2HF9A

Crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
211
structure length
211
Chain Sequence
KDILKANKRLADKNRKLLNKHGVVAFDFMGAIGSGKTLLIEKLIDNLKDKYKIACIAGDVIAKFDAERMEKHGAKVVPLNTGKECHLDAHLVGHALEDLNLDEIDLLFIENVGNLICPADFDLGTHKRIVVISTTEGDDTIEKHPGIMKTADLIVINKIDLADAVGADIKKMENDAKRINPDAEVVLLSLKTMEGFDKVLEFIEKSVKEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, metal binding protein
molecule keywords Probable hydrogenase nickel incorporation protein hypB
publication title Structural insights into HypB, a GTP-binding protein that regulates metal binding.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 81
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hf9A00
1KI1A 1DAEA 3BE4A 1Z6GA 2CJWA 4DT1B 1L4YA 3OAAD 1FNMA 4Q66C 2Q3FA 2FPKA 2IWRA 1F2UB 1JR3A 2ZSDA 3A1SA 4MRNA 4WOPA 521PA 3AF4A 3B1WA 5IRCD 3WYFA 2EFEB 5EE0A 3FFAA 1ZUIA 4MRSA 3OF5A 2BKUA 4A1FA 4L16A 4JYCA 4DUGA 2EFDB 3U3RA 4HAUA 3N2EA 1XPUA 2ZUCA 3FDIA 1COWA 1F2TB 2IEZA 1IQPA 1KO7A 1C4OA 3ND8A 4JVSB 4MGKR 4CEHA 2NG1A 3QG1A 5FPHA 5HCNA 2JLWA 4TL8A 2OV2A 1XNJA 4Z8XA 1OKKD 2WWXA 3FOZA 2ZREA 1PV4A 1E99A 1H65A 3U60B 1KI4A 4TWZA 5SZJA 4M0LA 5E7JA 3T15A 4B48A 4E03A 1Z8FA 1DE0A 4KVGA 5EE9A 1OH8A 4PPQA 1FMLA 1G5RA 1E4YA 3IHWA 4EJSA 4PC6A 3AP1A 4EIWA 3BIFA 3PUWA 2WAYA 2V9PA 1XFAA 2G0TA 3WXMA 5FTLA 3UXMA 3LFUA 4FIDA 3AQ4A 4LJYA 4PQYA 4V0MA 3B7GA 4JJKA 4DT1A 5CLQA 4LHZA 5B58C 3RS3A 1E6CA 1CR1A 2YNMA 4CGZA 2QN6A 2NMVA 4D26A 2UZ3A 3BFKA 1G16A 5G3ZA 4PFSA 2OLJA 2Q21A 1S2MA 3NBXX 3GFPA 3NTUA 1TMKA 3M4YA 4G5SA 1P62B 1NBMD 1YJ5A 1X1SA 5CK4A 3EZ6A 5SZIA 1I4TD 3UMFA 2JLQA 3FTQA 1KGDA 1YZQA 2ZQ5A 5LD2B 1CBUA 3W8NA 2YZ2A 4JMPA 1E1QD 4JBXA 3SOPA 2QI9C 2HF9A 3G82C 5IHPA 1OB5A 5KO2A 3IPXA 2ZRKA 3BBPA 4PR0A 1E1RD 2VEDA 1MO4A 4PZLA 1KZGB 1QG4A 1WP9A 2XJ4A 5E4FA 3SJAA 4B3BA 1XCGB 4BEBA 2ZRJA 1T5IA 4KSCA 1JXMA 5DSZA 5KSPA 2CBZA 3QKUA 2P65A 1UEIA 4J0QA 2JLZA 2WOJA 4HDQB 2QEQA 2ZRGA 2OBMA 4YLGA 4LV8B 2NO0A 3BB4A 2I4IA 1W2HA 2JA1A 4RZ3A 4Y0VA 3GLHE 4FD2A 4LK2A 2V4ZA 1CS4C 1W48A 3T1VA 4QBFA 3I61A 3C15C 1FQKA 