1N5IA

Crystal structure of inactive mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp) at ph 4.6 (resolution 1.85 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
208
structure length
208
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 85
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5iA00
4QRHA 1XCPA 4EJSC 1VCIA 3AP3A 3L2OB 1MKYA 2GILA 4BLPA 4EJSA 1ZMXA 1XTQA 4A8JB 2O8CA 1XMIA 2CE7A 2YWHA 3KKPA 4LHXA 3I1FA 5AR1A 1CR4A 1VECA 3WNDA 5KYKA 1RRFA 1XFAA 2P6UA 1OYYA 1FW6A 1HT1E 1XXHB 3K9NA 2IC5A 1XEWX 2GCNA 2YWFA 3BE4A 3GJXC 1NG9A 5FTMA 3QKSB 4BFSA 1FOEB 4AKGA 4MYHA 4QNMA 4LCBA 1TADA 4XSHA 2VLIA 4R9UC 5BXQC 1KKMA 4MGIR 1KY2A 4KYIB 2WKPA 3BGWA 4PHFA 3X1YA 4A1FA 5JCPA 1IN8A 2VF8A 2VHQA 2WAYA 3NKVA 2VP0A 3DPUA 4KVGA 3G5UA 1N6LA 3IUYA 1WP9A 4LJ6A 1P4SA 3NBZC 1B23P 3CRW1 1MABB 3LBNA 3LX5A 3ZVLA 3SYLA 1TAGA 4MRPA 4Z8XA 4LJYA 2VL7A 2AWNA 3OE7D 1P2SA 2EYUA 1W4AA 2Z4SA 4MGZR 2UZ3A 4IW3B 1V5WA 4NONA 3DHWC 1V43A 2C9YA 2WHXA 4JL5A 4XSGA 2CNWD 3EC1A 4LV6A 4URZR 1YZQA 5K8UA 2QAJA 2QY9A 1WA5A 5JBQA 3GLIE 4ERNA 2RGCA 1GDDA 3K70D 4ZKDA 3W34A 1NRJB 4D0LB 4EJSB 4EFLA 2A2ZA 2O8CB 1ESNA 4Y0VA 4DLXA 5BYJA 5CLLA 4HEJA 3LWNA 5J5CA 1OKKA 2CLDX 2D2FA 2KBFA 2OFWA 2ZI6A 4KV9A 2F3RA 5AJYA 2WJVA 3C16C 3ZQ6A 5HTKA 1E79A 2Z5FA 4I1SA 4QGAA 2WBLC 5HR5A 3FYHA 1C4OA 4PAOA 2PZEA 3EG5A 1ZM9A 4JBYA 4QJ4A 3K0FA 1NLYA 1E2PA 3ADCA 4W7SA 2UKDA 3PCRB 4ABYA 5CM8B 1US8A 1X1RA 5AUOB 3NEJA 1YZUA 1YKSA 3VNVA 1E94E 5B58C 1E4YA 3QKUA 3I5YA 1RIFA 4PPNA 4BFUA 1QF9A 1X86B 2LKCA 2ZRNA 3FMOB 4GP6A 2ZI7A 3QEJA 1TF7A 3CNOA 3CPJB 3KJIA 1XWIA 5DE3A 3A58B 3MUFA 5F2EA 2O8EA 4QGFA 4LZZA 5L3SA 5L3VA 2CXXA 3CNLA 1M8PA 4DLUA 3AVPA 1E2LA 4EQ6A 3MLEA 2HYDA 2REXB 1O87A 1VTKA 4KBGA 5EZ5A 1M1YE 4IDQA 3T5DA 2Q0HA 4C0QC 2LKDA 3K0EA 3QSYA 3OFNA 1KDPA 1T8UA 3KUDA 4LOAA 4BRWA 2OAQ1 3U6BA 2HLDA 4X8LA 1SXJD 1XX6A 3N2EA 3OIUA 3WYGA 4W5HA 2CL0X 3HU3A 2Y8EA 1R0WA 4AI6A 1GRQA 1OJLA 1P72A 4JVLA 5CJPA 1JEDA 1G41A 4ON9A 1U99A 1RYFA 2FA9A 4YC7A 5EP4A 4TYWA 2JLZA 5AJZA 4PSAA 2QZ4A 3IQXA 5L3QA 3UPUA 3TE6A 3WMGA 4D0GA 4DC9A 4JLDA 3WRYC 4JL8A 1NVVR 2CBZA 3QBTA 2GDJA 1UKYA 3T06B 2A7QA 3A36A 4RD1A 1G8YA 2PZFA 3GJ5A 3K0FB 3TGPA 2O8DA 2XZPA 3QJYA 5FUWA 4ZDJA 4D4KA 8OHMA 4I1VA 1PUIA 2JA1A 4HDCA 3AVTA 3IBYA 3VR1A 3FB4A 2J5XA 2OZEA 4LC1A 1US8B 2JGNA 1E0KA 2YOFA 1MV5A 3RSOA 3THXA 2QT0A 2FSGA 1XJ0A 4QHYA 3K53A 1WB9A 4FW9A 1W2GA 4D4MA 3G0HA 4TLDA 4IOJA 2O8EB 2QRZA 5L3SB 1Z6TA 2QQ0A 4HDOB 2OV2A 1OV4A 2XNDD 4EQ6B 5DIFA 1E2FA 2AK2A 3AGQA 4K46A 1IHUA 4ZI3A 1IBRA 5FTJA 3ASYA 3ZZUA 4PC3A 5AK0A 1R7RA 1JXMA 3AH8A 5F9FA 1KAGA 4TT3D 4HSEA 1XJCA 1R2QA 3QPUA 5G40A 5EUQB 1GNQA 2VH5R 2DPXA 3BS4A 1UEJA 3SJBA 4BZQA 3NH6A 2AN9A 4G5QA 4IDPA 2XTZA 3T1VA 2WWWA 4EIWA 5FTLA 1C9KA 1XTRA 1MRSA 1P2UA 5IF9A 3GLFA 1ZUHA 2FN4A 2B6HA 4I81A 1G5TA 3IIJA 1IOZA 5L3QB 1AA9A 2HUPA 4QKQA 4KJZA 5FOXA 2IS1A 5EE5B 1W0KD 3M1IA 2XB4A 1X3SA 5AJVB 2OILA 2ZJYA 4C9BA 2O5VA 3EIEA 5KPDA 1TEXA 3PG5A 3PUYA 1AS2A 2O8DB 2GKSA 1II9A 5AUQA 3VR4A 3ONWA 1J90A 1M6NA 3LD9A 2C9CA 5FL7A 2E1RA 1P73A 4C2UA 2KI5A 1ZCBA 3THXB 3AF3A 4PZZA 3TVDA 4MYCA 2RCNA 3KFVA 1R0YA 1HYQA 3OEEA 1P5ZB 5BW8A 3F5FA 4WZ6A 3ZYCA 1EG7A 2IUSA 1IM2A 1XTSA 5EUMA 3FVQA 3SJCA 1EFRA 5B57C 1N6KA 4YQFA 2BEJA 2PLRA 2Q3MA 1KGDA 4QJ3A 5KNCA 1ETUA 3DMDA 4G3XA 1B0UA 3RC8A 4MDFA 1Y63A 2EQBA 1P3JA 3BFKA 1MR3F 2O0JA 3FHOA 4CDGA 4KVAA 4MKIA 3U3RA 1E2HA 1YZNA 2W6IA 4E22A 1M7GA 1XPOA 4C0BA 1GNPA 3CR8A 3CNNA 3CWQA 3CONA 3RSLA 3M4YA 4BFVA 1HT2E 3TSZA 121PA 4BLSA 1HA3A 4L9SA 5JJKA 2QSYA 4MKFA 4Q7MB 1WBBA 3GJ3A 3HYRA 1UJ2A 1XP8A 4LJ8A 4XVUA 3GLFB 4D25A 2W2VA 2EU8A 4LDJA 4KSCA 4ARZA 3P32A 4RZUA 1AN0A 1E9CA 1J99A 3PEYA 5H68A 5DISB 2NPFA 3LQRA 1GM5A 1VMAA 3UWOA 1ZJ6A 2ZI4A 4DDTA 1SVSA 4ZDKA 3KKMA 3PUZA 4KFTA 3ZJYA 3UKDA 4FIDA 4LI0A 4B76A 1NN5A 1RW4A 2VIIA 4NMMA 4OI1A 2WSSD 3MJHA 1TQ6A 5FPTA 4B33A 4TYYA 3QXXA 1QHHA 2HV8A 1CJVC 1UKZA 3ZLJA 2EWWA 3VU9A 1GRRA 1KZ7B 4XVQA 1YVDA 2QT1A 4PANA 4Q00A 1D2EA 4YMSA 4B73A 2PJRA 2IEZA 1IAQA 2QQEA 4CW7A 2ZE7A 4PQRA 5KDDA 4OL0A 4EPRA 2F43A 1FMLA 5J4KA 4FD2A 3QY0A 4O2LA 3VTKA 1DELA 2ZVQX 1BYUA 4DUGA 4Q9JA 4NCJA 3THWA 2PCLA 3DEFA 1QHXA 4J0QA 3IDQA 2YOHA 3MWKA 3A8TA 4IVQA 3E70C 5IDVA 3ADBA 5FI1B 5TARA 3GLGE 5CK5A 1OB2A 2ZVPX 5GJVC 2IF2A 2X2FA 4MITA 2J1LA 4FWIB 4XTCS 1UBEA 4S2EA 3R8CA 5JECA 3AP2A 4D81A 1ANKA 4BLQA 3C5HA 3PENA 4ARZB 3V4RA 2O8FA 3SR0A 3AVXA 1Q1ZA 5FOWA 5EXTA 5FUYA 5GJCA 4AKHA 1YZGA 4NCHA 2J3EA 3RRYA 4C4PA 5KHOC 2VSXA 3RWOA 2X1VA 1WRBA 4BWYA 2FE4A 2D62A 5DI9A 3NEYA 1AGPA 2WVJA 4Z8YA 3AGPA 3A1TA 1H65A 2FMXA 2P5TB 4DLRA 4ZKEA 3HPRA 2ODWA 2W2TA 4TSFD 1GKUB 4TLAA 5GJBA 4V03A 3K09C 3NC0C 3OHMA 2Z0MA 3HYTA 2XNSA 3K09A 4H9GA 1YZLA 5L3RA 1G9XA 3LXXA 4EPTA 1OLOA 1QHHB 4LJ5A 3ECCA 4TMZA 1E2KA 3R7WA 2ZI3A 4KFSA 2OO7A 3VU9B 2R2AA 3LDAA 3F3YA 4RD4A 5AJXA 2NO9A 3SEAA 4L9WA 3T12A 4FI3C 3SHWA 4DDWA 1IY1A 1NN3A 3QI2A 4IOLA 2XB2A 1E3MA 3B1VA 2XEXA 5DHAA 3Q72A 1H8EA 2F43B 1FUUA 3TW8B 3Q9LA 1KI2A 3EZ6A 3KQUA 4ILEA 2ZYWX 3THWB 2A30A 1E6CA 1E98A 4OI4A 1I4TD 3VHXA 3RRMA 