4DQXA

Crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
255
structure length
255
Chain Sequence
b'SMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEIGSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNGGGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFAEAKDPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSIGNHLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable oxidoreductase protein
molecule tags Oxidoreductase
source organism Rhizobium etli
publication title Crystal structure of a short chain dehydrogenase from Rhizobium etli CFN 42
rcsb
total genus 85
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dqxA00
1PS8A 2IXBA 2IEBA 2F00A 3RKRA 1DBVO 2G17A 1PJLA 1K6XA 2VZ0A 1HT0A 1M6HA 4I5EA 1UZLA 4EITA 3GPIA 4BO8A 1MP0A 2DPHA 3GEMA 4R41A 2PNFA 2GYYA 4PVCA 4Z9XA 5JAMA 4PLPA 4RVGA 3W6ZA 4BNHA 4YRBA 1QYDA 1GZ4A 2FPGA 5JYEA 3Q3CA 3BMOB 3H9GA 2Y1EA 3M2PA 3KYDB 1LXCA 4LSWA 5TT1A 5JYDA 2EGGA 1K2WA 4K6FA 4KUGA 5A5EA 4HX5A 2G82A 2V6FA 3PPIA 1XELA 4GBJA 1X13A 4DIFA 2BI8A 6ADHA 4J7UA 4CR8A 2DT5A 1E3LA 2QRLA 1NFQA 1VE9A 1KEWA 3FNHA 5B4TA 1F06A 1UR5A 1HE4A 3TOXA 3LF1A 4BMSA 1NWHA 1BWSA 2ILTA 3VVBA 5DT9A 4I1IA 4KP7A 2VWHA 3RU9A 3WJAA 3UVEA 5TJ9A 1Y8QA 2WSBA 3D4NA 4BO6A 2BKAA 3AM4A 1BDBA 4WASA 4YR9A 5B1YA 3ZHZA 3TFOA 1PJ3A 1WAMA 3HG7A 3PRJA 2HAEA 4IXTA 5JDIA 4FPXA 1BMDA 1DXYA 1ZIDA 2OORA 3IUPA 2O2YA 3WYEA 5TJHA 1T2AA 5F21A 2HJRA 3G1UA 4YJFB 1E6UA 3D64A 4KOAA 2CMDA 2VTEA 1D3AA 3PP8A 5JC1A 1AXEA 1ZSYA 1E1LA 3VVCA 1C1DA 4GL4A 1HDGO 1KVTA 3HSKA 3BMOA 2I9PA 5L4LA 4BUCA 4HXYA 4CMHA 3VPSA 4R68A 3OA2A 4HWKA 4OYRA 4WEOA 1YOVB 3BHMA 3IL2A 2OP1A 2B36A 2OZPA 4RV9A 4J91A 3EAGA 2J3KA 1N1EA 3GQVA 4CMKA 1G6KA 2NLOA 1HDZA 4TRNA 2WMDA 1YQDA 2FPPA 4D42A 4ZQEA 4B4WA 1MFZA 1JAYA 5JDCA 5EINA 3ZH2A 3PJGA 3I6QA 4RVHA 1DAPA 1U1IA 3DBLB 2P5YA 3H9JA 3RROA 4OL9A 4CM7A 3A1NA 1ZMTA 4JJGA 4JXKA 3S8MA 1SOWA 1QYWA 3GVXA 4XX0A 3CH6A 3ZWOA 4G5HA 4B4OA 2O7SA 5LDGA 5ITWA 3I6IA 4BNYA 2UVDA 1HZZA 1OAAA 2XPCA 1R15A 4XQGA 2W2LA 2GRAA 4OJNA 1KVQA 4QX6A 1B8PA 1O9BA 1B0AA 3ZWBA 3H9QA 1E1MA 5A05A 1LX6A 1ISHA 1JVBA 3TZQA 1NNUA 2Q1SA 1PGPA 2EKQA 5KKAA 1E5LA 2YY7A 2JFGA 3JYLA 4IJVA 2DUUA 1N7HA 4FJ0A 1ISJA 1ZFNA 4UVIA 5TNXA 2YQ5A 4FB5A 4IDGA 3OFSA 3DZGA 4E3ZA 5U9CA 1WXDA 4NU5A 1NWCA 4YT5A 5I8ZA 2UUOA 2EJVA 2ZB4A 2NVBA 3LK7A 4O59O 4W99A 3AU9A 3MOGA 2YV2A 1QYXA 3HNPA 2Y0DA 4BGVA 1GY8A 3F1KA 3H9UA 1C3VA 5AXCA 3W4JA 3E03A 4JBGA 1PGQA 1UP4A 4PZEA 2A35A 1EBUA 3JQ7A 3VTFA 4A7PA 2J3JA 1ZK0A 3DHNA 4CMGA 2FR0A 1EVYA 2IZ1A 2XXBA 1LU9A 3JD3A 2HUNA 2EERA 1R66A 4UVHA 4HFRA 4II3A 1I8TA 2Y99A 4WCDA 4IDFA 4PZDA 1MUUA 1K0UA 1PIWA 3ZHBA 5CDSA 3WG9A 1ZXBA 4PLHA 4Y9DA 1EQ2A 1Z6ZA 2WE7A 3ANLA 3KSDO 1NR7A 4UUPA 1EFKA 3BMCB 3G1TA 3KLMX 4EUEA 4FC7A 1E3SA 3OH8A 5CDYA 1EUDA 3LT2A 5KTKA 2YDYA 2ZCVA 4J3FA 3F9IA 4BB5A 2ZATA 4RF2A 2VNAA 1FDVA 3SXPA 3DZJA 4ZA2A 5HM8A 3MWEB 4MKZA 4RQUA 5IDXA 2QHXA 3FPLA 5A02A 3ZU3A 1ZUD1 4XEHA 3UICA 3JV7A 4ZQHA 5KJ6A 5KWEA 2DLDA 4J1TA 5DDIP 1DC6A 4MKXA 3RUDA 3VC7A 2I66A 1E7SA 1ZK4A 5H81A 2FR1A 1A4IA 1MC4A 3QW2A 1MXFA 2VYVA 3NUGA 4FSHA 5DCWA 4RVUA 1U9JA 2C59A 4XCVA 3DBHB 3DQPA 3WGTA 1N1GA 4OGWA 1HWYA 2X9NA 3E9NA 1HSZA 1KVUA 1SZJG 2E49A 1Y5MA 4L4RA 3SEFA 3VZQA 4CMBA 4XB1A 4CJXA 4YYZA 5TLSA 1IPEA 1B3BA 3L9XA 4BMVA 4XQ9A 4XYBA 4WLVA 3HB5X 1U7TA 4URFA 1NYTA 1A7KA 1G1AA 2ZTLA 3VPHA 1UDCA 3FRJA 3JQ8A 1VL8A 4BGIA 1DFIA 3RVDA 3U4CA 1H9AA 2VZ8A 5A9SA 4O0LA 4IIVA 1XGKA 1XHLA 4IIUA 4M87A 3PJEA 4IUYA 3WXBA 1TXGA 5DBGA 2JD2A 1BXGA 3JSAA 4Q3EA 5F5LA 1ID1A 4YJGB 2UV8A 4MIYA 4NI5A 5G0WA 2BHLA 3IJRA 1P33A 1DJNA 1AHIA 3WMXA 1IZ9A 3FTPA 4RPKA 2IZZA 3ROPA 1B8VA 3QA9A 2JKVA 1QV7A 3K6JA 2ZB8A 1ADCA 4BO4A 1NHGA 4FS3A 5LC1A 1E1NA 1DLJA 3EUWA 1V9LA 4WLNA 4EI2A 1IB6A 3O9ZA 4BNFA 4F6CA 4NIMA 5KJ1A 4FQ8A 4FC6A 2C5AA 1TLTA 2PKRA 2CSUA 3KETA 1BXZA 1QORA 1VJTA 4CM4A 4OIMA 2DTDA 4R3NA 3F3SA 4MINA 4DYVA 1V3TA 5ENDA 3S2FA 4E0BA 4TKLA 1C0IA 4YCAA 1WWKA 2D5CA 4A0SA 3QQPA 2JD0A 1QSGA 2C2XA 5EQDA 4YB8A 2GSDA 1QRRA 3OICA 3C8MA 1ULUA 4AICA 5A9RA 4A10A 5A06A 4YJHA 4NBRA 2YFQA 3HQ4O 2G5CA 1MA0A 1PL8A 4NBWA 4IY1A 1P44A 3G0OA 4ILKA 4IS2A 4KQWA 1LSSA 2DU8A 1GAEO 3NAQA 2OBNA 4IM7A 4RJTA 4NG5A 4NFHA 2NTJA 3P5SA 4WJZA 3IP1A 1MFPA 4B7CA 2PY6A 2W2LD 4XR4A 1ZK1A 1J4AA 4G65A 3ZW9A 4INAA 3WICA 3E5MA 5CEJA 4CR6A 4PLZA 4Z6KA 1NVGA 3CINA 1P1KA 1JAXA 1EVZA 3MZ0A 4BQPA 3VTZA 5KIAA 4OKIA 4I9NA 4U0KA 4W82A 1GEEA 1M75A 3AM5A 1HEUA 3GA0A 5C37A 3GRPA 1ARZA 3WTCA 4H7PA 2VHVA 1A9YA 5T64A 4FGWA 2C29D 2ZTUA 3S2EA 1J49A 1H93A 5GZ6A 3UAGA 1ZXLA 3GNSA 4BKOA 3EW7A 3RWBA 2IZ0A 4TVOA 1EZ4A 4FFNA 2WYVA 3STHA 5CEFA 1I0ZA 2RCYA 5JAZA 1Y9AA 3WJ7A 4Q39A 3H7AA 3TF5A 3AUAA 3JQ8B 3UF0A 3ST7A 2GO1A 4N5MA 4DMMA 5JDIC 1PWZA 3ASUA 2B5WA 3CZMA 5EESA 2I3GA 1S7CA 4DC0A 3KYBA 2R2GA 3GAZA 5JO0A 3A28A 5L7WA 1Y9EA 1EUZA 4QUKA 1Y8QB 2YYYA 3FI9A 4BHTA 1XU9A 4E5NA 3I4FA 1NP3A 3VH1A 1VL6A 5K6AA 5KCZA 3DDNA 4CUKA 2Y0EA 3L4SO 5AVOA 5T5QA 1DSSG 4WNCA 1DRUA 1KEVA 3DBRB 3C24A 1YL5A 2VUTA 1K6JA 3Q1LA 3FR8A 5JC8A 4AJOA 5A03A 4E5MA 2ZTVA 4YAIA 4YT8A 4IDAA 2E37A 1DLIA 4U8GA 