1U4SA

Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedisulphonic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
307
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 115
structure length 307
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u4sA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u4sA02
4Z3DA 3RKRA 2OP0A 4NBTA 3I4CA 3DAPA 4E2WA 4N5NA 3C85A 3ZV3A 2B4QA 1EFKA 2VZ8A 1ISJA 4EUEA 3VHRA 1Z45A 3PWZA 3ABIA 4RVFA 1EBFA 3LDHA 4XQGA 5DBGA 1TI7A 4FCCA 1I3KA 5ILOA 3ORFA 1YRLA 3FNGA 1EQ2A 2CUKA 2PFGA 2JCVA 3HQ4O 3PQDA 4J90A 1GZ4A 4I5EA 1YB1A 2AMFA 2OGUA 3VPFA 1JKIA 4GSLA 2DFVA 3T7CA 1HSZA 5EMHA 5L45A 2YHIB 2DVMA 3VH2A 3LQFA 4YRBA 1OAAA 1CQIA 4RF4A 2WEKA 1E3SA 4DQXA 1LNQA 1E6EA 3EZLA 4XD2A 5A3VA 3DBVO 3AOGA 1KVSA 3L0DA 4XQ9A 2X9NA 3TOXA 3AUUA 3W4IA 3F9IA 4HFRA 1SCUA 4D41A 5DULA 3ICCA 4Q3EA 4E33A 1ZUD1 1A5ZA 2PKQP 4J0EA 4CMEA 3IAHA 4R16A 2X0JA 3D3WA 4CQMA 3BZUA 3P7MA 1Q1NA 1XLTA 2FSVA 2Y0DA 5U1PA 4GI2A 1K0UA 2J5KA 3IIEA 1YKFA 2HMVA 2GNAA 3JD1A 4C7KA 1R4NA 1DO8A 1LC0A 3MOIA 4Z9YA 3PYXA 2ZB3A 5TS3A 4TRJA 3LLSA 1WZEA 4OM8A 5GY7A 2VWHA 4HFMA 3ENNA 3AU8A 1EEHA 3H7AA 3KO8A 1BXGA 1NM5A 4BNGA 5TJ9A 1N5DA 2PKQO 2VHYA 1EZ4A 4AJNA 3M6IA 2J3JA 3IP3A 4KUHA 5DOZA 5AQ1A 1JQBA 3JYOA 3L07A 2PGJA 3JQGB 4CM7A 5JCXA 3FNFA 3ON5A 4A10A 3AY3A 1GEEA 5DT9A 5TC4A 5A5EA 1GAEO 1XU7A 2J5RA 2X58A 1QYWA 2X8LA 3DO5A 2G17A 4KUGA 4BIIA 2W8ZA 4TQGA 2W2KB 3I1JA 3JD0A 4BV9A 3DFZA 3H9GA 4CM3A 4OGWA 4PLVA 3MWEB 3LT2A 2VT2A 5IZCA 1ZK2A 2RH8A 3NT4A 3GNTA 1MFPA 3K92A 1XIVA 1NTOA 2HCTA 3E48A 1DHRA 3N7UA 5F1PA 4Q3CA 3EC7A 2DBRA 3TSCA 2AQIA 1CIVA 1Y8QB 1A27A 4M55A 3V1UA 4PVDA 1YL6A 3BMOA 1EDOA 3GVXA 3GFGA 2H5LA 4R5HA 2UUPA 2W98A 1Y9AA 4R1UA 2FZEA 4RVUA 5JO0A 3VZPA 1PR3A 3LSYA 1WW8A 4FPXA 4RV9A 4CR7A 8ADHA 2G1UA 3KSZO 3KVOA 1SMKA 4J2OA 4MDHA 4RPHA 4AJJA 2HKIA 1ID1A 3WICA 1M76A 4PLFA 4RVHA 3ZNPA 1LRLA 1QLJA 4MVJH 3VZQA 2Q3EA 4GLLA 3UXYA 2VN8A 1LLUA 5DBIA 4B4UA 1E0DA 5HS6A 4PLZA 4ALKA 4F6LA 4DBZA 2NWQA 3AWDA 2E4AA 3AW9A 3GQVA 3GRPA 2YV1A 3ZZNA 4F3YA 4AJ1A 1N1EA 1HDCA 1W0CA 3F4BA 1VPDA 2PV7A 4DPKA 4G5HA 1R0KA 2HU2A 5AXDA 2X86A 4EITA 2AEJA 5H83A 4X54A 1HDXA 4TRMA 3D64A 1ONOA 3HDQA 4GH5A 4IXWA 3E03A 1T25A 1E77A 1WMBA 3M1LA 1DFHA 4OL9A 1C0PA 3E9QA 3V2UA 2P5YA 5CHEA 1IB6A 1VLLA 4M89A 4WLNA 2YDYA 3PXXA 5JBIA 2CVOA 1L1FA 3OEWA 1R16A 3EYWA 1BDMA 4Y9DA 3GLQA 3WQQA 4RF2A 1F0YA 2BFPA 4FD3A 1TB4A 2ZYAA 3I23A 5CDTA 2BD0A 4P38A 4E4YA 1UP7A 3CMMA 4WCDA 2PY6A 4C7JA 4PLHA 4IM7A 5CEEA 3X2EA 5COAA 4ESOA 3WGIA 4B8WA 3GY0A 2GRAA 3PP8A 1YGYA 4OXNA 3NTRA 3H2SA 3CKYA 1LI4A 3ETDA 2DC1A 3QQPA 1U1IA 4FC6A 4BNVA 4WE3A 2A4KA 1C0LA 5A4DA 3UVEA 2JHGA 4NPCA 1EK6A 4E2XA 2YYYA 1PJTA 3CH6A 4E0BA 4KZPA 4NBRA 1DFIA 4II3A 1V3TA 4PVCA 2X5KO 5L7TA 4ILKA 2WDZA 4UUOA 1U8XX 4YT2A 1K3TA 4ND5A 4NQZA 3W4JA 1R0LA 1NAHA 2JD1A 1ML3A 4WLVA 1ZXBA 3BTVA 1ZKMA 3JQGA 1DC6A 3WGGA 4CLOA 3QVTA 1LLCA 2DLDA 4AFNA 5CG2A 3L9WA 1DRWA 4R68A 5TGDA 1B8PA 1Y1PA 4YA6A 2YHUA 2QHXA 2PZMA 5JMPA 3OJLA 1ZBQA 1I2CA 4PG4A 1DLJA 5IZ4A 2AG8A 3TJRA 1JVSA 1IULA 5I7SA 5LDHA 1DSSG 2BF7A 1GL3A 2A92A 3ZWBA 3WMWA 3OIFA 3S1LA 1FDUA 1N2SA 1EDZA 1PWZA 3IJPA 3DZIA 4IXTA 5JAIA 1P31A 4WLOA 1IPFA 1JN0A 1G1AA 1QG6A 1VKOA 2EF1A 1VI2A 2X4GA 4H16A 4BKQA 4JN6B 4N54A 2H9IA 4ID9A 3GA0A 3EDMA 1E1NA 4TRRA 1QYVA 3F6YA 1KY5A 4GX2A 4AJHA 1EMDA 1E7QA 4WCFA 2POQX 1V3UA 3JQ9A 5B12A 4BKRA 3PK0A 4GVXA 4Z0PA 5HA5A 4J16A 1RM0A 1E5QA 2VNSA 3AI2A 1N7HA 4XYEA 2EJWA 4AJEA 1SEPA 4YDRA 4WOJA 4P8RA 2Y1DA 3V8BA 4IIUA 1ISIA 2AEMA 4JJFA 3GGGA 4ALNA 3K96A 4ALMA 4A27A 3IKVA 4XYMA 1E3LA 4QXMA 1WDMA 5JCJA 3HFGA 4UUNA 1WDLA 2GZ1A 3TN7A 1YB4A 1RM5A 4F6CA 1ADFA 3DOJA 4UUPA 3O9ZA 3F46A 2UVDA 1KYQA 1G0NA 3AUTA 4LSMA 1FJHA 1O0SA 3ADPA 2ET6A 1UZNA 3P19A 4CM8B 2VTEA 5FI3A 1PZHA 2P9CA 4P4GA 2WE8A 3RWBA 2DT5A 4MKRA 4QSMA 3RJ9A 1Y8RA 4GQAA 2DPGA 4CUKA 2XOXA 1K6JA 2BI8A 4NI5A 2ZATA 4ZICA 4BV8A 4IQ0A 5BSEA 1BRMA 2EJVA 4D3DA 3Q0EA 1M2WA 3C1TA 3RJ5A 4QFCA 3V1TC 3U3XA 1DIRA 2HLPA 4GWGA 3D4NA 4Z9FA 2V6BA 1KY4A 2P2SA 4HFNA 3HJAA 5I9NA 3SLGA 1CQJA 1H93A 2QRLA 1T24A 2ZYGA 4BGIA 4DPMA 3ROKA 1MB4A 2Q1WA 3I6IA 4NK5A 3B1JA 4BQPA 3L4BA 4IMRA 1BDBA 4J1QA 3VKUA 5I8ZA 5FF9A 2Q2VA 2ZTUA 3H6KA 5DZSA 4WCFC 3HUDA 4Z0HO 4FDAA 2OBYA 3D3EA 3F5SA 1ZSNA 1A9ZA 3TFOA 3ZWYA 2BFAA 2CF6A 3TZ6A 4W6ZA 3ZU2A 4A03A 3VH3A 1RPNA 4PCVA 3INTA 3DBHA 4W4TA 1UZMA 3ZU3A 2NTJA 4OXYA 4GX1A 3BTSA 3EW7A 2AEFA 2A35A 3GUCA 3RIHA 4R41A 4OIMA 1D1SA 4IDDA 3RSHA 3ZHBA 4BNHA 4BGUA 4NIMA 2Q46A 2AE2A 1O94A 4D3FA 3LU1A 1P45A 4YQYA 1RM3A 1QYXA 1TT5A 1I3LA 2H1SA 3AFMA 4J49A 4ZRNA 2JD0A 5ER9A 5H82A 5KVQA 3ZHZA 3WIEA 1PGOA 3RROA 1BHSA 5JNLA 1E7RA 2I5PO 2IXAA 2YUTA 4IDGA 1A72A 1Y9EA 4HNGA 5JDIC 2CMDA 4UVIA 4XGKA 1YOVA 1LBEA 2HJRA 3I4FA 3Q11A 3RUIA 4IDAA 4M8SA 1PU2A 1UDAA 3EUWA 4XYBA 4YJHB 4UEOA 4DVJA 1ZSVA 4AJ4A 1NHWA 1PL7A 2P68A 3TL2A 2O3TA 4K28A 4JP3A 3NRCA 1B16A 3NAQA 4BNLA 4PLGA 3WMXA 1NXQA 3ANNA 1CDOA 3D4OA 4MVJM 1YOVB 1YL5A 4DLAA 1ISHA 3FWNA 4PG7A 4YJDA 2BKAA 4MJLA 5JYEA 1I5RA 3WJ7A 2E48A 5ITWA 3U9LA 2C2XA 