1U4SA

Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedisulphonic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
307
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 115
structure length 307
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u4sA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u4sA02
2RIRA 1PGJA 4QX6A 1EFLA 2X0NA 2Z1MA 3O8QA 3W4KA 5KVQA 3PI7A 1I24A 1W4ZA 3QVSA 1U4OA 1PL6A 1C0LA 3FNFA 3OM9A 3FTNA 3GHHA 4LMPA 3CIFA 3OMLA 1L1FA 2Y0DA 4GQAA 2VYVD 4J7XA 3JD4A 1T2DA 4KQXA 3DHEA 2C5EA 5KWEA 3UICA 5HTOA 3IAHA 2O2SA 5HS4A 3F47A 5H81A 3ZWOA 5TIIA 4J2HA 4CM5A 4KWIA 1K6IA 1T4DA 4BO9A 2DM6A 5TQVA 4F3YA 1BDBA 1Z7EA 5H83A 1U8XX 5T67A 4EJ0A 5DCWA 4NHEA 4L4SA 1A9ZA 4KUHA 3PRJA 3QY9A 4GBJA 3GZNB 4HADA 3RD5A 2XF8A 1ZK0A 1PGNA 1QYDA 3JQ7B 4L4RA 3VZSA 4R68A 3P7MA 1B16A 1LDGA 2O4CA 2VYND 4R5HA 5AQ1A 3OHSX 2ZB7A 3ROQA 3FN4A 5G4KB 2HSDA 4CUZA 1RKXA 1ZH8A 2O3SA 2AE1A 3JQGA 3I6QA 1A27A 3T4EA 4MVJH 4IJWA 2EJWA 2FSVA 3FWNA 4FFLA 1DHTA 1ZSYA 3GVIA 3WGHA 5IDQA 1YXMA 5B12A 2JD1A 3DC2A 4WCFB 1PQWA 4II3A 4NQZA 2PNFA 4X54A 4OYRA 4Q3EA 1DIRA 4AJ4A 3IKVA 3KVOA 4I1IA 3SXPA 2NVUB 1MC4A 3JSAA 4FBGA 1XCBA 4IPTA 3D1LA 4FQ8A 1QYVA 1ZIDA 2CVQA 3D4PA 2BI7A 1PR9A 2VWGA 3BYZA 4Y6PA 4FCCA 4YJDA 2UAGA 4KTVE 4LCJA 1DOHA 1MX3A 1OBFO 1S7CA 4TZTA 4GLLA 3AM3A 4DC1A 4Z0TA 4ZGWA 3AUAA 2Q3EA 4MINA 2BFMA 1FDUA 1HSZA 4XDYA 3WTBA 5JDIC 4A26A 3LT4A 4B8WA 4WLNA 3HNPA 4XA8A 1G0NA 5I7VA 5IN5A 2GD1O 2YW9A 3LT0A 1P1RA 2NACA 4BO2A 1LLCA 1X15A 1X14A 2QX7A 4TKLA 5A04A 4PLPA 5BSEA 2VN8A 4XRGA 1U8FO 4Y8VA 4IJVA 1LX6A 3ZNPA 2UUOA 5IG2A 1N1EA 2NTNA 3HSKA 3RI3A 4W82A 4FFNA 4E2ZA 4XQEA 3ZU4A 4WLEA 1IPFA 3GZNA 1K2WA 4JK3A 2VUTA 4DPLA 4MOWA 4XR4A 4IJUA 1DJNA 3JQ7A 3VPXA 5DBIA 3X2EA 2NADA 1V9LA 3GPIA 3AY7A 3PIIA 4CMHA 3DL2A 3EDMA 2PD6A 5G4KA 2I9PA 1R0KA 5DT9A 1XR3A 4RDHA 4NBTA 2J3JA 3OICA 3QJ5A 2W2KB 8ADHA 2HMUA 4PGFA 4EEXA 4XKJA 3Q0EA 3E82A 4WCFA 5T8KA 3RFVA 5ICMA 3WNVA 1YH3A 1F14A 1YB1A 4IIUA 5I9MA 4E2XA 1C0PA 3V8BA 1U3UA 3WMXA 4XDZA 2BFOA 4BGEA 2RHRA 3N58A 4AJPA 4OIMA 3GF4A 2NVUA 1GZ4A 2EG9A 4LMRA 5BNTA 1GQYA 2Y1CA 4FC7A 2GPTA 2WM3A 3OQ1A 5IXSA 1ORRA 3L4BA 4RVUA 4E13A 4GVLA 3QVTA 1NNUA 1VSVA 4WECA 4D41A 1X0VA 1IZ9A 3OIDA 4D44A 5COAA 5KNLA 4ILKA 2FR8A 4BOYA 3INRA 3H6KA 4R16A 3TFQA 4AJ2A 1NPDA 1ZK2A 1OC2A 2FOIA 1JA9A 3BTSA 3EW7A 3OF2A 1EVZA 1O89A 3GNQA 4CM4B 4NBWA 4IJKA 4CPDA 4DMMA 1VC2A 4CQMB 4YACA 3WMWA 4AJ1A 4HFMA 4J0EA 3M1AA 3QWHA 3M6IA 1R0SA 2V65A 2I5PO 1P1IA 1RJWA 3DOOA 2X5KO 4K6CA 4WOKA 1DFGA 3LQFA 1X7GA 1CERA 3GPDG 2EXXA 3TFOA 4R1TA 2X23A 1CJCA 1LSJA 5L51A 1EUCA 3GDGA 2ZATA 1XHLA 2ZJ1A 3H9GA 5DP1A 3K5PA 4D0RA 5K6AA 1BW9B 2C59A 1DB3A 1SZJG 1X0XA 2VNAA 4XQCA 3L9XA 3S2FA 3KXDA 3I1JA 4NFHA 4FW8A 5DOVA 1KBZA 2J5KA 2Q99A 1B2LA 1FDVA 1KETA 2XXJA 2YV3A 4GX0A 4FB5A 1NPTO 3DZKA 4BNGA 4EI2A 1UP7A 4NFYA 2W2LA 3IDSA 3I9OA 4BO7A 1MXFA 3NJ8A 1PWZA 4RVSA 2D4AA 3I9LA 4HBGA 4BGUA 1ENOA 4OO3A 4R1SA 5T6BA 5G0TA 3WWZA 1ONPA 2BGLA 3L07A 4FFMA 3CXRA 4LRTB 4CMGA 5CAEA 3WLFA 5A5FA 3WBFA 1PJLA 3AI3A 3HFGA 2O3QA 1L7DA 1N92A 4CM4A 2BGMA 3FCOA 4GX1A 4O0LA 4BMNA 1D3AA 2P4HX 1B8PA 4NBRA 3ADPA 3ZV3A 1LNQA 3GR6A 4ALKA 2NUAA 4CQMA 3DZIA 4RPGA 2Q4EA 1P1FA 4JBIA 5U1PA 5TT0A 2EGHA 1MV8A 1H2HA 2GCGA 1PWXA 4LRSB 3VZRA 1EFKA 2PFGA 3RUDA 4G65A 7MDHA 2WEKA 4YJGB 3L6EA 1I30A 3ZWBA 3U5TA 5A05A 4I9HA 3NJ4A 4ZHSA 1B8VA 1QYXA 3VKUA 3R1IA 1MB4A 4AJIA 4PLVA 5KJFA 5A03A 4TVBA 1WDLA 3PXXA 1YQDA 3PJGA 1SBYA 1JQBA 1PL8A 4IDGA 4W9NA 1BW9A 3ETDA 5DBGA 5DZSA 4NBVA 3LF1A 3RFXA 1UXJA 1QMGA 4Y9DA 3JTMA 4YDRA 3C7AA 4NJOA 1KVQA 1ONOA 3ITDA 5L7YA 3EK2A 3C1OA 1G0OA 5COBA 3OJOA 4UUNA 4YVFA 3WGTA 4CODB 4MP3A 4RPHA 5G4LA 3WQSB 1WPQA 3F6YA 3PDJA 2PZMA 3IJPA 2VQ3A 1Q7GA 3NKLA 1Z73A 2Q2VA 1ZEJA 4YR9A 1WMAA 3F9IA 1OMOA 4EUHA 4HX5A 4U0KA 2Y93A 4BGIA 3KM0A 5I7FA 2O3JA 4WCDA 3H8VA 1ENYA 2LDXA 4ALIA 2NNLD 4IGEA 2AQHA 1XDWA 3ENNA 4ITUA 4WCFC 4DLLA 5T8KC 1RWBA 1ML3A 3HADA 3JQ8B 2XAAA 1PS8A 4EGFA 4KMSA 5AXCA 3L6OO 2FR1A 1NFRA 1TA4A 3WWYA 5JMPA 1PJQA 3RUCA 3UCEA 3L4BC 4BNJA 3M2PA 1Y7TA 3R3JA 8LDHA 4E5PA 3FBGA 2CUKA 1U9JA 4LCEA 1P33A 2IXAA 3TOZA 4YT5A 1GQ2A 4RF4A 3LT2A 2Z95A 4ZVVA 5HA5A 3NT5A 2Q2QA 3U4DA 3G1UA 4JGBA 4EW6A 1V0JA 1LQUA 4Y6RA 4E5NA 1VJ0A 3JQAD 1UXGA 4O5OA 4S1VA 2B4RO 4OGWA 4DLAA 4B3JA 1F06A 3PHIA 2YFHA 4R5MA 4CM8B 4K1LA 2DTXA 1PQPA 4GKVA 2P9GA 4NFSA 1KC3A 1NM5A 1NVGA 4IM7A 3WIDA 2W8ZA 4ZU3A 4MVJG 4J2OA 5L4LA 1Q0QA 4E32A 3WGZA 4DIOA 3HHPA 1ISIA 5K6AC 1YDWA 4GX2A 2Y0EA 3H2ZA 1IULA 3S2IA 1NR7A 7ADHA 1O8CA 4CV0A 3BTOA 2Z1NA 1E3SA 1R4MB 3DBLB 4FGWA 1N9GB 1NQ5A 1YE3A 2AHRA 3QW2A 3VPFA 1NWHA 3SJ7A 3JQ8A 4HNHA 2HJRA 4NPCA 4IQGA 5EMHA 3NDIA 2YZ7A 3S55A 4CV2A 2JFHA 2IYOA 2YUTA 3O9ZA 4PLWA 3JYPA 4A7PA 3NV9A 1P1KA 4JP3A 3TZQA 4ZICA 3FSRA 5F5LA 4ZQFA 3K2BA 2JD2A 1YB5A 4Q9NA 3VH3A 1YJQA 1YOVB 2PGJA 2YY7A 1GFSA 2G82A 1MG5A 4JIGA 1B3BA 1MUUA 1PGPA 2CVZA 2Q46A 4L76A 3RUHA 2P5YA 4TRMA 3GN2A 1OFGA 5AXAA 1DLJA 4OMUA 3KYCB 4OHUA 2VTEA 5G0WA 3VH4A 1BRMA 2E4AA 2V6FA 4TROA 1Q7BA 3D3WB 4PLZA 1GAEO 1R12A 4CMJA 