1N5IA

Crystal structure of inactive mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp) at ph 4.6 (resolution 1.85 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 85
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5iA00
3U6BA 3MMPA 1EXMA 4OI1A 1KJZA 3OHMA 3WMGA 4K46A 1GDDA 1A82A 4Z8YA 1X1SA 2C03A 3A8TA 1LTQA 4MYTA 2BC9A 1E2MA 1B23P 3R9IA 3R9XA 1Q20A 4HLDA 1KGDA 3WRXC 1E2PA 3THWB 1IN7A 3U6KA 3X1DA 3THOA 2A7QA 2PCJA 5E95A 4WZ6A 3TUIC 3TVDA 3UG7A 2WSSA 4YDSA 2OCYC 1E2NA 5FBLB 2NG1A 4OK6A 4H1VA 3ICEA 2ZANA 3DVLA 2E1RA 5TY0A 5DI3A 2IEZA 5BQ5A 4MKHA 3LNCA 1VG0B 4CRWB 1D9ZA 4O25A 1G20E 1VMAA 3FKQA 1R4AA 4US1R 2IHYA 2JLYA 5L3RA 2YKGA 3ZD7A 2KI5A 4D81A 3BAFA 4KITB 3LWNA 2ZJ2A 1S3GA 1AZTA 1Z83A 3ZH9B 4AYXA 1QVRA 5EE3A 2FU5C 4M9ZA 1Q22A 3QQ5A 1U0JA 4OBEA 4EPVA 1UDXA 2YINC 1NLYA 2FV8A 4ASUD 1G41A 3SYKA 4BPBA 4PQFA 3LXXA 3DDCA 3QKRB 1NN0A 2J5XA 4OK5A 3HPQA 2BIFA 2CMKA 2ZS7A 2AWOA 2AXNA 2VSOA 4L5BA 1VTKA 1OH8A 3SQXA 1QHSA 1KI4A 3PITA 1HEIA 3PVSA 5LDDC 2H1LA 5EUQB 5J4LA 2JJ2A 1MRSA 1GL7A 2UZ3A 3EWAA 1P7CA 3QKSB 3LX8A 2IYSA 1KI3A 3MCAA 3KJIA 1BIFA 1EX6A 3GPLA 1YVDA 4FMCB 1E99A 3KFXA 4NCNA 2JJ1D 1G4AE 3L0PA 3T1OA 3AVQA 4DJTA 2R62A 4EIWA 5KSOA 4CEHB 1O3YA 3UWKA 1T3SA 3IEUA 3GLIA 3VKHA 3DPUA 4QJ5A 4DSTA 1ZVQA 4RZXA 3EIQA 5D3QA 1GVNB 1W5TA 4A8JB 2VH5R 4C9BA 3FE2A 3EARA 2R6FA 3QPWA 4UKDA 2QY9A 2BWJA 1UBFA 2ZYUX 4W9MC 2FJUA 5L3SA 1RIFA 2QROA 5IK2A 1BH2A 1N5IA 4ZKEA 3UXMA 3AVUA 2P5SA 2IYTA 4ABYA 4URXR 3A1WA 3KQNA 2P2LA 4URWR 2BBOA 2Y8EA 3LVQE 1AK2A 1JQLB 3TKLA 2BKEA 4HLQB 4MKGA 5KSYA 1M6NA 4I1OA 2OM2A 1YRAA 2XX3A 5L3VA 5C1BA 3GD7A 1NG1A 4LZZA 5H68A 3U3OA 1CS4C 3LVRE 2I1VB 4PO9A 5G3ZA 5J4HA 3RS4A 3PEWA 4UXHA 2HDNB 1CJKC 4GMXA 4G5GA 2C95A 1M7GA 4Y0VA 1OB5A 1NKTA 2Q0HA 2ONKA 2DFKB 2QRNA 1MABA 1T0HB 1N3BA 3DKPA 1PUJA 3BH0A 1DO2A 4TLDA 4TWZA 2UZIR 1TNDA 3RWMB 5KUTA 2AR7A 1DS6A 2AWNA 2H16A 5JEEA 4L9SA 4MRRA 4JT4A 4EKDA 2GWHA 2RB4A 2WJJA 3TUZC 3KQUA 4JBXA 4HLCA 4FMBB 3D31A 4K81B 1VCNA 2ZI3A 4M2LA 1ZUHA 4NHOA 3ICQB 4PFSA 2QRZA 3FGNA 4DSNA 1XMVA 3VKGA 3W8RA 2FFAA 4PHFA 1XJ0A 3GEEA 1KI2A 3OIWA 4RD4A 1HH4A 2PJZA 1YZGA 3B60A 2WWWA 4N0EA 1CP2A 3EPKA 3IKJA 3QXJA 3CPHA 1ONBA 1UEJA 1GNRA 1K6MA 3PG5A 2CLSA 4N1AA 1CEEA 1XTRA 3GJ6A 3L0SA 4DC9A 1YHNA 1G8PA 5IT5A 2FDCA 1COWD 3BWDD 3PUZA 2YOFA 5IF9A 1SKQA 4L16A 4IDOA 5BYKA 2NO6A 3K9NA 1M1YE 4QGFA 1KDRA 2WJVA 2B7CA 3FPAA 3T5DA 4B3XA 3A36A 3QF4A 2C99A 3O8RA 1CF4A 1F2TB 1Q57A 2QNRA 4N0DA 4TYWA 5GJBA 2F3TA 1TF5A 1R0WA 4BFTA 1XD2A 1ZC4A 3CNNA 3W8NA 1HUQA 2JEOA 1FQJA 2CLCX 5BN4A 2AFHE 4JVMA 2XXAA 3ZQ6A 1KKMA 4QFMA 4DXAA 1EFRA 4BLPA 1W5SA 4F4IA 3VQTA 4GNKA 1ELOA 2H92A 1SKYE 3A1VA 4JLAA 3RVBA 1ZCAA 2QAGA 4DEXA 1JEEA 1XEWY 3HU2A 2BKUA 4B76A 1Z0DA 1YZTA 1XTSA 2H7VA 2VSFA 4P4TA 3QENA 1VCIA 5FOTA 3BBPA 5FTNA 2CBZA 2CEAA 4LYHA 4JLBA 2GJ9A 2JDIA 4M1OA 4TMWA 3UATA 2GAAA 3HR7A 4IXMA 3OEED 2EVWX 4C2TA 1D8TA 3VX4A 1G19A 1RE0A 3GFPA 2GEVA 2JGNA 3QY0A 3EAQA 4TYPA 2AKAB 3AVOA 4KVGA 4DWJA 4AKIA 1VHTA 1VECA 4DBLC 1NF3A 4G5QA 5G53C 4A0RA 3F3YA 1Z5ZA 1S3SA 4ZV4A 2HXSA 3GLFE 3N5CA 3EX7C 2FGKA 4NYIR 2CXXA 1YR7A 5KDLA 3KKOA 5KHOC 1X86B 3B85A 1N0UA 3I8SA 1YZQA 5J4YA 3LBIA 3KDSE 2PZEA 2V4ZA 4KAXA 1GIAA 3IHWA 3K70B 2WWHA 1XTIA 2IYXA 2ZS8A 3ETLA 2W58A 3OIVA 4XTCS 3P26A 5DHFA 4Q4JB 4Q4AB 1SXJA 4BRUA 2J0UA 1XTJA 4GBMA 3E2IA 5C4GB 2DR3A 2G6BA 3H1TA 2NIPA 3CW2A 4JKYA 3KTAB 4A0FA 3HPRA 2XB2A 2X8AA 1KMHA 1W0JA 1XCGB 2BCGY 5F3WB 2J7KA 1IOZA 1FTSA 1SGWA 2JIZD 2RGBA 4LBZA 4XTRA 2FSGA 1JXMA 2YHSA 4JS0A 4O2RA 4H9GA 1R7RA 1JR3A 1T6NA 2BBSA 4MKIA 721PA 1E1RD 4S2EA 5FBVB 1S8FA 4BZPA 1FNNA 4TYQA 4AC9A 5JS7A 3L0IB 2DB3A 2AX4A 4YMTA 1P2SA 4M9QA 1Q3HA 2VPPA 1AS0A 2R6AA 1ZNXA 1A4RA 3X2SA 1IXSB 2J0SA 3D3QA 3EZFA 3LV8A 1FX0A 3AQ4A 1C4OA 4LJYA 3L0OA 4R98A 3H86A 4EPXA 1TADA 2DBYA 1P9RA 3PUXA 4MGIR 4QC2A 3I92A 1IJFA 3BOSA 4B3DA 1AIPA 3U3KA 3ZS8A 3AVWA 5F9HA 1OPXA 2P6RA 3MJRA 3LBNA 2RGXA 2NTYC 4BGDA 3U7FB 1RVDA 3CPEA 1MRNA 4AK9A 1MT0A 3HYRA 1UBEA 3H0KA 1L4UA 1IXZA 3L43A 2WSMA 5HKKD 1ANKA 2HXYA 1QHGA 4A8JC 2REOA 1F2UB 3BXZA 3BFXA 4Q03A 1QHXA 4OK3A 5DGXA 2QSYA 4HAUA 2GBLC 2QM7A 5B58C 1N6OA 1CU1A 2DWPA 3GJ0A 1Z06A 2VRWA 3A4MA 4DIDA 3ZDQA 4PAOA 4RCYA 3W6PA 4ZIRB 2ZR7A 2ORWA 2WKQA 5CYPA 2AN9A 5FTMA 5CK5A 5FR1A 3CRRA 4A1FA 2GVZC 1GRNA 2MSEB 3PFIA 4M21A 1Z63A 3AVXA 4DSOA 4IFBA 5JSZB 3PEUA 3CF0A 4HDCA 2IYVA 2IYQA 1OF1A 3RANA 2PEZA 1OYWA 4MKFA 5DO9A 4PPQA 3QIAA 3GCGA 2R2AA 4JVSB 4L9WA 3AH8A 4RKFA 1KO1A 3VR5A 5KU1A 2GK7A 5CYOA 3FMPB 1DOAA 4P32A 3X1WA 221PA 4NH0A 1GAJA 3GEHA 4N3NA 3IILA 5H70A 4BLOA 1ZYUA 3BJIC 1W4CA 2C98A 1QHYA 3BFVA 3QKTA 4ZI3A 5AR1A 4ASUA 1EK0A 5EQTA 1HYQA 2GXQA 1II9A 3RNLA 4HB0A 3QUSA 4Q9LA 4XJXA 3RDPA 4TL7A 1KI7A 2IYWA 2R6DA 1SHKA 2GXSA 3WP0A 3DKVA 1NVXQ 2CVHA 2FG5A 4NZYA 5JHGB 1JR3E 2FWRA 1M74A 1G7CA 4V0MA 2PX0A 4AYTA 5KNDA 3U44B 2OCBA 2HT6A 1P60A 3VNUA 5TDHA 1P6XA 1OXXK 1U8AA 2JJ1A 4NYJQ 5F9FA 3WBJA 1TQDA 2WPDD 3AB3A 1IHUA 2GDJA 2L0XA 1FL9A 1Q12A 5FOSA 1KK1A 3CRW1 5A5GA 2WJYA 1F60A 3K09A 3LBHA 3ZVNA 2LKCA 1Q1ZA 