1N5IA

Crystal structure of inactive mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp) at ph 4.6 (resolution 1.85 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 85
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5iA00
1SVMA 4A8JB 2MSCB 1Q44A 2KJQA 1EESA 4B3GA 2QGNA 3B1WA 4IVPA 1XEXB 4KFSA 5FR2A 2PH1A 1R5OA 4BLPA 5FBRB 4IVQA 3NBFA 3SJBA 2WMNB 1FL9A 3NC0C 2AL7A 3W90A 3TKLA 1WXQA 3VR5A 4NCNA 2F3TA 2N46A 1W4AA 4JL6A 1RYFA 2WWFA 2B92A 4WAUA 4QHSA 4EPYA 2DY1A 2NOAA 5JJIA 3GLFE 2GXUA 1UPTA 1E1QA 2PZFA 2VP4A 4RZUA 4DRZA 3LBNA 2VHJA 1NMYA 2B7CA 5CM9C 3M4YA 3K9NA 3MRSA 2ANBA 2C8VA 1OXXK 2ZRLA 2NPIA 2BVNA 1H8HD 2V6JA 1Z63A 1F6BA 5CB6A 1MOZA 4ABYA 4Q4JB 3HPRA 4I99A 3SJAA 2JJ8A 2QI9C 1KO8A 2C9CA 1TNDA 1EFTA 2W58A 2OBNA 3FOZA 2GDJA 4EFNA 1FFHA 1J99A 4U00A 4URVR 4PPGA 4OI0A 4PHGA 4Q18A 5IK2D 4JKYA 3QEOA 2BMJA 3UANA 1DS6A 2CL6X 4PR0A 3LY5A 1NBMD 4OQFA 3R7WA 2PEZA 2Z0MA 2VP9A 4PXAA 1Z0DA 4ESHA 4QM6A 1G4AE 1JPJA 3CRW1 3GJXC 1IAQA 3ONWA 4MGZR 4ZI2A 2GHIA 2FOLA 2G1KA 3OHMA 1ZCBA 1NLFA 3ETLA 5P21A 1BKDR 1E2NA 3C14C 1UJ2A 3VAAA 1DAFA 2XXAA 3D7MA 2BEJA 4QGAA 4DDTA 3ICQB 2ZE5A 2WJIA 2ZR9A 4F4CA 4EPXA 3K70D 3GLGE 4OQNA 2VF8A 3BRWD 2A5JA 2FPKA 5GADl 1IHUA 2QTVB 1WP9A 4Q1FA 4TYPA 2ZRNA 3IKJA 4BEJA 3BFVA 3I8SA 1G17A 3K09A 4KO8A 3LRPA 4Z8YA 4CT4B 4C0JA 1GFIA 4ZIRB 2PT7A 3CNOA 2ZJYA 3DZ8A 2WMOB 3IEUA 4TSFA 5DI3A 3U4QB 2OUKA 5SZHB 3T12A 5FPTA 1E3MA 1SQ5A 4A92A 1QDEA 2B6HA 2JAQA 4UNPA 2YZ2A 1QHHA 2YOGA 2HV8A 2VIIA 3VX3A 2QPTA 2XNDD 1HA3A 1TEVA 1ZC3A 2C77A 2YOFA 1NVVR 2JJ2D 2ZUBA 3Q85A 4ITRC 4M1WA 3JVUA 3LQRA 4PPQA 3TH5A 4C7OA 2BWJA 1FUKA 4B47A 3HYTA 1LFDB 5CLQA 1VG8A 2CHVA 5JI3E 4ZDIA 3SFZA 1OB2A 2IS4A 4ZIRA 2FE4A 3AVQA 4TT3D 4QHTA 1TF2A 5H70A 4G5SA 4RZ2A 3EIEA 4ZDWA 2HT6A 4WZBE 2IBMA 3CF6R 1X3SA 2ZI6A 3F5FA 4MGKR 4KLNA 1E0AA 2XITA 1LVGA 1XCGB 4GNKA 4BLQA 1XXHE 1SVLA 3QIAA 2WSMA 5KHOC 1N25A 3GEHA 1VG9B 3CLVA 4LDJA 4KBFA 2NO0A 1E1RD 1T3SA 3CRRA 1G7TA 3DZDA 1Z07A 4O2LA 4QG7A 1UDXA 4JJKA 3TNFA 4DJTA 5JWOA 3UIEA 5KUTA 4XJXA 4W5HA 4B3DA 2BBOA 2ZXUA 3NTUA 1TX4B 3EC2A 1KHTA 4BFTA 2JLWA 2KWIA 2KBEA 1RRGA 2EFHB 2GK6A 1KI2A 1Z6AA 3OZXA 3WRYC 1DAIA 3FHTA 2P6UA 4IEIA 1KSHA 4BLTA 3H1TA 1S2MA 1E2PA 4Q02A 1SXJC 4JS0A 4KJZA 1A5TA 1QVRA 4NKRA 3QPVA 1HY3A 1KJYA 2JLXA 1OFTA 4EKDA 3ASZA 3TUJC 1XXHB 2JIZA 1CTQA 1X8LA 2RHDA 1YRAA 2X19A 4R9UC 3VQTA 1NN5A 1QHNA 1NBMA 4PQRA 3E5HA 2XOKA 4Q1CA 3B78A 2O8BA 3RNLA 3RC3A 4POAA 3NG1A 4WIAA 2QL6A 2ECKA 4PC1A 3RS0A 2D7DA 2AR7A 2IEYA 2QENA 3A58B 1XFAA 2RAPA 3K0AB 4XVUA 4EPVA 4YMVA 3TIFA 1OPXA 1E0JA 5IRCD 3QENA 4JIMA 4QM7A 2G88A 3NKVA 3P1JA 5CK5A 5CIWA 3MG9A 2JJ1A 1KK0A 4MUBA 4XVRA 5EE1A 1Y3AA 3TQFA 5TARA 2FV8A 1W36B 1NKSA 1DAGA 2FSFA 4JL5A 3D8BA 3WY9A 1CP2A 3N70A 1NVUQ 2A5FA 2RH5A 2VP2A 3WBKA 4D4KA 3UPUA 1GRQA 4KFRA 4MRRA 1UADA 4TYQA 4LHYA 3KKNA 1XRJA 3AF1A 3L43A 4FCVA 4IXNA 4NZYA 4F91B 1QHSA 3CRVA 5EZ5A 4C9BA 2CJWA 1G5PA 4LJ9A 1ZU5A 3EC1A 5C1BA 2FPLA 1VG1A 1XTRA 4KYUA 2QBYA 2P6NA 2J7KA 5EJEA 1I2MA 3QXHA 1ZUHA 3BB4A 4PO9A 1UBEA 5D3MA 3PV0A 2P2LA 2QMHA 4DBLC 2BBSA 2MMCA 4B3FX 4IOMA 1JBKA 4PHFA 1COWA 2D2FA 3NH9A 1CR2A 1KI6B 1W46A 3RABA 2IYQA 2CMKA 121PA 4EAQA 2NO1A 3VHXA 1GRNA 3OEHD 5TB5A 4Q1DA 5BQ5A 2Z4SA 4TZ6A 4A8JA 1DE0A 2RGCA 1QZXA 2CDNA 4NYJQ 3AF2A 2W2XA 2QORA 2WIBA 4F4IA 3GCGA 4LJYA 3GLFA 2VLIA 1DAMA 1KIMA 1KYIA 4TMWA 1VCMA 2JJ1D 3EA0A 3TE6A 1GUAA 1Z08A 1DARA 1CULC 3VKHA 3I1FA 3E2IA 1M2OB 421PA 1WF3A 5A4JA 5HZHA 5F9FA 3UMSA 2ODBA 3FKSA 2Z4RA 5EE0A 3RLFA 1KSGA 5D3QA 3VMFA 1KJZA 4FMCB 1W7AA 3U44B 3SQWA 1KI3A 1OFUX 4OBEA 1GZSA 2C96A 1R10A 5G3YA 3W34A 4WA7A 5FOWA 3AVYA 4TL6A 3SBEA 2JDID 5TMPA 1N3BA 4LC1A 3A1TA 5FOXA 2AN9A 3VHLB 4Q5IA 1ZM9A 3WNCA 4KLZA 3ZVLA 5KSZA 4BZXA 2GCPA 2ZSEA 1G3QA 1LF0A 1S3SA 3THXA 3ZZUA 4ZI3A 1XPUA 3AP2A 4NE2A 1DBSA 3U5ZB 4QBFA 3K0SA 2QGZA 4BQSA 2PLFA 4DLSA 1T0JB 1XJ0A 2BOVA 1FOEB 4LOAA 1K6MA 2ZE8A 3EIQA 4LY6A 2PZEA 3IBYA 4QRHA 5CYOA 2ATVA 2AFHE 3PVSA 1E2EA 1E9AA 4URWR 3RANA 5BWMA 3SHWA 4OHWA 3K70B 2ZRDA 3MD0A 1ZNXA 5FBLB 1KMHA 3EPJA 4QNMA 3K9GA 4V0NA 1IJFA 4A0HA 3TAHA 2Z5FA 1ZNWA 3QKRA 3GQBA 3U61B 3TVTA 4RD0A 3QEJA 4EQ6A 4JLBA 4H9GA 5CK4A 4TLAA 3RWMB 4Q1AA 1DAKA 3EZ6A 4NBSA 3GPLA 1GL9B 2AK2A 2X77A 1YE8A 3ND8A 2R44A 1Z22A 4KVGA 3SYLA 2CXXA 5LDDC 3UKDA 5B58C 2G9NA 2YWGA 1R2QA 3NIBA 3SOPA 4EJSB 3W5JA 5CJ2A 4YDSA 2O8FB 3AVTA 4P0TA 3B13B 1ZIPA 2WJHA 3FVQA 2J1LA 1G3UA 3ADBA 1GOTA 4DDVA 2CLCX 3LVRE 3BGWA 1EFHA 4ZCIA 1ZW6A 4Q19A 4PTLA 2BV3A 4Q21A 5H1YA 3QKRB 1VCIA 2RGGA 1TUIA 2W0MA 2J46A 2V8OA 1VCNA 3QKSA 4GRAA 4S35A 4D0GA 4HB2A 4M0LA 2OO7A 2IEZA 1W36C 5C46F 1EXMA 4LHVA 3OEHA 4DCTA 4E09A 2OE2A 5KU1A 4JLMA 1F3OA 3FMPB 4V0MA 4LYAA 1E79A 4GOKA 4NPHA 3T1QA 2XNSA 4PC7A 1GL6A 1W48A 3T35A 2ANCA 4AURA 3VTKA 1XMSA 221PA 3WHKA 3Q9LA 4D2IA 4IOKA 3DMNA 4B76A 4DLZA 1HURA 1T5LA 1IOZA 3R8CA 4DIEA 1ZUNB 3C41J 4CEHB 3AGQA 1AGRA 5E7JA 1N6PA 3UMFA 4B32A 1S3GA 4UXIA 1OT3A 5G41A 5JWHA 1WRBA 4B2LA 4JJZA 1VYTA 1AQUA 1T3LA 2YYZA 4U02A 1A2BA 3NHAA 2A7QA 1FTNA 4IDHA 1U9IC 1R4AA 2RGBA 5EP2A 3T34A 