1N5IA

Crystal structure of inactive mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp) at ph 4.6 (resolution 1.85 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 85
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5iA00
1OF1A 2WKQA 5LPNA 1G7TA 3EZ2A 3CNNA 3Q72A 1J90A 4QOSA 5DH9A 4EJSB 4NTZA 3UWOA 1TAGA 3CRQA 4TLCA 2V7QA 4PPGA 3W5IA 2ZI4A 5HCIA 5KDLA 2UZIR 3B1XA 1KKMA 3NHAA 4IKEA 3JZMA 2FSHA 2DHRA 2FV8A 5EE9A 2BJWA 4B6EA 4PHGA 2NMVA 1U90A 4GOXA 4LC0A 1W4CA 2FPMA 1EG7A 4A0GA 5CK5A 4Q1FA 3AV0B 4BZQA 3A1VA 4DJTA 1Z6GA 4MYTA 2XSZA 2QA5A 2CJWB 2RGXA 3JVVA 5CJ2A 4CZ2A 4TZ0A 3ZVNA 2BDTA 3T1QA 5FTNA 1GILA 1M7HA 3Q3JB 1NMYA 1HT2E 4EJSC 3PUWA 4PC1A 4DWJA 2J0SA 1XTRA 1IJFA 1B0UA 3A1UA 2MSEB 2H16A 2TMKA 1QHYA 2QUZA 4ITRC 1E2FA 1KI9A 4DBLC 4FWTA 2W6JD 1OE0A 1KSGA 1WMSA 5BYJA 1GSIA 4XWKA 4A8JB 3U7EB 3OESA 2HUPA 4WA7A 3LXXA 2XJ4A 2PCJA 3TBKA 4ACBA 2LCFA 4Q48A 2ZJAA 3CX6A 4B3BA 4HUQA 3B1VA 4I1SA 5GJVC 2GCOB 1VYTA 2YC4C 1GOTA 2ZAMA 2NO9A 3PQCA 1AGRA 3OIVA 1UEIA 1IN6A 1EFCA 4RSGA 5HCNA 2CDNA 2Y8EA 1JR3A 3RWMB 3SE0A 3GLIA 3VR2A 4Q4AB 1ZM2A 4NYMR 2RGBA 4WBSA 2PT7A 4N3NA 4AIIA 3U4QB 1CEEA 4KV9A 4PC7A 2VHCA 1EFRA 2ONJA 4U7DA 3WMEA 2WOJA 3NC1C 1AQUA 4NP6A 2NO0A 4A0FA 1G16A 4MKIA 4B35A 2OO7A 2QPOA 2WJVA 2ORWA 2WMNB 5JWHA 4FMBB 4MRVA 4HZIA 2RGDA 3F8TA 2HJVA 3OZXA 3MJHA 4F92B 2GBLA 4TYYA 4N0DA 1KKLA 1OFIA 1WF3A 1E2DA 1KMHB 2ZE5A 2C9OA 4MRSA 1VMAA 2XOKD 1SZPA 3AEZA 1ANKA 4G5QA 5JS8A 3QG1A 2O0KA 3E1SA 4QJ5A 1PLJA 2A9KA 1H8EA 1E2QA 4OKSA 4A1FA 3ZZUA 3UG6A 3AUYA 1RVDA 2ZQ5A 1RIFA 1Z22A 3AUXA 2HT1A 3VR1A 3ZLJA 1T3HA 4QM6A 2WSSD 4DLTA 4D26A 1U81A 1JECA 2R8RA 1LFDB 2EYQA 1BMFD 2Q6TA 2BMDA 1EESA 1RJ9B 1M8PA 3RYTC 1D6JA 1PV4A 1MR3F 1DO2A 5J40A 3AVXA 2X2EA 1D2EA 1ZD9A 1KYIA 1UAAA 1N6RA 5K8UA 2F1IA 3DM9B 4JVLA 3GLFE 1EFTA 2ZRAA 3R8CA 1PUIA 2IEYA 4CYMA 3PFIA 4LDJA 3CBQA 2QSYA 2HXYA 3ADCA 3EXAA 1FQKA 1Z3IX 4YXWA 2D4HA 1FUKA 4LV5B 4US2R 1R2QA 1XD9A 2ZYUX 1UF9A 1S3SA 1OFTA 3AKCA 3WMFA 2IL1A 4LPSA 4YONB 4DLXA 2FH5B 2JCSA 4R7ZA 1US8A 3QF4B 4B34A 5A4JA 3OEED 4F91B 5JFGA 2V6JA 3PJRA 4C0HA 5JBQA 3C7KA 5H70A 1NL3A 2QRZA 3W6PA 3FWYA 4PHTA 2GCOA 1OB5A 2GJKA 2G0TA 3OEHA 4K46A 3VR6A 4M9XA 5HKKD 3MRSA 5KPDA 2Z4SA 4O0MA 3R7WB 1W5SA 2XTZA 3RC3A 4F7WA 4PAOA 4M9ZA 1KNQA 1S1CA 2OCYC 5C4GB 4LYJA 5JMTA 3DDCA 5HKKA 2RH5A 3HR7A 3CRRA 2WWWA 5JLJA 2QU8A 5TARA 2QGNA 4M2LA 1CF4A 2AXNA 4BLOA 1E2JA 2XSZD 4DDTA 4BLRA 4B3FX 2HYIC 2ZE6A 1KY3A 1SXJC 2LKCA 4HB3A 1E9DA 5SZIA 2ZUBA 3RRNA 2V7QD 1KK2A 5FOSA 2Q3FA 3IHWA 1X8JA 4MUAA 4UNQA 3ADKA 3QIAA 3AVQA 5FBWB 1T9HA 1E9AA 2AWOA 3QNUA 1ELOA 5FUXA 1ONBA 3B1WA 3X1XA 2ZVPX 1CBUA 4B73A 3CH4B 3U44B 2QBYB 2ZRKA 1E4YA 3IIJA 2OSBA 3RNLA 4I81A 2ZXUA 4KFSA 2WJYA 2YZ2A 3BS4A 4WXPA 3U2QA 3WRXC 2P6RA 4Z1MD 1A4RA 1YZNA 3QXXA 4GZMA 4CDGA 2IHBA 1Z8FA 1HV8A 5D3MB 3ADDA 1G6HA 4GSYA 4A2QA 1MV5A 1X3SA 1X6VA 3AVPA 3NTUA 1D5CA 3EARA 1IY0A 4JLOA 1IJEA 2PZGA 5H8WA 2ZUCA 1R10A 5FI0B 1UKZA 4C0JA 3KXKA 2FDCA 2CHQA 1PUJA 4TL9A 3IO5A 3E70C 4TMXA 3P4YA 1UEJA 2BM1A 1XMJA 3T5GA 2I4IA 2ODEA 2QENA 4CRWB 1J8MF 1E2MA 1FX0B 1Q1QA 4LYAA 4EQ6A 4E5UA 5LB2A 1JPJA 4IOLA 3ZJYA 1M2OB 2HDNB 4PO9A 4QBFA 1XRJA 3X2SA 1EX7A 2IWHA 2GF0A 1HH4A 1ZM4A 4D4KA 2VBCA 3TGPA 2C98A 2ZJOA 1CJVC 4KHZA 3T1TA 2QTFA 1HE8B 2J0QA 2A78A 4QFMA 4EIWA 1G8FA 1YE8A 1F2UA 2BCGY 5LD2C 2P65A 4QGFA 2VEDA 5D3MA 1QVRA 4AKIA 2REBA 3BFXA 4X8LA 1Q3TA 2GCPA 2QROA 4NYMQ 1N6PA 3L0OA 4D80A 1U9IA 1DEKA 4ASUA 3MMPA 4XVQA 2WPDA 1L8QA 1G41A 2CLCX 2FE4A 1QHHA 1U8YA 1W5TA 2WAYA 5J5CA 5JSZA 1OH6A 1KMQA 4URWR 3GLIB 1DVRA 2HYDA 1PZNA 4G1UC 2K5UA 1XEXA 1E9SA 2ASEA 4LHZA 4MH0R 2KBFA 3BWDD 1RC8A 1FTNA 4ARZA 2J5XA 1N5JA 3KQLA 2VYFA 4JVMA 5DISB 1TX4B 4HUQB 1OFUX 4KFTA 5LD2B 2VP4A 2BBOA 3SJBA 1WB9A 2YHSA 1R5OA 4LC1A 4RY2A 2MSCB 1P72A 3PV0A 1AZTA 1TF7A 3T35A 1AIPA 4M21A 4MYCA 2XNSA 5CLLA 1N25A 1S0UA 2ZU6A 3FYHA 4URZR 1IXSB 2NPIA 2F1RA 4RKEA 5FBLB 2FWRA 4V0KA 3R7WA 4JIMA 3W9YA 3U44A 1W44A 1BYIA 3D6TB 1YZQA 2GRJA 3KKNA 1R0WA 2WKRA 1AKEA 4NYIR 3SYKA 4JBXA 2SHKA 4TTRA 3LLUA 4LK2A 2VP0A 4B33A 2A30A 2AKYA 4GZLA 3ZS8A 2BJVA 2A5DA 1R4AA 2ZROA 5JWOA 1KI3A 1DAEA 1WA5A 4GFDA 4QBGB 3GLFA 3L8YA 4MRPA 2I3BA 2IW3A 1NI3A 1KDTA 1U8ZA 3A1WA 3LD9A 1ZIPA 2QPTA 3EWSA 3THYA 5F2EA 5KSOA 4FMDB 4DSUA 2H1LA 4JYCA 2ZIAA 1GKUB 2OLKA 3ZD6A 3VHLB 3R9WA 2H18A 2QRNA 1IHUA 1UFQA 3U3OA 1JB1A 5FPYA 2VL7A 3KFXA 3TE6A 2WKPA 3TUIC 4Z8YA 1G8GA 3BB1A 3BIFA 3GLHE 2ZUDA 1MABA 2R44A 3BORA 2EWVA 2PMDA 2V9PA 1G17A 4C7OA 2GJ9A 1JXOA 3EG5A 3H84A 3QBVA 2CCGA 1COWD 2PEYA 4YMWA 3WXMA 3B7GA 1I2DA 2PLFA 3UKDA 1Z2AA 3I1FA 5J4HA 2CK3D 2UKDA 2V54A 4PZLA 2GXSA 5CJPA 1WRBA 3GLHB 4Q1AA 4BLTA 4TL7A 3CZPA 2OBLA 3RLFA 2C9CA 2DFTA 3P26A 3TR0A 2QE7A 2V8OA 4AC9A 2IT1A 1E1QA 221PA 2OG2A 1CULC 4W5WA 1YRBA 1Z6YA 3QSYA 1Z2CA 4A0HA 2CVHA 1VCNA 2BM0A 1KMHA 5FPKA 1GNPA 4ABYA 4B48A 1L2TA 2O8EA 3QI2A 4A92A 4MITA 4W7SA 1NBME 3G5UA 2B7CA 5BN4A 1ZNWA 4QNMA 2J87A 2AK2A 3H0KA 5SZJA 4HAYA 1HE1C 3WHLA 4N0EA 4DB2A 1S2MA 3VNVA 1DO0A 3CLVA 2NO1A 3I72A 1JNYA 2V3CC 4DLVA 2C03A 1N6LA 