4DQXA

Crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
255
structure length
255
Chain Sequence
b'SMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEIGSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNGGGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFAEAKDPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSIGNHLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable oxidoreductase protein
publication title Crystal structure of a short chain dehydrogenase from Rhizobium etli CFN 42
rcsb
source organism Rhizobium etli
molecule tags Oxidoreductase
total genus 85
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dqxA00
3ROMA 3Q2KA 1P77A 4DPLA 3TZQA 5KVSA 3DAGA 4E3ZA 2WSBA 4FSHA 3HG7A 3JD2A 3GZNB 4GGPA 1WDLA 3QSGA 3L9XA 3ETGA 2OP1A 1SNYA 3K73O 4OSOA 4PZEA 4DGSA 3U5TA 2H5LA 4I9NA 1LBEA 3N58A 4F46A 4L73A 3W8DA 1YKFA 2PTGA 4MKRA 3OIFA 1UXKA 2IZ1A 2UUOA 3H65A 4OXKA 2GRAA 4PLHA 1N5DA 2WJPA 3GG9A 4YJDA 1CIVA 1EUCA 3AW9A 4B4UA 2GR9A 3KEOA 3L4BC 4NDNE 1GU7A 3ZU5A 5U1PA 4YBZA 2CVQA 3TN7A 1ZW1A 3UFXA 2DBRA 4E32A 2X0JA 3H4VA 5L7YA 4HFNA 1CRWG 1Z73A 1E3JA 1BXKA 4BKRA 2VN8A 3SXPA 5BT9A 2UV8A 3C7AA 4HFMA 4BOYA 1QV7A 2VZ0A 2JD2A 5CEEA 3GY0A 1E1NA 3CXRA 3AWDA 1NFQA 3DONA 4G65A 4PLFA 2OHXA 1D3AA 2AQHA 4CMKA 4DMMA 1YXMA 3NJ4A 4DTIA 2VWPA 3JQFA 4PLWA 3HDHA 3MZ0A 3O38A 2C07A 4NI5A 2FWMX 3FCOA 3JQ7B 2QYSA 1GUZA 2OP0A 3B70A 4IZHA 4TRRA 2NACA 3AM5A 4DIOA 3HHPA 4NU6A 1Y9EA 4CR6A 3TZKA 3GDFA 1P45A 3HSKA 4BO1A 4GAEA 5G0UA 3UXYA 4R9SA 2AEFA 2E4AA 3BTUA 2G5CA 4PVCA 4DQXA 1M76A 1U3TA 3ETEA 3GDGA 3AI1A 4HFJA 1GQQA 1ENYA 3H5NA 1M2WA 3DL2A 4BQPA 5KIAA 1FXSA 2GUGA 1UH5A 3EAGA 1V3VA 4W7HA 1JAYA 5BQFA 3H9UA 1EVIA 3GNQA 4AJ2A 1BXGA 2Q1SA 4MKZA 3CZRA 5ENVA 3S1LA 2BFAA 2AEJA 3AJRA 4PZDA 3ULKA 4BNGA 5C7LO 4XGKA 3EZYA 1D8AA 4B7XA 2Q99A 3L6DA 5I7EA 4E2YA 2BFPA 5I9MA 1ZNQO 4Y6PA 1P0FA 4P4GA 4DVJA 3EZLA 4JK3A 4WE3A 3RBZA 1U3UA 3HQ4O 3VPHA 1I30A 1YO6A 4ZA2A 3INTA 4IJVA 3BMQB 3GRPA 5DCWA 2VOEA 1C3VA 4PLTA 3EGOA 1ISHA 4AJLA 3LVFO 3NX4A 3I9NA 4GLOA 1F8GA 3RUAA 1ZEMA 3MCVA 2ZQZA 3G1TA 1J0XO 4QXMA 1QR6A 3DZKA 3BMCA 4OL9A 3WQSB 3S2EA 4CMAA 5HTOA 2C82A 4MP6A 2B0JA 3SC4A 1HDYA 1T1RA 2CY0A 2W90A 2WDZA 3QQPA 4RZHA 5JW6A 3P2OA 2DKNA 5C37A 1IB6A 1DHTA 1H6BA 2VUTA 4OKNA 4Z3KA 4UVGA 3DHYA 4RPJA 4ZJUA 1C0LA 3UF0A 4C7JA 1HT0A 1ISGA 2CUKA 3PYXA 1S6YA 2VQ3A 2O3TA 1T2AA 3FNGA 4JQCA 2Y93A 2G0TA 3Q9UA 4TKLA 3SLGA 4LSMA 1E7RA 3G0OA 5TX7A 4XRRA 4MVJH 3SX2A 2IYPA 5MDHA 4R51A 3GHHA 5JS6A 3ASUA 1PSDA 1KOLA 2Y1EA 1G6KA 1MFZA 1A7AA 1M75A 3DOJA 3B1FA 1LNQA 4WCFB 5IZCA 2ZIZA 5JAIA 4NMHA 4ALLA 4CLHA 3AFNA 2IEDA 1EBFA 4WLOA 4RZIA 4EZBA 2GO1A 2OMEA 3WMXA 3PWZA 2FY8A 1HWYA 1X1TA 1LRLA 2DTXA 3PGJA 4KMSA 3MTGA 5JMWA 1F14A 4CM3A 4BNUA 1NVMB 1PGQA 1QSGA 4PCVA 3TFOA 3M2PA 3QWFA 4FDAA 1LQTA 2X5KO 4W82A 1PGJA 3JQAD 1R15A 4FC6A 1A5ZA 4WEOA 5CPFA 4ZICA 1BRMA 1WXDA 3Q0EA 1LA2A 1ZBQA 1I2CA 3NT5A 1E1KA 3O4RA 1ZK3A 2SCUA 3GN2A 1U3WA 4DXHA 1NM5A 2H6EA 5B4VA 4E31A 1MX3A 4YJFB 1X1EA 3U4HA 4K6FA 4RDHA 3QV1A 4Q3AA 4YRAA 5I9NA 4BMVA 5TT0A 4XB1A 5TS3A 3O8QB 1J49A 4DUPA 4LRTB 4FIZA 4CQMA 2PFGA 4Z0HO 4R3WA 4I5EA 3PJEA 2BGLA 3C1TA 2HCTA 4Q39A 2X0NA 1QYXA 2ZJ1A 3E48A 3MEQA 3PFFA 2EXXA 4W9NA 3PRJA 1KVTA 4XCVA 5BNTA 1JLLA 1ZKMA 1XIVA 2W98A 1WDMA 1NPYA 2PZKA 3WDSA 1Y9AA 4UEOA 2OOSA 2EKPA 3U4IA 4E2WA 3SVTA 4D7AA 1EBUA 4JP2A 1HDZA 5CEJA 1W6UA 3FF4A 2V7PA 2HSDA 2HRZA 3PPIA 1UDAA 2Y99A 2VZ9A 5G4KA 4YYZA 2NTNA 4KQXA 4R1TA 4J7XA 5CAEA 2O3RA 4JGBA 2V6GA 5FYDA 2AMFA 1OMOA 4WJZA 3KSZO 4DPMA 4HKTA 4CR7A 4NG5A 4PG6A 3VPFA 3QIVA 1PZFA 1DFHA 2A35A 1Y8RB 3I9JA 1T2EA 1EMDA 4B8WA 5B4TA 1DXYA 2PV7A 4JJGA 5JCXA 3G3EA 4AJIA 5JCJD 1LLCA 2HO5A 4CM8A 2B83A 3C85A 3H6KA 4YRBA 5K9ZA 1PEDA 3JD1A 3ROPA 3ZWMA 2WE7A 1DEHA 2I66A 5JO9A 2VRCA 3ZNQA 4RPHA 3IIEA 2NU7A 4FN4A 3P19A 4XQGA 2BD0A 4TVOA 4TKMA 3RKRA 2ZYGA 3KYDB 3QVSA 4CMIB 3C24A 5JC1A 3V5NA 4Z6KA 4BIIA 4CPDA 4J7UA 5TF4A 2FZWA 4D42A 5T64A 1FMCA 2I5PO 3DC2A 4NH4A 1TEHA 3EYWA 3FPLA 3H5AA 3JTMA 4JN6B 3DAPA 1VJ1A 3D0OA 1M66A 1AGNA 2J3JA 2YFHA 4G5HA 4MOWA 1I3KA 3I4FA 4WOKA 3OA0A 5KWEA 3FTNA 1NVTA 2QG4A 1LC3A 1LSUA 2W2KA 2O3JA 1P0CA 4ID9A 4Y67A 1HF3A 5A9TA 1ZXLA 1E3WB 1JN0A 2EKLA 2Q2WA 3FNHA 1U8XX 1OC2A 5TJHA 4FBGA 1C1XA 4WUVA 5CHEA 4AFNA 4MIOA 4XQEA 1BW9A 3CTMA 1ORRA 3PDUA 2VHXA 1KC3A 4LCJA 3GUCA 3WX0A 3K2EA 3JYOA 4OOEA 1V6AA 2VT3A 2Y0DA 4FB5A 3LT2A 2OL4A 1PWXA 5IJZA 1ENOA 2XOXA 3ONDA 2B37A 3QVOA 3WOHA 5KNLA 1ZCJA 1LDEA 1LX6A 4RQUA 3ROKA 1GTMA 3DMTA 4EBFA 3ZU2A 3DBVO 3RROA 4E5KA 4GWKA 4FD3A 2RIRA 3E6AA 4ND3A 2D0IA 2DAPA 2HAEA 1YB5A 2ZCVA 3WYCA 1PJTA 3EC7A 3L6OO 1O0SA 2B4TO 3RUDA 3B1JA 5G0VA 5AXAA 3BXXA 4HWKA 3PGXA 2Q4EA 5JE8A 4LMRA 2PK3A 3BTSA 4PFJA 4YAJA 4PGFA 1J6UA 2I3AA 1U9JA 2IODA 3E9MA 3WQRA 1UAGA 1BSVA 1BVUA 4UVIA 2IZZA 4CMHA 4CV2A 2BMAA 1BXZA 2NU9A 4MVJM 2HQ1A 1V35A 1ONPA 1V3UA 1R4NA 1GEGA 4CLOB 3GHYA 4RDIA 2PGDA 2VOJA 4LMPA 1PJ2A 2P9EA 1EVYA 1KYQA 4QO7A 4CV1A 2BFMA 2JFGA 3C7DB 5TRTA 1UZNA 3BTOA 1IPFA 3VAZA 1GUYA 1XU7A 5DCUA 3MJ4A 1CEQA 2GZ2A 2VYNA 3JQGA 1NHGA 3QWBA 4U6SA 3RAJA 1E3SA 1K6JA 