1U4SA

Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedisulphonic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
307
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 115
structure length 307
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u4sA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u4sA02
2WMDA 1NWCA 2DFVA 2HMWA 5GMOA 4CMCA 4TRJA 3ONDA 2JD1A 3K92A 4PZEA 3PFWO 4GLOA 2GN6A 2YDYA 3BAZA 5IF3A 1UAGA 1YL7A 3TZKA 4B4WA 3CZRA 1FK8A 4II2A 4TZTA 5HS6A 3D0OA 2GYYA 4WLEA 3IAHA 3IMFA 2HKIA 1U4SA 3G0OA 4WK6A 4LISA 3NGLA 4PG5A 2J5QA 1QYVA 1Y8RB 3B1FA 4YAIA 4FB5A 1DRWA 5BNTA 3K73O 3ZCXA 1GQYA 3FPCA 3Q6IA 4E5YA 2BD0A 2Y1FA 3ULKA 1EQUA 1GPJA 2ZYDA 4QECA 2EKQA 4EJ0A 1WLYA 2D5AA 1O94A 3FF4A 2P2SA 3RUFA 1HSOA 3PVZA 4Z9FA 4BNUA 2NU8A 4C4OA 2EGGA 4RLHA 3P2YA 4GSLA 4BNGA 1RPNA 4UAGA 4WNIA 1HTBA 5L45A 3GNQA 4Y6PA 5TS3A 3U3XA 1XKQA 4UEJA 5L53A 2J8ZA 4HX5A 4BO9A 4RQUA 2VZ8A 5TSDA 3GVCA 1KVQA 2HO5A 3BHMA 4CUJA 2C0CA 1HL3A 4Z6KA 2OBNA 4XIYA 1A4UA 4KUEA 2EXXA 3S2FA 3GH3A 1TT7A 1DFHA 4OSPA 1LUAA 4BNWA 4J2OA 3UGKA 1FMCA 3NJ8A 5IAAA 3AY7A 4XB2A 4CQMA 2FPIA 4CLEA 4PG4A 4JBHA 1XA0A 3AI2A 2P91A 1X13A 3GDFA 4QO7A 3V1TC 3E5MA 2YYYA 3L6OO 3OJ0A 4E3ZA 1E1NA 1F14A 5U1PA 1ZJZA 1DLIA 3PJFA 1E77A 5CFZA 1LQUA 5DBGA 2WYUA 3BHJA 3LZ6A 5JAMA 1D8AA 4M55A 1J4AA 2GN9A 2PLAA 1SZJG 2VNSA 3JQGA 2BGMA 2DVMA 5FFFA 1Z73A 1U28A 3ICPA 3OEWA 4J1NA 3ZV5A 4F3YA 5CDUA 5ITVA 1B26A 1K6IA 1KEVA 1RWBA 2I67A 4LMPA 4JN6B 4PLYA 4RPGA 4P4NA 5BSHA 4Q3CA 1KBZA 3WR5A 3TOZA 2BELA 2Q4EA 2VZ0A 2X1HA 3Q9UA 4B79A 4O59O 4BO6A 5EQFA 5CDGA 5ITWA 1PJ3A 2FZEA 3ADOA 2A35A 1Y8RA 3ZWAA 1PQPA 4IZHA 3L6DA 1E5QA 5TF4A 3G3EA 4PGFA 3DZGA 3RROA 1ENYA 3L07A 3ONFA 1UXIA 1U3VA 4J91A 1LLUA 1DC6A 3ORFA 5JMPA 3RU9A 3K9QO 3UXYA 3TF5A 3TL2A 1U1IA 2HU2A 3C24A 1OMOA 3TOXA 1W4ZA 1GZ3A 1UZLA 3MJSA 1EQ2A 1I3MA 4RZHA 2O50A 5DBFA 2HCTA 5DOZA 3DHEA 3ZNQA 3DBHA 3ZWVA 2Q1UA 5U4QA 5I9NA 1T24A 4HKTA 1KIFA 3H5AA 1A4IA 2BMAA 2VUTA 3DAGA 3C1TA 2CY0A 4MKZA 3JV7A 4KP7A 1DIAA 4Q3AA 3V5NA 3RC9A 3VHRA 1EDOA 1E7RA 1YJQA 4K6CA 5COAA 3WLFA 4ESOA 4DQUA 1JKFA 5A9TA 3CUKA 3ANNA 3WJAA 4OL9A 1HETA 2Y05A 3FR8A 3AOEA 1O9BA 3R3SA 1GUZA 4WKGA 3E8XA 3VH4A 1GL3A 1VKNA 4A2CA 3AOGA 1NVGA 1QRRA 3JYOA 1GQQA 2IZZA 5JLAA 3PDJA 3KYDB 4XJTA 4CV3A 1O6ZA 2EWMA 4UVEA 4DREA 1DXYA 4FR5A 3NEPX 5EQDA 2EKPA 1YL6A 2HK7A 1ISMA 3DL2A 2YV2A 1C0PA 2XXJA 1PL6A 1PJ4A 4GWGA 2OL4A 4WNCA 4J2HA 1R4MA 3EHEA 2FZWA 3H2SA 1L7DA 2A9FA 4G5HA 1ONPA 1LDYA 4C7KA 3EAGA 2Q1WA 3JQAA 1OC4A 4J4HA 1N1EA 3AU8A 1P1RA 1IZ0A 4NZ9A 4EI2A 5CDYA 1TXGA 2PWZA 3LLVA 5T8KC 3ZWBA 2X0NA 2DUWA 3GNSA 2WD7A 3AY6A 3VZQA 4CQLA 4E2ZA 1NPYA 1T2DA 2DU8A 2PZKA 3PYLA 5KWEA 4K26A 2QRLA 3LQFA 4TVBA 1B2LA 3I9OA 2C59A 3WYEA 4WLUA 1WDLA 4LCEA 1E6UA 2O3QA 5JBIA 3WX0A 1RYEA 3VOSA 1U9JA 3KZVA 4U0JA 2VCYA 4M87A 3RBXA 3H5NA 4PLFA 1GQ2A 1E7MA 2IXAA 3RJ5A 3IL2A 1P1JA 3KTDA 3GY0A 3AM3A 1U5AA 1I30A 4UUOA 3W4IA 3OA2A 3DHNA 3M1AA 5JCXA 4CV1A 2NU9A 4MP3A 1Q7GA 4PLPA 3HADA 4DC1A 4HY3A 1G1AA 1R0KA 3DC2A 1FJHA 1RM3A 2V6MA 3OF2A 3KRTA 4NBUA 4D42A 4ZN6A 5L9AA 5JC1A 5MDHA 5G0WA 3DBHB 3JQ9A 3GOHA 3AUTA 2IE0A 3E9MA 4QSMA 5I9LA 1U2GA 2O2SA 4NFYA 4JJGA 1U3UA 3QV1A 4YVFA 4A5OA 5H83A 3PWSA 5DF1A 5KVVA 1DB3A 2B37A 1PGPA 4BNFA 3MCVA 4D43A 5JC8A 4EJMA 4BNHA 3PHJA 1P1HA 2CD9A 4ALMA 4CV2A 2PH3A 3WB9A 3RSHA 4J7XA 4JX8A 3WGIA 2Z5LA 2GUGA 2PGLA 3S2EA 1YBMA 4RVGA 1NASA 3RKRA 2X8LA 3STHA 1QSGA 1R4NB 2VOEA 2C7GA 3ETEA 4PLWA 1PJLA 3KV3O 2JAPA 4L4RA 3AI3A 1HYEA 1LXCA 4I5FA 3R1IA 4DLBA 2X0JA 4YJDA 2JFGA 2VOJA 1D7OA 3BMNB 1H5QA 3HN7A 1BW9B 3ON5A 3COSA 4PIVA 4BNIA 1UP4A 1ONOA 3DDNA 4UUNA 2VYVA 3LSYA 1T2FA 5T8KA 4BO0A 4ONEA 3UICA 3WMWA 4ALNA 4HWKA 4JQCA 3VC7A 3GFGA 2G76A 3VZSA 1KY4A 3C7AA 5T57A 1J49A 3D7LA 1R6DA 4OMUA 1DRUA 4JBIA 5I7VA 6LDHA 4FC6A 1R0LA 3OQBA 3VTZA 1YJ8A 1I8TA 3R6DA 1B15A 5KVSA 4WLOA 1KY5A 3ASUA 1FXSA 3G49A 3FNHA 2VT2A 2PD4A 4RQTA 2EERA 4BO8A 2AG5A 3HZZA 4DA9A 1OI7A 4J1TA 4MINA 3F46A 4HNHA 3AOEC 4RLSA 1HLDA 1L1FA 3BA1A 4E2YA 5F5NA 2NTJA 4OO3A 2EW2A 3U5TA 1XWFA 4XQGA 3GQVA 4Z9XA 2DQ4A 2HQ1A 3LC7O 3PQFA 1NR1A 1SAYA 2PH5A 4Y6SA 3FCOA 3ZWYA 2Q4BA 4CM9D 2HLPA 1FDSA 3UUWA 1VJTA 5L7YA 3C3XA 3UVEA 1QLJA 2ZQYA 3RKUA 2P9GA 2PFGA 3JQAD 5LDGA 3WGHA 1T26A 4MIEA 3EK2A 5BSFA 1E3WA 5ILOA 4R4JA 4E5MA 3DZBA 1E7WA 3ZNNA 1NFQA 4W9NC 2NVBA 4LCJA 1EBUA 2PD3A 1N9GB 5JXWA 1RYDA 1LRKA 3GGOA 4NJMB 3SLKA 3UAGA 3RQSA 4XQ9A 3HSKA 1W6UA 2J3HA 3PHIA 3QA9A 4ZQBA 1Y8QA 2HUNA 1AHHA 4R54A 4PLCA 5AQ1A 4NU6A 1A72A 2Y0EA 3A9WA 4I9NA 1MA0A 1TB4A 3Q2KA 1BXKA 2V6BA 1NTOA 4YTEA 3AW9A 4MVJF 4GWKA 3EDMA 4H16A 3T4XA 3VPFA 3V1UA 4A0SA 3M6IA 4YACA 4R3WA 4M8SA 4N7RA 2B4TO 1Z7EA 3PZBA 1LRLA 1NHGA 1V9LA 3SLGA 1GUFA 4GVXA 3C85A 5I8WA 3L4BC 3GK3A 2C82A 3TL3A 3MOGA 2Q1SA 4GI2A 3U09A 4A27A 4B3IA 2OORA 1K2WA 4RPHA 2CDAA 3D4OA 5T64A 4OHUA 1ISFA 3DONA 3LYLA 3JQ7A 3EYWA 3OMLA 4CPDA 2FRDA 2PKRA 4TROA 3E48A 3FSRA 3N58A 5ADHA 1BXZA 1M76A 2D3TA 4HADA 3WGZA 1JA9A 4GX5A 4HFMA 3GGGA 4J49A 1M67A 3V2UA 4BB5A 1A7KA 4YRDA 3WGQA 3GG2A 2I5PO 1DIHA 3WSVA 