4DQXA

Crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
255
structure length
255
Chain Sequence
SMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEIGSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNGGGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFAEAKDPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSIGNHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a short chain dehydrogenase from Rhizobium etli CFN 42
rcsb
source organism Rhizobium etli
molecule tags Oxidoreductase
molecule keywords Probable oxidoreductase protein
total genus 85
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dqxA00
3WNQA 4MVJG 1RYDA 3BA1A 4LGVA 3DR3A 2WYVA 1X0XA 4YRAA 4FB5A 3I6IA 3I83A 5ENDA 4NU5A 4U6SA 4RPHA 1BW9A 2DBVO 4O1MA 1SO8A 2OFPA 1B26A 1CERA 3GT0A 4NFSA 1WWKA 4GWGA 4GSLA 4EJMA 1R0SA 4FQ8A 5DCUA 4XQ9A 3IL2A 4BKUA 5ICSA 4IS3A 3FSRA 3PHHA 3ZWWA 1MUUA 3QRWA 1ZXBA 3DBLB 1HE4A 1ISFA 2EP5A 1ZVMA 3SC4A 2JFGA 4DBZA 2OP1A 3GDFA 1PGPA 4XJTA 3LQFA 3BMQA 1ADFA 4CM9D 4D3SA 1MXHA 3ZH2A 3I9MA 4WOKA 2Y68A 3TFQA 3KXDA 1RWBA 3PWSA 3L07A 4NJMB 4UULA 1ZEMA 2AQ8A 3JQ9C 2B5VA 4FCCA 3VTZA 1CF2O 5JY6A 3W4KA 1YJ8A 1QV6A 1U9JA 3I1JA 1Q1NA 2QIOA 4JQCA 1PZFA 4BO9A 4E2YA 4QT0A 4FOOA 2GSDA 3MEQA 2XOXA 2HCTA 1SCUA 1O8CA 5L95A 4PG8A 4ALNA 5TLSA 3STHA 1QG6A 5BSHA 5G0VA 4DIOA 2XXJA 3MWDB 4P4LA 4YB8A 4BNNA 3WGGA 1YRLA 2B4RO 2C0CA 2X9NA 4KTTE 4WKGA 3WG9A 4H3VA 2ILTA 1MFPA 4Z3KA 3ZU4A 2NV6A 4MP6A 3RQSA 4R01A 3AUTA 3UCXA 1M6WA 1BSVA 5IDXA 4OQYA 1WVGA 3IOYA 3KBOA 2GUGA 2YZ7A 3S2IA 2IZ0A 1EZ4A 3COSA 3BXXA 3VZRA 4E12A 2Q4BA 4LRTB 1R12A 2B4QA 2CSUA 4N7RA 4AL4A 3E1KA 3ZWCA 1ONOA 4DVJA 1LI4A 2AG8A 3WB9A 3RUDA 4OXKA 4BGVA 3VPXA 1FMCA 1V35A 2WWRA 3D64A 3BTUA 1YJQA 2IEBA 4R68A 3GQVA 3WOHA 5IDYA 3SLKA 3ZNNA 2PH5A 1Y9AA 1YBVA 5BR7A 1CQJA 4DREA 1T1RA 3PJDA 5JCJD 1DSSG 4TROA 4LCJA 5COQA 4NG5A 1U8XX 4ND3A 3V5NA 3TZQA 4E6PA 4CQLA 2J5QA 3HWRA 1WPQA 1MV8A 2Q46A 5TJHA 5I7VA 4LSMA 1F06A 5HBRA 2QRKA 4IDFA 2VT3A 2NU7A 5I9NA 4IM7A 1NBOA 2ZYGA 4HFMA 4OHUA 2CDAA 2VHZA 3M1AA 1I3KA 3ZHBA 1BDMA 5IZCC 3H9GA 5BNIA 4HNGA 5ADHA 4EBFA 3A28A 2OOSA 2GYYA 1DC6A 1P44A 4YWJA 1R16A 2BFOA 3DMYA 4RGBA 4GH5A 4YAJA 2UV8A 1NAHA 1OI7A 1GZ3A 4H15A 2E49A 5KOIA 1AXEA 3GN1A 5BSFA 2F1KA 1R4NA 2GN6A 2X23A 3WGQA 4MIOA 5FI5A 3ONEA 1DFHA 1Y5MA 4N5MA 3CMMA 4NMHA 1FDWA 3H4VA 3C24A 4HWKA 1PGJA 2YV3A 5HA5A 4MO2A 1O0SA 1IY8A 3DBHB 4IDDA 2C5AA 1X13A 4R5MA 4BO1A 1UXIA 4UVEA 2VYND 3GN2A 2YV2A 2GF2A 3BTOA 4TWRA 1IULA 3C7DB 1NR7A 2BD0A 4PIVA 3JQAD 4FS3A 2HRBA 3BMOA 4CMHA 5TT0A 3W8DA 4Y98A 4UAGA 4IIVA 1YDEA 2CFCA 2VYVD 1HEUA 3LT1A 1GAEO 4WGGA 4UUNA 5KIAA 1XA0A 2ZTLA 4ZN6A 3CPSA 2C2YA 4CM8A 4PLGA 1DFIA 2IRWA 3QWIA 4IZIA 3CE6A 1E5LA 2NQ8A 3AUAA 3D3WB 3U4HA 1EUCA 1R15A 4FW8A 2NUAA 2H9IA 5AYVA 1GUFA 4P4NA 4CQLB 2VZ9A 5A9SA 4BO8A 1R66A 2XXBA 1K6IA 1OFGA 2SCUA 3B1JA 3WLFA 4YAIA 3ITKA 4J1TA 3IS3A 4FJ2A 3PQFA 4O0LA 3DHEA 3KUXA 3QJ5A 3ROPA 3G3EA 2ZCVA 1LSSA 3ZHZA 4AVYA 4CLEA 4GL4A 4ZVVA 2NU6A 4CUJA 4DMLA 4B7XA 4ZICA 3C85A 2VTDA 3JD0A 3ASVA 3TRIA 3IDSA 4WPGA 5AXAA 2IEDA 1KBZA 2VYNA 3OIDA 3RVDA 2D1YA 3L6DA 3SJ7A 2P4HX 4EUEA 1JDJA 2EV9A 7MDHA 3P2YA 1NP3A 1U7HA 2Q50A 3K9QO 4C4OA 4PG7A 3WWZA 4TRNA 5TGDA 3FBTA 3GEGA 1DIRA 4MDHA 1K5HA 4WCFA 3PTZA 4LRSB 3Q0EA 4GGPA 1LU9A 4KUHA 1P1RA 4L75A 1H6BA 1NPTO 2X9VA 3F47A 2IZ1A 5GZ3A 1C1DB 3G0OA 1BDBA 2P9EA 2Y67A 3H7AA 2Y0DA 4PLCA 1D4FA 1BXGB 1VPDA 1O95A 3Q2IA 2HMSA 3HHPA 3K30A 4EEZA 5JAMA 4JIGA 4DLAA 1X7DA 3Q9UA 2QZZA 2B83A 1NTOA 1O5IA 1X1EA 1XQ1A 1YQXA 2Y1FA 4KTVE 3BMNB 1NR1A 2DPHA 1H2HA 1WLYA 5A9RA 1EUDA 4R9RA 1LDEA 2YJZA 2I99A 2O48X 1EUZA 4ND4A 1GTMA 4QO8A 4E33A 3JSAA 2CDCA 1EK5A 2YUTA 3OFSA 4Q3EA 1H9BA 4IBOA 1M66A 1QLHA 1VM6A 3IP3A 3QWBA 3ZWYA 2PY6A 4CM4B 2B35A 2NM0A 3JQAB 4NNJA 2D8AA 5JNLA 2C07A 1E7RA 2R00C 3CUKA 5H81A 4J9UE 4K9DA 3GEMA 1P1KA 3FPCA 2CZCA 2VHVA 3NT2A 5K6AC 2IXAA 1HETA 4IJKA 3WGTA 3L6OO 3KTDA 1E7SA 2VHYA 3L9WA 4J91A 1C3VA 3HSKA 3W8EA 4A73A 1H6CA 2FMUA 3VPFA 4GX1A 1TA4A 1I2BA 1KC3A 1NFFA 1QR6A 5JPIA 1HTBA 5KCZA 3PJEA 1UH5A 2RH8A 1A72A 3L9XA 1U2GA 1A7KA 4DIBA 4JN6B 2AEFA 2G17A 2ZCUA 4PRKA 4WNIA 4RQTA 4Z0TA 3BTSA 3GGPA 4CV1A 4KWHA 2EEZA 5CP8A 4CM8B 1E3EA 1DC3A 4QSMA 5KJ6A 2WYUA 4CLRB 4JBHA 4ALJA 2FZEA 4WEOA 5JAIA 5IXYA 3WGIA 1H2BA 3H3FA 1Z73A 3H5AA 3U4IA 3VTFA 2G82A 2IYOA 3F1LA 1ENZA 3DTTA 3BZUA 5CEFA 3GVPA 3N74A 1U3VA 3D4OA 3V1TC 5L7TA 1DRVA 3D5QA 3HADA 3WICA 3E82A 3HN7A 5L51A 4CMIA 1F12A 5B4TA 4MJLA 4CODB 3QWAA 2PV7A 1E1MA 3HZZA 4KZPA 4PLZA 4PVDA 1BHSA 1BXZA 3DEYX 3VVBA 1I01A 1YO6A 1Z74A 2BGKA 2D4AA 2PLAA 1T2CA 4XQEA 1IYZA 1R0KA 1O6ZA 3L4SO 4JJFA 5ITWA 4WCFB 4XIJA 4NBWA 3A4VA 1YOVA 2PZJA 1P0FA 2BI7A 2RBEA 2I3AA 2HU2A 3JQBC 1GUYA 3AY7A 4E2WA 3E5RA 1BXGA 3INGA 1PJBA 5A4DA 4R69A 2FOIA 3DZJA 3KB6A 1GPJA 3M6IA 5ES3A 4TKMA 5FFFA 3D4NA 1B15A 2Y99A 3FRJA 1LC3A 2VTEA 2YQ5A 3JQ6A 4XDZA 4CR8A 4EITA 5HM8A 5JO0A 1DIGA 3JD2A 1LSJA 3JD4A 2PD3A 3C1TA 4PLYA 1RM5A 5L7YA 1ULSA 1QYDA 1UXKA 1DIAA 2AG5A 3NJ4A 4HNHA 5C3MA 4MINA 3ICCA 4O6VA 4ALLA 2Y0EA 4LVCA 2HMUA 4RL6A 1E3WA 3UUWA 3IMFA 1FDUA 3F4BA 