYA 4U2EA 1QS0A 3M83A 1IMJA 2H4YA 4MS4B 3GDWA 2AN9A 4ZVSA 3RJMA 2X77A 3M34A 4RMGA 4Y1GA 4MV5A 3FMPB 1P0CA 3BVPA 5SZKB 3K9HA 3N86A 5ALSA 1XTSA 1TEHA 1Z45A 1JAZA 4RIGA 4BMSA 2B4KA 4QQRA 3S2IA 2J3MA 4YBZA 2P40A 4D82A 5LYJB 1FSGA 2B99A 3O2NA 3R24A 4A0SA 3QVTA 4LY9A 2PD4A 4KQCA 3JQBA 1UFQA 2CLHB 1NQ5A 3DBRB 4BYGA 4DR2B 3SPXA 1J2TA 3V7WA 4IDCA 2I6QA 3V8EA 3NIBA 1VJ5A 5G1NA 3RNOA 2ESRA 2JH8A 1WB9A 1U2DA 4KNVA 1VG1A 4R0VA 3GJ5A 4LF8B 3RKSA 3CCCA 4KVGA 5DN6D 1KI6B 2Y1GA 3NRCA 2HPVA 2CD7A 1U8UA 4J9VA 4BTLA 1NRWA 3CYFA 4FDTA 3UMFA 5F76A 4DR5B 4KREA 4NONA 2PZFA 4BFSA 4DCCA 3ETNA 2W2VA 3HDYA 1QVAA 5T41A 3I30X 3W1EA 4YYEA 4FYHA 3IAAA 4LXTA 1QX3A 5ALGA 1MZVA 4K8OA 1OX5A 2AG5A 1IHDA 2KBFA 2QRKA 1BQEA 1U8ZA 4KJZA 4EI9A 2EFEB 4KQ9A 4QFDA 2C83A 2WM9B 5CJPA 1HNNA 4K40A 3OX1A 1U28C 4DG9A 5C18A 3ILHA 4Q9AA 4L74A 4K1XA 4WOJA 4D9KA 1KWGA 3JQAD 2AE1A 1XTVA 3CLVA 4G25A 5IVKA 3GRVA 1FS4A 3AO0B 3FWKA 4HWOA 1BS9A 3E7FA 2WUVA 1F9AA 3MYRA 4LZPA 1QIKA 1KH1A 3T06B 2FUG1 3T3MB 5F3RA 3S2ZA 1WETA 4EK9A 1OWOA 3ZQUA 4HBGA 4IS2A 3IUPA 1JIQA 1XMPA 2DUUA 2EW1A 3ENZA 1QH1A 1IPEA 1NUHA 1CDEA 1L7NA 1X8JA 3H83A 3HYNA 1W93A 2HXSA 2IDMA 4JYBA 1ZAYA 1Z68A 4B82A 1YK0A 2Y9MB 3L9WA 4Q48A 2Q99A 2OFPA 2WHYA 5E6UA 4UM8B 3ISJA 3J7AC 5I7SA 1IY8A 4DRZA 3W5DA 4WCFC 1GZ3A 4RPGA 4ND1A 3R9XA 4O0MA 4LUCA 1L5GB 1BTOA 2IZ0A 2AS0A 1X2BA 2JH3A 1L7RA 2ZB3A 3A4VA 5I51A 3VKFA 3ND7A 4C7MA 2TMYA 4RCZA 2BGTA 1U1DA 4JT4A 5KSWB 1HMPA 3EDMA 1XZBA 5ALMA 4KEAA 1GQ2A 5L3QB 1Z0SA 4IZIA 2FK7A 3H1FA 4TQ9A 4CL8A 5AW5A 5AR1A 1TRKA 3IIKA 1PD1A 5G0UA 1W85B 4CR6A 1Z7YA 1LTHR 4ESEA 1EVZA 4BGVA 1IVNA 4PSDA 2GWRA 1NYRA 2PGAA 5E1OA 5IJAA 1TYBE 1OZGA 3SIRA 1X8LA 3MINB 4C1NA 5IZCC 3FB1A 3TOXA 4A15A 