1NLZA 2GJAA 2VP0A 1CF4A 3FDIA 3GJ6A 1LF5A 4LBVA 4QL3A 2FSGA 1Q1QA 3EXAA 2V54A 3QG1A 4AYTA 4ZCLA 5LPNA 1VDZA 1LY1A 1XPRA 2IC5A 1EFRA 4IW3B 2JLQA 2ZTSA 4CEHA 3R8FA 3P26A 2DPXA 1FMLA 4M22A 1G4UR 4Q9JA 4EIWA 2IYWA 1CRPA 2AD5A 1CRQA 3FE2A 3BWDD 4FW9A 3K1JA 1GNRA 3CX6A 5KNDA 1AS0A 4MKIA 1KI9A 4Q66C 3SEAA 1NN0A 3BH7A 2FFQA 2FGJA 4U7DA 3K0AA 2OLJA 1ZM2A 1CBUA 1UBCA 1P75A 3SR0A 3MMPA 2J5XA 5K8UA 2RGXA 5JRJA 3HU2A 4OJKA 4QGHA 3KQUA 2CVHA 1OF1A 2OXRA 5J4YA 1SVIA 2PMDA 4RZXA 4NONA 2QBYB 3BH0A 3P20A 1RFLA 4CF7A 2GBLA 2BJVA 4Q7JB 2ZU0C 4X8MA 4Q47A 1M6NA 4TLCA 3O47A 3K0FA 1HTWA 1UM8A 3QBVA 4B44A 2DCUA 4MKHA 3H2YA 1U0JA 1T9HA 3AP3A 1SZPA 5DHAA 5JS7A 3IIMA 4CEIB 1N6KA 2QP9X 3RRZA 3X1YA 3GLHB 4A15A 2V6IA 4ILEA 2JASA 4BZQA 1RJ9B 2HJVA 4DB4A 3THWA 3GJ0A 4JBYA 1XTKA 5FL7A 3AF4A 5FUWA 3NEYA 1YJ5A 5CITA 1N2CE 4RD2A 2GXAA 4AIIA 1F2UA 3DDCA 3PFIA 3A1WA 3U7HB 1G6HA 2IYXA 3IHLA 3S1AB 4AWXA 5HPYB 2GJ9A 1XX6A 2GNOA 3OIVA 3AVPA 2G0NA 4URUR 1NSTA 4ASUA 2JEOA 1IJEA 2QUZA 3SQXA 1XZPA 2PL3A 2DWPA 2J59A 2QNRA 5GVRA 1E1RA 1XMIA 1JR6A 3T5GA 5AJZA 2F43B 1E4VA 3KKMA 3THWB 4FN5A 3T06B 4NTZA 3QE0A 3PXGA 5K8IA 1U9IA 1G5RA 2AKAB 3KB1A 1H8ED 1G8PA 2WKQA 3LBHA 2ZJ5A 1ELOA 4RY2A 1M34E 2XB2A 3GFPA 1KI7A 2WPDA 2ZQ5A 2ZETA 3U4QA 2O8DB 3ZGXA 2WKPA 4XOIA 3D6TB 2BBWA 3LH5A 1CS4C 1QHXA 4PSKA 3QXXA 3CIOA 4FI3C 4L4UA 4DXAA 4V0ME 4GDFA 4PPNA 3ZS9A 4LJ6A 4LV8B 2CCGA 4BLRA 4JKIA 5LD2C 2WM9B 3NDBB 1X8JA 3TJZA 1XMVA 3MFYA 1E9DA 2D3WA 4C3ZA 2R65A 2KI5A 2P0EA 1U81A 4DC9A 1E9CA 1P9WA 3PEVA 4PZZA 2ERXA 3QG5A 2YNMA 2Z6VA 3EZ7A 4D26A 5CYPA 1DO0A 2WVJA 2XNDA 3BS4A 5L8VA 4LCBA 4AG6A 4YMWA 1EFRD 1SXJD 4IFBA 4MKGA 2IW3A 4NCKA 1N6NA 3B2EA 3P4YA 4IJMA 1V5WA 2HCBA 1UKZA 4J0QA 5KYKA 2JA1A 1IN5A 1D9XA 2GCOA 1ZAKA 4JT4A 4AKEA 1SULA 1BMFA 2ZEJA 3ZVRA 2UZIR 4TLEA 4L5BA 3B1YA 3IBGA 4Q4HB 4LHWA 1T0HB 4EJSA 5FTMA 3U3JA 1E94E 3WP0A 1Z6GA 3EA5A 1E32A 2FX3A 1U98A 3KXIA 4TQAA 4CDGA 4D80A 4OI1A 1FX0B 2EFEB 4YC7A 4TZ0A 2GRJA 1XJQA 3CF2A 4D6PA 5J40A 2C78A 2H18A 3PEWA 3WMGA 2E87A 2GJKA 2OEPA 3U6KA 4KFUA 4ARZA 3U60B 1E2IA 3QOFA 3ZVMA 1HT1E 2OFWA 4JVSB 4XTRA 1N6HA 4PHHA 4BGDA 2Z43A 1C9KA 2A5DA 4QBIA 1WMSA 5AJVB 2OLKA 2QP3A 1RC8A 4RCYA 2DFTA 4XWAA 1VYUA 2QQ0A 2W6IA 5KSOA 1UAAA 2HYDA 1OKKD 2DHRA 2ZRPA 3LO5A 3LWNA 3W6OA 1X86B 2PMKA 4C0HA 2CK3D 1KY2A 3SI7A 1JEEA 1U0HC 1DAEA 2OCBA 4DT1B 2YWEA 5HTKA 5AUPB 3G5UA 3LXXA 1GNPA 4NYIR 3AH8A 2ZU6A 5KNCA 3WMEA 3TUIC 5KSPA 3VU9B 5C2JB 1J7KA 3K9LA 2JLSA 5DGXA 2A30A 1Q3HA 3CWZA 4UNRA 3T1TA 1ZM3A 1ZC4A 3QF4A 5L3RA 1JB1A 4A4DA 1PLKA 2R2AA 2CHQA 3HU1A 4EPRA 2XXAB 1DG3A 1Q1ZA 4ZKEA 1NLYA 2CEAA 3OAAA 1LV7A 4GSYA 4M4SA 3FFBA 3CF0A 1X6VA 2OILA 3ZQ6A 4Q1BA 5F3WB 3I4LA 2MMGA 3X1DA 3K70C 2C5LA 3T1OA 4LHXA 2DWOA 821PA 2WSSD 1IN4A 2G6BA 2Q9AA 4XD7D 5FUYA 4PANA 3QF7A 4IRUB 3CRMA 1Q12A 1G7RA 4R2IA 1P3JA 1BYUA 2AHOA 2E1RA 4M1TA 4Q7KA 4ACAA 1Z8FA 2ZRCA 2ZRKA 2NGRA 4AKIA 3VU9A 3UG6A 2D06A 2R6GA 4KODA 4YDHB 1AN0A 2GZHA 2GK7A 2RCNA 4A0GA 1XD2B 1X1RA 1TQ6A 4Q4HA 1TADA 4LYFA 1YR9A 1PZNA 4EPTA 1FTSA 1KO1A 4FCWA 3ADCA 3IEVA 3ASYA 3U2QA 2PX0A 2OXCA 5DLQC 4A8JC 2QQEA 4W5WA 1E2LA 3Q3JB 4QNRA 2WWIA 1TUEA 1XXHA 3B1VA 1G6OA 4KYIB 4P32A 4DLUA 5DI9A 1RPZA 4RCZA 4WZ6A 4C0QC 2G77B 3SU8A 521PA 1IY0A 1TPZA 1WQ1R 2KSQA 3NBXX 4JVLA 2XGJA 1D8TA 2GJSA 4MH0R 5EXTA 3LA6A 5FPYA 3OIUA 1T6NA 2GA8A 1NMZA 4TT3A 2JLRA 2QSZA 3ZLJA 4HLUC 4M1MA 2GWHA 2IUTA 3K0CC 4TQUS 1DADA 2ZI3A 1P61B 1OXUA 2RHMA 4D4LA 2QE7A 5EE3A 4D81A 4X8HA 1DG1G 1Z6YA 5JS8A 3FYHA 1KAOA 3U7GA 2HF9A 3OEED 2V55B 4GBMA 4TTPA 1R7RA 3AKYA 2H1LA 3GFTA 4HZUA 3E1SA 3RYTC 2ZM5A 5J4VA 3FKQA 1QHHB 1B0UA 1P2TA 1CXZA 2YINC 1W0JD 4NYMQ 1UBGA 2GF9A 1MT0A 1GKYA 1QVAA 2OV2A 4PSVA 2GEDA 3PQCA 4GZLA 2CNWD 4V0KA 4JLKA 2R6AA 1E4YA 3MWJA 2ZYWX 1IN8A 3L2OB 3Q72A 5LB2A 3K0CA 1GDDA 1P5ZB 4UNSA 5FBWB 5TXGA 3RS5A 4R7ZA 3VFDA 5E7IA 1FP6A 1T91A 4OQXA 4QC2A 3RAPR 3AGPA 2VA8A 4NHOA 5FL3A 1EWRA 1RYHA 5C4MA 1S9HA 2O0HA 3PUYA 1NRJB 5FL7D 2WWHA 5BN5A 3OE7D 4FXPA 4ON9A 4FWTA 3WNBA 4MRNA 3V9PA 2GEVA 2IXEA 2EFGA 1S1MA 3CB4A 3EWAA 4O2RA 4Q9HA 4WXPA 2UZ3A 1RRCA 4TMKA 3BFKA 3THOA 1HQCA 2QA5A 3TW8B 2XZPA 2ZE7A 3CRQA 1KZGB 3I72A 4LJ7A 5FPKA 1PLLA 1U99A 3GJ4A 1CLUA 1CR1A 3GEIA 1JALA 1OH8A 2ZSAA 1KOFA 3AKDA 1RJ9A 2XB4A 1AS3A 4DEXA 2D4HA 2CCKA 2Q6TA 1FPMA 3IPXA 4K8OA 1GVNB 4JLJA 4O0MA 3BFXA 3IIJA 1SGWA 1WBBA 2QMEA 3RS2A 1UF9A 3QSYA 1LW7A 3B7GA 1WDTA 1M7BA 5EUMA 3GJ5A 4DWJA 3P32A 3KUDA 5DE3A 1OJLA 2A9KA 4B71A 3Q5EA 2WHXA 1E2FA 2O0KA 3B1ZA 4E5UA 4JLPA 4M8NE 1D6JA 3OE7A 2HT1A 3IIKA 1KAGA 1WE2A 5C18A 4M2LA 3ZJYA 1RE0A 4NH0A 1OH7A 2ZANA 4OL0A 2R9VA 2G0TA 1XF9A 2ZYTX 3QI2A 4BRWA 2F55A 2FGKA 3MWLA 2BHRA 3X1WA 4HLDA 2GTPA 1KMQA 3WXMA 2HLDD 4DLYA 4XIGS 1QHIA 4FWIB 4TLBA 5A5GA 1P72A 1HH4A 1XTSA 1V43A 3A36A 1E2HA 3GJ8A 3K0EA 3KKPA 1W0JA 3AVVA 1VHTA 1ZUIA 5J5CA 4KFTA 2CVFA 5L3SA 4A1FA 1A4RA 4UXHA 3LW8A 2CHGA 4QKQA 2CE2X 2PEYA 1US8A 1BYIA 2QM8A 1ZU4A 4AK9A 2BKUA 2VP5A 4MRVA 5BN4A 2ZJOA 4DT1A 3ZVNA 4M53A 3N2IA 4ZKDA 4X8LA 2DWQA 5HE9A 1VECA 4BEBA 3ZS8A 1G5TA 3DKPA 4DUGA 5FTLA 2J0SA 3V00A 