1N5IA

Crystal structure of inactive mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp) at ph 4.6 (resolution 1.85 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 85
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5iA00
4OI4A 1M7HA 1JECA 4M9ZA 1GITA 4DIDA 2GK7A 3TRFA 5DHAA 2ZREA 3K9HA 1KO1A 3RANA 5FR1A 3AM1A 2R8RA 1KDRA 4TLAA 3CF2A 4FI3C 2B6HA 4MKFA 1KJYA 1PLKA 1G4AE 4MYCA 4NZYA 4C0JA 4XVUA 1DO0A 1N6KA 4NH0A 1XMSA 4HZIA 5IT5A 2EU8A 3G5UA 2JLRA 2IYSA 2GJAA 1JR3E 4CGZA 3EAQA 4PHFA 2GJSA 2ZJ5A 2PL3A 4BFWA 3LA6A 4C7OB 1R5BA 2JAQA 4F4IA 2WICA 4UXJA 2IYZA 2D7DA 1B0UA 1YRAA 1N0WA 3NVAA 3C7KA 1TF5A 1OHHD 4IJMA 4EPYA 3IQXA 2K5UA 4Q1DA 4MGKR 2OLKA 1PUJA 1G17A 3OIUA 3MJHA 2IT1A 4JLVA 4LI0A 2ZR7A 3GQBA 1E2JA 2ZSEA 2V6IA 3EXAA 1N6OA 4W9MC 2UKDA 2JCSA 2RGEA 3OFNA 3AVWA 3O8RA 1ZNZA 2WV9A 1FMJA 4Q1FA 5HCNA 3REGA 3RSLA 1YKSA 1S8FA 2NZJA 4PC3A 2C78A 1W4BA 4HAXA 4ACAA 4BUJA 4YMVA 4WAUA 1W7AA 1JXMA 4L9SA 4TTRA 4JKIA 4ASUA 5EXSA 1Z0JA 1KJWA 2O8BB 1FTSA 3AP2A 1R0YA 5FL7A 5FTKA 3EARA 1JEEA 5DI3A 2BVNA 4QHTA 4JIMA 3DOEA 4HLQB 5F9FA 1DAMA 4PC6A 3GEIA 4HDQB 1HTWA 1OXTA 3W8RA 4MDFA 3IILA 1HY3A 5EQTA 1SVIA 4EAQA 1GDDA 2YVUA 1OLOA 4RD1A 4QRHA 3RWOA 1E9EA 4R2HA 2VF8A 1TTTA 4YDHB 4KHZA 5FBQB 2QQEA 2Q9CA 2IUUA 4DSUA 1OB5A 2BEKA 3C8UA 2G1KA 1W47A 2YJTD 1UJ2A 4JLOA 5JWOA 3KX2A 2RGAA 5BYKA 3KQLA 3UANA 4KJZA 5K8TA 2PLFA 2ZRKA 3BB4A 2F43B 4FW9A 5DGXA 1G6HA 2P2LA 2ZJOA 1NKTA 4BFYA 5EE0A 5CDFA 3CPHA 2QE7D 4HLUC 4XWOA 3A6PC 1E2KA 2J7PD 721PA 4XVRA 2QRZA 1U0HC 5JLJA 4Q01A 1XF9A 1P61B 1FP7A 3B85A 3S1AB 3O8CA 2HDNB 4QGGA 4PZZA 1VYVA 2WHXA 3GJXC 3MSXA 4N1AA 5IK2A 2QSYA 2HCBA 1OFHA 3LH5A 4RFSB 2GWHA 4D81A 1P75A 3U3OA 3THXA 1HUQA 4I1OA 1G7CA 4PPGA 2CCJA 1IY2A 2UZ3A 1EFRD 2R6AA 1KI7A 3EG5A 3QVUA 1UF9A 2GAOA 3JVVA 3KXIA 4PZYA 1TL7C 3THYA 1J8MF 1YRBA 2A5GA 1U99A 2R6CA 3KXKA 1T6NA 4N0DA 2IF2A 5JJKA 4AY2A 2QBYB 4XVQA 3MLEA 2WWHA 3P4YA 1C4OA 1G3RA 2J9RA 4F4JA 3IQWA 5C18A 1VHLA 2IEZA 5L8VA 5DN6A 2JEOA 4LCBA 1X8KA 1LF0A 2VEDA 3RABA 4IEEA 3I72A 2IXFA 3K0FB 3VHLB 1Z63A 2HLDA 2CL6X 3FMIA 1ZMXA 3KJGA 5EE3A 1YR8A 2FDCA 4RFVA 2B8WA 1NVVQ 2HF9A 2CK3A 1DVRA 3CUEF 4AC9A 2IS4A 1NN5A 5JCZA 4B3BA 5LD2C 4EIWA 1JNYA 4R71A 3B82A 4RCZA 1Z0KA 4Q47A 4M53A 2HYDA 3L8YA 3VR2A 2Y8EA 1BO6A 4DLUA 5J5CA 2NGRA 1G16A 3B1XA 4CT5A 2E9SA 3IDQA 5KDDA 1A5TA 4AWXA 3U2QA 1MRSA 1RFLA 4OI0A 3NDPA 3O8DA 4TSFA 1E2NA 1G3IA 2W0MA 2ZRHA 1QRAA 4B43A 1XEXB 1M7GA 4P4UA 3OHMA 2BEJA 2QU8A 1GIAA 4CDGA 1A7JA 3PUXA 1KI3A 4X8OA 2ERXA 1UKVY 4LJAA 2EYUA 2OT3B 3MJRA 4DCUA 3WY9A 4KFSA 1LW7A 4AYTA 4BLQA 3T5DA 1G20E 1ZJ6A 3DZ8A 2OCBA 4GZMA 4Q1BA 4W5JA 3AVUA 1Z0FA 3CRW1 4QG7A 4BLPA 4URUR 4E09A 4P33A 4PSKA 3SJAA 2VPPA 2FFAA 1NG1A 3M1IA 1E99A 4DUGA 2NTYC 1S9DA 4L9WA 1VCMA 2ZUDA 3PEUA 821PA 2XZOA 1F2TB 4Q7LA 4E5UA 3C16C 4CEHA 3NH9A 2NIPA 1DG1G 2J0VA 2ZEJA 4KFTA 1E0JA 4OQMA 2J87A 2P5TB 5CJ2A 1EESA 4PTLA 4TL7A 4YMSA 3U4QB 4KCGA 1CJUC 3HU1A 3SQXA 2IYLD 1DAHA 3IHLA 1QBKC 1CU1A 3B60A 2VQSA 1GOTA 1MR3F 1R5OA 1VG8A 4JJZA 3QQ5A 4DXAA 4AKGA 4A6PA 1NJGA 3GLHE 4Q1CA 3O47A 1KIMA 1ZM3A 2X77A 4IVPA 4Q02A 4XD7D 1SXJD 3IIKA 5EJEA 2JLXA 5KTYA 4AG5A 4EDHA 1E9RA 2C8VA 2ZI4A 1K5DA 3QKRA 3B2EA 1BMFA 1NN0A 4M9SA 4GL2A 1OKKD 2CMKA 3GMTA 3WNDA 3U7EB 621PA 1PLLA 4B2IA 2EWVA 4GPTA 4IHQA 4DT1B 3CH5A 4JLAA 2FOLA 4RZUA 1VG0B 4C0QC 3RS4A 2LCFA 4RZ2A 1N5LA 5LDDC 2YOHA 4OI1A 4LRWA 1W4CA 1NLZA 4NCIA 2YWEA 3SJCA 1IHUA 1R5NA 1K6MA 2FPLA 1KOFA 4TQ9A 4A6XA 4B32A 4DEXA 3DEFA 4ZIRB 1P73A 4C0KA 2WSMA 1G5RA 4MYTA 4DLSA 2IYWA 4HDCA 3K0AB 2OAQ1 4TMZA 4UNNA 3LDAA 4PSAA 4PC7A 1Y63A 2ZITA 4GMXA 1AJEA 2ZQ5A 2WSSA 1Q12A 3QXHA 2A2ZA 4I4LA 1TU4A 1Z3IX 5FBVB 1N3BA 2OILA 2QM7A 2WJIA 3I1FA 1SXJB 4V0KA 3VR3A 3U44A 1Z6XA 4ZDWA 4AYXA 5HPYB 3FMFA 1SZPA 1IY0A 4B76A 1WE2A 1R2QA 3A58B 1KNQA 2CDNA 1TUIA 1CR1A 3AF4A 2WOOA 3BH6A 4A36A 3I5XA 3VHXA 4LHZA 3KJHA 1YZKA 5DLQC 1W4RA 4UXIA 2B7CA 4DKXA 2FJUA 4B48A 3TJZA 2H16A 3VX3A 3FFAA 3K0CC 3OEHD 3BS4A 2ZU0C 2ZUCA 3RC8A 5KHOC 4JLBA 4FMCF 4PZLA 3GEHA 4GP7A 5KUTA 2GCNA 1DAFA 2PCJA 1X8LA 2CLSA 4GSYA 4HAVA 4NBSA 1E79A 2FG5A 2RMKA 5LPNA 3RDPA 3Q5EA 4XWAA 3TIFA 3BE4A 4CRWB 1NVWQ 4UNRA 2ZJ2A 1JAIA 1BYUA 4DSNA 4XTRA 1JR3D 2R6DA 1OXVA 3MWLA 5BXQC 2NOAA 4DSOA 3SYKA 2OFWA 2E87A 1B23P 3KKMA 3DDCA 2A7QA 1KI9A 4M9QA 4FXPA 1XTRA 2AR7A 4DDTA 1DPFA 4PO9A 3EPKA 4NL4H 4K8OA 2OLJA 3BORA 1IXSB 2ZETA 4NCNA 1AN0A 4Q00A 1G18A 5GJVC 1OIVA 1S96A 3SNHA 5AJVB 3SFZA 4EJSA 1IN6A 1NBMA 1W0KD 3BFXA 3PEVA 1SHKA 2JIZD 2Z0MA 3LBHA 4HDOB 2XXAB 2RCNA 3FHOA 4RCYA 1ZCBA 1NN1A 3VU9A 4PANA 5BW8A 3GLGE 1DAIA 1E9DA 3J81k 4URWR 5C1BA 4C2UA 4FCVA 4NHOA 3RAPR 5B57C 3FHTA 4HB0A 4AYWA 1MABA 3WP0A 1DAEA 2R9VA 2ZRCA 1W2HA 2GXUA 4OQFA 3PUWA 4LC0A 4P32A 1CKEA 5FUXA 1FMLA 2CL7X 3DMDA 4A15A 5BYJA 2XTNA 3FMOB 3QY0A 3RC3A 3B9PA 1XB2A 1P9WA 1KMHB 1T9HA 3H4MA 3OAAD 4M8NE 5LD2B 2EW1A 2FEOA 2QE7A 2ZRPA 2W00A 2VRWA 1P3JA 3R20A 2QN6A 2J7PA 2WJJA 2ZE7A 3LY5A 4I1VA 4PC1A 3E1SA 2CHVA 5G41A 1P9NA 4B47A 2OO7A 1U9IA 1T0HB 2FSIA 3IBGA 3ETLA 2O8FB 4D0GA 3B9QA 3EA5A 1ZD1A 