1U4SA

Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedisulphonic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
307
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
total genus 115
structure length 307
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u4sA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u4sA02
4Q3CA 4IIVA 1EUZA 3AI1A 4J4TA 1JKIA 2I65A 4MVJH 2PZMA 3EVNA 4GLLA 2IYOA 2OBYA 2X22A 1LLUA 3LF1A 5KCZA 4R5HA 1UDCA 1R4MA 1ENOA 3BHIA 3TFQA 4BO4A 1KC1A 2X58A 2C5EA 3ZV4A 3AW9A 3H5AA 3IKVA 2BFPA 2CMDA 5AXCA 3ZHXA 3DHEA 2GN6A 4CMAA 1CEQA 2NV6A 4BO9A 1ADBA 3WGHA 4RVSA 3QWHA 1XU9A 3HB5X 2B83A 1D1TA 4NJMA 2JKVA 2JCXA 5BNTA 3F47A 3GZNB 3KXDA 5TIIA 4D42A 3OJOA 2CUKA 5A9RA 3E9NA 5HTOA 5U1PA 2NWQA 4XYMA 2B35A 2Y93A 3WLEA 3TF5A 2P9CA 4O63O 1QYWA 3PYLA 2DFDA 2E48A 2X8LA 3MTJA 4L73A 3MZ0A 3L4BC 2QRLA 3G17A 4LSWA 1PGPA 4A73A 1XU7A 1LDMA 2HU2A 3AK4A 3WSWA 4R3NA 4I1IA 3QVXA 3AUAA 4HFRA 4R1UA 3NT5A 1CQJA 1E6UA 3PHJA 1DFIA 1EUDA 1NBOA 3LYLA 2JHGA 1X14A 3VZSA 3QJ5A 3WTCA 3MJTA 1EDZA 3RBVA 4LRTB 3DMYA 3ZNPA 5EESA 3PIDA 4WK6A 5G0SA 3DO5A 2BGKA 2NTNA 2HMUA 5TSDA 4CUKA 5DULA 4NBUA 3W1VA 3ZW8A 4DPLA 2HMSA 1YO6A 1ZFNA 3QVTA 2YY7A 3TZKA 1ZVMA 4YJDA 1PJCA 4OH1A 1Z6ZA 3JYNA 3ZGYA 3VPFA 2ET6A 3GMDA 3G49A 3JQAA 4A26A 3LDHA 4U7WA 1WPQA 3L4SO 3PI7A 1V0JA 3B1JA 4LMPA 2YV2A 1TXGA 4F45A 4O59O 1WWKA 1D8AA 4E2ZA 5I7VA 1RM0A 3GLQA 1Q7CA 1OFGA 3VTFA 4B3HA 4KTTE 4ND4A 4M89A 1SEVA 1I32A 1LQUA 1ZSNA 1NYTA 4PLWA 2WEKA 4BGVA 4YPOA 5GZ3A 7ADHA 1ZIDA 3SEFA 4ZRNA 1L1FA 1H94A 3S1LA 4BNHA 2X9GA 3ENNA 1JW9B 3KLPX 3WWYA 3GVPA 1LBEA 5AVOA 2RBEA 3ZHYA 4TKMA 3VH3A 1ZBQA 3FNEA 2IEDA 2I66A 3GRKA 3UXYA 4MP3A 3JYLA 1BXGB 1PQUA 1EVIA 4C4OA 2DBVO 1I8TA 1BGVA 3ANNA 4W99A 1IZ0A 4AJHA 1ISGA 3L9WA 2ZTVA 4WUVA 2VYND 3FSRA 1AHHA 2HCTA 3ZWMA 2UUOA 4BNZA 3UCXA 1PS8A 2Q4BA 4RV9A 2EJWA 3QWIA 4EYEA 2YHIA 3P5SA 4RL6A 1R37A 4DC1A 1DRWA 5DCYA 2E37A 3GAZA 4TWRA 3ETGA 4Z3DA 1ZO8A 4PLFA 3DOJA 3IOYA 3NX4A 3UVEA 3AM4A 3KM0A 1GYQA 3RQSA 1T4BA 3KYCA 3NRCA 4YA6A 4BV8A 3CMMA 4CMGA 3PRJA 5T64A 2GASA 2GPTA 3WGQA 1M75A 5BR7A 1NPTO 4BGEA 4B3JA 5BSFA 4CLOA 4FIZA 1UP4A 3MJVA 3FTNA 3JD2A 4IS2A 1EK5A 3NGLA 1NFFA 4CM1A 1MA0A 5A1TA 1UXIA 1DIBA 1KVTA 4G2NA 4EJ6A 1UAGA 4DUPA 3KO8A 3S2EA 3BAZA 2G5CA 2XXBA 2DVMA 2P9GA 1DIHA 3D4OA 3DZKA 4C7JA 4R41A 3ZCXA 1BG6A 3JQGB 4LW8A 1YS4A 1SNYA 4TZKA 1ISJA 4MOWA 1GEGA 2ZKLA 3AM3A 1U2DA 1HDRA 1QORA 4LCEA 2ZB8A 3JQBC 5A02A 3GEDA 1S6YA 2UAGA 3VZRA 5CEFA 1G6KA 5IZCA 5CPFA 2JD2A 4R54A 1W4ZA 2DPGA 4L75A 3EGOA 1J4AA 2VNSA 4EEXA 3G1TA 2DKNA 4PG7A 5EMHA 1K2WA 3DZJA 4FGSA 5IN5A 1RM5A 1BVRA 1V3TA 2ZB7A 1M76A 3GR6A 3JQ7A 5TC4A 2IRWA 5A06A 4JBIA 1HSOA 4GL4A 3JYPA 4QFDA 1PJBA 1EBUA 4JXKA 1CETA 4N18A 4A7PA 1EFKA 1ID1A 1ZCJA 3CSDA 2VTDA 2D0IA 3JD0A 4TKLA 3RUFA 3OJFA 4PLHA 4YAEA 2HDHA 3GF4A 3JQ9A 5ITVA 2YV3A 4BNJA 2YFQA 5G0UA 4WLNA 5IXSA 3B6ZA 1GUZA 1RWBA 2DTXA 5JAZA 2EF1A 2PKRA 3L77A 1C0KA 4K6FA 4RVUA 4CL8A 1LNQA 2W4QA 1F8FA 4AJNA 4XYEA 4M55A 4QTZA 5HWSA 1VE9A 3AUSA 5IN4A 3TDKA 3ZNNA 5DP1A 4BNWA 3GEMA 3GDGA 1SC6A 1LUAA 2YHUA 4CQMB 4C7KA 4Z6KA 1PEDA 2IE0A 1MX3A 1Q0LA 3P7MA 1UP7A 1OC4A 2EXXA 2PKQO 3NDIA 3OQBA 1H93A 3S2GA 4L8VA 4CLRA 1Q7GA 4NHEA 1C14A 1JVBA 2DQ4A 3G79A 2PR2A 5G4KB 2Q2QA 1X1TA 3OECA 4BKOA 4O5OA 4QT0A 5L7TA 4H15A 1J6UA 3H3JA 2Q4EA 3JQFA 3KYCB 2PGLA 4QSMA 4U6QA 2P68A 3FBGA 4Y6RA 1ADGA 3L6EA 3RC2A 2O4CA 1YRLA 2X5OA 3O9ZA 3U49A 1KERA 3KHUA 2F00A 3ANMA 1GQ2A 1E77A 1GAEO 2ZTMA 1N2SA 3JD3A 4L74A 1I3MA 5IF3A 2UUPA 5JCXA 2P2SA 1WZIA 3GEGA 3ZV5A 2XXJA 4BS9A 3U4DA 1GYPA 1TLTA 3WBBA 4JQCA 4CMEC 4CMIA 2NU7A 4PN3A 5GZ6A 1IOLA 1EQUA 2ZYDA 3VVCA 2YZ7A 4N7RA 2JJYA 2B0JA 5CDGA 4Z0TA 2VUSA 3AI2A 2PH3A 3OICA 2A4KA 4YCAA 3HFGA 1XLTA 2FY8A 3GA0A 1YH3A 3PXXA 1GY8A 2EIHA 4J7UA 4ALLA 4Q39A 4FFMA 1VPDA 4B4WA 4YR9A 2BLLA 5B37A 4XX0A 1S7CA 1LTHR 2ILTA 5I9LA 4E4YA 3R1IA 4EZBA 3GDFA 1PR9A 1GD1O 2PD4A 2FP4A 4D0RA 4WOJA 4MVJD 4JNKA 5CP8A 3NTQA 1GCOA 1OAAA 4G81A 1D7OA 3L6OO 4W4TA 1R0LA 4K26A 4OIMA 1U3WA 2VN8A 3R3SA 2D2IA 3NUGA 4NU5A 4BVAA 4Q3NA 3H6KA 4NR0A 3KSZO 2B5WA 3K92A 4J4BA 2JL1A 3PYMA 4IQ0A 4I8XA 2QYTA 3HSKA 3UFXA 3PJFA 3KYDB 3AI3A 1Y9EA 3MEQA 3R3JA 4IY1A 4NJOA 3W4KA 4I5GA 1NXQA 4BO8A 3JTMA 5LDGA 4RO0A 4MVJM 2FSVA 3D3WA 1R16A 1KEPA 4PG6A 4F46A 3WNVA 3AU8A 3FD8A 3JSAA 4KTVE 1TVEA 1GYRA 2ZJ0A 2DAPA 3S2IA 4YQZA 2NTVA 4YXFA 4GVLA 2NM0A 1LLCA 1EQ2A 1HLDA 4F3YA 4M49A 3U4IA 2P4HX 3K31A 3TZQA 4RF4A 4IZIA 1K6IA 2EWMA 1QR6A 3PFFA 3EC7A 1ISFA 4IS3A 1M67A 1E3JA 1ZNQO 1T24A 3OJEA 3Q2IA 4TVBA 3ASVA 4ZQEA 5ICSA 3RCBA 3JV7A 4M54A 3NKLA 4S3MA 1B15A 3I4FA 3WX0A 1VKNA 1ZK0A 2G1UA 4AJOA 2PNFA 3DMTC 4FDAA 4CMCA 4W7IA 4CM9D 2NU9A 2VWQA 1GTMA 3PP8A 1MP0A 1PJTA 5G4KA 4BIIA 2JCYA 4B7XA 4WE3A 1ENZA 4KZPA 4PLYA 2QRKA 3KRTA 4N5LA 4KOAA 1SOWA 1T2DA 2CFCA 1F8GA 1A27A 2GZ3A 2GDZA 1KC3A 3PWZA 3KYDA 2EERA 4M87A 1O8CA 3STHA 1X15A 3GGGA 4GLOA 5JAIA 3JQ8A 3OIDA 4ONEA 2FHSA 1LSSA 3W4IA 1QYCA 1N9GB 3WGTA 3VZPA 2DTDA 3FHLA 3IJPA 3QVSA 3GT0A 2OP0A 2C20A 3DZIA 4Z3KA 4I9HA 1KY4A 1ZUD1 5I8WA 3UKOA 