2WWRA 4RDIA 4Y6SA 2B69A 2G5CA 3WICA 1ZMOA 1HZZA 2VHWA 2OBYA 2OBNA 4BNUA 5EN4A 2DT5A 4Z3DA 1YB4A 5GZ6A 4QEDA 1IYZA 2VWQA 2PZJA 2Y68A 4RV9A 3QIVA 3K31A 2GZ2A 2HK9A 3GZ4A 1UAGA 2IEBA 1YBAA 2J5RA 5LC1A 1BDMA 2OMEA 1HXHA 3ZWXA 4DWVA 1I2ZA 5L7WA 3DBVO 2A94A 2I66A 1E7RA 2VT3A 3QSGA 5BSGA 1DRUA 1YO6A 4Z9YA 4E30A 4PRLA 4W9NC 4Y67A 2EV9A 5ITVA 5L9AA 4JBHA 3T7CA 4MJLA 4RF2A 5EQFA 1M6HA 3ZW8A 2DVMA 1ADCA 1I32A 1N9GA 1D1SA 1YJ8A 4HWKA 4M55A 1I0ZA 4EJMA 3KSUA 3AW9A 4QUKA 1UDCA 1QR6A 3EVNA 3ZI0A 1NHGA 4BNZA 3FF4A 1P0FA 4GI2A 3AOGA 2GR9A 3W8EA 3DQPA 4N18A 3JD0A 4M86A 1D8AA 2O7QA 3ZH2A 2O50A 1R66A 4FN4A 1YOVA 1WAMA 4ZQHA 9LDTA 2Q49A 2X0IA 3H5NA 2C07A 3K92A 3KEQA 4XQGA 1PJ4A 4O1MA 1O95A 3KYCA 4XYBA 4ZQGA 3VH2A 1FJHA 1Y1PA 4AJHA 5A1TA 4PG8A 3U4IA 5TNXA 3D3WA 3O03A 3L9WA 1ADFA 1JU9A 5CFZA 1ISHA 3GEGA 3D4NA 3UN1A 3WGQA 3GMDA 2WTBA 3I52A 4YJFB 3H9QA 3O26A 4RZHA 2JKVA 3NGLA 2ZYGA 5G0VA 1DC3A 1N7GA 3JQ9A 3WGOA 2ET6A 3IJRA 1K3TA 1UH5A 5TX7A 3WX0A 4J1TA 1A5ZA 1DJQA 1KVRA 1GD1O 4Q3AA 3I9MA 3AK4A 1VJTA 2JAPA 3QQPA 1QORA 4Y98A 1O0SA 1LC0A 3IS3A 1KOLA 1QYWA 5CDSA 3FTPA 1PU2A 2AW5A 1P0CA 1O6ZA 3OJLA 5TGDA 1T24A 4BKPA 3D3EA 1QV6A 1L7EA 2OUIA 4WEOA 3IL2A 4Q3CA 3KV3O 1I3MA 3C3XA 4PLFA 3DBRA 3JQ6A 5F21A 3QA9A 3TDKA 4XEHA 3PHJA 4ND1A 3VC7A 2Y05A 2Y1FA 5CEJA 4OH1A 4DA9A 2NV6A 1MP0A 4IDBA 3TL3A 4D45A 3WDSA 3MTJA 4WLOA 1LSSA 2PLAA 4CM9D 4QTZA 3AUUA 2NTVA 3MJVA 3TZCA 1HF3A 3UH1A 2B4QA 4II2A 1HE4A 1C1DB 4NJMB 3U9LA 5DF1A 1I3NA 3OIFA 1F12A 3SX2A 3DHYA 4BO8A 2OO5A 1LXCA 2HMTA 3JD1A 1GEGA 1YVEI 2G0TA 1NPYA 4OM8A 1I2BA 1NHWA 3TZHA 1NVTA 3ABIA 1DEHA 1PL7A 2DUUA 4FC6A 4BKRA 4YJFA 2X4GA 4FS3A 4K6FA 4ALJA 3OP4A 2C54A 3EVTA 3H9JA 4JP2A 4JXKA 3ZHBA 5JNLA 2A92A 2FPPA 1JLLA 1YL5A 1LU9A 3EY4A 3ON5A 3RUEA 4E2YA 3UOGA 1LSOA 1E7SA 1ZK1A 4ZRMA 3AU8A 4OXYA 3NYWA 2EIHA 2P9CA 2VOEA 2I67A 1K5HA 1NTOA 3INTA 4DYVA 3BTVA 1I3KA 1HE5A 1E1NA 1XLTA 3V2HA 4A2CA 3MOIA 5F1PA 3JYNA 3PYMA 4BO1A 3KSDO 2D2IA 4L9RA 1EUDA 3PQDA 5I9LA 4CMEA 4AFNA 5KVSA 2B36A 2X1HA 3B70A 3P19A 1NR1A 3E5MA 3G0OA 1ISFA 2J3HA 2YFQA 4RLHA 4XYMA 1VKOA 4ROSA 5L40A 1CWUA 2GZ3A 5KJEA 3OQ6A 2DFVA 4O59O 1C1DA 1FDWA 1WZIA 5THQA 5AOVA 2AMFA 4FOSA 4L0QA 3ULKA 1E1KA 3PGXA 3RASA 4OXKA 1WDMA 3ASUA 4IS3A 2DFDA 4J7CA 4LVUA 3ZCXA 5DCYA 2FSSA 3ZHZA 4AICA 2VHXA 1UXIA 3L6DA 2O48X 1GU7A 1PJCA 2GERA 2VRCA 5AYVA 4A0SA 4YRBA 3JQDA 1DC6A 1X7DA 3ZWYA 1LLDA 3NRCA 4CLRB 2JFGA 1B8UA 1TT5B 4PLYA 1SEPA 2GN6A 4OSPA 3UXYA 4Z9XA 1V6AA 4OKNA 2P4QA 3DONA 4KTTE 4ZJUA 3DOCA 2Y1GA 1N8KA 1KY4A 1XSEA 3VPHA 1MGOA 3WG9A 5HBRA 5JS6A 3TL2A 1KERA 4XCVA 2VHYA 3DEYX 1I36A 3WFIA 2FZEA 3B1FA 1ZUD1 4BO0A 2VWHA 2VWPA 4LISA 1QKIA 1LDYA 5T57A 5FI5A 2JD0A 3Q6IA 1VL0A 4IQ0A 3UCFA 5CPBA 1AE1A 1U5CA 4YQYA 1HDCA 1EVJA 2CDBA 4JJIA 5DDIP 3PYLA 4RPKA 3PGJA 4FJ0A 2JCYA 4P38A 3EGOA 3NTRA 5HM8A 1N7HA 3JQ9C 4BO3A 1T2FA 3DR3A 1KIFA 2OOSA 2D3TA 2DU8A 4J4HA 1H6DA 2PZKA 4AJJA 1G1AA 3UUWA 3DBHB 3AI2A 1AXGA 2QIOA 5JE8A 1A4UA 5CDYA 2TMDA 1FF9A 1PZFA 4NDNE 1DC4A 4UEJA 4WEQA 1EE2A 3GDOA 5L4NA 1KVTA 4IDFA 1R15A 2H5LA 4WE3A 5IZCA 5A06A 4E31A 4CMBA 2PKRA 2ZYDA 1U2GA 3DB2A 2BKAA 5A9RA 1XKQA 4CLRA 1TT5A 3QWIA 1RYDA 4TRNA 4W7HA 3IKTA 3DZJA 3JQBA 2AA3A 5GZ3A 1O5IA 3MWEB 2AQKA 3PJFA 4NBUA 3ENKA 4U8GA 1ENZA 4JN6B 4TWRA 5C7OO 1FK8A 5IZ4A 5CEFA 3ICCA 1BXGB 3C1TA 4MKXA 4DXHA 2HAEA 4XYEA 4B4UA 1DIAA 3E1KA 1HL3A 4CJXA 3EZYA 2BD0A 2ZQYA 3WTCA 3NT4A 1U7TA 1H2BA 2GO1A 1LQTA 1T1SA 4OQZA 1YQGA 1UXKA 1ARZA 2NVBA 3TN7A 3KOUA 3RWBA 1KVUA 2P5UA 4RQTA 5IJZA 2X0RA 3OEYA 3SC4A 1GUYA 4MVJD 1F17A 2TMGA 1Q0HA 4RORA 2NSDA 3KSZO 3UHAA 1SOWA 2X5OA 5C37A 2GZ1A 1JKFA 1KY5A 3JV7A 3ONEA 2EKQA 5T5QA 5CDTA 2J5QA 2HMWA 3PLNA 5JCJA 3AUSA 3H3JA 1T26A 4CLXA 1J49A 3PZBA 5JYDA 2CD9A 2OORA 4BMSA 4PLCA 2JCVA 1I8TA 3F1LA 3DBHA 4U5QA 4WK6A 3JQFA 1GADO 1K0UA 2CFCA 3GVHA 3OSUA 3DMTA 4CUKA 4FFOA 3JQCA 3IIEA 1Y8QB 1ZFNA 3I4CA 3LVFO 4DPMA 5JAIA 4CMEC 5JAMA 1M75A 3SEFA 2VCYA 1ZK4A 3GDFA 3PFWO 5GMOA 1SAYA 1OC4A 1GV1A 1BHSA 2HK7A 3KLPX 3QP9A 2BHLA 2J3IA 1GQQA 2YDXA 3U3XA 2O3TA 4B7UA 4MVJM 3N7UA 4XWYA 3UW3A 3ANMA 2X9GA 2HRZA 1BXGA 3SLGA 3OEWA 5I9NA 1PIWA 4RVHA 1WNTA 1BXKA 2AQ8A 4ZRNA 3V2GA 2AEFA 4L74A 3WJAA 3BMCB 1SPXA 3PFFA 1NBOA 3I5MA 3RJ5A 2I65A 3RU9A 2D59A 3PVZA 1ID1A 1VL8A 1P3DA 4OQYA 1Y5MA 3TOXA 2ZTLA 4GMGA 3QLJA 2X6TA 5L45A 2ZTUA 3ZDFA 3DZHA 4CLOB 5A02A 4UEKA 5FWNA 3BZUA 1WZEA 2QZ9A 1EDOA 3QWBA 2R00C 2JAHA 5B1YA 2E49A 5CDUA 3NDJA 4PG7A 3GT0A 4MP8A 1SCUA 3TPCA 6LDHA 4JJGA 1LTHR 1XWFA 3IP3A 2Q4BA 4J4BA 5JO9A 3RBZA 4DQXA 1M2WA 4ND5A 3D5TA 1DBVO 1A7AA 1Q0LA 3G49A 4EYEA 2LDBA 4R54A 4BL5A 4BNNA 3ANLA 2OFPA 1W73A 3S2GA 1Y8QA 3CMCO 2GRAA 5K9ZA 2UUPA 5JCXA 1GYRA 4RLSA 4NU5A 2W2KA 5KVCA 3MJEA 1U1IA 1HDRA 1ZK3A 2ZB3A 2FPGA 3ZWAA 4I5EA 3SVTA 1VL6A 3BAZA 3K6JA 4FSHA 3ZWMA 1DFIA 1CQJA 3MOGA 3TJRA 1UP4A 2PGDA 1WLYA 3WYEA 2DBVO 3S8MA 5MGBA 2CF5A 3GRPA 2ZTMA 4ID9A 1P1HA 1GUZA 3IMFA 3B1JA 3BMCA 4YTEA 5A9TA 5IZCC 3I9JA 3KUXA 4MDHA 4EUFA 1W0CA 5IAAA 4CLOA 1ZVMA 3F4LA 4AJEA 4ONEA 4YBZA 1C1XB 4KZPA 1Z82A 3JQBC 1C3VA 4NZ9A 2B5VA 3WGIA 1QSGA 