2VZ0A 3L4BC 4ZQFA 1H6BA 1CYDA 3OA0A 3RUHA 4BUCA 1C0IA 3OECA 5EIOA 3V5NA 2WTBA 5L53A 3ZW8A 5KVSA 1K6IA 2UV8A 2HJSA 3W6ZA 2Q4EA 1HDYA 2XPCA 1HL3A 1SNYA 4NFYA 4YRDA 3DTYA 4GX5A 4EJ0A 5MDHA 5KWEA 4XB1A 4IJVA 1F12A 5TIIA 1CRWG 5JDCA 1B3RA 5IXSA 4E30A 1JWBB 5A02A 5JAZA 4LSWA 1RKXA 1P44A 4LMPA 3RD5A 3NEPX 4RVGA 4Z6KA 2JFFA 5KTKA 2O3UA 1PSDA 2HSDA 1ADCA 1O8CA 2JD2A 1JA9A 1FF9A 5JXWA 3WB9A 1VL6A 2YW9A 1B14A 3NDRA 3H2ZA 3HN2A 5TLSA 1Y8RB 3DZBA 3FPCA 5ADHA 4LVCA 1GCUA 2ZCUA 4URFA 3SJ7A 3JQ8B 1LA2A 4BKOA 3LZ6A 3WTBA 4DUPA 2OL4A 2VUTA 3LC2O 4XQCA 1U4OA 1I2ZA 2FRDA 3PHHA 2QZ9A 1ZZEA 1P1HA 2PH5A 4HKTA 3PHJA 3A1NA 1HLDA 4CPDA 4R69A 3CINA 3GEMA 3DQPA 4FGSA 5KVVA 2NM0A 3E1KA 4OO3A 3CE6A 4MO2A 1J4AA 3BYZA 5JLAA 5ICMA 5L4NA 1LSJA 3SLKA 1R4NB 3JQ9C 3MJCA 1Z74A 2HAEA 2NSDA 3JD3A 2EP7A 4LW8A 1NPYA 1LSOA 3DHYA 1ENYA 1GYPA 4AJIA 4JCOA 2VQ3A 4MVJE 1D8AA 3EGOA 2PGDA 4O1MA 5DDIP 4PG8A 3C24A 1B8UA 1GYQA 2QRKA 2ZKLA 4J6FA 2VWQA 5DF1A 1QXSA 3L6DA 4DGSA 2WYWA 4BNMA 4IDBA 4D46A 3OICA 4TMFA 3O26A 1I2BA 2IODA 3K2BA 1GADO 2P9EA 4CMHA 2ZQZA 4J9VA 3DBHB 1I33A 1ZXLA 1DC4A 5THKA 2J3IA 4HX5A 4QO8A 4W7HA 3GPDG 3EK2A 4ZGWA 4PLPA 1SB9A 3QV1A 3E5MA 2RAFA 1OOEA 4IJUA 1YJ8A 2HQ1A 3W8EA 3WQSB 3ZHYA 4J91A 3ZWAA 3L6EA 2OMEA 4FJ2A 4E5MA 4O5OA 4ZD6A 3DOCA 2JL1A 4MP3A 4BMSA 3K2EA 5C7IO 4BO3A 1RJWA 3KBOA 5C5IA 3OH8A 2FR0A 2O4CA 3KYCA 4IIVA 2D59A 4XGIA 3CXRA 3CEAA 1EVYA 3R3JA 4XJSA 2QW8A 3ZCXA 4YJFB 2Q2WA 4Q3AA 3T7EA 1UDBA 4JIGA 1E5LA 7MDHA 2OOSA 3KSUA 2YZ7A 1B26A 2NVWA 2GUGA 3MJVA 3QWBA 2V7PA 3QHAA 3RUFA 2C2YA 1NNUA 5CEJA 4E5NA 4E2ZA 1T2CA 1H9BA 1MX3A 4YJHA 4Y98A 3VTZA 4EI2A 4GGPA 5BSHA 5AVOA 1X0VA 1ZSYA 3V1YA 3PFFA 1LQTA 1U7HA 3DTTA 4QEDA 1GQ2A 1IY8A 4JX8A 5TT1A 4CUZA 4MIYA 1ULUA 3H9JA 4J2HA 3DZJA 5JE8A 3V2GA 4BNIA 2B36A 1HYEA 1DPGA 3GPIA 1EUCA 5FFFA 2GN8A 5C7LO 4L74A 1PJCA 2ZIZA 3I6QA 2OP1A 3QIVA 3KRTA 3GT0A 1X0XA 3UF0A 3DB2A 4IZHA 3VDRA 4OOEA 1E6UA 1O95A 3K30A 3QWHA 5TSDA 5L7YA 3FD8A 3ZWOA 3TWOA 1YBMA 4J1TA 2C7VA 1DAPA 3KEOA 3GAFA 4D0SA 1ARZA 3K6JA 4EJ6A 4G2NA 5T64A 4ZN6A 3GNSA 1BMDA 3TPCA 2B5VA 4BKPA 1ZEMA 2GR9A 2VYND 2V6GA 5IDWA 2HMWA 3T4XA 1HDOA 1LTHR 3GMDA 4BO5A 2EP5A 1R4MB 4FJ1A 4WECA 1MGOA 1N9GB 1LC3A 2Z1NA 3ZHXA 1Y81A 1EQUA 4D0RA 1X13A 2VZ9A 4TKLA 5T57A 4CV0A 1ZH8A 3BAZA 1DBVO 1ADGA 1O9BA 4IUYA 1GR0A 4B7CA 3UHAA 2B4TO 3OJEA 4B3IA 3ASUA 3GG2A 2HMUA 3PIIA 1UUFA 4H15A 1HDRA 1LSUA 3WSWA 3CZMA 3QSGA 4Y6RA 4IS2A 4BNYA 5LC1A 3LLVA 1TT5B 2W4QA 3KB6A 2VOEA 1W6UA 4QX6A 3H5NA 4N7RA 4S3MA 1PJSA 1U3WA 3PDJA 2NQ8A 4LRTB 4PLTA 1H6DA 2OO5A 5L3ZA 5ER6A 5A9SB 1UXIA 4HFJA 2IEBA 2ZK7A 3TQHA 4FFMA 1J5PA 2NTVA 2DBQA 1U5AA 5A05A 2O3SA 4O6VA 1PJ4A 3Q2IA 3RKUA 4BO7A 1I10A 1VJTA 3HB4X 3INRA 1V35A 1LDBA 2GERA 2Y1FA 4HUJA 4OSPA 3LT0A 4RZIA 4YAIA 5EPOA 4CUJA 4E13A 2ZJ1A 4BHTA 2AQKA 4B3JA 4KWHA 1WDKA 4AJKA 1MC4A 2EKQA 3QE3A 4QUKA 5ENDA 3ITKA 1A9YA 2TMDA 5G0TA 5HRUA 6ADHA 1T2AA 3DEYX 3PI7A 3QP9A 4PN3A 4YPOA 5A03A 5I8WA 4CMAA 4YAEA 2BLLA 2OZPA 4RVDA 2GGSA 4CODB 3FTPA 5K6AA 2C20A 1HXHA 5DN9A 4BO9A 3DZGA 4GWKA 1GQYA 5IZCC 4UVGA 3OJFA 5CG1A 4NG5A 5KKAA 2PNFA 1VL8A 5L4SA 1NQAO 5KJFA 2DTEA 2NVUA 5G4KA 3WTCA 5I7EA 3HDJA 5JFOA 4L0QA 3G0OA 1T2DA 1NR1A 3EHEA 4I5GA 3GZNB 3KLPX 2AG5A 3AJRA 3KYDA 5CDUA 3PEFA 1F8GA 4MP8A 1H2HA 1H2BA 3GG9A 4FFPA 3JQCA 3GMSA 4LCEA 4FW8A 5TNXA 3T4EA 2X0IA 4DIOA 3GOHA 4YEDA 1P1KA 2D5AA 3DXFA 3UW3A 1DEHA 3QVXA 2YY7A 4R51A 3EMKA 2EGGA 2EIHA 4Y6SA 4DXHA 4MIOA 2OFPA 2R2GA 1M66A 5I7FA 3A06A 4J4BA 2GSDA 4PZCA 4R1SA 4CLRB 2AHRA 2J8ZA 2AE1A 4IMPA 2VYVA 1KVTA 1ZEJA 3ROMA 3C3XA 3D5QA 2DTDA 1UXJA 3K5PA 2RBEA 4D3SA 2AQ8A 2FPGA 1HE5A 2VWGA 3LYLA 1JW9B 4I9HA 2HUNA 2EWMA 3JQFA 1B8VA 2GPTA 2NU8A 2X5OA 3ANLA 1NPTO 4J1SA 1QSGA 1YE3A 3C1OA 4GLOA 5BSFA 2WD7A 3OM9A 4BS9A 3H3JA 3U4DA 2YJZA 4YTEA 3LC7O 4MP6A 2X22A 1VKNA 5ICSA 1RYEA 1TA4A 1NVGA 1ZNQO 1E7SA 1NQTA 1R6DA 4N5LA 2I76A 3AK4A 4PRLA 4FB5A 3WFIA 3AI3A 3U49A 4DQUA 1MLDA 4J4TA 1LSSA 2FP4A 2Y0EA 1VJ0A 1HETA 4WLEA 2E6UX 1Q0LA 3LT4A 3ZWNA 2CVQA 3D5TA 1PQWA 4D43A 4R9SA 3JQAD 2BELA 1LLDA 4HP8A 2VHVA 3ENKA 4TRNA 4F45A 1HLPA 4H7PA 3NT5A 3ZGYA 5IN5A 4EYEA 4IJKA 2C7GA 2JHFA 4ZRMA 4GGOA 3FN4A 3OBBA 4J1NA 4DLLA 3Q9NA 1GQQA 1Q2XA 5EN4A 3SC6A 3WGOA 3WYEA 2RHCA 4OJNA 4XRRA 5JAQA 4CM5A 3G1UA 3JQAA 1LDMA 1A71A 1VL0A 2G0TA 5KIAA 3MCVA 4R5MA 1RWBA 1UAGA 3JQ6A 4IDEA 2X9GA 3WSVA 4BMNA 4D44A 1MG5A 2VTDA 4W99A 1S6YA 3I83A 3ETGA 2BFOA 3KYCB 3F5QA 2D5CA 1E7WA 2J3HA 3F1LA 3UICA 5L95A 3ZU4A 1AN9A 4CMGA 2Q1SA 4QECA 4EDFA 1LX6A 2W2KA 3MTJA 1LDGA 3RU9A 5JO9A 3V2HA 4NFSA 3GDOA 1Y7TA 2EW8A 1AHHA 3NDJA 1NP3A 3ZU5A 1C1DA 1OC4A 4ZA2A 1P9LA 1IL0A 2WJPA 3MOGA 1UR5A 3FBTA 4E3ZA 5J23A 2X6TA 3D1LA 2Z95A 4MVJI 2CVZA 5CP8A 4AJ2A 5FEUA 1FMCA 1G6KA 4WEQA 4DTIA 3SJUA 2P5UA 3UGKA 3PHGA 1IZ0A 1D4FA 4PRKA 5JC1A 3H9EO 3PZRA 1OMOA 2R6JA 3DHNA 3B1KA 1H6CA 4FBGA 3OF2A 2IXBA 4GL4A 1PL8A 2NVBA 3IQDB 2Y67A 2BGLA 4TSKA 3OQBA 4ZQBA 2DBVO 2D4AA 3OHSX 3QVWA 4IY1A 1NR7A 4YAJA 4G81A 4Z0TA 1ZFNA 3IDSA 4KTTE 4UVEA 4YJFA 4MKXA 1T2FA 5U9CA 1B15A 1R66A 4NFHA 3I9KA 4AG3A 5JPIA 3RC1A 1UZLA 