4DQXA

Crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
255
structure length
255
Chain Sequence
SMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEIGSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNGGGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFAEAKDPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSIGNHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable oxidoreductase protein
publication title Crystal structure of a short chain dehydrogenase from Rhizobium etli CFN 42
rcsb
source organism Rhizobium etli
total genus 85
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dqxA00
4NMHA 3PJGA 4FCCA 4Y6PA 3IDSA 1DC5A 3E9QA 4DGSA 3WLEA 1GZ4A 3TOXA 3RBVA 4ALMA 5BNTA 3K2EA 2GZ2A 3W6UA 1BMDA 2Q4EA 2YFQA 1ISFA 4Y67A 1KEWA 1WDLA 3DB2A 1O6ZA 3G3EA 2VHXA 1K6XA 1B26A 2LDXA 5TS3A 3WXBA 5B1YA 5F5NA 4CLRB 4JROA 4R3WA 3WIDA 4UVGA 2V65A 4H7PA 4I9HA 5G4KB 1WMAA 1E92A 3B20A 3V2GA 1WPQA 3GF4A 1TT5A 5KNLA 1DBVO 3RKUA 2VWPA 3IL2A 4JLWA 4CLXA 3SLKA 2W90A 4IQ0A 3K2BA 1PJSA 1KVSA 1NAIA 3RUAA 3NKLA 1WAMA 1LU9A 1ZEMA 3G79A 3OQ6A 4LVCA 4NG5A 5JC8A 3U09A 4HKTA 5U9CA 4FJ1A 1EVJA 2C0CA 4TKMA 5F3RA 4EGFA 5IDXA 2DU8A 1I5RA 3P5SA 3RCBA 2W2LA 1IULA 4IJKA 4GMFA 3EMKA 5JAQA 3AY3A 1E1MA 2X8LA 2EKLA 1MXFA 2RH4A 3E03A 1PJLA 3AY7A 2Z1NA 5COAA 4O5OA 4A5OA 2E4AA 4E3ZA 4YAJA 5F5LA 2JCVA 5L45A 1E3WA 3DR3A 2B37A 2OBYA 3K96A 1EBFA 3K31A 1GQQA 4R1TA 4IMPA 4E5KA 3CZRA 3D4PA 2GASA 4K9DA 2I76A 1NQOA 4N18A 4XRGA 2JHFA 4CODB 4YRDA 2Y05A 4FFPA 4CM7A 2HRBA 2PKQO 2HMTA 5U4QA 2YHIB 4YPOA 1HSZA 4WK6A 2HKIA 3PEFA 2H9IA 3B1FA 2FRDA 1VL0A 1Y8RB 3JYLA 4H16A 1BWSA 2AXQA 5A04A 2Q1SA 3RUFA 1IY8A 1NFRA 3F4BA 1PTJA 3BYZA 1OC4A 4YAIA 2LDBA 2GSDA 4IY1A 4GX1A 3HN7A 2CVZA 4E5NA 1A27A 1X13A 1YO6A 4I5DA 3WLFA 2AW5A 2JFFA 4IJUA 4W9NC 4WEOA 3JQ9A 3AUTA 3H65A 4BS9A 4CV1A 2OOSA 3OIGA 1MX3A 1DLIA 4QO7A 4CV3A 3D1LA 3C24A 1KY5A 4I5GA 2Q1UA 4CM6A 1PQUA 1R0LA 3WYEA 3TQHA 3H5RA 1DB3A 3PHLA 1ZXLA 4P4NA 3NAQA 1HZZA 4A2CA 3QVXA 5A02A 4M55A 4PG7A 1TXGA 4XWYA 4NFSA 1M6WA 2VRBA 3GHHA 1O95A 1ARZA 1Q0LA 2P5UA 4XR9A 1GYRA 4HNHA 4R51A 4E13A 1XR3A 1PS0A 2C5EA 3TWOA 5A4DA 1T2EA 2IRWA 5AXCA 2HMWA 3WG9A 4FR5A 4M49A 2EV9A 4DQUA 1VKNA 1CJCA 1WDKA 2PH3A 5BQFA 4BO6A 1N9GA 1PL7A 4CMEC 2IEDA 3WIEA 3S8MA 3U3XA 4Q3EA 1HDZA 4OMUA 3BMCB 3QLJA 4S3MA 1DJNA 3OQBA 1GPJA 5IXSA 4WGGA 1LLQA 3PFFA 4XGKA 4BNYA 2JCXA 4ND2A 4Y6RA 4BMVA 2O3QA 1KVUA 5JMWA 1QG6A 2C2YA 4B3HA 1B3RA 3AOEA 2VT3A 3JYOA 2VQ3A 1T1SA 4UVDA 1E0DA 4J7XA 2C20A 3JCZA 2QG4A 2GGSA 1MG5A 4B79A 1R6DA 3FSRA 3ONDA 1LA2A 2UYYA 3DDNA 1U1IA 1TEHA 3GMDA 4GGPA 4U7WA 5BSGA 4CLOB 1GDHA 1NBOA 5T67A 3GT0A 1HL3A 4PFJA 3ZW9A 1DRWA 3W4KA 3JV7A 4GVXA 1R12A 4RQUA 5L51A 3PWKA 4M86A 3NX4A 3OA0A 1JKIA 4YAEA 4F6LA 5BSHA 4OXNA 2D8AA 3VHRA 3F1KA 4KUHA 3VPSA 5COQA 1JWBB 4ONEA 4J2HA 5EINA 1TLTA 2Q2VA 4MVJG 4P4LA 1A72A 1V9LA 3BHMA 3GZNA 4E5YA 2RCYA 5TRTA 2EP7A 1B8VA 4IJWA 3GFBA 2VZ8A 1HWYA 2J3KA 3RUHA 1V0JA 3MOGA 5AQ1A 5L9AA 4MVJE 2Q2QA 1E5QA 4CM8B 1SB9A 1U5CA 1KVTA 1SMKA 2DBRA 2I99A 3DTYA 4FOSA 3A4VA 2D4AA 5JCXA 4TQGA 3GPIA 4Z0HO 1TT7A 2YUTA 3ADPA 3BTVA 3GUYA 3L4BA 1R16A 3P2OA 3ZWNA 3B6ZA 2XXBA 1XHLA 3DQPA 3JD0A 2ZTUA 3IP1A 1PGOA 3L4SO 1HDCA 1QYDA 5G4LA 4YJGA 2AEMA 5FF9A 2PTGA 4WLNA 1I8TA 4IPTA 2J8ZA 1BSVA 1LEHA 2D1YA 1BGVA 4ZHSA 1YBAA 4BNLA 3UCEA 4MOWA 4RLSA 2JL1A 2WE8A 3QY9A 1HLPA 3H3FA 4B3JA 3BMQA 5ITWA 5JBIA 1YDEA 5G0TA 1XQ1A 4IJVA 4AJLA 1VKOA 2VYND 1Q1NA 2FR1A 4CR7A 3X2FA 1TA4A 1BDBA 4YT2A 4CMAA 4KQXA 3L07A 4GX0A 2AEFA 4OKNA 4ALKA 4DPKA 2DVMA 4EEZA 4EEXA 3CE6A 2O3TA 1RM4A 3JQBA 1DC6A 2DUWA 3CMMA 3OF2A 2PY6A 4FOOA 4ZQGA 5TJHA 3DZIA 1I01A 3KYDB 2H5LA 4ZVVA 5DDIP 4RF2A 2B35A 2FMUA 2GZ3A 1QYVA 1PJQA 1YJ8A 2OP1A 3Q6IA 4XB1A 1I10A 5DF1A 2I9PA 3FNFA 3TRIA 3AFMA 1ENZA 4XQEA 1ZK0A 4XR4A 3PVZA 2WD8A 3WQRA 5T8KA 1DEHA 4R1NA 1DAOA 1YRLA 3H8VA 3ASUA 2VHZA 5GZ6A 3R0IA 3KVOA 4BKUA 5KJCA 4KMSA 4B7XA 1G1AA 1UDCA 1GTMA 2R00C 2Y1OA 5FEUA 1U2DA 1RYDA 4O63O 4BNFA 1YXMA 1IHXA 1LNQA 2YV3A 3ORFA 3UFXA 3DZHA 3SC6A 3K6JA 2FY8A 3F4LA 4M8SA 1QP8A 3WYCA 4NDNE 5B4TA 1P77A 1B8UA 4BV9A 3AUUA 4D44A 2HMVA 3VPHA 3WNVA 3OP4A 3I9NA 3TF5A 1CERA 3C1TA 3HDQA 2ZB4A 3VPGA 1JWAB 1ZVMA 2ZB3A 4K6CA 2V7PA 4K28A 3U4HA 3Q9NA 2CSUA 3N74A 1BXKA 1PSDA 4EUEA 2DFVA 3RVDA 4PRLA 3DTTA 1DSSG 4CM9D 2PGLA 2JD1A 1KETA 3DAPA 4YBZA 3D5TA 1ZIDA 5LC1A 3DHEA 3FNGA 2BFPA 2BLLA 4NBVA 5AVOA 4H3VA 4K6FA 3GDOA 4RVFA 3DZFA 3Q0EA 4OIMA 1K5HA 1EZ4A 1XSEA 3T7CA 5AXBA 3TL2A 2O2YA 3NT5A 3KSUA 4MVJH 1U7TA 5I7EA 1LSJA 5IZ4A 1SNYA 5JAZA 1CETA 3HNPA 2Q4BA 4DMMA 2GCGA 3H5AA 3PGXA 4RVUA 3WYBA 3ZV5A 4N54A 3JQ7B 3L9XA 2CNBA 1VJ1A 1RYEA 3CKYA 3DBHA 4QUKA 4Y6SA 4ZQFA 4J9VA 5TIIA 1RPNA 5JDIA 2NUAA 5I9MA 2GNAA 1Y5MA 4I8XA 4TRJA 5CEFA 1VRWA 1BXGA 1I3LA 2I67A 4PGFA 1J49A 3GDGA 4II3A 5L95A 2EHDA 5THKA 3C1AA 3LLSA 1GUZA 3S2IA 4ZRMA 2P9CA 1V35A 3QVTA 5K0ZA 4R9SA 4YXFA 1T2CA 4W7IA 3ZDFA 1MXHA 1N92A 3WWZA 3A14A 3QWAA 2I3AA 3E9MA 3JQFC 2Y0CA 5C7LO 2JAHA 1I33A 5B37A 3TZ6A 3I6QA 3RBZA 5DCYA 4IDBA 4AJHA 4R16A 5I9NA 3W6ZA 4CMKA 3C85A 2PA3A 4Z3KA 5BT9A 5CDYA 1HYEA 1P3DA 