4ZD6A 1HWYA 3RC1A 2UAGA 1IOLA 4AJ4A 1QP8A 3GZNB 2G5CA 1VI2A 3RCBA 4Z3KA 4DMLA 3UCFA 1R15A 1QKIA 4XRRA 3WDSA 5JFOA 3PLNA 4L74A 1ORRA 4D3DA 1P74A 2V7PA 5TIIA 1UXHA 2W8ZA 5FWNA 5A05A 1YONA 1HLPA 3RUDA 4CLRB 5U9CA 1SEVA 4MVJM 3VVCA 1NQTA 4Y6RA 3ADPA 4M49A 4F46A 4OJNA 4WCFB 4XYMA 2ZKLA 3VVBA 1DOHA 3C8MA 2IZ1A 2QYSA 3OIFA 2UDPA 4NPCA 4PRLA 3FHLA 3QWBA 4J4TA 5KJEA 3PQDA 3H9JA 5L7TA 3H3JA 3MJ4A 4DPKA 2QQ5A 9LDBA 1N1GA 5KTKA 4OKIA 2JHFA 4WOJA 3KUXA 5BSEA 3HUDA 3K31A 4MDHA 4BKUA 4L9RA 1MFPA 4NH4A 1PEDA 1NAHA 1N5DA 3PJGA 1YKFA 3TZCA 3MJEA 5CEFA 2R00C 2WJPA 2W2LD 1CERA 4O1MA 3SC4A 5MGBA 4E33A 1YDWA 2Q49A 4YJGB 5L95A 4W82A 2QX7A 4I08A 4CM4A 5DCYA 4ALLA 2CF6A 3SJUA 3DB2A 3TN7A 3NTRA 3QY9A 4CM8A 2CNBA 4J1SA 4RDIA 4IDAA 1SMKA 4IDDA 1F8FA 4BMSA 3HB5X 2Z1NA 2OBYA 4L4SA 1E7QA 1P0CA 2BF7A 2QZZA 4XGIA 4DIFA 1H2BA 4YT8A 2YY7A 3Q2IA 5B4VA 3V2GA 3DBLB 1KVRA 2RH4A 2F1KA 3WGTA 3H9GA 4K6FA 3QVSA 4W7HA 2I9PA 3F6YA 2G1UA 3RUEA 5JAZA 1T2AA 2FY8A 1UH5A 2O23A 4D0RA 1LDMA 2OFPA 5DDIP 1E1MA 2Y67A 3I9LA 3TRIA 1R4NA 1BMDA 5FI3A 6ADHA 4JLWA 1K89A 4YAKA 2BLLA 2EJVA 4BKOA 4CM3A 3VH3A 3M1LA 1ENZA 1CF2O 2E6UX 1BVUA 2PR2A 4FN4A 4JK3A 2X7HA 5DBIA 2IZ0A 3QWAA 3WWYA 4GX0A 2VWQA 1V3VA 2ZTVA 3GAFA 4B4VA 4BNLA 3VDRA 4CLXA 4U8GA 1V6AA 1EVJA 4CL3A 4R9RA 3TPCA 3W6ZA 3D1LA 2WTBA 3ZU4A 5G0SA 5JDIC 4EYEA 3NT2A 4FFPA 1M6WA 2GZ1A 2QG4A 2EJWA 1AXEA 3G17A 2YHIA 1F8GA 2P9CA 2VTDA 3ABIA 2I3GA 5B12A 1U4OA 2EP7A 4WJZA 4YRAA 5B1YA 4FSHA 5IN4A 3H6KA 1MUUA 4J4BA 4ZRMA 1QYXA 3QVTA 3AJRA 4GMFA 1ISJA 2PKQO 5JY1A 1U8XX 1NP3A 1GD1O 1CIVA 5I7SA 1NVTA 1CYDA 4MVJA 1F12A 3IUSA 4W6ZA 4BO4A 4N5MA 1VJ0A 4CR6A 4EUFA 2C29D 1EVYA 3ZNPA 1E3SA 3IQDB 1HE2A 4BO5A 8ADHA 1CJCA 4ITUA 3E18A 4FGSA 3U4CA 3CKYA 5A9SA 2ZIZA 2J5KA 3FR7A 4IPTA 4BV8A 1EE9A 2NM0A 3NV9A 2FR1A 4EZBA 5CPBA 1NVMB 1XQ1A 3GVIA 3JCZA 1B8UA 1VL8A 1BWSA 1LC0A 1SCUA 5CP8A 2GO1A 4P4LA 1E3IA 3D3WA 3LT2A 4IDGA 4IY1A 4FJ2A 1AUPA 1MG0A 2Q2WA 3FI9A 5AXDA 1ADGA 2AQHA 3H9EO 5C37A 5C7IO 3UCXA 5B37A 2IEDA 4PLZA 2YJZA 5JDCC 3KVOA 5F5LA 2ZTMA 1ARZA 4FCCA 5THQA 1K0UA 1QR6A 2PV7A 5CHEA 4AG3A 3GEMA 1PQUA 1YVEI 1QV6A 1H94A 3OJLA 1LDGA 3ZV3A 2C5EA 4RVFA 3L4SO 4JNKA 3QSGA 1ZZEA 2E82A 5I8ZA 3CSDA 1KVSA 4XX0A 2X9VA 3GA0A 3BXXA 4RPLA 2DFDA 5AOVA 3TNLA 3TQHA 3EY4A 5FI5A 4DRYA 5A3JA 1GYPA 3DZHA 4E12A 4J90A 4LMRA 3JYNA 2EIHA 2YHIB 7MDHA 1JKJA 3ZU3A 5HTOA 4KWHA 1NYTA 3I4CA 5FF9A 3VAZA 2C07A 3AU9A 3B1JA 1LDEA 4BGVA 4YR9A 2GZ2A 5JO9A 1EFLA 1IYZA 3VPGA 2WEKA 4CMBA 1NHWA 1XCBA 1VM6A 2DKNA 3QVOA 4XQEA 2GLXA 1EUCA 3W6UA 3KYBA 1KYQA 3WYCA 3NKLA 3QLJA 1UDCA 1LU9A 4NBVA 4CM7A 2NTVA 2ZTLA 3ROKA 3TZQA 3GDGA 1JAXA 1DC5A 4YT5A 3FN4A 4RO0A 2JFHA 4OQYA 1U5CA 4IDEA 3BTOA 4TMFA 2NQTA 1HDZA 1PZEA 4OXNA 4TRRA 1PX0A 4ZQFA 4NI5A 1CETA 1GCUA 4XJSA 4PLVA 4DLAA 3WYBA 3KLMX 3GAZA 4DYDA 3INGA 2WYWA 2DT5A 1D1SA 1C0IA 3QWHA 4M54A 4P38A 3VTFA 4AJ2A 3NDRA 2WD8A 3GT0A 1U3WA 3PLRA 2BKAA 4JJIA 3IC5A 4CQMB 4PN3A 1H6CA 4N54A 1TEHA 2PY6A 4U0KA 1XIVA 4BHTA 1PGJA 2W2KB 1D4FA 3I9KA 1YXMA 4I5DA 2IODA 4H3VA 1IL0A 4R3NA 4UULA 4D3FA 3ENKA 3O03A 2I99A 3EW7A 1WDKA 5H82A 5C7OO 3V1YA 4UVDA 2CDCA 3QJ5A 4UVIA 1G0NA 1GCOA 2GGSA 3BTVA 3GFBA 1UXGA 2X5JO 4CMEA 1IZ9A 2UV8A 2X6TA 3OJFA 4PCVA 4R41A 4ZA2A 1Z7BA 3OM9A 2CMDA 1HDYA 3GC6A 4XGKA 4DYVA 4OXYA 4QTZA 2OHXA 2AE2A 1PSDA 2WE7A 1KEUA 3I5MA 3I9MA 3PJEA 4BGUA 2NVUA 4I8XA 4BO3A 1DAPA 1UDBA 3HG7A 3NX4A 4CMIA 2J6IA 4CR8A 5IZ4A 4IQ8A 1LLCA 5IXYA 1E0DA 3G79A 1NFRA 2ET6A 3ZWXA 2AE1A 4LVCA 4TRNA 4L8VA 1BG6A 1XU9A 1GEGA 1VLLA 1BDMA 2VWHA 2CDBA 3RFTA 3WIDA 4E32A 4J9UE 3UW3A 3Q3CA 3MOIA 4KWIA 5CDSA 3PWZA 5T5QA 1YQDA 5IXSA 2P4HX 4U6SA 1HF3A 2BRUA 4UEOA 5JNLA 1U7HA 3ASVA 4JGBA 2EHDA 2B4RO 3LLSA 3HJAA 4KDEA 4K9DA 3JQ8B 4CMKA 3ZHYA 4FOSA 1H6DA 1WMAA 2D4AA 3HFGA 3HNPA 2AQ8A 4YRBA 3UH1A 2Y0CA 1C3VA 3AY3A 5DP2A 4CODB 4HV4A 5GZ1A 5JSFA 4HP8A 1QYDA 5ES3A 4C7JA 1F0YA 4BO2A 4BUCA 5BT9A 5C7LO 4X54A 4TKMA 4HUJA 3CE6A 3PFFA 2VYNA 4LVUA 4EDFA 3L0DA 4B8ZA 1ZK2A 4NBTA 1Y1PA 3TFQA 3M2PA 3FRJA 3GEDA 4IDCA 3LF1A 3OICA 3KYDA 3UOGA 1Y9EA 3F5SA 4KQXA 2FMUA 1ZK4A 4GKBA 1R12A 3PGJA 4CJXA 4GLLA 3W8FA 4R16A 2B5WA 4PLHA 1UR5A 3WXBA 1YE3A 1N7GA 1Y6JA 2H9IA 2O3SA 5A5FA 1I33A 3CMCO 1VRWA 1OAAA 5CEJA 4DLLA 3IP1A 4IIVA 2B36A 2O3UA 5F3RA 3GEGA 3CMMA 3ZW8A 4I9HA 2DAPA 1UP6A 4NMHA 1HDRA 4DXHA 1DHRA 5JDIA 3QVXA 2FPGA 3GRPA 3I1JA 4PRKA 4RGBA 2GN8A 1PL7A 2NVWA 2NNLD 1HKUA 1PGOA 4MP6A 2GR9A 1XQ6A 3V8BA 4D46A 4CMIB 2X9GA 3IKTA 3RC2A 3QWFA 2OMEA 3EZLA 3DQPA 3H7AA 4YWJA 3RBZA 5CDTA 5L3ZA 3AUSA 1UXKA 1O8CA 4FD3A 2DPHA 3OQ6A 4OAQA 4WCDA 2P9EA 3FNFA 1BXGA 1LDBA 2AW5A 2W98A 3LT0A 4UUPA 5HS4A 2FN7A 4DVJA 5KKAA 1E7YA 3CXRA 3FD8A 3ZWPA 1ZMOA 3ZI0A 2R00A 4B4UA 2JL1A 4M89A 4GSKA 1SC6A 3K5PA 2HSDA 2VWPA 3KSDO 3KLPX 4S1VA 4CUZA 3DMYA 4UREA 1EK5A 2DPGA 1Q2XA 1QV7A 4NFHA 5TLSA 1ADBA 3VDQA 1PGQA 3I52A 4RF3A 2Q2QA 5EL0A 1ZEJA 1WW8A 4CLRA 1R16A 3F4LA 1FF9A 2VZ9A 1C1DB 1TLTA 4KTVE 1XG5A 3Q9NA 4FJ1A 2VHXA 1DIBA 4K28A 3RU7A 1ZFNA 3HWRA 3KSZO 2ZQZA 3GF4A 3R0IA 3LC1O 3PTZA 5BNIA 2GD1O 3U4HA 3ST7A 4DBZA 2VWGA 2OP0A 3TJRA 