5L7YA 1IYZA 3G0OA 3OIGA 5LDHA 2YDXA 3IQDB 3AUUA 3MJEA 2DBRA 4ZQFA 4D3DA 3AY6A 4ZICA 4CLDA 8ADHA 4R16A 2OL4A 3H4VA 1W8DA 2GLXA 2C5AA 2GN9A 3HB4X 2OOSA 1I3NA 2RCYA 4J1QA 2F1KA 4E5NA 1I30A 3UN1A 5C7OO 1FDTA 1UAYA 4BHTA 3NT4A 1NPDA 3PFWO 1ENPA 1TI7A 5TT0A 3WGZA 4Z9FA 3ULKA 3D5QA 4OYRA 1BW9B 3VKVA 3ONFA 2B37A 5L51A 3RFVA 4BNLA 1P77A 1EBFA 1T1SA 2OO5A 3L9XA 4S1VA 1X7HA 2VZ0A 3EDMA 5I7FA 1P1IA 3HG7A 1HDOA 4XYBA 3WGIA 3GN1A 1ENYA 2A94A 4CJXA 4P22A 4NBRA 4R01A 1QG6A 2VRCA 5JMPA 3PHIA 1WDMA 4Y8VA 1DXYA 1FXSA 5HS6A 2CY0A 3GOHA 3WOHA 4HV4A 4QEDA 3VDQA 3W6UA 1WAMA 1A5ZA 3ITDA 4XEHA 4MDHA 3ZV6A 4DPKA 1H2BA 4RPGA 2EKLA 1ZK4A 5IDXA 1VKOA 5FEUA 3GQVA 2FR1A 4MVJE 3ETEA 1KBZA 1HDGO 1JQBA 5A03A 4MKZA 2EW2A 3ZDFA 1U4SA 2DT5A 4CLHA 5JY1A 5TS3A 3EZLA 3GMSA 3BYZA 3RUEA 4JJGA 1AE1A 1N8KA 1Z73A 4EDFA 4CLRB 4AJPA 1XGKA 1B0AA 3UICA 2I3AA 2I76A 4WNCA 2VZ9A 4DBVO 2FWMX 2X9NA 2PGJA 3INRA 3UAGA 3DZGA 4GSLA 3EY4A 1UZNA 4E12A 2OFPA 5IG2A 2YW9A 4R69A 1PJ3A 4Z0PA 4UUPA 1C0IA 2NQ8A 2V65A 3GY0A 2JFFA 2X0JA 4IPTA 2E82A 1VLLA 3H9QA 5TJ9A 4HADA 4OXNA 1B16A 1LDBA 2WE7A 1JWBB 2J5KA 2HK8A 5JBIA 5CHEA 3PLNA 1IY8A 4IJWA 3OBBA 3TN7A 1G1AA 1X0VA 3LT0A 4G65A 4HWKA 1LLQA 3O8QA 5T6BA 2AA3A 3HDJA 4MIOA 3I9LA 5IFLA 3RJ9A 3WJAA 4FJ0A 4WEQA 4DQXA 3LQFA 3NEPX 4OJNA 5AQ1A 5C7LO 2GZ2A 3CMCO 4BL5A 4CM8A 1Y5MA 4GI2A 5THQA 2DTEA 4A2CA 2DPHA 4LGVA 4LSMA 2FPGA 3I9JA 2O2YA 4RLSA 4I5FA 1WW8A 3JCZA 3TJRA 1MXFA 2W98A 2Y0EA 3BXXA 3C7DB 3JQEA 2IEBA 4E31A 2G17A 4J2OA 4CM3A 5HA5A 4YYZA 4UVDA 3RC7A 4NI5A 3GZ4A 4GWGA 1SOVA 2FPPA 2O7QA 3AOEC 1A4IA 1ZXLA 1Z7BA 1O95A 5JAMA 1LA2A 4P4GA 1HETA 1I10A 1P74A 5DF1A 1A9ZA 2ZYGA 1E7QA 3IUPA 1KVRA 4RPJA 5DBFA 3CINA 2GN4A 4ZVVA 3GK3A 4FQ8A 4F6CA 4CV1A 4LMRA 1I2BA 1NHWA 3F46A 3LT1A 1DC6A 1IL0A 2AHRA 3GHYA 3EZYA 3HDYA 1NR7A 3K2EA 4JK3A 3ZWAA 2JD0A 5K6AC 1KEWA 2D3TA 3RSHA 3L6DA 4PIVA 3PQDA 4AJ1A 2HMTA 1IULA 3ROMA 3ZWCA 3DTTA 3H9JA 3EVTA 4OSOA 1X0XA 2C59A 2EV9A 5U4QA 3UW3A 1C3VA 3DAPA 4JX8A 2CVOA 2PWZA 3L4BA 3E8XA 4BMNA 1U2GA 1VSVA 4AICA 3BTUA 4UVHA 1A4UA 1DIRA 1I36A 1P1JA 2GCGA 1BXGA 2OZPA 3DZBA 3E6AA 3G3EA 2VT3A 3DEYX 1EE9A 4NFHA 4E5MA 1UXHA 4FJ1A 1OZAA 1DB3A 3DBLA 1F12A 1NQTA 3QY9A 1C1DA 1MFPA 4BO1A 1HF3A 3SLGA 3GPIA 4JCOA 5ITWA 1PGOA 3EUWA 2POQX 3F4BA 3JQDA 3AFMA 3TWOA 5A05A 2GERA 5L45A 4OKIA 2VOJA 5HM8A 4TRNA 4CPDA 5TT1A 2PZKA 1V35A 1M2WA 2BELA 1GUYA 5JO0A 1V8BA 3JQCA 4PRLA 1ONPA 2I5PO 2HK9A 2XOXA 3IP1A 5JNLA 1PX0A 3FR7A 3IAHA 5BNFA 1H6CA 1EVJA 4EUEA 2Y1EA 3DWFA 1LDYA 1NAIA 3I6QA 4Z9YA 1R4MB 4ALKA 3ZN2A 5AXBA 3GVHA 3V8BA 2OORA 3VVBA 4DIOA 3RI3A 1R0KA 3W4JA 4R1NA 7MDHA 2GNAA 4BNNA 4J4HA 4DPMA 2PKQP 1J49A 5CDYA 3B70A 5A9TA 4L4XA 2UDPA 2R00A 5I8ZA 1TT5A 4JLWA 3V2HA 4CM8B 3WYCA 2PTGA 4JROA 2R00C 2ZCVA 4YB8A 3K9QO 1R66A 3WG9A 4DIFA 3IP3A 4P38A 4ZRMA 1EMDA 3BIOA 5TF4A 3WICA 4F6LA 4Q3AA 4GX1A 4RPHA 1XEAA 4J7XA 4JIGA 3UOGA 4RJTA 3COSA 4CM4A 5L95A 3WMXA 4EEZA 3LU1A 3A4VA 2GSDA 3LC1O 3FI9A 4J1TA 1A71A 1UXJA 1NVGA 5I9MA 5IDYA 4B7UA 5JO9A 3T7EA 4KUEA 3JQ7B 1GV0A 4DVJA 1QKIA 4DQVA 1E1NA 5K0ZA 2I9PA 4CM7A 5IDQA 4RDHA 5ICMA 1UXGA 1R4NB 4U6SA 2G82A 4BO5A 2HK7A 3Q9UA 1U1IA 1E5LA 4BNYA 5JCJD 4NMHA 1NWHA 2QW8A 1YVEI 1HSZA 3FWZA 2A35A 3HWRA 4BQRA 1TA4A 3SLKA 2NACA 3DB2A 4YACA 1CYDA 1DLIA 2WD7A 4YT2A 1LSJA 1JTVA 5KIAA 2GUGA 1YOVB 5EPOA 3RKRA 1J0XO 1U3VA 4J90A 3WQSB 1K89A 4ZGWA 5CEJA 5LC1A 5G0VA 3IDSA 3BMOB 3TOZA 2Y1CA 3D64A 4WKGA 4Z0HO 4IJVA 4E33A 1YBAA 3JQAD 3UCEA 4U0JA 3BA1A 3ZWVA 1JVSA 1Z75A 2Y67A 1I3KA 1GADO 5AOVA 3P19A 2R6JA 2VUTA 4NPCA 3ZZNA 4DLLA 1N9GA 2Q2VA 3PDUA 4WPGA 3DTYA 4DTIA 2RAFA 4IGEA 1FF9A 4LISA 2EHDA 1I0ZA 3PZBA 3QQPA 5L4LA 1NQAO 2BFAA 1NVTA 4PLVA 4GVXA 4R3WA 4JJIA 2CDBA 5KVVA 1LDGA 1HDYA 1P31A 4E3ZA 3E03A 1J5PA 3RUCA 3HN2A 5IZCC 1PS0A 4XYLA 1HE2A 4XQEA 2WD8A 2FZEA 1T2CA 4HUJA 1NQ5A 3HADA 1U3TA 2ZCUA 4NH4A 3U4CA 2D59A 4GX5A 4TROA 2XPCA 3O03A 4D7AA 4KUGA 2EJVA 1MC4A 3BMOA 3MJSA 4JP3A 2Q99A 5LCXA 4ZA2A 4BNIA 1JKFA 5CAEA 3KEOA 3OP4A 2WDZA 2AQKA 3D5TA 3CEAA 4RF5A 4EI2A 4GX2A 4UREA 2Q1UA 1Q1NA 1ULUA 4DGSA 1E1MA 3KSDO 1IUKA 4XRGA 4W9NC 4NK5A 4BMVA 1E6EA 3OSUA 4WLVA 6ADHA 5EL0A 4HFMA 3PQEA 4IXWA 1XQ1A 2Q1TA 4IQ8A 3ZHZA 3E18A 4DMMA 1RJWA 4ILKA 4DYVA 4RF3A 2G76A 1G0NA 1DEHA 1QV7A 4YJFA 5A04A 2QX7A 4DREA 3GFGA 4N54A 2W2KB 3ITKA 4J91A 3VDRA 3FNHA 4RLHA 3HFSA 2ZQZA 2AXQA 4NDNE 1HRDA 3P2OA 3ST7A 2CZCA 1MFZA 3DQPA 1XELA 4IGFA 4BMSA 2WYUA 2IXBA 2NU8A 1GL3A 1HYHA 4JGBA 3LC2O 4XDYA 3OH8A 4E21A 3AY7A 1RKXA 4CR8A 4IDBA 2BMAA 1NAHA 3X2FA 4E30A 4KWIA 3DZHA 3A14A 3DFUA 3KEQA 1QYDA 1VJ1A 4WGGA 2V6GA 5F1KA 1GZ4A 4BQPA 1QV6A 5KKCA 4RCVA 3IL2A 3RUIA 2HAEA 5KWEA 5HS4A 3M1LA 2NTJA 3INGA 3CTMA 1K6XA 1E3SA 4DLAA 2YFHA 4B4VA 3F1KA 2Z1NA 3GAFA 4J49A 4MVJA 3MOIA 2J6IA 4PLGA 3FNFA 1DJNA 1N7HA 4WNIA 3TOXA 4DA9A 2RHCA 5L40A 4OHUA 4UULA 4L4SA 4IDGA 4J9UE 5ES3A 5JC1A 3GN2A 2WWRA 2JCVA 3FCOA 3VC7A 1NM5A 4EW6A 1O6ZA 1U4OA 4CV2A 3BMQB 1MXHA 1PSDA 1EDOA 3RUHA 3OIFA 3JQBA 5TGDA 1JU9A 2Z5LA 4YDRA 2VHYA 2DUUA 1SPXA 4FJ2A 1KETA 2D8AA 5JFOA 3DL2A 4HNHA 4OGWA 4WJZA 5THKA 4L4RA 