1EBFA 5A9SB 5TSDA 4E33A 1DFHA 1A7AA 1M66A 2VN8A 3OJLA 4UAGA 2FHSA 1I5RA 2C0CA 4U7WA 4F6LA 1P31A 1D1SA 2GPTA 3D4PA 1DOHA 3EYWA 4K9DA 3RUEA 1I3LA 3AUUA 1ZJYA 3UOGA 2Y66A 2BFMA 4JX8A 4BV8A 4YQZA 5DBFA 4I9HA 4CUJA 1BW9A 4CM9D 2GN8A 3E9QA 3ENKA 1CF2O 2GNAA 1GL3A 1QP8A 5DZSA 4YJDA 4CLXA 4R9SA 1I2BA 2OP0A 3GZ4A 3LSYA 5A04A 1NASA 3K9QO 4PRLA 3SLGA 3AUTA 5JDCC 1J6UA 3LT4A 2UAGA 4HFNA 2P4HX 3KXDA 4IJKA 4U6QA 5JPIA 3SJ7A 4OAQA 3ZI0A 5BSEA 1PJ4A 4QSMA 3F46A 3LU1A 5F1PA 1FDTA 1WVGA 3DBRA 2QRKA 4D46A 3GY0A 2OBYA 3HN2A 2O4UX 4Y6SA 2QQ5A 2NTVA 2OO5A 3WR5A 1D8AA 3RBVA 3QLJA 5FI5A 5JW6A 3P2OA 4RCVA 3OQBA 4UEJA 5CDUA 1Z7BA 3WQRA 1KETA 3HADA 2BH9A 5FYDA 5C3MA 4GGOA 5FEUA 3FNFA 4O5OA 1IHYA 2FSSA 1PEDA 1GQ2A 1BXKA 4J2OA 2NVWA 4CM8A 2H9IA 3W8FA 4XIJA 1OZAA 4NHEA 2WD7A 2YUTA 5T57A 4A73A 2O4CA 5C5IA 1P77A 4ND3A 2O3RA 1BW9B 1HE2A 4J0EA 3S55A 2OGUA 1UZMA 4U6SA 2X5KO 2O23A 1XG5A 4HNHA 2HU2A 4P4GA 3DAFA 3ZGYA 2JHGA 1LSUA 4CL8A 5KJEA 1DAOA 2EHDA 4JK3A 4DYDA 2PGDA 2AHRA 3LLVA 3RUAA 3ZCXA 1ISMA 1YGYA 3GN2A 1O6ZA 4WE3A 3CXRA 2X4GA 3BYZA 3H2SA 2ZJ1A 2PZMA 3WGYA 5I9LA 3ZU2A 2BGLA 2C5EA 4Y67A 4RGBA 1CRWG 3ON5A 3RC1A 4DPKA 3NDRA 1HZJA 5IFLA 2GUGA 1EUCA 4XGNA 1IULA 4H15A 3RIHA 1GUYA 4HY3A 5DCUA 5JAIA 3VOSA 1H6BA 5G0SA 4M55A 4P8RA 5U4QA 7MDHA 4MPDA 4UUMA 2GCGA 5G4KB 4NBVA 3AJRA 3LC1O 4YAKA 4ALLA 2P9GA 2Q46A 5IF3A 1IL0A 4IJUA 3PK0A 5KOIA 3GDOA 2W2KA 3BMQB 4AFNA 3F4BA 1E5QA 3JQBC 1DFGA 3U4HA 4BNLA 4ALMA 5IZCA 1YWGO 4RF4A 3ZNOA 4KTTE 1HKUA 4MVJA 4QT0A 4LVUA 4I08A 1FJHA 4GVXA 4K26A 1GYRA 1T1RA 4P4NA 5IG2A 2ZTMA 3AOEC 1TT5A 5TRTA 3ZWNA 4E2YA 4R1NA 5IDWA 2O2SA 4II2A 4AJIA 4FOOA 3JYQA 2YJZA 2NU6A 4YAEA 1ZSVA 3MJTA 3DONA 4CL3A 2F1KA 2X7HA 2Q49A 4RDIA 3V2GA 1PS9A 1YJQA 4CV2A 1EMDA 4XWYA 4HFJA 4BNMA 4B3IA 2DBZA 4Z0PA 4F3YA 5HRUA 4BO1A 1PQWA 3WBFA 2V6BA 4ZQBA 2B4QA 3VH2A 3SJUA 4DC1A 5B12A 1DC5A 4FD3A 2AQKA 1T1SA 3UXYA 4FIZA 1GPJA 3WDSA 3K2EA 3LT1A 5HWSA 2Y1GA 3O03A 4BNJA 2J5RA 4D3SA 1LJ8A 1I33A 2X0NA 2I99A 4DL9A 5TGDA 2DPGA 4RLSA 3DBVO 4MVJH 1X7DA 4UVEA 4MVJM 3QVWA 1HDYA 1UH5A 3ZW8A 3LT0A 4I5FA 3OETA 2WWRA 1ENZA 4ND1A 1L7EA 3BMNB 3R3SA 1AHHA 4DPMA 3M1AA 3BXXA 2CFCA 3V8BA 4GPD1 5T67A 2Z95A 3FN4A 3ICCA 3JYOA 5A3VA 3IUSA 4D41A 4IQ0A 1XU7A 4DIBA 4BO5A 2C82A 3DZBA 3DOJA 4ZN6A 2HMVA 3WYBA 3QSGA 2X0RA 2POQX 3RU7A 5FFFA 1VLLA 4WCFB 2VRBA 1E7MA 3L6OO 3JQDA 3PIDA 4LSMA 3IMFA 1PSDA 3NGXA 3PYXA 1UUFA 1BTOA 1VI2A 4IDBA 4NBTA 1SCUA 3WWZA 1PGOA 4DQUA 3D0OA 1I10A 4E21A 5CFZA 4Z9FA 3AFNA 4ROSA 3DAPA 3KSZO 3KEQA 4EEXA 1QLJA 1GDHA 4C7KA 4BB6A 3HFSA 1W0CA 3L77A 3OM9A 3OQ1A 3FHLA 3PGXA 3QY9A 5EMHA 4B3JA 3JQAD 4J1SA 2PKQP 2JFFA 4GQAA 4XYEA 5TS3A 1H94A 2NWQA 5ITVA 4PLYA 5B4UA 4OXKA 1DC3A 1TVEA 3H5RA 2CF5A 3GVHA 3ITDA 3GPDG 1HYGA 3B20A 4CLOB 1QV6A 3DHEA 4GAEA 2X9GA 3WBBA 1Y8RB 3RI3A 1X15A 1E7WA 2HCTA 3SX2A 4WLFA 2NNLD 3I9NA 3OJOA 3D3WB 3OMLA 1A4UA 1DB3A 4PFJA 4WPGA 3ZN2A 2Y93A 5AXAA 2GD1O 3KRTA 3GNTA 1C0PA 5C7LO 3W4IA 5ES3A 5ICSA 1F0YA 2H5LA 5EL0A 3B1JA 4Q3BA 4BNVA 2WYUA 3E1KA 4R69A 3JD4A 2BF7A 2HLPA 1JTVA 4Y8VA 5TT0A 1NPYA 1P1JA 1QG6A 2E4AA 4LRSB 2LDXA 1A72A 1MXHA 1RYEA 3HWRA 4YA6A 1PS0A 3TSCA 3PQDA 4EJ0A 3LVFO 5IXSA 4RVDA 2PR2A 1XKQA 1BVUA 4OQZA 1E0DA 3DTTA 3PHIA 3C1OA 2B4TO 3WGZA 4CMIB 1U4SA 4BVAA 4IMRA 5COBA 3NV9A 5U1PA 3L6EA 4JJIA 4YT2A 4CQMD 2DTEA 4Q3DA 5BNIA 3WNVA 1TA4A 3B6ZA 1SMKA 4WNIA 5HS6A 1NM5A 3GFBA 4M49A 4NZ9A 3MTGA 1PJCA 1CWUA 3TN7A 4A27A 4CLRA 3I3OA 4JQCA 3PZBA 5G0UA 1XSEA 1A71A 4YTEA 3FR7A 3ITKA 1LQTA 5EQFA 4EYEA 4LRTB 4KTVE 4NK4A 5FF9A 2BELA 3VH4A 1BXGB 1LEHA 1UXHA 3R3JA 2AE1A 4JLWA 3Q2KA 4CQMA 5K6AC 1PR3A 4S1VA 3WNQA 1R16A 3PXXA 5HTOA 2EP5A 1MGOA 2ZQYA 3G79A 5DP2A 3U4DA 1LSJA 2ZYAA 1LRJA 1UXGA 3I52A 4RL6A 1ONPA 3PJDA 3QRWA 2Q2QA 2AEFA 2O3JA 2WJPA 4N5NA 1KVRA 2VZ9A 3VH3A 2B37A 1KS9A 1I32A 1N2SA 1YQXA 3SC4A 1XEAA 3GT0A 5CEEA 3PEFA 4GX5A 1LLQA 4HBGA 3D7LA 1WDLA 4D0SA 1VPDA 4RVFA 4UULA 1I3KA 4FCCA 5HA5A 5K9ZA 2YZ7A 2IXAA 2C54A 2BGKA 3CTMA 2D1YA 1AUPA 1LNQA 9LDBA 1YKFA 4W7HA 3ZV4A 1EVIA 4TWRA 1UP7A 1I24A 2AXQA 2NQ8A 4GSKA 1MG0A 2GN6A 3X2EA 3WQQA 4XDZA 1LDMA 2YDXA 3L4BA 3A06A 3UH1A 2Q99A 3N7UA 4YACA 1RJWA 4UUNA 5HS4A 5JY1A 3PDUA 1M67A 3EVNA 2YV1A 4GLLA 4GKVA 4PG7A 4TZKA 4RF3A 3ZU4A 4ZRNA 4FFLA 5JS6A 1ZO8A 3DOOA 4LGVA 1IOLA 3ANMA 2R6JA 1CIVA 4FGSA 5COQA 3S2GA 4EJMA 1LDYA 1SEVA 4AJ2A 2VHYA 4CLEA 3I9JA 3HZZA 3NGLA 5F1KA 1C1DB 4ESOA 3CZRA 3GAFA 3MEQA 3G17A 1Q1NA 4IGFA 4QO8A 1LDGA 1P9LA 3KHUA 1T2EA 5JNLA 1JKFA 7ADHA 2QRJA 4DQVA 3HDJA 1G0OA 2BD0A 1DIRA 1L1FA 4RPGA 1LA2A 1BRMA 1YDEA 2W4QA 3EDMA 4XRGA 1SB8A 4XD2A 3RQSA 1YJ8A 2E6UX 3KUXA 4FW8A 5L53A 4CM3A 2X5OA 2RH4A 3ROQA 1R6DA 4J16A 4MIEA 2RAFA 3GH3A 4AJPA 1PGJA 2I65A 5DOZA 4TQGA 3HDYA 4L76A 3OF2A 1PL7A 1SEPA 3C1AA 1MB4A 3IAHA 4ONEA 2P2SA 3RCBA 4NDNE 2ZJ0A 4G81A 3O8QB 1F8GA 1EE2A 1VJ0A 2B83A 3HDQA 3OSUA 4J43A 2Y67A 2Q4EA 4DUPA 5L4NA 3EMKA 2E82A 5BT9A 4JJFA 2PV7A 4ITUA 3PIIA 1TT7A 3M1LA 2BRUA 3WOHA 1NQOA 1TB4A 2PZJA 4AJ1A 4YJHB 3TFQA 3NT5A 3V1YA 5IDQA 4A2CA 4R54A 3HN7A 3P2YA 3RBXA 2CVZA 4J4BA 5IDYA 4DPLA 2D3TA 2OMEA 1I01A 3Q6IA 3H5NA 3AY6A 3QV1A 4FJ2A 4ZQGA 4FFRA 