3ONDA 1MUUA 4D79A 4RPLA 4QO7A 2FZWA 4BNWA 2YHIA 2PZLA 9LDBA 2ZYDA 2RIRA 2IYPA 1ONNA 1U7TA 3E82A 5DCYA 1YVEI 2GN6A 3G49A 4Y6PA 2Q99A 1R4MA 3ZNQA 1PJQA 3OIDA 3RC2A 3I5MA 2ZTVA 1SC6A 4J4HA 3VVBA 4KTVE 4Z9XA 1LUAA 2YQ4A 1HKUA 3FSRA 4P4NA 4FIZA 4U8GA 1KOLA 3GRKA 3M2TA 4CMBA 2TMGA 5BR7A 1H0KA 3ZWMA 2Y1OA 4N18A 4EUHA 4L75A 4ROSA 1YQGA 1JVBA 4U0KA 3BMCB 4L9RA 5BT9A 2PH3A 2I3AA 5CFZA 3OEYA 5JDCC 1WZIA 3DC2A 2X7HA 3Q1LA 3C1AA 2WD7B 4M49A 1LJ8A 2Y1CA 3F4LA 4FQ8A 2Y66A 2ILTA 4JJIA 3WX0A 3AOEC 4NR0A 2YDXA 3MZ0A 1EK5A 1I0ZA 5A9SA 3VAZA 4UEKA 3GHYA 5G0VA 5EINA 5CPFA 1T1RA 1IHYA 3LF1A 3QJ5A 3GH3A 4FOSA 1CJCA 1I32A 3S2EA 1IPEA 4J7CA 3RUAA 4JP2A 2UYYA 1MXHA 3HZZA 1Z6ZA 3B6ZA 5G0WA 2BRUA 2Q50A 1P33A 5ENVA 2WYUA 4GMFA 5T6BA 4YQZA 3WQRA 1N9GA 4WLFA 1JKFA 5HBRA 3KM0A 4EEXA 5HTOA 1P3DA 2C07A 3A9WA 4FJ0A 4GAEA 1CF2O 5I9LA 2O7QA 3GVIA 1YJQA 3DR3A 1CERA 2UDPA 1UP6A 4BO2A 1GEGA 3AM5A 2VRCA 4BKUA 4KMSA 1IZ9A 1U3VA 4DL9A 2WE7A 4UAGA 1NAIA 3ADOA 2NNLD 1RM4A 4B4WA 3S55A 4I8XA 2ZCVA 4OXKA 3AI1A 2NVUB 4M1QA 1HF3A 4JBHA 1IOLA 1PZEA 2O3RA 3HDHA 3N58A 4R9RA 1CEQA 5BQFA 4CLXA 3H5RA 4TKMA 3WNVA 4FFOA 4TWRA 3QWFA 2WD8A 4YXFA 2EERA 3LF2A 2RCYA 2W2LD 2ZTLA 3I3OA 1EFLA 2IEDA 2NU9A 2R00A 3NKLA 4XJTA 3SBOA 3D4PA 4RQTA 4CLDA 1FDVA 4PG5A 2G76A 5L4LA 3PYLA 3UFXA 4LVUA 1V0JA 3U5TA 2J6IA 3HFSA 5HWSA 3FTNA 5TF4A 3ZWCA 3TZHA 3IMFA 1GD1O 2E82A 1LEHA 3CSDA 1XU9A 2PWZA 4FN4A 4INAA 5IFLA 3AY7A 4XKJA 4CM1A 4AJPA 4CQLB 3IP1A 1M6HA 3ITDA 4GKBA 4OYRA 3BA1A 4H3VA 1HYGA 3OIGA 4RPGA 1U3UA 1HE3A 4U0JA 3B20A 1A7AA 3NJ4A 2Z5LA 3QVOA 4R4JA 3DL2A 3K8ZA 3Q3CA 3FR8A 3QLJA 5IG2A 4MVJF 4RJTA 2EXXA 4BNKA 5CDGA 3C7CB 4WASA 3M2PA 3TNLA 1PJLA 2EG9A 3QWAA 3ZN2A 3KUXA 1J0XO 3AOEA 3R3SA 5C7OO 5T67A 3WBFA 3AU9A 4MPDA 3DAGA 4ZQHA 1CWUA 3KZVA 4J3FA 3U4IA 1DIGA 2B0JA 4Q3DA 5CDYA 5ES3A 3JQ8A 2HK8A 1KEPA 4WOKA 5A5FA 3FCOA 2D2IA 3UCXA 3OA2A 3K73O 3OETA 4OQZA 2CFCA 5T8KA 4ND1A 2O48X 3I9MA 1XDWA 1LDYA 3PQEA 1E1LA 4EBFA 4I9UA 4LN1A 1EVJA 4IQGA 4K26A 4CMJA 1DIBA 3WNQA 4DA9A 1XA0A 1D1TA 1E3JA 5LDGA 5GZ6A 1BWSA 5TJHA 4L4SA 1IE3A 3VZRA 5ILGA 2EV9A 3U4HA 2DAPA 1MA0A 3JQAB 4ALIA 4WUVA 1KC1A 4OQYA 3BMCA 2RH4A 2AQHA 2P9GA 1XYGA 4IDCA 1ORRA 5TX7A 2B35A 5EJ2A 3BXXA 3MJ4A 1RYDA 4F46A 3JQ7B 4NZ9A 2HK9A 1GZ6A 4YRAA 2JKVA 5CAEA 1I3NA 3R6DA 4ZU3A 4YCAA 1NHGA 3G3EA 3L6OO 1B0AA 4DLBA 2XF8A 2VCYA 4D7AA 4BO0A 2BI7A 2NU6A 3PJDA 4K1LA 3GF4A 4RPJA 4CR8A 2PTGA 1ONPA 1B2LA 4FOOA 3GDFA 4JNKA 4R01A 3WIDA 1QV6A 3HE3A 1A7KA 1ISFA 4E2YA 3LT1A 1PS8A 2HO5A 1Y5MA 3DOOA 4PFJA 1YWGO 1X14A 4NHEA 1HDGO 4CM9A 3WR5A 3ANMA 2C54A 1ADBA 2NADA 3MJTA 3PRJA 3S2GA 4MVJG 2QIOA 1ZIDA 1PZGA 2DTXA 1I8TA 4JROA 3O03A 4OMUA 3F47A 4IS3A 4TZTA 3AM4A 1O89A 1IUKA 3GHHA 3HN7A 3DZKA 1KS9A 2DFDA 1FDTA 1QYDA 3RC9A 1NFQA 2LDBA 3JYLA 4OKIA 3ZWPA 3RUDA 4OOFA 1C0KA 4HADA 3JQBA 3RBZA 1DDOA 3GAZA 3PVZA 4IQ8A 3ZW9A 5CEFA 1PTJA 4KUEA 4RO0A 1SB8A 5KJ1A 1PGPA 3PYMA 3WXBA 3QRWA 3UAGA 4QTZA 3ZDFA 4BO1A 1Y8QA 2IDZA 3FR7A 1KVRA 4YBZA 3RU7A 3P5SA 2GN9A 2GLXA 5KJ6A 4GX0A 4CM9D 5F1OA 1ENPA 4E31A 3WBBA 3HWRA 4RL6A 3CUKA 2O3QA 4LRSB 1W8DA 4ND2A 4CV2A 5F5LA 2EEZA 4CLHA 2Y93A 1B7GO 3H5AA 1M6WA 4WJZA 4B4VA 4ND4A 3R0IA 2Q4BA 4BB5A 1C1DB 1LDEA 1GUFA 4U5QA 3VTFA 4AL4A 4YJGB 5EL0A 3WOHA 1TXGA 3QY9A 4KP7A 4RDHA 4YAGA 3PJEA 4PGFA 1HYHA 5JW6A 3FPLA 3KOUA 4R1TA 1NVTA 2OHXA 3BHMA 2OBNA 1GY8A 3G1TA 3DZHA 1GFSA 3TZKA 3ZNNA 4K6CA 1V9LA 3ROPA 1HRDA 3JV7A 2DKNA 5F1KA 4O59O 2FSSA 3BTUA 3MJEA 4UREA 3NJ8A 4OKNA 2V65A 3COSA 1E6WA 1PL6A 2VT3A 4CLRA 3HADA 5HM8A 1Y5RA 4MINA 1K89A 3HHPA 3H9UA 4Z3KA 4YVFA 5JAMA 3IOYA 1GV1A 3HSKA 4XX0A 5TT0A 2FR8A 1MC5A 4WEOA 2WMDA 8LDHA 3E6AA 3G17A 2JFGA 2VYVD 4CMIB 1I24A 4CQMB 3PGJA 1XWFA 2JAHA 3I52A 4XZ3A 1ZK3A 2GZ3A 1E3IA 1P1IA 4CM4B 4R1NA 2PLAA 1H9AA 1XEAA 3NX4A 1JAXA 1I30A 1SAYA 2X0NA 4GKVA 1SEVA 1C14A 1DIAA 4P22A 1R15A 1FK8A 3PZBA 4NK4A 1E1KA 4NJMB 1TEHA 1NASA 1HEUA 3GEDA 2VWPA 3JSAA 1Z7EA 3DFUA 1DB3A 3KV3O 3MWDB 4BB6A 3ETEA 1AE1A 4RQUA 3CIFA 1P77A 4B8ZA 1PZFA 1SZJG 3PPIA 2VHXA 1A4IA 1BXGB 1YQDA 4NDNE 4WK6A 1LLQA 3SXPA 5TRTA 4CMIA 2DU8A 3VPXA 2LDXA 3H3FA 1KEWA 2PD4A 4Q9NA 4DBVO 5L7WA 3K31A 3GR6A 4BO6A 3BMNA 2GYYA 3PWSA 1QYCA 3E18A 2Z1MA 5THQA 4J7XA 3FNHA 5G0UA 1P1RA 4XDYA 4IGFA 4W9NC 1PGQA 4XDZA 5KOIA 4L73A 3H9QA 4CM6A 1J6UA 3VPSA 3I9OA 4P4LA 2X0RA 1UJMA 4MVJD 1SPXA 4I5DA 2Y1GA 1LU9A 5CPBA 3IKTA 1EBUA 5B37A 4I5FA 4CLEA 4XA8A 3SEFA 1M75A 5K6AC 2FR1A 1JTVA 1ISGA 2EGHA 5G4KB 4WPGA 2B5WA 2CD9A 2O2YA 2WYVA 4ZQGA 4IGEA 1D7OA 2Y68A 3KYDB 2QQ5A 2HMSA 4BGEA 2BH9A 3TRIA 5IAAA 5ITVA 5I9MA 4FFLA 5MGBA 4XR4A 5EERA 1E92A 1AGNA 1X7DA 1ZCJA 4HNHA 2C29D 2Q2QA 3FWZA 4E32A 1GUYA 2Y1EA 2YQ5A 5B4UA 1TVEA 1BXKA 2D8AA 1ZMOA 4JLWA 5F5NA 5JCJD 4TVOA 3TOZA 1X15A 3TL3A 4ALLA 1NQOA 4WNCA 2Q45A 3IC5A 1GYRA 1LXCA 4RORA 3KHUA 2I9PA 1JKJA 3R1IA 3W1VA 2H63A 2PZKA 3M1AA 4NBVA 1PS9A 1HWYA 1YL7A 1I01A 2IZZA 3ZV6A 1PQPA 1MG0A 3WG9A 1CETA 4A2CA 4BOYA 4J0FA 3NGLA 4S1VA 1ZK0A 1HE4A 3K9QO 3Q2KA 1U4SA 1NQ5A 3WWZA 3GDGA 3IUPA 1YO6A 3O38A 4LMRA 1FDWA 3AUAA 1DRUA 1YDEA 4AICA 3AM3A 3FRJA 1F8FA 