2HCJB 1KY3A 4KO8A 1GILA 3CUEF 4XD7D 4XSHA 4WA7A 1YZUA 4A2PA 5FL7D 3KXIA 1WBBA 4MITA 1UF9A 4IOMA 1LVGA 2VHCA 2CCGA 3DHWC 4YXWD 5F98A 1G7SA 2QAJA 3ZZ0A 1XEWX 1P62B 4JT2A 1S0UA 2ZU0C 3EC2A 2GA8A 1Z6TA 2OCAA 1ZM2A 3HU1A 1ESNA 2MSDB 4P4UA 4Q1BA 1G6OA 2IXEA 3NKVA 1R5BA 3QXCA 1XXHE 1Z0JA 4CEJA 1P9WA 1W1WA 2JAQA 4JLKA 1ZU4A 1P9NA 1FQKA 3KUCA 3WYAA 4YMUA 4YMVA 1NL3A 2DPXA 3A4NA 4BFVA 3NBZC 3V9PA 1A7JA 1GWNA 1E2KA 1DAHA 1SZPA 1G8YA 1YZKA 2GCNA 2KBEA 2N1BA 2RGGA 3LXRA 4TQ9A 4I1SA 3FOZA 1JR6A 4IVRA 3ASZA 4BZQA 5HR5A 4NKRA 3W5JA 1FUUA 2X1VA 3K0AA 5JCZA 1WA5A 1HQYE 3O8BA 1G8GA 4HLUA 2GEUA 4A36A 1U90A 1W47A 4ZKDA 1UEIA 3CIOA 3CONA 3QEJA 4LJ6A 1DELA 4LUCA 1DVRA 2QI9C 4Q9HA 1P4SA 1J99A 5KPDA 1I2DA 1QHHB 3NBXX 3QE0A 2SHKA 4TSFA 3H4MA 1X6VA 1TEXA 3LA6A 1RRGA 5SZIA 1KSGA 4MQBA 2ERXA 4LGMA 2HEIA 4D0LB 4NCKA 3U5ZB 2ZU6A 3SI7A 1FMJA 4LBWA 4PTLA 3FMIA 3LX5A 4PAMA 1HURA 1E9FA 1ZUNB 1W0KD 2GEDA 3VU9A 4LJAA 3BB3A 1CJMA 4DLVA 3CRMA 5G41A 1XEXA 4PZYA 4MH0R 3V4FA 1NG9A 4XWOA 3Q5DA 3HDTA 4Q4HA 4GP6A 1G7RA 3JZAA 1IXRC 4IEEA 4ESHA 1T5LA 4F7WA 3MD0A 1OXTA 4IOLA 2XJ9A 1COWA 1KK3A 3NDBB 2QUZA 1KNQA 1M8PA 2ZEJA 4Z54A 2CCKA 4RD6A 3FHCB 1NLZA 2BEKA 4LSGA 3RAPR 2O8CA 5E7JA 1Z6AA 3TSZA 5H8WA 3TMKA 3NH6A 2FF7A 4OKSA 1KDPA 1LS6A 2C96A 3MSXA 4UJ3A 1AKYA 4TN1A 1II8A 1OFTA 5EXTA 3ZJYA 3MFYA 2QGZA 3N70A 1GOTA 2GRJA 4CT4B 3QF7A 1HT1E 3K8YA 3IPYA 3PQCA 2O0KA 2ZSBA 5UKDA 2RMKA 3VHXA 2QU8A 4LJ9A 1NMYA 1SVSA 2R6GA 3FFBA 4OJQA 4A92A 5J5CA 1BMFD 2OFOA 1XZQA 2ATXA 2BMJA 3UK6A 2YC2C 1U94A 2G77B 1OH5A 5EXPA 1E2DA 1CKEA 2ZAOA 2ZR9A 3OEEA 4LJ5A 2OAQ1 3LW8A 4Q21A 4QGAA 2ZRIA 2C8VA 1VHLA 4E03A 1MH1A 1DAFA 5CJPA 4YLGA 1Z6GA 4Q7KA 4LJ8A 3SYLA 4LBYA 4EQ6B 4EFMA 4NYJR 1KSFX 3B5JA 2O8DB 4XSGA 3GLGE 4A0HA 2KE5A 2J46A 3WHLA 5CDFA 3OIYA 3RS5A 4X8OA 3BD9A 1Z0FA 3OFND 4PHHA 2D4HA 5JJIA 1P73A 1E2HA 1E9CA 1AQUA 3LW7A 5HCNA 4ZDWA 3FMOB 4TTRA 3W6OA 1KDTA 1Q1EA 2VP9A 3HYTA 4GL2A 2J9RA 4TLAA 2P5TB 1NIPA 3B9PA 4IW3B 3DM5A 1M7HA 2G0NA 4UJ5A 3K9GA 3AM1A 5DI3B 1Z0IA 4GZLA 2JIZA 2ASEA 4PHGA 4U5XA 2J59A 2R9VA 4JLPA 3THXA 1XRJA 4M1KA 4QXAA 1UBCA 1XU4A 5AJZA 1DARA 3B13B 1CULC 4A15A 4V0KA 3NBFA 1E1RA 2AD5A 2O8EB 1JPNA 4YMSA 1JPJA 2I1QA 3W5IA 1BO6A 2WBLC 2N42A 2WVJA 3HWSA 5AWFC 4JJKA 1XF9A 4L4UA 1G21E 2JLRA 2OZEA 2CL0X 2XJ4A 5HTKA 4KCGA 2TMKA 4JLOA 2YZ2A 4GOXA 1R5OA 2QZ4A 3B1YA 5DI9A 4XVUA 1RZ3A 3DZDA 3VMFA 2O0HA 2HLDD 4RD1A 2JLSA 2VHTA 4HEJA 1LF0A 3QBVA 3TJZA 4TL9A 4BWYA 1NSFA 4XIGS 8OHMA 2PCLA 1KSHA 1KMQA 2QN6A 2JLZA 1VCOA 5FOUA 4AG5A 1E0SA 1SVMA 2ORIA 4HZIA 2G1JA 2IK8A 1N6RA 2V55B 1L8QA 2CK3A 4QBHA 4KHZA 1G1MA 1U8ZA 3KJGA 2JJ8A 2Q9BA 4C0BA 3U4QA 2PT7A 4H1UA 1LB1B 2FEOA 4X8LA 1DBSA 5HKKA 4JZKA 5IDVA 4CF7A 1TQ4A 2Z0MA 2PL3A 1J7KA 5EP4A 2Q3MA 2F9LA 1SKYB 2ANCA 3A1UA 1EG7A 1U99A 2D7CA 2RKOA 4PSKA 4TTQA 1ZP6A 3SHFA 4ERNA 3K70D 4BEBA 3WRYC 4CZ2A 1YKSA 1T4GA 5AJWA 3MLEA 4JYBA 4U7DA 1SQ5A 1ZIPA 3GFOA 2WJGA 3GJ5A 2IT1A 2WWXA 4LBVA 4B6EA 1EFUA 2ZPTX 4KV9A 4IFEA 1OE0A 3VFDA 1TX4B 2A78A 3ZZUA 4AKHA 2DYKA 3K0CC 4X8MA 3LDAA 1TF2A 2VHUA 4RKEA 3PEVA 4HDQB 5D3MA 1U81A 1G64A 3GLFB 3ZYCA 4C0QC 2BMEA 3EXAA 3KQLA 4DUGD 2W2XA 3FB4A 5AJYA 3VHLB 5EZ6B 3I3SR 4JL8A 1GKUB 2CCJA 4OJKA 2AK3A 2IC5A 2Z4SA 1IY2A 1MABB 4D4LA 4U00A 1KJWA 4KSBA 2ZI6A 4RFSA 4TZ0A 3NC0C 1HT2E 1E9DA 4JMPA 4KFRA 3M6AA 4MA4A 1CIPA 4DLWA 3FKSD 1PUIA 1NJFA 1J2JA 2ZR0A 4IOJA 3Q8XB 5EUMA 3PCRB 4EJSB 4MUBA 4TMTA 1BS1A 2R65A 1FPMA 2ZRAA 1XBTA 4ZDIA 4AKEA 1Z08A 2VL7A 5GADl 5AUPB 1GTVA 1ZBDA 3C16C 3A58B 4U02A 3I32A 3UMSA 1P75A 3FYHA 3I62A 5P21A 2DHRA 4NCJA 2ZIAA 4Q7MB 5GJWC 2F7SA 5E7MA 2VP2A 3UANA 4NYIQ 2NO9A 3IIKA 1G3MA 2QTHA 2O8FA 2WPDA 5L3QA 1ZM3A 1G3UA 5E7IA 1E32A 1W4BA 4PAQA 3AVVA 3BRWD 3BIFA 4I81A 1J8MF 3CF6R 4A2WA 4XD7A 4TMZA 1D6JA 4GDFA 1P2UA 2AD1A 5ELXA 5FL7A 4Q9IA 3SYNA 3THWA 2ZJZA 3Q72A 1US8B 4M1TA 4F92B 4YXWA 1N6PA 3CNLA 4LDJA 2AXPA 3GJ3A 3B7GA 4MGYR 3QF4B 2D7DA 1MOZA 4C3ZA 4WIAA 1HY3A 4JL5A 2FGJA 2KBFA 3IO5A 3RS2A 1XD2B 4RZ3A 3TRFA 2ZYWX 3CB4A 2ECKA 1RRCA 2VTKA 1KHTA 1N2CE 2W6JD 1TUEA 2OT3B 5BXQC 2OCPA 4G3XA 1KNXA 1FMLA 1GNPA 1KI1A 2E9SA 2F43A 3WYGA 2B8WA 1Z6YA 1KZGB 4DT1A 1CR0A 2WICA 3M1IA 4HAWA 4DB2A 3RRNA 2J1LA 1E94E 2NO7A 4WZBE 4DIEA 5JHHB 1A2KC 1NSTA 2CNWD 1TEVA 5KTYA 4URVR 2FA9A 1OV4A 1M2OB 1YJ5A 5FOXA 2B8TA 2QP3A 3OF5A 3VKWA 1V43A 4QNRA 3TAUA 4LHXA 2CJWB 1DAKA 1VG1A 2OXRA 3P27A 4TMKA 3FTQA 1ZMXA 1R10A 2H18A 4L8GA 1G5PA 3NH9A 1CRQA 5TB5A 4W5WA 1IJEA 5JWOA 3CZQA 4WXPA 1Q1BA 4QJ3A 2X19A 4IKEA 2GF0A 2FSHA 3RC8A 2HF9A 4K8OA 4M8NE 5DISB 3MJHA 5EXXA 5K8TA 1CR4A 3I5YA 1KZ7B 1WCV1 1QG2A 3SN6A 3QOFA 2DFLA 4R2HA 1TQ6A 1ZM7A 2BOVA 2ZJYA 1XD8A 3OE7D 2WWYA 4M4SA 4FWTA 4UXJA 1WRBA 2FSFA 5DSZA 1XPRA 2J41A 1FNMA 3KKPA 2GZAA 4D2IA 4Q1CA 2J0UB 1SHZA 4I1UA 1KDOA 3NXSA 2C9YA 2O8BA 1KO4A 1WE2A 4A8JA 5TVKA 5CB8A 2PEYA 1KI6B 1KMHB 4FW9A 1KYIA 3C4JA 2QGNA 1JEDA 4P33A 5EE0A 4CT5A 5BW8A 5CLQA 4C0LA 5FBRB 2Q9AA 2GBLA 1W36B 1NY6A 2NO1A 1JJVA 3MRSA 1RYFA 3K0FA 4HDOB 4D25A 2EFHB 2GJ8A 2A30A 4IDHA 4LRWA 3GLIE 3EA5A 4DZZA 4GP7A 4QM6A 2ERYA 1X1RA 4D4JA 