1U4SA

Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedisulphonic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
307
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 115
structure length 307
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u4sA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u4sA02
4UREA 4NJMB 2VT3A 2YDXA 3EDMA 3ON5A 1R37A 5C7OO 1YGYA 3GGGA 3JQCA 1GL3A 4GWGA 3I52A 1PJQA 2JD1A 3D7LA 3FTPA 3GA0A 1IPEA 2Y66A 4OSOA 5CEEA 1U8XX 3D64A 1NVMB 4DREA 3C7CB 2NQTA 1M75A 4CV3A 2VUUA 5A3VA 3STHA 1R4NA 4WGGA 1UH5A 3QRWA 2VHWA 3WWZA 4IQGA 4W7HA 4BNZA 1DFHA 3K92A 3WJAA 4D0SA 3AY6A 1WMBA 2Q1SA 1GUZA 1NWHA 3GF4A 4E2WA 1I33A 4OYRA 4ONEA 2BH9A 4F3YA 1XYGA 3R3JA 1M6HA 1O94A 1NQ5A 2HMSA 5EN4A 4BL5A 5L4LA 1O8CA 4E5NA 3JQ7A 1FDSA 1RPNA 4DMLA 3LC1O 2IEBA 5KJCA 2GR9A 1ZXLA 1X14A 3WQRA 4BUCA 4XQCA 4M55A 2X1HA 4K6FA 3DB2A 3I9KA 1XKQA 3JSAA 3ZW8A 3EVNA 4AJJA 2AEJA 1B7GO 4JP2A 1BVUA 3INTA 1R12A 2Z5LA 9LDBA 3PYXA 4DYVA 4BV8A 4ZHSA 1AXEA 1SMKA 3F46A 3R0IA 5IG2A 3AM5A 5GZ3A 1PR9A 3TFQA 4FD3A 3VHRA 1V6AA 4RLHA 1I2ZA 3GMDA 4MVJI 2FSSA 1A5ZA 1OC4A 3AOGA 1T26A 2OZPA 1DPGA 1WVGA 1AHHA 2O48X 1P1RA 3D0OA 1S7CA 1TT5B 3WMWA 4BS9A 2OMEA 4QO8A 5ILGA 3QQPA 2VHVA 3GFGA 3GEMA 4OGWA 3AI3A 5ITWA 3A06A 3BHMA 1V9LA 4MIEA 3ZHYA 3ICPA 2YQ4A 4GMFA 1LI4A 2I6TA 1HSZA 5IDYA 1I36A 4LMPA 1M66A 3BTVA 3JQGA 4XJSA 4B3HA 1M6WA 1C1XB 1MXHA 2CD9A 1T2EA 2JFHA 3JYNA 4L9RA 3WQQA 5KVVA 3JD3A 3LC2O 3KYBA 1JW9B 4B4WA 3QVWA 4OQYA 1GV1A 4B3JA 4MVJE 4IUYA 1X15A 2X5JO 4RPKA 1B26A 2W4QA 3JYLA 4CMEA 1PQUA 4I5GA 2DVMA 5C37A 4XX0A 3I9OA 2YJZA 3Q9UA 4PVDA 3GAFA 1SB9A 1BXKA 1WNTA 4GKBA 4KWHA 2VRBA 4IDBA 1E1MA 4INAA 4PVCA 3UHAA 1GZ3A 2X0RA 1PWZA 3BMOA 3F1KA 3DFUA 3KB6A 2FOIA 4A5OA 2I67A 5G0VA 1I3MA 1LSOA 4J90A 5JC1A 4E31A 3HB4X 3TL2A 1X7HA 2EIHA 3Q3CA 3INGA 4ESOA 2P4QA 2RCYA 3LT2A 4R9SA 3K73O 1YRLA 3WBBA 4P4LA 4GSLA 3WWYA 4PN3A 5B4UA 4WLNA 3CINA 3JQ8A 5DP1A 3NJ4A 3OJEA 4I9UA 1HE3A 2DBVO 1NFQA 3HUDA 4URFA 2NADA 5JDIA 3V1YA 1LLDA 4RV9A 2J5RA 3RJ9A 4OAQA 4O59O 1CF2O 3GLQA 4AJIA 1I3NA 3ZH2A 3L4BC 3U09A 1KY4A 3PLNA 3KV3O 3GT0A 5L3ZA 3WGQA 2C29D 4CMIB 2C7VA 3C85A 1XEAA 4CR6A 1IOLA 5THKA 1M76A 4TRNA 3RAJA 2VNAA 3I4CA 3ZZNA 1JKIA 4OL9A 2PKRA 2WJPA 3KYCA 5BSHA 5BNIA 1E1NA 2XXJA 3KHUA 4FIZA 1HYEA 3W8DA 2JL1A 1KOLA 3KUXA 3H9GA 1U5CA 4IY1A 5H83A 5DOVA 5AOVA 2XPCA 4NFHA 4OXKA 1E5LA 4J4BA 1ISFA 3SX2A 3AY7A 2JAHA 3PIDA 4MP6A 4IM7A 5KIAA 2WMDA 4XGIA 3UUWA 4RDIA 1T1RA 4BKPA 5JAZA 4CMJA 4GGPA 4BNMA 3ONFA 4WLVA 3FR7A 3ASUA 3DMYA 3IIEA 5TF4A 5TQVA 1I3LA 2C5AA 1E92A 4UUOA 3SJUA 1PQWA 4AJEA 5HBRA 4QO7A 3A28A 1UDAA 2C2YA 2DBRA 5JDCA 4TKMA 1DXYA 4DA9A 2EP7A 2IZ1A 1K6JA 2Z95A 4Z9FA 1V3UA 2O3SA 4ROSA 4HFJA 1A7KA 1JVSA 3CMCO 5ES3A 3WQSB 5JAMA 1WP4A 3WGYA 1YXMA 4IZIA 1CDOA 3LC7O 3GHYA 2E82A 3NUGA 4R3NA 5FYDA 2PR2A 4KTVE 3MTJA 2NQ8A 3MJVA 1J6UA 2NVUA 2Q3EA 3I5MA 1HZZA 3OQBA 2I66A 4C7JA 2GYYA 1YWGO 2PGJA 3CZRA 2PZLA 4GMGA 5KVCA 5G4LA 3V2UA 3TZKA 3ZV4A 4BMSA 3V5NA 4ZU3A 3PWSA 1G0NA 2P68A 1R4MA 4YT5A 1P1IA 3VKUA 2GSDA 5JCJD 1NPTO 4J1SA 4MJLA 3AOEC 5IAAA 3ZGYA 1JKFA 5IZCA 4BMVA 3ZHBA 5L45A 4CLDA 2CUKA 3GRKA 4J1TA 4TQGA 4WK6A 4ZQBA 5DOZA 3DBVO 1A71A 4DQXA 4BNNA 1IE3A 2FRDA 3JQBC 2ZTMA 2AXQA 2J8ZA 2A92A 4QUKA 3RUFA 1UXIA 1U8FO 1D7OA 4H16A 3UAGA 2OBNA 1EFKA 1IYZA 2A9FA 4GI2A 1DIRA 5G0WA 4QTZA 4TROA 4DLAA 1HLPA 4BO3A 2YDYA 4RO0A 2O7QA 4CV0A 4HFNA 1J49A 4UUNA 4R5MA 1MC4A 4CL3A 1MG0A 1WLYA 2TMGA 3RBVA 1P0CA 1DBVO 4M87A 2AE2A 1RYEA 2Y93A 3CKYA 3ADOA 5F1KA 4YYZA 3S2GA 2AG5A 2B5WA 2WD8A 3WLEA 2NVWA 4CM8A 3ENNA 4HWKA 4LW8A 4RGBA 4IPTA 4AJPA 4WCFC 4Y6RA 5JCJA 2P4HX 2X5OA 3E5RA 2CF6A 4II2A 2BGLA 3O38A 4S3MA 3N58A 1B8PA 1IY8A 2LDXA 3WNVA 1QMGA 1ZSVA 4M54A 2GO1A 4BQRA 3W4KA 1FF9A 4UULA 3ZCXA 3PI7A 3LT4A 4O5OA 1PIWA 3DZHA 4CLHA 3HDYA 1A9YA 1T2AA 2I65A 1DSSG 3BMNB 5LDGA 4BIIA 1CYDA 3PXXA 1MXFA 3ANLA 4RVHA 5F21A 5T8KA 4BGUA 4EI2A 2YZ7A 1VKNA 5DNAA 3DHEA 4HFRA 4I8XA 2OBYA 3JQAA 5TGDA 4KQXA 2DT5A 1U2DA 3VPSA 3HDQA 2IZZA 1ZKMA 5EJ2A 5DF1A 1DHTA 2B69A 2NU8A 1WXDA 3L6OO 4JP3A 4OOFA 1KVTA 2HUNA 4ND4A 3IS3A 4CV2A 3OIGA 4C4OA 1GUFA 5KJ1A 1C0LA 1N1EA 2HMUA 4BNGA 5CDTA 2DUUA 2O3JA 4CUZA 2RIRA 4M8SA 4Z0PA 1YH3A 5ICMA 3R3SA 3AUAA 5FF9A 3TF5A 1Y9EA 1YVEI 4OO3A 3O4RA 1F8GA 1SBYA 4NU6A 5AYVA 1D3AA 4W7IA 3ZWOA 4DPMA 3MOIA 1Y8QB 3K2BA 2F1KA 3AU9A 5J23A 3HNPA 4J4TA 3FNEA 5A02A 5JBIA 4NH4A 1WDKA 3L6EA 4JJGA 5AXDA 1HE5A 1XSEA 2BLLA 1VSUA 4AJ4A 4XGKA 1GV0A 5COBA 2WYVA 3EC7A 2NU7A 3V8BA 4UVHA 3NTQA 1IZ0A 1N9GA 4LSWA 4U7WA 1J0XO 4FSHA 3EGOA 1C1XA 1TVEA 2UV8A 4OOEA 4ALKA 3AK4A 4TVOA 2Y0CA 4JBIA 1GPJA 1HTBA 3FBGA 1NBOA 1SO8A 4BNKA 4NBWA 4CLOA 4WASA 2A35A 2R00A 5U9CA 1PS0A 3NEPX 4UVGA 4DLBA 1K6XA 3P19A 3ZWAA 4CM5A 2C0CA 3VZRA 2ZATA 4DMMA 3ABIA 2AE1A 2DTXA 3HHPA 2PTGA 4AVYA 5L7WA 3GPIA 4U0KA 5T67A 2VNSA 1GZ6A 4EITA 5A04A 1DOHA 4JX8A 3A4VA 3MEQA 4IIVA 4K6CA 5G0SA 5FEUA 1V0JA 2GASA 2QX7A 3RCBA 2NLOA 3GFBA 3I1JA 4LMRA 1XU7A 4JN6B 3C3XA 2G76A 4WJZA 3KEQA 1FJHA 2NV6A 2NUAA 1Y5RA 4AJ1A 1ZEJA 5DP2A 1LDGA 3TRIA 2UUOA 