5AJXA 1XU4A 3FKSD 4EQ6B 3T06B 5TMPA 5GJCA 3VNUA 3BGWA 3QBVA 2QZ4A 4V0KA 1GL9B 3PV0A 2SHKA 4M2LA 1SULA 2ZYVX 4JLBA 4R2IA 2OG2A 1MR3F 1TEXA 4UNSA 1SXJB 1XBTA 4EJSC 4MYUA 4CZ2A 5DH9A 3NDBB 1ESMA 3ZQ6A 3WRYC 2AWNA 2BIFA 1QDEA 1KDTA 4HB0A 1VPLA 1SQ5A 3B1VA 4GZMA 4GPTA 5TARA 4LJ6A 3UMRA 4BRUA 3D31A 5KDLA 4U02A 1VYUA 2WMOB 1NY6A 1Z6XA 1E0SA 1XEWY 1XCMA 2NGRA 2QU8A 5JCZA 4L8GA 3U5ZB 4XIGS 2OAQ1 4D6PA 1CU1A 4TSFD 1XEWX 3MJRA 4LY6A 2ZS9A 4XTRA 1W4CA 2JIZA 4YMUA 4C0LA 1M7HA 3CX7A 1YU9A 3H2YA 2J7PA 4DWJA 2JDIA 1K5GA 4TMZA 1EX6A 4L5BA 4E09A 4LUCA 1P4SA 1SVOA 5HZHA 1G8YA 2J9RA 2ERYA 3AGPA 3TSWA 1TAGA 4MKIA 3UG7A 3NXSA 4KJZA 4TTRA 1G5PA 4BFYA 3RYTC 3PEVA 3MWYW 3VTKA 1G19A 1D5CA 2KJQA 3AUYA 4PZZA 1VIYA 4M9XA 4NBSA 4TN1A 3UMSA 3Q7QA 5L3VA 4BE7B 1CR4A 4A2PA 2X8AA 2GEDA 3KQLA 2ODBA 3B85A 5DYGA 3WRXC 2PMDA 2JJ2D 3WP0A 1P9RA 1Z6YA 2YKGA 4GMXA 4HATA 3PITA 4O3MA 3C8UA 1N5IA 1GAJA 4NH0A 4B44A 1ZW6A 3IIKA 1NN0A 2IHBA 1FZQA 1W0JD 4BUJA 1Z0IA 3HWSA 5AUNB 5K8LA 2QROA 4BZQA 3K70C 1NG9A 3VR2A 2P3SA 1D8TA 3KTAB 4HAVA 1ZD9A 4ZI2A 3KXLA 1Q3HA 1ZAKA 2F1IA 2P2LA 4TL6A 1J90A 5FBWB 3RAPR 5L3RA 3A6PC 3B60A 1EFTA 4EPYA 4DLXA 5DN6D 2ORWA 1S9HA 5J4YA 2BWJA 3QKRA 2DYKA 4LBYA 3S1AB 3LH5A 4F92B 2FSIA 1NVWQ 4EDHA 2GVZC 3PUXA 4V03A 5C2JB 3LVQE 1SVSA 2F6RA 1EFCA 5DI3A 1KAOA 4L9WA 2JLRA 4O2LA 4WZ6A 2IK8A 4WBSA 1ZIPA 1DAKA 4AK9A 4DB2A 5EXPA 4C0SA 1TUEA 4TZ6A 2QGZA 4Q7MB 3VR4A 4WIAA 3KJIA 3TSOA 4BGDA 4C0KA 5JS7A 2J87A 1P2SA 4M1KA 4BZPA 8OHMA 3CF0A 5FUXA 1G8PA 3QG5A 2PL3A 2VHTA 2A2ZA 3VR1A 1UJ2A 2ZXUA 5CM8B 1SXJC 4NONA 3JZMA 2IYTA 1KY2A 4KFSA 5AUPB 3C5CA 3MG9A 4N1AA 3NH9A 3LRPA 2WSSA 4TYWA 4M9QA 1VYVA 3GLHA 1IXSB 3EXAA 3FHOA 3DPUA 2ZROA 3S1AA 3SJZA 1U81A 2DWOA 4KV9A 1Q21A 1XZPA 1YKSA 1IY2A 4AY2A 3VX3A 3DKPA 2G83A 2YINC 3AVUA 1XJ0A 2ZVQX 4EKDA 4ITRC 4FINA 5KDDA 4NDZA 1II0A 5JECA 4UXJA 1NVVR 4PC3A 4XOIA 4H9GA 4BECA 1X1RA 2WWIA 2XSZA 2IXFA 3NH6A 5JS8A 3V9PA 4URZR 3CB4A 2WWFA 4DIDA 3GMTA 3HYRA 4W9MC 3F0TA 1N0VC 4LPKA 4DCUA 1Z0KA 1FOEB 2JLXA 1AZTA 2N42A 3ZDQA 1D2NA 2B8WA 4L9SA 2FJUA 5H70A 