1N5IA

Crystal structure of inactive mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp) at ph 4.6 (resolution 1.85 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 85
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5iA00
2QMOA 1BMFD 1KI1A 3X1DA 4B6EA 1Z06A 5EXTA 3P27A 4IXNA 2R9VA 1HUQA 3B6EA 5DSZA 3TQCA 5BQ5A 3CRW1 3BFKA 4XVRA 1WP9A 5FOSA 4LYHA 3K1JA 3RRNA 4Q4AB 2OBNA 1LS1A 1DELA 1YZUA 4NKRA 2HYIC 4RD1A 1PLJA 2A5JA 3P26A 3D7MA 3GEEA 3KUDA 4OI4A 4Q7MB 1MO5A 2BKUA 2ZSBA 4NBSA 5EE3A 3SU8A 2N46A 2BMJA 4RZ2A 4YONB 4A2WA 3I92A 3I5YA 2GVZC 1GITA 1DBSA 3GLFB 5F9FA 4MYUA 4OHWA 4W5JA 1NMYA 5DHAA 3QXCA 3CWZA 3AV0B 1SVWA 2OFWA 4DDVA 1TAGA 1YRBA 2YOHA 4O0MA 2GJ9A 4KXFB 5FPHA 4OK6A 2D7DA 2ZI7A 4HDQB 3U44A 1BOFA 2WJIA 1ZINA 1S3GA 3B1XA 4M53A 3C16C 4A0HA 4DSNA 2UVQA 4BUJA 3QXXA 2PT5A 4XVUA 5BN5A 4Q9LA 2IT1A 2J46A 4OQNA 4CIDA 1VYUA 2ZRIA 3CNLA 1AA9A 1PLKA 4M1SA 4HAZA 4Z51A 1E9FA 5FPYA 3R9WA 4C7OA 3PFIA 1TQ4A 3UIEA 1OFIA 3W34A 1J8YF 1NVUQ 3KXIA 1UKYA 2IUSA 1W4AA 3EX7C 1T6NA 1UBEA 4QJ3A 1UDXA 2RHMA 1PJRA 2ZVPX 4DZZA 4ZKEA 3OESA 4KVAA 4NU0A 2F43B 2V1UA 4HAXA 3CX6A 1NJGA 4LJ4A 2XB2A 4AD8A 1FX0A 3AKYA 4O2RA 4WZAE 2GK7A 2NGRA 2IUTA 1F2UA 2Q3HA 1DAGA 2ZRPA 2GJAA 5FTNA 3WHLA 5KNDA 1KZGB 1G6HA 4JLNA 1II8B 2ZRGA 2HXYA 4EJSA 4PPFA 2XITA 3QJYA 3I72A 4ZV4A 1CULC 2R44A 3C5HA 1CU1A 2JJ8A 5JCPA 2KJQA 4ESVA 3A37A 4C0SA 2V3CC 5FTKA 2QGNA 2TMKA 1SVIA 5CB6A 3KZ1E 4MKFA 2QN6A 3CNNA 3OF5A 4MKIA 4EFLA 1W7AA 1VCMA 4F4IA 1WMSA 3RS5A 2QM7A 1XTSA 3LD9A 5K8UA 3AM1A 2ZPTX 2FDCA 1WE2A 4A8JA 2AD5A 3B7GA 2AKAB 3KKPA 4LJ6A 1BIFA 3G5UA 2ZI6A 2GCOA 721PA 1KY3A 2FX3A 4UNPA 3ZD7A 2QGZA 1R2QA 2DCUA 2QMUA 3KQLA 2FU5C 3AKDA 1D9XA 2D4HA 3TH5A 1CKEA 2WICA 4QM7A 4B76A 4CYMA 2B7BA 4U00A 2IXEA 2WBLC 5JEDA 1W4BA 5KSYA 3S1AA 3QF4B 1RJ9A 4DLYA 2MMGA 1KSGA 1EXMA 1EX6A 3IQWA 1DO2A 2YC4C 3AUXA 1P9WA 3RVBA 4XOIA 2W2TA 1COWD 2NO7A 4U5XA 1CR2A 2J7PA 2ZRCA 2PX3A 5HCNA 2IW3A 4TYPA 1LV7A 5JJKA 4IDQA 2NO6A 1E2QA 1XWIA 2W58A 1KI8A 2I4IA 4LC0A 4DCNA 2ZR9A 4LBZA 4WVFA 1CXZA 2DWPA 1NN5A 2Q6TA 1NIJA 5C46F 1G3UA 4NZYA 5DIFA 4BFWA 5FUWA 2ZYUX 1OHHA 3BH0A 4EPVA 4FN5A 3LNCA 1E2KA 1DAEA 2BEKA 3FE2A 1F2TA 2PMDA 2V7QD 4J0QA 3VMFA 1E0JA 4C4PA 3MLEA 3LRPA 1MH1A 2EW1A 4JYBA 5H1YA 1NVWQ 1OB2A 1GZSA 3SDZA 4ESHA 4NMMA 3GFPA 5CK5A 2ZJOA 1D9ZA 1NSTA 1OXUA 1AIPA 5EUQB 3ZZ0A 3TKLA 4NCIA 2JEOA 4B3FX 4JSTA 4AG6A 1TNDA 2WWYA 4ON9A 4B2PA 4QBHA 2IYQA 4EJSC 5AUOB 1US8B 3FDIA 1GRNA 4GMXA 3QXHA 3WNDA 2HV8A 1KO8A 1Y63A 5B58C 4G1UC 4NE2A 1G291 3KJGA 3IBGA 2WSSD 1QHHA 3WMEA 3KTAA 3NHBA 3CKLA 1Q1BA 1JI0A 5KSOA 2ONJA 4DCSA 1CEEA 1NKSA 3CR7A 3LXRA 3PUZA 4BLSA 3SQWA 2V6IA 3AVOA 1HQCA 1Z29A 1NLYA 4A2PA 4A8JC 2VPPA 1HT2E 3I1FA 3H0KA 4XD7D 1ZAKA 2NPIA 1AJEA 1U9IA 5JI3E 2DFKB 5FOWA 3TK1A 1JNYA 4PAQA 1QG4A 1G20E 4CEJA 3UMFA 1DG1G 3DZDA 4Q47A 3VX3A 1E9BA 4CT5A 3MFYA 2MSDB 3TAHA 3SNHA 1HH4A 3V00A 2IYUA 1LVGA 3A4LA 3LBIA 3LBNA 5FOXA 2FNAA 2NTYC 3AKEA 2Z83A 3A36A 4LSGA 4Z8YA 3B9PA 1AS0A 5EE9A 2GJ8A 2IK8A 5EE1A 1KI4A 3DDCA 5SZKB 5UKDA 3RWOA 4WZBE 1E2FA 4GMDA 1G7CA 4PSVA 1W4CA 4JLJA 2E87A 1XEXB 4JVSB 1OH6A 4JLVA 5LD2B 3VR1A 1TF7A 1GVNB 1OH8A 4FXPA 2XZLA 1IY1A 1QHGA 4R7ZA 4G0NA 3VU9A 3VR6A 5EP1A 4NYIQ 3GLIE 3PXGA 1XF9A 1GL7A 1XEFA 4D80A 3QPWA 2YKGA 3SJAA 2PLRA 3Q7PA 1I2DA 5CJPA 2XOKD 1GOTA 1A4RA 4Q1EA 2HXSA 3VNVA 2C95A 1G4AE 1TUIA 2JLVA 1G9XA 2W83A 2WIAA 1ZP6A 1W0JA 3SFZA 5CITA 121PA 2O8DB 3SS8A 2D2FA 3CO5A 4MQBA 1T5IA 2NO1A 1QBKC 2PT7A 2VHQA 2JAQA 5KNCA 3DL0A 1T91A 4HATA 4US0R 4Z1MA 2C5LA 3F8TA 4FWIB 5C18A 1IXSB 2PCLA 2RMKA 4BFZA 2F1JA 4BPBA 1XTRA 3Q5DA 2EQBA 3QEJA 4UKDA 5JS7A 5M04A 1MABA 1XZQA 3F3YA 3DVLA 3HR8A 4TMXA 2JA1A 1KO1A 2NPFA 4C0BA 4JL6A 2BMFA 3C4JA 4E03A 1IY2A 3EZFA 4LV8B 1IN6A 2YWFA 4TLCA 5J4VA 3LBHA 4JIMA 3HPQA 1L4YA 3JZAA 3PIRA 4JT2A 5F9HA 1ZM3A 4ARZB 2FGJA 1U9IC 4QHTA 1HQYE 1WA5A 1YR6A 3PEVA 2IS4A 1L4UA 5C4MA 3O8RA 2GVDC 2J7KA 3MWKA 4GP6A 2VSOA 1XJCA 2ZUBA 2CCJA 4I81A 4WXRA 3LW7A 2ERXA 2RH5A 2DFTA 1Q12A 3LA6A 1ZM4A 3ASYA 3CBQA 1Q1EA 4LYJA 5EP3A 2BBWA 1XEWY 2C03A 5FR1A 2ONKA 3IKJA 5HKKA 1EFHA 2BJWA 2WV9A 1OYWA 1E2HA 4DUGD 5JJIA 2DFLA 2GDJA 1E69A 2FPLA 1YZKA 2GF0A 3EC1A 4QNMA 5HE8A 2Z6VA 5SZJA 2Z5FA 4O25A 4OQXA 2ZE6A 1PV4A 4H1UA 1AS3A 4HB4A 2J0SA 3AVYA 4B2LA 1E99A 2J0UA 1ZVQA 1OB5A 3OEED 4RD0A 4AIIA 2GILA 1UBFA 4LHZA 1P60A 4DT1A 1UEIA 4ZIRA 1Z63A 4PO1A 2DBYA 3NIBA 4UJ3A 1E2GA 2JASA 4JL8A 4TQUS 2ORWA 4S2EA 2IHYA 1XPUA 1BKDR 2XJ9A 3A1SA 2W6JD 4NCHA 2FV8A 4HSEA 3U4QB 3TW4A 2RGNA 2OG2A 1ZM2A 2P5SA 1SVKA 3LLUA 1KK0A 2QZ4A 2A3RA 2ZU6A 4NYJQ 2F3TA 1Z6XA 4R2HA 4CEHA 1L2TA 2B8TA 4EQ6B 1RIFA 3FPAA 1GDDA 1R5OA 5L3SB 4W9MC 621PA 2RHDA 1YR9A 1H8ED 4Q7KA 5A4JA 3FHTA 5EUMA 2BMDA 4JVNA 4F4CA 3LFUA 4PO9A 4AWXA 4Q7LA 3QKRB 2PZFA 2GXAA 5JWOA 1R0WA 4KYUA 3NBFA 1E9SA 5J4HA 4C2TA 1JR6A 4B3GA 1KIMA 3I4LA 2P0EA 5EXPA 5FTMA 4H9GA 4Q7JB 1W49A 5E7JA 4M1WA 2QP9X 4R2IA 4DLTA 3P1JA 4M0LA 2LKDA 2O0HA 3HJNA 2CMKA 4PTLA 3KQKA 2N42A 2PX0A 3EIQA 3I62A 2HF8A 4LRWA 4NP6A 3NTUA 1WQ1R 4JS0A 3KDSE 1XTQA 3BE4A 4TT3A 1M1YE 