1U4SA

Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedisulphonic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
307
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 115
structure length 307
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u4sA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u4sA02
2V6GA 3LYLA 2JJYA 3C85A 3TJRA 2QW8A 4CUJA 1J0XO 2O4CA 4YDRA 3WLFA 3KYBA 2P68A 4NNJA 1N1EA 3HB4X 3O8QA 4JLWA 4Q3NA 5A3VA 3RWBA 2AQKA 4UUNA 4BO2A 3KRTA 1CDOA 1YL6A 2VTEA 3OQBA 1TXGA 2B4TO 3WGTA 5JY6A 4PLTA 1U2DA 2NSDA 1WMBA 1VL0A 4HV4A 1O5IA 1ZUD1 1PX0A 5AXCA 4BNKA 3GRKA 4CMGA 3EK2A 3RC9A 3UXYA 1YL5A 4WCDA 3VPHA 4GI2A 1LA2A 3U62A 2GASA 1N1GA 3ITDA 3H9QA 1ZXBA 4E30A 1PEDA 4JCOA 4Q3EA 2Y1DA 3OA0A 5DBIA 2Q50A 3TZQA 3A1NA 1H93A 2X23A 3BMNA 4AJOA 4J1TA 1O0SA 1C3VA 4GVLA 1X7DA 2PH3A 3QY9A 2EJWA 4G5HA 2GO1A 2Y99A 1OBFO 2Y05A 3ROKA 1CF2O 1YJQA 1BDBA 3VZQA 2NTJA 1RYDA 1FDWA 2AE1A 1SC6A 2C54A 5JAQA 1JTVA 4H3VA 3WX0A 4BNGA 4KDEA 1CYDA 2Z1MA 4AJJA 3ZU5A 2QIOA 3AK4A 3K6JA 5EN4A 1D1SA 1H6DA 3AUUA 4D3FA 1F8GA 1K0UA 2WD7A 3RIHA 1B8UA 1YOVB 3SC6A 1KEVA 1G0OA 3PJEA 2VHWA 3DWFA 4B3JA 4Y9DA 4ILKA 4OSOA 3EVTA 3DTYA 5IDXA 1E3SA 1ENYA 1HDCA 1DFIA 2EKQA 2DBQA 1V6AA 4A10A 1XGKA 4PZCA 4LISA 3GVHA 4ZU3A 3AU8A 2DPHA 3GZ4A 1EBUA 2AA3A 4MOWA 4ZRNA 1Z82A 4ALNA 1YB1A 1J5PA 4WLEA 2Z5LA 4GMGA 5DBGA 1NHWA 4EW6A 2WMDA 2CDCA 3FR7A 3O9ZA 5IZCC 3KYDA 3PYLA 1OFGA 4TRRA 5IZCA 4NJMB 3DBLA 2O3UA 2Q1TA 2PLAA 3FPLA 2VT2A 4OIMA 2ZB4A 4WGGA 2CD9A 2OHXA 4J9VA 3JQCA 3E8XA 2QRJA 4EZBA 3E6AA 3H3FA 5BR7A 4WOJA 2PWZA 2Y1OA 1JKIA 1FJHA 3JD3A 5FF9A 4NPCA 1OC2A 1BW9B 1HE2A 2OOSA 3VZSA 4BMVA 3B1KA 4YAJA 3O4RA 4G81A 3GVIA 5COQA 2PR2A 2B5VA 1IPFA 2CMDA 3BTVA 2BI8A 4PG5A 4OM8A 3VTZA 5C37A 5ES3A 4YQZA 3B1JA 4RF3A 3W4JA 3EYWA 3KETA 3RSHA 1W73A 4CLEA 3F6YA 3ZU4A 4R41A 2O3RA 1P1HA 1Q0QA 2Q45A 3HDYA 4GBJA 4IXWA 5IAAA 5TT0A 1TT7A 4PZEA 2EP7A 5EIOA 5A06A 2VNAA 2P9GA 4J7UA 4MP8A 3E9MA 5EJ2A 5K9ZA 4BMNA 4OL9A 4IDCA 4XYLA 1WNTA 1T26A 1WDLA 5CG2A 1DO8A 4LVUA 1AUPA 3H9UA 3LC7O 5DNAA 1CWUA 1O6ZA 4U0KA 3S2FA 5JE8A 1EMDA 4J4HA 4BNXA 4NBRA 4YJHB 4IUYA 2B4RO 1AXEA 3I3OA 3OJLA 4MKXA 3OJ0A 4HNHA 2VOJA 1YS4A 4XRGA 3HSKA 2B35A 8ADHA 1SB8A 4MVJF 1ZW1A 2CFCA 1LRJA 2FWMX 1F06A 2WYVA 1NQ5A 4BL5A 3JQBC 1F0YA 1I3NA 3IDSA 5AXBA 3FNGA 2P9EA 2D0IA 1HDGO 4LSWA 4BNVA 3JQBA 2O3TA 4FCCA 1ZK0A 3KVOA 1Y8QA 3OA2A 1I10A 1P1IA 4XQCA 4BQRA 5KJ6A 3BMCA 1H6CA 3PWSA 5BNTA 1FDTA 1U7TA 2DPGA 4OXNA 3GK3A 4MVJH 1MV8A 3JQFC 4AJ4A 2GSDA 3ZW9A 4CQMB 2TMDA 4RORA 3X2FA 1RYEA 1P1FA 1HLPA 4CODB 1VSVA 3ZV6A 4DQVA 3JQFA 2RHRA 4F3YA 3PZRA 1Q2XA 1X7HA 2PGDA 3TQHA 3HADA 1HSOA 4P4LA 4HBGA 2NWQA 2W4QA 3WYBA 3ETDA 4IJVA 4PLPA 4YPOA 3D1LA 2Z95A 5KJFA 1SOVA 4FIZA 4L0QA 4B3IA 3VOSA 3L9WA 4Q3AA 1XSEA 4HFNA 3NTQA 4PLZA 1AE1A 2ZYDA 3AW9A 4FBGA 3GAFA 5EL0A 4IZIA 5L9AA 2PGJA 4RDHA 5K6AA 1PTJA 3F47A 5HWSA 5I7VA 5JNLA 5DBFA 1SB9A 4YAEA 2E48A 2B69A 3ICCA 4QQRA 2JAHA 3MOIA 1IZ9A 3NJ8A 2DTDA 4JP3A 3OHSX 3WWYA 1L1FA 4BNTA 5G4LA 4YRBA 4CM4B 3SXPA 2HU2A 4KZPA 4WEQA 3RU7A 2WEKA 3QWBA 1AGNA 4R9SA 5BT9A 4EGFA 1H5QA 3HG7A 3DZGA 3GGOA 3F3SA 1Z75A 3FTPA 4K6FA 1YOVA 4WASA 1H2HA 4L74A 3U4CA 3OEWA 1HEUA 1I3MA 2JD2A 2UUOA 1I3KA 4RVSA 2HDHA 4BV9A 1NWCA 1U3VA 3EY4A 4DL9A 4XDZA 1U4OA 3CXRA 1HE5A 4A7PA 4E33A 1IZ0A 2BKAA 3GEGA 5TX7A 4E12A 3WGZA 3BXXA 1GQQA 2AG8A 3AM5A 3DAFA 4G65A 4LK3A 4MDHA 4AL4A 3TPCA 4YT2A 2O2YA 2Y0DA 2PKQP 2GN9A 3WIDA 4IDBA 1XU9A 4MVJD 3R1IA 4XJTA 4TZKA 1QYWA 5KWEA 7ADHA 1NAIA 4DRYA 1UUFA 4XR4A 1BWSA 4NJMA 4ALKA 2EGHA 1XCBA 5ILGA 3VKUA 3PQDA 3S2GA 2B37A 1KEPA 4IM7A 3AUSA 1GL3A 3BAZA 3QWIA 2F1KA 1UP7A 4YB8A 2Y0CA 3GN1A 4BO6A 4HFJA 4FGWA 2E4AA 5JO0A 2VRCA 1BW9A 1VRWA 2Q2QA 3BTUA 3RUIA 5DF1A 1YO6A 3RQSA 4CQLB 3PK0A 3ROMA 1BTOA 2BFMA 4D3DA 5DOVA 1H6AA 1UXIA 4CLOB 2X6TA 4BUCA 1T1SA 1GFSA 4GWKA 2FSSA 4DGSA 4R5MA 3D4OA 2BD0A 1TB4A 3GLQA 1DJQA 4YT4A 4WLUA 2Q2WA 3BHJA 4D46A 1XA0A 1JWBB 5AQ1A 1YE3A 2ILTA 2W98A 2X9GA 3FHLA 4KMSA 2CVOA 1WP4A 3NGXA 3W8DA 4NBWA 4FJ2A 3VPXA 2PV7A 3PXXA 3GFBA 1PGQA 3HWRA 4R01A 2X5KO 4DYVA 4AJEA 4PLGA 3VH4A 4EYEA 1PU2A 4PG8A 1HE3A 2ZJ1A 4YT5A 2EERA 3ZH2A 3ETGA 3C7AA 1NP3A 2NVUB 4YJHA 3WSVA 2J3IA 3H8VA 3NV9A 4L4XA 1ZXLA 4BNLA 3MZ0A 5IXYA 4DLAA 1E7YA 3VTFA 5KNLA 3GVPA 4JP2A 1X7GA 3K96A 3EUWA 1VL8A 4O6VA 2RH4A 1WZIA 4RQUA 5KJEA 3VVCA 1U3UA 3H2SA 3GA0A 1PL7A 1UZNA 3DMTC 4BKUA 3ZWAA 2OMEA 4LW8A 1UAGA 4OSPA 4AFNA 4RPKA 3A06A 1HKUA 1Y1PA 2EJVA 3EGOA 3DMTA 3C7DB 1TEHA 2FZWA 2DBZA 2PA3A 3K73O 4DPMA 2R00C 5F1PA 2PD3A 4K1LA 5BSHA 4KUEA 4OOFA 1IL0A 4P38A 1XWFA 3IC5A 5G4KB 1GU7A 3VH1A 3CMMA 1DC6A 1GCUA 2R00A 1GEEA 4CQMA 2P5UA 2NTVA 3GUYA 4E13A 4RPJA 4JN6B 3G49A 4RF5A 5TS3A 7MDHA 4M89A 4CMCA 3KXDA 1ZCJA 2V6MA 3JD2A 4E3ZA 2EW8A 3ADOA 3E03A 2LDXA 3WYEA 4E2YA 4EI2A 3F1KA 3JQAD 1GQYA 1ADFA 3RI3A 3RD5A 5JS6A 2X22A 4XKJA 3RFXA 3KSZO 4YACA 1KEWA 3FRJA 2BI7A 5CDTA 1D3AA 1YBVA 2VHXA 1QYXA 1JN0A 1SMKA 3CEAA 3FN4A 4LN1A 3SVTA 1MXHA 4GWGA 1D7OA 2DFDA 3NDJA 3I83A 5KJCA 1VE9A 5L7WA 4GSLA 4PN3A 4MIYA 1BG6A 1SPXA 4E31A 