2O8BB 2GA8A 3QEJA 3QVVA 4Q4JA 4TL6A 1QHXA 3CR8A 1OLOA 3U3KA 4BEBA 1AZSC 1AQYA 1UKEA 3KJHA 4LGMA 3CKLA 1E79A 5FBQB 5M04A 5L3SB 2QBYA 4TMZA 5E4FA 1MO3A 1XP8A 1G6OA 1Z0IA 1GP2A 4DLUA 2OBMA 2JJ1A 1N5IA 1FMJA 1YQTA 4OQLA 1OPXA 4B2PA 1NN1A 2OFOA 1DBSA 3VTKA 4TQ9A 2WJIA 3TR5A 8OHMA 1R8QA 4B76A 3EASA 3ND9A 3BC1A 4QGHA 4OJQA 4B71A 5KDDA 1OKKA 4QJ3A 4JT2A 1N6OA 2GTPA 1HQCA 3FGNA 3K0FB 3K09C 3KKMA 3RS4A 2WWYA 2GXUA 4B2IA 1VG0B 2WWXA 3U60B 2ANCA 2HJGA 4PAQA 4A6PA 3EC2A 1G1MA 4HAVA 4M9QA 4NPHA 4BGDA 5L3VA 3OEEA 3P27A 4DUGA 3EIHA 4Q9LA 3GD7A 2HLDA 4B3DA 3SQXA 4YDHB 1KDOA 4PO1A 2B6HA 2ERXA 4LYFA 5IK2A 2C8VA 1CU1A 4URXR 3MWKA 4R98A 4DCVA 4AK9A 2F1HA 2FFAA 3FDIA 3JVUA 4JVSB 1TTTA 4Q7MB 2O52A 1LV7A 2JASA 2WWGA 3KXLA 1I2MA 1GG2A 4LJ6A 1KAGA 3NIBA 5EZ5A 4M1SA 2C99A 5JZVA 3TAUA 2J3EA 3IDQA 1FNMA 5C1BA 4IVPA 3R8FA 3LRPA 3IBGA 5F9HA 2KWIA 2W6ID 3SNHA 3L43A 4BRUA 4EPXA 2P5TB 1XTQA 3AP3A 4I99A 3REGA 5K8TA 5E3HA 3AVWA 5EXXA 1UBEA 2BV3A 1SHKA 2CXXA 4Q1CA 3LO5A 2FZLA 3FKSD 5L3SA 3IIMA 2Z5FA 2XEXA 1WBBA 1TPZA 1F6BA 3K70C 4FD2A 4E09A 3SJCA 2R6DA 2LKDA 4C0AC 3P1JA 3A1TA 3GLGA 1XCMA 2ZREA 1Z28A 2XOKA 3VR5A 1ZIOA 4XD7A 4R2HA 3RANA 2GDJA 1NJFA 4ZPXA 1TU4A 2FPKA 4BFUA 2JLVA 2GXQA 2OHFA 2RHDA 1I4TD 3ZVLA 3M0EA 4TZ6A 3SS8A 5EXPA 5G41A 4DLZA 1Z29A 4AI6A 1K5GA 3LW8A 1N6NA 4GBMA 2RGCA 2EW1A 2QY9A 3GMTA 3AB3A 5HZHA 3U6KA 5FOTA 2JLXA 3BOSA 1KI8A 1SQ5A 2BVNA 4JLMA 4RZUA 2ZRPA 4ZI2A 4FINA 4ZDKA 3SQWA 4NBSA 1L7VC 2DFKB 5JWRA 1NVVQ 1GL7A 1ZM9A 5JSZB 4TMVA 4KFUA 1JJVA 5FPHA 1W4BA 2ZYWX 3KB1A 3TW4A 1ZBDA 1KZGB 2VP5A 4WZ6A 2KE5A 3B6EA 4CEHB 4PXAA 3I8SA 1PJRA 3AM1A 1LF0A 1OXUA 2HCJB 4FMCF 1G8PA 4GMDA 1MKYA 3LBNA 3X1DA 3EWAA 3HDTA 1Q44A 4BZXA 4M1YA 3VU9B 4EDHA 2RKOA 1E98A 2WHXA 3HWSA 3KJIA 1RYFA 1G3UA 4G5SA 3NC0C 4PSVA 1ZCAA 1II9A 1A82A 1XNJA 4F4JA 4Q1BA 3NDBB 1TQ2A 3VFDA 1LS6A 4Z1MA 4ZIRB 2DWOA 1XB2A 1Y63A 2BBWA 3I62A 4B3GA 2OFWA 4MGIR 3WY9A 1IBRA 1TQDA 1V5WA 1W1WA 3L0IB 4MQBA 5AJYA 1DTSA 4LCBA 2GK6A 3PUXA 4BFTA 4ZI3A 4HAWA 5TB5A 2Q21A 1P7CA 3EC1A 5ELXA 1NLFA 3CM0A 4QM7A 3KFVA 2DR3A 3RWOA 1VDZA 2GEUA 5FI1B 3T06B 1KSHA 1DELA 3ZIAD 2J46A 3WMGA 2A2ZA 3MUFA 4FCTA 1ZRHA 2IXEA 3I92A 1ZUIA 4S35A 4Q7JB 1S8FA 4L9SA 1DAIA 1S4QA 3VMFA 2W0MA 3A6PC 1F60A 1VHLA 1ZINA 2WBLC 4RD4A 1UDWA 5DHAA 3GLGB 5JEDA 4ZO4A 2VHQA 2Q9CA 3EAQA 4NONA 1Q3HA 1Z0JA 4IOKA 4NHOA 2ZE8A 2F9MA 3KTAA 3PUYA 3O8RA 3U4QA 4DHEA 2D06A 4HB2A 1OV4A 4Q4AA 5GJBA 5JJKA 2REXB 3OE7D 1NVXQ 2WZQA 1L4YA 4IOJA 2W00A 1N0UA 2ODNA 3LV8A 3OEHD 1ESNA 1TU3A 3GJ4A 4PX9A 4A82A 1LW7A 4DRZA 5FUWA 3KQKA 4P4TA 1VECA 4LJ5A 4QG7A 2QP3A 2VH5R 1CIPA 3QKRB 3WNBA 1ZMXA 2MSDB 4X8MA 1OXVA 3QKTA 2YOHA 3RDPA 4M53A 3TRFA 3QKSB 3CONA 1EGAA 3QXSA 1ODFA 4PQRA 4BLSA 1ZD1A 2FSGA 4K81B 2ZS7A 1N6IA 3KXIA 4D4MA 3SHWA 2PT5A 4Q00A 3K9GA 4KODA 4Q19A 5KTYA 2IS2A 2IS1A 2AXPA 2ZRGA 2H8KA 1E9EA 3DOFA 4HZUB 5L3RA 3VX4A 4DIEA 4TYWA 4I1OA 2ZS9A 3THOA 2ZTSA 5H68A 4MA4A 1KY2A 2P3SA 3THXB 2AN9A 3PG5A 2D7DA 1T91A 2ZRCA 2AL7A 4RFSA 4B47A 1W48A 2D2EA 4HAXA 2D3WA 4NL4H 3E5HA 4X8HA 3QXHA 5B2ZA 3T1OA 4US0R 3FFBA 3GJ7A 2GHIA 3EX7C 4MKFA 2CLSA 3QKUA 4PO8A 4D0NA 4AKGA 5J4LA 2FU5C 1XXHA 1W4RA 3AP1A 3MWJA 4PQYA 1II8A 2GJSA 4A6XA 2D2FA 3EW9A 4EUNA 5F3WB 1P9WA 4V0MA 1QHSA 3HPRA 3ZZTA 2GETA 1S96A 2O0HA 2ZRNA 5CB8A 1ESMA 2P6NA 1M6NA 4G5RA 5BXQC 2OFXA 3T1VA 2QQEA 1UDXA 2ONKA 3K0FA 4WZAE 2X2FA 4KBFA 2H7VA 4FWIB 5G3ZA 4MYUA 1G3IA 2IUSA 1VPLA 3IHLA 2EFHB 4XVRA 3W8RA 1W36C 5EJEA 3Q7QA 2N46A 4RD1A 4CIDA 1F2TA 3QKSA 1XD2B 2XNDD 1GM5A 4U00A 5HE9A 1ZCBA 2N1BA 3ND8A 3IQXA 3M6AA 3K53A 4M1TA 5C18A 4KYIB 5GVRA 1J8YF 4BASA 2BHRA 4DCSA 2C5LA 2ZJZA 1JAHA 1P2TA 3AF1A 4UXIA 4BFVA 3KQNA 3WNCA 2V55B 3LLMA 1NJGA 2VSFA 2ZPTX 4DLRA 3NH6A 5IK2D 1DAMA 1PLLA 1T4GA 3EIQA 1G9XA 5BWMA 3QE0A 1E32A 1PLKA 1AM4D 3KUDA 4HEJA 4O2RA 4UQOA 2WMOB 5CYPA 2YOGA 2KSQA 3DL0A 5UKDA 3TNFA 4D6PA 1A2KC 1KI1A 1YHNA 3LX8A 4OQFA 2Z6VA 4TMWA 3L2OB 2QN6A 2WICA 1P4SA 4OHXA 3UMSA 2FOLA 3LFUA 3OIWA 2W83A 5EP2A 1JQJC 5GVSA 1XDBA 3BXZA 5JJIA 4DXAA 1G7RA 4LJYA 1P60A 5EZ6B 5TMPA 1IXRC 4IFBA 1IONA 3BERA 2W2TA 3LXRA 4Q7KA 3BH0A 2DWPA 3EA5A 5FR1A 4M1KA 4QXAA 3ICEA 1S9DA 4JJKA 4BFSA 3U61B 2CMKA 1LB1B 3KTAB 2ZS8A 2BOVA 3VKGA 3NKVA 1V43A 3W6NA 3PIRA 2BBSA 5F9FA 1BOFA 3SHFA 4PPFA 2ORVA 3PITA 1II0A 1JI0A 2FSIA 2JJ2D 2DWQA 3N5CA 4AYWA 2A7QA 2GESA 2EU8A 3SYLA 4PC6A 3BJIC 3C15C 2I1VB 1IY1A 3I32A 3MJRA 4WAUA 1VKJA 3HU2A 1UKYA 2R62A 3I5XA 3NEJA 5AJWA 1ZNYA 3LVQE 1ZM3A 3U7HB 4POAA 2WJJA 3WP1B 3CW2A 1GZSA 3FKQA 1LY1A 1D9XA 4JL8A 3RVBA 3P20A 4R71A 5JCZA 3AKDA 1DAGA 4JSYA 1TMKA 1ZU5A 4JLNA 1MO4A 2XXAA 5J4KA 2CL0X 2GZAA 1UBCA 1IQPA 4LBVA 2W2VA 3CWQA 4ARZB 1DAKA 4XIGS 3PEYA 1M34E 3QQ5A 3GPLA 3DKPA 1MOZA 4JL5A 4PR0A 1BS1A 3PVSA 1RRFA 4C3ZA 1GRRA 2I1QA 5KNCA 3HU1A 1YZUA 5TXGA 2C2HA 1E2NA 2PBRA 1TNDA 2YWHA 1XBTA 4O25A 4C0BA 2CL6X 3GFPA 1YKSA 1UBFA 4ZIRA 2FPLA 4AURA 1W49A 2YV5A 2BC9A 4TWZA 1G7CA 4LJ8A 4R2IA 4OBEA 3ECCA 4ZV4A 4X8OA 3AGQA 2PX0A 2R2AA 4M4SA 2QAGB 5FH9A 4M8NE 2YWFA 3RS7A 4CEHA 1KO4A 2YINC 3O47A 2XNDA 5KHOC 2ZRJA 3ADBA 4O2LA 