1XG5A 1H6AA 4J91A 3GVPA 1LC0A 2R00C 3ANMA 3D1LA 3PHHA 3A4VA 2Z1MA 4TZTA 4YT2A 1R12A 3D4OA 1N1EA 4O5OA 4CM9D 1JKFA 3F46A 4IBOA 2WE8A 3DAFA 4RVFA 3ZV4A 3KUXA 3HZZA 1TVEA 5FFFA 3RUFA 5CDUA 3N74A 4RVSA 3RIHA 4E30A 4KUHA 3UUWA 2GZ3A 4CLDA 1KS9A 1JKIA 5L45A 4KDEA 1WMAA 4RORA 2YZ7A 3VH3A 1U2GA 1IE3A 1RM3A 1E1LA 1XA0A 1Y81A 1TB4A 1GCUA 4K6CA 1SEPA 4R5HA 5F5LA 4L4XA 1X7DA 4HP8A 5K6AC 4N54A 3OM9A 5T57A 2IZ0A 4Q3DA 1V0JA 2VWQA 1XYGA 4RF2A 3WXBA 4O6VA 4J2OA 1HKUA 3UKOA 4XQ9A 5TNXA 1U8FO 5TJ9A 4B79A 3K5PA 1EDZA 3W8EA 3QHAA 2A92A 1K2WA 4IDBA 1WZIA 3CUKA 5DCYA 4OOFA 3QLJA 3GAFA 1R66A 2Q1UA 4Z0PA 3HFSA 5DNAA 4BV9A 3U09A 4BHTA 1LJ8A 3FN4A 1ZK0A 1MXHA 2BKAA 5KVVA 2WYVA 2JAHA 3PZBA 2DBZA 2EF1A 1ZJZA 1DRVA 1ISJA 3AM3A 1KVRA 1Z45A 4GX2A 2JKVA 4L4RA 2CZCA 1NAIA 3ANLA 1Q7GA 4RF3A 2B5VA 1KVUA 1OZAA 3WB9A 1RWBA 2VHZA 3D4NA 3TL3A 1JKJA 1DFIA 4XA8A 4F3YA 3OQBA 4BNJA 4RJTA 2H63A 1HDRA 1HXHA 2FPIA 4PLZA 4I08A 1RM5A 4QT0A 4GI2A 1GDHA 4OXYA 1L1FA 4I5FA 4CLRA 3OQ6A 3T7CA 5U9CA 1BXGB 4ZQFA 4A5OA 1A4UA 2J3HA 2X7HA 3H7AA 1H9BA 4CUZA 1ZH8A 4ZQHA 5HWSA 3WG9A 4XWYA 1Z75A 4KQWA 4I9HA 1UAYA 4Z3DA 1YVEI 1SC6A 4XIJA 3LC1O 1VKNA 1MP0A 5EMHA 1HDXA 3CE6A 2NU8A 5JYDA 3WBFA 1GZ6A 3DOCA 3MJCA 4CMEA 1LSSA 1PGNA 4CMBA 4HNGA 3K31A 4URFA 3LLSA 1F17A 3OIDA 1LUAA 2E49A 1RYDA 1NP3A 2C5AA 4KZPA 3V2HA 2JCXA 2YUTA 4R4JA 4DA9A 2Q45A 1MV8A 4HBGA 4F6LA 2EJVA 3E9QA 5DBGA 5K0ZA 5CG2A 3GAZA 3RFTA 4GLLA 2E82A 2P68A 3G1UA 3BMCB 4KTVE 4GSLA 2CVOA 3L9WA 1KC1A 4BO5A 5ITVA 4K28A 5MGBA 3H3FA 1B8VA 3KRTA 4UVDA 5ER6A 4J4BA 4DYVA 3F4BA 5JAQA 3MJSA 5G2OA 2HMTA 3PHLA 1B26A 1JVBA 2POQX 2PNFA 3D5QA 3WBBA 2WTBA 1JAXA 3CMCO 4YAIA 3AFMA 3PQDA 1D1SA 1HLDA 4ND5A 1Z7EA 4NK5A 3FSRA 3PIDA 2ET6A 1JQBA 1QLHA 4XQCA 5EPOA 2D3TA 5JYEA 1HTBA 2FRDA 2CSUA 4CMCA 2O50A 1Y5MA 4K1LA 2VZ8A 3VTFA 3WIEA 4YJHA 1XQ1A 3GZ4A 3HDYA 3QWAA 2PZMA 1YL5A 1XWFA 4IINA 1UXIA 5DP1A 1VJTA 1EK5A 4I1IA 3LDHA 4Q3NA 4KOAA 5T6BA 1GYPA 3E5RA 1X14A 3KV3O 4YAGA 3U4DA 1OAAA 2JHGA 2DUUA 4Y8VA 5F1PA 1DJQA 1R4MA 3JQBA 3EY4A 1DLIA 3DMYA 5IFLA 4QQRA 1U3VA 6ADHA 1PJCA 1ZZEA 3ADPA 1GPDG 4LVUA 4H3VA 2DBVO 2IEBA 2VHWA 3RJ5A 2C29D 2DT5A 2YDXA 3W6ZA 5I9LA 2D2IA 1RJWA 4A2CA 5DDIP 4BNHA 1D1TA 3ZWBA 1OI7A 2C54A 3LC7O 4R5MA 5DT9A 4M55A 4J1QA 1GEEA 3GH3A 2JFHA 4NBTA 2BGKA 3D64A 3HFGA 1YE3A 1SMKA 2W4QA 3TZHA 4TROA 3H9JA 3INRA 2GD1O 4XGNA 5DF1A 4YJGA 1DFGA 2PKRA 1LXCA 4B3HA 3IOYA 4KWHA 3GQVA 1F0YA 1Y1PA 3JCZA 5THKA 1R0KA 3WGQA 4QFDA 2X6TA 3DHEA 2PH5A 3T4XA 4BMNA 2O23A 3RC9A 3ADOA 2UDPA 3V8BA 1NQAO 4YCAA 4NBRA 3UCFA 3GVCA 3UW3A 4WLUA 4AJNA 4JX8A 4J4HA 4Q3CA 1ZMTA 5G0SA 1C1DA 2AQIA 4GQAA 4P8RA 2GF2A 4IDCA 3VPSA 2WM3A 4FJ0A 1NPTO 5COQA 5G4KB 5GMOA 4GVLA 2I67A 3DO5A 5FI5A 1PGOA 3KLPX 4FOSA 3X2EA 4E21A 4MDHA 3EW7A 4EW6A 1D7OA 3JQ6A 4ONEA 1PX0A 1KEPA 4LRSB 4BKPA 4BNXA 3OICA 3LQFA 1YQDA 1VM6A 4AJPA 3K92A 1MA0A 1ZUD1 1I3NA 2O2SA 3WIDA 2HMWA 2NSDA 3EVTA 5G0TA 4A0SA 4CM8B 5JDIC 3R6DA 3OHSX 4Z9FA 3WTBA 1P3DA 4MKXA 4CM4A 2FSSA 3MJEA 1Q7BA 1YWGO 5CFZA 3KYCA 4J16A 1NFFA 3GVHA 4BO3A 3DBLA 2FHSA 4BKOA 2PGLA 2JAPA 3ZHBA 1P33A 3U0BA 4M8SA 4XYMA 2R00A 3W6UA 3I9LA 1C0KA 3AY6A 4KDFA 3ZU4A 4IQ8A 4NU5A 2IDZA 3F1LA 2RAFA 4BKUA 1J5PA 3NKLA 2YDYA 2PLAA 4TQGA 3FNEA 3TDKA 2V6MA 1TI7A 3FBGA 1Q7CA 2VUUA 1VSUA 2ILTA 3W4KA 1GPJA 2RCYA 3I6IA 2GDZA 4IS3A 1ISFA 2E48A 1ISMA 1ZSVA 1ML3A 2W2KB 3ZWOA 5KKCA 3JQ8A 2QZZA 1ARZA 1H6CA 3B20A 5GZ6A 4IDDA 5IN5A 3GGOA 1QLJA 4LVCA 3R0IA 5AYVA 1ADGA 1C1XB 5JC8A 2D1YA 4L76A 1Q0QA 4L8VA 4S3MA 9LDBA 2GN8A 3FPCA 4AG3A 5K6AA 3RUEA 4UUNA 2YQ5A 3ZWVA 3AM4A 4Y6SA 2WWRA 4DBZA 4TWRA 1FF9A 1LU9A 2EWMA 4IZIA 5COAA 1EVZA 1WVGA 2FP4A 2YYYA 3GVIA 4OXNA 5ILGA 1UP6A 5B4UA 3JSAA 3ONEA 5BNFA 3LT4A 3ZI0A 2Z1NA 4TRMA 3WGIA 1N9GA 4I9UA 1PZHA 3ONFA 4QSMA 1GQ2A 2JD1A 3WMWA 4J0EA 1EFLA 1P1RA 4J9UE 4O59O 3PHJA 3HB5X 4MVJD 5A05A 3OECA 3BZUA 1YDEA 3GF4A 3PP8A 5FI3A 1LRKA 4XX0A 5A3JA 4IMPA 2DQ4A 1YQXA 3A9WA 3GDOA 1GR0A 1RYEA 2VRBA 4IMRA 3VC7A 2PR2A 3QW2A 1LSOA 4HY3A 3AOEC 1DPGA 4QTZA 3D7LA 5GZ3A 1PQPA 2J5QA 5JCJA 3T7EA 1NASA 4KUEA 3NT4A 1VI2A 5G0WA 4E12A 2J5KA 1HETA 3HUDA 4DQUA 4B3IA 4JBHA 1Y8QA 2B36A 3ITKA 5TSDA 3E8XA 1I33A 2V6BA 1KY5A 5JNLA 1UP7A 5JDCC 4E4YA 1O94A 2X5JO 1R4NB 1G0NA 2HKIA 3DBHA 4OIMA 3ZCXA 3W4JA 1DO8A 4U0JA 3HE3A 3K30A 3CKYA 1WPQA 5DOZA 5A9SA 2PZJA 3E03A 3OH8A 5COBA 4BNKA 1E7QA 2EERA 4CQLA 3G79A 3RUHA 3K6JA 3Q9NA 1X7GA 2EGHA 1CETA 3QJ5A 4WCDA 3IDSA 3JQ9A 3V2UA 3TF5A 1ISIA 3FNFA 5A4DA 5KKAA 3JQGB 3OIGA 3BA1A 1P31A 4JLWA 3RWBA 5T8KA 4WNIA 3OP4A 3OMLA 2BI7A 4NQZA 1LLQA 3I83A 1B8PA 2LDXA 2PH3A 4MVJP 3DZJA 3SEFA 3U3XA 4M86A 5LCXA 1TA4A 1DAOA 1DC5A 1ZMOA 5ICSA 5DZSA 1T1SA 2CNBA 2DC1A 4L74A 4EUHA 1Z7BA 1U1IA 2AEMA 4H7PA 2OGUA 2CVZA 1SZJG 5A5FA 1ZSNA 3JD0A 2PKQO 3PK0A 1EFKA 4BNTA 4EEXA 4NJOA 2X9GA 1PZEA 1H2HA 4BVAA 1IZ9A 2OFPA 3OJEA 3TOXA 3GRKA 2GYYA 3IKVA 3G49A 1I3MA 1WZEA 4NIMA 3V2GA 3NAQA 2FMUA 1DC4A 3C7CB 4HXYA 3GT0A 3M6IA 5A02A 5HBRA 1R0SA 4XZ3A 5C3MA 1ZEJA 5EN4A 3PVZA 2NWQA 3GR6A 5F21A 3L07A 3H9GA 4PZCA 5ITWA 2NTVA 3GOHA 3NT2A 3PIIA 4EJ6A 4L75A 3B1KA 3NDJA 1NPDA 5H82A 2X9VA 5TIIA 2TMGA 4U5QA 4IUYA 