1X0XA 3QHAA 3OEYA 4AJPA 4BO4A 1OZAA 1X15A 5TIIA 5MDHA 3JD0A 1LNQA 1PWZA 1DB3A 1NVMB 4XYBA 3V2UA 3HJAA 1NBOA 2OO5A 3JQ8B 3RJ9A 1NPYA 2YW9A 3HZZA 3VH2A 2DUWA 4CPDA 1JLLA 1DFHA 3U4DA 2PFGA 4KP7A 3DOOA 4CM4A 1PJ2A 2E82A 4EEXA 3M2PA 5L4LA 3UHAA 2J6IA 5I7FA 4Q39A 1GUZA 4IQGA 1MP0A 4OH1A 4QFDA 1VPDA 3WJAA 3TN7A 3AU9A 4XZ3A 4YTEA 3K92A 3N74A 1NR7A 3IOYA 3PHLA 1PQUA 2VZ9A 3WBBA 1Y81A 1GAEO 2DBVO 2DM6A 4AJKA 2ZTUA 4D44A 1PJBA 2YZ7A 2XPCA 2HUNA 1K3TA 4MVJG 4HNGA 1A72A 5F1KA 1GCOA 3F4BA 3E48A 1N7GA 1DEHA 4BO0A 2HRZA 1ZFNA 4LSMA 4WKGA 4BO5A 2ET6A 3MWEB 3S8MA 1QR6A 2NACA 1U3TA 3WYCA 2OORA 3BTSA 4INAA 4JQCA 4OKIA 1B8PA 2I67A 4DMMA 3GH3A 1U9JA 3T7EA 2IEDA 2F00A 4IJWA 2CZCA 3R6DA 1E6EA 3BYZA 4DIBA 1A27A 1T1RA 1BGVA 3FWZA 4CV3A 3I23A 3OMLA 1GEGA 1JVBA 4A73A 4J91A 4J90A 3RBXA 4GX1A 2X86A 2A9FA 5A5EA 2P4HX 3STHA 2DVMA 1I0ZA 1I3LA 3P7MA 4J16A 1WWKA 3RU9A 1UP4A 2ZB8A 3VPFA 1YONA 1B2LA 1ISIA 1PL8A 4CLDA 4R1NA 4CQLA 3ZNPA 5JYEA 4IQ0A 4F6LA 1UZMA 4URFA 4CLOA 4QEDA 3WOHA 1YL7A 1F12A 3E18A 2GDZA 3PI7A 1RKXA 4RPLA 4PLHA 3GAZA 2IXAA 3ETEA 5BQFA 3GN2A 3NGLA 1IE3A 1AHIA 4FFPA 1ZEMA 2OBNA 1HXHA 4R51A 4QT0A 2H9IA 5U4QA 2VUUA 3MJEA 1IB6A 4ONEA 3RKRA 1ORRA 1ZSNA 3H6KA 3U09A 2OP0A 5HRUA 3GNSA 2E6UX 2FR0A 2RH8A 2PTGA 1WZEA 5C7LO 1ADGA 1IULA 1QP8A 5G2OA 2NU6A 1MC4A 4GGOA 4CV2A 4XJSA 3KBOA 2ZQYA 3WGYA 1DSSG 1P1RA 1I30A 2D8AA 2NVUA 1KVUA 1OI7A 4MVJI 5A02A 1P33A 4P4GA 4ND4A 4II2A 4W7IA 2ZQZA 3OQ1A 4I9HA 3ROPA 2FMUA 4GL4A 1YB4A 2J3KA 1DIGA 1I33A 3K2BA 2Q3EA 1M66A 1HYHA 5AXDA 1QG6A 3H5AA 1EK6A 3G17A 4L9RA 4DBVO 3L4SO 4DIOA 1LSUA 2FR8A 4ZRMA 1WPQA 2FRDA 5CEFA 5ENDA 4BNYA 3X2EA 4TZTA 3ZV4A 1YRLA 2IDZA 4TSKA 3HNPA 5G4KA 4CMBA 2HJSA 1I01A 1JKFA 4FFLA 4I8XA 3Q11A 4W99A 4BNUA 2HMUA 3AOEC 5EQDA 4W4TA 1TI7A 3K31A 3WICA 1P45A 3MTGA 4D45A 3EW7A 3HQ4O 3JQ9C 4Y6SA 5KJ1A 5JC8A 3ABIA 4LCEA 1CRWG 4Y6PA 3AOEA 3G1UA 2YFHA 2IE0A 3LU1A 3RBZA 3JQ9A 1B26A 4BKOA 2IYOA 3VVBA 1PJLA 1EVIA 1BXZA 4GMFA 3PHGA 1TLTA 1LX6A 4GAEA 1D1TA 1FDVA 3QA9A 3ONDA 2GCGA 1PJCA 3QVTA 4QECA 2HRBA 5EMHA 4GQAA 3KOUA 3S55A 4UUPA 2B83A 3I6QA 1CERA 4U8GA 3L6DA 1TT5B 1E1LA 1GZ6A 3VDRA 1UDBA 3KUXA 3IJPA 4X54A 2OBYA 3DAGA 1EBFA 1I36A 2W90A 3NTRA 2R6JA 5A04A 3C1TA 4XA8A 4DIFA 4MIOA 4RF4A 2FPIA 2YUTA 1PSDA 4E0BA 2ZYAA 2GGSA 3JQ8A 2EG9A 3UN1A 2W2KB 3P5SA 5L7TA 4FQ8A 4Q3DA 4XGNA 4UEOA 2P91A 1BVUA 1EDZA 3FF4A 4CR7A 4Z9FA 3NT5A 1VI2A 3TNLA 2OXIA 5F5NA 1HLDA 1QYCA 2O7SA 3PJFA 2HK7A 2AEMA 1SEPA 3H3JA 1GPJA 2EIHA 4M54A 1QV7A 5DT9A 4IY1A 2JKVA 4YXFA 1ISHA 1K2WA 2BF7A 3E5MA 2JCXA 3GMDA 1LC0A 4XEHA 3ZHZA 3L0DA 3RC2A 4GKBA 1XKQA 4I9UA 1QSGA 2YHUA 5TRTA 4CMJA 2BFAA 4XX0A 3GPIA 1Y9AA 2ZIZA 1E1NA 4FB5A 2O3QA 4IIVA 2P5YA 1FDSA 2J3HA 2VYND 2O50A 2B4QA 1LDBA 2CDBA 3U3XA 1DIBA 3HUDA 4FW8A 5CAEA 1YDEA 3WXBA 2WDZA 1NPTO 4BO7A 3OIDA 3IUPA 4PRLA 3H9EO 2HAEA 1M6HA 3DMYA 3IKTA 3NEPX 3PPIA 4AJNA 5H82A 5BNFA 4FFMA 1LRKA 4MVJM 3PWZA 1T2CA 5AXAA 2YJZA 4O59O 4DBZA 1GR0A 1FXSA 2RHCA 5A9SB 1NASA 3WMXA 1JKJA 3P2YA 5ENVA 4CMEC 1RJWA 4LMPA 2O7QA 2A4KA 3TL2A 1NWHA 1K5HA 3TSCA 5ITVA 2AEJA 1NR1A 1GV0A 3WGOA 4CMEA 1Y5MA 3T4EA 2I99A 3TF5A 2D2IA 4WOKA 1OOEA 1ZMTA 4QTZA 4WPGA 4ZD6A 2FY8A 3TRIA 3Q0EA 3UOGA 5CG1A 3ZWWA 2P2SA 4ND2A 1QORA 3FBTA 4WLOA 2Y68A 2W2LD 1I2ZA 3KB6A 2CUKA 3MJ4A 1MFZA 4CMIB 1XQ1A 3TOZA 4PG4A 4OYRA 4EITA 3JYLA 3FSRA 1D8AA 5DP2A 4BGVA 3I9KA 1NFRA 2XXJA 3I9JA 3UW3A 1F14A 1XQ6A 3EMKA 3ZN2A 2QYTA 3P19A 5A3JA 2POQX 4ND5A 2VWGA 4EJMA 1ONOA 3UCEA 5DCYA 1U5AA 3GGGA 1ZK4A 4BNWA 5JLAA 3FD8A 1B7GO 1KVSA 1M75A 3PLRA 4A0SA 5C7IO 3R3SA 5TQVA 3DEYX 5G0UA 5LC1A 1W6UA 2Q1WA 1GYQA 1ZZEA 5KIAA 3DFZA 3EZYA 4JBGA 4JIGA 1E3WB 4DC1A 4IZHA 1L7DA 1LC3A 4XIJA 4UVGA 4N18A 2I3AA 3FNEA 5JO9A 2Y1FA 3WBFA 1ZKMA 1E0DA 5T57A 1E3LA 4L4RA 3ZWMA 4ZICA 1Y8RB 4GLLA 5BSGA 3PIDA 3VAZA 2IZZA 1MA0A 3N58A 4RO0A 2C29D 5L40A 3PP8A 3U5TA 2CF5A 3QRWA 2JFHA 4CLRB 1NQOA 3PZBA 3U9LA 1U4SA 2FPGA 4WNCA 3KSDO 2C7VA 5JCJD 4NDNE 3ZWYA 1O89A 3JV7A 2V6BA 1NVGA 3NX4A 4QX6A 2VQ3A 3MOGA 4C7KA 3ZU3A 1KERA 4JJGA 2IZ0A 4GSKA 1HWYA 3ANNA 4PGFA 4YJDA 2VCYA 1C0LA 5FEUA 5T5QA 3L07A 1LRLA 5IDQA 1YQXA 3AM3A 1R4NB 4U7WA 3ZHXA 5KKCA 3EVNA 3L6OO 4AG3A 1ULUA 4ESOA 4YYZA 2G1UA 4EUEA 5I9LA 3VH3A 1VL6A 3UKOA 4IS3A 4KDFA 3W8EA 1DAPA 3LT2A 4PFJA 3H9GA 2DFVA 2X9VA 5DP1A 4KOAA 3RKUA 2X5JO 1KY5A 5F1OA 3DBHB 4WUVA 4D7AA 3BHMA 4NG5A 4CL8A 5TJ9A 1T2FA 1TT5A 1J49A 3W6ZA 1ZNQO 4R3NA 2VRBA 1E7QA 3F1LA 3NYWA 3RJ5A 4RVFA 4M1QA 2D1YA 3GR6A 3TFOA 4RJTA 2NQTA 2EXXA 3GFGA 3JQGB 4XGKA 5TC4A 1T2EA 1GYPA 2EGGA 2HKIA 2NLOA 2Y67A 1GUFA 3NDIA 4L8VA 3UCFA 1KYQA 5F5LA 3ZDFA 3LSYA 4DLLA 5L4SA 2FZEA 1C1XB 2W2KA 3C3XA 1MGOA 2QHXA 2NVBA 4J2OA 1I32A 2QRLA 2A94A 4XB2A 1ISGA 4HFRA 4WLVA 1B0AA 4J6FA 3ULKA 4CLXA 3WS7A 3DZHA 1PIWA 2J5RA 4I1IA 3GZNB 1XDWA 4Z0HO 4J7XA 1HETA 1PS9A 2AQHA 3PDJA 1E77A 2V6FA 3KHUA 4IMRA 5JYDA 1T2DA 1C1DB 1E7RA 2NV6A 2G17A 3UVEA 4XWYA 3FBGA 1OC4A 2EW2A 1LBEA 2VYVD 3SC4A 5K6AC 1VJ0A 2X8LA 4CMHA 3V1UA 3LT0A 2BFOA 3ROQA 2ZTLA 3ZV5A 2CVQA 2EKLA 2EEZA 1WVGA 3QVSA 3RUEA 3OH8A 2OP1A 3DZKA 2E49A 1MLDA 3JSAA 