3KQUA 1OB2A 1P75A 2ZE7A 4LPKA 3RC8A 1GUAA 2CBZA 4IRUB 2KJQA 1MO6A 4C0QC 1F5NA 3HPQA 1TUEA 4HLQB 1DG3A 1N0WA 4V02A 2YKGA 3CF2A 3L82B 1T0HB 5AUPB 4BE7B 2F43A 5J4VA 3UK6A 1XD2A 2BIFA 4JJZA 2H92A 1KO1A 5JEEA 2ATXA 2OCPA 2ODBA 3GJ6A 4IJMA 4XOIA 4CGZA 3O8CA 4XTCS 1ZNZA 5SZHB 5L3QB 4A8JC 3T61A 2VP6A 1S3GA 3B78A 5FPSA 1SGWA 2VLIA 5BQ5A 2EFGA 2P2LA 3B5JA 4LJ9A 3UMFA 2J9RA 1LTQA 1ZP6A 1JXMA 3QVUA 2MMCA 3VKWA 1OHHA 3B9PA 2R65A 3FMOB 2WVJA 2IXGA 1Q1EA 4TTQA 4JBYA 2D62A 4L15A 1JEEA 5EE0A 2JATA 1ZD8A 1CJKC 3VX3A 1XEWY 3SOPA 2QTVB 4TL8A 3SJAA 5KNDA 4JT4A 2WJHA 3ZS9A 1C4OA 3K9HA 3TLXA 2XAUA 2AD1A 3M1IA 5J47A 3THWA 3ONWA 1BIFA 4XSGA 4L16A 2G0NA 3KB2A 1EFRD 3CWZA 5K8LA 3THXA 4A9AA 2FJUA 5JI2E 3PR1A 3BB3A 1XJ0A 4TYQA 1XX6A 4DDVA 4NKRA 3I73A 2NO6A 1TF2A 4OHZA 4DLWA 1VCMA 3K09A 3AF4A 2DPXA 1M74A 2IEZA 1FW6A 4KJZA 1DG1G 3TSOA 4C2UA 5E7JA 1RRCA 2QMUA 4PHHA 1G3MA 1WXQA 2IYWA 1G4AE 1NG9A 4BFWA 121PA 3A4NA 3DZ8A 4TLAA 3C14C 4P3YA 2IBMA 1HEIA 2LWIA 2RB4A 2VHJA 4WZBE 2IYQA 5LBIA 4C9BA 2JLUA 1GITA 4IDPA 5TV2A 4OK3A 2CHVA 2JIZD 2G83A 1P2UA 3QY0A 2QNRA 1NVVR 4IOMA 3L0PA 3IKJA 2QM8A 4PSKA 3CUEF 1Q1BA 4ZKDA 4UNPA 3B13B 1DAFA 2J0UB 3B1ZA 4Q4LA 5DO9A 4BEJA 2F55A 4M1MA 4E07A 1YRAA 4II7A 1YR9A 5AUQA 4DVGA 1H8HD 2FA9A 2V1XA 4HLCA 4M9SA 2GF9A 2O8EB 1CR0A 4LYHA 3NBYC 1E2HA 1IN8A 1IAQA 1NG1A 1NIJA 1NKTA 1XTKA 2RGEA 1ZAKA 3AKYA 3WNDA 2J41A 2PZEA 2W0SA 2ZRHA 3ASZA 3HR8A 1Z6XA 5E7MA 1OFHA 1ZC4A 2FMXA 4TYNA 2RGGA 2EFCB 1N2CE 1QHHB 1CKEA 1T0JB 2ZJ8A 3MGCA 1E3MA 1NNEA 3SYNA 1CP2A 3OIUA 5A5GA 4LRWA 1COWA 1GKYA 4PFSA 3D7MA 2G88A 5EXTA 4Q4JB 3NDPA 4LJ7A 1TL7C 3KJEA 4C4PA 1YJ5A 3P4XA 2QI9C 4MKHA 3EPKA 1E2KA 3IEUA 3OHMA 5C2JB 3HYTA 4GL2A 2RGNC 3B9QA 5CM8B 3TJZA 4P0TA 5BW8A 4IW3B 2D74A 2DFLA 1XJQA 4XVUA 4YLGA 5P21A 2RGNA 5FUVA 2J59A 4M22A 1W0JD 2Q9AA 5DLQC 3JZAA 4DCNA 2G9NA 1E9RA 4ZDIA 4GI7A 1OYYA 4C0KA 2DCUA 2O8DB 4RKFA 4G5GA 4OHVA 3LH5A 1Z06A 2D7CA 1UPTA 4PPQA 1C1YA 3CO5A 4IDHA 1R5NA 2IC5A 3C5HA 1GIAA 1OYWA 2MMGA 4AG6A 3UIEA 4LHVA 2ZYTX 3LY5A 1IM2A 1E2IA 2YNMA 3CB4A 1VTKA 1R6BX 3MD0A 2QTHA 3NBFA 2GVZC 4W5HA 2VHTA 3EPLA 1SXJB 2CNWD 1M1YE 1ZM7A 2W6IA 1YZTA 3V4RA 3V4FA 1NSTA 3DVLA 3LNCA 4KYUA 3WYAA 1Z6TA 1ETUA 4OHWA 3IPXA 4FCVA 3K70D 4Q4HB 4V0ME 5CIWA 4EPTA 1CJMA 1KI7A 3FMFA 3KKOA 3NBZC 3G0HA 3IEVA 1RE0A 4UNNA 4BLPA 1QHNA 3DKVA 2DFNA 2OILA 2RCNA 1SVOA 2ZSDA 4D0GA 3K0SA 1CXZA 1Q20A 3V00A 3REFA 3I5YA 3I61A 2BKEA 2XB2A 2GZDA 4Y0AA 3SC3A 1RRGA 3FOZA 4XD7D 4EFLA 3CRVA 1XTIA 2R6CA 4RD3A 5CB6A 1E1RA 1UADA 5JI3E 1M7GA 4QBIA 2HLDD 4ZCLA 4CVNA 1Z07A 4F38A 3THWB 1AJEA 2WIAA 5JCPA 2NQ2C 4A8JA 2IUUA 3QJYA 1TUIA 3PEWA 3OAAA 5HR5A 3OIYA 3PCRB 1R0XA 2WAXA 3M4YA 3OFNA 4YDSA 3Q9LA 4HSEA 1P73A 2OEPA 2ZI9A 3CNOA 4BLQA 3CZQA 3SI7A 3OE7A 2IYVA 4RZ2A 5KSZA 1YZKA 1R7RA 2E1RA 3C8UA 3BGWA 2NOAA 4QRHA 1FFHA 2UVQA 1KO7A 4CEJA 2JEOA 1HUQA 5SZKB 3WRYC 3FMIA 2C78A 1G5RA 1KSFX 3NXSA 4KVGA 2AFIE 5DSZA 1KIMA 4JKIA 2OAQ1 4JLKA 5CLQA 4ZDJA 3ASYA 2UZ3A 4DLYA 2JLWA 3O8DA 4K8OA 5KO2A 2GAOA 3NVAA 3SDZA 4MGYR 3K0AA 2EFDB 2O8FB 1QBKC 3RRMA 3DM5A 4RFVA 4QKQA 2ZI3A 3RABA 2QMHA 5FTLA 2O8CA 5B30A 1RKBA 4TLEA 1F2UB 4E03A 2B8TA 3HJNA 1GWNA 1FTSA 4HDCA 1UBGA 3MLEA 2ZR0A 1W2GA 3T34A 2B8WA 1YR6A 2JJ8A 2QAGA 2JGNA 2Z0MA 3FE2A 4GP7A 4Q7LA 1E0AA 4B75A 4TQAA 3WHKA 1IN5A 1LF5A 1BKDR 1NP6A 1VIAA 2GZHA 5LDDC 2Q9BA 1W4AA 3Q8XB 1HYQA 1E96A 5KNBA 2JLZA 4LHXA 4QGGA 1CS4C 5B58C 4AKEA 1FZQA 1Z0FA 1I4DD 2QPAA 5FFMA 5FTMA 3ETLA 3GLGE 2GAAA 4A36A 1XTJA 2WWIA 3UG7A 421PA 3ZIAA 3LQRA 4AG5A 2HXSA 4PPNA 4R9UC 4G5OA 1FX0A 4QJ4A 3SBEA 4JMPA 1H65A 5KSPA 4RD6A 3QBTA 2GKSA 3CPHA 1JR6A 4DT1B 3FTQA 1GL6A 2JLSA 4YXWD 4EPRA 3E2IA 2X8AA 2XZOA 1ZU4A 2OV2A 2PH1A 3QEOA 3IQWA 1Z63A 2PL3A 4G0NA 3VQTA 3BD9A 1N5KA 5DGXA 2QT0A 4DSNA 1AKYA 1I4LD 2IF0A 3KL4A 4HDQB 2IYXA 4FIDA 4JLAA 4TLDA 3K0CA 4Q18A 3ZD7A 2O0JA 2DBYA 2GK7A 5B57C 3QXCA 3A58B 5EP4A 3K0AB 2WOOA 2H5EA 5AK0A 2C95A 3PENA 2GBLC 4OQNA 5LB4A 2ZANA 1KNXA 1F3OA 3RSLA 1X8KA 3ZVMA 3Q5EA 1E69A 3IBYA 1GKIA 4JKYA 3A8TA 3NWJA 4Q03A 4B44A 4Q21A 3GEEA 3QPUA 4BECA 4B6FA 2AD5A 5IDVA 2BEKA 4LJ4A 3SEAA 5ANRB 2ZEJA 1CR4A 2VO1A 3SN6A 3GJXC 3CX7A 4CEJB 1AS0A 5KOYA 1KAOA 1X1SA 4C7OB 2JIZA 1E9BA 1HURA 1C9KA 2GVDC 4ZKEA 4IXMA 1E4VA 1IOZA 4V0OA 2RAPA 1EK0A 2WIBA 4NMMA 5FTJA 4C0LA 2QORA 3VHXA 4XWOA 1QG2A 3RS0A 4FMCB 1EWRA 2B21A 2ZVQX 1RYHA 1XPUA 3AGPA 5CIQA 3ZYCA 4BFXA 1SXJD 4EPYA 5FOVA 1YR8A 2XGJA 2IF2A 2WSSA 2VQSA 3CF0A 4Q66C 1XXHE 1ZUNB 1ZJ6A 3AF3A 2WJGA 4MRNA 1E94E 1D8TA 1P2SA 2CE7A 4V03A 1VHTA 2VF8A 1A2BA 4NDZA 4OI4A 2X1VA 3MCAA 2BMFA 4OHYA 1JALA 4OQMA 2OESA 4M1WA 4NCNA 1O87A 1AGPA 3W90A 3ZZ0A 1CR1A 1OXSC 3A4MA 2FZ4A 4QHYA 4LUCA 1W0JA 3CX8A 3W34A 5AJZA 5K8IA 1RJ9A 2G77B 3RS5A 2F7SA 2QT1A 4FXPA 4Q9HA 3TUJC 1E2LA 2OCAA 2P0EA 4I1UA 2J0VA 3F0TA 5B64A 2JLQA 1SKYE 1TEXA 4IFEA 1Z6AA 1XEWX 1E0KA 4B32A 4W9MC 4JZKA 3H86A 3KZ1E 5EXSA 3AVYA 1KI6B 2KBEA 1WDTA 4HLDA 4LHWA 4GT1A 5E7IA 1GNQA 2FGJA 4NU0A 1Q1ZA 4AY2A 2OBNA 4QHTA 3DO6A 3A1SA 1HY3A 1JR3D 3B85A 2A5JA 3LA6A 3C41J 3PEUA 3EPJA 4P32A 3CF6R 3TSWA 