4C0AC 2PEZA 3QF4A 3GLIA 2VBCA 3IGFA 2D7CA 5HE8A 3SE0A 4XWAA 2O0HA 1FTSA 5JI3E 1S1MA 1W5SA 2WV9A 3NH9A 2AD1A 2GEVA 4E5UA 3AP1A 3Q7PA 2BJWA 2BCGY 3FWYA 4MA4A 4QC2A 3PQCA 4DDUA 2O8FB 1JPNA 2W0SA 1DPFA 2GJKA 1KYIA 1KSJA 4Z1MD 2IF0A 1F2UA 5H1YA 3NBXX 3OEED 4TL6A 4Z51A 2P2LA 4HLCA 2WAXA 3T34A 3QBVA 1OHHA 1KK0A 1KO7A 4NDZA 2RGGA 4MGKR 1EFRD 5E95A 1HE1C 2WWGA 1D2NA 2DY1A 2JJ8A 2QG6A 3A1VA 4TQUS 4MRVA 4Q1FA 2OESA 2W00A 4ASUA 4R98A 4U7DA 1XTIA 4TL7A 3BAFA 2W6ID 1P62B 4F93B 3DM5A 3R7WB 1XD2A 2WTUA 2R6FA 4HB0A 2YV5A 4D26A 4PR0A 2XSZA 5FOVA 1KSFX 2ONKA 1KK3A 4MRSA 3ICQB 3VX4A 4CZ2A 1TTTA 1OPXA 2F1IA 2W6JD 3LO5A 1GVNB 1YQTA 2J46A 3D3QA 3TSOA 5JMTA 1KY3A 1IN7A 3RS4A 4EKDA 1E32A 4V0NA 3U4QA 4DSNA 3LBIA 3UK6A 2ASEA 3BFXA 3EC2A 1N6IA 5AUPB 4Q4JA 2PJZA 1EWQA 1CR0A 2WWFA 2ZROA 4B3DA 3QF4B 1N5IA 2AKYA 1W4BA 2ZSAA 3MG9A 2GCPA 3U7HB 2IXFA 4BFZA 2Z83A 2DCUA 1R8QA 1YZTA 2V7QD 3DOEA 1OT3A 4MKGA 4M1WA 1MRNA 4NU0A 1JEEA 3WNBA 2FDCA 4MRRA 4PC1A 3PJRA 4NBSA 3B7GA 4YDSA 2I1VB 3PUXA 1F2TA 1F2UB 2WOJA 3I8XA 4WXPA 3KDSE 1E0AA 3SC3A 4I1OA 3UMRA 5C4GB 2OCAA 4RFSA 1NVVQ 1U8YA 3RRNA 4ACBA 4LHVA 3NBYC 2O52A 1MT0A 5FBRB 5HCIA 3G82C 4EPWA 2X77A 2G9NA 3SFVA 1G7RA 3WMEA 2ZJ5A 4OHXA 3MD0A 2DWPA 4OBEA 2FSFA 4Q21A 2FX3A 1WDTA 2ZJZA 1C1YA 1JNYA 4M9XA 4QBGB 4DVGA 1OXSC 2YYZA 2C95A 4TMTA 2WJYA 3CUEF 2ZE6A 4B71A 1XD2B 2ZRCA 4Q1DA 4OQLA 3PEVA 1JPJA 3GD7A 1S0UA 1I2MA 1VKJA 2OT3B 4XJXA 2H5EA 2ZS8A 4TLBA 2GZAA 4AY2A 3RVBA 5C46F 1OSNA 3RAPR 1G3UA 3LNCA 5G3ZA 3UWKA 3VR2A 2F3TA 1EK0A 3U4QB 2GBLA 1CKEA 2AR7A 1YZKA 2OLJA 3EZ7A 1T9HA 1GFIA 2C2HA 4Q4JB 2IYZA 2A5DA 3GPLA 2BM1A 3TR5A 2H57A 1FNNA 4G5SA 4KLZA 4DT1A 2Q9AA 4Q4AA 2DFLA 3GEEA 1ZIOA 2WKQA 3KJHA 4M21A 1P9NA 5DN6A 2RGNC 4Q1AA 1ZU4A 5JJLA 2RGNA 4Q4HA 2WJGA 3W3ZB 1OB5A 5DNYB 5L8VA 1E1RA 4LK2A 1E2NA 4PPQA 2J0SA 4BFXA 4GT1A 2JLWA 1F2TB 2D74A 5TVKA 4OK3A 1FNMA 1GKYA 5FBWB 4RFSB 1QZXA 4DB4A 1Q3TA 2JJ1A 2ANCA 1BMFD 1YE8A 1DG1G 1JQJC 2OEPA 4K81B 2RGAA 4P4TA 3WYAA 1NJGA 2VHTA 5KNDA 1BO6A 3VR3A 3KQKA 2G6BA 3TAHA 1XJQA 1W47A 2W83A 1TL7C 5TXGA 1AJEA 1VIYA 1W48A 2FPMA 2R62A 5J4YA 4ZO4A 4PZLA 3VAAA 2RGXA 3QG1A 2D2EA 3K0CC 3TJZA 4QBIA 2F1JA 3AF4A 3K0CA 1KI9A 3D8BA 2CL7X 2ZU6A 4M22A 2DR3A 4PXAA 4HAZA 3AVWA 3WP1B 3RYTC 1TMKA 3RS0A 4ZIRA 2XJ9A 3DL0A 4GRAA 1S2MA 4Q18A 5G3YA 3SN6A 4W5WA 1N6NA 3OEHD 3T5GA 2FEOA 4MDEA 4FMCF 2NZ8A 4CF7A 3THOA 1YRBA 4C30A 4UNSA 3IIKA 4DT1B 4TZ6A 1GG2A 5JRJA 2JLRA 4KSBA 4NHOA 1OHHD 4Q4AB 1QVRA 2ZITA 1SULA 2QPOA 1D8TA 4GI7A 1DOAA 3EPHA 4Q4HB 1MO5A 1OFIA 3CRVA 2WWIA 4ASUD 3B6EA 4HUTA 2VSFA 1XPRA 1GL9B 4IOKA 1NL3A 2N46A 1G3MA 4WXRA 1Q3HA 1M7BA 1U8ZA 4C0JA 4C0SA 4OK6A 3R9XA 3AUXA 2RB4A 2V54A 2ZRHA 1T3SA 4JVMA 4YMVA 4NE2A 2WZQA 4PHTA 4TN1A 1EX6A 5DHFA 1U0LA 3K0AA 2FJUA 1CBUA 2VP9A 4HATA 1Z29A 2PBRA 2QGZA 1E2IA 2H92A 4DIEA 3U44A 1TF2A 4Q48A 1UM8A 1Z0JA 5EE1A 3LV8A 4HB3A 4JBWA 5SZIA 2ZQ5A 4TL8A 2HCBA 4RD3A 5K8LA 2KWIA 4B2IA 2B7CA 4GL2A 3E1SA 2DB3A 2KB0A 4TLCA 1I4LD 3KL4A 4CEJA 3WXMA 1XEWY 5IHPA 1ZP6A 4XIGS 5CB6A 1JECA 1UEIA 4Q1BA 2RGDA 4V0OA 4YONB 1VHLA 3HR7A 1Z5ZA 4ZIRB 1XBTA 3BB1A 5KNBA 3BH7A 4LBYA 4AYWA 1G8GA 1CJTC 5SZJA 5FI0B 3W8RA 2D06A 1L4YA 4LHZA 4O0MA 4A6PA 3DKPA 4DBLC 1OH5A 4TYNA 4BLTA 3KJGA 2CHQA 5TMPA 1II8A 3GLGA 2PMDA 2FG5A 4ZPXA 1KI3A 3FHCB 4UXJA 1OYWA 3FKQA 4RFVA 2ZRPA 4L8GA 3X1DA 1TF5A 4KITB 4DB2A 2C99A 1N0VC 1E0JA 3GLHE 4FMCB 4GBMA 5JS8A 1J7KA 3CB4A 2IT1A 4TYQA 1T0JB 2IHYA 4N1AA 1Q21A 4NCNA 2J0VA 4CVNA 3ND8A 3B85A 5BQ5A 4RD6A 1W2HA 2IYXA 4LJ9A 3VFDA 1NIPA 3NHBA 1Z3IX 1T4GA 5CITA 1H8HA 4HAVA 4WAUA 1KK1A 3GJ7A 4HI0E 4Q02A 1FL9A 4P33A 4QBFA 3AVOA 3K0AB 2OAP1 1GP2A 1LS1A 4RZXA 2CHGA 2FZ4A 4M2LA 3IHWA 3J81k 3NBFA 1Z07A 2GTPA 3U44B 4HZIA 2ZRDA 4NKRA 1IJEA 1U94A 2WMNB 4WW0A 4RJLA 3KQHA 1KKLA 4H1VA 1PZNA 2JLSA 5M04A 1NI3A 3FKSA 2GK6A 3B60A 3LRPA 3TSWA 2C5LA 3EPJA 1X8LA 1NF3A 1XF9A 4CEJB 1Z22A 4A36A 1BS1A 2H17A 3L0SA 2YKGA 4CEIA 1BH2A 821PA 5KUTA 1TU4A 1XZPA 2QEQA 2NO7A 4W9MC 3RC3A 3VQTA 1A1VA 4FXPA 1KO4A 1U81A 2CHVA 1SKYB 1ZUNB 3DDCA 3QVUA 3GEIA 1G20E 4OK5A 1N5KA 1Q0UA 2E9SA 3P27A 1P7CA 5J4LA 1II8B 3D31A 4D80A 3GLGB 4ZCLA 3FGNA 3IQWA 3QOFA 1Z28A 1AS0A 4DCUA 4LY6A 1XMJA 4RCYA 1LV7A 1OFHA 4PQYA 2EFGA 3CR7A 4JLKA 4QOSA 2CEAA 4M0LA 4Q7KA 2BWJA 3EA5A 5E7JA 5FBVB 2JLQA 4Q03A 2PLFA 4TTRA 2ATXA 1G7TA 3QF7A 4X8HA 2RHMA 1WXQA 3CZQA 3I8SA 1OIWA 1W0JD 1ZM2A 2QTHA 1ZUIA 4U00A 3O8RA 2BMDA 4BLRA 721PA 1G17A 1R4AA 2NOAA 1JB1A 2QP4A 4KODA 4MUBA 4DXAA 3IIMA 1NP6A 3MWLA 3PVSA 2IX3A 4JLPA 3TBKA 4DEYA 1HURA 4PPGA 2ZETA 4LJ7A 3L43A 2GVZC 1JR3D 4YXWA 3GJ4A 3LAWA 4Q5IA 3UXMA 4LYAA 1DAMA 2IW3A 4F92B 3UG7A 4JS0A 1CR1A 4BFYA 4CEIB 1G1MA 2AD5A 5TB5A 4N0DA 2FWRA 3QG5A 1KI1A 3MCAA 4AK9A 4QGGA 3GJ6A 5JCZA 5AWFC 2QN6A 1E2GA 4B6FA 4II7A 2IHBA 1Z6YA 3A6PC 5KO2A 4ESVA 1GRNA 3RDPA 4OYHA 2QAGC 4PC2A 4OHZA 4HDQB 4C0HA 2QAGA 1DADA 4IEIA 1LF0A 1NVUQ 4LBZA 2HJVA 4RVCA 4EUNA 1SZPA 2BJVA 1NNEA 2BEKA 5CM9C 1HEIA 1JAIA 3I3SR 3MWJA 2P67A 3FMIA 2L0XA 3TMKA 1DAIA 2ZRMA 1TUEA 1TPZA 4QG7A 2IYVA 2XTMA 1DAHA 4NCIA 2QL6A 1O3YA 1GOTA 3QXCA 4DCVA 