2ZTLA 4BNGA 2C29D 2GERA 3AW9A 1XWFA 2A4KA 3RJ9A 1EVZA 1MV8A 1NFQA 2YYYA 3DMTA 4ALLA 4D3FA 3H2SA 4ND3A 4D0SA 3H6KA 4QEDA 5G2OA 5JC1A 3HHPA 1S7CA 1ZW1A 3OH8A 4OOFA 4OSOA 1FXSA 3DEYX 3OBBA 1I32A 4EJMA 2VTEA 2NV6A 2A94A 2AA3A 4GAEA 1HE2A 1Y8QA 5ICSA 2FOIA 2HCTA 3C8MA 1MA0A 4KTVE 1WVGA 1JAYA 1NPTO 5G0SA 4CM5A 4WNCA 1I3KA 4L8VA 3UF0A 5JLAA 1XKQA 4FQ8A 5JE8A 1ZJYA 5CFZA 1EK5A 2F00A 2IXBA 1GD1O 1H6CA 3SX2A 3P7MA 4BNTA 1HDYA 3ST7A 1A4IA 2FSSA 4BO7A 5JY6A 3U0BA 4CQMA 3S2EA 1KEUA 2QRJA 2HLPA 2RHRA 3GRPA 4RPHA 5JNLA 5BSEA 3WX0A 4DTIA 4BMSA 4J0FA 4N7RA 1P33A 4DYVA 4U0JA 1NR1A 3ANLA 5KJ1A 4J1SA 5C37A 1DIAA 3O8QA 1T2AA 4J6FA 1P74A 1PX0A 4CMIA 4RF4A 3UN1A 3NJ4A 5ENVA 1F0YA 2O3SA 4FSHA 4KUEA 1LDMA 3UCXA 5K6AA 1Q0QA 1V3TA 1WW8A 2UUPA 5JO9A 4D43A 2DAPA 3WTBA 3GAFA 2NU6A 3MJEA 1UXKA 1PZFA 3JSAA 1C3VA 4P4GA 4G81A 5H83A 4EUHA 2NTVA 4MIOA 3KHUA 1MC4A 3R3SA 1OFGA 1U5AA 1FDVA 1O0SA 1R66A 1GPDG 2ZIZA 1H93A 3QWHA 4JGBA 5EESA 4CMJA 1DFIA 1WXDA 3FN4A 3I83A 4FJ2A 4EUFA 2CUKA 3D4NA 4ZQHA 5TSDA 2QQ5A 5COBA 3AI1A 4BKRA 4J1NA 2XPCA 1P1RA 3WGIA 2V6GA 2O23A 4II2A 1GEGA 2W2LD 3NTQA 3HUDA 1E7RA 3INGA 2B4TO 3WQSB 4XIJA 1Y6JA 2X0NA 4I9NA 2GN8A 3NGLA 1B7GO 3BMNB 4FFOA 4RZIA 2FN7A 4RGBA 3TZCA 4OKIA 1QRRA 4E4YA 3OJEA 4XYGA 1X15A 1DHTA 1YOVA 7MDHA 3WNQA 5L40A 1RM3A 3WSVA 3PQFA 3TPCA 3ENKA 3SEFA 1PS9A 2YQ4A 3V2HA 3MWDB 1UDAA 4CLDA 3D64A 2NU8A 2WDZA 1UXHA 4ROSA 1LSOA 1JDJA 4I5EA 1E7WA 1UP6A 4L4RA 1GEEA 5CP8A 2PGDA 1F14A 1U28A 2DPGA 4HBGA 3DBVO 4IS2A 2EJWA 3TDKA 4YRBA 4ZRNA 3ZWPA 4KTTE 2HRZA 5A03A 1EQ2A 1DRUA 3FHLA 2VCYA 5L4SA 2D59A 1U2GA 3Q1LA 5JDCA 3GG9A 1FF9A 3PLNA 1TT5B 3EVNA 1D1SA 4C7JA 4UEOA 4E12A 1ZBQA 5ER9A 4FPXA 3WFJA 5TT0A 5A1TA 1ZSNA 4R4JA 4RVDA 3HE3A 1NVTA 4WLUA 5GY7A 4J7UA 4KDFA 3K9QO 1P1IA 1C1XA 4ZGWA 8ADHA 1A4UA 3DOJA 3BAZA 3GEGA 5KWEA 2B5WA 2O3RA 5F21A 4BNHA 4MP6A 1WLYA 2YDXA 2BRUA 5TC4A 2OO5A 4DLAA 1F06A 3I6IA 4N5NA 3GVCA 4LGVA 1H0KA 1SOWA 2NSDA 3AU9A 2UV8A 2HK7A 1E1LA 3EVTA 1B15A 1UXIA 3H9GA 4RDIA 5JY1A 3EY4A 3JD4A 3RUIA 3DZGA 1UZLA 4GL4A 4DUPA 1QYXA 1AHIA 3R3JA 3WBBA 1QXSA 1T4BA 1YS4A 4ZJUA 4LRTB 1E3WB 1WDMA 4XB2A 4N5MA 4W9NA 3G17A 3LLVA 5CEEA 5TT1A 4BO2A 4Q3CA 5JCJA 3KETA 3GVPA 1NWHA 1JN0A 1C1DA 4OQZA 4XRRA 4RQTA 1NHWA 4AJ2A 4WUVA 2I5PO 3QW2A 4UUNA 3LSYA 1NVMB 1B0AA 1H6BA 3OJ0A 5CEJA 2RAFA 3D4OA 4WEQA 1QYCA 1YKFA 2JCYA 3BXXA 4AL4A 1ZZEA 3PDJA 1V8BA 2Y0DA 3WGHA 1B3BA 3GGOA 1NQ5A 2X5JO 3KM0A 5L7YA 5DCWA 3U9LA 3IJPA 2IZ0A 2DQ4A 3ULKA 4CR8A 3O9ZA 4NFHA 1MLDA 2FR0A 2Q2WA 3H9QA 4WE3A 1M76A 2Y1FA 3U4IA 3KZVA 4PLTA 4R68A 1CEQA 4CMHA 2X9VA 4JCOA 4FIZA 5G0VA 4D3SA 2DFDA 2WMDA 3JQAA 5L4LA 3MJ4A 4CL8A 2V6FA 3DXFA 4NBUA 5CDTA 1VSVA 1I3NA 4DIOA 2IXAA 4Z0TA 4IDGA 3GNSA 4NHEA 4Y8VA 2Y1EA 5K9ZA 3ICCA 1QSGA 1WWKA 5A9SA 1LDNA 5CG1A 1LQUA 2PKRA 3UICA 3AOGA 3ZU4A 3VOSA 3OJOA 1HEUA 3ZI0A 3U5TA 1ZNQO 3FTPA 3ZN2A 3FTNA 2YW9A 2QHXA 5B4UA 4RF5A 4BGUA 1KS9A 1EFLA 2NVBA 2EGHA 4CLEA 4Z9XA 4EJ0A 2OUIA 3EUWA 1E3LA 5IF3A 1LUAA 2XOXA 2BKAA 3PGJA 4WCFC 1XU7A 1CF2O 2BGLA 3JYPA 4D42A 1JVBA 4MVJI 2YV2A 4JP2A 4FC6A 2G76A 4YR9A 2SCUA 4IDCA 2XAAA 4R5HA 1QKIA 3MTGA 1N9GB 3OJFA 3WMXA 2JAPA 4DIBA 3WWYA 3SLGA 4GKBA 3VTFA 1E1KA 1DDOA 4GMGA 2CD9A 2FPGA 4JN6B 4BKOA 4F46A 5L53A 4HWKA 2Q1WA 2YJZA 3PZBA 5KVSA 4DIFA 2GN4A 3FBGA 3UXYA 2EKQA 5KTKA 5JMPA 1W6UA 4J3FA 4B4VA 1ORRA 3KBOA 1EE9A 4GH5A 2OXIA 4J43A 2EW2A 4PLPA 4YJDA 5C5IA 3PYMA 1C0LA 3D3WA 3ROKA 4XGNA 2G0TA 5DN9A 1O8CA 3NV9A 4KZPA 4TWRA 1R0KA 2PD4A 4CQLA 4BKQA 3H4VA 1M67A 2RHCA 3TL3A 1NQAO 3RWBA 4EBFA 3GC6A 4MIEA 4GVLA 2B69A 2C7VA 5H82A 2P5YA 3ON5A 3PTZA 1N7GA 2PNFA 3I9OA 4KWHA 1EDOA 3MTJA 1NQTA 1PWXA 1EEHA 3LC7O 3DHYA 3LF2A 3OFSA 1XG5A 3R1IA 4TVBA 1PGJA 3BHJA 3I23A 1JVSA 2DT5A 5I7VA 1VSUA 3K8ZA 3UKOA 2P9GA 3GZNB 4JP3A 2AQKA 3ENNA 4U6SA 1ZK2A 2PH5A 3ABIA 4NQZA 2J3JA 1NFFA 3HB4X 3IC5A 4MKXA 4PLFA 1VI2A 4OAQA 4HUJA 5IDQA 2HAEA 3F9IA 1LBEA 1YGYA 2P9EA 3HG7A 5BR7A 3MWEB 2GUGA 2PZKA 4NJOA 3B1KA 1UDBA 3GOHA 4G5HA 2QYTA 1KIFA 1UZNA 1E3IA 3AM3A 3U4CA 2ZQZA 1NPYA 3VDQA 3Q9UA 4QX6A 2P91A 1Q0HA 2NVUA 2Y66A 4FGWA 1F12A 4E31A 3ADOA 3LC2O 3ZHXA 1ZMTA 4YJGB 3QRWA 1LQTA 2Q49A 4BV8A 4XX0A 2H6EA 1OZAA 5HA5A 2IZZA 2DUUA 3RUEA 2R00A 3KOUA 4PLZA 2ZJ1A 4E33A 4FDAA 2NVWA 3BMQB 1H94A 2HSDA 1GCOA 3PIIA 5T5QA 4TRNA 1NX6A 1OI7A 3H3JA 1K3TA 1SB8A 2D0IA 2DLDA 1Q7GA 2EJVA 2ZYAA 4GBJA 2X9NA 4FS3A 4QTZA 2HK9A 3VZPA 1MP0A 1GZ3A 4Z3DA 5KVCA 2HO5A 1LX6A 3CTMA 3K30A 1NNUA 3PHHA 4J1QA 3VH2A 4DRYA 2NQTA 1N5DA 4AG3A 5FI5A 4D7AA 4W99A 2DC1A 2IYPA 2XF8A 4B3IA 3G0OA 3I9KA 2ZCVA 4BGEA 3RASA 1EQUA 2H63A 2DTDA 1X1TA 4L4XA 1E7YA 4A27A 3G1UA 1T4DA 1DLJA 2HDHA 1Q7CA 3T7EA 1DO8A 2PV7A 2EKPA 4OXYA 1A5ZA 5JYDA 2YDYA 4LN1A 1CQIA 2PZLA 3LT0A 1LLUA 1V3VA 4LCEA 1F17A 2IODA 1ZK3A 3GNQA 4NPCA 4XKJA 3WMWA 3ZNNA 3GN1A 5G0WA 4D46A 3RFTA 4DBVO 2RH8A 2H1SA 1QLJA 3P19A 1XU9A 3BMOA 1HE3A 4M1QA 4R9RA 1BTOA 4AJJA 3WFIA 2CMDA 4UVEA 3WJ7A 1PZEA 3DL2A 1G6KA 1PGQA 3FRJA 3HDJA 3C1OA 1WP4A 4PCVA 1DHRA 1H6DA 5LDHA 4EJ6A 4L4SA 4RPGA 3ZH2A 5T57A 1QLHA 2AMFA 4D0RA 3ZWXA 3GHYA 4XD2A 3NTOA 2QW8A 3ZU5A 1VM6A 2YFHA 2Q46A 2BELA 4YVFA 4ZA2A 