4LOAA 1U94A 2A5YB 5EUMA 4CEIA 1AS3A 2VP2A 5F98A 2H17A 2NO7A 4YQFA 4PAMA 4KVAA 5DIFA 1MRNA 2YOFA 1R0ZA 4IVQA 4HDOB 2HT6A 1X8LA 3SFVA 1XTSA 3GLHA 3MFYA 4NE2A 4P33A 1U0JA 2QSZA 3CR7A 3IGFA 2OXRA 4LV8B 1Q21A 5HZKA 4QGAA 1QVAA 2ATVA 4TLBA 4ON9A 2WSMA 4HAUA 3HP1A 4ESHA 2EWWA 2ZI5A 2FEMA 4IVRA 4YMVA 4OL0A 4XSHA 1W7AA 3W5JA 4KO8A 1NF3A 2CHGA 1W47A 4KBGA 1KOFA 5AR1A 4C30A 3DOEA 5KYKA 3ZH9B 2GWHA 1YVDA 4H1VA 2G1KA 2YWEA 3KKPA 3RS2A 3IIKA 4F4CA 4TYPA 2QP9X 3BH6A 4BUJA 4LX0A 1X1RA 1KK3A 2OAP1 4US1R 3KKQA 1ZC3A 3CRMA 4D4LA 1TADA 1XXHB 3QKRA 1YR7A 5EQTA 1QHIA 2JJ2A 1KJZA 2ANBA 3NEYA 1PVOA 1U9IC 3BRWD 5C4MA 5FL7D 2QL6A 3VR3A 4RVCA 3K70B 1GTVA 1XZPA 2G1JA 5DYGA 2IX3A 1JEDA 4MUBA 2YJTD 2VF7A 1L4UA 4PTLA 1XZQA 1E0JA 2AWNA 2FFHA 3PEVA 4ZCMA 2ZJBA 4GNKA 1MO5A 4B43A 2VHUA 1TQ6A 1JAIA 1G3QA 4RCYA 2ZYVX 1T8TA 4DEXA 4W5JA 5CDFA 5JECA 2XXAB 5GJCA 5CYOA 2WM9B 4XH9B 1KO8A 2VSOA 4NCKA 1IN4A 2QE7D 4Q9KA 3UXMA 2JA1A 4Q4HA 3I3SR 4UKDA 1XU4A 3AVVA 4MRRA 1KDRA 3OF5A 4Q9IA 1OSNA 2RMKA 4PC3A 2P5SA 3DPUA 1U0HC 1J70A 4U5XA 1K5DA 3SR0A 3EIEA 2X77A 3TQFA 1G18A 1T3SA 2EYUA 2VSXA 3D3QA 4KCGA 3VKHA 4GPTA 1G7SA 3U3JA 4OK6A 4LWZA 1KHTA 3R9IA 4MGKR 4CF7A 1U2RA 1NN5A 4H9GA 5G40A 521PA 3K0EA 1FOEB 5CDFE 4PC2A 5KPJA 4EJSA 2F3RA 4HUTA 4CEIB 5IHPA 1HT1E 3J81k 5FOWA 2XTMA 1OH8A 2PZFA 2W58A 1BMFA 1R8SA 1XEXB 2OE2A 4Q5IA 1N6KA 5GJWC 1RPZA 2RGAA 3AVOA 4RD2A 5FTKA 2JLRA 1QZXA 3TK1A 4DSOA 3QF7A 1OIXA 2FX3A 5BN3A 1GVNB 4I4LA 4JVNA 5IRCD 1WQ1R 3UMRA 2GCNA 6Q21A 1QG4A 4OI0A 1U0LA 4P4SB 2XTNA 4DT1A 5CITA 3PUZA 2R6FA 4LHYA 4XTRA 2ZITA 4KFRA 5DI3B 4OYHA 2QQ0A 3ZQ6A 2NZ8A 1FMLA 4YMUA 1JQLB 4KSCA 3UWKA 3LW7A 3WYFA 1U98A 5CM9C 3X1YA 3Q85A 1K6MA 4DUGD 1G64A 2FEOA 1NBMA 2DYKA 5CK4A 4ASUD 1T5IA 1ZW6A 1Z47A 2ZRMA 3OFND 1E2EA 2WTUA 2IK8A 1J2JA 2GJAA 2IYZA 2QG6A 2Z83A 4FMDF 1NLYA 2PEZA 3I8XA 5EE3A 4JLVA 1NKSA 1NSFA 4NCIA 1SKYB 2FSFA 2IA5A 1SVLA 3AH8A 3TKLA 4DC9A 4KITB 2VRWA 1LVGA 2ZSFA 2G6BA 3BH7A 4D2IA 1G19A 4TSFD 1GNRA 1NBMD 3O8BA 2NGRA 4A4DA 1H8ED 3FVQA 3FHTA 2QM7A 2AX4A 2ORIA 2XX3A 4D4JA 2W2XA 4HYYA 1HQYE 4UXJA 2BWJA 1G5PA 2E9SA 3DEFA 2YYZA 3BK7A 4G01B 1Z0DA 1ZVQA 4ERNA 3K1JA 4DDWA 1KGDA 2OZEA 3FPAA 4JS0A 3PXGA 4KU4A 4QL3A 4A2PA 5DE3A 2P67A 4LJAA 1LS1A 1RW4A 3A4LA 3U3MA 3GLIE 4NYJR 2IYSA 2IHYA 4HATA 4LV6A 3EPHA 2IS4A 5FPTA 1OKKD 2A5GA 4Z54A 4AYTA 2ZI6A 3WBJA 1CJTC 3H2YA 3THYB 2R9VA 4BWYA 2O8FA 5E95A 1JPNA 1Q22A 2X19A 4ZDWA 1MH1A 2NG1A 4V0LA 1XEFA 1N0VC 4B74A 2OXCA 3T15A 4RJLA 4FW9A 4I1VA 2J7KA 3PUVA 4JYBA 3DZDA 1U99A 2FFQA 2P6UA 4EPWA 5JHGB 3LBIA 1J7KA 3B60A 2JJ1D 3LAWA 3C5CA 2PJZA 4HLUA 4J0QA 2IYYA 4JSTA 4P31A 5AUNB 2EVWX 4YMSA 1W2HA 3LQQA 2WWHA 2NPFA 2QP4A 2PMKA 1FPMA 4PQFA 2F9LA 3EZ6A 2JDIA 1VYVA 3TSZA 1SHZA 4D81A 3CPEA 3ZGXA 4E22A 5HTKA 4BZPA 1XPOA 2KI5A 1RZ3A 1XMSA 2XZPA 1M7BA 2GEVA 1UKVY 3S1AB 1OT3A 1QHGA 4JL6A 1G20E 1OIWA 4L8GA 2IXFA 4QBHA 4UNSA 3N2EA 1QF9A 4MYHA 3RSOA 1KO5A 2QGZA 3LX5A 1P9NA 2QEQA 4EKDA 1E9FA 5HE8A 5FL3A 4LBWA 4URVR 1SXJE 5IT5A 4Q01A 3TQCA 1P3JA 4YMTA 5EE5B 1A5TA 3GFOA 4ESVA 4NCHA 2N42A 4GMXA 1E99A 4KAXA 1W36B 1FUUA 2IYRA 4EAQA 4TT3A 4IDNA 2JDID 2Q3HA 4IDQA 1E1QD 5J4YA 3SBDA 2L0XA 2QMEA 3RAPR 1OW3B 4AD8A 4MDEA 2YWGA 2V1UA 3B2EA 4S2EA 3W6OA 5HPYB 4HAZA 1E9CA 1Z0AA 5FOXA 1Q12A 1A1VA 2IYUA 1R5BA 3IO3A 5A0FA 1AS2A 721PA 2ZRDA 1JJ7A 3MWLA 4PZYA 3AF2A 4QC2A 5DHFA 1G8YA 1II8B 1FL9A 4M0LA 3EA0A 2BKUA 1F48A 5FBVB 4UNRA 1SVKA 4LBYA 3W3AA 4UJ3A 3UANA 3MAAC 2VIIA 4D0LB 1P62B 4DIDA 1DOAA 3RS3A 4CT5A 2XZLA 3A36A 5L3QA 1EX6A 1OIVA 5DI9A 2BMJA 1DPFA 2ZETA 2FN4A 1CRPA 4AWXA 4JLDA 4U02A 3TH5A 2HF9A 4OQXA 4O3MA 1TEVA 2V6IA 3BFKA 2FG5A 2C96A 4ZCIA 4DEYA 3U7FB 2CVFA 4XJXA 2ZR7A 2QAJA 3ZQJA 1OXTA 2FF7A 4DCTA 3AVUA 3NG1A 4BFYA 2VA8A 3KUCA 1W36D 2HF8A 1SVIA 2B7BA 3G82C 2F1JA 2GNOA 4KI0A 5L8VA 3NH9A 3AP2A 4RZ3A 2RHMA 4OI2A 1IY2A 1NLZA 3QUSA 2BCJQ 3LVRE 3MWYW 3VAAA 1E1RD 1KI6A 4EFMA 2R6AA 3I4LA 3FKSA 1T6NA 3F3YA 4WOPA 2AHOA 4H1UA 2GJ8A 4JLPA 2EFEB 4MKGA 1X86B 4PZZA 2C9YA 3QENA 2REOA 3TMKA 4Z51A 1TF5A 2HV8A 4AYXA 1RRPA 2F3TA 1XWIA 4LSGA 3TVDA 3UPUA 1BH2A 2PCLA 3ZDQA 4DZZA 1P6XA 2YVUA 3GLFB 4RFSB 1YZGA 1MT0A 4B3CA 1OXXK 1BO6A 2OM2A 3V9PA 1KDPA 3DHWC 2DB3A 3U6BA 3IILA 5DN6D 3C4JA 3W8NA 1XCGB 3RRYA 2Q3MA 3SU8A 2ZU0C 4TTPA 1GRNA 3QG5A 1Z83A 4IXNA 2NTYC 3S1AA 4Q47A 2OUKA 1KJYA 4P4SA 5BYKA 1T8UA 3GCGA 1GRQA 2OT3B 3D31A 1QRAA 2OCBA 4HB0A 2A5FA 1VG8A 4B2LA 1D9ZA 4QHSA 1G8HA 4Y0VA 2IWRA 4AKHA 1SXJA 2ZRBA 4FI3C 1NRJB 1KK1A 1UJ2A 5AJVB 2VP9A 4BQSA 1KZ7B 5JRJA 3X1ZA 4Z8XA 3TVTA 1HTWA 4Q02A 3U3RA 621PA 2JLYA 3RRZA 1OH5A 2V4ZA 1T3LA 2XJ9A 1SVWA 1Y3AA 4LBZA 1G5TA 3NHBA 4TT3D 1XFAA 2ZSAA 3SZRA 3H1TA 4GRAA 3Q7PA 5DNYB 2O8DA 2QAGC 3AKEA 2ZJ2A 4URUR 3A37A 4LI0A 4DCUA 3R9XA 2J7PA 2CCJA 1NY6A 1RFLA 2OLJA 1BYUA 2PLRA 2E87A 2CL7X 1G21E 2ZSBA 3B8HA 821PA 5BN5A 1CTQA 4OI1A 3U7GA 1EFHA 1W0KA 1ZUHA 5TVKA 5FOUA 3VU9A 2ZRLA 3L0SA 2F6RA 3U5ZB 1N3BA 4IEEA 3FB4A 1B23P 3BFVA 4OK5A 1G291 4UXHA 2ZM5A 2O8BA 1R0YA 4KXFB 4PSAA 1G3RA 2IS6A 2NZJA 2QZ4A 3F5FA 2CCKA 3B82A 1CRQA 1DARA 3GJ5A 3HYRA 3T5DA 