4C4OA 3TF5A 3L9XA 1X7HA 3ZV4A 4WGGA 1MV8A 2C59A 2PGLA 3GNQA 4RVSA 4TZKA 3VDQA 5AXBA 1WVGA 1VSVA 2F00A 2JCXA 3S8MA 3H65A 2O7SA 1LQUA 2FN7A 4M54A 1WLYA 3WLEA 1UXKA 5DNAA 3WLFA 4DQVA 2X5JO 3ZV5A 3ZH2A 2ZJ0A 2Q1UA 5T5QA 3GVPA 2BHLA 1QV7A 4I1IA 5L9AA 3UCFA 1LRKA 1NPDA 4PZDA 5JMWA 1Z7BA 3U09A 4L8VA 4NBUA 4XIYA 3EY4A 2ZB8A 3KSDO 1M67A 2XXBA 5KNLA 3L4SO 1DOHA 4MKZA 1I36A 4AJLA 4LK3A 4MVJP 4R3NA 1GUZA 1T1SA 4BNXA 1YONA 1L7DA 5JY6A 1UXHA 1OC2A 2FMUA 2HDHA 5IDYA 3I9LA 3SC4A 4YYZA 3KETA 4R54A 3W6UA 2RHRA 5T8KC 5IXYA 2QZZA 4IDFA 1EE2A 4DWVA 2VHWA 4CV3A 3DBRA 1AXEA 4M87A 2I6TA 1NVMB 5F3RA 5GMOA 4IPTA 4EGFA 4LGVA 2X9VA 2YV2A 5HS4A 4E5YA 4ZHSA 3P2YA 2CSUA 2X1HA 2IYOA 1MXFA 2QRJA 4JJGA 1TLTA 3JD4A 3VVCA 1P0CA 3U62A 3ZWVA 3GGOA 5TQVA 4YT4A 1S7CA 4WNIA 1PQUA 1XKQA 5IF3A 5K0ZA 1AXGA 3KLMX 5BNTA 1NWCA 4BMVA 4QT0A 4IJWA 4BNJA 3C8MA 2OXIA 4B3HA 4FFNA 1DIHA 3N74A 2JFHA 4M86A 4AJOA 4BO4A 1X1TA 2AW5A 2G82A 3NYWA 4PG6A 2GASA 3BHIA 4NNJA 3ONFA 2SCUA 3LK7A 1PGNA 4PIVA 4U6QA 2CZCA 4R3WA 4J7UA 1C1XA 4WLUA 3JQBC 3RFXA 1MFZA 4BO8A 2O3JA 4J43A 3RCBA 2GD1O 2EW2A 4ITUA 5IDQA 2VRBA 4N5MA 1VM6A 3W8FA 5A1TA 1F14A 3WYCA 1A4UA 4UUMA 4I08A 1JLLA 4RLHA 5JDIA 3GVHA 4Q3BA 1YQXA 5DP1A 2NTNA 1P1FA 1B3BA 4KDFA 2VUUA 1IHXA 6LDHA 3DMYA 4Q3NA 4E12A 4EEZA 2WM3A 3FF4A 3H4VA 5JS6A 3DMTA 1Q0QA 1OBFO 2VNAA 3E8XA 4Y67A 4OH1A 4WKGA 1UH5A 3GGPA 4O0LA 5B4VA 3QA9A 1GCOA 4XYLA 3BHJA 2GZ2A 4XB2A 5KCZA 2YV3A 4E21A 1TT7A 3DWFA 4AVYA 3D7LA 1VE9A 1GU7A 2ZB4A 4DIFA 3S2FA 1NFRA 4RLSA 1E7YA 3FBGA 4W7IA 3RBVA 2P91A 1VC2A 4ND3A 4U7WA 2FWMX 2C0CA 4EW6A 2PR2A 2QG4A 1VSUA 1PJ3A 4YWJA 5L51A 1BVRA 4FS3A 3LC1O 3BMQA 3NTOA 2AA3A 1T26A 2NLOA 2Y0CA 2QX7A 2GCGA 4FFRA 3VPGA 1GPDG 1O5IA 3JCZA 1AUPA 4YR9A 1QP8A 4PZEA 4FR5A 1ENZA 5FI5A 4XIJA 2GO1A 1XSEA 4U6SA 3PHLA 4DRYA 3WS7A 2E49A 5BNFA 1P0FA 5KVCA 1WPQA 4ZJUA 3FNEA 4DREA 4CL8A 3BMQB 4E5KA 4FSHA 2CY0A 1ISMA 1T2EA 4RF5A 3H8VA 2IE0A 4DIBA 2C82A 3WJAA 2I99A 4E6PA 5I7VA 5COQA 5IJZA 3ST7A 5B1YA 2CDBA 2PZJA 3L77A 1EUDA 2PA3A 3C7DB 3EZYA 2B83A 1UDCA 4KQXA 1DXYA 5B4TA 3PTZA 4Q39A 3JQ7A 3O4RA 4CM4A 2Y05A 1L7EA 2C5AA 4B7XA 3VPHA 3RVDA 1ENOA 3NDIA 2CDAA 3RI3A 1O6ZA 1SOWA 1XGKA 4XQEA 1K6XA 2X23A 2J3KA 2B69A 2HRBA 1QMGA 3F1KA 1YB5A 1YDWA 1PIWA 1E3WB 4DMMA 4BL5A 4YT8A 5A9TA 3PJGA 4B7UA 2B37A 3DONA 2Y99A 4CR6A 1J49A 1WWKA 3RUEA 1QLHA 4LISA 2EHDA 2W2LA 3STHA 4BNZA 4CL3A 2O2SA 3OFSA 1GPJA 3VZSA 1PJ2A 4MIEA 5DBFA 5GZ1A 1BVUA 4YT5A 4A73A 4CQLA 2XXJA 2PD6A 3TFQA 1F17A 4NU5A 1Q7BA 2D1YA 1KERA 4HBGA 3TZCA 3ZNOA 3PWKA 4KOAA 2W90A 1EUZA 2A9FA 3PGXA 4PLCA 4ZQEA 4NU6A 3PQFA 1U9JA 4E5PA 3PHIA 1ZO8A 4IINA 4DMLA 4RPKA 3DBLB 5AOVA 3TDKA 4GVLA 3GN1A 3HG7A 3ROQA 1LRJA 2FPPA 1BW9B 2J5QA 3EVTA 4BQRA 5A06A 5AYVA 1ZW1A 1T4DA 3RQSA 1QKIA 2O4UX 5C37A 5L40A 3DDNA 3Q9UA 4G65A 2IZ1A 4NJOA 4XEHA 3MTGA 1HSOA 3OSUA 2I65A 3TZQA 4GMGA 3CPSA 3Q6IA 2E37A 1ZK1A 2BGKA 3PDUA 5H81A 4CQMD 4A0SA 1ZJZA 1W4ZA 2BGMA 3WGTA 1GV0A 3DBLA 1GZ3A 2FHSA 3FI9A 1OI7A 3P2OA 4YACA 2UAGA 1N7GA 1R0SA 1XG5A 3A14A 2DUWA 3B70A 1JU9A 2Q1TA 1DFGA 1BXZA 3U0BA 2QYTA 1ZVMA 3D3WB 5F21A 2CF5A 4OAQA 3UKOA 2DM6A 2IRWA 4NH4A 3WGYA 1KVQA 3NUGA 1N8KA 2VUSA 2ZTMA 5COBA 1K2WA 3DBRB 1G0OA 4L76A 4RCVA 4JK3A 3A4VA 2CNBA 4CMEC 1BG6A 1JAYA 2A94A 4XWYA 3ASVA 5IDXA 4MVJA 3RC7A 2DBZA 4W82A 3W8DA 2BMAA 4NMHA 2B4RO 5A9RA 2Q49A 1DJNA 1D3AA 3GZ4A 5DP2A 1U2GA 1NBOA 2JCYA 2O23A 3WDSA 1PWXA 3OMLA 1N92A 2F1KA 2JJYA 1PEDA 4UVHA 1H6AA 4HWKA 2DUUA 3JQFC 4A7PA 1QRRA 4RDIA 3NT2A 4UULA 4OHUA 2YFHA 2GF2A 1DJQA 3DZFA 3VC7A 1XCBA 3JYQA 3OP4A 2NV6A 3WGQA 3JQEA 3AY6A 3VOSA 1Q0HA 5GZ3A 3O8QA 3VH1A 2PK3A 1X7GA 1OZAA 1U2DA 1WNTA 2OUIA 3X2FA 1DC5A 5G0SA 4CV1A 4YB8A 4IZIA 4HV4A 1T4BA 1H94A 3GFBA 3ICPA 4DYVA 3SX2A 1C1XB 1Q7GA 2VOJA 2GDZA 3SVTA 3ZWXA 3CMCO 1KC3A 5KJEA 1YH3A 3KYBA 3ONEA 3UH1A 3JD2A 3OQ1A 4CJXA 3HB5X 4HXYA 3BMNB 3NTQA 4JQCA 4O63O 3VKVA 1E3EA 1FXSA 4D42A 1UP4A 3ULKA 5G2OA 5DOVA 5EQFA 2PKRA 1YXMA 3U4CA 4B79A 5CDSA 1UAYA 3PLRA 1KVUA 4JGBA 3MJSA 3CTMA 1U28A 4TROA 4BNNA 1KIFA 3I9NA 1YS4A 4OSOA 1KEVA 3UN1A 1EVZA 1OFGA 3BTOA 3WYBA 2EKPA 3IS3A 2R00C 3OJOA 2D0IA 3RUCA 4B4OA 1VJ1A 1PX0A 2NACA 3E9MA 4HY3A 3W4KA 1NYTA 3RAJA 1FDSA 5IN4A 1PGJA 3G79A 5JSFA 1WMAA 4MOWA 2NQTA 2C5EA 4YJGA 2D3TA 2O50A 4XYGA 3WFJA 3B1FA 2WWRA 4PLYA 9LDTA 3UCEA 4KWIA 1KBZA 1HZZA 1KETA 1ULSA 2DQ4A 3QW2A 1Q7CA 4PLWA 5LCXA 3GEGA 1LDNA 4XR9A 3WGZA 1NFFA 4FGWA 1F06A 1XQ6A 3QWIA 2QYSA 5JY1A 1DHTA 4DYDA 1VRWA 1UXGA 3GVCA 3RFTA 3BIOA 4J9UE 1WAMA 1HE2A 4BGVA 4K9DA 3BMOB 3RFVA 4GBJA 4EUFA 7ADHA 1U8FO 3GZNA 2P4HX 3PLNA 4L4RA 4BNUA 1BW9A 3VH4A 5EESA 2YFQA 1E7MA 2FY8A 1PJBA 3DHEA 2P4QA 1QORA 3JYPA 2VRCD 4W9NA 5A3JA 4XCVA 1MP0A 3JQDA 2EKLA 3NGXA 2NUAA 3E9NA 4CMKA 4XGNA 4A5OA 3PFWO 4KDEA 1HDZA 3EVNA 4ZVVA 4TVBA 3WWYA 4Y8VA 5DCUA 2UUOA 4CM8A 1NX6A 3WGHA 4GPD1 1V8BA 2FOIA 3GC6A 1X1EA 4CMCA 1SBYA 1IYZA 4XRGA 1I3MA 1V3VA 3DAFA 2AXQA 4NJMA 4A26A 4UVDA 1PR9A 2H6EA 4BVAA 4UEJA 5A04A 3I9JA 3NV9A 3KTDA 5JC8A 1XR3A 1Z75A 1HT0A 1DAOA 1JWAB 1EE9A 3AUSA 3LVFO 1DLIA 1BTOA 4JBGA 3C7AA 2HMTA 2IZ0A 