3NRCA 3LDHA 4HFJA 2Y1DA 1T1RA 2OFPA 3QWBA 4FW8A 5DBGA 3ROQA 1LC3A 1U3UA 3W8DA 2IDZA 3DZBA 4YAKA 1A7KA 4W82A 1I36A 3E1KA 5HBRA 3A1NA 1ZCJA 2ILTA 4IIVA 4B4UA 1PJ3A 3DAFA 3HSKA 2DTXA 5DOVA 4Q39A 4BNKA 1JKFA 3EAGA 3QWFA 1C0PA 1T24A 4FC7A 3ONFA 1UAYA 4GSKA 1HT0A 3HZZA 3GDFA 5I9LA 4B8ZA 1QYWA 3DZJA 1AN9A 2WJPA 3I4CA 3L6DA 4EDFA 1BW9A 3N7UA 3L77A 3NJ8A 1AXEA 1MB4A 1YE3A 4DL9A 2A9FA 5A9RA 1I0ZA 4Q3DA 3BHIA 1B16A 3KRTA 2AEJA 2E82A 3AUSA 1LSSA 4IS3A 4P38A 1EUDA 4RORA 5LCXA 2VUUA 5L7TA 5FFFA 1U8XX 4DPLA 3D0OA 3E8XA 1UZMA 1HE5A 3JQ8A 4PLVA 4AVYA 2V6MA 3EHEA 3IKTA 4OYRA 1LTHR 2EWMA 3W4JA 3ZWWA 3IP3A 2OP0A 5EQDA 4JBHA 4AJ4A 2JD2A 1BXGB 4BNNA 1RKXA 4NBRA 5HTOA 5JAMA 1MUUA 1O89A 1YVEI 6ADHA 1I24A 4QSMA 2TMDA 4M87A 4NIMA 1JA9A 1NPDA 3LC1O 4RLHA 5IFLA 4OSPA 4CQMD 4L76A 1U3VA 3GA0A 4CR6A 2CF5A 2ZTVA 1EVIA 4BNVA 2YHUA 3O4RA 3D3EA 4J90A 1DFHA 1IOLA 4IQGA 1ISJA 2VUSA 3DFUA 1V6AA 3COSA 4PLWA 4ZD6A 3CXRA 3VKUA 4AJKA 1XQ6A 2VRCA 4RCVA 3AK4A 2W4QA 3NGXA 4OQYA 3M6IA 1QMGA 3E48A 4L0QA 3AU8A 3PXXA 4O1MA 1JW9B 1Y81A 3JD3A 4O6VA 4M89A 4TKLA 1DIBA 1HDRA 2VWHA 3AY6A 5TF4A 1UUFA 4YTEA 3M2PA 3MJSA 1I2ZA 4KDEA 1MC5A 1R37A 3OICA 3ZV4A 3O38A 3L6EA 4QFCA 1ZXBA 4LSMA 4YCAA 4OL9A 4L74A 3VH3A 1PS8A 2EEZA 1HDGO 4HY3A 1E5LA 3ZWYA 1Y8QB 3RAJA 5IDWA 3ETEA 1PZHA 3OECA 2IEBA 3P2YA 4PVDA 1DC4A 4EZBA 5A3JA 1XIVA 3GVXA 2C5AA 4U0KA 2NLOA 4WCDA 4JNKA 4LRSB 3RI3A 2C07A 2P2SA 2YV1A 2CZCA 4AJEA 3WGOA 2DBZA 5CHEA 3OQ1A 1BVUA 5FI3A 3DFZA 1OC2A 2AE1A 2QYSA 5ER6A 4J91A 4CQMB 1U3WA 1KEPA 2NU9A 1PJTA 2XXJA 4JXKA 3RU7A 2WYVA 1HKUA 1JTVA 2CDBA 3S1LA 1BRMA 2X9GA 2EW8A 1VJTA 4IZIA 2C54A 4E2WA 3ZCXA 3IIEA 1KC3A 1Z7EA 1YBVA 3OM9A 3O8QB 1E77A 4Z9YA 1NVGA 3CPSA 4CMIB 1LLDA 4GPD1 4PLYA 2GF2A 1ADCA 2G1UA 3JQ6A 4CMCA 5I7SA 3DBRA 4RVSA 3VVCA 4D41A 3B70A 1FDUA 1Y9AA 4NJMA 2O7QA 4XDZA 2X5KO 5KIAA 4XGIA 4YQZA 3A06A 5JXWA 1IYZA 4TRRA 4YT8A 4UUMA 2ZK7A 4L73A 4MVJA 1BHSA 2JKVA 3L0DA 1M66A 5EL0A 3ZWCA 4NR0A 5HS6A 4J0EA 3BTOA 3W8EA 1KVRA 2NTJA 4GWGA 5ADHA 5ILOA 5ILGA 4CUZA 4YB8A 5EIOA 4A26A 1KOLA 5BNFA 1M2WA 1NASA 1SC6A 1ZKMA 3NT4A 4J4HA 4YEDA 3WS7A 3UW3A 1PJBA 3ZWBA 4RDHA 1NAHA 3FNEA 2X7HA 2O50A 3KLPX 2JFGA 3F47A 2CDCA 4GQAA 1EE2A 3WOHA 4WLFA 2EXXA 4CMGA 5TJ9A 5JYEA 3ZHBA 1I2CA 3MCVA 4A73A 2C82A 1LRJA 1OMOA 1GUYA 4GSLA 3RFVA 5G0UA 2NWQA 1YOVB 2G82A 3JQCA 4MIYA 3QVOA 1DIGA 1P0FA 2AHRA 2PZJA 4J7CA 1HSOA 5JCJD 3E6AA 5L4NA 4BUCA 2VTDA 4BO8A 3EGOA 4F3YA 1EVYA 2X1HA 5AOVA 4RO0A 4WLVA 4BHTA 1P44A 3PPIA 3SJ7A 3MJVA 1H5QA 3ZV6A 4FD3A 3H2ZA 3WSWA 3K92A 1A71A 2Z5LA 1DXYA 4KOAA 2VT2A 2VHWA 2Y99A 3DONA 4LK3A 4UVIA 3U4DA 1GYPA 1UXGA 1QV7A 3T4XA 4NBTA 3UAGA 2WE7A 2RBEA 3VPFA 4YJFA 1VPDA 4HFNA 2BD0A 4D3DA 4PG8A 1QR6A 4P22A 3PI7A 4FN4A 3O03A 3AI2A 2OORA 3HFGA 2GLXA 2WEKA 1DJQA 4E5PA 3GVIA 4LCJA 1C1XB 2BFMA 4UEKA 3GR6A 3QSGA 4GKVA 5KKCA 2AG5A 2D5AA 2X23A 5ES3A 4Z6KA 3D5QA 4JBIA 3JQAD 2A92A 3UHAA 3B1JA 3GUCA 2HMUA 5IDYA 2FWMX 2D3TA 1VL8A 5EPOA 4RL6A 4TVOA 4HP8A 5B4VA 3RD5A 2HUNA 2VHYA 3WBFA 1ZK1A 3OJLA 1N2SA 1T25A 3HDYA 2J5RA 4JJFA 4XQGA 4A03A 4KQWA 1CRWG 3F1LA 1DFGA 1RM0A 2X5OA 3CEAA 4NK5A 3ZWVA 4DLBA 2DBVO 3I9MA 3KB6A 3O26A 3CMCO 4L9RA 5A5FA 3DAGA 4ALNA 2AE2A 2JHGA 1W8DA 3ETDA 4BMNA 1TI7A 3TZHA 1YL7A 1BDMA 1MFPA 2BF7A 1Y9EA 4KWIA 1C1DB 4JIGA 2VWGA 1E1NA 4NZ9A 1Q7BA 2PR2A 4WOJA 1ISGA 3JQGA 2WM3A 3GRKA 4LMRA 1UXJA 4YJHA 2HJSA 4ZN6A 4U8GA 1MFZA 1NXQA 4URFA 3NDIA 1U8FO 1V3UA 4OGWA 3CINA 1XDWA 2VYVA 4WOKA 1HYGA 3PYXA 3ZWAA 1ULSA 3NDRA 3V5NA 1YBMA 1HXHA 2W2KA 1N7HA 4WCFA 1LRLA 5T64A 3VC7A 1ZJZA 3PQEA 1NWCA 1GQYA 1MGOA 3CSDA 3V8BA 5IZCC 1R4MA 4IBOA 3M2TA 1ADBA 3AM4A 5JW6A 5DOZA 4DPMA 3JQAB 4PZDA 4BO4A 4BO0A 4LW8A 3BZUA 3QHAA 3TJRA 2ZATA 4PLGA 3G1TA 4PZCA 4OOEA 4XIYA 1P45A 2WD7A 1YL6A 3KYCA 3CUKA 3GG2A 3I4FA 3PWSA 5A9SB 1XLTA 1ENOA 4QXMA 3U62A 4E21A 2NACA 4YT4A 5GMOA 5KCZA 5KJFA 4UREA 3BIOA 1TVEA 1IHYA 2I66A 4CV2A 2B83A 4K26A 4UEJA 2UAGA 3PJFA 3EZLA 2GPTA 2OZPA 2YZ7A 3PHIA 4RF3A 3DMYA 3AWDA 3VZRA 1PGPA 4F6CA 1RM5A 2X86A 2QZZA 1EFKA 3KO8A 3IAHA 4IUYA 3VTZA 3VZQA 3ZWOA 5L7WA 1H9BA 4TRMA 1J6UA 5A9TA 3RKRA 3MEQA 1YWGO 2CF6A 1LRKA 3ZW8A 4MPDA 3ITKA 4N5LA 3PHGA 4GI2A 3OMLA 2Y68A 1A9YA 5CDGA 2EG9A 4D45A 5K6AC 4XJSA 2Y0EA 1C0KA 3H7AA 3ROMA 4QT0A 2UUOA 4WKGA 4YACA 1K89A 4PRKA 5ENDA 3AUAA 3GEDA 4IMRA 1ENYA 2O2SA 1IZ0A 2X22A 2NQ8A 1GADO 1I30A 1P0CA 1SBYA 4ND5A 4E2ZA 1DAPA 2E49A 4C4OA 4CMEA 5TQVA 4CL3A 3D3WB 4MINA 4PLCA 2FHSA 2B5VA 4OO3A 1ML3A 2X58A 2ZKLA 1M6HA 4CLHA 3KLMX 1IB6A 1U9JA 4JX8A 3PJEA 1ZSYA 1N1GA 3GH3A 3IQDB 4CQLB 3HJAA 2O7SA 7ADHA 2PLAA 3C7DB 3QVWA 4A7PA 1KC1A 4BIIA 4DQVA 1DIHA 5IG2A 2WSBA 4LVUA 1MG0A 4XZ3A 1UR5A 5KKAA 3K5PA 3RQSA 5CG2A 1X14A 3WDSA 3KTDA 2FPIA 4R5MA 2UDPA 1T2FA 4R1UA 4CM4A 1HRDA 1XCBA 4RPLA 4A10A 4NU6A 1JLLA 3D7LA 4EITA 1BXZA 4QECA 3ZV3A 2Q1TA 1YQGA 2RIRA 5CAEA 4YRAA 5DBIA 1WZEA 1E3JA 4UUOA 2FZWA 1AGNA 2QRKA 1EMDA 1BVRA 4IDAA 3DBLA 4XJTA 3H5NA 3EW7A 4K1LA 3I9JA 2YY7A 2A35A 3KEQA 1ZFNA 3FR8A 3BA1A 1ONPA 4IDFA 3TFOA 1R4NA 3X2EA 3DO5A 3DZKA 3EDMA 1SOVA 3C7CB 4FFRA 3GAZA 1JAXA 4CJXA 4DMLA 4JBGA 4XYBA 3LK7A 1PR9A 3LT2A 4G2NA 3JQEA 