2W2TA 4ERNA 4ZI2A 2AN9A 4RKFA 3NTUA 3W8NA 2VP6A 3I5YA 4Q4AB 1E0SA 3KKOA 5DH9A 3ASZA 2ODWA 1AK2A 4KFUA 2I4IA 5FL3A 1Q1ZA 2V6JA 1FPMA 2ZRJA 1QDEA 1G3QA 3K70C 1AKEA 3MMPA 4BFSA 1RYFA 3U6KA 2D7CA 2RGNC 1QHHA 4MKIA 1WB9A 4PPNA 5FBLB 4IVQA 3HDTA 3KL4A 5JBQA 2GTPA 1ZP6A 3ZIAA 4KBFA 2ORWA 1E1QD 4DDWA 1TEVA 1KYIA 4JVMA 4C30A 4BFVA 3WHLA 2FFHA 4POAA 2B92A 4NYMR 3GFTA 4HATA 1M8PA 2HXSA 2OZEA 3GJ3A 4U02A 4WA7A 3PEYA 4B75A 3SQWA 4JLNA 5FOVA 2ODBA 2RGGA 4ZDKA 3CM0A 5TY0A 2EYQA 5JJLA 2PZEA 4QGAA 5B30A 1NL3A 2ATXA 2OSBA 1GG2A 1II8A 1U98A 3X1WA 2BKUA 3REFA 1Z6TA 2EFCB 3W34A 3QPUA 1TX4B 1L8QA 1IOZA 3X1ZA 4JSTA 3WRXC 1W44A 4P4TA 2FU5C 4PSVA 4UJ5A 1ZNYA 1IAQA 4WZAE 1D2NA 1EX6A 2P67A 1BIFA 1UDXA 2HJVA 1AGRA 4IOJA 4Q19A 5L3QB 2IYTA 3PVSA 221PA 4JYBA 1RIFA 1E2LA 4MKHA 2HCJB 2GRJA 2FGJA 1G291 2W6JA 3OE7A 1KO7A 1XD9A 1UAAA 1OXUA 4DDVA 1N6LA 3FMPB 4MITA 3CX6A 1QHIA 3QEOA 4MA4A 1FX0A 2IYXA 4QM7A 4TZ6A 3WMEA 5AJZA 5EUMA 5JS8A 1F2UB 2DBYA 4XSGA 1FNNA 4FIDA 2QUZA 2WWXA 1ZW6A 1GUAA 4GI7A 2H7VA 1S1MA 1UADA 2IL1A 1KKLA 3NEYA 1HURA 2MMCA 1S4QA 4DZZA 5AK0A 2C03A 4TQAA 3T06B 121PA 4D0NA 4R7ZA 5H70A 2VSFA 4KAXA 3T1OA 4PPFA 4B35A 1MO3A 3U3RA 4JL6A 3LWNA 5FR2A 1TF2A 1HYQA 3LXXA 2BBWA 4LY6A 3DHWC 1ZAKA 3KQKA 4IFBA 2IYUA 4URZR 2C9OA 3RSOA 5CM9C 4DLWA 2GETA 3EIQA 2QGNA 4M2LA 2V7QD 3F5FA 2V55B 4KYIB 4RD4A 4YXWA 1KK0A 3WYGA 2QAGA 4PO8A 2BMDA 4KODA 4O2RA 1HQYE 5BWMA 5IRCD 1WF3A 2QAJA 3VKWA 2MSDB 5HCIA 1U8ZA 2REOA 3L0OA 2MSEB 4F4CA 2RGDA 2IXGA 2CJWA 3BGWA 3MWYW 1HV8A 4WIAA 4DB4A 3MD0A 4X8LA 2YYZA 4JBXA 2H17A 2WMNB 5F2EA 3RVBA 4AD8A 4ZO4A 4US2R 1LV7A 3AGPA 4C3ZA 1D9XA 1KO8A 4TMVA 2F6RA 1OFTA 1BKDR 1I2MA 2ZI7A 5FTLA 4Q4HB 5J4HA 3GLIE 1KDOA 2F3RA 3NC0C 4IEIA 2P6RA 5FUWA 3ZLJA 1CP2A 2JDIA 1SXJE 2CCKA 3Q8XB 5CM8B 1N5KA 2IYRA 4E22A 1M74A 3H86A 3LVQE 2WPDA 2WWWA 4O0MA 1TPZA 1IM2A 1A82A 2JLVA 1ZC4A 3H2YA 1KAGA 1L4UA 4TL6A 4LBYA 5FOUA 2PEYA 4EFLA 2QPTA 2GA8A 1NVXQ 5AJWA 2ECKA 4DCSA 3DO6A 4KYUA 2FZLA 4F92B 3PEWA 2XZLA 2NO7A 2GZDA 4R2IA 1T5IA 5A0FA 3LBIA 1DBSA 3FGNA 4A1FA 1K8RA 2AXNA 1SVOA 3M0EA 4CZ2A 3ADBA 1DOAA 3BXZA 4TT3D 2BKEA 4AIIA 1J90A 2ASEA 3WNCA 4BE7B 4FCTA 1GAJA 2JJ1A 4FMDF 3CPEA 4OBEA 2R6FA 1SHZA 4TWZA 4NE2A 1P7CA 5HKKA 4G5GA 1VYUA 4C9BA 3DPUA 3K70D 4XH9B 1KY3A 3TKLA 1T91A 4FWIB 1Z28A 4YMUA 2O8DB 3LX8A 5TXGA 2QRNA 1PVOA 2BM1A 2PJZA 1E96A 2J0UA 3BBPA 3GLHB 1QHNA 4Q7MB 4TMTA 3X1XA 4TLEA 2Z5FA 4D82A 3W3AA 3CR8A 5JEDA 1YR7A 4Y0AA 1E2EA 2VHQA 3G82C 4Z8YA 1EFUA 3PV0A 4MGZR 3R9IA 5G53C 2V54A 4JLMA 1G5TA 1NVUQ 4JBWA 1I4TD 4MRRA 4A2WA 4QNMA 1TQ2A 5L3SB 1SQ5A 3KQUA 2RHDA 4QBGB 2PBRA 2A5JA 1LTQA 2AHOA 2EFEB 2PT5A 4M22A 3TW8B 1W1WA 2Q0HA 3L0SA 4ON9A 1Z83A 2B21A 2HEIA 4V0NA 5IHPA 4P4SB 4P3YA 3TSZA 1WMSA 1UBCA 4GRAA 4KSCA 3H0KA 3T5GA 3RS5A 3MWKA 1XCMA 3TVDA 2G1JA 2NZ8A 3D31A 2C2HA 3CRVA 3K70B 3VKGA 1G1MA 2QMEA 4JLDA 1OE0A 2QPOA 2GCPA 5P21A 3AF2A 3LAWA 1H8HA 2ZAMA 3MCAA 2DY1A 5AJYA 4OHYA 1FTNA 3D6TB 3VMFA 2GCOA 1D8TA 1UEJA 3TH5A 3EZ7A 1Z6AA 1X8JA 3TK1A 5BN3A 4IDQA 1OH8A 4LYAA 5FPSA 2GVZC 1QZXA 3SN6A 1L4YA 2CHQA 2D06A 3UG6A 3RLFA 3TSOA 5EE9A 1T3HA 5AUQA 4PHHA 4CEIA 1WBDA 1IY1A 3B1YA 1KDTA 3F3YA 4GT1A 4P31A 2Q3FA 4DC9A 3LD9A 3K9LA 2QT0A 3KTAA 2ZRLA 3ECCA 4FMCB 4KXFB 3T61A 3P32A 1EWRA 1Z22A 1KJZA 4CEJA 1FOEB 5FOWA 1E6CA 2HT6A 2V8OA 4LWZA 5TVKA 3ZZUA 4RD3A 5B64A 2RKOA 3WBKA 3FKSA 5EUQB 3R7WA 1T3LA 2GAAA 3ZZTA 2W58A 2V4ZA 3CNOA 3CW2A 3K09C 3QXCA 2O8EB 1UEIA 3A1UA 2IW3A 4PAOA 4EPWA 3PJRA 2QT1A 5BQ5A 2FFBA 1W4AA 1SXJC 1J8YF 2ZRMA 4Q7JB 5E3HA 1COWD 3SJBA 1CJKC 1I4DD 4Q66C 4HZUA 3N5CA 3W90A 3K9GA 4LYHA 3UG7A 1IBRA 3AUXA 4B3XA 1TU3A 1JR6A 1MT0A 5EE5B 1NP6A 4RKEA 4A2QA 1RJ9A 2KI5A 3K1JA 4Q1AA 1VG1A 3A4LA 3C5HA 4G3XA 4PPQA 4C0LA 2RAPA 1D2MA 2LKDA 1Z2AA 4Q4LA 5E95A 4JLKA 5KNBA 2D74A 3K0SA 1LS1A 1OYYA 1XCGB 1RYHA 1XD2B 5CLQA 4ZCLA 4OK3A 3SR0A 1T5LA 2ZYVX 3A37A 5DI9A 1UBFA 1J99A 2ZIAA 3KKPA 3QF4B 5EXXA 4CYMA 5HZKA 3GLGB 2C99A 4QHSA 3Q85A 2F9LA 2KBEA 3AVOA 4HUQB 3ZQ6A 4L5BA 3SJZA 3VKHA 3JVUA 2FNAA 5E7IA 4NYJR 5EE1A 1G4UR 2VYFA 1GSIA 1ZIPA 3Q3JB 1JJ7A 4BLOA 1NNEA 4KO8A 4F91B 5FH9A 1VKJA 1GKYA 1ZD9A 4LPSA 4TYWA 4KVGA 1N6IA 2SHKA 2DWPA 5D3MA 2QORA 3FFBA 4U5XA 2XEXA 1W36C 2JLQA 1S2MA 3AV0B 3BAFA 2QMOA 4LC1A 2AFHE 2VIIA 3KZ1E 5FOXA 1G21E 1P9RA 2NQ2C 4Q9IA 3EC1A 2ZS9A 2AWNA 3WRYC 1RE0A 2VP5A 4JVNA 1AS2A 1XEWY 1ZNWA 5JZVA 3U60B 1P2SA 3BFVA 2XSZD 3NKVA 4LX0A 2IXEA 4LV5B 1TQ4A 2VH5R 1CTQA 1QHXA 1LF5A 3PCRB 3GJ5A 3HPRA 3GFPA 2YOGA 4AG6A 3V4FA 4A8JA 4EQ6B 5F9HA 1XZQA 4BEJA 1XXHA 3FOZA 3AVQA 5JHGB 4OQXA 2D2FA 3LV8A 3T34A 4G01B 3QF7A 5CDFE 2H18A 3KUDA 1YZGA 4US0R 2QENA 1F3OA 3A1VA 4MYUA 5A5GA 4LHXA 3HP1A 4PR0A 1E0AA 5FFMA 3P20A 2GESA 2XNDD 1U90A 1VYTA 3A1SA 3IIMA 1NIPA 2REBA 4D0LB 1LVGA 2NPIA 2RGCA 1WCV1 2WWYA 2ORVA 4GFDA 1GP2A 4BRWA 2J59A 4WXRA 5ANRB 2GBLC 1OT3A 1IQPA 1M34E 4J0QA 3AKCA 4ARZB 2I3BA 3LFUA 2QL6A 3RS2A 4IDPA 4BFUA 1KAOA 1QHYA 1G8PA 4Q21A 1TMKA 5FUVA 2A30A 2BDTA 4PXAA 2JGNA 4IDOA 2G9NA 3SS8A 4RSGA 5JSZA 1RZ3A 1OSNA 1G8FA 4QJ4A 2ZPTX 3DKPA 3D3QA 4NYIQ 1U0JA 3LQRA 1SKQA 