4ILKA 4R69A 4L73A 4YJHA 1NR1A 2B37A 4HKTA 4ALMA 2VUSA 2VWQA 3M2TA 3QIVA 4HY3A 4D79A 4H15A 2WDZA 4CUJA 4YWJA 3K2EA 4E2XA 1DFGA 4B79A 3C24A 3ZN2A 4CMEC 4YRAA 1LEHA 3RUIA 1P1HA 4ALLA 5JYDA 1EQ2A 3ZWCA 5JLAA 1WZIA 4WOJA 3GDOA 1QXSA 4S1VA 4WLOA 1BXGA 4CL8A 3FPLA 3VPHA 1MA0A 3ETEA 3KYDA 3VZSA 3G17A 4ALIA 1DIBA 1O89A 5IF3A 3C1OA 5JO9A 3QSGA 4X54A 3KEOA 3D3WB 1AHIA 2AEMA 1UXKA 4HNGA 3F3SA 4KP7A 3MWEB 5TC4A 4KUHA 4AJNA 1GEGA 1XGKA 5A03A 1L7EA 5JDIC 3PJEA 3RU7A 1E7SA 4EEZA 2ZQZA 1YONA 9LDTA 2POQX 2X6TA 1V8BA 4BO8A 2FY8A 2JD2A 3PVZA 4N5MA 4ZJUA 1E3LA 4QX6A 2Y05A 4NBRA 1OI7A 1IHXA 1PZHA 4XB1A 3BHJA 2OXIA 2I99A 1VJ1A 1LX6A 3L6DA 4XJTA 4MVJG 2Q4EA 3RQSA 3DBLB 4U5QA 1VKOA 3O03A 4I9NA 4W9NC 5CDYA 1TEHA 3ZU3A 1Y6JA 3HADA 4L75A 1FDWA 1ZUD1 4P4GA 3VDQA 4PLHA 2V7PA 1Q0LA 1BTOA 4J2OA 3WYCA 3IAHA 4FR5A 1LLUA 2BGMA 3ZWPA 4YJGA 1AUPA 4EYEA 3OM9A 3KZVA 1C14A 1UJMA 4CR7A 2B4RO 3TWOA 2PD3A 4MKZA 1C1DA 1PJLA 4PG4A 3GH3A 4J1QA 4ZD6A 1KC1A 1E3IA 2D2IA 2A94A 4NHEA 2Y67A 3GGPA 1T2DA 3TZCA 1Y8RB 2J5KA 1QYXA 3PJGA 5K6AC 3WMXA 1PL8A 1YJQA 1MG5A 1ARZA 2UDPA 3PWKA 2RAFA 5JDCC 4DIOA 4PLWA 3VOSA 2JKVA 3CH6A 3TZHA 4E5YA 4A26A 2EV9A 4OIMA 5EL0A 4N5LA 5G0UA 1UXHA 5I7FA 1VM6A 1UZLA 4EDFA 4FQ8A 3KSZO 4NBVA 4FFMA 3OJOA 1JWAB 2BHLA 3M1LA 3DZKA 1E3WA 1PJ3A 2QRJA 2ZTLA 3LVFO 3ZV5A 3HB5X 2ET6A 4DC1A 3DR3A 3OF2A 4NNJA 4PRLA 2GF2A 5CPFA 2P9GA 5K0ZA 3G3EA 1DLJA 4WNCA 3FNHA 3KVOA 2VHYA 2Y68A 1GTMA 2O3UA 5AQ1A 3NYWA 3GAZA 3KOUA 4D45A 3CEAA 1JQBA 4XR9A 1LQTA 2C20A 3HE3A 4NI5A 5BR7A 1PGOA 3DC2A 5IZCC 1Q0QA 2C7GA 4CMAA 5B12A 3GY0A 1D8AA 2VWGA 1WDLA 1PS8A 3E6AA 1ZXBA 1HDXA 4HADA 4YTEA 2IYOA 2DTDA 3ZWVA 3ZWBA 2H63A 1WWKA 2OHXA 1YQDA 3BTOA 4WUVA 4FJ1A 2RH4A 3PRJA 3GUYA 4BNWA 1LDYA 1XWFA 4XA8A 5G4KA 3ZV6A 3H5RA 1YB4A 3QWIA 3L9WA 1PQPA 5CAEA 4NDNE 3V2HA 2X9NA 3JD2A 3WB9A 2OGUA 1GADO 1KVRA 3GC6A 4OH1A 2GZ3A 2YFHA 3AM4A 4EUHA 3GRPA 5JY6A 2R2GA 1YKFA 1B3RA 4IDAA 2PD6A 3EUWA 4R1UA 3PQFA 3ZV3A 1U4OA 4HX5A 1DB3A 4CQLB 3DBHB 4YJFB 5AXAA 4CLEA 4GPD1 2J3HA 1JAYA 1B8UA 1K89A 1OZAA 1P0FA 4DBZA 5I9NA 4CLRA 2HMTA 1KEWA 4IINA 4BO1A 3DAPA 3D1LA 2IODA 3Q2IA 3S2EA 3BA1A 5CHEA 4DVJA 1W0CA 3ROKA 1ENYA 4GX2A 3GNQA 2GN8A 2IE0A 4JBGA 4P4NA 1XCBA 3RFVA 4L8VA 1F0YA 4OKNA 5T8KC 2ZYGA 3E9NA 3GMSA 4RVFA 3TSCA 3VZQA 4IJVA 1DC3A 1O6ZA 3KXDA 4BNXA 1O9BA 3AUTA 3ZNOA 1HF3A 4RVUA 2PA3A 3BMCB 1BXZA 2VOEA 1DEHA 3CSDA 1ZK2A 3PHHA 4A27A 4B4VA 3H3FA 3VH4A 3W8EA 2VTDA 1ZFNA 4WNIA 2SCUA 3PHGA 3KETA 1H6BA 3KO8A 3OETA 4YXFA 3GVPA 3HN7A 1ONPA 1XDWA 5FI3A 1ZJZA 3O9ZA 1GQ2A 1WDMA 2VWPA 2NM0A 3IUSA 3Q9NA 3HDJA 1EVYA 2GZ2A 4XRGA 4OMUA 5JCXA 1I01A 3SLKA 1H6AA 2E49A 1E6EA 3JTMA 1U7TA 4Q3BA 2FR8A 5L4SA 1A4UA 1GPDG 2QQ5A 2UUPA 4R01A 5CG1A 1ISJA 3DOJA 1NM5A 1UAYA 3ZU5A 1HYGA 3RUEA 2Y1EA 1LUAA 2UAGA 3UW3A 5JXWA 3HQ4O 3WGTA 4KTTE 1UXGA 1ZEMA 2V6MA 4CM9D 4WE3A 4BNVA 3FD8A 4J0EA 4E5MA 3GZ4A 1Q1NA 5GMOA 3W6UA 3GEGA 2O2YA 3IJPA 3IJRA 4A7PA 4RCVA 1PS9A 2FR0A 4U0JA 1XHLA 2HJSA 1YJ8A 1DIGA 2V6BA 5ILOA 2R00C 1X0VA 2YW9A 3IUPA 2O23A 4J0FA 2ZYAA 4RPLA 5TT0A 3EW7A 2XF8A 3K96A 1ZCJA 1I24A 1T24A 4OSPA 1R0KA 4NQZA 4BV9A 3AM3A 3RUAA 1YBMA 1I2CA 3HN2A 4HNHA 1PJTA 4R16A 4DC0A 4R1NA 3GDFA 1LRLA 3CTMA 3H7AA 1X7DA 2C5EA 1SEPA 4EJ6A 3WBFA 1IZ9A 1RKXA 3QWAA 3GK3A 3JD0A 3D3WA 2FZEA 4XKJA 2C59A 3SEFA 2BFOA 5LC1A 4EUEA 5JS6A 3E9MA 2J3KA 1NFRA 1PEDA 1R0SA 3I9NA 3UGKA 3AI1A 4XGNA 1DIAA 3WS7A 4Y6PA 4HBGA 4A10A 4RZIA 3PP8A 4D7AA 1Z73A 1Y5MA 2PGDA 2QHXA 3ROPA 3LF1A 2FP4A 3QP9A 2IEDA 3NKLA 1QG6A 2GDZA 4MVJD 2HKIA 4QXMA 5F1PA 4CMGA 5IN5A 1BW9A 3DBLA 5A9SA 2QW8A 4GBJA 4XQEA 3UF0A 2PD4A 3PQEA 3WSWA 1W4ZA 3FN4A 4EW6A 1Q7CA 1CRWG 4YAJA 3TL3A 3EAGA 3TOXA 3OEWA 3F4LA 4F45A 3I9LA 3DBRB 2W2KB 3OICA 4I5EA 5KJFA 1Y81A 1X0XA 1H94A 3VVCA 1LSSA 4B7UA 1ADBA 4XDZA 3F5SA 3UVEA 3H4VA 3DZFA 2WSBA 3U4HA 3RFTA 2PNFA 2YHIA 4MINA 1AN9A 1PL7A 2CVOA 1K6IA 2HQ1A 4R5HA 1HT0A 5LCXA 2O3QA 3MJTA 5JE8A 2NTJA 4CM4B 1DC6A 4YAGA 4BO7A 5G2OA 4M49A 3I83A 4XQGA 1NYTA 3BMQA 3DMTC 4R9RA 4XIYA 1MX3A 1E7WA 4NU5A 4OM8A 1VI2A 4IXTA 1HLDA 4YT4A 1CWUA 1PJBA 3MZ0A 4L4RA 1U4SA 4TKLA 4GH5A 3CZMA 3K8ZA 4GX5A 4YEDA 5CP8A 4FS3A 3V2GA 1C0IA 2PY6A 1ZBQA 1E1LA 2HU2A 2HDHA 1YBVA 3FCOA 1P1JA 1K5HA 4XB2A 5EESA 3AJRA 4J7CA 1XLTA 5HWSA 3ICCA 1N2SA 1CERA 3FSRA 3WG9A 1LBEA 1TLTA 3NGXA 4JK3A 2W98A 3IMFA 5IZ4A 1JVBA 1YL5A 3WGIA 2WYUA 5ADHA 1ISGA 5F5NA 1F12A 3OA2A 2BMAA 3Q11A 4TZKA 1NAHA 3JQDA 3PHJA 3QY9A 4HP8A 4M1QA 5A9RA 5JC8A 1IL0A 4KMSA 1E3EA 2QYTA 5JW6A 3Q1LA 1PSDA 2X0IA 3ZDFA 5TS3A 1W6UA 1YOVB 3PZBA 2WD7A 1M2WA 1Y7TA 4YACA 4H3VA 4DBVO 1LLCA 4XYMA 2Q1TA 1U1IA 5L95A 4RPHA 2GD1O 3INRA 4E5KA 1SOVA 3ZW9A 3AI2A 3DZGA 3H9UA 1DDOA 1I5RA 3IP3A 2DPGA 5HTOA 1QLHA 3G0OA 3U3XA 1VLLA 4FOOA 2I5PO 4QFCA 1VL6A 1C0KA 1UZMA 2ZB3A 4FDAA 8LDHA 1Z7BA 3O26A 1YB5A 5IXSA 1MLDA 1U9JA 1HXHA 1QV7A 1PJ2A 4R3WA 4WECA 3ADPA 3EHEA 1PU2A 4PLCA 1E5QA 1O95A 5HS4A 1O0SA 3I3OA 1ZSNA 3WTBA 1E6WA 4BGIA 2OL4A 5TJ9A 3WICA 4YRDA 4FFNA 3JQEA 2VZ9A 3PGJA 3DFZA 1ZJYA 2XAAA 3BHIA 4K26A 2G82A 4BQPA 2O4CA 3O8QA 1A7AA 4CQLA 3NDIA 2ZYDA 4LISA 1EUCA 