1CCWA 1XXHE 3ICPA 2ZWIA 3JRWA 5I8WA 4KW7A 3NT2A 1JI3A 2EATA 2BKEA 4KKVA 3PT9A 4HGYA 3GJRA 4FT4A 3EASA 5EKXA 5AJTA 1CZKA 1YS6A 2B5WA 3ANXA 1VOTA 1WB6A 3LO5A 4OBXA 5DPMA 4PV7A 4YP7A 1QPZA 3K0FB 2I2FA 1I7QB 3NANA 2PGDA 3CR7A 3NC4A 3T3IA 3FLEA 3BYZA 3KTOA 1OVMA 3PQ6A 2AN1A 1O95D 3DULA 4RKQA 4WEQA 5AKLA 3RH0A 2QD3A 4DUYB 4P83A 1GG8A 1QHSA 2UVPA 4BNXA 1TI7A 1Y3HA 2R86A 1SBZA 3PFNA 4L4YA 5DISB 3U9SA 4A2QA 5L40A 3X2FA 3PNMA 1NRJB 3QP9A 2GCOB 2WUWE 3ZVRA 4OQFA 2HHJA 3BULA 4G0YA 5KYGA 2Q2OA 1DHTA 4J4TA 3SF0A 3EPJA 4O1MA 5FUXA 4MA5A 5JD4A 4DHWA 4R1TA 2Q3HA 4DNQA 1MGOA 4Q7MB 3LAWA 3IVMA 4TV9A 1Q0TA 3WLRA 4QJIA 3MWEB 4FMDF 4CIAA 4BVFA 4MWCA 3H4IA 2ZVJA 2R8YA 3OCUA 3V2IA 3KFXA 4MV7A 5HWSA 4MP6A 4C6SA 4W5NA 4BQOA 4BIIA 1XVIA 4JGIA 2ORYA 4YI5A 2PZJA 4PSCA 2PKWA 4X45A 2OB1A 4JVSB 3USCS 2AFHA 3BGWA 1SVUA 3V8RA 2B7BA 4EFLA 5EEGA 3RYFB 2WJYA 1PYGA 3WLIA 4B8YA 1ZM9A 2E1RA 1Z6ZA 2WJPA 4I9GA 1SKYE 2PD6A 3D8NA 4KHPB 5H8WA 1JR2A 2QRZA 2ZIAA 5IJ0B 3QE4A 4RTOA 3DJFA 3O82A 2E37A 4LJYA 2R1TB 4BVKA 4QAJA 2A5JA 4Q6BA 4DWJA 1AVTA 4BZXA 1ID1A 1NYQA 1Z83A 2V58A 5G41A 1PWYE 4O2BB 1VSBA 1E0JA 2FJUA 3GDGA 4QYSA 5D87A 1K6JA 2QWXA 1WOMA 4URFA 3OOJA 5C1DA 3AWIA 4CG2A 1D0IA 1V43A 3DV2A 5EIWA 2G9RA 5CITA 2FI1A 2P9JA 1W35A 2PJZA 3PKIA 1AGYA 2D0DA 1M2VA 1MFZA 5FADA 4EHIA 2D06A 2O0HA 4INPA 4CR8A 3GLGA 2AJBA 1SPXA 1YB7A 2J5XA 3ACDA 3ADDA 4OKSA 1JKFA 1MX5A 4RAOA 4TTAA 3EVAA 5I9BA 2IX3A 1AXEA 5IJZA 3VNQA 1OPRA 3G23A 2H48A 2W71A 4EYOA 1S9DA 5F9HA 3C7TA 1DL5A 1N3IA 2FEKA 4D9MA 3IP5A 4O2AB 1NUTA 3TVDA 3LYLA 3DNFA 3J7TA 3NGXA 2Z08A 4XR4A 5K6RA 2JANA 3RD5A 1M2FA 3ZGVA 3C3CA 1KZ6A 5CH3A 2QTVA 4XFJA 4KQEA 3RM3A 1QYDA 3I9OA 1HUQA 1YD7A 4GMGA 4DDKA 3IKMB 4EUFA 4IDOA 