4LYJA 1ELOA 1E2IA 3BFKA 4IXNA 1DAGA 1US8B 2IYYA 3K0EA 4TLCA 2QTFA 1XTKA 1Z6GA 4URYR 1FP6A 2WJVA 2GXSA 1JPNA 2A5FA 2GJKA 2OAP1 3VFDA 4PC2A 1GWNA 2ATVA 1H8ED 1L2TA 1NLYA 3QG1A 4B71A 2QP9X 1EGAA 1A2KC 1X6VA 1XTQA 2ZE6A 2C5LA 3FPAA 4JL8A 1BS1A 1UM8A 2CE2X 2G88A 5AUPB 5JECA 2GJ8A 4NMMA 1DE0A 3QKSB 2P5SA 1E98A 3U7HB 2OUKA 4V0LA 1RRPA 1AS0A 1CR4A 2ZAOA 3U6BA 3I8XA 2RH5A 2FZ4A 3C15C 3AVVA 1WP9A 2IHYA 2WWGA 3DOFA 4QJ3A 4YMWA 2A9KA 2FSHA 3Q9LA 3TAUA 3QKTA 1OW3B 4DWJA 2X2EA 3EPJA 4I99A 4UNSA 2ZJZA 4JT4A 2V3CC 3CPJB 1K5GA 2FF7A 1XDBA 3NH6A 1SVKA 2O8CB 1OFUX 3U3MA 5KYKA 2GJ9A 1ZU5A 3KQHA 1MV5A 1Z5ZA 2AX4A 2XOKA 1LNZA 5BN4A 1N25A 3VNUA 2PJRA 4OHZA 3L82B 4XJXA 3QEJA 3C4JA 4NONA 4D4JA 3P26A 2N42A 1EFTA 3THWB 4BLRA 4Z1MD 4KLNA 2OFOA 5EZ5A 1ZUNB 3U3KA 1P2VA 4C7OA 3EC2A 5EP4A 1ZINA 3D7MA 3EZ6A 2ZI3A 4JBYA 2X2FA 3N2IA 4PX9A 4DLRA 4HLCA 3W6PA 2AL7A 1S3SA 3HU3A 2PZGA 1YQTA 2ZSDA 3TMKA 5SZIA 2ZI5A 2J7KA 3KB1A 5JS7A 2GXAA 1G8GA 3HU2A 1OH5A 3LO5A 2BV3A 1PJRA 1MO4A 1E2QA 4O25A 3I62A 2J0SA 2P6NA 3GLIB 4NCKA 1TUEA 4G1UC 4LOAA 3GJ0A 4JT2A 4DLXA 4JVLA 4RD2A 4C0HA 1E2FA 1SGWA 1W36D 5AUOB 1HEIA 2XZPA 4QHYA 3OEED 4ESVA 4L4UA 4DCTA 5BN5A 3WBJA 4OQNA 4BEBA 3W5JA 5JWRA 4B3FX 2O8BA 2FSFA 2CBZA 2QTHA 2KSQA 1UKYA 2CVHA 1Y3AA 2VP4A 3EIEA 3W6OA 1MOZA 1JALA 4OJQA 1E1RD 2AFIE 1OHHA 1DTSA 2Z43A 4UJ3A 1JB1A 4FMDB 1N6PA 1W0JD 1E32A 2C04A 5GJWC 2IWRA 2A5DA 3HWSA 4H9GA 3GLFB 4JVSB 2GKSA 5E7MA 1A1VA 2IF0A 2GDJA 3HR7A 3QXXA 4Q4JB 3I8SA 4OQLA 4NPHA 1QG4A 1EG7A 2A3RA 3AF1A 4LJ9A 2O5VA 2VLIA 2AWOA 2I1VB 3UATA 4DLTA 3AVTA 5GVRA 3P1JA 4D4MA 2IYVA 2JASA 2NO1A 5EP2A 3QBVA 4KV9A 2QQ0A 4NDZA 1W36B 3C14C 5J4KA 3WMGA 2F43A 2XB4A 3B8HA 2L0XA 5KU1A 1X86B 3VAAA 3MAAC 3T15A 4DIEA 1R0ZA 4IXMA 2G0NA 2EFGA 1Z0AA 1KSGA 5CB8A 1XBTA 5J4VA 3DZDA 3AF3A 1KI6B 2W6ID 3AQ4A 4JKYA 3TSWA 3K53A 1FQKA 1YVDA 2CHGA 3EZ9A 3PITA 4B73A 3S1AA 4Q48A 3KFXA 4CT4B 3OIVA 2IYQA 1Q21A 1D2EA 4TYNA 4ILEA 5FPHA 3G0HA 1OXXK 4RFSA 1W48A 2ZI9A 1WRBA 3ZD7A 2GF9A 2KJQA 2ZRBA 3NEJA 1VG9B 3FWYA 5KOYA 1Q44A 5CJPA 5JI2E 3CRMA 3EX7C 1XTJA 4RZ3A 2YNMA 3B13B 2G3YA 1YJ5A 4HB4A 1YZLA 4M1TA 3SDZA 2EVWX 5ELXA 2H57A 2QI9C 1GNRA 3TUIC 1NMXA 2H92A 5CLLA 1OXSC 4PQRA 1U2RA 2QBYA 2DCUA 3E70C 3LX5A 4QBIA 4FCWA 2CCGA 3C41J 3P27A 5J40A 3I3SR 3D8BA 1OF1A 421PA 3ZJYA 1JQJC 3OF5A 1IJEA 1XPUA 4L16A 1JBKA 2FH5B 2ZTSA 3Q7PA 1WXQA 3K0FA 3NBZC 1SVLA 3Q7QA 1N5IA 4IOMA 1NBME 1KZGB 1ETUA 3T1TA 4B3DA 4LHVA 1KSHA 4TTQA 1QVAA 3OFND 2R65A 1OJLA 3B1WA 2WTUA 4TLBA 1AA9A 3X2SA 4TZ0A 1CR0A 1DAKA 2VA8A 1EFRA 2X19A 3SYLA 3VR1A 4C2TA 5FPYA 1GL9B 1A4RA 2WBLC 3MFYA 3LLUA 4ASUD 2XNSA 3WHKA 3DM9B 4JJKA 2JLYA 2VSOA 4LZZA 2KBFA 4D4LA 4JLPA 3UWKA 2KE5A 3CX8A 1WQ1R 5FL7D 1Z08A 4V02A 1XEXA 3JZAA 4R98A 3TUZC 1ZM2A 1WBBA 3QSYA 1OV4A 3KKNA 4QL3A 1F48A 2ZSBA 2H1LA 2J1LA 2Q9BA 2C77A 3ZVRA 1U8AA 5IF9A 1CXZA 1KI4A 1C9KA 1EX7A 2DWOA 4LHYA 2O0HA 2OV2A 2BBSA 2QGZA 1KI2A 1ESMA 4BASA 4WW0A 3RWMB 1QG2A 3M6AA 1DG3A 1F2TA 1YR6A 2AXPA 3FE2A 4YMTA 3Q72A 5JCPA 4IDHA 4QFMA 4D25A 1XPRA 4C0BA 2CEAA 4OL0A 1P2TA 2PT7A 2WZQA 3AH8A 2XB2A 2WIAA 1SKYB 1GM5A 4O2LA 1W5TA 4KITB 3U4QA 2ZI6A 3HR8A 1R8SA 2ANBA 1ODFA 4XTCS 1T8TA 3ZS9A 2CLDX 3TUJC 5DI3B 4EKDA 2GEDA 5DIFA 1NVVR 1I4LD 1Q1EA 3QPWA 5IK2D 1P60A 3WP1B 4XIGS 3QNUA 4MRVA 3THOA 5UKDA 1ZD8A 4XOIA 2O52A 1YZQA 1Z29A 2NO6A 3BOSA 4PHTA 3U3JA 4XWKA 3LVRE 5HR5A 1X1RA 5KSYA 3FHCB 1A2BA 3KQNA 4F93B 2E1RA 4DT1A 1E9BA 3SBEA 4MRNA 1ZNXA 3L2OB 4IFEA 1CRPA 3CNNA 4P0TA 2EWWA 1XJ0A 2OG2A 2X8AA 5DISB 1U94A 2IBMA 2N1BA 2EFHB 1ZYUA 4OHXA 4HUTA 4W7SA 2W0SA 1HA3A 3F8TA 2WKPA 4M1MA 4JYCA 4C0AC 4LBWA 1G7RA 2XJ4A 4BRUA 4ZIRA 1NMYA 1CJVC 2JJ2D 3FB4A 3QI2A 3IO5A 1ZU4A 1FNMA 1IN7A 3CWQA 3IUYA 1GNQA 1HH4A 5DN6D 2HUPA 4DLZA 4Z54A 3K0AA 1AGPA 3CIOA 2O0JA 4QBFA 3K09A 5AUNB 4ZDIA 2B7BA 3W9YA 4WOPA 5K8IA 1YZUA 4XD7A 3NC1C 2HLDD 2ZJAA 4ZV4A 3I4LA 2ZROA 1SXJA 3CRQA 2CK3D 3THXB 4NP6A 1E9FA 2IHBA 4YC7A 2F9MA 1XMIA 4LPKA 1OKKA 4X8HA 2GZHA 1G5PA 3V00A 1Z0IA 1OFIA 1KO4A 1VIYA 1LY1A 3AGQA 5FOSA 1VCIA 2DFNA 2YZ2A 1XNJA 1JQLB 2BBTA 2FSGA 3X1DA 3I32A 3NHAA 3THYB 1KHTA 3IO3A 4TSFD 3PUYA 3PIRA 3WXMA 1N6NA 1XFAA 4A4DA 2ZRIA 2YC4C 3IBYA 4EPRA 2ZRGA 3K8YA 5GJBA 3IHWA 1WDTA 4BZXA 4YQFA 2ZJYA 2JA1A 1E4VA 4GP6A 5E4FA 1ZBDA 2NMVA 4ZKEA 1VTKA 2F7SA 2ONKA 5B2ZA 1BOFA 3LW8A 1AS3A 1N5JA 2PEZA 5JHHB 1EXMA 5CYPA 3H1TA 3IPYA 2AD5A 4O3MA 5TB5A 1TQ6A 1XMJA 4HLUA 2ZU6A 1QHSA 2OXRA 2Q21A 4DUGD 3AVPA 3IEUA 2ZYUX 4LJ8A 4ZPXA 2RHMA 1XWIA 4QOSA 5IDVA 5J4YA 1YU9A 3AF0A 3BIFA 1AKYA 4GDFA 1XTIA 2RB4A 1OPXA 1U9IC 4GOXA 2OHFA 2OFXA 3GLFE 2WM9B 4V0MA 4BWYA 5CITA 1CR2A 2VHCA 3ADKA 4LBVA 2NG1A 1QVRA 4OYHA 2PH1A 2KWIA 1LB1B 3OEHA 4S35A 2V1XA 1FZQA 2IEYA 2RGBA 5KNDA 2OBLA 2XXAA 4IVRA 3ZS8A 3DMNA 2NO0A 1Z47A 5B58C 3TAHA 1XJCA 4A92A 1ANKA 2VTKA 4IOLA 4MRPA 1BMFD 5DSZA 5K8UA 1XJQA 4KSBA 2QNRA 5DE3A 2BJVA 2F1HA 1DO2A 4NU0A 1XPOA 4NKRA 4KFRA 5FTMA 4I1UA 3KB2A 4QC2A 1IXRC 2AKAB 1JR3A 1RW4A 1W5SA 2VHTA 4EPXA 2ZM5A 1ZCAA 4M4SA 4AK9A 4CEHB 4AKIA 4CVNA 4LV8B 2D3WA 1KMHA 3GD7A 5KPJA 1VCOA 4MRSA 4QGHA 