2QA5A 4YDHB 1E2HA 1EFRA 2J5XA 4GOKA 1G41A 1GNPA 1ZNWA 1U90A 2ZETA 4D4LA 4MA4A 2R6GA 3RWOA 1FFHA 4ACBA 2P0EA 4H1VA 3VU9A 2W0SA 4ARZA 2R6CA 4RD0A 2HCBA 4I1OA 1R8SA 3HR8A 4QGGA 5IK2A 3ZVMA 1G7SA 3BAFA 4C7OB 3AGQA 2D7CA 2RGCA 2MSEB 3BS4A 3B9QA 4Q4AB 4TYPA 2OHFA 4ASUD 4BFXA 4F93B 3SJCA 3SYNA 3OFNA 1G1MA 4LYHA 2CL6X 1U0LA 3TH5A 2CVFA 1GM5A 2HCJB 2H92A 3GCGA 1KK2A 2JGNA 2QMHA 4JS0A 1NLYA 1DTSA 4QJ3A 2XOKA 1LF0A 2QMEA 2QPAA 3SQXA 1E9EA 2FH5B 2OLKA 1LS6A 3U7GA 1Q44A 1T0HB 1C9KA 1Z06A 1P60A 4JVMA 2CLCX 3EPLA 3FHCB 4JJZA 1G8HA 3EX7C 3DMNA 4Q4LA 3CUEF 1TX4B 1TQ4A 4Q00A 2RHMA 4L4UA 2RGDA 1EG7A 1M7BA 3LBHA 4HB3A 1AS3A 4OHXA 1I2MA 1IBRA 1NIPA 2HXSA 2AKAB 4R7ZA 1GILA 1FTNA 1ZU5A 3RS5A 1Z6AA 5ANRB 5G40A 2ZRLA 4GT1A 4NCNA 4NL4H 4D0GA 2H57A 3TK1A 2DHRA 421PA 4CEIA 3QXCA 2ZJYA 4KYUA 4C7OA 1A4RA 3CPHA 1IAQA 4MUBA 3VHXA 3LWNA 1UEJA 2FFAA 2PJZA 4LYFA 4JLDA 4YMSA 4QGAA 4Q4AA 4B43A 4URWR 1MO6A 2RGXA 4B3CA 2ONKA 2RGBA 2ANBA 3JZAA 5AJYA 2X2FA 1QVRA 2DWPA 2O8BA 4C0QC 3I1FA 3MWKA 1FL9A 221PA 2GAOA 4A6PA 4NMMA 5EXTA 1E9RA 2AWOA 3I92A 3KJGA 2QBYB 1GFIA 1VIAA 2DFNA 2C5LA 3L43A 1T91A 5KNDA 2L0XA 4P31A 5F9FA 2MMCA 1S3SA 2YOHA 3L0SA 4M1WA 2R9VA 2Y8EA 2XNDD 1P3JA 3RS2A 1P61B 3LBNA 5H68A 1K8RA 3ZZTA 2YJTD 1T3SA 2O0HA 821PA 2VHQA 3CF2A 5GJVC 4XD7D 1W4BA 3O8BA 1E69A 1W4AA 1YHNA 3R7WB 4BLQA 4FMDB 2ZAOA 2YOGA 4PO9A 4IDPA 3WYGA 4I4LA 2BEKA 3QIAA 3LX8A 1A7JA 1KNXA 3KKQA 2EWWA 4HZUB 3F8TA 2X1VA 5FTMA 1QHIA 4Q7KA 4NCJA 3O8RA 3IBGA 5CLLA 2FZ4A 4HLUC 3CWQA 1HE8B 4KSBA 3SEAA 4ZCLA 4KLZA 2QRNA 4WW0A 3R8FA 4TLAA 1WRBA 1XXHB 1FP6A 3IIMA 4PSAA 3K0CA 3UK6A 2Q0HA 2WJVA 3THYA 1WE2A 1XP8A 3OE7A 2OCPA 2J7KA 2VSFA 2QQEA 1DG3A 1GRNA 3CRRA 3IBYA 4ESVA 2QBYA 3AVYA 1QHYA 4BEJA 1G3QA 1M74A 3OEEA 3KJHA 1R4AA 1CRPA 4BRWA 4KYIB 1JAIA 4LJ5A 1DAHA 2ATVA 4OJQA 4BPBA 2KI5A 4ZDWA 1IJFA 4ZDJA 4DSNA 2G1JA 4XVQA 4P4SB 1NY5A 4HB4A 1U0HC 2QT0A 1W36D 3LAWA 3R7WA 3LNCA 1L8QA 2CK3D 2G0NA 2VF8A 2CLDX 3AVQA 2FEOA 4HZUA 3OIYA 3AV0B 3SNHA 5FBVB 2ZPTX 1GUAA 4Q9JA 4NYJR 4KVAA 3TVDA 2XB2A 4B34A 1QHGA 1KSFX 4TMWA 2A5YB 4QNRA 