1ISFA 3B85A 5DMHA 3QV2A 2A2ZA 4I36A 4QQKA 2KLHA 1YL6A 4ICIA 3LOUA 3BIXA 3AU8A 4X0EA 5HF5A 2FLVA 3L79A 5BT9A 4MR9A 4C0AC 4D0RA 1R6DA 3PI6A 5AJVB 3B3FA 4NMWA 4TLCA 1J5PA 2JIBA 2PSHA 4TSFA 3CBGA 4YGXB 4H1TA 3VI4B 4EPTA 3E3MA 3RK1A 4MLZA 2ZJ2A 4MKXA 5DI9A 5FTNA 2B61A 2VT7A 2SECE 4YJ3F 2X5NA 2IXFA 1N25A 2JCSA 3GLKA 2VBIA 4C29A 5A4KA 2YOFA 4QOFA 3GLGB 3A3PA 1Q12A 4D3YA 3LLMA 2ID7A 5JRDS 3D02A 4HVLA 1NASA 3EVNA 1DO8A 3NUGA 2WDZA 1COWA 4N3BA 1OGJA 1MW8X 1PJRA 3COZA 3P2EA 1V8PA 2HD4A 2PY6A 3QPAA 3QLTA 1OZAA 4XSVA 3M9XA 5DM1A 3DFZA 2H1IA 3QYFA 3RU7A 2WTXA 3U0VA 4LFBB 1DRVA 4Z86A 2ICAA 2X2PA 4FR2A 3DC7A 4KQ2A 2FK8A 1RP7A 5BSKA 2JGJA 1ZH4A 1NPDA 3BE5A 2YXEA 5C8DA 4UXIA 4NAUA 1ULHA 3V1MA 1B6TA 1GSIA 4LJ8A 2WWHA 3GBVA 4XYLA 5FL3A 3KD2A 4BO9A 5HOEA 2P6OA 3ZQKA 1JSLA 1V1JA 3TQCA 1Q1GA 2C3YA 3LKVA 2HLHA 3SS9X 3W7AA 3DTNA 4FEAA 3NWBA 3AVYA 2QVXX 2WA1A 4GUAA 1H05A 2ID9A 1J09A 4K88A 4KLNA 4WQMA 5ALVA 4B79A 3S1LA 1I30A 4PQGA 2C7OA 3IDOA 1UPFA 1W75A 1CRPA 2VBCA 3O0DA 3QE3A 3WYBA 4OA5A 5JO0A 2G76A 5CA1F 3CR8A 3SZOA 1F0YA 3AUSA 3IBYA 2GFHA 4HNGA 1JHYA 5TR9A 4P4TA 4TYPA 3K16A 3U16A 1KQNA 4YALA 3HCAA 4AMVA 2CDCA 4ZOCA 4J07A 2HDOA 3MWGA 1ABFA 4DRXA 2RSLA 1T8WA 3P9YA 3WIDA 3ZDFA 4RMHA 1A4RA 3PNVA 1VPDA 5FBWB 2RK6A 4DWWA 1J0XO 1L4FA 2GPJA 2QLJA 3RIHA 1EGQA 1XU4A 2A5FA 4ESHA 2IEYA 1J8YF 3VTFA 4RFSA 2AGVA 3I9V1 2PMEA 3GFVA 5JRZA 1UT6A 4BMYA 3JQRA 4WDQA 1M6NA 3VA7A 4C3UA 1U0SY 5AXAA 5HPYB 3JAWA 3HCWA 2J1LA 2XZTA 3TZLA 1CUGA 3GBSA 5IULC 2RKWA 1IXKA 3NTVA 4WXYB 3BIOA 1O5TA 5GZ1A 2QUKA 4NENB 1X8XA 2QT1A 3CIOA 4NNPA 5EEHA 4CYMA 5HBGA 4V0MA 2XNSA 3MK31 1CUXA 2JNWA 4NXMB 1YSCA 2ZRHA 1XLTC 2C0QA 2I6TA 3GGCA 3UB2A 4B33A 3VGPA 3QBTA 3BMCA 4N03A 1XN1A 