1GUFA 3PJFA 5C5IA 1W73A 3H8VA 4RPKA 1DLJA 1HL3A 3CZMA 2GN9A 1E3EA 4FCCA 3ZW9A 2D5AA 3DOOA 4PLGA 3VKUA 5BSEA 3O26A 1NR7A 3S8MA 4AJJA 4WOJA 2NU6A 3R1IA 4W99A 3KXDA 1O95A 4YWJA 4U6QA 1DJNA 4E5MA 2AQ8A 2OXIA 5KOIA 3R3JA 2X8LA 2YW9A 3AUSA 1DB3A 1HYGA 4WGGA 3VH1A 4BO4A 4C7KA 1ZK2A 4KP7A 3LZ6A 4A10A 3U4CA 2GASA 5IDYA 5LDGA 3ICCA 4D3DA 4M49A 4NBVA 1ZSYA 5JLAA 4CLRB 1GCOA 4TSKA 1Y6JA 4LGVA 4YAKA 2AXQA 3WNVA 3EUWA 5T5QA 2I6TA 4D0RA 1PJQA 2O48X 3IMFA 2HJRA 3WSWA 2EHDA 4GL4A 5BR7A 3PTZA 1DC3A 3WGOA 3GUYA 1NWHA 1YGYA 4R1UA 1DIBA 2GGSA 4GSKA 1I10A 3JYNA 2YHIA 4CM5A 2UYYA 3IKTA 1M67A 4ZQGA 1JDJA 2DPGA 3ZHZA 2PD3A 3OSUA 3PEFA 4XYEA 3IJRA 1PS9A 2NM0A 3VVBA 5F1OA 1I8TA 3GFBA 2ZYDA 3L4BA 4FGSA 3PZRA 1LTHR 4IQGA 3TSCA 2FZEA 1P1KA 5LDHA 2Q2QA 1U28A 2X58A 1CF2O 2IRWA 3AUUA 1DC6A 1ID1A 3K9QO 4KUGA 3ZWYA 1Q0HA 2EG9A 1QG6A 3ASVA 3JYPA 1N1GA 4EJMA 3P2YA 5L4NA 2A9FA 4FW8A 1H6DA 3GEMA 3KO8A 3WJ7A 1YBMA 4XGIA 3AOGA 4FFRA 2C2YA 4DWVA 2BH9A 5L9AA 2BFOA 1F06A 1PJSA 3GFGA 4LK3A 3DTTA 4D0SA 1LLDA 3H9QA 2AW5A 4N5NA 4E2XA 4YQZA 1DOHA 4RGBA 3EVNA 4C4OA 1TT5B 5HS4A 1YJQA 2C5EA 3NGLA 1EQ2A 3F6YA 4EITA 5A9RA 3O9ZA 3M1LA 3ABIA 3VH2A 2W8ZA 4Q3EA 3RBVA 5CDGA 4YJHB 5HA5A 1MC5A 2H9IA 5EIOA 1KVSA 2WYWA 3BYZA 3WICA 3A14A 1XDWA 3OBBA 4NJMA 5CP8A 1ZJYA 4Y9DA 3DZGA 3MJVA 3WGGA 3U62A 2PA3A 4DC0A 3TRIA 2WEKA 2A4KA 3KOUA 4J6FA 1EDOA 1PQUA 2WD7A 1YOVA 3FBTA 3HN2A 1O89A 3IUPA 4RL6A 1I36A 2VNSA 4N5MA 3V1TC 3F5QA 3I3OA 3JQFC 4YRDA 1PU2A 3IUSA 1H93A 1U7HA 1H0KA 2FR1A 3CMMA 3QVWA 4J43A 3QE3A 5ICMA 3VZQA 1YL7A 3X2FA 4B3JA 1KVQA 1I24A 1IL0A 1GADO 5JXWA 2ZB7A 2YQ4A 3OJOA 1HDGO 4ALJA 3MWDB 4MP8A 4D43A 2BRUA 4IY1A 1JU9A 1A7KA 5C7IO 2G17A 2CD9A 1DRWA 3KVOA 2PWZA 2VYVA 2UVDA 4E13A 3C1AA 1L7DA 4YJGB 2QIOA 1NYTA 4BNIA 2QQ5A 2X0RA 4BV8A 4FC7A 1QYCA 4J4TA 4QFCA 4ZVVA 3BIOA 4AJKA 3WWYA 1WMBA 1VJ0A 1HSOA 3VKVA 5I7FA 2P5YA 1XELA 3IC5A 1FK8A 4FPXA 1ADFA 1T2CA 2PD4A 2IXAA 5L7TA 2XPCA 3Q3CA 3KSUA 3WSVA 4F6CA 2EV9A 2O3SA 2DVMA 1IY8A 1Y7TA 4DLBA 4N18A 1C1DB 3KYBA 4IJKA 1HE3A 1HLPA 2DBQA 3AOEA 2IE0A 3UAGA 4CUKA 1O5IA 2ZB8A 3ZV6A 2I99A 4XRGA 1YONA 2NUAA 3K96A 2EW8A 1FDSA 2QW8A 3JYLA 1CYDA 2ZQYA 3WGTA 1T26A 3G17A 2NLOA 5L53A 2JD0A 3K2BA 1VE9A 3C1OA 3DZIA 3WJAA 2ZTUA 4ZQBA 1U5CA 4M1QA 2Y1GA 1K5HA 3H5RA 4JNKA 4XJSA 2OZPA 4F45A 5JSFA 2VHYA 2V65A 5CDYA 5JAMA 4Z9YA 5B37A 4CM4B 1I01A 4DBVO 2YV1A 4PG7A 3RKUA 4RLHA 3KYCB 4RV9A 3MWEB 4R54A 2Y0EA 3DBLB 2YFQA 2A94A 3KLMX 3ON5A 4ALMA 4D79A 4YT8A 1Z82A 4E2ZA 2ZATA 5GZ1A 2RBEA 4BO0A 1VL0A 4J2HA 3KTDA 3RFXA 4ITUA 2J6IA 4OSPA 3UICA 4DQVA 4RF4A 5DBFA 2VTDA 4B7UA 3IQDB 3PLNA 3TPCA 2NADA 4BGVA 5TLSA 1CERA 3BMNA 5U4QA 5KJ6A 3Q6IA 4W4TA 3FR8A 3KEQA 1PJ4A 1IHYA 3NYWA 1E77A 1U2DA 2HUNA 3JQ8B 3GGGA 4GMFA 4BO2A 4FGWA 1QV6A 5HM8A 3DZHA 2AG8A 1LRJA 5CDTA 2NVUA 3DZFA 1UR5A 2Y1DA 2JJYA 4BO7A 2EJWA 2Y1FA 1MLDA 4II3A 1A4IA 3W8FA 3OF2A 1QRRA 1PZGA 2UAGA 1MG0A 5BSHA 5IZCC 1WW8A 3GMDA 4NZ9A 4R1NA 1DIRA 2V6FA 3TJRA 2BLLA 2G76A 3OJLA 4HX5A 3E1KA 4OH1A 1F12A 2ZB4A 1WAMA 4HUJA 2R6JA 1BG6A 1HEUA 1N9GB 4IXWA 1UDBA 3PWKA 3D3EA 1SBYA 3PI7A 2YV2A 1NVGA 3EDMA 3WYBA 5EESA 5CEFA 2VYND 4WKGA 2DFDA 4CLEA 3JV7A 1AE1A 3RI3A 4LSWA 1H2BA 3LLVA 5J23A 4EI2A 2XXBA 4BB6A 4RPLA 5IG2A 1YQGA 3OQ1A 4JIGA 4XR9A 3ZN2A 3ZV5A 1XCBA 3U49A 3NUGA 4PG8A 3FRJA 5A5EA 1OFGA 4AJ1A 2DTDA 4M89A 4CMJA 3TWOA 4OHUA 3UN1A 4XYGA 1NXQA 2GN6A 2JCVA 1MB4A 1ULUA 4RLSA 4BKQA 2HMVA 3FWZA 5L40A 3DBRA 3P7MA 1CQJA 2Y67A 4BS9A 2DLDA 5AXBA 1BWSA 1Y8QB 1HYEA 1HZZA 5EQDA 5A3VA 3ZWAA 3DQPA 4MIEA 8LDHA 4R68A 3PFWO 5GY7A 4MVJG 1XHLA 2HU2A 3ZWWA 4MVJE 3PJGA 2GLXA 1EUZA 4IGEA 3DBHB 2NTJA 4YVFA 4BGIA 4XDYA 2FN7A 4XYBA 4E33A 4G81A 1PR3A 4P4NA 5A9SB 2P5UA 4D46A 4CL8A 4CQLB 4BNNA 1GV0A 4W9NC 4XIYA 3DFZA 4NR0A 1B15A 4QUKA 1JWAB 1LDMA 3ZWNA 1E6WA 2QRKA 4OMUA 1I2BA 4MVJI 1AN9A 5IN4A 1EEHA 4ZHSA 1RM4A 4YAEA 1UUFA 4PLPA 2Z95A 4WPGA 4AL4A 3C8MA 1NAHA 3TFQA 4P38A 4LN1A 4CM7A 5T67A 3RCBA 1N7HA 2D8AA 4NFSA 1Z6ZA 1GZ3A 1E7SA 1YRLA 3AI2A 5CPBA 3VVCA 4FS3A 4E5NA 3CSDA 5IDWA 3IL2A 3GGPA 5FF9A 5DULA 1SOWA 2ZK7A 1GFSA 2VHVA 2HLPA 1P44A 3DZBA 4AJOA 2EIHA 1HSZA 5EERA 1D4FA 1SOVA 1A9YA 2C7GA 3DDNA 5ES3A 3CH6A 1UXGA 5A03A 1CDOA 4MPDA 2IXBA 1ADCA 3FI9A 3AI3A 1PJBA 1QORA 3GPIA 4R9RA 4MVJA 4UVEA 4CQMB 1VL8A 1YB4A 4QX6A 1E3IA 3ZNPA 4L0QA 1DDOA 3AY7A 3WS7A 3ZWPA 2AA3A 3AY3A 1MXFA 3ZHYA 1KBZA 4B4OA 2I65A 3ZDFA 1E7YA 3FTPA 4IGFA 2O3QA 1SB9A 3ZNOA 5DBIA 1T2FA 3Q11A 2AE1A 1HDOA 3GVXA 4BGEA 1I0ZA 4E0BA 3LC2O 3NDRA 3RUCA 1U4OA 4OAQA 4II2A 1KEWA 2DUWA 4IIUA 5KJ1A 5BNIA 5FWNA 3PJDA 4DMLA 1B14A 3S2IA 1CJCA 3NTOA 1IPEA 3WWZA 1R16A 1LEHA 3FWNA 4OGWA 1DHRA 1KEUA 2HMUA 3DEYX 1NFRA 4R69A 4TVBA 1B16A 2HK7A 4BL5A 4JJIA 3QY9A 2Y1CA 2C0CA 1AXGA 4UEJA 1WDKA 4CR8A 4FFMA 2PY6A 4RQTA 4GKVA 2GERA 3BHMA 3TL2A 2W2LD 3DMTC 4IJUA 1P1HA 1R37A 3F1KA 4ROSA 4RCVA 3D5TA 4J1SA 3RBXA 4GWGA 3LT0A 4MINA 4BMSA 4U7WA 1TLTA 3BMOA 1P74A 3JQAA 1KY4A 3I1JA 1WWKA 3N7UA 2D4AA 5EL0A 5JBIA 2AE2A 1C14A 3ENKA 1FDVA 3IP3A 4GBJA 3RU7A 1PTJA 3RSHA 4BO9A 3E82A 2YHIB 1P9LA 4B7CA 4NBWA 3JQDA 3ZWXA 1NR1A 2QRJA 3HNPA 1GV1A 4XDZA 3MOGA 2ZCUA 3ST7A 