1N2CE 3T15A 2RGDA 4CT4B 1R0XA 4XWKA 2A5DA 5FOUA 1JAIA 2QTHA 3SYLA 1P9NA 3EARA 3BAFA 3K0CC 4KFTA 4TZ6A 1A82A 1U90A 2AFIE 4LGMA 3GLIB 4YMTA 4G5QA 1ZNXA 4URWR 4PQYA 1P73A 3FGNA 2REBA 3ZVMA 4XTCS 1FTNA 1IQPA 1E9CA 3PEYA 3T34A 1K5DA 4JJKA 2WKPA 4Q4JB 4PPNA 1C1YA 3FHCB 4KI0A 1G3IA 2NG1A 3ECCA 3IIJA 5JHGB 5AJVB 1XRJA 2IWRA 5LB4A 4F92B 3WRYC 2G6BA 1WDTA 3TAUA 4DBLC 4S35A 1TQDA 5FUYA 3EA0A 1N6LA 5DNYB 1H65A 3HPRA 4MITA 4TL9A 4GFDA 4DEXA 2NOAA 4DIDA 2OFXA 2C78A 2G1JA 2RGNC 1JJVA 1X8KA 4PSAA 3TNFA 2WWHA 3RS7A 4D0LB 4BLRA 3KJHA 1CR0A 4UNQA 3VKWA 1RZ3A 5SZHB 2PBRA 3UATA 4HUTA 1GNPA 3CM0A 3W5JA 1C9KA 1O87A 1QVRA 1CP2A 5AUPB 1E94E 1W0KA 1JPJA 4RFSA 3THWA 3CF6R 2DB3A 1IN8A 1KJYA 3G82C 3MUFA 4DLZA 5DH9A 2R6AA 3CX8A 4GRAA 4BLTA 1G5TA 2P2LA 3CRMA 4FMDB 4I99A 4XWAA 1CJKC 5JWHA 1D5CA 2WTUA 2WPDD 2WKRA 1J99A 1XB2A 2WJVA 2BM1A 4IJMA 4IHQA 4JLOA 1G64A 4MGKR 4HDOB 4DCTA 3TIFA 4RKFA 1J7KA 1JXOA 2VF7A 4TSFD 1F48A 4GOKA 2EFGA 4IVQA 2W6IA 3GLFE 4QGGA 1DAKA 1YZGA 3THXB 4KYIB 1NVXQ 1U98A 2AD1A 3QPVA 4PC3A 2O8CA 1HTWA 2QP4A 1M6NA 2J5XA 4KFRA 4HZUA 4ASUA 2Y8EA 1LFDB 1M7GA 3E2IA 1OFTA 3AP3A 2OSBA 3BH6A 5EP2A 2MSCB 3UKDA 5TY0A 2HT1A 1JBKA 2BDTA 3CRVA 1V5WA 4Q21A 4K46A 4IDHA 4MGIR 3RSLA 2PMKA 1G8YA 4PQFA 2CEAA 4CZ2A 3NEYA 1II0A 4UJ5A 4LZZA 2C9CA 4POAA 3BC1A 3SBEA 3X1YA 3THYB 3W8NA 2OCAA 3QQ5A 4ITRC 2ANBA 4OJQA 4DWJA 1RYFA 5CM9C 2IYVA 2KI5A 3U3JA 1OPXA 1K5GA 1KI6B 1S9DA 2HLDD 2YWGA 2B92A 4JZKA 4NTZA 4PC6A 5KU1A 1KK2A 2P6RA 1U0HC 4HB0A 4Q4HA 5L3QA 2ZS8A 4M1TA 4TN1A 3GFOA 3EA5A 5BYKA 2UKDA 4K8OA 521PA 1G3RA 4TMVA 1Q20A 3QBVA 3QG5A 4V03A 3QG1A 3B1WA 3PUWA 4W5WA 3GQBA 3LY5A 3WP1B 4IVPA 1XD2B 1A2KC 4R98A 4TTRA 2X1VA 4I1UA 2HF9A 1X6VA 4LYAA 3SQXA 4G5SA 2REXB 3CH5A 1IOZA 1MR3F 2YWHA 3WY9A 2H1LA 1LTQA 3K0AB 4C0LA 2DWQA 1FUUA 1G7SA 2QUZA 4PO8A 4BGDA 4ABYA 4AY2A 1KMHA 1GUAA 1Z6TA 1A1VA 1RRPA 2V7QA 1E2LA 1KK3A 4JVMA 2ZYWX 1KNQA 1IBRA 1EG7A 2ZSEA 4QL3A 4HUQB 1FMLA 1Q1QA 4EPRA 2ZJ2A 4IDNA 3TUJC 1E2PA 3RS3A 1SZPA 2YV5A 3IDQA 2FPMA 2V55B 4QJ4A 2BBSA 4BFUA 3X1ZA 4AKIA 1J90A 4NDZA 3CNOA 1NI3A 3OIYA 4AYWA 2WAYA 4HAYA 2NIPA 5D3MA 1G7RA 3R8CA 3W9YA 3IIKA 4XSGA 3M1IA 2P65A 5E95A 2JJ1D 3PR1A 2G3YA 1Z0FA 2WMNB 5BYJA 2Q9BA 2WSSA 1NVVR 5DO9A 4ZKDA 3TGPA 3AF4A 4PC1A 2D7CA 2QEQA 1TEXA 4BECA 4HLUA 3CZPA 5CJ2A 3K70C 4OI2A 1N6NA 3CR8A 1OSNA 2VH5R 1G7TA 4Q4AA 1FFHA 1XX6A 2BHRA 3KKOA 4GOJA 4TMWA 1AM4D 2QY9A 5GJWC 2QPTA 4EPYA 3ZVNA 5JRZA 2CJWA 1J2JA 4TTPA 3TR5A 3E1SA 1NIPA 3I8SA 5KUTA 3K0SA 2BJVA 3E5HA 4G5OA 4B71A 1UBCA 4RKEA 4QHYA 3N70A 4A0FA 3AVXA 1T9HA 2BKEA 5E4FA 1XXHB 4CVNA 5LB2A 2Z4SA 1P2UA 1T3SA 2Q0HA 4LDJA 4ACAA 4MDFA 3ZYCA 1G6OA 1QHNA 3EIEA 5B30A 5KDOA 2JDID 4TMKA 3W6PA 5G3ZA 4HAUA 3M4YA 2FEMA 3AB3A 2GEDA 2CK3D 4KBFA 1FZQA 1U81A 3U5ZB 4PC7A 1EFRA 1JR3D 3LXXA 2ZUCA 3TSOA 2WWFA 3IHWA 2QAGB 2ZM5A 4P32A 2MSEB 1VG9B 1YE8A 1YZNA 1KMQA 2WJYA 2QENA 3FFAA 4DHEA 5JEEA 2J0QA 4ZI2A 2O8FA 3NDPA 5IDVA 4C30A 3GJ4A 4MA4A 3GJ5A 3OAAD 4HZIA 1U8YA 3V4RA 5FBVB 4A6XA 4M8NE 1SVSA 1OF1A 3BBPA 2WOJA 3HU3A 3C15C 2XGJA 1KJZA 1S0UA 1CIPA 2VRWA 3K0FB 1QDEA 1NNEA 2KE5A 2QRNA 5AUQA 4B44A 3KKQA 3X2SA 3WYAA 1EX7A 1FP7A 4TYNA 1P5ZB 1Z07A 3HU1A 4JLMA 1T0JB 2HEIA 2VLIA 1X3SA 3IEUA 3AVVA 1VG0B 3D3QA 2BEJA 5SZIA 3SC3A 5KHOC 2XTZA 4UXHA 5JZVA 1SHKA 3IHLA 4Q5IA 4OI0A 3MGCA 2CNWA 2CXXA 4P3YA 4HLUC 5EZ5A 3UWKA 4E22A 1E1RD 5DI3B 1Z6GA 1YZLA 2ZSDA 1N5LA 3HDTA 2JLQA 1K6MA 5GJVC 5JECA 1RRGA 2ZQ5A 4PHGA 4LI0A 1G18A 1SKYB 1W47A 1QRAA 5AJWA 5JMTA 3A4NA 5FTJA 2GEUA 3BS4A 2JGNA 1B23P 2DY1A 3HU2A 1OIVA 3T1QA 2N1BA 3SEAA 4TLDA 4CEIA 1HT1E 5JSZA 3HP1A 5TB5A 3SI7A 2ZRKA 3QIAA 2Q9CA 4AC9A 4YXWD 3LVQE 3ZIAD 4QG7A 3KQHA 3QOFA 4B35A 1P72A 1TPZA 2F1HA 1KO4A 2V6JA 2XSZA 4I1SA 4BFVA 2AWOA 1Q3HA 4KAXA 4ZDKA 5AUNB 5KO2A 4LV6A 2JLUA 4OL0A 3QF4A 4BQSA 2FOLA 2QMHA 1TMKA 3KFXA 2ZR7A 5FUVA 2GJSA 1GNRA 1ZD9A 2C9YA 3FKSD 2FEOA 3Q5EA 4DUGA 5IF9A 2FZ4A 4PHFA 3K9NA 1YR8A 2FZLA 3DZ8A 2F1IA 4AK9A 3AUYA 4IRUB 2WMOB 2REOA 3H2YA 1CF4A 1TQ2A 2QI9C 3O8CA 5JS8A 2BIFA 1NBMD 4M1MA 2IYWA 1XNJA 2ZAMA 4BZQA 5DN6A 2Q3FA 3L82B 3LV8A 3FTQA 1N5JA 3F0TA 2R6GA 3VFDA 4P33A 1R4AA 1VHTA 4URYR 1XZPA 4N3NA 5ANRB 5JBQA 1YR7A 1TTTA 4D0GA 5FPTA 3KQNA 4C9BA 1G19A 2CL0X 1XMVA 3K09C 3FMOB 2VF8A 5A0FA 4WOPA 4V0ME 4AURA 1NN0A 2W6JA 2WZQA 5P21A 5L3VA 3DM9B 3O8BA 3GLHB 1P61B 4IXMA 1XPOA 1BYUA 4MRRA 2DPXA 4B74A 1T8TA 3D31A 2XNDA 4A82A 2VP6A 4UNSA 2Z4RA 1US8A 4L8GA 1E2IA 2B7CA 1ONBA 4OHXA 4FCWA 1AKYA 1KDPA 5HCIA 3RC8A 2ORIA 2VP9A 3EASA 5B64A 4PR0A 4AKGA 2QORA 2QL6A 3FFBA 3IEVA 2NO9A 2CDNA 4Q66C 4DIEA 4PX9A 1E4YA 2A5FA 2BCJQ 3RANA 5L3RA 1F2UB 1RVDA 3DMNA 4BZPA 4F4JA 2A78A 4MUAA 1XMJA 4JBWA 1VYVA 2O0KA 2GKSA 1FP6A 3LAWA 3N2EA 2XNSA 4HAVA 1UKEA 2Q21A 4YMUA 2F6RA 2JLYA 4OQFA 1Z6AA 4QKQA 1VIAA 4YDHB 2XJ4A 4FMCF 3BFVA 1X8LA 2R65A 3BD9A 3CRRA 5EE5B 2H18A 3RWMB 2JIZA 5EXXA 2GXQA 4X8HA 2OXRA 1VPLA 3AVQA 5EQTA 2VL7A 1HY3A 3CLVA 3ZIAA 3B5JA 5C2JB 4JYCA 3SHWA 3ADDA 4YQFA 1IJFA 4BFSA 4MYTA 3VR5A 3QXSA 3B78A 4KO8A 3A8TA 1TU3A 4D81A 4EUNA 1S9HA 1DAFA 4GP7A 4JLAA 2IS1A 2FF7A 