3DZJA 3H3JA 5LDHA 2GUGA 4MO2A 4I5DA 4K28A 3V1TC 4NK4A 5GZ1A 2YV3A 1EUZA 2O3RA 4CV1A 5FWNA 2PZKA 4R68A 1Q0HA 4PRKA 3WGOA 4YR9A 4Z3KA 1MFZA 1I30A 1DJNA 7ADHA 2D1YA 4XYGA 1HDGO 5COQA 4Q3CA 1SC6A 4NJMA 4BKRA 1ZH8A 1MB4A 1ADFA 3G1TA 2EW8A 4WOKA 2EERA 1DRVA 1K2WA 3EMKA 2DUWA 4JCOA 4J4HA 2W2LD 3JYOA 7MDHA 4QSMA 1ISIA 2OOSA 2O7SA 1HSOA 3JCZA 4PZEA 3QE3A 2YV1A 3QV1A 4Q3DA 3DWFA 2P9CA 2GN4A 3FBTA 4KQWA 3OHSX 5TX7A 4E6PA 1QR6A 3KLPX 3WYEA 4WPGA 4ZA2A 4IDDA 1ULSA 3RROA 1SAYA 3B1KA 3SBOA 1EFLA 1HE4A 1LDBA 1C3VA 1EZ4A 3AUUA 2ZJ1A 4OQZA 4B7CA 1B0AA 2ZB8A 4LK3A 2X9VA 4D0RA 3Q0EA 3F5QA 2X7HA 1NQTA 2DPHA 4GLOA 1OC2A 2G0TA 5HM8A 3PDUA 5I9MA 1U5AA 1D1TA 2VHZA 3OFSA 5JYEA 1KY5A 1V3VA 3K31A 3RUCA 3UICA 2GGSA 1ISMA 2ZTVA 4WCDA 4IS3A 4MVJH 1ENPA 4ZRNA 5L40A 3OIDA 3ROQA 3GOHA 2IXBA 3FNGA 1HDZA 2EP5A 2VYVD 3ZWWA 3UXYA 4E33A 1F14A 1LJ8A 1JN0A 5KNLA 1EUDA 2P5UA 4PLPA 5JO0A 4A0SA 3PK0A 3TJRA 1H6DA 5B37A 4AJKA 3BYZA 2P5YA 3RU9A 5A05A 4Q3NA 4N5NA 1P77A 5B4VA 3VPGA 1H9BA 4B3IA 3COSA 1TT5A 3ULKA 3U62A 2E6UX 4LRSB 4RL6A 2PH5A 2E4AA 1NVGA 3TN7A 3VTFA 1HKUA 2QZZA 3GNSA 4E2ZA 1MGOA 3C8MA 4Q3AA 3TQHA 1GQQA 1UP6A 2PKQP 1IB6A 1LXCA 2C07A 2DFDA 3GVHA 5T6BA 5A5EA 3GG9A 1R0LA 2BF7A 3WSVA 5HRUA 4WCFB 5BNFA 2YUTA 4OHUA 1P45A 2OO5A 3LLVA 4J7XA 1PJCA 3NTRA 4R51A 2B5VA 4P8RA 3E5MA 1RM0A 4R4JA 2Y1DA 3CPSA 3D5TA 3DTYA 2FWMX 3B1JA 3OQ1A 1UZNA 4BKOA 5T64A 3OECA 1HWYA 4IJKA 4BNIA 2X8LA 4E30A 4IDGA 1AGNA 3ETDA 2JCVA 2Z1NA 4PG6A 3WGGA 3RASA 4BMNA 4BNLA 3DBRA 2W2KA 4BO4A 4GVXA 2R6JA 3K5PA 4NBTA 1HDYA 1NPYA 3QJ5A 4AJ2A 8ADHA 3IQDB 3RC7A 4QECA 2YFQA 4WKGA 5ENVA 1Q2XA 2X22A 5ER9A 4IS2A 1B15A 4KUGA 1ISHA 2IZ0A 2Q99A 1V3TA 3W1VA 4D43A 2VTEA 2D8AA 1BSVA 1R4NB 2AW5A 3LSYA 1H93A 1HE2A 4RPGA 1MFPA 2EKLA 4CMIA 4FW8A 3DL2A 4IGFA 1W73A 1FK8A 2EKPA 3ONEA 2VYND 2FR1A 3DOOA 4D46A 4ND3A 3A9WA 1H9AA 1BWSA 3FRJA 3TZ6A 3EZLA 1PL6A 2PFGA 4FBGA 1EDOA 4QT0A 1E1KA 1HDCA 3SC4A 3JQ7B 4UVEA 5KKAA 2TMDA 4EJ0A 3OSUA 3MJCA 3OJFA 2ZKLA 1ZO8A 4YJDA 1KYQA 4PG8A 3F4BA 2BD0A 3H2ZA 4J43A 4LCEA 4F6CA 1PJSA 4I08A 1PJ4A 1LA2A 1ZNQO 2EGHA 4RJTA 4G2NA 3UCXA 2IXAA 4HXYA 4NMHA 2OFPA 3EZYA 1QRRA 2WYWA 3CE6A 5EQDA 2OP0A 2GNAA 3U5TA 1LC0A 1QKIA 2D4AA 2QG4A 3ASVA 1U7HA 1UDBA 4HUJA 2WE8A 3HSKA 3PZRA 4L0QA 2FPPA 1EVJA 1LDNA 3FTNA 2VYNA 3I23A 3OP4A 1DAPA 5B1YA 5L7TA 4RPJA 2DBQA 4NR0A 1Z74A 3U4DA 1SEVA 3UKOA 4E4YA 3RSHA 4DQVA 4RF3A 3LLSA 1L1FA 3ITDA 3ANNA 5AXBA 2HSDA 1PGJA 1WMAA 5H82A 4JJIA 5EERA 1PZFA 2ZK7A 3MWDB 2AEFA 4PLYA 4EBFA 1Z82A 3JQGB 3QVOA 1U3WA 1TB4A 5IDQA 1TXGA 1DO8A 4PCVA 4CMHA 1XQ1A 1U2GA 3RIHA 4UEJA 1YDEA 4MPDA 2CMDA 4PLFA 4ND1A 2WEKA 1FDTA 4XIJA 3X2EA 3TPCA 3EYWA 3OH8A 4CM7A 1HL3A 2XOXA 4FJ0A 1NP3A 3JD1A 2CZCA 1KERA 2DFVA 3UCEA 3ZNNA 3I6IA 4DPKA 2CSUA 1UUFA 1P3DA 1JLLA 4CM6A 3BMOB 4PZDA 1H2HA 1N8KA 4ALNA 1ORRA 3GNTA 1NX6A 4TVBA 3W4JA 1YBAA 3L0DA 3AUSA 5DZSA 1G6KA 5TNXA 4F6LA 1ID1A 1MUUA 1LDEA 1P9LA 3FNFA 1PR3A 2Y1OA 1HDRA 1ENOA 3JQ8B 3SC6A 5CDSA 4J49A 3WDSA 1FDVA 3WIEA 4D44A 4D3SA 1L7DA 3BZUA 4AJHA 4RVSA 2AMFA 1HZJA 3NX4A 1E7MA 5IN4A 4GX0A 3W4IA 4BGEA 4CODB 2AHRA 1BDMA 3M1AA 3OJLA 4MVJP 1YQXA 4CMCA 2HLPA 3A1NA 3KYCB 1ZZEA 3TFOA 3PHIA 2QIOA 3FHLA 2DAPA 4EEXA 3JV7A 4KUEA 2JCYA 3WNQA 1DRUA 4UEKA 4YT2A 5KTKA 3F1LA 4RLSA 2PV7A 4NZ9A 1GYRA 4H7PA 4D3DA 1R66A 4DXHA 4FC7A 3SLGA 5KKCA 4ZGWA 3BMNA 1DIHA 5CFZA 4Z3DA 3UN1A 2NU6A 1V35A 4IQ0A 4PZCA 5GY7A 4II3A 4A03A 2VWHA 4ZQHA 4WLFA 1KBZA 1NPDA 5EINA 3Q6IA 4N54A 3HG7A 2CDBA 1GUYA 1YS4A 3N7UA 2Q2QA 1A9ZA 1SNYA 1GD1O 4ID9A 3ENKA 5ITVA 1UR5A 4RF2A 4R1TA 2NNLD 2RBEA 4FFPA 1ONOA 1LRKA 1CIVA 3NAQA 1YL6A 1NNUA 2B0JA 3H2SA 3ZI0A 5BNTA 2P9EA 1VPDA 2EJVA 3JQBA 4Y6SA 4BNYA 1QP8A 2QRLA 4JLWA 4KWIA 3ZNQA 1ML3A 5BSGA 4MKXA 4CM1A 2CF5A 5CEJA 5JAQA 1CJCA 1T4DA 4KOAA 3WXBA 2PKQO 3C7AA 4IQ8A 4UUMA 1Y8QA 2JFGA 3IC5A 2NVUB 3QWFA 3C1TA 5JY1A 1XG5A 5DBFA 1LU9A 1NAIA 3ZWMA 1GY8A 3DHYA 2WTBA 3NDRA 4CM3A 2IDZA 3R6DA 1VE9A 2JHFA 2PLAA 4YT8A 1AE1A 2YQ5A 4WCFA 2H1SA 3RUDA 3ONDA 3LT0A 1ULUA 3HJAA 1R4MB 4PLGA 5GZ6A 1Y1PA 2H9IA 3I6QA 2AA3A 4MDHA 2IRWA 3RKRA 3T4XA 4WLEA 4R1SA 3VH3A 4E0BA 5CG2A 5JMWA 1Q7GA 4XQ9A 4WLUA 1IHYA 4B8WA 3H9JA 1T25A 4P38A 3GDGA 4TRMA 5DCUA 2CDCA 2OUIA 3T7EA 3QWHA 4YPOA 2BELA 5ER6A 5KJ6A 3D4NA 2JFFA 1Q7BA 3GR6A 3E48A 4KDEA 1NASA 3LYLA 1WAMA 4B4UA 3PLRA 1QORA 3D3EA 1DAOA 4IXWA 1PTJA 3C7DB 3L77A 3NT2A 1E6UA 3F9IA 4AFNA 5DBGA 2CVZA 4YVFA 1HYHA 1KVSA 1P33A 2X58A 2P91A 3AU8A 1TA4A 3PYMA 5F5LA 4C7KA 4CQMB 1YQGA 1EK5A 4IBOA 3PJDA 4K1LA 3IOYA 2GZ1A 5COAA 4MIYA 4J2HA 3RUHA 1J4AA 1K3TA 4XCVA 1QV6A 4ND2A 3OMLA 4CM8B 3DZBA 2HMVA 4QQRA 2ZIZA 1MP0A 5TSDA 3PFWO 2O50A 1DFIA 4IJWA 3CXRA 1PZGA 4FJ2A 4PIVA 1VJTA 4Y9DA 1RM5A 2FPIA 3GGOA 2Y1CA 4JNKA 4O0LA 1JWBB 4OXYA 3VDRA 5I7EA 2J3JA 3VC7A 5T57A 3TNLA 2LDBA 4ZQFA 3CUKA 5MDHA 3PFFA 2I3GA 2X23A 4FC6A 4D3FA 4FFRA 3PEFA 2ZCVA 1GCOA 1GYQA 3GEDA 3WR5A 4Z9YA 4BNJA 1KS9A 2CNBA 5JMPA 3JQAB 2W8ZA 4AG3A 4BHTA 2PK3A 4DLLA 1F17A 1U3VA 1W8DA 2GERA 3JQFA 1RM4A 4GQAA 2QYSA 3QA9A 4G81A 4J6FA 4N18A 2VUTA 4QEDA 1PGPA 4DRYA 1EVIA 3D4OA 3H9EO 2EKQA 