5CJ2A 4JVLA 4M8NE 2F9MA 4HYYA 1ZBDA 2IS4A 4HUTA 1T6NA 3P1JA 1XD2B 5DHFA 2HT6A 1XXHA 4QBHA 5TVKA 3ZLJA 1NI3A 4XSHA 3IIJA 2JLUA 5HZKA 4CIDA 1ZYUA 1EWRA 1QVAA 4JBYA 3PEYA 2FGJA 4XWOA 1IN8A 1RRGA 2VYFA 3QKTA 3IDQA 3HPQA 3MUFA 1HV8A 3EW9A 5AJVB 1EESA 3E70C 4C2TA 1YZTA 2XZOA 4N3NA 2C04A 2WPDA 3IO3A 4GI7A 1J8YF 4P4SA 2F55A 1X8LA 2Q9CA 1NN3A 2ZRFA 1KI3A 3B82A 5FBRB 2G6BA 4AG6A 1W1WA 3AKDA 1CJMA 1JJ7A 5D3MB 4B47A 3NC0C 4S35A 5CDFA 5DGXA 5JI3E 1YRBA 4EFNA 4N0DA 4X8LA 3TAHA 1XTQA 1CP2A 4CT4B 1KI2A 1U8YA 3ETLA 4DDWA 2Z6VA 2IF2A 5BYJA 1K5DA 5SZKB 4DCVA 4E22A 4Z51A 4AYTA 1GVNB 1HT1E 4HEJA 4A8JB 2D7DA 1DARA 4AD8A 2ZR7A 1SVLA 2GEVA 3PCRB 4M9ZA 2ASEA 4ZIRB 2GILA 1KSGA 1XRJA 2ZJBA 2J0SA 1PLLA 1XX6A 3E5HA 1OHHA 1OYWA 2PT5A 2GVDC 2CNWA 1KZ7B 1UBEA 4OHVA 5F2EA 1ZVQA 3W90A 3REGA 2CE2X 2H1LA 1XJCA 4EAQA 1KJYA 2GETA 2ZS7A 3GLIB 5TV2A 1FNNA 3LY5A 4Z1MD 3A1VA 4BASA 4TLBA 1P9NA 1R0YA 2Z43A 1CKEA 2ECKA 3BH0A 1YRAA 4Q01A 4QC2A 5FL7A 3Q9LA 1MABB 1EK0A 1C1YA 1VG8A 3HJNA 5JWHA 1QG2A 1CTQA 3E1SA 2B92A 3NHAA 1XZQA 5D3MA 2FA9A 4D4KA 4A82A 3SFZA 2GDJA 2IBMA 2VBCA 4ESHA 1ZD1A 1RRPA 2FNAA 1UKYA 2AFHE 1ZM4A 2YWFA 3W9YA 1NN1A 3AVOA 4LCBA 4A8JA 2JJ1D 4DXAA 1Q22A 2V3CC 1JJVA 2I1QA 4PPGA 3EPJA 2D74A 3PQCA 1HURA 4M22A 4ZCMA 4ZIRA 1NF3A 1KJWA 2XZLA 4DLYA 3CW2A 4DEXA 1W0KD 2O52A 2CJWB 1IXRC 4D25A 5KNCA 3MWLA 1WBDA 1CJTC 1LVGA 3I73A 5EE5B 3NEJA 1CJKC 2QG6A 4GL2A 4OI2A 1S0UA 3GP8A 4Q1DA 2WWGA 3GLIA 1YR6A 1ZIOA 4IDOA 2RKOA 3M0EA 3VR3A 1NLZA 2DY1A 4CRWB 1JNYA 2QT1A 1NBME 4PHHA 4ZKEA 4B6FA 2XGJA 4IOJA 4AKGA 4B3XA 2C9YA 1MABA 3GPLA 3DDCA 3IPYA 3ZZ0A 2NPFA 4MKGA 3AKEA 4URXR 2BCJQ 4LDJA 2B21A 4IDNA 3EPKA 4TLDA 3U3KA 2A5DA 2GWHA 3B78A 1J70A 1E2DA 4TT3A 4B3GA 1LNZA 2ZE5A 2R6DA 2REXB 1D9ZA 5C4GB 1EWQA 2AK3A 1IY1A 3CH5A 2GBLA 1AS0A 1J8MF 4BQSA 4TQUS 3HU3A 4LJAA 5JBQA 3RRNA 1XEXB 2REBA 3EZ2A 3LDAA 1OE0A 5JHHB 1R5OA 4EFLA 2LCFA 2ZYUX 1UAAA 1KO1A 2C2HA 3TVTA 5CJPA 3WP1B 4UJ5A 3AVPA 3RVBA 4XTCS 3X1WA 1ZM2A 3UWOA 3ZS8A 1IN6A 2XTZA 3KQKA 4DLVA 5DIFA 2OESA 4MRPA 2BMEA 2ZJ2A 4A8JC 1IM2A 3P4YA 1E79A 2KBFA 