1ISJA 1I0ZA 4U5QA 9LDBA 3B20A 4E2ZA 2VHWA 5JMPA 3AK4A 2BF7A 5A04A 3PDUA 2QZ9A 2CD9A 4BB6A 4BKOA 2JJYA 5JC8A 2Z5LA 4YQZA 5HRUA 1C0PA 4TVOA 5A3JA 5BNTA 2X86A 2V7PA 3WFJA 1JKFA 1ENPA 3HG7A 4IDBA 3GMSA 2AW5A 2P2SA 3LT4A 2A35A 2GASA 3BHIA 4QFCA 5L53A 2JD2A 1KVRA 1PL7A 4ESOA 4NBUA 3WWYA 1DOHA 1QYVA 1HDCA 4WECA 3RWBA 4YDRA 5EMHA 4PVCA 4KQWA 1XEAA 1ZBQA 3T4EA 4C7JA 4AICA 2W2KA 1R4NB 2HMVA 4ONEA 3O9ZA 1VLLA 4Y9DA 1ZK0A 3OH8A 4O5OA 1Q7BA 2JHFA 2EXXA 1B3RA 4NH4A 2QHXA 3OIGA 1KERA 5TRTA 4ZQEA 1RKXA 5KWEA 1LDBA 1JA9A 2ZB8A 3MCVA 4RF4A 3L6EA 4LSWA 1Y7TA 4FJ0A 4WLFA 4BMVA 4PN3A 1VSUA 1KEWA 1EBFA 1N7GA 4H16A 2V6GA 2Y1DA 4WLVA 3V2UA 5A02A 3DFUA 3BHMA 1GPDG 1LDGA 1HZZA 1NNUA 3JD3A 2A92A 4R3NA 1JAXA 3EVNA 3LK7A 1PJ2A 2HMTA 4CLOA 2VUTA 5C7LO 1O9BA 2A94A 3CTMA 4RPLA 2X0IA 4F46A 3BAZA 3LF1A 5CDYA 2Q1SA 3EAGA 3WNVA 4D3DA 2HO5A 3T4XA 5BNFA 4YR9A 2JD1A 1LA2A 3JCZA 3V2HA 3EZYA 5F5NA 4QECA 3OJ0A 4RF2A 3PI7A 3RC7A 4AJPA 3QLJA 2FP4A 5T6BA 2AE1A 1EK6A 2CNBA 5BQFA 5I8ZA 2WYWA 5T8KA 3VH1A 2DUWA 3ENNA 1V8BA 3GRKA 1ADCA 1PZHA 4RLSA 3E6AA 1G0OA 1HYHA 3PYXA 1E1KA 4K28A 3ULKA 1UUFA 1LEHA 2VWGA 4GKBA 2I65A 3DZFA 3JQ9A 3GHHA 4RDIA 4CV0A 2OP0A 4L9RA 4NR0A 1G0NA 3LSYA 2VUSA 3Q2KA 5I8WA 5EL0A 3INRA 2GN9A 4JBIA 3GUCA 4HBGA 4IDEA 4K6FA 3HQ4O 1ULUA 3KYDB 3LU1A 2X1HA 1E7QA 4MVJE 1T2AA 3DXFA 1XG5A 4BB5A 1C1XB 4AJOA 5C7IO 2BRUA 2Z95A 4UREA 3K5PA 1ONPA 4ZRNA 3SVTA 1PJQA 1TT5B 4DC0A 2ET6A 2ZKLA 1P1JA 1E92A 4NDNE 4D45A 2XPCA 1QYCA 3NT5A 4K26A 1F0YA 1IUKA 4UEJA 4XX0A 4M1QA 3W1VA 2V6FA 1V3TA 4MIEA 4MVJM 2UUOA 3L77A 4AG3A 2AA3A 4W99A 3H3JA 3O38A 4FOSA 1PGNA 3GVCA 1RM4A 3OP4A 3PP8A 3H2ZA 2O3RA 2AQIA 2YY7A 3BTVA 2WE7A 1U3UA 4TKLA 3KLMX 4U0JA 2ZIZA 2B36A 4BQRA 1IPEA 1BG6A 1OOEA 1U5AA 4XDYA 4XYBA 1A71A 4XKJA 3UF0A 3RROA 3HDHA 4IQGA 3UH1A 4EZBA 4ZQFA 3IAHA 4FC7A 2HJSA 3DBLA 4E13A 4R41A 3E8XA 2P4QA 3VDQA 1EVYA 4WLNA 1DRUA 4AJLA 3UN1A 2R2GA 2HK7A 3TZCA 1TXGA 3OIFA 1MXFA 2ZTUA 3R0IA 3DBRB 5IG2A 1QMGA 4II3A 2BFPA 1I33A 4GVXA 1J49A 3BIOA 1KYQA 1QP8A 4JX8A 5TC4A 4R9SA 3UAGA 4FSHA 1Y8RA 5T57A 1DIBA 2UVDA 3F6YA 1I3MA 3RUEA 5DN9A 1DAOA 1U8FO 1YOVB 2PFGA 3PWZA 3QHAA 3UCEA 4IJWA 3KETA 5I9MA 4YT5A 3TZ6A 1KY4A 3S1LA 2DBRA 2AQHA 3UKOA 1JVBA 1CEQA 2NADA 4QO7A 3H8VA 4J4TA 1GQYA 3FNEA 3O4RA 1JWBB 3HNPA 1SB9A 3D4PA 4NJOA 4HX5A 3GVXA 1LXCA 3QVSA 4BNIA 4J1QA 1GYRA 4J4HA 4FPXA 4L8VA 5GMOA 4UEKA 2TMDA 1PS0A 1XGKA 1F8FA 4A2CA 1DO8A 4GX2A 3U5TA 4MVJA 4D41A 4CMCA 1I5RA 3ADPA 3QVWA 4NBVA 4Q3CA 3V8BA 1I36A 4BNKA 1GEGA 2F00A 5DZSA 4PRLA 1N8KA 3EY4A 3H2SA 1K6XA 5FF9A 4XCVA 2HQ1A 3TZKA 3VPSA 4E31A 4YT8A 4XEHA 4QQRA 1AHIA 4J2OA 4FFLA 3QW2A 2X8LA 2AE2A 4RVGA 4JP2A 5GY7A 2A4KA 3OA2A 2W4QA 1VKOA 2O3UA 5BSGA 2Y1CA 5B1YA 2ZK7A 2QRLA 4JXKA 8LDHA 3NDIA 4BMSA 4PLFA 1ZSVA 1XSEA 1YB4A 4UUPA 1KVUA 3GK3A 1PJTA 3DONA 3ZWPA 2O3TA 4ITUA 4ZU3A 3AY6A 1JAYA 3WFIA 5I7EA 4HKTA 1BXKA 2X4GA 5T5QA 1Y1PA 2I6TA 4J0FA 3HDQA 2GR9A 4HFRA 4UVGA 1VE9A 4FFOA 1WMBA 2YHIB 4RF3A 3ZV5A 1HYGA 3N7UA 2PK3A 5G4LA 5G4KA 2BFAA 3VZQA 4E32A 3HUDA 1LLUA 4NIMA 3H5RA 3RFVA 1VSVA 2VCYA 5THKA 3LVFO 4XA8A 2ZYAA 4MKXA 1MG5A 1SBYA 2D5CA 3C7CB 5CHEA 1ZK4A 3LC2O 5EQDA 1IHXA 5IAAA 1YL7A 5JXWA 4BL5A 1LBEA 1K6JA 1XHLA 3EVTA 4R3WA 5F5LA 5G0SA 2Y93A 4AJHA 4BKRA 2Q2QA 3PQDA 3ZU5A 1DIHA 4WLOA 3K2EA 4IY1A 4ZJUA 1WMAA 1V9LA 3LYLA 3NAQA 3ZW8A 1ISHA 3PRJA 2G0TA 1VJ1A 5CDUA 3R6DA 1UAYA 1V3UA 3AM3A 4I08A 1FDSA 4G81A 4OXNA 1W0CA 2C7GA 4BGIA 1K3TA 1GDHA 1XIVA 1D3AA 2FHSA 3CH6A 4EGFA 3D1LA 2PKRA 4IQ8A 4FFPA 4NPCA 3GAFA 2NACA 2GERA 2HDHA 3PVZA 4AJ4A 1ZJZA 3IQDB 1P33A 2HJRA 4BGEA 4M87A 1LSOA 2J3HA 4TZKA 4F6LA 1C14A 1W4ZA 1B3BA 1IZ9A 3KZVA 1UDBA 3SXPA 5CAEA 1YVEI 1EEHA 1WDMA 2D0IA 2EJVA 3WYBA 3PHJA 3PHIA 5A5FA 2WM3A 2JFHA 4BNLA 3QY9A 1NWHA 2I66A 1GZ4A 3MJ4A 1HF3A 4KDEA 5JE8A 5I9LA 3AOEA 5MGBA 4MVJF 5G2OA 5U1PA 3UXYA 1HDRA 4IIUA 3ZWMA 2DTEA 5TQVA 4WNCA 1Z45A 4UUMA 1N1EA 1T2DA 2JHGA 2H63A 3DWFA 3PLRA 3EW7A 1B8UA 3DZBA 3WJAA 1P31A 3GG9A 3NGXA 4CMGA 1VJTA 4F45A 2JCVA 5TS3A 4MP8A 3PYLA 3QE3A 5ILGA 5L4LA 4CMKA 3SBOA 2Z1NA 3SLGA 1YB5A 2VZ0A 3F4LA 1T26A 2NVUB 1IB6A 3Q1LA 3U3XA 4RLHA 4HV4A 3RC2A 2OGUA 1WDLA 3WS7A 3VC7A 5MDHA 4DMMA 2VNAA 2X5JO 3QVXA 1GCOA 4BO7A 1T4DA 4XR9A 5JDIC 3HB4X 3O26A 5KVVA 3GHYA 4ZA2A 3WSWA 4BVAA 1ML3A 1P74A 4E5YA 1ADBA 4FC6A 2W98A 1ZO8A 4HFNA 4JP3A 3U0BA 4BOYA 3WIDA 2WDZA 4MP3A 1EFKA 3F9IA 2BGMA 3DFZA 3KEQA 1T24A 4AFNA 3E9MA 4KOAA 1FXSA 2O2SA 1O89A 1E6WA 1A7AA 3WJ7A 5ER9A 3JYNA 4DA9A 3I5MA 4XGKA 4B4VA 5JDCA 1PTJA 3PIDA 5JAZA 5IF3A 5TJ9A 3LF2A 1N2SA 2VT2A 2ZB7A 2Q4EA 1TB4A 2GGSA 2YYYA 4KDFA 3ZWVA 1KOLA 2E4AA 4FDAA 4CLXA 1PL8A 1N1GA 1ZSNA 2E82A 3OECA 3MJVA 4WE3A 4ALMA 4OOFA 4FN4A 1U4SA 3GMDA 5I7FA 3AI1A 3PEFA 4WOJA 4GLLA 3I9JA 3GR6A 2PGDA 5TT1A 3M2TA 5EIOA 5B12A 2HAEA 3GY0A 1XCBA 2G5CA 3ZGYA 2CVQA 3OQBA 4ID9A 3FD8A 3PWKA 5KNLA 2YHUA 4OO3A 1PQWA 1JTVA 1E3SA 2PA3A 4YPOA 5KJ1A 3TWOA 4JROA 3HFSA 1PQUA 2WE8A 3D3EA 3RU9A 1JKIA 1XQ6A 1XKQA 4BO0A 5CDSA 2CUKA 1GYQA 4W7HA 4O59O 4A26A 3LC1O 3VAZA 4L73A 2NTJA 1CIVA 4IJUA 1OC4A 3H65A 1YS4A 2GZ1A 2QG4A 2ZQZA 3B70A 2DKNA 4YT4A 1IZ0A 1U28A 3KVOA 3VH4A 2DC1A 