3ZHXA 4BOYA 5KVSA 2WDZA 3K96A 1PL6A 2JHFA 2GN9A 4U0JA 1SO8A 3AWDA 1B3RA 1UAYA 1LRKA 2DM6A 1YDWA 1YOVA 1HDCA 3OIGA 4PCVA 3ABIA 3PZRA 1V3VA 5THQA 4AJ4A 2NV6A 3I23A 1ZKMA 5DBIA 1HSOA 1KY4A 1U4OA 1GQQA 4MP8A 1J0XO 1ENPA 1PZHA 3H8VA 1ADBA 1HYHA 1RM3A 2EEZA 3T4XA 4CQMB 4WLOA 2O7QA 1L7DA 2B5VA 4JBIA 4XDYA 4J7XA 3PI7A 3W6UA 3FNGA 3GVIA 1WMBA 4XR9A 1UAGA 2ZIZA 4CM8B 3VPGA 4CQLA 1E6EA 4LN1A 2FP4A 4UUOA 1O95A 2GN4A 3WIEA 2B0JA 1CYDA 2O3QA 3LF2A 5MGBA 8LDHA 1Q2XA 3JTMA 3T7CA 5CDGA 4I9UA 4RZIA 1U5AA 3LLSA 1J5PA 2X58A 1TI7A 4GKBA 1BDMA 2V6GA 3E82A 4NFSA 4CM5A 1W6UA 3N74A 1AE1A 3VAZA 3MCVA 4BS9A 2XXJA 2DBRA 1T4DA 5DN9A 2B4RO 2Q45A 1P3DA 1H6AA 3U9LA 2HJSA 3HE3A 5JO9A 1R0KA 3H3FA 3UCFA 2I67A 2FMUA 1QMGA 3K5PA 3ZV3A 3Q9UA 4EZBA 1U2DA 4EGFA 4XJTA 3AY7A 3QVTA 4MVJG 2IYPA 2WD7B 1KBZA 1WLYA 3DZFA 1Q7BA 3WYCA 2C7GA 2EP7A 1T2DA 4QECA 2PD4A 4R4JA 1DIHA 4WK6A 3ROKA 3PQFA 3U49A 1N92A 2X6TA 3AOEA 3JD1A 3MJSA 1NFFA 4XGKA 1D7OA 4J0FA 1OC4A 4YPOA 1X1TA 2JAPA 3AOGA 5EERA 3MJ4A 2GZ3A 4LMRA 1R0LA 5JCJA 4GWGA 1X7HA 5IZCC 1DRVA 3TOZA 3QVSA 4R3WA 4EW6A 4D44A 2AG5A 3F5QA 3GFGA 5T8KC 2VUUA 3PWKA 4CLHA 2IRWA 4ALJA 1E92A 4YJFA 4A03A 4J7CA 1QXSA 4BNWA 1U3TA 1UZNA 1PR9A 3JQGB 2P5UA 1ML3A 1I2CA 1FF9A 1Q7CA 2H63A 4GLOA 4E5KA 2AW5A 2QYSA 1P1IA 3JQ6A 4W9NC 2AQHA 2G76A 1UDAA 4K6CA 3VZRA 2ZYDA 3ETDA 4EBFA 3GDFA 1UXJA 3QWAA 4C4OA 2P68A 1O94A 3C85A 1PJQA 1KERA 2Z1MA 2ZB3A 1H5QA 3WFIA 3FSRA 5THKA 1AN9A 3NEPX 1R0SA 4MO2A 1C0KA 2Y1OA 3I83A 4R5MA 5EJ2A 2O3SA 4B4VA 1U3UA 4FBGA 4CV1A 4OMUA 4YQYA 4E5PA 1O8CA 3OP4A 4PG5A 4YRDA 1N8KA 2NVUA 3NKLA 3WX0A 5ADHA 1X1EA 3ONDA 2CZCA 2DC1A 1VJ1A 4H16A 3U62A 2GLXA 2X9VA 1F14A 3KB6A 1FXSA 4CPDA 3E8XA 1DEHA 1VKNA 4BO7A 2AEJA 2X22A 5T8KA 4ID9A 4TVBA 3WWYA 4LW8A 1QLHA 5L95A 2QW8A 5DF1A 3DFUA 3RSHA 3AK4A 1BGVA 2GZ1A 3TZCA 5L9AA 4DA9A 1ZSNA 4L9RA 4OSPA 4GX1A 2NM0A 2V6MA 4I8XA 3EGOA 4B7UA 4E32A 4BO9A 1WZIA 4WCFA 1WDMA 2PTGA 3DWFA 5F3RA 4DTIA 1ADFA 3PHLA 5CDTA 3HUDA 1YXMA 1DDOA 2RHRA 3HHPA 2CUKA 4EEZA 2OUIA 1YB1A 1ZK3A 3ZHYA 4MDHA 3RC9A 1A27A 2CF6A 4Z3KA 1YRLA 3EVTA 3IKTA 1MX3A 2EW8A 3SC6A 3UCEA 5IAAA 3UFXA 4BNKA 3RJ9A 1JWAB 5EPOA 1PTJA 2CY0A 1NQAO 3EK2A 4YDRA 3WB9A 2UUPA 2NU7A 1LC0A 2Y05A 2BFOA 2VYND 3GGGA 3PYMA 3V1UA 3F5SA 2PK3A 5BQFA 3R6DA 4AJHA 1ENYA 3IC5A 4M8SA 3C7DB 2IE0A 5I7EA 4IQGA 4JIGA 4MVJF 2FRDA 2AQIA 5I8WA 3I9OA 4FN4A 2UYYA 4J2HA 3ADPA 1BSVA 5L4SA 4D43A 1AXGA 5A9TA 3WGGA 2ET6A 3MJCA 1T24A 3LYLA 1Q7GA 4NR0A 2J5QA 5I9NA 2ZYGA 4F45A 4ZGWA 5B4VA 1MG5A 4CMCA 1ZNQO 1E3EA 3PHGA 1XR3A 4BKQA 3INTA 1PJ2A 1GD1O 1M6WA 1EK6A 4DBVO 3TPCA 3ZNPA 4CM9A 5AQ1A 5JCXA 2CD9A 4DQXA 5EIOA 1E6WA 1LSOA 2BMAA 2CDBA 1YO6A 4NU6A 5KVQA 5TIIA 3RC2A 4D3DA 1JQBA 5IXYA 3KLPX 4PLGA 1EFLA 1GQYA 5DOVA 3EY4A 4IDEA 1YBVA 3WFJA 3RFTA 2VWQA 4IPTA 4KWHA 4R16A 1MV8A 1P1RA 4N7RA 3IJPA 4AL4A 4MVJD 1NVMB 3GEDA 4WOKA 1F12A 3TL3A 1B15A 4BKRA 4E31A 4E2WA 1N9GB 1ZBQA 4NNJA 1T26A 1XYGA 2AE2A 2IODA 4XYGA 4ALIA 2XOXA 1KY5A 1VC2A 1LDBA 5DCYA 2HMUA 4GVLA 3UN1A 1YVEI 5G0VA 1NXQA 2Q1TA 1XWFA 5G4KA 4AJEA 3OECA 3ZWAA 3DTYA 4FFPA 1GADO 2CDAA 4Q3NA 4BNNA 1SBYA 1VSVA 4IBOA 3ANNA 4AJNA 4DBZA 3DB2A 4KDFA 3QP9A 2D59A 2AEMA 4YXFA 1VL0A 3ENNA 5GMOA 4PG8A 3GN1A 1DHRA 3KV3O 3JQ9A 5J23A 4I5GA 5T6BA 2Y1CA 3HDHA 2FZEA 1HL3A 1B7GO 2EW2A 2GASA 3GGPA 3LC2O 3UGKA 5JMWA 4Q9NA 4ND4A 5LDHA 3WQSB 3V5NA 4CV3A 4KQXA 3GEGA 3ZWXA 1O0SA 3DZKA 4YJGA 1SC6A 5BNTA 1WDKA 4CUZA 1DPGA 3ZZNA 5BSHA 2GGSA 2W90A 5JMPA 4R5HA 2NVUB 3DMTC 1SPXA 4PLCA 5FI3A 4BL5A 3AM3A 1U3WA 4ALNA 2JFHA 1LLDA 2JAHA 1KC1A 4LCEA 1W8DA 1ADGA 3H9EO 1PZGA 2NSDA 1JDJA 4CMEC 4L75A 3VKUA 2HMTA 4UVDA 3ZWWA 1CQJA 4L0QA 4LCJA 3OIFA 4OXNA 3PJFA 4B3HA 4GGPA 1BVRA 3MJVA 1M76A 5CPBA 3NDJA 2HRBA 1OI7A 4RF5A 1NPDA 4G2NA 4CODB 3FNEA 1V0JA 4RVSA 3NRCA 1DIGA 4RPHA 2VCYA 3F47A 4GMGA 2DFVA 2YHIA 3GNQA 1B2LA 2VHWA 3EHEA 4K1LA 4R1SA 1KVSA 2O48X 2O3TA 3OIDA 3OJFA 3TNLA 2I6TA 1LI4A 3BA1A 1YL6A 1MLDA 3IOYA 3AY3A 3JQ9C 4HKTA 1P1FA 3BHJA 2DVMA 2TMDA 3EZLA 4WKGA 4JGBA 1JKJA 4UEOA 1OC2A 2EJWA 3EZYA 3CKYA 4BGEA 1N7GA 3PHJA 4ZQFA 1SNYA 4KUEA 4D79A 1V35A 5GZ3A 2R00C 3ONEA 1JVSA 3GR6A 4KUHA 2J6IA 3GHHA 5A1TA 4BNUA 5C7OO 4BNZA 1V8BA 5ER6A 2EKLA 3D3EA 3Q2IA 4E4YA 5JSFA 1GV0A 4GX2A 3TJRA 4W4TA 4I5DA 2OL4A 1YS4A 1ZK2A 2ZK7A 1RM4A 4YBZA 3DC2A 3IIEA 1YE3A 2I76A 3BTUA 3H2ZA 4AVYA 2UDPA 3DEYX 1NHWA 3P7MA 3UKOA 2X8LA 3W4KA 3H3JA 2D8AA 4TRRA 1ZMOA 1U8FO 1G0NA 4R01A 1X0VA 4LK3A 1LTHR 3WGHA 4TRMA 4P4LA 4RO0A 4OO3A 5COAA 5G0TA 4A5OA 5CHEA 1CEQA 4Y6PA 1ISGA 3ADOA 3TL2A 4PLTA 1FDUA 3VDQA 2Q50A 1WMAA 3AI1A 5I7FA 1ZVMA 3I9LA 4GWKA 2Y0CA 1PJSA 2Q4BA 4J1QA 1NFRA 5IZ4A 1ULSA 1PZFA 1N9GA 3KO8A 2NU9A 2OHXA 1GR0A 1E3JA 1Y5RA 1GYPA 1QYVA 2JCVA 2PD3A 2RHCA 2FZWA 2PH3A 3QWHA 1XQ6A 3R1IA 1X7GA 3NX4A 5TQVA 4BIIA 5JLAA 1OFGA 4CMIA 3QVXA 4FDAA 1CERA 1Y81A 3DBLA 4HFMA 3U4IA 4YT4A 3KZVA 4XGIA 2AMFA 1HYEA 5ILGA 4L4XA 1YBMA 4BNGA 3INGA 3PWSA 1LC3A 4ZD6A 3BTSA 1Z73A 4PZCA 1P45A 1NAHA 1ISIA 3GG9A 3H4VA 3L9WA 5DNAA 4P38A 3LZ6A 1B8UA 2HKIA 3ETEA 3VZPA 3WS7A 3CMCO 2VWPA 2NQTA 4D0RA 4DLBA 3ONFA 1C0LA 4OH1A 1NX6A 2GZ2A 3KEOA 2WYWA 1C1XB 2DTXA 