3A14A 3I3OA 4EITA 5TT1A 3CMMA 1SOVA 2QW8A 3JYLA 4E4YA 1Q7CA 3D7LA 1PZEA 4UVGA 2GNAA 2OHXA 4J0FA 5A3JA 1QV7A 2Q1UA 4GAEA 3RROA 5B37A 4N54A 1ISJA 4C7KA 1CRWG 2NU7A 1EVIA 1ZSVA 4PZDA 4U7WA 4BV8A 3W4JA 1UXHA 3QWAA 4HV4A 4WASA 4IZHA 1Y8RB 2GSDA 3ZNOA 3U4CA 3ZV6A 2PK3A 1BG6A 3C7CB 1YWGO 1PJSA 3I4FA 1UAYA 3I83A 2H6EA 1PGQA 1IOLA 2CVOA 4HFJA 3DTTA 1ZNQO 5C7LO 4GWGA 3Q9UA 3WQRA 4BB5A 4XD2A 3JQFC 2B0JA 4LSWA 2AEMA 1EMDA 2YQ5A 3DMTC 3E9QA 2Q50A 3GK3A 5G0UA 3VPGA 3A1NA 4N7RA 1R0LA 4CMKA 4BO4A 4ALLA 2EHDA 2QYTA 4H7PA 3WOHA 3ZZNA 4B4VA 1Y6JA 4XYLA 3TZ6A 4YT2A 5HWSA 1UZLA 5F3RA 2GDZA 4M8SA 4ND4A 3FPCA 2W4QA 5I7EA 4RPJA 2WE7A 4K9DA 4GGPA 3WR5A 2YV2A 2W2LD 4DMLA 2I99A 4MP6A 4YJGA 4Z6KA 3VOSA 2HLPA 1PX0A 2VZ9A 1LDEA 4FFPA 1NASA 3WB9A 1UDAA 4BUCA 1Z6ZA 1Z74A 2DTEA 4CM6A 1P44A 1U3TA 1Y8RA 3GHYA 4JBGA 1DAOA 3LZ6A 1EZ4A 1VE9A 1CIVA 4XQ9A 4LW8A 4CR7A 4ZD6A 3WS7A 5C7IO 1Z45A 2DQ4A 3DZFA 3FWZA 2PKQP 4CQMD 3RU7A 1ZSNA 1IHXA 1ZCJA 5TJ9A 1U3VA 2BELA 4J91A 5L4SA 1IE3A 1TVEA 4J9UE 1B26A 4HNGA 4M1QA 3BXXA 1X7HA 2O7SA 4YCAA 2Q1SA 4MIEA 1R37A 3DDNA 4CM3A 3RKRA 5A9SB 2BI8A 4I8XA 4BNXA 1A71A 5KTKA 4I08A 4R51A 1J5PA 3AUTA 4MKRA 1KEWA 4BNTA 1WXDA 4W99A 3CZRA 1GPDG 3RVDA 4AVYA 4LN1A 4M87A 1JVBA 5IDXA 2GUGA 3LLVA 5C3MA 4QXMA 5C5IA 5IFLA 2O2YA 5CG1A 4FIZA 9LDBA 5DN9A 4Q39A 5JO0A 3P2YA 3I9NA 2HMSA 4KDFA 1LI4A 4YEDA 3M2TA 1EEHA 4CL3A 5I8WA 1RM3A 3FHLA 4P8RA 1E5LA 4R9SA 1FDSA 4IQ8A 1E3IA 3V1TC 4H3VA 5ENVA 2WYVA 2QRKA 3PHLA 1RM5A 2O3RA 2EERA 3U4HA 2FRDA 2ZQZA 3DAGA 2Q1TA 3PHGA 4R4JA 1U5AA 4XRRA 3GN1A 4MIYA 3ORFA 4CM1A 4UREA 5B4VA 3DO5A 4W6ZA 1N1GA 4UAGA 4CM8A 3EUWA 3H5RA 2Z5LA 1E0DA 4B4OA 4J6FA 4D42A 5JC1A 4Q3NA 2C29D 4TKMA 1DXYA 1JKIA 5A9SA 2WYWA 2VHVA 4M89A 2WD7B 4CM7A 5IDWA 2C2XA 3WYBA 4ND3A 4P4NA 1GZ3A 4GWKA 4YAEA 3ZHXA 3I6IA 4RVFA 5CG2A 3R3SA 4ALNA 4DQVA 2EJVA 2AG5A 4YT4A 4XZ3A 3DBLA 1R4MA 3K2EA 4TRRA 5COQA 4F6CA 2CY0A 3U09A 4RZIA 1B7GO 2BF7A 4DVJA 2IDZA 3PTZA 3UGKA 1MA0A 3LYLA 2EWMA 3E9MA 1YGYA 1V3TA 2NQTA 3CEAA 3OIGA 1K6JA 4J1NA 3X2FA 1EK5A 4ZN6A 2JCXA 4IY1A 3W1VA 1RPNA 3WSWA 1PS0A 1IL0A 3F5QA 3OJEA 2D0IA 3C85A 5JY1A 5JXWA 1HDXA 3AM4A 1VKNA 2HK8A 2HQ1A 3PEFA 4NK5A 4TQGA 5BSFA 4XR9A 1UZMA 2DBRA 4PVDA 5F1OA 5L7TA 4WKGA 1AGNA 3KTDA 3ZU3A 2DKNA 4CR8A 2PH3A 3DOJA 5KIAA 1Y5RA 1JN0A 1B14A 5IF3A 1YRLA 2CMDA 3QVXA 1B0AA 1QLJA 1SB9A 3GOHA 3TZKA 2EP7A 3FR8A 4B79A 1E3LA 2WD7A 3IP1A 2NU8A 2BLLA 4IDDA 3KO8A 4P22A 1RYEA 3DAPA 4R41A 1C0KA 3WFJA 5THKA 2Y0CA 3K30A 2WSBA 5J23A 3U0BA 2IODA 3K8ZA 4JNKA 1HYGA 4F6LA 3HDYA 3BHMA 1NAIA 3D0OA 4PZEA 3LK7A 1H6AA 5ES3A 3T7EA 1T2AA 5ILOA 1YKFA 2YHIB 4DL9A 4INAA 3NT2A 3OBBA 2IZ0A 1BTOA 4L4XA 4J4TA 1PSDA 2C0CA 2VUSA 3QWFA 2V7PA 3MTGA 4LVCA 5I8ZA 2ZYAA 4OOEA 2PV7A 4R3NA 3WBBA 2GN8A 2XOXA 3AY6A 4QFCA 2BRUA 1ISMA 5TSDA 3VKVA 3GEMA 1BVRA 2YQ4A 1EBUA 5F5NA 2P91A 3LC2O 4XJTA 3PIDA 4RCVA 2FMUA 3GVXA 4UULA 1CYDA 4WLUA 2HUNA 3Q1LA 2GF2A 4P4GA 4DLBA 3DZGA 1WWKA 3RBVA 5U4QA 4JROA 2BFPA 2CNBA 2ZJ0A 4IS2A 3DFZA 3HN2A 3INGA 4IMRA 3JD2A 1GYQA 1ZKMA 1LRKA 1VLLA 1XG5A 1JDJA 2NWQA 2FY8A 5EERA 5KOIA 3D64A 3OQBA 1DC5A 1ULUA 5G2OA 2I3AA 5EINA 3ZGYA 1ZW1A 3D5QA 1ZJYA 2YJZA 1EQ2A 4J16A 3E9NA 3O38A 4IBOA 5DOZA 3CSDA 2P68A 3AFNA 2O4UX 1GL3A 3C24A 2VUUA 4MPDA 4BHTA 3NGXA 4I5GA 2RHCA 2I3GA 2VZ0A 3BTUA 3H9UA 4BO6A 2YHIA 4NIMA 3C7DB 5H82A 3ADOA 4KOAA 4DIBA 2FZWA 3GGGA 1PTJA 4TMFA 2X22A 3GMSA 4UUMA 3EAGA 1XU7A 2VYNA 5ITWA 1HZJA 3JQEA 3PJEA 4NJMA 5EJ2A 4CL8A 5JAZA 4EEZA 1ZXBA 2AG8A 1GY8A 3DMYA 5TJHA 4IDAA 3E48A 4HXYA 4M49A 1VJ1A 3CZMA 3FI9A 1VRWA 3MJSA 2CSUA 2X58A 4O6VA 4FD3A 4OAQA 4EUEA 4PVCA 2WJPA 1HKUA 4FGSA 4OSOA 1P1JA 1QYCA 2AXQA 2FHSA 4MVJI 1SB8A 2GGSA 3CKYA 4MVJE 3A06A 4PG4A 4O63O 3HG7A 3HUDA 6ADHA 1AN9A 3JYQA 3K96A 4HFNA 1HTBA 1X13A 2R00A 2X86A 3WLEA 1HDGO 2PZLA 5TRTA 3W6ZA 3LC1O 3ETEA 1SMKA 1GPJA 3PWSA 1DRVA 1EK6A 2W90A 2PR2A 1MXHA 3GY0A 3QV1A 3E6AA 3FNGA 1NQOA 4NK4A 3VTFA 4PRKA 2CZCA 2V6BA 3W6UA 4QFDA 4CUJA 1NVMB 2Y1EA 1I10A 2RBEA 4JLWA 4BIIA 4YAJA 1ISGA 2DC1A 4IDEA 2Y1OA 4B7XA 5MDHA 3W8FA 4Z3KA 3P2OA 1E3EA 2X9VA 3NTOA 5FI3A 3KLMX 3B1KA 5KKAA 4IIVA 4RL6A 4RQUA 1XYGA 1H6BA 4FPXA 3Q3CA 2ILTA 3G79A 5L3ZA 3CTMA 4J43A 4CMIB 2VRBA 4BKQA 3ZWNA 3PLRA 1QLHA 4LGVA 4IINA 2PWZA 2EEZA 3DWFA 4KDEA 3QHAA 1BVUA 4NI5A 5B4UA 1I3LA 3KRTA 3T4XA 1HT0A 4YA6A 3PWKA 4YYZA 1M6WA 3VPSA 4N5MA 4DGSA 3AI1A 3JD3A 1JWAB 1TT7A 1WMBA 2O3UA 1FDTA 3G3EA 1JWBB 2ZB8A 1LC3A 4CQLB 1ZXLA 1A4IA 3COSA 1V8BA 4F45A 1DRWA 1YONA 3JCZA 4D7AA 3P5SA 4R1UA 3RCBA 4DREA 4GPD1 2ZIZA 4NNJA 2HKIA 4YJHB 2NVWA 3PZRA 1A9YA 5EIOA 3SBOA 4D43A 4YAKA 1LUAA 3V2UA 3CPSA 2WE8A 3MWDB 4U6QA 3HB5X 4XB2A 2X8LA 1Z7BA 2BFAA 3E8XA 1ZEMA 1DIHA 1JAXA 2VNSA 2VRCD 1DLIA 3Q9NA 4W4TA 3MZ0A 3RIHA 2RCYA 1I2CA 2XXBA 3V1UA 4QSMA 3GAFA 2JHGA 2D5AA 3GRKA 5JFOA 3PP8A 3UKOA 1N2SA 3IC5A 2ZB4A 1Q2XA 4R01A 1SNYA 4ESOA 2YYYA 4WNCA 4FR5A 4CMIA 3AOEA 1H93A 1UUFA 2V6MA 4ZQEA 3TF5A 3S2EA 5DULA 5AXBA 4XIJA 3V5NA 1F8GA 2GLXA 5DBFA 1YDEA 3ZWVA 1K6XA 4E12A 2X0JA 4OXNA 5CDGA 4UUOA 3KHUA 5JPIA 3MEQA 4WLVA 4RF5A 2PTGA 4CQLA 4IUYA 1OI7A 