1BWSA 3NKLA 3QA9A 5G0UA 3S55A 4OKIA 1HL3A 1PJLA 3WDSA 3WMXA 1QRRA 1JU9A 5CDTA 1YB1A 2EW8A 2EW2A 3GVIA 3MOGA 2YQ4A 5IZCA 2PZLA 2YDYA 5KKAA 3RIHA 5A9SB 2JCYA 2QYTA 4MVJP 2WD7A 3AFMA 4YRDA 3SX2A 4J2HA 4E4YA 1VC2A 1PJSA 4I9UA 3O8QB 1ZJYA 3GGGA 4I5EA 4CQMB 4RVDA 4S3MA 1J6UA 2NLOA 2GN4A 2GDZA 4W9NC 1CETA 1HE2A 1N5DA 1KEUA 4YRBA 3NX4A 4W82A 3B1FA 2BMAA 4MIYA 4CPDA 3H9JA 3TSCA 2HMWA 2DFDA 3KSZO 4YTEA 5CDGA 4INAA 3OJEA 3WGZA 4ILKA 2Q99A 1G6KA 3V2GA 1EQUA 5IZ4A 2B37A 3SEFA 2HUNA 4UVHA 5BT9A 5JYDA 2I5PO 2X7HA 4IUYA 4MVJD 2CF5A 2W2LD 4ZHSA 3ZW9A 1UP7A 1GEEA 1NM5A 1CYDA 1BW9B 4CMAA 4Q3BA 4RDHA 2NU8A 3U09A 1V6AA 4BHTA 3U62A 4YCAA 5JY1A 3MTJA 4H7PA 2FWMX 4GX5A 4J9VA 1OAAA 3TQHA 4OQZA 4NK4A 1BVUA 5B4VA 2B5WA 3NEPX 4CMIB 1LRJA 3BMCB 3Q11A 4FIZA 5JMWA 4IGEA 3R3SA 4YAGA 5JFOA 3TFOA 4R4JA 4PG4A 1D1SA 4BNVA 4DL9A 2PZMA 1NAIA 2CMDA 2P91A 2PWZA 1E7MA 5ICMA 3Q3CA 2OL4A 2ZQYA 3RUCA 5F3RA 3DZIA 5J23A 4XR4A 1LLCA 4K6CA 4EUHA 3PXXA 4JGBA 2Z1MA 3RC9A 4J43A 4L0QA 2RIRA 4BO2A 2WTBA 3OEWA 3BMCA 3IP1A 5G4KB 3FCOA 3ZWOA 5JC1A 2GZ3A 4YXFA 2P5UA 3ZU2A 4OGWA 3GLQA 1E1LA 2BFMA 1VL0A 3ETGA 2C2XA 3R1IA 3ABIA 2WSBA 4P8RA 3RFTA 3OF2A 4B3JA 2B0JA 4LMPA 1DFGA 2ZB4A 4EJ0A 1BTOA 2UYYA 2JL1A 4Z6KA 4OYRA 4JJIA 2PD4A 1YGYA 3WQSB 2BGLA 2DUUA 1DAPA 3ENKA 1GU7A 1LLDA 2Y1GA 4BIIA 4L4SA 2FPIA 1A4UA 3PK0A 4PLHA 5TNXA 4KMSA 3BMQB 3GNTA 1FDVA 5EESA 1SPXA 4YJDA 3TL2A 4NBRA 3U9LA 1Y81A 2DTXA 5TSDA 2AEJA 3GNQA 3S2GA 4A7PA 5CPBA 3WXBA 3FPLA 2W2KB 4CUKA 4F6CA 1YBMA 1PR9A 1LQUA 1E6EA 2DVMA 3JQ8A 1H94A 3VKUA 1PWZA 3GH3A 3RI3A 4LVUA 4MKRA 3AW9A 2VHXA 2EWMA 3QV1A 3EHEA 4DGSA 3E48A 3H9QA 5EERA 2NNLD 1NQOA 1ZIDA 2VZ8A 4D7AA 3PYMA 4PLPA 4PGFA 2XF8A 4DWVA 3L4BC 2WD7B 3HN2A 3QVTA 4FFRA 5DOVA 1CJCA 2I76A 1IPFA 2Y0CA 5IDWA 2CVZA 1E7WA 4A10A 1SAYA 4FFMA 4P4GA 2CY0A 4N18A 2IYPA 2G76A 4PZCA 2DPGA 2D59A 3GDOA 3FF4A 3DZGA 3DO5A 3GC6A 2YFHA 1M76A 4OSPA 4BO5A 4GQAA 3ST7A 1CQIA 4ND5A 2J5RA 5A03A 4PZDA 1ID1A 5F1KA 2P9CA 4AJJA 1LX6A 2Q1WA 1ZNQO 1BRMA 3KSDO 2X5OA 2OBYA 1D8AA 4I9HA 5JSFA 3IKTA 1I2CA 3UW3A 4NBTA 4B8WA 3FR8A 3OICA 4I8XA 3ZCXA 4XRGA 3MTGA 2V6MA 3CXRA 3E9QA 1PGQA 3RUIA 3UVEA 2JCXA 2OMEA 1MC5A 4I1IA 1WDKA 1X14A 4ND1A 1H9AA 1P45A 1Q2XA 2EF1A 4WUVA 3ADOA 5AXCA 1F17A 2D3TA 3JQFA 1WP4A 4RF5A 2DQ4A 3ONDA 3VZSA 3ZI0A 3RBVA 4NK5A 2NQTA 3RUFA 1ZK3A 1MLDA 1Y5RA 3ON5A 4MVJI 3GRPA 3NTRA 4N5LA 4WLUA 5K6AA 2E48A 4IS2A 3TPCA 4IMRA 4YJGA 5IXSA 3K6JA 4KUEA 1SNYA 4II2A 4DBVO 3E18A 4MOWA 1S6YA 1ARZA 3KYBA 4BNHA 4Z3DA 2P68A 2CVOA 1KS9A 3OSUA 4MVJH 2FPPA 4I9NA 1F8GA 1PEDA 4CM7A 1TVEA 3DZKA 1QV7A 3MJTA 2WEKA 4G65A 3WBFA 2IXBA 3LT0A 1A27A 1UP6A 4IZHA 4IJVA 1WAMA 3VOSA 3AU8A 3NT4A 2CF6A 2RH4A 4WEQA 3ZNPA 2FZWA 3RC1A 1P0CA 2OUIA 1UXJA 4OM8A 3DQPA 2IE0A 3IUPA 1N9GB 3DOOA 3JD1A 4A27A 1V3VA 4OKNA 3RUHA 2X9GA 3DOCA 1MP0A 4YA6A 1GCUA 4Y6SA 1BMDA 1EVJA 3ROMA 5KTKA 3Q6IA 5B37A 4A03A 1I8TA 4WCFC 4L4RA 2O4UX 1R4MA 4BNXA 3KEOA 3PQEA 1MG0A 3QWFA 4RQUA 3WIEA 5EPOA 3R3JA 1NPDA 1PJ3A 4GBJA 4M8SA 1LQTA 4Z9FA 1SEPA 3WSVA 3ZWAA 5BSEA 2DM6A 5KVCA 4D42A 1RM0A 1UAGA 2GCGA 3GZ4A 3WGYA 1PWXA 1C0LA 3NRCA 3KHUA 4GSKA 3DBHA 4UVDA 4YBZA 3RBXA 2EJWA 2Y1OA 3IJRA 5JW6A 1HT0A 3WTCA 3ANMA 3F46A 1DPGA 1LNQA 2Q1TA 1JWAB 2VWPA 4G5HA 4JJGA 2ZYDA 3BMOB 3KV3O 4YAEA 3A14A 1UZLA 4DUPA 1PU2A 3QP9A 2XAAA 3DMTC 1EMDA 1KVQA 1KETA 3FWZA 4XQCA 3I52A 4CM5A 4XYEA 2FY8A 1J4AA 3K2BA 4CLHA 1DEHA 1XELA 4J7XA 3AUSA 5EQFA 4PFJA 5GZ1A 2X0RA 3DBRA 5AVOA 1X7HA 3AI2A 4CV2A 3D7LA 3WQQA 3I9LA 4BKQA 2C5EA 4J0EA 2J3KA 3JQ8B 4BUCA 3F5SA 3T7CA 1M6HA 2NTVA 1AUPA 2G1UA 5F1OA 4CMJA 3RD5A 3OJLA 4IINA 4DTIA 1LC0A 1Q0HA 5LC1A 3UFXA 1BVRA 2B4TO 3W8FA 4U8GA 2W2LA 3ASUA 1ZMOA 2Y1EA 5B4UA 3EDMA 3CINA 2EHDA 4RPGA 3X2EA 3E03A 3WX0A 3QIVA 2EG9A 4N54A 4UEOA 5AXBA 3VVCA 5HWSA 1GR0A 3SJUA 3AM5A 3ZNOA 3QVOA 5L4NA 1X1TA 1HKUA 1GQQA 2GRAA 3E5MA 4BGUA 3VHRA 4CL8A 1U4OA 4OOEA 3ANNA 4DYVA 4RORA 5TF4A 3EC7A 2BELA 5KJCA 4Z9YA 3INTA 4RVSA 2Q1UA 4TVBA 2IZZA 3PLNA 4BV8A 4IXWA 1H5QA 3DOJA 1YWGO 4FD3A 5FWNA 1KIFA 2RCYA 5G0WA 1EDOA 3ETEA 3BMNA 3DHNA 4WCDA 1W73A 1UXHA 2FRDA 3I23A 4YACA 1SOVA 3UOGA 1D1TA 1QXSA 1LTHR 5JDCC 5EJ2A 5DCYA 3GFGA 1PX0A 2DT5A 5T64A 3HE3A 1E7YA 4J49A 3AOGA 3TNLA 4CLRA 1JLLA 1VJ0A 4HY3A 1C1DA 2O3QA 1CRWG 1YH3A 2O23A 2D5AA 2AQKA 4QUKA 4RPJA 2Q45A 3B6ZA 3AWDA 2UUPA 3P5SA 1PJCA 4R1TA 4CM3A 2VRCA 1SEVA 4P38A 4GMFA 1WZEA 1YDWA 4BNJA 4GWKA 3NDJA 5HTOA 3AFNA 5LCXA 4BNUA 1R4MB 4PLWA 1NPYA 3U4DA 4U0KA 5I7SA 3ZHXA 4RV9A 4BKPA 1YE3A 2YDXA 4RPKA 1ZSYA 4XWYA 1PJ4A 1ENOA 2E37A 1Z6ZA 2GLXA 3AY3A 4E5KA 1MA0A 3OEYA 4ROSA 1DJQA 4AJ2A 1BGVA 1W8DA 4FBGA 1R6DA 4RZHA 4Y67A 1ZFNA 3VPHA 4XGNA 1C0KA 1T1SA 3EMKA 4TRMA 4QFDA 4S1VA 4NZ9A 2HKIA 1ONNA 6ADHA 2EERA 2X22A 4IMPA 3LDHA 3GVHA 4URFA 4L4XA 4DQXA 1UJMA 3CEAA 1AGNA 2ZJ1A 4XYGA 1ENYA 3P2OA 2OXIA 4A5OA 1M2WA 3ANLA 3ZV6A 2JD0A 5IJZA 1DBVO 3W4IA 5JBIA 2NVBA 2R00A 3EYWA 1UP4A 4XYMA 4BNTA 2W8ZA 3HFGA 4CJXA 4Z9XA 2QQ5A 1DJNA 1Z7BA 3TZHA 1ISIA 2V65A 2Y66A 3RUAA 1QKIA 5JO9A 1HXHA 3HJAA 4K1LA 4DLBA 2C82A 3TN7A 5L3ZA 4BNZA 1RYEA 4OL9A 4YEDA 2OZPA 3ROKA 2EGGA 4EYEA 3F5QA 5JS6A 3Q9NA 2LDBA 