3UK6A 1M34E 1VECA 3EG5A 2G83A 3L8ZA 2YVUA 1IJEA 5AK0A 1L7VC 2CBZA 1SVOA 2AHOA 3GEHA 5B57C 3S1AB 3CW2A 1Z28A 5F98A 3JVVA 4NONA 5CYPA 1N6HA 4IFEA 4KSCA 4A0GA 2LKCA 4B47A 2HJGA 2D3WA 1ZC4A 1QF9A 2J0VA 3VR2A 4JKYA 1YHNA 4X8MA 2WWGA 3MJRA 3SR0A 4OHVA 2NMVA 3THOA 1Z5ZA 3OFND 1LF5A 4URZR 4XVQA 1GAJA 3RAPR 4A6PA 2GRJA 5HR5A 1N0WA 2P5TB 3IBYA 2WOOA 1G3MA 4LJ5A 3U7HB 3WXMA 3KXLA 1G17A 2ZREA 5FL7A 2QMEA 3WMFA 4D4MA 4A15A 1M7BA 1PVOA 3FB4A 1VKJA 2CHGA 3DOFA 1VIYA 3QKTA 2JJ2D 4RZ3A 3AVUA 2OT3B 4DDTA 1G3QA 1JAHA 1CJVC 1OIWA 4B73A 1IXZA 2GZHA 3QF7A 4D6PA 2X2EA 3BJIC 3LQRA 5FH9A 3TLXA 4LC1A 1Q44A 4MKHA 1E9EA 4E07A 2HDNB 1ZRHA 1Z6YA 3T5GA 1ZJ6A 5A5GA 1W5TA 1IAQA 1P3JA 2ZTSA 1ZW6A 4TL8A 3H86A 1MV5A 2GXSA 3NBZC 3L2OB 2GCPA 1DAHA 1QHHB 3G0HA 3KTAB 4W7SA 1N6PA 4FMCB 2O0JA 3BXZA 2BBOA 2BMEA 1OH7A 3T1OA 5BW8A 3AVPA 1N6OA 5H68A 1AQYA 1OKKD 1DS6A 2IWHA 5FI0B 4ZDIA 3AVTA 2QE7D 4XIGS 3NC0C 5J47A 3GLGB 1B0UA 4YMSA 3VAAA 2H8KA 1YRAA 4JSYA 1S1CA 2GCNA 4P4UA 3R8FA 1NVVQ 3FMFA 1JR3E 4DSOA 1J8MF 5HPYB 2GZDA 2R6FA 2YYZA 3NEJA 2OCBA 1GFIA 3AF0A 1CRPA 4M1KA 5K8LA 3B82A 1E2EA 1P6XA 4LPSA 1ZM7A 5LD2C 3FHOA 1ZU4A 3OE7D 3L43A 2OE2A 4M1YA 4MYHA 4TL7A 4DCVA 1NY6A 2ZRBA 1FPMA 4HDCA 2GESA 1A7JA 3RC3A 2KSQA 2KB0A 1PUIA 3CWQA 2ZU0C 1GNQA 1M2OB 4I1VA 1W36B 4PPGA 4V02A 1S4QA 3BERA 2AX4A 3B1VA 4I1OA 1DARA 4L9SA 2VP0A 2ZJAA 4DEYA 4IFBA 1RFLA 2L0XA 2WWWA 3OIUA 3PEWA 3UMRA 4A4DA 1T4GA 1TEVA 2RB4A 3VU9B 4BRWA 3U4QA 4P4SB 5BWMA 2JLSA 2ZANA 2D74A 2PZEA 2VA8A 3KJEA 1AQUA 3RABA 1E1QA 1AK2A 2GAOA 3RRMA 2P6NA 4Q00A 4DXAA 1GRRA 1JJ7A 5CIQA 2QP3A 2UZ3A 2X19A 1AGRA 5E3HA 5L3SA 1R7RA 3K0CA 1TF5A 2FSIA 2ZRNA 5JLJA 1NMZA 1Z47A 2PEYA 4US2R 3WNCA 4TL6A 1XCGB 1D8TA 1AZSC 4B32A 4G01B 2FG5A 2NZJA 2ZJ8A 5KNBA 1VG1A 4H1VA 3QKRA 4ACBA 2ZJ5A 4CW7A 3SYNA 1DADA 1GTVA 1E79D 2ORVA 2Q3MA 2V8OA 2CCGA 2WJHA 2RGAA 4LX0A 2O8EB 1FTSA 4OQMA 3ZVLA 2PCJA 1M74A 5EXSA 5HZKA 2XZOA 1IN5A 2AL7A 1MABB 3EC2A 5JJLA 2YC2C 2HJVA 4NYMR 2X77A 2OM2A 2ZI4A 2GBLC 1VYTA 3BOSA 4PXAA 4X8LA 4JVLA 1R0YA 2DFNA 1VG8A 3TSZA 1S1MA 1E0AA 1E2DA 5FL3A 4FMDF 4D4LA 1OFUX 3DOEA 2C77A 3BRWD 3OEHA 3MCAA 1OH5A 2P6UA 2XXAA 4KVGA 5DISB 3BB1A 3PQCA 3W6OA 3GLIA 821PA 2O8BA 5K8TA 1UEJA 2QRZA 3CZQA 4D4KA 1M7HA 5CB8A 1FW6A 221PA 4UQOA 1SHZA 1G21E 1A2BA 1R8QA 3OIVA 1S96A 2ODEA 4Q4JA 2G0TA 5H70A 2WHXA 1TX4B 2P3SA 2WJJA 1OT3A 1BMFA 1E96A 2J7PD 1ZIPA 3SJZA 3Q7QA 4JT4A 3PITA 2BVNA 4YC7A 1UFQA 4DLWA 2QNRA 3ONWA 4UNNA 3K53A 4DKXA 1KO7A 2CK3A 4LHWA 1SXJB 1ZBDA 1OIXA 2EFHB 2J0UB 1D6JA 2QQ0A 2EWVA 5FBWB 3PEUA 1SQ5A 1FNMA 4DT1B 4DCUA 2AFHE 1UKZA 2GZAA 4IKEA 2H92A 2FMXA 3ZZTA 2FN4A 2VEDA 1F6BA 2G77B 2IUUA 2ZUDA 3C8UA 3OAAA 3JVUA 4RD3A 3TVDA 2R6DA 1ETUA 3U61B 3EZ6A 1MKYA 1FUKA 4IEEA 4K81B 1F3OA 1H8HD 4CEHB 3NG1A 3KB2A 3MRSA 1OXXK 1KO5A 1GG2A 1ZD1A 4TTQA 5FUXA 4IW3B 2WJGA 5G40A 3SHFA 1YVDA 3RRYA 2OCYC 4HLCA 4BEBA 4LBWA 3C7KA 3TR0A 3PENA 4L4UA 1XD8A 2H57A 2CVFA 2G88A 3MJHA 3U3OA 3EWSA 4V0KA 2WAXA 5AWFC 4YMWA 2IS2A 5CYOA 1XXHE 2AWNA 4HAWA 1T5LA 2ZETA 2WSMA 3KKNA 3T5DA 1N0VC 2C8VA 1P75A 2ZJBA 1ZNWA 1OYYA 4TWZA 3SBDA 5GADl 2VO1A 2WWXA 1EGAA 5DGXA 4PZYA 3GMTA 2ZJZA 1LF0A 3IQXA 4CRWB 4ZCMA 3B1ZA 4MRNA 1RPZA 1JALA 2WKQA 1IHUA 4R9UC 4TZ0A 2ZRLA 1Z8FA 2A9KA 3TRFA 4JLDA 5DYIA 3WBJA 1KSJA 2UZIR 1KI6A 3I32A 4Q19A 1G16A 2RCNA 1JXMA 2GHIA 3CPHA 3MD0A 3W90A 1DO0A 3RDPA 4Q1CA 1N6IA 3LLMA 4IDPA 5EJEA 2FFAA 1XBTA 4B48A 1N3BA 3AP2A 1DAIA 2JLWA 1G5RA 3A4MA 5LBIA 5HTKA 1W36D 3C14C 1GKUB 2RGXA 2PZGA 2RGEA 3AF1A 1NSFA 4ILEA 4Y0AA 3FKSA 5DLQC 2GXUA 2QQEA 3SFVA 2GAAA 5TMPA 1EWRA 2AN9A 3KFVA 4Y0VA 3FKQA 3MG9A 2ZXUA 2OBLA 3K0EA 3OIWA 4XSHA 3R7WB 2DR3A 3U3KA 3HYTA 3O8DA 2Q9AA 3U6KA 3K0AA 5E7MA 2J1LA 4DJTA 5CLLA 1YZTA 2QROA 4AI6A 4V0LA 3W5IA 1NKTA 3KKMA 3VKHA 2IYXA 1N6KA 4A9AA 1R6BX 5FTLA 3RS4A 1SKYE 4HUQA 1GILA 1KYIA 3QVVA 1W0JD 5FI1B 5BXQC 1E2NA 1E9AA 3FWYA 3THWB 3C41J 2JLXA 4IOLA 1UADA 4B6FA 3A1UA 4KFUA 4RZUA 5EP4A 3SZRA 2C04A 4Z1MD 3A1WA 1OLOA 3EPHA 1COWA 5H8WA 3QY0A 3WHKA 3WRXC 2ZRDA 4TMTA 1RRCA 1GL9B 2BWJA 2ZYVX 4MGZR 1XD9A 1P2SA 1I4TD 4GZMA 1FOEB 4DLVA 3ZQ6A 4GDFA 4RD2A 1VCIA 3QE0A 3ADKA 2PLFA 4B3DA 1HA3A 4Q9HA 4BFYA 1DVRA 2VP5A 3AF2A 4LPKA 1XEWX 2W2VA 2ZI3A 4OQLA 3QKSA 1CBUA 1HV8A 2O8CB 4N1AA 1G41A 2D06A 2IHBA 3N2IA 4OYHA 3WP0A 4RZXA 4B3CA 4EIWA 4U7DA 3ZD6A 5FPKA 3RS2A 2I1QA 4GPTA 3T1TA 4M1OA 4LY6A 1KY2A 5G41A 1YJ5A 2F9MA 2VSXA 3DHWC 4JKIA 1TF2A 3A6PC 1AN0A 4EPWA 5HKKD 3L0IB 3QVUA 2EYUA 1AZTA 3CH4B 1XXHA 2XZPA 3A58B 3MWJA 1XDBA 3B9QA 2EWWA 4RJLA 3R9IA 1OJLA 2F3RA 1U8AA 3BORA 2WWIA 3MMPA 2OEPA 2ZE5A 3GLHE 2XEXA 1NG1A 4OHYA 2CLDX 4ZPXA 4EPTA 4JJZA 5FBQB 3AGPA 4GT1A 4NH0A 1XCMA 2VP4A 1KKMA 1SXJD 3DM5A 4AKEA 1WBBA 2QSYA 1KDTA 4C2UA 1QHYA 2IYTA 3I3SR 4C3ZA 5CDFE 1CR1A 2IF2A 2QAGA 1G4UR 4D0NA 3NH6A 4MRPA 1OE0A 1ZD8A 2XB4A 2ZSAA 8OHMA 1BO6A 1NN1A 1ZIOA 2OO7A 3P4XA 3WNBA 4XD7A 3B8HA 2ASEA 4KCGA 2VYFA 3BWDD 2HUPA 3VR4A 1QHXA 5GJCA 2WM9B 3OFNA 4LHYA 3D6TB 4M9SA 3GLFA 3QSYA 3T06B 4EFMA 3EW9A 2ANCA 4C0JA 1NJFA 1TUEA 5FOTA 2ZE7A 1KMHB 1UM8A 3IILA 4Q01A 4IOMA 