1DIBA 4GVXA 2OL4A 3WXBA 1W6UA 4WLFA 3LF2A 2C7GA 3KETA 2F00A 4GMFA 3BMNB 2VZ8A 4YJHA 2B5WA 5T64A 4EDFA 5BNFA 3MJTA 1EUZA 2EF1A 1DHRA 1LJ8A 3HN7A 4HP8A 4H15A 2JJYA 1FXSA 1NQAO 2EGGA 2IZ1A 4IXTA 2A35A 4QO7A 3IOYA 2QHXA 4E0BA 3LDHA 4QT0A 3LLSA 4RJTA 3VDRA 1E7QA 2I76A 4AJKA 4C4OA 1LLQA 3RBXA 2HDHA 3WSVA 2R6JA 1XIVA 1KC1A 3GA0A 1GV0A 2V6GA 4BMVA 4H16A 5IXYA 1F8FA 5DNAA 5A3VA 1Z75A 4CR6A 4NU6A 3ZV4A 2JFFA 1C0IA 4TVOA 1D4FA 1BGVA 1LLUA 4RVGA 2B35A 1NFFA 3WYCA 2OP0A 1DO8A 3OJ0A 4CMCA 1I5RA 1Y9EA 1D7OA 4KWHA 4YT8A 2X7HA 3U49A 4DRYA 2VOJA 4URFA 1OOEA 5KCZA 2DBQA 1RM4A 5EL0A 1YBMA 4DBZA 4MVJP 1HEUA 2HCTA 3F1KA 3B6ZA 3CE6A 4ND2A 3RFTA 1EBFA 1H0KA 4I5DA 1XQ1A 3JQAB 5I7SA 3G17A 4HFRA 3W8DA 3AJRA 4NH4A 1P31A 3RC2A 1AHHA 1WP4A 3HDQA 1E7MA 4BNMA 1HDYA 2PKQO 1E7WA 3CH6A 3KYBA 4BB6A 5JCJD 3E5RA 5JAQA 2Q2WA 1Y81A 2DPGA 1IHYA 2EKPA 3O4RA 4DTIA 4QECA 1M66A 3PPIA 3SC6A 4AJLA 4FJ1A 5KJ1A 3F5SA 3BMNA 4B4WA 2QQ5A 4EJ6A 3QVOA 1UDBA 3AM5A 4NMHA 1R6DA 2X5JO 2UVDA 2OZPA 1E1LA 4W7IA 1U4SA 4BNFA 4DC0A 1MG0A 1ZO8A 2YV1A 4KUEA 2ZKLA 5GZ1A 1E3JA 3GG9A 4BVAA 1PJTA 3ZN2A 5ICSA 2DUWA 1ONNA 2O23A 4K28A 1UJMA 1NP3A 1R4NB 1E1MA 3HFSA 2NTJA 3ZU2A 1IY8A 3E18A 1HSOA 1WW8A 3F3SA 3FD8A 1DAPA 3H7AA 3QVWA 2CDAA 3DFUA 2Y99A 3DZBA 4UVHA 2Q45A 3PWZA 4Q3DA 5L53A 1GZ6A 4B3HA 2PGLA 1SEVA 2H9IA 2HJSA 4DUPA 4UVEA 4DYDA 3IUPA 3RUAA 4E21A 1BMDA 4OOFA 1PR3A 1E6WA 4PZCA 1YQXA 2AE2A 3EYWA 4UEOA 3JQAA 5FFFA 3ROKA 1EDZA 1XA0A 3HWRA 3LC7O 1HE2A 1W8DA 1EE9A 1E92A 3ZU5A 4WGGA 2Y1DA 1BWSA 1A72A 5AVOA 3TQHA 5LCXA 1V3UA 3PDUA 1ADBA 2HMVA 4ZA2A 1MC5A 1YS4A 2PD3A 2PH5A 3FPLA 3QE3A 2QZZA 4GL4A 4K26A 1U28A 1V35A 1MFZA 3AOEC 3HQ4O 3EC7A 3IUSA 3VAZA 1NX6A 1CEQA 4BNYA 4UUPA 3DAFA 5JLAA 4BKUA 1DFHA 1LRJA 1QP8A 3MCVA 1P74A 3BHIA 4PG6A 1O94A 3ZV5A 1PGOA 1GDHA 5BR7A 4XB1A 2UDPA 2RH8A 1TEHA 2JL1A 3OH8A 4IZIA 4HKTA 4LSMA 3ZNQA 4JQCA 3HDJA 2E6UX 5F1KA 1NXQA 2NM0A 1C1XA 3H3FA 5GY7A 1JVSA 4PFJA 2CDCA 1S6YA 4RPLA 4OKIA 3VZQA 4BQRA 2AQIA 4ZQBA 1R4NA 4RF3A 4C7JA 1I33A 2GN9A 3FBTA 1M67A 1KEPA 3VHRA 5CPFA 4WUVA 4NR0A 3TWOA 3STHA 4DBVO 4M54A 3H4VA 4MO2A 1LRLA 1JTVA 3A4VA 3UCXA 4PLGA 1H6CA 3WGYA 4GX5A 2BGKA 5JDCA 3PQEA 1IPEA 3BIOA 1JW9B 2FP4A 3I9KA 2F1KA 4AJOA 2IEDA 1KYQA 4PIVA 3R6DA 4R9RA 3K9QO 4AJNA 2NU9A 1DPGA 3H9EO 5JY6A 5CEEA 4IXWA 3ASVA 3NEPX 4I9UA 4B3IA 1DSSG 2JHFA 3C8MA 3VVBA 3LSYA 3WNQA 1E3WB 1ZJZA 3NUGA 3GH3A 2GYYA 1T2CA 3C1AA 4UVDA 1BXZA 1H5QA 1WVGA 3UF0A 3GGPA 5IDYA 4FJ2A 3AY3A 2WDZA 4J3FA 4RVDA 4BV9A 3JYOA 4PCVA 4UVIA 5EQDA 3ROPA 2BMAA 3BA1A 2OGUA 3VDQA 1O9BA 1MLDA 1SC6A 3RKUA 2RAFA 3ANNA 4QQRA 1KEUA 5BNIA 3AWDA 2FPIA 3I23A 1PJ2A 3ONDA 1CETA 1U3WA 1PZHA 4E3ZA 3L0DA 4J1QA 3ROMA 2DTDA 2XPCA 1NQTA 1VI2A 1P45A 1QRRA 1GCOA 4CLEA 1C14A 3GC6A 5EPOA 1JAYA 2C20A 5ER9A 4J90A 3RUIA 1RM0A 4CV3A 4E33A 1J4AA 1J0XO 1H9BA 1KVSA 1ZBQA 2E37A 4DIFA 4A03A 1H94A 1AUPA 1HDZA 1E5QA 4J9VA 4BNWA 2DPHA 4PLTA 4AG3A 2J6IA 3BMOB 4YB8A 3E03A 2D8AA 5KJ6A 1X1EA 3OA0A 4MKZA 3M1LA 3WGGA 4BKOA 1BSVA 5B4TA 1YBVA 4BNIA 3R0IA 2G17A 1PQUA 4KQWA 2WMDA 3VH1A 2C5AA 2VHZA 2FN7A 2EP5A 4Q3BA 2Y66A 4DPKA 3A9WA 4EZBA 4JCOA 1HLPA 2J8ZA 2P9EA 3BMQB 3GQVA 2QYSA 4D46A 3VVCA 5JW6A 3ZWWA 2NQ8A 4JX8A 4BGVA 1E3WA 1B3RA 1LSUA 2H63A 1U7HA 3GUCA 1PEDA 1HDOA 1GEEA 2AEJA 2NLOA 3BHJA 2B4TO 4E6PA 4E5YA 2RH4A 2DBZA 1QXSA 1TI7A 1XEAA 4RGBA 4BNHA 1SO8A 3B20A 3EHEA 2CF6A 4LK3A 4NG5A 1LDMA 5ILGA 4A10A 3RJ9A 5CP8A 5U9CA 1GCUA 1TXGA 4YAIA 2IYPA 3GVPA 1J6UA 5TC4A 4E5MA 2EKLA 1HETA 4IDCA 3RC9A 3FNHA 1AHIA 1HRDA 2W98A 1CF2O 3VTZA 1MFPA 1P77A 4IMPA 2D5CA 2POQX 2B83A 3ITKA 5ENDA 2UYYA 2VT2A 4OJNA 1HYEA 2HU2A 2C82A 5L95A 1E7YA 3NDRA 3SLKA 4J49A 2C2YA 4CM9A 5ADHA 4YWJA 5BT9A 2GASA 1E77A 1CQIA 4Z0PA 2IXBA 3GEDA 3BMOA 2J3KA 3S1LA 3ZNNA 4MVJF 4WNIA 1PJBA 3KYDB 4XYGA 1E6EA 1XQ6A 4GH5A 3L4SO 1T2EA 5K0ZA 4GGOA 2EW8A 2I6TA 3GAZA 4YRAA 5FF9A 1HE3A 2BH9A 4FOOA 3DBRB 1EVYA 1LDNA 5FEUA 2P2SA 2QG4A 4MIOA 1NAHA 3BMQA 3K73O 5KVVA 1EQUA 2D1YA 2PA3A 1YL7A 3KB6A 3V1YA 4R3WA 4G2NA 1LBEA 3IQDB 4XJSA 3ST7A 5KKCA 1DDOA 3GG2A 4BNLA 1PS9A 3F4BA 4WOJA 2G1UA 3PHHA 4CMAA 3RAJA 3D4OA 2IRWA 3Q11A 4L8VA 5TF4A 4N5LA 4KUGA 1CDOA 4TRJA 5ER6A 4FFRA 4HUJA 4PN3A 4WJZA 5JBIA 2OXIA 5JC8A 3RUFA 4PLHA 5JYEA 5JDCC 2B37A 1OZAA 4PG5A 3A28A 4CV1A 2A4KA 3GNSA 4TZKA 3PJDA 4YQZA 1GUFA 3HE3A 3PYXA 1P9LA 4XGIA 5A4DA 4XIYA 1YL6A 2R2GA 4D3SA 5BQFA 4G5HA 3WIEA 4YAGA 3RQSA 3QRWA 4D0SA 3GFGA 1G6KA 2IZZA 4TSKA 3SJUA 2IE0A 1UR5A 3UAGA 4A27A 3G1TA 4D3FA 4YPOA 5TLSA 2ZK7A 1T25A 2WYUA 4GLOA 5TS3A 4DQUA 1H9AA 1GYPA 4J7UA 4RO0A 4E2WA 4FDAA 1ZZEA 5JMWA 1VSUA 1X1TA 2ZCUA 2C7VA 3AFMA 3GUYA 3NX4A 4YRDA 4A73A 2YHUA 3KYDA 3U62A 3DXFA 3UVEA 2G76A 4ALMA 1NFQA 3KEOA 3H5AA 4WPGA 5LDGA 5BSHA 2QRLA 3GFBA 2X9NA 3H2SA 1LA2A 3OECA 5AXDA 1TLTA 1LEHA 3TRIA 3ICPA 3Q2KA 4B8ZA 1VPDA 4D3DA 4OL9A 5CHEA 3RC7A 4L75A 3FRJA 3L77A 3MJ4A 5KJCA 1DIGA 4S3MA 3NTQA 4KP7A 4Z0HO 1XELA 3LT1A 5IN4A 1R16A 2ZCVA 1VM6A 4BS9A 1IUKA 1GR0A 3OJFA 1HYHA 1U2DA 2HRBA 1NYTA 1K89A 3OA2A 2WD8A 4BQPA 1ADGA 1B15A 1UP6A 3PQFA 3WQQA 4GSLA 2A9FA 1LDBA 1HLDA 1XU9A 