1VIAA 3LXRA 3A4NA 4GOKA 2QM8A 5TARA 3T1QA 4M0LA 4G5OA 4QBHA 3ZDQA 1GFIA 3GFOA 4MYHA 4A82A 1VDZA 3ZZ0A 1F6BA 1XZPA 4HAZA 2O8FA 1L7VC 1Q0UA 5J4LA 3QENA 1W0KA 3E5HA 1F60A 1RKBA 3DM5A 3NHBA 4FMBB 2JIZA 5DHFA 4DCNA 2WSSD 3CZQA 1R10A 4Q9KA 1CJTC 4Q4AA 3TR0A 2GVDC 4DBLC 2XJ9A 1NY5A 2WJYA 3QKRB 1NI3A 1G41A 1E2PA 1SVMA 4MQBA 1V5WA 3QXSA 3QPVA 4MGYR 2BOVA 3ND9A 1M2OB 2QSZA 2F1JA 2YC2C 2BMEA 3VNVA 3LRPA 4RD6A 4M1SA 3I61A 2CNWD 4AKEA 3U7FB 2FX3A 1HQCA 3T35A 1JAHA 3P4XA 3PG5A 3EASA 1UBEA 1II9A 2DFTA 2J0QA 1ZM4A 1NF3A 3OAAA 4PQFA 2HYIC 2J41A 3CRRA 4LSGA 5D3QA 1LFDB 2PX3A 4KVAA 1E2HA 4MUBA 2ZJ8A 1E4YA 3CBQA 2TMKA 4TMWA 4QM6A 1E79D 3EPHA 1OYWA 2VP0A 3LW7A 1YE8A 3NXSA 3GJ4A 4QJ5A 2RGXA 2X1VA 4WZ6A 2BHRA 3U44B 4BQSA 4DCVA 5CIQA 3B5JA 4YDSA 1GNPA 3V9PA 2F55A 1DADA 4EPVA 2XAUA 3IPXA 4CF7A 1KMQA 3AKYA 5L3QA 3IEVA 2WIBA 4RZXA 1CEEA 4WXPA 2QAGC 4B2LA 1ZUHA 1E2MA 2GEVA 2F1IA 4LDJA 3WNBA 3NBFA 1VPLA 2QROA 3UMSA 4D4KA 2DB3A 2HV8A 5A4JA 3CF6R 3RRNA 1ZM9A 2J5XA 3BK7A 2NPFA 3ZD6A 5F98A 1E1QA 2C96A 4OKSA 4RD0A 4Z51A 4BPBA 4DHEA 1NBMD 2VBCA 2Q9AA 1NN3A 3VX4A 4K46A 3ZVMA 4PAQA 1UKEA 1VHTA 1F2UA 1T0JB 3CKLA 3FTQA 3HYTA 2KB0A 1EWQA 1E94E 2QZ4A 5FPTA 5EP3A 2F1RA 1DEKA 1SKYE 4LGMA 3ND8A 4TLDA 4DLVA 3BB1A 3HYRA 4IDNA 3CWZA 4IOKA 2GHIA 4IRUB 4V03A 5FBRB 2QA5A 2HJGA 4ZI3A 3RS3A 3KJIA 3N70A 2G6BA 3NWJA 4UNQA 3VR5A 1KK3A 3B6EA 3ONWA 3GJ8A 4DLYA 4ZKDA 3I73A 4D6PA 4OK6A 4TN1A 3A4MA 2UVQA 2ZS8A 4YLGA 2P6UA 2WAXA 4ZCMA 1P6XA 4EJSB 1S1CA 2JJ8A 4ABYA 2LKCA 5KDLA 4B2PA 3FVQA 5HE9A 1H65A 1DELA 1EFCA 4S2EA 1G6OA 1Q20A 1XMVA 3QG5A 2WJHA 1RRGA 2ZSFA 4Q9JA 1T3SA 3K0CA 1NMZA 4JMPA 4M9XA 2ZVQX 3VU9B 1N0VC 2G83A 4NYMQ 3DVLA 1JEDA 2FPKA 2AK3A 1MABB 5FTNA 3X1YA 1T4GA 3W3ZB 3TGPA 1ZVQA 2VHUA 5HZHA 1XU4A 4Q4HA 4PFSA 4CIDA 3BWDD 3I92A 4A9AA 1Q57A 3ZIAD 1CJMA 2ORIA 4JZKA 1AIPA 1ZRHA 4TYQA 2BC9A 5L3RA 4BZPA 4DDUA 2JJ2A 2Q3MA 3NBXX 3BRWD 1N0UA 2Q3HA 4LJ7A 2YOFA 3LQQA 2V7QA 3T1VA 1IN4A 3TQCA 1BH2A 4QKQA 1U0LA 2BMFA 1N6RA 5KO2A 3JZMA 5CIWA 1AZTA 1TF7A 2ZRFA 1O87A 1N2CE 5HE8A 5F3WB 3CH4B 4BLSA 2MSCB 1XXHE 2GXQA 4B33A 3BH0A 4TL9A 5LB4A 1RVDA 3PXGA 1GZSA 5JRJA 2ZS7A 3WYFA 1G7SA 3QUSA 2A5YB 2D2EA 2PZFA 1DARA 4GOJA 4HB3A 2DFLA 2FPMA 3AVXA 1W49A 1XTSA 5KDOA 3ICQB 4HAUA 1MO5A 1QHHB 3CONA 1QF9A 1NKSA 4Q18A 2R6GA 3QXJA 2W6JD 3M4YA 3OE7D 4B3GA 1E69A 3SU8A 1G64A 3U7GA 2QY9A 1EK0A 3TR5A 1GKIA 2O8DA 4HSEA 2HXYA 2CLCX 4UKDA 5J47A 5SZHB 3GLHA 2VP9A 5H8WA 1P5ZB 1I2DA 2ONJA 3B78A 3RRYA 3ZQJA 4JL5A 4LJ5A 4OHVA 2PMKA 4H1VA 1NG9A 5AR1A 1CIPA 2UZIR 3NG1A 4TTPA 1KSFX 4URVR 1KKMA 1II8B 2FMXA 4BECA 3MRSA 5L3SA 2W2XA 4DEYA 4IKEA 2GK6A 3AKEA 2V1UA 1R0XA 1KO5A 2R44A 4TT3A 3ZVNA 1XCPA 1Q3HA 2ANCA 3T12A 4DRZA 1SVWA 5C4MA 2ZRAA 1P4SA 4GBMA 4P4SA 2DWQA 1RPZA 2OCPA 2PX0A 2BMJA 5FTJA 1CULC 4RVCA 1ESNA 2H5EA 4JLJA 2W83A 5CK4A 1TAGA 2MMGA 1UPTA 2H8KA 4LV6A 4M1KA 4N0EA 2QMHA 5LB2A 1SULA 3H84A 1E0KA 5JRZA 1N6HA 4BLTA 1GRQA 2OCAA 3UMFA 4YXWD 2RGNA 4M21A 2ZR9A 4PAMA 4U7DA 1GVNB 4M1WA 3O8BA 1J7KA 1ZM7A 3UKDA 1FX0B 1MH1A 2Z4SA 4KLZA 2IS6A 4II7A 1OH7A 2PCLA 2YKGA 4GNKA 1ZUIA 2ZANA 1FQJA 1JJVA 1C1YA 3DL0A 1QHGA 4WVFA 1DS6A 1VMAA 5CB6A 2FA9A 5GJCA 2CL0X 2EFDB 2QEQA 1FUKA 5EZ6B 3RHFA 2ZE5A 3BD9A 4B44A 4A2PA 1OH6A 5DYIA 3AP1A 5C4GB 4OJKA 2JDID 3KDSE 2YHSA 3RS0A 4TMKA 5EXPA 3SBDA 2WPDD 3KFVA 1KY2A 2BBOA 3B7GA 3GP8A 5K8LA 4TQUS 4A0FA 2WWFA 1NY6A 4URXR 3U61B 1R8QA 4JS0A 1R7RA 2QAGB 2PLRA 4NCHA 2O8EA 4MKGA 1OIWA 4CW7A 2FN4A 2OBNA 2ZUBA 5FI0B 1NSTA 4HAYA 2YWFA 4FINA 4AKHA 1M7BA 1R6BX 2CJWB 4B34A 3OESA 4M1YA 1KI1A 2BCJQ 3EPLA 3NDBB 1G8HA 1NSFA 2GF0A 1PV4A 2JJ1D 1G9XA 1XX6A 2QTVB 4W5HA 4E03A 2OCYC 5G3ZA 3EZFA 2DFKB 1XD8A 4C4PA 3GPLA 3IIJA 1FFHA 4Q03A 5HKKD 1II0A 1Q3TA 4A8JC 1XEFA 2CNWA 2C95A 2OESA 4X8MA 2LWIA 1XD2A 2ZRNA 4G0NA 4L15A 4DB2A 1T8UA 3WYAA 4QGFA 4C0SA 3V4RA 3ICEA 2EQBA 3A8TA 1R0WA 3QF4A 3GLGA 2XTMA 1XEWX 5GVSA 4EUNA 4HUQA 3CR7A 5JI3E 4DVGA 1PLJA 3TNFA 3A1TA 3AEZA 4NTZA 1E2GA 1AM4D 5HTKA 1KK2A 1CBUA 8OHMA 4HEJA 3L8ZA 3OIWA 3PENA 4PQYA 1COWA 3HPQA 5AJXA 3SEAA 1HT1E 3EA0A 1GRNA 1HE8B 4ZDJA 3PUZA 1YZTA 1Z6YA 2WKRA 5SZKB 3TQFA 1RRCA 2BIFA 3KUCA 1ZC3A 1UFQA 1E9CA 2BJWA 5FPKA 5TV2A 3C5CA 1CLUA 3W5IA 2YWGA 1S0UA 2B8TA 4KU4A 1W46A 5L3VA 1GILA 2GEUA 4KI0A 3RS7A 2ZE8A 4N3NA 3CLVA 2IWHA 2IUTA 4BZQA 4EQ6A 5C2JB 3A36A 3MUFA 1D9ZA 1H8HD 1GL6A 2IS1A 4E07A 2J0UB 5AWFC 2YV5A 3AKDA 5KSZA 3R8FA 1IXZA 1O3YA 1FL9A 5E7JA 3B1VA 2VO1A 4ACBA 2VSXA 3LLMA 4V0OA 3B1ZA 1YZNA 2W2VA 3NIBA 3OZXA 4JSYA 3ZGXA 4RJLA 3W6NA 5M04A 2JATA 3EW9A 3SZRA 2C9YA 2CE7A 5TMPA 5FI1B 3UK6A 4ITRC 3ZVLA 5DYGA 4EFMA 5JEEA 2HF8A 2Z83A 4OK5A 4HLDA 2REXB 4OI2A 2WKQA 1NIJA 2P3SA 4GZLA 1G3MA 3MWJA 2IX3A 2FE4A 1KDPA 3PFIA 1G3UA 2N46A 4B74A 2OM2A 2XSZA 3FYHA 4ARZA 4FD2A 1G8YA 3VTKA 1FUUA 1E2DA 3TLXA 5KPDA 3FKSD 4G5SA 2ZVPX 1GL7A 1UDWA 2YINC 4LUCA 2CXXA 2BM0A 1TADA 3U5ZB 1U8YA 2C9CA 2ZYTX 5TDHA 4D2IA 2JLWA 1V43A 3UPUA 2GCOB 5FOTA 1Z8FA 3FKQA 6Q21A 1RC8A 1OB2A 2DPXA 1P62B 2DR3A 3FDIA 3QOFA 2OXCA 3IGFA 4NYJQ 4RY2A 4R9UC 1US8A 3QVVA 1D5CA 5EP1A 4CEIB 1EFHA 2GILA 