4CM9A 2W2LA 1LC3A 2E49A 1M6WA 4BO6A 3C8MA 3K96A 2NLOA 3ORFA 3BMNB 1QYVA 3WGGA 3FBTA 1R6DA 1HE5A 3UF0A 3NAQA 4INAA 4XYGA 3QVOA 3H9UA 4TRRA 3F9IA 2WTBA 1YBMA 4NQZA 2FN7A 2W2LD 4MP8A 4XA8A 1E7MA 1XSEA 1JDJA 3MCVA 2RIRA 2NUAA 4EGFA 5A5FA 4FFNA 3ANLA 2FZWA 5L4SA 4GGOA 2TMDA 5ENVA 4DRYA 1ARZA 3RC1A 1C1XB 5CEEA 4R51A 1ZKMA 2C29D 2QRJA 5TRTA 2CNBA 4E5YA 1O94A 1C0PA 5IXYA 2IZ0A 3GNQA 4UUMA 5EERA 4CV0A 4ESOA 2D5CA 4BB5A 3JD1A 4DMLA 3CPSA 5KNLA 3ROQA 3VPSA 4UAGA 1Z74A 1FDUA 3PIIA 5EINA 3WGOA 4MVJP 4YAJA 4BKRA 4PZEA 3K6JA 4WLEA 4E13A 5JS6A 4ITUA 2VHZA 1KVQA 4WCFB 1YE3A 4D3FA 4E6PA 3IIEA 5JLAA 3EK2A 1P44A 4FFRA 4LVCA 4TVOA 4XGIA 1KVUA 2ZIZA 4BNFA 3ZNQA 2PH5A 2PD6A 3KETA 1DIAA 1XKQA 2GN8A 3CH6A 3V1YA 1OMOA 4QX6A 3RUDA 3WSVA 3WR5A 1H6BA 1D1SA 4II2A 3GDOA 4AJLA 1W6UA 1LRJA 3NDRA 4UEOA 1XA0A 2EEZA 3QWAA 4J0EA 5A3JA 1KYQA 2PZLA 4CM6A 2I3GA 3FN4A 3VOSA 3ZWXA 4YAKA 5T67A 5K6AA 2AEFA 1EVZA 4D79A 3AOEA 4UVEA 1U28A 4CMBA 3LT2A 3ENKA 1NHGA 3Q6IA 1P1FA 5A5EA 3A06A 3R6DA 4EJ0A 1W73A 3AU9A 4M1QA 3ZWBA 3CE6A 1YQGA 4HNGA 4IDDA 2Q46A 3HJAA 4RVGA 2VHXA 4BKPA 1JA9A 3CUKA 4LN1A 4QFCA 4CMEA 1ORRA 1OBFO 1LJ8A 4RF2A 2Q1WA 3BHMA 2D4AA 2O3QA 3PJEA 5JDIC 1IHXA 3U0BA 1O5IA 3RIHA 3E48A 3H9GA 1UZLA 3WYBA 2QYSA 3GH3A 1IB6A 4BGUA 4RVFA 2JFGA 1KEVA 2XAAA 2Y1OA 4FFPA 2O4UX 5G0TA 3DBHB 1ISHA 3LLVA 5EQDA 1KOLA 5B4TA 2Q50A 3QWBA 4HBGA 3Q11A 4HX5A 1Z7EA 3M2TA 4JBGA 4XIYA 2UVDA 2NVWA 4MO2A 4D44A 1Q0HA 5COBA 1T2AA 3KZVA 3WLFA 3WS7A 4TRMA 1YL6A 1N1EA 1Q2XA 1QRRA 1R0SA 2EW8A 2A92A 2W2KA 4XQGA 4B7CA 3JQGA 4PG8A 4NJMB 4K9DA 5FFFA 1L7DA 3OETA 5DOVA 3RROA 4XWYA 4YT4A 4E32A 1SZJG 3BMCB 3PZRA 1YQDA 4MP6A 4WCDA 5EQFA 3UGKA 3O4RA 5FI3A 4YRDA 2FSSA 2JHFA 2LDXA 1Q7BA 3TL3A 5C37A 3FPCA 3W8EA 2GF2A 2AW5A 5B1YA 1VL0A 2B4QA 3MTGA 4XJSA 2VRBA 4XGKA 4HY3A 3FWNA 3FTPA 3ON5A 1WP4A 4KQWA 3I5MA 5IAAA 2VWHA 1I3LA 5KVCA 1PGQA 3F3SA 3NJ4A 3BTVA 1HZZA 1YWGO 2QZ9A 3RASA 3SBOA 1UZMA 2NVUA 5AXDA 3JQFC 5JDCC 5BSEA 4IXTA 2CF6A 3E5MA 3KV3O 4LVUA 2IYPA 4AL4A 1O9BA 1GUFA 2YV1A 3RU9A 4Y9DA 1KEUA 1OI7A 3E5RA 4KDFA 2HSDA 3LZ6A 5TJHA 1NVMB 4YTEA 5COAA 4OM8A 3PHLA 1E92A 4ALJA 1YXMA 3LC7O 1V9LA 3SJ7A 3H9EO 3Q2KA 1P33A 4AJ2A 4YT5A 1DC3A 2WYVA 4XR4A 4CQLB 2PY6A 2PV7A 1B14A 3KUXA 3WMWA 1TT5B 4Y67A 3NYWA 1UUFA 4QO8A 3DBRB 1E0DA 1VM6A 1GZ6A 2Q1SA 1ZSYA 3D1LA 1U8FO 2NVBA 5TLSA 3JQAB 4Y6PA 4CMKA 3MJCA 4GPD1 2H63A 3O26A 2Q3EA 1K3TA 2BI7A 1DSSG 4IIUA 3BTSA 3SX2A 3RWBA 3PHHA 4J1NA 2YYYA 4OOFA 3BMNA 3DHYA 1NR1A 5A9SA 1WXDA 2NQTA 5T5QA 2B4RO 3PJGA 1X1EA 3ONDA 1MLDA 4XRRA 1GEEA 2WMDA 3UCFA 3PK0A 4QXMA 2NSDA 1T1RA 2Z1MA 2AG8A 4YBZA 3B1KA 4J9VA 1XWFA 4UUNA 3I52A 3WIEA 4YJGA 1PGNA 1XG5A 1RYDA 3KVOA 2TMGA 1Y1PA 4FPXA 5ENDA 2AE2A 4IDCA 1T2EA 1HDCA 5KKAA 5T8KC 3RJ5A 2YQ5A 4OQYA 1IPFA 3SXPA 4BO2A 4RORA 1CERA 4W82A 2AQHA 5CG2A 1F06A 1DBVO 2OUIA 4DYDA 1H6AA 2VYVD 4MIEA 1UH5A 3OHSX 3PTZA 4WCFA 3QRWA 5I7EA 4YQYA 1IE3A 3CXRA 3VH4A 4YJHB 1A7KA 5GY7A 2ZTLA 4RQTA 5L3ZA 1E3LA 3ZNOA 1EFLA 4IJKA 2FR0A 2G0TA 3DAGA 3K8ZA 5ER9A 3C24A 4RZIA 3R0IA 5F21A 1ISIA 1NASA 2EP5A 1PZHA 1SO8A 4FBGA 4IINA 4OKNA 4D41A 4MIYA 1B3BA 1EK6A 1O89A 5B4UA 1V3VA 3K73O 2B5VA 4RGBA 1VJTA 3E9MA 3GZNA 3S55A 1YB1A 4RVDA 3VPGA 1LU9A 4R68A 4WEOA 1GZ3A 1GFSA 1HEUA 1AN9A 4NZ9A 3KOUA 1HT0A 4BB6A 4E5PA 2Y1GA 4L76A 1XIVA 3PJDA 4XKJA 4XQCA 1ZSVA 4YAIA 3TZCA 3AWDA 3IS3A 2JD1A 2DFVA 5G4LA 2OP1A 1NFQA 3BHJA 3GVXA 3VZQA 3WQQA 4PLTA 3LF2A 5DOZA 4R5MA 3D3WB 2ZB4A 4UEJA 3TPCA 2YJZA 3U5TA 3QHAA 2QG4A 3GHHA 3IUSA 1R12A 1DAPA 4BKQA 1WZEA 1GDHA 2O3TA 4NG5A 4CQLA 5JE8A 4BO7A 2W8ZA 1RM4A 1E5QA 3JD4A 4BO3A 3D4NA 3ZWYA 2P4QA 4CV3A 1QLHA 2NADA 1IPEA 1RYEA 4FW8A 3ZHBA 5DBGA 1ADCA 3TFOA 1B8PA 4TMFA 4NBVA 5KJ6A 2HKIA 1YONA 2GO1A 4W6ZA 3O38A 2BGLA 3WFIA 4B3IA 3RFXA 2JAPA 4BGIA 4E5KA 2FRDA 4GKVA 4DC0A 1XCBA 4GKBA 3DOCA 4WLFA 5JCJA 1JAYA 4E2XA 1E1LA 2EP7A 2VRCD 2RH8A 2X9VA 4OL9A 1MG0A 1ZEMA 3M6IA 3I3OA 1YB5A 4GMFA 3RAJA 4RVHA 3NT2A 1R15A 4NFYA 3KB6A 3DXFA 3KSUA 4GMGA 1GCUA 1MB4A 4WECA 1TT7A 2BKAA 5IDWA 3EW7A 2X86A 2FPIA 4GH5A 4FR5A 2XF8A 4R4JA 2WYWA 3C1OA 3C3XA 4K1LA 3WNQA 4IDEA 3OEWA 4ZD6A 5KTKA 2VYVA 3C7CB 3DBHA 2H9IA 1PL6A 3F6YA 1UP6A 2HMWA 1PJQA 4CR6A 1H9BA 3ICPA 3Q3CA 4MKXA 4G5HA 3ADOA 2E4AA 1D4FA 4NIMA 1B26A 1UXKA 2W90A 3N74A 4DIBA 4P4NA 4WLOA 3CZRA 2CDAA 5A4DA 5CDUA 4IMPA 4PZCA 2WE8A 2HRBA 3QIVA 3H2ZA 5FYDA 1E7WA 1U9JA 4P4LA 2J5RA 4XZ3A 2B4TO 3WDSA 2D1YA 3PHGA 4J0FA 4OXKA 1HLPA 2H5LA 2J3IA 4BNTA 2WD7B 3HN7A 5BT9A 4YT8A 3GNSA 1XHLA 1I24A 2PZJA 2Y68A 3RD5A 4ID9A 2GD1O 3QSGA 2O50A 3ZU4A 4MKRA 4UVIA 1DHRA 4B8ZA 1GU7A 5EIOA 3ADPA 3F5QA 1WVGA 1EE2A 3RFTA 1NPYA 4FC6A 3WBFA 4PLZA 1B8VA 4I5DA 3GG9A 3T4XA 4CMIB 1DO8A 5JW6A 4NNJA 4KP7A 4K6CA 2E6UX 2AQIA 2VQ3A 1YL5A 3OF2A 4CLOB 5C5IA 1DRUA 1CJCA 2C7GA 4PFJA 3S8MA 1LQTA 5KJ1A 3H7AA 4BNUA 1DFGA 4N5MA 3H5RA 3AY3A 1KIFA 2HJSA 5FI5A 3RBXA 2O3RA 5JPIA 3GGPA 1YGYA 3NTRA 1BDBA 2P5YA 3N58A 2O2SA 2V6BA 1HDXA 1D3AA 4L0QA 2HJRA 1N7GA 4FFLA 2DBQA 4TZTA 3I9NA 3T4EA 2A9FA 1SB8A 4XB2A 4XGNA 2BD0A 3OJ0A 5KOIA 4TSKA 1ZXBA 4OQZA 1PWXA 4MPDA 2J3KA 2BH9A 