1EGAA 3FTQA 1KZ7B 1W1WA 1QF9A 1PVOA 3AVWA 1FZQA 3J81k 5KSYA 1LS1A 3QXSA 4XWOA 4ESVA 3SZRA 1R8SA 5BYKA 2YKGA 2WICA 3KKOA 4BFYA 5M04A 4RFSA 2CBZA 3BORA 2I1QA 4BFXA 2EU8A 1FX0A 5JCPA 1WA5A 2CLDX 2R62A 4M1OA 2BBTA 4A0FA 1GG2A 1A7JA 3TUZC 1WB9A 1VIYA 4EFLA 2OFXA 2FWRA 3LXRA 4RFVA 5L3QA 2HF8A 2H8KA 1KDPA 2GAAA 1Z0IA 4IOJA 2B8TA 1OYWA 5KPDA 2GXQA 4AYXA 3KJHA 2FU5C 2CL0X 2VRWA 4C0SA 2KBFA 2ZAMA 3MUFA 1VKJA 3L0PA 2G1JA 4LC0A 3SHFA 1K5GA 4HAZA 3Q7QA 4M1KA 3MWKA 4P4SB 4M9XA 4TQ9A 3TSOA 3X1ZA 5KDDA 4JLNA 1YZKA 3CR7A 1ZNYA 4EFMA 4S2EA 1PJRA 1E2DA 3R7WB 1Z28A 4B48A 3Q5DA 1P9RA 3QBTA 4HEJA 2YVUA 2ZAOA 4CT5A 4US0R 3C15C 4JLVA 1UBFA 2WSSA 3CR8A 3PCRB 4IEEA 3MGCA 721PA 2X8AA 3QY0A 3KQKA 1XB2A 1E9SA 1RZ3A 3GEEA 4NCHA 4W5JA 1AKEA 1KJWA 1E99A 1Z0AA 1J8YF 3GFOA 3TGPA 5JFGA 4N0EA 1R0XA 3JZAA 2NG1A 4OQLA 1BH2A 1NP6A 4RSGA 2YC4C 4HAXA 3PUZA 2AFIE 3TSWA 1YZGA 1ZCAA 4URXR 2QAGA 1YVDA 1YR8A 3SS8A 4TL9A 2L0XA 4LSGA 4MGYR 4HYYA 5EXPA 5JWRA 1MO5A 5EXXA 2VF7A 5JSZA 4OK6A 5EP3A 4Z1MA 1PUJA 5L3VA 4I1VA 3CZQA 4DCUA 3VR6A 4Q4JA 4DB2A 4KV9A 4D0NA 2RKOA 2VSXA 4ZCMA 2ODNA 1KNXA 4LV6A 2X1VA 4LJAA 2QRZA 3DVLA 5TDHA 3VR4A 1HUQA 4FIDA 1BIFA 4M9ZA 1MH1A 1ZJ6A 4A36A 2ZSDA 2ZUDA 4RZ3A 3W3AA 1RKBA 2Q0HA 3KJIA 1IXZA 2NZ8A 1C1YA 4HDCA 1W4RA 4M1YA 2ZRAA 2ZYUX 4XTCS 2BMFA 2AD1A 5HKKD 4UKDA 4UQOA 5HE8A 1XDBA 1IBRA 3EARA 1KK2A 3WRXC 1KK3A 3KJGA 3N5CA 1IM2A 4DUGD 3EZFA 4DLTA 2ZREA 5G40A 2LKCA 3TSZA 3VR1A 3L0IB 2YJTD 2J41A 2WOOA 2VPPA 2VSOA 4Q01A 2F1HA 2ONJA 2ZS9A 4GP7A 4QOSA 2O8FA 4PO1A 3CPJB 1L4YA 3GMTA 2JLUA 1IXSB 1XEWX 2GF0A 2QAJA 2PJZA 1CJUC 2R6FA 2WOJA 4BECA 2ZR0A 5AUOB 4JBXA 4LUCA 4QJ3A 4MQBA 5KTYA 3BOSA 5E4FA 4DIDA 3EW9A 1KSFX 1KTVA 5SZIA 3CX7A 3VKGA 1XU4A 1CJKC 1R0ZA 2DBYA 4EDHA 2CL7X 4KVAA 2MSDB 2HJGA 2RB4A 1OIXA 2IYSA 2Y8EA 3WYFA 4BZPA 4BFUA 4UXJA 5EQTA 1TQ2A 5FUXA 4N0DA 3OIWA 3AVOA 5G3ZA 1VYVA 1NBME 2WPDD 1II8B 2QG6A 3KQNA 5KO2A 3S1AA 2I3BA 2FPMA 2OAQ1 1G7CA 4F92B 1CKEA 2ZRJA 4JT2A 4WBSA 4GT1A 5B30A 1DTSA 4L16A 2O8BB 1L2TA 3BXZA 3NWJA 1Z6XA 3FFAA 2RGDA 4HAYA 4RD3A 2OSBA 1AJEA 2IYVA 5E7MA 3ZD7A 4YQFA 4G5OA 5LB4A 4BFZA 4PPFA 4LZZA 1UEJA 4C2TA 1Z47A 3CW2A 3DL0A 2YV5A 4QXAA 1LNZA 5B57C 2PCLA 1L8QA 3GJ3A 3I3SR 4TWZA 3ZH9B 5JEEA 4QGGA 1MABA 4D4MA 3MCAA 5ANRB 5JECA 3B5JA 4BLSA 5H8WA 3CUEF 1U8ZA 3LD9A 4G1UC 4R98A 3C16C 1GP2A 5FTJA 4C0KA 1MRSA 1W4BA 4BRUA 1TF7A 2IUSA 4DDWA 4MUAA 1JR3E 2REXB 3WYGA 1M7GA 2YC2C 4DSTA 3RRMA 4WVFA 1ZD8A 3DEFA 3UWKA 5IK2A 1NNEA 1MR3F 4B6EA 1OXVA 4YMSA 4RJLA 3GLGB 3I5YA 1N0UA 5K8LA 3TK1A 4PO8A 1AKYA 2NMVA 4BASA 1GILA 5B64A 2WBLC 2H16A 2FMXA 1OV4A 3KL4A 3W8RA 1MO4A 2AWOA 5HR5A 2GCOB 1G8FA 1G3RA 1ONBA 3BB3A 4URYR 3KTAA 2QT0A 4YMTA 1ZYUA 2QAGB 2YOHA 3FGNA 1NY6A 2BCGY 3C7KA 4M1SA 3VR3A 1G7SA 4F93B 2C2HA 2WJJA 4OKSA 5EE9A 4Y0VA 5CB8A 1I4TD 2F9MA 4YLGA 4PFSA 5DSZA 1JI0A 2NZJA 3R9IA 2F43A 4P4UA 3ZQJA 4Z54A 2OESA 3H86A 3SDZA 5CDFE 2ZRFA 4TMTA 3RRNA 1AIPA 2BM0A 5FH9A 1XPOA 5AJXA 3L82B 2VP6A 2Z83A 2ZVPX 4FMBB 4B74A 2P3SA 2QN6A 3EPHA 1G18A 1J2JA 4BLOA 1S96A 3A4NA 1W5TA 1S0UA 5CLLA 1NMXA 2QZ4A 2BC9A 3LDAA 4A6XA 3N2EA 1KMHB 4FINA 1HV8A 2XSZA 1FUUA 1NJFA 1LS6A 2VQSA 3A4LA 3REGA 1P7CA 1Q0UA 2XTNA 1P2SA 2FFBA 2PZGA 2QRNA 3NEJA 1KI6A 1FP7A 1ZBDA 2H7VA 1KKLA 1G41A 1OLOA 4JLDA 4L8GA 2W2VA 3QPUA 4JBWA 3U3OA 1M74A 2BMDA 1F2UB 3A1SA 4FMDB 2A78A 1U94A 3IO3A 4DVGA 1KO5A 2D62A 2HUPA 2H5EA 3DM9B 5AJYA 5KDLA 1OHHD 5KNBA 3T5DA 3VKWA 3X2SA 2EYUA 1G64A 2ERYA 4XWKA 2O0JA 2NO6A 3OIYA 4LV5B 1CR4A 1N5IA 2ZI9A 2JLYA 2IWRA 4YONB 5D3MB 5JZVA 2QMUA 1R6BX 1Z0JA 1W2HA 4DSOA 4BWYA 1R5BA 2ZJZA 1L4UA 3O8CA 4CGZA 1W47A 4P4TA 5AUQA 5TV2A 5BYJA 3DMDA 1QBKC 4US2R 1G20E 1UFQA 4A2PA 4BE7B 2RGNA 1E0SA 4BFSA 1T4GA 2ZJ2A 1T8TA 1NSFA 1K8RA 4TTRA 5IHPA 4GPTA 5FR1A 1XBTA 1N6RA 3QJYA 4TTQA 4NMMA 4GMDA 2JATA 3KUCA 2KE5A 2EW1A 3AEZA 3NC1C 4I1OA 4OK3A 1SXJE 2IUUA 4CIDA 4MDEA 2P6RA 1NKTA 1U2RA 1CJTC 3TVDA 4R2HA 4JMPA 2IWHA 1RW4A 1ZNZA 1TQ4A 1WCV1 3B85A 4FMDF 2IS1A 1OB5A 1EWQA 3ZD6A 3MAAC 1YU9A 2V1XA 3SN6A 3OF5A 1XTIA 1QG4A 3GLIE 2EFCB 4PQFA 5FBVB 4IDQA 4US1R 1E6CA 4BUJA 3H0KA 5G53C 5CM8B 4TMZA 2NPFA 1G8YA 4PQYA 1HQYE 2ZYVX 5FI1B 1Q1BA 2ZR7A 2ONKA 2WV9A 4CZ2A 2HLDA 2OG2A 4OHXA 2NQ2C 4II7A 2GXSA 1S9DA 3PG5A 2W0SA 2JLZA 1S1CA 4Q4AA 5ELXA 2CK3A 1TU3A 3JZMA 5HCIA 4ACBA 1G21E 1G3IA 1JECA 4A2QA 4MYCA 3T61A 2FA9A 1IQPA 1A82A 2JDIA 1KSJA 1Z29A 2P65A 4NCJA 3VR2A 1HEIA 2Q21A 5F98A 2B8WA 2C04A 1D9ZA 1D2EA 1NG9A 5CDFA 4EJSC 1R8QA 1Z2CA 1Q57A 5TY0A 4IFEA 4C30A 4QFMA 3EZ2A 4CYMA 5KOYA 5FOSA 2EYQA 2BM1A 2FSHA 3QUSA 1G16A 2FN4A 3O8DA 4GI7A 4HDQB 4C2UA 3LX8A 4GL2A 1GRRA 2QP4A 2GZAA 1VG0B 3RS7A 4F4JA 3LW7A 1T8UA 1NL3A 2WZQA 3L8ZA 2A5YB 2V9PA 4LHZA 4DCVA 3RHFA 5JLJA 3QQ5A 4HB4A 5EXSA 3O8RA 4G5RA 2FZLA 2OCAA 2BEKA 3ZDQA 1FNNA 1G19A 2IYRA 2GKSA 4OHZA 3I61A 1ZIOA 1TMKA 4F7WA 1JR3A 5IT5A 1X8KA 4OHYA 1ESMA 2PX3A 1A2KC 1HYQA 4AYWA 2YHSA 3D3QA 1T3HA 3F0TA 4LJ5A 3UMRA 1US8B 2JGNA 1EG7A 2JCSA 3U7EB 1UKEA 3GLHE 4YXWD 3KDSE 3IHWA 3GLFB 1QHYA 1Q1EA 5EUQB 1Y63A 1OIWA 3KX2A 4G5QA 5JRZA 2C9YA 4FD2A 4C0AC 