3CZRA 5EQDA 1EVIA 3MEQA 4NBWA 3FHLA 4IBOA 1XQ1A 1Z82A 2HRZA 2OORA 2WSBA 3QVSA 5U4QA 2I67A 4JBIA 1WP4A 2I66A 3AFNA 2GN4A 1W73A 2VYNA 4K6FA 1DRVA 4EJMA 2FPIA 5KJCA 3PIDA 3KXDA 1P1JA 4DC0A 4DPLA 1E3WA 2BFMA 5FYDA 1NWHA 5DCWA 4CLOB 3KEQA 3ZWWA 4I9NA 1ZK4A 3INGA 3F3SA 1HTBA 4II2A 4ALJA 1U5CA 3PJFA 1K5HA 3S2IA 4LCJA 3EAGA 5C3MA 4EZBA 1Z73A 3OJ0A 1HZJA 4QFDA 1YBAA 1N1GA 1P74A 1DC3A 1XELA 2NU7A 2ZQYA 4KQWA 3O8QB 2VHZA 1AHIA 3DMTC 1BSVA 3D0OA 1BGVA 5AXAA 2V6MA 1SOVA 2G5CA 3GN2A 3ZI0A 1H5QA 1GTMA 2XAAA 2DPHA 4L4XA 1E1MA 4RF3A 3E5RA 5KKCA 3A28A 1U3TA 4JXKA 1GDHA 5AXCA 3IUSA 3OQ6A 5BSGA 1ZMTA 1SO8A 2PD3A 4RGBA 5BNIA 1PS0A 3RBXA 4BNTA 4BNFA 1JDJA 1WXDA 2I3GA 4DC1A 1YBVA 2CDCA 4FC7A 3JTMA 5K9ZA 1R37A 4D45A 3HNPA 2JAPA 3GK3A 4WCFB 1Y6JA 1C3VA 2V6FA 5FWNA 3UOGA 3RASA 1ZJYA 4RZHA 1QR6A 1XHLA 1KEUA 2HK7A 3UUWA 5JYDA 1R12A 4GSKA 1V6AA 3JYNA 3IL2A 3GUYA 4ONEA 3IJRA 5G4LA 2ZB7A 4YAKA 4QQRA 3HDYA
chains in the Genus database with same CATH superfamily
2P77A 1B76A 1FNSA 2ZRJA 3JZAA 4QVGA 4YRPA 3RTGA 3SF0A 2OP0A 3H5IA 4PPYA 3HMQA 2O2CA 3NTXA 3RU2A 4CETA 4B71A 2VZ8A 3QBTA 1ISJA 1M3SA 3VHRA 2NP6A 1RAFA 2H07A 1YFZA 1EBFA 1T15A 1GL6A 3DPUA 4LHXA 1P2TA 3PC6A 4FCCA 4GI5A 4X7PA 4YUZA 5ILOA 1Q20A 1O96A 1SBCA 3D2BA 4WI1A 1FX1A 2CWDA 1FVXA 3KT6A 1TKRA 2CUKA 2N9UA 4W5TA 2JCVA 2F1RA 4HGZA 3K8QA 5T4HA 1R50A 3F78A 1ELOA 4NRDA 3GEPA 2XQKA 3TAXA 2WP8J 2DFVA 3PDIB 4JKIA 1HSZA 1GQFA 3GP5A 2JEYA 4MVYA 4RESA 1ABBA 4Y9RA 2DVMA 1KGSA 2P6NA 3DTVA 3HLYA 5FLYA 3VH2A 2OV6A 5F2OA 4BX0A 2C4MA 1KS2A 1OAAA 4I6EA 1WTCA 4RF4A 2VA9A 4WK0B 1E6EA 2Y0BA 3DTVD 2O14A 5A3VA 3U39A 5KWSA 5JAHA 3VHLB 3AOGA 1ZJ5A 2RC5A 3VYSB 4UCFA 3TOXA 1E9FA 3E58A 1CNMA 1ZONA 4UHFA 1JV2B 5K3FB 5KHOC 5A2QA 2Z0MA 2N46A 3WMRA 3KYJB 4E33A 1IPHA 3O2SB 5D7NA 4PRZA 1B6RA 4IG9A 2Q3HA 3CVUA 3UAYA 1TKBA 3CLKA 4G1BA 1XLTA 5AVWA 2FSVA 1G2OA 1LB1B 5U1PA 2JANA 4B84A 1RPZA 4Y2PA 4GI2A 4OD0A 1K0UA 1UFQA 2J5KA 1G3QA 4FSDA 1UKZA 2GNAA 2Y1XA 4QGHA 4D99A 5C5CA 2KB0A 3A10A 5GIPE 1QVAA 1AF7A 5EJ5A 3W5CA 3V1MA 1KDOA 4EG6A 3BL8A 2AI2A 1RAAA 1DO8A 1ZGJA 2WHXA 4Y6GB 4Z9YA 2ZB3A 3CGGA 4TRJA 2ZROA 1WZEA 1IN6A 2QAGC 4G9BA 4C06A 4ENRA 1FJXA 1GKLA 3H7AA 3KO8A 1BXGA 1NM5A 3QLUC 4Y6OA 2IOYA 2VHYA 4IRUB 4JL6A 4ACBA 5AOBA 4W7SA 2ZVJA 4S1OA 3BQMB 1G20E 3SMQA 2FDCA 3L0IB 3BVPA 4H7KA 1JYEA 3P94A 4INPA 5KTRA 2IXEA 3HVJA 3FNFA 3VDMA 4YV2A 4A10A 4R7ZA 4QJ4A 2CV1A 1XU7A 1L7OA 2J5RA 2YC2C 4QWWA 2QRMA 2EEPA 1GGKA 2PMBA 2X8LA 3AMVA 3CVOA 1W4BA 2F8MA 2G17A 3D6VA 3LHDA 4IHQA 4JU9A 4OBBA 4Y7DA 2Z6AA 4BIIA 2WWXA 2FI1A 3BE8A 4TQGA 2QJWA 3WRXA 3I1JA 2FCRA 4MAFA 2FZ4A 3ET4A 1BE6A 1YA8A 2B25A 3U7IA 4OTZA 4OGWA 4LWPA 1FFYA 3GLIB 1ZK2A 3RWMB 1YIAA 4RSGA 2NO1A 3PX7A 3OZIA 3FJ1A 2A5DA 2W6ID 4D9NA 3U37A 3RFUA 1BE0A 3TSCA 5GTDA 1QHXA 5I9TA 3E84A 3QI2A 3WL5A 1HZZC 1PJRA 3EZXA 1O97C 2PX5A 1YL6A 3HV2A 3QYPA 1EDOA 1XD9A 2X8JA 2H5LA 3GVXA 3R0XA 5DBIA 1ISSA 1E69A 3O92A 4HQNA 2ZFUA 2CXTA 3GFQA 3RSOA 4HGQA 5EIAA 2WFLB 1KYWA 2XIQA 3MNFA 2PYIA 1SMKA 2VHCA 1U1EA 1VLZA 5GV7A 3V55A 421PA 1VHDA 4LC9A 3VYRB 5IKEA 3K70D 2GCOB 1CUEA 1ID1A 3EZ7A 5EZYF 3UC5A 1BCSA 4RVHA 4F7DA 3DGFC 5FX2A 1QLJA 1NBMD 2NYUA 3CEJA 3QXSA 2IYXA 5JH7A 3OTOB 2WB4A 1COZA 1XEXB 3QPVA 3VR6H 3V9AA 3IA7A 3COJA 5HJ5A 1LLUA 3AKZA 5HS6A 3IOEA 1UBUS 5ALFA 4OFXA 4PLZA 4ALKA 4BGDA 2NWQA 4K9QA 1OXUA 3GRPA 3R23A 1N2BA 1XK6A 2FPWA 2I78A 2VLIA 4F3YA 1X80A 3L7LA 3G7UA 2NYVA 4ZK2A 1N1EA 1JR6A 3P9QA 5F12A 5GWXA 1KF0A 3MXTA 1VPDA 2XCTB 5LPNA 1EUCB 1UT6A 2HA7A 4D98A 2ZJZA 4DPKA 4R6WA 1R0KA 2C5HA 3K71B 1YS7A 3GJ5A 4UMVA 3TCKA 2GCOA 2EFDB 1T9ZA 3D6UA 1RRKA 2AEJA 1BCSB 3A8TA 3FLBA 3OF3A 3I9V1 3D64A 4X54A 2OQRA 3FZGA 1DQNA 2ZS7A 4DADA 4LOKA 4ZMSA 2W83A 2N1MA 4OK5A 1KZ4A 3S8EA 1E77A 1TUGA 4CBVA 3SQOA 10MHA 2FAXA 2JIMA 1DTSA 3A4MA 4IDNA 1SXJB 1Y37A 3C5HA 3F97A 1G2IA 1O6BA 1VRCA 2PMFA 3EYAA 4E14A 2EBHX 5BUSA 1QO7A 3NEYA 1DAFA 3KTAB 5BRAA 2QZSA 3MM4A 4IQFA 4MVCA 4OFZA 3UGJA 1KI4A 5ELMA 2H54A 4ZVNA 1L1FA 3OEWA 1OYVA 3PQ4A 1BDMA 2HJGA 1NC1A 2QE6A 3IMKA 5TQ0A 3KJGA 3WQQA 4WZZA 4A2WA 2BFPA 4FD3A 5JSZB 3OZFA 2N1BA 5ESWA 5EIBC 2KLHA 4BFSA 2BD0A 2G4CA 2REQA 2ZSBA 4L2IB 4P38A 4B3XA 4E4YA 2F62A 4LXQA 5FTMA 1O08A 2JA1A 3CMMA 2JI8A 4RX1A 3B2EA 2R47A 2QTNA 4IZOA 5COAA 2GJ8A 1RQGA 2ZLBA 4JLAA 4JLSA 4OB8A 3GY0A 2GRAA 4MAAA 4AX4A 4OXNA 1H5NA 1LI4A 4WXPA 5IDVA 2Z83A 2W70A 3JPYA 3KPJA 1U1IA 3PRKE 4FC6A 4NYIR 4YP6A 5TQ0B 1RI2A 1SQ5A 3NASA 5JJLA 3FPAA 2YXEA 4KIFA 4X5OA 4Z4HA 1KPGA 1K7CA 5A4IS 4M0MA 3UVEA 2JHGA 2OV8A 1EK6A 1LVHA 2ANBA 2YW2A 5AHOA 4E2XA 4QRDA 3WLJA 3M5DA 3ZDXB 4E0BA 1A8IA 4NBRA 4U7GA 3BKWA 3QE2A 4IIHA 2DR3A 3F5DA 5CH3A 2X5KO 3B8EA 2O8CB 3CT4A 2WDZA 4ZOEA 1K3TA 1FS4A 3ZJ5A 1VRVA 2IYQA 1NNI1 3HBJA 1NVFA 2CDNA 2HV9A 2QR5A 1NXSA 2LRHA 2R1VA 3H0KA 3HABA 3MIZA 1EGAA 2QD1A 1LLFA 2NO5A 3KD3A 2XYRA 3KOYA 3WLNA 4EPWA 2B1JA 1IK6A 1C4KA 4YGYA 2VDJA 2X3YA 4P31A 3WGGA 1X70A 3QVTA 1IHDA 3UHJA 2QLTA 4GP9A 3ITEA 5B3AA 1FDRA 3TGLA 1T43A 2HSJA 3W2HA 5CG2A 3SF8A 1G3MA 3E05A 2JEOA 3L9WA 1H2EA 3ZY4A 3QEMB 1B8PA 4CCAA 3ABZA 1TJ5A 1Y1KE 