4A2WA 3GP8A 3U60B 1FMJA 1UBGA 3WHKA 1GUAA 3EW9A 5JSZA 3TNFA 3QE0A 3H2YA 3TLXA 2QMOA 2QRNA 1X8JA 3KKNA 3R9WA 1S9DA 2D3WA 1U98A 1LVGA 2CMKA 2VQSA 2NMVA 1WCV1 2QSZA 3E2IA 1FPMA 1TQ4A 5IK2A 1CULC 2ZE8A 1Z0AA 4AKEA 3QUSA 1RFLA 2CE2X 1IN6A 4TWZA 2HXYA 3R9IA 3SJAA 3CF2A 4XD7A 2QM7A 3BH6A 5CYPA 3W6PA 3IEVA 2ZJ2A 2GF9A 4H1UA 1BYIA 1T3LA 2VA8A 1VYUA 2C04A 2GJ8A 2REOA 1JALA 3Q85A 3TQCA 3TUJC 1G6HA 1A5TA 4L5BA 1CEEA 4V02A 2CCGA 4P31A 1Z2CA 4WBSA 4DHEA 4GOJA 1GZSA 3BIFA 1COWA 4AD8A 2QAGB 3W90A 4C3ZA 1SHKA 1IY0A 4FMDB 3B2EA 2HDNB 1N5LA 5TY0A 2VO1A 1AQUA 3EZFA 3CKLA 3AVUA 2EFEB 3ND9A 5JEEA 4HAWA 4GSYA 2KSQA 3REGA 1CXZA 4EFNA 4PHHA 3CRMA 3TW4A 1OKKD 3FFAA 4PSKA 1P9WA 1TEVA 1E79D 2GK7A 4QNRA 3FKSD 1E69A 5JSZB 1G18A 221PA 1E2EA 3N70A 2NPIA 2EVWX 1SXJE 2QTFA 1NLZA 1IXZA 2OCPA 1JR6A 1IONA 2PMKA 1UDXA 4TQAA 3O8DA 1T8TA 2W0MA 4Q1CA 3AV0B 4Q9KA 3I61A 2BBTA 1Z0IA 2JATA 3FPAA 4TYPA 5CLQA 4LV5B 1W36C 2YOGA 3RS2A 2IL1A 1N6PA 4US1R 4B6EA 2GNOA 3DZDA 1LY1A 3ICEA 4ITRC 4B2PA 4PX9A 4Q1EA 5GVSA 2RHDA 3V00A 1QG2A 2J59A 3P1JA 1DAGA 3QXSA 2AFIE 3REFA 3FE2A 4ESHA 2J7PA 1L2TA 1FFHA 4A82A 3X2SA 3DKVA 5EP3A 1X8KA 2HEIA 1XZQA 1MH1A 2DYKA 1Q12A 1S96A 5DI3A 5KSYA 3OFND 1R0XA 2OXRA 3IEUA 4ZI2A 3MFYA 4WZBE 3U5ZB 3AKDA 2HLDD 2VEDA 4QJ5A 1UF9A 2ZR0A 1DBSA 4CEHA 4IOMA 4KHZA 2DFTA 3I73A 3B1ZA 2PH1A 2QTVB 1NBME 2J0QA 3B82A 4Y0AA 4LGMA 1GTVA 2ERYA 2QU8A 2BVNA 3I72A 1QRAA 1CJMA 1SKYE 1NKTA 3ZD6A 1TQDA 3LA6A 1FQJA 1M34E 4RY2A 3U3MA 2JIZA 1WBDA 2G1KA 3DZ8A 3W5JA 2IYQA 2N42A 2XOKA 4G5OA 4MRNA 3LW7A 2XAUA 4XWKA 2BC9A 3JZMA 3HDTA 1PJRA 3L0OA 3B9QA 5EXXA 3SJZA 1W36B 1G64A 2R6CA 3U2QA 3UMSA 4QHSA 2ZM5A 3BERA 4KO8A 521PA 1NG1A 2ZYVX 3GEHA 2ONJA 3L82B 5SZHB 4D82A 3B13B 3OAAA 4OHWA 2MSDB 4WA7A 2XX3A 4JVSB 4B3FX 3CX6A 1KHTA 2G88A 4DWJA 4A4DA 2AL7A 4LBVA 1E1QA 5TDHA 1D5CA 2QUZA 1KO1A 5HPYB 4FINA 4LV8B 4ZDIA 5DI3B 5A4JA 5BWMA 3Q5EA 5KDOA 4A0RA 1XEFA 3ZVNA 1DG3A 1ZD9A 1RVDA 1RRPA 3AB3A 3MSXA 4UQOA 4KXFB 3ZQJA 1W1WA 2IYTA 2IYWA 4CEHB 4UNRA 3T61A 1YR8A 1WF3A 3GLHA 2QM8A 3PXGA 5CK4A 3FOZA 1PV4A 3EASA 1ZU5A 4G5GA 4A92A 4B3CA 1KK2A 1CRQA 1CP2A 5HZKA 3D7MA 4MYUA 1ZC4A 1JXOA 1YR7A 5AJWA 3V9PA 1W46A 1Z6AA 4FN5A 3PV0A 4IEEA 2WWHA 3PUVA 4JLMA 1RZ3A 1X6VA 1YRAA 2CCJA 3NC1C 4IHQA 4BE7B 5K8IA 3O8CA 4XD7D 4G0NA 5EE3A 2QE7A 2FNAA 4QL3A 3B78A 5B2ZA 5FL7D 2FEMA 2JJ2A 3CH5A 2VHJA 4DLTA 5F98A 1XDBA 5LBIA 1E9AA 1Z2AA 4A0HA 3H0KA 5B30A 4DKXA 4OI0A 4R71A 2XXAA 1BIFA 1R8SA 3GCGA 2J9RA 1N5JA 1ZRHA 2VHCA 2ZRJA 1QDEA 1G5RA 2FFBA 1G6OA 4US0R 1XMSA 2JDIA 1FTNA 1R0ZA 5FTNA 3FMFA 3ETLA 2C98A 1FX0A 2CL6X 5FPKA 2LCFA 1M7HA 4K8OA 2V8OA 2PT5A 4HZUA 2OSBA 3ZZTA 4IRUB 4G5RA 2WIAA 2P6NA 1Q57A 5H8WA 4B48A 1E9EA 4B44A 4JVNA 2R8RA 2KBEA 4D4LA 3QKTA 4HLDA 3HJNA 3GLHB 1EXMA 3NHAA 2H8KA 2QROA 3F0TA 3VR5A 1E9RA 2GEDA 3IPXA 4NYMQ 2YWEA 3QVVA 1AK2A 1UBCA 1EFCA 4C0LA 2WJJA 4RCZA 1YR6A 5FBQB 4JYCA 1HQCA 4NYIR 1J8MF 4M4SA 2IXEA 2OE2A 3CWZA 4P0TA 2FPLA 4B3BA 1S4QA 3RRZA 2C03A 2H16A 2CDNA 1R5NA 2NO0A 2OBNA 2WPDA 2XTNA 3CRQA 3CRRA 4PC7A 1XEXA 4B47A 3VR6A 1T6NA 3PEUA 3JZAA 3X1WA 1ZM4A 2FPKA 1AZSC 2HT6A 3KJEA 2O8BA 2HF9A 1U0JA 4AKIA 4NYJQ 2CK3A 1RYHA 2ODNA 5C4MA 1G8HA 1T5IA 3MGCA 4GDFA 1T0HB 4DSUA 2YJTD 1E2QA 4KCGA 2XXAB 1U8AA 1G19A 4LYHA 3ZS9A 3SU8A 2P6RA 4IVPA 3OESA 1RE0A 1XTJA 4BASA 2WJHA 4AWXA 1F5NA 1L4UA 4JYBA 4I99A 2WJIA 4DLVA 3FMPB 3TKLA 3MJRA 3WBJA 2F55A 1GWNA 3M0EA 4RSGA 1OXTA 1FX0B 4U5XA 5JS7A 1D9XA 1E96A 3QPWA 4I1UA 2FOLA 2OXCA 3EA0A 4Q9HA 3R8FA 4OJQA 2OBMA 2ODBA 4HZUB 4RD0A 4O3MA 1LF5A 2QPAA 1NVWQ 2CVHA 4JLNA 2FGKA 4DUGD 4WZAE 3D6TB 3LBHA 4KI0A 1TQ2A 3I62A 2ZJAA 4JLOA 1AGRA 3ZVMA 1Z6XA 2VP6A 1HUQA 3AVVA 1UBFA 4P32A 3A1UA 2ZRLA 2V6JA 4CIDA 5JWOA 2BKEA 4HB2A 3OE7A 1X1SA 2RGBA 2XGJA 3KB2A 2BMFA 4A15A 5FTKA 2V6IA 1GIAA 2CNWA 4A0GA 3LLUA 4HB4A 2MSCB 1J70A 1AZTA 2ZRGA 4URWR 1XEXB 2WM9B 2AWOA 2JASA 2I3BA 3OAAD 3K70C 4P4UA 1FZQA 2BCJQ 1J2JA 2O8BB 4AG6A 4PO9A 1T5LA 2ZJOA 3OIVA 1YHNA 4A2PA 1UFQA 2NTYC 1T3HA 2CVFA 5CJ2A 4DEXA 1D2MA 3V4FA 2IWRA 5FBLB 4AC9A 2VYFA 3OF5A 3BORA 3KFXA 1Q1BA 5FR1A 2J45A 1LFDB 2GHIA 3PUWA 3ZGXA 4HAYA 1E9SA 1UPTA 1SGWA 3AKYA 2A5JA 3W5IA 3MMPA 4JT4A 3WRXC 4GP7A 4IKEA 3GJ0A 3MAAC 3SFZA 5KSZA 4PC6A 4Q01A 3CIOA 4GOKA 4B43A 1H8ED 3AKCA 1HTWA 1LW7A 3BD9A 3IILA 3BOSA 5BN3A 1IJFA 3HU2A 1JQLB 4HUQA 3GQBA 4XVRA 3RS5A 1PLKA 2EWVA 2JCSA 3PEWA 4DLZA 1ZD8A 2Z4RA 3F8TA 4RKEA 3EAQA 3SNHA 4F7WA 4MKHA 1N3BA 3HR8A 3QIAA 5B64A 4BUJA 1U2RA 2C96A 1KMQA 4BZPA 2VP5A 2ZXUA 2ORVA 3IO5A 2GAOA 4UJ3A 4XH9B 1SXJC 2NO6A 2ZU0C 1DO2A 2KE5A 5J40A 1GAJA 1SXJA 4IXMA 1ODFA 1ZNZA 1XRJA 3PR1A 2ZR7A 2ZAOA 1Z08A 1OXXK 2ZI5A 1KJWA 4Z54A 1NIJA 3K70B 1VG1A 3LX8A 1VCOA 2NZJA 4X8MA 2CJWA 2OCYC 4PQFA 4GMXA 4TMXA 1U90A 3CO5A 3SI7A 1ZD1A 1KTVA 1KDOA 1IN5A 2VSOA 4IVRA 2BIFA 3HP1A 2G0NA 3E5HA 1QBKC 1SVLA 2ZTSA 3FTQA 1G16A 4US2R 1KZGB 1GKIA 1MO3A 3THYA 4UNQA 2XSZD 2C78A 3A4MA 2G3YA 2GJSA 2Q21A 2E87A 3P4YA 4HLQB 1HV8A 2R6DA 1IXRC 5J4HA 2I4IA 5ELXA 1G4UR 2GRJA 2QMEA 3NTUA 5EP2A 4DJTA 2JLVA 1N2CE 1ZINA 3CX8A 4KLNA 1E0SA 4LHYA 3M6AA 4M9QA 4TTQA 