4GWKA 1G0OA 1A27A 3PDJA 5C7IO 1PZEA 4CM9A 1ZK4A 1O5IA 4CMKA 2VT2A 5DDIP 4BO5A 1GR0A 5T5QA 1NWCA 2QZ9A 1ZMTA 3KM0A 2PGLA 5EPOA 4YQYA 4Z0HO 4XR4A 1SCUA 4A2CA 4JGBA 2A4KA 4ITUA 4DIFA 4E5PA 1E7QA 2ZB7A 2HJRA 1CETA 3DXFA 4DUPA 3UOGA 1VJ0A 5AVOA 3ZU4A 1N9GB 2BI8A 4YAEA 5L4NA 3ST7A 2EGGA 3AY3A 4W99A 4XYBA 4IJUA 3ZNPA 4JXKA 3E1KA 4YBZA 2EJWA 3E82A 4GX1A 1JKJA 3MCVA 4IDCA 2AG8A 4YAIA 2O4UX 3ZWNA 4M86A 3AWDA 1VL0A 3OEYA 4CLOB 4BKUA 3JYPA 4JQCA 3EVTA 3I9JA 4YCAA 3RD5A 6ADHA 1H6CA 1YL7A 1Y8RA 4JBHA 4P22A 1UP7A 4XD2A 3RVDA 1ZK0A 2EW2A 3U49A 1H5QA 4U6SA 1LSJA 5A4DA 2Q46A 5JFOA 2Y99A 4MVJA 1Z75A 3PJFA 4CPDA 3PHLA 4LSMA 2ZTUA 3ROMA 3WGZA 2NU9A 2B4QA 3IKTA 1E7YA 1LQUA 4NPCA 3RC2A 3VVBA 2W90A 4MKRA 3GQVA 4J1NA 1ENZA 1KEVA 1X1EA 4CLXA 4NFYA 4IDEA 1QLJA 2FMUA 1CQJA 1HDOA 3ETGA 2ZB4A 4PGFA 3PWZA 1KIFA 4Z0TA 4WEOA 3PQDA 4FFLA 5FFFA 3E8XA 1N7HA 4YJHB 1SPXA 3JQ9A 3M2PA 3NRCA 3IL2A 1JU9A 3MJ4A 5TRTA 4DGSA 2ZQYA 1FMCA 1NR7A 2CFCA 3B1FA 2C82A 4W9NA 1DHRA 4I1IA 3L4SO 4ZN6A 4L4SA 1E3JA 1Z45A 4B8ZA 5F3RA 4RVGA 4E2YA 3AW9A 2OP1A 1FDUA 1YE3A 2PWZA 3NT5A 5I7VA 2X4GA 4TRJA 2VN8A 5KVSA 1E77A 4W82A 2YHUA 4IIUA 5H81A 3T7CA 3DAFA 1BXGB 2G17A 1I10A 3NTOA 1IPFA 4BGVA 3H9QA 3KYDB 4RVDA 3BTSA 2X0NA 3ITKA 3RBZA 3LT1A 1IUKA 3RBXA 3H8VA 2HK8A 2I3AA 4BO0A 5K6AA 3OIFA 3P5SA 2B83A 4FN4A 1ZSYA 1GDHA 1OFGA 3GG2A 4ZQEA 4NG5A 3VKVA 3F47A 1JA9A 3GZNB 2EHDA 1UXJA 3RC9A 4A73A 4I5FA 2I9PA 3NV9A 5IXYA 3PYLA 3V1UA 3CIFA 2NTNA 1DLIA 2RH8A 4PG5A 1OMOA 3DBHA 3LU1A 4YJFA 3P2YA 4AICA 5EMHA 2DC1A 1A4IA 1EDZA 2WE7A 1BMDA 3I4FA 1B8VA 2GRAA 4G5HA 1CEQA 1MC5A 3U4CA 4CQMD 4DL9A 3WFIA 4CMBA 4FB5A 2E48A 5HA5A 1KC3A 4PLTA 4YJGB 4XWYA 2Y0EA 3MJEA 5BSFA 4E21A 4Z9XA 3HFGA 1N1GA 5JPIA 5EQFA 2GLXA 1H2BA 1C1DB 3AFMA 4E32A 3AFNA 4ND5A 3WGHA 5A06A 5IFLA 2HRZA 5KCZA 3U4IA 5CPBA 2BFPA 4ZQGA 2HK9A 3KTDA 3BMCA 1E7RA 2VZ8A 3RI3A 2HCTA 4TZTA 2RHCA 4DPLA 2V65A 4GGOA 1HEUA 1F06A 4GL4A 4EUFA 2H5LA 4KDFA 5C3MA 3QLJA 3ZWXA 3EY4A 1QYDA 1F8FA 3T4EA 3GPDG 4I9HA 4NBUA 4TWRA 4YDRA 2NWQA 1B3BA 3ZHXA 1TT7A 3LDHA 2JJYA 5EIOA 5A5FA 2Q45A 3JQAD 1EMDA 3LQFA 1E3WB 4CQMA 4EGFA 2Q1WA 4GKVA 3C1AA 5DT9A 3FWZA 1X13A 4O6VA 3WOHA 5DULA 4RQUA 5TJHA 5TT1A 3P7MA 3FI9A 3HZZA 1AXGA 2OORA 1I0ZA 4J91A 5THQA 2Q50A 4GVLA 4N7RA 3PTZA 4L74A 2W2LA 3WYBA 3B20A 2QRKA 4NFSA 1WZEA 4YB8A 1CQIA 1XR3A 1RM3A 5I9LA 4J9VA 5B4TA 1DJQA 5L51A 4UUPA 1KVQA 4IGEA 3S2IA 3GHHA 4F46A 2D5AA 4BNTA 2VZ0A 4J7UA 4O1MA 3UH1A 1LSUA 5DCWA 3H5NA 2EG9A 2EEZA 4IDFA 3UCFA 3GVCA 3SJ7A 4OKIA 3S8MA 2PH3A 5JAIA 3PPIA 3OA0A 4YA6A 2NACA 5KVQA 3ZU2A 1HRDA 2P2SA 3GVIA 5U4QA 4LCJA 5G0TA 5G4KB 3F6YA 4XRRA 1NFFA 4L4XA 2Y1GA 3U9LA 1PGQA 4ZICA 2NTVA 1B14A 1EBFA 3BTUA 4LGVA 3G79A 4AJOA 4BNFA 4EZBA 1LRJA 2PZJA 4XYEA 3B6ZA 1JAXA 2Q1UA 1I8TA 2G5CA 3KSDO 3OBBA 4BNUA 1SOWA 1QYVA 1GYPA 2I76A 2AQKA 2NVBA 1WPQA 2FPGA 3M6IA 3BAZA 5I8ZA 1K0UA 3RKUA 3BXXA 5HS6A 1OOEA 3QHAA 2X0JA 4J9UE 4NJOA 3FF4A 4YRBA 3OJ0A 1NHGA 2VYVA 2XXBA 4RZHA 1P1KA 4DQUA 4XZ3A 3H65A 5BSEA 4CLRB 1NXQA 2ZJ0A 3E18A 4DIBA 1EEHA 2V6FA 3LF2A 2VHXA 1VRWA 3BIOA 1GEEA 3LK7A 1KEUA 4BO6A 1U28A 4CR8A 2H6EA 3D4PA 4AL4A 1VSVA 2EXXA 1ZK1A 2F00A 4IMPA 5CDUA 3H6KA 2JD0A 5BT9A 1DRWA 3HFSA 1P1FA 5DN9A 1R15A 1UDCA 3WJ7A 3DEYX 4TRRA 4XDYA 2DM6A 2DKNA 3FR8A 3UFXA 3ANMA 3JQFC 4DTIA 3QVXA 1LC3A 4ALJA 4CUKA 3I9MA 1BVRA 2WWRA 2CDAA 2Q2WA 4CM4A 4YQZA 3S55A 3GN1A 2J6IA 1R16A 4WEQA 5IDWA 1OBFO 1QYCA 1I2BA 1N7GA 3GN2A 3MJSA 2PZMA 2BKAA 4JIGA 5K9ZA 1UP4A 4MVJF 4RF5A 4DYDA 1KVUA 3IDSA 4Y8VA 5F1OA 1U3UA 5U1PA 1MV8A 2FZWA 5L53A 2G1UA 1EBUA 4UVIA 2EWMA 1ZIDA 1D1SA 3NJ8A 3QVSA 1BDBA 3GUCA 3P2OA 4MP3A 1VC2A 3WIDA 4IZHA 2GCGA 1NQAO 3ZWYA 1XU9A 2BI7A 1NVTA 4G65A 4TSKA 4XYLA 3DDNA 3SVTA 2NSDA 1EK6A 1P74A 3WTCA 1T2FA 2BGKA 3DZIA 3X2FA 1S6YA 4EJMA 4IMRA 1XIVA 5A3JA 1T1SA 4L76A 1E3SA 1GAEO 1B16A 2B4TO 2Z1MA 1Z7EA 2BRUA 2X5KO 3A14A 3B70A 1GFSA 1KETA 2FN7A 1ZVMA 3RJ5A 1YOVA 3WLFA 1P31A 3RFXA 5FI5A 2Q4BA 5JSFA 3L9XA 4RORA 3LZ6A 3OQ6A 2D5CA 3DONA 1BRMA 3G1UA 2V6GA 1RWBA 3MOGA 3DHNA 4GAEA 4E12A 1TI7A 3QW2A 4JJFA 2HO5A 4E13A 4FGWA 3KRTA 1FXSA 6LDHA 4FFOA 3KBOA 3E03A 4B4OA 1OAAA 3HWRA 3DMTA 1E0DA 1G1AA 3N74A 2VCYA 1BGVA 2O3TA 4U8GA 2DBZA 5TIIA 2C54A 4D42A 3L4BA 1I32A 4FGSA 4MIOA 5A9TA 4UVDA 3GZNA 1N92A 4PLVA 5KWEA 1EE9A 4J3FA 3JQ9C 3IKVA 1ZW1A 1BW9B 5KJEA 1BG6A 1NHWA 5A1TA 5A9SB 3K30A 2CY0A 3QWBA 1YO6A 2DQ4A 2HMWA 4KZPA 4HFMA 3TDKA 4D41A 4BO2A 3HDHA 4BB5A 3NDJA 2RHRA 1QYWA 4RF4A 5I8WA 2YV2A 1P44A 5MGBA 4OJNA 2JCXA 2FSVA 2D59A 1LTHR 4JROA 2CVQA 4MOWA 2X9GA 5IJZA 3W8FA 4YAKA 1C0PA 2YHIB 4TMFA 1N5DA 1ADCA 1PWXA 4BVAA 2B35A 3GVXA 4BKQA 5ICSA 1T4BA 4R41A 3DAGA 1WW8A 4DWVA 4BNHA 2UVDA 4CJXA 5L9AA 4RQTA 4Q9NA 3L07A 4UEOA 1NTOA 1J5PA 3K6JA 3S2FA 3BMQB 1M67A 4U6QA 2Q2VA 1LLQA 2VQ3A 3VPFA 1JDJA 2HK7A 2O2SA 3R1IA 1XELA 4PLZA 4Z6KA 4Y67A 4OXNA 1QSGA 2GPTA 5C5IA 1EQUA 2WM3A 2ZCUA 2Y1FA 4PFJA 1Y9AA 4O63O 1A72A 2DTEA 1EVZA 4FPXA 5L7YA 3KSUA 3JD4A 4M89A 3DO5A 1PGNA 4K9DA 4LN1A 1UAGA 1ADGA 4NIMA 3E9QA 3IP1A 4BO9A 5BQFA 2Q49A 2IYPA 3H5AA 3CMMA 1ONNA 3VH1A 4BOYA 