3D6FA 2QHXA 4L51A 4OHRA 5FOWA 5FUXA 4KOEC 1OZ0A 4UM5A 4B82A 1TQ4A 1E66A 2YX1A 2EBUA 4S24A 3TJRA 1IULA 1V7CA 2Q2OA 3SS8A 4BUJA 4JR2A 5LDHA 2B1GA 4P81A 2V5VA 2WWYA 1Y8ZA 1GZ7A 4OG2A 5ALRA 1NLZA 4C89A 1QM5A 2LBPA 1XYYA 2H4XA 1BEEA 4KYVA 3THRA 2DQYA 1Q1QA 3LDAA 5JCPA 2HQRA 4GBED 1YFKA 3IXMA 5AKEA 2OYSA 4YXFA 5CFOA 4IIDA 1AKTA 2K6GA 1KXJA 1ZX1A 3S1LA 5CVDA 2IPNA 1FDUA 3EPPA 3DYVA 5KOHA 1PRYA 1ZD3A 1ZVQA 1JLKA 3CNHA 3DEKA 4MKHA 4WLOA 3S0JA 5JAIA 1N2CB 3I45A 1VKOA 2IV2X 3VR4A 4H16A 1O3YA 3O21A 4MPJA 1QIEA 1NDUA 1ECBA 1P6QA 2J5BA 2H9IA 1KSJA 2PXAA 3GPBA 4N54A 1E1NA 2GWHA 1IQ0A 5KBYA 4TRRA 2C1ZA 5TT0A 3F6YA 2MWMA 2XKJE 4PAGA 4AJHA 1CUVA 1SBHA 5H3HA 1E7QA 4F93B 3DE6X 4L8FA 5IAOA 3PXUA 3AF0A 3MJDA 3CONA 1U0EA 5CLHA 4Z0PA 4GVXA 4OGFA 2CKDA 4J16A 4A6EA 4AMZA 1U9YA 4DV1B 3A6LA 5DTQA 4AZWA 1JFFB 4OQNA 2OHGA 4RAOA 2WJ4A 1IY1A 4PRYA 4AJEA 1SEPA 3DEZA 1FMFA 4P8RA 4H77A 1WXQA 3BSWA 4EY8A 2O2JA 2WQ6A 1RC0A 1ECPA 1IAQA 3IKVA 4QXMA 2O8BA 4EGCB 1W34A 3PFNA 5FPHA 4RTSA 4MUYA 1YB4A 3RTDA 3CG4A 5G1NA 1ADFA 1OZGA 3DOJA 4COOA 5CU7A 2VYCA 4BN5A 5CFMA 5IH7A 1ECLA 1M1XB 3O9ZA 5TMDA 1E9BA 1ODJA 1X3LA 1GZHB 3II6X 2ET6A 3P19A 3HR8A 4X0EA 3TRHA 2WU0A 4CM8B 3UOWA 4QULA 2DH5A 3G88A 3PRHA 1KDRA 2GYWA 1QRSA 3EZGA 4DLUA 1OX6A 3IOCA 5K3AA 3RWBA 4QSMA 4Q48A 3AVWA 1TCVA 4MUMA 1JG1A 4C4SA 4MQBA 1OA0A 1RS0A 4GQAA 4WNYA 3TMKA 1XZKA 4CTJA 1K6JA 2BI8A 3I6MA 1XNGA 2V74B 5KX5A 4PEVA 4ZYLA 1QUEA 1ZH4A 1K4MA 4TPKA 5DGDA 4E70A 3ZKWA 1M5RA 5AW1A 2Q8QA 3KP1A 2HLPA 3E81A 2RGBA 4E5VA 4NCBA 4PR0A 1GAXA 2P2SA 2ZQ5A 2CXSA 3SLGA 1ABEA 1T8WA 1H93A 1T24A 2G06A 3NXKA 4C4TA 5L3SB 3SS7X 4ZI7A 3G2KA 1U8AA 4DPMA 2XE8A 4LV8B 3ROKA 3PF9A 3I6IA 2WJZB 4KQGA 3B3GA 3L4BA 4QKQA 3A1WA 2XNDD 4K8OA 1VYTA 3CX7A 3HXLA 4BX9A 1BDBA 1ECGA 3GELA 1JEDA 2ZTUA 4WQMA 5CLGA 5I8ZA 1XJQA 3H6KA 3NNNA 1H8ED 1J8FA 2FQWA 2OBYA 3F5SA 4PSAA 2A7QA 1ZW6A 3CG0A 1A9ZA 4NOKA 3ZWYA 2VC2B 1I4EB 2AYZA 3OIYA 1CY8A 3PX2A 4ISCA 1A50B 4INJA 3TZ6A 4MICA 3B5JA 3QE0A 4A03A 4BLQA 1GRNA 2GZSA 4CKBA 3DP9A 3IBFA 2Z3VA 2OBFA 1EG7A 4NTZA 4ZREA 4F2GA 4W4TA 1KK1A 4TT3D 4ZI7B 3TSWA 4GX1A 4J0CA 2A35A 3A6DA 5FQOA 3RIHA 2HB6A 1NJ2A 3EGDB 4OIMA 4IDDA 2L2QA 3AWIA 4BGUA 1GGEA 2Q46A 4LA4A 1JI3A 4NIMA 3IPCA 4D3FA 1NT4A 1QE3A 2Z2XA 3KKZA 3LU1A 3M8KA 1ZRNA 2Q9BA 4HR7A 5FH9A 3B1XA 1CUYA 1QYXA 2BZGA 2MINA 2IOHA 4ZRNA 3DOEA 2CYAA 4J49A 5H82A 3HR4A 3O74A 4FYIA 2GM3A 4B2PA 1N5RA 1QH8A 1Q74A 4Y2VA 2XVYA 3U60B 3OY2A 4BLOA 1J99A 4DSUA 3AR3A 2ODBA 4N4AA 1XF9A 3LS2A 1ZN8A 4Z4FA 3N2YA 2CMDA 1VHLA 3L4EA 4UVIA 3ORSA 1YOVA 4D4JA 4NXNB 1XRQA 3FMPB 2HJRA 1X8XA 4M8LA 4M1YA 2H1RA 1L4GA 3KT8A 4BE7B 3CJTA 3BICA 3NJRA 4U1RA 4AMVA 1TZJA 1UBFA 1H23A 2QJRA 1WVIA 5JVDA 1IK4A 1AXRA 1NVAA 3AEYA 1N0WA 4KC0A 4OUDA 3RWOA 4EY4A 1Z25A 4K3VA 4UEOA 2C1XA 3LY5A 1W0JA 3GJSA 2P68A 4B3CA 4ZO7A 3G8DA 2O3TA 2ZWOA 4K28A 4ZANA 2JGLA 1ORDA 3CX8A 3NRCA 1RJGA 4QYWA 3R7SA 4ARAA 5LP6C 2Q7DA 3VVMA 4AN0A 4HNVA 1VMAA 5AVXA 1I80A 1YOVB 3QU4A 4MMYB 2IYTA 3ESCA 5JYEA 2OO5C 1T29A 4KIUA 3WJ7A 3NALA 3P9YA 4UC0A 4WL0A 1GZUA 4XCQA 4W8GA 4E1AA 1USGA 4FDUA 1RJFA 4E03A 1KU0A 3L4BC 4ZQFA 1CYDA 3FYHA 3RUHA 1F1JA 1RWNA 1TZBA 2OV3A 5EIOA 1E2HA 4LXHA 5D3QA 3TSZA 2B98A 3D6HA 1H3FA 2CL0X 2FWBA 3AKDA 1JRLA 2JGEA 3L7OA 3G89A 3JAWA 3RIEA 2HJSA 1HMYA 1PQ4A 4DKJA 1T8PA 2XPCA 3HO8A 1HL3A 4EJ0A 4NP6A 1FNDA 3DMHA 4FGZA 3WIVA 5KWEA 4CL2A 3ND8A 4RSRA 2AHOA 1P8AA 3BWBA 1H1TA 1ESCA 5BQOA 4FHGA 5ERYA 1IEWA 4X65B 2VJAA 4GT1A 1DL5A 5LQRA 1RKXA 1ZA2A 2V7QD 2X6RA 3RD5A 5AM0A 4H2DA 5L6LB 3L8YA 4IJ6A 2IYAA 5ALTA 1Q15A 1F2VA 3K5IA 3QVLA 4B80A 3T1NA 2AXPA 3WADA 2DE0X 2MSKA 4I55F 1PR4A 3KL4A 4F8YA 1U81A 1E94E 2H1LA 1Z2AA 2DQKA 3CF4A 4JX9A 2XTZA 1ISPA 2QM3A 3FFWA 1VL6A 3TUJC 2CEAA 2M32A 3HKBA 3WB9A 5AKGA 4DM7A 1VCIA 3HN2A 1EXMA 5C5DA 1YR7A 3EFBA 1B0UA 1REQB 3GFSA 3SJ7A 3VOAA 1GLVA 2DMRA 4ACAA 5T4BA 3C3CA 3IX7A 3Q8MA 1B93A 1HQCA 1GPAA 2WHEA 3QX7A 3SJAA 4OBEA 3PFCA 2FV8A 1RMTA 2BJWA 2WIAA 2FVXA 1YQUA 4DUPA 2MR6A 5DGIA 5FL7A 1WABA 1EX6A 2VUTA 3K3PA 3PLAE 4LZZA 1O6FA 2GPNA 1ZZEA 2OWEA 1EM6A 3ZJUA 1GU0A 4M8NE 2I2FA 4QJBA 3LFUA 4W9MC 2EJBA 3B9BA 2LGJA 2WMNB 4E08A 1CHNA 4GSYA 3CINA 3GEMA 4FGSA 4HZGA 1O8BA 4UCWA 2NM0A 2BKVA 4OO3A 3CE6A 4ZOAA 5L4NA 2Q3JA 1AK9A 5BW8A 3SLKA 1CD5A 4QODA 4MWOA 2NSDA 4C3ZA 5ED4A 1SUPA 4FFBB 1ENYA 1WSAA 8ADHA 3OZGA 1AD2A 1VHTA 2B4YA 2PGDA 3EA4A 3FB4A 2JJ1D 3N8IA 4O1MA 4PG8A 3WWEA 1B8UA 1GYQA 2QRKA 2ZKLA 2UUCB 2VWQA 4Q05A 2BFFB 3ROXA 1J8VA 1QXSA 3L6DA 4JJKA 2JIDA 5JNWA 2WYWA 2V5UA 2Z9DA 4M0EA 4BNMA 3QF7A 4M6WB 4TMFA 5BQ3A 3VPBA 2IODA 1NW7A 3T7KA 2Q5QA 4CMHA 1POWA 4J9VA 1YB7A 1OLXA 3OAAD 1QQ6A 3EA0A 4QO8A 1NVUQ 4ZGWA 3EK2A 2DGDA 3QV1A 1WCWA 4F2HA 4KK3A 1SY7A 2BISA 4JI1B 2YASA 4FFBA 4IJUA 1YJ8A 2HQ1A 1PZXA 4MKFA 4YHHB 1PYDA 4IRXA 3EH2A 2OMEA 3AF1A 4FJ2A 1UFRA 2H2IA 5IT4A 4MP3A 3DLPX 2RCNA 3K2EA 5C7IO 5AM1A 2X4IA 4Y1GA 4KXNA 3QFHA 3CZPA 3KBOA 4GZLA 2XNCA 1U02A 2VFAA 4IIVA 2D59A 3PNSA 3RS9A 5AW0A 3TG2A 1KQ3A 1OLOA 1EVYA 2KHZA 2PLWA 2YJGA 3CEAA 1OTHA 4NWIA 3LQ1A 5DGXA 3T7EA 5DXAA 1KMIY 4WJKB 3SHVA 