3OSUA 5L7WA 4IINA 4IUYA 1EZ4A 3JQEA 3JD3A 1NQAO 3RAJA 5L4LA 3DZIA 1O0SA 1PJ2A 1GTMA 2YV3A 1C0KA 1LX6A 1EK6A 3OP4A 3ZDFA 3BMQA 2DBQA 2AHRA 2JD0A 2OO5A 1C14A 1H9AA 2DTDA 2EG9A 4NNJA 1DIRA 1ISHA 1H9BA 5AXBA 1M6HA 1ZEMA 5A03A 4EEXA 2DBVO 3D64A 4RVUA 1HT0A 3QP9A 1E1LA 3RD5A 3KEOA 1QXSA 4R1UA 3QWIA 3EUWA 1Z6ZA 4FFMA 5IN5A 1BRMA 1D1TA 1WMBA 4IJVA 2OXIA 1YB4A 2FHSA 5HWSA 1H2HA 3O38A 4NBRA 1X15A 3CTMA 5H81A 1E7SA 4Q3EA 1MXFA 4R1SA 4BIIA 1PWZA 2VRBA 4YJHB 5KJ6A 1P31A 2A94A 4OOEA 4DBVO 5JDCA 1LC3A 1I2CA 1XGKA 4YT2A 5IFLA 1PS9A 2GSDA 1A27A 1BGVA 4TKLA 3JD2A 3B1KA 1JAYA 1UP7A 3LT4A 4AFNA 1V3UA 1RM5A 5EN4A 3W8DA 5CAEA 5KOIA 2Y1DA 3DWFA 3WNVA 4ZRNA 2YDXA 4BL5A 3K96A 4RDHA 2HMTA 1NQ5A 2VQ3A 4BNMA 4NBWA 3UF0A 1MFZA 1LI4A 4OM8A 3RASA 4MPDA 3DR3A 4NK5A 2QYTA 3GMDA 2H1SA 3GPDG 2PK3A 2HMSA 3GVPA 1NWHA 1UZMA 5HRUA 2X4GA 4MVJI 3LC2O 1IB6A 5K9ZA 4NG5A 4F6LA 1J5PA 1C0LA 4IJUA 2QRJA 3WQSB 4OH1A 3O8QB 1FDTA 1I32A 1WPQA 2DM6A 1XDWA 1Z75A 2G82A 3FBTA 2BI7A 4AJPA 4PG7A 3BMQB 4L4XA 4A10A 3UHAA 3VZPA 2JCVA 4BKPA 1NQOA 3JD0A 4IJKA 4CLHA 4Z0HO 5A04A 2CVZA 2G0TA 2CFCA 3PEFA 1CQJA 1PZHA 1WWKA 2BFPA 3U9LA 5FEUA 3SJ7A 2HRZA 1N92A 2I65A 4DIBA 2BFMA 2FWMX 3S1LA 1X1EA 3DOOA 4UVGA 1ZXLA 4XDZA 3WBBA 1ADCA 2WWRA 1HEUA 3D5TA 3WJ7A 3WFIA 4QEDA 1QMGA 4CM6A 1NPDA 4JP3A 2Y0DA 3HN2A 3L9WA 2AMFA 4WOKA 2HMUA 1XLTA 3F9IA 5ENDA 4YJHA 5IDXA 4RJTA 1ZSVA 2PD6A 2IDZA 1XELA 1CEQA 1Q0QA 3LF2A 4IMRA 5ENVA 2IYPA 2CVOA 3CPSA 2PA3A 1Z74A 2GN4A 3NGXA 4BNVA 1UXJA 1JVBA 2VUUA 4GKVA 4W7IA 4DUPA 2NADA 2JHGA 3F5QA 3H3FA 1P45A 3P19A 4B4OA 4CMHA 1ZK0A 1VL6A 5L4SA 4XGNA 1LDNA 2Q1TA 1DRVA 4BQRA 4E21A 3K2EA 1B3RA 4OIMA 2VNAA 2YZ7A 4XQCA 2PGJA 3RIHA 2HJSA 1WNTA 4GVLA 5AVOA 1DHTA 4G65A 1P3DA 2V6FA 4D79A 4NQZA 2A4KA 4CV0A 4XIJA 1GV0A 1B7GO 2EP5A 4ZU3A 1D3AA 3BMCB 3D3WB 1R4MB 2RH8A 4S3MA 4A03A 3GDOA 1EUDA 4XWYA 3OH8A 1P0FA 1QYCA 1B16A 1NAIA 3WMXA 4CM1A 3A14A 4XZ3A 3A06A 4ZQGA 2E48A 2H5LA 2LDBA 3FTPA 4PZCA 2HAEA 3ZWCA 3BZUA 5ER9A 4CM9A 4ZICA 4BO7A 5T6BA 3DFZA 3ROMA 4CQLB 2ZB7A 3OFSA 3VKVA 2EKLA 1Y5RA 1LEHA 3DAFA 3F1KA 5F1OA 1YQXA 4QFDA 2VHVA 5G0TA 1U3TA 2J5RA 3CZMA 3DAPA 2FSSA 1OFGA 3WLEA 3TZ6A 4TVOA 5JW6A 4XDYA 5A3VA 1BHSA 3TDKA 5DN9A 4XYLA 3JD4A 3AWDA 5KJCA 1GYRA 2QHXA 3T7CA 3PYMA 1EE2A 4QX6A 4LSWA 1FDUA 4IDFA 1WAMA 4W9NA 3PRJA 3OQ1A 1RJWA 3DOJA 3GGPA 1KVUA 4Z9YA 1YBVA 4LN1A 1M75A 1UJMA 3OBBA 4D44A 3C7DB 4FDAA 4DWVA 2RHRA 2PZJA 4J9VA 1LRJA 4FS3A 2FR8A 1HE4A 3I23A 2VHWA 1BSVA 1V3TA 2YV1A 4XR4A 1PQWA 1S6YA 1T25A 3PHGA 3Q1LA 3RC7A 1RM0A 1UAYA 1ENOA 3WG9A 5TX7A 1DIGA 1TA4A 4N5NA 2X9NA 3P2OA 2G17A 1ML3A 4FPXA 4HFJA 4WEQA 3W4KA 4KQWA 5JYDA 1R37A 3OEYA 2ZJ1A 3LDHA 1VSVA 1Y7TA 3KO8A 3PWKA 2CSUA 1OOEA 3GNTA 2B35A 4AJIA 1W73A 4KMSA 4A73A 1I01A 2C54A 2EGHA 5C3MA 1WVGA 3BMCA 1HE5A 3SEFA 3C1OA 2JD2A 1P1IA 5JE8A 3FTNA 1EFKA 2O3TA 3GLQA 1BDBA 3IP3A 2X58A 1E3WB 2LDXA 5DOVA 5BQFA 3W1VA 3NT4A 1LQTA 4U5QA 2YFHA 2I3AA 3PIDA 4FFLA 4GX2A 1I36A 2JJYA 2JAHA 3AI1A 4XYEA 2O2YA 2X5OA 3H8VA 3LK7A 4KUHA 1P9LA 4ZQHA 4QQRA 2O7SA 5F21A 3GVHA 4B3JA 3JSAA 3L6EA 3DOCA 3VZRA 2J3IA 1SPXA 4EJ6A 4O6VA 4ALIA 5G0UA 5JYEA 3NAQA 4DMMA 2ZCUA 2Q50A 2PGDA 1WXDA 1Y5MA 2VYND 3IIEA 4AL4A 5IZCA 1NFFA 3ITKA 1NXQA 2DLDA 2HJRA 4IBOA 4MVJE 2NVUB 4TRMA 3ZHXA 4AJKA 1VL0A 4MKRA 3QRWA 4BOYA 2X5KO 4IM7A 1H0KA 5JCJD 4XKJA 1LSSA 3SC6A 4ZGWA 4HFNA 5CEEA 1JU9A 3PI7A 4PFJA 4E5PA 1OC2A 3DO5A 3NJ4A 5EMHA 5TJ9A 2DC1A 4XYGA 3H2ZA 5JMWA 3ZHZA 4JP2A 4R01A 3PJDA 3IS3A 1SB8A 1PTJA 4CQMD 3KSUA 2HMVA 1UDAA 1DFIA 3DMTA 5JCJA 4D3SA 4PG6A 4BO1A 1ZSYA 4B7CA 4E31A 3JQ7B 4PZDA 3OECA 1LSJA 4J1QA 4IMPA 1VKOA 2X86A 4W99A 4CL8A 4B7XA 2IEBA 2BGKA 4XD2A 4AJOA 4JXKA 1X14A 2JCYA 3OJOA 4R51A 3QW2A 1X0VA 4OKNA 2I76A 3OJEA 4ND2A 3AM5A 2Q46A 4PVDA 1JLLA 2HK8A 1Y81A 3B20A 1P44A 3CIFA 1NBOA 1PR9A 3LT1A 4OQZA 2GF2A 1YGYA 3EMKA 1XEAA 4K1LA 4Q3BA 4FIZA 4GL4A 3WGOA 5IJZA 5KIAA 2POQX 4I5GA 5COQA 3GZ4A 1WDMA 1L7EA 4OGWA 1NM5A 5A9RA 2FP4A 2OGUA 2Y1OA 1I3LA 1MX3A 3AK4A 2ZB8A 3MJCA 3PDUA 1Y8QB 4FQ8A 2BFAA 3IKVA 4GX1A 4JJFA 1SO8A 3VPXA 5AYVA 4GPD1 1Z45A 4WCFA 1KEPA 5TT1A 1BW9A 4MIOA 4RVDA 3FNGA 3S8MA 4G2NA 5G4KA 4KDFA 2Q45A 1YL5A 1WZEA 4CMGA 4P8RA 1DC4A 3GVXA 3RFVA 1GU7A 5B4TA 3T7EA 2NSDA 3OIGA 3IUPA 4FFNA 4Q9NA 5HM8A 1MB4A 4ID9A 3PK0A 4P4GA 1U8FO 3DBRB 3OHSX 1YWGO 3NTOA 3WICA 1KC3A 4BGIA 5TRTA 3NT5A 4GGPA 4YAJA 2VRCD 5JAIA 1V8BA 3O4RA 4E0BA 1R66A 5GZ6A 3NUGA 4WLNA 4DC0A 2FPPA 3A4VA 1BXGB 3WGYA 2UUOA 4E13A 2GASA 1PU2A 5I7FA 1M2WA 2EF1A 4IS2A 3TSCA 1JQBA 1YRLA 4DQXA 2VRCA 4DTIA 2A92A 3H65A 1EDZA 3I9JA 1HE3A 1YBAA 5DT9A 1JWAB 1WP4A 4BMVA 4IDBA 5ICMA 2OP1A 3ETGA 1JW9B 4EEZA 2E37A 2Q3EA 3WTBA 4MVJH 1HDOA 2NACA 2ZTUA 1ZK1A 1UUFA 1ID1A 1LJ8A 3D5QA 1Q0HA 1ZH8A 4DGSA 1LSUA 4L73A 1H6AA 2ILTA 1T2CA 2GERA 1C1DA 4YJFB 4KZPA 3KOUA 3OETA 3BMNA 3I6IA 2XF8A 1O89A 2W2LA 1DDOA 5TC4A 4D7AA 5G2OA 1PR3A 2QRKA 1LTHR 4WEOA 2WYVA 3C1AA 4U7WA 1MC5A 1FDWA 3PQEA 1XHLA 4WCFC 5J23A 1SEPA 2VT3A 3PP8A 3DEYX 4ZJUA 4J3FA 1N9GA 2UUPA 2Y68A 3DXFA 3Q0EA 2ZJ0A 1VC2A 4KOAA 3LVFO 4XEHA 1WZIA 4BNJA 1I3NA 4O63O 3WGGA 