1H0KA 1GZ4A 1D4FA 3K9QO 4XEHA 3TZQA 5CDGA 5CEFA 1YDWA 3MTGA 2DLDA 1X1TA 4FOSA 1RJWA 1LDMA 1ZMOA 5DBIA 2DU8A 2HRBA 2HAEA 5AXCA 2GN6A 4LVCA 3FPCA 3NT4A 3AOEA 1T2CA 5ENDA 2WD7B 1GCUA 3NGLA 1VL8A 2E37A 4R54A 2EF1A 2AQHA 2J5QA 2YY7A 4B7XA 3DTTA 5JNLA 1DC4A 2BFMA 2VRCD 5DCYA 1EE2A 2YYYA 1XA0A 1YB1A 2C2XA 2VOJA 1ZK3A 2AQ8A 1U3TA 4AJLA 5IDXA 1XQ6A 2X86A 5KOIA 1GQYA 3TOZA 2AQIA 3EK2A 4NK5A 3DOCA 1GU7A 1NQOA 2B36A 1B2LA 3W6ZA 1DC5A 4MP8A 4HV4A 1SZJG 3WX0A 4GSKA 4UAGA 4Y98A 2JAPA 4Q3EA 3PGXA 4QFDA 4FCCA 4LRTB 1BHSA 2BFAA 3ZHZA 4MVJM 4W4TA 3U0BA 2UYYA 4GLLA 4ZRMA 1HETA 2ILTA 3RWBA 4BB6A 3ORFA 4ZVVA 2Y0DA 3VZPA 3DQPA 4LVUA 1JTVA 3S1LA 1KEPA 3KLMX 3O8QB 4E3ZA 4RDHA 2FHSA 3PIIA 3SXPA 2D0IA 1PX0A 4J16A 3VAZA 2J3IA 3VH2A 1Z6ZA 2VRCA 2JHGA 4W6ZA 3VPXA 3FWNA 3G49A 3D5QA 3Q2KA 3JYQA 4PG7A 4Q39A 5C7LO 1I3KA 1R6DA 3VTZA 1X7GA 3WFJA 5TLSA 1RYDA 1LNQA 3QVTA 2D3TA 3RC1A 1IULA 3JQ6A 5I7SA 2GN9A 1SB8A
chains in the Genus database with same CATH superfamily
3CJQA 5I9BA 1IN6A 5I5GA 4GEKA 3AR9A 3EDMA 4LZWA 2CMKA 1NRXA 1OB5A 4OP2A 3V8NA 4EB3A 1W4AA 4HMOA 3G88A 3PFIA 5WRFA 5IANA 1A7JA 3A70A 5JXJA 1SCQA 3I52A 5JH7A 3W5BA 4X8OA 1PJQA 3D7LA 4FMBB 4OHRA 5DBOA 1TW3A 5FQNA 4XD7A 4BNDB 4YQFA 5CEEA 4OSOA 1U8XX 2HPZA 3KHKA 1AKYA 2NQTA 5E6RB 3SR4A 4E5DA 2XTNA 3A1DA 4FQ7A 4F96A 2VUUA 4FMCB 1Z38A 4RK7A 2OWEA 5L3SB 2B7BA 4WGGA 4EHBA 1T15A 1JRLA 2VHWA 3WWZA 4F5DA 1SN7A 4DLPA 3K92A 4D0SA 5KX5A 1WMBA 2CL5A 5TVKA 1GUZA 3MS2A 2PX4A 5KDLA 1N5KA 1V1RA 2PXHA 3GF4A 4E2WA 3HL4A 2YNMD 2R9VA 1J97A 4OYRA 1LPNA 4WZAA 1ODKA 3D6AA 3B2QA 4I2VA 2XUPA 1ESMA 1NQ5A 2QD1A 5EN4A 4QU8A 2W7TA 4BL5A 2IEYA 3MJRA 1Y1SA 3LQ2A 4JYBA 3U7QB 4YJ3F 3JQ7A 5IJXA 5JRJA 1PT8A 1FDSA 1P4HA 3RO7A 1P9WA 4KXVA 2YVLA 4Q24A 2EATA 4BLPA 2GK3A 3WQRA 5EOVA 2HHJA 1QOPB 1MZPA 1OXBB 3DB2A 3IALA 2X2EA 3JSAA 1E60A 4NE9A 3QKTA 4AJJA 2AEJA 3D8UA 2RI1A 3AHHA 1UDWA 2R85A 3NONA 1P9RA 2R8RA 4ARVA 2OESA 3VR0A 2H9YA 2GKGA 2YYSA 3JS5A 5FOTA 4BV8A 1YNOA 4ZHSA 1TECE 1IFXA 4CEJB 4OFWA 4ZMBA 3JPYA 1PR9A 4S1PA 3A4TA 3TFQA 3VHRA 4KQKA 3R74A 2NO7A 5ALIA 4LGYA 3UB3A 4CG2A 1DXOA 1OLOA 2QYOA 1CKEA 2FSSA 1A5ZA 4IIJF 3FWYA 4HDMB 3FHTA 2RGGA 1DPGA 1KJZA 1AHHA 4L8LA 3WDKA 2IH5A 4IEIA 1O5TA 4NX2A 1OGJA 2VA9A 3D0OA 4H0FA 3ZXIA 2AMLA 4UAUA 3T5GA 1FSFA 4QO8A 3OPYI 1A8UA 1RKBA 3GJ7A 3WWOA 4LC9A 2F43A 4JY7A 3LXRA 3VJKA 3KL2A 4I4TB 4OGWA 1BROA 1NURA 4HZUB 3DP9A 4RLQA 1J00A 5DM2A 1ECPA 3ZCVA 3D43A 1QCCA 3G2NA 2IPMA 4MIEA 3ZHYA 4CU2A 2I6TA 1WCIB 5IDYA 4MH0R 2CT8A 4LMPA 2C58A 1DEKA 4MW6A 3TSWA 1M66A 2OV6A 5CJ2A 4OYHA 4QYIA 1M2FA 1NN0A 1NRWA 2DLCX 1HR0B 1R0ZA 1XZIA 2N0SA 4JKOA 4WFJA 4I14A 3I5AA 3Q7TA 4R3UC 4JYZA 2ZOSA 3JALB 4M60A 1POXA 2BFEA 1GV1A 2RGNA 3EASA 4RIFA 3UJ6A 4HATA 2PBLA 4R8RA 3ZBUA 4AS3A 4B3JA 5I7WA 1B26A 3JYLA 3NIFB 4G6ZA 1GQOA 4I5GA 5ALYA 1BN6A 1U6JA 2DVMA 2OXEA 3LVQE 5AMXA 5K0FA 3ESZA 4M9QA 3Q9UA 4UHHA 4KC0A 3LQKA 1SB9A 4JI6B 2LGJA 3IIJA 2WZQA 4COOA 1GZ3A 2X0RA 1XMIA 2GJ9A 1JFVA 4GG1A 4H7EA 1GRRA 4ZVLA 3UK1A 1PWZA 5BT8A 3GRCA 4R6WA 4BLRA 4TOIA 2QKYA 5JISA 5JC1A 4RACA 1C3JA 3MXOA 1L4UA 4HQLA 2GD0A 2I2AA 1SHLA 2A9OA 4WJLA 3F96A 3TL2A 3ZVRA 2DR2A 5A6SB 4NTZA 2RCYA 4LGMA 2HFJA 4R9SA 4CBVA 2J0SA 1VOTA 1T29A 4WLNA 2XA2A 2JFNA 3EXAA 3GU3A 4L9WA 4LRUA 5DP1A 4JUCA 4Z49A 2QVYX 4M9UA 1ZI8A 2DBVO 2TRSB 3UKDA 2HWXA 2NADA 4URHA 1B6SA 5JDIA 1LLDA 2VNIA 4B6FA 2GTHA 5IF9A 2F3UA 4DIKA 4HX2A 3T1VA 1VPEA 4EFDA 1DCFA 2GEUA 1CF2O 5CLHA 5CXUA 3OT1A 3BSWA 4AYXA 4TL7A 4DDHA 3FNIA 1F6BA 2HO4A 1KY4A 4QDTA 3KV3O 3WGQA 5AKHA 4I1YA 2C29D 4UTZA 4QGSA 4B87A 1XCMA 5THKA 3UXMA 2XMZA 1YJBA 2H3EA 5F9FA 3LVBA 2QN2A 3I3SR 2Q0QA 2GAJA 3HB9A 2WJPA 2VSOA 2UZ1B 3KYCA 4XB6B 3QG1A 2GZHA 3HXLA 2OZVA 3T1YB 3OT4A 4FIZA 2CD7A 2D6FA 4C07A 2G71A 4LRWA 3J81A 1U5CA 1QGUA 5DOVA 1TQHA 2XPCA 4DR7B 4MQMA 1MH1A 4NFHA 3T1TA 1C8LA 2DOKA 2FSIA 3LKZA 1CRQA 3E23A 1QK5A 1AO3A 4QYWA 4MCHA 2GRJA 5DGIA 3WWEA 5KIAA 2AZ4A 2DXIA 2VSFA 1RLUA 1T1RA 4BKPA 1NZDA 3OFJA 4OX9B 3A3PA 4GGPA 4BNMA 1T2NA 3ASUA 3SFZA 1N6NA 1ANKA 3DDCA 1RBZA 4AP9A 3U7RA 1I6WA 3OQIA 3HMKA 5A4IS 4C1NA 2BZ0A 4DUZB 5ADWA 1OE0A 1G7TA 3EIOA 3BH0A 2HIMA 5JDCA 4P0PB 1DXYA 2JI7A 2VDWA 4DXDA 1NBME 1Z6YA 4RCYA 5IAGA 4EDHA 1V3UA 2J7PD 3HK2A 2ST1A 1VDMA 2O3SA 4TL9A 3N6XA 4HFJA 4YRTA 4K6OA 3WQSB 3OOWA 3HUTA 1E9VA 1WP4A 1NW6A 1YCGA 2F62A 4IOKA 3IGFA 4IZIA 1CDOA 4WZZA 3AY0A 2W6MA 2ZWOA 3FJOA 5FYDA 2PR2A 4ZOCA 4KTVE 1WHSB 3O91A 2FWAA 1OBCA 2WNSA 3DXYA 5IJ0A 3QUCA 5BV7A 4JT8A 2PS1A 4M83A 3NVKI 3UWOA 1G21B 3S2ZA 1HZZA 1S1MA 3KUCA 2WWVD 1XRMA 2I66A 3HZRA 3I64A 1LPSA 1YVRA 2A7XA 2PGJA 4HLUC 4AO8A 2JB9A 3ZTYA 4GMGA 3V7UA 4ZPJA 5KVCA 2J0UA 1DBRA 5JW6A 2HZ7A 3NHFA 3WA7A 4NESA 1JAHA 4Z4FA 3BGDA 4QGHA 3FIJA 3V5NA 2AJ8A 3AVTA 1WQ3A 2GN0A 1FDIA 1R4MA 4YT5A 1P1IA 1SUFA 2I2BA 1CE8B 3VFDA 4IP0A 1US8A 4BZXA 4J1SA 4MJLA 1SKUA 1Y34E 2BGJA 3BKWA 4O4LA 4ZREA 4BMVA 4KYIB 3L43A 2FZ4A 2XWQA 3GRKA 2Z2JA 2O8BB 2ZS8A 4WK6A 3MMPA 2XCUA 3DBVO 4WMLA 4F4IA 3SLRA 2KE5A 4CF5A 4WAUA 3KQUA 3NZEA 1PW7A 3MPUA 5IC4A 3C3JA 1S2GA 1XKLA 3JQBC 1NYLA 1TF7A 2J8ZA 2A92A 