3DZJA 3KSUA 3RC1A 2PK3A 2XF8A 3GF4A 4DREA 1Y6JA 3CTMA 3OETA 3INTA 3Q2IA 4O63O 2X9NA 2AXQA 4MJLA 4BO9A 2UUPA 1GDHA 4NBTA 1WW8A 4N7RA 2IYPA 1ZJYA 5IXSA 2OZPA 4K26A 4ALMA 3D3EA 1U8XX 1ADCA 3PYMA 2ZK7A 4J9UE 3B70A 1DRUA 5FWNA 5A9SA 1HZJA 3D5TA 3KLMX 2WE8A 4ZHSA 5JBIA 1XU7A 3SJUA 1RWBA 1XLTA 2D5AA 1SOWA 4ND3A 1ISFA 4PLCA 3LT1A 1YQGA 3PJDA 4NH4A 1DIHA 4GX5A 4MKZA 3UAGA 5JY1A 2UVDA 2P4QA 4UUOA 2I5PO 3TZKA 3D7LA 2GYYA 1UP6A 4RL6A 5DCUA 1PJ3A 4BGUA 4NU6A 4KUGA 1C14A 4UVHA 4CMIA 5KVVA 3ZWXA 4ZQHA 3GT0A 1M67A 4Q3BA 4Y6RA 3QLJA 1I24A 4I5GA 4IDFA 1WLYA 4R1UA 4ITUA 4JK3A 3CH6A 2PZJA 3ZCXA 4IJUA 4J1QA 4U5QA 1HYGA 3RFTA 2GERA 1GUYA 1NTOA 2NU7A 3HFGA 3IAHA 3IJRA 3QVWA 1E6WA 3C7CB 2RBEA 5I7SA 3WLEA 4BGEA 1Z74A 3DTTA 2OUIA 1I5RA 5I8ZA 1IYZA 5L95A 1ZEJA 3C1OA 4K6CA 2A92A 4CM9D 4JJFA 4YR9A 3DO5A 1ML3A 3PEFA 4RPGA 3MCVA 5ADHA 4J7CA 3ZHYA 1E3WA 3AI2A 4TROA 1B3RA 3DAPA 4B7UA 1U3WA 2D4AA 3OBBA 5IJZA 2VWQA 1Q7BA 1O8CA 4PG7A 2B36A 4EJ0A 1Y8RA 4YJFB 5CEJA 2WWRA 3R0IA 5JAMA 3QWHA 4WEOA 1H2BA 3GNTA 4IMPA 2AHRA 1KY4A 4CLRA 3VPSA 4Z3KA 5EQFA 5A03A 3SJ7A 3UH1A 3K5PA 1EUCA 2D5CA 3H4VA 1AHHA 1N9GB 1KC3A 1IHYA 4FOSA 1UJMA 4RF2A 4DA9A 3TZ6A 3V2GA 1HE4A 1NPDA 3G0OA 4NMHA 1R4NA 1ENZA 4A27A 1HSZA 1VLLA 4IGEA 2H63A 4NZ9A 5HS4A 1U28A 1DC4A 4HFMA 5BSEA 3WJ7A 2X0NA 4MP3A 4I5DA 1ZBQA 4XQ9A 3TL3A 4BHTA 3DBHA 2IEBA 4R16A 4NBUA 4XCVA 4GH5A 4QXMA 3GY0A 3WFJA 3Q9UA 4ZA2A 2AMFA 3QWFA 5JSFA 3VKVA 3PTZA 4NHEA 5HBRA 3QV1A 1LLDA 4XIYA 3KO8A 4DVJA 4BNNA 2HMWA 1PZHA 2JHFA 2DTEA 3PRJA 3JQGA 4RLSA 1SBYA 1DFGA 2EV9A 3VDQA 3WG9A 3D5QA 4D3SA 4BV8A 1MG5A 1ZK1A 2GRAA 5EPOA 3I9MA 3WTBA 3NAQA 3ZGYA 1Z45A 3E9NA 1C1XA 1X14A 3AUAA 2G0TA 2C5AA 4OAQA 1CJCA 1LDNA 4ND1A 4RVUA 1ID1A 2NADA 2VT3A 3GZNA 5BNIA 1H9AA 4AJ1A 2RAFA 2J5KA 3VPGA 1AN9A 1UAYA 1VJ1A 1C1DA 3JTMA 4O0LA 5A5FA 1ZK3A 3PQFA 4LMRA 1J6UA 4BO1A 4BB6A 2V65A 3G1TA 3LLSA 4AICA 1Z73A 4BNZA 3RC7A 2YV3A 4WECA 1CIVA 1Q0LA 2PZLA 2A35A 1V3VA 4EUFA 4BNIA 5CP8A 4F45A 1ZK2A 3DOCA 2FP4A 4CR8A 1JAXA 2HMSA 3LC1O 2PNFA 4H7PA 4BQPA 4AJLA 1DIAA 3Q2KA 2Q2VA 3GC6A 3RUCA 4JBIA 3ASVA 4S1VA 4TRNA 4UUMA 3ZWOA 1HDOA 1YJ8A 3UICA 4E2WA 3LLVA 1EE9A 4TKMA 3SBOA 3DONA 4DWVA 2B5WA 1EFKA 1DDOA 2G5CA 3KEOA 5JFOA 5KVQA 1R0KA 3G79A 4PG6A 5A4DA 1HL3A 5IF3A 1SNYA 1E5QA 2H6EA 4GX0A 4TRJA 3HB5X 1NNUA 2YDXA 4AVYA 1ONNA 1DRVA 4YAKA 5KCZA 2XOXA 3D64A 2AE2A 3DOJA 4W9NC 1Z7EA 1RPNA 3QSGA 1NVTA 3DXFA 5K0ZA 1TVEA 2Q1SA 1PZFA 3JQAB 5DCWA 3LDHA 4MIEA 4W9NA 5JMWA 2C5EA 1Q0HA 4B7CA 2JD1A 4J2HA 2BRUA 2O23A 2NU8A 2NM0A 4R1TA 5KOIA 3ZNOA 3GGPA 5COAA 4CM1A 1GQ2A 1PGJA 1EE2A 3CE6A 3D4PA 1KETA 2BMAA 3DL2A 1Q7GA 1LTHR 1B16A 1V3TA 2HK9A 1NAHA 4J0EA 1XHLA 1QMGA 3U49A 4C7JA 4R9RA 1XG5A 4U6QA 2VHZA 1GZ3A 1EVJA 4KWIA 4Z9XA 2VHVA 4TVBA 2ZTMA 1X1EA 3ENKA 5I8WA 4GGPA 3ASUA 4FD3A 1LJ8A 5CPBA 1AXGA 4E5KA 3ANLA 5KVSA 3A9WA 3UFXA 1R4MB 2GF2A 3BMOB 3E1KA 3JQ6A 4IBOA 1JAYA 4YJFA 4BVAA 2NQ8A 4DLBA 3OECA 1ENOA 4J4BA 2GR9A 3TZCA 3WMWA 5L45A 5T6BA 3UF0A 3CIFA 3INRA 1GTMA 3H5RA 3KTDA 4AJIA 4YT8A 4CLHA 3TWOA 1HDYA 2ZTVA 4RLHA 2FPPA 1BMDA 4EDFA 2RCYA 2QZ9A 1N9GA 1QV6A 3AY6A 1P74A 3V8BA 1K6XA 1JQBA 1XELA 3ITKA 1G6KA 1ARZA 1MX3A 1ZJZA 3TFQA 1GD1O 3PIIA 4MVJA 2EF1A 2Q4BA 2CNBA 2YV2A 3FCOA 4PRKA 2AQ8A 3C8MA 1JU9A 2FOIA 1UXKA 4WCFB 1LUAA 1PJSA 3JQ7B 1YBAA 4NI5A 1T25A 5IDYA 3HDQA 1HTBA 3NRCA 4OQYA 4RQTA 2DAPA 2WE7A 2JAPA 3MWDB 1E5LA 3IL2A 1T4BA 2EWMA 4JX8A 1ISMA 5LDGA 5B4VA 3WDSA 5GY7A 3O38A 2ZCVA 2CDAA 2D3TA 2FN7A 1C0KA 6LDHA 1CQIA 2VWPA 3K8ZA 4OOEA 1PS8A 1FK8A 3ZWPA 1UDCA 2IRWA 4HY3A 5TGDA 4ZJUA 4YCAA 4MPDA 3JCZA 4E32A 1HYEA 1EVYA 1PS0A 1R0SA 3A28A 4BMSA 3V1YA 4AJ2A 1K6JA 5JCXA 1V9LA 1HDRA 1W8DA 3ON5A 4E2ZA 3IMFA 2PY6A 3B20A 4TMFA 1U8FO 2GLXA 5CDUA 1PJ4A 2VNSA 1F8FA 3NJ4A 2WYWA 1E3JA 3DZBA 3QP9A 2NNLD 3ZWNA 3CUKA 1R37A 3DHYA 4QFCA 1P1JA 2FHSA 4E4YA 1P0CA 1UXGA 4JGBA 5GZ3A 3MJSA 1RM5A 1VC2A 3AFMA 4PLWA 4BNJA 3PQEA 4UEKA 2X0IA 3OIFA 2Q99A 5LCXA 1GY8A 2R2GA 5ICMA 1J4AA 4RPHA 4P8RA 4C4OA 1LLUA 1JDJA 2I6TA 3RUFA 1PZGA 1DIRA 4P4NA 1V0JA 5ER6A 4B3HA 1JA9A 2CF6A 1KVRA 1YB5A 3VZPA 5HA5A 3A4VA 3OICA 3PWKA 4RV9A 2ZYGA 1KBZA 4PIVA 4R3WA 3LQFA 1VJTA 5LDHA 4NBVA 4Z0PA 3GG2A 4A2CA 1LQTA 2X5OA 3GVCA 2LDBA 4N54A 4XGIA 3WNVA 3NUGA 3W8FA 4Y67A 1N92A 1LU9A 2PGLA 4N5LA 4NJOA 4R4JA 1R12A 3BTOA 4DTIA 1B8VA 3WQSB 2QRKA 3ST7A 3B6ZA 4ROSA 4YVFA 5I9NA 1PQPA 3W1VA 5ITWA 4XB1A 1NHGA 3DB2A 5B37A 4DC0A 4RVHA 1G0NA 3OFSA 4FJ1A 2WM3A 3RBVA 1YVEI 4M55A 4JNKA 2I3GA 3I6IA 1R16A 5FI5A 3JQAA 4IDDA 5ICSA 1NYTA 1D4FA 5A1TA 4I5FA 3KZVA 3S2EA 1LDYA 3ZWBA 4BKPA 1IHXA 1E1KA 1MXFA 1X13A 4R69A 4RVGA 1Q1NA 4ZN6A 2VRCD 5CFZA 5ER9A 3EDMA 1JVSA 3T4XA 1W4ZA 4NFYA 4WE3A 4Z0TA 5DN9A 1V3UA 5CDGA 2H5LA 3GPDG 2G76A 4HKTA 4RDIA 4ALLA 4OXYA 4LRSB 4BS9A 1BXKA 4XD2A 4F6CA 1XR3A 4N5MA 2VZ0A 3GUCA 1L7EA 1E1MA 2B0JA 3BA1A 1NQAO 2IXBA 4MKRA 1S6YA 4Q3CA 3VZRA 3WIEA 4J4TA 4YBZA 4CV0A 1T2AA 1SCUA 3H5NA 1A9YA 3OJEA 1M6WA 2HCTA 1R4MA 2QX7A 3BMOA 4UAGA 3GRPA 3WB9A 2DU8A 1A5ZA 1NXQA 2Q49A 2H1SA 4DYDA 1P0FA 4RZIA 1VKNA 2D59A 4R1SA 5U1PA 1UXJA 3EC7A 3SX2A 1PGOA 