1B0AA 4IXTA 4D43A 1NASA 3HDYA 1L7DA 3M2PA 2DBZA 4Q3NA 1HE5A 1PZGA 3SC6A 3CIFA 4PG5A 4I5DA 4OXYA 4AJKA 1LJ8A 3MOIA 4IGFA 1O94A 2RAFA 4UVIA 2FR8A 3PZBA 1Q0LA 2H1SA 4W9NA 1H0KA 2OORA 1VL8A 2HSDA 3WYCA 2O3SA 3AJRA 4D3FA 1E3IA 3PHLA 1HDZA 4CM9A 1DHTA 3VZPA 2NVUA 4AJIA 4BQPA 5IFLA 5KJFA 2UDPA 1JW9B 3GAZA 5CG2A 4TSKA 3ZZNA 3E9NA 1GADO 1E6UA 1PR3A 1IOLA 4U6QA 3AU9A 2P9GA 3ICPA 3JTMA 1PS9A 2C7VA 1RM3A 3FI9A 2AHRA 4JLWA 5CFZA 1T2EA 3FNGA 4TQGA 2EGHA 3JQCA 4PZEA 5DT9A 1MFZA 1DC4A 3A1NA 4ZGWA 5L40A 1P1HA 1YKFA 2I9PA 1VI2A 3RSHA 4KUGA 4ZRMA 1LRLA 3RCBA 3GZNB 4E3ZA 3G1TA 2GD1O 1HDOA 3DHYA 3WR5A 3PDJA 3RKRA 1HDYA 1YQDA 1M75A 3PFFA 3ZHYA 1P77A 1E1NA 1MX3A 2PH3A 3TOXA 4CM1A 3GOHA 2A9FA 1NWCA 4C7KA 1RPNA 4CQMD 1ZK2A 1AN9A 3WGOA 4CV3A 2BKAA 1VL6A 3X2FA 3ZWNA 3DZHA 4Y8VA 4CR7A 4D0RA 2H6EA 2JAHA 1LDMA 1WZIA 2JKVA 3LC7O 1K2WA 1XLTA 2DU8A 1Y9EA 2ZATA 3PJFA 3UCFA 4DQUA 1NHGA 1TT5A 3DB2A 3LLSA 4GMGA 4L74A 2CDBA 3FNFA 4NQZA 9LDTA 5C5IA 2LDXA 3WGHA 2C59A 1G1AA 1GD1O 3ZWXA 3K73O 5AOVA 3TOZA 4BNMA 5COBA 4IDCA 3GNSA 1EVIA 4J4BA 4DXHA 1EBUA 1NFRA 1B7GO 4QXMA 1E3JA 3GFBA 3DL2A 3QSGA 3GUYA 3JYLA 3W6UA 5FI3A 1HZJA 5A06A 1GV1A 1GY8A 1KEPA 4E5NA 4W7IA 4L76A 4R1SA 2VWQA 1S7CA 3DAPA 3HB5X 4ZQHA 3JQGA 3CSDA 1YBAA 4Y6PA 4FR5A 3W4JA 3W6ZA 1TEHA 3OMLA 3V1UA 1H6DA 2VQ3A 1UZMA 5A3VA 4Q9NA 1Q7GA 1YONA 1A5ZA 3GZNA 5THQA 1E3WB 2Q49A 4FGWA 3NTQA 1DDOA 3EZLA 1U3WA 3OJOA 4R16A 3V1YA 2TMGA 3P19A 2JAPA 1E77A 1J0XO 1U2DA 3RBZA 3IUSA 3UGKA 4E0BA 3AI3A 1C0IA 1EE9A 1DXYA 3P7MA 3JQAA 4RVFA 1OZAA 5KVQA 4ZD6A 2P5YA 1SMKA 2BH9A 3T7EA 1W6UA 1PIWA 1YL6A 4OIMA 1QSGA 4J1SA 1K89A 5T67A 4GLOA 4YJGB 3OQ6A 4PCVA 5JCJA 5KJEA 2DBQA 2EKQA 3GF4A 3H9EO 3KLPX 4QX6A 3DAGA 5T8KC 3S2FA 2IODA 3I4CA 3ZNQA 4E5MA 1EFLA 1TLTA 3JQ7A 2W90A 2Q2WA 1HYEA 4G2NA 4XGIA 2O2YA 4CMBA 1XYGA 3TL3A 4EW6A 3ETDA 4YJHB 1LDNA 1VKNA 4D46A 3QQPA 4XQGA 1AHHA 4OSOA 4LN1A 5ILOA 4AJEA 2HK9A 4WASA 4I5GA 4JBGA 1U3TA 1X0VA 5LDGA 3KRTA 4Q3DA 1UDCA 4HXYA 3F1KA 5DULA 1JKJA 3FNHA 1DB3A 1HDGO 1SC6A 3LT2A 2DFVA 3GG2A 5IDQA 3DTYA 4HUJA 1M67A 2O4CA 2O7SA 3JYPA 1B8PA 2V6BA 4ZQGA 1QLJA 3DBVO 3OQ1A 3F3SA 8ADHA 1PL6A 3VKVA 5F21A 1SZJG 1XU9A 1P3DA 1YXMA 2POQX 4ALKA 4RCVA 2WD8A 2X6TA 4FJ1A 4YT2A 1A9ZA 2J3JA 2PGLA 1MC4A 2UAGA 1Z7EA 3K96A 3KOUA 4GX0A 3ZDFA 2YHIA 3WTBA 2OBNA 3B1KA 1WW8A 4J7UA 4Z0PA 3IIEA 3GPIA 1FF9A 3U49A 4IDGA 3KM0A 4DYDA 4PLVA 1H93A 4DQVA 4FFNA 5JCXA 4RJTA 4B4UA 1MGOA 1QYWA 3JYQA 4M55A 5G0TA 5EN4A 3ROQA 2FR0A 3O03A 1XU7A 1HRDA 1XDWA 2X5KO 1FJHA 1PGOA 5C37A 1I3LA 3CMCO 4D79A 4YYZA 4TMFA 2VOJA 5ENVA 4W6ZA 2PTGA 4YJFB 2PD6A 5DBIA 4Q39A 2FSSA 1UXGA 3S8MA 4KQXA 4CR6A 1NVMB 3NV9A 4KWIA 1ZZEA 1I30A 1I2ZA 4LISA 5DP1A 4CLDA 4O63O 2NSDA 3EUWA 1Z75A 2X58A 3PJGA 4XYLA 3G17A 4M89A 4LW8A 3FR7A 4NHEA 1I10A 2C54A 3DMTA 2WMDA 4M86A 4RVUA 3RKUA 3RU7A 4R54A 3OJFA 4BV9A 4RZIA 4IPTA 1QORA 3I4FA 4M49A 1GUZA 3K8ZA 4FGSA 4AJ1A 5L7WA 3DAFA 4LMRA 2PKQP 2PNFA 4XB2A 1B8VA 3FN4A 3JQBA 4JNKA 4J1NA 5FYDA 3JQEA 4D44A 1Z82A 3WQRA 4J6FA 4A0SA 3JV7A 3RAJA 3ZU3A 5U4QA 1NYTA 1AXGA 4BNGA 5H83A 1ZH8A 4B7UA 5AQ1A 3C8MA 1ZW1A 4UUOA 1R37A 4WJZA 3CZMA 4GVLA 1KVSA 2Q3EA 2VNSA 1IE3A 4EUFA 1Y8QB 1HLDA 2GPTA 4EDFA 2D2IA 1DRWA 2RHRA 5FEUA 3ZV4A 1EDZA 1Y6JA 4E5PA 3MJCA 1F14A 4CM4A 1UR5A 3RFXA 2ZB3A 2ZTVA 4IQ0A 5CPFA 3D3WA 4XRRA 5K9ZA 1KEVA 2Y05A 5JAQA 3I9OA 1Y8RB 1EVZA 3K92A 3MJSA 4TRJA 3VDRA 4J7CA 4WLEA 4BNYA 4Q3AA 1T25A 4CUZA 1L1FA 1DC5A 1XR3A 1ISMA 1N7HA 4JK3A 3PPIA 1OBFO 2DLDA 1A9YA 2AXQA 1YQGA 5DBFA 4NFYA 3DC2A 5ITVA 3D0OA 3EK2A 1XWFA 4QTZA 2DTDA 1QYXA 1H6AA 2GZ2A 1CWUA 1OC2A 4NU6A 4OAQA 5DF1A 3I3OA 4NJMA 1UDAA 2YW9A 3H6KA 4CQMA 5A5EA 5F1PA 5KKCA 4PG6A 3TF5A 3PZRA 3O8QA 3C3XA 1TI7A 4P22A 5CG1A 1HSZA 4MKZA 2Q2VA 3AUUA 4LK3A 1ZXLA 4W4TA 2FSVA 4JCOA 3KYCB 3AM4A 1B16A 4I5FA 4OJNA 2BI8A 3L0DA 4R1NA 4YVFA 3TDKA 3L4BA 3NTOA 5K0ZA 3ZWBA 3JQ7B 1E5QA 2FPGA 5DNAA 4GPD1 1NXQA 2QW8A 4B79A 1LUAA 2VRCD 5H82A 4BO3A 1NQTA 3DDNA 1NQ5A 4ALIA 1KC1A 4DPMA 1GYPA 5GZ6A 1ZCJA 1GFSA 1HSOA 2NWQA 1DLJA 3A06A 1P1IA 4Z0HO 1AE1A 1ZEJA 1EQ2A 5A05A 1ZMTA 4NI5A 5TX7A 5CEJA 1KY5A 1N92A 1U1IA 3A9WA 1V0JA 1J5PA 3KSUA 4GGOA 5C7OO 4IDAA 4BMNA 1JQBA 3M1LA 3C1OA 3KYDA 3OM9A 1OMOA 4EJ6A 2X0NA 4DPKA 4RVHA 4GI2A 2RHCA 5HS4A 2HRZA 2PR2A 3GA0A 1C1XA 3LZ6A 4B4WA 4GKVA 2ZJ0A 4TRRA 5AXDA 1NVTA 3OETA 3CZRA 3K31A 3IC5A 1TT7A 3C1AA 4BO4A 5HS6A 1T2FA 4EI2A 2O3JA 4AJNA 3NYWA 2HK8A 2I3GA 3JQGB 5JYEA 1E0DA 4WK6A 1FK8A 1LDYA 3PGXA 5DBGA 1HWYA 3WLEA 2PZKA 5DDIP 2NU9A 2O7QA 3ITDA 2PGJA 3ORFA 1KVTA 2IDZA 4E30A 1B2LA 3OA0A 4GAEA 3VH3A 2J5KA 3ZN2A 3OHSX 5L9AA 3H9UA 1PSDA 3UICA 4B3HA 3D5TA 4XIYA 3VPGA 4XD2A 1Y8QA 5LDHA 3GGOA 1WXDA 2FN7A 4E21A 4DRYA 3C7AA 3PGJA 4YJHA 4DLLA 3BHJA 4E2XA 5COAA 1PQPA 5EINA 2PKQO 4DC1A 4RO0A 2EIHA 4ND2A 5ER6A 5DCWA 4CL3A 2EP7A 1A4IA 2GN8A 2VUUA 4HADA 1NQAO 1T4BA 6LDHA 3MJEA 2VYVA 2EKLA 4R51A 3RJ9A 4B7CA 5DP2A 1LLQA 4BNWA 4CLOB 1HDXA 3TJRA 3ZV3A 1GL3A 4BO6A 3G49A 1HLPA 4R1UA 3FTNA 1LSUA 2O50A 4F3YA 1P9LA 4Y6RA 2J3IA 2I67A 3LLVA 3KYCA 3RASA 1SOWA 2ZTMA 1HE3A 4TZTA 3RJ5A 4D0SA 4XZ3A 1ORRA 3NUGA 2EKPA 2B69A 3NDRA 3PIIA 1JVSA 