4Z0HO 1JU9A 2BGMA 4EUHA 1JA9A 3R0IA 2FPIA 2E48A 4Q3CA 2C2YA 3JQBA 1T4BA 2Q1WA 2Q2VA 3GZNB 3ZV5A 4NPCA 3RAJA 1I2ZA 3GRKA 2W8ZA 4NK5A 2JCXA 3FBGA 5L3ZA 3S2IA 4DRYA 5F5NA 4DXHA 4YWJA 5CG1A 4WEQA 4ZVVA 3OBBA 5L7TA 1GPDG 3H6KA 4CQLB 4KDEA 3NJ4A 4XRRA 1OMOA 9LDTA 2FR8A 2EWMA 1JWBB 1Q0QA 2C7VA 3ASVA 3GUCA 3D5QA 2H6EA 5L7YA 4IINA 4XB2A 3PFWO 3N58A 5KNLA 4D45A 4Z3DA 1U2GA 4GSLA 2EV9A 3FBTA 4PG4A 2WEKA 3D1LA 4RZHA 4DVJA 4D3FA 1KOLA 4NBUA 4ZHSA 3D4OA 2JD1A 4CM4B 2P91A 3M6IA 4FR5A 5GY7A 1EQUA 3FWZA 5ICMA 5G2OA 1WW8A 2CVQA 2VRCA 3GMDA 2FSVA 3FCOA 1GZ3A 3W8EA 1LDNA 3DXFA 4HUJA 4XYMA 3BMCA 4TKMA 4QO7A 3GZNA 3CSDA 4BGUA 3PYLA 2NACA 4BMNA 1U3VA 1H2BA 2PD6A 4J90A 2EGHA 3E18A 5K0ZA 1GTMA 5H82A 3DOCA 1M2WA 3K8ZA 3JYNA 4IMPA 3JQEA 4IDCA 4ZRMA 2PGLA 2DKNA 2Y1FA 4BO0A 1E7RA 2D0IA 1Q0HA 4BO3A 3AI3A 4B8ZA 2PLAA 2QZZA 2YFHA 1C14A 1HRDA 3K31A 2NADA 4C7JA 3V2HA 1D4FA 1T2FA 2VHXA 4ZJUA 1RM5A 2PFGA 2WM3A 2RBEA 3GLQA 3UCXA 1PX0A 4PRKA 3DL2A 1Y7TA 1U28A 4BKPA 1W73A 4GH5A 4ND5A 5KKCA 3ZWCA 4EJ6A 4OOEA 3TZKA 3VHRA 3DBHA 5IJZA 4OOFA 3UW3A 4E2XA 1HXHA 3BIOA 1JW9B 4MOWA 1KEUA 4L73A 1ZEJA 5IN4A 5I9MA 1IUKA 1KC3A 4F46A 3AUSA 4MVJP 2VTDA 4M86A 4WECA 4CLOA 1UDBA 2Z1NA 4XJSA 1UJMA 3LDHA 1T2CA 1Z7EA 1H6DA 4UEKA 4XYLA 4ZICA 4BV9A 2GR9A 4B4UA 3JQFA 3TRIA 3A4VA 3GGOA 4Q3AA 1EDZA 1LLUA 2J3IA 3RUFA 1EK5A 1R4NB 1H0KA 1HETA 4B79A 2A94A 2HMWA 3GC6A 3PVZA 3K30A 2IEDA 3UUWA 2P9CA 3VPXA 4MKRA 5JE8A 1WPQA 1O5IA 3MTJA 5CP8A 2EXXA 5H83A 2I5PO 3O8QA 2HRZA 4O1MA 2CDCA 3NT2A 4ZU3A 3MJEA 4NQZA 4N5LA 1DJQA 5LCXA 4CM1A 5IN5A 1NQ5A 3ZWYA 3PGJA 1DRWA 2H1SA 3K2BA 1Y8RA 3KYDA 1D1TA 3E48A 3NYWA 4JROA 3T4EA 3WGQA 5L40A 2J8ZA 1N5DA 2EG9A 4LVCA 1XQ1A 1CDOA 5TC4A 3GG2A 1R37A 2J5KA 4R9RA 3WTBA 1PU2A 3PLRA 4IDDA 1DIBA 1P1HA 4BO2A 2D5AA 4JBHA 1PZEA 4IQ8A 3Q9NA 3GVCA 1RM0A 4J4HA 4B8WA 3GHYA 4XKJA 4PLWA 4HP8A 3L6DA 1GU7A 5MDHA 4WLEA 1LRLA 3B1FA 1AGNA 2C07A 1FK8A 1CJCA 4FFMA 4WGGA 1KYQA 4QFCA 3KYCB 2HO5A 2X0IA 4GMFA 1FDWA 2X23A 4DLLA 4R1UA 1YONA 1DIAA 2GERA 3AU8A 4K28A 1DO8A 5KJCA 1EVJA 3H65A 8ADHA 2GDZA 5G4LA 4Y6RA 2VUSA 3HB4X 2YHIB 5AYVA 3T7EA 5HBRA 4DWVA 3C7AA 5JBIA 3DZIA 2X0JA 4FOSA 1GCOA 1K5HA 5CPFA 4XIYA 5AXBA 4E2ZA 5B37A 3OA0A 3BHIA 5BNFA 2V7PA 2O3UA 3GOHA 3AFMA 3RJ5A 4NJMB 4CV0A 2VYNA 3Q11A 1SOVA 4E13A 1E3WB 2GF2A 4OSOA 4J49A 1XIVA 3WMWA 2NUAA 4Y98A 3F6YA 4BQRA 4YAJA 5FWNA 3RBZA 4RDHA 1Y6JA 2IDZA 5ENVA 4YVFA 2Q1UA 4CMEA 5BR7A 1ZEMA 1I3MA 1H9BA 2HK9A 4CMJA 5BSFA 4IGEA 2RIRA 3CIFA 1XDWA 3D3WA 1PQUA 3I5MA 3PTZA 4UVGA 4J1NA 1B14A 2OFPA 3DMTA 4AJJA 1HF3A 2G1UA 1R12A 4PVDA 1BG6A 2CNBA 3A14A 5A4DA 5DULA 5DP1A 4BNTA 2JCYA 2V65A 4R51A 4IXWA 3WIDA 1GFSA 1P74A 1NBOA 2R00A 3GDGA 3GMSA 3VKVA 1OBFO 1YB5A 2W98A 3KM0A 4PG6A 1F8FA 3OJ0A 3FF4A 5CG2A 3NTRA 2VRCD 4NJMA 1U8XX 4Z0TA 3WGOA 4BKUA 2Q3EA 3WGIA 2RH8A 3VZSA 3L07A 3GF4A 3OHSX 5ER9A 4AJKA 3U09A 4RPJA 1LQUA 4M1QA 4OXYA 2A9FA 1LDEA 2EIHA 3JQAB 3TDKA 4FJ1A 1HTBA 1QKIA 3KTDA 1GV1A 3I1JA 3QE3A 1FDSA 1MC5A 3EC7A 4CLDA 2YV3A 5KVVA 3F1LA 3IP3A 1Z45A 3SVTA 5AOVA 2X5JO 3VDRA 3GUYA 2D4AA 1CQIA 2HK7A 2QYTA 3B70A 3BTVA 3F4LA 3IS3A 3C3XA 2NU8A 4YAGA 1ZH8A 3IDSA 4O6VA 2EF1A 2CVOA 1PGNA 4BNXA 1IZ0A 3FWNA 2AG8A 3L4BC 4RORA 1NQTA 4L74A 3B1KA 3COSA 2Z5LA 3RUIA 1U7HA 2DUWA 4EUFA 2QIOA 4DMLA 1XA0A 3E6AA 3KSUA 3PWZA 2PH5A 3WSVA 1WNTA 3JQCA 5KVCA 2QZ9A 3ZNQA 1YB4A 1HDXA 1R4MA 3JYPA 1IY8A 2HDHA 4NH4A 2A92A 1GZ6A 3NT4A 4P22A 1HE5A 3DR3A 5JFOA 3DZHA 2SCUA 1HLPA 3OQ6A 1XLTA 3KBOA 5JY6A 2WTBA 3C1TA 4TSKA 3BTOA 5ILOA 1H6CA 2HSDA 1I30A 4QEDA 1IYZA 3K92A 3LQFA 3C7CB 3VPFA 3QIVA 1Z75A 3KYCA 1LUAA 2VQ3A 3U0BA 3K73O 1F17A 3DMYA 4N54A 4HV4A 1YL7A 3P19A 4E6PA 3RD5A 5TX7A 4DIOA 2EKPA 3GK3A 3FTNA 1GYQA 2WD8A 3ROMA 4PN3A 4OKNA 2Q2WA 3RKUA 1K6IA 4XA8A 1ENOA 1ZW1A 1GEGA 2I3AA 3AI2A 3RFXA 3JCZA 3G3EA 2QX7A 4RLHA 1IHXA 1PJTA 1UXIA 2FY8A 2P4QA 3DO5A 3OEYA 3ZDFA 2HK8A 3ICPA 4DLAA 1GUZA 4QQRA 1E3WA 1P0CA 2B35A 2OXIA 3OEWA 4JN6B 2XAAA 4E12A 1PQPA 3AW9A 4ALKA 1ORRA 1IE3A 1LLCA 3IQDB 2XF8A 2YHUA 4JNKA 4IS3A 4IZHA 3SLKA 3KVOA 4TROA 3Q0EA 3OJEA 2G0TA 1HLDA 4XZ3A 4CMAA 1RYDA 2BLLA 3PLNA 1K3TA 3O38A 4O63O 4XQCA 4E5YA 4YRAA 1ISFA 1ONNA 1NVTA 3V2UA 2FWMX 4WUVA 4W9NA 3X2FA 3ZV6A 2B69A 3ZWMA 2PZLA 1RPNA 1HDRA 4J9UE 4X54A 4OM8A 3L0DA 1Y1PA 4EDFA 3JD2A 4TRJA 2ZQZA 5C7IO 1UXKA 2VNSA 5I7SA 4ND2A 3JD0A 2PGJA 4Z9YA 2VT3A 3PQEA 2X86A 1VKOA 4W7IA 5TF4A 2DBQA 2WE8A 4MVJI 4YEDA 1E7YA 1UP6A 2DBVO 2PZKA 3BAZA 3QVOA 3RASA 5GZ1A 1B16A 3UHAA 5I7VA 2PWZA 2JL1A 1LBEA 4D7AA 3NTQA 2ZCUA 4CR7A 3S1LA 4HNGA 3SBOA 1R4NA 2J3HA 2HQ1A 4PLFA 5JCJD 4WOJA 3JQFC 1YBAA 4TZTA 3MOIA 4FFOA 3M2TA 4UREA 4MJLA 4AG3A 2TMGA 4AJLA 6LDHA 1TEHA 1E1KA 1PJBA 2VOEA 2ZB7A 1JKIA 3G49A 2DQ4A 4M89A 1JLLA 2Y1DA 3WLFA 4E30A 1NPTO 4IJWA 2YW9A 4NFYA 1E3IA 4J4TA 1GCUA 1RWBA 4TMFA 4L4SA 2BFAA 4WCFC 3CUKA 2VYVD 4CLRB 4J6FA 4RQTA 1DHTA 3BMNA 4MP3A 1FMCA 3ULKA 4DREA 3JQGA 2IYOA 4B7XA 1YQGA 3CMMA 3O26A 4NJOA 1I36A 5AXDA 1K89A 2AQ8A 1QR6A 5BSGA 1NTOA 1A5ZA 4XQEA 1O89A 1E77A 1V6AA 2OOSA 3NJ8A 3CPSA 5JAQA 2Y68A 4RPLA 1VSUA 2AA3A 4DGSA 4H3VA 3FPCA 1H2HA 1RKXA 2D2IA 5CAEA 2JJYA 1R4MB 4GI2A 1E7QA 