2ZAOA 4L4UA 5JS7A 1NVWQ 2A3RA 1KK0A 1H8HA 2O5VA 3IPYA 4G3XA 3QXJA 1AA9A 1XMIA 2ZR9A 4L5BA 5KDOA 1TQ4A 3T12A 3X1WA 3P32A 4OJKA 1NIPA 2CJWA 3EZ9A 1WE2A 4NZYA 1G4UR 3N2IA 4NH0A 1FQJA 2C04A 1S9HA 1IN7A 3GJ8A 3UATA 4EPVA 1VIYA 4EQ6B 2AKAB 3BBPA 3QPVA 4NYJQ 4BRWA 4PHFA 3LBHA 3AQ4A 1GFIA 3LDAA 5TY0A 1VYUA 3FHOA 1D2NA 4ILEA 2J0UA 4TQUS 1S1MA 3QPWA 3K0CC 4MGZR 1KTVA 1AN0A 1KI4A 2PX3A 3FMPB 3TW8B 1VG9B 3GQBA 4A15A 4JLBA 4HLUC 5FL7A 2F43B 4NYIQ 4WVFA 4HI0E 2ZJ5A 1GL9B 1XD8A 2CK3A 2ZI7A 3B1YA 4GOJA 2BEJA 4D82A 3KDSE 1NVUQ 3FHCB 5FR2A 2KB0A 2IYTA 2G3YA 1GDDA 1NMXA 1UM8A 2FGKA 1OH7A 1J99A 1DAHA 1W0KD 1E2PA 1YZLA 2BBTA 3L8ZA 5AWFC 5EP3A 5AUOB 1T5LA 3DMNA 4TSFA 3TIFA 3SJZA 4EFNA 5GADl 3KJGA 5DYIA 1N6HA 1U8AA 2H57A 3AVTA 1SVMA 1P5ZB 4RZXA 3VR4A 1Q57A 4XWAA 1N5LA 2B92A 4ACAA 3WP0A 4F4IA 4DDUA 1FP7A 1VG1A 2WV9A 4PANA 4BPBA 3CH5A 2IUTA 5KUTA 2AR7A 4GOKA 1W46A 3K9LA 2ECKA 5EUQB 4LZZA 1CJUC 2Z4RA 3ZVRA 1SKQA 4KLZA 3NBXX 4C2TA 4WXRA 4BFZA 5KSYA 4DB4A 4Q1DA 3WBKA 1D2MA 1NN0A 1Q0UA 1XPRA 2C77A 1JBKA 4HZUA 1NMZA 1WBDA 1YU9A 3BB4A 4LY6A 2FFBA 4F93B 3FFAA 4HB4A 2CLDX 4MDFA 2J7PD 4L9WA 3KX2A 1EXMA 4URYR 4WW0A 1EFUA 2ZJYA 1XCPA 4DLSA 5TDHA 4V0NA 1MRSA 5JJLA 4Q1EA 1VCOA 2VPPA 3CRW1 4UJ5A 1E2GA 3OAAD 2YC2C 4D25A 2FNAA 1CR2A 1QDEA 1US8B 3QF4A 1OJLA 1SULA 4QNRA 4KSBA 4TN1A 5FUYA 1XJCA 4GDFA 2ODWA 1E0SA 2ZRFA 3WYGA 4CW7A 1EWQA 1OHHD 3DMDA 1DE0A 3H4MA 1A7JA 2NIPA 1P2VA 1NY5A 2IYLD 3CNLA 3CPJB 3Q5DA 3EZFA 5H1YA 1P9RA 2CNWA 4RD0A 1NN3A 1HA3A 1LNZA 3GEIA 1Z08A 4KLNA 1KSJA 3HU3A 4A2WA 5AJXA 2XITA 1Z5ZA 5DN6A 4DSTA 1XF9A 2HEIA 4TMTA 2DY1A 2VTKA 2ZSEA 1VCIA 2ZRIA 1ZYUA 3TAHA 5C46F 5IF9A 1ZNXA 4FCWA 1O3YA 1JR3E 4FN5A 2Z43A 2CE2X 3C16C 3SFZA 4IHQA 3W3ZB 2XB4A 4IEIA 1Z0KA 5FBRB 1K8RA 1AK2A 5EP1A 1P61B 3GJ3A 3R20A 4JLJA 3MSXA 1KI2A 4Q9JA 4CT4B 3BE4A 2CEAA 2GXAA 2GILA 5JRZA 2JAQA 4TMKA 2AFHE 4C0SA 3RHFA 3KQHA 1WCV1 2EQBA 3K8YA 3GJ0A 3CIOA 5G53C 4DKXA 3VNUA 1WP9A 1XMVA 3N70A 3MG9A 4B3XA 1SVSA 3GEHA 2R6GA 1E79D 4NCJA 1IXZA 2W6JA 1FP6A 5D3QA 1FNNA 3QOFA 1DS6A 4YC7A 2PJRA 3K9NA 1E6CA 5JHHB 4N1AA 2ERYA 3AF0A 3GP8A 5EE1A 2WPDD 3GFTA 2J1LA 4IDOA 5KU1A 3ICQB 1MABB 5G3YA 1F2TB 3LWNA 2AK3A 3EZ7A 4RCZA 1KJWA 1CLUA 3BAFA 3IUYA 2Q0HA 2BMEA 4P4UA 1DADA 2HCBA 2GEDA 4M1OA 5DI3A 4WIAA 2O8CB 4GP6A 2WWFA 3D8BA 3TUZC 4JBWA 2J45A 2QMOA 4A0RA 1GAJA
chains in the Genus database with same CATH superfamily
4FQ8A 4GE0A 9LDBA 1BJKA 1GPLA 1G7TA 3IDAA 1Y9DA 3A32A 3CNNA 3CPSA 3MT9A 2GN8A 4E2ZA 2R8ZA 5BRJA 3EQ8A 3KHKA 3P0RA 5DH9A 3RYCA 4ZZ3A 4O2AB 3UWPA 4NTZA 4WDQA 4Z4CA 5FWNA 5E9JA 3GV0A 2HDOA 4TLCA 4PPGA 3ZIDA 1NJ6A 3QVSA 2C58A 4N3GA 3UAGA 4C6SA 3B1XA 1KKMA 1LV8A 4AS3A 3G7UA 2FSHA 2VN8A 2FV8A 4S0XA 3WWCA 5AW6A 4N3BA 2PMWB 2BI7A 4WN9B 1QQTA 3QVLA 3PQ5A 5HFJA 4WCDA 3ER6A 4JQZA 4GOXA 4LC0A 2OENG 3HCFA 2FPMA 1EG7A 4ZYVA 1R12A 1RXUA 4Q1FA 4O4LA 1BU8A 4Z2AA 5A5DA 1VBNA 5DYYA 5ALHA 4Z5XA 3NP9A 3OZAA 1C30A 1AF7A 3H65A 2WVAA 4RPCA 2FPXA 4X7PA 4XVHA 2QIPA 4ZALA 3T1QA 1GILA 3LIIA 4KO2S 4EW1A 4EJSC 1QQ6A 3B3AA 3FR8A 3LYLA 4M9RA 1ZJ5A 3WWPA 1NULA 3S8EA 2X3UA 1TTPB 2QUZA 2RARA 3Q0TA 4JQOA 4RYLA 3TIVA 4DABA 3OT4A 4DBLC 5AHOA 5IWAB 4W5RA 3O3OB 1V7QA 2BI8A 4O1HA 5BYJA 2ZB3A 1AQNA 4TROA 3P0HA 2OAGA 4NCAA 3ECSA 4OGWA 1K4MA 5DOVA 1R1DA 4YDRA 4YV7A 1U4SA 1FVXA 3IP3A 4CFZA 2Z8YA 4OB6A 4FZ5A 1Y8AA 3QLEA 3E8MA 4X84A 3HLKA 3L0CA 3K4QA 3ZUGA 1QCCA 3NHRA 5IAEA 3M3PA 2ZAMA 3K9WA 2NO9A 4EG4A 4A5OA 4C08A 1JLSA 3F5SA 2ZSJA 1WHSB 2RHOA 3A1DA 2DOKA 1F6DA 2Y8EA 5YASA 2VJQA 5IMBA 1RJGA 5HF5A 4FYXA 1XCBA 3UMVA 1R27A 1U0RA 1WHTA 4EIWA 5IULC 5LOVB 1QO0A 3IVMA 4AMUA 2OQRA 1A8IA 4AZ0A 4POOA 2RHJA 5IJWA 1O96B 2VAXA 4DTCA 3U4QB 2FP4B 4KTTE 3KU4A 4KV9A 4R9NA 2VHCA 5IC4A 3AF6A 4GKBA 4BKRA 3WMEA 4U7DA 4TXNA 4QPZA 1FDRA 1G21B 5CDUA 3NC1C 3ZQUA 1AQUA 2VJCA 2XGOA 4FR5A 1FK8A 4A0FA 5ADVA 4L85A 4A3SA 4MKIA 1NUQA 1UJBA 2DU8A 3WK5A 1PJ8A 7YASA 4RKQA 4BNJA 3EVCA 2ORWA 1HQDA 1MOQA 3PWZA 3WIEA 5HS4A 5FEMA 3VV3A 1BRTA 1MGPA 1T3ZA 1Y6RA 5AK3A 3CTMA 4MRVA 4HZIA 4BTLA 3F8TA 3NHWA 3GMSA 2VJNA 2GBLA 3EVNA 3HSYA 5D8DA 4JAVC 4RS3A 4JBLA 1WUIS 3C8DA 2P6OA 3EYAA 4RA6B 3HY6A 4BAGA 3MCUA 2Q8PA 1FSGA 4PRYA 5BT9A 1E2DA 1RCTE 4PFQA 1R0BA 4DYHA 5AVRA 4KRFA 2WHPA 2C9OA 1HEYA 4MRSA 5LQKA 5HKAA 1GNSA 1SZPA 5BN1A 4RTRA 1ANKA 1JP7A 1YBVA 3D0RA 2BFFB 1RAGA 3BCSA 4G26A 4EBFA 3K2IA 3O93A 1UOEA 1NDHA 4CMGA 3UG6A 4ZEOA 3AUYA 2ZQ5A 5BO5A 2HY7A 3L1JA 1R9GA 1Z22A 3GT3A 3ORYA 3OT5A 4L7QA 3TB4A 4NI5A 1BROA 3ZLJA 4QM6A 4JCCA 2UUOA 4JUDX 2VCHA 5B6IA 3SXPA 2JB9A 2JPDA 5D01A 1LFDB 2EYQA 1M67A 3QHAA 1YB4A 2J48A 2OSVA 3F7NA 4IMIB 4JJ6A 3SLKA 3HN7A 4CKBA 1RJ9B 2HV9A 1TA9A 1M8PA 2I4NA 3BGVA 3T8YA 1L5YA 2V7TA 2R86A 5JIBA 1R88A 1ULBA 1PV4A 3LT2A 1U3WA 2EWMA 4QQFA 4HBGA 3A3KA 1O95D 3JXEA 1N6RA 3PUJA 3GLFE 1X87A 1EFTA 1PUIA 4J7AA 1RM3A 5FFNA 2D1FA 5IW8A 1ZN8A 3PFIA 4R1QA 1A98A 4LFAB 1AC5A 3G9UA 4D3SA 1FQKA 2ZPAA 3ZXUB 3UWSA 3I5AA 4LXTA 4CUJA 1XD9A 2Y6UA 2EBUA 3TXAA 4KIFA 4HOYA 1S3SA 3NGMA 3P9IA 2IL1A 1ESDA 4YONB 4FFPA 3VYWA 4DLXA 2J5QA 3AI1A 4EMUA 4F2WA 4B34A 