3JQDA 5CEEA 1GV0A 3WYEA 2C20A 1DLIA 2VRBA 3I6QA 4CMEA 3H5NA 3U4CA 5L45A 2YV1A 1U5CA 1YL5A 2DAPA 3PFWO 5L4SA 5IN4A 4B8ZA 3ONFA 3I9KA 4PLTA 3UHAA 1DHRA 1FDTA 1NVGA 1R0LA 1WNTA 2OHXA 3KO8A 3HDJA 4N5NA 1I24A 2VOEA 2WJPA 1NFQA 4M54A 2C29D 3I9NA 1N9GA 1ZK1A 3WMWA 2J6IA 2VWHA 3BYZA 3IJPA 4XB1A 2NVWA 5JDIA 4EEXA 1LRKA 4R5HA 3WBBA 1GZ6A 3OBBA 2GO1A 2QX7A 2VN8A 4CM6A 1NX6A 1GQ2A 2AMFA 5A9TA 2HLPA 1SB8A 1IHYA 4HFJA 4U7WA 3PHGA 1ZKMA 4J90A 4KP7A 1D7OA 4DIFA 2BLLA 2X0JA 3G79A 3AOEC 2AEMA 5KVSA 2OO5A 3N58A 3GDGA 2BHLA 3NJ8A 1PS8A 1U7TA 3JYOA 4B4OA 4MPDA 2GNAA 3CKYA 1EE2A 1VRWA 3IKVA 3GPDG 4HP8A 4NFHA 4OMUA 3S2EA 7ADHA 1L7EA 2E6UX 3GEDA 1X15A 4YAKA 2J8ZA 1PZEA 1ISGA 3FWNA 5JLAA 3FHLA 2QYSA 3MZ0A 4B3IA 1CDOA 3QWHA 1P1FA 1ZUD1 2FR1A 1ADGA 4QEDA 4YJFA 3NGLA 2YFQA 2JFFA 4J3FA 4CMEC 1IL0A 3FBGA 5DOZA 1NHWA 4X54A 3EGOA 5A1TA 4XJSA 3JQFC 1X7GA 1B14A 1Q7CA 1RJWA 3MWEB 1I32A 1Q0QA 1E3LA 1JN0A 5IN5A 1I3NA 5TIIA 2H5LA 3G1UA 4LCEA 1UZNA 2NTNA 1K0UA 2R6JA 4BNFA 4BS9A 1MB4A 3VH2A 5U9CA 3FTPA 2QRJA 4YQYA 4J16A 4DPLA 4ZQBA 4OH1A
chains in the Genus database with same CATH superfamily
1UOQA 3WNQA 4MVJG 1SGWA 3ZUGA 1ZNXA 5EHGA 3Q8LA 1BHO1 1XHEA 1P2TA 4FB5A 2V7BA 2QTVB 2QN8A 3HU2A 1AMNA 4ZVKA 5TS2A 4RPHA 1BW9A 1ZESA 2XT6A 4O1MA 3IOCA 2C9DA 1JEQB 1HG0A 3GCGA 2RGGA 3HPQA 1P0MA 3NBXX 4D3YA 5J1TB 5FTWA 4CTKA 3F3MA 3DO8A 2FDRA 1D6NA 1AM4D 3PHHA 5EJGA 1QJCA 2ZRIA 1XXHE 2X4IA 3QRWA 1WZCA 5IAKA 1AQNA 1C3XA 2CMFA 1GJRA 1ZXBA 1C80A 4ZOLF 1V7PC 1ISFA 5HPYB 2HSEA 2EP5A 1ZVMA 2R2AA 2JFGA 4L1KA 5CH5A 2EZ9A 2CNWA 3TMKA 2G09A 2Q28A 2WKSA 1NW7A 2OEPA 3LA6A 1DDIA 1LPSA 3EXHB 1ID8A 1NRWA 1E1QD 2WK1A 3FDZA 4HDNB 5KYKA 1JDZA 4AI6A 5FL3A 9ATCA 4WOKA 2R751 1ECCA 3TFQA 3KXDA 5ALQA 4AF7A 3TK1A 3CEJA 1Q77A 1RWBA 4QDTA 3U7HB 3PGMA 3ZCRA 3QKWA 1QIMA 2FQQA 5D7BA 4NJMB 2EFGA 2ZDHA 1U0GA 4RV5A 5K4AA 4IXMA 4Q1FA 3SYMA 3S3TA 1L7PA 3DOIA 1UANA 4DXAA 1U9JA 2RHMA 3A8TA 2JFNA 3I1JA 4I2VA 2QIOA 1K06A 1M8KA 2B7LA 1CJVC 4FYJA 4D99A 1PZFA 4MWDA 2JFYA 3DUFA 4DMHA 1Z15A 4E2YA 1CF4A 1HOXA 4NZNA 3MEQA 1TMYA 1CG6A 1QR2A 1JEJA 1ODIA 3NYRA 1G6Q1 1ULAA 1HFJA 4D9EA 4HNAB 4CT4B 2PSFA 1HKHA 4FGKA 5IKOA 3STHA 3ZH9B 3SQWA 1CUJA 4M3NA 5GOZA 1IN8A 1B0PA 1MW8X 3CBQA 1MV5A 3MCZA 3HTXA 3Q88A 2ZVJA 2AJCA 2Y77A 4KTTE 1V7QA 2X9NA 5E3JA 3WGGA 1OAOC 1C2YA 2ID9A 4K87A 4M8NE 4HPJB 4H3VA 2ILTA 3HGMA 1T4CA 2QLJA 3GT7A 2ZRJA 3FFXA 4EO7A 4CKBA 5CCBA 2ZUCA 3GARA 3OZRA 3UT0A 5IDXA 1LF5A 1LLFA 3LQ1A 3E22B 4HGNA 4LVNA 2E4VA 4UM5A 1Y89A 3R24A 1H1DA 3R5FA 4HC4A 3AQIA 4OHPA 5TXGA 3GFSA 1W59A 3KBOA 4M22A 5FRDA 4PYJA 2YZ7A 1R8JA 1XROA 4M83A 1EZ4A 3P97A 4FFWA 1XD2B 1E5XA 4X60A 3AR6A 1GKUB 1OHHA 2CVHA 2Q4BA 2VPTA 4PBTA 1R12A 3TGLA 4WOPA 3ONVA 1U7WA 2HU8A 3ZWCA 4AL4A 1ONOA 4Z1MD 5FWYA 5D5HA 1QE3A 2WY2D 2AG8A 5AKJA 4D4MA 4WTOA 3RUDA 5EJ5A 4H7EA 4DCNA 4OXKA 4BGVA 1KO1A 2G6TA 4P6VF 3VPXA 1V5WA 1R0ZA 4EG8A 5MGNA 1E3DA 1S5PA 3BTUA 1Q6YA 2L17A 3D64A 4UAVA 2ZRCA 3SLKA 2F1HA 3E81A 2I8LA 1KYXA 2JEZA 4OA8A 3DFIA 1JFTA 3WLPA 1FFEA 1YBVA 3OM8A 2E89A 3PJDA 4ZC8A 2BSAA 4L0MA 4B3BA 1L5NA 5L8VA 4JY7A 1NG9A 3AHEA 1G38A 4ND3A 1ZOLA 2J5QA 1FNNA 3CLTC 2Q46A 3HWRA 5TJHA 2H17A 5BRAA 5I7VA 2B8EA 3HA5A 4KH0A 4JL6A 5KSPA 4Y6QA 1QE0A 2G77B 1Y4SA 2YFKA 3L5OA 3ILXA 1RAEA 2VT3A 3NTXA 4IDFA 2WHQA 5I9NA 5IYZA 4HFMA 2QL9A 4HUQA 1QH8B 5DBEX 1NXOA 1I3KA 4R40A 4AY3A 3WDMA 4G8DA 4Q7KA 4RULA 3MT7A 4GOMD 4DUYB 3H9GA 2XTNA 1OH7A 4NZPA 2H4ZA 5AIBA 4OD0A 3DDWA 1R8YA 2KLHA 4MUYA 4DCJA 2AFVA 3AEQA 4TGLA 1ST2A 5IK2A 4M1EA 4RGBA 4PPQA 2QM8A 3LT5A 1XZCA 4RKYA 4DIMA 1JBQA 5SZIA 1K1EA 4ZT2A 1WU8A 2XA2A 4QPCA 1AXEA 5BSFA 1EX6A 2IHUA 4UTXA 4FCWA 1GAJA 1X7WB 1T0UA 1X77A 2HA2A 2HEIA 1E2UA 3WGMA 3QI7A 3HJCA 4NMHA 1FL9A 1FDWA 3N8KA 4OAOA 3V7WA 3EGXA 2X14A 4Q00A 4ESVA 2YV3A 4X63A 5CNKA 4FI3F 5T41A 2DERA 2IYZA 1IY8A 3ZE1B 1SY7A 2XY4A 4O8ZA 3TCXB 4R5MA 1EDBA 3MBIA 3P94A 1KP2A 3N2GA 4RY2A 5DHFA 3S70A 4D4JA 1CE8A 4TWRA 2WIFA 5EKSA 1U2PA 3G5UA 5JCZA 2ZRDA 4FS3A 4G41A 4TV8F 3TSYA 2H0RA 2AOUB 3DD1A 2E5WA 1TYAE 4Y98A 5GM1A 1GRRA 4EABA 5JASA 1HEUA 1JU4A 2HIGA 3LT1A 5KQPA 3I5XA 2HF9A 4G63A 1XA0A 2ZWVA 2OV1A 1NSFA 3CPSA 2ACKA 4QEZA 3REOA 4PLGA 4CM8A 3KOWA 1DFIA 3QEKA 2OGZA 3QWIA 1DU4A 2RGNC 4MXDA 5H16A 2X0KA 1F6BA 2PX8A 2WG2A 3D3WB 1B23P 4DWOA 3PDCA 2GZAA 1EUCA 4I19A 2NUAA 4JP5A 4BZZA 4A0GA 5KMGA 3THYA 4GPIB 4PW0A 4YP7A 3MF4A 4BO8A 3L8MA 1K6IA 3X1YA 3IA7A 3WLFA 1R5BA 3ITKA 3VKFA 4J1TA 1WETA 3AQ4A 1AKMA 2J7PD 3MTBA 4R1QA 5JZOA 3PQFA 2G72A 4NEHB 1QU2A 1QHNA 1GL6A 3C3MA 1KEEB 5D01A 5LXTB 4CLEA 2IXTA 5IMSA 3R8FA 4ZVVA 1GNRA 1HH4A 4BRZA 3ZIAD 4C6TB 1FZQA 3IDSA 4LPSA 1VHWA 1T13A 2R6DA 3H2HA 3EQ2A 1F2UA 3FGOA 3G2NA 2W93A 2YWCA 2VYNA 3H4MA 1EUCB 4KQKA 2B78A 5F7OA 3SJ7A 2FJPA 2P4HX 2HWUA 3F2IA 3GDWA 1NVAA 5F2EA 2EV9A 2SHKA 3G0GA 3UOWA 4ZI3A 7MDHA 5I45A 2ZJ8A 2QROA 2Q50A 4DXDA 1L6RA 3OFNA 1XZ8A 2GF9A 1RJFA 1CUXA 2Q0XA 3FBTA 3E7PA 1DIRA 2HPVA 4JYBA 2OUKA 2RC5A 2QQ0A 5FA5A 3TMYA 3P9XA 4F84A 2Q6KA 3B6EA 3X2SA 3NHJA 4AF6A 3HZOA 2EFYA 1SFRA 5FTNA 3ZG6A 3H7AA 3QV2A 3VYSB 4KODA 1AH2A 1D4FA 2FF5A 1R7RA 1G7TA 1BKYA 2OE2A 3Q2IA 1YA8A 3ONWA 