3HJAA 5L51A 3S2FA 3AUAA 1MGOA 1V3TA 1ZK4A 3F4LA 3ZW8A 3LYLA 2P9GA 1DSSG 2O4CA 1HE4A 1I2ZA 3LK7A 5ENDA 2Y68A 4GGOA 4D41A 4WCFC 4OQYA 3KETA 3FHLA 3F9IA 3WQQA 2BELA 3UCXA 1N92A 1QKIA 1BW9B 2DTEA 5JO0A 3QWHA 3VHRA 5G4LA 1SCUA 3I4CA 4J49A 5JFOA 3FD8A 3GPDG 2Q2VA 5I7VA 3ROQA 4CM6A 1V8BA 2P91A 5CG1A 2P4QA 4EUEA 3E9NA 1SAYA 5DP2A 4EEZA 3ITDA 1W0CA 3ZV3A 4GVXA 2NQTA 4Q3BA 4U8GA 3VZPA 4L4SA 3H2ZA 1K6XA 3OEYA 1YBAA 1ONNA 4TMFA 1WLYA 1XR3A 3IS3A 1WP4A 2O7QA 3VZSA 3KSDO 1LDGA 4I8XA 1X0VA 2TMDA 4J1TA 1RM0A 1H9AA 5L3ZA 4OQZA 2J5RA 3S55A 1NQOA 5L4LA 4JROA 2B4RO 1GYRA 4CV0A 3V1YA 3MOIA 1IULA 4NJMB 1YBVA 3UOGA 3JYQA 3BHJA 4ZU3A 3WNQA 5H81A 3CINA 4R41A 4NFHA 3ZGYA 3I9MA 4YR9A 3E18A 3GG2A 4B8ZA 3IJPA 3TZCA 4RVHA 3F3SA 4WECA 2HRBA 1RPNA 4LCEA 4QEDA 1PS8A 2WD7B 1PIWA 3COSA 3OA2A 4FJ1A 4XJTA 1DBVO 1PWZA 1YOVB 4EDFA 2GZ1A 3L4SO 4JBIA 1SB8A 3I5MA 3ETDA 4QO8A 4XR4A 1OOEA 2EGGA 2PD6A 4IIVA 3GC6A 4GPD1 3JQEA 3BHIA 5FEUA 3WR5A 3PYMA 1O8CA 1K3TA 4Z0TA 3RUIA 1E0DA 3HDJA 4MVJF 4UREA 1YH3A 2J3IA 1PR9A 2BHLA 4BNMA 2X9NA 3CEAA 2VCYA 5B12A 2EW2A 4YT4A 4RVUA 5TQVA 3L77A 5H83A 3SLKA 4TRNA 4CL3A 2JL1A 4R3NA 4B4WA 3UGKA 2LDBA 3ZWCA 9LDTA 2EKQA 1G1AA 4YB8A 1HYHA 3HB4X 5KVCA 1BDMA 1PS0A 2GNAA 4UEKA 1JW9B 4ZQEA 1A9ZA 1PL6A 4W7IA 3WLEA 3NDIA 2EP7A 5IZ4A 3VH4A 3RU9A 3L6EA 4UULA 2FPPA 4JCOA 3D3WA 4JP3A 2FR8A 3IP1A 4DL9A 1G0OA 3LT1A 2HK8A 4DPKA 4YXFA 4ILKA 4OYRA 5F1KA 1M6HA 1B3BA 4ZRMA 3GEGA 1CQIA 1X0XA 1J4AA 3QWIA 2Z5LA 4FFOA 4FR5A 1AHHA 4PLYA 4WEQA 4J0FA 2CDBA 1HZJA 2B35A 2JCYA 3GZNA 7MDHA 1W4ZA 2X22A 2YJZA 3EHEA 4FFLA 2ZYAA 5JY1A 4AJ4A 4I5GA 1U7TA 5F3RA 1TT7A 3AU9A 3D4PA 1Q2XA 8ADHA 3S2GA 4A03A 2YV3A 4R01A 3SC6A 1ZVMA 4XB2A 4CMEC 2WYUA 2I9PA 1R0LA 4AJEA 3H9EO 3PYLA 4GX1A 3GMSA 5ER9A 1OBFO 4CUJA 2X5OA 1EE2A 1MFPA 2YHUA 2Q1TA 2D5CA 4XKJA 4UVHA 3I52A 1IYZA 4W6ZA 3PLRA 5AQ1A 5EJ2A 2RHRA 4IXTA 4BNFA 3KHUA 1GQYA 1ZFNA 3RVDA 4D3SA 5ILOA 3KZVA 1L7EA 4K9DA 3FR7A 4FOOA 4TZKA 1K0UA 1B3RA 3VDQA 4IDAA 4LW8A 5IXSA 2P9CA 1XQ6A 1CWUA 1GYQA 5IF3A 2O4UX 3NTRA 3LU1A 2VNAA 4PIVA 4O0LA 3VZRA 2OBYA 3OJFA 4PG5A 4WK6A 1XSEA 3DXFA 4ND1A 1MUUA 3M2TA 1NTOA 1YB1A 4JBGA 2J8ZA 2NV6A 1YJ8A 1GY8A 1PL8A 4GKBA 4WLVA 2DU8A 4YACA 4LISA 3AK4A 1Q1NA 2O2YA 4PVDA 5AVOA 4DLAA 1R6DA 1FDUA 1P1JA 3BMNB 4CM9A 3JQ7A 4R1SA 3VPGA 2EP5A 1KIFA 4GX0A 1NX6A 4ND4A 1BMDA 1PJLA 2G1UA 1P1FA 4FJ2A 1GD1O 5DOVA 3R3SA 2RHCA 2NVWA 5B1YA 1FDWA 1NBOA 2VUSA 4OKIA 3TOZA 2NVUB 1RKXA 1EVJA 4IS2A 3U9LA 1NNUA 2QZ9A 4PRKA 3PHIA 5I7SA 3MJTA 3ENNA 1XGKA 1DIGA 1E7MA 4NHEA 3DR3A 3Q1LA 1JWBB 1H94A 4GX5A 4N7RA 5JAZA 1I3LA 3OEWA 2HJSA 4NFYA 5JMPA 4A26A 3RJ9A 4E5YA 5BSGA 3JQBC 3CIFA 4IPTA 4P4LA 4MP3A 4A7PA 5THQA 1QXSA 2Q49A 4L9RA 1JTVA 1ZIDA 3GNTA 4P22A 1IUKA 4CV3A 4NK4A 2NNLD 3F47A 2O3UA 4PRLA 3VPXA 4QECA 3SJUA 1WNTA 3NTQA 3LF1A 2OBNA 4FFNA 5KJCA 2AG5A 2C2XA 2Y05A 2Y1OA 2DM6A 1BGVA 2I3GA 1ZXBA 2C7VA 3BMQA 4FQ8A 2VWGA 4D3FA 3DBRB 4DIFA 4EGFA 1B0AA 4YA6A 2X0IA 4Y98A 5HRUA 4NPCA 2ZTMA 3NGXA 1E7WA 4H15A 4IQ0A 4YPOA 3OETA 5F5NA 5JDIA 4ALNA 2ZKLA 4EJ0A 3Q2IA 3WFIA 3E5MA 4BNWA 5L4SA 2X4GA 2IYOA 2BGMA 3PQEA 3GLQA 4CQMD 1XKQA 1ONOA 3SJ7A 4BNVA 4DREA 4PG4A 3A06A 3OJ0A 1YS4A 2R2GA 3PQFA 1R4MB 4D45A 3JD3A 5A04A 1DRUA 4OO3A 3WYEA 4DC1A 4IDGA 1GZ4A 1UXHA 4MO2A 2QHXA 2B69A 3RQSA 1TXGA 2I76A 3L0DA 1X15A 3NV9A 2C20A 2CDCA 4R16A 3STHA 2FR0A 4CODB 4CJXA 3RASA 4EYEA 3QVXA 2XF8A 4HV4A 1X13A 3ANNA 2QX7A 5IDXA 5L7WA 5TC4A 2XXJA 1N7GA 3MTJA 5EQFA 1T25A 4OJNA 2B5WA 3ZH2A 2AQKA 1EE9A 4Y6RA 1LLUA 2CMDA 1K89A 2G82A 1VL6A 4BO8A 3P5SA 2P4HX 1QYDA 2ZTLA 4WCFA 3BAZA 1EQUA 4CLXA 5A06A 1W8DA 2Q3EA 4TRJA 5L95A 1NQ5A 2NQ8A 4N5LA 4JJFA 5HS6A 2P2SA 4A27A 4ESOA 4XYLA 4YEDA 1E3LA 4BB5A 1VSVA 4ZD6A 3WLFA 2CF5A 2F00A 3INGA 3PDJA 4KWIA 3SBOA 4IM7A 4AICA 1ADBA 2CFCA 4ZRNA 5TT1A 4PN3A 1U4SA 4GMGA 2VRCD 1QYWA 1DIAA 1E5QA 1UJMA 3NEPX 3DTYA 3HWRA 1DIHA 4YQYA 4M54A 3PXXA 1C0PA 1FJHA 4UAGA 1H5QA 5IAAA 5IDQA 2CF6A 1UDCA 1VPDA 1I5RA 4J90A 4S1VA 2GPTA 4DLLA 3RC1A 3QA9A 5KTKA 1GL3A 4RPGA 3KB6A 5KVQA 4J9VA 1QP8A 1Q0LA 1LDBA 3B6ZA 3RC7A 3I9OA 5A1TA 3GEDA 1ZO8A 3PWSA 5ADHA 1U5AA 4D44A 5BSFA 4YJFA 2VTEA 4YT5A 4J1NA 4RO0A 4RVDA 1ZK1A 1IOLA 2OO5A 3EMKA 5LC1A 3ZZNA 2HDHA 4MIYA 3O8QA 5JDCA 2PKQP 2OUIA 1IZ0A 2OORA 3BTVA 3TQHA 3KBOA 3TZ6A 4RF5A 4YDRA 4BNLA 4ZN6A 5I8WA 3RFVA 4CMGA 1LQUA 5C7OO 5KJEA 1E1MA 1SEVA 3AUTA 1ENZA 1HDCA 4E5PA 4UUOA 2QYTA 1LDYA 3VTZA 1BHSA 1KEVA 1LDNA 4YTEA 1E6EA 4ZGWA 2Y0CA 6LDHA 3DWFA 2E6UX 1UXJA 2VWHA 3DHNA 1Y5RA 1QMGA 1O9BA 3PHGA 1C0IA 1JA9A 3WTCA 3T4EA 1O6ZA 3IAHA 1YDWA 1A27A 3UCEA 3H2SA 2O7SA 2Q46A 4J3FA 3BMOB 3JQAB 1AXEA 2DPHA 2PZLA 3EK2A 4AJHA 3CPSA 2AHRA 3QP9A 1E5LA 2NVBA 3WGYA 4ALKA 3VOSA 3RC2A 4Z9XA 2GN4A 2WD8A 2B4QA 1NQTA 1Y8RA 1AHIA 2QRLA 3ICPA 4E6PA 4DIBA 4BGUA 1N2SA 1S7CA 4INAA 1BVRA 1OC4A 2UUPA 3H3JA 4G2NA 4GH5A 5KJFA 1SPXA 1UZMA 1V9LA 1EZ4A 1VRWA 2DFVA 4BNZA 1PGPA 1QYVA 3KM0A 1T2DA 1K6IA 3GN1A 3W1VA 2X1HA 4JXKA 1HRDA 1PJ3A 1VLLA 3TNLA 1M6WA 4HFRA 4ND2A 3GA0A 3I23A 2PGJA 4AVYA 2C59A 3KYDA 2YY7A 3HDQA 3NJ8A 4O63O 4CMIA 4EUFA 1MC4A 1LSJA 1Z74A 2Q1WA 3JQ9C 1T4BA 3O03A 4IJWA 4M87A 5DN9A 3F5SA 