2QG4A 2GN8A 2PH5A 4GKVA 4B4VA 1TA4A 2ZCUA 4OMUA 4LVCA 1R6DA 4HP8A 5G0TA 2GZ3A 2Q4EA 4J1NA 4J3FA 2C7GA 3CKYA 1NX6A 1KOLA 4PCVA 3ADPA 2C82A 4HWKA 3PHJA 2YQ4A 3PVZA 2IODA 2VOEA 2C59A 2YHIB 3I4FA 4FPXA 1ZH8A 1ADBA 2JHGA 2I76A 3GDGA 4FC7A 4H15A 4MVJE 4D42A 1DC5A 4UVEA 4WCFC 3HN2A 4YRAA 4AJHA 5TLSA 5L3ZA 5MGBA 3TZHA 2NVWA 4PLFA 1IOLA 4WCFA 1GYRA 3JQ7A 5IDWA 3CPSA 3LF2A 3RAJA 1M2WA 4QSMA 3JD1A 2HK8A 2PZKA 3GMSA 4DUPA 2AEFA 4E5YA 4S3MA 4K9DA 5IZ4A 5DULA 5TNXA 3E5RA 3CZMA 4WLFA 4J1SA 3ZWCA 4CQMD 3AJRA 4L75A 1BDMA 5CPFA 1ZVMA 3ZZNA 3V5NA 3GDFA 3GHHA 1NM5A 3EAGA 3F4LA 5GMOA 4OO3A 3K2EA 3JYPA 4E2XA 1PL6A 1PQWA 4FC6A 5G0VA 3CMCO 3WGIA 4BNMA 1MUUA 4D0SA 1V8BA 5H83A 4U6SA 5J23A 1WMAA 4FS3A 3ONFA 3F46A 3LZ6A 3L6EA 3FPCA 4FFOA 1P77A 1KVTA 2Q1UA 2ZB3A 4FOOA 3SLGA 4Z9YA 4BB5A 4CM8B 4E5PA 2I65A 3ANMA 3DHNA 1U1IA 3JYOA 4PVCA 3SLKA 5CEEA 3DDNA 3H2ZA 4IDEA 4O5OA 1K89A 4OJNA 5U9CA 1FMCA 1QLHA 4IINA 5I7EA 3WQQA 3CINA 1PGPA 1E6UA 3AY3A 4OXKA 4R54A 1N7HA 1BVRA 4FFRA 1LQUA 2CSUA 2GUGA 4E5NA 4DXHA 1HT0A 3OJFA 4RGBA 4M87A 1NQTA 4KTVE 4ZVVA 5FI3A 3UCXA 3JQEA 5HM8A 4G2NA 3ONEA 5B4TA 2JD0A 1LLQA 2NTNA 3AWDA 1IUKA 4NR0A 3LC2O 4CM3A 1U5CA 1U7HA 2Q46A 4ALJA 4D41A 4KTTE 5FFFA 1DLIA 3QVXA 3OIGA 1H94A 4YEDA 3WGGA 3QVOA 3KYCB 3V2HA 2Y1CA 1LXCA 1HDZA 4W7HA 3VC7A 1MB4A 4BKQA 3L4BC 2IZ1A 3BHIA 4A26A 1MFPA 5F21A 3L4BA 1YXMA 3Q3CA 3AI1A 1EFLA 5THKA 5C5IA 4HADA 1W0CA 1EQUA 2PD6A 1E3EA 1A7AA 2HQ1A 5THQA 4FGSA 3M2TA 2Y0EA 1DHTA 3RUAA 1E3IA 1UDAA 3ZWVA 1GV1A 2QYSA 4Y8VA 4W6ZA 3WNQA 3PYXA 1PJQA 4XQGA 4R68A 2ZKLA 3LF1A 3TOXA 3DC2A 4J43A 2WYUA 3QIVA 1UZLA 3WQRA 1CEQA 1DLJA 4M8SA 5BSFA 3K9QO 1X0VA 4JXKA 3CZRA 1Q7CA 3PFFA 2YV1A 3L77A 4LRTB 4B4WA 1WDMA 2PZMA 4MP6A 3KEQA 2JCVA 2HSDA 2DBRA 4CMKA 2Y93A 2O4UX 5L7YA 4CUZA 2P9CA 4I08A 1B3BA 3GEDA 3HE3A 5CDYA 4KWHA 5G0WA 1ZIDA 2DTXA 2O3SA 2UYYA 4LGVA 1DHRA 2VHYA 1A4UA 1YQDA 3SEFA 2GN4A 5L4NA 4OHUA 1LSOA 3PFWO 4UEJA 4E21A 3M1LA 4W82A 1QLJA 4B7XA 5TF4A 5B4UA 1YGYA 2C0CA 5IN4A 5AVOA 3FI9A 1T24A 3OJOA 2VUSA 3O03A 3RCBA 3H7AA 1OMOA 4MINA 1UH5A 3IIEA 1KC1A 4NK5A 4CUKA 1EDOA 4ZQBA 1NFFA 3PHHA 1XIVA 2VTDA 2DUUA 3IKVA 4H16A 1ONPA 4UVIA 3VHRA 1EK5A 1LEHA 2JL1A 3ZI0A 2Y1EA 3UGKA 1PWXA 1DXYA 4TRMA 1QYDA 3DQPA 4HX5A 4DMLA 1U2GA 3PGXA 5B12A 2PD4A 4I5EA 1RM3A 4EJ6A 3FNHA 1ZSVA 1A7KA 2YHIA 1H0KA 1E7WA 2VYNA 4IJKA 4IS2A 3I9NA 4BIIA 3WGHA 4PZDA 1I8TA 3WR5A 4JROA 2DC1A 4XQEA 4FN4A 3E82A 2Y1GA 2BGLA 3OF2A 4BKRA 5L53A 4RZHA 1K6IA 1JWAB 4N5NA 3OQ6A 1B14A 3BMQB 5KKAA 3QWAA 2BGMA 3EZLA 1XYGA 4FJ0A 5JPIA 1P1KA 3INGA 3W6UA 1R0LA 3WTCA 3L9XA 4E5MA 4JBHA 3NDRA 1FDUA 3KM0A 1EVZA 3IQDB 1HF3A 5AYVA 4YJGB 4DPLA 3RVDA 1YDWA 4GX2A 9LDBA 1XEAA 1BRMA 1BSVA 4DPKA 1X1TA 1H9BA 4NFHA 1LDGA 3DBVO 4P22A 5G0SA 1VM6A 3KV3O 3TDKA 2PKQO 1E7MA 4CMAA 4XYEA 4CM8A 2W2LA 4J0FA 2VZ8A 3CSDA 3ICPA 3V1TC 4D0RA 4IIUA 1RM0A 4EEZA 4L73A 2OFPA 3HHPA 5I9MA 2W8ZA 4PLYA 3FWNA 2GZ2A 4M49A 4WJZA 4KQXA 1ISJA 1R66A 2QQ5A 2SCUA 2XAAA 4TVOA 4Z3DA 3ZNQA 4D79A 5JXWA 3IUSA 4ALIA 2Z1NA 1RM4A 1PR3A 3D3WB 4Z6KA 3RUHA 1PGNA 5EERA 4OQZA 2YY7A 3GEMA 1V35A 3PDUA 2TMGA 5JAZA 3GNQA 3DBRB 3AOGA 1YKFA 2XXBA 3MEQA 4B79A 1SZJG 3HN7A 3GVXA 2WTBA 4YRDA 1QRRA 2ZB7A 1DC3A 2VWHA 1DAOA 3AM4A 1OAAA 1Y9EA 2I66A 1N8KA 4KUHA 1DPGA 2BH9A 2C20A 4WK6A 4O1MA 1Z6ZA 2DKNA 3K30A 5A9RA 1VKOA 3Q6IA 4MO2A 1KEUA 3COSA 3AUTA 1I2CA 1LDMA 3OSUA 3KYCA 5AOVA 3EHEA 4UVDA 3S2IA 5IN5A 4L4SA 1WAMA 3R3JA 4GPD1 1DRWA 1H6BA 2GPTA 2EHDA 4BO8A 1PR9A 4OKNA 3FTNA 9LDTA 1KS9A 3HDJA 2X7HA 5GZ6A 4CM6A 3LK7A 5JCJA 1N5DA 2BELA 5JAIA 4CR6A 4IDGA 1P31A 5COBA 1WXDA 2RIRA 4CV1A 2J8ZA 1GADO 1P3DA 5DOZA 4WNIA 3DHEA 1HRDA 1BXGB 2JFGA 2OGUA 3GG9A 3DR3A 3H9JA 1UR5A 1SEVA 3GQVA 3IS3A 1E7SA 1O94A 5IG2A 1NFQA 3OM9A 3DZFA 2BHLA 5KTKA 4TKLA 2UDPA 5F3RA 3PLNA 1E92A 4TWRA 4K28A 3NT4A 3RASA 4II3A 3I1JA 1C0PA 1O95A 3ZNNA 3F5SA 5FYDA 1YH3A 1SAYA 3JQDA 4B8WA 1A71A 3OP4A 2GD1O 2G82A 2X58A 3M1AA 3O8QB 5A05A 1EUDA 1UXHA 2HMVA 3S1LA 1A4IA 2X0RA 3BIOA 3DFUA 3C24A 4ZQGA 1VSUA 4ID9A 2VUTA 4ZQEA 2Y66A 2V7PA 5T67A 5T8KC 3QE3A 1KVQA 4RVDA 4HXYA 2DQ4A 4BNHA 3RUDA 1A9ZA 4CM5A 1T4DA 5CDSA 2C2XA 2C07A 5T8KA 3E9QA 2X0JA 4R5HA 1GPDG 1I2BA 4JJIA 4NK4A 4YAGA 1LI4A 3W4IA 2HMTA 3BMNB 5JW6A 1ZMOA 3N7UA 3MJVA 1ZSYA 2DLDA 1JW9B 4HUJA 4Y98A 3DZIA 2UV8A 5C3MA 2YFQA 2VYVA 1IPEA 5TSDA 1LLCA 3I5MA 3H65A 2NUAA 1ULSA 4NU5A 1PZEA 4M86A 3UUWA 3NKLA 1GZ4A 2I9PA 3LVFO 4IDAA 3IP1A 4RCVA 4EBFA 2PKRA 3D4NA 4BGIA 4NQZA 1HDXA 2YQ5A 5DZSA 1QXSA 4CL3A 4YAIA 2WD8A 4DQUA 2FSVA 1EUZA 4L76A 5JDCC 2GN6A 2JCYA 2WD7B 3FR8A 1EEHA 1LSJA 3NTOA 1N2SA 1ENPA 4BNFA 4IXTA 1WDKA 2HJRA 5JDCA 3C1AA 1DOHA 1YWGO 3BMQA 2BFPA 4WLNA 3F9IA 3ZW8A 4DQXA 3IP3A 2J5QA 2CY0A 5TT1A 3U0BA 1CQJA 4FFNA 3W4KA 4XYMA 2YDYA 3D0OA 3U4HA 2X1HA 2YYYA 4FDAA 5C7OO 2JFFA 3I4CA 2VN8A 1QKIA 4Q9NA 5CHEA 1IY8A 3ENNA 4YJGA 4CJXA 3JD4A 3Q9NA 4GVXA 2C2YA 3NT2A 3A14A 5T64A 1ZO8A 4LCJA 3KYDB 2QZZA 4A5OA 5JMPA 1O9BA 3ZV3A 3DBLB 1R15A 4B4OA 4YA6A 2AW5A 4BO3A 1SO8A 3AI3A 3O26A 2ZJ0A 2HO5A 3ORFA 5DDIP 5H81A 4XDYA 4XRRA 1HZZA 4E6PA 5IFLA 3GDOA 