2VAPA 2OV8A 1QFJA 2RHDA 1HDIA 1U99A 2BJWA 3AR4A 3I9V1 1N6KA 4YYEA 4LRXA 2MOKA 4RLQA 1X7DA 3GEBA 4TTRA 1ULHA 3RABA 4DLAA 1FLDA 1Q16A 2QZZA 2Z2ZA 3TR0A 3VR4H 1VDMA 1O5IA 2FPIB 3ZUPA 1XQ1A 1YQXA 2Y1FA 3MINA 2PRJA 4D0NA 1AKRA 1D0SA 2GT1A 2VCEA 5CT9A 5BQXA 2CUZA 1WLYA 4A2WA 1G55A 4HLNA 4KK4A 2PWYA 1W96A 2YJZA 3LI2A 4MZDA 4KLRA 1EUZA 1RRVA 3K9BA 4BQIA 4QO8A 3I9FA 4UBIA 3JSAA 2CDCA 4RANA 4L08A 3IPRA 2M6KA 3AHCA 1UODA 3RU2A 1EK5A 2YUTA 3OFSA 4PSUA 2QY6A 5LB2A 3B38A 3IP3A 1RNLA 2W2OA 1R74A 1LK0A 5KOHB 4ADSG 4TSFD 1JQAA 2GXQA 5BV0A 2C07A 5JNLA 1JG7A 4U2DA 3Q7SA 2JAUA 4WY5A 5H81A 2V58A 1EUYA 2CZCA 3V8NA 1C3JA 4AF8A 3PDIB 1XK6A 3NPMA 3PFIA 3WGTA 1G7RA 4KGXA 3WISA 3EH2A 3L6OO 3OTOB 2WAMA 1YULA 3KTDA 4F72A 5A0VA 3RRZA 4IWYA 3KIPA 2NSYA 2FMUA 4GX1A 4IGKA 4KWCA 3RLIA 1TA4A 2P1ZA 5E95A 1KMMA 2B21A 1I2BA 1WU7A 1HTBA 5TQJA 2P0EA 3NBQA 4N3AA 4F3KA 1W4AA 7GPBA 1WZ2A 3L9XA 1VA4A 3OQIA 1U2GA 1A7KA 2WIDA 2SECE 2AEFA 4PRKA 3GGPA 4CV1A 5CCEA 2G9UA 1DC3A 4QSMA 1IIRA 2ACEA 4LPKA 3FJOA 3EF3A 1L1QA 1NF8A 3G7UA 5HF8A 2IXFA 2HCFA 2N3ZA 3K0AA 1H2BA 1V8OA 1Z73A 4RXTA 3RT9A 3QBVA 3W05A 1CXZA 3ZD6A 3QUSA 4UOQA 4WXYB 1H5UA 3L7CA 3K9WA 5FA8A 4P33A 4TL9A 4PQYA 1JYSA 3EGEA 3U7QB 1AUVA 3D5QA 1T6XA 3C74A 3QVKA 1U7OA 5JQGF 3A9RA 3HN7A 3TQQA 2DUNA 3ROZA 1U81A 1JLSA 3H2YA 4ZI7B 4FSXA 2O8EB 4E11A 4ETNA 1XTVA 3ZGNA 2VA9A 3QWAA 4CODB 3HVKA 3LY5A 3T9FA 1ZXXA 4YDHB 1GRQA 3I04M 4QRHA 4KZPA 4PLZA 4PVDA 1DZ3A 3TRFA 4DJTA 4W5RA 3GL9A 2BGKA 2WT9A 2XYGA 3CX3A 3LPLA 2WPDD 1T2CA 1UM8A 1IYZA 2C2GA 3HDVA 3TJMA 1O6ZA 3L4SO 2J9ZB 5BV8A 1UBHS 2ZRNA 2BYTA 2VZLA 3CUEF 3KR9A 4GL2A 3F9CA 3A4VA 2WT4A 1P0FA 2QRNA 2BI7A 1G8YA 1NBIA 2RBEA 3C8ZA 2ZIAA 2O8EA 1W581 4Y2XA 4CNBA 1BXGA 1C9KA 2HNBA 2G9RA 2AOVA 3BUSA 3UBMA 3KZNA 2FOIA 3M6IA 3KB6A 1ZW6A 2G07A 5A4DA 3H2BA 3IKMB 1N1MA 3OLYA 3BQ9A 5FFFA 3W2IA 4H7JA 3GA5A 1T2VA 2JATA 4WZBA 2MIIA 2AOTA 5JO0A 3BXEA 3LAWA 5BYBA 3BWYA 5F9MA 3OQPA 3FB1A 4FP9A 1J06A 2VHCA 3RRNA 2DRIA 1MDBA 1ULSA 3NETA 4C43A 1QYDA 1DIAA 3BE5A 3E9ZA 2WAAA 1IC6A 2YZMA 1P8AA 3UPTA 1ODCA 4R6XA 4LVCA 1U8EA 1PVOA 1ZGGA 4V0QA 1OFUX 3ISTA 3N5CA 1E3WA 1O5OA 2A2ZA 4CF6A 1VHLA 2AD5A 1PZNA 4HPXB 4L95C 4B2IA 4QUAA 4YALA 2JK1A 4U7GA 3TSWA 4PNEA 1VMEA 1AS3A 3B20A 4NYJQ 3HKBB 2AUNA 1JKJB 1T36A 2BF7A 1JIVA 2CFRA 1FC0A 2JFOA 2QZ9A 4H0FA 5CX4A 1YKSA 3COVA 2ZIFA 2O0MA 3OCJA 4BKOA 4ECEA 4EI8A 1ZU4A 4PZ9A 5REQB 3C70A 3H75A 1EK0A 2H4XA 2V7PA 3D81A 3KZOA 3WFJA 2I1WA 3EFOA 1PDVA 4KYIB 1ENPA 3T3PB 2W7TA 4EO9A 1QF6A 1OREA 1PV1A 2P2SA 4IGIA 4JI1B 3U44A 2GARA 2AB0A 5E2IA 1H8HD 2WG1A 4TS9A 2WTUA 1PL7A 4ESOA 1RLMA 1NI5A 3M6VA 3QY0A 2BGWA 4YDRA 1C3OB 5EEGA 1MRSA 1Q2UA 2P77A 2EZTA 5CAEB 4ARCA 1OASA 1J8DA 4D8TA 2LNDA 1TM4E 1USUA 1ZM9A 1ZBQA 4HAVA 3COZA 4QBIA 5AI9A 3T4EA 2W2KA 2OOKA 4ZJZA 4IWNA 1VLLA 3OTGA 4Y9DA 5AM4A 2OILA 3WDKA 3CB2A 5CX1B 3A10A 5IJAA 2BGIA 3GLUA 5ALVA 4ZOEA 4LI3X 3HCPA 3PQ5A 4IEFB 4G5QA 4W1PA 2FW7A 1WXHA 2QHXA 3ZKAA 2R6HA 2QTAA 1R10A 5C5EA 1KERA 4UTVA 2X3FA 1CJTC 2GJ9A 4WHMA 3M34A 4OUDB 1YCDA 4ZQEA 5GVRA 2M32A 2YFYA 3C5CA 5F7XA 1JA9A 3MCVA 4RF4A 3TLZA 1MORA 2OFFA 1IUNA 1K27A 1U28C 2MSCB 4LSWA 4BMVA 2J7PA 4A3SA 4V1CI 2V6GA 5P21A 4PANA 3UK2A 5JNRA 3AJ9A 4YLEA 2K6GA 3JD3A 1MO2A 4YGYA 1NLMA 1JAXA 2ISCA 1WF3A 2Q7OE 1PEYA 3VJKA 5C7LO 1EAYA 1JEEA 1SU4A 5CIQA 3RK1A 3BT7A 4RPLA 2H2AA 3NHZA 5AVXA 2OGSA 1OJLA 5CLGA 5EIFA 3VQTA 4ZYWA 3EAGA 4QODA 3N5KA 1UFRA 3T4XA 2I2DA 3HXMA 1LA2A 3JCZA 3EZYA 3FTQA 4B2LA 4QECA 3OJ0A 3R4VA 3OZCA 1RAAA 2VK8A 3HYNA 3C45A 3PI7A 4PFSA 5EXDA 3RC7A 5IW8A 4OLFA 4AJPA 2FP4A 3LPCA 1BA3A 1O94D 2H9YA 1EK6A 4UC0A 1BS1A 2B98A 5F2KA 3VH1A 1KJWA 3ENNA 3DFMA 5CVDA 5EXXA 1Y1RA 5IP5A 3RTBA 2ZRPA 1PZHA 4D5EA 4RLSA 4DUGD 3BPSA 4C06A 5EWJA 3OZAA 3RYTC 1RMYA 3CU5A 4R2XA 3O8BA 3GLHB 1NT2A 3T3GA 1E1KA 1M8PA 3AJAA 1UUFA 3KXIA 3ZDEA 1QH8A 2VR1A 4B17A 3BL5A 3JQ9A 4RDIA 1X1DA 2WAYA 4L9RA 4MI3A 1L5WA 2O8FB 3LSYA 5I8WA 3Q2KA 2GN9A 3GUCA 4HBGA 5EZSA 3GRUA 3ZD7A 2IDKA 4TV9A 1YDGA 1E63A 4D5GA 4G3XA 3RH0A 1XCOA 2TSYB 1JBKA 5HUHA 5HVNA 1GKYA 3RK4A 1LBIA 4HQFA 1F0KA 3AINA 3OWXA 3RHSA 4BB5A 1C1XB 3BRWA 3LVRE 4AJOA 4YJ2A 1Y5IA 5KSWB 4B3CA 3W3ZB 2BMEA 5EP4A 3PC8C 4CEHA 1CY8A 5L3SA 3T5TA 5LLTA 4UREA 3K5PA 3A11A 1EBBA 4LYEA 4ZAVA 5D3MB 1PJQA 1TT5B 3H3XA 2NO7A 2Y1WA 3Q12A 4NDNE 4D45A 5C8YF 1WBDA 2XSZD 1QYCA 1SKAA 4MUXA 1JDBB 3WKAA 3HU5A 3NT5A 4KBFA 2IBTA 1IUKA 8ATCA 1DADA 1YIDA 3NW9A 8OHMA 4MIEA 4MVJM 2H7CA 3IHKA 1NOKA 3LOUA 5G02A 2OLEA 4BNDB 4JHXA 2NXWA 1NF2A 3BXOA 3HCDA 4M7PA 5FV7A 4FDTA 4RTJA 5ETJA 2C7RA 1FNBA 2IEIA 5F76A 3GVCA 4ZWNA 2GX6A 4IHJA 3MAAC 1ZZGA 4YR7A 4YMUA 3FWPA 3VYUB 1WPXA 1F8UA 4OJTA 2VJOA 4JI6B 1WHTA 2AD1A 3GLRA 3HCOA 4EVIA 4AQDA 3EVBA 4HMOA 4LDNA 1E3TA 5JCPA 1NMYA 2B36A 2HO4A 3O1IC 4GPAA 4J6EA 5DWVA 4CZ2A 3A1FA 1BGXT 1U5AA 2E9SA 2XR1A 2BVNA 2YWBA 7REQA 2EZ8A 2NTEA 4MW2A 4XYBA 2I71A 4XKJA 4IQGA 4O2AF 4FYYA 1LNZA 3DBLA 1HFWA 1XBTA 1PFVA 2P9ZA 1XJWA 4GMDA 2BM8A 1NJ6A 1DG1G 2R8YA 1DRUA 4BLVA 5DB4A 4AJLA 2D2XA 4YCDA 2R2GA 1XZNA 4L02A 3IURA 1KJJA 5DIFA 2VJPA 5AUPB 4PPGA 5F3DA 2IY9A 1H3EA 3SDBA 1T8YA 1ZOIA 2Q1YA 1BS9A 