3T5MA 4FHDA 3PDHA 3I2JA 1UXIA 3RS3A 4H16A 1WS6A 1K5DA 3QF4B 1EFKA 3I42A 4H08A 1E9BA 2V7VA 5DEOA 3KQKA 4HDSB 3AEKA 1HLPA 2R65A 4O4JB 4V3CA 2PCJA 3ELYA 4RO0A 4BO3A 1F0PA 1JPVA 3BRWA 4HFNA 5TPZD 4F04A 2AOTB 2BR4A 2FW8A 2C8JA 3HUFA 4CL3A 3E5HA 4P2GA 2R87A 2BEVB 3RBVA 5FWXB 1A2QA 4ENTA 2JJQA 4Z54A 2Y93A 5T3UA 1P0IA 2PX3A 3ANXA 3UMVA 5JAPA 5JH7F 5F1KA 4B3MB 4YYZA 3H86A 1WKCA 3QPAA 5AK4A 4C0BA 1NUUA 4EYOA 1K7CA 1YI1A 1G7RA 1QPBA 1VJRA 4HWKA 3F0TA 2P4SA 3CJTA 4QULA 2ZAMA 2P4HX 2FE4A 3ZDQA 2ZLBA 1VGQA 4FB4A 2BGLA 1MF7A 5KQMA 2FDRA 3N58A 3VYWA 4HVCA 1IY8A 3MMSA 1GPNA 4L50A 4ZV7A 5KX5F 4M54A 5DLPA 1HUQA 2PS3A 4EG6A 3ZXYA 4ETNA 5BSVA 1FF9A 4OAOA 5AHWA 4Z4EA 2F1IA 4NKRA 4A2QA 3SEAA 1A9YA 3ZY4A 2OYRA 5KTYA 3N8NA 3PXUA 4QZVA 3OU6A 4LF5B 1Y42X 1MCZA 4X3PA 2YZ7A 5DNAA 1XAJA 1H8EA 1XTQA 1ZN8A 1NXOA 1ZM3A 2REXB 3BE5A 1FS6A 1PQ4A 2HMAA 2OBYA 5KWIA 5TGDA 4EGSA 3GLFB 1K8XB 2CFTA 4TVSA 3GH1A 4QNRA 2P1RA 4PIMA 1GNLA 3EQ2A 1GSHA 2B69A 4M21A 1KSHA 1WXDA 3BRCA 3L6OO 4JP3A 1CF4A 1T8WA 1GPMA 4KBYA 3IS3A 3E7WA 4OU4A 4CV2A 1NMYA 3WGKA 2G67A 4C4OA 4E6EA 1MDBA 1DKPA 3W9YA 4NDZA 3UZUA 4HXGA 4JA2A 1M8GA 3DFMA 3PDCA 4MKGA 4DMUB 1EJ0A 1UADA 2HPAA 4EOGA 1TU4A 2J9ZB 4B46A 2WVHA 5FF9A 1V2HE 4JFAA 2W6CX 2Q8PA 3OLZA 4PSDA 3OZVA 3O4RA 4YV7A 4RY2A 1F8GA 1PEKE 2Z2XA 1OR8A 4GE0A 2QWXA 1E4EB 1D3AA 3ZWOA 5GV8A 4EHLA 1YVDA 4YDQA 8AT1A 4KVFA 2ODNA 1M74A 4Z4HA 1P5FA 1YR3A 2XT6A 2C04A 5J23A 3EG9A 4N39A 2AWOA 3B53X 1TPZA 3ZVNA 2IUSA 4HZUA 2CBGA 5AXDA 2ZS9A 3LNTA 3ANTA 1XSEA 1Q57A 3JSXA 2IYNA 1GV0A 4AKSA 1O94C 4UQLA 4QOIA 2QS9A 1WSDA 3DLHA 2VDQB 1E1YA 1ULAA 2CNOA 3D1VA 4A8JC 4FSHA 3EGOA 2UV8A 3A1WA 1IHOA 1ZRNA 3GFVA 2BH2A 4MUEA 4N3NA 4S1WA 3KJFA 4YI5A 4EMTA 4EYGA 1KI1A 4KL8S 1SO8A 4LOAA 1A4RA 1V3QE 5INTA 2MDTA 4CLOA 1ES9A 1LD3A 3B36A 5GP1A 1HC7A 5U9CA 1PS0A 4CFYA 1BQ4A 5DGHA 2IPOA 1K6XA 3I1YA 2ZUUA 3ZWAA 4CM5A 3MRTA 4BC1A 1SUSA 1XJ0A 2BEKA 2GZAA 4I81A 4ZIRA 4OQQA 4URVR 3TXXA 1KO8A 1DTEA 3ABIA 4WIAA 3MYRA 1CY8A 5DN6A 5AI0A 3HHPA 4J0CA 2FUKA 7REQB 3GPIA 4U0KA 5T4BA 2VNSA 3MELA 3TSZA 4M0PA 4ZK2A 4ZK6A 2VK1A 3SFTA 4EW3A 4RSMA 2JZNA 1GM5A 1L8QA 2E9SA 2WIAA 5C1BA 3ABQB 1E2JA 3KKPA 5A04A 1BKYA 2YNMC 3C98A 5B6PA 2PL1A 4L8WB 5BN3B 2AKEA 4C30A 2AN4A 2A5FA 2XB6A 4GC5A 3RS0A 5A6SA 1Z56C 1DEXA 2QX7A 3EXIB 2JFXA 3GFBA 3I1JA 4CI0B 1QX3A 2LWIA 2D1FA 1CLEA 1Z4LA 3C3XA 2X40A 2O59A 3LA6A 3GXBA 4BE9A 3EEBA 4M1TA 4DT1B 4AJ1A 4C76A 4B3CA 1GKYA 4XVCA 1CZRA 3TRIA 4GI1A 3V4VB 4F5EA 4EUNA 2EKBA 4WDQA 4LYGA 2ES4A 1G59A 3B9BA 4FHEA 4F86A 5DISB 3JU3A 3THYB 2OGSA 3A6JA 4OGFA 2VWQA 1ORDA 4RV5A 2IP4A 4HY3A 1Z3CA 1F2DA 4YRJA 4DCMA 2QTTA 1ZYUA 1UBKS 7AT1A 2QROA 1ZU4A 5KVAA 5U4XA 1ESCA 4PRZA 1H9CA 4YRAA 1LEHA 1R5BA 2G1KA 3L7YA 3KVRA 3RUIA 1SQGA 3W5UA 2RJ3A 2VJAA 3FAZA 3RS8A 3TJZA 9LDBA 1RAHA 4DZZA 3AH8A 3L0SA 2IYRA 1I14A 2HD4A 5JLAA 1TFRA 4PQRA 4WOJA 5KC8A 1JMKC 3UO8B 2QTCA 4HN4B 4OHWA 1E2MA 3PDIA 4M1EA 2J09A 2Y92A 1G21E 3FPLA 5ED0A 2RKWA 5CCEA 1H2EA 1KKMA 5SZHB 3VZSA 3FVWA 2OB2A 3VO1A 5IF3A 2QT9A 4IIBA 2RC6A 3UXHA 5AIBA 3I9V6 2NZXA 3TW0A 4HTAA 4LJYA 1E2NA 5K0TA 2W48A 2W2VA 3MWEB 2P9HA 1U8EA 3C39A 1XGKA 2XBLA 3DS8A 1L7EA 3OAAD 1SIOA 4R71A 1QRUA 3SZRA 2PKCA 2ZQZA 4ZVPA 1R7RA 5HK9A 1R6BX 3FGZA 4JWKA 3KPYA 3IO5A 3L01A 4M4SA 1NLUA 1QRSA 1PZHA 4ND7A 1Y89A 3D8RA 1VJ1A 2I99A 4UCWA 1SCUB 1ABEA 1Z15A 4PCLA 2GEVA 1BQEA 3L7CA 3K0AA 1WHSA 1T5IA 3KZXA 4I9NA 4W9NC 5F51A 3JX9A 1QFJA 5IDVA 3OTQA 5FI0B 1FDWA 2WIGA 4LJ8A 1KQ3A 1U65A 3ZHOA 3HLTA 3G9QA 3AGQA 2EFHB 1Q77A 3FMOB 1LLUA 3I9V1 2ZRHA 4NYIQ 1JTEA 1ODLA 1PG5A 2W8BB 5KB3A 4JU9A 3ONVA 3ZXXA 1A97A 1EINA 4EYEA 3V3TA 3KSRA 2WR8A 1JKJB 2Z2YA 2BFCB 1AGRA 2MMGA 4LV8B 1KNXA 4MKZA 2ASVA 3AKEA 3R7WA 2GVNA 4DGQA 5MHTA 4HVLA 1FS4A 4FX5A 3GA5A 4D6YA 4G0VA 3CVVA 1E3IA 2XNKA 2A94A 3OWOA 1QIMA 3ZGOA 1OWNA 4DCCA 1T2DA 1QWSA 2AJBA 3KUDA 5FFMA 1Y3BE 2J5KA 1QYXA 2VG8A 2BDTA 2YTZA 2PLRA 3AP2A 4LWPA 3A6ZA 5CITA 4MQEB 4DIOA 3S8EA 1SG0A 3SF8A 2JKVA 4O4LF 3E7PA 4AMVA 3WC4A 3IA7A 1X8KA 3QMMA 5JS2A 3P9CA 3ZJ4A 5F64A 2EV9A 5E4TA 2CXNA 1ZJJA 1PYDA 2NU9B 3GEBA 3H9BA 3K05A 4DLSA 1G7CA 1V26A 4XTRA 2RB4A 3LDFA 1AKTA 1UXHA 2I4IA 1KJ9A 1GXSA 4EDFA 3E3MA 3MGBA 4N6NA 4C4PA 1N2GA 1J2YA 4G4JA 3B51X 3NJRA 3LCVB 4O4JA 3RHFA 3UT5A 1JLRA 5K01A 2P0YA 4PSAA 3HI6A 5FHRA 2J85A 2WY2D 2OO7A 3FWKA 3GLFE 1OVGA 2VTVA 2YIVX 3CV3A 3JATB 5FWXA 1FTQA 2OM2A 4YUWA 2F1OA 3H5TA 4DC1A 5EJ8A 1NOJA 4HGOA 3LCJA 3FCEA 4NV0A 5K0ZA 2CJFA 4WNCA 1I5EA 3ZIDA 5C35A 4UM7A 2VHYA 3KJXA 3TNFA 3NYRA 4IV5A 1P91A 2O3UA 3W5CA 2P2YA 3OZXA 5AVJA 2WA1A 4JBNA 2WICA 3NOVA 4OQPA 4OPMA 2QTHA 3AG6A 3F49S 3O8DA 4BMNA 4D45A 4YCMA 1IN1A 1B1CA 1YKSA 2WP8J 4OQXA 4YHHB 4NI5A 3HE3A 2O5CA 1PGOA 2CJXA 3KL4A 1DINA 4QGBA 2VDUE 5F2NA 4MS1A 4UMDA 3SP1A 1UKBA 1KZYC 3ZY2A 2R62A 4FZJA 5FBHA 4PY2A 1B74A 2Z6QA 4ZCTA 2VP2A 2FU5C 1R6AA 5EMNA 3I1IA 2F3QA 1XUOA 1X8JA 2FRDC 3A9VA 4WUVA 3TRFA 1QH1B 4X90A 3EXEA 3WKBA 4RZQA 4UW9A 1O5OA 3GFRA 3FYUC 4XA8A 2ZRKA 1NMQA 5E6UA 2B4AA 2JNWA 1EA7A 1Z2CA 3WLKX 1Z2NX 5ABPA 3GMIA 2DRIA 3T41A 1J56A 2YWGA 3RFUA 1ZONA 