5A5GA 3WNCA 1U9IC 2LWIA 3QQ5A 4HUQB 3U3JA 5CDFA 4AIIA 5AUNB 1NBMA 1E2JA 1K5DA 1DVRA 1Z8FA 3GFPA 4B74A 4DLYA 2XNDA 4R2HA 2V55B 3NWJA 5LB4A 1KJZA 4RD2A 2CK3D 5IRCD 1VDZA 2A5GA 3GFOA 2IYSA 1S8FA 2G77B 2EFHB 2Q3FA 4PO1A 4TT3A 4TMKA 4AG5A 1T91A 2ZYTX 4UXHA 3K9LA 3VKGA 1AIPA 1SXJB 4B3XA 4ZCMA 2GJ9A 1KDTA 4KBFA 2IS2A 1UKVY 1BOFA 3B1YA 4BGDA 2AX4A 1Q1EA 5DYIA 4XTRA 2G83A 5C2JB 4KFUA 2Q9BA 5TV2A 4IFEA 2V1UA 1NN1A 1VG8A 2CJWB 2ERXA 3DVLA 4BLOA 1WMSA 3T1QA 4AYXA 1YU9A 2ZEJA 5DLQC 3BH0A 1VG9B 3T1OA 3VX3A 3CPEA 1HH4A 4RZ3A 1ZIPA 1DTSA 4HAUA 3SHFA 1W0KA 4LHWA 5CB8A 2I1QA 2CLCX 3KZ1E 5IT5A 3EIHA 2ECKA 1QHYA 3THYB 1XD9A 3BWDD 4DLWA 3S1AA 2GXAA 4B3GA 2C77A 1R10A 1F3OA 4WOPA 3SZRA 2FSIA 4FCTA 1R5OA 1KI7A 4JMPA 4F4CA 5KTYA 1E4VA 1G3QA 4IDOA 3B1WA 5JHHB 3KQLA 1G3IA 1G291 2VP2A 2FV8A 4EPYA 2GETA 2BBOA 5JZVA 3QENA 4Q7LA 3O47A 2R44A 4B75A 1RJ9A 2QPTA 2IA5A 2ATVA 2MMCA 5J47A 3EWAA 4LYJA 621PA 2VP4A 1PUJA 5DN6D 3C41J 5JHGB 5FPYA 4NPHA 1OH8A 3NG1A 1E1RD 1XNJA 2CCKA 2WSMA 4LJAA 1Z83A 4R7ZA 1UAAA 5UKDA 2F6RA 3LLMA 2REBA 3BK7A 1MO4A 4D4JA 1AM4D 5DGXA 2GXUA 5GVRA 4N0EA 4URXR 2ZR9A 2TMKA 2JJ1D 3K8YA 3IBGA 4NYMR 4Q9IA 2A5FA 4XWOA 2DHRA 3KTAA 1RRCA 2H1LA 2AK3A 2J41A 2R6GA 3SS8A 1L7VC 1XCMA 1WQ1R 1A2BA 4V0ME 4EPVA 4DSTA 1CR2A 5HZHA 4ACAA 1MOZA 1SKQA 1DAKA 1VCMA 1E9BA 2AXNA 2RH5A 2YVUA 3JVVA 4GFDA 3EXAA 3H86A 5H70A 2YHSA 3H4MA 4IDNA 2ZSDA 2HJGA 4NP6A 4NZYA 3KKQA 1Z47A 2OCBA 4LWZA 4NYJR 3S1AB 1LTQA 1TX4B 3W6NA 3LQQA 5EQTA 2GEUA 1P2TA 2FFQA 1PVOA 2P5SA 4B32A 1KIMA 1LB1B 3BRWD 2IYYA 3KX2A 1N0WA 1ZNXA 4LJ4A 4F4IA 4A0FA 4CYMA 2WSSA 4LPSA 3WYFA 4HAXA 2F7SA 5DH9A 3SBDA 3EPLA 1VYTA 3A4NA 1RJ9B 3HWSA 1Q1QA 1DAFA 1DE0A 2IUUA 2IYRA 2CLSA 4PHGA 1E2DA 4LYFA 1K6MA 5GADl 4DZZA 3L0PA 4E03A 5HCNA 2FGJA 4FMDF 4MGYR 2Z6VA 1KO5A 2KJQA 4YDHB 4BEBA 4DSOA 3NXSA 5LPNA 2ZS9A 3OIWA 4POAA 4OQNA 1ZM7A 5JFGA 1SVMA 2XZOA 2DFNA 4NYIQ 1G7CA 1HQYE 5FUXA 2YC2C 3Q3JB 4Q9LA 3KTAB 1R5BA 3QPVA 1RRGA 5D3QA 3VKWA 2GF0A 4L16A 2BBWA 3VKHA 1OXUA 2D4HA 3BXZA 1I4DD 3HU1A 2WMOB 3QEOA 2QNRA 4PTLA 2QP9X 2R6AA 3B9PA 1Z0DA 5KPJA 3ASZA 4M1YA 5LDDC 2VPPA 4XOIA 2XZLA 4NH0A 3BFVA 3HPQA 1YJ5A 3RABA 5DYGA 5KSPA 2J0UA 2OBLA 5EE9A 2F9MA 1NBMD 3C15C 2QENA 4MYTA 2ZPTX 1JI0A 4Q7JB 2GCOA 4TSFA 2HXSA 4KFRA 5HKKA 3LW8A 5KU1A 4JL6A 3L8ZA 3RHFA 3QXHA 1DEKA 4S35A 2GJAA 1WE2A 4B34A 1EX7A 2BM0A 3CF0A 1Q22A 1M2OB 2AHOA 4EDHA 1NMYA 2WWYA 4P3YA 4PFSA 3LH5A 4A9AA 2DFKB 1A4RA 2J7KA 1Z63A 1W4RA 3ZD7A 4BFWA 1A82A 2IYLD 1E9FA 4EPXA 5E4FA 2G0TA 1S1CA 4I4LA 1FUKA 1OE0A 1NMZA 3RS3A 2MMGA 4URUR 4V0LA 2BOVA 4N3NA 3K9GA 4JIMA 2ZRBA 4JLVA 5F3WB 4O25A 3C14C 1KI8A 5C18A 2A78A 2ZI9A 3MWYW 3N5CA 4M53A 5JEDA 1UADA 5P21A 3WY9A 1SVKA 5LB2A 2ZRAA 2B7BA 4V0KA 4UJ5A 3L0IB 1H8HD 4U02A 5FOUA 4AYTA 2JLUA 1SVWA 4QBHA 3WMFA 3I32A 5E7IA 2VRWA 4M1KA 2WICA 3Q8XB 2G1JA 1Z6GA 5EZ6B 2N1BA 5JWHA 4TMWA 2Q3HA 3A4LA 2EFDB 3TQFA 1SHZA 4PZYA 3AKEA 4A6XA 4ZV4A 3PFIA 4Z1MA 3ADDA 1FP7A 1EFHA 3A37A 5D3MA 1N0UA 2F9LA 3KQNA 4F4JA 4IXNA 3NVAA 1XXHE 2J0UB 4UXIA 5G41A 3NIBA 1KSGA 2IUTA 2UVQA 4D6PA 3K0SA 1OIXA 1P2VA 1U0HC 2IXGA 3C8UA 4PPFA 2IBMA 1GL7A 3WBKA 4KU4A 4FMBB 4L4UA 3KKOA 2GCOB 2V1XA 1GILA 2V4ZA 1EFUA 2QI9C 3DO6A 5FUVA 3W9YA 3CH4B 3SDZA 2GZDA 4BQSA 3W3AA 1XD8A 1JR3E 5JJIA 1F60A 1W44A 4YMUA 1SVOA 2B21A 5E7MA 1S3GA 1NKSA 2OUKA 3PIRA 5CYOA 3U3OA 3WP0A 4JKYA 4CT5A 3I92A 1HY3A 2W6JA 1QG4A 3FDIA 3NDPA 1E9DA 1KSHA 2OG2A 4IJMA 5EP1A 2Z43A 4DIDA 3AVQA 1NVXQ 2K5UA 4GZLA 4MUAA 4LRWA 3KB1A 4TZ0A 2PX0A 1F48A 1JJ7A 3UG6A 3O8BA 5EJEA 4WIAA 2RKOA 3BJIC 4AURA 1LS6A 3BC1A 4JSTA 4KAXA 1P9RA 5FFMA 1TU3A 3TUIC 4Q47A 1OFTA 2BDTA 5CDFE 2WKRA 2V7QA 4M1OA 3LY5A 2ANBA 1DARA 3U7EB 3BB3A 4PO8A 3U6KA 3TIFA 5CIWA 5FL3A 3SBEA 5EXSA 3CZPA 2YZ2A 3CBQA 4P4SA 4YXWD 3N2IA 5D3MB 5GJWC 3W6OA 2RAPA 4MH0R 4YMWA 3CW2A 3UATA 5F9HA 3CPHA 5EE0A 2PCJA 2V9PA 2R9VA 2QORA 1QHIA 2ORIA 2GZHA 3IO3A 3UANA 2H18A 2QBYA 2SHKA 3BBPA 4DLSA 1R6BX 2BHRA 2QA5A 5A0FA 2F1RA 2VTKA 2W2XA 4FCVA 1EGAA 1ZC3A 5G53C 1QHNA 2P0EA 3RLFA 4LC0A 4URYR 4BPBA 1PLLA 1CLUA 2X2EA 1JAHA 5E3HA 1KO8A 1OF1A 4BFTA 3TUZC 1G21E 3K9HA 5HE9A 2FFAA 1K5GA 4BEJA 3ZH9B 2QMHA 1RPZA 4DCNA 1NY6A 4WVFA 1G8FA 1QHSA 3Q7QA 3T1TA 1ZNWA 2PL3A 1N6RA 3H1TA 1XTKA 1DS6A 1UDWA 1OH6A 2ODEA 1KNQA 3SQXA 1SQ5A 3EIQA 1ZM3A 3A1WA 1GITA 3EPKA 4C2TA 1M74A 2Q6TA 4TMVA 2B92A 5CIQA 1RC8A 1Z0KA 2OFOA 3WHLA 1W7AA 3ADKA 2PZGA 1F6BA 1NJFA 2RGEA 2OM2A 5HKKD 1PLJA 5BN5A 3ZS8A 4E07A 5IK2D 1EWRA 3CLVA 4P4SB 5SZKB 3W8NA 1CTQA 2JLXA 4GZMA 5JWRA 2NIPA 4O2RA 1MO6A 4F38A 2B8WA 2ZJ8A 2B8TA 3T15A 2JLYA 2YINC 1BMFA 5KSOA 2FH5B 4M8NE 2XJ4A 1ZNYA 2MSEB 1P61B 2ZRFA 4TTPA 1KMHA 3L8YA 4C7OA 4G01B 1GSIA 2QBYB 4TQ9A 2ZREA 3K1JA 3LFUA 3KXIA 2EYQA 5JRZA 1G3RA 2AFHE 4DDVA 4OKSA 1KI6A 1COWD 4HLUC 1E2MA 1Q20A 2A3RA 5DO9A 4HLUA 1G5PA 4LX0A 3I4LA 3H84A 4IFBA 3AEZA 5FOTA 5FR2A 1AKYA 1TNDA 421PA 4D0NA 5BN4A 1SVIA 5FPHA 1CS4C 4CRWB 3ZVRA 2A5YB 2DWOA 1XCGB 3GMTA 1NSFA 4Q19A 4GNKA 4DRZA 1KDRA 3OEHA 5KOYA 4FCWA 1L8QA 1S3SA 1ZYUA 4MQBA 5FPSA 3C7KA 3LXRA 1K8RA 5EXPA 4ZDWA 5J4VA 4DCTA 3NDBB 1AKEA 