3HBFA 4POAA 1GGEA 4AN4A 5LP6A 1E0AA 3Q0IA 4QULA 1EI9A 1WCYA 4GGMX 4QDKA 3NKFA 3OG9A 4GVXA 4M53A 4OK3A 1XXHA 5CA0B 3V4RA 5HX7A 1IOVA 3BIOA 2SNIE 5HKOA 1NV9A 4JX8A 1RJGA 4R9SA 3UAGA 3IVRA 4Q4JB 4EJSC 3DLTA 4Q9HA 3EOAI 3N86A 4EUNA 2F17A 4ETIA 3G5MA 1KE2A 2AG0A 4JC0A 4LXHA 5I9MA 3PU6A 4DSAA 3KETA 2LW7A 3ILYA 1JHDA 2ZYIA 5A3QA 3PGA1 1U2GC 1YACA 1CEQA 4NV1A 4QO7A 3H8VA 2GBPA 3MLAA 3A26A 4WXHA 3P0HA 4YQFA 1QONA 1TM3E 2PS0A 3FNEA 2ODBA 5IJ0B 1LVHA 1CLEA 1JWBB 4X7MA 3DE4X 1AK2A 4M2LA 1Q11A 3KQWA 4FNOA 5JI2E 2BGGA 3QVSA 4BNIA 1QK3A 3UYLA 2PO7A 4TYQA 3HGTA 4IX9A 5B3JC 4HAUA 3QOWA 2TMDA 4UEKA 1F8FA 3GRAA 3FHJA 4K2AA 4KV7A 4M38A 3I2YX 5HXAA 3PEYA 4GPEA 2D7DA 1IM2A 2BBOA 3ZDYB 5AW9A 4CMCA 4BMDA 2KW5A 3QVWA 5K20A 1QQ6A 2CLKB 4WDQA 2NUTA 2NT4A 1YR8A 1IWOA 2LIVA 3GGJA 3PFKA 4HGZA 3VMMA 3D2LA 2BGJA 3P0FA 1K6XA 2BL4A 4ZMBA 1GT6A 2NZ8A 2I6XA 3ESXA 4YT8A 3CS3A 4XEHA 2C1EA 1GZDA 2FMTA 2QRVB 1CEYA 3CVUA 1PR2A 1OVMA 2HQSA 1W36B 3QW2A 1KMNA 2AE2A 4B6FA 4ER0A 2OKCA 4ENPA 2F4VB 5GY7A 1U31A 2A4KA 3L8HA 4FMCB 3TYXA 1IZ7A 1R88A 2NU9B 3BXHA 4AROA 2WNIA 4PTYA 3IBGA 3ASZA 2GJKA 5BSGA 2XDWA 1P2UA 2QRLA 3FYHA 4J07A 2LZ0A 2HFKA 3B85A 3TOSA 4C01A 4ICIA 3B8EA 4ITVA 8LDHA 2IOFK 3AO0B 4PLFA 1ZSVA 1KYIA 1XSEA 3HKDB 2UYHA 1RRCA 1KVUA 3EXIB 3GK3A 4QLBA 4J0DA 2Z98A 1P4AA 3DONA 1Q1EA 2H4JA 3ZWPA 4B71A 5ITSA 3AY6A 3WK6A 4BX3A 1AD2A 3JYHA 3PQ7A 3T7IA 2V5AA 5T5QA 4AW9A 1Y1PA 2I6TA 3BH6A 1L6IA 2QRVA 1TA9A 1YB7A 1L7NA 5I9SA 1K7XB 3EASA 5JSZB 1I0LA 4JFRA 1F51E 3ZS9A 2YHIB 2C4WA 1VB5A 5EIWA 2WVGA 5F2OA 3SS7X 3WBKA 4CKEA 1HYGA 1DC7A 1IEVA 1XD9A 1U2TA 2BFAA 2A3NA 3VZQA 1E1RD 3WLKX 3SF0A 1U2DC 1YZVA 2XTJA 3CBGA 4Q9AA 3CH5A 1XO1A 2JLSA 1VSVA 4XM0A 3AM1A 1ECFA 4ZQCB 2OHFA 4Y9SA 5H3CA 4P54A 2WJIA 3T9DA 5CHEA 2CXRA 3EIUA 3TQIA 1EFPB 5ALWA 1L4BA 4HYQA 3HA2A 1YL7A 2KYRA 3RANA 1K6JA 3KDAA 1GZUA 2GXSA 1CUCA 2YY5A 1KGDA 3HR8A 3GCDA 2Y93A 1TZKA 4DB4A 4RTLA 1FU8A 2QVLA 3DFFA 4QDZA 4MWEA 4GPZA 5LWQA 4H35A 4IY1A 2AKEA 2JFQA 5LNK6 1T6YA 4EARA 1PR6A 1UFQA 1NW9B 2A9OA 3LM8A 3MVEA 1V9LA 4MW6A 4YDSA 1ISHA 3FTCA 1GL9B 1XAJA 3RVMA 2EW1A 4EG4A 2G0TA 2BFWA 2C5SA 1B0UA 4MMXB 3KHTA 5B57C 1KQPA 1OF1A 3HU3A 5CDUA 4O4JF 4EGJA 3AM3A 3HUFA 2FSHA 1COWA 2CLEB 4GD3Q 1JJAA 4I08A 1SUIA 3ME5A 4P3NA 2XMBA 4U1RA 3S5UA 4NOMA 3NM6B 4E7PA 4DMGA 1Z36A 1K3TA 2QL6A 1FU7A 5H8WA 3U4QA 2JH8A 3KAPA 1DO2A 4DJFC 1TGYA 2PKRA 4IQ8A 2W2MA 2WVHA 3MWEA 5JXGA 3THXA 3W5AA 2G36A 2O52A 3ETHA 4JEHA 4OI2A 3U4GA 3PX7A 1RFGE 1RI2A 4R8SA 1HBJA 1XQXA 2IS4A 4G1MB 3PVZA 2AN4A 2C1ZA 3A6FA 1P33A 2HJRA 1AUXA 4M9XA 2FMKA 4KK3A 2OXTA 4F5WA 4HAWA 4TZKA 5AJVB 5BUCA 4C5BA 4KGDA 1W4ZA 3KZVA 3OJXA 5LQCA 3K9HA 3COJA 4MMYB 5KC9A 1G8SA 1WDMA 3SXUB 3L84A 2EJVA 2YWFA 5EHIA 2B3TA 4FHDA 1T6BY 2BEUA 2E85A 2JFHA 3HVIA 4RMJA 5HJ2A 4BNLA 3EIXA 1MZVA 3RWOA 1E2FA 1JFLA 4WRRA 4LWZA 2NO0A 5HM6A 2UUAB 2HIHA 5U1PA 4Y2JA 4LFCB 5AKZA 1CZUA 3UHFA 1V8FA 3V8PA 1EGMB 4M36A 1IZ8A 1LJLA 2DTEA 2H0AA 2UVPB 5BSWA 4DR7B 2L2QA 2OB1A 2A8YA 3QJYA 4M8LA 4W5OA 2P6MA 1KDPA 5LLDA 1OWMA 5DPMA 1T2DA 4R1OA 5E7QA 4A16A 2JHGA 3CF4G 3DWFA 3EW7A 3PLRA 1B8UA 4LUCA 3HUTA 1D9ZA 3GLIA 3OKPA 1VJTA 3L8ZA 2JCVA 5TS3A 2CL5A 3PYLA 3KZCA 3IQGX 1ZC4A 3RHTA 1QPZA 4IH1A 3VHQA 3ZDDA 1R6UA 3SBOA 5C18A 1P62B 2VZ0A 2FG7C 4DQ0A 1PD1A 2F3TA 2WV7A 2Z9CA 1IB6A 2NVUB 3HMKA 1IMOA 4LVOA 1JHOA 2FFHA 2VUIB 2REOA 2W9XA 3D1VA 4QPJC 2IPMA 4HV4A 5FNVA 5LOVF 1WDLA 5DNCA 2C7QA 4V1CA 5ALNA 4EZEA 4L8WB 1U0OC 2GD6A 4YRKA 2AFHE 4GU5A 2KSQA 4BO7A 2W0MA 4OLBA 1KPGA 2ZS8A 4ZA2A 3WSWA 3QPWA 1JGTA 2Q6VA 2QX9A 4E5YA 1OH5A 4KIGA 3EQ6A 5LJIA 2NZ2A 4JKYA 1ADBA 4BOYA 4HFNA 1XRQA 1ZWLA 3OIVA 5JADA 1YRYE 3W6NA 5CFOA 3P9KA 3NHYA 2V6IA 3E05A 4CCWA 5LM3A 1IBRA 2O2XA 3TE6A 4Q02A 1KIAA 1XMIA 2QJOA 3OZFA 4N76A 1T24A 2CZQA 1VHTA 2Z5GA 4KOAA 3UGQA 2H7XA 1O89A 5AJUA 1MIOA 6ABPA 4BUJA 1ZPDA 1A7AA 5IX8A 2UYGA 2AWOA 5CM2Z 2O0HA 5TQ0A 1A9SA 3K4QA 1ZI8A 1UADA 4D57A 3TUIC 2FZGA 4UHFA 4M60A 4B4VA 4DMFA 2JHAA 1SUFA 2ZJ7A 4RKQA 3ND7A 4ZAFA 4MS1B 1KDTA 3RKSA 5JJIA 2AHOA 5TJ9A 1YAHA 3QSYA 2Q4EA 1HK7A 4OHRA 5TMBA 1KOLA 5A5DA 2ZJ4A 3EB9A 4KI7A 4CLXA 3NIBA 2P2CA 2CYBA 1N1GA 3ORRA 3M6MD 4UU1A 1HT1E 1TUBA 4D8UA 3WI7A 4HDKB 1J2JA 1U4SA 1SULA 5I7FA 4Y2RA 2VYFA 2UXCB 1KO8A 4L6AA 4Q4HB 3ER9A 3AI1A 2XBLA 3UK6A 1F1BA 3GR6A 4MPRA 5FWYB 5TT1A 1M1YB 2UZ1B 3NYIA 2IPNA 721PA 2EZUA 2FPXA 2ZRGA 1EGVB 3RVBA 1XE3A 3IFSA 1I7DA 2G5CA 4PTLA 1M2JA 1KI6B 3THSA 1UPTA 2ZVDA 2YHUA 2WTNA 1JTVA 1EK2A 1GDDA 4JZKA 4TL7A 1JFFB 3P4UA 4MA0A 1A77A 4O3FA 3NEAA 5JG7A 3SJZA 2VDLB 4C0XA 3HFSA 6REQB 3E70C 4HAXA 4ZVNA 1YKGA 2K2QB 1O03A 2ONKA 2CUKA 2SKDA 1ZIOA 3EG5A 1USWA 4W7HA 4RAQA 4Z8YA 2R86A 2YVLA 3BD9A 3E7DA 3LC1O 4L73A 2W58A 3FPKA 3CGGA 4KPUA 5AJWA 2Q5JA 3RSLA 4YIHA 1CEEA 1YS4A 1UM9A 1W94A 4D82A 3JWGA 3HYLA 2H65A 1IG0A 3B1YA 3QFRA 3FA2A 4LJ4A 3S40A 4PYRA 3TD6A 4YT4A 1D0IA 3LX5A 5G0UA 1I2MA 2I6UA 1HL3A 1OBCA 5BPFA 2QMZA 3E0QA 5K03A 3FPHA 1QNFA 5HE8A 2HHJA 4GZMA 4EJFA 3LIIA 5J5AA 1G42A 5CDTA 2EW8A 3MOGA 2P41A 3ZLJA 4EO4A 5KKAA 2GJAA 3HB1A 2BLNA 1KFJB 4WXRA 3RIHA 2JCYA 2QYTA 4IOLA 5EC8A 4YRPA 3AFMA 4DRXB 3K0EA 3GUHA 