4ESHA 3UXMA 4B6FA 1CF4A 1IONA 2HT1A 2FV8A 2XNDA 1KGDA 3PR1A 2OBMA 2VP2A 4XSHA 1XP8A 1IN8A 2G0TA 4L8GA 2PMDA 2QP3A 4Q7KA 3KTAB 5CK5A 3SYNA 1MRNA 1W2GA 3E2IA 3EIHA 4LYFA 4DJTA 1Q1BA 1RRFA 1TQDA 2VHJA 4UQOA 3BB3A 3KKQA 5G40A 4CEJB 3PUVA 1S3GA 4LHWA 3QKSA 3CZPA 4PHGA 4TYYA 4EFNA 1VCNA 1OIXA 3AP3A 2WVJA 1E3MA 3R7WB 4Q1EA 4I1SA 4GMDA 1XRJA 3F0TA 4QNRA 5KSPA 2XITA 3BERA 4A0RA 1U81A 3CX7A 2ZR0A 2D4HA 2IA5A 4IW3B 3KXLA 2XTZA 4A0HA 1Z07A 5KSOA 2V9PA 2F3TA 4HZUB 3L43A 2ZYWX 1BYIA 2QP4A 2OE2A 2P0EA 2AKYA 4MUAA 4NCJA 1KK1A 3TE6A 1ZIOA 1Q22A 5H68A 1RJ9B 3CF0A 2O8CA 5DO9A 1NLFA 4LJ6A 2DHRA 1IN5A 1F5NA 4M1OA 1H8EA 2IC5A 2DYKA 1UBGA 3VR4A 3ADDA 3A1WA 2P65A 3RYTC 2BCGY 4QXAA 3THWA 1JPJA 2VL7A 5JWHA 4MH0R 2Z6VA 4NYIR 2AK2A 3EZ2A 3VR6A 1NRJB 3Q5DA 5KNCA 2ODNA 4D26A 2WWIA 1KI8A 4TMXA 4AI6A 2AD1A 3LNCA 5GADl 5LBIA 4MGIR 2XGJA 1KTVA 4B3CA 1G19A 1JI0A 3RNLA 3TW4A 2IUSA 3SE0A 2JLUA 5D3MB 1HE1C 3PQCA 3GLIA 1TEXA 4UNPA 1VECA 2XX3A 4YONB 521PA 2ODEA 3ADCA 1IJFA 4W5WA 1GTVA 1HT2E 2Z4RA 5SZJA 3AVYA 2A78A 2QMUA 1GRRA 2IK8A 1MO6A 3BC1A 1R4AA 2C98A 3K9NA 4UXHA 4WBSA 3SI7A 4EJSC 2ZXUA 1E9AA 4PO1A 1G7TA 3SFVA 3VQTA 4A8JB 1M6NA 5H1YA 4Z1MA 4Z8XA 3L0IB 1P72A 1XXHB 3AUYA 4Q5IA 2JLZA 2ZJBA 4BGDA 2JLSA 4K81B 4G5RA 4HB2A 2YWHA 4HYYA 4LBZA 3CO5A 4F38A 3GEEA 2FFQA 5JMTA 2WMOB 3GLFA 2IS2A 3TVTA 4Y0VA 4Q4JA 1Q1QA 2FGKA 3N2EA 4H1UA 4BFZA 3EWSA 5EXTA 3L0PA 3NBYC 3QKUA 1J70A 2CVFA 4EPTA 3R9WA 2R62A 4DSTA 4FWTA 4G5QA 4A0GA 3CNLA 3QIAA 2Q6TA 2WOJA 1KZ7B 4HI0E 2OEPA 4I81A 4OHWA 1AQUA 3KJEA 3OEEA 3IKJA 3QBTA 3GJ6A 4F7WA 1SVSA 4WZBE 1PUIA 4BFTA 4B6EA 2ZRDA 1ONBA 1Z2CA 1KI6A 1X3SA 1AQYA 2FWRA 2D62A 2WAYA 2WJGA 1E9SA 2G77B 3OIYA 4TYPA 2O0KA 5JJIA 3R9XA 1GKUB 1E1RA 3GCGA 3CB4A 5JSZB 2BWJA 1MKYA 1KSJA 2QG6A 2NO9A 2ZSAA 1KNXA 1YHNA 4AURA 1W0JA 1NJFA 1S9HA 3WMFA 4ZCIA 4Q9LA 5CYOA 1P2UA 3SHFA 3RRMA 1J2JA 4LJYA 3R8CA 2R2AA 3DKVA 3UIEA 4Q9HA 5DNYB 2XOKD 2ERYA 4U00A 2J45A 4US1R 4FN5A 3ZH9B 4MDEA 4BFXA 1CRQA 3TBKA 2QPAA 3AB3A 3BJIC 1Z0DA 3HJNA 3UWOA 3ZYCA 5JFGA 3MG9A 2J46A 3EWAA 3SC3A 2FEMA 2I1QA 1Z06A 2GBLA 1LS6A 2W6IA 4HAWA 3BH7A 1CS4C 4V0ME 4TL8A 5G3YA 3MGCA 4LJ4A 2GNOA 2J3EA 2GZAA 4KBGA 3RRZA 3SOPA 5FUYA 1WA5A 3GJ7A 5FBWB 3LBNA 5C46F 1D6JA 1M1YE 3QE0A 4D80A 1TNDA 1FW6A 3ASYA 1X1SA 4LK2A 1YR9A 3UMRA 1AZSC 1PZNA 3SHWA 1JXOA 2VF7A 1UKZA 3QJYA
chains in the Genus database with same CATH superfamily
4OI4A 1LLFA 5IJ9A 2W6QA 3SC2B 3Q3IA 1GITA 4GLLA 3X2EA 3TS1A 1QRSA 2LCIA 3D0QA 3HUDA 4QOIA 4FI3C 1Y89A 5DNVA 1DEAA 1GRCA 4C03A 2BY4A 2IXTA 4MYCA 1WAMA 3D43A 5BN4B 3BTOA 1N6KA 1MENA 4HQNA 4AJ4A 1DBPA 4IV8A 4DR2B 2JLRA 4KQFA 4HS4A 4NQZA 1T6BY 3N0TA 1VMDA 3K9FC 3UJ8A 1X0VA 4RQBA 4PHFA 2G5TA 3ENKA 4O4LF 3TXYA 4C7OB 3AX6A 3EGEA 1AD2A 2B5VA 4TKZA 3LKVA 3FMVA 4A5OA 5BNTA 1NFRA 1TF5A 3VAYA 1OHHD 5JVDF 1BN6A 2B4AA 1DDIA 1Y8QA 2K5UA 5EHIA 3U9TA 3U19A 1APBA 4NARA 4BJ6A 3OIUA 2W4IA 1QKIA 1F7UA 2QLTA 1VI2A 3IYLW 1KEPA 3PVCA 2W2PA 4NBTA 1UQTA 5JY1A 3PB3A 3EXAA 1LJUA 5BWBA 3HJCA 1C1DA 4WJKB 3S40A 1G38A 5DN9A 2FEXA 4Q3OA 2RHLA 3D7SA 2RGEA 3AVWA 4GF5A 4IJVA 3SHVA 4PIPA 1BWPA 4FOLA 2XKAA 5KYUA 4ETIA 1RIIA 3RSLA 2QR3A 4J2HA 3ZHOA 2D1YA 1WLSA 1S8FA 5DBFA 1TZJA 2Y67A 3IKLA 5ALZA 4LFCB 4C29A 2XB8A 3WB1A 2C78A 3W2IA 4YMVA 1GGFA 1O57A 2DPHA 4BUJA 1QS0B 1TLLA 2R3SA 2Y1WA 4WAUA 1W7AA 2I6QA 3EXFB 5BN5B 1N78A 1JXMA 4DJEC 1X39A 3R8XA 1P7VA 3I9OA 1XYGA 1B43A 1VM6A 2G7MC 3AP2A 3JAWB 3JTMA 4YPVA 3PFGA 1HLPA 1JEEA 2V74B 4DMGA 3WI7A 1CY0A 5DI3A 5BSFA 1I36A 2RHRA 2HDHA 1YCFA 5F9FA 3C1AA 3F90A 4N49A 1WXDA 1H9AA 3I2FA 3QPBA 4HDQB 3VZQA 4CKEB 3IIIA 4NE7A 4TXLA 2AFHA 5DTMA 2GARA 3EFOA 5DYTA 3HY4A 1M76A 3KLMX 4GQAA 4TS9A 2WIFA 1GZVA 4X6YA 1Q2UA 5F33A 1OLOA 3LJKA 4RD1A 5H3CA 4ZYUA 5I7EA 1IUKA 1XMOB 1GCUA 4H7PA 2UU9B 3ZI7A 4R2HA 3GRVA 4F6LA 2VF8A 2XRZA 2C4TA 3LDUA 3PU6A 3DZGA 2QQEA 1OB5A 5FBHA 2Q7DA 3EF0A 5KMGA 3UB2A 1FYVA 4K6CA 3RYIA 1J56A 3UANA 1QKJA 2HBYA 1SG6A 5K8TA 1FXSA 2HD4A 3ST7A 4Q9AA 5DLYA 1PZXA 5C5IA 2F1OA 4LTNA 3DE1X 2P2LA 2K87A 5EE0A 3DB2A 1DKNA 4GOMD 3RK0A 1WMDA 2KX7A 2B0CA 4IWYA 3UA4A 4PX2A 1RLJA 1I5OA 2BM8A 2JBWA 2XMRA 4MJ7A 2IE0A 4PZ9A 4XVRA 721PA 5KNDH 2EEPA 3HFJA 2FRDA 1J09A 1FP7A 5CG1A 3C87A 4OHOA 5BRJA 2HDNB 4HGYA 4IJKA 4R1UA 3O8CA 1FSZA 1JLHA 4IDGA 2FF5A 2XA9A 1TB4A 2X6RA 3OZIA 5ERGB 2BZGA 3SKVA 3GJXC 2DJ5A 3MSXA 5IK2A 3LBYA 4BKQA 3CUUA 4WBNA 4TTVA 3LH5A 2GO7A 3BSFA 2V0NA 2O4UX 1MG5A 3AFNA 1P75A 4D81A 1DO8A 5JCXA 3FLMA 1HUQA 4YJFB 3W5VA 3THXA 4FFPA 3R5SA 1T6YA 2GKOA 2HPHA 1GGEA 3CVJA 1FFBA 1SCDA 1GUFA 1F9AA 2BEVA 5REQB 3CXUA 2J09A 2Y6UA 3WHPA 1VB5A 2KLHA 3THYA 3KB8A 1KVQA 3FOBA 2A5GA 2H1VA 1PQ4A 3ER8A 5GAJA 2JFWA 5T4BA 5JAMA 3WGKA 4RLSA 3KR9A 4UAVA 3RU3A 2V6GA 3ENWA 3MB5A 4NX2A 1G3RA 1MJGM 3SYTA 4F4JA 1NYQA 3CRNA 5C18A 1VHLA 3O21A 4FGUA 3P2IA 2PRZA 1WUHS 3MHPA 4M99A 5KJ6A 2VEDA 1FRFS 2HHCA 3I72A 1U0SY 4DCGA 2FQQA 4O8ZA 2HSZA 3TD2A 4OH1A 5B6JA 4F0JA 5EE3A 2ISCA 1ZSYA 1UZNA 5LZ5A 4WBNF 2G76A 4FCCA 5CR9A 1NN5A 3KETA 2X23A 4B3BA 4DMCA 5ITSA 2XI4A 1KP2A 1Z0KA 2D54A 3ICWA 3DFUA 3ET5A 