3RC1A 1WDKA 1TB4A 3UFXA 4GKBA 4JJFA 4YXFA 3EMKA 4GSKA 3CUKA 4R69A 1ENPA 2VYVA 3H65A 1T4BA 3ETGA 4P4LA 3RSHA 3N74A 1M76A 5JDIA 4D79A 5HS6A 4A5OA 3FR7A 4QO8A 4BNVA 1Q1NA 1V3VA 4B7CA 4CLDA 3WJ7A 5HRUA 4BO5A 1N5DA 4EBFA 5JSFA 3GVCA 2NU6A 4E5KA 3HB4X 3HJAA 2PY6A 4L73A 4BNKA 2Q1WA 1IB6A 3GNTA 3NAQA 2UV8A 1KEVA 1ULSA 5LDHA 3O8QB 1UZNA 3TSCA 4N5NA 3OFSA 3ZW9A 4Z9FA 3AU9A 1I01A 1Y9AA 4U0JA 5DCUA 1IZ0A 1GTMA 3ONFA 1KS9A 4J1SA 5A5EA 2OP1A 3DHNA 5G0SA 3ZWCA 2HO5A 3EZLA 2E48A 2FR0A 2VTDA 4XX0A 2PD4A 3KZVA 2Y67A 1QG6A 2YDYA 4XGKA 3PK0A 3HZZA 3W4IA 2QRJA 1PZGA 1D1TA 4IGFA 3Q2IA 3TNLA 4CLHA 3GGOA 1A7KA 2DAPA 3HDHA 1T1RA 3KBOA 3LU1A 4HY3A 2ZTVA 4I5FA 5EESA 4AL4A 4F46A 2FWMX 1FMCA 1PJ3A 3MJCA 2EW2A 4R1NA 5FYDA 1OAAA 1AXEA 3GLQA 3ZWPA 2E82A 1ZMTA 1JKJA 3JQGB 3VZPA 2SCUA 1HWYA 3F46A 1NWCA 4G81A 1XGKA 4U6SA 4MVJA 3ZHYA 1F0YA 5DP2A 3DTYA 1E6UA 2DLDA 3FNEA 4I9NA 3CINA 2H1SA 4XGNA 3OETA 2GN4A
chains in the Genus database with same CATH superfamily
1AKRA 1GNQA 1QH8B 1DXQA 2OUKA 3KJHA 3L82B 1K7EB 1EFLA 1QFXA 2XWBF 4H7IA 1KI8A 3CRVA 2Q8PA 4WCVA 2Z1MA 4YMHA 3GLIA 5F2NA 3JAWB 5IBRA 4JSRA 4BV3A 1MF7A 1AQLA 1EB9A 3WGUA 1U4OA 1I4WA 1C0LA 1NDQA 3C97A 3FNFA 3KQMA 4KAFA 3OM9A 5J5CA 3ZYZA 4LXQA 1D04A 1I13A 1QO0A 3TM4A 3AEYA 2A0WA 4HYEA 5AO9A 4EHAA 1FP2A 2VYVD 1VPVA 2R84A 2XA1A 3BPSA 1UKVY 5I51A 4PX2A 3UICA 3SKYA 4CN8A 1AQ6A 2O2SA 4MH0R 3F47A 4OHFA 1YKGA 4NEHB 3KVNA 2IUEA 5TQ2B 5TIIA 2WD9A 3QBVA 2BKUA 3AESA 5H83A 3N1UA 1V1JA 5DW3A 4B6PA 3LSTA 2H0QA 4NHEA 5EJMA 1V45E 2Z98A 3KAKA 5CLJA 1A9ZA 4GXTA 2FZGA 1RBQA 2EGUA 2YS6A 3O8BA 4IRXA 2HIAA 2PZGA 4LJYA 3EXHB 4BATA 4B5KA 2D1SA 4WNAA 1CZUA 2ZULA 2XGMA 3HVIA 4L4RA 3P7MA 4R5HA 1LDGA 3KIPA 2VYND 2KJQA 3JR7A 3OD1A 2QRZA 4EPXA 5KTOA 3O3CA 5HG0A 4RHTA 3ZLBA 1TKBA 5J43A 3IB6A 2C7BA 4CUZA 1RKXA 3JQGA 2O3SA 2AE1A 4AQYB 4KRXA 3OOHA 2XCTB 1UPXA 1DHTA 4BO8A 1UKYA 2DQSA 2JJMA 5BWCA 3NHFA 2FI1A 1GZ5A 4K46A 1PQWA 5IF9A 4Q4AB 2I8LA 3VR3D 5KREA 2R44A 4NDAA 3DV0B 2JHCA 1DIRA 2I4MA 4AJ4A 4J75A 2ZIFA 1NOKA 2PWBA 1QVRA 1JLSA 3BRCA 1ESNA 1PZXA 3ZKWB 2X19A 3QOXA 2DHQA 4I1IA 3OAAA 3W7VA 4ZEWA 4BX9A 1ZBDA 1YOBA 4FBGA 3JAWA 1DAGA 3DFKA 3HCCA 2H07A 3NC1C 4IPTA 2RGRA 3D1LA 1FU4A 1ZIDA 2ZI3A 5JISA 3DTNA 5I7OA 1I5EA 1PR9A 3QPCA 3I9V1 3NRJA 4WK2B 1ZJ6A 3MG9A 2Z09A 3U3JA 1RAGA 4ESEA 5C4MA 4TZTA 1HLFA 4GLLA 3ERCA 4RVNA 5CH3A 2H5JA 1K5DA 3OX1A 3HMKA 3NV7A 3UATA 3WTBA 2BFMA 4LXHA 2FU5C 4AF6A 1AZWA 5KTSA 3E9RA 4B8WA 5GADl 4WLNA 1FFHA 1G0NA 2EFHB 3K9NA 3E23A 2GD1O 5IN5A 3LT0A 5TQ2A 4BO2A 2ANBA 1LLCA 1X15A 4TKLA 4RETA 1W52X 4ZODA 2L18A 4PLPA 2VN8A 2QMUA 4PNZA 3EMDA 4DJDC 1RC8A 3G0DA 4IJVA 4OJKA 3VBCA 2XMRA 3VI4B 5A3QA 1H9CA 4FUTA 3T3PB 5CNIA 3HSKA 4F6RB 4K9NA 3RHZA 1I9GA 2ZIWB 4XQEA 1ND5A 3LGAA 4GZ6A 3EXHA 1WL8A 1YRWA 5ETJA 1KY3A 4RTRA 1BCRB 2CJPA 3VKFA 5DTIA 1GRNA 4IJUA 1DJNA 1JHXA 4P3YA 2C7RA 2NADA 1V9LA 4ZVLA 1LK0A 3RS8A 3S81A 1ORHA 3RTGA 1K06A 3HDVA 3EDMA 3IBSA 4WWHA 4E4TA 4MK4A 2I9PA 1N2ZA 5CJ2A 1EYZA 1R0KA 1RC1A 5DT9A 3OC6A 5BURA 1D6MA 1R18A 3EX7C 4Z49A 4TWIA 2C8KA 1C4OA 1HURA 1JQLB 3JRWA 1K63A 3KDPA 4M0KA 4UNNA 2BFFB 2HMUA 3DDOA 2C7PA 3PLAE 2M6RA 2IU4A 5B2FA 3OPVA 3UA4A 2P11A 3E82A 3RFVA 3SAJA 4Q4AA 1XVAA 1F14A 1YB1A 4IIUA 5I9MA 5HP4A 1XA3A 3DV0A 4TXNA 3X1DA 4ZTUB 1MAUA 2AC4A 1QNLA 2D5IA 3EGEA 1B6RA 1EVKA 4XDZA 3ZKWA 4TYYA 5JCOC 2RGDA 3NIBA 2OHHA 1GZ7A 1GZ4A 3GF4A 1KJ8A 4LMRA 5TB5A 4E46A 2EDAA 1GN8A 3KJXA 2FB9A 5IXSA 1WMFA 1MO4A 3LCMA 4B5LA 3QVTA 1VSVA 1BGWA 1K6EA 3OPYI 4WECA 1X0VA 5GJBA 1IZ9A 4GZLA 4OMFG 4D44A 4IZ6A 1L8OA 4TPKA 4BOYA 4G07A 1GKIA 4G8CA 3EW7A 3BTSA 1JA9A 4CM4B 3OF2A 3GNQA 3PC8A 1LPPA 4IJKA 3KWLA 4G1MB 5ALXA 4JFRA 4FOTA 1VC2A 3FKSA 2NUAB 3ZBPA 1V7ZA 3W6NA 3WMWA 4HAXA 3AR9A 3VC1A 5MF6A 3QTTA 5BNTA 2X6RA 3L02A 3QKIA 3HR8A 1CUXA 1OT3A 1R0SA 3PBKA 4AXBA 4F6RA 1CUZA 1RTKA 1QCCA 4EI7A 1BCRA 1DFGA 1ULZA 2H4FA 2D7DA 2QY6A 2XVAA 3ZZ0A 1CNMA 2EXXA 2KM1A 3AEKB 4RXUA 1EESA 4R1TA 1CJCA 1GARA 3LUDA 4P6VF 2ZATA 3P45A 4DJAA 2GZSA 2IHUA 3K5PA 4KV7A 3SX4A 3E4DA 4MKIA 5B6JA 1DB3A 3L8ZA 4PGHA 1SZJG 2BFFA 3E3MA 3AP2A 1SD2A 3A36A 3I1JA 5D2CA 4NFHA 1W29A 3H7IA 3N8KA 2DF8A 3DCNA 3U1BA 1E89A 2BGIA 3DQQA 4O8CA 3OTWA 4UTZA 2IUUA 4FB5A 3DFMA 1NPTO 3SHVA 4EQZA 2FUNB 1QU2A 2WINI 3NM5A 5DNDA 2ZXUA 3PICA 4NFYA 4X45A 4JQZA 4NOKA 5EVCA 1YVUA 1TAGA 3E05A 4G5QA 1C7FA 3NJ8A 4ZT2A 5LUBA 5E7MA 2RD2A 1Z56C 2F8MA 4RVSA 2CJWB 1EINA 2D4AA 3DTVB 3I9LA 3IXMA 1G2PA 1YJAA 5IU6A 1O6CA 3OJCA 1ONPA 1AJEA 3CXRA 4ME6A 3FAZA 3CW8X 4H4DA 1GG5A 4HEA1 1XAJA 5BN3B 1YS1X 1N2BA 1PJLA 3A4LA 3CUUA 3ICOA 3V4LA 1C3XA 1NW3A 1UOQA 3H8WA 3HFGA 4I8IA 5B3KA 1QP7A 4QDTA 3RSQA 2R60A 4D26A 4ARCA 1U0OC 3FPHA 4CM4A 2AJ8A 3H16A 1VE1A 3KZNA 4A6XA 1X2BA 1G7TA 3ETJA 2NGRA 3JQRA 2EFCB 3LAWA 4RY2A 2J6HA 4BMNA 2G6TA 4XSHA 3ZV3A 2NUAA 2REXB 4MRMB 1AU9A 3Q0TA 2Q4EA 3PL1A 2P1RA 1FXWF 3PIRA 4QDKA 5U1PA 5IUJC 2R8PA 1DBPA 4DXHA 1H2HA 1T3ZA 2F43B 4LRSB 3ER6A 1EFKA 3RUDA 3QUQA 1I30A 2DQYA 4KIWA 4WOPA 5A4IS 5LQNA 4ZVRA 2VQFB 1YASA 3TXAA 3AEKA 3UO8B 1B8VA 1I7NA 4YO7A 4AJIA 2DR3A 3EGIA 5BMVF 