4I9UA 4DSZA 4EG5A 2DETA 2D5LA 4DW8A 5TE9A 2HA4A 4I5EA 2FK7A 3LLMA 3ZE9A 3ZCQA 1E9DA 4M8KA 4DY6A 4S3MA 1F48A 5ENZA 3WWOA 3BK1A 2NLOA 2HV8A 3PVSA 5DSTA 4DLUA 4W9NC 1PJAA 2QSJA 1KEUA 4M0FA 1WHTB 1D03A 2WIAA 3D2AA 3B1FA 4LXGA 4HAZA 4MROA 4W82A 3QE0A 2KLBA 3GPCA 3LBIA 3M9LA 4KNWA 5EWMB 4Q19A 4KSYA 2W6QA 1U63A 4EQ6B 2I4IA 1CFJA 5C8YA 1JL3A 3RTEA 5ALEA 2N75A 4INAA 1OT3A 1X7XA 2YV4A 5DN6A 5IKMA 1QVVA 2J0EA 4ILKA 2Q99A 2QTZA 3QEAZ 1Y1LA 4CCYA 4CIXA 1UKYA 3MC1A 1YQQA 2VDKB 5FBKA 4EFLA 1U2EA 4PX9A 1BFKA 2VNIA 1J97A 5BW4A 4OJKA 3UMGA 4Y1GA 1JYFA 1BQEA 4CMAA 3LX6A 1M3SA 1HDEA 3RIXA 4C2TA 3SCZA 4H7IA 5K51A 4OK5A 4QWWA 3RR2A 3T35A 4BHTA 4EA8A 2VF7A 2ORWA 4QQ8A 3CR3C 1QF7A 4YCAA 2EGUA 4N5IX 5FTMA 3RVPA 4ERNA 4BLQA 3LHSA 4DR1B 2FWMX 4GX5A 4ND8A 3TQHA 2P6OA 4JU9A 1WR8A 1DO0A 1PG5A 1LRJA 1Y3HA 2LXNA 1LPBB 5KTOA 4IGEA 5I7HA 5JFOA 3RS9A 1CZOA 2ETXA 3D54D 1QHXA 1NAIA 5E3HA 1HEYA 2CE2X 4MV1A 3WFZA 3F2VA 1E1CA 1I6LA 1H3NA 1E7MA 2PWZA 1GFWA 3TZLA 5ICMA 1D2RA 1PN3A 1HRKA 4MQ6A 1N36B 4HMPA 2YWJA 3B6IA 2CWWA 3DZIA 1WCV1 4JB2A 4JEMA 4AULA 4EUHA 1I9GA 1PHPA 2Z1MA 3RC9A 1DCFA 3EDYA 5AT1A 4JXJA 1LPNA 2ZYUX 4L0QA 1IBMB 3R5KA 3LCRA 3EXAA 2GM4A 1GPMA 3TTWA 1J1IA 4UDXX 2QXTA 4U39A 1L7RA 1C8LA 4ENRA 2RB4A 3ZWOA 5CXUA 2G06A 3S1AA 5JC1A 3TKLA 2HDOA 4OGWA 2QUKA 3MFQA 4ZOLB 4LI0A 1VL0A 3ETGA 2C2XA 4P8RA 3ABIA 3RFTA 1WVMA 4JR2A 3V97A 4MQ4A 4D4IA 2ZB4A 3LCJA 2WBLC 1R0XA 4EJ0A 4Z6KA 4EHNA 4F4JA 1JB9A 4JJIA 2QUAA 4GMXA 1YGYA 4L5BA 2BGLA 2TYSB 3WQSB 1R5JA 1LLDA 5A5GA 3IJ5A 3ENZA 1FBTA 4FQ5A 1PE0A 2FPIA 1WNFA 4LSGA 1CW2B 1JG1A 3OKCA 2YOFA 3H1PA 4UBNA 1TM2A 1NXPA 3GNTA 3O8NA 2SKEA 5EESA 4YJDA 3FVVA 1EUQA 5KOJB 4NBRA 1JSRA 3OLQA 5TSDA 2CZGA 1XMPA 2EKZA 3WLNA 4AS3A 3IUQA 4MAMA 3S2GA 2A0KA 3Q15C 3JZFA 4P53A 3GJYA 5CPBA 3SE7A 1A1SA 1LX7A 2R62A 3GOQA 1MEEA 1X1AA 1HMYA 3E23A 3A2LA 4RA6B 1CUZA 2GD0A 1YRWA 3L1UA 3R0XA 3ICQB 4TKUB 3WKEA 3H17A 1T15A 2AX4A 2D13A 5FR2A 5EIEA 3E48A 2Q5HA 3OPQA 2ZZMA 1VJDA 3BD6A 1NNEA 1IVSA 1AGRA 1VJRA 5CT5A 1L4NA 3OI7A 4WXMA 2C4TA 2RHJA 3S2YA 3IIKA 4DSTA 4JJ7A 2WP0A 4UAUA 4HDMA 3B1VA 3OX1A 3L4BC 3AF4A 2D1TA 3HN2A 3QVTA 1WD5A 1SCUB 2HYDA 1G21A 4S1NA 3W8NA 3AF0A 1E7WA 2J0QA 3VAYA 2AT1A 1SAYA 4A10A 4FFMA 1N0IA 4N18A 3IO5A 1KK0A 3GELA 3NUQA 4NMLA 2DPGA 1XPJA 1ZJ4A 3F8SA 1H0SA 2AMVA 1EHYA 2ZWIA 3DZGA 3LO5A 4ZT4A 4TV8B 5C2JB 1VKHA 4OSPA 4D9NA 2X0EA 1ZD8A 2MINB 1QH0A 2XNJA 4LTDA 1CQIA 2AS0A 1BC5A 3FAZA 1XZBA 1FMFA 2XMDA 2I2BA 1U7ZA 3HBAA 2J5RA 3L8DA 4G4JA 4LG1A 3UMVA 2P9CA 1LX6A 1OXBB 4LZJA 2C3MA 5IT5A 2F3RA 4M9RA 1BRMA 3A7EA 2PA0A 1MH1A 3KSDO 5LKAA 1YS1X 3T5PA 4HLUA 4P86A 4HNUA 3M5CA 5JSFA 5IM5A 3IKTA 2OFWA 3C39A 1OXXK 1AKEA 4C08A 3BSSA 2EU8A 2GBFA 5CB4F 3OU2A 4C0JA 3OICA 3M4XA 2HT1A 1JECA 4G8JA 3MTGA 3CXRA 5F73A 1XN1A 2OMEA 1RKQA 1W88B 1M1NB 2PQ6A 4RLFA 2CLLB 2QRMA 4RTQA 5F98A 1XC7A 3ZTYA 3P0RA 2NG1A 1Q2XA 2A5DA 3AP2A 4LXTA 4MW4A 4P93A 3A70A 5ALSA 5BSVA 2D3TA 4B73A 2QY9A 2WQZA 3OZEA 3ZWQA 2A84A 3ONDA 4WZAA 1EX7A 1ST3A 4ARZB 1SC3A 3TRKA 1CQJB 1TZJA 3ON5A 5ALHA 3R8XA 3GRPA 4N5LA 1D6MA 1FX0A 4WLUA 3GJ3A 4RENA 1DBIA 2E48A 1N3YA 4ZOCA 1YNSA 3IVGA 4LYJA 1EGQA 3EH1A 1KKMA 4DNOA 4LOIA 4D4HA 3BXGA 4JMLA 1Z4LA 3T54A 2HNAA 1SUWA 4MOWA 3IB6A 5CGQB 4ZV4A 4MVJH 4ZZ3A 5AK0A 2FPPA 2GN1A 5KNBH 4CM7A 2WF6A 3NASA 5IPFA 1AXRA 1P4SA 1QV7A 1E8MA 1GCAA 4G65A 1ABEA 4I4IA 3WBFA 1RBQA 2YMLA 1CUIA 2CMKA 3Q9LA 4BC1A 1BU5A 1SOMA 3AU8A 3DEJA 3NT4A 1UK8A 2V4MA 4COKA 3GCZA 4LHWA 4EUKA 4EB3A 1VI6A 1ZD5A 2A9RA 2VJCA 2AXEA 4G5GA 5JAHA 3VTAA 2G9NA 3EPJA 1BVYF 3DQPA 4BJHB 4EKDA 3IUPA 5A2GA 5NLLA 4ZTUB 3JD1A 4QYSA 3K15A 4E22A 1BEEA 3RU9A 1JKMA 4QYTA 3DW3X 3RUHA 1HG1A 2X9GA 1GCUA 1L7QA 2FFBA 5KQSA 1BMDA 5DM0A 1SM4A 3C6YA 3Q8XB 3CT6A 2QSZA 2HHAA 4OF4A 3V8QA 1Z2DA 4OB8A 3L93A 3IQEA 4TMZA 4O3MA 4PQRA 2PIAA 3AEQB 3BIJA 3IP9A 3I8SA 4R2LA 5JVDB 2IY7A 1Z3CA 3PQEA 2FRVA 3HM2A 3UA3A 5J4VA 5JFTA 2BMVA 5BORA 2XEDA 4M1WA 5ITZB 4X1IB 3MJHA 3NAZA 3ZJVA 1XWWA 4DV6B 4YCJA 4HEJA 2F8SA 4BZXA 1C7IA 1LQTA 1SEPA 2YYAA 4BFZA 1Y34E 2FF7A 1OFUA 4D42A 5AUNB 3ICEA 2GCGA 2EQ5A 3GZ4A 1U1CA 2X4LA 1JR2A 2NU6B 2AVNA 1SJ9A 2GEKA 1HT0A 1T8WA 3BFXA 1XEXA 4INPA 1YOBA 1LNQA 3RVNA 4G89A 4LX8A 2FW6A 5F7ZA 3SX4A 1HC7A 5D1HA 1MB2A 3SS9X 4BLSA 1UAAA 3VDMA 4RE5A 3OBIA 4YAEA 4DUPA 4G9BA 5SYNA 4CNQA 3I32A 1B1AA 4BQNA 3DMTC 3HK2A 5IFKA 1EMDA 1EP3B 1IAQA 3L7YA 4H59A 5DHUA 5AW2A 3UJ8A 1RQPA 4QGGA 4CM5A 2FY8A 1NP6A 1J4AA 1CZNA 1EA5A 1W5AA 2C2MA 2V5VA 3K2BA 4U3JA 5CFRA 5JRDS 1SZPA 1XELA 3LBYA 3MWYW 4O29A 5LQDA 4PFJA 1Y9ZA 1TRHA 1TQDA 3DBRA 2GZMA 4S2EA 4EYOA 3AI2A 3B8HA 3QXJA 1YHZA 4UXJA 2QTHA 3D7LA 3DYIA 4PXSA 4UHEA 1G3UA 1LI7A 4BKQA 1AKWA 1I5EA 4PZ0A 1QH9A 3N7AA 4C6HA 4LF9B 1NU8A 4J0EA 4Z51A 3JQ8B 2G4LA 3L79A 4MW5A 3NIGB 2RAUA 3SN6A 2NTVA 1AUPA 1PBNA 3PC8A 3U1TA 4K9LA 3L46A 4Q47A 5IVDA 1LC0A 3DWIA 4NH0A 1JH9A 1Q0HA 1S4QA 2FUCA 2QMHA 3I34X 5FXMA 3UFXA 2D3WA 2CJPA 1U2ZA 2J4FA 2R5FA 3AC0A 4P0TA 4CFYA 4ZJYA 4ZYUA 3MFYA 4BP1A 2WINI 4H3HB 4CKZA 2M2IA 3J80A 5B4UA 5DI9A 3EWIA 4UE6A 3CINA 2EHDA 4N82A 3U19A 1M8FA 3X2EA 1XL0A 2EG9A 4N54A 3KZXA 5JD5A 1HFEL 3GFQA 4JC5A 5G