1OFVA 3C1TA 4ZO9A 4CT0A 3VR2A 4YTEA 5J5CA 4D96A 3BWMA 1MX1A 4QLAA 5KDDA 3P9SA 4NNJA 4IQGA 4OJMX 1GYPA 3U2QA 5JS6A 1MRSA 1ML4A 1RFLA 3JD3A 4OI0A 3O8DA 2VYVA 4FB5A 2QIOA 1G3IA 2ZRHA 1SZJG 1XEXB 1M7GA 1XU7A 1GHTA 2BEJA 3OJ0A 1DRVA 3F5SA 3H9GA 1NPTO 4CDGA 4JXJA 4Y6LA 4KRGA 1N7HA 4BP1A 3IKTA 2QX6A 4X8OA 1GUYA 2Q6VA 2W7TA 2XLCA 4GKVA 4ML3A 2AFRA 4RJKA 4DV5B 4GXRA 1FDUA 1J5XA 5EKDA 2OPHA 5IW8A 5B6PA 4W5JA 3C6YA 4WXEA 2OCBA 3AVUA 2XQGA 3EGCA 4FDVA 2QZPA 4QG7A 5EJ4A 3UPTA 1Y3BE 4E09A 2VS1A 4NNPA 4PSKA 4XQCA 2C5GA 3JYOA 3CLKA 3FNQA 3SJAA 1EVYA 4BMXA 3I42A 3T1YB 3IQZA 4YMGA 4Z3OA 2X2PA 4ZA2A 4MA0A 4ZVLA 2V0CA 2NTYC 1S9DA 3SS9X 3OT5A 1STOA 3F2VA 3KP1A 3PEUA 5KHAA 1RE1A 1U7UA 4PRYA 1JU4A 1RZRD 4YI5A 2H9IA 2XUZA 1RXUA 3HC7A 3LCJA 2C0CA 2B4TO 4U6SA 5KX5A 4CEHA 1D4OA 1DG1G 2ZJ1A 5CB4B 4KFTA 1E0JA 3WKBA 3W2FA 4TWRA 4JCOA 3U4QB 5EY5B 3O83A 1ULBA 2B8EA 2W2MA 3C3XA 1DAHA 3DAGA 1OGJA 3WL7A 4LF8B 1B1CA 1IBKB 3HCOA 1XPJA 5SY9A 4C04A 4EY5A 1QBKC 3A9UA 3BXEA 1J23A 4BAZA 1CU1A 2X3UA 1XQ1A 4DILA 4BX0A 1A8UA 1DX9A 4L1KA 1OVMA 4UBMA 3QW4B 4S3MA 3GLHE 4Y2XA 1ZM3A 2X77A 4MVJA 4OFBA 4Q02A 4FZ5A 3W9BA 5EJEA 5HS4A 1JLMA 2JLXA 4EDHA 1E9RA 3ZWCA 4E88A 3QKRA 5IXYA 4JT8A 1BMFA 1OR8A 1JU9A 2D3TA 3Q1KA 3JVDA 4OBXA 4H7IA 3R7AA 2CMKA 1ES9A 3U7EB 621PA 3WAJA 1S7CA 2DHEA 2EWVA 2JFHA 1UPCA 4GPTA 3CH5A 3T9AA 2FOLA 4B2IA 1IEQA 1QZUA 1U8TA 4QO8A 1M73E 1N77A 2LZ0A 5KJCA 4C0QC 4O4HB 1VGRA 2ES4A 4TV8F 4GG1A 3FIUA 2YOHA 4KN6A 2UXDB 1JHVA 1N2JA 4K0KB 2Q2QA 2GFIA 1ISJA 4LRWA 1ADJA 4NCIA 5LYYA 4D9GA 2X9QA 3FVTA 5EJFA 1IHUA 1XOIA 2CBXA 2FPLA 3IP7A 4A6XA 3GCDA 2JCYA 1N5DA 2XGSA 4B32A 3KRTA 4ZIRB 1WABA 5DHPA 4ALKA 2WU4A 2OYCA 3DKIA 1UM9B 4DLSA 3ANNA 1J9ZA 2PL5A 2R11A 1DC3A 2JA2A 3A4YA 4P34A 4QG3A 3CVVA 4I0WB 2E2WA 2W2LD 4PSAA 1JSLA 1AJEA 2GVNA 1EVZA 1PSZA 3L0ZA 3NIDB 2WSSA 1Q12A 3E18A 2M98A 2Q5CA 4H6VA 4I4LA 5EZSA 2X0FA 4MUGA 4ID9A 2QM7A 2AYZA 3FCCA 2NQTA 2OV8A 4X84A 5CH5A 5HDQA 4FEAA 5B1SA 3VR3A 1B6SA 4OXKA 4ZDWA 3TZKA 4AXBA 5HPYB 2IV7A 3MVEA 4MVJF 4LVUA 4KDFA 3T7KA 4B76A 1ENZA 1E7WA 1E3LA 2GF2A 2O14A 4UBOA 3T4PA 5EESA 3A7EA 4YREA 2X5JO 1UBUS 1TUIA 4Y2SA 2FMUA 3MELA 4FHGA 3AF4A 3I5XA 2DLNA 4NXNB 3WAGA 3TNLA 4QDKA 2FAXA 1HYHA 4FFVA 5E1DA 1ADYA 1PFVA 2JW5A 4DKXA 3UY4A 4PINA 1LPAB 1EQAA 4KWTA 2XT9A 4REOA 1RSZA 4ZOLA 1SKBA 2DR0A 2P4QA 4EFKA 3RC8A 2ZU0C 1P1KA 5KHOC 4JLBA 4PZLA 1SIWA 5KNDD 1BA3A 1XZEA 2FN9A 2ZYHA 1Y1KE 1DAFA 3IUNA 5IZ4A 4N5MA 1XELA 2OHVA 4F2PA 4P81A 1T3TA 3N2GB 4IV5A 4JSRA 1COZA 3B3FA 4EG4A 2AN3A 1E79A 4QZVA 2RMKA 3GMSA 2IYOA 4RE5A 3JZDA 5A03A 1T29A 4Y18A 1RACA 4QQRA 4JITA 3QBEA 2P35A 1NVWQ 4FYYA 2ZJ2A 4WTOA 4ZOAA 1TDJA 5J2UB 3BF7A 5K3EA 4MQFA 2DPGA 1LX6A 3LHDA 1JR3D 4DSAA 2YMQA 3OA2A 4JB8A 4MKRA 2H9YA 5BXQC 3LZCA 1XJWA 2VWPA 3MMSA 2PGLA 4NBKA 1L5HA 2APJA 2A7QA 3OZAA 2ZBGA 1PT7A 1OFGA 1K9VF 2HLNA 4X1OA 2AC7A 4K8OA 5LLDA 4BWFB 1C3OB 2HSDA 3MTIA 1IXSB 3FWNA 3V8PA 3QI7A 5CEJA 1G18A 5GJVC 1Y3FE 1JKFA 4U8HA 5ETJA 1M1YB 3K31A 3E5NA 3KVNA 3M1LA 4O1MA 5AJVB 5DMXA 3SQOA 1NBMA 3BFXA 3DYBA 4EITA 1MC4A 1MXFA 3L3BA 1IWOA 1M72A 2JK1A 4MLPA 1UOQA 4MWBA 3HY6A 4RCYA 1W94A 3DBOB 1CE8B 5DLEA 5ADHA 2P8JA 1DINA 4QOJA 1NN1A 5D5QA 2RBEA 2XDAA 1N9KA 2OMKA 4XAQA 2JHCA 5BSKA 3L4BA 4LCJA 4URWR 2NUBA 4K6HA 3J81k 4R8RA 4CCAA 1N8KA 4FE3A 4PZUA 4RDIA 3M82A 3NOVA 1WMAA 2DUJA 3SXJA 3IA2A 1NVMB 2XVAA 3I2YX 3WP0A 4URHA 1YA8A 4NZPA 4B6GA 1MQ9A 1IBMB 1W2HA 2GXUA 1RP1A 3DT6A 3EGDA 4LC0A 4LY9A 4BO1A 4B81A 5ALLA 4BE9A 4CR8A 2RKWA 1EWTA 1MA0A 5ELMA 1FUYB 3DNPA 4ZVOA 3N0RA 3DE7X 4DPMA 4EA9A 3F9IA 3SWWA 4HDNA 3ZDBA 4J03A 5K8JB 1AUQA 1CQJB 2EKBA 3RVKA 1KOGA 1T9HA 3OAAD 5JC8A 4KZKA 3U62A 4RZSA 2QE7A 4ZK2A 1LTHR 3MB8A 3K0KA 1QRTA 2QN6A 4K9DA 2ZE7A 3LY5A 5G41A 5JE8A 1YQ9A 5IDYA 3KOMA 5L6MB 1U9IA 2BUAA 2W93A 4I6JA 4K9QA 3CW9A 1NBHA 1KQFA 4CMAA 1I3NA 2FR8A 1ZD1A 2EBFX 4P7BA 3L7CA 5DZSA 3KSZO 2AN9A 1SBQA 1W85B 3LM8A 1M6HA 2EV9A 2YHBA 2RK4A 3JVEA 1Y4AE 3NHKA 3PC3A 3PGJA 4QELA 3D2LA 3CTPA 4TOIA 4Q4AB 3T3MB 3VOTA 4BMSA 1E0SA 1PUXA 1ISRA 1WXFA 1XDZA 2PWYA 2ODWA 2YQZA 1AK2A 3ASZA 3E3AA 1NDUA 4GYJA 2I4IA 4KFUA 2BEWA 1F5SA 5DEOA 2IDJA 3ZTWA 4JBNA 3MQFA 4OGFA 2ZRJA 3W05A 4D3SA 4F84A 4K9OA 1WOMA 4YNBA 1A98A 1T8RA 2CLHB 2OECA 5HM6A 2HH9A 2X4GA 3AIKA 1HDCA 1WB9A 3ZXXA 3GR6A 4IVQA 2J3DA 1QOPB 4RSHA 8ATCA 2ATEA 2CYBA 1L9KA 2FPGB 3KBOA 1OC2A 4FPXA 1IBSA 1ZP6A 4HMQA 3WYCA 5JBQA 1ATZA 4KWCA 2ORWA 5JPIA 2WQ7A 3RUDA 3VSBA 2GB4A 2QMYA 3L7IA 4H31A 1QIMA 2FFHA 2FPPA 4Q39A 3KTOA 3VDMA 4LC9A 2FETA 1M8PA 1H2FA 1Y5RA 2HXSA 3ETJA 3GJ3A 1XZGA 3R3XA 4P7FA 4WA7A 2NSJA 2VA9A 4ZT3A 4XX0B 5DB4A 2ODBA 4ZAGA 4D7AA 1RWXA 2QD1A 1D7OA 2RGGA 4ZDKA 1A9XB 5FNZA 1KTIA 3TN7A 3CM0A 2EW2A 1ZGBA 3K2EA 4RVSA 1A5ZA 3ZLUA 1NL3A 1W19A 2ATXA 1GG2A 1J7JA 1DIRA 1U98A 2BKUA 2PIDA 3EHDA 4R8MA 3REFA 3WLLA 3LPAA 4FOPA 5C8VA 4EHLA 4GGPA 3QPUA 2GFHA 4D3YA 1L8QA 3TR6A 4D0RA 1BE6A 4OAPA 4M0DA 4EJ0A 4DCCA 3D6VA 4PSVA 4UJ5A 2DUUA 1R9JA 3RI3A 5ALKA 1WXIA 2P78A 1EWYA 1TJYA 4WZAE 1J33A 4N3CA 1B74A 1JHQA 1T2DA 4CF4A 3ABSB 2IYTA 2WW8A 4YMIA 4GPBA 2VF5X 