5L51A 3E82A 4B7UA 1PS0A 2X0RA 3JQAB 1UZNA 1E3EA 4MVJP 3DBVO 5ER6A 5JPIA 3I6QA 4GBJA 4EUHA 4BKRA 3L77A 4CMAA 2C5AA 3ROPA 1EUZA 2JFFA 3F3SA 2O3RA 3DBRA 4RCVA 3NDJA 2QW8A 3DZFA 3EGOA 3X2FA 3BHIA 4LRTB 2ZYGA 4FW8A 4YEDA 4A26A 4BGEA 4CM5A 1E3LA 5AXAA 1K6XA 1R0SA 4L75A 4CMEC 3ETDA 3P5SA 3UN1A 2TMGA 3MZ0A 2RCYA 4FBGA 1I24A 1LLQA 1V0JA 1CRWG 1YS4A 5KJ1A 2X0IA 1HYGA 3JQBA 4NFSA 4XA8A 4YA6A 1B3BA 4MOWA 4RF5A 4RF2A 3KYCA 4ZVVA 3NDIA 1CWUA 3RVDA 3ITDA 2EW8A 3JYQA 1G0OA 1MXHA 3RBVA 4W4TA 4MVJD 1LNQA 1C1XA 3OA0A 2D5CA 3AUUA 3PPIA 5EIOA 2Z95A 4G81A 3OIDA 3DBLA 3UFXA 1E3JA 1TVEA 2AQIA 3VH2A 4CLOA 1VJ1A 5IDQA 3K6JA 2ZATA 3ZWWA 2GCGA 4IZIA 2QZ9A 1P33A 2XAAA 3HDHA 4BNNA 5A5EA 3E1KA 3JQ6A 4NIMA 4EBFA 2BFOA 5KJFA 1DLJA 1T2EA 1DBVO 3GZNA 4FFRA 4R5MA 4J43A 3RI3A 4B3HA 3EVNA 4E2XA 1HYHA 1I2ZA 4TWRA 3QVWA 4BNZA 2I6TA 1X0XA 3D4PA 3A1NA 3S55A 2HDHA 2FOIA 4ILKA 4LRSB 1KERA 1A71A 1JTVA 1IHYA 2B5VA 2W2KA 3IJRA 3JYLA 1PZFA 3O26A 2NU7A 3GUCA 3QHAA 4RPJA 5I7EA 1PWXA 4MIYA 3D3EA 4L76A 4QO8A 5I9MA 4WLFA 3WIEA 2WD7B 5TQVA 5B4UA 1SOWA 1BVRA 4M1QA 4RV9A 3X2EA 1ZK3A 2YFQA 3A28A 3RUCA 1DSSG 5GZ3A 4AJNA 2BH9A 1SOVA 1YOVB 4OOFA 3T4EA 4E5KA 5JO0A 3S2GA 2Y1GA 4P22A 4D41A 1QYWA 3E9NA 5CG2A 5EESA 1HZZA 2YQ4A 3WFJA 4EITA 1NX6A 2EEZA 4YYZA 1Q7CA 1H93A 2EV9A 4BS9A 2PTGA 1MGOA 3ANLA 1P77A 3IJPA 4WLVA 4H15A 5JAQA 4ALJA 1XYGA 4GH5A 4BMNA 2CF5A 1YQGA 3PZRA 2D1YA 4F6CA 3U0BA 3VPHA 1IULA 1YO6A 1X7GA 2HRBA 3CINA 1AGNA 3G1TA 2NQ8A 3H9UA 5THKA 1C1XB 4BNYA 3PHLA 1JN0A 4PLGA 3DZJA 2B83A 3MEQA 1B14A 1E92A 4YBZA 5LDHA 1TT5B 2TMDA 3K30A 4R68A 1F17A 2IXBA 3AUAA 3FNEA 4LSMA 3DHYA 2GRAA 3WBFA 4YPOA 3E03A 3CH6A 1VSUA 2AEMA 2P4QA 5JS6A 1E5LA 1B0AA 3KHUA 4XRGA 5L40A 2C2XA 2FSVA 4BNKA 1ZMTA 3BYZA 3LU1A 3MJTA 4AJ1A 4O0LA 4J16A 5IZCC 4DIOA 3UCEA 1SBYA 2P68A 4MO2A 4CR7A 3FWNA 1DJNA 1ZSNA 3ZNOA 3NYWA 4IJWA 4HFRA 1ZVMA 4BKQA 2Y99A 3E9QA 3KETA 1LA2A 4IXWA 4BNXA 5BR7A 4BV9A 1YB1A 3BMOB 4GQAA 2RIRA 2V6GA 4ZHSA 3AFNA 1HXHA 3I83A 4MP8A 3WSWA 4AJHA 3HHPA 3VPSA 2O4UX 3JQGB 5EERA 2W4QA 2Y93A 1A9YA 2XOXA 3BTUA 1I10A 4Q3DA 2VYVD 4OSOA 2PZMA 1YH3A 3ICCA 4LW8A 4NDNE 4R1NA 1W0CA 3GHYA 3AM4A 3TFOA 1ZNQO 2D59A 4XB1A 2Z1MA 3INTA 1ZW1A 3JQBC 2DBRA 2Y66A 3D4NA 1T4BA 4URFA 3HDQA 5ILGA 4HNGA 1HDGO 4DPMA 2H6EA 2FR0A 5G0VA 3ZHBA 4R9SA 4TZKA 2X23A 3VH1A 2B4QA 1QORA 1NR7A 3CEAA 3H9QA 3L4BA 4QUKA 3ZV6A 3IOYA 1PJQA 1A7AA 1DJQA 1IE3A 1Q1NA 3DMTC 3DTYA 1B8VA 7ADHA 9LDTA 1MG5A 1HDCA 1ISGA 3HDJA 2VHZA 4YXFA 2YHUA 3FBGA 2P5YA 4YQYA 1HRDA 1VE9A 3NTQA 1ZUD1 1V35A 3GHHA 3WWZA 4HXYA 1HZJA 1GUYA 3KB6A 3U4IA 4FOOA 4BVAA 5A1TA 4OXKA 3WNQA 3E6AA 1GR0A 2DTXA 1TT5A 4JROA 2GPTA 4Y67A 4UEKA 1DAOA 1B8PA 1F06A 4J6FA 4RORA 5TGDA 2JCXA 2GNAA 1VPDA 2IYOA 2YQ5A 4KTTE 5DULA 4AJEA 3RFXA 1QG6A 4RF4A 2Q2VA 3JQCA 5C5IA 2VTEA 2JKVA 4EUEA 3DTTA 2ZK7A 1TI7A 1JVSA 2NU6A 3F47A 4Z0TA 4NHEA 3JQFC 1I5RA 4TQGA 3SVTA 3MTJA 2DUUA 1AE1A 3WQQA 4DQVA 3KM0A 1X7DA 5A9SB 2E49A 4CMJA 3I4FA 1E6EA 2YW9A 5HA5A 1GAEO 3JYPA 3JQ8A 4NU5A 3GPIA 1CDOA 3MJVA 2CZCA 4UUMA 4DPLA 2X22A 4YQZA 3BMOA 3SXPA 2R6JA 3JTMA 2AEJA 4MJLA 4CUKA 3KBOA 4Z3DA 1P1KA 1ULUA 3MWDB 4OYRA 4Y8VA 4WPGA 3ZV4A 1M66A 4AJJA 3N74A 2P5UA 4AJLA 4IQGA 4YCAA 5F1KA 3PYXA 1E1KA 3HFSA 3JD1A 2ZCVA 4QFCA 1IPEA 3QE3A 2RAFA 3HQ4O 5JY6A 4WE3A 3JQFA 5A06A 4YAGA 4FGWA 1T1SA 5TJHA 4PVCA 1BTOA 1EBFA 1Y9AA 4XYBA 1ZJYA 4E6PA 3PXXA 3GUYA 3U49A 1KS9A 4ND4A 1S7CA 4Z0PA 2BGLA 1CQIA 4E30A 4E4YA 3RUAA 1ZBQA 3FWZA 1MLDA 4I1IA 4AICA 3ZGYA 5EINA 1NPTO 4D45A 3K2BA 1E6WA 5DNAA 3KYCB 4YJGA 5IDWA 4YT4A 1GY8A 1ADFA 1AHIA 4CM4B 4R69A 4A7PA 2C7VA 5KKCA 3HE3A 3WS7A 1KOLA 4CM8B 1K3TA 1LLDA 2GZ3A 8LDHA 1KETA 1K5HA 3GR6A 2B0JA 4TSKA 1KC1A 1ZKMA 5CG1A 4CLOB 3R3JA 1P1FA 1AN9A 1Q0LA 4GMGA 2ZB4A 5EJ2A 4J7UA 1IUKA 4IIUA 3WTCA 1MV8A 2D2IA 2Y1EA 4Y98A 3ROQA 1GV1A 2O3JA 2R2GA 2WE8A 4JIGA 3ZWOA 4ROSA 1JDJA 1YDEA 2XPCA 3ONEA 3I3OA 5IG2A 3BTSA 1LSOA 5GY7A 1N7HA 4RVSA 4YDRA 4YAEA 1EVIA 2QIOA 3GN2A 3G1UA 3VKUA 4JBGA 4MKXA 2W90A 3DFUA 3HB4X 5KVCA 4F45A 3O8QA 1PL8A 3QQPA 2CVQA 5ICSA 4IS3A 4N18A 5KNLA 1YB5A 5DZSA 2NLOA 3INRA 5LCXA 1EMDA 3HDYA 5BNFA 5G4KB 2IRWA 3BIOA 1ONNA 3RUHA 1YOVA 3PGXA 1XR3A 5F1PA 5COBA 3H4VA 4ND3A 4ND5A 4INAA 1I3KA 2UYYA 1PZGA 2ZB3A 4FC7A 2GDZA 4FFOA 4ND1A 4PLTA 1PJCA 3ZU5A 1GEEA 4XR9A 5G4LA 2BI8A 2OUIA 3EC7A 4QXMA 1A9ZA 3SX2A 3U62A 4GGOA 3ZW9A 3GMSA 2VUSA 5A02A 1ZXBA 3PIIA 1DPGA 1H6BA 4RPKA 2SCUA 3TWOA 3KEQA 3I9NA 1X7HA 4NK4A 3GN1A 2AEFA 3F4BA 4E2WA 3SBOA 5AXCA 3P7MA 4ALKA 3RWBA 5L4NA 4UVHA 1ZCJA 1RKXA 2F00A 3S2IA 4IXTA 2C2YA 5DCWA 4N5LA 1PIWA 4EGFA 1GZ6A 1HDXA 4J7CA 3UKOA 5KCZA 3EVTA 5T67A 3RUIA 3W4JA 2Y1CA 2E4AA 1NNUA 4PG8A 1ZO8A 2PNFA 4J0FA 5LC1A 4IGFA 1KVTA 1PGNA 3E5RA 4AVYA 1SNYA 5EPOA 3GG9A 1W8DA 5HBRA 2YUTA 2H63A 2Q99A 2WSBA 1XSEA 1EEHA 1XU7A 4RVHA 4B8WA 5A4DA 1SB9A 1PJTA 3N7UA 4NJOA 4YJFA 3GRKA 4RZIA 4YB8A 1X1TA 1ISIA 1N2SA 1GYQA 1FDVA 1I2BA 1OZAA 3NRCA 4II3A 3ZWMA 4WGGA 1U2DA 3ZH2A 1J6UA 2PKQP 4Y9DA 1MC4A 4XCVA 3QIVA 4R5HA 3JQDA 4U6QA 1DC3A 2UVDA 1RM4A 3K8ZA 3ZWNA 2J3JA 1DFGA 4WUVA 4ZQEA 4D0SA 1EVZA 