4OK3A 1U8ZA 1Z3IX 1NLZA 3QXJA 2AXNA 4XH9B 2JJ2A 2C99A 1JECA 1ELOA 5HE9A 4LCBA 2J45A 3SJCA 2IEYA 5DI3A 4FCVA 5FR2A 2CCKA 4R71A 4GI7A 1P9RA 1Z2AA 1R0ZA 4FINA 1U94A 1II9A 2YOGA 4QM6A 1FL9A 3EZ2A 1A5TA 3VKGA 4WW0A 4B3BA 3N5CA 1WRBA 3WYFA 4YLGA 2R2AA 4QC2A 4F93B 2ZRJA 2XOKA 4PAOA 4Q9JA 4B34A 1KSHA 4F91B 2F43A 4YDSA 2OESA 1J70A 1E3MA 4MRSA 4OBEA 3K09A 1TQ6A 4HYYA 2QBYB 1NY5A 4QOSA 4BLPA 4QBFA 4JLKA 1OKKA 1MO4A 1L8QA 1ZUNB 3Q3JB 4M9ZA 4TT3D 1V43A 2QE7A 3ZQJA 4JLBA 2CJWB 2FGKA 3R20A 1Z0JA 2QT0A 4Z8XA 1RC8A 1GIAA 1II8A 2Z0MA 4HLQB 4NYMQ 3UXMA 3CIOA 5IRCD 2FSFA 4Q1DA 5FFMA 2A30A 1Y3AA 1QVAA 2ODWA 4RFVA 4JBYA 1X1RA 2QAGC 3OE7A 4V0OA 4ZDJA 2IYRA 3EZ9A 2CE7A 4LBVA 4MYCA 3ZH9B 3V4FA 1QG2A 4W5HA 4O2LA 4WA7A 3A1VA 1SVLA 2YNMA 1S2MA 4IEIA 4NYJR 3VHLB 3MAAC 4BASA 1GKIA 4BE7B 3EPKA 4EDHA 2EFDB 1YQTA 2AR7A 4C0QC 4RCYA 4KLZA 3B85A 5F2EA 3KJIA 1W0KD 1NF3A 1N0UA 3GLHA 2ATXA 5ELXA 1ZCAA 3P20A 4KITB 2O8FB 1S8FA 2A5GA 2FWRA 2VTKA 3CPJB 2IYSA 1VTKA 2BCGY 4HB3A 4RCZA 3WYGA 1WBDA 3AEZA 5CDFA 3HYRA 4D82A 3GLGE 2VSFA 3NH9A 5BN4A 1E2MA 3L8YA 2JLZA 3EXAA 4WIAA 2F7SA 1HEIA 3U44B 4G3XA 3U3RA 4E09A 1OXSC 3EIHA 2J41A 1KOFA 2LWIA 1XPRA 3CPEA 1HE1C 2W6ID 3OEEA 4DSTA 1E79A 4NCJA 3CF2A 1P4SA 4I4LA 4BFXA 4A92A 5DE3A 3T12A 3LWNA 4ASUD 1I4LD 4C7OB 4JMPA 3RLFA 1QHSA 1VHLA 1E98A 4KFSA 3U7EB 1JB1A 2GA8A 2VHJA 1UPTA 3RYTC 3PJRA 2PEZA 1NMXA 2G0NA 3T1VA 1R10A 421PA 1GP2A 2IA5A 3QKUA 3K70D 2B6HA 4L5BA 3VR3A 3QENA 1QHIA 4MDEA 4EAQA 1OW3B 4B33A 5BN3A 5JSZB 4CEIB 3DPUA 1XU4A 5DI9A 4DRZA 2FA9A 3BB3A 4UNRA 2EFEB 1H8EA 4A2QA 1F5NA 1P7CA 1FX0B 1KGDA 2P67A 4LJYA 3TQFA 4D4JA 3QPUA 4AKHA 5KDLA 1KNXA 2EVWX 2IC5A 5IK2D 2ZAOA 3QUSA 1G5PA 3ZDQA 3R9XA 2R6CA 3ZZUA 2W0MA 4EJSB 5DYGA 1MO3A 2DWOA 1PLLA 5JFGA 3TSWA 2VHTA 4LHVA 4WBSA 2CLSA 2AXPA 4BEJA 3NVAA 3UMSA 5J4KA 4QJ5A 3BIFA 2GTPA 5KSZA 4OI1A 4FCTA 3TBKA 3T61A 1U0LA 1Q1ZA 2X2FA 2CL7X 3CRQA 2CVHA 1IN7A 1ZNZA 4WXPA 4C0KA 4B43A 3TJZA 1EFCA 1W44A 2QAJA 4KODA 4A8JB 1MRNA 3IUYA 2CL6X 4NHOA 2GCOB 4P31A 1P2TA 1IONA 3NC1C 4N0EA 1O3YA 4QFMA 5LDDC 3W6NA 1Z22A 3LDAA 1D2MA 3FOZA 1T3LA 4ZCLA 5TV2A 2RGCA 1CJMA 1RRFA 4FD2A 3H84A 1RJ9B 1CRQA 1U0JA 1XEXA 5J4YA 3ZS9A 2OV2A 1SULA 1H8HA 2FE4A 1W1WA 3EAQA 2BBTA 5KDDA 2EYQA 2YWEA 2H17A 3REFA 1DTSA 4PSKA 1E4VA 1RYHA 2OILA 2SHKA 2ZI5A 1KI3A 3FMPB 4JL5A 4CGZA 1EWQA 3A1TA 4UXJA 2EU8A 1GL6A 1KTVA 4MKGA 1IXRC 1U2RA 5EZ6B 4AYTA 2IL1A 3K9LA 3VNUA 1T0HB 1KAGA 2F1RA 3GCGA 3ADCA 4BLOA 1ESMA 1F2TB 5DHFA 5GJBA 2O8DA 5AJZA 1Q0UA 3B1YA 4X8OA 3GLGA 1X1SA 1KI2A 3TVTA 1E2JA 5FPSA 5AJYA 1C4OA 3VHXA 1FQJA 2OXCA 1NN3A 1SXJE 4KU4A 5CK4A 1DOAA 3M6AA 2WPDA 1KI7A 4QXAA 1XTIA 1ANKA 5EE0A 2CLCX 4IDOA 1NRJB 2OFOA 4F7WA 2QM8A 5E7IA 2V54A 3U6BA 4DSUA 2I1VB 3GD7A 2IYLD 4PPQA 4DLUA 2LCFA 3P4YA 4Z54A 2XX3A 2IEZA 2J9RA 2IYZA 4FW9A 4TSFA 5FBRB 2VBCA 1DPFA 4V0MA 3KL4A 1R5NA 3BFXA 3L0PA 3NXSA 2CE2X 3GFTA 1RKBA 2B21A 4EKDA 4ARZA 3SJBA 2W00A 2G9NA 1IM2A 3GJ7A 1EFRD 5J4LA 4DC9A 3IO3A 2C96A 2XAUA 1KHTA 1PUJA 1W46A 2GK6A 2NO0A 5KSPA 2V1XA 1T8UA 4CF7A 4P4SA 2GBLA 2CHVA 2E9SA 3IPYA 2A2ZA 2QPOA 2QT1A 4KBGA 3LO5A 2QPAA 4GL2A 4US1R 2ZROA 3OHMA 3GEIA 3ZLJA 3NBXX 3LH5A 4CEJB 2O52A 4ZI3A 1SGWA 3CUEF 5GVRA 2HLDA 2D62A 4JBXA 2OAP1 3MWLA 2ZSFA 2G1KA 2HCJB 1M8PA 2RGGA 4FWTA 3U3MA 1WXQA 1JPNA 4QGAA 4KJZA 3B60A 4ZO4A 1LNZA 5JHHB 1Z08A 3K9GA 4NCKA 4D2IA 5KPDA 3GPLA 4LJ8A 1YU9A 4BFTA 5JCZA 4MUBA 5JWRA 2OHFA 3FVQA 4URVR 3ICEA 4RD6A 2CNWD 4XTRA 1SKQA 3WMGA 2O8EA 1Q21A 1W48A 1KZ7B 1X86B 4LJAA 3KQUA 3D8BA 2C2HA 1N5KA 2GETA 1E9RA 1OV4A 1MRSA 1R8SA 1ZCBA 2HYDA 1D2NA 1GSIA 2FFQA 2YOFA 1MOZA 3TMKA 5JRJA 3RSOA 1HURA 2H7VA 3FMIA 1HYQA 5KYKA 2CHQA 1YKSA 5C4GB 3HR7A 4QBGB 4M2LA 4DLSA 3JZMA 4EQ6A 4QNRA 2K5UA 5IHPA 5J5CA 5KPJA 4OK5A 2Z43A 1E0SA 5TXGA 2ODBA 5AJXA 3HWSA 2A5YB 3EZ7A 4HEJA 4E5UA 1XTKA 2YINC 4ZCIA 1ZUHA 3W3ZB 3ND8A 2XSZD 1GRQA 1MO6A 4EFNA 1W2GA 4BZXA 3NDBB 4URXR 3Q72A 2YJTD 2IXFA 1W36C 2V9PA 4YMVA 1W5SA 1LY1A 1BS1A 3KXKA 3CX7A 2PJRA 2JJ1A 2ZRAA 1KSFX 3RRZA 5JI2E 3DO6A 2VIIA 2IX3A 2OUKA 4RY2A 5GVSA 2BOVA 3QBTA 4PHTA 1VDZA 1KJWA 2QU8A 4TQ9A 3SOPA 4UXIA 1XJQA 1XP8A 5FBLB 1SXJA 1FNNA 2ZVQX 1CTQA 2FJUA 5DN6D 2O5VA 4HI0E 4CDGA 3B13B 5HZHA 3U2QA 1WB9A 4Q9IA 3EPJA 5C1BA 3QNUA 3PVSA 2OBMA 1NBME 4IOJA 1BYIA 2BV3A 2FFHA 4Q18A 4B2IA 3AGQA 3AH8A 3E70C 1GM5A 2QTVB 3I8XA 4GBMA 2AK2A 2IF0A 2YHSA 3AQ4A 2OLKA 1OXTA 1ZM9A 4Q03A 4DB4A 3K8YA 1I4DD 4QRHA 2J3EA 2GEVA 3CF0A 2XNDD 3EPLA 1TADA 1HE8B 1VMAA 2FPKA 3LVRE 4KSBA 3V9PA 4FMBB 4A36A 4LUCA 4NCNA 3DMDA 3MSXA 3DEFA 5TDHA 2OAQ1 4BWYA 4P4TA 2JDIA 1G8GA 3LX5A 2ZYTX 3IGFA 4G5RA 1DAMA 3GJ3A 4GOXA 5TARA 3W8RA 3PV0A 1KI9A 3NKVA 4Q48A 3ADBA 1JR3A 1DE0A 1RE0A 1XMIA 5KTYA 3AVWA 1FQKA 3T35A 1OHHD 3J81k 3U7FB 2ZEJA 4TQAA 5K8IA 1Z2CA 4WZ6A 4ZIRB 1ODFA 4II7A 4QHSA 1XJ0A 4DDWA 2XTNA 2IS6A 3MWYW 1VCNA 1P62B 1GWNA 4PQRA 5CIWA 1KDOA 2VHUA 1G8HA 4MGYR 1UF9A 1TL7C 4LOAA 3GJ0A 4GZLA 1NG9A 2R62A 2J59A 4KLNA 4TLEA 3SE0A 1UJ2A 2ZJYA 3I73A 2DHRA 4GNKA 4OKSA 3SYKA 4WAUA 3UPUA 4F38A 2JIZD 3QI2A 2QG6A 3X1XA 2BC9A 4LBYA 2PH1A 4U02A 1ESNA 