2OLKA 2AKAB 3AF2A 1W4CA 4M1SA 3OIYA 1EESA 1XB2A 2ZAMA 4OI2A 4JJZA 2XITA 3AF1A 2IS6A 2A9KA 2ZSFA 4V0MA 2GVDC 4NTZA 4NCKA 1UKEA 2BMEA 4PAMA 4B2LA 4D2IA 1KAOA 3GJ8A 1D6JA 1W36D 2V3CC 1A7JA 1IN4A 2PT7A 3ZIAA 4FWTA 1XU4A 2C8VA 4OJKA 4RZ2A 3IKJA 4LBWA 4M1TA 1CJKC 2BBSA 2J7PD 1N25A 4C7OB 1KMHB 4JZKA 1DO0A 2UZIR 1OFUX 5ANRB 1E99A 4EFMA 1ONBA 2GA8A 1CRPA 4PAQA 5JLJA 3QXJA 1VG0B 2DWQA 1KI6B 4JSYA 4TLEA 5FOSA 1KNXA 3GLIB 4Q4LA 3EZ2A 4OQMA 3RANA 1JJVA 1P60A 1ZAKA 5FH9A 1YR9A 1II0A 1J8YF 1NMXA 3SOPA 2IYUA 2EFCB 1AS3A 4IDHA 3ZZ0A 3KXKA 2X8AA 1G7SA 4QXAA 3U7FB 2FF7A 2H7VA 4L15A 3TVTA 1IQPA 2O0KA 2RMKA 2WOOA 4TL9A 5C1BA 3DM9B 3RS7A 2IK8A 5LD2C 2AXPA 3EZ9A 2F1HA 2ZUCA 3B5JA 4F91B 1S9HA 3KUCA 4LPKA 1HE8B 2NG1A 3SYKA 6Q21A 1VCNA 1AQYA 2YC4C 1XPUA 2JIZD 4YLGA 1TUIA 3P26A 1BKDR 2XOKD 4JJKA 3A1SA 3P20A 1ZW6A 4NL4H 2HF8A 4PSVA 3GFTA 3GLFE 2HT1A 1EFTA 4M1MA 2GESA 3FFBA 4JLJA 1NLFA 2EW1A 3PITA 2BMJA 1ESMA 1G8PA 1XMVA 1FQKA 2WIBA 3QKRA 1P6XA 3KXLA 3LVRE 4B35A 1KJYA 1I2DA 1ZVQA 4M9ZA 3RNLA 4E09A 2NQ2C 1FP6A 2PX3A 2GAAA 3T35A 4URVR 3U3KA 2FZLA 4BECA 1Z0FA 3I5XA 3TH5A 3VNUA 1JBKA 1VYVA 3SYNA 1OIVA 3AVYA 1E1QD 3B1XA 2GBLC 3X1XA 2ZSEA 2Q9CA 1D9ZA 2YNMA 2YWGA 2ZANA 4EAQA 5BYKA 3C4JA 4KYUA 1ZBDA 3JVUA 4JBXA 4ZCIA 3X1ZA 2ZS7A 3VHLB 2HYIC 1IY2A 4M9SA 3VMFA 3FHTA 3R20A 1LNZA 4UNNA 2OFXA 2C9OA 3AM1A 1Q44A 4YMTA 2FU5C 2GWHA 2IS4A 5KDLA 1IXSB 2QGNA 1CIPA 3LVQE 4GPTA 3AUYA 1ELOA 3EWSA 1VHTA 3ZDQA 4UNPA 4DCSA 1OXVA 5LD2B 2ZUBA 2ORWA 2ZJBA 3Q5DA 3U7GA 3EARA 3TAUA 4A2QA 3IPYA 2BKUA 3IHLA 2JAQA 2X19A 5JI2E 2FSHA 2QE7D 3B8HA 3UMFA 1KOFA 1RKBA 3OZXA 1GL6A 1GNRA 3DMNA 4JLAA 4A8JC 1W5TA 2JJ2D 4OHVA 4A8JA 4UKDA 2D7DA 3DOFA 2R65A 3P4XA 2GXQA 2GXSA 1KI4A 1N6OA 1XXHA 3QKRB 4BZXA 2ZSBA 1CJUC 1W0JA 4GMDA 4QGHA 4OHYA 2VHUA 2ZUDA 4BRUA 2W58A 3QKSA 4QFMA 1W49A 1ZCAA 5DSZA 1NY5A 2JDID 2DBYA 4RKFA 1CF4A 2ZRKA 4QHTA 4CGZA 1QVAA 3CF6R 3MRSA 2PEYA 4W5JA 2FFHA 3QNUA 3BB4A 4C0KA 4JT2A 1NN0A 2BV3A 1A2KC 1JR3A 2QP3A 1G4AE 4X8OA 3TK1A 2QMUA 4OQFA 2VF7A 1OH7A 3AQ4A 3CX7A 1Y3AA 4JKIA 3UIEA 4R2IA 1N6HA 4OQXA 3SQWA 5K8TA 2J87A 3RWMB 1MABA 4QM6A 1QHGA 2OHFA 1DAEA 3AF0A 3TR0A 4QM7A 4JLBA 3TRFA 2ZE5A 4CT4B 2WWXA 1VPLA 2IWHA 2ZIAA 2NGRA 3C5CA 1P75A 2JEOA 4LUCA 2ZYUX 1OW3B 2NO1A 2HCJB 1Z06A 3CM0A 4Q66C 3ZIAD 1NSTA 1CU1A 1VIAA 2IEYA 4GOXA 2ZRIA 4G1UC 3EX7C 2P3SA 2P65A 1U9IA 2WPDD 4LSGA 3U61B 4HYYA
chains in the Genus database with same CATH superfamily
4Y2YA 4YAFA 4X64B 1ZHHA 4QRHA 4EHLA 3OTWA 4G84A 4MVJH 1MKYA 2DQYA 2GILA 2IFTA 4LISA 5ADUS 5C7OO 4FTWA 3NM4A 2HLNA 3GPBA 3JALA 4HN2A 3VR5H 3M82A 2GD1O 2PD6A 4LHXA 2O7QA 4TTJA 5BSHA 3OPMA 3EQ7A 3WNDA 2BLNA 3HB0A 1NZJA 1XFAA 1U8EA 4BKUA 4B7UA 1FW6A 1ETHA 5HX7A 2I8LA 2LPMA 3K9NA 3WNQA 2GCNA 1IZZA 4JGIA 4G8JA 2ORED 3QKSB 5FTMA 4BFSA 1NAIA 2IOQA 4MIEA 4MYHA 2HBRA 1BRMA 1TADA 5GOTA 3ZWOA 3U9SA 4TVBA 3TLGB 1WHSB 2JA2A 4Z5XA 3JVEA 2PA0A 1SQSA 2VAXA 3LCJA 4WKBA 1PU2A 2HF7A 2QXUA 3BGWA 2RSLA 3UUFA 3RYIA 2KQUA 2XW6A 4PHFA 4C2BA 1H9AA 3A05A 3KAKA 1E3LA 1RYMA 4M6WA 2VF8A 2WAYA 1CWUA 5DWDA 1G8SA 4KVGA 1N6LA 2GAFA 3IUYA 5BR4A 2UZ1A 5BWOA 3G9ZA 3DFFA 1CZUA 1B23P 5C8YB 1MABB 3SKYA 2JBAB 3SJUA 4INPA 2VYNA 5TLSA 2Y4OA 1E7QA 2RGYA 1H6BA 3SYLA 4N5NA 3R3HA 3O1IC 3E7XA 1CT9A 4LF8B 2AWNA 3OE7D 2EYUA 5LQKA 3RQIA 3RWBA 1CEYA 3ZXUB 1KU6A 3AJ8A 5ER9A 5HUJA 3RRJA 3DHWC 3NMUF 2WHXA 4JL5A 2GLUA 3P5BA 3RAJA 4DMCA 2XB8A 1ZW1A 3JATB 1N7JA 2BGIA 1JAYA 1TRHA 4L72A 5DTQA 4I2VA 3S2UA 2PPLA 4EX6A 3GLIE 3D4LA 4YPVA 1NRJB 1HZJA 3DTTA 5IBPA 2DH5A 2VNIA 3DE7X 3JQAA 4Z4FA 2O8CB 1K06A 1GGKA 1T5OA 2NO4A 1IBCA 5CLLA 3LWNA 2CLDX 2KBFA 4QT0A 2EZ8A 1X9GA 4LGVA 4MCJA 2OOKA 2IQIA 3PHIA 3ZQ6A 2R6ZA 1KBQA 3ZK9A 5I7AA 2FQ1A 2ID4A 1CQWA 2IZ1A 3F9IA 2LTAA 1SG6A 4JYMA 1NQOA 4QGAA 4V3BA 3Q9NA 4WMLA 3STWA 2R1TA 3DC2A 5C4IA 1NNI1 2PZEA 4JI1B 4CUZA 1ZM9A 4DC1A 3K0FA 1BROA 2A8YA 1E2PA 4R51A 3GDWA 5LDHA 4W7SA 3FPEA 3PE3A 5LC1A 4AMYA 4CT0A 3RYHA 3AESA 3DEAA 4C0WA 4RDHA 4R5HA 4BQRA 5A0VA 5B1DA 4F72A 1H4VB 1E4YA 4N82A 2W2LA 3QKUA 4AJKA 1RIFA 1T9GS 3PHGA 4RACA 3PZRA 2ZRNA 2EP5A 4W5RA 1U6IA 4O8CA 2Y2VA 2XH8A 2ZI7A 3VYSB 2ZSKA 4EG8A 3GRPA 5JXHA 2QTAA 1Z7YA 3KJIA 3VKUA 4LSZA 3KETA 3CZMA 4FSHA 5DE3A 2O8EA 2A6PA 2ZVJA 3NAMA 4LZZA 1P29A 1E3WA 4U9HS 5IASA 5L3SA 5L3VA 2LGJA 4BCDA 2QMYA 1KY5A 1O87A 2REXB 2WAAA 3B1JA 2IE8A 3NHSA 2ST1A 1LVUA 4IDQA 3WKBA 1ABEA 1D2GA 5FIUA 1T8UA 4R54A 3UCXA 3EQZA 1WUKS 5L53A 3COJA 3ETEA 3PRJA 5BSFA 4X8LA 4DCOA 1GSAA 1HORA 4PN3A 2PGDA 2VTEA 4KAJA 1QO9A 3QV2A 1QAMA 2IY8A 4J0GA 3ON5A 5ILQA 1W85A 3AG6A 4JVLA 3ZKAA 4YHHB 3UGTA 3VJKA 1CIJA 1U99A 4MWGA 2FA9A 3CLHA 3N7TA 4TRRA 4TYWA 5AVSA 2EOAA 1N2EA 3E35A 3ZXIA 1OXBB 1REQA 3E5NA 4JX8A 3WMGA 4DC9A 1YMVA 1EDDA 1J7JA 2Y77A 1EX1A 3BXGA 3RF7A 1C9YA 4KKVA 1XR3A 4MUHA 5THKA 3X1MA 3M6FA 4M36A 3PNPA 4KPYA 4HY3A 4NRDA 3D3WB 3RJ9A 2O8DA 2JFFA 2WT8A 3M6VA 1A9XB 2XZPA 1N92A 3DHYA 3QJYA 4M7PA 5DW3A 5KYVA 4OD0A 1PGPA 1HFKA 4DSZA 1RXWA 1ZUWA 1AVTA 4HDCA 5BV8A 1T0UA 3GJRA 2J5XA 3ND5A 4LC1A 4ZZ0A 1W96A 3EFBA 1RWVA 5LLSA 5C8XA 3THXA 2AFHB 3RSOA 1XCJA 