3PXXA 4MI9A 5SY6A 1W88B 1GL7A 3PCXA 5ESDA 3IHTA 4N3CA 2MHCA 1JQBA 1PL8A 5EQTA 4W9NA 4D4GA 3ETDA 3OPMA 1QIIA 3HUEA 2NZXA 3DGFC 3QZUA 1Y7LA 4EKGA 3L7CA 4Y9DA 4LOJA 2IX3A 2BCJQ 2D2EA 2PX6A 4H3KB 1U1GA 4NJOA 4PYIA 1ONOA 3TX6A 1YIDA 4WESB 2P3SA 4TMZA 3KJNA 2IYQA 3FROA 3MGGA 4UUNA 4G1UC 3TAUA 3VO2A 1V8ZA 2QLMA 4NSNA 1AK1A 2IA5A 3F6YA 3DDHA 3NBKA 2QOEA 2B8JA 1OXXK 3A25A 2OPHA 2PAFA 2WPNA 3VGJA 1UM8A 1D1PA 4FFBB 4KV9A 1UXOA 4UBJA 4JYPA 3V2IA 4ZKEA 5IC6A 3A1SA 2CJWA 3DTVA 2PRIA 2RH9B 3F9IA 1I0LA 4EUHA 3FY4A 4HX5A 4UHHA 1KYIA 2GCEA 4AS3A 1O3YA 3KM0A 2BMFA 3K8YA 1FTGA 3FA2A 3H8VA 4AQ7A 2NNLD 2PZAA 4RWEA 1A0OA 1X9HA 3WIUA 4RHYA 3H75A 1V2GA 1XWIA 1P4GA 5T8KC 4DLLA 5AW8A 4D02A 4BCBA 1ML3A 3DR5A 3FYUA 3O9VA 3JQ8B 1PS8A 4MRMA 3RRZA 4DHWA 3QLTA 1OPRA 2CL0X 2HN9A 3CIOA 2XB6A 2ZYWX 4MW0A 1CJTC 1YS7A 2PJZA 3H87A 3IP7A 3E7PA 3IVAA 4AMGA 1NFRA 2F43A 5JMPA 4L28A 1N0IA 4FTWA 4KFTA 4M1ZA 4DCPA 3RUCA 4DMKA 5IUNC 2ONJA 5H16A 1QE3A 1KZ4A 3M1IA 4RA9B 4BXOB 1QS0B 2D1FA 2ZM6B 1TZ2A 1IJFA 2C2MA 2AMLA 2DY0A 2GBGA 1FRFS 3NO4A 5F78A 4E5PA 5E2BA 2CUKA 5BR1A 1U9JA 3KFXA 3TOZA 2X14A 1JEEA 1YHNA 4YT5A 1W88A 1G16A 4RF4A 3LT2A 4C30A 4JI7B 2A0FA 2FJ0A 4N39A 1V0JA 3E2PA 2HF7A 4Y6RA 3SBEA 3WDLA 5DPMA 4E5NA 1ESDA 1ADYA 1Z7GA 5SZKB 3LJKA 1F06A 2BJHA 4AMYA 1U0HC 1WVMA 3FM9A 3OOYA 3COJA 2HREA 3AVTA 4K1LA 4M8KA 2ZJ3A 1SRRA 2WG0A 3QVJA 4FFBA 2P9GA 4NFSA 4OL0A 1NBME 1NVGA 2CHFA 2W8ZA 3AF4A 4MHTA 3BB1A 3DOEA 4EZEA 2FK7A 4J2OA 1OREA 3FYSA 3B7WA 1BE0A 4XQ0A 1JG7A 2H7CA 5D5QA 5EOVA 4C0LA 5CA1F 1VG8A 1TCAA 1M9NA 1U8AA 4GX2A 2G3YA 3BUSA 3I5XA 4YCMA 1IULA 5G02A 3C16C 7ADHA 3TUIC 4FHFA 5JAHA 3TQCA 3DBLB 1JXQA 1R4MB 2EF0A 1NQ5A 2KHZA 3JALB 1RHKA 2AHRA 1X74A 4ZJYA 3KJFA 3SJ7A 1XJQA 3JQ8A 1P9OA 1N5IA 3NDIA 4V0ME 2C3OA 5AOCA 3S55A 1QU3A 2IHTA 3JWHA 5BMVB 3X1JA 3REOA 4DUGD 1BCSB 1LBSA 2Q0XA 3C1UA 3JYPA 1B43A 3GGDA 4HRXA 3BDVA 4YV0A 2R68A 5K0SA 1CUWA 1D09A 1LPMA 3KOOA 3MFQA 3TZQA 4ZICA 3AVUA 4ZI3A 4FYWA 4RA9A 1QS0A 1VCHA 1RVV1 1VG1A 4JITA 3D3KA 1P72A 2JIBA 3AIIA 1Y8CA 3I53A 1YJQA 2GFIA 5ESRA 3U40A 4ECAA 2G82A 1Z5NA 1N6LA 1R88A 2X15A 3COPA 4FDUA 4OYHA 1MUUA 4TQAA 2CVZA 4RD4A 2KYRA 2W5UA 2XNHA 2O2JA 2P5YA 4KN9S 3UPTA 1OFGA 1T8YA 5AXAA 5KC9A 2B8NA 3NP9A 2Y77A 4YRFA 2LV8A 5G0WA 2FTKE 2IT1A 2BGRA 3HYSA 4TROA 2CNKA 4PLZA 2QV0A 1M34B 1VCNA 4ENQA 3C98A 1X80B 2ORED 3KKKA 5BYKA 1RRVA 1VE3A 2WWRA 4RDIA 5ALZA 4QARA 4Y6SA 1DCFA 2Y9PB 6YASA 3Q15C 2FKAA 4RTOA 4C6RA 3STXA 1ECPA 2J4CA 4Z3DA 4G56A 1JBEA 1NJFA 4QEDA 5SZHB 2VWQA 3RGGA 1RZRD 2PZJA 1G9SA 2Y68A 1OXVA 1N57A 4JBYA 3I8SA 4Z9AA 1J39A 3WLIA 1S2IA 2C1ZA 2P0AA 4JC5A 1UAGA 2H4WA 4G0NA 1T91A 2J5RA 4DWVA 2FW1A 1HXHA 2OENG 3R3ZA 2BCGY 1T8SA 2PX3A 4HNSA 3RSOA 5EJ8A 2EEPA 2I66A 1ES9A 2QNIA 3HGTA 4ATNA 1DRUA 1FXWA 1KTVA 5AVSA 3SR0A 5L9AA 4F06A 2AN3A 2X7JA 1BZYA 1MAVA 3R24A 4ZJZA 4X44A 2D5LA 3CCBA 1ADCA 5ENZA 5EMJA 1XTJA 3FZNA 1YJ8A 2YWFA 3JALA 3LA8A 3VR4H 4CKCA 3L4JA 4YDHB 4EJMA 4NF2A 5HJ2A 4QUKA 3H0EA 4US2R 3KVRA 5BMVA 3NTLA 1JEYB 3FF4A 1BCSA 5SYAA 2GAIA 1AZTA 1N5OX 3HRIA 5JLJA 3L7DA 2F3RA 1WU7A 3B3GA 3N8IA 1Y1LA 3F49S 3QMPA 1Z4JA 4TN5A 5D6OA 5ARCA 4HDOB 1D0SA 2GEBA 5TE9A 1CUJA 2BKLA 2PAAA 2Q7XA 5D86A 5ARDA 5A5GA 4V02A 2C07A 3AUKA 3I61A 1YRBA 3KEQA 3A3NA 1JI3A 3IH5A 4XQGA 4D97A 4Z53A 2XUPA 4FHCA 2NNWB 4XYBA 4JBLA 3VH2A 4N1AA 1OAKA 5A1TA 1VMIA 3IP5A 3MWLA 4OQXA 4IW3B 5CDFE 4RC9A 1IEXA 1M34A 1JU9A 4XWGA 1X80A 1RWXA 3UV6A 3PFCA 1ISHA 1V2HE 5HZMA 2Q3FA 5HQ3B 4DFDA 5HILA 5KWVA 1LI5A 2ZETA 5I5GA 4BAUA 3U4AA 1EP1B 3EEBA 3WKEA 3UN1A 4B83A 1FMTA 4RKRA 4EZIA 1BN6A 1Y80A 5I9BA 4ZMBA 1KYZA 2VJBA 5J63A 4YMGA 3W06A 1U3CA 3CC8A 4RZHA 4B44A 2JZNA 3ORYA 2ZYGA 3GJSA 1DC3A 1IQ0A 2XA2A 1CR1A 4DZRA 3GWGA 1ADJA 3JQ9A 1DELA 4ISCA 3V8VA 5K20A 3MHTA 1VGVA 1K3TA 1JLLB 1SBIA 2FPPB 2H5IA 2WDPA 1YU9A 4A1OA 2UYQA 4Z54A 2JLVA 1KVRA 4YJKA 2QUHA 1QORA 3FSJX 2YWDA 3I0NA 3OURA 3SQLA 5EMLA 1QYWA 3O83A 1M0EA 4M3NA 1XU4A 4J03A 1SHLA 1O6ZA 3K32A 5TGDA 2I54A 1E6KA 1QFJA 2A59A 2OUIA 4WEOA 3IL2A 2PUDA 3K8QA 3EAFA 1WMSA 4V3CA 1W5BA 3C3XA 4PLFA 2LKDA 1JEYA 3B85A 4NQRA 4XEHA 3PHJA 3QF4A 4MQEA 1QZTA 2V6IA 4ND1A 4EY4A 4LG1A 3CUWA 1FFGA 2GM9A 4DA9A 1VIMA 5I7WA 1XJ5A 2NV6A 2QX9A 3MIIA 4DOMA 3DNFA 5IK2A 5T4BA 2IBMA 4WI1A 5F2EA 1W36C 1OIXA 2PLAA 2W8BB 1M2NA 1QG2A 2SICE 5KOJB 1KH1A 3MJVA 5GGYA 3TZCA 5KINB 4B3SB 1OFUX 4KNYA 4TLMB 3E2MA 3V4SA 4II2A 4RANA 5FNVB 1AT1A 1HE4A 3GRAA 1C1DB 1L5FA 1T2NA 2WVGA 3EVAA 4UD6A 3U80A 2LD4A 3ZCQA 3OIFA 4YAUA 1GKLA 1Z5OA 2XUQA 1F12A 1KIMA 1Y98A 1MU0A 1OLXB 1NMSA 5B3JA 2VPQA 1Z26A 1H05A 1JH8A 1JIUA 1W75A 5D3QA 3W78A 3OF3A 4R71A 1N2CB 4FB4A 1A76A 1GEGA 1OH5A 1DO0A 4FNGA 5HQ3A 3TZHA 4EG6A 3R76A 3L7KA 4GVPA 1EVLA 4D9NA 3IMCA 1JSRA 2DUUA 5IM5A 2YFYA 4HGRA 3MWGA 4YQEA 1W4BA 2MWMA 2J41A 2IJGX 3FKQA 3AERA 5HVNA 4FHZA 5D3ZA 4FZJA 1VMAA 4IDQA 4K6FA 4YRRA 3RU3A 2QG9A 4JP2A 4JR2A 1Z38A 1VIDA 3L7NA 3E22B 1WOMA 1WDWB 2RB4A 2IIQA 2XF2A 2FPPA 1JLLA 1YL5A 3PXGA 4F4UA 3RUEA 4CETA 3FPSA 4O5AA 3TLEA 5JHGB 4I4TF 2ZE5A 1JILA 1O6BA 3O4IA 4E2FA 3NYWA 2EIHA 2P9CA 2O14A 1N7IA 