1ZKDA 2B9EA 3AY6A 2OV1A 3DA8A 5FKJA 5B58C 4KDRA 2XMCA 4JEMA 5E3IA 5M5BA 3O8RA 1G2PA 4ND8B 2XMGA 5GOZA 3KVVA 1LBSA 2COEA 2H0QA 2XOKA 4KV7A 1F2VA 3WQRA 5B55A 2QM0A 621PA 2I4OA 4TMWA 1SCNE 1OJ7A 3L43A 1SBTA 1DADA 3AEKB 3DC2A 4XJVA 4M1KA 2XNDD 3ODGA 5FLYA 2OHIA 4ZDWA 4KH0A 2CVZA 3K3PA 1FW8A 1HQDA 4DXDA 1PV2A 1C3OB 1BFKA 2O3RA 3COSA 4A03A 3DFUA 5C8VA 3OZUA 4CR7A 1R0YA 3H9CA 1I14A 2P9BA 1EAYA 1WXWA 1L5HB 1MENA 2X4DA 1KTIA 2B7LA 2XUDA 2R6ZA 1G6KA 4XI9A 4A27A 3P4YA 2R97A 3H9BA 4CKZA 5LZ8A 1RIIA 3B3JA 1K9VF 1G59A 1W25A 4PHFA 1VB5A 5ELMA 4MDEA 3AR4A 3ZKWB 1EK2A 2XNKA 1EQUA 1OWPA 4D8TA 4OPMA 3CPSA 5KOIA 2NTJA 1G7CA 1XGKA 3CRZA 4KFRA 1TVMA 4EY8A 2Q6KA 2YNMD 1AS3A 1LPAB 2HA5A 2NNWB 4AY2A 2V03A 3QG1A 3TLAA 1Z6PA 5DGIA 1WVIA 3AR5A 3H3FA 3IO5A 4UUQA 1E0SA 4YIHA 4NG4A 2C7PA 1UOOA 1DJQA 1OFUX 1EM8A 1KI4A 3E5RA 1MH1A 1LI7A 1XT6A 1E6MA 3TBHA 3UAGA 3MRSA 3QELA 2CVPA 4M38A 4UE6A 1HT0A 1RJ9B 5BP7A 2XQIA 3O9ZA 3OY7A 2ZCUA 1EHIA 1GYPA 4K9QA 4KVAA 4MYHA 3HNRA 3JPWA 4AQYB 2XEDA 1IHUA 4HNRA 5CB4B 2WNIA 5JOQA 1ZIYA 4NE9A 1CE8B 1XQXA 1Z0ZA 1L5NA 2YJGA 3LBHA 4N8SA 1ADCA 5KOHA 1PW5A 3KUDA 5DBIA 1ZIXA 4B74A 2PT6A 1N1EA 1TK3A 2H2WA 1SVSA 2Y1KA 2OV2A 2Z8YA 5CEFA 1UBKS 1VGQA 1NMZA 3HY6A 1WG8A 3K5WA 2W4IA 2BMEA 4L85A 4OGLA 4R2HA 3WB2A 1SXPA 1BQ3A 2WBLC 1T36A 2DFLA 4RC9A 3EMBA 5D5HA 5GTDA 1Q7CA 4ENWA 5H80A 1QYCA 821PA 1QQ7A 2YWRA 1HE1C 4IL5A 4N0DA 2A86A 1CUCA 2BISA 4DBVO 5I4IA 4LOJA 1PQUA 3EQ7A 4F9FA 4BQPA 2Z3VA 3O95A 4JLBA 4L8GA 1L5LA 5JXIA 1SXJE 4DDUA 1E9SA 1NATA 3OMLA 2E18A 1NDHA 5A71A 2YXNA 2XUHA 3K0EA 1L3IA 2ZYTX 1M6YA 3BD9A 3W2HA 2I1VB 3EZ2A 5BNWA 1B0ZA 4BYMA 2K2WA 5HEKA 1DARA 5F9FA 3LBIA 3ZTWA 1ID8A 4Q7LA 3ZXIA 5AH0A 4E7PA 1GGEA 1NN5A 3IQEA 