2KWIA 2ODNA 3BH7A 4GSYA 1ZU5A 1AS2A 4FI3C 3Q9LA 2JATA 1E9DA 2NQ2C 2ZR0A 2ECKA 4Q9KA 2XXAB 1KK1A 1RW4A 2ZS9A 2EFCB 4N0DA 3KUCA 3PUVA 5CM8B 3THXA 4O3MA 2FH5B 2DYKA 4TLAA 4AG5A 4PZZA 2O8BB 1CJTC 2VP2A 5G53C 1QZXA 2D2EA 2RKOA 1N25A 1SXJC 1E1RA 3F5FA 1N5IA 2OLJA 1ZUIA 4RD4A 3ZGXA 1R5BA 5IT5A 3UG7A 4DLRA 3L0OA 4Q1FA 1YZQA 2IYYA 4P0TA 3ETLA 1SVMA 1FMJA 3NBYC 3PUYA 3R7WA 3U7GA 3THYA 1TU4A 4A0RA 1DG3A 5J40A 3RS0A 3LQQA 1WCV1 1XCPA 2MMCA 3RHFA 1S3SA 1LS6A 1E6CA 1I2MA 3U60B 4MH0R 4D25A 5FL7D 1X8JA 5CLQA 2GF9A 4YXWA 4MRVA 2JLRA 1F60A 3FYHA 1MT0A 3LW8A 1JEDA 4LWZA 2IBMA 4M9XA 2RGBA 1E32A 3UANA 4PC2A 3ICQB 1K8RA 4QGHA 3CONA 2A7QA 1OFHA 2PJZA 1ZYUA 4TYYA 2ZRFA 3X1WA 3VX4A 4M21A 3ZVRA 3QEOA 3SN6A 4TMZA 1IY0A 1ZMXA 1EFTA 5FOVA 4D26A 2JCSA 1EESA 4HB2A 2NZ8A 4A1FA 5F3WB 4PAMA 4M4SA 2QSZA 1XTJA 2VHCA 2YZ2A 1D2EA 1XD2A 2VQSA 1UBGA 3LX8A 1CS4C 1JEEA 1NBMA 2WVJA 4NPHA 3PUXA 3EWAA 1VCOA 1IN4A 3P32A 2KBFA 2ZRHA 4C0HA 4QGFA 1UDWA 3WBKA 2ATVA 3L0SA 4KV9A 4OHZA 2F9LA 3CB4A 1T3HA 2XTMA 1W4RA 2ZE8A 1UKVY 3AKCA 3H4MA 4Q02A 4QBIA 5AR1A 4FIDA 4Q1BA 2H5EA 4RFSB 3Q85A 3I61A 3DKVA 3TW8B 4IVRA 3NHAA 1G8FA 2ZIAA 1Q22A 3M0EA 4DDUA 3C5CA 3ZJYA 4L16A 4HLDA 4LJ7A 1EFUA 3Q8XB 4EPXA 3IPXA 2C98A 3KB1A 4ZDWA 4G5GA 3IO5A 3O47A 4PFSA 4L9WA 4B75A 4RVCA 2B8WA 3RNLA 1AGPA 4TLBA 1XMSA 1OXVA 5IK2A 4DVGA 5L8VA 3KX2A 1G1MA 2ZS7A 4AYXA 4C0AC 2OCPA 2C9OA 2FSGA 4Q1AA 4LYFA 4HZUB 3BK7A 5LPNA 3TUZC 2IXGA 2X8AA 4M9QA 4BLQA 1LB1B 3BB4A 3TUIC 2E1RA 1Z83A 4OJKA 4ERNA 5KOYA 1UAAA 3GJXC 3K70B 4LV5B 2OZEA 2FSHA 3IIMA 3OZXA 3W3AA 2GJKA 4DB2A 1WF3A 3ZS8A 1E1QD 1CLUA 3AF3A 2H16A 3B2EA 2HT6A 6Q21A 4KHZA 4IOKA 1Z0DA 3UWOA 4NL4H 3ASZA 4BRUA 2ZRMA 3GP8A 4M22A 4NYIR 2HCBA 4PANA 4PZLA 4Q4HB 2GWHA 5L3QB 1ZNYA 5TVKA 4DLXA 4LHXA 3VQTA 4LK2A 1KKLA 1KDRA 4TYQA 4Q4LA 2PL3A 1AKEA 2AK3A 1Z0AA 3DKPA 1P2VA 2KBEA 1JQLB 5B2ZA 2GNOA 2I3BA 3GJ6A 1Q3TA 1U99A 2ZITA 1XFAA 2ERYA 2QTFA 3UG6A 1Z0IA 4XWOA 2QA5A 2V4ZA 3PCRB 3ND9A 5D3QA 2W0SA 3NWJA 1NP6A 5G3YA 1G8PA 1JQJC 2BM0A 2R8RA 2J87A 1Z0KA 3I5XA 4B3XA 2QBYA 3K0FA 3BGWA 1KAOA 3PG5A 3QKSB 2RAPA 1NLFA 1EK0A 1ZC3A 2AKYA 2ZI9A 3AP1A 1GKYA 3OEHD 3H1TA 1Q57A 2WIBA 3VTKA 1CJUC 4URUR 1DEKA 4XJXA 4L15A 3GJ8A 4V0NA 1BH2A 1LW7A 1NL3A 1PZNA 1N6RA 1CR4A 1W2HA 4JLPA 3REGA 4LJ9A 3TE6A 2F55A 2FFBA 5D3MB 1E0KA 4PHHA 2W2XA 4TYWA 3K9HA 4RSGA
chains in the Genus database with same CATH superfamily
1QPZA 1CCWA 2AFVA 4TMFA 3IUQA 4BQPA 4HRXA 5HFJA 4MQ5A 1ZGJA 3LY8A 3MD9A 3R7SA 3FD8A 5EXTA 3T8YA 3P27A 1I3KA 2R9VA 4XUCA 3W06A 1HUQA 5F5XA 5DSZA 3TQCA 5BQ5A 8ATCA 8GPBA 3CRW1 2Q6VA 4A3SA 1TM5E 3RRNA 3K1JA 2P3OA 4NKRA 1YZUA 5F7XA 2QLMA 1QE5A 2F4NA 1JZTA 1XP5A 5H81A 1SPXA 2EP7A 3DE3X 1M1ZA 3LF1A 4U4AA 1X7ZA 3D7MA 4Q7MB 3KUDA 4OI4A 4TWRA 1MO5A 2BKUA 3FTDA 3EULA 2AF3C 2Q4BA 3HSYA 3SBOA 4ZICA 4WBNB 1VLJA 2KX7A 3OU6A 2WD7B 3LKVA 4YONB 2BGWA 1STOA 4CR8A 4POOA 3BVPA 3WYNA 2WJPA 5KYUB 2GQ0A 2W2OA 3IMFA 1NMYA 5F73A 3FTEA 3CWZA 3P9PA 4ZVMA 1HDXA 1TAGA 2YOHA 1U0FA 2ZBUA 2V3VA 3G2QA 3KTDA 4OK6A 5T6BA 2RH9B 2ZI7A 1OGJA 2C8KA 3IIEA 1MHPA 4HDQB 3U44A 3FAZA 2CLLB 2IHZA 3TW6A 5IYZB 4DBZA 2C83A 1KZ1A 5LP6C 4DSNA 1JA1A 2ODAA 4HDSA 5BN5A 1V5FA 2IT1A 1IQRA 3OZTA 4G84A 1M0WA 2DLDA 2O50A 2D0PB 2GS9A 1PLKA 1S02A 4M1SA 4R41A 4ZTBA 5CA1B 2N47A 4L07A 3TX6A 3BKWA 4Z51A 4H7EA 3AC0A 5DXJA 3HCWA 3NP7A 4H1WA 3UIEA 5DNAA 1Q7RA 3IP9A 3F49S 1K9VF 4Q6WA 1FFXB 3WLTA 2ZP1A 1P29A 1ZWKA 2HMWA 2Z6AA 3J7TA 4M36A 3KFLA 4Y7DA 4OLAA 2JFNA 4BLVA 1Q1AA 1VP3A 2J3JA 2QTRA 2X42A 3PNPA 1L1RA 5ILOA 4FYHA 1KQPA 1ADFA 4ZKEA 4BNFA 2YY7A 2ZYHA 5C4IA 1RM5A 4MO9A 4RGQA 1Q7TA 4EX6A 1HFKA 3ITEA 1JHQA 1MJ5A 2OCXA 3KU4A 4HQFA 4UM9B 1GU1A 4QREA 3NHSA 1QE3A 2WYUA 2RJOA 5EERA 3RSFA 4AZ0B 4O2RA 3KT3A 3EZLA 2YW2A 4IVNA 4WZAE 2PQMA 3UHFA 3PR2B 3EZNA 4ZJPA 1ZFNA 4ZMBA 3FGZA 2A67A 4BX2A 3BJMA 1H2EA 1F2UA 2IUTA 4P8RA 2GJAA 3ESQA 4HEA1 5FTNA 1KZGB 1TM7E 4FZRA 2ZRGA 4JLNA 4KVFA 2G8LA 2FRVA 4PPFA 4WL0A 2XITA 3QJYA 3VC7A 4LZAA 3TOVA 3C5HA 3GBPA 1ADCA 3S3TA 5KX5F 4OGGA 1I6KA 1PGQA 5HKBA 2FUEA 4HFJA 4BKMA 4L6IA 2TMKA 1SVIA 3ROXA 3SNKA 3D3NA 3CNNA 1N75A 2ZYIA 5KTSA 2J3DA 1XDWA 4EW2A 2QXYA 1Z38A 3ZE7A 5EZYA 2CZGA 1XZAA 1Y7TA 2ZXFA 2IUYA 1XWWA 3LD9A 2MR6A 3LT2A 2RFLA 1IHYA 2ZIXA 1BN7A 2ZPTX 3LM8A 3CX4A 3ITNA 1WE2A 2DFVA 4IIJB 3TXYA 4DA0A 4C76A 5HM8A 2I6SA 4LJ6A 2ZI6A 1VE6A 1NSYA 5SYAA 3OZEA 721PA 1XAHA 1KY3A 1P0CA 1P1IA 2BFCB 1UK9A 2HQRA 3GMSA 1IRXA 2C4NA 2QMUA 2TRSB 3N8DA 2FU5C 3AKDA 1AQ6A 1RRMA 4HRVA 5BMVA 3V7FA 3P9ZA 4W5OA 2D4HA 3OLZA 5HKAA 4WKOA 4CBVA 2W2QA 3UB3A 3PFWO 1PQPA 3FNIA 3PU6A 2YJ6A 5DBHX 1G8KA 2IXEA 2WBLC 1W4BA 2A92A 4GI1A 2CXPA 2I80A 4DLYA 5JEDA 1KSGA 1FP4B 1NQ5A 1PJ2A 3DBRB 3IQWA 1M6YA 1DO2A 2C3OA 2YC4C 3M9WA 3LCVB 4Y1RB 2JLYA 2FR8A 1RC0A 2ON6A 1IUKA 1O95A 1HRKA 2ZKLA 4PG6A 1YRLA 4CMIA 3HHEA 2IW3A 5H4GA 3FTNA 5JJKA 1K89A 1FDWA 1P1KA 4LNHA 1QIIA 1AQLA 4LBZA 4DCNA 2GM5A 4WVFA 2G5CA 2DWPA 3W9UA 1NIJA 1H23A 1MFPA 2FPWA 5CDSA 4YR9A 3LUAA 3PNOA 2BE9A 2CNLA 1OWMA 4BFWA 2VJMA 4NS1A 4OIMA 4FN5A 5BMOA 4ZC8A 4UHDA 1RNLA 1F2TA 2PMDA 