4PGFA 3E82A 4YWJA 4IJUA 1ZMTA 4A27A 3DAFA 2CSUA 3KLMX 1TEHA 3PYXA 1X13A 3WFJA 2EKQA 5ILGA 4OOEA 4IBOA 5BSGA 5L7WA 1H5QA 4J7CA 2H6EA 4H7PA 1PZGA 3U4HA 4MVJI 3ZU2A 2YQ4A 1PR3A 3ZWWA 5BQFA 4WASA 2ZJ1A 3WB9A 1FDSA 1ZW1A 3D0OA 1UDBA 1PJ4A 4PG4A 5MGBA 1LX6A 1K6JA 3VAZA 4PVDA 3IKTA 1KY5A 1QXSA 1GV1A 4URFA 3ROKA 4W7HA 2DC1A 4PLPA 2Y1DA 5TX7A 4LRSB 4BNVA 5HBRA 3W6ZA 3K5PA 3BZUA 1ZMOA 1U7HA 3OQ1A 3T7CA 4AVYA 1NX6A 1X7GA 3G1UA 1K5HA 3DR3A 1Q0QA 4KQXA 1CF2O 4QQRA 3ZU3A 4XQ9A 4FC7A 1RPNA 1P3DA 3H3FA 1I5RA 4BNMA 4ZHSA 1HE3A 3CZMA 1Z82A 3LLSA 5A3VA 1MG5A 5IJZA 5F1PA 3EMKA 3RKUA 1DC5A 1C1DB 1DHTA 1I33A 2OBNA 3HZZA 1LLDA 4GBJA 2P91A 2OXIA 3SC6A 1E3WB 4KWHA 1HYEA 2BFOA 4ZJUA 4PG5A 3GGOA 3PWSA 1AHIA 3JQ6A 4OXYA 2DBZA 3OQ6A 1KS9A 3ETDA 4ZU3A 1MC5A 3VPHA 5DN9A 3M2PA 1QSGA 1AXGA 1UDAA 3BTOA 4Q3DA 5ER6A 5C7IO 3GVIA 4LCJA 4Z9XA 3ZH2A 4E2WA 4II3A 1C1XA 2LDBA 4E0BA 5L53A 4BKUA 1WMAA 2VT2A 5JAQA 1V3UA 4B8WA 1P1HA 4IZHA 1U7TA 2NNLD 2YUTA 1ZK1A 2HRZA 4XIJA 3N7UA 4YRBA 4B4OA 1Y7TA 3OJLA 4XCVA 1FMCA 1ULSA 4PVCA 3V5NA 1NNUA 1ZH8A 1CRWG 3A1NA 4CLXA 4IUYA 5F5NA 9LDBA 2C54A 1SMKA 1MGOA 2ZQYA 4M86A 4PLCA 1YOVA 3VPXA 1N1GA 5B12A 4ZQBA 3UUWA 4OMUA 5EN4A 3GRPA 3D3EA 2HQ1A 2VUUA 1U5AA 4GQAA 3NGXA 3V1TC 3NV9A 3DZFA 4PZDA 3ROPA 5JC8A 1GPJA 3C1TA 3DC2A 5I7SA 3TSCA 1HKUA 3HNPA 3L07A 3NTOA 1BW9A 2GZ1A 4AJEA 4AJJA 1EVYA 3AFNA 9LDTA 1AUPA 3OMLA 1E3IA 3A9WA 2BHLA 4NFSA 2VHVA 3Q0EA 1WMBA 3C7AA 1PTJA 5ILOA 4IQGA 3MOGA 4CM4B 3DFZA 1CIVA 4A0SA 1PU2A 3I83A 3ZV3A 3I1JA 3I4CA 3QP9A 4NBTA 1BSVA 3GUYA 1PS9A 1X7DA 5H82A 1ZZEA 2VWPA 3HE3A 3D4PA 4BNXA 1LI4A 1AXEA 2IODA 4J43A 2VYNA 4MVJF 1LXCA 2ZTUA 1P0FA 5F5LA 4O1MA 2DM6A 2VWGA 1XDWA 1F14A 1U5CA 2NU6A 2UV8A 1LRKA 4YJHA 4R9SA 4ALMA 1B8UA 1P1KA 1ISMA 2X0IA 2AEMA 1E6WA 5JSFA 2YDYA 2BI8A 1DOHA 5DCWA 2R2GA 2Y66A 1EZ4A 3AUTA 3E9QA 3JYOA 4HFNA 3HDQA 1DC4A 5T57A 3QWFA 4U5QA 2V7PA 4J2HA 4ZQHA 3L0DA 4U0KA 1B7GO 3FPLA 5G2OA 1M6HA 1VSUA 3HHPA 4QUKA 1P45A 4MVJG 4AJ4A 3K2BA 3WTBA 3SJUA 4Q9NA 4R9RA 1CDOA 4HXYA 3RU7A 1XYGA 3C85A 1JKJA 4DL9A 3PWKA 4TQGA 5DZSA 4JJFA 3F1LA 2O3JA 1BWSA 3U62A 3PQFA 1E7YA 1E7SA 5IZ4A 3HQ4O 2X0NA 3GVCA 2FR8A 3H65A 3S2FA 3AM5A 4Y98A 1I2ZA 2J5QA 1PZEA 2C82A 2ZATA 5JDCA 1R4NA 1PL8A 1NQOA 5CDSA 4GX0A 3W8FA 4CQMD 1HE4A 1L7EA 4N5NA 4D0SA 3MWDB 5F1OA 1HTBA 5DT9A 1EUCA 1PJLA 2J3HA 4YAGA 1A9YA 2BGMA 4ND5A 1PQPA 1BHSA 2V6MA 1Y5RA 4R1SA 2CDCA 3PGXA 4ZN6A 3DBRA 2O3SA 1FDVA 5JYEA 5DCUA 1U3UA 3QW2A 3V2GA 3UHAA 3I9MA 1O0SA 2C07A 5B4VA 4BNGA 3V2UA 5FF9A 1VJ0A 4JP2A 2ZK7A 1NP3A 3P2YA 4FD3A 4DXHA 4QECA 1Y9AA 3JQ9C 3QVWA 2ZB3A 1BTOA 4I08A 4MJLA 4A5OA 3H2SA 2I6TA 1PWZA 1E3WA 8LDHA 3SC4A 1F0YA 2Y0DA 3B1FA 1CQIA 2C7VA 3PEFA 3PDJA 1H0KA 2IZZA 4W9NA 1HYGA 4AFNA 2QQ5A 2CVQA 2X1HA 3FF4A 3KYBA 5DNAA 5MDHA 1DDOA 1SAYA 3GFBA 4YJGB 3V1UA 4DBZA 3TL2A 4X54A 3DMTA 3TZ6A 2X6TA 1YL7A 3ZW9A 4Q3BA 4ZQGA 3WIDA 5JMWA 1T25A 2WSBA 3A28A 2AQ8A 4NK4A 3ICCA 5T8KA 1VL8A 5TNXA 3WJ7A 4BUCA 4TRJA 4OO3A 1DAOA 2HMVA 2Y05A 2Y99A 4IDFA 3K30A 1ZK3A 4XJTA 1W0CA 5H83A 3OFSA 4I9UA 4UVGA 4FN4A 1U8XX 1LC0A 1T4DA 2J3JA 1ZJYA 1H9AA 2X0RA 3FRJA 3LT4A 1WLYA 4BV9A 1NWCA 2PD3A 5BNIA 3LK7A 3U09A 3OA2A 3IJRA 1PIWA 4JN6B 1PZFA 4D46A 1G0OA 5U9CA 2RH4A 4B4UA 3GC6A 4H3VA 4K28A 2X5JO 4BNKA 1WNTA 1DPGA 2OMEA 4MINA 4EUFA 2IZ1A 3U3XA 3DHNA 5CG1A 4RPLA 4BO0A 1BVUA 1DRVA 2B69A 1YKFA 1LDEA 2GR9A 5F3RA 1HL3A 1QLJA 2BFMA 4GAEA 3ZU5A 2RHRA 5JYDA 4CODB 1IHYA 4FOSA 2VOEA 5KVQA 4DWVA 1Y8RA 4HFJA 1Y6JA 4J6FA 3WGYA 5JDIA 3EAGA 3FR8A 3ZWPA 2PA3A 5J23A 2I67A 3NDJA 1DIGA 3KTDA 3I9KA 4Q3EA 2I99A 4IMRA 1LEHA 1ONOA 3ONEA 1DLJA 4XR9A 1HWYA 5KJFA 1GQYA 4L9RA 2EG9A 2HLPA 2CF5A 3JQ8B 2Y1FA 5HRUA 4I9NA 3PPIA 1P0CA 3B20A 4QO7A 4HP8A 5DP2A 4ROSA 3Q9NA 2FOIA 3FNGA 4UUOA 4CR7A 3HUDA 4U8GA 2WJPA 4YEDA 1XQ6A 4O0LA 4WCFC 2DLDA 1DFHA 3X2EA 1YQXA 2DU8A 1E1KA 3GUCA 5L9AA 2GRAA 2AG5A 4JBHA 3WXBA 1V6AA 2JFHA 4PRKA 2X4GA 5EJ2A 4H16A 4FGWA 4LK3A 1SCUA 3E1KA 2IDZA 3GPDG 3H5NA 2OGUA 2EKPA 5TQVA 4EJMA 1FDWA 1BXKA 3UH1A 2C2YA 4AJKA 3MJ4A 4FCCA 1LSUA 3I6IA 3VH1A 4WOKA 1I01A 2SCUA 4EBFA 1Y8RB 4P8RA 1EEHA 2AE1A 4A03A 5KJCA 2C0CA 3INTA 3DOOA 4OSPA 1Y8QA 3IMFA 1QMGA 4IDAA 2BRUA 1YDEA 3VH2A 2VCYA 4J3FA 1B3RA 1MV8A 4DQUA 1HDZA 2CD9A 1PL7A 4HKTA 1T26A 2P9EA 4AJIA 2AEJA 1N5DA 1YDWA 4GWKA 4J16A 3C1AA 5DBIA 4RPKA 1PGJA 4NBWA 1E3EA 1YBVA 4NU6A 4D3SA 1VI2A 3D7LA 4ND1A 4UEKA 2CVZA 4CQMA 1VC2A 4ALIA 5CDTA 2C2XA 4GSKA 1UJMA 4B79A 5FWNA 4J1SA 5JY6A 3CKYA 5C3MA 3DONA 3KBOA 3JYQA 5DDIP 2NVUB 3OM9A 1PJSA 5ADHA 3RBZA 5L4NA 1BDMA 4D45A 1TB4A 1Z45A 1YJQA 3TRIA 1F17A 4FSHA 4EITA 2GGSA 1ZEJA 3F4LA 4CMJA 2HUNA 5K9ZA 1ZK2A 4RDIA 2VNAA 3ASUA 2O3UA 4GGPA 1Y8QB 2BF7A 3QV1A 1FK8A 2JAHA 2PFGA 3AJRA 4FOOA 1WDLA 1IZ9A 2Z95A 1JLLA 3OEYA 2O23A 1RM3A 2DUWA 3EYWA 1K0UA 3LSYA 4WLUA 3W8DA 5JXWA 1XR3A 3ZI0A 1WDKA 2D5AA 5I9NA 2GYYA 1HZJA 2X23A 2O7SA 2UYYA 4FFOA 4CUZA 4DLBA 4O6VA 4Y6SA 4BOYA 3BMQA 3MWEB 2O48X 4YVFA 3WQRA 1CWUA 3EHEA 3M1AA 5KJEA 4XB1A 2PK3A 1M66A 4CL3A 1FJHA 1SB9A 4CLEA 1PJ2A 1JWAB 5A9SB 3Q1LA 5CFZA 5H81A 3O8QB 4A10A 6LDHA 3F5SA 1NTOA 