3MUFA 5C46F 2W83A 1LFDB 1CBUA 2JASA 1AS2A 2EU8A 3X1XA 5K8LA 3KX2A 4PANA 3I5XA 2GXAA 2V7QD 3UIEA 4B32A 4WBSA 4EUNA 3LO5A 2NGRA 3S1AB 3Q85A 4BLQA 2PH1A 1FX0B 1E2IA 2B6HA 4R71A 4Q7LA 4DLXA 3CRVA 3RS7A 4ZDJA 1U9IA 3EZ9A 5A4JA 4C4PA 1BMFA 3N2IA 2YC4C 2OV2A 1KIMA 2V1UA 5KOYA 2YOGA 2QE7D 3T12A 1TAGA 3QPUA 4FCTA 1G7TA 1DG1G 2IYYA 4GT1A 2YWHA 3AP1A 5BN3A 2DFTA 3GJ7A 2XSZD 2WAYA 1R8SA 2V6JA 3H2YA 1Q1QA 2AHOA 4OQMA 2B7BA 1DTSA 3B1XA 4KVAA 3RRZA 3OAAD 5EJEA 1IQPA 1R0XA 3NC1C 2WAXA 5E4FA 4JLDA 4QBIA 1XZPA 2ZRPA 1XXHB 5JEDA 4NE2A 4M1MA 4ACBA 4B71A 4MDFA 1E6CA 4ZCMA 1E69A 1MO5A 3OFNA 4DLZA 5LD2B 1G3QA 1K5GA 3BK7A 4M53A 4QHYA 3W9YA 2VQSA 3PUYA 5KSZA 4CEIB 1OLOA 4Q48A 2K5UA 1IAQA 1W44A 2ZRBA 1IY0A 4P4SA 1A1VA 5CM8B 2ZI4A 1WF3A 2ZJAA 4LPKA 2C77A 1XMSA 4EPYA 1DAIA 2A5YB 4PX9A 3SU8A 1WDTA 2KSQA 1XMJA 1YZLA 3KKQA 2ZVQX 5KSPA 1SVLA 2ODWA 3TH5A 1HTWA 4A4DA 2QSZA 4UNSA 2Z5FA 3CM0A 2IF0A 3TGPA 4Z8XA 4O2LA 2OE2A 4FMDB 1E2FA 1F2TA 2PJRA 1KTVA 2QT1A 5FTLA 1U0HC 3CRQA 4EPWA 2PX3A 2OEPA 4JLVA 1MO6A 3IQXA 4BLSA 1XTQA 1W46A 4C7OA 1XFAA 5FPKA 1LS1A 1X8JA 5FPTA 2HLDA 1N25A 1QHNA 2KWIA 3V00A 3CR8A 1NI3A 2W6IA 3D8BA 3SZRA 4B73A 4MYUA 4EPRA 5FH9A 2PT5A 4BECA 2ZRNA 3L8YA 2HJVA 2IEYA 5J47A 4PHTA 2P3SA 3SFZA 1S2MA 3RS3A 3CF2A 3EW9A 3ZZTA 4D26A 1Z28A 1O87A 1W2HA 4TL6A 1LV7A 3EPLA 1N6HA 4KXFB 1LY1A 1N6NA 2H5EA 1OHHD 2QTVB 1DO0A 2ZJBA 4NCHA 2AKYA 1ZCBA 2W0MA 3CPJB 5FPHA 1S1CA 2IX3A 4C0SA 2D06A 2G83A 2OHFA 2ZE7A 4YQFA 2REBA 4FWIB 4M1YA 3RC3A 2IHBA 4FMCF 1NN3A 3AP3A 5KDDA 5E3HA 1CLUA 2Q3HA 2G9NA 3CLVA 1P3JA 4GI7A 5B30A 2XOKD 2J0VA 2CE2X 2X2FA 1E2EA 4URZR 2XZLA 4PPNA 2EWVA 1FP6A 3PXGA 5SZKB 4BZXA 3BGWA 5CJ2A 2REXB 1T0JB 2BDTA 3SJZA 5F2EA 4MYCA 4ZPXA 1U98A 2C2HA 2X2EA 3ECCA 5HE8A 1U9IC 2EW1A 5B57C 2GKSA 4KJZA 5AUQA 4F4CA 1KAGA 4Y0AA 1E2QA 3C41J 521PA 3T35A 3VR6A 2MSCB 1FW6A 4LHZA 5JLJA 1AQYA 2PMDA 2XTZA 1DG3A 5DLQC 3FWYA 2IWRA 3BB4A 3K0SA 4BLRA 2DWOA 2J87A 2NMVA 2EWWA 4HYYA 1RKBA 1NJGA 3C15C 1IN8A 4KBGA 5JWHA 4V0LA 3U61B 4PZZA 3QJYA 3GLGB 2VP4A 1SXJE 2ZSFA 4Q19A 4RSGA 4B6FA 4DUGA 2XZPA 3DL0A 4IDPA 4LV6A 2ZE8A 4OQNA 1I4TD 2QEQA 4IJMA 2O5VA 1OFIA 5FI1B 3W34A 1E9AA 3QBTA 5IHPA 3T1TA 1DAEA 1FP7A 1MR3F 3BERA 3WY9A 4US0R 5EP1A 1U0LA 4MRNA 3FKSA 3P4XA 5TXGA 2GJKA 2IXFA 2ZI5A 3B9QA 5JI2E 3A6PC 3SJCA 2A3RA 2BEJA 2FX3A 1YR6A 2Z6VA 4RD2A 1G4UR 1JECA 1RJ9A 3AGPA 2F3RA 2QG6A 2I3BA 2QA5A 2GETA 4TQUS 2C78A 4AWXA 1XEFA 2FZ4A 4OYHA 5CB6A 2QORA 3GEIA 1E2LA 1R5NA 3CH4B 1NMZA 3VU9B 2ZE6A 1S4QA 2LWIA 3GJXC 2RHDA 1XEXB 1JB1A 3WMFA 3SS8A 4ON9A 3IHLA 4KI0A 4TT3D 4Q4HB 1F2UA 2WJHA 2VBCA 5BN5A 1VIYA 1IN6A 1KO8A 2GCOA 5FUYA 3ADKA 2IYZA 2QBYA 4DKXA 3GFTA 4C0AC 1ZC3A 4ZIRA 1FTNA 3U3JA 2Q3FA 2HF8A 5DN6D 5GVSA 3GLHA 5IK2D 2O52A 1BYUA 3G5UA 3U7GA 5G3YA 2IS6A 4F38A 3RSLA 4C2UA 1S1MA 5LB4A 4BRWA 1P72A 1JAIA 5CK4A 3HU3A 3CX6A 2W6JA 2WHXA 2ZJOA 1QDEA 1E98A 4S35A 3AUXA 1K5DA 2FH5B 3JVUA 5FTJA 2EQBA 4I1VA 4HATA 5EP3A 1U2RA 3T1VA 2A2ZA 5JJLA 1L7VC 1DE0A 1E0JA 1NMXA 4GOKA 1JI0A 3TLXA 4HAVA 2ZREA 1GRRA 2BMFA 1W48A 3P1JA 1Z0KA 3L8ZA 5DH9A 2ZRDA 1SVKA 2DWQA 2OBLA 1EFHA 3DOFA 1Z29A 5KYKA 1ZRHA 3DM9B 4TLBA 3VR3A 1J8YF 3KJHA 2GJAA 1KK2A 4ARZB 2OILA 3BH6A 3K70C 1OB2A 3SDZA 1HE8B 2ZRCA 3AKCA 1HE1C 5JWRA 2CL6X 3ND9A 3AGQA 4JBYA 1VPLA 1XTKA 2JATA 1NVWQ 3RABA 5EE1A 1FZQA 4HUQA 1YZNA 3NTUA 4HB4A 3U44A 1E96A 5EP2A 5G40A 3CBQA 4TQAA 5FOVA 3B78A 2A5FA 3SBDA 2BBTA 2CHGA 3D7MA 4JYCA 2VHQA 2IL1A 1NRJB 1RRPA 1PLLA 4R9UC 3T34A 4W5JA 1VG9B 4R2IA 2PMKA 2YWGA 1Z0AA 1GZSA 4Q1FA 4Q5IA 4V0ME 3UKDA 5LPNA 1E1QD 4DLRA 4JVNA 4J0QA 1J70A 4PO1A 1G6HA 3A37A 4W7SA 5BYJA 2J0QA 3THXB 4LYAA 4OQXA 4XVRA 1FUKA 1NN1A 3IUYA 2PZFA 2QP4A 5AUNB 2I4IA 1GKIA 4WXRA 1YR8A 1ZM9A 4XVQA 5KNCA 3P32A 1WQ1R 3QG5A 4NONA 1VKJA 5B64A 5KNBA 4Z1MD 4XWKA 4JLMA 4CW7A 1T9HA 4B74A 2V7QA 2C9OA 1Z2AA 121PA 4B3BA 3MWJA 3TBKA 3SHWA 1NLFA 4Q47A 4DDTA 3FHTA 4JJZA 4URUR 2XAUA 2ODBA 4OI4A 2B21A 1J90A 2H8KA 3K0CA 1Z2CA 4V03A 3UMFA 4LC0A 4IVQA 2P65A 2AL7A 2CDNA 2YNMA 4KFTA 3GJ4A 4CIDA 1H8ED 3ZVMA 5EE9A 3AVTA 1QF9A 2QE7A 4Q02A 2D62A 5FUWA 3I73A 3Q9LA 3GLHE 4QJ4A 3KJEA 5AK0A 5DNYB 4B3GA 3IQWA 2EYUA 2WKPA 4FCWA 4E5UA 2HYIC 2XSZA 3C14C 2IXGA 4YMWA 4BFYA 2IUSA 4B34A 2QTFA 3R7WA 3OAAA 4RZUA 2VO1A 3E5HA 3NIBA 5AUOB 3IBYA 1KKLA 4IOKA 3AF3A 1MO4A 1QG4A 2DY1A 3X1ZA 4BEJA 2P0EA 1NVVR 3CH5A 4RZ2A 1ZNZA 4MRPA 1SVWA 1VIAA 1G9XA 1KI9A 3R8CA 4WZAE 3H84A 1UKZA 1N6KA 3FVQA 2ZI9A 1TQ2A 4G5SA 1FFHA 1G291 3KB2A 1AS3A 1RYHA 1G5TA 1S9HA 1XMIA 3WNBA 5C18A 4LJ7A 2R6CA 4XOIA 2IWHA 2WZQA 1W36D 3HP1A 2BHRA 2ZETA 4D4MA 5HZHA 3CO5A 4UNPA 1ZW6A 2BM0A 4F91B 3NBYC 1OYYA 4BFXA 3QEOA 3VR4A 3SC3A 2YOHA 1ZD1A 4B2LA 4MUAA 3U7EB 2LKDA 2XZOA 2NOAA 4HZUA 4NYMQ 3AUYA 2ZI7A 2ZUDA 5HZKA 1KI8A 3U60B 1LNZA 2QENA 1PJRA 3EIHA 3ONWA 4M9XA 1GUAA 2A9KA 4NBSA 4TLCA 1GG2A 3G0HA 1E79D 1F48A 2XNSA 3AKEA 4V0OA 4NU0A 4DCVA 5CITA 3ZD6A 3R20A 2F9MA 4DDWA 3KQKA 3WBKA 4ZDKA 1TUIA 1II0A 1KAOA 4JSTA 3DO6A 4B47A 1NBMD 4D82A 2V3CC 2IYUA 1TF7A 2MMCA 1OXVA 2N46A 1OHHA 5M04A 2RAPA 5FBQB 3GLIB 4DVGA 2ZSAA 1HQCA 