5IVDA 5B12A 1NX6A 3BXPA 2J3QA 1XVTA 3H8JA 3ZWYA 3PTAA 3F3KA 2E2WA 1H6CA 1Y37A 1FNCA 2OY0A 3LY7A 4MMXB 1GZSA 1UOQA 3EOAI 3FDZA 4MW7A 4Q3DA 3W6UA 5B7GA 3L6CA 3U19A 5EL0A 4BE4A 3CPSA 2AOXA 4EY5A 4LF8B 1VHQA 4MAMA 4UPDA 1MU0A 5EE5B 2E4WA 4RV5A 5EUQB 3E9DA 5CT9A 1XU7A 1ZHFA 5T64A 5J2UA 3H18A 4CM9A 4JSTA 5L3QB 1MC8A 3LXUX 3ZY3A 2D8MA 3EUWA 3EBOA 4GVXA 1V3TA 3HXOA 4MRMB 5LQUA 4RULA 1XQ6A 4KE9A 4Y9SA 1KO8A 1Y63A 5B58C 1R9MA 3VH3A 2KQUA 1I5EA 4WI1A 1GPMA 1GZUA 4BKOA 2H5LA 3RI3A 5ICEA 5JS6A 1JSCA 2VYND 2BMVA 3OQJA 3GAZA 3Q3CA 4F6RA 3FN4A 2Q5JA 5G0SA 3FCXA 3AW8A 1GZHB 1QV9A 1Q19A 3GJQA 2ONJA 3HCEA 4P98A 1NKSA 4RJJA 3AF5A 3CR7A 3LXRA 3C85A 1T9BA 4OU4A 5EMJA 4BLSA 3QE4A 3RRJA 1QLWA 2PHZA 4ZEXA 2BSQA 3SQWA 2V6IA 3AVOA 1LNQA 2BKAA 1DC6A 1HQCA 4KQ1A 1NLYA 4A8JC 2QOEA 2GZ1A 4HEQA 4GOMD 2JGFA 1U2EA 2A9JA 2IIPA 4HWRA 4LY0A 5ALMA 2HH9A 2YIDA 1Z2PX 4EAAA 3EWIA 4MR9B 4ATNA 5K0GA 1AJEA 1FS6A 2D1TA 1JNYA 4PAQA 5FEMA 3VPHA 5AKEA 3G59A 1OBHA 3AOGA 1CK4A 4IUYA 4ZZ1A 1TO1E 3V3TA 4FD3A 2IYUA 1LVGA 2JFBA 5FPSA 2J6BA 3LBIA 5LZ5A 2FW8A 5BSTA 1MD9A 4X71A 4WE3A 2Z83A 1L4FA 4LSGA 4Z8YA 4W5RA 1X0XA 1Y3CE 2IK8A 5EE1A 2C9MA 4UHBA 1O96A 1UCFA 2IDZA 5EUBA 3M6MD 3ML1A 3I52A 4GMDA 1G7CA 4U2FA 3KHSA 1W4CA 2GARA 4JLJA 4BX3A 4QX6A 1REQB 1LBEA 2C4VA 3H65A 5BO5A 4NFYA 3A3KA 2XZLA 3VVCA 1Z4NA 3X0DA 1HKHA 4R7ZA 3OZVA 1HDIA 3ZW8A 2DKNA 1Y4UA 1WR8A 3PQ6A 1GO2A 4IWNA 4NYIQ 2XUFA 3GLIE 4RJ2A 1H0HA 3DOHA 2GMWA 1EVJA 4WZAB 5NULA 3EF1A 4D80A 4DM7A 3SJAA 4U2BA 3KR1A 4MWGA 1BJRE 5FO1A 1I2DA 5K0EA 1WXWA 5CJPA 1LVUA 3TMAA 1BE6A 1WB6A 4P58A 1TUIA 4K9OA 4JEHA 4KR3A 2JLVA 2LE0A 1IK6A 1SUEA 3KCQA 3L0BA 2NU9B 5AJUA 1VA4A 1ZP6A 4YAKA 2O8DB 3MS7A 5DHRA 3TZQA 5LUBA 3SS8A 3CO5A 4YCLA 1ZGGA 2OO5C 2P9JA 2VDVE 1Z5PA 2PT7A 2VHQA 2XUIA 4HX2A 1E63A 1OI4A 3C6MA 1I1HA 3M2TA 3QY9A 4KXLA 4US0R 5LZ8A 3OTHA 5JH7A 4L57A 1U1DA 4FBMA 2B0CA 1IXSB 3B5IA 5AW3A 2RMKA 4Q93A 1BDJA 1XTRA 2ACWA 3LSYA 3Q5DA 1MABA 1XZQA 5LOVB 3M6LA 5CLIA 3F7OA 3HR8A 3Q3HA 2PUHA 4JL6A 4P82A 4B3HA 4EJFA 2O5EA 1BVUA 1IN6A 1JMKC 3LBHA 4ZVSA 2HSJA 3DNFA 1UP7A 1KYVA 2G08A 2FGJA 3LHKA 5JQWA 4DIKA 4R1PA 1CFJA 1HQYE 1VMIA 5BUSA 4H4DA 1ZEMA 2OZKA 4G5FA 5LOVA 4ZOLB 3LX4A 1E60A 1GLVA 4GP6A 2J3IA 1L4EA 1XJCA 2VSOA 2YCBA 3ZDRA 2P75A 5ADHA 5DNEA 3DE6X 3CZRA 2QRUA 1R00A 4EG3A 2WLTA 4EUFA 2RH5A 4LYJA 3LA6A 4H3HB 1SXHA 5KYTA 1XEWY 1JHYA 1UZAA 2R86A 1C1DA 1IEWA 1ZRSA 2COKA 3AG6A 3CN9A 3IKJA 3OZGA 2NXNA 3UFBA 5HKKA 2GCEA 1EUYA 4G0ZA 3TW0A 2BT4A 1OYWA 4BFCA 4PONA 1Z4JA 3W05A 3P2OA 1AQJA 1E69A 3CZ4A 4RDXA 2MINB 2FPLA 1YZKA 2GF0A 3E3OA 4IR7A 4QNMA 4C7JA 4CV1A 1NQTA 1Z4QA 3GMDA 4QYTA 1KPHA 4V0QA 3VZSA 1U3WA 4BQIA 2E21A 4LYDA 1TUBB 3C3EA 1VJ5A 1U8XX 2DOKA 4IF6A 3OZSA 1BKYA 2I54A 4DIBA 1PV4A 5D5PA 3DNMA 4LG1A 1U3UA 4GEKA 4H1UA 3CLSC 3AVYA 1QB7A 3MIIA 3G6WA 2XKKA 4OX9Y 3FOBA 4J0GA 4QXQA 4QEZA 3MTAA 4PZ0A 4DLBA 5EJEA 1B6TA 4D43A 3JQ8A 1UBFA 4EGQA 2Z6UA 4B7UA 4ZOCA 4CLOB 1JF8A 2UVDA 4DT1A 2OXTA 2I7VA 3CXUA 4X1KA 4G1FA 4GECA 2QLNA 4L95C 1Z63A 3IQZA 3PQ5A 3UEOA 3ZTYA 1HOXA 2PMBA 1J56A 2EP5A 3OE5A 4OHPA 4PLHA 1RZVA 3K5IA 4I50B 4NHEA 4YMIA 3WHPA 3ZE0B 1VE7A 1YDFA 1Z74A 1YJ8A 2XQKA 2G71A 1PE0A 2OHIA 4P7FA 3OCZA 1D6MA 4ZVNA 5BQFA 4CF4A 3C39A 5IBQA 5F76A 2RGNA 1I10A 1ZM2A 2OG2A 3LLUA 1KFEB 4CPDA 1M6VA 2A3RA 2QIOA 3E22A 4O2BB 2W42A 4NYJQ 4M89A 5HIMA 1L2TA 4HGQA 4L73A 5KVAA 5KYXA 1QGUA 1R5OA 3JD0A 3FSGD 3R24A 3PLRA 4C4ZA 4W9MC 3Q9NA 5DN9A 1ZVKA 5DWVA 3RAEC 3D4NA 5HDBB 2BFEA 3UYLA 3FNRA 4IIXA 4LXIA 1M6HA 1X1AA 1EFLA 4PO9A 4OMUA 3QKRB 3AEYA 3IR6A 4RQAA 4G1VA 4J1TC 4KPGA 4AROA 4EY6A 3QLVA 3ZIDA 1IPHA 4KYUA 5EIOA 3T95A 3WIUA 1NW4A 3NBFA 1E9SA 3NGMA 4DC0A 5J4HA 4C2TA 1JR6A 3I4LA 3IUNA 4X9XA 1C7IA 4I19A 2HR1A 1W49A 5E7JA 3W77A 4M1WA 3GA7A 2DR0A 3HBJA 3AEUB 4U3JA 2Q28A 1E1DA 3P1JA 1NUHA 3IE0A 1ZMRA 4U6QA 1P3DA 4CIVA 5U1PA 4LMRA 1JI3A 3NHPA 6ABPA 4UHJA 3OT5A 5JLAA 5CAEB 2VQ6A 3PWZA 2ZT7A 2NN3C 5FUMA 3ZYZA 4NP6A 4FWBA 1LXCA 2BY4A 4RPJA 3IAXA 3KDSE 1TEHA 1HPLA 4YUYA 2XUZA 3WOHA 1N2CE 1ND6A 5KMGA 3KB6A 3ZX5A 2FAXA 4CT4B 3DBIA 4ZI7B 4GH5A 1JAIA 1ZH8A 4XEHA 2NUPA 1IWBB 4RZIA 5FOUA 2D6FA 1P9NA 1ZR4A 3BAFA 3K0CC 5IM4A 1Z36A 3ZJUA 2BUBA 3L3BA 3GLIB 1OZ0A 3KTOA 5I7RA 5IW8A 3U0VA 2I2AA 2FSPA 4EFKA 4WV3A 1SUWA 1XA0A 2CZCA 2PUDA 1IQPA 1WSWA 4O4IF 4JI4B 4DYDA 1PT8A 1TD1A 4DSZA 1EKXA 2ZDGA 4RHTA 3Q2OA 3FHCB 4KI0A 1G3IA 3WDKA 3QP9A 3IIJA 3FR7A 4QEDA 4AF7A 4W5NA 4WX2B 3D6HA 3ER6A 3LHIA 2IV2X 3VZBA 2ZJ3A 4RF3A 3TR6A 1WDTA 4DBLC 4S35A 5BSKA 4DV4B 5I7UA 4P0QB 2PR7A 2MR5A 2NV0A 2RHRA 2VDWA 4PLPA 1B0ZA 2XUGA 3QK7A 4TL9A 5EMHA 4JAVC 1ZVJA 4BBJA 3E84A 3HCCA 4WXHA 4CTMA 1UMKA 3FHLA 2BI8A 3AB8A 2JFPA 4MHSA 4RKRA 2RI1A 2VJDA 3I0ZA 2I62A 3LT1A 3QMPA 3RS7A 2OWEA 3KJHA 5LLDA 4P7GA 1ID1A 4X90A 1PFKA 2PBRA 2BGTA 5HIIA 3E7PA 5SZHB 5A1TA 7REQB 5DW3A 5IF3A 4N54A 1C9KA 1O87A 1YQXA 3TRHA 4ESOA 1E94E 4PG7A 1L7EA 3CF6R 4PS0A 1ZO8A 1IN8A 2NNWB 3IBFA 4WFKA 3TW8A 4B87A 1DXYA 2R6AA 3WGHA 1R64A 3D3KA 3QWIA 2GEKA 1CJKC 5JWHA 5AQ1A 1D5CA 4UUNA 1D2CA 3EEBA 3C5WP 1Y80A 1Z0ZA 4W9NC 4R05A 1V8BA 