2B69A 2HK9A 3ZU2A 2NV6A 2VN8A 3JQ9C 4H7PA 2XXBA 5TT0A 3F1LA 2O48X 4NJMA 1GPDG 2OOSA 2PZLA 1GDHA 4DL9A 5K0ZA 1G6KA 2CUKA 2OZPA 5BSGA 4Q39A 4FJ0A 2J3KA 4IQ0A 1GFSA 2V65A 2BHLA 1O95A 1K6JA 4BQPA 5TNXA 1PJSA 1IHXA 4CLDA 2O7QA 2RHCA 1IPFA 5KVQA 3W8EA 4NR0A 1T1RA 3MWEB 4O5OA 2WDZA 5K6AA 1OBFO 1N8KA 4WASA 1JWBB 2ZYAA 5DP1A 1U7TA 4J0EA 4WECA 4BB6A 3ZZNA 1GADO 3B70A 1LBEA 2O4CA 4IGEA 3DZKA 4RL6A 4BNTA 1PJBA 3WOHA 4LGVA 5FYDA 4GAEA 3B6ZA 1ULSA 1QLHA 1MP0A 1JKIA 3M2TA 3ANMA 3U4DA 1DO8A 3FPLA 4JCOA 5DCUA 3H5RA 1A5ZA 3L9XA 4EW6A 4E5NA 4I9UA 2DBZA 2AA3A 1DEHA 3RJ9A 1T4DA 3AFMA 2RBEA 3EZYA 3O9ZA 4HBGA 4R1TA 1ENPA 3V2HA 1AXGA 3IDSA 4QT0A 2NTNA 2C20A 3PHHA 1Z82A 3Q11A 2DTEA 4I5EA 2NWQA 3ENNA 2AQKA 4M86A 3TZHA 1I0ZA 2D0IA 5CPFA 2NUAA 5K6AC 3KXDA 2WM3A 1GZ4A 4MVJG 2AXQA 4KUGA 1KEWA 3C7CB 4L0QA 1IY8A 2D8AA 3MTGA 5IDYA 3ZN2A 4LK3A 3WQRA 1ZIDA 1O5IA 2VHYA 2AG8A 1J0XO 4Q3NA 2I66A 1HSZA 1PS8A 1Q7BA
chains in the Genus database with same CATH superfamily
2WMDA 2F8LA 5GMOA 3WRXA 3BG5A 4TSFD 1IM2A 4TRJA 2RJNA 2IOYA 3C6KA 3E23A 1GCAA 3A6LA 3K92A 3OM8A 4YP7A 3IELA 2J67A 1XVAA 1U1GA 4PZEA 2FGKA 1FDIA 3KQQA 3STVA 4OQEA 3EIQA 1DUIA 3Q72A 1KARA 4FYVA 4K0KB 1QONA 3IXMA 2FEPA 2XVZA 3FUVA 1YZTA 4PX5A 2IGTA 1XK7A 3IAHA 3TD9A 3IMFA 1DJMA 1U4SA 1QO9A 2D1FA 3QUQA 3GJ4A 3G2NA 1DUVG 3KU1A 1Y8RB 3HGMA 3MN1A 5KNCD 5HKKD 1W49A 3ZCXA 1GQYA 3SICE 5LZ5A 3RYFB 3Q6IA 2ZIAA 3VUEA 5EJ4A 3H8JA 2BD0A 3P9KA 4H17A 3ESCA 2OAP1 5DEOA 3PQ8A 4TUYB 1W0KA 1EQUA 2ZYDA 4MUKA 4ZJZA 4W63A 4EJ0A 1PLLA 1WLYA 2C2BA 3FF4A 3NORA 1UC5B 3VKVA 1P72A 2ANCA 1CPYA 3LRXA 3PVZA 3L0PA 3RSOA 4BNUA 1Z5OA 4C4OA 1MO2A 4YFVA 3VZCA 3ICWA 4FXOA 4Y2UA 4DFDA 4B7ZA 4MSUA 2CLHB 5L45A 1H2YA 3GNQA 4JI0B 2LUOA 3NW9A 3U3XA 1VB3A 4MUBA 5E6UA 2J8ZA 4HX5A 2VZ8A 1FTNA 2HO5A 4HDSA 4Z6KA 2R6GA 3MS4A 3K0AB 3F6EX 2VPTA 3FVWA 2EXXA 2BTOA 3EGVA 2LRHA 1BE0A 4Z1MD 2Q6VA 2R8EA 3DV0B 1LUAA 1AX9A 2OZLA 3LPCA 4HEA1 3KZNA 5IAAA 2EX0A 4IV8A 4UW9A 1T8SA 4PIMA 1OFVA 3SR3A 4TKUA 4XB2A 3T52A 3O75A 1NLFA 1YC5A 3D6UA 1GDTA 2B20A 421PA 3G89A 5DTEA 2BDTA 1MJ5A 2WIAA 1NMZA 4QO7A 1HORA 2IYVA 2YYYA 2QA5A 3VTKA 4DXAA 5L3SB 4E3ZA 2AXEA 1XTBA 2ZUDA 2W6MA 1TTTA 1V8PA 4PEVA 1CR4A 3NKFA 2WPNA 1KIMA 5ALTA 5HJEA 1BN6A 2WYUA 4QQ8A 4QXPA 3OOEA 3UJNA 4WKCA 5JAMA 1AQNA 3AUKA 1SZJG 2VNSA 3JQGA 2BGMA 5K3SA 4RELA 1AV6A 1VGRA 2GAAA 2D7DA 2HHAA 5FLKA 2O5CA 3WMRA 2HDNB 2JI4A 2QVYX 2B61A 3ED5A 1T9KA 3AFIA 1RWBA 4F4UA 5KTRA 1G5QA 1SXJC 3DL7A 3OQVA 1ZQ9A 1Q12A 2XT6A 4Q3CA 5E1OA 5BSHA 3VNUA 3T3NA 2KLBA 2BEUB 1RWQA 4U4AA 2X1HA 1M33A 1PYOA 4O59O 3P26A 1WY5A 3VU1A 4ZVKA 2FZEA 4MS1A 2BTEA 2X76A 3ZW7A 1T6BY 1YJ5A 4IZHA 3GLGA 3G3EA 4LEIA 4PGFA 3RROA 3W9SA 4RFSB 1HEYA 1KNXA 3L07A 5D00A 3RYIA 4J91A 2DJ5A 2RHJA 3CLKA 4EENA 1JFFA 1Z5ZA 2GCNA 2WU3A 5JHGB 4V2UA 5E4JA 1EFVA 4PO1A 4QXQA 3TF5A 3UA3A 3SMVA 4UXJA 1A2QA 2WAMA 5BV8A 2HU2A 3C24A 2X3UA 1GGEA 1Z6TA 1KMMA 2F3QA 2DHQA 8MHTA 2XECA 3BL5A 3H0EA 1MAWA 3NC0C 4CRWB 1WM1A 1LI7A 1EQ2A 3VBCA 4E14A 4RZHA 5JPCA 2HCTA 2FTKE 1KDVA 4O4JA 1RYZA 3ZWVA 1OWLA 1OIWA 1Q15A 3OU2A 1ADJA 4DNOA 1A4IA 1J0BA 3GZJA 4GL2A 2CY0A 5EQTA 3GJQA 3JV7A 3SFVA 3HM9A 1G8YA 3RC9A 2XDQB 3R5FA 1XMQB 4OQDA 4CF6A 3B85A 3R3WA 2V6IA 4HDSB 5TDHA 4DQUA 5BNWA 1CZRA 4JIMA 3AR5A 2ACWA 2V5VA 3GPCA 1IY9A 4CIBA 3AEUA 3DCJA 1F60A 1E4YA 2GBLC 3IBFA 3F71A 2JHAA 1MU0A 2H5JA 3AOEA 4X6LA 1GUZA 3E8XA 1GL3A 4WZ6A 1QVZA 5B1IA 1I7QB 4H27A 1NVGA 1QRRA 3JYOA 1QTNA 2IZZA 1DAEA 3QBTA 1E2LA 1NF2A 4MV9A 4ZODA 5JLAA 4YCMA 2EWMA 5JCOC 3S8YA 1JEQB 1XU4A 2A4MA 1DXYA 2VPIA 4DREA 3CRVA 5KQRA 1FC0A 1KRWA 5CMLA 4DMRA 3NEPX 1KMNA 5LQSA 1FFYA 4B32A 3LLUA 1O3YA 2VSFA 2XXJA 4BQEA 2DY0A 1R74A 5ALMA 4HS4A 1QAOA 3H2SA 4M99A 4R40A 4QBTA 1WO8A 5DTQA 3PUHA 1YB6A 1LDYA 4AP5A 2H11A 4LK2A 5DIFA 2R8YA 3LO5A 1KU6A 1S8OA 1OC4A 1W581 4RE6A 3MJRA 4Q48A 3E27A 4ZARA 5C4IA 4LFCB 5IK2D 3WV4A 1N1EA 3GAAA 3HSYA 4NZ9A 2FPWA 4GOLD 4EI9A 5IF9A 1URPA 3Q3IA 4X6XA 4WJKB 1KKMA 3BE8A 4ZZ2A 4FYJA 4JYAB 1MPTA 2RG7A 2DUWA 2WZCA 3AY6A 1J00A 1XLVA 3GNSA 4L3VA 4X45A 1JDSA 5F35A 1NPYA 2R7KA 3EFOA 1L7MA 1I4OA 1OX5A 2ODAA 4JL5A 1NN0A 3OZUA 1S02A 1YR8A 5EUCA 1OH8A 3TH5A 1YNSA 4RVOA 2OV6A 4WLUA 3JRWA 3WYEA 1WDLA 2FLWA 2XGSA 3OC0A 4ZDJA 4QVIA 4ZTZB 3WX0A 4LXTA 2CV0A 1CQIB 4FP9A 4EHLA 1U9JA 1OLUA 3O6VA 3RBXA 2VP2A 1F8YA 5CM2Z 3CVJA 2OAQ1 2OFFA 1E7MA 3UQYS 5MFZA 4WZZA 1NG9A 3FKSA 4TS1A 3GY0A 3AM3A 1U5AA 1BU5A 4L08A 3PNBA 3X1XA 3UAVA 2GK7A 5F7XA 4HY3A 4BCCA 3ER8A 3TQCA 4CDRA 5EIHA 1CZOA 2C4VA 3FPHA 4D42A 1ZKDA 1IU9A 4AURA 4ZN6A 4JSRA 1Z6XA 3DBHB 4NY1A 1EP2B 3L79A 4E7PA 4LTNA 4C06A 4FDTA 5I9LA 3AUTA 2IOQA 2E4ZA 4KAJA 4RTNA 1I1OA 4NFYA 1EG7A 2RGGA 1H4SA 2OORC 4D0GA 2O2EA 5EWJA 2GAFA 5DF1A 2P4UA 3HKEB 4C0AC 2XB2A 1DWQA 1CS4C 1XZHA 2F1OA 4PZPA 2X9QA 4C4XA 1X92A 4BNFA 3ASZA 4PAGA 4EJMA 3CH5A 2M6KA 3V2IA 1EFAA 5D5HA 5GWXA 1CUGA 1U1FA 3HN6A 3RSHA 2I2FA 4J7XA 4JX8A 3DM5A 2PGLA 2FVYA 1EFCA 3EMVA 3FFBA 5B6PA 4RVGA 4Z49A 5A2QA 2JLQA 5BVGA 1MPXA 1R4NB 3HZOA 4LNAA 5LA6A 2HFJA 1KSHA 2OFWA 2QRVA 3ETEA 4PLWA 3IPAA 1GNLA 3KV3O 4DADA 2H1LA 