3AOGA 1OC2A 4ND3A 4R1TA 5KVSA 3WYEA 3ZWNA 2PLAA 1SBYA 2VHWA 3I23A 1KVSA 2ZYAA 1MUUA 1H2HA 3ABIA 3U9LA 1DJQA 5CPBA 2Q49A 3GNTA 3QE3A 4PCVA 3WWZA 4FS3A 3DDNA 2QZZA 2EGGA 1JAXA 3HDHA 4I5EA 3RVDA 4YRAA 4D43A 3RUAA 4E2YA 1I2CA 5GMOA 3PLRA 2H1SA 2QHXA 4OAQA 4RZHA 4KMSA 1NFRA 1SEPA 4CM5A 1BXZA 1LDNA 4XD2A 3NJ8A 3QLJA 2P5UA 3TNLA 2VZ8A 1P1RA 1QYXA 1ADFA 2V6FA 1B2LA 3QA9A 1ONNA 3GG2A 3OA0A 4IM7A 4KUHA 2FMUA 3H8VA 1LSOA 4M8SA 1P9LA 2EGHA 2YHIB 1ZJZA 2X7HA 3SVTA 2WM3A 5COQA 5G0WA 4ALNA 2PGDA 2B36A 1VRWA 3LVFO 3VTZA 4KDEA 1YB4A 2Q45A 2Y0CA 5GZ1A 3ZWOA 2VTEA 4ND2A 1GR0A 1PQWA 1Y81A 3BMCA 1OOEA 1UR5A 2HO5A 4FB5A 5AYVA 1JN0A 3VKUA 1VL6A 3I9OA 1C0LA 2Q2WA 3PVZA 1LRLA 3TQHA 2OHXA 2IXAA 1E7RA 4CUJA 1ML3A 3PGJA 3CIFA 4CMHA 1BMDA 2QIOA 1AGNA 1A7AA 3DBLB 1T2FA 1HXHA 1YJ8A 3IC5A 2X5KO 4YJFB 4AG3A 1BRMA 4EUHA 1N92A 2J8ZA 4XDZA 3VHRA 1A72A 1GPDG 5BSHA 2AMFA 5AXAA 1H6DA 3RC9A 1GQQA 3TZHA 4RQUA 3DBVO 1QP8A
chains in the Genus database with same CATH superfamily
1OXKB 1S3IA 2MMGA 1L5HB 1RLIA 2FEOA 2RDMA 3ORQA 2IL1A 2PZMA 3EVNA 4TXNA 5FA5A 1HA3A 2GNPA 3NI2A 3FMIA 2X22A 3KOYA 5F4ZA 1W0JD 2OZLA 3FHOA 1JKMA 2WVHA 3LF1A 5I9IA 3K0AA 3OC6A 2JLWA 4H4CA 1R4MA 3PEWA 1QB7A 2D13A 3W77A 2XOEA 3EYAA 3TFQA 1XYVA 3V7WA 1KC1A 3V9PA 2SBTA 4WVLA 1K8RA 3MUFA 1GGJA 1OXTA 4G09A 4BNDA 2PG3A 3PBKA 1XD2B 2REQB 4P3KA 3ZQUA 3DMFA 2GN6A 5FI0B 5ES4B 4IKEA 1QKJA 4P84A 1Y34E 1CEQA 4HNVA 1R64A 4J3NA 1DG1G 1H1TA 4MICA 3BWDD 4NJMA 4EJSC 5A3SA 1ADYA 3DD5A 5JS2A 3MT7A 2FEWB 4C2TA 3WLSA 3AB3A 5A3QA 4CTJA 1EAMA 2ISCA 4LJLA 4QSHA 1S89A 1FTSA 2GKSA 5TIIA 1VGVA 3E9NA 4O0MA 1GKLA 2H31A 2OZKA 4NONA 4RSHA 5U1PA 3NTUA 3ZE6A 2P9CA 3SM3A 4UQLA 4H6VA 4JENA 1GRVA 2Q07A 5IKMA 4X7PA 4X61A 5C2JB 5LXTB 1M8FA 3W05A 2DFDA 4ZCTA 3GRYA 5DHUA 1CB0A 3TUZC 2FF5A 3NTLA 3QE0A 4JUFA 2X42A 1PGPA 3LY9A 4WK4B 4WXEA 3S5UA 4KN8A 4A73A 3E3MA 1LDMA 3TMYA 3WSWA 2WUWE 2NZUG 4EGSA 3LOQA 3IAS1 2AXNA 3TD2A 4ETWA 2XDYA 3AR4A 1SCIA 5CT4A 4AX8A 1HK7A 1G55A 4Y9RA 1OTHA 4BFWA 3VFDA 3DLIA 4WOBA 1EDZA 1WQ1R 3BULA 1AVTA 4EHJA 2A0YA 2GN2A 3LX8A 4L5IA 3RBVA 4LRTB 3DMYA 2GESA 4Y2VA 4MYTA 1Y8CA 2JDID 1ORHA 2HZBA 3PIDA 1L4HA 2FG6C 3FVVA 3LGAA 2VS1A 3DO5A 4MQFB 2BGKA 3P9KA 4WK6A 5TSDA 2IQ5A 1A96A 1YFKA 3UJ6A 4WESA 4BRWA 4DPLA 3W1VA 3IYLW 4K6GA 2QRQA 4AKEA 3QVTA 5BMOA 4UZEA 4KPGA 2CLLB 2KM1A 3JYNA 1Z4LA 5CDHA 3CF4G 2ET6A 2P9QA 4QPCA 4L6AA 2RJ3A 5ERXA 1I80A 2BCJQ 2PWAA 3K09C 4GXQA 3PI7A 1UBHS 4JUCA 4C87A 4CE6A 5JFGA 1XRNA 5ERYA 1VGQA 4O59O 3FDJA 3HU5A 3TB4A 4BN4A 4E2ZA 3GLGE 4OM7A 5DTEA 1KNXA 2D2FA 3C5WP 4M1MA 4O2LA 4QXAA 2ISQA 3ND6A 1I32A 1LQUA 3IOBA 3B85A 5J59A 3IR7A 4RKEA 2AOUB 1ZMRA 3O7WA 4P4SB 5SV2A 4ABYA 1NYTA 1D6JA 4BGVA 5GZ3A 7ADHA 3QOWA 2W6ZA 4ZRNA 3H2GA 4FHDA 1L1FA 4BNHA 2Z2YA 1CUZA 2RGNA 1U8EA 2M98A 2X9GA 1A7UA 1XL0A 3GVPA 4I5IA 2BFDA 4M0DA 2E6KA 1SN7A 4KGZA 2IVFA 1JQKA 4TKMA 5D6OA 3TM4A 4HUQA 4MGZR 4LHVA 4KSBA 1W85B 1ZNXA 4C0HA 4EATA 1BXGB 2EHJA 3R8CA 1YQ9A 1Z0IA 5CA0B 1Z0DA 4LIPD 3RRMA 1YR2A 1CR1A 2B99A 2YL2A 3FOCA 5KAPA 3NHFA 4KVAA 5BYBA 2K5UA 5T4EA 3R7FA 3SZMA 4QJ4A 1IZ0A 3PJRA 2OXEA 5D8DA 2A30A 2ZTVA 4HPXB 3B1VA 5EIAA 5FAXA 4BN0A 4RKRA 2ZR8A 3IPRA 5ED4A 2QNRA 3UCXA 5IKEA 1AM4D 4K3VA 3NDPA 1DP4A 3AHIA 1QC5B 1XZ8A 4K87A 4RL6A 1M1UA 1A2BA 3G1WA 1IPHA 1NJ6A 2PX0A 4RKQA 2IYXA 5LMCA 3E15A 2JLCA 4JEUA 3EBPA 1YJAA 3W5UA 4Z3DA 1P2GA 1ZO8A 3HB0A 4I50B 4PLFA 4DUGD 3UVEA 3M9XA 1IH8A 3RSFA 3KM0A 3QNWA 1H3NA 2W2OA 1YI1A 1T4BA 2JASA 3RRJA 3JVIA 4JXJA 4L28A 2P69A 3H7IA 3VDMA 2ODQA 3PRJA 2HF2A 1C9EA 3QBVA 2F1HA 4C4TA 2VEOA 3IAXA 5KQSA 1NPTO 1C4OA 4BGEA 4FM9A 3JR3A 3OX4A 1VCIA 3GMIA 5KUTA 4FIZA 1E2LA 1UP4A 3MJVA 3FTNA 4Q7EA 1M8KA 1EK5A 2RKBA 1NFFA 1MA0A 3O0TA 1KP2A 4EGCB 3PEEA 1V9SA 3IEUA 4TYMA 4OBXA 3EJWA 4WXHA 3ZH9B 4EJ6A 4YY3B 5BPHA 3TSYA 1W52X 3KO8A 4AQ7A 2DCMA 1KO1A 1UINA 1DBPA 4K9MA 5AJXA 4Z8XA 5EZYB 4E6EA 1NU8A 2PSHA 3BE4A 3KAJA 4EVIA 2DVMA 1USKA 1EHYA 2PMKA 1Z34A 3AL3A 3VJKA 1XDZA 4OJQA 1AC5A 1LPOA 4R41A 3T7SA 3RT7A 4I36A 3S2ZA 3ZCXA 1DV1A 2Z09A 4FDVA 1QVWA 1XNGA 1LTKA 1GUAA 1GEGA 1NUPA 3FWHA 1HQKA 3KDPA 2Q8PA 2OQVA 1RR6A 2FMXA 2QTMA 3SS8A 3OFNA 5FPTA 2IEGA 2ZB8A 5BURA 4NOJA 1DKPA 5ALUA 5LR6A 2IGBA 1N7JA 3MGAA 3N75A 1O9HA 2I8CA 2JD2A 1KPIA 1UKCA 1W4ZA 5FTNA 3EGOA 1R9NA 2KJQA 4MLCA 3OE1A 5E9AA 5EMHA 1C9DB 1BQ4A 3LDGA 2BBSA 4KH0A 4YMUA 1Y1QA 1IOZA 1M76A 3QVGB 3JQ7A 3NPAA 5JSZA 1Q14A 1XO1A 2IRWA 5A06A 1XJ0A 4P7JA 4F60A 3TJZA 1PJBA 2ZP1A 1EBUA 4GI1A 2L17A 4Q01A 3VNQA 1BD4A 2QP3A 4GBED 3BWYA 3I09A 4AECA 1NVVQ 1JPUA 3FSEA 5A0FA 1EFKA 3B3GA 3UBMA 1IQUA 1ISPA 3ETHA 3OJFA 1AMNA 2FNAA 1NW6A 2VPPA 3EJ6A 4FZ5A 4GI3A 3EARA 3DE1X 1P62B 5WRFA 4BNJA 4EFDA 2YHAA 2BGWA 5JEDA 5IXSA 2EG5A 3SSNA 3RYFA 2YY6A 2YFYA 1VLQA 2FRVA 4NNPA 4QPZA 5K8VA 1X42A 2IYRA 1JQEA 3UW1A 2PZEA 2BR4A 3FKQA 1UPCA 1ZOLA 2CLKB 4TMKA 5L3SA 1SZCA 1IN8A 2W4QA 4QU8A 2XXAA 2VZEA 3RG2A 3IP5A 2IBMA 4MYRA 4QIHA 4AJNA 4DLTA 4DLSA 2BMDA 3RFUA 5HWSA 4IQ4A 1XRPA 5IN4A 3ZGNA 4M1KA 1IBSA 3MJRA 1DG3A 4O1IA 3RPEA 4NBLA 3AF3A 4BNWA 1GPNA 1LUAA 2Y92A 4JITA 4KQEA 2ZG6A 2YHUA 