2GJAA 4QL3A 1WCV1 4GRAA 2QAJA 1NMZA 2CMKA 3SN6A 4IEEA 5FR1A 1S9DA 4Q21A 4DCTA 1E9FA 2JLSA 2W6JD 3Q7PA 3GLFB 4NP6A 2IUUA 1Q12A 4UNQA 1E9AA 5F3WB 4A92A 2NO6A 2J46A 3VMFA 1NKTA 3KUCA 4G5GA 5F9HA 4B33A 5CM9C 1V5WA 1Z07A 2ZE8A 2CHQA 3SBDA 1Q3TA 4POAA 5FPKA 5JCPA 2PX0A 2O0KA 1N6KA 4IVRA 5TB5A 4D2IA 4YONB 1XEXA 4LYJA 1QF9A 2IYLD 1KI6A 1QHXA 1Z6TA 2WJYA 3DL0A 2PCLA 3EZ9A 1F6BA 1XTRA 3MSXA 2GJKA 2NQ2C 1NJFA 2I3BA 3P20A 1PJRA 1A1VA 1NKSA 3B1ZA 2GBLC 2ODEA 3MGCA 4NPHA 3VQTA 3DHWC 3UG6A 4GDFA 1E2GA 2Z4RA 3AKYA 2BCGY 1SZPA 1MH1A 3O8DA 4WZBE 5D3QA 3K70B 4WXRA 2F9LA 2DPXA 1GITA 4B6EA 1I2DA 4DIEA 5DE3A 4BWYA 2WAXA 4FMCF 4UJ3A 3CH4B 3GLGE 3ZGXA 2E1RA 1LB1B 4XWAA 2P5TB 4MH0R 2NO1A 2WIAA 3ADKA 3G5UA 3AF1A 5L8VA 2VP2A 4TTQA 2XXAB 3GEIA 4FXPA 2QTHA 1NMYA 4PSVA 2X19A 3GLFA 5J40A 2QAGA 2VP6A 2R6AA 4NU0A 3KFXA 1KI9A 5E3HA 3ZIAA 1GWNA 3QEOA 2OCAA 1JEDA 3ADDA 5AJWA 1XB2A 1TU4A 2GZDA 4RKFA 1U98A 2RGEA 2OXCA 1ZRHA 3NDPA 4AC9A 5K8UA 3RS7A 4LJ9A 2WJJA 1KK1A 1N25A 3QPWA 4OQXA 2KBEA 2QM8A 4KBFA 4LZZA 5TDHA 1F60A 2GESA 4FWTA 3L2OB 5FOUA 3EWSA 2C99A 3I32A 1G4UR 1E2PA 2QP4A 4EPXA 3FFBA 3T34A 1KSJA 1JBKA 4R98A 1Z5ZA 3N5CA 4Q19A 4TYQA 1NBMA 1OIWA 2PLFA 1G8GA 3UATA 1OYYA 3QXSA 4RKEA 4E5UA 2OILA 4PHGA 3TAUA 5JI2E 1E1QA 1Q20A 2ZRPA 4RD6A 4Z8YA 3T1TA 1XCPA 3A8TA 2RGAA 3CRW1 4RCYA 4NYJQ 5KU1A 3UWKA 3AKCA 3QY0A 3FKQA 2VSOA 1E1RA 1KO4A 2HT1A 3O8CA 3LLMA 4TTPA 1E2QA 2NTYC 2J0QA 1UDWA 2XXAA 1W2GA 1SVWA 4GNKA 4W5JA 2A30A 5GVRA 3RRYA 3FB4A 3RC8A 3GJ7A 3QPVA 5J4KA 3FGNA 4Q47A 1KDPA 2DBYA 3QKRB 3VR5A 5FL3A 4A15A 1Z08A 2ZUBA 3LW7A 3FKSA 2ZE6A 1XD9A 3UANA 3I5YA 1U99A 1SXJD 4XVRA 5BYKA 3T12A 2BM0A 2QAGC 1Q57A 4P4UA 2R65A 2C95A 4A36A 1I4LD 1G3IA 3CR7A 5DI3B 2IEYA 1U2RA 1II8B 4NKRA 4G3XA 1UF9A 3NWJA 3THOA 3WNDA 2OBNA 3UPUA 3GJ5A 2AD5A 2B7BA 5G41A 5JRJA 2F3TA 3SQWA 4JLMA 3PVSA 2FFHA 2HYIC 1OXVA 1G17A 5DYIA 4JSTA 5H8WA 1GZSA 2YWGA 4JZKA 3BK7A 5EQTA 1SVMA 2HYDA 4MYHA 4TSFA 3BFVA 5HKKD 2ZITA 1W4RA 4QBGB 4MKFA 2ZYWX 3GJ3A 2H17A 2WKPA 2WHXA 4P32A 2O8DB 3K9NA 4F4JA 2QE7A 4KFRA 4TMKA 1W47A 3CF6R 3NVAA 