4JA0A 4EB3A 3RRFA 1IOVA 3IAHA 3B3FA 3JAKA 3R7FA 1AF4A 4WRRA 3W77A 1NJ5A 4HP8A 4C0HA 5JBQA 3EQZA 5H70A 2Q4EA 3GBVA 1XIVA 1M1XB 4YO7A 4N6NA 2HRZA 1T1EA 3OEHA 1YE3A 3MTGA 5HKKD 2BP7B 2CLKB 5JSQA 4DLBA 2P4UA 1F14A 1O97C 2XMQA 4UW9A 3R7WB 5AW3A 2J3LA 1BU5A 1CUFA 3TRKA 2GD1O 3ND5A 4BO2A 3JSAA 2ZT8A 3PQ6A 4M9ZA 5C4GB 4BNXA 2H4HA 4QQNA 2WU3A 4LYJA 3ETGA 4EELA 1KARA 1DG9A 2RH5A 3QYAA 1K4YA 4B7UA 1GZ5A 4NAUA 3ZWAA 1OLUA 3LF2A 4M2LA 2Q7XA 4UDNA 1FUEA 1CF4A 4BCCA 2C61A 3FZGA 1IH8A 3G5MA 2PVSA 1KYXA 1SBTA 2H07A 3UT5A 4B3FX 4DDTA 1ZGAA 4YV2A 1KY3A 1SXJC 1QB8A 4KNWA 2F3QA 2VC2B 5AVVA 2EKPA 3BWBA 1VSQA 2ZUBA 3D3WA 1W581 1KK2A 5FORA 3DE2X 3RRNA 4BGEA 2Q3FA 3IHWA 5EMNA 2ZSUA 1JFLA 3P52A 3ADKA 4R6XA 3CSUA 2V45A 3H5IA 4MV4A 5FBWB 1T9HA 1E9AA 3F47A 4N41A 5FUXA 1ONBA 3B1WA 4BBPA 3QEBZ 4FZ3A 1D2GA 3LDGA 5GAJA 5ICFA 1UMBB 2CYBA 3CH4B 1QGZA 1GZ7A 2GBPA 3EMVA 3X43A 1E4YA 2QUKA 2XIJA 2GZ3A 2OSBA 3GA0A 3RNLA 5L9AA 2EHJA 4GPIB 1W4ZA 3DF7A 4FILA 2GKOA 1C2YA 5BUSA 3TGLA 2WJYA 3BS4A 4RIFA 3PVCA 3QXXA 4GZMA 3X2FA 4CDGA 5L53A 2NYAA 1IZ0A 1HV8A 1SBCA 3LQFA 1TZKA 1QC5A 4MR8A 2HUNA 2BGKA 3BMOB 2WJZB 4IJKA 1YU6A 5REQB 3OE4A 4U9UA 1DUVG 1NQVA 1R10A 4BP3A 5JCOC 4CMHA 5JD5A 2PDAA 2GN9A 2WYWA 1QOQB 3IO5A 1PJ4A 3E70C 3LKBA 4ZJUA 1J8QA 3P9RA 3MHTA 5HWSA 1GA1A 3M6XA 2BM1A 3OTGA 1XMJA 4LF9B 3S99A 5G0VA 5DK6A 1G59A 1DBPA 4LYAA 4EQ6A 1FX0B 5FT9A 5I5GA 2HQRA 5GOTA 3CTPA 1YZYA 1B6TA 1OY1A 1TKCA 4F56A 2H85A 2VDJA 5DASA 2Q1WA 3DUFA 1J2EA 2WA2A 2Q7DA 3LWZA 4D4KA 4XQ9A 4ZI7A 4F3TA 1L7DA 1G0OA 2C98A 3NYWA 3LHDA 2Y9PB 6PFKA 4OQZA 4DCCA 2A9PA 2A78A 5LYJF 2VYCA 2V9CA 3EIFA 3RGGA 2LZ0A 3JWPA 3TTTA 1RQLA 4EQZA 4UM9B 1FW8A 2FW6A 3M2PA 3QOYA 2RK6A 5AQEA 1VLMA 1XNQB 3OE1A 2CXRA 3MTBA 1G41A 4GWLA 1S02A 4KK3A 1XCOA 2P9CA 1W5TA 2WAYA 4XGQA 2C2XA 4MWZA 4TZTA 4MW9A 3AW8A 2FMHA 2O1SA 4URWR 1JMYA 2F62A 1CRLA 1JU3A 1VL2A 3VSCA 4C0WA 4YT8A 3PT5A 4MH0R 5I9SA 3C7CB 2KBFA 3NANA 3LHKA 1YRLA 1RM4A 3BWDD 3V8BA 1Z0ZA 1QRRA 4RH0A 2VTEA 3ZHRA 1GTG1 2E85A 2VYFA 3JAWA 4EKEA 4QDOA 2JGRA 1LWNA 1L8OA 2ASVA 1LPSA 3QLVC 4FD3A 3AEUB 1U04A 2BBOA 3SJBA 3MJVA 5HR5A 1WB9A 1LJ8A 4LC1A 2BPOA 2BYTA 2MSCB 1T8WA 2ZBDA 3BTUA 5JDCA 1B2RA 1ISFA 3O9ZA 2OG1A 3G2JA 4ALJA 1P72A 3DZHA 4YAFA 1I3CA 3T35A 4DJEC 1PNTA 4BUZA 2P9FA 4F6RA 1RQNA 3MBOA 2CLHB 4H4EA 4E70A 5CLLA 3LY9A 3SHVA 4TS1A 2ZU6A 4ND4A 2CF6A 2CJPA 3ZHTA 3D9QX 4LXGA 1WCYA 1HR0B 2F1RA 5CURA 4G1FA 2EIHA 3C6KA 4RKEA 2FWRA 5LZ7A 3WFZA 4YR9A 3CT6A 5T4HA 2GFQA 3U44A 5LOVA 3G2PA 5B7QA 4FEGA 4GEKA 1JN0A 5HKOA 2FP3A 4QEZA 3KKNA 4NYIR 2WKRA 3DE6X 3SYKA 4YJ3F 4JBXA 5GMOA 2SHKA 2JHPA 5DMXA 2B4TO 4R51A 1A27A 3ZW8A 1P2GA 3PDUA 1KVUA 2GUGA 1GPYA 3HP4A 2KLBA 2AKYA 4D1YA 1EYZA 3RUAA 4W4TA 5GP1A 4AY3A 1R4AA 3WS7A 1OOEA 4O4IF 1KI3A 4JR0A 1DAEA 3U0VA 3W05A 4QBGB 4YK7A 1I7PA 1M6VA 3QVWA 1KEPA 3RGWS 4MRPA 4BE4A 4YA6A 5JG7A 4NE7A 4BQOA 1ZD3A 1GR0A 2ZR8A 3WFJA 2Q0XA 4TVSA 4WXEA 1CZLA 1ZIPA 1MHPA 2QPTA 2GN6A 3EWSA 3THYA 1KRWA 3AEYA 3VR4D 5ESDA 5KI6A 4MHTA 4JI1B 2ZIAA 4C43A 1GKUB 2AJ8A 4NARA 3ZD6A 4MJLA 2XRFA 3VHLB 2H18A 2QRNA 1UFQA 3GGCA 3UHFA 3CLHA 1RHQA 3KTOA 1ZN7A 3JYLA 2ZUDA 4YRTA 4IJUA 3BORA 1F1JA 2V97A 1VBFA 1K2WA 2PMDA 4RVFA 3RKSA 4C7OA 4UTZA 5FWXA 3KZXA 5CHEA 3A06A 2EAUA 2CCGA 4QXQA 4UCXA 4QFCA 3S5UA 2JH3A 2PEYA 4CKYA 3HYLA 4JU9A 3B7GA 2PLFA 3U3XA 5FUMA 1W8IA 2HSGA 3RC9A 1Z2AA 2WU1A 4JJGA 4P5EA 5AKIA 5LQMA 4PRZA 2CMGA 3FWHA 1PJQA 2V0GA 4PZLA 1KTIA 1TVKB 1IB6A 2GXSA 1XKTA 4QUKA 3W3AH 4MI6A 1CJCA 1R0SA 2OBLA 3RSZA 4CTJA 2ZAGA 2C9CA 2DFTA 4LSWA 4CNQA 1LX7A 2HA4A 3PUHA 3OM1A 2Q1SA 4QVGA 1OGYA 3VVBA 221PA 3HCWA 2YXBA 1LC3A 1MUUA 1Z6YA 2O0MA 1Z2CA 4DS3A 4EHJA 5DNEA 2CVHA 1Q2UA 4FE7A 4X60A 4BMCA 4F5WA 1FFWA 1KMHA 2RONA 1DWOA 5JDIA 1SO8A 2JGKA 3ZDYB 2RIRA 1U9CA 1L2TA 2FQXA 4X61A 3CUUA 5EWJB 4MITA 4W7SA 1NBME 1A2QA 3I45A 3G5UA 5BN4A 5JVDF 1ZNWA 2PUGA 1BFDA 2ZB7A 4S1OA 2GBGA 1FFEA 2J87A 3HI4A 3VSDA 5NULA 3DE4X 2H3EA 3DLAA 2AK2A 1HI9A 5I7AA 4KREA 1Y4ZA 4N0EA 3TI9A 2ES4A 4XQEA 5DU2A 1R8YA 3ZYZA 1IK6A 5KAPA 4F97A 3TTSA 4R41A 2Z6UA 5IAKA 1JLLA 2H7XA 2QNBA 3VRHA 3E7XA 2C03A 4D3FA 4NFLA 1Q7EA 3TX2A 2O8BB 2P2DA 1HMYA 4Q4JA 4TL6A 2FRVA 4BEBA 4E1VA 4LQDA 3VC2A 1T2AA 2OXTA 1MJNA 4EG1A 3DH0A 4L4XA 4A8PA 2Z2ZA 4J6FA 4O02B 3JWIA 1K66A 1SR8A 3LCCA 1PT9A 5EIFA 5E4FA 1G6OA 4Z86A 4MEAA 1N5IA 1Y5IA 1FMJA 2ZZNA 5L45A 2O2GA 1NN1A 3I2FA 1MJGM 4ZVTA 3FSEA 3C97A 2OQVA 5AVUA 4BXOB 1SU8A 1R8QA 4Z0TA 8OHMA 4GI5A 3ZY5A 1R8XA 4KQFA 5I7FA 1JL3A 1D2AA 4OJQA 4BC0A 4B71A 2GZMA 3QA9A 1Y5RA 3PXXA 4EA7A 2LDXA 1TVMA 1N6OA 2OHHA 3LXUX 3FOCA 1OC4A 3OP1A 4FGSA 2HNKA 2WWYA 1XNRB 2GXUA 5FV4A 2ID4A 1MC1A 1P6UA 3M7IA 4DV6B 5C53B 1NPTO 3WI7A 1MLDA 5F2KA 4A6PA 3EC2A 5BORA 4BGDA 4QO8A 3WNZA 3OEEA 3P27A 4LMAA 4DUGA 4Q9LA 4KN5A 2HLDA 1QB7A 3LSTA 1WPGA 4BTEA 1EHIA 2FPOA 2J3QA 3UGQA 4Q3CA 4Q7EA 3RUEA 1OYVA 4G9BA 5IK2A 1R74A 3DBVO 3JQCA 4BO4A 4BVHA 3N5KA 4R98A 5CH5A 3E9DA 4TVOA 2QG9A 2XZTA 3ES9A 3HWWA 4JVSB 1Z5UA 2LVBA 3EBLA 4MCIA 1IQRA 3KAJA 4KIUA 1UAGA 3KXLA 3AB8A 5BWCA 2JFWA 4I55A 5JZOA 4LJ6A 1J4AA 1JZSA 1E7QA 