3M49A 2B1JA 5TS2A 5I01A 4CEHB 3AETA 3PFKA 1NMYA 2IE0A 1MX3A 1XZLA 4NJEB 1Z2PX 3P7MA 3B2QA 4I1YA 2EWVA 4AY5A 5IPFA 4DKJA 1J24A 3T3IA 2AG1A 3E0QA 4ZYVA 2RFLA 1LNZA 2X0KA 3BB1A 3C6XA 3G88A 4HR7A 4L8VA 1U5BB 1U90A 1MVLA 2H2HA 1WD5A 2YN2A 1Q7GA 4EM6A 2V6JA 5MFPA 2JJ1D 3I2HA 3LXUX 1CUDA 2DQ4A 4E08A 3GZJA 3G79A 3N0RA 5K01A 2ZRDA 4C4AA 1X1TA 4H3KB 3NEAA 4O5OA 5JI3E 3TZLA 5TR9A 2RIPA 3QTBA 4U6QA 4Y18A 2P68A 4TLLB 3L6EA 4B2YA 2Z6VA 1M2JA 4KQCA 3U49A 1CJMA 1KERA 1D2NA 1WF6A 4FXOA 3SHWA 5T3UA 1AOXA 3AFOA 1EJ0A 4HN9A 4RHTA 4C6TB 2J0QA 1B76A 2QOEA 1E4YA 1XVLA 2J3QA 1G64A 4V1CB 1F2TB 3ZV5A 3U4MA 3RFFA 1CUHA 4RGYA 1P4SA 1R9MA 2QAGA 3U4DA 3S2UA 3QV2A 4CMEC 3O75A 4GKJB 3L01A 3RDPA 2C7PA 3OHMA 3OIVA 5D3KA 4PAWA 5K3SA 5CB6A 1C7EA 1EQUA 5SY6A 4N7RA 4RNCA 2JJYA 1A9TA 1QO9A 4MMYB 3QLVA 4DLYA 1B4DA 1P29A 2VQFB 1Z18A 2PH3A 1CZRA 5FUYA 2A4KA 3GT4A 4YCAA 3WSTA 3ZS9A 5IT9A 3FW1A 2AOTB 4AAYA 3DAYA 3ZXIA 1E89A 3CJQA 1YH3A 2GHRA 1QK4A 2A2ZA 3IMCA 3VOAA 4B4WA 4YR9A 2BLLA 1X7YA 1N2IA 4KX3A 3ABSB 5B37A 3WIVA 3VZDA 4LDPA 3AVTA 2ILTA 3T6KA 4I1VA 4MWDA 2DHRA 4E46A 4ZDIA 5K8TA 2FP4A 5ESXA 1P17A 3N5KA 1AA6A 2ZUTA 5F64A 4LY0A 3OKFA 2RHMA 2OPBA 2ZSEA 1V11A 4W4TA 1R0LA 4IG9A 3U44A 3EXEB 2R751 2RI0A 3RARA 2BAGA 1FS5A 5JJCA 2VN8A 2ZUFA 1LK0A 2F8TA 2H9YA 5AIAA 2VPZA 1T13A 4DS3A 5K45A 4WX2B 3KSZO 1AZWA 2DULA 2JL1A 3O6VA 3PYMA 4LZZA 3SR0A 4ANFA 4F86A 3PA8A 1SD1A 3BXFA 3PJFA 1K5GA 4FR2A 4XIIA 2XEXA 1Y9EA 2ACEA 3MEQA 3OO0A 4IY1A 4NJOA 4I55B 3U81A 4EG3A 1MQ8B 3ED1A 5IC4A 5FQNA 1EQAA 4MVJM 1IHDA 1KEPA 2GN0A 4IKOA 2E87A 4ZTBA 5F2KA 3TPFA 5IJ9B 3H1BA 4UU1A 3P97A 3EPRA 3WNVA 1OLOA 2K6GA 4KTVE 1T15A 2FETA 2XGMA 5AJWA 2VP5A 4DR1B 1L6RA 4JXZA 2ZJ0A 5B1HA 2DAPA 2E7ZA 4BV3A 1E5TA 2GT1A 1OGIA 3RRBA 3WDKA 1XZFA 3TW4A 4F3YA 3Q8XB 4I6EA 2MYUA 1O94C 3UG6A 4I46A 5C1IA 4IG4A 1K6IA 2ZRLA 4Z2AA 3A4IA 3RGGA 3I05A 3UMSA 4MYDA 3PFFA 4YDSA 2RGNC 4HEA1 1ZNQO 2JI8A 2GJSA 3Q2IA 1DU4A 4TVBA 4K7JA 1M1XB 3LX4A 2VDJA 3I4FA 2I78A 1Z8HA 4PYLA 4C4ZA 1OAKA 5CX4A 1TO6A 3S3TA 3WX0A 3BDVA 1N6PA 2FYTA 2C3PA 3W6OA 3X1WA 1MA3A 3F2IA 5FLKA 2F17A 3QBJA 4Z7JA 1XFDA 4FGUA 1PJTA 4WAUA 2CXTA 2W93A 5G4KA 4C9BA 1Z25A 2W71A 2XUIA 4QICA 5E4TA 2YWXA 1DUSA 1ORVA 4N5LA 3TZBA 4EB6A 2CL0X 3KOWA 1RHUA 4MA5A 4ZEOA 5C5EA 3PWZA 1W75A 5LYJB 2XA2A 5LFAA 3SWWA 1M2KA 1GILA 3STHA 1AY0A 3BZWA 2C4VA 3IEMA 4BTEA 1Q1EA 2LE0A 4GLOA 1FFXB 5C81A 5AWFC 4ONEA 4WY8A 3W4IA 1CK4A 1U2QA 3A9RA 5LD2C 2B21A 3SIPA 3MYRA 1KQPA 3QFFA 5CX1A 2C20A 1XZDA 1DJOA 5ARDA 4MQ4A 4QHSA 3M89A 4I9HA 4QL3A 8AT1A 1E64A 3HVRA 3P4XA 3U6BA 1TJ5A 1SUFA 3CO0S 3P20A 3PC3A 1UBOS 4G84A 1Z2AA 5I8WA 1W88B 2R84A 3NO4A 5DHFA 5TQ0B 3LFUA 2OXRA 1PHPA 4D8WA 1T3GA 1YJ5A 1IM8A 2W8BB 2A5DA 1HYBA 4GC5A 4TQAA 2QRGA 3COJA 4YMIA 2OL4A 1NL3A 5HXAA 5B36A 1QVRA 4NWIA 1KP3A 2C5AA 3HB4X 1G20A 3ILHA 3KXIA 1I3NA 2CLCX 2Q9UA 2RCYA 1UBMS 2ZIWB 3ZLTA 4X1YA 4F84A 3SDBA 1S01A 3A3YA 3UN1A 3W04A 4RVCA 3Q3JB 4N9WA 3HSYA 4COOA 4BHTA 3NT4A 5KWSA 3E7XA 3NXKA 1FLDA 3GQBB 4O2AF 1PFGA 2DZDA 3MJHA 3K9LA 4K2HA 2GDJA 5TT0A 3WGZA 4Z9FA 3ULKA 3MTQA 1DTWB 5E4YA 1BW9B 3Q0TA 3ONFA 2JBAA 3CN7A 4L9AA 3WGJA 5C7YA 4G4JA 5JQWA 1XEFA 2C9BA 4P83A 4RD4A 1RRKA 3ZGVA 1M83A 4MQ6A 2LKCA 5H68A 1O3YA 5HMLA 4OUDB 1KDVA 1IN5A 1Z26A 2F64A 3LBAA 5HGXA 4O4LA 5I5EA 3K32A 2XJ9A 4EMSA 3HV2A 1ENYA 2HZ7A 3RLIA 4MGIR 1QH8A 1VZ2A 4P22A 2XZPA 2QPAA 5HFNA 4R01A 3T4PA 1ZJ5A 2AJDA 3TINA 2VRCA 2V96A 4RD3A 3VU0A 3VR5A 1CR6A 3A04A 1P6UA 1UJBA 5JXGA 2QNBA 1FXSA 4N41A 4C4PA 5L3VA 3WV4A 1XTRA 2VUIB 1Q7RA 2IELA 3WOHA 1JIXA 4F1WA 4EI9A 3ZDBA 4NL4H 4V3BA 4L08A 2CJFA 3ITDA 4XEHA 4MDHA 2KX7A 3RK4A 4DPKA 5JZ9A 2M6RA 2EKLA 5DM70 4C78A 4D0NA 1DOZA 2EC5A 2FPSA 3DEIA 3FF1A 1SBQA 2YVLA 3A4NA 1G18A 4H18A 4OHZA 4YV0A 3UHOA 1HDGO 1UMBB 1VE3A 2H4XA 3TLAA 4U5XA 1A9RA 3GCWA 4GPEA 1PSZA 3SOPA 2LIVA 1NN3A 2RGCA 3I76A 5J4HA 1C8BA 1T91A 4BY9E 3TNDA 2GN1A 3G2KA 1SVOA 3QEKA 5CM2Z 3WP1B 4GDMA 3ZKWA 3TW6A 3UICA 4N40A 4F8EA 2I76A 4WNCA 1P5RA 2W00A 2X9NA 3QOXA 1KSJA 5G3YA 1E6CA 3INRA 1F5NA 3LBIA 3GJYA 2E0IA 2P3SA 1A97A 2WUDA 1MOPA 1VKHA 2FOXA 3EY4A 2AUMA 1MW9X 4WFJA 2PKCA 1JR6A 2GEFA 4BB5A 1IJKA 16PKA 2X0JA 1ZOIA 2E82A 2PKXA 3DV0A 3GJ4A 4JB3A 4O2AB 4X8OA 3A9UA 5TJ9A 5JPCA 3JPYA 1ZD8A 1UANA 5FNVB 1F8YA 1S3GA 2QTRA 2VKQA 3HJCA 4R2HA 1LDBA 4ZCQA 4V1CA 2YJ3A 1BX1A 2H3EA 3AZOA 3R5HA 4WZAA 4PBSA 5EMNA 4REQB 1WUYA 4IJWA 3KKEA 2V3CC 3CVYA 2QBYB 1G1AA 1KO7A 3MBIA 3T3MB 1OKKD 1JEAA 1LLQA 3DT6A 3Q8LA 1REQB 3VKGA 3HDJA 3HRHA 4ZV7A 3V1LA 3WJAA 4A6EA 4WEQA 2HT1A 4L5AA 3U7QA 4IDPA 1NNLA 2IP1A 1J1UA 3HYRA 4UC0A 2D1SA 4RMNA 5THQA 4KZKA 4A2CA 2O9JA 4A92A 2FMFA 2XYHA 3SLRA 1K63A 1L1QA 3BERA 3DDUA 3I9JA 4LJ6A 4RD1A 5MF6A 1X7XB 1E2JA 2O2YA 2NO6A 1L7RA 2QE7D 3I9FA 3VJMA 1AKEA 3OPYB 1QQAA 1WW8A 4HMPA 3TJRA 4DCJA 1MXFA 4YRSA 1HX7A 2W98A 2NYAA 2NXEA 2OVBA 3QYAA 1RLJA 3QLUA 4JL8A 3Q1KA 4UXJA 3V7NA 2J45A 1TTTA 4KQ1A 5HA5A 4U9HS 2PU7A 1Z83A 1MNQA 4FMCF 5EOVA 4F7WA 4WKPA 2O20A 4LHSA 5LNK1 3QF4A 3H2BA 3GZ4A 3JYHA 4NI5A 3LHIA 4C04A 3O8CA 2FPPA 1XZCA 1UKVY 1V11B 2V9CA 3LSTA 4WERA 1G3UA 