5I8ZA 1BDBA 3ZNNA 1IHXA 1T4DA 4RVGA 4CM1A 4UUMA 4XD2A 1B8UA 4BO6A 3NRCA 2D59A 2FSVA 4B4VA 5T8KC 2J3KA 3VDRA 3UHAA 4Q9NA 3UVEA 2CDAA 2F1KA 2X23A 5KCZA 4WLFA 5EINA 4WNCA 2FPGA 1HE2A 4NBUA 2ZJ0A 3K8ZA 1ENPA 1E3WA 1P1IA 4IDEA 1EK6A 1HE5A 1E6UA 3V1UA 5JPIA 3QVTA 1I32A 4KTTE 2VT2A 3JD4A 1E92A 1PQWA 1UZLA 2FOIA 4OM8A 3HN7A 4HNHA 3C3XA 3DFUA 1UP4A 4XEHA 4O1MA 4PLVA 4J7CA 7ADHA 4ALIA 3OFSA 2ZB3A 1BTOA 4NNJA 4A73A 2VYVD 2E37A 1XLTA 4X54A 1KETA 1SO8A 4BNYA 1X7HA 3W4IA 2XAAA 3A28A 2WMDA 1VKOA 2W2LA 1VC2A 3JQCA 4U0KA 5CDSA 1MG5A 5AOVA 1LI4A 3ZU3A 1F8FA 1EUDA 1XU9A 3LF2A 4UUPA 4IDFA 3GNSA 1DAPA 2GSDA 2Q4BA 3QRWA 3WGZA 2RH4A 1AUPA 3I9KA 1FDTA 1ULSA 2GCGA 2H1SA 4BUCA 3GK3A 3ZHXA 1GAEO 4H16A 3DB2A 1TT5A 2RH8A 3LSYA 1N8KA 1NWCA 1YL6A 2HMSA 3RD5A 4WASA 2BI8A 3I6QA 1T24A 5IXYA 1B2LA 2HK9A 3A1NA 3WGHA 3WFJA 1JVSA 1NHWA 4WLEA 1KERA 4DYDA 2ZTVA 4HADA 5AXCA 1XEAA 2X86A 2BF7A 3UH1A 3HADA 4WLNA 4MJLA 2EEZA 2Y66A 3M1AA 4K26A 2Q50A 4I5DA 2JHFA 4DRYA 1B7GO 4PLCA 5AXDA 4CLOA 4BQRA 4FFPA 5JY6A 1A72A 1A71A 3D3WB 3ORFA 5TGDA 1PL7A 2JFFA 3AU8A
chains in the Genus database with same CATH superfamily
1K0FA 4TWJA 1P72A 3Q2KA 4CKBA 4DPLA 5CVEA 3EMDA 3RANA 2MSNA 4NC9A 1V5WA 1KJJA 2E9SA 3H8JA 4GGPA 1V7CA 2X6RA 1G2OA 1SNYA 2OP1A 3K73O 1SULA 4OSOA 4PZEA 2GBLC 3F2IA 4GPZA 1UBEA 6PFKA 4C1NA 1A2KC 1XKXA 5BUZA 3UWOA 4W8GA 3W8DA 1ZPDA 3SQDA 3KEMA 5GVSA 4NCKA 5JI2E 1OH6A 1R8QA 3ADBA 2V8BA 1UXKA 4JVSB 4HG2A 1BE1A 4MW9A 2ZSAA 4OXKA 2DH5A 3FFBA 1XPRA 2EQAA 1VI6A 2ERYA 1YD7A 2GQ0A 3C3BA 3C6QA 2OA0A 1NJ6A 3GG9A 2QTHA 4DZRA 5K99A 3VU0A 2ADMA 3B48A 2PQ0A 4F2DA 4EVRA 4N0DA 4MZDA 1JF8A 5DGTA 1YMVA 1JDBC 4RPCA 4R1PA 1S96A 1M0SA 3KEOA 4PSDA 4NDNE 4GIBA 4JKYA 1IZYA 2B8TA 1NSYA 5ALJA 5K03A 3UAVA 1WETA 4E32A 3LCCA 3DM9B 3HCNA 4F8EA 1SKMA 2IDMA 3H4VA 4KR3A 2GM3A 2XMSA 4HFNA 1CRWG 1Z73A 2Q5QA 1WUTA 2EOAA 1E3JA 2VO1A 3PUKA 3R40A 4TV8A 3FMOB 1RYNA 1BXKA 1LY1A 2N1BA 3SXUB 2VN8A 1LH0A 2A0UA 1Q19A 5G02A 2X5XA 3M83A 3C7AA 4O2AB 4F97A 1ZZGA 1A8PA 3LTNC 4RS4A 5CEEA 4ZZ0A 2ZRPA 3SFTA 1YBHA 1T8UA 1U0FA 1K6EA 1RRVA 2ZJBA 4DMMA 3NJ4A 4JEUA 3UYKA 1OPXA 5FWYA 2LIPA 3IIIA 3VNVA 5HJ7A 4PLWA 3HDHA 2ZS7A 1UC4B 3MZ0A 1JSLA 4OHZA 4JJ8A 5ALRA 3SYMA 3O38A 1RS0A 4A2QA 5K20A 1XXHA 3TB4A 2J4DA 1I80A 2JLVA 2FWMX 1JQ5A 1K9VF 4L8LA 1W75A 5CLGA 3ILVA 1GUZA 1QNLA 2OP0A 2GFHA 3I4LA 1QGAA 2NACA 3M6MD 1LTQA 4MRAA 5FXMA 3ZCPA 3G59A 4DLKA 1ODFA 1INLA 5ECDA 3TZKA 4ZDJA 3GDFA 1P45A 3HSKA 1CJTC 1J24A 1GAQA 5G0UA 7REQA 4X66B 5ESDA 1RXSA 4R9SA 2AEFA 2GB4A 1SOUA 3K9LA 2G5CA 3FW1A 3QE2A 4PVCA 3P9QA 4DQXA 1C2TA 3QU2A 1BMFA 2BM0A 3K6SA 3EZ9A 1O5TA 3CVVA 2CHUA 3EVBA 2WTNA 1M1YE 2PGXA 2ZTHA 3WGVA 4F9TA 1M2WA 1OXUA 3EASA 3BXGA 1FDRA 4BAUA 1FXSA 3E7XA 1V45E 2OCIA 1MAVA 2J7PA 1JAYA 4PPYA 5BW8A 2O5EA 5TVKA 1KXZA 4AJ2A 1EVIA 4RH3A 4U7TB 2Q1SA 2P6PA 3G5UA 3WKEA 3CZRA 2DMRA 5ENVA 4D80A 2BFAA 1GITA 3O8BA 3TRHA 4D0LB 4ER3A 3E7PA 2AOTA 2EP8A 5CCXA 2N3ZA 5HTKA 5LOVF 4GKAA 4Y2JA 5LIPA 3ULKA 3PQ6A 2HRDA 3DNFA 4G0XA 3EZYA 4NCXA 4UNRA 3U3MA 1L3CA 4E2FA 5I7EA 1OY1A 3ORQA 1IHPA 2H7CA 4Q03A 4Z8XA 2VF5X 1TQHA 3PE3A 2E89A 2PS9A 4V0ME 1ULBA 3HQ4O 4NAUA 2J46A 1SN7A 5G4KA 1YO6A 3JATA 1BEUB 3KJIA 3OUTA 4X93A 1VG8A 1B0PA 4X8OA 4H1UA 16PKA 4AZSA 1O6FA 1CUHA 1DAGA 1ZOIA 3SGLA 1ISHA 2HLNA 5DPMA 4L9SA 3ZDEA 4AJLA 3NX4A 3AHGA 3IT3A 2EIXA 4AROA 5HRCA 1Y8CA 3QYFA 1ZEMA 4Q1FA 4LHEA 1KS2A 5DGXA 3RUAA 4OL9A 1PV2A 4JU9A 4KACA 2QTAA 1JR2A 2OENG 1KR2A 4FZ5A 1U7OA 1C3OB 3KHTA 2I78A 1OXMA 2C82A 3NV7A 3H8WA 5D1HA 3SC4A 2CYBA 1T1RA 4K46A 1XMIA 2GAJA 2W90A 1OBHA 2DE0X 4NCHA 3P2OA 2DKNA 1L3BA 2PVCA 3IEVA 5FI1B 1AGYA 2VUTA 2G67A 2BM8A 2RGUA 3FRIA 4OKNA 3FJ1A 5ECYA 4XAQA 3OMXA 1FSFA 3BL8A 4RPJA 2E5FA 1Z8NA 2JZCA 4QLOA 2ZIXA 3ND6A 2C2KA 2IWHA 3UF0A 2VJPA 3BL6A 4BEJA 2QM8A 3KAJA 1HT0A 3WZMA 4DMHA 3JY6A 3IR6A 2ZJ5A 2G0TA 4HH3C 4TKLA 3FWYA 2AR0A 4LSMA 4RDXA 1E7RA 1KI1A 2YUIA 3BH7A 2Z3WA 4F38A 1X9HA 4E51A 5TX7A 1W5TA 1W25A 4UOQA 1OV4A 4XRRA 2QVZX 2IYPA 3NHAA 4E5VA 1X7WB 3Q7TA 4EZIA 2I91A 3LDAA 2DJIA 3I0ZA 5JS6A 3WJ2A 3EYAA 2A5GA 2WV7A 3OZUA 3PNVA 5E1MA 3W5DA 1MFZA 4D4LA 5LQJA 3GLFE 4TVKA 1H0HA 2IF2A 2HWXA 3DOJA 2VDKB 4LJSA 5C1IA 4DSZA 1PLJA 4KLRA 5IZCA 2ZIZA 3PQ2A 2ZDGA 5JAIA 3UHFA 3DQQA 4ALLA 4CLHA 5CT5A 4RIIA 2AOUB 2I7CA 2XKJE 4GD3Q 1O0BA 2XT9A 1FNCA 3BD6A 3Q8LA 4RZIA 4MJ7A 4EZBA 4OHFA 4WOCA 3CNQS 1NMXA 3C5HA 2ZJZA 3GCXA 3B78A 4WOPA 4Z0NA 1HWYA 1HQDA 1X1TA 2NZVG 1LRLA 2FI1A 1TK2A 4N39A 5FUYA 4GHWA 1A2QA 4B6SA 3KVNA 2IUTA 3DKRA 4GP7A 5AK5A 1PFUA 4D9FA 3PD7A 4QRDA 1W93A 4R6XA 1MT3A 1E8DA 1PGQA 3L0PA 4FMCB 2HCJB 3O3NB 4TYQA 1G5FA 1YR1A 4XCQA 3KEFA 2D1RA 2ZUWA 3NMUF 2QLFA 4IHQA 2X5KO 1OV6A 2HB6A 4TV8F 3JQAD 1R15A 1P81A 2RG1A 5MF6A 4PRZA 1BRMA 3WYFA 4EFDA 2NO1A 2AUTA 3O93A 4RCZA 1Z0AA 3BUSA 4WTOA 3QH4A 3JZMA 2SCUA 2H08A 5ENZA 1L1QA 4WKBA 3DO6A 3GJ7A 3AL2A 4QREA 4FN5A 4WXHA 1U2DC 1YI1A 2C4WA 1CQPA 5CX1A 3AEQA 4CEHB 4YJFB 1M74A 1MJGA 3FWPA 3IVRA 4K6FA 5A6SA 5J43A 3PA6A 1HG0A 2AYZA 1RLMA 1XEXA 2BC9A 2ODAA 3EAQA 2QLBA 4FGJA 4HN2A 3TM4A 1OHHA 1EM6A 1TYCA 1U65A 1ZS9A 2IU3A 3O8QB 4LRTB 3DLTA 1A96A 5E2AA 4DUPA 