4WVLA 3S27A 1T5BA 3H1BA 1E2LA 3N2LA 5I4IA 1VLZA 1MNAA 2HCJB 2Q3BA 1VE3A 5LYJA 3U5TA 1CS0A 2NZUG 3I64A 1KWKA 3P2MA 3UXHA 4MINA 1U7XA 1ULHA 3ZQUA 1XD9A 5HGXA 1OXUA 3IPAA 4BYGA 4EX6A 2UZ1A 4EZIA 1BW9A 1N6LA 1XZFA 2DHCA 3E9NA 5IVKA 4OUDA 1QHIA 3HO6A 2P7IA 3TD6A 2WTBA 3A28A 4UARA 2PYIA 1KJQA 1N3YA 1ODIA 2DBYA 3JVIA 4XSGA 3SQMA 4JU9A 4PLHA 3TKAA 1VL5A 1ZW6A 1GUAA 3EHEA 3QTLA 1ZJ4A 3FUTA 4DLAA 5F5NA 1KKLA 1HURA 5KOHA 4P8RA 5CFPA 3FKJA 121PA 5H70A 3ZEIA 5CLGA 1MJ5A 4CLEA 2VSFA 1Y81A 2FDXA 2LIVA 1REQA 3PQ5A 3MT0A 3RFXA 4B35A 4F8YA 1MO3A 2IPNA 2O1EA 3D2CA 3R6TA 3LWNA 5EWJB 1HYQA 2J3HA 1JDVA 4ROSA 3RSGA 3VBEA 4BZWA 2IYUA 3N8KA 4D56A 1WY7A 4HWOA 3IC5A 4GR9A 3GN2A 1B14A 1GJRA 4LRQA 4G8DA 4DLWA 3OTHA 4J1QA 5L45A 3OTGA 3AG6A 5ULLA 4ALMA 3QLTA 4KYIB 3T3NA 4IGFA 3LC0A 3R0QA 1LK0A 4PO8A 4U8GA 1FFSA 3IQHX 5BWMA 1RI1A 1YVRA 5WRFA 3TTUA 3U4AA 3S2SA 5JBIA 1NJ2A 2MSDB 2FMHA 3MUNA 3A4IA 1P7PA 2VT2A 4O4IA 2J9YB 2AT1A 3DEAA 4JELA 4LA4A 3TI7A 1RWBA 4RAQA 1QM5A 5AK6A 4AP5A 4ZRNA 3RODA 2OYSA 1Y80A 4QPCA 3VSEA 4DWVA 4DB4A 3NCTA 3ZX5A 2YYZA 4DC0A 3TRDA 2WMNB 1U11A 1YIDA 1Q0SA 4QJBA 3OZFA 5F2EA 3ZE8A 4AD8A 2V7EA 2YNMC 3EVAA 5EMKA 3G2QA 1KO8A 3GG9A 1Y9EA 2QTVA 4C3ZA 1QCCA 3D4BA 1OFTA 1TRHA 2P4UA 3FH0A 5ILGA 2ZI7A 3E5MA 2GSDA 1N4AA 2F3RA 3X2FA 3RSHA 4E03A 2JDIA 3HBMA 1BGXT 1JH8A 2CCKA 3EW7A 3L79A 4DLNA 4E22A 2IOHA 2VPYA 3H86A 2UUBB 3I2KA 5CH8A 2V97A 3O1LA 3DHNA 4JFAA 2WWWA 1NE2A 1SUDA 3IBTA 3OQNA 3A9RA 2QTMA 4F11A 4AP9A 2C42A 3Q3CA 2VWGA 4AJ2A 2PWZA 1O89A 1GPMA 4ZN6A 4LBYA 4GOLD 4CL0A 2PL9A 3WX0A 1WIWA 2GAIA 2PEYA 3A32A 4NR0A 4DNXA 4EFLA 2GA8A 1NVXQ 5AJWA 5IM5A 3L4KA 4F5ZA 1GEGA 2FZLA 2XIQA 2GZDA 1QLWA 3CUTA 1T5IA 5K2MA 4DA7A 3FGNA 1RNLA 3AEUB 2I6SA 1U4SA 2AXNA 2PKRA 3GEGA 3OPVA 5ADWA 1DOAA 1XTPA 2XUJA 3VNRA 1DBRA 1YB5A 5LDGA 5D1NA 3OJOA 1J42A 4LXGA 3ICPA 5EC8A 3AETA 1XJ5A 3DOIA 4BE7B 4ZC1A 2BRUC 5TGTA 1BDIA 5HVNA 4OBEA 5J9FA 3GVXA 5HKKA 3AZOA 3G6WA 2PRSA 3HRHA 3S7ZA 3DPUA 5IUNC 1ZA1A 1A4IA 1DCMA 1C0LA 1KY3A 2Q27A 1DJLA 3ND5A 1F2VA 3PKIA 1NXSA 4FWIB 2WZCA 4QRDA 1ENYA 3VC1A 2O8DB 2NTVA 1FTWA 1H9CA 3EGVA 1JQAA 2QUIA 1PVOA 4R4JA 4P22A 2ILVA 1Y6JA 4WUTA 1E96A 4F7DA 4GE3A 5EJ6A 4FHCA 1H4SA 5CCDA 3GDFA 2GPYA 3UHPA 1MHPA 3JPYA 3D8TA 1VCHA 1YD7A 4Y0AA 3TZLA 3G82C 2JHFA 1T1GA 1KKUA 2QRPA 4OHKA 4MGZR 5EIOA 5FJJA 4KQ2A 3QMVA 1P2FA 4YJ3A 1PR2A 4JBWA 1WHTA 1K8ZB 2G09A 3HNPA 1TQ2A 1EFDN 1SQ5A 2FG7C 2O3SA 5B1IA 3H2JA 4FFLA 1RADA 1U2QA 2VDUE 3TKYA 4PGHA 5BT8A 2AHOA 2PT5A 3OZGA 1ZUWA 2IELA 4J1TC 3TW8B 3L0SA 3KUUA 4M98A 3GFRA 2IBTA 3JAKA 1Z83A 2B21A 4Z4IA 4V0NA 3F67A 1CY6A 2AG6A 4P3YA 4GRAA 3RIMA 3H0KA 3K0BA 2XAAA 2M6SA 5SYAA 1Q92A 1NXXA 5JIBA 3U26A 4NESA 3G17A 4IVNA 3CRVA 3V55A 3V7NA 2OQRA 1TZMA 3SYRA 4AXXA 1BKSB 1QIKA 4PQGA 1QIFA 2ARKA 1SO8A 1SA0A 5EJ2A 2YRFA 4Z4CA 4QDUA 2M6RA 5IPFA 3LT5A 1EM8B 3I39X 3VR6H 1ZKDA 5CDSA 3EJWA 3HCNA 3L77A 5BQXA 4OHYA 3VMFA 2WU1A 1JT9A 2B0JA 4R8VA 4TVBA 4X7MA 3EZ7A 1Z6AA 3U9SA 1DLJA 1V11B 1AV6A 4PFJA 1S8OA 3I9MA 1EUQA 2PO7A 4P0PB 5BOSA 1EA7A 2D06A 4UCXA 1R12A 1UBHS 2C3YA 3IBSA 3QEMA 1PJCA 4R81A 4AQYB 1H0KA 4BNMA 4GOOD 3WNZA 4HGRA 3UPDA 4PHHA 1NDQA 3GRYA 2IU6A 2A1IA 4M3NA 4YJ3F 2V4MA 4CM8A 4P31A 2HMAA 5FADA 1HSOA 1N32B 1AKVA 4TYMA 2Y1LA 1U3DA 2IHKA 3ILHA 1KZHA 1IUPA 2I7VA 1GY8A 4JZYA 2D5IA 1YOBA 3B7PA 4KXFB 4BX8A 4QICA 3IT2A 4RK4A 3GRAA 3NI2A 3QA3E 3EPPA 1Z34A 5C8XA 1SQGA 5B58T 4WACA 1E6CA 2V8OA 1ZLXA 4RD3A 1UMBA 3BKWA 4KGXA 3FKSA 3VZPA 3WBKA 5HRCA 2GAAA 4L2IA 3BL5A 3CNOA 2C61A 1UEIA 3A1UA 3D8NA 4EPWA 3NT5A 4NFHA 4OJNA 4YCMA 3BXFA 4UULA 1PJ4A 4H3SA 1JMKC 3K6JA 1HZZA 1SXJC 4ZPJA 4DHWA 3RCBA 2JGRA 3UMVA 5L4SA 2I6TA 1J8DA 1I4DD 3V1MA 2AYXA 1X1BA 3NHZA 1YGYA 2PBLA 3VGPA 3H8WA 4PVDA 1NHWA 3JYLA 1QFJA 5CLJA 1IBRA 3AUXA 2YZ7A 2Q3JA 4ISBA 4L5JA 2A1TR 1C1XA 2WTAA 3C85A 3FZEA 1TU3A 2XA2A 1G9SA 2QW8A 3GRCA 4EVRA 2VFAA 5EE5B 4E1AA 3C6QA 1B0AA 3DP9A 1LH0A 3K1JA 5HEKA 3GUUA 3GZNB 5CW2A 3RVDA 3D59A 4JDPA 1BFUA 4BVBA 2ZIGA 5DCWA 4Q4LA 4UAJA 4Q3CA 5E95A 2D74A 3RIGA 5KNBA 3DFZA 3MEQA 2AW5A 2VJPA 4HN2A 4RJTA 3L49A 3K0SA 1OYYA 3KM0A 4NU8X 2ZOSA 3SR0A 2ZYVX 1WZUA 1JQKA 3CX3A 1W73A 4I9FA 1DAPA 4C4RA 5HZKA 4QHSA 3LCRA 1H5QA 2V5VA 3SJZA 1LDMA 2X3FA 1GSIA 1ZIPA 3PLNA 3Q3JB 3QLEA 3HB0A 4ILKA 2BONA 1Q83A 4G1EB 3TL3A 3DYIA 3RYHA 4MB6A 2Q5EA 1R0LA 4KVGA 3T7RA 2DWPA 2JIDA 3VJMA 2VDNB 1GDTA 2QORA 1D6SA 4G23A 2GQ0A 3HQ4O 4H0NA 5C4IA 4W1RA 3H0EA 1FPQA 1O5OA 2JLQA 2YV4A 2FCRA 5IMSA 1W36C 3THSA 3KZ1E 3A3PA 2NQ2C 1NVFA 1Y1PA 3B9RA 4G5YA 3T7CA 5CVUA 3ZN2A 4QQKA 2QX4A 3BHJA 2IIPA 3EXG1 4FC7A 4FFBA 5CVJA 3WRYC 4RVGA 4JVNA 1XEWY 1G0NA 2IY8A 2X1HA 1F4PA 3H99A 3BFVA 3V6MA 3AJ9A 4LX0A 4ZRDA 3FYUC 4KQGA 1CTQA 4Y1EA 2KPOA 4BNFA 4UUQA 2WYHA 1VPDA 4XE5A 3GFPA 3IUJA 4FYMA 2JH8A 4KWIA 4WXYB 3SQNA 3W5DA 4LRXA 1T2FA 1Y7IA 1QWSA 1NW9B 3GFQA 3MXOA 4YBZA 4Q05A 1MPTA 4ZCTA 5CXUA 5KTPA 2RKBA 1N2SA 4GRDA 4QTXA 2EF0A 3MWDA 4E5KA 4HDRB 4R3WA 2I62A 5C8YA 3LPMA 5K6AC 4IQ4A 3W9SA 1OX4B 1Q6ZA 2YRWA 1C80A 1AKMA 2PA3A 3KUDA 4MW7A 3SM9A 3WSWA 1L7RA 4OX9Y 4BNUA 3PZRA 1VSUA 