5JDCC 4AJOA 1KEVA 2P4QA 3INTA 2C7GA 2BI7A 2NVUB 4ID9A 4E2YA 4XDYA 2JFHA 3C7AA 3NT2A 1ADFA 2EERA 4W6ZA 1EUCA 2BI8A 5B12A 1PJ4A 3E5RA 4HFRA 5U1PA 4KP7A 3KEOA 4CMBA 1HF3A 5F1OA 1D1TA 1IPEA 1P1FA 4E32A 2J5QA 1Z45A 4CLRA 5FWNA 4CUKA 4QO8A 2E6UX 3KYBA 4OH1A 2J3IA 2OGUA 4CPDA 5G4KA 2PK3A 4NI5A 1J4AA 4IIUA 4RV9A 1GL3A 1SAYA 1JKJA 1XGKA 4Q3AA 2GYYA 1ISHA 2VUTA 3MZ0A 1ULUA 4ND4A 3FR7A 8LDHA 4WNIA 4HADA 4ALIA 2I3GA 4GX5A 2EIHA 4YDRA 3GGPA 5IN4A 2Q45A 3PJDA 4LMPA 2E37A 4C7KA 1U4SA 1PR3A 1KYQA 3GVHA 4E0BA 3TZQA 5IJZA 4RPKA 2GRAA 4MP3A 3IKVA 4CV0A 3ZNOA 4DYDA 1G0OA 4TZKA 2Q3EA 3EK2A 4WECA 4WLEA 1LC0A 3WR5A 2OBNA 3HADA 3LT1A 3RU9A 2EF1A 4ZICA 2QX7A 4ITUA 9LDBA 1LSUA 4BOYA 4ZQEA 2IE0A 2Y67A 4IM7A 5DP1A 2G17A 2HJRA 4FJ0A 4ILKA 5KVQA 3RROA 1Z82A 2O48X 2HQ1A 2OMEA 5BNIA 4I08A 5HRUA 3BMOB 2GN9A 1GCUA 1GUFA 4YAGA 4AJIA 5C7OO 4FFMA 3SXPA 3AI3A 3LF1A 1XA0A 2X0IA 3A28A 1RWBA 2D5CA 2FP4A 1FMCA 4I5FA 2YHIA 1NYTA 2EP5A 4PIVA 1ISIA 1EDZA 4HX5A 3VH4A 2ZCUA 3W1VA 4DA9A 1A7AA 1ADGA 1NM5A 3QQPA 4OM8A 4RZHA 2VOEA 1Y8RA 2AG8A 3ZU3A 5TLSA 4OXKA 3F5SA 1T2DA 4ALJA 4ZQBA 1VLLA 1B14A 2BGKA 3DC2A 1H2BA 5L3ZA 5KOIA 4A0SA 4GX2A 4R69A 2BFAA 1VJ0A 1ZK4A 3V2UA 3Q2KA 3S55A 3DOCA 1LJ8A 3DWFA 3FD8A 2X0RA 3LQFA 4NU5A 3WGZA 3GPDG 5HS4A 1IPFA 3BTUA 2VRCD 1ZH8A 1Z73A 2GDZA 4YQYA 2ZYDA 5DNAA 3STHA 2DTEA 3LYLA 1ID1A 4O59O 3HDHA 1D4FA 1P1JA 3ZU2A 3SJUA 1BW9B 4TMFA 4EI2A 3OEWA 1J5PA 1GV1A 1UH5A 1GV0A 1W4ZA 2DBQA 2E48A 1ZO8A 5F1PA 1PQPA 3WGYA 4BKPA 4BO1A 1Z75A 3PK0A 1GU7A 2Q99A 2NNLD 3FBTA 4BL5A 1F8GA 4XQ9A 1W73A 3PFWO 2HMSA 3IMFA 3Q3CA 3UOGA 4W4TA 1UJMA 2VWQA 1LDYA 1H2HA 1NR7A 2VNAA 3IUSA 3U49A 1JU9A 4BNIA 2Q50A 3JQ8B 2B36A 1D8AA 3PWZA 4H15A 4DXHA 2CY0A 3R6DA 3AM5A 3KSDO 1HDXA 4FGSA 4DREA 2B0JA 2ZB8A 4LISA 1EK6A 1ZSVA 3VAZA 1X7HA 3FI9A 2C2XA 3PRJA 1LDBA 3NEPX 3GFGA 1L7DA 2NTNA 4Y9DA 3WICA 2QIOA 3BMCA 4MJLA 4NBWA 1PQWA 1SO8A 3TSCA 3V1TC 1SEVA 5IN5A 3JQ9C 4R3NA 1YB1A 2PKQP 5DT9A 3ZZNA 5DBFA 3QWIA 4BO3A 4ND1A 1PU2A 2TMGA 1WMBA 3ANNA 3PHJA 4BQRA 4XYEA 2YQ5A 4B8WA 1E6UA 3JD2A 2W98A 4QFDA 4PVCA 4GGOA 4PLHA 4Q3BA 5A3VA 4BB5A 1SCUA 4J49A 2J6IA 4BNMA 2GZ1A 4YWJA 1PZGA 3JTMA 3VZSA 4B4WA 1GY8A 1DIRA 2VZ0A 1Z7BA 4IQ8A 5AXAA 3OSUA 3RJ5A 3OHSX 3WQQA 4CLOA 3JQFA 1DPGA 3LT4A 1YDWA 4HNGA 4BO9A 3VPXA 5AYVA 4BVAA 4MVJD 4HV4A 1PGNA 2WTBA 1H6AA 2J3HA 3CH6A 4JJIA 1I3MA 5HWSA 5JS6A 2P68A 1OAAA 4P8RA 3PIDA 1Q2XA 4U5QA 3T4EA 3HN2A 3IUPA 4W7HA 3DBHB 3NTRA 3DHNA 5JO0A 1FK8A 5DULA 3HWRA 3S2GA 4R41A 5MGBA 4JJGA 1AUPA 5ICMA 4DC0A 2Z1MA 5JFOA 1C0IA 4GWKA 1PIWA 4GLLA 5H81A 1FDWA 2I6TA 1X7GA 2EGGA 2PD3A 3AOEC 3EC7A 3MOIA 2NADA 3Q11A 4Z9FA 3UCFA 4AJNA 4CM8A 3ASVA 3ZWMA 2DPHA 3RC2A 1D7OA 1CWUA 1UP4A 5EQFA 1QV6A 4UVHA 3TZKA 2BHLA 3HFSA 4ESOA 2QZ9A 1PL8A 1GAEO 1VC2A 2W8ZA 3LVFO 4MO2A 1QORA 4HXYA 4MDHA 1PJCA 4TSKA 5FYDA 5CDSA 2BMAA 3ANMA 1N8KA 2HK8A 1A9ZA 3F46A 3FPCA 5TGDA 4XCVA 4IDDA 2O3UA 3JD1A 4MVJF 2B4RO 2ZQYA 2HU2A 2OL4A 4YA6A 3DBRB 1F8FA 3GGGA 4BNWA 3IS3A 2X0JA 4NJMB 3OETA 4J16A 1BG6A 4XEHA 3RUDA 2GN6A 3I52A 3QJ5A 3V1YA 1HETA 2AQHA 2VOJA 2Y1GA 2ZB7A 1SEPA 3F6YA 4INAA 4Q9NA 3QVSA 3ZNPA 4RVGA 4AJ1A 4PG5A 5DP2A 2PZMA 1LXCA 1YQXA 3FPLA 4PG4A 2VZ9A 3IJRA 4XYLA 1HE4A 1K0UA 5CDUA 4WLOA 2BFOA 5C7IO 3KYDA 3W8FA 3KV3O 1E6WA 4E2XA 1P1KA 2CFCA 3H9EO 5BSFA 5JSFA 3UGKA 3EYWA 3L4BC 5ITVA 1WNTA 2FPPA 4BNXA 4OJNA 5GZ3A 2IZ1A 3INRA 3KSZO 4B4OA 4B7CA 2CVOA 2C59A 1E7SA 1ZEJA 1IE3A 4L75A 3RSHA 4DQXA 3ETGA 1XELA 4X54A 1K2WA 5CPFA 1YB4A 1D3AA 2NU7A 4LSWA 3M1AA 3OIDA 4UAGA 4WPGA 1GQ2A 3ZNQA 4DVJA 4Z0PA 3GZ4A 1PWZA 4CUJA 3GLQA 4BO5A 2GR9A 3Q2IA 3PQDA 1Y5RA 3RFXA 3K73O 1H9AA 4WASA 3KUXA 3FCOA 1U4OA 4M54A 4S1VA 3IOYA 3NDJA 1CYDA 3AJRA 4F45A 3CZMA 4DLLA 9LDTA 3ZGYA 3ROPA 2WWRA 2Z95A 3JQBC 3PYLA 5DCUA 3WGGA 2UVDA 4NFYA 3W4IA 2VYVD 5CPBA 2GD1O 2VYNA 4YJFB 3BTSA 3WB9A 3I1JA 1M75A 5MDHA 2BGMA 5KJ6A 4IZHA 1ONOA 1DRVA 4J1TA 3M1LA 3I5MA 4IDEA 4U6QA 1WZIA 3RUCA 2V6BA 3F3SA 1LLCA 1G0NA 1O5IA 1C14A 3L6OO 1YB5A 5J23A 1VE9A 4FB5A 3E82A 2FZEA 1P1HA 3OEYA 4I9UA 4R54A 1UP7A 2F1KA 3FWNA 1EBUA 4UUPA 5THQA 4BB6A 2R6JA 5T8KC 2B4QA 5F1KA 4R01A 4BQPA 4RJTA 5KVVA 3ITDA 5I7FA 3ZHYA 4J2OA 3N58A 3L9WA 5JAIA 1UAGA 1I2BA 3FWZA 1KVQA 4J9UE 3GY0A 2PGJA 4JQCA 4MVJP 4J4TA 2Y1CA 2PD6A 4IGEA 3FF4A 5EMHA 5IXYA 1Y1PA 3JYQA 3F5QA 3QIVA 5IZCA 1U3TA 3ICPA 3KXDA 1FJHA 1TB4A 3FNHA 4BGVA 1P31A 5TX7A 1SPXA 4OHUA 5I8WA 4AICA 4BNJA 3G49A 4JK3A 5IAAA 4J4BA 2JJYA 3JQ7A 1GR0A 1ZMOA 4QQRA 1Z6ZA 5A05A 3I3OA 1OBFO 2DKNA 1FDTA 1YL5A 4MKRA 3JQGB 3H9JA 4RPJA 4YYZA 4CM3A 3RC9A 1X1EA 4YJHB 3MJTA 2POQX 3E5MA 4I1IA 3TOZA 3DOOA 1VL6A 1ENPA 5GZ1A 1AE1A 5T6BA 1HDOA 1K6JA 3SC4A 5EN4A 4CM9A 3GK3A 2W2KB 1E3SA 3PDUA 2O3JA 2CVQA 3JQDA 1E3EA 3RIHA 4MVJM 4D79A 3WJAA 4WCFB 4ZU3A 2AQIA 3S2FA 4FBGA 1R15A 2VNSA 1B8PA 4UULA 3GN2A 3RC7A 4FFNA 5AXDA 1CQJA 1R0SA 1Y7TA 4DBZA 1R4MB 2PFGA 4FFLA 4AFNA 4BNUA 4CM1A 1J0XO 1YQDA 1SZJG 2BH9A 1IZ9A 3QP9A 3EZYA 4NK4A 3OIFA 1ZUD1 3HQ4O 4TROA 3ZHZA 3TFQA 3C3XA 4O0LA 2IYOA 3SVTA 3WGTA 2WD7B 4Y98A 3WTCA 3KYCB 1IUKA 1PJ2A 4TZTA 2QRLA 4RVHA 3PZRA 5JDIC 1GZ6A 1HYHA 1FDSA 3TNLA 1ONNA 3SBOA 3UH1A 