2IHYA 3A1TA 2WBLC 1VCNA 3IQWA 4Q1CA 2O5VA 1TUIA 3A36A 2ZI4A 4W7SA 3CNLA 3GLHB 3RNLA 2J3EA 1Z2CA 2QMOA 2PH1A 5HPYB 3T5GA 3QBTA 3RLFA 3TIFA 3NG1A 4IFEA 3DVLA 4MITA 3CPEA 1T0JB 4AIIA 4KBGA 3A1WA 1R0ZA 3FPAA 4U5XA 2QORA 3H84A 5GADl 1XPRA 2YYZA 3A58B 4R9UC 1II8A 2GXSA 3K0AB 5JJIA 1M6NA 3EAQA 3U44A 1F48A 3EC2A 2JJ2A 1UM8A 4X8HA 2OEPA 3CR8A 5EP4A 4G5RA 2OAP1 4LX0A 2VHCA 3OEHD 2HDNB 3Q8XB 1Z0JA 5FBQB 4KO8A 4ZDIA 1JQJC 1W0JA 4YC7A 1KY3A 4O2RA 5FOSA 1E4VA 2KE5A 3RS0A 1YZGA 3FVQA 3KKPA 1A5TA 1HQYE 4PSKA 4HAXA 3NBFA 4I81A 4Q48A 3PEUA 1KMQA 4RZUA 4XWKA 1YZNA 2O8DA 2ZANA 5DN6A 4BFTA 4JKYA 2EW1A 4DEYA 1MO3A 2C98A 5FOWA 2IS1A 2G3YA 2RB4A 3ZZUA 3LO5A 2WV9A 4JLAA 3B1XA 3VU9B 3DO6A 4I1VA 5EP2A 3UIEA 4ARZB 2RMKA 3QUSA 2ZRMA 1J7KA 2EWVA 3QKSB 1W7AA 4DLZA 1T3LA 3ZD7A 3FE2A 3GJXC 1DO2A 3LBIA 4X8OA 5HTKA 4JLPA 3K9GA 4RFSA 2J1LA 1N6NA 3ZVLA 3VNVA 2HLDA 1S8FA 2FSGA 3K0FA 2WSMA 3B5JA 2QQ0A 3K0AA 1UBGA 3BB3A 4IKEA 2IX3A 2ZTSA 1ANKA 4O0MA 3ZVRA 4U00A 2RHDA 1QZXA 4D4MA 1T4GA 4LPSA 4CT5A 4DLRA 1IHUA 3H4MA 3MLEA 4TMVA 1OPXA 4KCGA 5C46F 3WHKA 1TF5A 1O87A 4RJLA 1IN7A 1AS2A 1X8KA 1XWIA 2VH5R 2Q3MA 1UDXA 1G7TA 1N6IA 2P5SA 3RHFA 4IEIA 1W44A 2PBRA 4IRUB 2BMDA 2J0UA 1E98A 3RRZA 4E07A 3TUJC 2OFWA 4JKIA 4DKXA 1UKEA 3L8ZA 1OV4A 4DVGA 3L8YA 5P21A 3EIHA 1KDRA 2R8RA 3OFND 3VHLB 2OBLA 4PTLA 4QXAA 721PA 3DM5A 4URYR 5DI9A 2D2FA 3DKVA 4IOLA 3QKSA 5FH9A 3HR7A 4CEIB 4OBEA 3QOFA 1OXSC 4JT4A 1AM4D 4PANA 1EFUA 1KIMA 4CEJB 2WJHA 1NVXQ 3PENA 5CB6A 2AD1A 1T3HA 1HE1C 1P2TA 4KI0A 4MYCA 3EPHA 1NLFA 2PZEA 1VMAA 4DDTA 2EFHB 2O8BB 5EUMA 3QE0A 2V8OA 1UFQA 3B6EA 3PXGA 1TU3A 1RRFA 2HXYA 3ICQB 1LF5A 3Q5EA 1G5TA 4IVQA 4QKQA 1MRNA 4URVR 3T1OA 1LTQA 4TMTA 1GTVA 3IILA 3VFDA 3QXXA 4LHXA 1KNQA 1XPOA 3KDSE 3P4XA 3KB1A 2IYSA 5FI1B 2BBOA 1NJGA 2ZU6A 1Z0FA 3HU2A 5JFGA 4B2PA 4Q4JB 3DZ8A 5JSZA 2ZAMA 3C7KA 3RDPA 6Q21A 1G6HA 2GJ8A 2A5GA 2FZLA 1OXTA 1YR7A 2MSCB 2ZRBA 1JPNA 3CO5A 2I1VB 2PX3A 3F5FA 1U94A 4ASUA 2OCBA 3WHLA 3BC1A 1IN5A 3FWYA 4LJ8A 4PZYA 2GZHA 3TQCA 4TYNA 1XTIA 4TL9A 2ZI3A 3WNBA 3MCAA 2UVQA 3ADCA 4CEJA 2C78A 