3AI3A 1HYEA 1LXCA 1T6ZA 2FXIA 2PZ8A 2ZSIA 1G3IA 3G0GA 4IUCS 4L2IB 2KBFA 2X0JA 1O5TA 2W93A 4ON9A 4YJDA 1E3TA 4YLGA 2VOJA 1TJ5A 1D7OA 2HRRA 1YVUA 2PXAA 2VRNA 3IVAA 4S0XA 1BW9B 3T1HB 2NZVG 4G5OA 5D01A 1KDOA 3COSA 1QGOA 2QUAA 1D9ZA 2BZ1A 1UP4A 2BMJA 1E9AA 1E2MA 4YCNA 1Q92A 2CNKA 3LSYA 5B1EA 5KSWB 2O2DA 2OENG 4ETWA 1ZGBA 4LMAA 5H1YA 3WMWA 1KAQA 3A9CA 1LCIA 5HIMA 3EYAA 3OESA 2VLBA 2UZIR 2G76A 4O08A 4INJA 4QSHA 3C7AA 4GGMX 4OMUA 4JCCA 2ES4A 3B12A 4NYMR 4EFMA 2E1RA 1MQSA 2WIKA 3CXUA 1XPUA 5IYZA 2J9YB 4FC6A 3T7TA 3SYMA 1JDBB 1EHIA 1IN6A 3FGNA 2B7LA 3R6DA 7ABPA 4WLOA 1CQJB 2ZJOA 1XNJA 2J7PA 1KY5A 3NVMB 3W7AA 4ZIRB 2PPVA 2IWRA 4Q37A 7YASA 3FNHA 2VJQA 3SE7A 3I0ZA 5HRCA 3F90A 5FAXA 4I99A 4FD2A 4INPA 4MGZR 2QEQA 4C7VA 2M98A 3BWBA 3BWCA 4DA9A 4X00A 2KWIA 1EFUA 2QORA 3I58A 4HNHA 3H2KA 3N6RA 1RQPA 2SKEA 3HEAA 1CF4A 1HLDA 5D7NA 1L1FA 3AP2A 2DBYA 5CFPA 5DNUA 3RANA 5DHAA 3MS2A 2G9RA 1RYBA 2JARA 5K51A 3U5TA 1GNVA 2B1IA 1NN1A 3ORYA 4GZLA 4BVEA 4CF4A 1D6NA 3HU1A 4FYYA 1YR1A 1NR1A 2GRUA 1Z5NA 2WM9B 3OT1B 1PZMA 2LR0A 4WNYA 2B1JA 4QOFA 1SAYA 4R9NA 4TMVA 4NCJA 2OILA 1EGQA 3AF0A 4AZ0A 3FCOA 3TD2A 1EFPB 1OTXA 2HNKA 5HUJA 2Q4BA 2QR2A 2W58A 4ZV4A 1SXJD 2BP7B 4YI3A 3HVKA 1VJTA 3C70A 3S5JA 3DKIA 3T7DA 1A4XA 4PC1A 1QLJA 1KJZA 5ALFA 4P3KA 2IIVA 2P9GA 1RRVA 1L5RA 3OQNA 3RC8A 5HIIA 1RYHA 4ZMSA 1U0RA 2FW8A 5BSFA 1E3WA 1MTZA 1PJAA 5ILOA 3C6ZA 4RYDA 2UYQA 4HAYA 2A59A 4L4ZA 5J4HA 2AK2A 5B6JA 1VPVA 1Y6RA 1SCUB 2KBEA 1NFQA 5KOYA 4MRMB 2NVBA 1DQPA 2H1IA 1OILA 2PD3A 5JARA 2G63A 1U65A 2LV8A 3L46A 4Y2GA 1PJZA 3WLOA 2AJBA 3SLKA 3TKYA 3JU3A 3N8NA 3RQSA 3FMIA 1FP4B 4JLNA 4XQ9A 1SFRA 1OXKB 5FTJA 3OFKA 1KKLA 4NS1A 5ICCA 1TZBA 4CDGA 3QLTA 4R0NA 1UBHS 4UCXA 4ADSG 4K9KA 4PLCA 3WGMA 1HRKA 4NU6A 1A72A 3A9WA 3UENA 2H5IA 2VDNB 1BXKA 3MWDA 2PCJA 4NONA 1NTOA 2WAOA 2C7QA 3DV9A 4A92A 5AM4A 5SZHB 1TJNA 4LNUB 1YASA 2HSJA 1MW8X 2VJPA 4B4DA 3DXXA 2O8CB 2NYAA 4G1UC 4M8SA 3K2QA 1GKUB 1XTRA 1PFUA 2YBEA 4QBHA 4WN9B 3OCCA 3SLGA 1RHRA 3K70D 3L4BC 4TWZA 1QVAA 3RHFA 3MOGA 1QQTA 3U09A 2OMKA 2OV1A 2OHHA 3A9SA 2AZTA 2R6DA 5H0IA 3T5AA 5DM70 1SVNA 1M54A 2G6BA 4UM8B 4OLBA 5TR9A 5T64A 3UM9A 3QLVA 2ZBQA 1GCIA 1NUAA 4JEIA 4JENA 4XLZA 3A9UA 4RMNA 3EBLA 1KFCB 4TROA 4MICA 3TQOA 4DSTA 4E5DA 4YLYA 1IUOA 4H7KA 4L50A 2BGJA 1M76A 2OBFA 2R8XA 2ODEA 4EJSB 1XMVA 1SCAA 3GGGA 1EVKA 4KRXA 4KR6A 1A7KA 3QKIA 4YRDA 3WWCA 3WGQA 4WGFA 5F3WB 2I5PO 1J0CA 2PAAA 4M1SA 1DIHA 3VOAA 2IX9A 1PV2A 3H2JA 4PRYA 1VJGA 1NR5A 5KNDH 4NYIR 2UAGA 2GPYA 4N48A 4XW2A 2MSCB 1WB6A 1JLKA 5F12A 4REQB 3ADDA 1D9XA 5G1NA 1TTPB 2JKYA 4LY9A 5MGBA 2RH9B 3T06B 3LL4A 3RVRA 4C08A 2BFFB 4KXXA 1O5OA 1UFRA 3F9RA 3IUJA 5JFOA 1UK6A 2V7PA 5LBTA 5DV9A 3FYUC 5A4AA 4WAUA 4O02B 5A05A 2BM8A 4CLRB 4BZZA 3EC2A 3M9LA 3ZHOA 4MVJM 1ZD3A 2NYRA 3TW6A 3VVCA 4GLJA 1GHTA 2IDMA 1EIWA 1GUBA 4DT1A 1NQTA 2W6ID 2BR4A 4G37A 5LU9A 3TEFA 4BB9A 4D8VA 4AKHA 3G82C 3OLXA 4D25A 2ZM5A 1E6KA 1ZRMA 1KZ9A 2ZAMA 1CRLA 4NVRA 4TTJA 3VVBA 4TYWA 1KI3A 1FQKA 1DO0A 2QX8A 3ECAA 2IDKA 2IZ1A 3AKCA 2QYSA 2CLLB 3CNLA 2OXTA 4UTPA 1QRSA 1CUHA 5BXYA 3QWBA 4QARA 2RJ3A 4OGGA 1UMDA 1TEVA 3H9JA 5HDBB 3HRHA 3D7NA 1ORTA 5EMLA 5EFOA 5CU7A 3HKDA 3P9CA 3IGFA 4G0PA 2ZI3A 2B25A 2JHFA 2QY6A 4HNSA 1ZR4A 1V41E 1F4LA 1KXJA 3BMXA 3OLZA 2B1RA 2QPLA 4M38A 3I32A 4NH4A 1MFPA 3ZBTA 2I54A 4LJYA 5AO9A 4LJAA 3REGA 3PJGA 1Y4SA 1YKFA 3SOZA 2CNWD 4Z7NB 1FRFS 2ZUSA 3I6BA 3OBIA 4LHYA 4UBMA 1FYEA 1FYDA 2FVXA 4O1MA 4B45A 3DE4X 1DAGA 1SHKA 1M2NA 2H51A 2IH2A 2EZ4A 4D9CA 4Z4HA 2HMAA 1TE2A 2ZITA 4B34A 5L95A 5T6MA 1Z7WA 2R6AA 4OFZA 5TF0A 3PT5A 4NMWA 4FFVA 5DCYA 4CM4A 3EIHA 5CFOA 3PS9A 4F60A 1XTVA 2XI4A 2Q7XA 4UHBA 4CM8A 4COOA 5IC4A 2XA1A 4DV0B 2WZBA 3M34A 1FVHA 5CIQA 4DC9A 3QSYA 2A8YA 4IDDA 1M5RA 1Z16A 1VMKA 5LYJB 3EA0A 3O4GA 1XRNA 4BMSA 4EGAA 5KPDA 2I7TA 4LHEA 4L4SA 2J3QA 2KM1A 3MW8A 4Z4IA 3STWA 3GO4A 1E7QA 1EPUA 1P0CA 4ZT2A 4HDNB 4LWQA 3VDMA 4C0QC 4YT8A 3BXGA 2YY7A 3V6MA 5JALA 4Y9UA 2XKJE 1HT3A 5AM3A 5A3QA 5A3RA 1FP7A 5B1SA 1RLMA 2GJKA 5AOCA 4LXGA 4HATA 3U9SA 5ISMA 4LZAA 2ZZNA 1UK9A 1EFTA 3F6YA 3OI7A 2G1UA 1W1UA 1UH5A 2YWFA 2OE2A 2CYBA 2YZ2A 3PFIA 3PVCA 3CUVA 1CNMA 2OZEA 4B0PA 5DDIP 4BMCA 1EA5A 3I9LA 1E2FA 1LZLA 3Q12A 3MGGA 2IYUA 4JLWA 4QDOA 1K89A 4UAVA 2EWVA 2PL9A 4YAKA 5K20A 4YP9A 4OGLA 5ARBA 1WQ3A 4XAQA 4BKOA 3DJFA 2WLTA 2DT8A 3VH3A 1PT8A 5JASA 3M1LA 2HIMA 3G0HA 1CF2O 3E5NA 2P9BA 3L1IA 1BGXT 5ICEA 2R0QC 2ZQ5A 4EB8A 2X7HA 3LE8A 1LPOA 3HV0A 4UMFA 3ZE8A 4GI7A 2WWWA 1H2EA 4F11A 2P6PA 4ZVRA 2ZTVA 2XDAA 3JZIA 2EP8A 3R09A 2QD5A 1AGXA 2OAEA 3VNRA 5B3KA 1DTWB 5L6LB 1BX1A 3VJMA 2J85A 1KSGA 4NV1A 3VDRA 1LW7A 5CB4B 4UHHA 1V6AA 3TINA 4F4JA 2F48A 2RDMA 1JHVA 3PKZA 5CNKA 2X40A 1R8XA 4HVAA 2QYOA 2EKZA 3OUUA 4LY0A 3FZGA 4FW9A 4I8DA 3PNLA 4DA7A 3ZU4A 3CWQA 3KJHA 4EYEA 5HZMA 3QOWA 4FFPA 3DMDA 4G4JA 1MQAA 4LYGA 4E5UA 2D2VA 4A6PA 3QTTA 1MIOA 4QGFA 4QBIA 1AXEA 1F8GA 1SQSA 5H9VA 1FX0B 2ZSHA 2QZSA 2VTDA 3ABIA 5LP1A 2OVFA 2NUTA 1WCIA 3AR8A 2WWGA 5CXSA 3OZBA 3AJ8A 3KD3A 4EB0A 5F64A 1IEQA 2ZROA 1YZHA 1KEZA 3QVUA 4DZTA 4H7JA 4RNDB 1Z18A 