1H6BA 1RYMA 4IDBA 4B34A 3RADC 4RH1A 3E9YA 1TA0A 3FZQA 3NGLA 3REGA 3U19A 2NLOA 1RWOA 5CDSA 1UMDA 1EBFA 2X58A 3OY2A 4XASA 2PNJA 4JL5A 5JFOA 4HVCA 1KS9A 1XL0A 1H3NA 5L51A 3CN9A 4UUNA 5FBQB 2WTAA 3LT1A 4Y9TA 5D01A 3C98A 7GPBA 4AMGA 3QJGA 1KYVA 3HJTA 1FU7A 2QE7D 4QUKA 1XYYA 1W4BA 3QXJA 5DHRA 1BS1A 1JG2A 1K8QA 1X7XB 1ZFNA 1K63A 3B6MA 3D7MA 3N9IA 4KN8A 4B35A 1CJSA 1SHUX 3TZHA 1UADA 2EFDB 4FQ8A 3TCNA 2WUGA 3C4QA 4LZZA 4C30A 3MAAC 3SHQA 1QV7A 3AGQA 4KTTE 1E6KA 5EJAA 3TJZA 5IKXA 4EATA 2WU1A 4ENSA 2YY7A 3EOAI 3ZGYA 2WSBA 3LPAA 4Y2PA 5KTPA 1DAEA 5DX1A 2VF2A 3QI7A 2B21A 3AEYA 2WSSD 4JBWA 4J6EA 3D3JA 1P2SA 2NU9A 4TT3D 3UK7A 3VMFA 1RLTA 3EQ6A 1J97A 2YHBA 4KAJA 1WHTB 1N7IA 1O5IA 2HMTA 3KK0A 3OO0A 2NP7A 1R2QA 3AKDA 2FMIA 2XE6A 3TLCA 5BRAA 3WHPA 1CRLA 5E1DA 5EJGA 3UM9A 3HXLA 4R2IA 1NMXA 2QZ4A 4TL6A 1XVLA 1O9BA 1B43A 3SEAA 4PEVA 1B41A 9ABPA 3CNQS 1T9AA 2WI8A 3ZYZA 5JAHA 1W44A 4G37A 4OQDA 5F7OA 2GM4A 5CTJA 2Q1YA 1VCIA 3OC6A 4QJ3A 2YWHA 3RC8A 4JXJA 2YKGA 4QOIA 3QFFA 2C31A 4Z2AA 8LDHA 4DR3B 3GVHA 1N33B 4EWLA 2VA9A 2PH5A 1JIKA 5JQWA 4GU5A 4MGZR 4BV3A 4F85A 3O74A 5IJWA 3E5MA 2XB2A 1XTZA 3ETGA 1PK7A 1TT5B 3S2YA 4GHWA 3PL5A 3A6KA 3GRPA 2CL7X 2YH2A 3PF8A 4L3OA 3RF6A 2VZEA 2G9ZA 3FNFA 3UPTA 3E23A 5JY6A 1BU5A 5AQEA 3T38A 4Y3UA 4CEIA 4RPHA 2JGDB 3PTLA 5D3ZA 3VDXA 4LDRA 1GQQA 4LXUA 5JALA 2OAP1 3JTMA 3BSWA 2XRYA 5CM9C 1YS2X 2ZTUA 1V71A 3ZNPA 1MEEA 3OEEA 1K86A 4U3JB 1A9XB 4LMAA 2VHTA 3RFTA 4IXTA 3IP8A 1UKZA 3IHWA 2AUNA 1AGNA 3KR2A 1C8LA 2IXAA 1EP1B 1UPCA 1CJBA 3PC7A 3KC2A 1ELOA 4UTPA 5ADHA 2B8NA 2H92A 4RETA 3B1JA 5CT9A 3CF2A 4QXMA 1YQ9A 1GAEO 2J9FA 4MPPA 4R2WA 4P93A 4B46A 4B4UA 4CFYA 1YKGA 2HO5A 4F4CA 4KPGA 2ZP1A 1CX9B 5EJ5A 2ZYDA 2O5CA 