4MYUA 3AY0A 4R8LA 4MCIA 4FZ3A 5I7UA 2GHRA 3JQAB 4G0QA 4JLSA 5IX8A 4NPCA 4X44A 3ISVA 1EVQA 4BP3A 1U90A 4RPLA 3ZWAA 1ZHFA 4GEKA 3IQEA 5T3UA 1LVGA 3RWBA 1GPJA 4PN3A 2JGMA 2A0XA 1OBVA 5EXDA 3M4ZA 2WJWA 4BVEA 3F71A 1QTRA 3NHLA 1A97A 2GBLC 3QIVA 4IKPA 1GL3A 1M34E 1GKKA 1WVMA 2F9FA 3K1AB 4OGWA 4X54A 3UQYS 4AZ0B 4ED9A 5CYGA 1HMYA 4W9RA 3GPCA 1Q6YA 2QM3A 5D5PA 1KAOA 1QHYA 2SKDA 4OJTA 2HO5A 1UAGA 2Q5HA 3DSRA 3E1KA 3QX8A 3AZPA 2VYCA 2PPLA 4JCCA 4RV9A 3TLYA 5CLFA 5JNLA 4CHTA 2OV4A 1OXMA 3L1KA 7MDHA 1X7ZA 4ND4A 2B8JA 2D5LA 3J7TA 1SBIA 2R4QA 3QKWA 4WOKA 4ZYTA 1QR6A 4IDOA 2G9NA 3SS8A 5JSZA 1BDJA 3BREA 1K27A 5J1SB 2X8JA 4O5OA 5A3QA 1QV9A 2FW6A 2BFOA 4NYIQ 4FOSA 1NZJA 4YCNA 2WIDA 2ALJA 4RGQA 3ZD9A 3LKBA 4LYJA 3QMMA 2CUTA 4X6XA 2AN5A 3K0EA 4CFSA 2QTFA 1I3MA 3N0WA 4G9EA 1FP6A 2WJVA 3DO5A 2ZJ0A 3NNDA 4GW3A 3RVLA 2GXSA 3G1WA 7ABPA 1U8XX 4KPFC 2OAP1 3JWEA 4RK5A 5AHOA 1GFWA 1PR4A 1DTWB 1FU7A 3QG1A 3L6RA 1XTUA 3WMRA 3WB2A 2UYHA 1EGAA 3T7SA 3W8EA 3DE4X 3DMTA 3AUSA 3D6UA 3DEZA 3EB9A 3I34X 3FPAA 1PWYE 3E9RA 4LAFA 2QHXA 4TV9A 4X6UA 5F35A 3V2HA 1N7JA 1Z37A 2GZMA 3S55A 4B87A 5KQMA 1FIUA 2VTBB 1UBSB 2EJBA 3QKSB 4RF5A 3VJRA 4XYLA 3LFTA 1U28C 3U7HB 4I4NA 2OCXA 3VR6D 4OQYA 3FGZA 2OY0A 1FFCA 4YRCA 1AS0A 2NX2A 4BNJA 4XFKA 4DIBA 4MZXA 2FJ0A 2PZJA 5J43A 3I8XA 3U6BA 1V7ZA 3C15C 1PYGA 4LF4B 3RFCA 2L69A 3AVVA 2PS1A 4F4HA 2WWGA 4F8JA 4LFBB 2BMWA 3M6WA 4JI1B 4DG8A 4Z7OB 4YDRA 2TSYB 4C2AA 3A0UA 1ZS9A 4K9LA 3NCHA 3QKTA 2Y76A 3PFBA 2QI9F 4E7PA 3P0FA 1OMOA 3LZ6A 2NSYA 5DBOA 1C8KA 3F6SA 3CPJB 3FPGA 2AUMA 2IE8A 3NH6A 2I65A 3NOXA 4L6IA 3U3MA 2M9MA 1WSBA 1ZU5A 5KYKA 3E7FA 1MV5A 1Z5ZA 2GGSA 2CDCA 1A1SA 4P82A 4CKBB 5BN4A 5HKOA 4N5IX 4RAOA 4OHZA 2FPIB 4XJXA 4KXWA 4M0CA 1ZJWA 4D4JA 1ISIA 3ZNPA 1RLIA 1CNMA 1EFTA 1W52X 1NW8A 1EJ6A 2OFOA 5EZ5A 4FR0A 4KDRA 3SBXA 4C7OA 3FN4A 3CUVA 1TM2A 2I1LA 1NBIA 2XEDA 1TYZA 2AEFA 2W22A 2G36A 2ZI3A 3G1TA 3N2IA 4JBYA 1Y0BA 3KB6A 1H1DA 2AL7A 3C3AA 1EZZA 1PW7A 1YQTA 2PZGA 2X1LA 3TMKA 3UWDA 3MOIA 3BWEA 2ZI5A 4I36A 5SZIA 4YT4A 5JS7A 3O74A 2O6LA 1RABA 3SCZA 2VHEA 2BV3A 3LO5A 4ZHSA 1MO4A 1C4KA 1CG6A 2O3UA 2WF9A 4ID3A 2WQ6A 3K2IA 3FBGA 5A3SA 3QPDA 3DE0X 3D7KA 1YMVA 2WF5A 2VSQA 4ZJYA 1TUEA 3C3DA 4AP6A 3TMYA 4F04A 1KBZA 4KKVA 4ZREA 4HLNA 1W36D 3MTGA 3QEAZ 3OEED 3VZRA 1QS0A 3EWNA 1NQTA 2PE5A 2QLLA 3EXFA 5BN5A 4PYJA 1Y3CE 2FRDC 4RVFA 1H69A 1MU0A 2A59A 2F4NA 2F3SA 4RKQA 1ZPDA 4YJHB 3JAWA 4G63A 2F3PA 1OYVA 1E7RA 3L8DA 3RG2A 1OI2A 4PNPA 4UQPA 3R7NA 1FDWA 2VDOB 4GPAA 5J5VA 2A67A 4CPDA 5KKNB 3U48A 4CKEA 5B55A 2MOKA 1PCXA 1G0OA 1SH7A 3IT3A 3JPWA 2PM8A 1JB1A 1EP3B 1E1KA 2JAHA 3KVYA 3MTAA 5CFZA 1E32A 2C04A 2IYEA 3ILYA 5CFOA 1AZWA 3R75A 1QH9A 2QN1A 1V7PC 1UFRA 2L2QA 3MFQA 1VRWA 2ZUFA 1XRLA 2GAFA 2GDJA 2WZBA 3QXXA 1GZ7A 5B6IA 4LJ9A 3FTFA 1G2QA 1KS2A 3PR2B 2CJXA 3GI1A 3RV4A 1G4HA 2I1VB 4DLTA 3AVTA 5GVRA 4Y0NA 4D4MA 3B6ZA 3QBVA 4KV9A 1DQYA 4ZVSA 1OLXB 1E5VA 5DFAA 1W88B 3CE9A 3B8HA 2XB4A 3EDRA 2L0XA 2C7QA 1K0UA 2RJ3A 3MAAC 4DIEA 5B1DA 1R0ZA 3IEMA 3E05A 4YAIA 4TKLA 1KSGA 4HAIA 2ZIWB 3E22B 5COQA 3G9XA 4UTZA 2WNHA 4QPPA 2FPSA 1Z6PA 4R2MA 1SRQA 5K4GA 1BC5A 1C7FA 3PFWO 3PITA 5CM2Z 5LLTA 3D8RA 3IVCA 4DLLA 4Q48A 3P71T 2JI9A 4CT4B 3OIVA 4MS4B 1M0TA 2FKNA 2OHXA 4G6ZA 5DNDA 4KXUA 3ZR4B 5LZ9A 3U56A 5FPHA 4NEQA 3G0HA 3NJ8A 1O95A 2OCDA 1W48A 4OOEA 1CUIA 5K9ZA 1XK7A 1L4MA 2GF9A 1VLMA 2O2JA 1E5LA 4G89A 4YJFA 2ZRBA 5LC1A 2HU5A 5LA6B 1Z73A 1H2ZA 2VRCA 5L40A 3MK31 1FFXB 2JVIA 5FHRA 3BGIA 4RZ3A 1A96A 5REQA 3O73A 4HB4A 4G2NA 1YZLA 3QWFA 4M1TA 4RVHA 3SDZA 3C74A 2H57A 4IF6A 3LHFA 4CF3A 2VQFB 4POOA 4PLZA 3TCNA 3IELA 1E7SA 3TUIC 2G40A 4BJ1A 3RTEA 5CLLA 1OXSC 1YS2X 3MGBA 5FRDA 3V1KA 2C5FA 4PQRA 2W6MA 1YJXA 3V4OA 4E3WA 3G79A 2JARA 5LQCA 4LF7B 4M0KA 2CCGA 3C41J 2F00A 1DJMA 4I5FA 1GYRA 2P2NA 1OF1A 3MGKA 4B5KA 3GH1A 3IQIX 5IABA 1IJEA 4RVOA 1XPUA 1E3SA 1ZCJA 2Y4NA 4QYWA 2J0EA 3O1IC 4TZKA 5F52A 2VNAA 2VNHA 3Q7QA 4HKTA 5EMMA 1KZGB 1ETUA 1GEEA 1T43A 1L5VA 2C4NA 2O2XA 4LHVA 2J9ZB 3QV1A 4TTQA 5T57A 3UGKA 4COKA 1DBIA 1T36B 1OJLA 2QZZA 3DO8A 5SYMA 3STWA 1S6YA 1V47A 2JFOA 2CXQA 2POCA 5EEHA 3U09A 2XZTA 2I9KA 1AA9A 1JSXA 3DEKA 3RUFA 3S28A 3SMQA 3R1IA 1BHSA 4BB6A 4C7XA 1EFRA 3SYLA 3BM5A 3VR1A 3IMCA 2BI4A 4W7HA 4BC0A 3SZ3A 3ZLBA 1GL9B 1M66A 2DT5A 2Y0CA 3QOYA 1J39A 4KRYA 3RIEA 4G81A 1RWPA 2FQWA 3HP4A 4ZT6A 1YMQA 2VSOA 4RGVA 1WUKS 3PXAA 3JYPA 4FFRA 4GM4A 5CDUA 3II6X 1WQ1R 5AW3A 5LDHA 4R7TA 3BWCA 1XEXA 3PQ6A 4UC0A 4R98A 5TLSA 4YCLA 1GQQA 2PKQP 1ZM2A 3VC3A 1P5HA 1WBBA 2NU6B 4E11A 4S1VA 1L7OA 3RQSA 2ZSBA 2QN8A 4QJ3A 1L7MA 3VSDA 5ICCA 2HC9A 3LYAA 2OYRA 4C7JA 1UIRA 4A73A 1OGYA 1ZI9A 2VNJA 1RU3A 2CW5A 2WYIA 5AH0A 1JF8A 4HQKA 5H0IA 1IQUA 4LGVA 2K2WA 2B98A 1S5PA 3H8SA 2X0KA 4PVCA 1QG2A 5AKIA 1AQLA 2DPLA 1I80A 3EVGA 3Q72A 3H9EO 3KD2A 3P2JA 4IDHA 5CT9A 3EVBA 4D25A 4FVTA 5CB4A 4TKMA 3SD7A 3SYMA 1DXYA 1VJCA 1ZIDA 2CEAA 2WNSA 3BE5A 4RULA 2J6BA 3AH8A 1SKYB 3OFVA 1YF3A 1XZCA 3HUTA 3Q40A 1Z33A 3S2YA 4MVWA 4KITB 1L8LA 3U4QA 4JVOA 1JHRA 4XTCS 1K3TA 5IJ0B 3L5OA 1GN9A 4MQEB 4NV3A 2QSUA 3D0RA 2ZBVA 4JQOA