3Q1LA 4J49A 1KIFA 5JC1A 1Z7BA 1DBVO 5ILOA 3F5QA 4A03A 8LDHA 4BOYA 3T7CA 3I9OA 3D3WA 5HS6A 1EZ4A 5JDIC 4GLOA 4PLVA 2GZ1A 2ZATA 4QO8A 3KLPX 4UREA 3RROA 6ADHA 3DBRA 5JDIA 1EQ2A 3PJGA 5EESA 2WSBA 2CVZA 1CETA 5EINA 3U4IA 4IQ8A 4FR5A 4CM9A 4EUHA 3AFNA 3M6IA 3QW2A 4F46A 3WFIA 5KVCA 1G1AA 3WWZA 2X4GA 3BZUA 2O3JA 1LDEA 5GZ1A 2EP5A 3B1FA 2FR1A 2J3JA 4B8ZA 3MJCA 4ZQFA 2UAGA 4NIMA 1BHSA 1Y5RA 2OL4A 3FNFA 4NFSA 3PGJA 4TQGA 5TJHA 2GNAA 4UULA 4IGFA 1DJNA 4CM7A 2HLPA 2O2SA 2NU9A 1C0IA 3JYQA 4I9NA 4U0JA 2EKPA 4QUKA 4XYGA 1MG0A 3PHIA 3P2OA 1F17A 2O48X 5A9TA 2DT5A 1PJTA 4B4UA 1QYVA 1S7CA 2WJPA 5B1YA 2AG5A 3QQPA 4D43A 4OGWA 3MJTA 4FSHA 4ZGWA 3ZHBA 3HFSA 4MVJP 5HTOA 4QO7A 1P44A 3I9LA 2BGKA 1BXGA 3GHYA 1LSSA 2BLLA 4IPTA 4YQYA 4PVDA 3WSWA 1FF9A 1M76A 2E37A 1Y7TA 3I52A 3MTJA 3JYNA 3G3EA 4KQWA 1B15A 4YWJA 1YBMA 4XR9A 1P9LA 3ZU2A 3QJ5A 1Y8QB 3HDHA 3GOHA 3WGQA 3BMCB 1MC5A 3RFVA 5L51A 2AQIA 3LT4A 3AY7A
chains in the Genus database with same CATH superfamily
3TG8A 4EPRA 2JJYA 3IT0A 1EXVA 2HZBA 4CUJA 4H1TA 2VATA 3HNOA 4RXTA 1TF7A 5K6TA 3RWBA 5A1JA 2QRZA 5F2EA 3DOIA 2AQKA 3PS9A 3Q7RA 4G2TA 5I5GA 1NOJA 1YIDA 1YHZA 3DQZA 3B3FA 3CBGA 4HDKA 3KRTA 4NV1A 2JCSA 2OD9A 1UMBB 1BX1A 1P5FA 1A8SA 2VTEA 3OQBA 1QANA 3ROEA 4EHLA 3WGTA 2A86A 3OE4A 2H1OA 3D2LA 4QYTA 1VL0A 2YFYA 1NBME 1O5IA 2XXAA 1PX0A 3W7BA 1R0ZA 1NF3A 3DTNA 3GRKA 5CD9A 3DE4X 2P35A 2OAQ1 3EK2A 1LK0A 4MX8A 3UXYA 3VPHA 5KYKA 1OX6A 3P9RA 4GI2A 5K8JB 2R8PA 2IOHA 3U62A 3OTWA 3WDMA 3H9QA 3KPWA 4ZZ0A 1HDEA 1P5RA 4ZCPA 4E30A 3NONA 4IIJF 4J1TC 1M5TA 4JCOA 4LXTA 2EU8A 3DNMA 3MCWA 3RRNA 3MWJA 4KYUA 5HZKA 1H93A 2X23A 4YMGA 2VSXA 4DARA 3O8LA 4PYQA 4C5BA 2PH3A 2DSTA 4G5HA 3HM2A 5D84A 5KQPA 1PNQA 4GC9A 2Y99A 1IEXA 1XJ5A 2X8JB 3NPAA 2VFAA 5JR3A 1V5WA 2O6HA 4F9TA 5B30A 2ZETA 4PQGA 3VZQA 3ZLUA 4D4LA 1RYDA 2G67A 1FDWA 3O4FA 2AE1A 2Q0SA 2ZRNA 3C2QA 4M8LA 1O6GA 1L4NA 2JC3A 2Q9AA 4H3VA 3WX0A 3SFZA 5H0IA 1Z2CA 1J7KA 1I2AA 4O5AA 1BA2A 3U3MA 4ARBA 4DRXB 3QYJA 4YPFA 4F3CA 3DE6X 2QIOA 3ABRB 1HM5A 4AC9A 3L7KA 1RQXA 3HU2A 1W7AA 4H60A 1D1SA 2VS1A 3REFA 5K0LA 1K0UA 4XLTA 4IXMA 1NI4A 1DO2A 3RIHA 1YOVB 1BMQA 2CDNA 4DIEA 5AUPB 2O59A 3PJEA 2HWXA 3DWFA 5F3WB 3D8RA 3VR4D 4IDOA 3KCQA 2ODBA 3DTYA 2R1TA 5J59A 2EQBA 3IBGA 1GZVA 1UZUA 2PRYA 3SC2B 1V6AA 2QX6A 3MC1A 4DC9A 1Y1TA 3TE6A 2B21A 4NONA 4M0PA 3IJEB 4ZU3A 1A7JA 3GZ4A 2CXUA 4XX1A 4BECA 1R8SA 2F62A 2ZSDA 1II8B 3EGCA 4WLEA 5E7MA 4JT4A 4Q9HA 4EJSB 1L4EA 4DA0A 4DGQA 4EW6A 5E6RB 1OA1A 2I0FA 5JVDB 2W8BB 3QLVA 721PA 3HI4A 2O2ZA 3L8CA 4ICIA 2ZSAA 2NO5A 3QXJA 3B2QA 1J8QA 2FG7C 5A3SA 1JPVA 3N8NA 2H1VA 3DBLA 1GQOA 2PMCA 2PLAA 3FPLA 4Y2UA 2DECA 1PEAA 3NYIA 1UT6A 2ZB4A 4J0DA 4ZPXA 3VYTB 3GT7A 3ISVA 3KS9A 3TFWA 4B85A 5B5SA 5EJEA 4UBNA 4TX1A 1NVVR 2QRJA 2P0AA 5TY0A 5K4HA 1JKIA 3CNLA 3FG9A 3JD3A 2FKNA 4BXOB 1IOZA 1GLNA 1OC2A 3MFQA 3O4GA 5IUNC 2J67A 3ZDRA 3E70C 3B1KA 3K0AB 3SX0A 1EAMA 4BMVA 4D4HA 3D81A 4D98A 3ILSA 2YJGA 2B5VA 1KDPA 1T1JA 3GWGA 3DAYA 1N0HA 3ELYA 3HCRA 2CMDA 3MBIA 4L8WB 4R1PA 5KSWB 5C37A 1QAQA 4JLDA 4QRIA 1Q7RA 1N2OA 5NULA 3QHPA 1G5TA 2JFYA 5FB3A 1W73A 4PNHA 3V9AA 1M1ZA 3FKJA 1L3CA 2OGTA 1KR5A 2WM2A 1P1HA 2XVYA 3BL5A 3RWMB 5AW4A 4YP0A 5IAAA 2R44A 4KBGA 5DKFA 5TT0A 3WWDA 1NYLA 1F2VA 2QIPA 3VU9A 1TT7A 4F3NA 4NU8X 5KDOA 4PZEA 1B1AA 3DV0B 5EIOA 3N8HA 1CHNA 1P17A 2IDMA 2W2XA 4ACBA 5A06A 2KQUA 3NBUA 3L7MA 4J7UA 1JG1A 5K9ZA 2BMFA 3G0BA 2L19A 4X71A 4ZO7A 3C6YA 5EP1A 5IH7A 2CB0A 4XYLA 1WNTA 3BE6A 5EI5A 1DQSA 3VGPA 5K03A 3VKHA 4LVUA 2R8BA 4YRCA 4ZMSA 3H9UA 2IHKA 3K6RA 3LC7O 4P3NA 3THWA 5IU6A 3QKSA 2P9YA 1TM1E 4QJ3A 1QWOA 1Z5WA 1P19A 1UODA 2X7JA 3PD1A 3KKNA 4QAQA 4QOSA 3QEMA 1C3OB 2DB3A 3FXAA 4UUQA 4NBRA 4YJHB 3A26A 2IXFA 4G8BA 2HA3A 4N65A 3VYWA 2A5YB 2AW3A 1D04A 1RRKA 2ZRBA 4NC9A 1C3XA 4OY3A 3OJLA 4C4YA 3IAXA 2CBZA 4BLRA 2ZIXB 4PBRA 3WWCA 4YRSA 3OJ0A 2FMHA 1VJRA 5D01A 3Q3HA 2XDQB 2WM9B 1YA8A 1X7WB 3TRDA 1ZW1A 3CVOA 3ZK9A 4YRRA 3L7IA 2P79A 4BZXA 2V98A 3KVVA 4I1SA 1IN4A 2HEGA 1FFWA 3B2EA 4UKDA 5CVJA 5DN6A 4F3RA 5REQA 3DL7A 3KOOA 5B1IA 3UIEA 2WKQA 3R40A 4JB8A 3RAGA 1RXYA 1PYDA 1ZK0A 5JSUA 1M9NA 3QNMA 1P1IA 1WSDA 4BQRA 1SVWA 5BNTA 1XZAA 2A0FA 3GLTA 2AF4C 4MVJH 2OHVA 5F2KA 2F8TA 2JFZA 1MV8A 4CQMB 3IJ5A 3DM9B 3L7NA 5CFPA 1Q22A 4RBNA 3I42A 1G3RA 1JFLA 2XSZD 3NVAA 4KQJA 1RQNA 3RAPR 2GXQA 2XADA 4A91A 4CODB 4FFVA 1F48A 1LX7A 3AR4A 1AUVA 4F3YA 2RG1A 1Q2XA 1X7HA 1YC2A 4UDXX 3L93A 3HADA 1UMBA 4PC1A 1WW2A 4HBGA 5DYIA 3R7NA 2NWQA 1L4HA 2GM5A 3ETDA 4IJVA 1CVIA 4H31A 4MIKA 2Z95A 1ZL0A 4FN5A 1QTQA 5HCIA 3K4HA 5K0JA 3HLYA 4H9GA 5YASA 1H8EA 3A10A 2X2FA 1XSEA 3BB1A 4HFNA 4L1KA 4MO9A 4KPFC 4X6YA 5BY2A 2QN3A 1E2EA 1I3CA 1YRHA 5BQOA 4PLZA 3NM6B 2ZYDA 3AW9A 4MQLA 1G7TA 1W5EA 3AJDA 3GAFA 3TNYA 3VOBA 4KG7A 4ZTZB 1PTJC 4ZT2A 4O2AB 5C52B 1WXHA 2NZYA 1TYDE 1HOTA 1VJCA 2YASA 3I30X 1G5RA 2WDPA 3FJ1A 4DB2A 3KJIA 4Z5XA 5I7VA 4A6PA 2QLLA 2WD9A 2X8JA 4OYHA 4UFPA 4B2LA 5BPFA 2JAHA 1N0WA 3NJ8A 1OGJA 5BYAA 3O2QB 1JGTA 3OLZA 1FXUA 3E53A 3RHZA 3WWYA 2P4EA 1L1FA 2C9CA 1JLLB 4P3OA 4UMDA 1QQ6A 1ZJ4A 4NESA 4C4XA 2NSJA 1S9DA 