1G9XA 2Q9CA 4OQMA 2VO1A 3LVQE 3BERA 3H4MA 1XCMA 2V4ZA 2WAXA 1SVSA 2ZIAA 4GFDA 2ZRHA 8OHMA 4AY2A 4PAQA 4LBWA 2RGEA 3PEUA 2RGNC 5FOVA 2V3CC 2IXFA 1GSIA 3UWOA 4Q48A 1OIVA 2VHCA 4TYYA 2PT5A 1P62B 3EPKA 1RRFA 3HYRA 2VTKA 3AM1A 1CJVC 1ZD9A 1W0KA 3C4JA 3EAQA 5JJLA 1AA9A 5L3QB 4LRWA 4IDNA 3WMFA 1AZSC 3F8TA 4HB0A 3C5CA 3HPQA 3IDQA 3KXLA 1U0LA 2VHTA 4G3XA 3KTAB 4B73A 3W9YA 3QNUA 4EQ6B 2J0UA 1D2NA 3QPWA 2A3RA 5CJPA 2QT1A 3A37A 3FMOB 3T15A 4X8OA 1YR6A 3SJCA 1QRAA 5AR1A 1P6XA 5DYGA 4A2WA 2FFAA 1YR7A 4MA4A 3DOEA 1B23P 1UEIA 2XZOA 4UJ5A 4F38A 3KB2A 3VNVA 3GLHA 3B60A 2EVWX 3PUVA 1CEEA 1KI1A 2QTFA 1D2MA 4MGIR 4NU0A 4C4PA 2EQBA 3I92A 1AM4D 2CCJA 4QJ4A 4IDPA 4TMXA 4Q03A 1G8HA 5FFMA 5FBQB 1NN3A 1JEDA 4V03A 5BN3A 3MLEA 2J9RA 2W2TA 3MJRA 3SBDA 3K53A 1P2UA 1DOAA 2C98A 5FPHA 1Z5ZA 5DO9A 1SVWA 5TVKA 3TQCA 2ZRBA 1R0YA 2BIFA 2GEUA 4N1AA 1EFCA 2P5TB 3KKQA 2O8EB 3BE4A 2N1BA 2IS2A 1ANKA 5GJVC 1N5JA 4PSAA 2Q3HA 1SVKA 3TMKA 4I4LA 1VPLA 4OI4A 3U3MA 4FMCF 2QTHA 3TRFA 3SC3A 4HAWA 2VSFA 2H17A 2QPOA 2UVQA 3CNLA 3NH6A 2IK8A 4OK5A 3CBQA 3WHLA 1NJGA 1JPNA 2VL7A 2ZS7A 2ZJ8A 2XEXA 2XOKD 5C4GB 3TW4A 3RS3A 2FEOA 3FHCB 1G1MA 3M6AA 1XEWY 1N5KA 3M1IA 4FCTA 5L3SB 1YKSA 3DM5A 2F1RA 2Q9BA 4G0NA 2IHBA 5AK0A 5JHGB 2O8DA 3THYB 4MDFA 3CH5A 2LCFA 2ZI7A 3LX5A 4Q9LA 1M1YE 4ZDJA 2XJ9A 4OI2A 5IDVA 1NY5A 1Z83A 3I73A 2WIAA 4L9WA 1XD8A 3BB1A 2ASEA 2OBLA 1O87A 5J47A 4MRSA 3SYKA 3V4FA 4WXRA 4LPKA 2X2EA 3IQWA 5DHFA 3LLUA 2ZI5A 1E2JA 5JSZB 5DIFA 4CEJA 4B75A 4LBYA 2UKDA 4HUTA 5EP4A 1U8YA 4W9MC 1J90A 3RVBA 2IT1A 4RKFA 4EPWA 2DFNA 4NYJR 5JJKA 1COWD 4NCIA 2C95A 1FW6A 4JLOA 3TLXA 3TBKA 1YRBA 2IF0A 1M7HA 3DHWC 4NDZA 4DCSA 5K8TA 5J4HA 3OAAD 3AUXA 1KK1A 3RSOA 1UKVY 1OSNA 1P4SA 2ORWA 2W6JA 4JZKA 5FTKA 1XEXA 4ARZB 5BW8A 5H68A 3AQ4A 1IN6A 3K0FB 4DCNA 1XD9A 4IXMA 1YZNA 3B1XA 1E69A 2XX3A 5HCNA 1P9NA 3LFUA 1H8HA 2J87A 2J0QA 3A4MA 5GJWC 2KB0A 2VHQA 3RDPA 2ZROA 3WNDA 4C0LA 2PLRA 3NVAA 3TR5A 4DSNA 2B21A 1ESNA 1MO6A 2JIZD 2XJ4A 3B6EA 3C8UA 4Z8XA 1X1SA 1ZM4A 4L15A 5B2ZA 2VHUA 3A1VA 1DVRA 2D74A 4JSYA 3ZZTA 2O5VA 2P5SA 4DKXA 4RD6A 2J0VA 4LJ4A 4AD8A 4Q7MB 2OHFA 3DO6A 2I1VB 2XTMA 3BD9A 4TN1A 4MKFA 3UG7A 2QE7D 1SHZA 2PCJA 4DHEA 1XD2A 1P60A 3RS4A 3PIRA 3Q7PA 2BCJQ 3QF4B 4HZUB 4GOJA 3I5XA 4PC2A 3EX7C 3CNNA 2AXPA 1Q21A 1N6IA 5DI3B 5DNYB 1AQYA 1MO3A 1EX6A 1W49A 1GITA 1U90A 1KDRA 2B7BA 2J7PA 2OCPA 1GL7A 1IY2A 3GP8A 1W44A 2ZI4A 4HUQA 4CEIA 3VNUA 1GTVA 1LB1B 1EFUA 2PBRA 2YWHA 4PC6A 1C4OA 3UATA 2GAOA 4K81B 3CM0A 4PC3A 6Q21A 1PV4A 1MV5A 1KNQA 1QG2A 1G3MA 3FWYA 1XP8A 3PJRA 5JBQA 5IF9A 2DFLA 2OBMA 4M21A 1N6LA 3I62A 1CR0A 3QXCA 4B6FA 3H84A 1PUIA 3R9XA 5JI2E 3CPEA 2W00A 1XJCA 2R6DA 3F3YA 4AI6A 3HJNA 3G82C 4DLXA 1E98A 2LKDA 4MYHA 1CJMA 1GNQA 1NN1A 4PX9A 4B3CA 4B43A 1HE1C 4XH9B 3KQHA 1KI8A 4JYCA 5FI0B 4KITB 1SXJA 1M8PA 3E70C 3LQQA 4KI0A 2F7SA 4PHTA 1EX7A 4QGFA 4BFWA 2MSEB 2O52A 1AZTA 1K5DA 4Q7LA 4GOXA 2FG5A 4JVMA 2FJUA 2J7PD 1SVOA 3QKUA 4MITA 1I4DD 1NI3A 2IA5A 2CE7A 2ODEA 4N3NA 5E3HA 2J3EA 4YXWA 5DN6A 1JJ7A 2OT3B 3IQXA 2ZVQX 2Q3FA 3L0SA 4NYMR 3BH6A 1JAHA 2WWYA 2GVDC 2REBA 4M9QA 2EWVA 2C99A 4G01B 4MYUA 2DFKB 3Q8XB 2RMKA 2H57A 5LBIA 4Q1EA 2JJ2A 3TAUA 3LNCA 1FQJA 2WWGA 2OCYC 3GLGA 2CJWB 4MYTA 1P73A 5CIQA 1J8MF 4P3YA 4GZMA 2W6JD 3A6PC 4D0LB 1XCPA 5FPSA 3RC8A 3BIFA 1F60A 4DLRA 1MRNA 2OAP1 2IL1A 3ICEA 1Z2AA 3EWSA 2HCJB 3A8TA 5HKKA 3DPUA 1YHNA 2F1IA 5JHHB 1XTJA 2W83A 3HDTA 4IVRA 2QEQA 5DH9A 3OESA 5UKDA 4D82A 4BPBA 2GILA 3CO5A 3KJEA 4UNQA 4XSGA 4QHYA 2ATXA 1XWIA 1SKYE 3CX8A 4NP6A 2D7CA 2WJVA 4GMXA 1NVWQ 2G3YA 1NVXQ 4HATA 2ZS8A 3SJZA 4AKGA 2W6ID 3IGFA 1GM5A 2WJGA 4ZO4A 1GIAA 3RWOA 4Q4AB 4YMUA 1BO6A 1JR3D 1R0WA 1NIJA 1YZUA 3CZPA 2HXYA 4BFVA 4LI0A 3WP1B 4CW7A 3R9WA 2GETA 3G0HA 1F2TA 3AF0A 5FOUA 4B33A 4DLVA 2YWFA 4HB3A 1EK0A 3PITA 3BK7A 4ZPXA 2AXNA 2BDTA 3OFND 4WW0A 4KU4A 2XTZA 1NVVQ 3ND9A 5EP1A 3B9PA 1Z0KA 3FMIA 4HI0E 2GBLC 4JYBA 3IILA 2N42A 1DELA 1SHKA 4KXFB 3CH4B 1GWNA 1II9A 2ZJAA 3GLIA 3FMFA 5SZKB 621PA 4XSHA 1SKQA 1KY3A 1W2GA 4PZLA 1ZMXA 2DB3A 3HP1A 1Z06A 1TTTA 3GJ7A 4DDUA 1NIPA 3T1VA 1AS2A 3ZIAD 3QKTA 4TYWA 1Q3TA 2J45A 4RD4A 1TEXA 5F9HA 1H8EA 1HE8B 2H92A 3CKLA 2ZSBA 1F48A 4HAVA 3RSLA 3W3ZB 2PJRA 4P4SA 4IKEA 2X2FA 3PR1A 2ORVA 2J0UB 4HAUA 1SKYB 2C03A 1I2DA 1MKYA 1FMJA 4I1SA 4PAOA 3U3KA 4HSEA 2QPAA 4B34A 5JEDA 2BKEA 4AKHA 2NO7A 1I4LD 1ZD1A 4IDOA 4LJ8A 4A6PA 1E96A 1GKIA 2AX4A 3VX4A 3R20A 3GLIB 4TL8A 1TF5A 2GCNA 1RRPA 4B2PA 1W4CA 1F5NA 2OM2A 4WZAE 2AK3A 3CPHA 4ZV4A 3BJIC 3MJHA 4XVQA 4V0LA 2FNAA 3NDPA 2DR3A 2HDNB 4AG5A 2ZE6A 3RRYA 3CONA 1YZLA 5FUVA 2F1JA 3SFVA 3AF3A 1JJVA 2VH5R 1OXSC 5AJWA 3I32A 1NF3A 1DAHA 1J70A 4HLQB 5HZKA 2FZ4A 1IY1A 3FKSD 4Q9IA 4TSFD 2SHKA 1VMAA 1TL7C 3WBJA 3REFA 1ZM7A 1P2VA 4V02A 1NG1A 4KAXA 2GZDA 3ZYCA 1LTQA 4DSUA 2FH5B 1IONA 2DYKA 2I4IA 1RVDA 3I8XA 3THYA 3AVXA 1L7VC 2F3RA 3FB4A 3KXKA 2OFOA 4I1UA 2QSYA 3B9QA 2ZPTX 3K9HA 4MRPA 4Q9KA 3IO5A 2R6CA 3K8YA 4AC9A 1IXRC 4TMVA 1N0VC 3JVVA 3QXJA 2O8EA 4DZZA 2ZSFA 1E9BA 2GJ8A 1DPFA 3L8YA 3QVUA 1H65A 5A0FA 1DO2A 4C0BA 5LD2B 1YZQA 5GJBA 4LPSA 4KHZA 