2HSEA 1IBKB 3JALA 4IWYA 1BMDA 2EKLA 3OUZA 5HRAA 3GJZA 4C29A 4GX1A 5C1BA 3R8FA 1X15A 3QP9A 1SVNA 3E9ZA 1DEHA 2KWIA 2W6ID 3D3KA 3NBKA 5TVGA 3UJ9A 2P5TB 3VU8A 4BRUA 4CCYA 4HQRA 5EZYF 3QLVA 2FVYA 5G0UA 4A10A 5DNAA 4YPFA 4D8TA 1UBEA 4IHKA 5LIPA 3SIPA 1SHKA 3TMYA 2L69A 2ZIEA 2FZLA 3FKSD 1GU0A 1IMJA 1ICIA 4NENB 2XEXA 1Y8RA 4R31A 4XRRA 1GPH1 3EPPA 4JR2A 3L79A 2HO5A 1ADCA 1LSJA 4XR4A 4DQ0A 3K70C 1WBBA 2G28A 4EY8A 2N0SA 4TVBA 1V6SA 1N1DA 4L4YA 4E09A 2XDQA 3TWOA 2EIXA 3DCNA 4ID3A 4AO7A 1D2RA 4J91A 1N7HA 1G5QA 4L02A 4C0AC 5JCOA 3GLGA 2YNMD 1ZVVA 2ZREA 2E2WA 5IBPA 1Z28A 4A1OA 1XVTA 1ONNA 1XQVA 3EEBA 5IT0A 3MMXA 3DEYX 3NJ4A 3K30A 3IT2A 2I99A 3L7LA 1A76A 1H4TA 1RQGA 3U7JA 9LDTA 4X66B 1Y9EA 3F1LA 3AQIA 1MFPA 1PWHA 1EVKA 1Z29A 4AI6A 1YUMA 3LW8A 1D4ZA 4GBMA 3U6KA 4JI0B 5HZHA 5FOTA 2IPNA 2VUSA 4P08A 1O8CA 1L3IA 1KS9A 4JLMA 4KYVA 3PQDA 4PYQA 4MUFA 3V5NA 1U1GA 4K6CA 1WUKS 3R24A 1I9GA 2GRUA 5CMLA 5LWHA 2GPTA 3NTVA 4QJIA 5F12A 1NVVQ 1WEHA 2XWSA 3KQOA 3N8KA 2QTRA 1VE7A 1JIIA 5CD9A 1H93A 5FPHA 2X2PA 3NIDB 1JF8A 4N8EA 3TTWA 1P39A 3B6EA 4KKVA 4YHBA 5HZMA 1JLMA 4X1YB 2HRRA 1CB0A 1WMFA 3UHJA 2HBYA 2R5NA 1OZAA 4PE5B 1CW2B 1G8PA 2NAFA 1MJFA 4GMDA 4V1CB 3A1FA 3X1DA 4EB6B 3EWAA 3HDTA 3JQPA 3NBQA 2QVBA 5A6SA 3VU9B 3BDIA 4EDHA 1E92A 2RKOA 3HWSA 3CEPB 4A26A 1QCDA 1Z3CA 3F4LA 4PSVA 1PRYA 3V4VB 5KYXB 3IEXA 4HGZA 2XH8A 5G4KA 4JUBA 4MPJA 1LS6A 2W2OA 5DXJA 3ZX5A 2J6BA 2DWOA 2OV6A 3GT4A 4GSKA 3T7IA 2Z5GA 2CNNA 3WY9A 1TQDA 3C8HA 3LP8A 2PAAA 1GCAA 4BNDB 4FOTA 3QX7A 2VDWB 5BWLA 1O03A 4XWGA 4DV5B 2CF5A 5DT2A 3PD7A 1NLFA 4OCZA 3CM0A 2DR3A 1PV1A 3RWOA 1KSHA 3HJCA 1UC4B 5LA6F 1Y7LA 3G2LA 5LLDA 5TPWB 4DMCA 4MUKA 4FCTA 1ZRHA 1SWVA 2IXEA 5LP1A 4S35A 3Q7TA 3D5QA 1O6ZA 1P18A 1S8FA 2HA3A 4HS4A 1IVYA 4L9SA 4WFJA 3ONVA 3T5BA 4LXHA 3VMFA 5J3JA 1F0PA 1XLWA 3CW9A 4IXTA 4IX9A 1X1AA 4UVEA 1HFWA 2FX2A 2WBLC 3OIDA 4IVNA 4JROA 3B1KA 5DNVA 2PQ6A 5JEDA 3A9SA 4B3TB 4ZEMA 1Z7GA 4MARA 2Q9CA 1Q3HA 4GM4A 3OOYA 4CQNA 4Q3KA 4E7OA 2WEKA 3O8RA 1YL6A 1RAIA 2D06A 3KQQA 5TEWA 2AQHA 3P9YA 3PGVA 4HB2A 3W1EA 4QLOA 2IUFA 1NR7A 1RHUA 1LDEA 2D59A 3EVTA 3LFTA 3ZDXB 1NVXQ 2PHZA 5E8RA 3GLQA 3PRJA 5GV8A 1UBUS 1E58A 2W00A 3OFVA 3PHGA 4NPAA 4LXYA 5CAEB 4AAYA 3GJ4A 4PX9A 4DRZA 2QD4A 2R4QA 3U3ZA 4NICA 4P4TA 4W99A 1VECA 1ZMOA 4JUAA 1B23P 3QUAA 3QKRB 5ELLA 3H2SA 3WNBA 5A0VA 2MSDB 3OQ1A 1OXVA 3NR2A 1P1RA 3QKTA 5K3BA 2XT9A 2OR3A 3TIXB 5B3LA 2XW6A 5LMCA 1V4NA 3TRFA 1VJ5A 3MBKA 3G85A 4TTAA 1XRSB 1AMNA 2R7AA 4CKCB 2ENWA 4OMUA 5LKRA 2ZS7A 4D4MA 4HDKB 4DUPA 4MEJA 4YRGA 2FMUA 1E2BA 3R0XA 5EL0A 2BH2A 4C4AA 2IS2A 5E4YA 5KTYA 1TJYA 1ONOA 1GQQA 1Y8CA 2AXPA 1POXA 3ZBPA 3FLEA 4M1EA 2IS1A 3Q9NA 3IJPA 4HZUB 3IAAA 1CY6A 1DDOA 3PC8C 3K2EA 3RSGA 2VVTA 4XXHA 4TYWA 1HOXA 2QK4A 1JDNA 4J7XA 1PR6A 2ACEA 2ZTSA 5EXEA 5CDGA 1KY2A 1JKMA 3THXB 4BMOB 1H2HA 1M33A 3H19A 4G09A 5EERA 4CIYA 1QMPA 3C39A 4KXMA 5F23A 2IXBA 2BISA 4RFSA 5JATA 5J2TF 1XJWA 1I7LA 2D3WA 4HAXA 4ND8A 1LNQA 4OBWA 3OPXA 3PJGA 4RXTA 3FFBA 1RM0A 5LQUA 1ZBQA 3GJ7A 2GHIA 3EX7C 3UOGA 3QKUA 2JFGA 5FWYB 4JT8A 1EP1B 1YQXA 4I4IA 4MQLA 4A6XA 3EW9A 4FJ1A 2KM1A 1H69A 4L6IA 2Z98A 1DZIA 2YVAA 5LP6C 1WKCA 2EJVA 2MHCA 2O14A 3KVOA 4NPCA 2AQIA 5LU8A 4F71A 2ZRNA 3DPSA 5CB8A 2P6NA 2IIPA 1M6NA 3Q0EA 4EG0A 4RS4A 2HSJA 3GGJA 2R2GA 1QO9A 2M6RA 4B6JA 4R54A 2NSLA 3K0FA 2UYGA 4WZAE 5C8YF 4MR8B 4KBFA 3NNNA 4LDAA 1BGWA 2EFHB 1EZZA 3AR9A 3GJTA 2E4WA 4X1YA 2P6PA 2O2CA 4ZMSA 2HGZA 2Q5IA 4UPVA 1KZYC 1UP6A 2N75A 2N46A 4R9VA 4C88A 4LJSA 4PS0A 1UANA 2GN2A 4GLFA 4LJLA 2XMRA 1NI5A 2PJDA 4FSXA 2UYHA 3OD5A 5JI3E 1UMBA 3IC5A 4LQCA 1OR8A 1WXGA 3Q2KA 2VPXA 3ND8A 3RG2A 2J3JA 3M6AA 3S7ZA 4FB5A 5B7NA 3B6JA 3ZE7A 4KYIB 4PZPA 3OTHA 3ZTTA 4OHBA 3ND6A 1LBEA 2JAHA 1XLTC 1P2TA 1PL0A 1SBQA 2BGJA 3AF1A 3LY8A 4BFVA 2P69A 4LYYA 2UYQA 4HWPA 3ODGA 5DM0A 4DLRA 3E8XA 3E3OA 3HXQA 4HFJA 1PLLA 5E1MA 1T4GA 1TLTA 4NATA 2WYOA 3VV2A 4B3JA 1M6EX 1FXWA 3QE0A 1PLKA 1SELA 3LE8A 2CVOA 4QXRA 3QFTA 2FN7A 2HCRA 3CX3A 5JYBA 3D64A 3HDYA 1B8PA 2WMOB 2O48X 4N7BA 4F4FA 2WRZA 1BDMA 3DL0A 4M0DA 1LSOA 3AHHA 3TNFA 4D6PA 2IOQA 4NV1A 1ZOPA 1KI1A 4DA6A 1PT5A 4ENWA 1D4FA 4JI5B 4P3PA 4LWOA 2BR4A 2EP7A 4PZCA 2QN6A 2WICA 3AHEA 1HBJA 1HKHA 1NNLA 2FOLA 1TRHA 2X13A 4MS1A 4UOQA 5EP2A 4KPFC 3BXZA 4PLGA 3T4EA 3T9CA 3V1UA 5BWNA 2ZZMA 1G7RA 1UFKA 3O03A 3D6FA 3E58A 4LJYA 1F5SA 2E5FA 5EZ6B 1IXRC 5FV7A 3OA2A 2A8YA 3HEAA 3CNEA 3LXRA 4Q7KA 4UHJA 5FR1A 4I4NA 3CX4A 4DFDA 1QF6A 3HZRA 4JB0A 4DCJA 4B4OA 3ILXA 1KZ6A 2A1UB 2WJ4A 4D9MA 3U7QA 5IDXA 5JU6A 3Q8WA 1FU4A 1K0UA 4KH1A 1L4FA 3ZJTA 4RZQA 3NKVA 1V43A 5CVUA 3PIRA 1YAJA 2BBSA 5BSKA 5JAZA 1QQBA 3PPWA 2WINI 4ZC1A 3WKEA 4BNLA 2JJ2D 1P80A 3IX7A 4H7FA 4CCAA 4EMTA 1MCZA 4MLPA 3U0BA 5KNBH 1QH8A 4HDSB 3BJIC 2VYVA 3X44A 5CIYA 2FEKA 5DWVA 1UINA 2EFJA 3I32A 3LOPA 3M4XA 2FEWB 1PKEA 1VKJA 1KH1A 2WHRA 2ZGVA 4N6OA 3E9QA 4P5DA 3I5XA 1UK6A 4F9EA 2VK2A 1ZNYA 1C5KA 4GXNA 5DHPA 4B3IA 2AFHB 1ZM3A 4B79A 2WJJA 3RCBA 5G1PA 3ZU4A 3ZLTA 3F6YA 5J5AA 1M9NA 3D7LA 1EBFA 3HGQA 3KT6A 1PSZA 3RVBA 4OUDB 1ODKA 4Y3UA 4CM3A 5DYWA 1IUOA 