2ONJA 3IIMA 2NPFA 2GZDA 3RHFA 4OHYA 2ZRKA 2ZJ8A 4YONB 2EFEB 4OL0A 4G01B 2FFHA 1VG8A 1ZNWA 2OLJA 2RHMA 5L3QB 2WTUA 1W7AA 2O8DA 3WNCA 4D0NA 5L3SB 3OEHD 2FFQA 2FN4A 2QQ0A 5EXSA 2XOKA 4LHVA 4NDZA 3TNFA 4ITRC 1NP6A 1TU4A 3REGA 1I4DD 1Z3IX 3BORA 3Q5EA 4FN5A 2ZS9A 1CRPA 4BLTA 1LW7A 4D80A 3B82A 1MO3A 3E70C 2W0SA 1NN5A 1NY5A 2BV3A 5L8VA 3LLMA 2FPKA 2YYZA 6Q21A 4MDEA 2YWEA 2QMOA 4JSYA 2RH5A 5CDFE 3TW4A 3B1WA 1YRBA 3C7KA 2DCUA 1M34E 5TMPA 1M7BA 1OW3B 2RGEA 4RD0A 4ZCLA 4D6PA 3AV0B 3QNUA 1Z22A 3TR5A 3FHOA 4LV8B 3C8UA 3I61A 3UG6A 2F43B 4CYMA 2O8EA 4M22A 2HT1A 4Q66C 2P6NA 4DT1B 3B6EA 4TYYA 4C0KA 3GQBA 4DLSA 3B2EA 5K8IA 4GOJA 4LY6A 1XWIA 3SJAA 3TVTA 1CJVC 3KFVA 3OZXA 3WP1B 2GK6A 3THYA 2GF9A 1Y3AA 2G0TA 3QI2A 1E2GA 2A5DA 4JIMA 5JECA 2WM9B 5BWMA 4DHEA 1SVOA 3PR1A 4P0TA 3N2EA 4DLUA 3LFUA 4I99A 4M1WA 2J7PD 4DCNA 5JZVA 1X3SA 4AURA 3TSWA 5JRZA 4FD2A 1UAAA 1TL7C 2JLUA 2OUKA 3GP8A 2OO7A 3T1QA 1QBKC 1T91A 4PXAA 1RFLA 4F4JA 3R8FA 4DDUA 5JBQA 4II7A 4RFVA 3LLUA 2FMXA 4JVLA 1N5KA 4TT3A 3PJRA 3TK1A 3VNVA 3PUWA 3QVUA 1VYVA 3BS4A 2BJVA 2GTPA 2R8RA 2O8BB 3KKMA 4G5OA 3TR0A 4A6PA 3CZPA 1KO7A 2OFWA 3EZ2A 4TLEA 2RGAA 5FOWA 3ZQJA 4RY2A 1UDWA 2V54A 4G1UC 3EIEA 2VA8A 4NPHA 1JBKA 3AEZA 1EGAA 5DN6A 3RRMA 3QSYA 3B1VA 4TMVA 2UVQA 2ZRLA 3K0FB 2XXAB 1NVUQ 5GVRA 4LPSA 2UKDA 2GNOA 2OBNA 1YU9A 4UNRA 1JQJC 1E9SA 1CTQA 2QAGB 3BC1A 4RJLA 1JAHA 1U8YA 1GM5A 4NYMR 4AIIA 4OI2A 3RS0A 1GL9B 2XNDD 4BFWA 4LHYA 1UKYA 3GLFA 1ZJ6A 3IO3A 1KSJA 1ZUIA 2GILA 3LQQA 4GPTA 4DCUA 1EWRA 2QPTA 2ZRFA 3IDQA 1S96A 4LYJA 4E09A 4QGGA 3QKRA 2VP0A 4QBGB 1DADA 3SR0A 3MAAC 1IN5A 3P20A 4OQFA 4QNMA 4M9SA 4QRHA 4PZLA 1E9RA 2CHQA 1DPFA 2WV9A 3I72A 3NWJA 4NTZA 1V5WA 3F5FA 3DZ8A 2ZUCA 3AF0A 3PENA 1ETUA 4EJSA 3QKSA 1BYIA 2QMUA 4Q00A 2WMNB 4KLZA 2OBMA 2CLDX 2XB4A 1W0KA 1N6IA 5FPSA 1ESMA 2RCNA 4AY2A 5CIWA 4TSFD 5HE9A 1XD9A 2RGCA 3MGCA 2X77A 4CEHA 1WP9A 1E9BA 2F1RA 4IVPA 4POAA 1SXJB 2O0JA 4KFSA 5KPJA 1PV4A 1R0YA 2ZTSA 2F55A 1I2MA 1G3IA 5B2ZA 4O3MA 4FINA 4EPTA 4W5HA 4Q4LA 2G1KA 1EFTA 2CVFA 5JCPA 4A2QA 1E0AA 3NHBA 1H8HD 1JJ7A 3MWLA 3I8XA 4P4SB 4B35A 4B3FX 1RPZA 2VSXA 1E1QA 2C9CA 1XPUA 1G16A 2DFNA 3M0EA 2OXCA 1US8A 3DOEA 4BFSA 1RC8A 1XX6A 2FFBA 4IDQA 1G8HA 1UFQA 2XITA 4A6XA 2W00A 2YJTD 4DLYA 1AGPA 3WYFA 3SEAA 5FFMA 3RRYA 4RCZA 2VHJA 4B2IA 1I4LD 2OESA 4Z1MA 4URYR 2F6RA 4C7OB 2CL7X 4JBWA 3JZMA 3T15A 2NQ2C 1PLKA 2ZAMA 4LHWA 4PPGA 1LF5A 5FUVA 2VLIA 4PC2A 4BE7B 3QXHA 2GCPA 3I1FA 1H65A 1ZU5A 2BJWA 1UPTA 2C5LA 3ZIAD 4AD8A 1UKVY 2NZ8A 1IONA 2P6UA 4D0GA 1AJEA 1NIJA 1H8EA 3VR1A 2VYFA 1EESA 3VTKA 4NMMA 3I4LA 3TSOA 2XGJA 4C0JA 3OIUA 3QVVA 5LBIA 1YQTA 3T06B 3J81k 3OESA 2CJWA 3SQWA 1A2BA 1Q3TA 4B44A 2D2FA 3ADBA 3FDIA 4LX0A 2GHIA 1XPOA 4WVFA 2KJQA 3AP2A 1CR1A 1P2VA 4IEIA 4ZCIA 5HPYB 4YC7A 1QHIA 4ZO4A 3LY5A 3AVYA 1YE8A 4WW0A 5FL3A 4MRVA 4Q1DA 1E9EA 4KBFA 1T5IA 1OXUA 3TQCA 3CWQA 3PIRA 3CR7A 3O8CA 1ZM4A 1G8FA 1PZNA 1XCPA 3HJNA 1GFIA 3ADCA 2BM1A 3IGFA 5J4KA 4Q01A 2Z4RA 2WKRA 1KI6A 1G17A 4BUJA 4IXNA 4BFUA 1KO5A 5KDOA 4L15A 4HUTA 2Q6TA 3T61A 1E4VA 4ILEA 5KO2A 4CDGA 4TMXA 4HAZA 4P3YA 1N5JA 1E0KA 3SBEA 1T3HA 3V4RA 3VR2A 4EJSC 1SVIA 3ND8A 2OFXA 3BB1A 3EASA 4HAYA 5CLLA 1VDZA 1G3RA 1OXSC 1TPZA 2ZRGA 2QL6A 2R44A 4KODA 5LB2A 4PC6A 1GP2A 3SNHA 3AKYA 3E1SA 1F5NA 4LOAA 4C30A 3S1AA 4A82A 3QPVA 1E79A 4HSEA 1VYTA 1F6BA 2ZRJA 4WAUA 3RLFA 1XNJA 4BQSA 2FNAA 3K9LA 4UQOA 2ZQ5A 2PLFA 1IM2A 3GJ8A 3MWYW 1RJ9B 3U3MA 4DCSA 2FOLA 3P4YA 1P61B 3PUVA 1NBMA 3RSOA 3L82B 1OKKD 4QM7A 1G5RA 2Z43A 3SFVA 2KB0A 3CX7A 2QT0A 2CK3D 2FPLA 1UKEA 1RRFA 2FEMA 1AM4D 4EFLA 3KXKA 3EWSA 1T3LA 2QMEA 1XB2A 5TV2A 2GXUA 2IA5A 2Z83A 2ZRMA 1AN0A 4Q7JB 4IRUB 5FPYA 4EDHA 1VYUA 2ZUBA 3TIFA 3KB1A 4OHWA 4BASA 3AF4A 1XXHA 1JALA 4F93B 4Q4JA 4Q4AA 3OEHA 4XWAA 1UM8A 4FIDA 2ANBA 3WXMA 5JS8A 5JJKA 2WSSD 3AF1A 1JXOA 1R2QA 4GSYA 4UNQA 3RYTC 2ZYTX 4Q18A 2GCOB 3BE4A 2JCSA 4IHQA 4PC3A 3KTAA 2V8OA 4GMDA 2QBYB 4CEIA 2G3YA 3DMNA 4HAXA 2ZITA 2D74A 2ATVA 4I4LA 2V9PA 1ODFA 1CJTC 1K8RA 2QAGC 3GLHB 4PR0A 4QG7A 1C1YA 1AKEA 1C9KA 3C5HA 1DAGA 4Q1EA 1XCMA 2C04A 4CEJB 4FCVA 4MGKR 4FI3C 2D3WA 2J3EA 3U2QA 2EYQA 4E22A 4YDHB 5GJCA 3ZVLA 2IYLD 4DSUA 1UADA 1N0VC 1OFUX 4QGHA 3A1SA 5DHAA 2ZXUA 2J45A 2VF8A 2PBRA 1DAMA 3A1TA 2ZRHA 3EZ6A 4P31A 3MG9A 1CXZA 1HV8A 1D2EA 3K0AB 3T5GA 2PZGA 2JA1A 4QOSA 2FZLA 5K8UA 1N0WA 2JLWA 4NP6A 4OHXA 1E3MA 4FXPA 2V1XA 1OIXA 1X8LA 4DB4A 3EC1A 3KZ1E 3Q3JB 5ANRB 4DLTA 5FUXA 5AJXA 1B0UA 3DEFA 1QZXA 4KFUA 2JJ2D 2EFDB 1WB9A 3W6NA 3LD9A 5AJVB 4LYFA 1ZAKA 3R9WA 2J7PA 2H17A 2NO0A 2OG2A 1SXJC 3U7HB 1PLJA 1AZSC 3VX3A 4GZMA 1OIVA 4HUQB 3UPUA 3CKLA 4QL3A 3IEVA 2HJGA 4AKGA 1XJCA 4QHSA 4KSCA 1XDBA 2JLVA 4LC1A 2IF2A 3IBGA 4PSAA 3K1JA 3NEJA 1W36C 5FBWB 3AF2A 4KU4A 3KQHA 3U3RA 2WIAA 1NVVQ 3K9HA 1AGRA 3G82C 1IY1A 1N5LA 1Y63A 3F0TA 4RD3A 1X8KA 3TE6A 2PLRA 2O8CB 2RGDA 2D2EA 1BOFA 2CE7A 3BFKA 2GZHA 2EFGA 1ZD9A 5DE3A 2W2TA 2VEDA 3D6TB 1OSNA 1TU3A 2Q21A 3NVAA 2BVNA 3SOPA 3ZVRA 2XTNA 1IN4A 3C5CA 1ZD8A 4LWZA 3M4YA 1NBME 5JSZA 4B75A 1II8B 1VCMA 4E07A 4XH9B 5DYGA 4OI0A 4PC1A 4ZI2A 2QQEA 4PC7A 