3D31A 3U44A 3AUYA 1Q22A 1Q20A 4CEJB 5J4LA 2BMEA 3UXMA 5FOTA 1KI4A 4G5GA 5GVSA 4CRWB 2XSZD 2ORIA 1OW3B 1OXTA 1ZVQA 5EE5B 2V7QD 4LWZA 5E95A 2QU8A 4DLWA 1WBDA 2HXSA 1O3YA 1QHGA 1XEFA 1Z6TA 3W8NA 3W5IA 1T5IA 4D4JA 2XZLA 3PEYA 4HLCA 2FSIA 4A82A 2AKYA 2AWNA 1MABB 3PENA 1OE0A 3V4RA 2F9LA 1ETUA 3P4XA 2Q3MA 1VCOA 4QBHA 5FTNA 1AGPA 2QMOA 2R8RA 4LGMA 1RIFA 3UK6A 4ERNA 3BC1A 1XNJA 1S8FA 4B35A 4LYHA 3OEEA 3W6PA 3LBIA 4XD7A 3ADDA 4A0RA 4JL8A 1E1QD 4PAMA 3ZIAA 1XTQA 4PZYA 4Q00A 3LLMA 4HUQB 2QM7A 3U7FB 1Z3IX 4K46A 4URZR 1TQDA 3ZZ0A 1AK2A 4HDOB 3X1XA 4TLDA 4B2IA 1N6OA 2HEIA 2JLVA 4V0OA 2IYLD 2QROA 3IPYA 2V7QA 2IX3A 3EIHA 4UJ3A 3NBZC 4H1VA 3KQLA 2ZITA 1JAIA 1II0A 3EPLA 5DISB 1OH5A 1XZQA 2TMKA 1BS1A 4B3BA 2FF7A 4QJ5A 3O8BA 3NBYC 1JXMA 3BAFA 3M0EA 4LX0A 5SZJA 4R71A 1JXOA 2EWWA 1TAGA 4HZIA 3B8HA 1N0WA 4JVNA 2IS6A 2WJYA 3QKSB 4LK2A 2WTUA 2WKRA 3BBPA 2O8CB 3EZ9A 2GESA 1W0KD 3OFNA 1E79D 1UKYA 5KDOA 2CLSA 4UNNA 1KO7A 1R5NA 2NO9A 2IF2A 3HU3A 3WYAA 4DEYA 3AVUA 2RGAA 4EUNA 2ZUCA 4P33A 3W6NA 1PLJA 2K5UA 1E2MA 4OYHA 4B3XA 1W36D 2E9SA 1Z0FA 4A9AA 4C7OB 2QY9A 2OZEA 1JQLB 3LAWA 4W7SA 1KGDA 3B82A 1DEKA 2FEMA 4RVCA 5F2EA 2IYUA 4Q4LA 4P31A 1TU4A 4JSTA 4LYJA 3A1UA 3AB3A 2IYYA 3HR8A 4M9SA 2FFHA 2C9OA 1G8GA 3NXSA 1A1VA 2HYIC 2O8CA 1S4QA 4IOLA 4QBGB 5JCZA 1E2KA 2NTYC 4ZDKA 4NL4H 1E9RA 2A5GA 4KCGA 4Y0AA 4JLAA 5DYIA 2CNWA 3CWQA 5GJCA 1KKMA 4Z51A 2ZRMA 1ODFA 1N5LA 3DKVA 2ZRIA 3KFXA 3SNHA 2P67A 2IYTA 3DOFA 1SXJB 4OHVA 3THXB 1OFHA 1XMJA 1OFIA 3ADKA 1JNYA 2VYFA 4IHQA 2XAUA 4U5XA 4E03A 2EFDB 3MWYW 1E2QA 3L0OA 3PUXA 1W5SA 1VTKA 4O3MA 2F6RA 1KDOA 3ECCA 4KBGA 2D2EA 2ZJBA 2VEDA 3AP1A 4RD1A 1OYYA 1E9FA 3AV0B 4LBZA 2WWXA 2NIPA 4O25A 1IN7A 1II8A 3GD7A 3MSXA 3LV8A 1KDTA 1OKKA 2IXGA 3QVVA 3FPAA 4E07A 4D25A 2LWIA 1E9EA 1G291 2WAYA 1JQJC 5AUNB 4TL7A 2IHYA 4TYNA 5JMTA 3C5HA 2GVZC 4NYIQ 2FDCA 1YQTA 4I81A 1ZP6A 5KPJA 2REOA 5DN6D 1GAJA 3EASA 2IYZA 2VBCA 3AKCA 1E0KA 4RKEA 1YZTA 2A2ZA 2BJWA 1CIPA 1D5CA 4OJQA 2G83A 4GP6A 5AWFC 4RFSB 3SE0A 5J4KA 1OHHA 3U6BA 4H1UA 1ZRHA 3NHBA 4CVNA 1GKUB 1F2TB 3U3RA 1E2GA 2ODWA 2QAGC 2V1UA 4HLUA 3IUYA 1BOFA 1UDWA 3KFVA 4KSBA 5BXQC 1U8AA 3SYNA 1CU1A 1VIAA 4ASUD 4WOPA 3K09C 1ZINA 4Z1MD 1OH6A 1BMFD 4E22A 2ZRGA 1FQKA 3HR7A 2WWWA 1VHLA 3KZ1E 3EG5A 4KSCA 3HWSA 3AKEA 5EZ6B 4L9SA 3FHOA 1HT2E 3TR0A 3PUWA 1FNMA 1KO4A 3P27A
chains in the Genus database with same CATH superfamily
4MUHA 1YWGO 4A8JB 4DIKA 2H0QA 1TUBA 1Q44A 1U2QA 4E7OA 2QGNA 4ZOBA 2ZT6A 1XEXB 3NONA 4L5AA 2B36A 3PVCA 3VKVA 3DE2X 3REQA 1G21A 2GPAA 3NBFA 1FMFA 1FL9A 2QLNA 4G0PA 3TKLA 3GVIA 4OH1A 2CVQA 3A1DA 3N2KA 3OQVA 3L06A 4JL6A 1PR5A 3W4KA 4E5VA 5B36A 2WWFA 3G0OA 1XL1A 3FG9A 2EKQA 4WAUA 1XF1A 2QYTA 3N53A 5A7GA 3L7BA 3R7SA 1QYRA 2NOAA 1QLWA 3HLYA 1SPBS 3TCXB 4XR4A 1UPTA 1E1QA 2KMLA 5BSHA 1YI0A 2I6SA 4C2AA 4K9SA 2L17A 2IKQA 4X60A 3HTXA 4W1PA 1V8FA 1LLCA 1Z2EA 1CUUA 3K9NA 1PK9A 5TLSA 4YRGA 3ONNA 3M6XA 2I2FA 4YHBA 1KQFA 1OXXK 2E18A 2ZRLA 4KQEA 4XAQA 2JIPA 5K4HA 3EK2A 3TOVA 4P3KA 5CB6A 1SG9A 1MOZA 1HFEL 1DQSA 2A1IA 2H4WA 2HX1A 3QLEA 1EE1A 4BNZA 3PXAA 2QI9C 4BO3A 1KO8A 2C9CA 4Z7NB 3LC2O 1IHDA 1U31A 3QBDA 1FFHA 4IGAA 4N40A 4DL9A 4URVR 4OI0A 3KSUA 3ZW7A 4HNVA 1T15A 5CDSA 1BGWA 4DPKA 1CRWG 2QN9A 3RD5A 3GUZA 2E85A 2QUHA 2QLMA 1XKXA 2GH1A 4L5CA 4GM1A 4PR0A 1NBMD 1Y6JA 2ST1A 3E9NA 4JU9A 1Y5RA 4ENPA 1DWOA 2L82A 2FSVC 2VWQA 3G0IA 4ZOQI 3U80A 1FVXA 3PXBA 3EDQA 4LRUA 4FGJA 2BGIA 3A11A 4ZI2A 2GHIA 1JE0A 1HT0A 4CM8B 3OHMA 3WNQA 3LC1O 1E2NA 2NSHA 2QN2A 2YIMA 3C14C 1TCUA 3D7MA 4CMAA 1W4LA 4CL3A 1EDBA 2FJ0A 4KQCA 4F4CA 5K45A 1UC9A 3K70D 3ILYA 2M1ZA 1YTLA 2WG0A 2WM3A 4RACA 4AUKA 1BW9B 5JANA 3JQAB 4FC7A 2PRKA 1ULBA 2FPKA 4GUAA 1YKFA 4XA8A 5FCDA 3QX7A 3WLMA 1OZGA 5T5QA 1EXDA 1DGQA 2GX6A 1B0AA 4K5QA 1W5EA 1Z5UA 3OE1A 2JH3A 4IH4A 3TLMA 4EB6B 1P5HA 4PBSA 1WABA 4Z8YA 4DLLA 3K1AB 3MYRA 1ST2A 1GFIA 1F1BA 1I32A 5HFAA 1UPXA 4ZIRB 5LSAA 3CNOA 3IEUA 1QRUA 5DI3A 4U2DA 2OUKA 3HCRA 3T12A 1E3MA 4YRMA 4Z0PA 3VSBA 1DTWA 5LZ8A 2GEJA 2X7HA 1W6UA 3JQRA 3FFTA 4ZO9A 5LR6A 2XNDD 1TEVA 2YOFA 3IKMB 2ZUBA 3R24A 4ITRC 1C30A 3L40A 2A9OA 5IJXA 4MVJI 3MM4A 4KR9A 3TH5A 4DVJA 2X2PA 1RS0A 2BWJA 1HNXB 4B6QA 2FZEA 5I01A 3OT1A 4N5IX 2Y1WA 5CA1A 1VG8A 2CHVA 1W19A 3TG2A 1RQXA 3ETNA 3CR3C 4EW3A 1Q7GA 4ZIRA 4QZVA 1FDRA 1SD1A 3TI7A 4HDNB 5H70A 3UAVA 4RZ2A 1Z7EA 4PHCA 4AJEA 2HT6A 2XDYA 3G89A 2OBFA 2IBMA 1I7NA 2ZI6A 3F5FA 1KOJA 2EZUA 4M37A 4WZBE 3RE1A 2VDVE 2RG7A 2Q5IA 4RJIA 3IE1A 1E0AA 2FW9A 1M1XB 2MYPA 1SVLA 3GZ4A 4M87A 4UBNA 3RROA 3UNXA 3GEHA 1BX3A 1V1MA 4FS3A 3FSRA 3E0XA 3BRCA 5DLPA 4JP2A 1GPJA 3OT1B 1T1SA 5CFQA 5HKOA 5KUTA 2JGDB 1KORA 4Q9AA 2XB8A 5ALHA 1K08A 3WV5A 2F2TA 5FA8A 2JJQA 3O8OA 2Y6VA 4WV3A 3JD2A 2JLWA 1Q77A 4YR7A 5GIOE 1CUJA 3NC4A 4MQ6A 2D0IA 4DWOA 1EX9A 1KI2A 1Z6AA 2AFHA 3IP5A 3NOXA 3OZXA 3HJHA 3I9NA 5TPWA 3WRYC 1TIKA 3CG0A 3S99A 2Y6UA 5LMZA 5KJ1A 2V6BA 2DT8A 3T4XA 5FA5A 2P6UA 3FHTA 1KSHA 2PWAA 4IL5A 1S2MA 5DZSA 1C9DB 3BMQA 3C1TA 4JS0A 4UDYX 3UB2A 1QVRA 3F4LA 2C59A 3QPVA 3WWZA 4EKDA 1XDSA 3ASZA 1O0BA 3PHJA 2ATIA 1B6RA 