3OLCX 3C6MA 1TMKA 4JUFA 4R3UC 1LD3A 4CGYA 1DRJA 2FRDC 1VB3A 1Z88A 2GZAA 4N7JA 3JAWB 2WNIA 3D7KA 4M0UA 4LBVA 2W2VA 3WZMA 2L42A 4XIGS 5AVZA 3PEYA 4HJXA 1J97A 4RMIA 4L76A 3WKCA 3WL7A 5EJFA 5BY2A 1MOZA 1BS1A 1YB5A 1DSSG 3BN3A 1P4RA 4C3ZA 2I1QA 4TMFA 1F4LA 1K06A 3NCTA 3R5TA 3ZDFA 4LJKA 1A8QA 1P0FA 2C2HA 2PU5A 1TLLA 2ZB2A 5JZBA 4D99A 4YBZA 5B2EA 2GCGA 4O25A 4B4VA 2X22A 1CY8A 4EJMA 3GFPA 1YKSA 2X1HA 2UVPB 1E7MA 2FPLA 3C3AA 4AURA 3G1TA 3MOGA 1QLHA 2BC9A 4ZXFA 3CMMA 3ECCA 1LPAB 4X8OA 2H2HA 3AGQA 4PXSA 4RF4A 4M8NE 3NOQA 1K8YB 3CG0A 3FG9A 3FVVA 4U2DA 1KO4A 4QICA 5CPBA 5BVHA 5DJ5A 4CEHA 2ZRJA 4JITA 3KYIB 4PZEA 3PC8A 1CVIA 3M33A 2JI4A 3S2SA 2J4CA 3MQ4A 5LYYA 2KJQA 4H1HA 3OQIB 4K9OA 3INRA 4JJFA 1G21A 4QWWA 1OLXA 1TW3A 3WFIA 3IEPA 4ZEWA 5CEJA 2JL1A 1F5NA 2XUJA 5A3VA 3CQ9A 3BXOA 1DG3A 3IAFA 4M89A 2EZ4A 3CF2A 3L82B 1L4HA 4OHRA 4BE7B 2W2MA 3AERA 4MV0A 3UK6A 1XD2A 2BIFA 4YV0A 3GZNA 2YZNA 3EGCA 2ZRQA 4D96A 4K86A 1J22A 3O8CA 4RY9A 4K9KA 5TT1A 5I3ZA 1JR2A 3T61A 3NVDA 3NTXA 5KTMA 3L7BA 4IF4A 3ZI7A 3CISA 1SGWA 4KO4S 4DILA 1SG9A 2EFGA 4PEVA 2I54A 3D4IA 3D0OA 5GWXA 2VDKB 3O75A 4LJ9A 3UMFA 5KSWB 3JYNA 4ECAA 5K0SA 1E20A 1NA5A 1JXMA 5FAXA 3AWIA 1VL6A 2HRDA 1YT5A 5K4HA 1LBIA 5H83A 2XYVA 5FWXB 3J81A 3LG2A 3ZZNA 2P2CA 3E48A 4BNWA 2WNHA 3VU0A 5A5EA 3RBAA 2A1TS 3EF1A 5FIUA 1J2YA 4K6GA 3ZLUA 5EE0A 2E0IA 1U2DC 2PQ0A 2UDPA 3LHIA 4X44A 1IZZA 5CB4A 1OWPA 3SOPA 2QTVB 4TL8A 5KNDA 4LXIA 5CA1F 4UAUA 2MYPA 3M49A 1J06A 3JYPA 2WJHA 3ZS9A 1IEVA 1P7YA 4M37A 4R1UA 1C4OA 1OX6A 2AD1A 2E4YA 5BR1A 3KKKA 3V8NA 4BYMA 3KB2A 4BZZA 1YC5A 1MTOA 3SC4A 2RHTA 5ALLA 1KOJA 2G9QA 1SUIA 3BB3A 5K5EA 4DDVA 1U0NA 4NKRA 1R4MA 3SXUB 3C45A 3EEFA 3I73A 5B37A 5F5LA 3RO7A 1V8ZA 1GAXA 3GOHA 5ABPA 1EIWA 4GGPA 3QJ5A 1T4CB 2QIOA 2QZPA 2QMUA 2X8BA 4J1SA 4PHHA 4RHYA 4RZHA 3R4CA 3A6GA 1AO3A 121PA 4BFWA 3DZ8A 4F3YA 5KNDH 2QTVA 5ALPA 3SEFA 2IBMA 4UVGA 3VUEA 2JLUA 1JIXA 2G4LA 3DT9A 2R1TA 1XHFA 4ZVUA 1GITA 4DVJA 1U0BB 3KQTA 2BFPA 4R0VA 2C5EA 4NZ9A 1ODJA 3I30X 3N75A 3I39X 2G83A 3FYUA 2PU7A 2RHHA 1NVVR 4IOMA 1JFFA 3WWEA 4Y18A 1ZGZA 1WSDA 2F3SA 3B3JA 5JCJA 1B1CA 1LX6A 3KEMA 4H4DA 4UNPA 1ZGCA 3WR5A 1JEYB 1OI2A 3QMMA 5JJIA 3H9CA 4KR0A 1YRAA 4HGYA 5AUQA 2SCUB 3J7TA 1JDZA 2NUBA 1GSHA 3JX9A 1IAQA 1NG1A 1NIJA 1P4JA 3NBYC 3PP8A 4HDOB 4V3BA 5D51S 1ND6A 3QBJA 3TJRA 3T54A 2PZEA 3ROEA 1Z6XA 4OL9A 3MJEA 5J43A 2BFBB 5DNUA 4LMRA 3BA1A 2ZBUA 5H9VA 4MR7A 2EFCB 4TTJA 1N2CE 1QHHB 1T0JB 1YQDA 3G0BA 1P77A 3MGCA 4MCJA 1BWQA 4Q3LA 4WADA 2PZAA 1PJ3A 4ICIA 1L5NA 1E3MA 4UTPA 4F8EA 5DBIA 4MVJD 3TDMA 3LKDA 5A3RA 1BWSA 1N2BA 3KRTA 4KQ9A 5CVTA 1W19A 3NDPA 2P9BA 4IIUA 4TV8B 1TL7C 1XZFA 1MGOA 1LWOA 1WNFA 3EDCA 1NZFA 2HO4A 4NE9A 3P4XA 2G09A 2QI9C 4R1PA 2SECE 3OUTA 5AP9A 4B7ZA 1ZAYA 1Z34A 4P34A 5G1NA 1E2KA 1CZRA 1F8GA 1SCNE 1FP1D 3HYTA 3A11A 3ZWCA 1P5HA 2B1JA 4FS8A 1QX3A 1VI2A 2PO5A 3OG9A 1PW7A 4E11A 4FYWA 2JLCA 3LT5A 2BE7A 5CA1B 3LDFA 4RLHA 4YLGA 5P21A 4EHHA 4LKRA 1E3QA 4K2HA 1ZX1A 4M22A 4MWEA 4RF3A 5HIMA 2V7GA 2PM8A 2E5LB 4P22A 1DXOA 2ZSKA 3QLJA 4QUDA 2QTMA 4RKFA 3HYSA 3QNWA 1F4PA 2CFTA 4P58A 3SIXA 1FYVA 1WKVA 2D7CA 3LH5A 4BJ6A 4PPQA 4B5KA 3AJRA 4BFLA 4IDHA 3E9RA 1R5NA 2IC5A 4IQGA 1DEXA 3C4VA 3UJPA 3LX4A 2WM2A 4PBSA 1NQOA 4ZT3A 1GIAA 1KPIA 2VQDA 4LHVA 2ZYTX 4AUKA 3RC8A 5IM4F 3FMGA 4OBBA 1J8FA 4B3SB 1RI2A 3MD0A 3NWEA 3NBFA 4YCNA 2GVZC 2XNJA 1XG5A 2M6KA 2JKZA 1UJCA 3P2MA 4W5HA 3KSBC 2RAVA 1ZM7A 4EGCB 1C9JA 1QFMA 4ER5A 5JMWA 3V4FA 4KYUA 1Z0SA 1YI0A 3ONFA 1LK5A 1M34A 3HGTA 4FCVA 4GQBA 4P7GA 4JI7B 5AICA 3FYSA 3HJTA 4NK4A 2BFNA 1CJMA 1KI7A 2GT1A 1JI3A 2X3YA 4QRIA 2D1RA 3UJAA 4YJ2A 4RW0A 2VDUE 1RWKA 1RYNA 2Z3WA 1OMOA 3JD3A 3VO8A 4OQYA 2CXQA 2RCNA 2R8OA 4G41A 3VDMA 2FY8A 1H94A 2Y1GA 5KCZA 2JD0A 1NJ1A 3I6BA 1QGED 3V7NA 4I50F 4Y0AA 1YCDA 2IEGA 4DEVA 4JXKA 1PEKE 1T5TA 2IPXA 3HZOA 2J0EA 3LUBA 4RD3A 4AECA 5KJFA 1UADA 4LS3A 3NB0A 2GEBA 4D9FA 3EY9A 2BM9A 4Y2GA 5K2MA 3WLJA 4BOYA 3OJEA 1ZZEA 3KLNA 4QEDA 4AY4A 5HUJA 3Q1LA 4P8RA 2IUUA 2A5LA 1Y0BA 3AY0A 2ALJA 1TUIA 3M5PA 3QJYA 4ER6A 3PEWA 4AJPA 2OXIA 4UMEA 1OBCA 5AHXA 2WAXA 3OFNA 5CP8A 2M98A 3PE3A 4N01A 4QT0A 1P73A 1N2EA 2XUKA 2ZI9A 3VISA 1ACMA 4IDAA 1CVRA 1J5XA 2ZBRA 3BHMA 3FNBA 3SI7A 2XA2A 4L2IA 1ZCJA 2IYVA 4OHMA 1HNXB 4RZ2A 3DBIA 3IESA 5AJTA 1YZKA 3Q2IA 3PYXA 2E1RA 4JCOA 4C6TB 4CEJA 1C3JA 1KO7A 2QRHA 3QUBA 1K6IA 3T0FA 1RXEA 1K63A 1QKJA 3ZHQA 3ED5A 4QLAA 2GZSA 1FIUA 4RE5A 1DQPA 1ODSA 2QRJA 4C4OA 1Y6GA 1G5RA 2QTNA 3NXSA 3DJYA 5E3IA 5L4SA 3T5CA 2OAQ1 1ZKDA 3RIXA 1KRXA 3TCKA 3UJNA 4CLEA 1UZLA 4YRCA 3ASYA 1T2DA 4ZDJA 4KNYA 2HLHA 4TMYA 1YK1A 3MTEA 4O2AA 5IVKA 1A5AB 2CSUA 4MGYR 4B6OA 4RTOA 5JFTA 3D1JA 3VKGA 4X85A 3GRFA 4UD6A 2SKDA 3TKAA 4D56A 5EGSA 4DLLA 2O8FB 2VFAA 3RRMA 4QKQA 1O0CA 2IZ1A 4HXYA 4CJXA 3GT7A 3CEMA 3UUEA 4FFOA 2IOHA 3WAKA 3RFTA 5K0GA 2B8TA 1LLDA 4WOKA 2E89A 3OLQA 4X45A 3N2LA 1USIA 2WU4A 4O1MA 1GWNA 3A4YA 1T4BA 3OOJA 4ETMA 2MTBA 3DR5A 3MLEA 1CQIB 2E48A 3QE2A 5AH0A 4ZREA 2WDZA 1UPUA 3TLMA 1VHJA 4BE9A 5LJIA 3C48A 5GIPE 1H6CA 3U62A 1RS0A 1KXZA 2JGNA 2QAGA 3LQYA 4GP7A 3ZDRA