2FR0A 2QG4A 3HCRA 2P9FA 1MVLA 2FSGA 2JAXA 2WJZB 3RLIA 1KOGA 5KAPA 3GJYA 5SYMA 1RPAA 1XJWA 1U5AA 1YS2X 5ICGA 1W2GA 3SVTA 1KJ9A 2XMPA 4IOJA 4TLDA 3NORA 5AXCA 2B61A 2VUUA 1Z6TA 2QQ0A 4HDOB 2OV2A 2QVGA 3ZHYA 2XNDD 4EQ6B 4QA9A 4I9NA 5K0CA 3B36A 4RTKA 2IXBA 3ZHTA 3R5HA 1IHUA 3H1AA 1I0IA 1ZUD1 3QELA 4YJ3A 3C39A 3T3GA 1KAGA 4LY3A 1H1LB 2DP4E 2OCIA 3QPUA 1IE3A 1QGOA 4FJ2A 4IRMA 4QGBA 1C9DB 4BZQA 4KLAA 3ANLA 3IKLA 4G5QA 2D2VA 1U3VA 3COVA 4IDPA 2IE0A 5LOVF 3TQTA 2AG0A 3MQFA 3AM4A 3PA6A 3ABZA 3P2IA 3TBHA 1ZUHA 4YX9A 3ZHUA 3GLFA 1EUZA 1G5TA 3FTNA 1SC6A 3IIJA 3L9XA 4KR9A 1ENYA 2RB5A 5F1YA 3WZ2A 4F2DA 1AA9A 3MT7A 2KYRA 4S0ZA 2QZPA 3VISA 1B6TA 1W0KD 3AUSA 5EE5B 1X3SA 5E1OA 3LP6A 2ZLBA 4PZDA 3R9XA 5HSGA 5FRDA 3DMFA 5CG2A 3EIEA 5KPDA 1MXHA 1I7QB 1C2TA 1M0EA 2VS1A 3VR4A 5J2UA 1G42A 1VKNA 3AY0A 1XVAA 3O3MB 2GJ4A 2VJBA 2I1LA 2VYND 5AHRA 5B55A 4PW0A 4WLEA 3WWPA 2C9CA 4MVCA 4AJOA 3SVZA 1B6GA 4NR0A 1P73A 2QQGA 2JVJA 4HGYA 2XVXA 1CETA 2R4QA 4BNZA 3TQRA 1Z73A 4C2UA 1IOWA 2IP1A 2JGLA 4PZZA 5JDCC 5MGBA 4MYCA 4OJMX 4UM7A 5TIIA 5JDCA 2Q5OA 2RCNA 3BREA 3ZD8A 1U1FA 3KFVA 4ARAA 1R0YA 3L0ZA 1LWNA 1ZOIA 3OEEA 2RBEA 5BW8A 2GPYA 1EG7A 3F9CA 1IM2A 2EKDA 4KXMA 3FVQA 4MRMA 4CODB 4YPOA 3AKZA 3S4YA 3CCFA 1YS9A 5CNJA 4LN1A 4YQFA 1WOMA 1KGDA 2Q3MA 2E4VA 3BIOA 5KNCA 4KPFC 1OVMA 2CJFA 2ZB4A 3JQAD 2V6FA 4MDFA 1Y63A 2C2GA 1DXOA 3AILA 3GUVA 3FFXA 4EMBA 2EQAA 4B4VA 5J5AA 1P3JA 1MR3F 5AW4A 2O0JA 2C1EA 3IP6A 1L9KA 3OF2A 3PNQA 2PQMA 4MWOA 3U3RA 1E2HA 1NV8A 3K0BA 5TPWB 4IF4A 4UBMA 4J0FA 1SPXA 1HT2E 2VUSA 4IWNA 1HA3A 4I1RA 1Y37A 4L9SA 2QSYA 1PFGA 1QCZA 2W42A 3AO0B 1A9SA 4Q7MB 4RJJA 3GJ3A 4XGQA 2XPCA 1TA9A 4KOAA 4RNDB 5TS3A 1XP8A 3S1SA 2E1PA 2R5NA 3CXRA 4OM7A 4WXEA 3NBUA 4OL9A 4D96A 4D25A 3SZGA 4FKMA 1JDBC 1QVWA 3WLAA 4KK4A 2W2PA 2YZKA 2B94A 1QRDA 3VNAA 2VT3A 1RHJA 3ZGNA 2YZMA 4DGQA 2I55A 2JI9A 5IWCA 2BCEA 2X0NA 2F90A 3LQRA 1BD4A 4UUQA 1VMAA 4PYMA 4M1QA 1BFUA 4IVNA 3K30A 1E4OA 4LWPA 5DGIA 1XPJA 3LYAA 3PRHA 1Z5NA 3A31A 1LK5A 1P0CA 1NN5A 2C31A 4J0CA 2VIIA 2J3JA 1H2RS 4NFLA 2QVXX 5IJXA 3W79A 4AY3A 1QS0A 1FFBA 1P33A 4DMRA 2WSSD 3V3KA 1YRHA 3F6YA 5BVGA 1MEJA 3ETGA 1QRRA 4ZVLA 3RK0A 4B33A 1LK0A 2JAPA 4OAOA 2QW1A 2EWWA 4N8SA 3OZIA 4J0IA 4L0CA 1K0UA 4LDNA 2CXPA 2E4YA 2JFBA 2OD2A 3GG2A 1WUHS 5BWBA 1YVDA 2OCGA 3S2SA 1FQWA 2QT1A 1U02A 4PANA 1D2EA 4Q00A 4YMSA 2M1XA 1FJ2A 4GKAA 5DXFA 3RNOA 4B73A 5J2TB 2EW2A 2F59A 1IAQA 2IEZA 2VJKA 3I2FA 4CW7A 1UWCA 3KL2A 4D8UA 5H16A 4AZ0A 4CIBA 3CXUA 4JJAA 1DT3A 3OC6A 4O2LA 1A77A 4JASB 3E22B 4UEQA 2M6LA 2ZVQX 4NZOA 1QF7A 2W9XA 3IBFA 3LX6A 3NWEA 4Q9JA 4F4DA 4LI3X 3H9BA 3T95A 4QODA 3MWKA 4R16A 2MYUA 4J75A 5IDVA 3WHIA 1P5RA 2HU5A 5B7NA 2C2ZA 1A2QA 2J9FB 1A71A 2ODPA 3R0JA 2LZ0A 2ZVPX 3GFFA 3LQ4A 2DAPA 2W4IA 5GJVC 1DRUA 4MITA 4XTCS 4FYIA 3WRVA 2OC4A 1D4ZA 4TV8B 3UAYA 3RUPA 3C5HA 1NOIA 3DTVB 4ARZB 1ORVA 1VE1A 3DWGA 2VPYA 1U3WA 4ZT7A 3S44A 4MUNA 2OK8A 3NATA 4G2TA 4RM3A 5BYAA 3GRZA 3RWOA 2X1VA 1WRBA 3A2LA 2FE4A 2ECOA 5DI9A 2C2KA 3GGSA 3LG2A 3AGPA 3STTA 3HBJA 3QX7A 1V6AA 2P5TB 3IUJA 4HWGA 4K87A 5AK6A 4BMSA 4JBGA 1IC6A 3HPRA 4TSFD 4AP5A 3EGOA 3A04A 1NJ6A 1PFWA 1FYDA 1V35A 2CMGA 3I9MA 3K09C 3NC0C 3O3CA 3OHMA 4XEHA 3O2SB 4H9GA 3K09A 1MJHA 3AYXB 4FI3F 2Y1EA 5COBA 2JRCA 1I1HA 4CLDA 5JT1A 2QRGA 4QX6A 1F8YA 1OLOA 1QHHB 4RJIA 4D7AA 3ECCA 1YB4A 4TMZA 4UDOA 4EPTA 5AM2A 3DA8A 2FPGB 4KFSA 1VC2A 4UVEA 3H9EO 3LDAA 1C7JA 2PLWA 3AB7A 2NO9A 4RY0A 4ZARA 1IN1A 4L9WA 2Y1FA 2FJ0A 3RUDA 1W9MA 2O06A 4DDWA 1IY1A 4IOLA 1E3MA 4CQMD 1IQ0A 3JCZA 4KO1S 3T9AA 4LYEA 2UDPA 1U7PA 3TLKA 1T9BA 4GYWA 3VU8A 4M55A 2OD7A 1X2BA 3UJCA 2Q5QA 4E33A 4YJGB 4XGKA 3I01M 2C7PA 3KQUA 4ILEA 3W1VA 5DYTA 3EWNA 4NAHA 4E31A 3SHTA 1B3BA 4DLLA 3RRMA 3IDZA 3GLIA 4CMKA 3IGFA 5T5QA 1BVHA 4ZVKA 1FTSA 3RU9A 1S1MA 3VR4D 1GZDA 3NH9A 1FB5A 5JI3E 2QVYX 5K3FA 1CFZA 2NSJA 2O50A 3AP1A 3Q7PA 4PYIA 4R31A 4WXYB 3T7KA 3D0QA 4Z0HO 4RGBA 4EL5A 3TX2A 4DMFA 1T9ZA 3NHZA 5FCDA 3RG2A 4DDUA 5JPCA 2O8FB 1ZR2A 4NU6A 3M6UA 4Z4GA 2XYQA 2PZAA 3PS9A 3GRUA 1KYIA 4LWOA 4Z1MD 3A9RA 3WLJA 4F97A 3FYUB 3OEED 3HP7A 1QTNA 4FEEA 3KQVA 1RYNA 3QBVA 1OHHA 4BJ1A 1KK0A 2PO5A 4NDZA 1N75A 2AW5A 3SX4A 3ZGVA 1D2NA 2JJ8A 5KNCD 4TQUS 4MRVA 1SEVA 4Q1FA 1I3CA 4KQ1A 3HDVA 1G2PA 1OTXA 2J9XB 3NT4A 1GZ7A 3BGVA 3NHYA 4FVTA 1AUOA 4HQ6A 1Z8DA 2E49A 2C8JA 3BAFA 1OPRA 1RBYA 1P0IA 4H7IA 4YP6A 5G0WA 2QTRA 4XUEA 3IDSA 2WAMA 4NI5A 2R6FA 2QM0A 2YV5A 5E2IA 1DCTA 4UOQA 2IHKA 4DHWA 1GLNA 4YRLA 2N0SA 2OM6A 5EJIA 1C9NA 4CZ2A 3ICQB 2V7UA 3R75A 4YV2A 2YXEA 4YAKA 2FW9A 4POOA 3CVJA 3TSOA 5JMTA 3E58A 1KY3A 3K8QA 3MUEA 1E32A 1RAHA 2Q3DA 2WY2D 1X13A 3PPIA 3LBIA 3UK6A 2ASEA 2P5YA 2VNHA 3I1YA 4I46A 2PV7A 5ARCA 1FJGB 4AF8A 1AUVA 1Q15A 5AUPB 2PRJA 2X7XA 1W4ZA 2WWFA 2ZT8A 4B3DA 5CB4F 3V7NA 3MG9A 2GCPA 3Q1LA 4WPGA 4YK7A 1EIZA 1NBIA 2C4WA 2DCUA 2LDBA 3OHPA 4YRPA 3FWNA 4NNPA 3RAGA 2V7QD 1IY9A 3H2KA 4CTOA 1OT3A 4HQKA 4R0MA 2P9QA 4MKGA 2IP2A 5T3YA 5MN5A 5IU6A 1X0XA 3TINA 3K1ZA 2ZBPA 1JEEA 4R3UC 3WNBA 2FDCA 2JKVA 2H52A 2X1HA 4PC1A 4NBSA 4RJKA 4YDSA 4ZVNA 3O91A 4KOEC 5IT4A 2I1VB 2F2TA 