1OSNA 1OZGA 1Z7BA 2WLTA 4PO3X 1L4BA 3LO5A 3HJGA 1T9DA 2BDTA 2WHRA 3RQIA 3Q0IA 1JR3E 1JMVA 1Z47A 5DBFA 5AVWA 1ZX1A 2GN4A 3BXGA 3AR3A 4FQ8A 3TAHA 1XXHA 3DXYA 1RRPA 5CLHA 1K88A 1H2RS 2DHDA 4JDPA 3JQQA 3ZHSA 3KEGA 4GRDA 1ZRNA 1NR7A 5AW1A 4JK3A 1KSFX 1GKIA 1Z7GA 2CE7A 4LC1A 4OEHA 3ESZA 5LP6A 3EPLA 3H2HA 4PIVA 2ZEJA 1R5BA 3RRNA 2HMTA 4ZV4A 5ADWA 3K1ZA 3IA7A 3M82A 3ZWCA 1YCDA 1FYFA 3JARA 4FYKA 1Y37A 2HNKA 4P58A 4D2IA 4ZYZA 1TMOA 2CXQA 4RH0A 2EV9A 3UW3A 2BEJA 1M72A 1WA5A 3DAPA 3I5YA 4JKYA 1NJFA 4BIMA 1QE3A 1E2HA 1SK8A 2PTHA 4RESA 3EHDA 4UVHA 1W87A 2IUUA 2GCGA 2ZJ2A 5FWXB 4JB8A 3DEYX 4HPJB 4N47A 3VSBA 3GFTA 2OHJA 1DB3A 2L19A 4AZVA 1F12A 4DIUA 3F71A 1C1DA 4L7QA 2O8FB 4BO1A 1HF3A 4I4TB 1E9EA 4HNSA 3QOFA 1PGOA 1SUAA 1TYZA 2IKSA 2W6NA 3CJTA 1XTKA 3W5IA 2CT8A 1ETUA 4K9RA 1WSWA 2H07A 4L9SA 2IV7A 4O4IF 3RTCA 4OGGA 2QAIA 5KTMA 1YSCA 1EEXB 3IDZA 2H5IA 5JASA 1KMQA 1M2WA 1P2UA 1I7NA 1Q1AA 1XNJA 2BELA 2HOQA 2JI4A 2XWSA 2ZVDA 2BPOA 2C00A 1PJ8A 1FNCA 3CX8A 3HABA 2WT9A 3I0ZA 4PRLA 1ONPA 2O07A 4PV7A 5TPWB 1SXJD 1Q20A 2BJWA 5IM4A 5F1YA 2MSNA 5CLIA 1OLSA 1JDSA 10MHA 4MIKA 4FTWA 4E3WA 4CU2A 4EUEA 1IN4A 5JZOA 5LIPA 4FYWA 1QP4A 2DWCA 5KOHA 4Z9YA 1IXKA 5AD1A 2Z5FA 3K35A 4ALKA 4UXHA 1XVIA 4EI8A 3WQHA 3RAPR 4RIEA 5IYZB 4BWGA 2WVJA 3PDCA 5M04A 2J4FA 1RADA 2ZPTX 4GXNA 2N3ZA 2ECQA 1UADA 3OU6A 2ZW9A 2FZGA 3W4JA 3HI4A 2VUHB 5E6SA 1F51E 2QTAA 3AIIA 1ORDA 1RKUA 2B7BA 2D2EA 3IQEA 4J4HA 3RF7A 3KKZA 4L4XA 2UDPA 1OJ7A 7YASA 5I8ZA 2XCQA 1TC2A 3R3WA 4P08A 4R2MA 3L0ZA 4YAFA 3SEAA 2WF7A 5GJBA 1CUJA 2QVXX 2R00C 2ZCVA 4HUQB 4Z53A 4YB8A 1FFSA 3K9QO 4CFYA 2KE5A 4DIFA 2I6GA 2GZSA 2RB4A 3PRKE 4M6WB 1QIKA 2YOGA 5H1YA 1ITZA 1EMDA 3BIOA 3W5SA 3IPYA 1QZUA 4Q3AA 1KI6A 1MR3F 1PFQA 2X3UA 3UOGA 4BWVA 3GLFB 5DW0A 5L95A 2P41A 5AK4A 3IFSA 4YI5A 5CBPB 1SBIA 2VAWA 3DW1X 4FINA 4L4ZA 2GSDA 1N2CE 3H8JA 1T1IA 3AUJB 3LC1O 3REOA 1UXJA 4LDJA 4DAOA 5H70A 3E22A 4YIKA 3NKVA 5I9MA 4MAFA 1XKXA 5KQMA 1U7DA 4B7UA 1BH6A 3U7RA 4CKWA 3U1VA 3ICEA 3THYB 1GV0A 3BF8A 4FILA 5EGSA 3T5PA 1RJEA 4KACA 3T7TA 1EKXA 5DX1A 2R6HA 1E1NA 1EX1A 3L1UA 4I9GA 2GA9A 3P4UA 5FO0A 1N2CA 3CX6A 5ADUS 5HKOA 2C5BA 3NKFA 4U6SA 5TXGA 5K6RA 2N47A 3S1AA 2R6GA 1Y4AE 1U1IA 1E5LA 4UBJA 4BNYA 1SVUA 4X71A 3ZHCA 4LXYA 3MGBA 1C8VB 4FEEA 2QW8A 2JGEA 4NMWA 1GRNA 3O84A 4QUJA 1HSZA 1CNFA 4RFVA 1QRSA 2CBGA 3HWRA 4M0PA 3HUEA 4PPFA 3VHXA 9ATCA 1PR6A 1Y5NA 5A4MS 1IY0A 2ZIXB 5ARCA 2PRSA 4YACA 5BRAA 1UBNA 1IQPA 4G9GA 3F49S 4G8JA 3UIEA 2XF2A 1S8NA 1SKYE 1YOVB 3RNOA 1KI7A 4JLBA 3B6MA 4IVRA 3BQNB 1J0XO 4OU5A 1U3VA 4J90A 3RSOA 2OBFA 1O6FA 1Z36A 2WA1A 2H1FA 2QRVA 3OFJA 2GKOA 3U7GA 1LPSA 2J0SA 2VQSA 5HJ7A 1ST3A 4FIDA 4MVYA 4B9EA 3ZY6A 3JRXA 4YX9A 1ND5A 1Z2DA 2R62A 1MC1A 1EFPA 3OZEA 3RTBA 2GCEA 3D64A 3NFYA 1C4KA 3IDFA 4KXMA 4Z0HO 1Q2UA 3BA1A 5GONB 3ZY2A 1E5XA 3CF4A 1MQSA 1XN1A 3EXFB 4QDJA 3LUJA 3HB9A 4CIYA 2I9KA 4LOHA 5AOVA 5HM6A 4R8KA 3ZYZA 2WBLC 3PCXA 1FNMA 4GYYA 1N9GA 2Q2VA 2ZRMA 2OM2A 1XJCA 2FUG1 3PDUA 4HRXA 4KDCA 4UNNA 3HO6A 4LF6B 2C98A 1ZUIA 3LV8A 4MKHA 4QYWA 5EWJB 4Z2YA 2QL6A 2YR0A 3F9CA 4CF3A 4GMXA 2K7FA 1VKZA 2PCJA 2NO1A 2R8PA 4YRQA 3VKWA 4M7PA 2YQZA 1DKNA 1NQAO 2P67A 4PLVA 1PDWA 4GVXA 4R3WA 4RY8A 3GT3A 1N6KA 4X5OA 2XKAA 1N6IA 1LDGA 5E0OA 2XLCA 3D8BA 3KQOA 1NVKA 1YQEA 3RUCA 4CKCA 3IV9A 1PS0A 3DJFA 3PCTA 4C3ZA 1T6XA 5KHLB 4MDYA 5FOUA 5AUQA 4HGQA 4XQEA 2WD8A 1T9BA 4K5QA 1CQPA 4HQNA 1NC3A 1T9KA 4KK4A 4RA6B 1NQ5A 4U3JB 1OXSC 2ZI6A 4BXOA 1Z5VA 3BK7A 1QP7A 3BRWD 3SC2A 4PFQA 5JSHA 1OWNA 4BLVA 4TROA 2Z5VA 2XPCA 4L0MA 4R8LA 1XTBA 4KUGA 2B1IA 1MC4A 3BMOA 3WRYC 1JNYA 1CQWA 3C3YA 5LCXA 4ZA2A 4Z7QB 1WOYA 2WSIA 1BD3A 4GKKB 3KEOA 2AYZA 1UK7A 3L1HA 1N0WA 3WLPA 1OB5A 1GN9A 1R0XA 5EPUA 3LHDA 3HJHA 2WTEA 1A9QA 4MQBA 3W7BA 5GGXA 2DQZA 5B30A 3ZLBA 1OV6A 3SHQA 1DE0A 1YR1A 4JWTA 1AS2A 4HDAA 4ENQA 4JYPA 4WT7A 3KQKA 2XTNA 1JP7A 4Z49A 5CVTA 3COZA 4JJ4A 1E6EA 1MENA 4NK5A 4YP7A 6ADHA 4HFMA 5B3JC 3LY7A 3V7YA 2Q1TA 3Q9LA 4QXPA 2OWDA 4DMMA 1RJWA 3D6MA 1IBMB 3MMSA 3OT1A 2VDNB 2G76A 3GGJA 4TKUB 3AVXA 3IV6A 1I9CA 3HS3A 4YJFA 3J81k 2QX7A 2VSFA 3GFGA 3QE4A 4J91A 4N54A 4DREA 1SUSA 3IUQA 4RLHA 3KL4A 4NZZA 1IXZA 3F8WA 1HRDA 3ST7A 2CZCA 5EIFA 1XELA 3UMVA 2O2HA 1IDN1 5CD9A 2WYUA 3AQ4A 2JH8A 4M1ZA 4TLDA 1WW3A 4LWOA 3QMVA 4BFUA 2WNHA 5IJAA 4M9CA 1ZLXA 2TS1A 3OH8A 5J9FA 4DJTA 2QMQA 1MJFA 1RKXA 4CR8A 4AQYB 4Z1OA 1NAHA 2FUKA 3X2FA 4F91B 1P4AA 3HI6A 4DMGA 4BLRA 2W70A 3QU2A 4GQIA 4WGGA 3ISTA 1XEXB 1Z5NA 4IFIA 2XNDD 2HLHA 2HAEA 1KKLA 1L5QA 2YHBA 4QNNA 1VPTA 4YJ3A 1AUQA 2NTJA 1YVRA 1VGRA 1OGJA 3W0LB 4HO1X 4M9SA 1X38A 2ZYRA 3TEJA 1A2KC 5CVJA 1FX0B 2FMKA 2AMYA 4JMLA 2QPTA 5ALDA 4PYKA 2FZCA 4QRIA 4LNAA 2O7NA 2VDUE 3GAFA 4J49A 3S40A 1O57A 1QIDA 3ECAA 1Y3FE 4IP0A 4MVJA 2J6IA 4B6GA 4ZI7A 4ZKDA 4GXRA 4PLGA 2IPAB 3EFEA 2XNJA 3GRVA 4GPAA 1KFCB 4N9QA 4WHMA 4ZAWA 4D9EA 1N7HA 1WU7A 2RHCA 3D0RA 4CF4A 5JC1A 4UULA 4L4SA 4OUDA 5L40A 2WICA 5U4XA 4MV1A 1XD9A 1D2EA 1TIKA 2G9ZA 2IKQA 2WWRA 3E4CA 3KZMA 4L4UA 1NM5A 4XFKA 1O6ZA 3CUWA 4FT4A 5CJPA 4EW6A 5JFTA 4RTRA 5ALHA 2JZOA 3BMQB 3MWEA 1CQIB 4G0XA 