2I6QA 2WJ3A 4FKBA 2J9GA 4P54A 1RWMA 2F43B 2W7TA 2PKQO 4DANA 5IANA 1U8XX 5JY1A 5BYAA 1SVWA 1NP3A 4B4KA 1GD1O 4NEQA 4HDMB 1V2HE 3V7YA 4DOMA 4TVSA 3GRFA 4DLPA 3FDXA 2DR3A 1DBSA 1F12A 2H29A 2XMSA 1MZVA 3H13A 3IUSA 4URHA 5AHOA 4S2EA 3K0CA 4GPIB 5FBLB 3BEOA 1EVYA 2NU6B 5DASA 3ZNPA 2JLVA 3JVUA 4C14A 1GPAA 4FWBA 4RHUA 1CJCA 4FGSA 4D9FA 3S2UA 3HCCA 1SKUA 4OGFA 1TKBA 1W94A 3U4CA 2I87A 4GSYA 5EKUA 4ANFA 5A9SA 1CYEA 4AWXA 3QLEA 3U39A 3ZEIA 1B43A 2JGAA 2AR7A 3R9WA 2HYDA 1ACJA 1NVMB 4JLMA 3GVIA 4HDQB 1F8UA 3S68A 1A9PA 1IMJA 1QZTA 5ALOA 1MEOA 1UIRA 4MQLA 4MV6A 1N77A 4EUSA 1U94A 5K0JA 4WA7A 4MEBA 3LT2A 3H7IA 3OLCX 4IDGA 4IY1A 4FJ2A 3U3KA 3KKMA 4KVFA 1T9CA 5AXDA 5DMHA 3EXG2 5C7IO 4QM7A 4IXNA 4X1YB 5B37A 4Q7QA 4PLZA 1WUJS 3KVOA 3TTSA 4FHDA 1AUQA 1ARZA 3BF8A 4ZYLA 1XN4A 1NJ8A 1NNEA 1E94E 1JQ3A 3KC2A 4G5RA 4TT3D 1T2VA 2DY1A 2IYNA 5PGMA 5AFSA 1KH2A 1KQPA 5CITA 2C5EA 2M9MA 4RVFA 2CLMB 4AZVA 1R4AA 3KVRA 4JNKA 2NO9A 2P27A 2PRKA 4C29A 5HW0A 2P40A 1KVSA 3A6KA 4XX0A 1IQRA 3TIGA 4F1WA 4ZZ0A 3CLSC 2XOKD 5AOVA 1DXQA 2IEYA 3TQHA 3MTEA 4DHEA 1GYPA 3DZHA 1YZNA 3KS9A 4J90A 4LMRA 5DYIA 3JYNA 2YHIB 1B1CA 4BB0A 4E12A 6YASA 4YMTA 1ZHFA 3R6TA 4RSMA 1N2EA 1XVUA 3I4CA 3PXDA 1JSCA 4BQIA 3CLUC 1KH3A 4BJ3A 1TZ2A 3BF7A 3FOBA 2EARA 4L8FA 1Z4QA 3WADA 5AQEA 4D3XA 4JQOA 2Q28A 2R25B 1IYZA 5IARA 2WEKA 4CMBA 3LQKA 3BIXA 3QFFA 3C14C 4DCOA 2C7RA 4DR6B 2DKNA 2J5BA 3QVOA 5DHPA 5E8RA 3H0CA 4XQEA 2VTBA 2GLXA 3CW8X 2EZ9A 3AY0A 2XUFA 3MBKA 3DDCA 4S24A 1KYQA 3IUBA 3EF0A 4JB2A 3WYCA 4EPXA 2R6ZA 4FIDA 1Z17A 4FFWA 1G2IA 2IL1A 4Q9JA 2NTVA 3T5CA 3ROKA 4CM7A 2JK1A 2ECQA 3GGSA 4DQDA 4ZIRA 2SICE 2R5WA 3VR2A 1VSBA 1G5TA 3TE7A 4YT5A 1XMIA 2JFHA 4NXMB 1AS2A 1U5CA 5C4MA 1GZDA 4LXHA 1B6TA 2C7PA 4MMZB 3BTOA 5E6UB 3U7HB 2A5LA 1AV7A 4KX5A 4D8XA 4AKIA 1I1NA 4OUDA 4TTIA 1L7QA 2C9BA 3EZXA 2HH9A 2P2ZA 1Y1RA 3RE1A 4L5JA 4LG1A 4MEAA 3WRXC 4C07A 2O5RA 3OZDA 4A8TA 4DLAA 4PLVA 5CA1A 2XLBA 3VTFA 2WYWA 1HV8A 1JLRA 3QWHA 1JALA 2OZLB 2WD8A 1X7WA 2MTBA 1U3WA 3OZ7A 4PBRA 4Q16A 2QP3A 4RXTA 4C0SA 4JJIA 3FOFC 2WTMA 4WBNB 4GMXA 1X94A 3HXOA 1TEHA 4ETIA 4U0KA 1XIVA 2VQSA 3PF8A 1PGJA 4BHTA 1D2AA 1E1RD 3I9KA 3H5VA 1ST3A 4RSRA 5FOSA 2J3DA 5EMMA 2VYCA 3WLQA 3FY4A 4Q4HA 2IODA 5MGNA 4QTYA 2WFMA 3ECCA 4KNVA 3VR2D 4X91A 1O6CA 1NW9B 2I99A 2V0NA 3NTUA 1XZMA 1U8ZA 1UFKA 4K40A 4L6CA 4U7DA 3F74A 5A62A 3ZJUA 4KE8A 2IYAA 4KXFB 3AR6A 1VP3A 3AIKA 3DMNA 4L3WA 4ENTA 4HN4B 4AU1A 3CF0A 1PK8A 3HKBB 5EE0A 4PZZA 1WQ4A 2QP9X 1KDPA 1H2AS 1MW9X 1ZWKA 2X5JO 1XRJA 3F5MA 3H16A 2I1VB 2UV8A 3LKZA 1G3RA 3PITA 4R41A 9GPBA 2AWOA 1AQUA 3UO8B 2YVUA 4DYVA 1GPBA 1QJCA 2OHXA 2WOOA 1SBCA 2AE2A 1PSDA 1Y3AA 3KK0A 3PJEA 3I9MA 2QV0A 4QGAA 1V37A 3B3QA 4PSVA 5LA6F 5FAKA 4BO3A 1DAPA 1LW6E 1TX4B 1E6CA 1QRDA 1JKXA 1JLMA 3LPLA 3ACBA 3IE2A 4ZVOA 4MVYA 5CD9A 5IZ4A 3HYSA 2PAFA 1CJUC 4IZOA 2F3PA 5CXUA 3G79A 2P2NA 1CZHA 1HLFA 2AE1A 2NOAA 4KYIB 1KU0A 2YRFA 5EWLB 4MGYR 4BLSA 4D9IA 2BGGA 5J2TB 4H1HA 4GXNA 2O8NA 2JLBA 5H3LA 3TEMA 1BDMA 1DQZA 2OC9A 4QTXA 4A0RA 1XEWY 2I29A 4E32A 5LP6F 2AN5A 1RRPA 1X8LA 3MOIA 2VPYA 4P7JA 1BQ4A 4KXQA 2ZWAA 1YQDA 4X95A 1HDIA 1SQFA 4PYOA 5ABPA 5HUQA 2P4HX 4TMZA 1HF3A 1U6KA 1U7HA 1PWYE 1W88B 3AFHA 3MTDA 4HVCA 2GPSA 5AVXA 2HA2A 2FK7A 5IBCA 4H31A 3LLSA 4XUCA 1M2HA 1WBJB 4Y6GB 4K9DA 3DE0X 1CHNA 1J06A 1I1HA 4B9EA 1GT6A 1G17A 3I1IA 3Q7EA 3U3ZA 3QX9A 5L3SA 3DLTA 1KI6B 4HV4A 5DP2A 3KTAA 1PR0A 4IAOA 1SJ9A 5DNEA 5TEWA 1R9MA 4B31A 1IJEA 4OP3A 2C8VA 5IVHA 4B43A 4CU2A 1YHNA 1NMSA 3P9NA 4MRMA 1J22A 2IHNA 1FQOA 2VYNA 2BGTA 3GRAA 3L0DA 4R8SA 3O74A 4IIDA 3AX6A 1ZK2A 4B8ZA 3JALB 2VG8A 1NQWA 3DFIA 4IDCA 2G0NA 3TFQA 4YCDA 2BFEA 3G2MA 3BSFA 4E03A 1CKEA 4FFSA 1CQWA 2XKAA 1R12A 3LIPA 4GKBA 4CJXA 4PLHA 3TNYA 4DLTA 2AFIE 3EF3A 2WHRA 5A5FA 1I33A 3U37A 4XD7A 3G85A 3ABQB 4LI0A 4Q21A 5K3FA 2FCRA 1UBOS 2OK8A 4B2PA 5KQGA 5EKTA 1ZRHA 3KOXA 2WJ6A 3GEGA 1DJOA 2BKEA 3CMMA 1WVIA 1WW3A 4LY3A 4OLJA 4IQFA 2B5OA 4K9RA 3FUCA 1AKVA 1VPEA 4ZO6A 4DWWA 1DHRA 1NLUA 2D0DA 5SZKB 4DXHA 1DX6A 3K05A 2FPGA 1TYAE 3HWSA 4PHHA 3JW8A 3KLOA 1MDBA 2NVWA 5JSZA 2PZBA 3HCAA 1HKUA 1YIDA 3HJUA 2V3VA 1P19A 1XUOA 1T5DX 1PDOA 1XQ6A 1JMYA 2CKDA 2GR9A 4MQMA 1TTQB 4NAVA 2ZZMA 3GH1A 3GIWA 3OE7D 5BSUA 4RS4A 3QWFA 1ZWLA 3VX4A 3ZH9B 5AM2A 1QCYA 5AUQA 3SXJA 1J2RA 3M5WA 4LA4A 4YWJA 4J0IA 3REQA 4NOKA 4WACA 3DCNA 5BW8A 1A77A 1YDFA 2ZZKA 3RRZA 5CA0F 3AUSA 4BFZA 4Q1CA 4ZKDA 1NJ2A 2DPHA 4OA5A 4QG7A 3BVPA 4GRAA 1ECCA 3GLFA 1LDBA 2W98A 4UUPA 1EINA 5DH9A 2VAWA 4AG6A 1SUDA 2VK8A 2W5UA 3JAWB 4M7WA 1E9BA 3QUTA 2B6HA 2WWIA 1JS1X 3K4HA 4XSGA 3RUPA 4DJEC 3V42A 1AO0A 3QF4B 1E7YA 1DGQA 3CXRA 3NBAA 4OREX 3RIEA 1P2GA 3RJMA 4EL0A 2D6FA 2QN3A 3L40A 1TVKB 1FB5A 4G8JA 1ZMOA 4QJIA 3ZI0A 4Q1FA 1UDRA 3S4YA 1BJRE 2PIAA 4RHXA 3TNJA 1EUQA 4XFDA 1TM2A 3K53A 2ODPA 3KZ1E 5FDFA 4OYHA 4S1VA 2FDXA 1X6VA 2GBLA 3C45A 4UNRA 2ZXEA 3DMYA 2HWUA 3P9XA 5LZ2A 1QR2A 2RI0A 3QBEA 5CX4A 3VKGA 3K9NA 3MPOA 5FWYB 2XXAA 1QV7A 1EXNA 3GFOA 2Q2QA 2V8BA 2VJMA 2ZUVA 1WW8A 3HJBA 4CLRA 5K09A 1TW3A 2DOKA 3AHEA 3FDJA 2Q3DA 1TCCA 1FF9A 2VZ9A 3PFKA 2A78A 5LQUA 