1X7DA 3A9WA 1DOHA 1PL6A 4IGFA 2WYWA 3LZ6A 5A06A 1CIVA 2CDAA 1RJWA 1YONA 3VVBA 4PN3A 2JD0A 5C3MA 3GNTA 1E6EA 5I8ZA 2VHVA 2Y93A 4BGIA 4XA8A 4EW6A 2ZTMA 1GFSA 4XQCA 5HM8A 3QV1A 4G65A 5DZSA 2X4GA 4HFMA 1LI4A 1PEDA 2OHXA 1NHGA 3E18A 1AXGA 3WGQA 4PZEA 4AJPA 1X0VA 3TN7A 1IL0A 3OA2A 3GQVA 1DC3A 1JQBA 2I65A 4IINA 1U7HA 1Z74A 4E30A 2O4CA 3ONEA 1HTBA 1K6IA 1O9BA 4WJZA 1LDEA 2NM0A 3DMTC 1L1FA 3VKVA 4KUGA 3MJCA 3PP8A 2WYUA 1L7EA 3H9UA 1YJQA 2PWZA 3GEMA 4BNZA 3RC1A 4E6PA 1B2LA 4NH4A 1HLDA 3NUGA 3PLRA 1KERA 3AFNA 1XEAA 1NTOA 3RBXA 2D2IA 1N1EA 3LU1A 3QA9A 1P9LA 4MP8A 1X0XA 3QE3A 4PG6A 3VDRA 3V1UA 1LDGA 3E9NA 1E7QA 4XYMA 1E7MA 2R2GA 2AQ8A 2ZYGA 4IXWA 1T26A 3UVEA 4MKZA 1GYQA 3VH1A 1YH3A 2GO1A 4EYEA 1CDOA 4CM4B 4R1SA 2FR8A 1AHHA 1EUZA 5TNXA 1ISMA 1NP3A 3NYWA 5EERA 4B7UA 5KJEA 3I9LA 4YT5A 3HB5X 2ZJ0A 2VN8A 1HZJA 1KBZA 1O94A 2G5CA 2P4HX 4DWVA 4NNJA 5LDGA 5EJ2A 5JPIA 2X6TA 1KY4A 2FSVA 3DBLB 2O4UX 2DM6A 6LDHA 3BMNA 4Q3NA 4E5MA 4IXTA 5A5EA 1XYGA 4DC1A 1R4NB 1OOEA 1S6YA 3GMSA 1W0CA 2J5KA 3CIFA 2ET6A 3JYNA 4GLOA 3UUWA
chains in the Genus database with same CATH superfamily
3K2QA 4DABA 3BEDA 3ELWA 3NP7A 4JP8A 1L0BA 1KY2A 4TUYB 1DC5A 1WMDA 3AVOA 3AWIA 5AJUA 5DIFA 3WLEA 2OLKA 4B31A 3KR1A 3CUYA 4CT0A 3TRKA 4EUKA 2GJKA 3K2EA 5BQPA 2I7VA 1BMDA 4Z9BA 2Q4EA 3WL7A 4NU0A 4DV7B 2C2WA 5EQJB 3BREA 1BCRB 4EO9A 2EARA 1OXSC 1DKNA 5ESDA 1R1DA 4WBSA 1PV2A 1B26A 2LDXA 1Z7GA 1G291 4R2MA 1IPHA 3PS9A 4E5DA 4FZRA 4B6EA 4CLRB 4A0QA 4JROA 3AIKA 4ZZ1A 1WMAA 3ZKAA 4YP6A 1QH8B 1GGHA 2MMCA 3CF4A 1TT5A 5KNLA 5YASA 4ED9A 3E3LA 1L4UA 3IL2A 2OBMA 4CLXA 2W90A 4M9SA 3K2BA 4QOGA 1PJSA 4AYXA 1U7UA 2A86A 3OQIA 1NT4A 4M0MA 3NKLA 3TR5A 1K7YA 2EEPA 1LGYA 3U09A 2J9GA 1Z2NX 1FNDA 3ROZA 4HKTA 1OX5A 4KPYA 3F49S 4P0TA 4FIDA 1Z4NA 4M1MA 4QGFA 3KE9A 3R3UA 3S7TA 2IQ5A 2I1LA 5F3RA 5IDXA 5K0SA 3I04M 1SIBE 2X15A 4L8YA 5KWVA 4QVIA 3ZWDA 1PR6A 4LBVA 4X6YA 1BCSB 3VBEA 5KSWB 5JAQA 1X19A 1E1MA 1BS1A 3EVBA 3IESA 5BWBA 2ECFA 4KPUA 3WQBA 3LYAA 4BQEA 1MZPA 2EGUA 3HBFA 1CDZA 2ZRFA 4ZGGA 1ZNXA 5FJIA 2IHNA 5JH7A 5DWDA 4R1QA 1E32A 3ZDAA 1NUQA 3E22B 4CRWB 1E3MA 2V5AA 1PG0A 1FRFS 3K4PA 1M73E 3EQZA 3THOA 3VOTA 3ZE0B 3ZVKA 2PPVA 4IMIB 4J0CA 2ZAYA 4QU5A 5C8DA 4EHFA 3ZOKA 4F9EA 3ESRA 3WMRA 2W58A 4K0RA 3K31A 3T5DA 2CK3D 4HG2A 4E5KA 4RJJA 3DE5X 4HAXA 2J33A 3MW8A 3ZLVA 2WU0A 3DFIA 3TVTA 3BF8A 4QULA 3NRBA 3ZC3A 5EOVA 2F59A 5H3LA 5BYAA 4CM7A 2ESRA 4UJ3A 4EBBA 1SM4A 2DFPA 1TD9A 2REXB 5U4QA 3GRUA 4MMZB 3LXXA 4OQLA 3OLYA 3A1CA 3WLHA 1O6CA 2J5BA 1DBSA 3EEOA 2H9IA 3CX8A 3OKCA 1SKAA 1ZX1A 3U6BA 3TMAA 1E62A 2GXUA 4O5AA 4H16A 4MZXA 1NUSA 2VC2B 4DDKA 1BWSA 4LXHA 1QGUA 2VP4A 3TLGA 3SWWA 1DRJA 5FA6A 3U4GA 4DKJA 3QIAA 2Q1SA 4BN0A 2AIRA 2H2GA 4AZVA 1HQKA 1OA1A 1T9DA 1IY8A 1P7WA 1RZRD 3RLFA 2E1PA 4JLSA 4NV3A 1OC4A 3O2QB 1X1AA 1L9XA 5BPHA 2X2OA 4GX1A 4AXXA 3EC2A 4AG6A 1SD1A 2CVZA 1X13A 3WLAA 2Z30A 3HPQA 2LKCA 3QXGA 3N8NA 3EZFA 3EHDA 4GKKB 4XIFA 5FL7D 5IH7A 5DXAA 3GPCA 2IYEA 3GOQA 3MAGA 6REQB 1SBQA 4CEHB 2R97A 1FYEA 3M49A 5BQ5A 1D07A 2PIAA 4G0NA 4H7EA 4EY3A 3H5LA 4N6GA 3OEED 1MX3A 1DLIA 4P32A 4WXRA 4ZVSA 4X62B 3C24A 1P1CA 1F3OA 2P2NA 4CM6A 1M2VA 1SG0A 1PQUA 1R0LA 3WYEA 1Q1QA 2KLBA 5I7HA 1L7PA 1ZXLA 2V8BA 2Q5IA 4IYJA 5EWMA 4IRXA 2MSLA 1J2EA 3H86A 4I6EA 4BMDA 4PG7A 1ODCA 4LXGA 5JJLA 2P5UA 4R51A 3UQZA 5B3JC 2VF5X 3WGQA 2CXNA 1JDBC 4LOKA 5IH3A 1T2EA 1P2BA 4YUZA 1LH0A 2Z5VA 4RJIA 3DEIA 4UTRA 4FR5A 4M49A 3GLKA 5FBLB 2PWAA 1YQWA 2FUG1 4DQUA 1KEZA 1Q77A 2I4LA 1L8AA 5DN6A 1G19A 2AF3C 1PL7A 4CNBA 1Z63A 4CMEC 1U8UA 4LDAA 3GD7A 3MRVA 4UTXA 3S8MA 4YLYA 1Y42X 4PAQA 1JQKA 3B7WA 1PG5A 3O2JA 4OMUA 1E1RA 4H4EA 4S3MA 3L02A 3X1DA 3SSOA 4WGGA 3NWBA 1G4AE 3ICQB 3B8EA 4ND2A 2Q9UA 3VQTA 1BVHA 3B5IA 5CGQB 4B3HA 2QKYA 2VT3A 2EFDB 2F3UA 4WIAA 3PQ3A 4L1KA 3H99A 4OD0A 5KKNB 3PNSA 1FDIA 5D84A 5K4GA 1FRZA 2BN4A 2OESA 5AKKA 1S96A 3O4FA 1PP4A 1GCGA 3AEQB 2H1VA 1F51E 1TUIA 4Z8XA 2RB4A 2NYRA 3GMDA 2VNKA 2JVKA 3ZGOA 4ATNA 1FPQA 3K8QA 3R7FA 5BSGA 4TKUB 2DETA 4IV5A 2QGZA 4P3PA 1SN7A 2AH5A 1BRTA 1C30B 4BBZA 1F1JA 1PNVA 4K9SA 4I14A 3A4LA 4RIGA 1E9RA 4OA8A 3PWKA 2CXSA 2DR3A 3QX8A 1E9CA 4YAEA 2D8AA 5BQXA 1FXWF 1XEFA 4CFSA 3VPSA 4A15A 2HQRA 1JWBB 4LVOA 3EBPA 3L0BA 4AROA 1YS1X 4F5EA 1N2IA 4MVJG 4MV9A 3CW2A 3EG9A 4Q6BA 2QMZA 2BJHA 1NI3A 3IX7A 3BHMA 3TX6A 3THXB 3KOYA 5KTPA 4FKMA 1N8NA 1OFHA 3I1YA 3KSRA 3CB2A 5TRTA 1JEQA 3BXPA 3OE7A 2HA2A 1B8VA 4V2IA 3Q7IA 5ARDA 2Q07A 3LPDA 3RUHA 5BSHA 1TE2A 5L9AA 1LZLA 3HR8A 3AI7A 1KZ4A 2ZM5A 5FWAA 3TRFA 2CT8A 2HLHA 3MWEA 2YWRA 1TL7C 1R7RA 1L6RA 1SMKA 2QVGA 4R9UC 2D4AA 1KAMA 3GPIA 4PONA 3WK6A 1GXSA 1TT7A 1ZRSA 4W5JA 2YUTA 3ADPA 1J8FA 2WKQA 4D6XA 4ZVMA 1SHTX 3DEKA 3ZWNA 3TSYA 1J23A 4DFDA 3ZUPA 1LBSA 3EIUA 4B0OA 2ZTUA 4QTYA 1WETA 4GEKA 1Q0SA 4GDFA 1IXRC 2XDQB 3FTEA 1JQLB 3L4SO 1AQ6A 4PQRA 3D4BA 4XPIA 4P82A 4WZBE 1QYDA 2HHAA 3JVVA 4NC9A 5FF9A 2H4XA 2YJ3A 4WLNA 4IPTA 3Q8MA 3LUHA 1BSVA 1LEHA 1D2EA 2D1YA 3FKSD 1QC5A 221PA 3GEEA 4G37A 4ZAVA 3B3AA 1K5PA 2IJGX 2PMKA 3P9RA 4MJ3A 5DX0A 5FOXA 2X3YA 5JSQA 1HLPA 5JCZA 4XD7D 5ITWA 4HRXA 4L3WA 4E5UA 2OK8A 4WXYB 5G0TA 1XQ1A 1Z15A 