3E2MA 3B6ZA 3KSBC 3PX7A 3PUXA 1F2UB 3BHMA 1M0TA 4WXPA 2QDKA 5C4GB 5I7WA 2YTZA 4HWKA 4R68A 3RRNA 3WJ7A 4DLAA 2CZCA 4LHVA 3NBYC 1KMIY 2Q6IA 2XT0A 2YY7A 1LJ8A 3HZRA 3WV5A 4M3NA 4QU5A 2JIQA 4WASA 1RMTA 4BMZA 2DLCX 2VZEA 5A0TA 3R6GA 4Y7DA 3TKYA 5D6NA 1XKQA 3KJZA 4GSLA 3M3DA 4EB3A 2DWPA 4F5DA 1NQUA 2FSFA 4ZVQA 3TF5A 2FX3A 4M9XA 3KYIB 5IC5A 1OXSC 5AOVA 1P4HA 3AEUA 3HUUA 2C95A 3UXEA 1LNSA 2WJYA 2VHEA 4QWMA 5CFQA 2VQ3A 4F85A 3H9JA 4IG4A 3PEVA 4S12A 1JPJA 1OZAA 4CE6A 4HOYA 4CKXA 3BAZA 1U7DA 1H0KA 1S0UA 2OT3B 3A6ZA 1NVMB 3KPJA 1F4VA 1QXSA 2FMUA 1R6XA 5D1NA 3PQ6A 4ETNA 2XEDA 1JJAA 1MIOA 1WMDA 1L6IA 2IGTA 2J32A 3LNCA 3UWDA 4E94A 3U4QB 4XQGA 1XDUA 1XNGA 1YZKA 2OLJA 3EZ7A 2AN1A 2XE8A 1P4GA 2BM9A 2NXNA 3IP9A 4Q4JB 3RRFA 5T4BA 3LC7O 1VL0A 3OPQA 1FFXB 4IWXA 2BM1A 1AF4A 1FNNA 1L8XA 2MSKA 5CNMA 4DT1A 1MNAA 3LRTA 2HADA 2Q9AA 4OB6A 5F5NA 2GGSA 2DFLA 4FHCA 4Q4AA 4ZYVA 1ZIOA 1P4RA 3IXQA 3KJHA 4GX1A 5FEMA 5HKBA 3I62A 5DN6A 3E27A 1V1RA 5JJLA 1JG1A 5HEKA 1AHIA 1UEXC 4J4TA 5DNYB 3UH1A 3NR2A 2AJ8A 4LE2A 3VBCA 1GPKA 1E2NA 2B20A 2HSJA 1AKRA 2NVOA 4PPQA 5H81A 4CG2A 2WHQA 1FVHA 1RXYA 4ZEMA 2JLWA 4UM5A 1RHUA 4OQPA 2P77A 4F9EA 5FWNA 3GCDA 4NULA 4AZSA 1EJ0A 4KQIA 4S05A 5BSWA 5DJ5A 3PXBA 2AYZA 1XSEA 2J5RA 2RGAA 3EXG1 2VHTA 5KNDA 5J5VA 5U9CA 1D4AA 2BTOA 1O7JA 3QX8A 3K71B 3UGJA 1XGKA 1W47A 1THMA 2WFAA 1TL7C 1DI0A 2VC2B 2R62A 2UZAA 3DT6A 5DGTA 4ROSA 4O4JA 4G0OA 1A0OA 4PZLA 4RYLA 3R7FA 3VC1A 4AJJA 5J4YA 1DAOA 2D2EA 3K0CC 1T5HX 4QQKA 5DXJA 1MHTA 2C4UA 3K0CA 1A9YA 2AN4A 3MMXA 1Q5PA 4L85A 3OLVA 3QVOA 3QHAA 1KFKB 4HWTA 3FI9A 1BAPA 2RI1A 3MJCA 1MX3A 4OQEA 3QE9Y 1T13A 2R2GA 2ZR8A 1KYZA 4G5YA 3W4KA 1SCBA 5DYWA 2FG7C 3RS0A 1J09A 4FFVA 3JD0A 5C7YA 3DL0A 5G3YA 3PFWO 1ZK2A 5DEOA 4U6QA 4AP9A 3OEHD 4ZYLA 4ZYZA 1ZGHA 2FEOA 4RZQA 3OOYA 3T5GA 3R3WA 1YRLA 2X15A 3A7DA 4BQIA 4UMEA 5AKKA 1V9CA 1VJ1A 4JBLA 3RUCA 2AMFA 3G1WA 3KG2A 4JITA 3WKCA 3HJFA 3NRBA 3JYHA 1DL5A 2OGUA 2DWCA 4UHFA 3M4JA 5JSFA 1OHHD 3EZYA 1X92A 5F21A 1SULA 5TC4A 5AVVA 4CV2A 1D8TA 3EPHA 4PLPA 4JUBA 4LK3A 5FJIA 1OFIA 1XG5A 4YRQA 3WK5A 2NTEA 3CRVA 2A7XA 3BD6A 3HA2A 1H93A 3AI3A 4G0YA 4P38A 1T4CB 3B8EA 1L5SA 4Z86A 4DR1B 2VSFA 3KPWA 3Q10A 4MHOA 4V0RA 1XPRA 1QTQA 4IOKA 4OQ4A 1NL3A 2C20A 4PIVA 1FSPA 2IV7A 2OPHA 1JDNA 3TI9A 5EJMA 4C0JA 1Z8HA 1U8ZA 3WE7A 4XGRA 4LJKA 4CDMA 5KYTA 3S99A 1YVEI 4NE2A 2WZQA 4FYVA 1GRCA 4TN1A 5DHFA 3K9QO 1E6WA 2YJ4A 4ZO9A 5A9RA 1NJ2A 2FJUA 2WW8A 4ZJZA 1Z29A 2PBRA 2Q2WA 2X6QA 1XMPA 2BFCA 3RVRA 4Z49A 3LVFO 4Q48A 4HB3A 4YNBA 3R7AA 4JBWA 3RSHA 1T36A 4EY5A 2G82A 1TCCA 3KZKA 4KQMA 4NCXA 3JPWA 2L2QA 2HU7A 4J9VA 5K8LA 4MDYA 3VTZA 1JFVA 3CTPA 3Q6NA 3UAZA 1PHPA 4KRFA 1IDOA 1XEWY 3KQMA 4HRAA 2GZMA 3ENKA 3EGXB 4Q1BA 2J3DA 5T41A 5CNIA 4MWEA 2GTHA 1T2NA 3T4XA 1RQLA 1I5EA 4D9MA 3O2JA 1UXKA 5DHUA 1YRYE 3BH7A 1C1HA 2D5IA 1KFEB 4L22A 1P7PA 4A6PA 3AL2A 2AFVA 3PTLA 3WGHA 3AJ9A 2PGIA 3NJ4A 4TYNA 3DMRA 4YT4A 4GE0A 2VZ8A 3IS3A 1MX5A 1AQ6A 1U3TA 4LGYA 1KI3A 3FHCB 4ZN6A 1OYWA 1T2CA 4YO7A 4BX3A 5C5IA 2C3MA 4RFVA 4WV3A 3X1DA 2PNJA 1IG3A 3C6ZA 1AV6A 3W77A 1A9PA 3GLHE 1E0JA 1QTRA 4FMCB 5JS8A 2Y1CA 1J7KA 2C84A 3NRCA 1H22A 2ENUA 4TYQA 1OC2A 3C85A 4O5AA 4H4CA 3G13A 3M4ZA 4QBTA 4B4DA 2OCXA 1XV5A 5KB3A 4DQXA 5L6LB 1SU4A 5IJ0B 3L7AA 1NWCA 1Y3IA 2ZAIA 3B85A 3GVXA 3ND8A 4GGMX 1ZK3A 1PNOA 3F8WA 3L1VA 4I5DA 4JT9A 1O1YA 5BSRA 1VHDA 3VFDA 4L57A 3IHKA 4D0RA 4R05A 2QK4A 4DYDA 3ANMA 4WAUA 4TWAA 5CITA 2BFNA 3T5AA 2SNIE 5B58T 3V4LA 5CA1B 4BMDA 1GP2A 4K3VA 3M5CA 4M2LA 2UU9B 3IHWA 4OHFA 3S55A 1K2WA 3OUZA 4UTVA 1JIKA 2H6EA 3HO6A 5CDTA 1PK8A 2ZRDA 2YNMD 3VPAA 1WSAA 2PQ2A 4V39A 3OLCX 4H1VA 5AM0A 3WTCA 2BHTA 5M04A 1NI3A 1RXEA 3FKSA 2GK6A 4GL4A 3PYMA 3H87A 3LRPA 3L84A 1E5QA 5ALVA 1U63A 1GU7A 2ZUUA 5KQRA 1Z8NA 1X8LA 3RJZA 3QVWA 2HU8A 4CCSA 2O8BA 2PANA 3AEQA 2YKGA 4YUYA 1L4HA 1VBNA 4I4CA 1POXA 5G0UA 5KUTA 1XZPA 2IH4A 1EE2A 2Z58A 4CWAA 4HG2A 4UBJA 1D6MA 3GXOA 4MPTA 4HNQA 3RC3A 3DT8A 1CY0A 2QM3A 4J4BA 5FV4A 2YHIA 3HEMA 4PNHA 3JZDA 5REQB 1P81A 3WB0A 4KIUA 3T5TA 5T4EA 3E5MA 2PUEA 1Q0UA 2Y0EA 3OPXA 3PC3A 4RK0A 1P7CA 3EISA 1SBHA 4D80A 3ETHA 1KR2A 1I4OA 4CM4B 5C32A 3P94A 3P4UA 4W1QA 3EF3A 1UIMA 4X7BA 4ZCLA 3SXJA 1Z28A 4JJ6A 2NP6A 1LV7A 4PQYA 2EFGA 1LRJA 3NHFA 2A9OA 1A72A 1RLJA 4QOSA 1Q0SA 4RF4A 5EWJB 2FMHA 4JJ8A 2CEAA 4M0LA 2VDWB 5KNDD 1KP2A 3EA5A 3NAZA 3DFMA 1BJRE 4HBGA 1QH9A 4MR9B 5KOHB 4JYPA 7REQB 4BO1A 2Q2QA 3TZCA 1AQNA 1MB2A 2JLQA 2PTGA 3CUKA 3O83A 4GGOA 3VOBA 2ATXA 1G7TA 3IVXA 1GEEA 4AF6A 4TV9F 4DOMA 1NC1A 1H5QA 3D6HA 2FSVA 2FUG1 3ZG6A 4QPNA 4ABTA 5KKNB 1G17A 3BMQB 5LMNB 3LHIA 1IWPB 1PFUA 3OFJA 3PNBA 4C4AA 2IX3A 3DBLB 4OLHA 3ONEA 1IHOA 4URFA 1HURA 2PXAA 4X00A 4FCCA 2R1VB 1L4FA 3IE0A 4IP0A 3HFRA 1YB5A 4GZ5A 4LECA 4PPGA 5KX5A 4ZYYA 3T3IA 3CX3A 4AWBA 2IY9A 5DNDA 1P1IA 3G7NA 2IYPA 1JLKA 1ND5A 4N3AA 4GSKA 2C7QA 3N39C 4LYAA 4RWEA 3C3AA 1T26A 2D13A 4F92B 4EI2A 4JS0A 1CR1A 1NQWA 1SUAA 2Y92A 2WHEA 1G1MA 4FHEA 3IUQA 4MQ6A 4C87A 4M7WA 5BSGA 2FK7A 3C4VA 4GBGA 2ZWVA 3H3XA 1C7ZA 3HHEA 4QGGA 3EEQA 2FR8C 5JCZA 3QQPA 3ORHA 1C7QA 1A88A 1B41A 1Z4NA 1V48A 