1TLTA 1ESMA 3A7EA 1GR1A 4KTVE 1XG5A 3KLBA 3KWJA 5EKDA 5HUHA 1E96A 1DIBA 5BWNA 3S2YA 3GYBA 1GTRA 1TQHA 4CZ2A 4BLOA 1NIJA 4KBYA 2KQUA 2BBTA 4BXOB 3PTZA 1L5NA 5BNIA 2GD1O 3GEPA 5F2EA 1G6HA 1M1YA 4C4YA 4C4AA 1KOGA 2CGEA 4DBZA 5LQRA 3OSUA 4JJ8A 4ITVA 4OMCA 3U44A 3JQEA 1RQ2A 1NQAO 3CN7A 4EVSA 3DZIA 5FOVA 1PJ2A 1KQGA 2YV3A 4ENUA 1C0KA 2XTMA 3DFFA 3UFBA 2SHKA 3OP4A 3P0HA 3JZAA 1CUIA 1C3OA 2IYYA 3N1UA 2DBQA 3G6KA 1JFSA 2VPPA 4N5DA 4OYYA 3B8HA 1XRRA 2QZPA 2Z57A 4RKYA 4XVHA 4WXYB 4ER5A 4J8PA 1Z7YA 1WA5A 4NNJA 1LBSA 1GSAA 3IOCA 3GJRA 1HDEA 3TQSA 4EA8A 1C81A 1GCGA 3PB3A 4N8SA 4DNFA 5A03A 1LPPA 2JVJA 4EI7A 2WWYA 3VR3A 4RVUA 3EW9A 3HNRA 1E1LA 2ONCA 1KR2A 3KEOA 3QP9A 4G0YA 3UHOA 3PR3A 1XDDA 3L05A 3WB1A 5ES4B 2QE7D 3EUWA 1T5BA 3WMGA 1GA6A 3D9QX 3DWIA 3BE5A 4P93A 1G291 2OXIA 1LVHA 1DKRA 3KZMA 3GFQA 5K99A 1XTKA 1YZVA 4HH0A 1WW2A 2ZYSA 4JJKA 3QVVA 4G0OA 4KYVA 3K70B 3ZWDA 3TOCA 1PO7A 5H81A 2OGWA 4Q3EA 4BV3A 5KYNA 3T9EA 3ZE6A 4Q4AB 1NBMD 2OO3A 4YJHB 1UFVA 5KJ6A 1P31A 3ZDCA 2A0WA 2VFAA 1RFLA 1SELA 2ADMA 1COWA 1A9XB 4D80A 1SWVA 3RJTA 1U2EA 1GRNA 3B1KA 1N5RA 1UP7A 4MJXA 4QODA 4AFNA 4WXMA 5EN4A 3K15A 3W8DA 3CPEA 4F21A 3ZS8A 3WNVA 1TVCA 3BDVA 3RVLA 1WKVA 3CNOA 5H68A 4ZRNA 1WIWA 4BL5A 1YJCA 3M4XA 3T8YA 2WU4A 1U2SA 5CD1A 1FIUA 2BR5A 2UUCB 1N78A 1FSZA 2BF4A 2HMTA 4H4EA 3C39A 4RLQA 3QPAA 1NQ5A 4WTOA 1N1DA 3AF2A 4FGUA 2FZLA 1SUEA 4OM8A 5ECDA 5AT1A 2P6OA 5GONF 3RASA 2AKYA 3GPDG 2OZKA 1C3XA 1JB9A 5MN4A 3FTDA 2VXBA 2GVNA 3HCNA 2FPUA 4ZT5A 1F4PA 3K0CC 5HRUA 3MD0A 4O2RA 1IBLB 1PF7E 2VF2A 2X4GA 4UAJA 3ELUA 1IB6A 5K9ZA 4P34A 1OH5A 1J09A 4F6LA 1CVLA 1J5PA 1HFWA 1C7QA 4IJUA 3MTIA 4JOSA 3O8QB 4TYNA 1H3EA 1YS7A 1YT5A 1XDWA 1KDYA 1Z75A 2OV2A 4IIBA 4BC0A 2IBTA 4V0ME 2PUTA 5ETJA 4PG7A 2X5XA 3BMQB 1TCVA 2YHSA 2AG6A 2JASA 1ZH6A 2M1XA 2JCVA 4BKPA 3BHNA 5L3QA 4QJ3A 4GEKA 5EA2A 1M7BA 3JD0A 1YK0A 3MBOA 4O4IB 4Z0HO 3ZJYA 4CLHA 2OA0A 1LFAA 3AHGA 4PPNA 4MB0A 3RRJA 1CQJA 2BFPA 5IWAB 4KQHA 4P7FA 1NIPA 4EHBA 5A0FA 1SVMA 1CE8A 3KKEA 4RSHA 1C7EA 3RR2A 1Q7TA 1A5TA 2FWMX 1XAIA 1P9NA 2JNWA 2OCLA 3Q7SA 2PT7A 1X1EA 1SBQA 3MFQA 4UVGA 1ZXLA 3M33A 2R8OA 3KQTA 3N6XA 2XCIA 4QTUB 1PZNA 1HEUA 1EJ6A 3WJ7A 3WFIA 4QEDA 4LQ4A 1DKLA 3H0KA 2VUHB 3C1UA 1SKYE 1FTQA 2REOA 2V58A 3BDIA 3FWYA 1UBJS 1TOAA 3L9WA 4BQOA 4WOKA 4B6OA 1Z4IA 4GOJA 2DETA 2HMUA 4OBEA 5LOVB 1MA3A 1Z07A 1KK0A 4YJHA 5ENDA 1ZSVA 5FUWA 4RJTA 4MVWA 5ENVA 3O7MA 1KTVA 1VCMA 2CVOA 1PNTA 1G55A 2C4TA 2GYWA 2PA3A 4J0JA 3NGXA 1U9IC 1OWNA 1W36C 2DRIA 1JVBA 1RSZA 4HGQA 4YMUA 1K7SN 3HB9A 3E8SA 2V8OA 1EWYA 1SHUX 3F5QA 1KI1A 1P45A 2YXDA 2QTVA 2BVNA 3LP8A 3P19A 1VL6A 4HGRA 5E0KB 3FIJA 1PDVA 4JI1B 2VDWA 1QZZA 1XZDA 4Q9HA 1XAJA 2I7CA 2VNAA 2CHVA 5I7RA 2R87A 3T3EA 2ZRAA 4HB3A 2I4TA 1WNTA 4UFOA 1I4EB 2Z3VA 3GRCA 4N65A 4NARA 3AEQB 4B6EA 1DHTA 3W7BA 4JVNA 5F51A 4AZWA 2PRZA 2FSGA 4CV0A 2QM0A 3A2NA 3HFJA 3HI6A 2ISSD 4XIJA 3MJFA 1Z63A 2CYAA 1IN5A 1D3AA 1JHUA 1ETUA 1Q5PA 2GTHA 2RH8A 4NECA 3A4YA 4OJMX 1F6DA 4PCLA 4R2XA 3SYTA 5IJ0B 3W5UA 4MDEA 3DBOB 4MW1A 2RK4A 2WA1A 4AY3A 1TMYA 2OV4A 2FSUA 4XZ3A 1USGA 3AV3A 3TCXB 3N2LA 2HDWA 4F97A 2HAEA 3VV3A 5ER9A 3W2IA 4PC2A 1D2CA 3ETCA 1USVA 1U3GA 4RENA 1NBAA 5HMLA 4LX0A 3ES9A 3VO9A 3AR7A 5SZIA 2ZB7A 3M6AA 3OFSA 1FNMA 2JIMA 5FBQB 2DZDA 4HCJA 3TSWA 3V4VB 3DAFA 3FCXA 1Z62A 1PVDA 5KYGA 3N70A 1XQYA 2HQSA 2V74B 5AOBA 1CY8A 2QGNA 3E22A 3EXEB 3CZMA 3DAPA 3GI1A 1OFGA 2P30A 2LWIA 4B09A 1BEZA 3UHPA 3E9CA 2UXCB 4PWZA 1N0IA 4GKAA 1MRSA 4TUYA 3KFVA 4IDOA 2IV7A 1UJ5A 1A9QA 5A3VA 2O8FB 3EGDB 3QE0A 1A7JA 4LHWA 2FF7A 3F67A 4OHKA 3TDKA 4PC6A 5DN9A 1IAQA 4MS1B 5LOVF 3H2YA 3D6TB 2VI5A 3A3PA 1ATZA 2P7HA 2OBBA 3PYMA 3VYRB 1OV6A 3AUXA 5TY0A 3EAFA 5JJ5A 4IDFA 5CM8B 3PICA 5ALVA 5SYMA 4BWGA 1L4GA 2AUTA 2GZHA 3WKEA 4KGXA 2VAVA 5SZJA 4J16C 5AK5A 1G6Q1 2UVPA 2J31A 2J48A 2WJYA 2YVKA 4D44A 3VJRA 2FUCA 4GUAA 2RHRA 2ZRCA 1ODTC 1LS6A 1K4YA 4J9VA 4DMKA 4Y0VA 1BSVA 3O4HA 4KO8A 1B6GA 4X3PA 3LDUA 3Q1LA 1QU2A 3ET4A 4R8KA 4U6NA 5KINB 5BYJA 3G0CA 2PU7A 2QZ4A 3NOOA 3K2IA 4HHEA 5K8VA 4TKUB 4G36A 1YDMA 2C4UA 3P2OA 4REQA 3S99A 1X1QA 4M9QA 2KLHA 3OOWA 4IHJB 2IYRA 2WUVA 3N7AA 1QM5A 4KQWA 2GT1A 4AKEA 2OHIA 2L18A 5LLDA 2VF8A 4QGBA 5IDVA 4D74A 3FYUA 5HDQA 3LT5A 5AI4A 2B7BA 1NC1A 3GNTA 5ARDA 5HFAA 5ALRA 3LXRA 4ER7A 5LMZA 1D5WA 3BD6A 4WZBE 1UKBA 1U9ZA 4A73A 4AKTA 4M9XA 4X9XA 2OO7A 2BKVA 3WBJA 5C3MA 3LPDA 1WVGA 4EECA 2MSKA 3INNA 3FTNA 1XZAA 1Q0RA 3SHFA 3GLQA 2GCOA 1BDBA 3VSCA 1R0CA 1CZNA 1EEXB 2R1UA 1QOZA 3DP7A 5DOVA 1OA0A 3BWEA 4US2R 3NT4A 1NNI1 1HZZC 2YFHA 3AXSA 4GX2A 3AI1A 4XYEA 2O2YA 4JBXA 5JQGF 3EPLA 2JFVA 5ESDA 4KUHA 5DHRA 2O0KA 4QQRA 4KXYA 4Q4JA 1GDDA 2O7SA 5J40A 1NZJA 3R6GA 4U7HA 5JRDS 2QS9A 3JSAA 3L6EA 3VZRA 3O4IA 3GWZA 1WXQA 1SPXA 2I6GA 4OEHA 5CVVA 4O4HB 4ALIA 1G8MA 1G4UR 4KQJA 4DDVA 4EJ2A 4K5QA 3NAQA 3G23A 4DMMA 3B3FA 3FLEA 2PGDA 3GIDA 1Y5MA 1O57A 1THMA 3IAXA 2A5FA 4MI9A 4GPZA 3NVKI 4MGKR 4LJ9A 5IZCA 4HDKB 3ITKA 3PQ7A 4IKOA 2OD2A 3EGDA 1SURA 3HU3A 3L93A 2C9YA 3LQYA 4TRMA 3EVDA 3ZHXA 4AJKA 5DI3A 5SICE 4HEHA 2NGRA 4IM7A 4Q01A 3STUA 4LDRA 4H6XA