3CW2A 8ATCA 1JT2A 3U81A 3PL5A 4LOIA 1I3KA 2CLDX 1NP6A 4YRPA 1HE5A 4A2CA 3I5UA 2C04A 3JYNA 4BO1A 1F2UB 1QIHA 4P35A 3UK1A 2GK7A 1M74A 4HS4A 4JYBA 4OCZA 3KSDO 1RJFA 2D2IA 3PA6A 4RD6A 4ZO6A 1N2CE 3PQDA 3RHSA 2D3WA 2TECE 5L8VA 2QUJA 3HO6A 4A8HA 2P3OA 2ZE6A 4BN0A 1CVRA 1AUQA 3OPXA 4R81A 4B2YA 2X1HA 1ZH0A 2FWBA 1NR1A 1QK5A 1G2QA 1ISFA 2J3HA 2PMCA 3CH7A 3WLOA 1WCIB 4CLEA 1OQAA 5KOJA 4QQNA 4YFYA 3PNQA 2INGX 3OQ6A 4HG2A 2DFVA 1ZUIA 1C1DA 4BX8A 1UINA 5KUTA 4QYIB 1G5PA 2VF2A 4HGZA 3ULKA 1E1KA 2P41A 4BBAA 3AP1A 3GGJA 5IVPA 1I4LD 2OE2A 3HNOA 4AMZA 4QKQA 4J7CA 5EMKA 5JTTA 2QR5A 2Q6LA 5TPWB 2ASEA 2CBXA 4AICA 2VHXA 1UXIA 3L0YA 4RPCA 2GHRA 5DCLA 1EXVA 1PJCA 1GTG1 2VRCA 3C5HA 1E98A 5EE0A 5AYVA 1FW8A 1SULA 2AR0A 1NUHA 3ESBA 2F59A 1DC6A 1X7DA 3IKMB 4OQFA 4WJKB 3NRCA 4AP5A 2JFGA 4PLYA 1OBOA 1SEPA 2BKVA 4EHJA 4ZV4A 3L5KA 2GN6A 4M21A 3ZE7A 4Q1AA 3UJNA 5AWFC 3E22A 1NKSA 2AB0A 3JWIA 1XRQA 4IV0A 4IUBS 4N6GA 4Z9XA 1KARA 1WG8A 3DONA 5KB3A 2I7VA 3LUAA 2Y1GA 2HJ9A 5B57C 1XZCA 4FHGA 4P7GA 3WG9A 1EFTA 1DARA 2BDEA 1Q3KA 1XRJA 3O4GA 4XCVA 2C4HA 1I36A 3IV6A 2VAVA 2LR0A 4KO3S 4BX0A 5K2MA 1DEKA 4NAHA 4BO0A 3WYGA 2VDNB 4G25A 1Y3CE 4EYSA 2VWPA 1AN0A 3LW7A 4KZKA 1RYNA 1ZW6A 3OCUA 3FRIA 4H1TA 1FC0A 4JAVC 4QOFA 4M46A 4LF9B 1RLOA 1F2UA 4OQDA 1TTHA 3GEBA 3PPYA 5DN6A 1IN7A 5LQAA 1EVJA 4QXPA 1UMCB 3KR2A 3PYLA 2XE7A 4RPKA 5EZ5A 1OX4A 3L0SA 4FJ0A 1EXWA 1P7ZA 1U0TA 3ETCA 3LE8A 4NCJA 4CBVA 1HORA 4GQIA 3WGJA 4BB0A 1J9ZA 4HDRB 1DG1G 2SNIE 2OOSA 5C5EA 2D3TA 4DJFC 1JFLA 2C9OA 4FYYA 3VAAA 2VHQA 3ZZ1A 2YYAA 1G6OA 3CS3A 2ETXA 4K6HA 4QYIA 3UUWA 5HJ7A 1QRDA 3LQQA 3CF4A 4NS4A 3DBHB 1MPTA 1JZSA 3AI2A 1T8RA 4PSVA 5CDYA 4JODA 2ZR0A 5JASA 5K6RA 3BIFA 4LJRA 5BV8A 4UEJA 4DGQA 2R6GA 3UMCA 3QX7A 1IUNA 3M7IA 5IZCA 2F1OA 4GPIB 5DBOA 5FLEX 2PKRA 4I4TB 1XAHA 3L5OA 5CVJA 1JNXX 5ELXA 4FFDA 3UV7A 1W25A 1U5BB 4LDZA 5EE9A 2VJPA 1ZCFA 3ICWA 1XZLA 2DCMA 4AWBA 1I7SB 1L9XA 3DZJA 1NXXA 5GZ3A 3DP7A 2TMYA 1JR3D 1KZ6A 3PJFA 1RWQA 2VNIA 3ENKA 1Z5WA 2E5WA 1NVXQ 3MINB 3O4FA 2X5XA 5DTMA 4JN6B 2ZBRA 5CEFA 3QI7A 1TPZA 1BXGB 2BVNA 2ZIAA 3ZEAA 5L3RA 1SU4A 2OO5C 1PUIA 2EL7A 4Q00A 1THGA 3OEHD 4HTAA 4ZO4A 1HL3A 2ORYA 1KEZA 1QQ7A 5FRDA 4DAOA 2ZQYA 3IT0A 2XYPA 2GPBA 1ML4A 3E5NA 1H2BA 1OZFA 4O33A 3WTCA 1BX1A 3WGVA 4FM9A 4LF4B 4IICA 2UZ4A 2ADFA 3GT3A 1XKTA 1SA0B 1GCAA 3SD7A 2Q0HA 1QFYA 3NHAA 4MQFA 2GQ0A 5IUKC 2O59A 3SC4A 4MVJD 2AWOA 1A88A 2TMGA 5LFAA 2NSDA 2X5OA 1KFKB 1E1QD 2FCAA 1QRSA 3ADCA 5A4AA 5SYNA 5CDTA 1L4NA 3JZDA 2DFKB 2HMWA 5EKSA 2ZAOA 3JPWA 2RGCA 1BRTA 2FEAA 1RHQA 2ZSFA 5DBEX 3SI7A 1XCOA 3GP3A 3NTUA 3T5MA 4H1WA 2HPAA 4UOZA 3D0KA 3CTPA 4NESA 4DCOA 5JYDA 1R5OA 2CD9A 3BRQA 3F6CA 4RZSA 4BMSA 4CQJA 4PLCA 3O8OB 4U9UA 1Q3HA 3MCWA 5FBQB 4P08A 4J3NA 3W8RA 1YSCA 3DBHA 4U5QA 3WV4A 4EHDA 2IS4A 1K0UA 1XLTC 2CFCA 1S89A 3IOEA 3R6WA 1ID8A 1V5EA 5K0BA 5DISB 3OKCA 1DBWA 4ROTA 2D7CA 5KVAA 3PEWA 3FWYA 3IIEA 3JQCA 3JWPA 1Y8QB 3UC9A 1M8GA 1QTRA 4XH9B 3AT1A 2DB3A 4KQGA 4I4TA 5H70A 1VB3A 5ALQA 3WYFA 4CMEC 2DHCA 4RMNA 4F86A 5JU6A 5I9SA 1JJFA 3SGLA 3MS2A 3ZGOA 2HK7A 3NP7A 4V2IA 3CBQA 1C9JA 1I5OA 2WIJA 3EF0A 2QLJA 3EY9A 4JJ4A 5LP6F 2V55B 3N70A 3MINA 1RRMA 3WXMA 1JSZA 5F9FA 2OD2A 4U7DA 2GT1A 4H60A 1JJAA 1BXGA 4L4YA 3AUYA 3Q2OA 4Q0MA 4L0DA 1GGJA 3V2GA 2JNWA 1YS2X 1G42A 2AQ8A 3G2IA 1W59A 3FZEA 1E1CA 5LB4A 3WJAA 2QD4A 3BMCB 2IV2X 1RAIA 2G8LA 3EJWA 3I5MA 4EFMA 3B1YA 4I8DA 3LZDA 3SQMA 1L5SA 1OFTA 1QKKA 3B89A 3LKVA 1SA0A 4R8LA 4W5HA 4FWTA 2G25A 3TQIA 1YRAA 2UYGA 4LZAA 4GF5A 4GMGA 3QLJA 3D6MA 2CBGA 5CVVA 5IFKA 5A02A 2AOWA 4CLOB 3G9QA 1D9ZA 1H0HA 1KJJA 2ZOSA 1ZGZA 2QZ9A 1E8NA 2B8EA 1J1ZA 2P79A 2R00C 2X7XA 3EIFA 2RHMA 4J2TA 2P78A 1Z4NA 4JVSB 4C76A 5HMMA 4MP8A 1O8BA 4O2AF 2IS6A 1LTHR 1XWWA 1XWFA 2Q4BA 2Z5FA 2CVPA 3O8OA 3RBZA 4DQXA 4NOMA 4RTLA 1KRHA 3LUGA 3C70A 3PA8A 4JBNA 2WM2A 4JLJA 4MLDA 5LN1A 3DKPA 4MS3A 1BDHA 3UWKA 2H57A 1DBVO 1AO0A 3H5OA 1Q0LA 2ENUA 5HQJA 5CCBA 1NKVA 3FETA 4AKHA 1XVLA 1V5FA 3OFND 1AOXA 3RHTA 4ZDJA 1T8TA 3CX6A 1Y8QA 3N6VA 2GRAA 5K9ZA 1Q77A 5GV8A 1YKSA 2M9MA 5DNUA 1TJ4A 2AC7A 4NU5A 5DWQA 2VBCA 2VUIB 4L50A 3QFCA 5KVCA 5KO2A 5GAJA 3AFOA 4BAZA 1U1IA 4PPNA 1J7KA 4O4IF 3ZWAA 4K0KB 4OHKA 3HCEA 3SVTA 5K0CA 4I55B 1RZVA 4MRPA 2BE7A 3BAZA 3IPAA 4GEGA 5M34A 2YCLA 1NNLA 3ZWMA 2I6UA 3BH0A 3ZCPA 4E5UA 2YIDA 5JPDA 5EXSA 1T36A 1SU8A 3BZWA 1Y42X 3T3MB 1GT6A 1IY2A 5CLLA 1VHWA 3IPLA 3NHKA 1A96A 1WLYA 2WJJA 4PAQA 5K8TA 3VDNB 3TUZC 1OLSB 5DI9A 5BN4B 2JLYA 4KQCA 5CK4A 5GINE 3HA3A 5E4YA 3GRPA 4RK1A 4BRWA 3YASA 1D6NA 4RQAA 3BMCA 4KYTA 1F7UA 1ACLA 4AB1A 1E0SA 3FKJA 4YK7A 3QXCA 3SDSA 3JU3A 2ID4A 1UPFA 4ZAYA 1N1MA 3WNCA 3P94A 3ZCUA 2WR8A 3TBHA 3BD7A 3OG9A 2GK6A 8OHMA 1JHYA 5IAAA 3PUVA 4CLOA 3NPMA 4AJEA 4ONEA 4QREA 4NARA 3ZIAA 2NTYC 721PA 5CLIA 1P7YA 3V7YA 5JFTA 1C3VA 3H6HA 2F1IA 1UKEA 3HDGA 1K66A 1QSGA 3A14A 3LPNA 5EXDA 3GU3A 4XDGA 2FOLA 2X0FA 4BTVA 3NOXA 2JFNA 2BMVA 3JYLA 4E4YA 4U00A 4Z7NB 1YA6A 2XT6A 4NE9A 4UVGA 4ETIA 1EAYA 2GRJA 4FGUA 2H2HA 2AR9A 4GAEA 4MUNA 3RROA 1ISJA 2BGGA 2C3PA 5KYTA 1ZSVA 2O19A 4PZDA 3FTCA 2JKYA 2PSFA 