2AFIA 2JLSA 2AR7A 1I2AA 1RLIA 2G1KA 1C9JA 5D7NA 4I5EA 3W5JA 1VLQA 3EEYA 5J2UB 1G66A 1FXUA 2OD7A 1MORA 1RBYA 4HN4B 2GBFA 1XZPA 2BHTA 2VDPB 2ZJ1A 1LWOA 3JR7A 1MB3A 3MXOA 3ZS9A 1G18A 3KOZA 3NNSA 4DLRA 5IT4A 3X1YA 4MVCA 1KZ4A 1AZLA 4XCVA 4JB3A 3FKSD 3X1XA 1ZKMA 1KP9A 4LZAA 1WDMA 2PZKA 4ENWA 2OOSA 1D2HA 2EKPA 4N3GA 2DPXA 5FFMA 1TKCA 2EYUA 3K8OE 1A1VA 4JP2A 1HDZA 2FEAA 2DUMA 3NIDB 3FF4A 2H1VA 3IULA 2HRZA 1G2PA 4GWLA 1U7UA 1KIMA 5MGNA 1E1RD 3AETB 4J7XA 5JWHA 2V6GA 4ZCIA 2AMFA 1B6GA 3VV3A 3KSZO 1NP7A 5LP6B 1GTJ1 3BM5A 3PRYA 3BMXA 4Q34A 3TPFA 5CLLA 4DXAA 2WHYA 1TA9A 3MW8A 3QIVA 3VPFA 2P0AA 1GIAA 5ELLA 4MO9A 1BH6A 4GBMA 2FJPA 3SMVA 1U2RA 1Y8RB 1YI8A 1EMDA 1DXYA 1GPWB 2PV7A 3LNTA 4JJGA 4QOGA 2BTQB 3G3EA 4K9LA 2F3PA 5FR2A 2EEPA 1J1UA 3Q5DA 4P7BA 2HO5A 5CM2Z 5K9ZA 4DCPA 4GLBA 1CDZA 3GRAA 2VRCA 3HDGA 2HHAA 4RPHA 2CXUA 1HEIA 1TTPB 2NU7A 2WFLB 3ZI4A 1R64A 4Y6QA 2II6A 1BKYA 2P79A 2Q21A 1O94D 2ZT6A 2BD0A 1UPCA 2QD4A 4JX9A 4N9WA 4TV9B 4TVOA 3WGNA 4ZFNA 1T4CA 3PXCX 3H83A 2ZIWB 1F1BA 2B9VA 3KCQA 3V5NA 1KRXA 4UHEA 3VHXB 1LK5A 2FZWA 2OM2A 3S27A 3Q9LA 2P35A 5T64A 3SYRA 1CJSA 2I5PO 3DC2A 3GYBA 1QGED 4NH4A 2I34A 4YRFA 2DETA 1CUEA 3BULA 3FPLA 1FQOA 1NDHA 2DKOA 2DR0A 3C8UA 2XB8A 2I4LA 1E2KA 1D8TA 4P7KA 3ZGOA 4NXMB 2F3QA 1ZWKA 2YFHA 3EISA 4L3VA 3V7YA 2W4MA 2O2HA 4XWAA 3ROGA 1V8DA 3WE7A 3H2HA 5HK9A 3C98A 5CRIA 1LSUA 3M9WA 4ID9A 1C4OA 5A9TA 4E5SA 4XOIA 3O5AA 4GT1A 4EFMA 4KQIA 4DR7B 4PYOA 2Z98A 2EL7A 5B5SA 3DZCA 4WVLA 1C1XA 4WUVA 3A05A 1YZHA 2GYWA 2UYOA 1M8KA 4KQFA 4MIOA 3CEHA 2I6FA 2YRXA 4LNUA 4LYDA 3S68A 4F91B 1SU7A 4X1YA 2XGJA 2YVUA 4TXNA 3MK31 4U9UA 2Q5JA 4EB0A 3W5AA 1KC3A 4B09A 4DCVA 4P80A 5CHYA 3VR5A 2JI7A 3RHSA 4IIXA 3P9RA 2BFWA 4DB4A 1QU2A 2Y0DA 4TYWA 3H0CA 2Q5OA 3C7KA 3KTAA 1PWXA 4LDRA 1ENOA 3RW9A 2XOXA 3ONDA 5IJZA 3QVOA 4L9AA 1S2NA 4RY2A 3WOHA 1ZCJA 4UFPA 2CL5A 4RK7A 1DWUA 4ZYVA 1LX6A 4DCSA 3KE9A 4FHEA 5ESXA 3ZK9A 2HBYA 2P4EA 2PR7A 1FUYB 2BGJA 4IRXA 4FD3A 4L5IA 3NNDA 4BFUA 4RESA 4EA7A 4KFUA 1DCTA 2DAPA 2HAEA 2QMOA 1MN6A 4RMIA 1FPQA 3ASZA 5BUQA 3HXMA 3WYCA 4R1QA 2DERA 3RS7A 4CXMA 3OQNA 5G0VA 1MB0A 2JGRA 3PGXA 3JAMA 1JB1A 1UKZA 5JE8A 1UBTS 4LXHA 5H3LA 4C05A 3R7FA 2PK3A 3T3DA 1NQUA 1W8IA 2XKBA 1Y9DA 1RZ3A 1Z0ZA 4PFJA 3V8EA 1AV7A 1SWWA 1U9JA 2HHHB 2E85A 5HOEA 3FUXA 2OGSA 5CW2A 5DBHX 4QG3A 3CR7A 3DDOA 2ZTSA 3Q8WA 2JAOA 4K9OA 4UVIA 2JA2A 4XWWA 1G8HA 2VDVE 3L7LA 4LDJA 4MVJM 4YDHB 2HQ1A 2HEIA 1ONPA 2WNSA 3S5JA 1GEGA 3ZHOA 1A2OA 4ZPJA 1GCGA 2VQ6A 4O8CA 3ESRA 4LMPA 4QSHA 5EIFA 4IRMA 2JDIA 3TBKA 4CKEB 1E2EA 2XYVA 1TMYA 1P8JA 5JXHA 2JFGA 3HJGA 1I7NA 4ZJYA 2R8OA 3B6IA 1IPFA 1BE0A 4INJA 4F2WA 1YIAA 2OVBA 3CLKA 1XL0A 3EXAA 4NZZA 1XU7A 1VB3A 4U8HA 3VAZA 1NVKA 2G4LA 2GZ2A 2PMBA 4ZC8A 1NHGA 2CLHB 3MINB 1GP2A 3DEJA 3H1BA 4X9XA 2FZGA 4RHYA 3L1UA 2FZ5A 1LC0A 3KD2A 4B3DA 2Q5FA 3T54A 2I03A 1QK5A 2ODBA 1AX9A 1KPHA 2QYOA 1V39A 1XTRA 1B0ZA 3A4VA 3MCTA 3SVZA 4ZEVA 2ZM6B 3AR2A 4G5QA 3NTUA 4OV6B 1YQEA 4TZTA 1L5ZA 2ONJA 2IU6A 3V7NA 3AO0B 3DCIA 1R9MA 1B6SA 3TS1A 5BR8B 2V1UA 4ZEMA 3THXB 2XBUA 3DAFA 2JFZA 3NFRA 3HZZA 3PUYA 1RWVA 4QBIA 3NQ41 3LD9A 4DR5B 4FYWA 4MUIA 3WWPA 3RUFA 5CDUA 1BA3A 2B6NA 1Y6FA 1DPFA 4RVSA 1EUCB 1T9AA 1WHTA 3WNBA 3OC6A 4U2CA 4UNQA 5L45A 3DG9A 3W5CA 4KDEA 1WMAA 4C29A 3V1MA 3ZR4B 3A0RB 2GM9A 3A11A 3BXOA 4O5AA 2EG5A 2WIKA 3A4MA 3WK8A 3MRXA 1D0VA 1GCUA 2ECQA 1SEPA 2C3OA 1AIPA 3GH1A 3PSHA 4HEQA 1YR2A 1U1DA 4K6CA 4R5HA 2P2YA 4TPKA 5F5LA 5DHPA 4N54A 2AVNA 3B2EA 5T57A 2PT9A 2ZI4A 4GRAA 2G72A 1SM4A 4BYGA 4CKWA 3BDIA 3DOHA 3OUZA 4KXQA 3GRFA 3H5TA 3HBNA 1HLFA 1XZDA 4J2OA 3UKOA 1JG3A 4LXIA 1CZNA 4RFSA 5TJ9A 2X77A 3K5PA 5TNXA 3W8EA 3H16A 3SK0A 2VF4X 2JANA 3L0IB 4JA2A 4QDKA 3CEPB 4WOBA 5HFAA 5GINE 4ATNA 1U63A 4D9JA 4XLTA 4OOFA 3GAFA 3AUKA 1FJ2A 2ETVA 5AR1A 2F43A 4Z0PA 4YO8A 4BN4A 2V9PA 3HPRA 3ANSA 2JEYA 1XZFA 1PQYA 3IV7A 5K8UA 3U09A 2YW2A 5FORA 3T3OA 1ZK0A 1Q0UA 1IOZA 4OB8A 3EZFA 1YQQA 2P6NA 5IK2D 4BX9A 3VU3A 4A8JA 4DV3B 4FVTA 4OHRA 5SY6A 4Z4EA 4ETWA 3AM3A 3DDHA 1KVRA 2J4FA 1Y3HA 1II8B 3G0IA 3FFAA 3SF0A 1T2NA 1OZAA 4XIGS 3T0IA 1RWBA 2VHZA 3W0LB 2F6RA 3RJTA 3A3PA 1DFIA 4XA8A 1HYQA 3ELWA 3TQIA 4F3YA 3EBOA 1J9GA 1HDRA 2EFYA 2FPIA 1T35A 4PLZA 3PNBA 4QT0A 4D9GA 4GI2A 3KQPA 4V3CA 2Q29A 1SCKA 4L0DA 4HAVA 4OXYA 2A0XA 4X6YA 2DB3A 3HCFA 3T7CA 3ISTA 5U9CA 2AVDA 4F86A 2PAFA 3H84A 1P3JA 3RUPA 1W88A 3H7AA 3NHJA 5HFNA 2LIVA 4K87A 5EKUA 2OB1A 3I01M 5I4IA 3ZDCA 4PYMA 4LZOA 4KJZA 4Q48A 3DBIA 3WNDA 5FUMA 2MT9A 4P32A 1X7ZA 1YVEI 2YJ3A 2RJNA 1Q95A 3FIJA 3H0KA 3I53A 1E2QA 1DAKA 1RI5A 5JYDA 1YV9A 2DUJA 3D59A 3COVA 1GZ6A 3MJCA 4CMEA 1FP4A 1NG9A 1YIDA 5JAPA 1PJRA 1LSSA 1L9KA 1BWPA 3L7KA 4KVFA 4E88A 3FGNA 3STYA 3NAGA 4KFSA 3LLSA 1F17A 2NUTB 3GX1A 2D5BA 4R8LA 3BFJA 2C5AA 4WFIA 2L82A 3LUCA 2I1VB 5KYYB 1J1ZA 1M6YA 1SA0A 5IDVA 1JHZA 2KPOA 4F6LA 2H0AA 4YIKA 4ZTBA 4D4MA 1FQJA 1XJWA 1TIKA 2GMWA 3E9QA 4I3HA 4GBED 5K0ZA 3TX2A 1ORDA 1N9KA 2XR1A 4Q1AA 5I9BA 1ZCZA 3ROZA 4KTVE 4A3SA 5IJ0B 3AEKB 2EU8A 2FR8C 4FIDA 5KVAA 1KC1A 4KMMA 4BO5A 5FNVB 1N0WA 3IQWA 4K28A 3KKQA 1B8VA 4IUDS 2C1XA 3U16A 1G5QA 1DTSA 1T5HX 3CW8X 1XZGA 1C29B 4G37A 