1TF2A 5BQ5A 2WOOA 2XZPA 1X8JA 4PHTA 4QFMA 1A2KC 4M4SA 4DSOA 3TLXA 1H8HA 2R44A 2OT3B 2YHSA 2JJ8A 4I1SA 1P7CA 1ZC4A 2VF7A 3K9HA 3E2IA 3KB2A 1WXQA 3THYB 4IDHA 3WNCA 2IW3A 2VPPA 1OFHA 2YVUA 3JVUA 3K8YA 1RPZA 4II7A 1GKYA 4FCTA 2GKSA 1E9SA 5FUWA 5JJKA 3EC1A 4CW7A 2IYZA 1YQTA 2CL7X 3QVVA 3P32A 2IWHA 2GRJA 4PPFA 2JAQA 4C0BA 2FPMA 4Q4JA 2BBSA 1GNQA 2CVHA 4A0GA 1LFDB 4W5HA 4D82A 4B32A 4DHEA 2A5JA 2W83A 2G9NA 3C14C 3RABA 1NSTA 3CBQA 5IDVA 3RS4A 2PT7A 4MRRA 3ICEA 5E7IA 1G20E 1OFIA 2ANCA 1MT0A 4M1MA 5IT5A 1DELA 3H0KA 3OEED 2GZAA 3GJ0A 3ND9A 2C8VA 3AVVA 2W6ID 2EYUA 1A82A 1CEEA 2XX3A 5JLJA 1MO5A 4TMXA 4B74A 2V7QD 1NMXA 1XTKA 2QNRA 1WA5A 2BV3A 2XNDA 4QOSA 3SZRA 1EFHA 5LPNA 4D81A 3OIWA 3CRQA 1T5LA 4QHYA 5EZ5A 1CJUC 4IOMA 1EGAA 4XD7A 1R5BA 5E7MA 2AX4A 3B2EA 1E94E 3EZ7A 4MKHA 1U0JA 3MRSA 3SYLA 4UNPA 3SFVA 1OH5A 1SKYE 1PZNA 4LRWA 4U7DA 4L15A 2F1HA 5KUTA 3VKHA 3SC3A 2FWRA 4HSEA 1D6JA 1HH4A 3K09A 2G77B 4BFUA 1LS1A 2OZEA 1RYFA 2NZ8A 3W8RA 2CEAA 1MOZA 2GEUA 4JLKA 4BLPA 1NSFA 2EU8A 2CCKA 4V02A 1Z22A 1TEVA 1XMJA 3RRMA 2V1UA 3WBKA 2AR7A 4WZAE 5BN4A 2IYXA 3TSZA 1IJEA 1JR6A 4B73A 1TNDA 3QF7A 4IHQA 2GJ9A 3CM0A 2C77A 1TQ6A 3HP1A 2IS6A 2GF0A 1Q0UA 3H86A 1G7CA 2ZSFA 2B7CA 5LB4A 1ZUHA 1RRCA 3TNFA 1E9CA 1TADA 1HEIA 1GIAA 4HLCA 1L2TA 1DAGA 2LKCA 5IF9A 1WF3A 2WTUA 2R6FA 3WMEA 1KDOA 3OESA 4PQRA 1GRQA 3DOFA 5DO9A 3K0CC 5AWFC 1NP6A 4Q18A 4CYMA 2K5UA 2CK3A 4PC2A 1TPZA 1QRAA 2X77A 1Z0AA 4CDGA 1N6PA 4ZCIA 5K8TA 1JECA 2QRZA 5LB2A 1H8ED 1TF7A 5BWMA 4A0RA 3V00A 4EUNA 2RGGA 1N3BA 1U9IA 3L0PA 3EIEA 3KKOA 4YQFA 2QL6A 2QP9X 1OSNA 4GP7A 1DOAA 3I8XA 4C2UA 2ZEJA 1G8FA 2QUZA 4QGHA 2FFQA 3T5DA 3PG5A 2J41A 1JALA 5JHGB 5KNBA 3N2IA 5DNYB 3ZD6A 1CRQA 1VTKA 2ZJAA 4I99A 3Q3JB 1Z29A 2PZFA 3W5IA 3K0EA 1ODFA 2CNWD 1D2EA 2CL0X 5HCIA 1RFLA 5JEEA 4Q1FA 3OIUA 2IS2A 2FGKA 3GQBA 2BM1A 3U6BA 1KO8A 2GCOB 3K09C 1E2EA 5BXQC 2XJ9A 4AWXA 4PAQA 4P0TA 5CB8A 1RJ9B 1FP7A 2CHGA 3EA5A 1DEKA 3ASZA 2FV8A 1E0AA 3SR0A 1XDBA 1FW6A 2ZRAA 1VDZA 3QF4B 2XNSA 3V4FA 2NZJA 1NNEA 4DLTA 4OQMA 5A5GA 2CCGA 2ZSAA 4B2IA 1MV5A 3W5JA 2EFCB 