4IZIA 2DAPA 4A26A 3H5AA 1U5CA 4MVJE 3FD8A 3TZ6A 3QHAA 4PIVA 1SAYA 1DC4A 1XCBA 1YH3A 1Z74A 3DHYA 3I4CA 1T25A 1C1XA 2QG4A 2BFPA 3JQ7B 3GVPA 3BZUA 3RC7A 3DAGA 2VT2A 2YQ4A 2W2KB 3BMQA 1X0XA 2FN7A 3D5TA 3TZHA 5L51A 2DFDA 1EDOA 3PDJA 4JP2A 4MP6A 3WLEA 1Q0LA 3ZWPA 5KJFA 3NTOA 4MIOA 1VM6A 3JQAA 2FOIA 3QJ5A 3LC7O 2PKQO 1X14A 2VOJA 4JCOA 1TT5B 3TQHA 1IPFA 1OOEA 1ZCJA 1ZZEA 4GX0A 4NMHA 3RUCA 2X1HA 3IKVA 1VRWA 4L8VA 3CEAA 3I9MA 5EN4A 3WSWA 4OQYA 4JP3A 4QXMA 3PHHA 1V3UA 1EE9A 1NR1A 5F1OA 1S6YA 2LDBA 1HE3A 2ZKLA 1P0FA 4KMSA 1Z82A 1W4ZA 3HJAA 3O4RA 1CETA 4OHUA 1ZJZA 3V1TC 3E9MA 3ZU5A 4LISA 2NTNA 4LMPA 1NAIA 3W1VA 2O50A 3QWIA 3QWBA 3ZWVA 3U5TA 2P9EA 4KZPA 4W6ZA 3ORFA 3I9KA 1PWXA 1WP4A 5L45A 1A9ZA 1WZEA 4HADA 4R1TA 3U3XA 1B26A 1EEHA 3QWFA 5A3JA 3KOUA 4WLUA 3RFVA 4QFDA 1I3NA 3HFGA 2PA3A 3RUHA 3ZNNA 4CM6A 1BHSA 4S3MA 4N18A 4KWIA 3TWOA 2HMSA 4QTZA 2BI7A 4M54A 1ONOA 1HDOA 3CE6A 3PFFA 4J9VA 3A9WA 1GUFA 5A5FA 3ETGA 3NDIA 1SB9A 4PGFA 3INRA 3DFZA 1JN0A 4PLVA 4BNIA 5JXWA 3E5RA 2A4KA 2C20A 1KEPA 1QYCA 1KIFA 3W8DA 2VWGA 2VHZA 3MWDB 4U5QA
chains in the Genus database with same CATH superfamily
2HHHB 2IEBA 3RKRA 5BR8B 1UMCA 4AMVA 3D6UA 1EX9A 1PJLA 1M8GA 1WKVA 2RHTA 4X1OA 2WNSA 2QORA 3JW8A 2IH5A 5J40A 2X0KA 1ZVQA 2J5BA 4IV8A 4Z9XA 4R41A 4DG8A 2NT4A 5JSQA 2XDQA 2ZWIA 4YMWA 5DHFA 4YRBA 1GZ4A 1KJ8A 1MENA 1A2KC 2WPNA 3H9GA 3HB1A 4LSWA 3KYDB 5TT1A 4WJLA 3J81A 5IJXA 4AS1A 4FTWA 4TWBA 3H1EA 5A5EA 1DG1G 2EFJA 2YNMD 3ZR4B 1XELA 1J42A 2EARA 4GBJA 5TY0A 3RSGA 4DIFA 3JVUA 4BECA 5HKAA 4QNNA 3E2IA 2ZWVA 3OQNA 2DT5A 1IXKA 2QRLA 1C4WA 3N05A 4GT1A 3OZSA 3FNHA 4LC9A 4OGFA 4XUDA 4RA9B 3R75A 3OC0A 2YXDA 3CRVA 2YOGA 1T1GA 3CUWA 4J2TA 1W9MA 4PYQA 4RL4A 2VZEA 4KP7A 4RK1A 1XUOA 2A78A 1Y8QA 5HIKA 1BOFA 3IPCA 2JGDB 3DXXA 4BO6A 5KWVA 2H7CA 4WASA 3IILA 4K9RA 3QFRA 3HG7A 1SQFA 2AX3A 3NHYA 4ED9A 4IXTA 4KXYA 4OJYA 5LUBA 2UYQA 2ASEA 2O07A 4DUGA 1ZIDA 1AS3A 3CURA 2PFSA 4YI3A 4DNQA 2O19A 3OVMA 4URUR 2AUNA 2R11A 2QSJA 3G1UA 4YJFB 1E6UA 1UBOS 5EUBA 1ZINA 5B30A 2ZGVA 3C3MA 2WTNA 2VTEA 3WRWA 1IQRA 1MNQA 2FG6C 3PP8A 4F71A 2B34A 1UBLS 5H9WA 2C2HA 3WA7A 1CULC 3EH1A 3LXXA 1O94D 1AKWA 2LWIA 1JFFB 2GVNA 2JFBA 1PNQA 3EW9A 1VMAA 2KE5A 3PKIA 3R6LA 1M1YB 1FP6A 4BUCA 1KSJA 5DX1A 3UPUA 5AVZA 1UJ5A 1YOVB 3SS8A 2KPOA 2HF8A 5TQ0A 1ZLXA 2CC2A 3EAGA 5KVAA 2J3KA 1N1EA 3J7TA 1XNRB 4L7QA 1G6KA 1FTQA 2I1WA 3L8CA 2NLOA 1DJPA 1C50A 4P5EA 1ZIPA 2GZSA 2NUBA 2HZ7A 3PSHA 2WMDA 1BXRA 1WQ4A 4J8PA 3U31A 2FPPA 1OJLA 2RONA 3PITA 4BP3A 3OCJA 4NYJR 3LWBA 4B6EA 1RC1A 1WMDA 1O95C 2XB8A 2ZIGA 4UOQA 4D42A 5AVTA 4AZ3A 4B73A 3UM9A 2FI1A 4KE8A 4RUKA 1HNXB 1KO7A 4A6DA 1GGJA 3ZH2A 3OUUA 1P5HA 2OHHA 1DG3A 3H9JA 3TLGB 4M0DA 3N2GB 3UXMA 3NIWA 2IH2A 3A1NA 4JXKA 4JB3A 5LSAA 2DZDA 1SOWA 5A3SA 4XX0A 3WWPA 3CH6A 3WRXA 3HM9A 1JU3A 1XVTA 4B4OA 3EGCA 4BGDA 1GPKA 1JJVA 1PUJA 5ITWA 2I29A 4BNYA 6NULA 2A9RA 3O3CA 1U11A 1VZ2A 1HZZA 4X1YA 3VHXB 5KNDH 4WCVA 1Z3CA 4JELA 3NOOA 2W2LA 3I5UA 4NZZA 3BICA 1LD3A 3EXHA 4UQOA 1EXVA 1O9BA 3NEYA 1B0AA 1RW4A 1ZNWA 2DR0A 2OZEA 2YNMC 1TTPB 2VHQA 3NWOA 2W2OA 1FP2A 1ULHA 2G5TA 3OPYB 5CU7A 5AI9A 5KKAA 1PGPA 1RRMA 2EKQA 2FKAA 2H4WA 3CRW1 5DX8A 2D6FA 3HWX1 1UMKA 1TMKA 5B1HA 4F5DA 4W1PA 3I37X 3DMRA 4IGKA 5ERGB 1XAGA 1QHEA 3NHJA 2RGCA 1N7HA 4FJ0A 4IJVA 3WL7A 1E60A 1ISJA 4KRFA 4BFYA 4FB5A 3O2SB 4IIBA 2F59A 2FJUA 3NM6B 4YDHB 1GG9A 1JDSA 5E6UB 5U9CA 5AOBA 2XUHA 1FVXA 3Q1KA 4HLQB 4XDHA 1QE3A 2VAWA 4AP5A 3S8YA 1ZMBA 3HB0A 3LK7A 4I55F 3AVXA 2BEJA 2QQ0A 2PZ8A 2ZE6A 4HB4A 2KM1A 3MOGA 2H1LA 4DCCA 3HNPA 3N87A 2Y0DA 3GGJA 4HN2A 1TW3A 2VQSA 3B9PA 3R7WB 3CCCA 4F5WA 3RFCA 3WOVA 2NU7B 3H9UA 1VJRA 1D9ZA 3PX3A 4WKNA 3TLGA 3E03A 4JBGA 3X1KA 4EB8A 3CG0A 4EZEA 5JCOC 4PGAA 3FZEA 3JQ7A 3PFIA 3VTFA 3THYA 4MYUA 3GLUA 3TB4A 2VDWB 1ZK0A 3DHNA 4TL7A 4CMGA 1T5TA 2IYTA 2ZE8A 4EGCB 1YE8A 2IZ1A 3JD3A 1P4RA 1MMFB 1SUWA 5D85A 1Z0DA 1R66A 3ACBA 3BC1A 4TM7A 4G0NA 2DPYA 2ZJOA 5CX4A 1PL0A 4DV5B 3DLAA 4KOAA 4HFRA 4KXMA 5A3RA 1I8TA 1QK5A 1QMPA 2Y99A 2YVQA 3FKSA 1PV2A 2DWQA 3AGQA 1PUIA 2XUPA 4XLTA 1MUUA 2WFAA 1K0UA 1CUWA 3DLPX 1JP7A 5ALIA 3H42B 3IPYA 4PLHA 2B82A 2JGMA 4Q9LA 4Y9DA 3AINA 1Z6ZA 4EAQA 1T3TA 4E08A 4IDHA 3M3PA 4MEBA 1E3SA 1E2KA 4FGUA 2YDYA 1FX0B 4J3FA 5KBYA 2XQIA 1HV8A 1JR2A 4UXHA 4TMYA 3ADCA 4RF2A 2RC6A 5C8YA 5IBCA 4G0WA 4RKQA 4RH0A 1OT5A 3HPQA 1XXHA 3MWEB 2IS6A 2QTWB 2OQRA 2QHXA 3CC8A 5A02A 3EEYA 4IOKA 5FL3A 1CUSA 1ZUD1 3M9XA 3OEED 3ZU3A 3JARB 4I6GA 3MCAA 3WGMA 1G6HA 1TIPA 1W46A 2DLDA 1JECA 2EFDB 3VGPA 3E3AA 3ZHUA 4IKPA 1DC6A 1MOQA 3W9UA 3JWJA 3RUDA 4FYKA 6CHYA 3RC8A 1AX9A 2CK3D 2FR1A 2I87A 1FQWA 3JAWB 4HDAA 4JS0A 1A4IA 1KEEB 3ANYB 4ZI2A 2XUJA 1JA0A 4C87A 1EDDA 1RDFA 3NUGA 2W6OA 1TO1E 3QPCA 4FSHA 3SHTA 4JEMA 4RVUA 4CKYA 1E0SA 1U9JA 2C59A 3DQPA 2ZUBA 4JEUA 4RESA 4RD3A 1HWYA 2WF6A 2XD4A 4V1CA 1HSZA 3ND8A 1NATA 4CMBA 2X41A 1IPEA 4JVSB 2IV3A 3R5FA 1B3BA 1KSHA 3KOMA 4JGGA 4BMVA 5CB8A 5KOJB 6GPBA 2D13A 4ETNA 2VRNA 1W0KD 2V4ZA 5I5EA 1QRUA 2AS0A 3TKLA 2H92A 3D7SA 1CJUC 1L6IA 5LBUA 4RJKA 3W7AA 1TCVA 1PYOA 2VSYA 4G25A 4P84A 4ESHA 3GUHA 3KJXA 2PUAA 1UDCA 2NZUG 4LY0A 4MUNA 4X7BA 