2AK2A 4CVNA 4B3CA 2WIBA 5TARA 3W90A 1KOFA 1KY2A 4WOPA 4BFZA 1GITA 1NKSA 3QXSA 1UJ2A 4QKQA 4DRZA 1QRAA 2CNWA 2XNDA 5C4MA 1P5ZB 4DEYA 3W3ZB 3TUJC 3GLGA 1QVAA 3UMRA 1D5CA 1ZNYA 3Q7PA 3B1ZA 2RGNA 3TQFA 1KK0A 1D2MA 1WXQA 4PSVA 3SJBA 4Z51A 2XEXA 1R0ZA 2H57A 5J4VA 1IBRA 2VP5A 1Z6XA 2NZJA 4NL4H 5LD2C 3JVVA 1D2NA 2JLQA 3IPXA 2ZYVX 5FI0B 3FFAA 2A5JA 2OSBA 3R7WB 4KLNA 1P2TA 3KKNA 5DYIA 4X8HA 2QM8A 3ASYA 1ZIOA 1Z07A 5EE5B 4D4KA 5IRCD 1GSIA 2ODNA 3OE7A 3Q7QA 1CR2A 4Q9KA 4JL6A 3TAHA 1G18A 4OQLA 2HYDA 3HR8A 2WOJA 3A4LA 5A0FA 2EFCB 4LI0A 1BKDR 2G88A 1R6BX 1FOEB 2ZROA 4ACAA 4ESVA 1RW4A 3GMTA 2QP9X 2W2VA 4DDVA 3EG5A 1H8HA 2MMGA 2YV5A 4B33A 2E87A 1UBGA 3QXXA 1TMKA 2QPOA 1E4YA 3IIJA 3TW8B 1N6LA 2BMDA 5GJVC 4A0GA 4B48A 3KXLA 4AYWA 4B43A 3CNOA 1AA9A 1L2TA 2Q9CA 3CWZA 3LRPA 5JMTA 3EZ7A 1XJQA 2FPMA 3O47A 4OHZA 1CJUC 3ZGXA 1MV5A 2IBMA 4PO8A 5FTKA 4B2PA 3K0EA 4TZ6A 1WBDA 3LH5A 3B8HA 1D9XA 2F1IA 1EFRD 4GFDA 2WOOA 2LCFA 3WNDA 4FMDF 1NNEA 4PPFA 2HUPA 2CHVA 2V6IA 2IS2A 4O0MA 5JRJA 3QG1A 1XP8A 1DEKA 2XTMA 1GNQA 1S9DA 4HZUB 2BCJQ 1OH7A 1R8QA 2ZSDA 1Q21A 2VP6A 4UXIA 2JDID 4G0NA 2F1JA 4EAQA 5C2JB 5J40A 4V0NA 3QKUA 621PA 3ZIAA 5FR2A 4C0HA 3WHKA 1GL6A 1T8TA 4LJ4A 4V02A 4NCIA 3KUDA 4HB3A 5H1YA 3LQRA 4R7ZA 3U4QB 4TTPA 2NPIA 3NG1A 4MRSA 4OHVA 1W4RA 4JLNA 4Q1AA 1KJYA 1OFHA 3K09C 1QHHA 3SE0A 4HI0E 2QMHA 2ZVPX 2OLKA 1EWQA 4ARZA 4LK2A 4QHTA 3FMFA 1Q0UA 2P67A 3W3AA 1WMSA 2IYRA 821PA 2FE4A 2WWIA 2IW3A 2ZE5A 3K53A 5EZ5A 1MKYA 2WWGA 1W49A 2HV8A 3AVPA 2YVUA 3NHAA 4M0LA 5JI3E 1SXJD 2HCBA 3MWKA 1T8UA 3PV0A 421PA 5CIQA 4EFNA 3EPHA 1OT3A 1OH6A 1A5TA 1JNYA 2GVDC 3ZLJA 4M1SA 4PQYA 4CGZA 3VAAA 1W0JD 4A9AA 2OAP1 3DMDA 3KL4A 4JKIA 3BH7A 1GRQA 4DCTA 2IUTA 3X1YA 4MGZR 2WMOB 2RGNC 1JR3D 4UNNA 5D3MB 4TL8A 2JLXA 2IS1A 5DIFA 4QBFA 1F3OA 3O8DA 1TTTA 1W2GA 4RVCA 2VF7A 4LCBA 3EPJA 2IS4A 3ZS9A 2GAOA 1YR9A 3L2OB 3REFA 4HLUC 1E2JA 3NEYA 4HB2A 4LV5B 4RFSB 4AG6A 2ZSEA 3F8TA 3RWOA 3AKDA 3ADDA 2VIIA 1Z8FA 3LAWA 5CM9C 1L4YA 1ZINA 4Q9JA 3CX8A 2GJSA 2A5GA 5HCIA 4GRAA 4TYNA 2FSIA 2F1HA 5SZJA 2AFIE 5JFGA 3THYB 3UWOA 1W4AA 2ZM5A 2GESA 4US2R 4AI6A 2W6ID 2QPAA 2ZJ5A 1GKYA 1EX7A 1SULA 2ODEA 4PQRA 3WMEA 2IUUA 1Z47A 2ORVA 2B92A 2WWFA 1HA3A 1PVOA 1OJLA 2BBWA 4JLJA 2YWFA 1OIWA 1OKKA 4G5RA 4EQ6A 4KYUA 1Q44A 3EA0A 4IDNA 2O8FB 3NDPA 5SZHB 3PEYA 1EFCA 4MYHA 4KYIB 2WJIA
chains in the Genus database with same CATH superfamily
4WD3A 3MJDA 3MMPA 5GJBA 1KJZA 2Z5LA 3WMGA 4I19A 1GDDA 5JCOC 1A82A 1X1SA 3SHQA 5FA6A 4OFWA 2BC9A 3SF0A 2ISQA 4J7CA 2H51A 1FVFA 2E2WA 3OQBA 3TF5A 1DV2A 3WRXC 4MI9A 5IUNC 5JYCA 3UC9A 1POXA 1XZEA 4F6RB 2PCJA 3Q2KA 3LOPA 5BVHA 2WSSA 1EUZA 4WKBA 5FBLB 4C7JA 3V3KA 4OJNA 4OK6A 3ICEA 3AJEA 4AS3A 2Y67A 2ZANA 1QQBA 2E1RA 3PLNA 2IZ7A 4U2KA 5EGNA 3UOGA 1Z0UA 1ZUWA 4LTMA 2QZPA 5EIXA 4PYIA 4F84A 3DLIA 1A8UA 4IDGA 4L50A 2PR7A 4TXJA 1I80A 2EARA 3TVYA 1BROA 1NX6A 1PR2A 1YRLA 5HMLA 2G72A 2AUNA 2FUG6 5AOCA 3IE1A 1CUSA 4UW9A 3ZD7A 1R8XA 5L3RA 5BO5A 4OUDB 4E46A 4IICA 3FW1A 3GRZA 5FPPA 3VHQA 2GT1A 2AZXA 1Z83A 4AYXA 2NYAA 4DQ0A 5M5BA 3LKBA 1RWPA 4OBEA 1OAKA 2FWIA 5LLTA 1QGOA 2NU7A 5H3LA 2BFDA 2FV8A 1G41A 5KYVA 1PJ8A 3S7ZA 3RVOA 4JR1A 2MSWA 1XDUA 4UEOA 3T7IA 1QVWA 1T0UA 1OY1A 3QKRB 4E33A 2OCIA 1NN0A 3AX6A 3I9LA 2YMQA 1LKZA 1ISSA 1X1TA 2VWHA 4H3HB 2BIFA 2F9FA 2C7PA 3SQXA 2A88A 5B3AA 2A33A 2FHPA 2Y66A 1QHSA 1KI4A 5LM3A 2VHXA 1M0EA 1FLAA 4CKWB 4LWQA 3K4HA 1XO1A 1F9EA 1MRSA 2V59A 3MAJA 4HH0A 4JI0B 3C1OA 2EGGA 1M2VB 3EWAA 3G0CA 3OCUA 2XY4A 4HXGA 3GUZA 3ORYA 4L78A 3ELUA 5BT8A 4NXMB 3N2ZB 3KHTA 4IIJF 1ZLXA 3P9SA 4XUEA 2IYSA 3HJTA 3F7NA 5EIEA 1TTHA 4Z4EA 2XR1A 4REOA 1YVDA 4FJ1A 1LLDA 4FMCB 3GAZA 3T1OA 2V3WA 1DC4A 3K9BA 4P3OA 3FTDA 1B76A 1GPYA 1ZJ4A 3NBKA 4CM8A 4L95C 4Z4FA 3VKHA 3DPUA 3A4YA 2VJCA 4RZXA 3VPBA 2FMUA 4K7JA 3MC1A 3EIQA 1Y1RA 3OZ7A 5GOTA 1QCCA 4A8JB 3T0FA 5JARA 3GF4A 1A9YA 1DHTA 1FRVA 1Y3CE 3EARA 5B1SA 2AEEA 4W7IA 3WB2A 4F5EA 1X80B 1JU4A 2OHIA 3LF2A 3RIEA 5JXWA 2D7JA 4W9MC 1V2HE 4WNAB 5DYTA 4MX8A 1NUHA 5JANA 4ZKEA 2HK6A 4G2NA 3RS8A 3AVUA 2P5SA 5FUBA 4OHRA 1R4ZA 4URXR 2FDRA 3H5LA 1VMKA 3KQNA 3L7KA 2J48A 3UYKA 3UT6A 3LVQE 3T5AA 5LLSA 2H4JA 3AY0A 3GEMA 3GGSA 1XMOB 3V6MA 4XUDA 1RWKA 3ZD8A 5C1BA 1I3NA 3LVRE 3PE6A 4LX8A 4BJ5A 4DV2B 2I1VB 2JD1A 5G3ZA 3EF3A 3RS4A 1IG3A 4GMXA 3COZA 4K26A 3I05A 2VOEA 1B7GO 3WDKA 4Y0VA 1O5TA 3HA7A 4WGGA 2Q0HA 2VG8A 2ONKA 2X22A 4HQLA 5KWVA 3HVRA 2BH2A 4X1OA 1T0HB 1Z33A 4OA8A 4O4JB 1PUJA 3K94A 3ESXA 4TLDA 2IBTA 1OT5A 1MC4A 4BNJA 1EIZA 1MB3A 2UZIR 1TNDA 1UMDA 5F7OA 3RWMB 5KUTA 1GU7A 5J1SB 4PCLA 2AWNA 3D43A 1V1JA 1V48A 3I23A 4DC9A 1NUSA 1H2BA 1T6ZA 4MRRA 4DAEA 2DH6A 4E6EA 2GWHA 5JH7B 1TMYA 3FOBA 3KOUA 1CUWA 1ZSVA 5SYMA 1SUWA 1V4BA 2ZI3A 4BBAA 1CFJA 3BHMA 3LPLA 3CZ4A 3P52A 1CJSA 2AR9A 1PGOA 2O2HA 1XMVA 4AZWA 1EUYA 5K8CA 3OX3A 4BV8A 5J58A 1KQGA 1Y6QA 1Z56C 2ENWA 2QU7A 2H31A 2UZ0A 3HJHA 1B6GA 4H18A 4KN6A 4Y9SA 1BGVA 4ZQHA 5F7ZA 4IQFA 4UTOA 4JCCA 4EF4A 3B60A 2O5EA 1T9AA 4C78A 1TA0A 5EKUA 5HIJA 1D5WA 5LP6A 3CPHA 1AKUA 3IUNA 1GNRA 3ON5A 3GLSA 1W5FA 3PG5A 3U09A 1IYZA 