3UQYS 1X8LA 4R9UC 2B78A 1P31A 2X19A 5JCJD 4IIDA 1HLDA 2EXXA 4LF8B 2PYDA 1WZ2A 4PQRA 4Q1CA 2PNFA 5ES3A 3B78A 2GAJA 3PL1A 4UHDA 3H5NA 4RU1A 3ZUPA 4CCYB 3EMVA 3NOOA 5LZ5A 4WIAA 4S2UA 1K75A 3B89A 2QL6A 5B37A 4PC1A 4RM3A 4YJ2B 1I6WA 4B3IA 2PUDA 2IEYA 3A58B 4ZALA 1XFAA 5KQPA 3KB8A 3TIFA 1OPXA 1NQ5A 1VIDA 4CDNA 4CDMA 4DQUA 2HF7A 2I3DA 1IIRA 4BVJA 2PUAA 1TT5A 1AK1A 5TF0A 2NVBA 2JJ1A 1KVRA 2CXRA 5U4XA 4RQAA 1SHTX 4XVRA 2GERA 4BIIA 1Y3AA 3WZMA 1NKSA 1S2DA 4JL5A 1UK8A 1B41A 1XZEA 2A5FA 2IYOA 1NFRA 2QN3A 2VP2A 3K1TA 4KFRA 4LYEA 4TYQA 3RK4A 4NZYA 3KKNA 1XRJA 2AUMA 1KY5A 2ID4A 5EZ5A 4OJMX 2IQ5A 2D5LA 4KPUB 5C1BA 2FPLA 2QBYA 2P6NA 5T4EA 1UIRA 7MDHA 3PS9A 5EHZA 1QLHA 3BB4A 2FUG6 2XHEA 3P71T 4PO9A 1U0RA 2JJMA 2P2LA 4AP5A 1Q50A 1D2CA 4B3FX 3HC7A 5JY1A 4JOBA 5CX4A 4J4TA 1LK7A 5G0VA 1UAYA 1Z2NX 1YJXA 2CMKA 2DWCA 3UOAB 4K3VA 3RVRA 2NO1A 1JG6A 4XM1A 3W8FA 4DJJA 4JHLA 4ARCA 1SHJA 4J91A 4Q1DA 5BQ5A 4CFSA 1JDSA 1HFKA 4A8JA 3VKFA 4JWKA 2D2XA 4EHNA 3BKWA 2IY9A 2WIBA 4E6EA 1I1OA 4G84A 5IABA 3GCGA 1Z8HA 5B7PA 1G21B 1XG5A 1KS9A 3GLFA 3KSAC 2YHAA 1KIMA 4EMSA 2XIJA 4YRKA 1UZNA 5BQXA 1Q14A 2OHOA 3R41A 2OCKA 4NFYA 4HDMA 3HCDA 1G59A 3TX6A 4N6GA 3DBRA 4ZJYA 2UUCB 3IAS1 3FDZB 3I1FA 2Q5CA 421PA 4L75A 4RADA 5LWHA 2B4AA 4RYDA 3PQ2A 4X91A 2GD2A 3A6KA 2SCUB 1DIBA 1FA9A 3GJTA 3FYUC 1MQSA 3FKSA 5IAGA 1L3IA 3ZE1B 2B1JA 1LSUA 1OQAA 3MB8A 5HKKA 5JQWA 5LNK6 3UPTA 3WLRA 3NCTA 1SZJG 1DLJA 4RPCA 4ZYVA 1JT2A 2NU8B 1B0ZA 3SQWA 1KI3A 3EXHA 3ZWMA 1GZSA 2C7OA 2QRHA 4BKUA 1TVEA 3OQHA 2ZB3A 4WA7A 2H29A 1AKUA 5DCLA 3AVYA 2M1XA 3SBEA 1VB5A 2JDID 5K4AA 4LC1A 4XOUA 4JX8A 5DGCA 2EZ9A 4KXYA 4EK9A 3VHLB 4Q5IA 3PIDA 1LNQA 1UJ4A 1ZM9A 3PTLA 3WO0A 3D2BA 1ZIXA 1L7EA 3DLAA 1JIVA 2VSYA 5BSTA 1ADFA 2O8NA 5KSZA 1STOA 2ZSEA 2GEFA 1AMUA 3IXLA 4DMRA 5EWJB 3D7LA 3AP2A 1VJ0A 1TZMA 1UJBA 1DBSA 4QVKA 1ZNQO 2G09A 2G4VA 2P2CA 3GCDA 2P78A 4A8PA 2PLFA 2I66A 4LOAA 2BOVA 1K6MA 3EIQA 4C06A 4X9XA 2D54A 2W98A 3IMCA 3RKUA 1BEZA 2AFHE 3RANA 5M2QA 5JNRA 3E58A 4FKBA 4OHWA 2XGMA 2VDQB 2ZRDA 2B61A 3MD0A 3UJ7A 4K0KB 5G4LA 4BBZA 1O6ZA 2G4LA 5IX8A 4QNMA 3TZQA 4DE5A 1GZ6A 5KQGA 1ZOSA 4O02B 3V3KA 1EK6A 3G9UA 3HBFA 1T36A 4WLOA 3GQBA 1JDBC 3ZD9A 1U3UA 2OK7A 2R8EA 1A69A 3T5CA 4GS5A 7MHTA 3QMWA 4H9GA 5B55A 4TLAA 1DAKA 3EZ6A 4EHAA 4YJ3B 1CUDA 2X77A 3ND8A 4HOYA 1H2YA 2JD2A 3HSYA 1I01A 1Z22A 3SYLA 3DOOA 1SWVA 5ALSA 1JLLA 5KHAA 2AMLA 4BVHA 1HDYA 5B58C 3S2UA 4COKA 3JRWA 1R2QA 4G0ZA 1GZHB 3W5JA 3DKRA 1ECPA 2ONZA 4EJSB 4LNUA 4D98A 5JH7A 1YDHA 4YDSA 3PHCA 5K09A 2O8FB 4QUJA 5DEIA 3B13B 3GL9A 1ZIPA 1RE1A 1IPEA 1NBHA 2OOSA 3F4BA 3SZMA 4DDVA 3WKBA 3IB6A 3LVRE 1YDFA 3EXIA 4U3JB 1NR1A 4Q19A 2BV3A 1C8KA 3DWFA 3QKRB 1UC4B 1HQDA 4HXEB 5J2TB 4DBVO 1TUIA 2DBQA 3OMWA 4UFPA 3SR3A 4S35A 4J9UE 3LWZA 1S7CA 2DQZA 2ZQYA 3G2IA 1JH8A 1KEUA 3Q3GE 1W36C 3RT7A 3IBTA 2W93A 1DCMA 3FA2A 1L5LA 2PWBA 4GBJA 3QYFA 3AY6A 2OE2A 2G5TA 2V45A 4JLMA 1F3OA 3FMPB 2ZAIA 4HGOA 4K87A 4LYAA 4V0MA 3VO8A 2E6UX 4U7WA 4NPHA 2QR2A 1DLIA 1MVOA 3B2QA 3HU5A 1MGPA 5D5HA 4AURA 1MJGA 3FPEA 1NULA 3DMNA 3WR5A 3FAKA 1Y5NA 3OKCA 1K86A 1O4WA 4B5KA 1UBNA 4BMNA 1HT3A 1ZUNB 3C41J 3RJ5A 3T5PA 2AJLI 3JWHA 1FP4A 4E70A 3UV6A 1N6PA 4XWWA 4KR7A 3WL5A 3UMFA 1S3GA 4H3HB 1OT3A 1BMQA 4DMGA 5TPWB 1TZJA 3RFCA 4Y30A 1OREA 3IKLA 1A2BA 3NHAA 5AK3A 2ZIGA 4I1RA 3DTTA 2RGBA 4TX1A 3VPXA 3QU2A 1KA9H 2BFAA 2VP0A 3U7JA 1CF4A 3FDIA 5BPFA 2VKQA 1LF5A 2YW2A 1Q17A 4MHSA 3G17A 2GBCA 2VJDA 4JJ7A 4OG2A 2FQXA 5L45A 5F4ZA 2PO7A 1NHGA 1QAMA 2FWPA 3LECA 3EXAA 3GR6A 3NASA 1UC5B 2QRJA 3TMAA 2HDOA 3EPPA 3ETGA 5B1HA 1SKAA 3JVDA 3G7NA 3OTOB 4N41A 1EFRA 3DMTC 2GKGA 2CVOA 3BZWA 4MINA 5DOVA 3VV3A 1OROA 3F5DA 3LHDA 3O2QB 3IUSA 1FMLA 3P5BA 2B34A 2IYWA 2OORC 5CIYA 3ETDA 3FE2A 3BWDD 1CEYA 4M7WA 1SXGA 3H5WA 4W1SA 3JAKB 5ILGA 1AS0A 4A23A 3TOSA 4WZAB 3BSFA 3GLTA 2P9BA 3NATA 4MV3A 1NN0A 1R64A 3SEAA 3W2TA 1CC1S 1SBQA 5F2NA 1V4BA 2FGJA 3PNSA 3K0AA 4KQIA 5D51S 1ZM2A 3ZIDA 4H7EA 4J07A 1XDZA 1P75A 2WFMA 1A5SB 3E9CA 2RGXA 5JRJA 3KETA 2BEVB 3TJMA 1A4IA 1Q6YA 1TT5B 4FYIA 2HA2A 4KWCA 1SVIA 1Z6ZA 1RHJA 4TSRA 2K6GA 4IIYA 4NONA 3BH0A 3QX9A 4MR9B 5J5VA 3UB3A 4ANFA 2GBLA 3IURA 3OKPA 1T3GA 3R3VA 4X8MA 3KO8A 2F3PA 3O47A 3K0FA 5DNCA 3GNSA 2VDWB 4LXGA 4C7BA 3ODGA 2DCUA 1FFAA 1P74A 3L7AA 1U0JA 3AP3A 1J42A 4CWAA 5CVTA 4MW6A 8ADHA 5G02A 5DM1A 4ATNA 5JS7A 5CCXA 4CV3A 1CQJB 1TECE 4N9WA 5DNDA 4QLBA 5BV0A 5HX7A 5K9ZA 4A15A 4YCCA 4BZQA 1K5HA 9LDTA 2HJVA 4DB4A 4JOSA 3BCHA 5KEIA 3PDUA 5A62A 2O5CA 5CITA 5IBCA 2GXAA 1SOWA 2MTBA 3DDCA 1RI1A 1ULTA 4RSRA 1NONA 1PX2A 3B53X 2EWMA 3WTCA 3E84A 1U0OC 1DG9A 3TD6A 2YCLA 3QGMA 2GJ9A 1XX6A 1MA3A 2HF2A 4ASUA 4URUR 4DDKA 2HLPA 4EY7A 3SQXA 3B8EA 1QQBA 5EJ8A 2DWPA 2QIOA 1SNYA 3HCFA 5LLSA 4J16C 3BWCA 1SCDA 4KRGA 4L5JA 1B42A 3T5GA 2XQIA 1RWNA 1GCGA 1FS4A 1I13A 1UR5A 2VDKB 4JYMA 5AJZA 2F43B 3WHPA 5KC9A 5KU7A 2WWTA 1QRTA 2O54A 3BGSA 2JCBA 5JZOA 4RENA 4HQOA 4FFMA 2WNIA 2AZ4A 1U9IA 1G5RA 1G8PA 1CYDA 2WKQA 1LDGA 3M6LA 4KQGA 1ELOA 4J1QA 1GA6A 3T95A 1KI7A 4UFNA 2WPDA 4IIXA 2ZETA 4RZIA 4DJ5X 3ROQA 5T7BA 5A7HA 2O8DB 