2ZBEA 4EB3A 5AFSA 4DRXA 2DETA 3LUKA 2JCGA 3DMRA 1VCIA 2M6SA 4FYJA 3RU7A 2NVOA 1HBJA 1WQ1R 1H5QA 4GU5A 5EXTA 1IBRA 4MVYA 3F3SA 3IUJA 5JRDS 1Z7YA 1JH8A 3AYXB 4K9NA 4HPWA 1YOVA 4YMHA 5GPBA 4BY9E 1X39A 3U4CA 3EZFA 3TTXA 1HEUA 5EJ8A 1SUPA 2UUOA 3O8CA 3S3TA 4C2TA 5E1BA 1NWCA 1U3VA 1U0FA 4RQBA 1F0NA 1C80A 1Q1GA 3CXRA 1E8DA 3RS7A 5K0FA 2PKCA 2G25A 1P5ZB 3UK6A 2BKAA 4MRVA 3LY7A 3V7NA 1M0WA 2C95A 2PH7A 3GBVA 4JU8A 3USCS 3K8OE 2QN2A 1II8A 4G65A 4LK3A 2X77A 3ILYA 3MK31 4MDHA 4X62B 4PGMA 3TDMA 5CCEA 4ZQIA 1YOBA 5JD4A 3VQTA 3L18A 4EJSA 3EBOA 2R96A 4GPIB 4YUVA 4JFRA 3RE1A 4C9BA 5JVDA 2W8BA 4MA0A 4B7AA 4QYXA 4JEHA 2GJSA 2IQ5A 4QREA 4HVCA 2JA2A 5KWEA 4PO3X 4H27A 5KSPA 1MTZA 1BWSA 4MW7A 4HEA1 4ZT4A 3NP9A 2VP5A 2VC2B 1XCBA 2RHLA 2WG2A 3VKUA 3B6IA 3WMFA 1AO0A 4UHHA 2DHEA 3CZ9A 4AKSA 2A88A 4MGZR 4CVNA 2H1WA 3JX9A 3Q7IA 1QTIA 3QQ5A 3T3DA 2FFJA 4YRPA 3GN1A 4BO6A 3T5GA 3OQJA 3GL9A 3R5FA 1JFFB 1HFEL 2HN9A 4X84A 4AT1A 1F5SA 5ERYA 2XMQA 4BXOA 1CE8B 2CMFA 1QRUA 2W11A 2Q2QA 3A1TA 2HPVA 4LRYA 3RUIA 2ZTSA 3LUFA 4BP1A 3Q85A 3PNKA 1DBSA 2E87A 2IZ7A 5EQTA 3RQSA 1YFJA 2RFLA 4CQLB 4M1MA 3ROMA 1BTOA 2IEZA 2VPIA 1KDOA 4MCAA 1EK1A 1N8NA 3EA0A 4CLOB 1OSNA 3MJFA 4P08A 4QLOA 4FDTA 4XWOA 2CEKA 3R23A 1MQAA 2BD0A 2VBCA 2IS2A 3C4VA 4YT4A 3I62A 5LLTA 3PQ6A 2PFSA 4WLUA 2OOKA 3KSRA 4ABYA 3QTLA 1NW6A 3O8BA 4FQ5A 4LNAA 5AM1A 5BNZA 1BVYF 3DV0A 3DWEX 2ZUTA 3LXRA 4KGDA 1NUHA 5AQ1A 1DADA 1ILEA 1HI9A 2ILTA 1H4VB 1EFDN 2W98A 1YNOA 5EVCA 4B2PA 1G98A 2CVOA 3C3AA 5DM60 4CU2A 3TIVA 4QPZA 2A0XA 5TGZA 2ZWAA 3RARA 4FJ2A 1FYVA 2PV7A 4R8MA 3IKLA 3GFBA 4R01A 2NPOA 2ZBQA 3PTLA 4LFAB 4DYVA 4TS1A 2VUIB 1YTLA 4U2KA 4AW9A 2C4UA 3QFTA 1POXA 3MNFA 1BS9A 1YA4A 4EYEA 1PU2A 2XE7A 5IEBA 4DDWA 1U0TA 1NJ1A 4M9ZA 4YT5A 1C3OA 2J5BA 1X1CA 5ERGB 1CEYA 4YJHA 2F7SA 4MB0A 3H8VA 1H3EA 2GM3A 1ZXLA 3MZ0A 5IXYA 4ZCTA 4DLAA 2RHOA 1E7YA 2GAFA 2ZIXA 3VTFA 5KNLA 1X7GA 2VHCA 1ZISA 1NDHA 3BIFA 3IUEA 4O6VA 4V0LA 2RH4A 4M0KA 1I6KA 3VVCA 1XZCA 3F8WA 2XDQA 2CJFA 3PR2B 3BKWA 3IO3A 3WL7A 4B71A 1X7WA 5ESDA 1UZNA 4B48A 4BE7B 3IEMA 1N2BA 3GW8A 4ZWNA 4OSPA 1OYVA 3BWCA 5HFAA 1PJZA 1OKKA 2Q6VA 3A06A 2EJVA 3AVOA 3EGOA 5KEIA 1QVAA 2FZWA 3TBHA 3ZEAA 3LFHA 3SNHA 1XMIA 2PA3A 1YMQA 4TOIA 5J4KA 3DP9A 5F1PA 1JG6A 3EB9A 3KT0A 3KCNA 3IC5A 5C7YA 4BASA 1QZXA 1ZIYA 5G4KB 1GU7A 4N7BA 1DUSA 5CYOA 1DC6A 4CQMA 2YWGA 3EA4A 3NNSA 1RADA 1Q16A 3G68A 2WWVD 4DCTA 2ZT8A 3KOXA 4L50A 1PEYA 2KMLA 4YJ3F 1AV6A 4RF5A 1RNLA 1S7GA 1CV2A 1Y3BE 3ZE7A 4BATA 1GVHA 2D5BA 4M89A 4OHYA 3F9CA 3J81A 1FP2A 2CYAA 1AKWA 2IOFK 3BFVA 3NKVA 4E3ZA 4GFDA 4JVMA 1NJFA 3C70A 2YFKA 4EA6A 3M3DA 2RGCA 2AT1A 5GM1A 1AKUA 1QKJA 3JQAD 1GQYA 2PRIA 4EFMA 2QWXA 1ADFA 4JR1A 3RD5A 2MSLA 5BSVA 3LP6A 4XKJA 1YKGA 3K0SA 2Q5OA 2I2BA 4JLOA 3VV3A 3ESBA 1BS2A 5AVRA 3KQVA 2VHXA 1SMKA 4DDUA 3SVTA 3KB8A 4GWGA 1D7OA 3LPAA 4O02B 3I83A 2ZYWX 5JD3A 5KJCA 3CGWA 3C0KA 3BQ9A 4FNAA 4G0YA 4HEHA 4UTXA 1SCBA 3O8DA 4QXRA 5K1ZA 3IDZA 5A4AA 2C9ZA 4O2AA 4DIDA 5AK5A 4LRWA 5CDFE 3AINA 3GLRA 3OEYA 5ALMA 3PXGA 4AJPA 8MHTA 5TIIA 1I2DA 3JD0A 4N8EA 5EKUA 3BBLA 2FPIB 1KYYA 1OXXK 4MGIR 4YHHB 2NO6A 3FLMA 1WPXA 1N2XA 2JRLA 4RMGA 2P9HA 3V2UA 5HCNA 1H2XA 2JKZA 2OO5A 3HJAA 4YLYA 4G5OA 1KNQA 4EELA 1OV4A 1K8XB 2O7RA 1JLLA 1KAMA 1WZ2A 1WPGA 1J42A 2PFGA 2QGNA 1NIPA 5AKZA 1ZLYA 3U4DA 3A6DA 3F6RA 2Q5IA 1JWLA 4P0QB 2GPBA 2B25A 4IV0A 4F60A 2WHEA 1BX3A 2P75A 1OFVA 3ZHVA 4PSAA 2F64A 3T1NA 1J23A 3UHAA 4LYDA 4QU5A 5EMNA 2O8EB 1JDTA 1GUZA 2CB9A 2ADMA 2B6NA 1NX9A 2D1SA 4IQGA 1KJ8A 1VPDA 5FOXA 3TN7A 3L49A 3T0IA 2Q4OA 4YTEA 1E64A 3K92A 4GZ6A 5EFZA 5BUZA 3CRVA 3IOYA 2VZ9A 3V8QA 2DHRA 4RMHA 3WBBA 1GAEO 1OTHA 2DBVO 1T8SA 2DM6A 3GD5A 3LUPA 3M7IA 2ZTUA 3GBSA 4MUXA 1G64A 1NXWA 3HY6A 4IYRA 2ZTHA 3TVYA 2JAXA 1JS1X 2XB6A 2YZ7A 1NE7A 1FTYA 3A6FA 3H97A 4TV9B 4JC4A 4MJ3A 4ENVA 3GA7A 1K3TA 4MVJG 4WFIA 5TARA 4HNGA 2QLNA 1H0SA 2YVUA 1GCOA 3QM1A 3H18A 4EB0A 5CFRA 1G8HA 2EL7A 1UPCA 4MS1B 1ZWLA 2XTZA 3KKEA 1D4ZA 3CCFA 3LWNA 4R1MA 3FYUB 2VYCA 4BO5A 1JHDA 2OVBA 2W93A 1SN7A 3S8MA 4OREX 1UJ5A 1ZH0A 3VC1A 4AU1A 1U3TA 1V11B 3BTSA 3WLKX 4HNRA 1Z4NA 2HT6A 2I67A 2OQVA 4ETIA 3B5IA 5C1IA 3UJ8A 1KKMA 3C48A 3NKFA 2IEDA 5DSXA 1V3QE 1R6UA 2G06A 3FSGD 4L5CA 1ORTA 5TPWB 4A9AA 1IVSA 1KH3A 1V25A 1RRFA 1MPXA 2ECQA 3JZIA 4CV3A 4PCUA 2P65A 5HDBB 1JVBA 3EGDB 2MT9A 4BWFB 3KLOA 3TPZA 1WD7A 1JKJB 1ULZA 3K35A 3ND7A 4J16C 4YRFA 5MGNA 1JFFA 1XNHA 1D1PA 4E1BA 1FC0A 3WDLA 3SJAA 1CE8A 3I2IA 2Q7DA 1N34B 2P4HX 1Y34E 1MO6A 1I3LA 5ICGA 2YJ3A 1BHJA 3WBJA 5FCDA 2DY1A 2NYVA 4EP1A 1UP4A 3TQQA 4G1FA 1G42A 4PANA 1YONA 4CQLA 1ISIA 1OV6A 1PL8A 3UO8B 4RELA 4R1QA 5A7FA 3DCJA 4IQ0A 4F6LA 4HYQA 1UZMA 4B46A 4CLOA 1JH9A 1BOFA 5K05A 3BSYA 1YL7A 2GVNA 4RK7A 3OEED 1U8AA 3QFHA 3RVSA 2JBAB 1KL7A 4IOLA 2IXAA 3ETEA 1VI5A 2ZRIA 5BQFA 4H6VA 3CA8A 3C6MA 3NGLA 3PGA1 1QOPB 4J3JA 1TYAE 1AHIA 1RI2A 3SZOA 1MOSA 2XNDA 4FYVA 4G26A 4RGQA 2VUUA 5U4QA 3C4JA 2H11A 3SYLA 1HX7A 2BV3A 2HCJB 3R8XA 1ORRA 2INGX 1DP4A 1EG2A 3ZKAA 1N3LA 2FK8A 4OTZA 3B60A 3PNLA 2FR0A 2OXFA 3GU3A 3LOUA 2PTGA 5C8YB 5TS2A 2Q5QA 4HLUA 