4Y1RA 2FU5C 1KY2A 3PI7A 3K9QO 4HYYA 4N6OA 2M6LA 2DR2A 1EEXB 4IQFA 5ARBA 5H59A 4YDHB 1NQUA 1XRSB 5EHXA 2SNIE 5DXAA 3S81A 3K6SA 2FHPA 3UCEA 1EGAA 5E8RA 1X7DA 3ZHCA 2XKAA 3ZHZA 4TLBA 2HK9A 4BLSA 1B15A 1XP5A 2J6HA 1UBFA 1O96B 1BEUB 1ODJA 3U81A 3QPDA 3OF2A 4ZEWA 3C3BA 5JC8A 2V8OA 2GK7A 1YZVA 1JIXA 3PQDA 2ZRLA 4J7XA 1RPNA 3ANNA 3BWXA 4ZU3A 1EBBA 4OYLA 3KZKA 2HF2A 1XNQB 4PZAA 4QFBA 1QIIA 2FWRA 3BH7A 2PT5A 4NFYA 1RHRA 1FXWA 1PR3A 3T41A 5BURA 2O8NA 3AB7A 5DTQA 2ZULA 3P8ZA 1E18A 3THXA 1MX3A 4MS1A 4OSOA 4XVUA 1SEPA 3IULA 3UUWA 4LE0A 2XHZA 2QVLA 3CLSD 2GD0A 2OKCA 1EWYA 4PO8A 1Y1SA 1NSYA 3OLYA 4C4SA 4WMLA 1T0IA 3DPSA 1P9OA 2B78A 3IEXA 3JR7A 5ALEA 1H94A 5BT8A 1C0PA 1GARA 4Y2GA 3AILA 1CUSA 3KTFA 4FKBA 5TJ9A 4Q12A 5I5EA 1QF6A 3T1VA 1N57A 2FWIA 2H4XA 5JTTA 1KZ7B 4GGPA 1U1FA 2BM8A 2YWJA 1FYEA 1DBVO 1DJOA 4GYWA 4EZIA 3KYDA 2D2EA 2OBMA 4GDFA 4K26A 2Q7XA 3ULKA 2MJLA 3A4IA 3IKTA 4GIBA 3MLEA 5AKXA 1OFVA 2JFYA 3HN6A 3H2IA 4GZ5A 3IIJA 5H68A 3DE2X 5CDTA 1NMEA 2ONYA 3W1WA 1TTTA 1FJ2A 2CNOA 3NNNA 4KNWA 2PKQP 5I7WA 4GVLA 3EEFA 4J49A 3NH6A 3RYTC 4Y2XA 3QNMA 2V3CC 3U61B 2RHHA 2CLSA 5B7PA 3T7EA 1Y34E 3D2AA 3QVSA 4N4AA 5BSWA 4MR7B 4Y6SA 5KPDA 4ZO6A 3DXXA 5DTJA 2A7QA 4DA8A 5C5EA 2ILTA 4G09A 3GCWA 4P84A 3SC6A 5F3DA 2WQZA 1X14A 3WA6A 2GO7A 5EJEA 1OT3A 3UWMA 1O57A 4KYUA 4LIPD 1RM0A 5LR6A 2ZS7A 1GU1A 2YYSA 2J4CA 1ZINA 1OWLA 1A0OA 3MTGA 1KQFA 2PLAA 3WJ1A 4WLVA 3HLTA 4G41A 5FI0B 2EXXA 3QITA 2FY8A 2QNRA 1CY7A 2AQ8A 3B9PA 4L75A 2J5RA 1GLNA 3AYZB 3WGOA 3L46A 4X54A 1T13A 1JL3A 2C00A 2WYHA 3UB3A 1ML4A 4DB4A 3HDQA 1Z5UA 2OXFA 1O8CA 1QSGA 3O6VA 4TS3A 4TVKA 3T7DA 3UWPA 2UYQA 5TQ2A 1M0WA 2WIJA 1PJTA 2R62A 2ZIWB 3OC0A 4PXSA 4X6YA 5T64A 4CM8A 2EOAA 2ZSBA 3A9UA 