3QKTA 4KO8A 4UBKA 5F51A 1KJYA 2YVLA 2Z58A 3FAKA 5IEBA 5J2UA 3QKRB 2YZ7A 1CYEA 1KARA 3JASA 5EA2A 4A8HA 2OM2A 1U1CA 3VI4B 3KQQA 3MAAC 5CEJA 4O2AB 1MX3A 3VDNB 4YJHA 4FBLA 1PFGA 4MQUA 4AQ7A 2GUWA 2O8EB 1OI3A 1KJNA 3A6EA 1XZGA 1EHCA 2VDUE 4GGPA 2ZREA 2BCGY 1ZGBA 5TMPA 2JIBA 1JHUA 3I12A 3USZA 3ODGA 2A2ZA 5AVOA 1KQFA 5K0NA 4GIBA 4KFSA 3DTTA 4Q19A 1N57A 4TV9F 2YJTD 5TT1A 3OOYA 1TC2A 3DZJA 4ZT5A 4QATA 4UCQA 3V2GA 1UBMS 3T06B 1DPGA 1JIUA 2Z5FA 2J31A 5C7LO 1G8PA 4KGXA 3R44A 1SQ0A 1QHYA 4DLWA 2ZIZA 3I6QA 4I9FA 3RS0A 3U81A 5BVGB 3L7BA 4NF2A 5K0JA 4RXMA 2XGMA 3ONNA 4UATA 4I6GA 4IZHA 3P97A 4LYFA 3IDQA 4DSTA 5KQSA 2C4WA 5F7OA 5L7YA 5AT1A 1ZUIA 3FKSA 3SM9A 4L8LA 3SSNA 1KAEA 4XXHA 3DT9A 2AK2A 3TWOA 2SICE 4J1TA 3D0QA 1TCBA 3LA8A 1EBBA 4U9HS 1L6IA 5JU6A 1ARZA 2DHCA 2ECQA 2XA9A 3K6JA 2Q3LA 4G2NA 4MROA 2Q28A 5TMBA 4CG1A 1AQNA 3DUFB 2PSDA 5T64A 2Q27A 4OHMA 4M8IA 3R8FA 4Q03A 1BMDA 2ZETA 2ZZKA 4JJZA 5H59A 1C30B 3V6MA 1FSSA 1ZEMA 4YMTA 1FPQA 4ZMRA 3H2BA 2XAUA 4B45A 3F3KA 4DV3B 2EP5A 1MGOA 1OXBB 1TAQA 1FVOA 5DNCA 3AVYA 1EQUA 1PLLA 1U94A 3L1IA 3QOFA 3L82B 4PXYA 3BAZA 1PNVA 2GTHA 1KH1A 2BMWA 3HPRA 1ICEA 5AI8A 2PGIA 2YZKA 4OLAA 4L5IA 1I13A 3K72B 2UKDA 3W5VA 1U7ZA 4H6PA 4WESA 1QQ5A 2G9NA 4EUSA 3HM2A 1ES9A 3QU2A 4QRHA 1JEEA 4Y6RA 1N0IA 4BNYA 3LUHA 4A8PA 2HRRA 3FPBA 4QM7A 4QOHA 1TT5B 3RYFA 1DKNA 1OROA 1GU1A 3GCDA 4FYMA 5LIPA 4Q1EA 3BULA 2X13A 3BD6A 1U3WA 3LK6A 3PDJA 5ANRB 1SVLA 1WHSB 3LNCA 5IBPA 4J6EA 3L05A 3ROTA 5L3ZA 3JW8A 1P5HA 1T0UA 1E59A 4HFJA 5DKFA 4FHZA 2ZJ2A 1B74A 4TN5A 4XI9A 3TQHA 2ZK7A 3IQZA 2BZ0A 4FFMA 2SKEA 2ZE5A 3AJ9A 2P0YA 3B1WA 3RRYA 4ZIRA 4C5AA 3R8CA 5JS8A 4KRYA 3TI7A 5A05A 3I6YA 3BB4A 2O3SA 4X1KB 4C29A 4EYOA 4YLYA 4BO7A 3RNLA 2C8LA 4EG0A 3ESZA 2CMHA 1Z2OX 3HB4X 3INRA 5M7EA 3FOBA 2NT4A 4HUJA 4OSPA 1FTNA 5CX1B 4CUJA 4UUBA 4YUWA 3L7NA 4NONA 1CZKA 2NN3C 4NQRA 4BHTA 3IGFA 4ND7A 2MYUA 5B55A 5J2TA 4CHGA 5T7BA 3EGEA 1GZSA 4CDNA 3RYCA 3NOVA 1DUSA 1RRMA 2DP4E 1MN6A 1M6VB 5ALSA 1T2AA 4LRWA 2ABWA 2Z1DA 1D0SA 2QRNA 5GM2A 4CCYB 4CMAA 4YAEA 1NR5A 1W35A 1Q0ZA 1EPUA 3FW1A 4CODB 5IM4A 2C20A 4MWEA 3BDIA 1XPJA 1Y9DA 1NVWQ 1OREA 4PZAA 5DN9A 4DA7A 2VS1A 5DYTA 3T1YB 5C80A 1ZA1A 4J0JA 1QFZA 5CG1A 1SOMA 3KUDA 4NG5A 3VO8A 4TXMA 5KKAA 3KQUA 3R3WA 1VL8A 1LW6E 5L4SA 4O3FA 3HCRA 1DWUA 2C5GA 3BE6A 4MI6A 1HDIA 3HTXA 1LGYA 1JG6A 2ZS8A 1XWWA 2P2NA 1HK7A 1QE0A 4ZDWA 3HDJA 4RDXA 5JFOA 4L0QA 4HNRA 4HB2A 4LBWA 1IZYA 3DW1X 3AJRA 2YIMA 4HB3A 3KYDA 5CDUA 1F8GA 3OU2A 1HG1A 4MP8A 1SUSA 5IJ9A 3EXG2 1H2HA 2BV3A 1XQYA 3D4IA 3F74A 1L7BA 2SECE 1Z56C 2R7LA 3GG9A 3GMSA 3KR9A 3AZPA 4CG3A 3KXKA 2F64A 5TNXA 3T4EA 3MGCA 2RGGA 1YR3A 1HQYE 4YEDA 2F67A 4QA9A 5A0VA 1IBRA 1L7VC 3UW3A 4JKYA 3QVXA 2NOAA 1YFJA 3EMKA 2EGGA 1XZAA 3BK1A 4MIOA 1WSWA 1S8AA 4GQIA 4DUYB 3DLCA 1XP5A 3F5MA 1U98A 3EGCA 2PEZA 2GSDA 2PYDA 2UZ1A 3PFKA 4PZCA 4Z4QA 2AHRA 2J8ZA 2C4VA 5JWRA 3KCNA 1KVTA 2AJCA 2MSWA 3LO8A 3LUGA 2WUDA 3RRXA 3WXMA 3DFIA 3LH5A 1LJLA 5DIZA 4ZHQA 5IPFA 4HRAA 1FBTA 1NP6A 4RIGA 1ZM2A 2R6ZA 2WTAA 4FX2A 3LYLA 1JW9B 1RFLA 4S1TA 1W5FA 2HUNA 3JQFA 3MA0A 4N5IX 5FUWA 4LQCA 4KRGA 2QP9X 3RW9A 3GA7A 4BFLA 3KZCA 5AM2A 1ZGGA 1NVVR 2JDIA 1D9ZA 4GLOA 4JLUA 2JFNA 2XDWA 2ZSJA 4AG6A 4I50A 4K9LA 1JHPA 4JHLA 2C9ZA 2F4VB 4J1TC 4PBSA 4K46A 4BS9A 1XZIA 3H3JA 4YTEA 5BV7A 2X22A 3D2CA 3S4YA 4DJTA 2JPDA 4N5LA 5TMEA 3I5AA 3T15A 1J7KA 1HY3A 1WXHA 2IELA 3ER6A 3TRKA 3PEWA 4FB5A 3FVVA 3AI3A 5KSWB 4TMZA 1E9SA 4DQUA 2X76A 1NBEA 1Z15A 2JFWA 3LQKA 3QPBA 3RVRA 1CEYA 1JMKC 3TKLA 2E6UX 3LT4A 3B7PA 3D5TA 1DG9A 2ZYTX 3EF3A 3KD2A 3RUPA 3VNBA 1U9IC 4D43A 3RYIB 1A88A 2BELA 2MMCA 2GF9A 3HHEA 2YOHA 4NATA 1HLPA 1J24A 4EYEA 3VBEA 5IJ0A 5AK3A 5EE9A 3FN4A 4GRAA 1WCYA 1C7IA 5BSMA 2HNBA 2SNIE 1Q2XA 2OG1A 3QBDA 4K6OA 3ORYA 1PSWA 3G59A 3SC6A 3WGOA 4PSDA 5C4IA 4D25A 1E2NA 3BG5A 3G1UA 3JQAA 2E85A 1LDMA 1N2XA 1H4TA 3MCVA 1TUEA 1RADA 1TCCA 3G0BA 4R5MA 1UAGA 2YVQA 4IDEA 1RBYA 2X9GA 1BZYA 3D81A 3N8KA 1E5DA 4URXR 4PC1A 3ETGA 4L8YA 3QXCA 4HDRA 4IKOA 4A3SA 1NUTA 4AZVA 1DV1A 1P19A 1Z83A 4PYRA 4QXAA 3WYFA 2IS2A 3BJIC 3T34A 3GUUA 4QECA 2B8TA 3DNMA 3IB6A 3LWBA 3ELDA 1OHHD 1OD6A 2PBLA 5L3RA 3IULA 4EDFA 4EVRA 2MJLA 2PL1A 3DB1A 2QI9C 3H4TA 2GSWA 2PZAA 1PVVA 2AZDA 4XCXA 1JEQB 3RU9A 4DMGA 2CHVA 2ZYUX 3V2HA 3DP7A 4LHZA 4F2DA 3WLKX 1Y7TA 5K4GA 1FQJA 3SBEA 1W44A 2DWQA 2R8OA 1FJ2A 1SHKA 1WUHS 2XNHA 4C1NA 2JBWA 3THWB 3N9IA 3QE9Y 5LQMA 1MO4A 3DE7X 2IPAB 4UTZA 5HOEA 4UMEA 1C1DA 1UC9A 1IL0A 2QT9A 2WJPA 1UR5A 2XUOA 3MOGA 2GHQA 3MT9A 3NC4A 4KRXA 3UJDA 2PWAA 3LPAA 2X6TA 1U3CA 1FFBA 3WBJA 3OT1B 5CP8A 3H99A 4AJ2A 1QDEA 2O0HA 1A2OA 1M1YB 4LS3A 5FEUA 1RAIA 5JBQA 1GNTA 3PHGA 4UBLA 1P2SA 4DA6A 4I1PA 4RD3A 1H2XA 1WV1A 2CE7A 3H9EO 3PZRA 2L69A 4YUAA 1D4AA 4OREX 2B99A 4GL4A 3ITNA 3P20A 2RHTA 3IQDB 2JGFA 2Y67A 4XWWA 2NSYA 1JG2A 4I1YA 3KZOA 1S3FA 4AUMA 1T9HA 4ZYUA 3I1FA 4TYQA 5C31A 5ULLA 3X1WA 4FHEA 4YAJA 3O1IC 1ABFA 1V8DA 2HF2A 2Q8PA 1AZWA 4HO1X 5HVNA 1YASA 2IPMA 1R66A 1WB4A 2IIBA 5EKUA 4D9JA 3KQKA 2HPVA 4ZGGA 3PS9A 1J1IA 3MTEA 1DAMA 1MUUA 1UJ2A 4F6RB 1E6KA 4UNQA 4DNXA 4OQXA 