3ROEA 4P36A 4HAUA 3ND9A 2J9RA 4YMSA 2R2AA 4LQDA 4IIVA 2CXSA 3F8TA 3X1JA 4DEYA 5C4IA 1UFQA 1XHLA 2Y2UA 3LW7A 3IAAA 4YMVA 1EH5A 3K72B 4RXMA 2QTZA 2WM2A 1PJRA 3GMTA 4M87A 2XTJA 4IUYA 4LF5B 5DBGA 1SVLA 2JD2A 4CGZA 2IYQA 3JSAA 3U3OA 1LTKA 3N6RA 1ID1A 3F73A 3LRXA 2QUAA 2BHLA 3GFRA 2FZ5A 5EXDA 2VA9A 1FPQA 3TR0A 4YRQA 1P33A 4KYTA 1DC7A 1NL3A 2AKAB 1ZD2P 2Q6IA 3RREA 1GGHA 1V3QE 4NZPA 2JKVA 1YOBA 1NT4A 2XB4A 4C3OB 3AC0A 1ADCA 4QRDA 1NHGA 4FS3A 1O54A 1E1NA 4AX4A 3JASB 1J20A 1V9LA 4I1SA 2NPFA 3VV3A 1MC8A 3I6ZA 4F6CA 4IHJA 3GBPA 5H3HA 4PXSA 4NIMA 3N86A 3O94A 4FC6A 3OPQA 1RPZA 5D3QA 3GYGA 3I9V1 1F5NA 3FNQA 1VJTA 2I4MA 1B0PA 2VHCA 2EZ8A 2QSZA 4EDHA 4YRGA 5J2TB 4LDNA 2RE8A 1J0CA 3KEGA 3R3UA 5FV7A 4EMTA 1XTKA 4AP6A 2VJKA 3CLRC 5ENDA 1HT1E 4IQFA 2WP0A 4TKLA 1C0IA 1NUHA 5AM5A 2CXOA 1Z6YA 2X13A 4A0SA 3PI6A 2JD0A 5EQDA 5IVPA 4YB8A 3CR3C 5AJWA 2GSDA 5SYMA 3T3IA 5AW8A 3C8MA 4A10A 3B36A 1WULS 1W36C 3FFWA 4EEKA 3HQ4O 5CA1B 1QH0A 2ONZA 4O2AB 5FOVA 5K0CA 2FW6A 4NBWA 1E4OA 4IY1A 4N65A 5CLJA 3ECCA 2R1VA 1GAEO 2NQ2C 4S1PA 3NXSA 3VYTB 4EHNA 2J7KA 1BEEA 4OQQA 5HE8A 5AHRA 3PQ7A 4NG5A 3SSAA 2CLOB 3TUJC 1F2UB 1X9IA 3ESQA 1R1DA 3L1HA 1F38A 3C15C 2NTJA 3KPJA 3TVTA 5I7HA 2BP7B 2GAIA 2D00A 5E38A 2CXQA 2WWGA 4Q19A 4F4FA 4AKEA 5HF6A 4G65A 2RHHA 1P2TA 2QL7A 3N7AA 3TTYA 4R7ZA 2PLFA 3WICA 3LZDA 3OHMA 3UOWA 5KYWB 2DJIA 3TIVA 4BQPA 2AJTA 1EVZA 3SQDA 4EHHA 1KYZA 1Z12A 1FFHA 4I9NA 4RK5A 4JYBA 4U0KA 5IDVA 4Q9DA 2P9YA 4AWAA 3HACA 2MSLA 1ORDA 2QX4A 3GA0A 5C37A 4CKZA 3AH8A 4EIWA 5LDDC 4RKFA 3VAYA 2LZ0A 2E5FA 1SWWA 3WTCA 1T8SA 4Q7KA 4UW9A 2VHVA 2H9YA 1T5LA 4FGWA 4UFNA 1G21A 5HCUA 1AXRA 4EA7A 1PQ4A 2CMGA 3L1VA 4ZVMA 3S2EA 5AJZA 4DA4A 4UBLA 2BKXA 3JWHA 3UAGA 1ZXLA 3A4MA 1WQ1R 2GT1A 3EXHB 4YBRA 3RWBA 5FHQA 1B93A 4RX1A 4EYQA 2V0GA 2WYVA 4UAUA 2KSQA 3STHA 3KXKA 1NOKA 1RLIA 3WJ7A 1E2PA 2ERYA 4ZDIA 4NOJA 3ANTA 5E8JA 2NW6A 2IT1A 3JQ8B 3TF5A 4B0PA 4ECAA 2OC4A 1IY1A 5P8WA 5JDIC 1PWZA 4GR9A 1N0UA 3KCQA 4EG7A 5KTPA 5EESA 2ZRGA 3UO8B 4DC0A 3SS9X 5F2KA 1XN1A 2F6RA 2R2GA 3D81A 3A28A 3GT3A 2G9QA 1H4TA 2EBHX 1RXYA 4UD6A 2X3UA 4KJZA 2FWAA 4H17A 4IJQA 3BHNA 3KOZA 3EPLA 4JUBA 4QUKA 2HCJB 4EUKA 4EB6A 5FJIA 5IFKA 4BHTA 4L5IA 4NATA 1G60A 2DY1A 1EM8B 1NP3A 5K6AA 4B7ZA 5KCZA 1J9ZA 4MRRA 2FEPA 1VYUA 5ERXA 3IEPA 3GU3A 2P0AA 4JC0A 5IYZF 4ZCIA 1E2IA 1XZJA 4LF7B 5C52B 1NOJA 3EOZA 4JLKA 2HUPA 2N46A 2W8BA 3C24A 4MMXB 2UUBB 5A71A 1MB3A 1U2EA 5EXTA 4YP0A 4AJOA 1TZMA 4DQ0A 4JY7A 5K0LA 5JS2A 2AK3A 4DSZA 3ZLVA 4IDAA 2E37A 4M9UA 4YP7A 5J43A 2OCBA 2PUHA 4HDSB 1HQYE 2XMZA 1DBIA 2ADMA 4MW0A 4S1TA 4X71A 5TSDA 4E33A 2PAFA 1E4EB 1M54A 3GUVA 1M66A 1RD4A 2HADA 2PS9A 2VN8A 2FHSA 4M1TA 2C0CA 3W5HA 1IJFA 3EF0A 2WAAA 1AGYA 1D1SA 2R7MA 5FWAA 1J9GA 1DOHA 1VBFA 2O05A 4MW2A 1M6NA 2GM5A 3RUEA 3KTAA 1RKUA 3KSMA 4LDQA 2EW1A 1JKJB 3QXJA 4Z8XA 1Z6QA 4HL6A 5DBFA 3BGWA 3RYHA 1BW9A 2JEZA 3DO6A 2WWVD 4DV7B 1M8JA 1H1LA 1W5EA 1TJ5A 2C2GA 3GJYA 4MARA 3G2IA 4JX9A 1GO2A 4UMFA 4PYNA 3RTDA 4DSOA 3TGLA 1L0BA 1MEJA 4LGYA 2R8BA 4AUEA 1Z3IX 1NYLA 4CLXA 3N8KA 1I2BA 2OP0A 1V16A 3RIEA 5CB0A 1E0AA 3FFXA 2JASA 2W0SA 4MS4B 4BFCA 1NASA 2IUFA 3BKWA 1X2EA 3OZUA 4PONA 2EOAA 3RS4A 4C78A 1UPTA 1UMBA 3KPYA 1XKXA 5JPIA 1DAHA 4LAFA 3ZI0A 3UHFA 1PJ4A 1F7VA 1NRWA 4U6NA 1ITZA 2GPWA 2J41A 2QRKA 3IBTA 3V3TA 3IUBA 2O4UX 4LPKA 4Y6SA 1EZZA 1QBKC 2QQ5A 4JQSA 2WR8A 3WR5A 4AZSA 4CNQA 4OI1A 2SBTA 3H7IA 3IAS1 3QLJA 1H9CA 3OFND 4MJ7A 1US8A 4D4IA 4PNEA 1Z7BA 2ZXFA 3HADA 5TMDA 3T38A 1VL2A 4OY3A 4O5OA 1IHYA 1PEDA 3BF7A 3H5LA 3FDIA 2OTCA 1BXKA 3A32A 1GPBA 3BILA 3D8SA 1G7TA 4JC5A 4KIJA 4AUKA 1P7YA 2YUTA 4RQBA 4FGJA 5T57A 4ZEWA 3PXCX 3VO2A 5C5IA 3I6BA 4EJSA 4AQYB 1NU6A 3DF9A 1HA3A 1UQTA 4BN0A 1L5QA 1UZMA 1OLSA 4FI3F 2Q6KA 4AY2A 4BPBA 3NM4A 1UBSB 2O23A 4EBBA 1GQSA 2Y9MB 3U44A 3RH0A 3HVKA 4KQJA 2HU2A 3QEMB 3FLEA 5TDHA 7AT1A 1ES9A 1J06A 1DAOA 3HFRA 5I4IA 3NC0C 4JK3A 5C7YA 3ZD6A 2CVPA 2ZVPX 3S2ZA 4PE5B 3RUAA 3T5CA 3KJGA 1YMUA 5K05A 5EZ5A 3QOXA 2J0VA 1NUSA 2QSUA 2GK4A 4RKYA 5LP6B 1TM7E 1OX4A 2CNDA 1O6ZA 1WABA 1LPSA 3WB1A 1NN3A 4HEA6 1B1CA 4JT9A 3TUIC 3H2SA 3UJHA 3DFMA 1I13A 1RVDA 5B64A 1C4XA 3MT8A 3WGYA 2E89A 1UOPA 4KLRA 4LHEA 1CRWG 3ON5A 5HJ7A 5BOSB 3S5UA 2C5FA 4B0OA 5IFLA 5GIPE 2NN3C 1AM4D 4N0PA 4NU0A 1PSZA 3RIHA 3G9QA 4COOA 4HY3A 3DA8A 2G1JA 1KPHA 2OO5C 4IHKA 1B0ZA 3EQ2A 3WK6A 1I5OA 1AT1A 1ZUWA 4M1ZA 1FP1D 4DUGD 2QAJA 3FKSD 4M9ZA 4UUMA 2GVDC 3ES9A 2CUTA 2MJLA 3ZW7A 3HB9A 1KK2A 3MINA 3OZFA 4AWBA 2P9GA 2Z9BA 1IL0A 4JYCA 3VUEA 5KOIA 3STTA 1XMJA 1AS0A 3FCEA 4G86A 3U4HA 3PENA 1Z06A 5CGZA 1QRDA 4ALMA 4KTTE 4ZO7A 2ZVDA 1SG6A 4QT0A 2R1UA 3EIHA 5EKSA 1EI9A 1FJHA 1MRNA 4O4JF 1UKVY 2AYXA 4B8YA 1I2MA 1Z07A 1J2YA 2O2SA 4DNXA 2C4HA 3IUEA 1K7EB 4F4JA 1TIBA 4FOOA 2YJZA 2NU6A 4U9HS 1BU8A 3GAAA 4MLZA 1ZSVA 3EXIB 1FS5A 1OBHA 4LJ4A 4Z4IA 2BMEA 5FPQA 3VKGA 1N25A 3IJ5A 2F3PA 1YR8A 5EY5B 3KQWA 2OD9A 1R2QA 1EMDA 4XWYA 4D9MA 5KREA 4ZJZA 1GNTA 3OTIA 4BNMA 2H5IA 5CRIA 2DBZA 2IF2A 4F3YA 3P8ZA 3H1TA 4YV7A 1PQWA 2G6TA 3E0QA 1TCBA 3KV1A 3S1AB 3FDJA 1NI4B 4E6EA 1T6ZA 2G5PA 2AQKA 2JATA 3VHQA 2HYIC 2XW6A 4YAWA 1GPJA 3TKAA 2EL7A 3O03A 2R8RA 