4IJVA 5DYNA 4ACAA 4P2BA 4Q18A 2Z6QA 1TA4A 4DSUA 3ZHVA 1BDBA 2ORVA 2G4CA 3UMRA 4CMAA 1F7VA 4UU0A 5BORA 2OKCA 1HL7A 1NQXA 4GX0A 3O84A 4BFWA 4RTJA 4ALKA 1G59A 1MRNA 1QLWA 3MQ4A 5EHZA 1ZGAA 3IV7A 2CL5A 4I7EA 4P4UA 4NPHA 2ST1A 4AZSA 1LCIA 4FOOA 5FWYB 2ZRHA 1WCYA 4ZQGA 4OHYA 3LS2A 5FQOA 3KYDB 3L79A 4LMBA 4YJ2A 1M34E 3A0UA 1I0IA 1ZM4A 2E4UA 2HDWA 4P34A 5U4XA 1XPUA 2RJOA 1XZ8A 2C2KA 2YXPX 2FMUA 5KHLB 2ZRIA 1QYVA 1PJQA 3CZ9A 4H7HA 4PV7A 1WUTA 5J2TA 1Z4OA 2GI4A 2H5JA 2I9PA 5DF1A 1KYXA 2XBLA 3FSGD 1A8SA 3TRIA 4N0DA 2CBZA 3C3YA 4XQEA 4M1TA 5BN5A 1HQCA 4DR5B 1KRXA 2RAUA 2DQZA 2XUAA 5T8KA 2ON6A 2XZLA 1DEHA 1ULHA 3N8HA 1YRLA 3LMKA 4LCBA 1QX3A 2X4LA 4OGLA 3ASUA 2VHZA 3A3PA 1X39A 4JELA 3QEMB 3TIGA 1R6XA 4KJZA 2ZIXA 1UZAA 2R00C 4HN4B 1NI4B 3G2JA 1U2DA 3D3KA 3IRVA 2I7XA 1GM5A 4BNFA 4L5CA 5LN1A 1LNQA 1OAOA 1ODLA 1HBJA 3SC6A 3K6JA 2FY8A 2Z9DA 1GRNA 4HLNA 1PK7A 2DERA 3DLBA 3WYCA 4NDNE 5B4TA 5I47A 3IERA 3F3MA 2NZ8A 3AUUA 1ORTA 5LXTA 1BMFD 5FNZA 4DCNA 1C5KA 3WNVA 1TQ4A 1QU2A 4AWXA 1RQPA 4H18A 2G06A 2GXQA 4X7PA 3F5MA 3ZCTA 4MYDA 5F1YA 3CHYA 4XFJA 4CQJA 3FIJA 2AKYA 1Z5VA 1PT6A 1ZVMA 3G82C 3W05A 4ZI7F 3EMVA 1E2DA 3ZYCA 3KSAC 2P90A 4O4JA 1VTKA 4JYZA 1UJ4A 3NTVA 5HYVA 3O8DA 3K94A 2WJVA 3N74A 1Z4MA 3Q9NA 4EUEA 5DM1A 1TCUA 1DSSG 1XKXA 2XT6A 3FPAA 4EKYA 2GK3A 1KETA 4H9GA 1BN6A 1MEEA 3C3CA 1ZIDA 3DM5A 5CDFE 1B23P 4EYSA 4HEJA 1PZXA 1DWUA 3PFGA 1JJ7A 1CB0A 3VSEA 2SBTA 2XWPA 4Q93A 1C9MA 1FFGA 3PDWA 3L06A 3R7AA 2AZMA 3UANA 3MJDA 1KHHA 1EZ4A 3AP1A 1F6DA 3N28A 1XMJA 4R8KA 5HBGA 3NBXX 4ZU1X 3KZOA 4YQFA 4K9RA 2O2YA 2NPOA 1HLFA 3KSUA 2P9YA 1U7TA 4MVJH 5I7EA 5KOJA 2WWIA 3IEPA 3E7DA 5B1HA 4Q4CA 4DBLE 3GD5A 5KTSA 2TRSB 2CYCA 1EGMB 1A2QA 2LCQA 3GNLA 3H5AA 2PAFA 1VLVA 2W8BB 4D2IA 1KO1A 1J42A 1L8XA 4MK4A 1V16B 2ZBDA 2CNKA 4UE3S 3RT1A 3OX4A 4OK5A 2CNBA 1VJ1A 3SG0A 1RYEA 3H1EA 5HMMA 3QBTA 4ZQFA 4EYKA 1J7KA 2HDNB 4YONB 3MN1A 3ZHCA 5KINB 3UATA 2VP2A 5CT5A 2XMQA 1NGSA 4YRLA 1IWOA 1VIDA 2M98A 2GNAA 1G2QA 1E79A 1EGQA 3CVOA 1Y5MA 4OY3A 2NOAA 5AVQA 3MG9A 1GTZA 1LS6A 2BFDB 2RKWA 3MTDA 2HIAA 4PGFA 4F4IA 3ZIAA 3PDHA 3GLIE 2I2FA 5IPFA 2A88A 5K6TA 1AKEA 4V0MA 1CTQA 3K0HA 1BOOA 2MT9A 3C1AA 4NJEA 3UYLA 4MRSA 4ZRMA 3BGIA 5AM2A 2P9CA 1V35A 1XDDA 2CJPA 2FUKA 3KQTA 5BR8B 1Y8ZA 1TM1E 1NTRA 4YXFA 1WX1A 3KPWA 5E6SA 3KUKA 4ZFNA 5BW5A 1U6JA 3WWPA 2AOXA 3A14A 1D6NA 3BF7A 2BMVA 2I3AA 2W6JA 2YWBA 3LKBA 4M6WA 4Q3KA 3GROA 4ER6A 1I33A 1TJNA 4RHFA 1FU4A 4YLEA 2ZRCA 1TQ2A 2V1UA 5DCYA 1J2RA 1QQ5A 4D82A 4Y1FA 3DAOA 1ANKA 4AJHA 4CTMA 3OFNA 5A6SA 5FLKA 1TCAA 2GPYA 3LRXA 1Q1EA 4R16A 3TOCA 5LYJB 3KR2A 3H05A 3J81A 4LJ6A 4BX2A 4FT4A 3IEUA 2J4DA 3D8UA 1Q0UA 5BT9A 1N6HA 2JJQA 2ZTLA 2C29D 2A4KA 1Q74A 2VJLA 2YYYA 1NFQA 5B1IA 3R5JA 4ND3A 1DQNA 3CNQS 1UBHS 3H6KA 1WDWB 4J0IA 4QEDA 3REFA 4I3HA 5JC1A 1XDGA 3ZCUA 2VNIA 3U44A 4NDZA 1SCKA 1ZW1A 3OH8A 1RPAA 4OOFA 4OSOA 3WBJA 5JZBA 4UM5A 1YRQA 3CZ5A 1U3GA 2H1CA 2NV6A 2A94A 4IGIA 3RBAA 1TGVA 1F3LA 4BQSA 4QFBA 1CR4A 2I3DA 3B9QA 4S35A 3TLCA 5JSUA 4RIFA 1Y8QA 2ZAIA 3DAHA 3E2PA 2FOIA 3CQ9A 4LJ7A 4MHSA 1MA0A 2E2WA 2QG6A 1CUAA 4DMHA 1ZGJA 4UU1A 5ADVA 2VYQA 5G0SA 3FYTA 3HXQA 1GVHA 3D54D 4WNCA 3R3VA 4O4LB 4RZXA 1VE6A 4TYQA 5D87A 3RVBA 1OH6A 3BFVA 2P62A 2OFOA 3CUVA 2VEOA 4N12A 4OXRA 1YK0A 2G9VA 1S01A 1WKBA 1EK5A 3P9NA 2QTMA 2NXCA 3T06B 4D4MA 1H6CA 3O4HA 3X3HA 1EK1A 2HHLA 4LRYA 4DC9A 1HDYA 2O8VA 3LNTA 4C2TA 4BO7A 5JY6A 3U0BA 4BLOA 1MJGM 4A6DA 1KEUA 4FYMA 3QFHA 2QRJA 2HLPA 2RHRA 3E3MA 3G6WA 2JK1A 3O5AA 3MXTA 3QMMA 4LDNA 1B6RA 1NMSA 4JODA 3ZVMA 3O83A 1SGWA 1EK0A 1CZHA 2WAXA 1U7ZA 2WUGA 4WKPA 5KBYA 1D03A 1U0RA 1XLWA 2F9LA 3MMPA 5FR1A 3I5XA 1SK8A 3L8YA 1ACMA 2EFHB 1CR1A 2HMYB 5FTMA 3DYBA 2Q5HA 3LWBA 3O8QA 1JJAA 2ANCA 3MHPA 3OPVA 3OKFA 4J6FA 3S2SA 2FAXA 2R6ZA 4NYMQ 4ARBA 1TYZA 4RF4A 3IDQA 1F0YA 3O92A 3UCXA 4F84A 1LDMA 1Z4PX 3RTAA 3FYUB 3ZEAA 3R77A 1ITZA 1V3TA 1WW8A 2VCEA 2CCGA 2UUPA 1QVAA 3F97A 5GJCA 5MN6A 1I6MA 2DAPA 4J0HA 1MABA 2XLBA 1H1LB 3TAUA 2NU6A 1L9KA 4UAJA 1PZFA 4CF3A 4P4GA 3O47A 2PT7A 1JG3A 4V0NA 1VE7A 2XGOA 1MC4A 2ATXA 1OFGA 4FCWA 2Z8ZA 4MSUA 3UGQA 4B48A 1DS6A 1Z2EA 5BSWA 2ZZKA 1R66A 1SCAA 1GPDG 4S24A 4I1VA 1MVOA 1XJ5A 4RFSB 2PJUA 3SM3A 4MWBA 1WXDA 3A1VA 4FJ2A 4WN3A 2JBAA 1KDZA 4RSMA 4JQYA 5TSDA 4H4DA 4QU0A 3HJRA 1R8XA 3CE9A 4L9AA 3DF9A 2VF8A 4YMSA 2AFRA 1R4AA 5DTQA 4F3CA 1UJBA 3ZCRA 4Q9JA 4ZCSA 2NZJA 1MIOB 2PBLA 3LKZA 1N5LA 3VO1A 2OA0A 1FS6A 4REOA 4C7VA 1NSFA 4RMNA 3LWZA 1ESNA 3H5VA 1VZ3A 4LZPA 1LQ2A 3O0DA 3HUDA 4ZT2A 2IOYA 3INGA 4PS0A 5C4IA 3NAZA 4DM4A 2X0NA 3F7TA 1ECBA 1G98A 1ZVQA 3QM1A 4AN0A 4V0LA 4I9NA 1GKUB 4C7OB 1JIUA 3O73A 3J81k 1YU6A 1ZICA 2UZ1A 4KQFA 4OKIA 2Z2XA 3OJEA 1AY0A 4XYGA 1X15A 1QHYA 1DHTA 1FQOA 2WJHA 1NY5A 7MDHA 1EE1A 1Y4SA 3WNQA 3QE4A 1UT5A 2ZIWB 4B7AA 3ENKA 2SICE 3WRYA 2VUIB 3VX3A 5JSHA 2COKA 3AJ9A 1UDAA 1YR2A 1RS0A 1DQZA 1G6HA 4JS0A 4CLDA 2WDZA 4NEQA 5BVHA 4KQGA 5AVVA 3OIVA 1HI9A 1LSOA 1SRRA 4C1NA 1E7WA 4TMZA 2FPRA 4RVCA 1GEEA 4G8BA 2PGDA 3JVIA 4NOJA 3QOWA 2HF8A 1PZMA 1WZUA 3GA7A 5DW3A 4YRBA 2PFKA 4KXNA 2I22A 3SHTA 4WGFA 5ABPA 5I7UA 1QVWA 1DNPA 2CFOA 3FHLA 2VCYA 3VGPA 4IJ6A 