1M2EA 1NQVA 3O4GA 3IEIA 3QWHA 4PSKA 3QXXA 2VJAA 1CQZA 4V0ME 2AZDA 1PR9A 3NQ41 4KWHA 2P9GA 1BDMA 4LJ6A 3T7IA 1Z73A 4ZGBA 3V4PB 1PQ4A 4BLRA 1GPDG 4CUZA 1ISGA 3NDBB 1X8JA 3TJZA 2GLTA 3KSZO 4I0WB 1ZOIA 3MFYA 3HEMA 2PWYA 1IU9A 4M1QA 1TPYA 4BNKA 2D3WA 1FVFA 2QJRA 2R65A 4C3ZA 2KI5A 1LZLA 1N8KA 1Q0ZA 2P0EA 2ZLBA 5DBOA 5BN1A 1ZVJA 8ATCA 1XA3A 3PEVA 4D9CA 4TXHA 3PLAE 3QG5A 5LYJA 1O95C 4FQ8A 1E3EA 4OSPA 2OA0A 4I6GA 1YRYE 2Z6VA 3IPCA 5HF9A 3W4IA 1T6ZA 2WVJA 5JVDA 4R1PA 3VHRA 4NENA 4YRNA 4AG6A 2YYSA 4YMWA 1EFRD 1SXJD 3FNFA 3TIIA 2Y92A 3W1VA 1H4TA 1N6NA 3P4YA 2ZKLA 3UICA 2XV1A 2VPXA 5LLDA 3DF9A 1V5WA 2PR2A 3HUUA 3L5OA 5EI5A 4F4FA 2AR9A 5KYKA 4ZI7A 5LN1A 4G89A 4OHUA 1AKRA 2GCOA 1ZAKA 2JRLA 4B82A 4QTYA 1KWGA 2IP4A 3WLTA 4TLEA 3I4FA 2V7WA 4KDCA 5EWLB 5A4KA 1Z37A 4B83A 1L1QA 1APBA 1ETHA 4J7UA 2C5FA 2RSLA 5C1DA 5ADUS 1SCIA 5FTMA 2CXNA 5JZ9A 2P8JA 1A9OA 1E32A 3SYMA 3ZHRA 4CDGA 1D4AA 1YQEA 2WF8A 2JH8A 5ALDA 4D80A 4HBGA 2IYEA 4ZYXA 3QE3A 4YC7A 3CF2A 2C78A 4FOLA 1N2BA 2NSLA 2QM0A 4WESB 3ORQA 3X2FA 4FU0A 1CHNA 2DSTA 3UAZA 3WMGA 3PEWA 2GJKA 2F8MA 2VXCA 4HVLA 3AWDA 1E2IA 4I7EA 3ZVMA 5TJHA 3K7EA 1E0DA 5HKLA 4C5AA 3TM5A 5CFPA 4RTQA 4PHHA 3F3MA 1P19A 2A5DA 2X76A 3BFJA 4G2TA 4HNRA 4QBIA 5DXFA 5HW0A 4GOOD 3CEJA 1SC9A 4RCYA 1PS8A 1VYUA 4ALJA 3AU9A 2W6IA 3O4VA 3JWIA 4FDLA 1M34A 3W6OA 4LJRA 1GADO 1GUYA 4HDSB 2ZUEA 1JG1A 1M3SA 3FZGA 2PMKA 3OURA 3WWEA 4KMRA 5AUPB 1L5MA 2BEWB 2OCBA 2Y0DA 4UHKA 3WYNA 4DT1B 1RZRD 1RXWA 9MHTA 3RVMA 5KNDD 1GNPA 4CQJA 4TS3A 1G38A 3NVMB 5AHRA 2BGMA 4OQPA 3VU9B 1J7KA 3K9LA 2JLSA 5C34B 5JVDF 1Q3HA 1E1CA 2HA6A 2A35A 2Y1GA 5T67A 4UNRA 3MERA 1ZM3A 4DANA 5HRAA 3QF4A 4L51A 3IESA 5CG1A 3CLUC 4QPCA 5D7NA 5EHQA 3T9BA 4EVIA 3RYFB 1EQAA 2XNJA 4XLZA 5FWNA 1R12A 1D0IA 2XWBF 1ZGBA 2CHQA 3HU1A 2WUGA 3HWWA 5I8PA 3PXXA 3T94A 1WP4A 2BSXA 1C3EA 3CVOA 3I23A 3Q1KA 4ZKEA 3ZHYA 1Y4DE 3FPGA 3FBWA 1RBMA 1G2QA 3K5HA 4LVOA 5LIPA 4XCQA 2WF7A 1YF3A 2ODAA 3IR5A 4GSYA 2IDZA 4M4SA 1Y7LA 1GUZA 5CW1A 1BDIA 4R51A 1D03A 3WGQA 1JTVA 1OT5A 3I4LA 2MMGA 5TQ0A 2O3RA 2C5LA 4YRQA 1N77A 1AVTA 3T1OA 1Z39A 2DHEA 3VBCA 3RSCA 4NE9A 4Z3DA 3ZCTA 4EFDA 5ALGA 4ARBA 1Y3IA 4RZSA 1V11A 2OD9A 5FUYA 3PNPA 2J31A 2E4XA 4JUBA 3U9LA 1RLIA 1TA4A 3K5WA 4TV8A 5EAIA 5EYPB 4R2IA 5HZKA 3V3TA 1BYUA 4ACAA 2E1RA 4AO8A 4A10A 4OSEA 1YVUA 1I3CA 1RTTA 2VZLA 3PC8C 2ZRCA 4XB2A 2ZRKA 2NGRA 4UCQA 4AKIA 4YAUA 5TS2A 2OXFA 5T4BA 5KINB 1U0SY 1MC1A 2YWBA 4KODA 3NORA 4YP0A 1MT3A 2BKVA 2RCNA 1XD2B 1Y34E 5IVIA 2QX7A 1XYYA 3FCYA 2A88A 1TQ6A 2MIIA 4A0QA 4BNWA 3DQZA 1VJTA 4URHA 3RTDA 4YQYA 4LYFA 1YR9A 2PX8A 2VZ0A 3IUMA 4J0EA 4P5PA 4DY4A 3KWJA 4YMHA 3A1FA 1Z7BA 3MN1A 3NP9A 4MEAA 6AT1A 1DIOB 2OXCA 3L8EA 1MC5A 1ZN2A 4UE3S 5F5LA 4A8JC 2FEAA 2WV7A 4YHHB 3GUVA 4QNRA 1N8TA 5AKHA 1RXVA 2WWIA 1A50B 3TG8A 4HDKB 4GIBA 1PFKA 1SA0B 2WK1A 3ILXA 3WGVA 2OFPA 3MRVA 1FFGA 1FFBA 3QK7A 4DLUA 4O2BB 3RJTA 1DC4A 3C3XA 1IZ0A 4QNNA 4RCZA 4WZ6A 4L08A 2JGAA 5CDTA 2G77B 2YMMA 3SU8A 1ZGZA 4LSZA 1WQ1R 4JVLA 3ORYA 1T0BA 1D8TA 2GJSA 3B6ZA 4J94A 2CEKA 4MH0R 4WXYB 3LA6A 5FPYA 2FPPB 4BATA 4LFBB 2I76A 3GUYA 2C4KA 3MMXA 3ROFA 4UBLA 3STXA 3E22B 5A9RA 2GWHA 2IUTA 5IDYA 3E81A 5KVCA 3HB4X 4TQUS 2CD9A 4TV9A 2LZ0A 2OP1A 5ECYA 1VGQA 2Z2KA 3GFRA 2X5JO 4D7AA 4D81A 2JB9A 1ZZGA 1HNNA 1OZHA 1R6VA 3RCBA 1XVAA 2Y76A 5AM3A 5G4KA 3FYHA 3U7GA 4CKCA 1W88B 2WFLB 4ZICA 4IUBS 3NX4A 3WISA 4RK6A 3AKYA 3FJ1A 3G2LA 4KZKA 4RGYA 3QPDA 3V7WA 3ZXXA 4EY5A 2Q6VA 1TJ5A 5JCOC 4UVIA 1AGYA 2I6TA 3DBVO 3FKQA 1L3CA 1XC7A 4L3OA 4BPBA 2YJ5A 3H9BA 3FTNA 3DA8A 1C5KA 1RHMA 1B0UA 1V6AA 4FGZA 5AVRA 1TK3A 4RYLA 4HN4B 1EQ2A 4XPIA 5F1YA 5H82A 1QVAA 4PSVA 2ZVDA 2XMDA 3W4JA 2I67A 1FFXA 1G5FA 4KEAA 1PZEA 3ER6A 4V0KA 3DLTA 3TXYA 4CM4B 1ATZA 3M3HA 1EG2A 5FI5A 2PQ0A 2NUAB 4ZHQA 1XCOA 3P0FA 1HM5A 1KQPA 3R6WA 5TXGA 2IUEA 3RS5A 4KX3A 4BNIA 3FUCA 3AGPA 1QGDA 1VLMA 3E48A 4EYSA 1RYHA 1TKCA 2DUNA 2P5UA 2C4NA 3ZD8A 4LN1A 3N3BC 4DM4A 1NRJB 4IG9A 4FXPA 3PQ8A 3WNBA 8ABPA 3VGPA 2XCQA 1S1MA 3EWAA 4PVDA 1P1FA 4N82A 5L6LB 3IOYA 2UZ3A 3KOXA 4QPZA 3BFKA 1EGVB 3VUFA 3A05A 1QGYA 2ZE7A 2WVGA 3A4TA 4EA6A 1KZGB 1EUCA 4OGGA 2J09A 1SCUB 2HREA 5EXDA 3KAQA 4KR2A 3WLPA 4C20A 3UUFA 1JALA 1OH8A 2GN8A 3T41A 1RJ9A 3ZJVA 1YKGA 1AS3A 2FETA 1GAXA 2CCKA 2WUEA 2J0EA 4EARA 4CF4A 1RP7A 1FPMA 1YJQA 3IPXA 1NVDA 4YV0A 5I9SA 1L5WA 3MWEA 3IIJA 4Q16A 5T57A 1LC0A 4CR7A 4ZVQA 5C5CA 5I7VA 5DTMA 4MI1A 4IMPA 5CNKA 4D96A 3QSYA 2OYSA 3RFUA 1L7NA 4JA0A 3D2AA 4QTTB 5EUMA 1NGSA 8MHTA 1RHRA 2O48X 3KU1A 1ZJYA 2A9KA 2J5RA 4Q3KA 4F6CA 1E64A 2CWWA 5DX8A 5EN4A 4NCAA 2O0KA 4FUTA 5DW3A 2YJ6A 5FORA 4IO1A 2I91A 5E6SA 1WE2A 2W42A 4M2LA 1DBRA 1RE0A 2ZANA 3N1UA 4OL0A 2R9VA 2G0TA 2ZYTX 4WLEA 4ZV9A 1N2OA 1ZJZA 4XD2A 2X0FA 2BHRA 3X1WA 3UJ6A 2Z57A 4L7VA 4U39A 2HHHB 3PT9A 2JFPA 2X4DA 1AGXA 3TB4A 2AF3C 2C3YA 2PUBA 4DLYA 3H0CA 3GH1A 4B4WA 3JQ9A 5LIRA 5ITWA 3PQ3A 2OFFA 5J2UA 4AQYB 3EWNA 3F97A 1TIPA 1UODA 1PJQA 2YH2A 3A9WA 3WL6A 5LFAA 3K0EA 1U4NA 2ABWA 1W0JA 2D7JA 4DR2B 4XGIA 4W5RA 1EDDA 5AM5A 4KFTA 5BO5A 4GKAA 1VPTA 1YQGA 1RBZA 4A1FA 3F49S 2AYZA 