5TEVA 1ZD9A 3RJZA 1FFHA 2FEOA 3VPCA 3ZWQA 2OZLB 5DV9A 3KAQA 4YCLA 1QTIA 1M0TA 2ZXFA 4X63A 5G2OA 2HMTA 1B26A 4KQ1A 1CD5A 2R4UA 4KITB 1OE0A 1S2OA 2POQX 2QPTA 2AKAB 4K3VA 1X8KA 3D5QA 4ZCPA 2B99A 3C3YA 3HR7A 1NNSA 1WLSA 1I4LD 1Y33E 2PJZA 4FCTA 4BC0A 3ETCA 3DPIA 5BPHA 2NXEA 1UMDB 4ND5A 3TNFA 2XVAA 1H0SA 4NK5A 3GRVA 3WRVA 3RVJA 5EPOA 2D3TA 3EF0A 1HTBA 2CSUA 4LHYA 1KSJA 4S0ZA 3V9PA 5FAXA 1UXOA 3EVGA 2W9XA 1CLEA 1QF9A 1KI6B 1J07A 3LJKA 3PV0A 3WIEA 3GZ4A 5AI9A 4EQZA 1YL5A 2XT6A 1PVOA 4I9GA 1AC5A 2VHCA 1RWNA 1SIWA 2OSVA 2DHRA 1K5PA 2G71A 3LM8A 1UBNA 4K6GA 1KAEA 1MIHA 2C2MA 4PZZA 3L46A 1MABA 3LDHA 5D86A 2GCIA 2SKEA 4WMLA 2PXAA 2P2GA 1Y5LA 1JHAA 1XTJA 3NAZA 3IKLA 3I6ZA 1M54A 5BWNA 1EWTA 1U0GA 1J2TA 4HZUA 1JDUA 1R4MA 3H1FA 3JQBA 5ARBA 3EY4A 2VJNA 2W37A 5IFLA 4QQRA 2EF0A 5LIRA 3TUIC 4EO9A 1UDRA 1PKEA 3ZVNA 1A1SA 1SXJE 3PVSA 3HKEA 3LKBA 1GSIA 4V38A 1GPDG 4HAWA 1BAPA 4D5GA 3OT1A 4H3VA 3R9KA 4IRUB 1ZICA 3P26A 1DXQA 4AKSA 2UYGA 2VXBA 5C8ZA 3RJ5A 3WL3A 2YDXA 2HMYB 5BXYA 2D2IA 2ENWA 1RJWA 1RXIA 1Q57A 2LVBA 3H13A 4HWOA 4A2CA 5DDIP 1E4YA 1LLFA 2QTLA 1XX6A 5AW2A 1G8KA 2WTXA 3UQZA 4DMFA 1OI7A 2XYHA 1EXVA 1SBCA 3LC7O 3I2IA 4RUKA 5D6NA 3ZJ5A 1P8AA 2Q5CA 4JCCA 5CJ2A 3DWGA 4M55A 4J1QA 2O8DA 2DQKA 3LP5A 5CVVA 3M4NA 2GPYA 4IVNA 4PX9A 1Q1GA 1VTKA 2BGKA 3LIIA 4DCCA 2CNLA 3EIOA 2W2OA 2FLVA 4Q0MA 1G55A 4TROA 1QB8A 3ESYA 3H9JA 3PQ5A 4I1OA 4UCWA 1E96A 2GD1O 3OWHA 3L8DA 5DBEX 2CMGA 5DF1A 3OUUA 1BEZA 4YJGA 1DFGA 2OHFA 1Z28A 4BZWA 2W48A 3GDHA 3VVLA 4B48A 4B3HA 5JVDA 5J3JA 4COKA 2XCRB 2JGAA 2DH6A 1LJUA 4ZV7A 3SIRA 1YACA 4C04A 1JEEA 2CD7A 5DLEA 3WGQA 1Z6TA 1N8SA 3OCZA 4G97A 1M6NA 2HL6A 4K6OA 4KDRA 4B74A 2O23A 3RC9A 5C5EA 3ADOA 4H7DA 2COKA 2PZEA 4MAAA 2VDQB 1OBCA 2D0OB 4V24A 3RIEA 3V8BA 1S7GA 1MNAA 4NBRA 5J4KA 3A3KA 5KX5B 4W1PA 4X95A 2IEAA 2V6IA 4RJJA 4JX8A 4NYJQ 4G0UA 4Q3CA 2OM6A 2FW0A 4S1OA 3LWNA 3ZH9B 1R5OA 4P8RA 3I62A 1QHHB 4CDNA 1NE7A 3VPSA 4KI0A 1RLOA 1P5RA 4D9KA 3SCZA 1EI9A 4X3PA 1GKYA 5CAEB 5A0FA 3SM9A 3DO5A 3FZGA 4QTUB 3M4YA 2HSZA 3HBLA 4K9NA 4YXWD 5KTRA 3GP3A 4N8SA 3H1EA 5B6JA 1PX0A 2PJUA 4BKPA 1E79A 4NX2A 1HR0B 3OICA 1V41E 3B3AA 5CNIA 2AK3A 1TZMA 2DUNA 2YOGA 2RK6A 2WHPB 3LUKA 4YRRA 1I6LA 3WIDA 4U7GA 4BY9E 1DKMA 5JNVA 4QIHA 4KGXA 3QLUC 3SQOA 3HL0A 5TY0A 1N5OX 3F8WA 2E1PA 4LJAA 4Y2XA 3WTBA 5KS2A 3QEBZ 4CM4A 2L18A 3GRUA 1Q7BA 3PR1A 4URVR 1SVMA 1BXRB 3KQNA 1NFFA 3MWEA 5DM4A 3GVHA 5IAOA 1YFJA 2PUFA 4RK4A 5T4BA 4BO3A 3DBLA 4G8JA 4XVQA 2BFBB 3LY9A 4MQ4A 3STUA 1UBKS 1A9TA 3LO8A 4RD3A 4CIBA 3UJ9A 5JH7B 1C0KA 3AY6A 4U2EA 2EFCB 2OFOA 4IQ8A 1P19A 1GNSA 3F1LA 3OLWA 1H1LB 4CQJA 5CT6A 4EM6A 1M34E 2PLAA 2VRWA 3EWSA 1DARA 3HKBB 3NBKA 2QDXA 4TQGA 2F8TA 2BE9A 4FX5A 1V11B 4HEA1 3KQMA 4MWTA 1QFJA 2F62A 2GAFA 1W36B 1VSUA 4YRNA 1TEVA 1KAHA 1FFDA 2IBMA 1YJ5A 2GDZA 3I6IA 4IS3A 3RS8A 5KWIA 5DSZA 2E48A 1QH8A 4X3CA 3CXUA 1V1JA 1ML3A 3HYRA 2G06A 3F5MA 4FYVA 2ZE5A 3JQ8A 1UBSB 3B89A 3B20A 1QVVA 2NP6A 1QFMA 2ZRHA 5IN5A 3GGOA 4QQ8A 2VK4A 3O8OA 1V8FA 5E7QA 4D8YA 1ADGA 3A1VA 3AC0A 1T1JA 3SNKA 4U4AA 1IQUA 2JVKA 9LDBA 3FPCA 4AG3A 2IUUA 3PE4A 4I46A 3ZWVA 2FSGA 13PKA 4TWRA 5PNTA 1L7NA 3UXHA 1ZMXA 3UMRA 4FWIB 3UUFA 3NM6B 1GG9A 4PO3X 2YNMD 1UP6A 2O2JA 3JSAA 5ALUA 5BNFA 5KWVA 2HJWA 5FBZA 3ZKWA 4E15A 3ZE0B 3WGIA 4I9UA 3ZDAA 1PZHA 4QSMA 1NVXQ 1YS1X 1DE0A 2YXEA 3AR9A 4HEHA 4M6WA 5EIAA 5E9QA 3T0GA 4COOA 3KD3A 2BISA 4QARA 4DFDA 3HB5X 4MVJD 4JGGA 4ZOAA 5GONB 5A05A 3F7NA 3OECA 4FE7A 3BZUA 4AY6A 3RGGA 2CXSA 5DT2A 1LRKA 1QGZA 4JYAB 3GDOA 3TAXA 2VYQA 3VO2A 3DMGA 5LYJB 3QW2A 1LSOA 4R7GA 4B34A 4WZBB 421PA 2JNWA 3FDZB 3D7LA 3JXEA 1PQPA 2ZRLA 3NBUA 4FNGA 3T7EA 1NASA 221PA 2YMMA 1AS3A 3ELBA 3ZQ6A 4BX3A 1Z2PX 3S1AA 3L40A 2BBWA 3NT4A 2BDTA 2EKDA 4IX9A 5G0WA 3RSCA 3S70A 1H0RA 4ARZA 5H70A 1XZMA 3OKFA 3SWWA 1BWRA 2M98A 3UPTA 1Y8QA 1FW8A 3VNRA 2AJ8A 2YWCA 5LZ8A 2W6NA 1CRQA 1RNLA 5JDCC 2FFHA 3OZEA 5G41A 2ZYRA 1O94A 1QP4A 2DSTA 2HKIA 3DBHA 4K9SA 5JQGB 3A9SA 4OIMA 1YF3A 2RKWA 3EULA 3D02A 1DO8A 4HQOA 4U0JA 4QPZA 2H16A 2YZ2A 2P1DA 2AFHA 2AN1A 1OR8A 5AM4A 2FFBA 2G9RA 4L0MA 2PZJA 3E03A 2VJCA 3MGGA 2V74B 1E7QA 4CQLA 2WFZA 4EUNA 2VTBB 4PHGA 3K6JA 1NIJA 3T06B 1X7GA 1ZD8A 3HFJA 3IDSA 4WZAE 3KB1A 4YCNA 1XF1A 4BJ3A 2B61A 5JVDF 1ND6A 2ZRAA 4HNRA 3OWOA 3UWMA 3A25A 1SCJA 5JS2A 3U1VA 5T8KA 4WNIA 4RXTA 1Q1QA 3HCRA 4QQFA 5A3QA 2WABA 1N6RA 1YFZA 4HJXA 2EL9A 3IDZA 4EA9A 3U5ZB 2P9YA 3DMRA 3DZJA 3SEFA 1OFTA 3OZRA 2JCGA 3DW3X 2X19A 4UXJA 3RWMB 1ODSA 5HZMA 2IX3A 4P33A 1TA4A 3BOSA 3CX3A 3OFKA 4BE7B 1PSWA 2YHAA 4B46A 4D0NA 3EB9A 4Z1MA 5DHFA 1QM5A 2B8JA 2QJWA 2WOJA 3OZBA 4I4CA 3RSFA 2WT9A 3TQTA 4C01A 4IFIA 1ZSNA 1U9IC 2ID4A 3AIIA 4OHWA 1EFKA 3U40A 4LJLA 5HG0A 1E0JA 3BERA 3AVTA 2PTHA 4M76B 5TQ0A 3E61A 1PZEA 1L8XA 4KFRA 2RGYA 3KKKA 4MH0R 4PICA 1E89A 1JILA 1IY2A 1L7XA 2NPIA 2OFPA 3I2FA 3K0AA 5E6SA 3AZPA 2JLZA 2BHRA 3EFOA 3NVDA 3VPDA 3A4TA 1S8OA 2GRJA 1G3IA 3NAQA 3K94A 5ALMA 1PDOA 1UMCB 1Q16A 4TWBA 1GN8A 5HBRA 1R0SA 1C3LA 3MMSA 1Y6ZA 5FTMA 4WADA 2NWQA 3LL4A 5F2OA 4BAZA 4CIXA 3CLUD 2YIJA 4DQLA 4PZCA 1L4GA 2LCIA 2NTVA 1VYHA 3IAXA 3K0KA 3NT2A 3PIIA 3I6MA 5DH9A 3TAUA 