4M9CA 3T7RA 1E3WA 1AUOA 1AO3A 2E4ZA 2OFPA 4W8OA 4GSLA 1TA9A 4X97A 3MWGA 3EFOA 1G64A 4CLDA 4H18A 2BCEA 4DCTA 5K99A 1XHEA 1J7KA 2O8VA 5BWOA 3HL0A 5IU6A 2CD7A 2VF7A 3T3MB 4RTKA 3UFXB 1BMTA 3IAHA 4PXSA 3ZK7A 3U39A 2PLNA 3K6JA 2W6IA 3FSJX 1NXPA 4L5CA 1YZGA 2ZJ4A 1ZISA 5JBNA 2VJBA 3WGZA 2C1EA 3QKWA 1KE2A 3Q8KA 1DX9A 4C0XA 1U98A 2AD1A 2ZUVA 3QPVA 4QGBA 2LP4Y 1FJXA 1M6NA 4KFRA 4DDMA 3DVQX 2VTDA 4MV0A 3DOUA 5CURA 4UTXA 1ZICA 5BVHA 4Y98A 2OSBA 3BH6A 3USCS 2HT1A 3HKBB 3WGYA 4BL5A 4Z4GA 3QQPA 2QRVB 5EGNA 4IDHA 3TEJA 3F4BA 2GNPA 4PQFA 1U4NA 3DWGA 2C4KA 4GQAA 4DM3A 3SBEA 1K06A 4LZZA 4F45A 1JXAA 3TB6A 4TVSA 2RHBA 1TK2A 3R5JA 1E5QA 1MA0A 3PBKA 2NZUG 4O4LF 2DWCA 2XYGA 1Y1SA 3C6BA 5CM9C 1MQAA 4HN4B 3SZGA 3O1JC 1IFXA 2DTEA 3L9XA 1C1XB 1N2XA 1S9DA 2I6XA 1U2ZA 3CURA 3KKZA 3D6JA 3HUDA 4JZKA 4MQFA 4PRYA 5BY2A 5KU1A 1KK2A 4JR1A 4FLMA 3CW8X 3IV6A 4Q4HA 4E15A 4PLVA 2TMGA 3ESBA 1EWKA 4CN8A 4E5SA 4RXMA 2I7CA 2ZZKA 5BYKA 4N48A 3L05A 4XDGA 1WABA 3ROGA 4KO1S 1Q20A 3MCUA 3DDHA 3SPXA 3FHJA 4OQZA 1AKTA 2C2YA 4HEHA 4LKOA 3MPOA 4M8SA 3RIXA 3GQBA 1IJKA 4Y67A 3OT1B 4BP9A 3HCBA 1UT5A 1M1YA 5AXDA 5EJGA 3WP1B 1XD2B 2XVYA 3IQEA 4UUBA 2FW9A 4TTRA 2X1VA 4HBGA 4I1UA 1PG5A 3WQQA 1ZG3A 1L5HB 5SY9A 5LQAA 2D1QA 3K0AB 4C0LA 2QN3A 5FT9A 4ZV9A 1CY6A 2I6UA 4BO0A 3PGKA 2YQ4A 4U8HA 1CJBA 5ILGA 1YS9A 1K08A 4PO8A 4R2MA 3IJEB 4ABYA 1R6DA 1E2LA 4UVEA 3ZWAA 1K2WA 4JVMA 2G9RA 3FWHA 4QL3A 2J6HA 3C24A 1RTTA 5JJBA 2DVMA 2XY4A 2W5UA 2Z9BA 2ZJ2A 4IDNA 4J16C 2CMFA 4EPRA 5C8DA 4HNTA 4FM9A 5AVYA 3GFFA 2FPPB 2ZT8A 1XTVA 3PYMA 1JFLA 3IJ5A 4IGAA 1V16B 3UNXA 2EW2A 3T1YB 3E61A 4KXUA 1TVMA 2BBSA 3KZXA 4BFUA 1J90A 3EE6A 2H8GA 4M99A 2P69A 3HTXA 1KC3A 5ALHA 3F3SA 1Z5UA 1T4BA 3IIKA 4TV8A 3IPLA 3M1IA 4XSGA 4TT8A 5E95A 4ZAZA 4RSHA 3FW1A 4PG8A 1E6WA 2CVZA 4LSZA 5IJAA 2GD6A 4DAOA 2C3YA 2COEA 2NV2B 3ZGYA 5JAPA 2L69A 2WMNB 5F64A 1MX1A 5BYJA 1B6SA 4RMJA 1U2GC 4KPEC 3ELDA 3PGMA 1T4CB 2QEQA 1TEXA 2DZDA 2GHTA 1R6TA 3CLTD 2E37A 1A5SB 4KW7A 1N6NA 3CR8A 2XT0A 3JWGA 3Q0EA 1G7TA 3E5RA 4ECAA 4BJ3A 2MOKA 1JJBA 4GOJA 4C3VA 2Z4TA 2D54A 4EB3A 4HUJA 2QPTA 2OCGA 3QVKA 4EPYA 3FYDA 1QU3A 1QH1A 2VWPA 4RZSA 4TTVA 1NXXA 4XYBA 4DSAA 5KUTA 2I33A 2VNKA 1QRUA 5LMUB 4B71A 2Q7OE 3ZWVA 1DKUA 2HTEA 1Y4ZA 3NETA 5EJIA 4QODA 1KJIA 2X8LA 4C22A 3IL2A 4DV7B 5EJFA 2H1RA 3C3PA 2ZJ6A 4KTTE 1DZ3A 5E4FA 5J2TF 2Z4SA 5LB2A 2OD9A 3GXOA 6AT1A 4ACAA 4DLNA 2J30A 3PJGA 2BEVB 3ZYCA 5TLSA 1C9EA 4DR7B 1QHNA 2G36A 3KVVA 4WKPA 5CRIA 3KETA 3W6PA 1UAGA 3GBVA 1NVBA 3M4YA 1CQIA 1DX4A 5IEJA 4KBFA 2CK3D 4X65B 4HDNA 4GWGA 5DJ5A 1LDGA 1U81A 2EXXA 2AQKA 2O2IA 3A6HA 3IAM1 1OXKB 4IQGA 2ZUCA 3ROFA 2AVDA 2WWFA 3IHWA 3TSOA 2HDHA 4IIDA 2YV4A 2QXTA 2LNDA 3N76A 4UHKA 2X6QA 1KMQA 1TW2A 2WJYA 3C2QA 1N2IA 5F4ZA 3TTUA 2Z1DA 3UAWA 3WYCA 5IJ0A 4KXWA 5JEEA 5JSUA 3HJGA 2J0QA 4C30A 1ZL2A 1JHZA 1F1JA 4Y2HA 5IZCC 1NAIA 1ZA1A 3A32A 5GZ3A 1TM2A 3GJ5A 4Q3EA 4CM8B 1QDLB 3IMGA 2UU9B 1DJMA 1U8YA 4CDRA 3DO8A 2PNJA 4EENA 1BFUA 1T43A 2DUUA 4A6XA 4A8PA 1I6LA 3HU3A 3SLGA 2VRWA 3PRKE 4CIAA 2JGDB 4E2ZA 4UTNA 1PK8A 1DTWA 5JPCA 4HNRA 5TQ0A 1GGEA 3BD7A 4KR7A 3FM9A 1T0JB 2D3TA 2HEIA 1I24A 3IEUA 2RC6A 2D5AA 3VOAA 2QRLA 1T3GA 4F5YA 1GTMA 2VSYA 1QGAA 1UH5A 2R11A 2WHYA 3MMSA 2WG0A 3DZBA 2Z09A 2LIPA 3BRCA 4JUCA 5EZSA 4BO9A 1PJ8A 1SHKA 4Q5IA 3N0VA 3KR2A 3MGCA 4P3YA 4HLUC 4RSRA 5EZ5A 1HWYA 4OAOA 4MAAA 4B3MB 4UVIA 2ZSDA 2VR1A 3OJLA 3QUAA 4JR0A 3EVEA 2UUBB 3WSVA 5GJVC 5JECA 2DLNA 2O8NA 1RWQA 1SG6A 1A9OA 4M60A 4S1WA 4ENPA 2HWUA 3EMKA 4G36A 4W1SA 1CUBA 2Y6VA 1P5JA 1UAYA 2CL5A 2E4VA 3HXTA 4PTYA 2GEUA 3BS4A 4R4JA 4F2PA 4JCOA 2ZBQA 4UREA 1UZUA 1SKAA 1Y3BE 3F73A 4GMGA 1MAWA 1U8CB 5AMXA 3SI7A 3UB4A 4B82A 3RADC 3W5HA 2Q9CA 2QX6A 1MH9A 4J8PA 2M6KA 3I53A 1UOOA 4YXWD 1Z4OA 2C7VA 2Q3BA 1A72A 3ETHA 4QG7A 1ADJA 1JFSA 1I0IA 3Q11A 5MHTA 1QH8B 1VZ3A 2NU6A 4G4GA 2QKYA 1P72A 4JHXA 5I9BA 4BFVA 1MCZA 5AUNB 4BUZA 3G8DA 4TUYA 1DPGA 2PQ2A 5LZ7A 3DWIA 5H4HA 3N2KA 2XIJA 1O5OA 4BMNA 1JG3A 5BWCA 1VGVA 4A0SA 2B1RA 2UXDB 2GPSA 1MJGM 2GJSA 3HWX1 1Y1KE 4DUGA 3MWFA 1EK5A 2FZLA 3DZ8A 1PR1A 2F1IA 4AK9A 5I47A 5I4CA 1RKVA 3DAYA 3RUCA 4Q16A 4YGYA 2B2CA 4F8JA 3H97A 4ABTA 3UJ7A 4OGFA 1MJFA 2BIFA 4I46A 4RQTA 3FWZA 4DOMA 5IVHA 4B3SB 5J43A 1S6YA 4BZQA 2F8LA 3L77A 1J8VA 3UH1A 5DCUA 3LV8A 3FTQA 3IKTA 4ALMA 4S2UA 2R6GA 5HQJA 3VFDA 5E9AA 4N6OA 4URYR 3NBAA 2Z9CA 4M38A 3VU3A 1WCWA 4QDJA 5DM60 3HCOA 1G19A 3MCVA 3IMCA 3HJAA 2DGDA 3QH4A 2YASA 3G8CA 1DFGA 1YASA 5CXQA 2W2KB 5A0FA 1NN0A 2W6JA 5P21A 3PZRA 3DM9B 4JENA 3QEMA 3STXA 1PI3A 1EUZA 2CXSA 5E38A 2N0SA 4IXMA 4BN0A 4D9KA 4E5YA 3OEYA 2DPXA 4B74A 3NCHA 4LSWA 1KFKB 3HY6A 4FFOA 1HMYA 1I4WA 2VVTA 1KVQA 2Z4RA 3AL3A 4ZVLA 3SYMA 1TLTA 4KV7A 5AW9A 1ONBA 3ENZA 1AKYA 2DBQA 3D5TA 3GDHA 3LC2O 3RC8A 4YT2A 1HOTA 2RSLA 5KX5A 4PR0A 4FYVA 1YHZA 2BUAA 3ADPA 3EVTA 2QL6A 3FFBA 5EJ4A 1RRCA 3IEVA 2I4RA 3DH0A 4DPLA 4JDUA 3JSXA 1QK5A 1W1IA 3ZXYA 4B40A 1E4YA 1VHJA 3F8SA 3L4SO 1RVDA 3BXEA 3DMNA 5JE8A 3O1LA 1B4DA 4MUAA 1DQPA 3JX9A 3DZJA 2E55A 3EUEA 3IB3A 2O0KA 3UC5A 2X40A 4HAVA 1K88A 2ZJFA 5T8KA 4NQRA 