1JALA 4EGAA 4I46A 3N53A 1FVXA 2JJ1D 4FE4A 4NATA 2IS6A 3S8YA 1YCFA 4CV2A 3KBOA 3KXIA 1EXDA 1DWOA 4EYSA 1I30A 2XQVA 4ZC1A 3KJXA 3UJBA 1IHPA 3GCWA 1JSXA 3GRUA 3NIDB 4HRVA 4II2A 4ND4A 1A4RA 1MDBA 4ZI5A 4A0RA 3I5XA 1ND6A 2IH5A 7ABPA 2CXQA 4YS6A 3CRRA 2FMUA 3WLAA 5FWDA 1VCNA 5IUKC 1YB4A 2WSMA 3K2BA 4INOA 5AXDA 1YDFA 5JS7A 2BH2A 1WSBA 2ZIGA 1EK6A 3H5AA 3LCRA 3OQIB 2BWJA 4L9RA 3U7JA 3K0KA 2CUTA 3DUFB 2DJIA 1XN1A 1ND5A 5FP0A 2FRDA 4TL8A 3WRXC 1FB5A 1N5MA 4JV5B 1U9IA 5ENDA 2P2NA 4TZTA 1YRLA 2IDZA 4Q7EA 4G86A 5CTJA 4G5GA 1OH5A 1U0GA 1Z68A 1XC7A 2WV7A 3MINB 3P27A 4CKXA 1WW3A 3OZDA 1BZYA 5G4KA 1SXHA 5LQNA 3W04A 1I01A 4FFLA 4EPYA 4B0OA 2CFSA 1IJEA 1RMTA 2AB0A 4DR3B 3EZGA 4W4TA 3K31A 2QDXA 5EC8A 4C4SA 3RGWS 1P45A 1L5RA 2C61A 2V7QD 3HQ4O 5KJ1A 5JC8A 3ABIA 1KI2A 1T2NA 4R9UC 1Y1LA 1Y5IA 3HJCA 3T5TA 3VI4B 4LWPA 5LQCA 3SXJA 3HA5A 3HYNA 5F98A 4BKOA 2IYOA 4QDUA 2VF5X 1LS1A 1E9EA 2YZNA 5KBYA 3SQNA 3PHGA 2IYLD 4KO2S 4IFBA 4YAFA 5E2IA 4TXNA 2HB6A 4NY1A 2GCGA 1VMEA 4A23A 1B6GA 4U02A 1G60A 2HRBA 1RQGA 5CBKA 2OZLB 3RRXA 4MWZA 4V0OA 3KOUA 4ROTA 3S44A 5K3OA 2FLWA 5KVAA 3LQYA 3S5JA 1CERA 1Y7IA 3L6DA 4RK6A 1Y37A 4JUCA 1RBQA 1V8PA 2XZPA 4G25A 3TVTA 1E1LA 3BFKA 2PXCA 1XD9A 4FXOA 4GICA 3NBZC 1HMPA 3KUXA 4OLHA 5I5EA 1N6PA 4UBMA 2W90A 2Q4DA 5DHAA 5EIWA 1SVIA 2R6JA 3EG9B 5JWOA 3C1TA 4WY5A 1EG7A 4XA8A 1VSTA 1V9CA 2QPLA 2RHBA 3N59A 2FPIA 5H4HA 1QGAA 5FULA 3LBAA 5K3SA 3S6JA 3K7EA 2WYHA 2ZYAA 1IK6A 5M04A 4OXRA 4FDLA 4DCNA 1WXIA 4Q9JA 2E3JA 4MW9A 5DASA 5JAHA 5G1PA 2DWOA 2W2KB 2Y4NA 4FQ8A 4Q3DA 4Z9AA 5AIBA 1Q77A 1U31A 4UEOA 4A2QA 4AN1A 3TOSA 1QZZA 1E3TA 1KU0A 2OXIA 4I7EA 4JSYA 4WGFA 2C4HA 4U7FA 4N47A 3D6NB 4W5NA 3B2NA 4CTMA 2O8EA 3L7YA 5B1HA 1IBLB 5K01A 1KPIA 1PR5A 1SEPA 1J07A 4S0ZA 5L6LB 5C1OA 2YMQA 3NWBA 2JKVA 4IY1A 4YXFA 1PFWA 2I6QA 2I2FA 1WBBA 4A0FA 4YREA 3FUVA 3C3PA 3WMRA 4BFWA 2JCXA 2GF0A 3I3SR 3GMDA 1LC0A 4K87A 4BFUA 1C7QA 2YOHA 3RC2A 4GKBA 4I9UA 1CY2A 4UZFA 1QSGA 2C5FA 2WFMA 4TV9A 2IYFA 1JXAA 1THMA 3ODGA 4LE0A 3GPIA 1PG2A 1D2CA 1Y9AA 2AMYA 2ZIZA 4FB5A 5J3JA 3U56A 4AKTA 2Z30A 1E4EB 3ZYCA 1FDSA 2VYND 3ECAA 1TM3E 2V8BA 4MS1A 4PIMA 1ZNXA 1GQFA 1XA4A 5E7QA 3FYUA 3U3XA 5BXQC 3WXBA 5JTTA 2R4QA 4BO7A 4DLPA 4IO1A 4ENQA 3H9EO 2E5LB 1M6HA 1V11A 1GRQA 2DEUA 4XH9B 2ZI5A 3D9QX 2WKSA 3NEPX 5JCPA 2PXAA 4F7WA 3U39A 4AO8A 4FFMA 1T8TA 1YV9A 1QTRA 5CIWA 5TPWA 3RANA 5JBQA 4O59O 1OXVA 4KFUA 3KU4A 1T9BA 1FNCA 4KXWA 3C14C 4Y6GB 1M6EX 3SYMA 4X66B 3EGDA 1ZD5A 4RH0A 1QGOA 1JKJA 1V4NA 5HIIA 5ENVA 4CMEC 4ER5A 4FMPA 2O7QA 4Z4HA 5ICEA 1NWHA 1K5HA 1JHPA 5GQSA 1FNSA 3L01A 1H3FA 3GYGA 2ON6A 1Y5MA 3I64A 4CXMA 1U0NA 4TS3A 1POWA 3ZJYA 4WOKA 5K20A 4QTZA 2EYUA 3GRFA 3MTBA 5E6UB 4ZD6A 3LDAA 3TRIA 2J4DA 4COKA 3TGLA 3Q0EA 5CG1A 3T1HB 2P2SA 2C5GA 2WTAA 3EMDA 4ZODA 3IHLA 3B13B 1JA1A 4I14A 4R2WA 3WGMA 1V41E 1W4LA 1MFZA 2CUKA 2JBAA 3N76A 4JVNA 1XQ1A 2G9VA 2P40A 2FW7A 2PAAA 3FE2A 2O2GA 3FJOA 4JR2A 4O8CA 4OYRA 3T34A 1D8AA 3T5DA 3W5HA 1L4YA 4BGVA 5AKJA 4BJHB 4ZDJA 2APJA 1KJQA 2RI1A 2NT3A 2IHBA 1F6BA 1HE8B 1XQ6A 2WJVA 3D3NA 3SYRA 3UW3A 3N2LA 4KDCA 4M9RA 4I4TB 3QLTA 2E4WA 4JAVC 3UWPA 3HR7A 5DGIA 5DCYA 3R0VA 3C39A 5CLLA 3TO5A 3CNEA 3OG9A 3TJMA 3FD8A 1B7GO 1M75A 3JZFA 5HUQA 5C8YA 3TM5A 3WK6A 2R85A 1YJBA 1RJFA 1S8NA 2PANA 4RFLA 1QF7A 1KI1A 2I62A 4OX9Y 1GYQA 1ZZEA 3O0DA 3R4CA 4TV8B 4KW7A 4DIKA 4RAQA 4HCJA 3PUWA 1JMVA 5EJMA 3DFZA 1TIKA 4RZQA 3VOAA 4JBGA 4JIGA 2ZLBA 3OUTA 4IZHA 4MSUA 3WLQA 1LC3A 4KREA 5EEHA 3C5EA 1QFXA 1ZKMA 4TTIA 1E0DA 1U5BB 2E4ZA 3C3BA 3HWX1 5I9IA 2O19A 4OBXA 3CRZA 1QHHB 2PT5A 1TLFA 4RKWA 3EARA 4GLLA 4A5SA 4D0NA 3U4MA 2XCUA 3OQIA 2WU1A 3NIWA 5FA6A 4GZ5A 4WADA 3K2IA 4RO0A 3ZS8A 3ZZ1A 4C03A 2M1XA 3DUFA 4C3OB 5L40A 2BMWA 2PX6A 3RTGA 3F5MA 1T9CA 4G0WA 2W6ZA 1NQOA 1JDBC 1MB3A 1NBEA 1RSZA 3FLAA 2ZJAA 2W48A 1A50B 3MINA 4BB0A 4V0KA 5HNKA 4NDNE 1O89A 4L2IB 3I34X 4FBMA 1FFCA 1KK2A 1NDUA 1NVGA 2WSSA 2C0QA 3REOA 2VQ3A 4UNIA 2GTIA 3ZU3A 2YZKA 3RHFA 4JJGA 4GSKA 1BQEA 5HZMA 4PGFA 1RQPA 2VCYA 1N6IA 2C03A 3L07A 3T7SA 1YQXA 4X8OA 4U7WA 5KKCA 3GPBA 4L9AA 5AW3A 3DHVA 3E9EA 2V7UA 1O94D 4ESOA 4ZGGA 5IVPA 5I9LA 1NMZA 3ANSA 1VL6A 3V1LA 3K70B 3LX4A 4OHMA 1UF9A 3FTDA 1ZI9A 3T1YB 1UBOS 3LHSA 4KRYA 4PFJA 1VRVA 3LPLA 3QKWA 1GTL1 1K7CA 1Z4IA 3RKUA 3WGJA 2WWFA 2X5JO 2OZLA 3KAJA 4R31A 3FMFA 3IEKA 1TA9A 1W4CA 1TJ4A 4EO7A 3PNQA 3QPDA 4CL8A 1M1YB 2Z2ZA 3DVSX 1PWYE 3D8HA 5H9VA 3QPUA 3TNFA 1J49A 4KFSA 4NABA 1I7PA 3ZHCA 2H06A 1NURA 4BPBA 3A1WA 4O4JF 2YOFA 2PVSA 4QHTA 5DM1A 3EG9A 3ECSA 3EGEA 4FHDA 3W05A 2NQTA 1J9GA 2EXXA 3JQGB 1PD0A 3NVDA 3F96A 2EGGA 1Q1EA 1B0ZA 1JPNA 1CY8A 1B42A 2GYVA 2IPXA 2NLOA 3NDIA 1XQVA 3OT4A 4L8VA 3GXBA 3L1JA 4HS9A 2VPPA 4BV2A 4B6FA 2IHNA 5EKXA 1AF4A 1WKVA 2W2KA 3M6UA 4RADA 5G1OA 2NVBA 1KTVA 4ZO6A 1I32A 2QRLA 4FS8A 3KFXA 1ISGA 4WLVA 4CLXA 1B0AA 4J6FA 4C7OB 2UUBB 3WS7A 1DRKA 3DZHA 2Y92A 1JMKC 3D8SA 4I1IA 1B76A 4ZFNA 1HEYA 1Z6AA 4IBOA 2HLHA 2WWHA 4Z0HO 4PHCA 1DT5A 5HHTA 2R7MA 4KACA 5LKRA 3KHUA 3QNWA 4QM6A 1T2DA 3BXOA 1C1DB 2UYCA 2BZ0A 2NV6A 3ND8A 3KDAA 3TB6A 2E0IA 3FBGA 2CLFB 2XRYA 3R3UA 