2FR8A 1R0BA 1OX4A 1E2GA 2QN6A 3F6CA 3D02A 4B6FA 1J9EA 3N9IA 2IXTA 4UE6A 4II7A 2H1VA 2OHGA 3QU7A 1N8SA 3UWPA 4ESVA 4D0SA 1BFKA 4I1IA 3VVMA 1OLXA 2QAGC 4YCMA 3HXQA 4C0HA 1MMFB 1JH8A 1B43A 2QAGA 4RVCA 3A26A 3QFSA 4LBZA 1EBUA 2R751 1XELA 3FRHA 4FC7A 4AVYA 3ER9A 5FNVB 2UUBB 1SIBE 3CLUC 2NVUA 2BEKA 3W2GA 2DETA 5B1YA 1T6ZA 3WYBA 2TSYB 1SU8A 2P67A 2O7RA 1Q84A 2PJUA 3AL3A 3CEJA 3IODA 3IURA 1LW6E 1ZMBA 2A9QA 1EDZA 3LUCA 3VVCA 5M29A 2IYVA 2ZTMA 2SCUA 1W25A 2QL6A 1BX0A 2YIMA 3P0RA 3N2ZB 4A2WA 3U60B 1RI1A 3QE0A 4NJEA 2OD9A 2R8EA 2HIHA 4FEAA 4GQBA 4YCBA 3KKNA 3WQQA 1QP4A 1RACA 3R9WA 3WL7A 5BMVB 3HCOA 3ZWMA 4F2WA 4ZOLA 2VCEA 3GI1A 1JFFB 5CD9A 5HM6A 5EJGA 3TIIA 7ADHA 3D5EA 2NMVA 1WCV1 2JHPA 3PUIA 3E2IA 1W29A 4G0QA 1EFDN 3BVPA 3WR5A 3QOXA 2DLNA 3EDQA 1EYZA 2H2HA 4MKXA 4DC0A 1IN6A 2RFLA 3SIXA 2VPXA 4EPRA 1ZVKA 2HX1A 3DUFB 2MJLA 2QM7A 3BH6A 1VIVA 3JWHA 4XD7A 5CYPA 2FP3A 4W8GA 1B76A 1GLVA 4LQLA 3W6PA 4BJ6A 3IEVA 3PCTA 4LQDA 1EG2A 3F4LA 4H1UA 3RREA 4O4IB 3D2LA 2NVBA 3SC4A 1XALA 1NXOA 1B6RA 2REOA 1MEEA 2YWRA 3EDOA 4C3OB 3GHYA 5J2TF 1NONA 4BV9A 3K72B 2VKTA 4P31A 3GDFA 4MCIA 4XM2A 5CLGA 3SS7X 16PKA 1Y42X 1TYZA 4MUJA 3LY7A 4DJEC 2BGMA 2BR4A 3K6KA 1X7DA 1UBOS 2B1RA 3AV3A 3DFKA 1XL1A 4I2NA 4IINA 3TIGA 4H6PA 4K1XA 1WNFA 3D6NB 1NR7A 2HB6A 5EAIA 5LWQA 2O5EA 1PJAA 3FAZA 5TY0A 4BNTA 2QJOA 5HJ2A 2OOSA 4O6VA 2XNKA 3ND9A 4HAWA 3QUQA 3CT6A 3GNTA 1YR2A 2C4HA 4GSYA 4ND3A 5FWYB 5CFPA 1R6VA 5AVWA 1JLHA 1ZVMA 3ELBA 3V8BA 3BPSA 5DM60 2C7OA 3IVAA 4TV8F 4DMKA 1E79D 2H1SA 3FKSD 1BOOA 3EXIB 2C5BA 3O8QA 3QNWA 5J4LA 4HDKA 3N70A 1SXJE 2XUFA 4N7JA 3W1WA 5IEJA 1HE5A 4ALIA 1X7YB 1IONA 2PMKA 3CR3C 4DIFA 5KVCA 3PJDA 4OG2A 2IH5A 2H3EA 3O8DA 1JG7A 4Q1CA 3AV0B 3NNSA 2JL1A 1J21A 1PCXA 4HGOA 4Q9KA 5ALDA 1P31A 2BBTA 1Z0IA 1C80A 3FPAA 4TYPA 3W9UA 1T6BY 5F1OA 4OIMA 5K05A 1E3EA 3DZBA 2DH6A 1M2FA 1PG0A 1WUYA 1RQ7A 2W2MA 3BMOB 3FBGA 3NB0A 4US1R 4WE3A 3RSGA 3TZBA 3WL3A 4B6EA 4LC9A 4KP7A 1LY1A 4Z0PA 2NNLD 4RPKA 3OPYB 5GVSA 1AKTA 3QFCA 2ADFA 2ZRQA 4II2A 1DAGA 1YA8A 2BPOA 2Y1DA 4QWWA 2CSUA 1CB7A 1L2TA 2J7PA 3DW1X 4YRBA 2NXWA 4X6XA 4MX8A 5CX1A 1YQXA 3DFUA 3LCMA 4J76A 1X8KA 1MH1A 1QH0A 1QK5A 3ZWYA 2H29A 1NMSA 1U2GC 1R0XA 2DPYA 2R8YA 3QVSA 4JI6B 2P9YA 1U2GA 3MFYA 1AHPA 4MYSA 4WZBE 4QUDA 3AETA 3AKDA 2HLDD 4TXMA 4Y2HA 4AB1A 1VLVA 2VEDA 4GWLA 4QJ5A 2ZIUB 1U1DA 5BOSB 3EN0A 2OHIA 2GPJA 1VYHA 1YDGA 3RVOA 4BN4A 3NASA 3FOWA 4IO1A 1I2AA 1G5IA 4Y18A 5IABA 4GOND 3ABIA 1VJRA 3L41A 5A03A 1ISIA 2J0QA 3OQNA 2ERYA 4GC5A 2QU8A 1QX4A 5LYYA 4RA9A 3EIXA 3WICA 3LYHA 2WMYA 3FTPA 3PYLA 4UTPA 2ZFUA 3CHYA 5DM2A 3ZD6A 5CAEB 2DR2A 1OBCA 1JTEA 1ZI9A 3RF6A 1U7TA 4X3OA 2WNHA 1HYEA 1M6WA 2O3RA 2XKBA 5LFAA 3R7SA 5B4UA 1J1UA 3BWBA 5CCDA 2IYQA 2N42A 2PBLA 4WHMA 5ECYA 2I2AA 3W5JA 5JH7A 1TVKB 5F51A 4J7XA 4P3OA 3LW7A 1ZGCA 4FFBB 3PWTA 1SUPA 3BGDA 1F8UA 4GXNA 1WD5A 1J8DA 5GV8A 1SHLA 3UMSA 2R6CA 2Z8YM 3G9UA 3G5AA 1ACLA 4HXYA 3BERA 2J5QA 4WLFA 1C81A 2HMYB 5IBQA 2WFZA 4Q24A 3SHQA 2JHCA 3GEHA 3DDNA 5HF8A 3L82B 2FHSA 3C3YA 1K4KA 3BD8A 4R7GA 4CMJA 1S01A 1GTL1 1T4MA 2C92A 2I8AA 3N8NA 1G6KA 1X77A 2VSNA 3B13B 4FZRA 4OHWA 4JVSB 3ZHXA 1S8OA 1V11B 2GZ1A 2WFLB 4B3FX 3QEMA 4E2ZA 2GNPA 4EDFA 1KHTA 3HXKA 2JLCA 2NXEA 1SRQA 4OQZA 4EKNB 5K01A 3CLUD 5AKEA 4A03A 1O77A 2C4MA 2VK2A 3KDPA 1SD2A 1K7SN 2AL7A 3IT1A 4IDFA 3VZDA 2QUZA 1KO1A 2VRCD 4FINA 2VVTA 3U4CA 5A4JA 5BWMA 4X91A 4WFKA 3TDKA 3ZVNA 3VI3B 2HCTA 1JP7A 1N5DA 1RVDA 4EFDA 5L40A 3MSXA 4W5TA 2IYTA 3IAXA 4HNTA 3NKLA 3V46A 3MMSA 3WB2A 4UNRA 3T61A 4F8YA 5I4IA 5ICEA 5ICMA 1XZGA 1PSDA 1YR8A 2QZ9A 1NP3A 3EA4A 3GLHA 2QN8A 4DEVA 2BFOA 1C30A 3PXGA 5D1HA 5DLEA 4M0UA 2GM4A 4QIHA 3EASA 4DREA 3NHKA 4UPDA 1OOEA 4QTUB 4RF2A 4G5GA 3H2SA 4DMHA 3L4JA 2FX2A 3IEMA 1CRQA 5BV7A 1FFCA 4M0FA 3AXSA 3TMAA 4MYUA 2W2OA 1W46A 4MW6A 1Z6AA 4JKOA 2XVAA 5GTDA 4PYRA 3PUVA 1T8SA 4IHQA 1X6VA 2OUIA 2YWDA 4KREA 4FP9A 2C2MA 2AMLA 1GPJA 4XD7D 4XRGA 5JMOA 2QE7A 2ZYDA 1OZGA 2Q5IA 1I80A 1SQFA 2WSBA 4YJ2A 2DKFA 2EDAA 4M8IA 4X20A 2VLBA 4DLBA 4DLTA 2JJ2A 3CH5A 2XA1A 3F5DA 5G2OA 1XDBA 3O5AA 4NEQA 3SEZA 5F98A 3A6LA 5D5PA 4M9CA 1E9AA 4JQYA 2PZLA 2YV3A 5LBIA 3H0KA 2NSYA 2HHLA 4R0VA 1J0AA 3CTMA 3FPFA 4MJLA 2XXAA 1EFPB 3H8WA 1UOPA 3KM0A 3GCGA 4CTKA 5IKXA 1N5JA 2QPLA 3BIXA 3VH2A 1H2BA 1M1ZA 3JQCA 2ZRJA 3K35A 1JG6A 4X1IA 1G5RA 4J7AA 3HLKA 4ICIA 3WIEA 1R1DA 1G6OA 1NNSA 1M8JA 4GPAA 4BNDB 2JDIA 4LSMA 3QBDA 1PX2A 5FTNA 3U0BA 3NU1A 3WL8A 4RYDA 2AOXA 3NYWA 4K9DA 2Q7OE 4CXMA 2CL6X 5CR9A 1PR3A 2GCEA 3ZJTA 2BZ0A 3BF7A 4FUTA 4IRUB 5A7GA 2O1SA 4G5RA 3RODA 3BTSA 2WIAA 2P6NA 4RK7A 3Q4GA 5H8WA 4ARIA 1DOHA 3ECAA 4JVNA 4B44A 4WOKA 4OBBA 4Z4QA 2G70A 3QKTA 4AURA 2GR9A 4BDSA 2HREA 4D4LA 1RAAA 1WUJS 1W5BA 3R0ZA 1JHYA 3M5PA 3RU3A 1L5WA 4FFLA 1NPTO 2JIOA 3HBMA 5J63A 5HJ5A 3TXAA 3S8EA 4C7VA 4EM6A 5TNXA 1AK2A 2YR0A 3F1KA 1H3EA 1UBCA 1EGHA 1AQJA 1OC4A 1EFCA 3G8AA 2BDEA 4RCZA 1MAVA 5DB4A 4XCVA 1LSUA 1HQCA 2GKGA 1QIHA 1YD7A 3C6KA 4B3BA 2OHHA 4HNHA 1IY8A 3RRZA 4RSMA 2R00C 1PKXA 2GPAA 4FHDA 3VC2A 1I7PA 2R00A 5F5XA 1T6NA 3UC9A 1FFEA 1E1LA 1VA5A 2I3ZA 4O3FA