3GRAA 4GI5A 4JB8A 3TIIA 4BNJA 4RY0A 3U48A 2X0NA 3OX4A 2I99A 1FIUA 1L6RA 4BFVA 2B21A 4JU9A 4DL9A 2FWBA 2ONJA 1S9DA 3ESCA 1TVKA 1IG3A 2YXEA 4MVJH 3DMNA 4UVEA 4MITA 5LQAA 3ONNA 3HXQA 1T29A 3OETA 4Q9AA 1MOPA 1V7QA 1ENZA 2QXUA 3OZRA 1L7EA 4X8MA 4NXMB 2QSYA 3AF3A 3BXXA 2R8PA 2WUGA 4MI6A 4UCQA 1EWQA 3FN4A 5K2MA 5KNCA 1F2TB 4MVXA 3P2EA 1MQ8B 2Y2VA 1W581 3OIVA 4IQ0A 3T7SA 4D9KA 1N36B 3AXTA 1KOGA 4QUIA 1SHLA 3ICOA 1PR5A 4DCOA 5JRZA 2POQX 2QS9A 1N5MA 3AJ8A 1UJ6A 1R0ZA 2J67A 3KJZA 2QN1A 4GC9A 3BXEA 1KMCA 5FFFA 1VLLA 3HXTA 2VRBA 1E7MA 3LI2A 5JADA 3P9RA 3ZDAA 3PYXA 4I6EA 1UUFA 1VI2A 4G9EA 5FOXA 3AO0B 3K8OE 4NP6A 4FGKA 3LUKA 3WWZA 1KFEB 3W04A 2E2WA 4A5SA 1U8TA 4E21A 5CFZA 2UZ1B 4LF6B 5J5VA 2W2XA 2XDQB 4K9NA 3KSZO 3K05A 2FCRA 1QLJA 1CW2B 4C7KA 2MCFA 4EQ6A 4HGRA 3D8UA 1AS2A 2PSFA 1UC8A 3L77A 3OQ1A 2E4XA 3PGXA 5EMHA 4BX3A 5IH7A 1CF9A 1JIQA 1OWOA 3A8TA 5DMXA 1QNFA 2QLLA 4NZNA 4RPCA 3OT1A 3ZZ1A 5B4UA 4EKNB 1JDVA 2DFPA 3FROA 5CYOA 3U9SA 3TTTA 4CKEB 2X0EA 5C1OA 1SCDA 2Q5OA 3FZQA 1GZSA 4P80A 4PW0A 1N2JA 4B83A 5C80A 2JCGA 2MHCA 1X15A 4D9EA 4JXZA 1M5UA 2HCTA 3E7XA 1RI3A 2AN4A 3BXZA 5BSVA 4ARIA 3SKVA 1XRMA 2ZJ7A 2PJDA 3DOIA 3OMLA 2ZANA 1A4UA 3SS7X 4R71A 4NAVA 4L8FA 3WLQA 2FFBA 4H2DA 3PDHA 2Z3ZA 1HFEL 1RTTA 2IITA 2YHBA 3AERA 1V8ZA 4OGLA 5E4FA 5EL0A 2FG5A 1WSDA 4FYHA 3GJ5A 1J7KA 1X8LA 2RGYA 2FEKA 4HWSA 1L5LA 2BFCB 1P1JA 4TGLA 3AWIA 4IKOA 4ZEMA 2O8VA 1A72A 1MXHA 3RRZA 3HWRA 5JSYA 3UG6A 1PS0A 4L22A 1M1YE 1Q74A 1UPXA 4EJ0A 1J2JA 3LVFO 4EJSC 4FR0A 2PR2A 1CUBA 1DAFA 1XKQA 2AFIA 2HFJA 3C98A 4OQZA 3QQ5A 3WA6A 4I1PA 1UAAA 1E0DA 2LRHA 3OUTA 2EJTA 2HNAA 2WAOA 2Z43A 3QOFA 5KNBA 2B4TO 4TSFD 4CCAA 2FN3A 3D54D 3CZQA 3PSAA 1PFYA 3AETA 5H80A 3CBQA 3PXDA 1EP3B 1DIOB 1Q0SA 1LCIA 2WMOB 4DDHA 4X66B 2YMQA 5MHTA 3NV9A 3CHYA 3L6EA 5ECYA 5U1PA 1TM1E 3ZTWA 1RHRA 1DBSA 5J1SB 2AMYA 2PX8A 4JOQA 3QMPA 1TA4A 2GNPA 1TEZA 2DKFA 2HRDA 5FUVA 3JSXA 1YDMA 3KZMA 3OCXA 3GFBA 3CEJA 3DE0X 3F3YA 2GJ8A 2M9MA 3OIWA 2C5HA 1L4FA 3BE6A 4YRIA 1ZA2A 1CWUA 2Q8NA 3CG4A 3TN7A 4ARAA 1XSEA 2DJ5A 1A71A 1NR5A 3QLVA 3FR7A 2JLYA 2REQB 3AT1A 1M7GA 1FTYA 1DGQA 4RZ3A 2VJDA 3WKCA 1BXGB 4FNGA 4EY5A 1ORWA 1WBBA 3F7NA 3Q2KA 3OLQA 5FNZA 5BSKA 4AW9A 2I54A 3P4XA 2H0AA 3NIDB 4ON9A 3WNQA 3ZK7A 3R77A 1N6KA 1ZESA 1W75A 2VDKB 2QRQA 3O74A 1MGOA 3WV4A 2IWHA 4FK8A 2ZQYA 4LHZA 5DP2A 3U4DA 5JBQA 2BFEB 4B3CA 3C3DA 1JI3A 3QE9Y 1K5DA 1X38A 1Y1QA 2HI0A 1ONPA 3LBNA 4MRNA 3C3BA 3TZEA 4D98A 3ROGA 3WL6A 2Q2QA 4U63A 3UT6A 3ZIUA 2VZ9A 1IM5A 3DPSA 2B37A 2FSIA 5G1OA 4OGKA 1KS9A 3VH3A 3VR6H 3ZCRA 4QVIA 1NW3A 1XEAA 1H2AS 2ANCA 3A05A 3FWPA 3PEFA 5DLEA 4BX2A 3H11A 4B48A 3FVQA 1SVIA 1VPDA 2J33A 4FFBB 1CEYA 5HA5A 3EIWA 2YZ7A 5FOUA 2IXAA 2VL7A 3NIBA 2R62A 3ZE0B 5ENZA 4ZVKA 1ID8A 2YTZA 3VKFA 2OQ2A 3D0KA 3P0IA 3CRRA 4TWRA 1UP7A 5JD3A 3MMPA 1T0IA 3FPKA 4TXLA 1W2WB 3NHPA 1P7WA 4X45A 5IK2D 2Q99A 5HS4A 2ZRHA 3RAEC 3B53X 1JHZA 1CDZA 1NJ2A 2WWFA 1M67A 2XT6A 2YV1A 1JDPA 1RZ3A 4GLLA 2AT1A 3ZI7A 2C7QA 1ISPA 3MT0A 2HTEA 5DASA 1Z63A 2PUTA 2HTFA 2R1TA 3ACCA 2PUEA 5AKJA 2NO9A 4CE6A 5K0EA 4FFLA 3E9DA 1ZO8A 3ZBPA 2Y76A 2QTMA 1CZRA 3HV2A 1QG0A 1CIVA 4FGSA 4LGVA 4MRPA 4PAOA 4H1HA 3SOZA 4DLWA 4M37A 4AJ2A 3PNBA 4UASA 2ZPTX 5F1KA 3B5JA 3LV8A 4HRYA 5CXXA 5DPMA 3CZRA 3MEQA 2ZSUA 1IRIA 2C4VA 4IGFA 4BVEA 1R6TA 3DDOA 4D6XA 3INNA 3R0XA 5JS7A 5CA1F 2H3HA 1FRVA 2PZFA 3H18A 4PYOA 1Z08A 2QJTA 5CLLA 4CKWB 1EBBA 4IW3B 7ADHA 5FTLA 3KYJB 2IP2A 3IAM1 1CUJA 1L9XA 2BBWA 4AKHA 2ZYIA 3V1NA 1XZGA 3EGEA 3KQUA 1ODCA 4GRIA 3TCKA 4D57A 4XRGA 4EKDA 4P2GA 1QCYA 4A2QA 1F6BA 4Z9AA 3KUXA 3EFOB 1D7AA 3Q6NA 1S2LA 4CM3A 2RH4A 2XGSA 1R6DA 4J16A 1IM8A 1JHDA 3D7KA 2PUJA 4BEVA 4CW7A 3AVOA 4AJPA 2V5UA 4NOLA 1J1UA 4CI0B 4DJAA 1J07A 4TQGA 2H1WA 1TJ4A 3EEFA 2A5DA 2MT9A 4L76A 4YR7A 3JARA 1OWMA 3OF2A 4AK9A 1K66A 4C29A 1PL7A 3IAHA 4ONEA 4HAWA 2QN7A 3HU2A 1R5JA 3RCBA 2HHLA 3N8DA 3FSGD 1I0LA 1MJHA 5CLGA 4WZBA 1J24A 3O8QB 2FLVA 3HUTA 3HYCA 4N49A 1JQ3A 1VJ0A 2AN5A 3GIWA 3HDQA 3OSUA 5FIUA 3SIXA 3B38A 3PNQA 1KAGA 1XQYA 8ABPA 4YWHA 2VH2A 5CJJA 5BT9A 5KNBD 2X3FA 4JJFA 3T1YB 2J3MA 4KQ2A 3A1CA 2QGNA 4WOBA 4GG1A 2QXTA 2WK1A 4JBYA 2BRUA 3WOHA 4EB3A 2DHEA 4AJ1A 4ZC8A 2BFWA 2PG3A 3D8BA 1O2DA 1GZ5A 4XOUA 5IJWA 2AI2A 1WUKS 3NT5A 4RGQA 4Y7DA 3RFFA 4GLFA 1A5AB 4M1EA 5ESWA 3R9WA 3BK7A 4R54A 1QP4A 3ZS9A 2CVZA 2DHCA 1DBPA 1KPIA 1W0JD 4EG3A 4TYWA 4KPUB 2AZTA 4J4BA 4DPLA 3NI2A 2P2ZA 3Q6IA 1OXVA 3AY6A 3LO5A 1TU3A 3QV1A 2VXBA 4FJ2A 4KX3A 4FFRA 4ZQGA 4PBRA 2HF9A 4BOYA 3QSYA 4BFUA 5EJMA 4BAZA 3G5LA 2Z58A 4QUEA 3IUNA 3O1HB 1G19A 1B3RA 1COZA 1HE8B 4B3DA 4Y2VA 4O8CA 3JX9A 1RPAA 1YDWA 3CPHA 3TRFA 1J25A 1KRHA 5CFPA 1HDCA 2HA3A 3IBCA 4FZ5A 2HW8A 4NYMR 1RCTE 4KKVA 3KALA 3VDNB 1XZAA 2VJYA 4R8KA 3OTQA 3KK0A 3T0GA 4DUZB 4MP8A 1ENPA 1XRPA 3KJHA 2ODBA 1WU7A 1RLUA 3KAKA 3B48A 2CLIB 1HYHA 4QUHA 4CQMB 4JJ7A 3I34X 3T5MA 4A0RA 1VLVA 4N41A 1L7DA 2B5VA 3G82C 3H19A 4HMOA 4LZAA 3HBLA 4G0PA 4CIXA 1J8VA 3W6UA 2ZRCA 4FW9A 2HXGA 2DPXA 3KELA 1UAGA 1Z18A 2ZIZA 1AF7A 3D8RA 2QN2A 1E6EA 1EDEA 3KIPA 5BQPA 4EY3A 1O95A 5E6SB 2B0JA 5E95A 4HN9A 4ZPXA 2BZ0A 4FLEA 5EA2A 4U7DA 1PKXA 1P19A 