4PYNA 1WMSA 3D6UA 1H22A 1SKAA 1VJ0A 2X8LA 5HK8A 3PCRB 5K6AC 1JB1A 3P9NA 5E7JA 3I04A 1N36B 4EI7A 5HKBA 1USVA 3KL2A 4M88A 4MV3A 1YQWA 1SFRA 4CG0A 5HZHA 3OH8A 2L82A 2OP1A 2XX3A 3VBCA 3HDTA 3HJGA 3ROXA 4GQIA 1E4EA 3DZJA 3KSUA 4ZAGA 5JI3E 1SXJC 2JFUA 2DULA 2JIZD 2PK3A 3D2CA 4I36A 4MTCA 3PSAA 4UEWA 3GJ0A 3LQ2A 1OZGA 2PEYA 3OETA 2WILA 3TZLA 4EX7A 4ZVKA 2OQ2A 3I39X 2Z5VA 5BSWA 4IP0A 1H4QA 2UUPA 1GAXA 4KE7A 2SECE 4GOKA 4MUKA 4N12A 4KXMA 4NBTA 4BLPA 5HUJA 2QTBA 4FHFA 4N7RA 3IQGX 2DWPA 4EH1A 3H4MA 2OZPA 2WPDD 4I55B 4W9RA 3D2BA 4H6PA 5IXSA 1K1EA 2H7CA 3N75A 3B70A 5AI0A 5FWNA 5TQ0B 1PI3A 3F9RA 5LFAA 3OOSA 4AZSA 3LP5A 1PG0A 4TTTS 4F1JA 3B7WA 2OAGA 4ZMBA 3SJUA 3JAMA 3EIUA 4ND3A 2ZIVB 5LXTB 2Q21A 2FMIA 2PSSA 3L41A 3DE7X 3HXMA 1VHDA 1CFJA 1TAGA 3R0JA 2C42A 2ZBRA 2HA2A 2H8KA 2Q0HA 3RVRA 1FYDA 1UOPA 4NH4A 1FMLA 1ODCA 1VPTA 5E6UA 3TM4A 5BR1A 3QA3E 5JY1A 3ZJVA 3WI7A 2P4QA 3RC3A 2WJZB 4CIVA 3D7LA 4CHTA 1UP6A 3PF9A 4UVHA 4C78A 2W6QA 4CMIA 5C53B 2OV1A 3G2HA 1TIBA 5ARCA 1TMKA 2WSLA 1HFWA 1CUVA 1I24A 4PHHA 4RD0A 2A78A 3K6SB 2ADOA 1WLYA 1XI2A 2ABWA 3LX8A 4NICA 2NU8B 5IJWA 4NCBA 1OZ0A 8OHMA 3ZCXA 5IKPA 1MJNA 4B3RB 1OI2A 4I4TA 4RY0A 4U5QA 1KK0A 3FYDA 3FUUA 1NSYA 3QMPA 1Z29A 3R3XA 4UAJA 4GMXA 2GERA 4F85A 4YBRA 1NXOA 2JIMA 3QVWA 3IAHA 2CJWB 1NMEA 3C7CB 2QXUA 4JBYA 4O2BF 4DG5A 4P86A 1J2YA 4YMLA 1GGNA 2HZ7A 2IUYA 1N75A 3IEXA 3WLEA 1R6TA 3SEAA 3DDSA 1R4ZA 2E5FA 4K6CA 4LJSA 4PBSA 1BE1A 1XDSA 5ELLA 5J1SB 1JQDA 1CC1S 1TPZA 4TV8A 2E5WA 4UASA 1RWQA 1Q44A 3FFBA 4KKXB 5ADHA 2WUGA 3AI2A 1ECGA 4HVTA 4L3WA 2G9NA 3C98A 2D4AA 4GPAA 1Q7BA 5IC5A 2HGSA 1U5BA 4NF2A 1SHJA 2B36A 3L8MA 1A9SA 1UK8A 4ATNA 3BXHA 3SBXA 1FNNA 1QHHA 4YCCA 1KMNA 1EFTA 5EIXA 1PDOA 2Q28A 3SXUB 3R0IA 5FTWA 5IVDA 3MPOA 5JAMA 4WEOA 4ZT6A 4BLUA 3H84A 2PVPA 4YRMA 1H2BA 1UMCB 2RK4A 2BSQA 1F4PA 1Q83A 2ZSBA 1V1JA 5AVTA 3VPSA 1RHUA 5A03A 3KALA 4EY8A 4JC0A 4PIPA 1EVEA 4CI0B 2X3FA 1HV8A 5KKNB 2WTXA 4LRQA 4L2IA 1KI9A 1XTTA 1TEXA 1E9RA 1RQRA 2B2XA 3H2KA 3ZQUA 1KC3A 3RSOA 3IUBA 5HF5A 4HN4B 3G9QA 3TZ6A 3KPJA 3V2GA 5SICE 4NMHA 1DX6A 1ENZA 1R9JA 2N1MA 2FZVA 1VLLA 4IGEA 1PO7A 2H63A 3PD7A 1J8DA 4AZ0B 4K0RA 5HS4A 2BMDA 4YUYA 4HFMA 5IAGA 4ZEMA 2MYUA 2OGSA 5EVJA 1EDBA 1VB3A 2X0NA 2DUJA 4IEFB 1GG9A 4BVBA 4BZPA 1IY9A 3Q72A 5GTDA 3BS4A 2P6NA 1FDRA 2Q8NA 2YJNA 4NBUA 2GYWA 3D7KA 1TCBA 4XCVA 1XZIA 3CX6A 1M1YA 3I6BA 2G1JA 2CXTA 3MELA 2UVPB 3HDVA 2IOFA 4JKOA 3IAM1 4OA5A 4XFDA 2QUAA 5JSFA 2KS6A 4WT7A 4ZAYA 3WFZA 1J56A 1LLDA 1W0KD 4PXSA 2P6MA 4RA9B 3KO8A 5CFLA 2AJDA 3QOYA 2BKEA 3LPCA 3B52X 1G8YA 1VFPA 2DTEA 2RGGA 3JQGA 1SBYA 3PRJA 4RLSA 3WG9A 4DNXA 1R0CA 2IYSA 4BV8A 1Z8FA 2QQGA 3EOBI 3I9MA 3QOWA 5LOVB 3UW1A 3KLBA 1Z45A 3QVKA 5DEIA 3KYIB 2D2EA 2ZRJA 5AKGA 3FDZB 2QUBA 1W5SA 5CFQA 3JY6A 2V9CA 2GD2A 3ZD9A 4C7OA 4ZEXA 5F7ZA 1S2IA 2I4IA 4GW3A 4D9IA 1BIFA 5AJTA 4WKNA 1SCDA 4AJ1A 1X1AA 2J5KA 1AN9A 1C1DA 1L9XA 1D03A 1ZK3A 2QB5A 2QLBA 2OVFA 3EODA 3PQFA 4YRTA 1U1CA 3RJZA 2KPOA 2C5SA 1CZLA 1P3Y1 3USES 3MYRA 2J30A 4X00A 5D3ZA 1GDTA 2ZUBA 2FW0A 1YAJA 3V1KA 4EB6B 4DV5B 2YV3A 4FYKA 2I2WA 1MT0A 4WSOA 1WG8A 3ROZA 2MJLA 3TLAA 2P9ZA 2FWNA 3DB1A 4EUFA 1BE8A 4OI4A 1MRZA 1SR8A 4ZOEA 1TNDA 2VA9A 2XBLA 4F45A 3JWEA 4HSGA 1ZK2A 3PQ2A 1VQ1A 2HDNB 1RC8A 3E7PA 2ZRFA 2QT1A 2X13A 2FGJA 1AGXA 4ARAA 2Y71A 3LC1O 1A82A 1MX5A 1RYHA 3VTAA 1NNSA 3ZG6A 1XP5A 2Q2VA 2NXNA 4KIJA 5KVSA 3RUCA 1RYYA 1VLJA 7GPBA 4S1VA 1APBA 4KR2A 3LX6A 1USKA 1QK3A 3TCKA 4I55A 1T6NA 1TMOA 3UICA 4R8RA 5K3EA 4BBAA 5E0KB 1QRDA 2QMHA 2XCIA 5TQ0A 4TKMA 1OIVA 1JT2A 2B5WA 4UQPA 1EEXB 4HDRB 2IXDA 3VVLA 2VCHA 1X7XB 4ZT7A 4WAUA 1WF6A 1QB7A 1Y4SA 5A4DA 5LXTA 4J0HA 2H6EA 1BMFA 1E9DA 1VHQA 3BORA 4KV7A 5HE9A 4JT9A 4TRJA 2H59A 3OLQA 3HFRA 1PK8A 5IPFA 2NW6A 3O47A 4F0JA 4HV4A 3UJAA 1ESNA 1HFKA 1ONNA 4BAZA 4LTMA 3U1TA 5KCZA 3BWYA 3ZDEA 2XOXA 3F8TA 3FZEA 4CKCB 2AE2A 1R9NA 4R83A 1GGFA 2D00A 4HO1X 1Z4KA 1YDGA 4L5AA 2Q1SA 3HCDA 5K0ZA 1A8HA 4QPDA 1W36B 1ESZA 2QUJA 3ED1A 3WV5A 3RVLA 1W96A 4DCOA 3K6SA 2JJQA 4Z51A 2JD1A 3GGCA 4QHYA 2NU8A 2QD4A 2DRIA 2NM0A 1KK3A 2C94A 3EZ2A 1XEWY 2G04A 3E7XA 3ZNOA 1M34E 4LHYA 4CM1A 1GQ2A 1PGJA 4KK4A 2PX3A 3NORA 2K5UA 3OLYA 4OHXA 3A6KA 2AMJA 3QPVA 5KWJA 2CJWA 1V3TA 4Q93A 2QU8A 5H70A 1NAHA 2HL6A 1NC3A 1KTIA 1FRFS 3GRVA 3TR6A 4GDFA 1ZJWA 1ZS9A 3EWSA 4LDRA 1T0UA 1FFEA 1IPHA 2VHZA 3KD3A 1JJFA 2YMPA 3QEJA 3NNDA 4KWIA 4E51A 1U6IA 2EZTA 3U31A 1WE2A 2Q27A 2ZTMA 4DG9A 5I7AA 1N4AA 5HKAA 1KMCA 2O5EA 2CLDX 1Q0ZA 3OKAA 4K0KB 1R6BX 3V42A 2I1LA 2ZE7A 3E1KA 3BMOB 4DMGA 3MIIA 1K86A 1W49A 4TT8A 4Z54A 5B1SA 2XT0A 3SXUA 4BVAA 3AL2A 2NQ8A 4QTTB 5F9FA 3PDWA 4GT1A 3OECA 4AURA 3AIOA 1AQ6A 1H3NA 1R6AA 1UMCA 4N03A 4S2EA 2DX7A 2GR9A 1RYNA 3NHUA 3L8ZA 3K9HA 1SU4A 3HBAA 4JUFA 4P7KA 3C5HA 4QD3A 4D9HA 2RH9B 1G8AA 4GBMA 2IU4A 3H5RA 3W6NA 4YT8A 3NXSA 4CLHA 4JWKA 3KZMA 1XAJA 3BK2A 3ZC3A 2WJJA 1FPMA 4RKRA 2FUNB 2B4KA 4YNBA 3D02A 5EKDA 1BMDA 4Y2GA 4MPPA 2C98A 3NH9A 4GI3A 5JNTA 4OF4A 3N86A 4IRMA 1KFKB 2VJYA 5DGCA 2IPAB 2ZJYA 4LMAA 4X6UA 4CCYB 5KTPA 2YUIA 1LBTA 1XZMA 3EEOA 5DXAA 3EJWA 1WO8A 8ATCA 5JVD