1K3UB 2YWHA 3TX2A 1U2GA 1XZQA 1M7GA 2XODA 4QYIA 4GM4A 9GPBA 4N3BA 3KT8A 1TZKA 1FF9A 2MSDB 3KU4A 4QAQA 3BKWA 4EYOA 2WIDA 3EVNA 1QHEA 4R8VA 3WLMA 3V4PB 5A4FS 1XJCA 4PX5A 4TTJA 2WNIA 4U1RA 4KPGA 4W8HA 3WFJA 4AQYB 1F6WA 1NVTA 3S40A 4RC9A 3IEVA 4JY7A 3NHLA 3A2LA 4F97A 2IX3A 3VR4A 3WIOA 3DTVA 4NZOA 1HPLA 1A4UA 1KTVA 3THRA 6GPBA 2B5WA 5JH7F 3EX7C 1G18A 2KWIA 3ND7A 2WHPB 5DVZA 1FP4A 5F21A 4A1FA 4BNHA 4OI4A 1NVBA 2YDXA 4BE4A 3OIUA 3PQCA 2HNKA 4IDQA 1F06A 3I6IA 2ZSFA 3HO8A 3A2NA 4L0CA 3U0VA 3VR3A 1OE0A 4A8JC 1GQFA 3NQ41 1UFRA 4IOLA 2UV8A 2Z58A 3W3AA 2HK7A 4HVCA 4YRIA 3EVTA 2GQ0A 1C8VB 1UXIA 2A5YB 3L0CA 3RRBA 2HWWA 3ND8A 3JD4A 4X7MA 2X0EA 4BAGA 1QZ3A 4FMBB 3RS7A 1NV9A 3DZGA 1DQYA 1R6VA 2A9VA 1L1EA 4FYJA 2BGRA 4DUPA 1M0EA 1PHPA 2QRHA 1QXSA 1TM3E 2C1ZA 2PJDA 1AS3A 4B35A 5L3VA 1E3WB 2OHHA 4MWOA 3KSBC 5BSVA 2Q3MA 4W9NA 5CEEA 5I51A 4M8KA 3AR3A 4WK4B 1W2WB 1NWHA 1JN0A 1XRPA 1Z68A 3H7IA 1YI1A 3A4MA 3IE2A 5JJBA 2NIPA 4XRRA 2L17A 5IRCD 5JAPA 1VG8A 3FI0A 4UUNA 5HGJA 4L8WB 4PNZA 1VI6A 1DOAA 1NVMB 4GE3A 1B0AA 1TC1A 3P5BA 1SUPA 5TQ2B 3TSWA 4EHLA 5C7YA 5CEJA 2AJLI 1WKCA 4WEQA 1QYCA 1C2YA 1YKFA 2OORC 1LBHA 3BXXA 2X1VA 3C2QA 3PDJA 1V8BA 4JMLA 4R81A 2UYGA 3FETA 1AS2A 1P2GA 3NBFA 3G7SA 3GGOA 4JNCA 3D6HA 2JLUA 3D2AA 2Y92A 3P2IA 4ABTA 2IYZA 1M2OA 3OMXA 4K9QA 5DXFA 5DN6D 2XJ4A 13PKA 5ICFA 3AERB 3ULKA 1UM9A 3P9KA 5F23A 1MLDA 3NM6B 1DAKA 4XCXA 1YE5A 2B92A 1FP1D 3H9QA 4WV3A 3DWGA 1E1RD 2Y1FA 4JUFA 6YASA 3JQRA 2DHQA 3HLTA 3KZVA 1E64A 4PLTA 1USWA 3LCVB 4W8OA 5EKUA 5ECYA 3P97A 3L1KA 3M6VA 3T7JA 3TKAA 3UAXA 2WMDA 3LNCA 4QOJA 1JTFA 4YWHA 4RELA 1J22A 1Z9BA 3JQAA 4IAOA 3IALA 5E6RA 3QFTA 3UJBA 4DLAA 4EGSA 5CDTA 3R41A 4NBUA 3VNRA 1VSVA 5HQJA 5JNVA 2FZVA 3N2KB 3BGWA 5BOVA 4G1EB 4A8HA 2AMLA 5JHGB 3AB3A 4L0MA 3JAWA 1SKYB 3R5TA 3W5HA 1QIHA 1D0IA 4RZ2A 4ZVNA 3WK4A 2Y0BA 2Y1EA 3M82A 1QSGA 1J0CA 4JLPA 2HGZA 5K09A 1D5CA 4QVKA 3SBXA 3G2LA 4HQRA 3VTAA 5K3BA 5K3DA 3QMPA 4Y1GA 4YAUA 1UKYA 4HRYA 3DEFA 3ETCA 5D3KA 3FOEC 3QEBZ 4JVSB 1HG0A 2P7IA 4A0RA 5KOHA 3NHZA 1HEUA 1Z5GA 3ZI0A 1WIWA 1N33B 3ENZA 1CPYA 1TEZA 4V0RA 3B36A 1Y7IA 4U5XA 4QREA 4RBNA 2YW9A 1SU6A 2I0FA 3MLAA 2QHXA 4K9NA 5B4UA 2PQMA 2QT0A 4NABA 4PZAA 4BGUA 3CLTD 4XGQA 3QY0A 1EFLA 2NVBA 3QVVA 1ZD4A 4CLEA 2R6FA 1TMOA 4Q34A 3IVAA 1ADJA 1CDEA 2XOXA 4XWTA 1J06A 4DBLC 5KS2A 3SVLA 1XU7A 3HCDA 4XVQA 4HT3B 3OE7D 1O03A 4PC2A 3T52A 1JVBA 4JP2A 4FC6A 3ECAA 5K8TA 2JF0A 3CCFA 3BDIA 3WNDA 4QC2A 4NICA 4R5HA 1QKIA 1TNDA 5FPTA 3B7PA 1URPA 3C6YA 4FM9A 3OJFA 4R1PA 4FVTA 3SY8A 3VTKA 1V5GA 4DIBA 2JAUA 3C7TA 4GKBA 3GJ5A 3AB7A 1E1KA 3LOQA 3LY8A 4Q9DA 5EE1A 3EAQA 3VNSA 1OWMA 2AN9A 3L04A 3EXHB 1FNSA 2P8JA 1OW3B 3SJAA 2P27A 4MV6A 4H0CA 4DXAA 4JOCA 2Q1WA 5H1YA 4KXLA 4DIFA 2GN4A 3B6EA 3EIQA 5JMPA 2IK8A 3EOZA 4GNRA 5KTKA 1KJIA 5SYMA 2C4MA 3QNWA 4GH5A 3UXMA 1GPLA 4J43A 2EW2A 4YJDA 4D56A 4EKNB 3KCQA 3PD1A 1C0LA 2IEAA 3LGAA 3U1TA 4XGNA 1YS6A 2DPLA 4XUDA 4ENRA 2ES4A 3IIKA 3NV9A 4FMDF 1D1PA 2Z6VA 5FIUA 3MWGA 4ZWNA 3TKLA 2AMJA 5BN3B 3Q9SA 4NXNB 3LE8A 1D0SA 1SY7A 3HH8A 4EPWA 1AV6A 1AM4D 2OZLA 3LUGA 1I1OA 1OYWA 4M0FA 4OI2A 3OSZA 2FPUA 3QU9A 1FQJA 4RH1A 1R18A 1ZM9A 2P6NA 3GC6A 4EY4A 2AB0A 2QRZA 3ON5A 5TPZA 1U31A 1WMEA 3EVGA 1QMPA 4KWHA 5CIQA 3N2LA 3KQPA 3MTJA 3CO0S 3U3ZA 4B44A 3QYAA 4KR6A 1M2HA 1W5BA 3LF2A 1XG5A 2JGRA 4TVBA 2IHUA 3BHJA 2O54A 3ESBA 3K6SB 1RYHA 2C9ZA 1WPRA 2VUHB 4ND8B 4OX9B 4JP3A 1YIOA 2E0IA 1K9VF 2WKPA 3ENNA 4LG1A 4OAOA 4U6SA 1LPSA 2GRJA 2Y0PA 5H68A 2JA1A 1W4RA 5AKXA 2FN3A 2J3JA 3T94A 2TECE 4I2NA 2FFBA 3NYRA 1Z2CA 1N1MA 3GGCA 1Q92A 4ZPJA 4FFVA 4Y2UA 4M1WA 5DLYA 3VFDA 2WAOA 5IDQA 4JBXA 4MXDA 1YR9A 1LBEA 1RMTA 3SE7A 4LSGA 2IXGA 3WYGA 1KI8A 2RFLA 2R79A 5BQOA 5IT4A 1A69A 4NJOA 1IM5A 3V8MA 3B60A 4M1EA 2QYTA 3EVFA 2QZJA 2D1SA 2BF4A 4HDMB 1E3IA 5BSKA 2DPMA 1KF0A 3AM3A 4G86A 1UPXA 4YH1A 3SF0A 3VDQA 1T3TA 2XYRA 5BVGA 2G1JA 2NVUA 4UASA 3NH9A 4B81A 4RHYA 3TLZA 4E31A 3ADOA 2FPMA 2R68A 3QMWA 3ZH9B 5FX2A 3R9XB 3ZHXA 1P4HA 3EVDA 4Q7QA 3QRWA 2I6QA 3BDAA 1JF8A 2H00A 2Q49A 3DL7A 4MLPA 1AXRA 4GPBA 4XX0A 3DT6A 4Y6QA 3ZCQA 3GH1A 2APJA 1P91A 4RGYA 1ZHFA 2GF9A 3OJWA 2VDRB 4KLAA 5DJ5A 4KQEA 4I9FA 1A2BA 2ZJ1A 4X5OA 4E33A 2ZWAA 4BYMA 3BMQB 2COEA 3RVJA 3TLBA 5LOVB 3KB2A 3YASA 1IEQA 3HJTA 2QX4A 4YJ2F 4TS9A 4XLTA 5AW0A 5I5GA 3H3JA 5I4KA 1RZVA 1SB8A 3INNA 3ET4A 5EG5A 2C5SA 2D0IA 3DW3X 1HFKA 4HXEB 3HVRA 1SELA 2EJVA 2ZYAA 4GBJA 4FS3A 5EKDA 5TS2A 1CY1A 1GZ3A 1NY6A 2FF5A 2G5TA 3C3MA 2HSGA 4GPEA 4O2AA 4QXPA 2DX7A 3PHHA 3VH2A 2WM8A 3ZX4A 3I9FA 2NQTA 1OILA 4IRUB 4EVRA 1SFRA 1UXOA 5FI5A 1K6MA 3PPVA 4CNQA 4I5IA 1Y5IA 2DC1A 2BP7B 2XF8A 1U0TA 5IASA 1YMVA 2PA0A 2XR1A 1RC8A 1OF1A 2GK6A 4UM9D 1C50A 1W88A 2CLMB 5BSUA 4IDHA 1H22A 2OKGA 5IC5A 1X1TA 4L4XA 2LPMA 3ZDQA 3UJNA 1E7YA 1MGPA 1Q57A 3G1UA 3L0SA 4P08A 1JALA 2CMKA 1Q7CA 2H16A 1E2BA 5ALHA 2EHJA 1DO8A 1OTYA 2DWUA 5A0TA 2XUJA 1AUXA 3S2YA 5JYDA 1YUMA 1V6SA 4NOMA 5KQLA 2WMOB 4FKZA 4QTUB 5DHAA 2B25A 3A1SA 4LCEA 1F17A 4ZARA 1ZK3A 3O9VA 4NPCA 5LXTF 1AB6A 3GN1A 4BFSA 3G0GA 4D46A 1N6LA 1QU3A 1Z83A 5AIAA 4P3XA 5SZHB 2RH8A 1AS0A 3DFMA 1QLJA 2QTVB 3NHUA 3P19A 1Q1ZA 