3S5UA 4EQZA 1P1HA 4OQFA 3JYQA 2QXUA 4G5HA 4YDHB 2WYIA 4FMCF 1A9PA 2CKMA 1KMCA 2R65A 4I9HA 2O6LA 5FJJA 4E21A 3CRRA 1Y6QA 2Q1SA 4F60A 2H18A 3RWMB 3H9EO 3JQAD 1Y1LA 4G37A 3WWZA 1BD3A 1R3DA 5JFTA 1DG9A 4P86A 4RHXA 4X20A 1GGMA 5ALOA 4QDOA 4WFQA 2JF0A 3RFVA 5JBIA 2YHIA 4MS4A 1OLUA 3ADDA 1H2YA 2OO5A 3FVTA 4NBUA 4BFSA 2B8NA 2Q5LA 4KUHA 1NE7A 1RRKA 4ZQBA 3GGPA 3A8TA 5COQA 4JLAA 1DAFA 4JUIA 4J2TA 2IS1A 2RDMA 2Q1WA 1M34E 3ECSA 3UXEA 2G83A 4EG8A 4MI3A 2R00A 4CU5A 3V8RA 3QX3A 1ETHA 1SEVA 5F98A 5DM1A 3S1AB 4IZOA 3TZLA 2HA5A 3E1GA 4IFEA 4J6FA 4MS1A 2QRHA 3EIUA 1NTRA 5EEGA 5HF9A 5DU2A 1C3EA 3TTTA 2XOXA 5JXHA 3PDJA 3ZWQA 4I5IA 4WCFB 4X41A 3WK8A 2GWRA 4GQIA 3VR2A 1P1RA 4MIYA 5AM1A 2YYSA 4KXYA 1YHNA 3RRBA 1YCHA 2WWGA 3PHHA 5JZ9A 4KHPB 1EVEA 2UZ1A 4H0FA 2HBYA 3O6VA 3MUOA 2NTJA 3THOA 1Z5ZA 3GMIA 4URZR 4UUMA 4ZZIA 1GAJA 2BRUA 4KDEA 2PS3A 4FOPA 4LJ5A 3ILXA 3KXLA 1G17A 2ZREA 4H08A 1IOVA 2QMEA 5FL7A 3U7HB 3O4GA 1XTUA 2VBGA 1M7BA 4A15A 5KVQA 3GPIA 3OPQA 2QN2A 3E3AA 3FB4A 3PKZA 1VKJA 1Y6JA 1ESDA 3NFRA 5ERGB 2CHGA 3DF7A 3RK4A 2JKZA 1VIYA 4PBSA 3NAQA 2Y1DA 3M6WA 3ZPXA 2JI9A 5EKXA 5KTKA 1HC7A 1SZDA 2FPRA 2PVSA 2HM7A 1P8AA 2KLHA 3GRKA 4RZ3A 3AVUA 1G3QA 4DRXB 5K2OA 4Q24A 1UPXA 2J0EA 3DTVB 1OIWA 3QF7A 1OROA 1NBEA 3BJIC 1KFJB 1JHMA 3IHKA 4KXNA 2ODPA 4JX8A 4LC1A 3ZUPA 3ZV5A 3T5GA 1IC6A 1NRWA 1ZRHA 3UUEA 2GBCA 4U6SA 1AT1A 5A5GA 1IDN1 3G7UA 3QXGA 3L8CA 3ROPA 5A4AA 4WADA 2CFRA 3Q1KA 4DDHA 2GXSA 3NBZC 1O97C 3I12A 3NHYA 4PRZA 3ZWMA 1QHHB 3KJFA 1QQ5A 2WRZA 3KTAB 3O0TA 4W7SA 4E14A 2GSDA 3JALA 2RHOA 3AIOA 1P7PA 2E1PA 2BBOA 3C74A 3V8MA 3BCRA 1CUJA 3CCBA 2C7BA 5E1DA 1AQYA 1LWNA 4KPUA 2AOUB 1RFGE 5K3CA 2B82A 3FUXA 4RBNA 2CNOA 2X4LA 4D9JA 4XIGS 1XDGA 5CTJA 3NS7A 1TA4A 3OTIA 1A9XA 1W5BA 1E1CA 1UOEA 1QWSA 2YJGA 4YUZA 3VOTA 2H2WA 3GFQA 1BS9A 4MJXA 2A1IA 2J31A 2JHGA 4NY1A 2PTHA 1J8MF 5BVGA 5HPYB 2YYZA 3TCXB 2A9QA 4BQQA 3E8MA 1T1JA 3EZXA 4JP8A 3GIDA 3ILHA 5TJ9A 3OC0A 4YJ2F 3LJKA 4KN9S 2UZAA 4D1YA 3B82A 4WRRA 5JIBA 1E2EA 4LPSA 3O5AA 1EGMB 5HRCA 3FHOA 2Z8ZA 3L43A 1JKJA 2C8LA 3ILYA 1YL5A 5ETJA 3GPBA 5AXBA 4EM6A 3VPAA 4HDCA 2ZRBA 1RD4A 4P54A 4D92A 4YRBA 4CG1A 1TJPB 4MUEA 5CFZA 1C8KA 1PUIA 1GNQA 1WHTA 3LK6A 5JYEA 1ZK3A 3G5MA 1IXYA 3A3OA 2JFFA 2PQ0A 1R9GA 2WF8A 1S4QA 3TLGB 1PKEA 1U0RA 4MS3B 2VP0A 2XCIA 4JP2A 4BAGA 4IFBA 4B2YA 1VIMA 2WWWA 3OIUA 4A03A 3I01A 3UMRA 4LRQA 4A4DA 4XIJA 4B8ZA 2PH7A 4NICA 1H6DA 5BQOA 2YBDA 3BCHA 1LK7A 1SHLA 3VU9B 4BRWA 4EBBA 1A96A 2D74A 2KPOA 3STTA 2UXBB 2VA8A 1RAHA 1AQUA 1EFPB 4R8MA 4R16A 3RABA 3Q5GA 3T9FA 3OKPA 4EKNB 1GNLA 1N7JA 1S01A 2WA2A 1Z25A 4LYYA 1XAJA 5L3SA 5KJCA 1AGRA 1UWVA 1Q1NA 4IYRA 4NATA 1X7YB 3K0CA 4PZ9A 2ZRNA 2D5LA 2VATA 4UU8A 1NMZA 1Z47A 4OQYA 4LWPA 3O7MA 5FD8A 1ZOPA 3WNCA 4BKUA 1D8TA 2NV6A 2Q07A 3QX9A 2D59A 2FG5A 2FZKA 2NZJA 2ZJ8A 4QT4A 5B2FA 2CSUA 4LN1A 3SYNA 2IUEA 1PGNA 3Q3VA 2PRSA 4RORA 1E79D 2ORVA 1UDCA 2Q3MA 3HV0A 2V8OA 1BD4A 3GT0A 4GZ6A 3SQOA 2WJHA 4JYZA 4E7OA 4U7JA 4OQMA 2IPNA 4QO8A 4U2EA 4Q39A 3KU1A 4G56A 3VOBA 4KKXB 3WRVA 5KOJA 2VAVA 1YIOA 5EXSA 3PE4A 2FX2A 4DMHA 5HZKA 3E9NA 1IN5A 4G97A 5ALKA 2XZOA 2QTZA 1UQUA 2XGOA 3JQFA 1QMGA 3EC2A 4ZOAA 2AC2A 4B6OA 5CVTA 3FCSB 3NAMA 1H1LB 4O2AF 5G1NA 3CH6A 2X77A 2M98A 1M34B 1OWPA 2OM2A 3DE2X 4ZGWA 4U7GA 1YBFA 3I42A 2Y1CA 1FDOA 3DC2A 3H0CA 3IX7A 3C97A 2PZKA 5HBGA 4EI2A 4N3BA 4D56A 5HX7A 1E2DA 2IQ5A 3T7AA 4YUWA 1TQHA 1X7WB 1UODA 2YYYA 5B4TA 5GTDA 1KRXA 4FMDF 1Z7YA 3PHBE 3DEIA 3W5UA 1CJSA 2C77A 3DOEA 3BRWD 3AR4A 3MCAA 2CVOA 4MWCA 4J75A 3RNOA 4C4XA 1U9CA 2XXBA 2ZT6A 3EFHA 2XR1A 5ECWA 4G0YA 1P4HA 3W6OA 4XQ9A 2PBZA 1AF7A 4RL6A 1SHUX 1EP2B 4JHLA 1M7HA 4F3KA 5CB8A 1A0OA 4FPXA 1PQUA 4YA6A 1W93A 3HNOA 2IYNA 2UVPB 4Q4JA 4BFLA 3OPMA 1F8YA 1TX4B 1EQUA 1MN6A 4MWBA 4RH0A 3RBAA 2B4YA 1O08A 1OT3A 1E96A 1TE2A 3FCCA 3DMTA 5I45A 2R60A 4LCJA 2ZULA 3SJZA 5JYDA 3LU1A 1K7CA 4JT4A 4HDKA 2X0NA 3BWCA 2BVNA 5CGZA 3KT0A 2CWWA 4CMGA 1YVEI 4NR0A 3SD7A 2C7OA 3TIXB 5C34B 1ZBDA 1OIXA 3KLPX 2QQ0A 2FEAA 4UMEA 3RTAA 1WU8A 1GGVA 1SC4A 1QYDA 4RH1A 2DEUA 1FNMA 2I71A 3OT4A 1DKPA 1E3IA 3DP7A 3RBVA 4DCUA 1UKZA 5JALA 1GQSA 2NZXA 3AY3A 5K03A 1RABA 3ICCA 1B0PA 2NLOA 3ODPA 1UWKA 2QS9A 1YS4A 3JASB 2I34A 2MSNA 1XMPA 1J8DA 2JBAB 1MIOB 2ZUDA 4NBVA 4ZT2A 3OAAA 4EB6A 4PWYA 3EDYA 1XYVA 2UYGA 4KUGA 1KU6A 1T36A 3B8EA 3L6BA 3IURA 4IKOA 3O8OA 3D6FA 3SC4A 3ZCVA 3HCNA 4IEEA 4M0DA 3UMBA 3ZD8A 4CEHB 2A0WA 1X7XA 3D4LA 3EDQA 4BGIA 3P9QA 1S8AA 5FUXA 1KO5A 5G0UA 2IOHA 4H77A 3M83A 4IW3B 4H3VA 2VHEA 1H69A 4GM4A 4TTQA 5G40A 5K3EA 3WZ2A 1DSSG 1N32B 4BEBA 3O9VA 3PENA 3R3WA 3QUBA 3NW9A 2G88A 5TGDA 4EI8A 4GYKA 4JI6B 1IZ0A 3QVGB 4JB2A 4V0KA 5DK6A 1I7NA 4AJOA 1EZ1A 2IS2A 2AWNA 4H7FA 4HAWA 4D42A 2ZETA 3CFYA 3PWSA 4OF4A 2FOIA 1J9GA 1WXFA 1XKLA 3MQ2A 4UBJA 1Y7HA 2XV1A 5DF1A 4X62B 5EIXA 2W2PA 4RFLA 1NMQA 2ZXEA 5B3KA 3L1VA 4HEA6 4YQEA 4ZCMA 4DV2B 2LPMA 2R6JA 1PV1A 1CFZA 2O20A 3PIDA 1VMDA 4PZYA 3RGWS 1HE2A 1WEKA 1YS7A 2I6TA 3B1ZA 3PTZA 4LDAA 5DMHA 1RPZA 3U31A 4DWOA 1IHUA 1RI2A 1VKHA 4R9UC 1DLJA 4TZ0A 3O8NA 5JZOA 2ZKIA 3Q1LA 3GJTA 2NVBA 3HQ4O