1VM6A 4GKBA 4HEA1 1A4RA 4UAGA 4F9EA 1OOEA 4HS9A 4NEQA 5CUQA 1RAIA 2CE2X 1Q6ZA 4YT4A 2H1VA 2CUNA 4J1NA 1GGNA 4BPRA 3D7SA 5K2MA 3EGDB 4XUGB 2VT7A 1HDIA 4B9EA 3TF5A 1AX9A 3N7TA 4P36A 4WX2B 1UMCB 5DNVA 3TCNA 5BRJA 4OMFG 4E14A 5C7OO 4J9VA 4FILA 4OF4A 3LNTA 2K7ZA 5IVKA 4F3TA 1E1NA 2ZCVA 5CGZA 4WASA 3AR7A 2C92A 1N1MA 4NE7A 4ZKDA 1WLYA 5HE9A 2I7CA 1U7PA 3RQSA 1CJBA 4TROA 2ES4A 4LOJA 1A7AA 4J1TC 2Y77A 5ECWA 4N8EA 4PAWA 1KJJA 5CAEB 4BQPA 3Q7SA 4BCCA 1PVOA 1FZQA 1NUHA 3ONVA 3QXSA 1KYXA 3P96A 5AKYA 2C2WA 2X8LA 5B3JA 1QF6A 3CWCA 4YJFB 4MWSA 4Q15A 3TL6A 5JAMA 5E3IA 2I1QA 3GT0A 4BFXA 2EU8A 1FX0A 5JCPA 5LOVF 4Z3OA 4ZRDA 5JC1A 1FXWF 5DN9A 3NHMA 2GARA 1T5DX 5BVGA 5ERYA 3D3EA 2EX1A 4BQQA 4A0FA 4AZSA 3TUZC 2QI9F 2G9ZA 2XWSA 3EBPA 3KYBA 2HF8A 5A06A 4GX2A 5DBHX 2GAAA 1H5NA 3NALA 4X63A 1ILWA 2O2DA 2XWQA 1XJ5A 3G0DA 4YUVA 2GXQA 2P4UA 4J7CA 4MOWA 3QW2A 3W06A 2FU5C 3EDRA 1L5YA 2CW5A 1PSDA 2NQTA 2KBFA 5KJ6A 4DR6B 3B3FA 4OHCA 5SY4A 4FZ3A 2AC2A 2GTHA 5J59A 2QD1A 4CKWB 4MLDA 1Z4LA 1VBNA 4P4SB 3ZY3A 5HUJA 1OLXA 1L5HB 4TQ9A 4P9NA 4BMOB 2LIPA 3P2EA 1NMEA 1YZKA 3CR7A 3R3UA 4JWTA 1IPHA 1AUQA 2ZJ1A 4N5LA 1FS6A 1NSYA 4XGQA 3WQBA 3RAFC 1Y8RB 2RAVA 3FNBA 4R7GA 1JIIA 1BX1A 3KWFA 3I01A 3LRTA 4JKOA 4M7OA 2B1GA 4BGUA 2RHHA 4LI3X 4D4HA 4KREA 4TKUA 1Y3DE 3CR8A 4R8VA 2V7EA 3MGCA 1S2GA 4J0JA 2CLHB 3JQ8A 3L01A 1Q1NA 1GAQA 1QYVA 4NCHA 3GEEA 5KNCH 1KJWA 3L1VA 1E99A 1J8YF 3TZEA 4CMJA 3INRA 4JCOA 1SRQA 2BMWA 4I1IA 2ZSHA 3IUQA 4WCFC 4CT0A 2PKEA 4GSKA 1T8PA 2AFIE 1ZCAA 3CZ9A 4OM8A 5IANA 1LNSA 1YR8A 3SS8A 3MRTA 3GA7A 4TL9A 2L0XA 1GPLA 3CRNA 5FNVA 3TLJA 1XTPA 2C3UA 4HYYA 4BWGA 5AJUA 5FO0A 1VL1A 2LD4A 3W04A 5JAPA 1M2JA 4BFLA 1FTGA 3BMXA 5JSZA 2VUSA 4WLFA 3R74A 4MAAA 4Z1MA 5A4AA 5L3VA 4OHKA 2SKDA 5BURA 2QX9A 4AT1A 3TTWA 1UK6A 4KUHA 1WZCA 4WN9B 2GSWA 2RKOA 1A4XA 4IXWA 4ZCMA 4O1HA 4QUKA 1KNXA 3MTEA 3WKCA 1XAGA 2QRZA 3GMDA 4U9UA 1G66A 4W9NC 1FU4A 1PU2A 1BIFA 1TRKA 2JAWA 1ZJ6A 3OBIA 4A36A 3COSA 1ORDA 2ZUDA 2O1EA 1GCIA 1QONA 1RWWA 2VKTA 5B12A 3OZCA 4O4LB 3OWHA 4YGYA 1OXKB 2DECA 4HDCA 4ZAGA 2PL5A 3HFJA 4AW9A 3E9YA 4BTVA 3JAWB 3D4IA 4Z4EA 2I6XA 3EYWA 5JE8A 2ZYUX 3P9XA 1XNHA 2QZPA 3CKMA 2GNAA 1V37A 4HV4A 5HKKD 1KARA 1IBRA 1R18A 3DR3A 3HBJA 3EARA 4RO0A 3K4HA 1TCCA 4GBED 4MLZA 3KJGA 2XYHA 1IM2A 5ELMA 4B5LA 5G40A 3LPLA 5IXYA 2GO1A 3TSZA 4WOKA 2B5OA 3RYFA 3HYCA 1C0IA 1I5EA 2VSOA 2WOOA 1H3NA 1EX1A 4QOSA 5E2IA 2C2ZA 3IAHA 4R4JA 5LZ4A 2H5JA 2WILA 1DRUA 3FYSA 1DU4A 3KQPA 4R3WA 4WY2A 2C3MA 3IAM6 2PJZA 4CF3A 1JU4A 1EVIA 4BECA 3O1JC 3VKHA 1NE2A 4JBXA 4CM9D 5KTYA 4IEFB 5SYMA 3BOSA 3VPBA 5E4FA 3A4VA 1DC7A 1QUEA 4RZHA 5F78A 5HBRA 1EFAA 4Z0HO 2JKVA 4BY9E 4PLZA 2PZLA 3EZLA 4DUZB 2TMGA 1IULA 1ISJA 1BGVA 1CJKC 1R0ZA 2DBYA 3G6WA 3KSMA 3NIWA 4R16A 3ICCA 5CHEA 4Q93A 1RZUA 1WW3A 2Z58A 2AFIA 2EJVA 2MSDB 1OIXA 2XCSB 1R6XA 3WYFA 4BZPA 4PLPA 5EQTA 3L1IA 4FGSA 1HG1A 1VLLA 3NKLA 5FUXA 1ZH0A 3M83A 3EGWA 1NBME 1Z8DA 3GRYA 5JDCC 3KQNA 3JZFA 3ED1A 2FPMA 2OAQ1 2C8LA 3T3OA 2YVQA 4NPCA 3TRIA 2ZRJA 3F9RA 1N5OX 2PK3A 1RXIA 2W6OA 4IQFA 4JT2A 4C3OB 1V25A 3D6MA 4OXYA 2XCTB 2XQFA 2JA2A 1DJOA 1XRQA 1GGEA 2HPAA 2IYVA 2OSBA 3M49A 2ZZMA 5AHOA 1NXXA 1U3WA 4CCWA 4GD3Q 4AO7A 4PONA 3U39A 4LDPA 1I36A 5E2AA 2CYCA 4L3WA 1ADJA 4PNEA 5JTUA 4PPFA 4JCCA 4LZZA 1XIVA 3ZLBA 4WKPA 3W77A 4QPPA 4BJ5A 4MVJF 4UPDA 3DL0A 4PBRA 5I47A 1VJCA 1WQ3A 2RHGB 3WJ2A 1PV4A 2ZAGA 4PSDA 4GC9A 2CVPA 4QXAA 1YASA 4XGKA 3ETJA 4EG5A 3U1BA 1F12A 1YDEA 1N2JA 1XP5A 3N6VA 4QGGA 3UW1A 3VI4B 2XF8A 3MCAA 3O8NA 5JRDS 1FIUA 4GNRA 3B5JA 1W581 4JEMA 1EHIA 1Y80A 1U8ZA 4X1IB 5EQJB 4UTRA 4GUDA 4R98A 3W3AD 1RWKA 5FTJA 2BFWA 4C0KA 3CG4A 1RKXA 1TF7A 2IUSA 2V7PA 3GRFA 4LXHA 3EY9A 1W75A 5C8YA 2O8VA 2AOXA 1IEXA 2XQVA 1E7YA 2XF2A 2GYWA 2YC2C 3HJAA 3OE4A 1VZ3A 3OZGA 1DQRA 4J8PA 1CUBA 2HJHA 1JQKA 1JEAA 3EVGA 1MP0A 4ENUA 1BCRA 4PFKA 1G6KA 2GS9A 3RH0A 3AR9A 1N0UA 4EG0A 3K0BA 3DTVB 3T1YB 1J5EB 3DMHA 1VL2A 1AKYA 4RH0A 4TRRA 4TV8F 2O07A 4C7KA 2FMXA 2J3MA 3QZUA 1C1HA 1NI4B 2XRYA 3K2IA 1TM4E 4PVCA 1QTNA 4I9NA 1G3RA 4RLHA 5EIBC 5F4BA 5GONF 3SHVA 4F8JA 5IC4A 1UFOA 3YASA 1ZYUA 4GR9A 1WL8A 1NY6A 3GLVA 1F9AA 3BMCA 3EQ2A 3QM1A 1ZH2A 4MKZA 3ROKA 2QNBA 2W2PA 3KBBA 4IIUA 5EE9A 2Q3EA 4G4IA 3ACCA 4Y0VA 3ELBA 4HN2A 3AR6A 2F9MA 4REQA 5DMXA 2WAMA 4PFSA 3K20A 2WFZA 3DWGA 1K63A 5GOTA 1QE5A 1F0NA 3PRJA 1V4VA 3KTDA 4GGOA 4D57A 1R8YA 2OESA 2C9ZA 1Z12A 2PZKA 1TZBA 2PZBA 4D5GA 1TM5E 3RRNA 3UJCA 4JXXA 5CH3A 1H4SA 1NWCA 3I52A 4PXSA 1L4BA 5AJXA 4DS3A 1QFZA 3FIUA 1R16A 1UK7A 3MJFA 4WJKB 4H18A 4RLQA 4UMFA 1ECGA 1K2WA 2D1RA 2Z83A 4FLEA 4KO3S 5F51A 4UUMA 4FN4A 4B74A 2XBLA 2O0LA 3SYTA 9ATCA 1G0NA 1VKHA 3A4NA 4ONEA 2B2CA 1S0UA 5BNTA 1NMXA 3L7KA 3LDAA 3IVAA 5B4UA 2PD6A 5AXDA 3KEMA 5KOHB 2I8LA 5LYJB 1FUUA 5H7XA 1ENOA 2HTFA 1NJFA 4TRMA 2VQSA 3A4LA 1BQ4A 1MMFB 1P7CA 2Q41A 1BE0A 1HEYA 2X9VA 2XTNA 3IBFA 4ETNA 2WF5A 4GPZA 1KI6A 3WRXA 4YMLA 4BO5A 4KXXA 3AYZB 5B3AA 3EDCA 5FLYA 4AY4A 5EZQA 5F3RA 3AETB 1UFRA 3DJFA 4ZU6X 2JHFA 3M6VA 4L8GA 4JBWA 2O23A 1FFYA 4M83A 1Q95A 1F2UB 1QF7A 1EBBA 1VL6A 4FMDB 2A78A 3IO3A