2RGUA 4ENVA 4HWSA 3QLUC 1DPGA 1KR2A 1P19A 3PDCA 3Q9NA 1H0RA 1XU7A 1GGEA 2B30A 4C88A 2OZVA 3HWWA 5IT5A 4RY9A 5HKOA 2FDCA 1COWD 1EVQA 3PCXA 5K0SA 3H2HA 2AF3C 2O50A 3EK2A 1ABFA 4B6GA 4JV5B 1SUDA 4F4HA 4B7UA 2NO6A 2PMCA 1CX9B 1GV1A 3K9NA 3V7NA 4DGQA 3KV3O 2BDUA 4B1FA 2W42A 9MHTA 4ER3A 3FVVA 5EUBA 3T5DA 3A36A 1RAHA 3NM5A 1CF4A 2WIDA 1F2TB 1Q57A 2OP0A 1DTWA 1SM4A 2CZGA 3HCRA 4MR8B 3DC7A 1GAWA 3R2JA 2P8SA 5JS2A 4QT4A 5KTRA 2OMKA 1R0WA 5HQTA 3FPFA 2Y76A 3W8NA 4BVGA 2X0EA 1FQJA 3JARB 4JP1A 5BN4A 3GZ4A 3A1NA 1YRHA 2XXAA 1KKMA 4QFMA 4DXAA 1EFRA 2XMQA 1XKQA 1ELOA 1SKYE 2H92A 1PR6A 3H8VA 1G55A 2QAGA 3JVIA 1JEEA 1XEWY 1FA9A 5M29A 2BGUA 3MTDA 1LCIA 3RSFA 2B2NA 4B31A 2OHHA 3TTWA 4ER0A 4KTVE 4O4IF 3GDWA 1MJGM 4MPPA 3QWBA 1H9BA 2XCLA 1PWXA 2GJ9A 1W6RA 3UATA 2VYCA 2EVWX 5K3SA 3D7SA 3OIFA 1M2OA 4MULA 5LZ8A 1QH8B 3PC8A 3VX4A 5BNTA 4C2TA 2G71A 3GFPA 2JGNA 4MJXA 4TYPA 2QVYX 5C8YF 1U0NA 1TJNA 1Q17A 5A06A 3TX2A 1NZDA 4UUBA 3GWGA 4O2AF 3DBOB 3KYBA 5ISMA 4KRGA 4OL9A 4AKIA 1VECA 5IANA 2YXBA 2FUKA 4MCAA 4BX9A 4LIPD 4E94A 3GO4A 3EVTA 1NF3A 1Y6GA 2V6FA 3VPHA 1PK8A 1AQJA 4M0DA 3T3IA 3K6SA 4Y6LA 2XPCA 3IDSA 3USZA 1AMOA 1YR7A 3E9CA 5KDLA 3AWDA 3IP6A 4KQMA 3VC3A 4YVFA 4BAZA 2XE6A 3E0QA 1N0UA 3F67A 4J7AA 1YZQA 4HEQA 5J4YA 1T9KA 1TYEB 3CW8X 3P2EA 3GVHA 2PRIA 4HLNA 2VOJA 2WWHA 1J0DA 1XTIA 3HN7A 5DHFA 2AJBA 4CQLB 3FWPA 4Q4JB 3W79A 1SXJA 3F4KA 3FA2A 4BRUA 3ROFA 5C4GB 1G9TA 3EXIB 3H1TA 5K0GA 3ANLA 2JFPA 2X8AA 2JK1A 3A6FA 1ZK1A 2F00A 3PSHA 2J7KA 1ADYA 2QVGA 3CX3A 1J8DA 3FPGA 4NOKA 5IBRA 4ALJA 5A9RA 2J6BA 4W5QA 2I55A 1R7RA 3DMTA 1V8FA 3D9QX 4IG4A 1JR3A 4INZA 1T6NA 3ABZA 4NU5A 1GNTA 2XODA 1VL1A 2BM8A 1S8FA 5IAKA 1RNLA 1V8BA 2CV2A 4Z4IA 2Q7XA 5LZ5A 2IJGX 1FNNA 4FLEA 4Z9FA 4BZPA 2DB3A 1ULHA 4M9QA 3JZDA 1Q3HA 3ED5A 4XIFA 3RKRA 5KEIA 4ZT2A 3SKYA 1ICEA 3MT9A 3C97A 3L7LA 2UUOA 2J0SA 3U56A 1DWUA 1FX0A 4J75A 4FX5A 1E63A 3QFHA 4EPXA 1TADA 4LF5B 3A0UA 5AW8A 1IJFA 4ML3A 3B52X 4ZT6A 4AUEA 4IMJB 4RDXA 1JHUA 4UTXA 5F9HA 1G5HA 3K30A 4DMCA 4PYQA 1P7YA 3PB3A 8AT1A 4BQPA 2JVKA 4KLCA 2IEDA 3MJRA 3CVXA 2E4AA 3U7FB 4LY3A 1WKBA 1PG2A 4ND5A 5EL0A 2XWSA 3WGHA 4DREA 2JAHA 4CIYA 3HFGA 4DS3A 1ZN7A 1IXZA 3L43A 4CTKA 1EVJA 5ED4A 1JDBC 1M2FA 1SCDA 1HNZB 1EGMB 2IZZA 3BXZA 3HKCA 3AKZA 3BFXA 3VTFA 4IDBA 3ET5A 3FCYA 3PFCA 3E1KA 4HAUA 2R5FA 2QM7A 1QYDA 5B58C 3GPBA 4CBVA 4JSRA 1RDFA 4BN0A 4O5AA 5JROA 3PXUA 3A4MA 4AQDA 4QPNA 4C7VA 1QCYA 5B4UA 4PAOA 4WK2B 4RCYA 5E4TA 3W6PA 3WYEA 4ZIRB 1YQGA 2ZR7A 2ORWA 2WKQA 4G23A 3V8VA 2RD2A 4X1YB 2AN9A 4OH7A 1ZDMA 2EKQA 4LRUA 2W2PA 1O7JA 1GRNA 2MSEB 1XV5A 1WBJB 3AR7A 3JQ7A 4CL0A 1L5ZA 3DEYX 3AVXA 4FZRA 4IFBA 4MV1A 3CA8A 3QVOA 3PEUA 1L5OA 4P92A 1J8QA 4FK8A 3AFNA 5A04A 2IYVA 4KV7A 3II6X 1I1QB 4Z9BA 4AUMA 1I5OA 2QRUA 3PRHA 3WLPA 4PPQA 4ALLA 2O3JA 2WT4A 3RUHA 4L9WA 3VR5A 3AH8A 1JHQA 1RBZA 1S3IA 1UBSB 3DOCA 4WN9B 2GK7A 1DRWA 5CYOA 1H3EA 2DSTA 1J00A 1V5FA 1DOAA 5IEBA 2H4WA 4NH0A 1GAJA 4BU0A 4PVDA 2WK1A 3GEHA 1U7DA 2P3OA 1W4CA 1Q0ZA 2Q5HA 1HLDA 1BGWA 3PYMA 3N87A 3KKKA 1HYQA 2IOYA 1AUVA 1PT5A 2GXQA 3RNLA 3ZZMA 2HZBA 5HM6A 2HKIA 5GZ3A 2VLBA 4XR9A 4ZHQA 9ATCA 4DCPA 2X5NA 4GYWA 5B1EA 1ESCA 1JW9B 4B3HA 1M8FA 4F9FA 2V7GA 1SHKA 2Q2NA 3GP5A 4RLQA 3PTLA 3BMNB 3WP0A 3SR4A 3E23A 2CVHA 1PIWA 3FTPA 4KP7A 5KYXB 2FG5A 2J9FA 2V96A 1IOLA 3B9BA 4NZYA 4OQ4A 5K3FA 5JHGB 1JR3E 2HCFA 4L0QA 4OHFA 1R3DA 3AF5A 4NICA 4AECA 1JFTA 5IVKA 2OZPA 2PO7A 3VPAA 5B2EA 3LIPA 4ZYTA 4V1CB 3SX0A 2O19A 3O2SB 3OE1A 2IDZA 3OA0A 4HWPA 4QJBA 3WSTA 2K2QB 3A0RB 3OEYA 5F5LA 2JIPA 3BCRA 1U8AA 3C85A 2HY7A 2N0SA 1OA0A 1JIUA 3QE2A 1TM4E 1TQDA 2WPDD 4P81A 5TQ2A 2GDJA 1BXRA 3V3TA 1Q12A 4HH3C 4U1RA 1WPRA 1XDZA 3BREA 3CRW1 5FOSA 4PYOA 1YA4A 4EA8A 1MA0A 3K31A 4GO1A 1EVZA 3E9DA 2POCA 4LISA 4K87A 1U0OC 2BM9A 5IHXA 1VJDA 4QXMA 4PRKA 4A2PA 1EXDA 1WBBA 1V71A 3MWGA 2G4LA 1UF9A 2HX1A 4IOMA 1HRDA 1LVGA 3RS9A 3UNXA 1LDNA 2QD5A 4R0VA 1P2FA 3G7SA 1W30A 1HOTA 2TMGA 1DC3A 3PJDA 4JR2A 4E7OA 1B16A 1GGNA 2XBMA 1NVKA 2IY8A 1XTUA 3JPWA 2B3TA 4EEKA 3MQFA 3O26A 1RFGE 4CN8A 2OCAA 3K0HA 5KMGA 2Z08A 2G40A 1G6OA 2Y1FA 3G5AA 2ZYGA 1AKNA 1GQQA 1WCIA 3G1TA 3NKVA 1KBOA 10MHA 4AX4A 4HDNB 4I4NA 1W1WA 4MDHA 4QU8A 1HFKA 4JLKA 1P9NA 1FQKA 4I55A 1SBHA 3W5CA 3NBZC 2DCMA 3V9PA 3U3JA 1G8YA 3LXRA 1A9RA 4IKPA 5H0IA 4TQ9A 4IH1A 3V55A 1P1CA 4Q15A 2W8BB 3ZE8A 1WUYA 3HUTA 4YJ3F 2X1VA 4IIUA 2P90A 2JEYA 4L22A 4LXXA 4AICA 3O8BA 4CM9D 1JR2A 2VJDA 2Z98A 5J59A 1MV8A 2GEUA 4A36A 4NOJA 4MLPA 1OPRA 1F06A 1UEIA 3CONA 2ECPA 1WM1A 2NADA 3D1VA 4NV3A 5HKLA 4AJ4A 1XC7A 2GR9A 2QI9C 4L74A 1UXKA 2QRHA 2VYND 4K9QA 3UPDA 4F06A 1I2DA 4BECA 5JS6A 5IS2A 3KB8A 3H4MA 2CXHA 1TEXA 3DTYA 3OQPA 3SP1A 2AMLA 3LCCA 4FZJA 1IBCA 4B84A 2QNIA 1V11B 1KETA 2D2IA 3FMIA 1V1MA 1ZUNB 1GFZA 2VJMB 4ZAGA 3MTIA 2P6MA 3PVZA 2ES4A 3CRMA 1M2JA 3SG0A 1KRWA 4B5LA 1U6KA 1X9HA 4HADA 4MP8A 3Q5DA 3B53X 4MDYA 4RESA 1LX7A 3EGXA 3JZAA 1HPLA 4ESHA 4ENSA 1TDJA 2GBCA 3LRTA 3MD0A 4UULA 2I22A 4X1IB 3UKOA 1SKAA 2EBFX 3Q3IA 2P6PA 1KGSA 3NDBB 2CF6A 2ZEJA 3O38A 3O84A 4HWGA 1N7IA 3LGXA 3FHCB 3TIVA 2NSYA 5T4HA 