3JR3A 1XR3A 4LTMA 4KUHA 5KTMA 3HG7A 3GV0A 3NM5A 4U5QA 3Q5EA 2XGSA 4RF5A 1A9QA 5B3LA 1RHUA 5KNDA 1CDZA 2PMCA 3WKBA 3TAHA 2ECQA 1EHYA 2CFSA 1TM7E 1IHOA 5KNBA 4C43A 3TRIA 4E88A 4BJ5A 2PR7A 1JRLA 3WGQA 3R7LA 3ZU4A 3IP6A 4HDNA 2DSTA 4PNZA 3UATA 2ERYA 5FR1A 3MEQA 3QXXA 3WYAA 2ZUDA 2X42A 3DYBA 4V38A 3L2OB 4LCJA 1U90A 3N5CA 1ODIA 1PDOA 4EJ2A 2FJPA 3IOYA 4R51A 1WQ4A 4UZSA 4ZMBA 4Z4QA 3QEMA 4QG3A 3F3KA 2I7DA 5P21A 2CDRA 4CKBB 1CUYA 3B6JA 1CJKC 2GN8A 3DLPX 4MUKA 5FBRB 3ZKWA 1HX7A 1Z2DA 3HBNA 1H93A 2FPGB 2X4LA 5BVHA 3QRWA 4ED9A 3FJ1A 3EDCA 1HEUA 1W5FA 1ZK2A 3MOSA 4PNPA 3VAYA 4EHDA 3WGMA 1XEXB 4NX2A 1OI3A 5AK3A 4FS3A 1EESA 2Q9CA 1DKUA 1KDTA 2O23A 2P67A 1PFGA 3EGWA 3KUCA 1MIOA 4EKIA 4DA0A 3D3EA 3I32A 4ROSA 5CXSA 1NRIA 1SA0B 4KLCA 4B8WA 4D8VA 5CAEA 4ROTA 4M0MA 4CXMA 3NHZA 5EUCA 5JIBA 3L7LA 2CMDA 1MO5A 4Z4FA 3A1DA 5GZ6A 5K8TA 2PX4A 1D6JA 2QR2A 3MGCA 4Y2JA 2CMGA 1ORTA 4B6FA 2C5FA 5CX4A 2Z1MA 1Y8QB 2VZLA 3BAFA 4IWYA 5JBQA 1QH9A 2BEWB 3U1TA 4ADSG 5KOJB 1OXKB 1XQWA 4RANA 3WMGA 3G2KA 4HDNB 3VDQA 2D8MA 1AZSC 4DIFA 1FDWA 3A31A 5HE9A 3A1SA 1E4EB 3C5HA 1ZI8A 5C53B 4J6FA 2BIFA 4WFIA 5DNCA 3QKIA 4X7MA 1TA4A 4J4BA 1P33A 4BO2A 4CQMD 1A88A 3W4JA 3QKUA 1ETHA 2XECA 1OY1A 2P35A 1NUPA 4OMCA 4HDKA 5DTRA 5AM3A 1Z0JA 2I4RA 3C7DB 3DMPA 2XMPA 3RSFA 4NENA 5JWOA 2XZOA 1GQOA 4RACA 4IEEA 2VK1A 4MWDA 4QUIA 3SLKA 1H2BA 3TQQA 2C4MA 1MHPA 2BTQA 3IRVA 4I14A 4JITA 1YDHA 5FV4A 2UYGA 1EKXA 1KJWA 1Q16A 4D57A 5LA6B 1RQRA 4M3NA 5KWJA 3FKSA 3S28A 3RBAA 5HCIA 2IQ5A 1T1IA 1L4BA 2VNHA 1V37A 2R96A 3NNSA 3BE4A 4BDSA 4BNTA 1FMJA 5MFZA 2VDLB 4X85A 1FFXA 2F3PA 1NL3A 3TK1A 2WKSA 3EPKA 4ALJA 1O94D 1Z6TA 2N47A 2NIPA 3ZZ0A 2QYSA 3BICA 4TV9F 3DLHA 4ABTA 2I2AA 3TECE 4M99A 5AVVA