1MXHA 1RS0A 1PSDA 3C87A 1Q1BA 3LPDA 5KSWB 2PJDA 4OI1A 1JU9A 2Z5LA 5E95A 3UT5B 2VHYA 2H8KA 1SPXA 5JZSA 2D8AA 5IYZF 4QJBA 1M2OB 2R7NA 1L5RA 4WJZA 5THKA 2EX0A 4UUBA 5JBQA 1VRVA 2G8NA 3HGTA 5C5CA 1VMIA 3U16A 2VLIA 3BMNB 2JZNA 1NW3A 3L0PA 3URKA 3WGGA 1R6DA 2CDNA 3HR4A 2JIBA 4JT4A 5HDQA 3TRKA 3UF0A 1NJ8A 4BB0A 6CHYA 2OBLA 3RC8A 3RAFC 4EB8A 3PX2A 1YBMA 4JR2A 1IRXA 1FYVA 3CZPA 4DSAA 4QBKA 4XA8A 1E7MA 1WQ4A 3FYCA 5EJAA 3ZJYA 4ENWA 4FFNA 5L4SA 1KK1A 2JFVA 3EUEA 1J56A 2R4UA 4GGOA 1HNZB 4DRYA 4B0OA 3RC1A 3LCRA 4KXYA 2JCSA 2PXXA 4XGQA 3NR2A 1ZAYA 2Z9BA 2CDRA 4G5OA 2I2CA 2N75A 2QRJA 3IQHX 2CNBA 1L4MA 1C0PA 3TYXA 2H1WA 5IXYA 1NBEA 5EERA 1T9AA 3UZUA 1RBMA 2D5CA 4HSGA 4HX9A 4RETA 5AIBA 1CUVA 5LJIA 3QX3A 2DOKA 3RVJA 1RI2A 4DLZA 5HPYB 5FD8A 3ROQA 3PVCA 3BCRA 5AP9A 1BN6A 4U02A 3QBTA 1RXYA 3WGOA 5ECGC 1I1OA 4MVJP 3JQRA 4PZEA 3K6JA 2W83A 3E7FA 4WLEA 4YAJA 4BKRA 5JS6A 2I7CA 4ITUA 5K3EA 4NESA 4EVRA 4DOMA 2NNWB 3PNSA 3VNBA 5D84A 3MTBA 5AJYA 2VA9A 5JLAA 1SOMA 2ZJ5A 3HA2A 3Q10A 4FFRA 3TMAA 5CDFE 1DAFA 5DI3B 4ATNA 2ZIZA 2AOUA 2NO0A 2WYIA 3AT1A 2D2VA 4P4SA 1DCMA 1TRKA 4FNMA 2H65A 1XQWA 1QIEA 2AFIB 1H69A 2G9VA 5KQRA 3CVJA 4II7A 2N42A 3V1YA 1OMOA 1W30A 2CWWA 4QX6A 1FQOA 4ZPJA 5DE3A 3WSVA 3ZU6A 5JJ5A 3KQTA 5BQ5A 1E0SA 1KK3A 1JHPA 4XPZA 3II6X 1KYWA 3NDRA 1U7UA 1DRJA 3CA8A 2EEZA 2I6FA 1G7RA 2Q5HA 5A3JA 2PZLA 4LY6A 1MBZA 2NXNA 1ADJA 4R2WA 1EXVA 1NM5C 3L7BA 3THSA 4YAKA 3FVWA 2CL7X 3KPJA 5IBPA 2BCGY 2AEFA 3GJ3A 4D79A 5K6AA 3PNYA 1C3XA 1A82A 2VH2A 3AOEA 3HCOA 4V2UA 2F3SA 1TMYA 1U28A 3LT2A 2WTXA 3RR2A 4JVLA 3ELUA 4YHHB 2ZTSA 1P2FA 2GSWA 3QKRB 5EE9A 1KH2A 3UB2A 4J8PA 3SEQA 3KZNA 4E22A 1JHUA 4ZIRB 4ZQCB 1SCAA 2OMKA 4D97A 4KE9A 4DRZA 2P2CA 3K7EA 2WIGA 3W1WA 2GZMA 2W6IA 3CLKA 3GLGB 1P9OA 2GM3A 2PHZA 1YQGA 4HNGA 3HJAA 3KVYA 4RVGA 5D86A 2VHXA 4G07A 4BKPA 1JA9A 1MQ9A 4LN1A 1DUIA 2DBYA 5EJGA 1XX6A 2WU1A 4K9OA 1VE1A 4RF2A 2VIIA 4O4HA 4KW7A 2D4AA 5JDIC 3E9EA 4NBKA 5DLQC 3GFFA 1FDRA 3U0BA 1YASA 4EY8A 1OWLA 3DCNA 5JAOA 1ZWKA 2O52A 3CLRC 1UZLA 3DO8A 3GH3A 4P3OA 4LSGA 3S29A 3WYBA 4BGUA 1OF1A 1RI4A 2ZRAA 1T4GA 3AEXA 3RIMA 4LDQA 1GQRA 1JXOA 1QJ4A 2UUBB 2EDAA 2PIDA 3VAAA 1ISHA 1KYIA 3BSSA 3QWBA 4HX5A 4F72A 2Z4SA 1Z7EA 4PCLA 4KFCA 1RIIA 3IJEB 5KIAA 2CLHB 2JGJA 5HIKA 3M83A 4PX9A 1JTFA 1PG5A 4MO2A 4D44A 3RTEA 1SU6A 3GFOA 4IH4A 1PEYA 5HQ3A 4OXQA 5LLTA 2ZDGA 1Z0FA 2OECA 4B82A 2HO4A 3VTKA 2A92A 4PG8A 2F59A 3THRA 1RKQA 5LLSA 4X95A 3NWBA 2ECFA 3QLUC 4K9DA 2ZUWA 1E9FA 3NHLA 2GVNA 3DAOA 1PT9A 1H5UA 1WB9A 2AX4A 2I7XA 5DVZA 3L7OA 2HWUA 3HCFA 5IEBA 1SZJG 4ER3A 1JFLA 1MX1A 2E4VA 3VR4D 3X2SA 1QGDA 3O4RA 4DCTA 1QG0A 4AKIA 1NVWQ 2GHIA 5K0NA 3PUKA 4YRDA 3U44B 2QM7A 3G89A 1QS0A 1YFJA 1Q7BA 1TCBA 3O8BA 5K8JB 4Y2HA 2EBUA 5LYJA 2W2PA 2IH2A 5K51A 4OLBA 1M3SA 2B4QA 3MTGA 1QVVA 1TO2E 1MJ5A 4DSZA 2O8CB 4BRZA 4ZDJA 4DXAA 3FWNA 4CETA 2RGYA 4NC9A 1KIMA 1K92A 3B1XA 5D1HA 2VWHA 3DLPX 4LF4B 1UODA 3BTVA 2QZ9A 4TXLA 2DWQA 5BSEA 5JDCC 3CG0A 4JQYA 2QE7A 3L0CA 4HLNA 4HB0A 5FR1A 2ZIEA 4AL4A 1NF3A 2YV1A 4EIWA 2X6QA 5BN5A 2GFQA 1KEUA 1E94E 2XMQA 1Z5OA 2XVYA 3E5RA 2HSDA 3A7DA 3D2AA 3LZ6A 5TJHA 3N2EA 2Q2NA 3Q5GA 5COAA 1NW7A 2QLMA 1RYMA 3PRYA 4OM8A 1EBBA 5KU7A 1E92A 4ALJA 1QANA 3Q2KA 1CW2B 2Z4TA 1NVXQ 1EB9A 1OIVA 2OAEA 3EH1A 4EWLA 1QGUB 1LW7A 1DEXA 4Y67A 5LQKA 3F6CA 4PTZA 5F3DA 1E0DA 2YVAA 3B13B 1GZ6A 1L9XA 1XF9A 1ZSYA 3FTCA 5DPMA 2NVBA 4DG9A 4D4MA 1N2ZA 1QVAA 1X1SA 1XRLA 4CMKA 3MJCA 2RONA 4N3BA 5IM5A 1NTRA 4X8HA 4IIBA 1SUDA 3SYKA 4AUKA 2Y2UA 4IIUA 4B44A 1FQJA 5BMVA 2QM0A 4JSRA 3RWBA 3WL4A 3DM9B 2CJPA 2YYYA 2WHQA 3U37A 1PFYA 3L8ZA 4BMOB 4JLNA 5EHZA 1X1CA 2LZ0A 2R79A 1LBQA 3BZBA 3LZCA 4MUJA 3KYIB 1MF7A 3HR8A 1NKTA 2QEQA 3ONDA 2MINB 1WUIS 1GEEA 4A0HA 1QLWA 1T10A 3UA4A 2GZHA 3I73A 2IOQA 2BR5A 4I2VA 2NSDA 4EGAA 3ND8A 4MAMA 2Z1MA 2AG8A 2Q9BA 2EAUA 2IUYA 4BUZA 4GOXA 1JHOA 1L7NA 4J9VA 3I52A 4OHMA 4YJGA 3N2YA 5IT0A 3BKWA 1TE2A 1TKCA 2H0AA 4RFSA 3E81A 4TSFA 3KVOA 2JLVA 1ZPDA 2HA3A 5D3ZA 1Y1PA 1U8YA 5JJLA 2AE2A 3TQRA 4AIRA 1WXEA 4ZAFA 5T8KC 3VNAA 1PFKA 3RW9A 2YQ5A 1EGAA 2F1JA 1AQ6A 1D1QA 2A5LA 3SXPA 2Q7OE 4W82A 1N0UA 5CG2A 4CF5A 2PT7A 3L04A 1DBVO 2H5EA 2OUIA 1OVMA 2VYVD 4HDSB 4TYWA 2A0UA 1MU0A 3M5PA 4ENPA 2I2WA 2MT9A 2HWWA 2J3DA 3EA4A 2ZTLA 5L3ZA 1E3LA 3EIQA 1EFLA 1FYWA 2FR0A 4B73A 5EZ5A 3SQDA 2VCHA 4J0HA 1V5GA 3LHSA 2V5VA 1T4CA 3SBXA 3E9ZA 3C24A 3EMDA 4XUDA 3U7HB 5F21A 4KYTA 1GNLA 1SELA 2LCFA 3GQBA 3H6GA 4ZVUA 1XTVA 4BAGA 1NNSA 4RHFA 4AMGA 5B4UA 3QZUA 4K9SA 3K73O 2B5VA 2GM4A 1PVVA 1US8A 3S55A 4Y2RA 4JKOA 4EHLA 4AY4A 2QJFA 3NH9A 3TX6A 2R6FA 3WB2A 3E84A 2Y6UA 3I9V6 1TVKB 3WLRA 1GZ3A 1GFSA 5I9SA 4OPMA 1AN9A 3HYLA 3VDNB 3SQMA 5LMUB 1VHQA 1YGPA 2O1EA 4Z0NA 3X1DA 1WB4A 4OY3A 1XAHA 1ZSVA 2WM9B 1T5LA 4PC3A 3ETNA 4XQCA 4L6CA 2WUEA 1FP4A 4XVHA 3A2KA 1LI5A 3IS3A 2HX1A 3T4UA 2Q9CA 3P2MA 4CFZA 5C1PA 4PYOA 2OCYC 2M6KA 4DC9A 1MPTA 2X7XA 2DFVA 5K1ZA 1CY7A 1M73E 2N1BA 2XYGA 4Y7CA 3S8EA 3LPNA 1WF3A 3QOYA 4MVWA 3VZQA 3DVAA 1ATZA 5SYNA 4DA8A 2ZJ4A 4UEJA 4DV7B 3QHAA 2VJAA 2QG4A 1YRBA 4HPWA 4MZDA 5JZMA 2QVYX 1PFVA 2V97A 3GLT