3RAPR 4CF6A 2Z9BA 5JCOA 5E7JA 2O8CA 1VLZA 2ATEA 3ZDYB 2WTAA 1WLYA 1T5BA 4BNXA 2H2IA 2HIHA 1BDIA 4R68A 3NH6A 2V5UA 3FI9A 2CJYA 3ZXSA 3U7QB 3W3AH 2ETVA 3ULKA 2G82A 2M1ZA 4I2VA 4OKSA 3KCNA 4HTFB 3WIUA 3GL9A 2AOTA 4CU2A 2QZJA 1P7PA 3DUFA 3EPLA 1RCTE 1II8A 2YN0A 1RM0A 3QYFA 1GOTA 1GPBA 1QFMA 1VE6A 4P82A 3W6ZA 3RWBA 1HT1E 4FB4A 5LQUA 2O0KA 2ZSBA 4R9VA 1JQEA 4CV3A 4LJ9A 3H3XA 1EUDA 4ZU3A 3JX9A 4COKA 4A92A 2R8OA 5J5CA 5BNFA 3UMMA 5J9FA 1XZQA 5CW2A 5CT4A 1CQIA 1IUNA 2F90A 4TZTA 2G77B 3IUBA 1Z4KA 2W5UA 2D5CA 1RAFA 3MCWA 4IUYA 2ZAOA 3OKCA 1JPUA 2OAQ1 4QGAA 2W2QA 5DNVA 5JT1A 2RHWA 4ED9A 4AJLA 4PLCA 4W9RA 2E4UA 2Q5JA 2WJZB 4S05A 3KAKA 3P9NA 4IHKA 4YBZA 3SYLA 4EG1A 3SVZA 2QLLA 1P33A 4X92A 4EO9A 3VYWA 4NYJR 1KSFX 3IOMA 1E3TA 3ZJVA 4JJ4A 2O8DB 1KIAA 1JG2A 4KUEA 1NJ8A 1QCZA 3K9WA 3NPAA 1AV7A 2QTMA 4UTNA 5CDFA 1JJIA 3ZBTA 4AJ2A 4X8OA 4OX9Y 3FSEA 3WJ7A 1NXOA 1S7CA 1C0PA 1M34A 2EFYA 2JI6A 3SGLA 4KO2S 4B8WA 4ENTA 5AQEA 1QB7A 3HYTA 4RAQA 3DL7A 3EZYA 3MCUA 4TLAA 3KVNA 1GGMA 5DTMA 2P5TB 4CG3A 1BDBA 5HSGA 2VTVA 4BDTA 3IA2A 1M7HA 1OBVA 2G0NA 4EKEA 3OUUA 4UJ5A 5CU7A 2F8SA 1W9HA 3K9GA 3MIZA 3RC2A 4INOA 4Z2AA 1XTBA 2JIZA 1EG2A 3F8SA 4I50F 4BEVA 4DMMA 4AZ0A 1C81A 3UAVA 1PR1A 2XEDA 2QJFA 4M1KA 1UBCA 1MUUA 3DD1A 3EWNA 3I0MA 3WL3A 1DARA 1GCGA 1SG0A 4WECA 3RH0A 3S2IA 4BTLA 2UXDB 1OWLA 2YXEA 1E1RA 3AZPA 4YRMA 3NC4A 2O8EB 2NQ8A 1CR6A 1YZVA 3S7TA 2DTXA 2WBLC 1YS1X 2XMBA 3Q12A 2Y1EA 2HMAA 2X9GA 3JQRA 4Y2TA 5DBOA 1XF9A 3WZLA 3FRIA 5HTKA 3NCHA 5I3ZA 3ZWKA 1YFJA 1LRLA 4GOXA 2XCUA 3V9AA 4XVUA 3BF7A 3G68A 3LT2A 5AM1A 5K20A 3DO8A 1RZ3A 1OBFO 1W35A 4HS9A 4RD1A 2SKDA 3EBLA 1D2GA 1RPTA 5T8KC 5C32A 4UUOA 1Y1PA 4BQNA 2P6OA 3KWLA 1E6EA 4H1TA 4XIGS 1K8QA 3PF9A 3BDVA 1MXFA 4H7DA 1SVMA 3A3OA 1U5AA 3D7LA 1YKFA 2PY6A 2VBGA 1U7ZA 4IIGA 2QYTA 1TMOA 2HJRA 3DE3X 3WYNA 3IUQA 4GD3Q 4W99A 6GPBA 1HYHA 1TM5E 2CK3A 3WGGA 5SICE 3WFIA 4YV1A 1U8ZA 4KIGA 3BMQA 2GHTA 1N5DA 3C3JA 3JQPA 3M6VA 1BA3A 2OXFA 1QP0A 2AUMA 2VBFA 3NVDA 1T9CA 4P98A 3WAJA 1H5NA 4CMIA 3N39C 3E9EA 4JBHA 4X8LA 5LDHA 1GPDG 3C8MA 1YQ9A 1EFPA 4CF7A 1MFPA 3TRKA 1GD1O 2Y1XA 1TQ4A 3OM0A 5D01A 4BJHB 4YO8A 4E13A 1J7KA 3D6UA 2Q3MA 1TGYA 3BVPA 2XDAA 3DMFA 4N12A 2F9LA 5EQFA 3CUVA 1SKYB 2XQJA 5IJ9A 2C57A 3TYXA 4AZVA 4BMDA 2Q8QA 4FS3A 3A6JA 4V3BA 1U99A 2D7CA 1FP4B 4PLZA 3SHFA 4MB6A 5SY6A 4L3WA 4DDKA 5DYYA 3L18A 4BRZA 2NUAA 4Q3LA 16PKA 5AJWA 3MLEA 2FY8A 2NYUA 3K6KA 2XECA 2P9GA 1SQ5A 4OHBA 2WJGA 3LTEA 3W5UA 1UZNA 3LQ4A 2IT1A 5KYUA 3VR6D 1Z4MA 5IH3A 3DJFA 3RRXA 1P0PA 1VP3A 4MS3B 1OE0A 1OAOC 4MVJE 3GARA 2NXCA 3VFDA 4AKHA 1QTIA 4CKEB 2J85A 1EIWA 1TF2A 2VHUA 4EGSA 4EG6A 4QEDA 2PGAA 5D3MA 3LUKA 4QXOA 1CUIA 4HGRA 3NT2A 1WXXA 2QDKA 4QEZA 4EW2A 2BMEA 4B6PA 4KXLA 1PFWA 1UPCA 3EXAA 4DUGD 3FB4A 2CXRA 1ONOA 1ARZA 5AJYA 3VHLB 5LMCA 3TFQA 3OPYB 4EITA 3NX4A 4LNUA 3ZGYA 5EJIA 3G2JA 2AK3A 2IC5A 2ADMA 2Z4SA 4KH1A 5FXMA 2IIPA 1H1DA 4D4LA 4XDYA 1CVRA 4KSBA 1P39A 2ZJFA 3IQDB 1PL0A 3NC0C 3NETA 4L5JA 4UHCA 5KYTA 2FYTA 2CLEB 5FI5A 2ZR0A 1NJFA 3NZEA 3Q8XB 5CT8A 3PCRB 3RU7A 1PJTA 1T5OA 2I9PA 3MWDA 3NGXA 3DLTA 3EGDB 1Z08A 4FKBA 2IXAA 3DBIA 3TOCA 5HJ2A 3RRJA 1RWXA 4BMXA 3PNLA 4KH0A 2OVBA 3A58B 1T8WA 4RMJA 3ZCRA 3CYFA 4GLJA 4UREA 1AKMA 1HFEL 4NFYA 4BV2A 4DLKA 1NF2A 3NIWA 2GM3A 5B4VA 3FYHA 1S2GA 1GXSA 4NCJA 2WUVA 2F4NA 5GJWC 2VK4A 2XVXA 4DG8A 3TB6A 3HO6A 4QTUB 5ARCA 1MEJA 3EOAI 3OMWA 1AH2A 2PS1A 2QTHA 2Y0PA 3BEDA 2I34A 2HU5A 4LZOA 4AO7A 5LP6B 2ZSJA 5L3QA 1GA6A 2YQZA 3PJFA 3QU9A 4MYSA 4NMWA 1FMCA 3E22B 3M5CA 5E7IA 3V8RA 9ABPA 2RI6A 4ONEA 1C3JA 4AAYA 3OZAA 4FYIA 4YAEA 4ETIA 3CF6R 4ENUA 2OB1A 4XD7A 1XVVA 3PPYA 2WF6A 1D6JA 2OV3A 1P2UA 3ANSA 3QJ5A 3SYNA 3OU7A 4M1TA 3U9TA 3EYWA 1DMSA 1NSYA 1RMQA 4EVQA 2AIRA 1RHQA 1SQ6A 1XZDA 2PSFA 3CLTC 2PUAA 4EELA 2CHEA 5C52B 1SZJG 1MOZA 4MCIA 2XUQA 4C3ZA 3Q6MA 1DTWB 3C74A 3VZRA 2A4KA 1D1TA 4WE3A 1KF0A 1R50A 4RZ3A 4EP1A 1I30A 1VLQA 2Y0BA 4RHUA 2ECKA 3IMKA 4KQEA 4RJJA 1NM5C 4QOHA 2DQZA 4U2FA 1TUEA 5BXQC 2GPYA 4AULA 4AXBA 3N6XA 4UDYX 5LQRA 1V39A 1GNPA 1V2GA 1J5PA 2QM3A 4NVRA 4WOBA 1Z7EA 1IQ0A 3FCSB 3D2BA 3WYGA 1Z6YA 2JRLA 3KWFA 1KZGB 3TW6A 2WICA 3M1IA 4P80A 1MEOA 1TMGE 2J1LA 4HYQA 3VTAA 4DIEA 1M83A 3I2JA 3PWSA 4OKNA 1A2KC 3KK0A 4IWNA 5KTYA 4N3CA 2NVOA 1RSZA 4URVR 5FCDA 2FA9A 2VRBA 1PFUA 1N9ZA 3DPIA 4W1QA 5BV8A 5K0TA 3B1KA 5AKEA 1M2OB 1BQEA 3UHFA 5IUKC 3SZGA 5CHEA 3ZQ4A 2AZMA 3TAUA 4X97A 4KVFA 1L9XA 4CV1A 4NCBA 1DAKA 1VG1A 1NUQA 3P27A 1T1SA 4L8GA 5AKJA 4KWTA 1L4MA 3HA2A 3JD4A 3QBJA 3N59A 1JL3A 1X1DA 4K6CA 3WK9A 4W5WA 5FNVA 1IJEA 5JWOA 2C4HA 4XQ9A 4QJ3A 1N33B 2ZBVA 4GICA 4NEQA 4IKEA 4LHSA 4OXKA 3TQQA 1FQWA 5A6SA 4TKUA 3MF4A 4PGAA 4CLDA 5JVDF 4YGYA 4ODIA 5B4TA 2IGBA 7REQA 1KXZA 2CUKA 3FCEA 2RHTA 4QD3A 3VZBA 3ETGA 4R2HA 4C14A 5B3LA 4G36A 2MYUA 1FTWA 1PN3A 4FC7A 3HZRA 4R8RA 1CS0A 1WLSA 5DFAA 4AIRA 2FSFA 3E03A 5DSZA 1XPRA 2J41A 1FNMA 2YUIA 2GZAA 2O0MA 3H2GA 3KKPA 4IZ6A 4KR3A 2B8JA 3FGPA 1QK5A 5HS4A 4I1UA 2I67A 3NDJA 4EJ6A 3OUTA 1ZIDA 1E7RA 4DHWA 4MW7A 4WCFC 4OD0A 4QYTA 4E6PA 1E7MA 2OC4A 4JC0A 2VDUE 4P38A 5EE0A 