2ZIUB 4OQPA 3O8NA 1YR2A 1TO2E 5FI1B 3U3MA 5LP6B 3IEVA 1GKKA 2F4VB 1KJ9A 3PCRB 5DM4A 4P92A 4EX7A 5J1SB 1Y8RB 2OWEA 1JRLA 2C4WA 2IEGA 3ZNOA 4RZ2A 4F92B 1VCMA 1BG6A 2H2DA 4B85A 3JTEA 3C7CB 3D7SA 1FE8A 3MBKA 3O31A 4JQSA 1ISRA 3LY8A 4IH9A 3T3EA 2PUCA 3FPEA 3MLEA 4I55A 4BLWA 4F5WA 5DU2A 5E3JA 1H69A 1VL5A 3CT6A 4G0YA 4CT0A 3LQ1A 1VCOA 3DTTA 3A1FA 3BF7A 2H1IA 4IGAA 4FDTA 4D3YA 4JZYA 1OLSA 5BN4A 4XD2A 1B6GA 1QR2A 1SQ6A 4JLSA 4L8GA 1BYUA 2KW5A 2YNMD 4OMCA 3DMTC 2Q50A 2QTWB 4GXNA 2C9YA 3ZS8A 4YUYA 1VKHA 1BMQA 4XVQA 5A5DA 4RTMA 5HK8A 1ZIOA 3ISJA 2FZ5A 3OZEA 1NXTA 1GGNA 1V95A 3CLHA 4ALLA 4K8RB 1BEUB 2WJVA 4U63A 3WOHA 4DR2B 4HNQA 1WNFA 3L0IB 4N3NA 3WA6A 2PA0A 3MERA 3TZ6A 4KB5A 1G8AA 2HCBA 4P84A 5F3RA 4W63A 2MSNA 3N3BC 4CCAA 4BP8A 2JARA 1INLA 1AKTA 1PTKA 1CUIA 3DNPA 3FPCA 3LD9A 1XPOA 4KWCA 4ASUA 3CLSD 4HX2A 3LCUA 4HVTA 2NZ8A 1SVOA 3SJZA 2W2LD 3HA7A 1U94A 1WM1A 5AFSA 1M5TA 2BBWA 2CNLA 4HJXA 1RVDA 1XDGA 2XE4A 3QXXA 4M1SA 4K05A 1WO8A 1QLWA 2JGDB 2OM6A 3L7AA 4FFPA 5CVEA 3KEGA 4V03A 3WB9A 4Y2QA 1V6SA 2V1XA 4JSTA 3CKLA 5LP6A 4DV4B 5KHAA 1Z74A 2QP3A 2DTEA 2ODTX 4CM6A 4QOIA 4YQFA 4CIAA 1Y8RA 1W0JA 1TLLA 2CUZA 5HCIA 5JS2A 1Z18A 4PONA 3DLHA 4JBGA 3NATA 1DAOA 4ES6A 4MB6A 3GWZA 5KTRA 4GPBA 3JY6A 1LBTA 2C2BA 3F7NA 2PV0A 3LP8A 1PLKA 1WY7A 2IS2A 2PG3A 1NXOA 1G3UA 4CQMD 3RU7A 1WSDA 1C2TA 1ZSNA 3EARA 2B2NA 1G20B 2IUYA 3E3OA 3KT8A 1U3VA 5TJ9A 1CB0A 3NANA 4HDSA 4GOND 3EPLA 1GPWB 5BW5A 1Q3TA 2QJWA 4I4CA 1VJ5A 1F48A 1X7HA 2Q1SA 4ER6A 5ALTA 4KR3A 3DDNA 2PKWA 5EI5A 5GM2A 5JS1A 2GBPA 3UJ9A 5CM8B 2NXJA 3OZSA 4COOA 4HSEA 3RKRA 4AY2A 2BI8A 2VHUA 3R5TA 4I8XA 4B6GA 2P0EA 3P9PA 1UOEA 1VTKA 2QGNA 4V0RA 1L3IA 4I08A 2RG7A 4MJ7A 4QQFA 5B5SA 5KWSA 1J21A 1J5PA 3AUTA 3NRBA 4MKRA 2IUTA 4M9UA 5FEMA 4UTRA 1WUYA 4UDYX 3RYIB 4EH1A 4ZJPA 1ICIA 1SC9A 2NYUA 1H2EA 5F64A 3VJMA 3RVDA 4EY6A 4D3XA 5DGHA 3IULA 5FWAA 4M1EA 3WC4A 4GSYA 4IYJA 2K7ZA 1QX3A 2ZIXB 2PL5A 2PLFA 4RD1A 3QEJA 4BMDA 4Z4FA 3FZYA 3GLHB 2G9UA 2O2YA 2OM2A 3U1TA 5B2EA 4LQ4A 1THTA 2HCJB 5JO0A 4A6PA 1Y5NA 3SQOA 1L3BA 3UQZA 2CFIA 2F9LA 1R4AA 4KDFA 1X86B 2VAWA 3T1NA 4O4IA 1C9KA 3HJNA 3BWEA 1YIOA 2JGDA 1WPXA 4PR3A 4EFKA 1D2MA 1E4EB 3K5IA 3OSZA 4LPKA 4YEDA 5EP4A 1WW2A 3OM0A 1EEHA 2FWAA 1RM3A 3HZRA 1YS6A 2PS0A 2D2VA 5DNWA 4EO4A 3SDZA 2YBDA 2R6DA 5IMSA 3HJTA 4H3VA 3TW8A 2QRKA 2H1FA 1GFIA 1RM5A 1VLZA 2YZKA 3UJAA 2G9QA 4ZVSA 1A8IA 1GAXA 2Q21A 2WG1A 4R4JA 2XWQA 1ICEA 1U5AA 1ZD2P 3VPCA 1AF4A 1HLGA 1EG2A 3KKQA 4H9GA 4XRRA 5A4KA 3L8YA 4MIYA 1PD0A 3ORFA 1U3FA 4CM1A 5EIXA 1KQPA 1G20A 3DO5A 3R0VA 4NULA 1DRJA 1N1GA 3GJRA 3JATB 4JLNA 4W6ZA 3VU9B 3I1FA 3QVKA 4EPWA 1QAMA 5JC1A 3VSCA 1EA7A 5NULA 2HA5A 4OQEA 1DXYA 1JKIA 2PLRA 2WYWA 2VHVA 4M89A 2Q9UA 4RE6A 4U8HA 4CM7A 4B76A 1MRZA 5IDWA 1CV2A 2C2XA 4MARA 4CWAA 4ND3A 3IURA 4YAEA 2B21A 1YFZA 3SE7A 4HH1A 1IHOA 2C4NA 4GUAA 1GO2A 3Q87B 3R3SA 4ALNA 1KNXA 3R9WA 3RYIA 2AG5A 3RK1A 5LZ5A 2H1VA 3A7EA 3GLKA 1U0EA 3U09A 3S8EA 5KYXB 5HJ5A 5KPJA 3GXOA 1F5SA 1SVIA 4DVJA 3EMBA 2ZIXA 4NBNA 3VMFA 1TC2A 1WZNA 1FJXA 3GLHA 2WWXA 3DZ8A 3SF0A 3ZK7A 1LVGA 2NQTA 1ESZA 5JYCA 3PNVA 2V45A 1CJUC 3IQEA 3LBAA 1EK5A 2X1MA 3ZZUA 1S4QA 4ZN6A 5AMXA 3W1VA 4NX2A 4WW0A 1Y8ZA 2LWIA 1E4EA 1RPNA 2K4MA 2Q3LA 5L6LB 1PS0A 4X8MA 3U37A 4HQLA 3OJEA 5GWXA 4F4CA 3PEVA 3K0AA 1FU8A 1QHYA 1RZRA 1SN7A 3G85A 1KTIA 3S27A 1WPGA 3FFTA 2CLSA 2YW2A 5HF9A 3J80A 4XUEA 5CNMA 2HQ1A 2WMNB 1OW3B 5D01A 2CYBA 1Z88A 3CGGA 4PVDA 1PNVA 5L7TA 3O1HB 3WAGA 3D8BA 2PH3A 4MW1A 4M7PA 4B82A 4D82A 1YMUA 2K87A 4BZZA 4FLFA 2HU8A 1R3UA 1Y5RA 3JATA 3MT7A 3VU9A 3ZY2A 4NYIQ 1GPKA 1WCV1 1U31A 5D5PA 3EDQA 3IQWA 3O84A 2UU9B 1YRLA 3PGA1 5EQJB 2CMDA 2C58A 3QVXA 2JH3A 2Z4SA 2HLNA 1H4QA 1B0AA 3EMVA 5BORA 2QD2A 1D1QA 2BLNA 3CNQS 1AQIA 3GBSA 3TZKA 3VPDA 1XZIA 5HJEA 2NU8A 1ORIA 3KO8A 1E3MA 3IE1A 1DAFA 2EIXA 1CUHA 1J8MF 2H1OA 1CC1S 3M6UA 2P2DA 4M4SA 3B1XA 3UGQA 4S0XA 5EIEA 5C5CA 3WWDA 2HFKA 1DQYA 3MCAA 3RT9A 3GAMA 3EYAA 3ZHTA 5AW5A 3KFLA 5DHFA 3TECE 5J23A 1CIPA 4REOA 4YXWD 2QTVB 1MENA 4C6SA 1HYGA 1ODLA 5CYFA 2A3NA 3A6LA 3BHMA 2OYCA 2VJCA 4PZEA 3ADDA 3IV7A 1MPXA 2IV7A 1DTWA 1T4CB 1TLFA 2D0OB 4FNMA 4IUCS 3SEQA 4A8PA 4W5NA 4XCXA 1YKFA 4NPAA 4DL9A 2X8WA 1VDMA 1X8XA 2QT0A 2TYSB 3S2YA 1BTOA 1TIKA 2I7CA 1CU1A 2HU5A 1U2ZA 1FMLA 1TF2A 1P5RA 2VUSA 3QWFA 1XNHA 2HRCA 1T8PA 4MJXA 1YZGA 1XTUA 3E8MA 5LA6F 3OZGA 1JXAA 2BDUA 1SVNA 1OKKA 2FVXA 1OV6A 1TZMA 1U90A 1VYTA 2HDNB 4R3NA 4ZEOA 2O8CA 1L8AA 1XOIA 4QFCA 4RHCA 3A31A 4OGGA 2Z6AA 1KBQA 3VKVA 4BVGA 3HBAA 2XSZD 4TOIA 1BVRA 5F5NA 1TF7A 4R2HA 2R6CA 1P3Y1 3AYZB 4LGCA 2W83A 4O29A 3WJ1A 1OB2A 4PC1A 2FKNA 2ZE7A 3VO8A 2J0QA 1A9QA 2CXNA 4LDAA 1NJ2A 4UMFA 2JJ8A 3QUCA 3EODA 3Q1LA 4IEEA 4CKBB 3TQFA 1PJAA 2JVJA 1CZLA 2PS1A 3B3AA 2OD9A 4JLOA 2V4ZA 4TL9A 4BMOB 4DBLE 3BERA 3MCUA 4JROA 3WISA 2GCPA 2ZJ0A 1XDUA 3AY0A 3P4YA 1D4ZA 3OLVA 4IS2A 4KXXA 3INGA 2WWIA 4K9MA 3WK7A 3JD2A 4MLCA 1USUA 3QHQA 4UFNA 2WI8A 2J3EA 2RGXA 4QT4A 1W1WA 1LRKA 1VLLA 1ZKMA 2NWQA 1C8KA 4QU9A 2FY8A 5EERA 1OH8A 1OGJA 1Y6ZA 1NUUA 1FRQA 3PD0A 4RGVA 1ZD1A 2C5HA 2I3AA 1O95D 2OZKA 1U2SA</