4LF7B 3NDJA 1TF2A 5CCDA 5L3SB 5LR6A 5EWMB 4CCAA 4G4GA 4U5QA 1WS6A 3PJFA 5C5IA 4FI3C 5CURA 1NXOA 3PUXA 1DQPA 3DT9A 1QCCA 3DOOA 3ZZ1A 4PLGA 1BD4A 3G0HA 2IPXA 4BEWA 4B3FX 4AJJA 2HA7A 4JT4A 2NU6A 4IXDA 1JJVA 4QG7A 4DM4A 2MYTA 3U81A 1TQDA 1O95A 1SCQA 5BR1A 4LXXA 1DJNA 3K16A 1OXVA 3RYIA 4P6VF 2F17A 3AP2A 3N8NA 3RRJA 2YW9A 4DDUA 4M0LA 2CUZA 5EKTA 4BO4A 3GEEA 1XRSB 2FKNA 1ZK2A 4IFBA 1VGRA 2ODTX 4RVNA 3P2JA 3AVWA 3U4CA 2PT5A 3UATA 2GASA 5IDYA 3AM1A 1KE1A 5LDGA 3OCXA 4WW0A 1IM5A 3MJFA 3HB9A 2WJWA 1FYFA 3QE0A 5E9WA 5HPYB 1CY8A 4CTKA 2HV8A 4US1R 4CLRB 1Y6JA 2RH5A 4YAKA 1OH5A 2O48X 4KPUA 5I5EA 2HJRA 1OWPA 1VE6A 4BVLA 4RKQA 4B3GA 1V8ZA 1NBME 3JAKA 3L82B 2QDKA 4EHNA 4I66A 3TD6A 4GL4A 2NAFA 4N6OA 5CH3A 3HA2A 1DC3A 3WGOA 1GT91 2NU8B 1OD6A 4UQOA 1NWHA 2Q7DA 1DIBA 4GSKA 1I10A 4JJ6A 5DN6A 2UYYA 3IKTA 1XLWA 4NE9A 5BSRA 3AKZA 3B8EA 3D81A 1BFKA 2ZIGA 2QORA 4QJ4A 1TVKB 3N39C 2WAMA 4MS1A 4F8JA 4XOUA 2ZIUB 5KSPA 2NM0A 3STTA 3VYRB 4UHCA 4A6XA 1DKPA 1P1BA 2OVFA 5F1OA 3ICVA 3FPEA 4I4TA 4C3ZA 4LSGA 1PUIA 2ZYDA 3GT7A 1MAHA 4FMPA 4QAQA 2WLSA 4FGSA 4YP0A 5ALGA 4IQGA 2E1RA 3BVPA 4OHBA 1UBMS 4BJ5A 2QX8A 3K9BA 2JCSA 3F7MA 2PCLA 2BUAA 3OVMA 1EWYA 3C3CA 2D2VA 3FDXA 3U1TA 3TZBA 1UBHS 2YNMC 3AUUA 1T43A 3L1KA 4F12A 2JS7A 4W63A 3ASVA 3BJIC 1N1GA 2ISQA 1CUWA 2ZI6A 2A9FA 1WKBA 4HQKA 2ZCJA 2X8JB 2QQFA 4LXGA 1FRVA 4HWGA 4EPWA 1WVMA 4A15A 2KI5A 2R96A 1SKYB 5DN9A 4XGIA 4REOA 1I4WA 1DC7A 1TK3A 2C2YA 4Y0VA 4EHBA 4PNEA 4UNPA 2C2GA 4RY8A 1EA7A 3K9HA 4W9MC 1IMJA 4BFLA 2DFPA 5IK2A 1NI5A 4OLHA 1YTUA 4BCCA 1VIVA 4C4RA 5B1DA 4A0HA 4KQKA 1OVGA 3C5WP 4ZDKA 2HIHA 1SUIA 4TMWA 1DOHA 2CSXA 3BGSA 3EVNA 1CVIA 1SFRA 2Z6VA 4IJ5A 3R2JA 3BE8A 1TT5B 1Z4MA 5AFSA 3UAYA 5J1SB 2H1CA 4H18A 3CB2A 4L5BA 3R3XA 1F2DA 3HCCA 2AT1A 5AQEA 5CDGA 3NCTA 4S2EA 3R3ZA 4BWVA 2K7FA 2O8EB 1NJSA 1POWA 3OFJA 4IQFA 5EIOA 1B43A 4MUGA 1WZCA 3A14A 5E9AA 2QIPA 2BWJA 1JHQA 4IX1A 4AZ0B 3Q3VA 4EO7A 2O54A 3GOQA 1T1GA 2XNJA 1U4NA 1OKKD 1D0SA 4BFTA 4Q9DA 2R66A 3IV6A 3PDHA 1DX6A 1OUMA 2A4KA 3KOUA 4F7WA 1E0KA 5JOQA 1KFEB 2PZBA 5AUNB 5BUSA 1KYYA 3LLMA 4P34A 3ZC3A 4B31A 4BXOB 4M7WA 3SJAA 1QS0B 4ZYZA 1JHUA 4R2KA 4AP6A 4IFTA 4E7OA 1OLXB 3IBCA 2QNIA 4IWNA 1EP9A 2RD2A 4NCBA 5FTJA 4R6WA 4R2WA 3WC4A 4BKMA 1PKXA 4OJTA 3V1TC 5CFMA 2AMYA 3I3OA 1MHTA 2IY8A 2HC9A 4FK8A 1PU2A 1FS4A 5F3DA 1VE5A 4FYYA 3CMMA 3QI2A 2A1IA 4EB6A 1THGA 2WYOA 3R77A 2PQ2A 4AKEA 2XUGA 4AC9A 3EGXB 1KVQA 4ALJA 3FNQA 2J9FA 3EODA 3MWDB 2IVZA 4XUCA 5I51A 2ID8A 2MSDB 4D43A 3TI7A 1NGSA 2AMJA 2BRUA 2N75A 2W6OA 4DDVA 2QUZA 4B40A 5HGXA 2QS9A 1YQWA 3E35A 2CD9A 1DRWA 2PWZA 2VYVA 2UVDA 2WSSD 3EXG2 2BIFA 3KPJA 4BTEA 2C4KA 5LD2B 1AHNA 4K8RB 4TYMA 4AYXA 1T2VA 1UEJA 1QYCA 1Y3BE 1NUUA 2EWWA 4WT7A 3G6WA 4AJKA 2VDRB 2PBLA 3ODPA 1MR3F 4ZOEA 1VSBA 1HSOA 1DEAA 2QD5A 5BW6B 5DX8A 4ZVOA 4FPXA 5HJ2A 1FK8A 3EIHA 3KAPA 5AM1A 1X9GA 4KWEA 4DUGD 1LPBB 1E2NA 2J0VA 2Q62A 3NKFA 4QEZA 2I4TA 3R6LA 3CLUC 4FW9A 1XZJA 2NGRA 3DF9A 3KSUA 3WSVA 1VP9A 3NHYA 2O3SA 4R8KA 4WBXC 3C0KA 4G0ZA 3TTTA 4DLBA 4N18A 1NOKA 3I64A 1G291 4RIFA 3CZAA 3M9LA 2AI1A 2IE0A 1E5VA 1RC0A 3GLKA 2CHGA 2I99A 3AF4A 3WRWA 1CJUC 1FLVA 4XRGA 4MRMA 6NULA 4WN9B 3K0EA 1NG1A 3R3UA 5AW7A 2V3VA 1GPLA 1V8OA 1QQ7A 3WLSA 3OCWA 3CUYA 2NLOA 1R27A 2YWFA 2Z0MA 2W6ZA 3ENZA 1NMYA 4LPKA 3QHPA 1EAMA 2CEKA 1K92A 1L5RA 1VE9A 5FWXB 4MDFA 4ZVKA 2C7PA 5D84A 4J1TC 1L5YA 4HATA 1OVMA 4LY6A 3TYXA 1PYGA 3DZIA 3LI2A 3WJAA 4AO6A 2H07A 2ODNA 5IKPA 4M1QA 4JNKA 1L8OA 4XJSA 2WU8A 3KQKA 5JS1A 4FUQA 4HAOA 2J48A 3C4QA 1UC5B 3D0RA 5JAMA 3PS9A 5B37A 3HJNA 5PGMA 5D3ZA 4JLNA 10MHA 4PG7A 2BEWB 3CLHA 1V6SA 3RIYA 4RV9A 1UMBB 2XEXA 3TLJA 4EF5A 5C52B 4JI2B 4KSYA 1GFZA 5EJMA 3GJ0A 1Q0ZA 3H2JA 2R1VA 3K6SB 2MU1A 4I4TF 3KLMX 1PZMA 3DE3X 2B34A 1K7FB 3LHIA 4H1TA 4TLLB 4R2HA 1W30A 4X7BA 1PWEA 4L5JA 4BO0A 1VL0A 4U9IS 3KTDA 4KZKA 5GV8A 3RFXA 2PUTA 1WHSB 2BN4A 4RF4A 4OJYA 3C2QA 3PLNA 3TPCA 1VL2A 2WIAA 4G0PA 3DFKA 4ME6A 1X1SA 2FCRA 2VKQA 4OQPA 2W00A 2IUEA 1JIJA 4ETIA 5KJ6A 3N70A 3Q6IA 2QXUA 4W4TA 5IABA 3V42A 2A9QA 4X20A 1HM5A 1PJ4A 2P9TA 1U9IA 2PLWA 1G8YA 5AIBA 1ZGBA 3HGQA 1W9HA 4H1VA 4IOMA 1QHEA 5HM8A 4LPSA 4RACA 2MR6A 3KP1A 1FZQA 2HPVA 2G5GX 2M1XA 3P9IA 4UMVA 4BPBA 2Y1DA 4YFVA 2JJYA 2UVQA 2EJWA 2RSLA 4UD2A 1MLDA 4YALA 4HZIA 1ZI6A 3FM9A 4HDCA 2VSOA 5ESWA 4A23A 4HGQA 1IK4A 1KK3A 2C8VA 1FYEA 1WW8A 2ZWAA 4YRZA 4ZODA 1DIRA 2YWBA 4NV0A 3H42B 5FKJA 2GVDC 2ICAA 1ST2A 3KLBA 2O52A 4J0DA 3A9VA 3OJLA 2B8EA 1U98A 2FP4B 2HDNB 1FU7A 3O3OB 4OH1A 1WZ2A 2R6JA 1OAOA 1JLSA 3QKRB 4B3BA 1NVGA 4QDJA 2I6UA 2GPAA 4IJQA 4M1KA 2DFDA 1O8BA 4Q4JA 3JV7A 2D54A 3HCPA 3EGCA 2BSXA 2IGBA 4L2IA 1AE1A 2HN9A 4Q15A 1Y3CE 1H2BA 1ONBA 2CLDX 3I3SR 1C3XA 1S89A 4CFYA 4EI2A 3GDWA 1P5ZB 2XXBA 4P7GA 2EQBA 1QK4A 1THZA 2QF7A 1MJHA 5IG2A 1YQGA 2PKWA 4JIGA 1WXFA 3ZN2A 1T9DA 3ZV5A 5EHNA 2XWQA 5DKFA 4X8HA 4PG8A 5GADl 4G5OA 4BB9A 2HSJA 2PEYA 5IBRA 3A9CA 5FBRB 3TWOA 5BYAA 3UN1A 5CXSA 4E70A 1NXQA 4MHTA 2CE2X 4MW1A 1ULUA 4ZV4A 4O4LB 4UZEA 2HMVA 3FWZA 4BKQA 5AM2A 2ZSFA 1Z0DA 2FF5A 4HAYA 1QKKA 1DWOA 3ZBTA 1CZOA 1UWKA 3X1DA 5CT8A 3ZWAA 4MIEA 2V96A 2MINA 3SIWA 4JT2A 3JVVA 3PFWO