1PK9A 4CT5A 4JDUA 3KR0A 3ZJUA 1M6VA 1NY6A 1FFEA 2NO1A 1LGYA 1SH7A 1ZK4A 3A9VA 4YRIA 1FFYA 3SCZA 4HT3B 2JIQA 2BSAA 2EFHB 3I2GA 3R1IA 4W63A 3GLIE 5KNCD 1J8FA 1DDOA 2IV3A 1YH3A 1L8XA 2AX3A 5KOJB 1Z16A 5E2AA 3V5NA 3L6EA 3FNIA 2JASA 3D0KA 3FYUC 2B78A 2VF5X 3I5AA 4IXDA 1KZ1A 4K6HA 2X0FA 4PANA 2NTNA 2V7QD 2QLMA 3UIEA 4B32A 1J0EA 1OX5A 2WU3A 1CDEA 3O74A 3N7TA 2HQOA 4ZOAA 3ZWNA 2OM6A 4CQJA 4ZEMA 4R1PA 1DXYA 1FX0B 2ZTUA 4DLXA 3CRVA 3RS7A 5M34A 4G0XA 4X93A 3T5MA 5A4JA 5C51B 4E08A 4C4PA 1BMFA 2G06A 3N2IA 5JO0A 2YC4C 2OV2A 2YNMD 1G8AA 2X8LA 2AUTA 3E9MA 5AI8A 3SLRA 3ZQKA 5IKPA 2V1UA 1IJBA 2CDAA 5E6UA 4FCTA 3HXLA 1GRVA 1TAQA 3IR6A 4RK0A 1G7TA 2ZUUA 3GFGA 3KQMA 4N82A 1NZFA 3PXEA 3QGMA 1YUBA 5IYZF 3HTXA 1L0BA 2YWHA 1C3LA 2GARA 4QOJA 2BFEA 3DP9A 3MWFA 5ITVA 2DFTA 2IH4A 3GJ7A 4QDUA 2PUVA 3MILA 1MQ8B 1FRFS 1TCAA 1C7RA 5LQSA 3DNFA 3H2YA 2V6JA 4H0NA 2IW1A 1J33A 1N1EA 3NFYA 2GASA 2HJ9A 3B1XA 3LUAA 4KVAA 4R5MA 4R1QA 3RRZA 4D5EA 1R0XA 2BN4A 1PFVA 3I4FA 4N5NA 1QXSA 1XRQA 4TV8A 5BV0A 2I7DA 2IVFA 4FE3A 4DARA 3A04A 3T5PA 2IYAA 1I01A 3KP1A 2X4DA 1L3CA 3OFNA 2AN5A 4MW5A 4DLZA 3O75A 3QE4A 3ESQA 1V25A 1G3QA 3A3YA 5SYAA 1SOVA 3CH7A 4QHYA 1J1UA 2VQSA 5BSVA 1TJPB 1L4FA 1EE1A 3MWEA 1I5EA 1OLOA 4REMA 4CEIB 3V34A 5BV7A 3R77A 3EC7A 2XB9A 4H15A 3WNZA 4P4SA 1DJLA 1ZAYA 1IG0A 2ZJAA 2IXBA 4OM7A 5ALTA 4DQVA 2OP1A 4WL0A 4TV9B 4CR8A 1A2QA 5AW7A 2EP8A 1XMJA 2XD9A 3OPMA 2JFUA 2FXIA 1SVLA 2LDBA 2OK8A 4KGZA 1FDWA 4LSZA 5DLEA 1HTWA 3UKJA 5K8VA 2Z5FA 2CFOA 1ZGBA 4L72A 3GVIA 5BP7A 4QSMA 3BJMA 2OE2A 4R3NA 1UPXA 4H3SA 4IIVA 5FTLA 4B5KA 1Q7EA 3NNNA 3CRQA 2GN8A 3UMJA 4EPWA 2OEPA 4FMPA 1MO6A 3IQXA 1JFRA 3OZBA 1YRWA 2DF8A 4GM4A 4ZO6A 3CH6A 4PWZA 3UMVA 1N4DA 3DSRA 4GLFA 4BNKA 5JDCA 5DXJA 3ZH2A 3V00A 3F5MA 3CR8A 3I9KA 3GT4A 4NECA 4EPRA 2Q4DA 3BG5A 1MMFB 3TWOA 1BJTA 2PT5A 3A1DA 4FVTA 1CB7A 4S0ZA 1WWKA 3CZ9A 3K2EA 5J47A 2V3VA 3JQCA 1JDUA 4A1OA 1I6WA 2J3LA 4RK5A 1OGIA 3OTIA 3ONEA 2J9FB 3G9UA 5K3FB 3TD2A 4OKIA 4TL6A 1JV2B 2QSUA 3KEOA 1GEGA 5K9ZA 1ENZA 3VR5H 1KC3A 2NO5A 3H5AA 3K0BA 3TXAA 3QE9Y 2H5EA 3SD7A 1YZYA 1Y7IA 3A27A 3IVAA 4R2WA 3CJRA 4XCXA 4Z9YA 2IX3A 3U1TA 1NGSA 3WR5A 4JC4A 1HF3A 4F2PA 1GAXA 2G83A 2ZE7A 5E2BA 4YQFA 1KQNA 4C1NA 2REBA 1DB3A 2JLAA 4FWIB 4M1YA 4WFJA 4FMCF 3TR6A 2XHEA 3AP3A 5J5AA 4ZMSA 5BSWA 5DDIP 3ZVKA 1A2OA 5ALXA 1EEHA 3QBDA 5ITZA 1VLLA 2ESRA 1ACLA 2Q3HA 3VM6A 3CLVA 1P3JA 3ZU6A 5B30A 4LF8B 3J7AC 2J0VA 2X2FA 4URZR 2JK0A 1PT8A 5IW8A 1FP6A 3PXGA 1V8OA 3ZEIA 5CFRA 2BDTA 1IB6A 1LBIA 3SJZA 3EW7A 3X1MA 1CF9A 1JDSA 1MBZA 4ER6A 2JJQA 5K8LA 2C2HA 5HE8A 3TPFA 3EGVA 3K73O 5FLEX 1DUIA 1R66A 4LDNA 4KMOA 5EZYB 2C4TA 521PA 1H4SA 2J5QA 3I4CA 2A9RA 1JGTA 5DMXA 3DJYA 3EGOA 1AQYA 4LWOA 4P4GA 1DG3A 4GPIB 2IWRA 5LP1A 1EE2A 2QXTA 3DTVD 4BLRA 2DWOA 5KMGB 4RZQA 1YUNA 2ZWPA 4B4KA 4C7MA 4HYYA 4KBGA 4MGHA 4PZZA 3QJYA 1A4XA 3RG8A 3IP7A 3L40A 2X7JA 1X87A 4ZVRA 4B6FA 1ZH4A 2XZPA 3DD5A 3IQEA 4M99A 4IJMA 2C42A 2PGJA 2ZT7A 1EM8B 4FGLA 3C8ZA 5GONA 4O1MA 5JXJA 3COSA 2QXUA 2Y2UA 3PK0A 4ZQGA 4HKTA 5IHPA 4KQ6A 4OQYA 1U2ZA 2RIPA 4YDRA 4B6JA 1LX6A 2PNJA 1FP7A 1MR3F 3BERA 1I7PA 2ZK7A 1CZNA 1USIA 2BI4A 2OO5A 5TIIA 3S8EA 4MRNA 3FKSA 3P4XA 5CLIA 2GJKA 2JFOA 2YZKA 5EMKA 3SJCA 1E77A 1DL5A 2FX3A 4LW8A 3LBYA 1MVOA 3COJA 1G4UR 2JARA 5F3RA 2ZWOA 1TYBE 1XNGA 2A92A 4G4IA 4NV1A 2FMKA 4IDAA 2RHGB 2HBZA 3KEQA 5JH7F 1L7XA 3HZHA 4L4ZA 1HRKA 2VJYA 4QU5A 3BXXA 5T3YA 5CB6A 3HFRA 3E81A 4LNHA 1U1FA 2WMYA 3EQ6A 3IOBA 1F1JA 2V7VA 1OGJA 1V1MB 2ODQA 2PZJA 4Y2HA 2RHDA 1B73A 4QODA 1F4VA 2RG1A 1RTKA 3Q40A 4UBKA 4D9KA 3OZIA 1K6JA 2GEFA 1P31A 4H59A 3M8KA 3PEEA 4KMSA 4R3WA 4XX0A 2OA0A 5JAOA 2NP7A 2QVXX 1UM9A 4JMLA 4CCYA 3W7VA 1KO8A 4CM6A 2XWBF 4QBKA 2GCOA 4WV3A 1J56A 3FPSA 1XQXA 2H65A 5FUYA 3H1PA 2IYZA 3KU4A 4BBJA 2QBYA 3GFTA 4F21A 1L4NA 2P0AA 3KHUA 2HF8A 2Y6UA 1BCRA 2GK4A 3F47A 1JUDA 3LO8A 5DSTA 4ZALA 1BYUA 4Z51A 1HL7A 3M33A 5TPZA 1AMNA 4CQMD 3C3YA 4RMHA 3VYRB 4C2UA 4P3XA 1S1MA 2OCKA 2FUEA 5LB4A 1Y8ZA 1QSGA 1WEKA 4BVEA 4RTNA 1JAIA 3DUFB 4PONA 3GLUA 1N5OX 2B4AA 3A4IA 2AZTA 3HU3A 3MGAA 2WHXA 3TOZA 2C7RA 3AESA 3JQ6A 4S35A 2Y99A 1J49A 4EKGA 4XM1A 4CMEC 2FH5B 4HWTA 5EWMA 4HATA 5B5SA 3W1EA 1U2RA 4J29A 3UFBA 4Z3KA 1EUDB 2MSKA 2A2ZA 2O3QA 2Y1KA 4X95A 1GZ7A 2Q3BA 4P5PA 1E0JA 3TLXA 5HNKA 1Z26A 3MTJA 3DDNA 4QX6A 4C6RA 3B2QA 1H2EA 3PT5A 4KQGA 4ZU1X 3ZNQA 1W48A 1Z0KA 4DYDA 2GPWA 5DH9A 5EWLA 4E4YA 2ZRDA 4WJZA 2GERA 2G80A 1EFHA 2OBLA 5T41A 3GFVA 4QUIA 3P9PA 1FBTA 9GPBA 2AEFA 3AEQB 4QQNA 3G2QA 3JR7A 3V8EA 3RVRA 3P8ZA 1O5OA 1YL5A 1U28C 3CRNA 3ND9A 4WY2A 1QH9A 3AGQA 1VJRA 1QQ6A 2JATA 3X1KA 3R3ZA 5EE1A 5JYDA 4EENA 4G5XA 1YZNA 3BA1A 2ACKA 3NTUA 3U44A 5EP2A 1TT5A 3LNTA 4XVCA 3BGIA 2I62A 1IY8A 2AS0A 2BTOA 3ELYA 2A5FA 3R3HA 4C22A 5EHXA 5JDIC 5L45A 1H2FA 1O9HA 3SOZA 4ZCTA 3LUHA 2BHTA 5ENZA 2YV4A 4EG0A 3AI2A 1E1NA 1FDSA 2XLBA 2IL1A 1SBQA 1NRJB 1SJ9A 2GN9A 2PRSA 1GYRA 1RRPA 1FU8A 1PE0A 1GL3A 1I7NA 1QFJA 4HQKA 4R9UC 4HVLA 3T5CA 1R27A 4DMLA 1XE3A 3C3EA 3KPUA 2FX5A 2NTEA 3NHYA 4J16C 2PMKA 3PPWA 1R6DA 1X13A 4LQ4A 4XFJA 5HK9A 2YWGA 4Q5IA