4OH1A 2GZ3A 4TLCA 2YFHA 4EUHA 2X5NA 1QHHA 5AI8A 3STYA 2O1EA 4K2AA 3UMGA 4DSAA 5KQSA 3WLTA 3A9TA 4GMDA 5E4YA 2D74A 5TPWA 2SKCA 1OTHA 3A0RB 4P7JA 3PQFA 2JIZA 2ZAOA 3LJKA 1JR3A 1I4OA 1KIMA 3I01A 1MQAA 1VYHA 2VJQA 3KWMA 4PFKA 4Q7QA 1DWOA 4CQLB 4CLEA 1XQXA 2J3HA 1U5BB 1CZLA 1II0A 3NAZA 4J94A 4MUBA 3TIIA 1DOAA 1OZAA 2G9UA 1GZHB 3VR2D 2Q3MA 5KHLB 3FKJA 1BMFA 4IIFA 1NLFA 3DMNA 3HNRA 3DAPA 2Z09A 4IINA 3WLPA 4C21A 1UK7A 3LW8A 3D1LA 1YR2A 3LHFA 4LJKA 2PKEA 3Q2IA 4K46A 1JHQA 4G1EB 2CMGA 2GETA 1PSZA 4WACA 3WISA 4A0FA 1TFUA 1DPFA 1RR6A 3BA1A 1UFVA 2EJCA 4DVJA 4CEHB 1F51E 3ROKA 4KR2A 1IEXA 2R1VB 1B6RA 4UDXX 1YZQA 4P4NA 3ZGZA 4MEJA 2XSZA 3RFVA 1A76A 3QITA 5T8KC 1UM8A 2ZYGA 3FNRA 4V0ME 2V59A 3BXOA 4KE6A 2JBWA 3T4UA 1DC3A 1UOOA 4UU7A 4W8OA 5FA5A 3PC6A 4ZOAA 4Q01A 3RS2A 3O90A 1C7IA 3X1WA 1PHPA 4YPVA 1HF3A 2INGX 2UUCB 1YR9A 2YFYA 1T0UA 1X1DA 3PUYA 4GZMA 3CT6A 4B4VA 3THWA 2BIFA 2QGNA 1BXRA 5FV7A 3NIWA 1ZFNA 3GJZA 2SCUA 3PHGA 3KETA 4G0WA 3KO8A 3DWEX 3GVPA 2VZEA 5EWMA 7REQA 2ZI9A 5JSUA 2QN6A 3WIBA 1GQ2A 4KRXA 1VFNA 3IUBA 1DWUA 2J3LA 2R6FA 4CFSA 4F1WA 2XWJI 3DJFA 3K5HA 2Q3HA 4KWTA 4NENB 3W7AA 1OH5A 4G89A 1KDTA 2EFDB 4B09A 1EU1A 3CVOA 1E6EA 2BMFA 3BWBA 1AKQA 1Q12A 2WU8A 5DEIA 3TG8A 2A4MA 2Q3FA 4S1NA 4MUKA 4JC4A 5KO2A 1GPDG 2QQ5A 1JBKA 5IWCA 5JWRA 1S02A 3RIMA 3WMRA 4DT1A 1USGA 2XCRB 2UAGA 1IRXA 3HV0A 2FQQA 1FBNA 3OFVA 4KTTE 2WUGA 2WOJA 4KDCA 1EVKA 4N82A 4CM9D 2ZDQA 4BNVA 3UANA 4GGMX 2ACKA 4Q19A 2OPHA 1JFFB 2VXBA 3HB0A 1DWPA 4UUQA 1BU5A 4G5RA 3IJRA 3CRNA 5AKJA 4Q9AA 4CRWB 1U3GA 3I37X 4NZNA 1F9EA 2FR0A 3AVOA 3H6HA 2HJSA 1BU8A 3QNWA 1F2VA 1HORA 2V6BA 4U0JA 3WLQA 4CN8A 2N75A 4G0ZA 4MLPA 2BFWA 3DE6X 4TLEA 2VTKA 5IS2A 3CNHA 3E58A 3I61A 1SU8A 1JS1X 1MO4A 2ZYAA 3EBPA 4RPLA 3U0VA 2XF8A 1ZCJA 4WWHA 1Z4QA 1I24A 1YDGA 1ICEA 4NQZA 3AM3A 3RUAA 1TYAE 3HN2A 1I2CA 1NSYA 4EKYA 2PL5A 3VUEA 3PXEA 4R16A 3HR4A 3EVFA 4D4HA 4M8KA 4RYLA 4DC0A 4YCLA 5G40A 2X0FA 1UMBA 1RJEA 3UA4A 1TUBA 2BMEA 5B30A 3WBFA 4US1R 4W5TA 2RHGB 2SICE 3CB4A 3JD0A 1TCCA 3QWAA 4P86A 4W9MC 1L5RA 1K9SA 2AYZA 5AM4A 3QFHA 4B83A 1U2EA 1NFRA 1PEDA 2ZKIA 3Q7RA 4MLDA 2OD7A 4Z7QB 1DIAA 1PHRA 3EHDA 3HA3A 1U7OA 2F8MA 2WKPA 3PP8A 5HF8A 3SJCA 1CF9A 3BX1A 1M2KA 2P2DA 3FOEC 1AQ6A 2BONA 2DB3A 2PVSA 4KXWA 4NONA 1XP8A 1JSLA 4JD5A 1JT2A 3CVUA 4P3PA 3EYAA 4H7FA 4XJVA 1KE1A 2GDZA 1CR4A 3IH5A 3LA8A 2GPYA 4MVJD 4QXMA 2EBWA 1MJGM 1BW9A 2FJPA 2IH4A 4ARZA 4OSEA 2WA2A 3J80A 2XHZA 5F98A 1K4MA 3UK6A 3DYIA 3UF0A 4Q66C 3SQMA 4YAOA 4JOBA 2BKXA 1UT5A 3FN4A 4EW6A 1CRWG 3SEZA 1BX3A 1X7WB 3TL3A 4DIEA 3O0DA 3TOXA 5C5CA 3F4LA 3M9LA 3I9LA 2W2KB 4I5EA 4M9RA 1DCTA 2BGNA 5EY5B 1H94A 2H4ZA 4ZCIA 2YVKA 1LSSA 5JQGA 4JT4A 1ADBA 4XDZA 4C88A 3DZFA 5KYXB 2WSBA 2BFCA 2FUEA 4JIMA 1EB9A 4U2GA 2YHIA 5I7HA 4KSYA 1NVUQ 1PL7A 4MINA 3QBVA 2QI9F 5KKNB 1TQ6A 4FE3A 4N76A 2XDYA 3MJTA 1WVIA 1GSIA 1P1CA 3P52A 2JCSA 1DC6A 1I7LA 2QN8A 4POAA 1L5NA 4TV9A 4BO7A 3LHDA 1E64A 3VSBA 4ARAA 2ZXUA 2QR5A 3AJ9A 3H1FA 3EOBI 1Z37A 3P4XA 1XF1A 4HLCA 2F3PA 3TI7A 2RGDA 2EBHX 3LKDA 3GEPA 4BFLA 2ZYTX 3I2GA 2GFQA 2JAQA 2QD3A 1VI2A 1ZWLA 3BFKA 1KDZA 1SH7A 3D3JA 1IEQA 2ZRCA 1C3OB 1AQUA 1PJBA 4I1SA 1EVEA 1XXHE 1SKBA 3JVEA 5H9VA 2LZ0A 1EX7A 3K8ZA 4N0DA 4GX5A 2P41A 3HPQA 4HH3C 4WNAB 1T43A 3Q1KA 4ZAVA 2PY6A 1BS9A 4LE2A 5BUSA 3O3CA 2WW8A 3K9CA 3F8TA 5JD3A 4BE4A 2CMHA 3EVDA 3HJFA 1IQPA 3EOAI 1XLTA 1PW5A 3IP7A 2FTKE 4O4JF 3MA0A 3VYTB 1QO7A 4RFLA 2BHSA 1LBEA 4I36A 2EKDA 4MW1A 1TLTA 2XCOA 4J7AA 4JK3A 1GL7A 1AG9A 1JVBA 1TAHA 1FOEB 2QGFA 3AEUA 4LC0A 5K8LA 2I8AA 3FLMA 4NOLA 2Z1DA 2K87A 1GA6A 2PEYA 3X3HA 3KZNA 4RTRA 4HNTA 4LAFA 2ZU0C 4TZKA 1VCIA 3JQDA 3QY9A 5EIEA 5JC8A 2FDXA 1REQA 3VXKA 1G8JA 3Q1LA 3AHFA 1L7BA 1C4KA 2X0IA 3ZDFA 5IW8A 1XO1A 4L8YA 1DTSA 1PT6A 4F1KA 1ESEA 2FFAA 5GIOE 1AZSC 1M2WA 2Q5LA 4X61A 4KHZA 3GLVA 4YRNA 4H3VA 4AZ0B 1W9MA 1EZ1A 2RSLA 1Z18A 3QMPA 2JF0A 2WBLC 2GD1O 1U1CA 1XJWA 3HBAA 3ZW9A 1FS5A 1AT1A 3H9UA 1YI8A 2DQZA 1V41E 1DIOB 1DXQA 1PFKA 1K3FA 2C1XA 2DPGA 3GCGA 4JITA 5HTOA 4KITB 1W0KA 3DCJA 4MI3A 5JXIA 2JBAA 1WPRA 3N0RA 4NWIA 4TS4A 2DHRA 1M0TA 1VMAA 4NU0A 1VL6A 2AFHE 4H4CA 1RBMA 4J0KA 5KC9A 4J8PA 1DX9A 1CR0A 4MV7A 4Q05A 4WX2B 2YL2A 2IKSA 2EFEB 5HFJA 1T3SA 2H00A 5IXSA 4QVIA 5DM1A 3IAUA 2R7AA 4QDUA 4MO9A 4R3WA 1Y6GA 3NOXA 4HVAA 1D1PA 1PU2A 1E5QA 4R2JA 4B9EA 2CCKA 1TF5A 1IBRA 1ZSNA 1NMZA 1Q1QA 4QARA 3PC8A 1S8OA 1KFBB 3ECAA 3V8QA 4WZBA 3WICA 1ZA1A 4HTFB 5H16A 5BPFA 3A9UA 2H2FA 4KYVA 2VZ9A 5KDOA 1HOTA 1ISPA 1JFSA 2XAAA 4LBZA 3VR5A 5K0BA 4K26A 1OI4A 2O4CA 3ENZA 3VI4B 4MSUA 1DRKA 1CEEA 5ELMA 1L5HA 4CQLA 2EBFX 3W5VA 5IC6A 2G70A 1U5BA 4Q4HB 3ZH9B 5L3QB 4OI4A 5L6MB 5C51B 2ZANA 3H3JA 2GUGA 2F3SA 2PA0A 3IDAA 3O93A 3EGCA 4PNPA 5AKEA 2ZJ5A 2KBEA 1NIJA 3KX2A 2DT8A 5JVDB 3LUGA 2PWAA 4NK4A 4YP9A 4FLMA 2YV3A 2YY6A 1JLLB 2VAPA 1OYYA 4B45A 2PZKA 1V5GA 2IYLD 4QTXA 4R68A 4PRKA 5BV8A 2P9ZA 4DXAA 4M36A 2R1VA 5E0KB 1I30A 3R4CA 4DSUA 5JCPA 3TTXA 5D5PA 4D4KA 2G5TA 4XYGA 2O8NA 1SC6A 1XTUA 1JF8A 3SIRA 4BBJA 1QP7A 1WX1A 5DTJA 5K3FA 4WOKA 3EMKA 1Z7WA 1UODA 4MKIA 4N7MA 4KH0A 3N2NA 1PJZA 