5IYZA 2QN8A 2O19A 3K6SA 2AN5A 3CUYA 1USIA 3M5PA 1GAJA 2BRUC 2Q0QA 9LDBA 1K68A 2RIRA 4AF7A 3ID6C 2WSYB 3E82A 1AKNA 3WLOA 2Q99A 2OCYC 3KQTA 1J09A 1HMPA 1P39A 3RVQA 4BJ6A 1N5JA 2IFTA 4J0GA 1VPLA 4PHFA 3RC2A 4XDHA 3COZA 5IAJA 1SC6A 3T9AA 4FIZA 2IW3A 2QXTA 2QN6A 3MBIA 1RXIA 1M34E 3NFYA 3W9BA 3ZWMA 3H4MA 4N18A 4IX9A 4V24A 3EQZA 1EP9A 4EO4A 2WSMA 1S7GA 3OFKA 2HBQA 2I3AA 1BVHA 4FM9A 1CJSA 2FW1A 2Q6VA 3OEYA 2J46A 2X7HA 4L2IA 3SN6A 3WGMA 3B82A 3C3KA 4M49A 2WAYA 2Y1CA 2HGZA 3DEIA 5IH3A 5JD6A 1XVAA 4EJ2A 4H7EA 5CA1A 4GL2A 3WX0A 5EIBD 1T4GA 1JH8A 1E5VA 4KXUA 5I3ZA 3T54A 4UEKA 2WW8A 2CE2X 1J33A 1OUMA 3L1JA 2GTIA 1T1RA 1IHYA 1OH8A 1RWVA 3ESDA 3GH3A 1P5FA 2EX4A 1AC5A 3C14C 4YCDA 1I32A 5JQGF 4U4AA 4MQ5A 4X8OA 4ZKDA 1CZLA 1UFKA 3F49S 2UYYA 1W4AA 2JAUA 3HZZA 1PUJA 5F4ZA 3FOZA 2JGIA 3JAMA 2DECA 4UPDA 5H0IA 4JSTA 5DMXA 2Q50A 1KYTA 2OESA 4XUDA 6Q21A 3AF5A 1VE1A 2BHRA 4MMZB 3WQRA 4PW0A 1N9GA 4GC9A 1JEJA 2ZT8A 4H0FA 3RS8A 3FIUA 5HKOA 1C3JA 5KWVA 1XDBA 1NW4A 3OPYI 3W7BA 1ZCBA 2NU7B 3O5AA 4M2LA 3UV3A 2YIDA 1P91A 1DAIA 3HUTA 3K0FB 4FJ0A 2XTAA 1Q1BA 2EJUA 4HYEA 2K4MA 3ED1A 4V1CB 5ALOA 5LDDC 1CERA 1LS6A 1E4EB 1UP6A 1WXEA 3AM5A 5LQUA 3E9RA 1JR3A 3DE5X 3PNKA 4A2PA 2WE7A 3QNWA 4CKCA 5HZHA 4X1IA 2AWOA 3G5AA 3H5VA 2ZCVA 1S8NA 3IQXA 4X1YB 3AI1A 2NVUB 3UMFA 2Q6OA 1IOLA 2PJUA 4MX8A 3PA8A 4URYR 3HI6A 3N58A 4OK3A 2ZANA 4KAAA 1OFTA 1MOZA 1GG9A 4TKMA 1J56A 3KR2A 3QWFA 1X1AA 4TWRA 2FFBA 1XDUA 4N82A 1V1RA 4KXLA 1YC2A 3OU6A 4BVLA 2EERA 5ESDA 4F85A 5A2GA 4B46A 2RCYA 3E2PA 4C05A 3KKNA 3I9FA 2IEDA 1JJBA 2WI8A 3V8QA 1C4XA 3IH5A 4XJTA 3VNVA 2WVGA 4F12A 3NV7A 4AI6A 1F9EA 2IYEA 4MW6A 4OK6A 4AMGA 3PYLA 1V0JA 3FTEA 1N5LA 1FP2A 3K9HA 5BWCA 3W79A 4H0CA 2QPTA 4OHOA 1NVKA 1I0LA 3VX4A 5JZBA 3L0YA 1G21E 2NX2A 3FTNA 3ZWCA 3TZHA 2VJDA 4JBYA 2GARA 4Q01A 4XASA 3AQ4A 2VBIA 3D4LA 3HP4A 5CURA 3TNJA 1NY6A 4FN4A 4J03A 5IFLA 2JVIA 1YZFA 1M6HA 2PRIA 1CJKC 3DH0A 1SRQA 1L4LA 3HU3A 3AESB 2QMHA 4PR3A 1CSEE 3B20A 4KVZA 4TWIA 2CSXA 1CY4A 3BRCA 1A7AA 1DKLA 3QVOA 2Y4OA 2NU8B 3U7QA 3EFHA 3G2OA 1OU4A 1PAUA 3DL2A 3I0ZA 5D6OA 5AOCA 4LDRA 3K8ZA 3QLJA 2RIPA 4RJTA 5CW2A 1V11A 5CCBA 4G1CA 4OJQA 5CDGA 3P2KA 5IVKA 4DJAA 2QW0X 1XL0A 1PJLA 2O9JA 1GTL1 2NT3A 3QWAA 3LIPA 5ALMA 2ORWA 3KUXA 1J0XO 3UMMA 1IBMB 2AC7A 4NZZA 5CMLA 5T67A 2Z5VA 1MQSA 1YZTA 1CWUA 2E4ZA 1PEAA 2I2XB 3DAGA 3OT5A 3U4IA 4Q3DA 4TTTS 3N1UA 1PKXA 1IFXA 4UU0A 3Q9LA 1KEPA 4REQA 1E0KA 3M6AA 1SURA 3UAOA 3HUFA 5BOSB 4RFVA 5HYVA 4TV8F 1YCGA 2D2IA 4MQLA 3OETA 4BVFA 5KNBH 2PSHA 2E21A 4G85A 4JSYA 5T8KA 5D1HA 1U7PA 2O48X 1XDWA 5LBUA 1GNRA 1STOA 2PM8A 5KNDD 3A6FA 3KBBA 3PQEA 1WIWA 1BVYF 3OMWA 2OECA 4LN1A 2CLFB 4PZPA 4EBFA 3AI7A 1U80A 2D4HA 2QVXX 4LXYA 4ZI7F 4NOMA 2OHOA 3ORHA 1PK7A 1L8LA 2W6ZA 4IF6A 1D1TA 1E3JA 1QX4A 1ZBDA 1BWSA 5GZ6A 1IE3A 3B3AA 4ZT2A 1G63A 4ALIA 3F6EX 1PFKA 4OQYA 3BMCA 4N39A 2P9GA 2OBBA 1ODSA 1U0GA 1VSQA 4IDCA 2YXPX 2GJKA 2VJQA 2B35A 2XW6A 4KR3A 3SR4A 4FQ7A 2AKEA 4ARVA 4X3OA 1Z18A 3ZDQA 5CH5A 4B2LA 5BSKA 5CAEA 1EX1A 2H92A 2M6KA 4YRAA 4E4TA 1I3NA 2HOQA 3W5DA 1RD4A 1YIDA 3OKFA 3QXXA 1B0AA 4JJ7A 5L3SA 2XF8A 4JYZA 4JQSA 5C35A 2YZ2A 1ORVA 4L8GA 2BI7A 2FNAA 4EFKA 1QBKC 2GWRA 2ZSKA 3PJDA 3GF4A 2HWYA 3VJLA 5FHRA 2H7YA 3FPJA 3OFJA 3KG2A 1ONPA 4FOOA 3PDHA 2BMEA 2I2AA 1ZXXA 3BREA 3VSCA 3PGVA 5KQLA 1A7KA 1ISFA 2HO5A 4OJYA 3DOOA 3H0EA 1PFVA 1JALA 1YWGO 2QW1A 3OX4A 4O33A 3MINA 4NHEA 4NV0A 3IELA 3GLFE 3ZS8A 1Y34E 3NAGA 4IUBS 2AOWA 3AIMA 3AVOA 3ANMA 1J22A 2C54A 2VDRB 3PNYA 4LPKA 4WRRA 2NADA 3RPEA 3PRJA 1B8OA 3DKIA 1MVLA 4C2BA 1NZFA 1ZIDA 1PZGA 2QIOA 1UOQA 3F47A 2IA5A 1WXGA 3MG9A 1O89A 3UANA 3W7AA 1OB2A 1OPXA 3GHHA 3HN7A 2PAAA 1QGUA 2XEDA 2FFAA 3HACA 2CHUA 3KKPA 1KS9A 3DQZA 7REQA 3EGVA 4LJRA 3KWJA 3RC9A 2LDBA 4TL8A 1UINA 3ZWPA 1E1RA 3V9PA 5BOVA 3FPKA 1W46A 4HI0E 1LPNA 2X8WA 3JQBA 3LI2A 2AD1A 1YRQA 4Z2YA 1SOAA 4IQ8A 4HAIA 4I3GA 3I39X 1OFUA 3P0IA 2XUQA 4KUEA 1SB8A 5F73A 3PYMA 4AY3A 3ZDFA 2AI1A 4BO1A 4UTNA 3F3YA 2QYOA 3C0KA 1QH8B 1ZI6A 3JR7A 3NHWA 1QNLA 2BSQA 2JK0A 5K5EA 2GH1A 3FTQA 5KSYA 3WJ1A 2YNMA 4B9EA 1L1EA 3CPHA 4C88A 1Z0SA 4O4IB 2GLXA 4D4LA 2RDMA 5KJ6A 5EMLA 5TS2A 2IJGX 5IJAA 3B6MA 2IXDA 1SXQA 4CM9D 1L5QA 1I14A 5ECWA 1R64A 5GGXA 1GM5A 3HWRA 2V4UA 4HLNA 4RL6A 4BEBA 3C7KA 4GXRA 2JI4A 3CUKA 4B3TB 3HJNA 3SE0A 1U2SA 2WZBA 3KQMA 3EPLA 4G1MB 4CLHA 3CNEA 3E4CA 2JIRA 1B7GO 1SXHA 1Y1LA 5KTTA 1JQEA 4U9IS 5FUYA 5P21A 1KYIA 3EUEA 4CDMA 3EXFB 1DWPA 4BB5A 1NF3A 4FYYA 4A8JB 4YLEA 3CR7A 4M1TA 4U5QA 1APBA 1TF7A 5E2IA 1IJBA 2BEJA 2KWIA 1AK1A 2W7TA 3V8VA 2QMQA 3HRKA 1HYHA 4P34A 2ZDHA 2ERYA 4UUQA 2AMLA 2XNJA 3CBGA 4BV3A 3KEFA 3TX2A 2CCGA 2Q3CA 1OXVA 3TZKA 3KVRA 4ZU1X 2ZI7A 4PYIA 1EJ0A 1WKBA 4RXTA 2JZCA 4EHIA 4GRDA 2EFEB 1GTJ1 3A6KA 3FCAA 2FSSA 1XUOA 3UT6A 4WKBA 5YASA 1DDGA 1RXEA 3NJ8A 4UREA 4FZ5A 4Y2UA 5DI3A 3H17A 4AY2A 5CBPA 4OKNA 1QPGA 1EX9A 4F06A 2VT3A 3KB1A 2QWXA 3G2NA 1Y5RA 4LNUA 4MINA 4NU8X 5EVJA 3NBFA 1K89A 3CEHA 3IAS6 1SKQA 4YVFA 5JAMA 3IOYA 1UDXA 2C8VA 4Q4AB 5AUQA 2QR2A 4DZTA 2VJNA 2AF4C 4B6RA 4NICA 4FS8A 3V4PB 3E6AA 1C8BA 4UZEA 2VYVD 3H42B