3JTMA 3T7CA 4KR0A 3TD9A 3WHPA 1U5AA 1RXVA 1EUDB 4WW0A 2ZR7A 2X4DA 1J5PA 2X58A 1PT7A 1Y3CE 4GKBA 4MCJA 3U3JA 2ABWA 4LC0A 4NFSA 4CKXA 2QVZX 3N74A 3M89A 1V5FA 1XZKA 3EIUA 4CHGA 5TEVA 3RSFA 4ZAZA 2BHSA 2XXJA 2WF7A 2Z5GA 4Y1FA 1T4DA 4IDNA 1KSGA 2B4RO 2Q45A 4X6YA 1P3DA 1Z6PA 3DT6A 1ZP6A 3KHTA 3OT4A 2HJSA 4TUYB 3U9LA 1IJBA 5HKKA 3NC4A 1R0KA 1MAWA 3H4MA 3HCCA 4MAFA 1TUBA 1QMGA 4HDKB 4AUNA 4R1QA 4C6SA 1L8LA 4XWWA 3KR9A 2I0FA 1U31A 4MLPA 4MX8A 2X42A 3P20A 1J1IA 4C76A 3KWFA 2GFQA 4TXNA 2C7GA 4QECA 3ROKA 1D6NA 2R5WA 4QGGA 3PQFA 3TVDA 1Q0PA 4Z86A 4U39A 3U49A 3NYIA 3VR6A 2BEUA 3I4LA 1YK1A 4G09A 4LGCA 4U3JB 4LHYA 4PY2A 4RY2A 4YPOA 3KQMA 2UZ1A 3PUJA 1X1TA 1GGKA 1H3NA 2ANBA 2HU8A 2ILVA 2JAPA 4C2UA 2GZ3A 4GE3A 1R0LA 1KYWA 3FYTA 4LMRA 2PMKA 3AG6A 3KVNA 4QTUB 4ZAVA 3SHQA 4FI3C 1K92A 2C2WA 4Y6QA 5IZCC 1SBZA 1M34E 1U0GA 4X1KB 5H0IA 3QVSA 1I4EB 4EW6A 4YUYA 1RYFA 3USCS 2DSTA 1X1RA 1TKAA 1G55A 1CUFA 1C7JA 3GFGA 1C7EA 4HNAB 3A2NA 3KSBC 4QJIA 3ECAA 2IRWA 4B85A 5DISB 3WIUA 2JJ2A 4R2JA 3IUQA 3V1LA 2TMYA 4TV8F 1UZNA 4K8RB 1V4VA 3CNNA 2H07A 4EA6A 2P5UA 4O4JA 1I2CA 5DHSA 1U0NA 4CCWA 3O2NA 2QR2A 4MVWA 4D25A 1P1IA 4ZHQB 4K6CA 2QP3A 1PD1A 3ETDA 4GW3A 4PHGA 1UXJA 3QWAA 2F64A 1XFAA 4G0OA 4K03A 4OA8A 3HNRA 4I36A 4A0FA 1CQIB 2FEXA 4XFKA 3AX6A 3C85A 4GI1A 5TPWA 2ZB3A 4XGQA 3RT7A 4E07A 2QEQA 1Q0UA 5FWYA 4ZYVA 1QGZA 1XL0A 3Q5DA 1OYOA 2YCBA 3NEPX 1R0SA 3F6CA 1C0KA 4YXWA 2ZM5A 4XWKA 5BWNA 5HSGA 5KNBH 4B4VA 1J90A 1U3UA 3C39A 3EXEA 1TZ2A 4FBGA 1MDBA 4RTJA 4CV1A 3WLKX 1KDPA 3OQIA 4YQYA 5E0KB 2NUPA 4U2DA 3ZKAA 4IJ5A 3LCVB 4FOTA 4YRDA 3R7FA 4DCSA 1N8KA 1EUYA 3SEZA 4HTAA 1W48A 5HOEA 2VP2A 4XWGA 5A5GA 1M8PA 2CZCA 4LWPA 4QQNA 1ZYUA 3T5AA 1VHWA 1VJ1A 1T9DA 2QT0A 4Y2PA 4ENSA 3EAFA 3NDBB 4K9PA 2A3NA 4JOCA 4PPYA 2GLXA 4XWTA 2XQJA 5DIFA 2GAAA 2FXIA 1IWOA 1FXSA 1SOUA 2YC2C 3K1TA 3N9IA 1JE0A 3E8XA 4PNHA 3UFBA 1DEHA 4CPDA 4F7DA 5B36A 3VR3D 3KNZA 4UHJA 5L95A 1NA5A 2DECA 5DF1A 5DGIA 3WLTA 3PUYA 1BGVA 1T9BA 4LYHA 3ZI4A 3DEIA 4OSPA 2MSNA 3L5OA 4X5OA 1P4JA 3AM1A 2BFFB 1CR4A 5MN5A 4I8XA 1VRVA 2I8CA 3EGOA 4B7UA 4A8JC 4BO9A 1C9NA 2PTGA 3CZCA 2N1MA 3DWFA 1UPAA 5LXTB 1XVVA 1OIWA 1W8IA 1A3CA 4HXFB 1ZOOA 3VYWA 4M88A 4EOGA 3BXPA 3L18A 4H0CA 1CB0A 3BWDD 5HRAA 5H70A 2L42A 1XDZA 4B33A 4MIKA 2FFHA 2GCPA 2ZRAA 4H08A 4Z3KA 3S81A 3IPXA 2PGAA 2O9JA 1E4YA 4WSOA 3TSOA 3SC6A 3H6HA 2LIPA 4BNKA 4WY5A 3NZEA 5EPOA 5HDQA 4RETA 2AOUA 3Q88A 5A6VA 2OZVA 4YH1A 1CU1A 2F90A 2BYTA 3GGGA 5BQFA 3ESDA 5I9TA 4PV7A 4AJHA 3LX5A 4EG5A 4TLMB 2GBLA 4YONB 3RVRA 4M8SA 4UZEA 1Z5ZA 4OJMX 1E2JA 5I8WA 4R8RA 4NCNA 4J0GA 5JALA 2VJMA 2H0QA 1U9YA 2O8DB 1G8KA 2SKCA 3WYGA 4HCJA 5GTDA 4B3TB 1PT9A 3HNOA 3QHPA 4QQKA 4RIEA 4ECEA 2OCYC 3LPMA 4KO8A 1T24A 4ND6A 1Q7GA 2J5QA 4Y7CA 1ZRSA 2ZYGA 3A1FA 1ATIA 2ZJBA 4OK5A 5B4VA 1MG5A 4CMCA 4RJJA 1ZNQO 4GWLA 1Q1BA 3BF8A 3BRQA 4G1CA 1H85A 1DAKA 1LPBB 1QH1A 1EK6A 1MPXA 1RU3A 1XP5A 1J8DA 1GRVA 1RTKA 2CD9A 2WSIA 3ZNPA 4GXRA 2YRWA 1HTWA 4B34A 1XZDA 3QUTA 4ZQCB 2CDRA 3P9PA 1NVVR 1E99A 3FTQA 3CF2A 1UK9A 1RYNA 2M1ZA 2D06A 4L78A 2W4IA 4CTNA 4WFIA 4WNYA 1WXHA 4PLGA 4HGZA 1GZVA 4WT7A 5F7OA 3PFCA 2HNBA 4MA0A 4HBZA 2Q4OA 5HQTA 2VBCA 5CHYA 4ETIA 1E9VA 1W25A 4Q1AA 4PWYA 5CH3A 3RFTA 1TQHA 1AC5A 2VWQA 2A9PA 3ZDRA 1ORVA 3PUXA 1EQAA 3B9QA 3PGVA 2D7JA 3PNYA 2QI9F 1OUMA 4MVJD 1GNRA 1ZZGA 1YV9A 4R3UC 3EZ2A 2V03A 2OMKA 1JDBB 1RACA 2HSZA 3FH0A 2ID4A 1M1NB 4UBIA 4BKRA 3K6KA 1G20B 1XNJA 3BN3A 4B82A 3OD1A 1UK7A 4HQ0A 3NOVA 1DPFA 4XYGA 1WUTA 2VDMB 2ZBVA 4GRDA 2QYOA 1KY5A 1VC2A 1JI0A 2A14A 1LDBA 3A3PA 3NBKA 3A58B 4GVLA 3HR4A 1YVEI 1OWLA 5CM8B 1VIYA 2P2DA 2Q1TA 3TGPA 4DV0B 4AJEA 3HGQA 4BNNA 1L4LA 1GADO 2CDAA 2J87A 3W2IA 1VSVA 4MJ3A 2P7HA 4LHWA 1RWQA 2Z57A 4AIIA 4LZLA 4KDFA 3KFLA 1UANA 2D59A 3SIRA 3STUA 2CL5A 2CXXA 3WLJA 4EWLA 2AEMA 2CUNA 2IGTA 3F6BX 2VBGA 3M6AA 1GNQA 1UJCA 1ZHFA 3KT0A 4PZZA 5E7IA 5JMWA 5JS1A 4WX2B 3LYHA 3SQXA 2OZLA 3WQSB 3AIMA 2MSKA 4YMTA 2HF2A 3I5YA 4TUYA 5B3JC 4US0R 3UH0A 3GEGA 2WSLA 2XGGA 3DZKA 3KXPA 4YJGA 5FTNA 4ESVA 4CUZA 4FFBA 1E9RA 1QVVA 5CR9A 1U6IA 2W83A 2ZRDA 2BE9A 1SPXA 3IYLW 1RYZA 4BL5A 1ZNYA 3KKEA 1U3WA 3T1NA 5C0OE 3UPDA 3F6EX 1AGXA 1HE1C 3F5FA 1SUPA 4JLDA 4K88A 4PICA 4EVIA 4PN7A 3H9EO 3RHZA 5K2OA 1RCFA 1ESMA 3VJRA 1KI8A 2E55A 2CB0A 4WFQA 1IDOA 3OIFA 3ZY2A 1RMYA 4OXNA 4HB3A 4B3HA 4QODA 3DD5A 3RVJA 4WKBA 3ICQB 2GLUA 1I6MA 4PX9A 2HRBA 3AR6A 1KFBB 1K63A 1NPDA 3D2BA 3W6OA 3IODA 3SSNA 1ZM4A 5BSWA 4QTXA 1ACLA 3FJYA 5SICE 1CJVC 1GSAA 4KBGA 1BEUB 2FHPA 2Q3LA 2Q4TA 4ZO6A 3UMCA 4GMGA 4D3ZA 3GNQA 5JH7F 1B2LA 2VHWA 1Y1RA 4K1LA 1XYYA 1RKVA 1VA5A 1IN8A 1YQTA 2WI8A 3HRKA 1W76A 3OJFA 4JOBA 4LA4A 5EHGA 3RANA 1FRQA 3SHVA 4NPAA 4POOA 4K6HA 4PPQA 5B57C 4GF5A 1SM4A 3NUZA 2H2WA 2RAUA 2XY4A 1JDNA 2ZVJA 3OEEA 5FBZA 3JQ9C 1D2HA 3GAMA 3HP1A 1YACA 2DVMA 4WKGA 3PPVA 4JGBA 2R8EA 4OBBA 4M60A 5J5CA 3DDZX 2FSPA 1OD6A 1YJBA 4EA9A 3A4TA 4ML3A 2QPOA 5E6UA 1XRNA 1CHNA 4ZQFA 2XWQA 4DV4B 1SNYA 5KQRA 1V35A 2RJOA 5TF0A 1ECLA 1N78A 1ZG3A 4OHBA 4D4MA 5FWDA 5AVVA 4ZARA 1GPYA 4G84A 4R6WA 2GEUA 1UJNA 2NO5A 1BYUA 1U1FA 4ZOLF 1YS4A 4F93B 5HZHA 2FF5A 3LWDA 1AO0A 4B1FA 3UUFA