4HDCA 5B1SA 3WNCA 5IUJC 4IDPA 2F64A 2OXTA 7MDHA 4QSMA 1X7YB 2ODPA 2NZ2A 1ISIA 2R0QC 2O7SA 5FRDA 4YRKA 2QJRA 1HSOA 4A0QA 3VMFA 5EUQB 3QE3A 1XPJA 3DGEC 1U2ZA 3IIMA 1RAGA 2JJ2D 3DWFA 4MR7A 1LK7A 2P9CA 3PR2B 4KQWA 4O25A 5DXFA 5FL7D 3OHSX 3CLHA 1EKXA 2JI4A 1U0HC 3WYEA 4TZ6A 1ZD9A 4B3TB 1OAOC 1MO2A 3C3EA 3QIAA 4JOCA 4ZAWA 4JX9A 1W88A 3KXIA 2IOYA 1SAYA 4QASA 1GZSA 4NC9A 1SCKA 1VMDA 2GHRA 4GOKA 2PQ0A 1WMFA 5CDHA 1XKXA 4ZYVA 3UATA 4ZCLA 2ZJ1A 2EJBA 4ICIA 1B0AA 2ZB8A 3IEUA 5CX1B 3RRNA 3LPNA 1F5NA 1OC2A 4O1HA 4RY8A 4XSVA 1IBCA 2HNKA 2O2GA 4F06A 4NXMB 4JDUA 4O3MA 1A7UA 2POCA 5CFNA 3K31A 2HN9A 3UICA 2XUAA 1LBTA 3L8ZA 4ZRDA 3D3NA 1ISMA 4GWLA 4WCDA 1N0HA 1CQPA 4MVJH 3ROQA 3NC0C 3GOHA 3OTIA 3B85A 2VYVD 1GTRA 4DADA 5C5DA 4PWZA 4DA7A 4LHVA 1P73A 1JN0A 3VDMA 5B3JC 5KNLA 1EUDA 3C5VA 5BWBA 4UM9B 2IHYA 3W06A 4D98A 4C9BA 2MSNA 4D9NA 5KZMB 1QYRA 5IWAB 1PV2A 1H6DA 4AJKA 4LVOA 4PFQA 4G1MB 4ZVMA 3S1SA 3K0FA 3IIKA 1L3BA 1XCPA 3RU9A 1IBMB 4Q3NA 3SSMA 4W5OA 1CUBA 3EZNA 4C29A 3HXQA 2QR2A 1TT5A 3COSA 1N3LA 3HCBA 4QKQA 1XQVA 4EKNB 1MH9A 2I7TA 3H2KA 3LZCA 1GGEA 3A04A 4NNPA 5H9WA 3I1FA 4HXFB 5FOUA 3W1WA 4IF4A 4G86A 4UNPA 1THZA 1WD5A 1OV4A 1U94A 4NCIA 5E8RA 4PN7A 1T5TA 2BGGA 1T9ZA 3R24A 3A3KA 1IXKA 2IGTA 2BF7A 5HRUA 1WNFA 3QOFA 4U7FA 3HVUA 4DWJA 4UU0A 4MHTA 1P45A 2R5WA 3X1XA 4RDXA 4ER0A 5HXAA 3HY4A 4JQZA 1CLUA 4PYNA 4BZWA 4UFNA 3K20A 4G84A 4DS3A 3E5MA 2FRXA 2ZUCA 1V45E 2Y1DA 2CBXA 2EBUA 3D5TA 3KTFA 3OQVA 3NUQA 5KNDA 2PU7A 5T64A 4WA7A 3D2CA 4IJKA 3KSBC 3RREA 4ZTUB 4KGZA 3EXG1 2HSGA 3D7MA 1AGNA 5LKRA 1U80A 2JCVA 1X7WA 2YXLA 2Z1NA 3L82B 3WGGA 2RK6A 4A2PA 4MPTA 4LJ5A 5HQJA 5HM6A 2C2BA 4FXPA 4BNLA 2W2KA 4IJ5A 1UPUA 1QHSA 1XFAA 2D5IA 3IPYA 4GT1A 3OKAA 4B3XA 4C3OB 5IJ9A 4QM6A 2Q7DA 1HDYA 1NPYA 4AJ2A 2NTYC 2H29A 1HK7A 3IQDB 2AMYA 3LPAA 1S4MA 4X41A 5KYXA 1A9XA 3M9WA 4QLBA 2ZSDA 3WP1B 3L1IA 4EYKA 5JQGF 1F0KA 5ENVA 2ZRGA 3V32A 2VDKB 3K9BA 4B2IA 1IM8A 1BD4A 1OXUA 4G5QA 5KTMA 1ZM7A 2QY6A 4U3JB 4Y9SA 3QU2A 4YRLA 1ISHA 1VJGA 2IZ0A 2NAFA 4CTKA 1V3TA 4DB4A 1E6MA 1YZGA 3ENWA 4PNZA 1Z13A 4TV9F 3R3XA 2E4WA 4M87A 1I6KA 2D7JA 4RQBA 3QE2A 1Y6ZA 2AW5A 4WCVA 1H93A 2MTBA 1L6IA 4QAJA 5J40A 3T3EA 2WJIA 1T0PA 3AVUA 3E53A 2FZVA 2B1RA 1B0ZA 2BCJQ 2P9QA 4FW8A 1N9KA 1C3OA 3EBLA 1FK8A 2EKPA 3ONEA 1P5ZB 4Y0AA 2O8CA 3S3TA 3CX8A 2O5RA 4ZCSA 4G8BA 1IJFA 2CXPA 1TMGE 4PPQA 1YDMA 3U40A 3FRJA 1X6VA 1OT5A 1PL6A 3S1AA 1EDOA 5EMJA 4M8NE 3WV4A 3OZSA 2AXPA 5K2MA 1E1KA 1HDCA 3ESQA 2B78A 3WLRA 5AJUA 4A8JB 2TMDA 3GEIA 3LWBA 5HUJA 2G9RA 1ZO8A 1RABA 3DDSA 1QNFA 3OOSA 4YJDA 2C00A 1V9CA 2RG7A 1TKBA 3ZK9A 2X8JA 3VJLA 5HOQA 2BD0A 2GZMA 3H2ZA 4J43A 4LCEA 4B5LA 3S8YA 1N2HA 4AKEA 2WTEA 3OJWA 4ZI5A 2ZYRA 1PJSA 4I08A 1QCZA 2WB4A 1MKYA 1QF7A 2Y1LA 2IXAA 5MF6A 2DEUA 1IWOA 1GITA 3EZYA 5DYTA 2FV8A 1JLSA 2C61A 3AHDA 4HPJB 1VRVA 3ZHVA 2TMKA 5LYYA 2WYWA 3GLKA 1XI2A 2RHLA 4DDTA 3BD6A 1LC0A 2C2ZA 4PANA 1Z0IA 5DIZA 4HYYA 2WKQA 2XQKA 1U7HA 4KO8A 1FQWA 1UBHS 4ITVA 4EJ2A 2VP5A 3AFGA 5BSKA 1ABFA 2FG5A 4L0QA 3TLXA 3NFRA 4Z4GA 4L5IA 3N05A 3UJHA 3I6ZA 3I23A 5K0LA 1AGPA 2QF7A 3F2VA 3NNNA 3UAOA 1DAPA 1CZNA 1JQLB 1Y4ZA 4RPJA 4H77A 3BAFA 1RC1A 1Z6TA 4NR0A 1Z74A 3FI0A 4CG3A 3DVSX 1YUMA 4NECA 4RF3A 4MQFB 3TR0A 3TLGB 5DLYA 4DQVA 1OU4A 3BXPA 1N75A 2D1SA 1WXEA 1PGJA 1WMAA 1S2MA 2HSDA 3KKLA 3N2GB 3VNRA 3IQXA 2FMTA 2RAUA 1PZFA 5JJ5A 2AEFA 2V03A 4EX6A 1Z82A 2C3YA 5KS2A 1F8UA 4G5FA 3ZE6A 1TB4A 5IDQA 4BE7B 2WKSA 3T52A 4QQ8A 1YK1A 4BX9A 3EB9A 1XQ1A 1B6TA 2XAUA 1U2GA 4CG0A 3QBEA 1YDEA 2XH8A 3BF8A 2COKA 1Y48E 2ZJFA 3IPCA 2CMDA 4YFYA 3SPXA 4GDFA 1EIWA 2VJKA 1Q44A 2PBFA 4GOMD 2P2ZA 1IMOA 1G60A 1VE1A 2G4VA 1Z2OX 5ADUS 1QGDA 2HLNA 4Q4HA 4XX0B 5L3QA 3WB1A 1EJ2A 2PZFA 3FFWA 1BJKA 5AW6A 4LOJA 5KREA 2CZCA 1PK8A 4YP1A 1TD1A 2V5UA 2DWPA 3ZNNA 4HDKA 2WQ7A 1RYNA 1XCLA 4DPKA 4FGJA 3BSSA 1JLLA 2FLKA 2QG6A 3CLUC 2UU9B 1U0SY 4U8HA 5DHFA 2XTZA 1N8KA 2ERCA 3GGCA 4TXMA 4XWAA 5AP9A 4M8IA 1L4NA 4KQHA 4MXDA 4OJTA 2BJWA 5CJPA 3W4JA 2A84A 3T5AA 1DC7A 3IMCA 4Q9DA 4L78A 4F6LA 1MUUA 5BURA 3V42A 3LRTA 3OPYB 4RXTA 4TV8A 1PR3A 1SZDA 3VR6H 2CJWA 4V0OA 2P4EA 5BW5A 3SC6A 2VK8A 1JI3A 3WDSA 3WIEA 1OW3B 1TZJA 1V47A 5ENZA 3GCDA 3ZCPA 4D26A 1FUYB 4KAJA 1YRAA 4BP3A 3DDHA 3CEHA 1T9BA 2YWCA 2WWHA 3Q6NA 4RVSA 4AJHA 2R47A 2AMFA 1HZJA 3H87A 3ROFA 4KMRA 1E7MA 1RYFA 5CK5A 3TLYA 4CODB 4BGEA 1ONSA 3BL6A 2J9XB 5LZ7A 1CQXA 2QL6A 3HO8A 1ZOOA 2R79A 2GZSA 4CMCA 1Y6FA 5LJIA 1G2PA 1S9HA 1AMUA 4KWEA 2BGUA 1T6YA 3UW1A 1AHPA 3FHLA 1SIBE 1Y7IA 1XTBA 3JV7A 4TTJA 1OXXK 2Q3DA 1NQWA 5LYJB 2VKTA 4L6IA 3AESA 1RI4A 1V7CA 1COZA 2PV7A 3D0QA 4NZ9A 3O1LA 3VBEA 2Q6LA 3RYHB 4BX2A 4J1TC 1KYZA 3ZHQA 2OCBA 4D3DA 1FFSA 3SLGA 5KKCA 5ITZB 5C53B 2ADFA 3CF4A 4M1MA 1RQLA 1R5NA 3M5PA 2FWJA 2EAUA 4Z3DA 1XDDA 2VAMA 2FUNB 5BYJA 1UMCB 4JC0A 4X8HA 4EG0A 4ZHQA 2X9QA 4A03A 4TZ0A 5D3QA 4ZQHA 2L0XA 1GPAA 1DDIA 2R6GA 5LQJA 4CHTA 3Q6IA 3WL8A 1FUKA 2Q7XA 3HG7A 4JL6A 3ZUPA 2YJ6A 4EO7A 1T5DX 2D2VA 1E69A 3EUAA 4EG7A 1F2UB 1SNYA 4ID9A 3VNBA 4WN9B 4ESEA 3L7BA 4R1TA 1ORIA 1F8YA 5ALWA 5K8IA 5DKFA 3NAQA 1YL6A 1B8NA 2J87A 1U9Z