1MRSA 1VMDA 1WHSB 1XF9A 4UPVA 4EJ2A 3T9DA 1N6KA 4IFBA 1QJCA 4O4JF 4B3IA 5CJPA 4AJJA 3DBOB 4BXOA 4WOPA 1G6KA 2O06A 1E79D 1LW6E 3GQBB 4LJSA 4L0DA 2WRZA 4HJRA 1WP4A 3HCOA 1XRNA 1V26A 4PCVA 4DRXB 2REBA 3F8SA 5KX5A 5AM1A 4DSZA 4EJ6A 4L4SA 4RPGA 1RRMA 3ZH2A 4A6XA 3ZIAD 1EINA 4AYTA 5CCXA 2XW6A 5KYUA 2SKDA 1M9NA 1CZKA 1IZ7A 3ZWXA 1YZLA 5ALPA 3NTOA 2QW8A 5KPJA 2B4YA 4D4LA 1SKUA 3RAEC 2HTFA 1SWWA 2IF2A 4M1SA 3A1FA 5E7JA 2QB5A 3W5UA 3Q12A 4HZUA 3QWBA 4UFNA 3DXYA 1HV8A 4RD0A 4UBKA 1U3UA 3PIRA 2X7XA 4U7JA 2W6JD 3DZBA 1GTVA 4ZCTA 3E1KA 4QGSA 4IIVA 1JDZA 3T4PA 1H23A 4NBSA 3V55A 3S70A 1XUOA 4A9AA 1U1GA 1A1VA 3BDVA 2O5EA 5FRDA 3VR0A 1X2BA 1CUHA 1U04A 2Z4TA 1G2PA 3KG2A 3NTLA 3OFND 4P93A 2D8MA 2P79A 1PT8A 3QWFA 1JSXA 1RQGA 1T3HA 2IHZA 3F7MA 2QX9A 2GEFA 1UAYA 3ONFA 4GSKA 1HT0A 3NOQA 4V38A 5G1OA 2ZIGA 1E0KA 1IHDA 3SQOA 2X9LA 1IC6A 4B8ZA 2DR0A 1AN9A 3I4CA 2WWTA 4PZZA 4OYLA 3TMYA 2D1TA 5CLHA 3N7UA 3QU4A 3SD7A 3OT5A 4FXPA 4U3JA 2ENUA 2JFYA 2IHVA 1TOAA 3ILYA 3A25A 4Q3DA 1P9NA 3DD1A 2ZBGA 1B16A 1SCDA 2AEJA 3LO5A 1JTEA 4M38A 4IS3A 4RORA 3R3XA 3VR6H 3OPYB 2ZE6A 5BURA 3P20A 3PPWA 4X94A 3K9CA 4PZ0A 1NM5C 2CLFB 5K3FB 4DPLA 4RX1A 1ODTC 1CS0B 3CZAA 1YZQA 3FAKA 4B09A 1HYBA 2H0RA 4BCCA 4V3BA 3VI3B 1PFKA 1G21B 3HKBA 1VBFA 3BGVA 4BTVA 2QENA 1FTYA 3TSOA 4C3ZA 1VGVA 2DFTA 2FQYA 3I5AA 3NOXA 1XBTA 3GJ6A 4INPA 1N57A 4NBRA 4OI0A 4WK2B 1P39A 2QPAA 5JXHA 5T4EA 4EHKA 1I24A 2AI1A 4QSMA 1U0OC 4US2R 5JXGA 1DU4A 3FGOA 3P45A 5ARBA 1QUFA 1UKZA 1Z0DA 2AOUB 3LC1O 5IFLA 3W2EA 4OSPA 4L76A 3WIUA 4CR6A 3O1HB 5HFNA 1SG6A 4BNVA 1R0CA 4QOSA 5IF9A 1KKLA 2WWHA 4EFKA 3D3EA 2KI5A 1IOLA 2RK4A 3TLYA 1IK6A 2VUSA 3D8BA 1FYVA 3R3ZA 4X3CA 3AFHA 4I1PA 4REQA 2BT4A 5EHXA 4P2GA 1XQ6A 2VRCA 2Q3JA 3NGXA 4BVJA 821PA 3EEQA 3PXXA 3NWPA 5HIIA 1JW9B 1Y81A 1Z5OA 1TCVA 2AEEA 2VI5A 4F06A 1QFXA 1YBFA 4KFRA 4N6NA 1OVGA 4NV0A 4TKLA 3ZE1B 4MQFB 4DLTA 2ZPAA 4TWAA 5KMGA 3CLTC 5TF4A 1G5TA 2JFUA 2IZ6A 3MUFA 4RV5A 5KZMB 1MOPA 3ZS9A 3BS4A 2OCIA 2QE7A 1MC5A 1RI5A 4WD3A 3ZV4A 3VPDA 4NYIR 4BQOA 1P62B 4FLMA 4ERXA 4LSMA 4D9CA 3GUHA 3OTIA 4EFMA 3IVXA 1EFRA 1PS8A 1BN7A 4KRFA 3TTTA 1SQ6A 1CRPA 1F2TA 4R0MA 2QLJA 2AN3A 2IEBA 2GZHA 3P2YA 2XECA 2NG1A 3LK6A 3WWCA 1QOQB 3GVXA 2G6TA 3GXBA 1DQPA 1VJRA 1UQUA 2EBFX 4JNKA 2Y76A 2ZW9A 1HEIA 1OLUA 5ELXA 5AW6A 1G7RA 2ZJ2A 4GZMA 2CVFA 2ACKA 4BN5A 2DBZA 1E6CA 3FMOB 1TZMA 4NCAA 4DNXA 3ZKWA 2IS6A 3OQ1A 1YMQA 1E2MA 1ZU4A 1L5SA 2D00A 1ZKDA 2G70A 1A9PA 2NV2B 3D2CA 2PRYA 4UCXA 5THXA 4AN1A 4BFTA 4KFCA 3UGJA 2ISCA 5FUMA 4J91A 1TA0A 3UMJA 1PJTA 3RU7A 2E5LB 2ZJOA 2ID4A 2GBPA 1HKUA 2GKGA 1XMIA 4UPDA 1JTVA 3UEOA 2WSLA 5IYZB 2P65A 2XBMA 2B2NA 3DVLA 4YUAA 1BRMA 1GGEA 2OGWA 2X9GA 3Q2OA 3QU7A 4U2KA 3SI7A 3TRHA 3SZUA 2C7PA 4JA2A 3HU5A 2P6RA 3DUWA 2VKQA 3O31A 3VYRB 4KAAA 3TCXB 1N0HA 1FTQA 1KC3A 2DY1A 2ZS7A 1YBVA 3MRSA 1RXYA 2PQ0A 3BD9A 2XIQA 1E77A 4RY8A 4Y0AA 4Z9YA 3TCKA 1NVGA 1B6TA 4J0DA 4JX9A 1SVSA 4U9IS 3RS3A 5CLJA 3D7SA 1ONSA 3EB9A 3JQ6A 3U7FB 1QAQA 4CMCA 5I7SA 3B6IA 1WXXA 4S2UA 4FYIA 2IGBA 1N2EA 1CT9A 2O7QA 4ARZB 3BK1A 2FUNB 2ZS8A 2X5KO 2B1JA 5AUQA 3QEAZ 2F3QA 2PLFA 4MA4A 4IHJB 3C39A 3T5AA 2FX3A 2RAPA 2AOTB 1FU7A 4HNVA 1ZOSA 3GLSA 3KJZA 1TVKA 4OUDB 1U7PA 1ULTA 1MJNA 3IAFA 3AL3A 2GCOB 5TMBA 1SVMA 3R9KA 3BA6A 3C41J 4BLRA 3TTSA 3W8EA 1LS1A 2YS6A 2QLMA 1CNMA 4NYJQ 2O8CA 5ILOA 3VR4D 1TKBA 1XRQA 1SJ9A 1WSDA 3DTVD 5EIOA 4KXQA 1M2WA 4J4HA 4KAXA 4GYYA 1QQ6A 4I3GA 5FOWA 2C99A 3UW3A 5FORA 4LJLA 2K2QB 3ZWBA 4RDHA 2CHQA 1QP4A 1F2DA 3FNEA 5HX7A 2O50A 1YRAA 3AKEA 4L8FA 4O2BB 3A6JA 4KC0A 3VR3D 3F47A 5AD1A 2BSXA 1JHRA 2NZYA 1OAOC 4URHA 2V3CC 1UDRA 3VDXA 3W3AD 3WGKA 3RT9A 4CMGA 3VAYA 2YNMA 3AF3A 6AT1A 4F91B 5BP7A 4ZYLA 3MCVA 2YWFA 4A73A 1D04A 3ZQ6A 3U48A 1GPAA 4TLMB 2HIHA 4LDQA 4ZMRA 4CXMA 1A8UA 3IQGX 1DIGA 3TUZC 4YV0A 1C41A 2ZSIA 1UJNA 4DXDA 3WLIA 1Z4QA 1W4BA 1HSOA 1J8MF 1RACA 3E6AA 4JP5A 3C6KA 4BUCA 5L4NA 4BNDA 3T7KA 3N5CA 2GN2A 1WXHA 3COPA 4TXJA 1U2SA 4F5ZA 1PTKA 2FHPA 4RO0A 3A7DA 1EI9A 3NU1A 2Z6AA 2B7CA 5HQTA 4EFLA 1P44A 3O0TA 4OHXA 5DFAA 2O59A 1QRSA 4PC7A 2WWFA 4AN4A 5A5DA 1H5QA 4DM7A 4E94A 4EG6A 3TG8A 1E2NA 3K92A 3OAAA 2AZDA 2Z5LA 1DXYA 3G0CA 2QD2A 4P5EA 2VT2A 3I58A 4GP9A 1O5TA 1SIUA 1BVYF 1M0SA 3T4XA 3KWMA 1O77A 3VPFA 5I7WA 4GOKA 1V8ZA 1VPDA 3NIFB 2BD0A 1QR6A 2FLVA 3KQMA 5HIKA 4AXBA 4ZT4A 1Q91A 2YWDA 1N5OX 3I92A 4UCFA 1E2IA 1FX0A 3I2KA 2QRUA 1UADA 3G9QA 4PSDA 1JBKA 1Z6YA 3A3YA 3FWPA 1DJQA 3HFGA 3QVGA 4ZZ2A 3LX8A 4CL2A 5HOQA 1C1XB 4ARIA 1U90A 1VG9B 3EPPA 4C6TA 2QR2A 3HJBA 4MWTA 4QYSA 1QCZA 2QP3A 2DECA 5KKCA 2AG5A 2D5AA 2X23A 1F4VA 3D5QA 1A5AB 3FBWA 3JQAD 3UHAA 3EF1A 1NC1A 5BUQA 5IDYA 4F93B 1ZINA 2D3TA 3NC0C 5JSZA 1VL8A 4Y6GB 4PO1A 2I8CA 4RL6A 4W5HA 1RT9A 3OOSA 5B4VA 2EX1A 2W6CX 2HUNA 5BV1A 2CFRA 2JCGA 3WBFA 4CKBA 3F73A 2CEKA 2F8LA 2V6JA 5BWNA 2OHJA 3R3WA 1PEYA 1D9XA 4Q05A 1L7MA 1PI3A 3UWDA 4A03A 4KQWA 1CRWG 1OTHA 1QFMA 4J0KA 1T10A 5GJWC 1RHUA 2HJGA 2X5OA 5ESXA 1QHFA 4Y2PA 3T8YA 2R7LA 3KB6A 3O26A 3MCTA 3NETA 3BFJA 3TLEA 1W8DA 1TO2E 2HLDA 4L5YA 5DM4A 3C6XA 4KWIA 3JARB 1C1DB 3RHFA 2CMGA 4KXMA 3GMTA 3A6KA 3G2HA 4RIHA 1CKEA 2GYVA 3THYB