2P6NA 2ZM5A 4RD4A 3KJEA 5SZHB 1EXMA 1AGRA 5JJLA 3HDTA 2EYQA 3IO5A 4PO8A 1X86B 4OQNA 1M34E 2WIBA 2NIPA 1JPJA 1Z28A 2XB4A 5H1YA 5LDDC 1M1YE 3QQ5A 1II9A 1E2NA 1SHKA 1JB1A 1KO5A 1NVVQ 1P9WA 4A4DA 4A2WA 4B3DA 1ZUNB 2ZE7A 4UQOA 1F3OA 3AUXA 4LJ7A 4OI1A 3W6OA 4UNNA 4V0ME 3ADBA 2XAUA 5M04A 1U9IC 1A2BA 4RVCA 4QGFA 2GCOA 1U8AA 3C4JA 1JEEA 2YC2C 3EARA 2HV8A 2FEMA 4RY2A 1RJ9A 1UPTA 4G5OA 3SDZA 1DO0A 2GJSA 4PXAA 4F91B 4OYHA 4DC9A 1VCOA 1KKLA 2W00A 3GD7A 3QF4A 3AVWA 2IYRA 1RVDA 1US8B 4IVPA 4YXWD 2ERXA 2GAAA 5L3SB 3ZS9A 2DFTA 2OFOA 1W49A 1ZNZA 1P72A 2FE4A 3LA6A 2VP9A 2DB3A 2J59A 2Z4SA 4QHSA 4D0NA 2RH5A 3NC1C 4GOXA 2BOVA 4IW3B 2RGNA 4P4TA 5B64A 5AUQA 1ZNYA 4FW9A 4Q03A 2BMFA 5AR1A 1BMFA 3LV8A 1YZLA 4Z54A 2JJ1A 1IONA 5EE1A 5TY0A 4OHYA 1XEFA 4DSUA 3D3QA 3CZPA 5JRZA 4HAWA 1G3MA 1W0KA 2VP0A 4DDUA 1NRJB 1KI6B 1JR3D 2VO1A 5A0FA 4A6XA 5CIQA 4GZLA 5TXGA 3GJ4A 1GKUB 2E9SA 2DFKB 3VX4A 1ESNA 4LHYA 3EA0A 4DUGD 2PEYA 2EQBA 2OXRA 3A4MA 3EWAA 5E95A 1N5KA 1COWD 2ZSBA 3KZ1E 4C30A 3TR0A 2VHJA 2QY9A 3BERA 4BLRA 1QHSA 1N0WA 5CYPA 1VCMA 1US8A 2PMKA 3FMFA 1KTVA 1Q1ZA 1GL7A 1ZU4A 3RANA 4HLDA 3KX2A 4DBLC 5L3SA 2O8CB 2QP3A 3CX6A 1ZM3A 3T61A 2V6IA 4Q9IA 1MKYA 3KQNA 2PJRA 1HUQA 1AN0A 2XEXA 2ZVPX 1AKEA 3C16C 2OM2A 2HEIA 3U61B 1P73A 1WQ1R 3MWJA 3PUVA 3A37A 1OF1A 4KU4A 4Q7LA 4BFSA 2OUKA 1X3SA 5L3QB 1E2KA 4Q9LA 2QAGB 3SJBA 4A0FA 4KITB 4BLTA 2AKYA 5KYKA 3IGFA 1KMHB 1WDTA 3LQRA 3Q5DA 2P6UA 2F3RA 3C5HA 4KFUA 4GBMA 2GXUA 5C4MA 3BFXA 1BYIA 1XMIA 1KYIA 4N0EA 2HF8A 3ONWA 1G4AE 2RGNC 1SXJE 4NE2A 1HQCA 2ZI9A 3OAAA 4NYIR 1E2FA 3AP2A 1J2JA 4NYMR 1IY0A 3B1YA 2A7QA 4FI3C 1FMJA 3W3AA 4JLOA 4C9BA 2A78A 2IUTA 4HUQA 4Q7JB 2GK6A 3THWB 1QHHB 4RD2A 5FOTA 2O8CA 5EP1A 2W2TA 1R5NA 2W6JA 4YMVA 4TZ0A 3EZFA 1E0KA 3ZIAD 2VTKA 2ZS8A 2DCUA 4IJMA 5G53C 4EPVA 2R2AA 1FUUA 2ZJ8A 3X1YA 1OKKA 5G3YA 2ZRHA 1SVKA 3R20A 3MMPA 4PC1A 2G1KA 5AK0A 4BZXA 2WWWA 5L3QA 2QSYA 4OQFA 5FI0B 5FOXA 4JYBA 4MDEA 1PUJA 2AL7A 3CLVA 4BLSA 2YOFA 4QNMA 1FX0B 1NIJA 2AXPA 2IL1A 5JMTA 4KLNA 3KXIA 1XF9A 4ERNA 1KMHA 3AVXA 1F2UA 4IDQA 1UADA 2CE7A 3G0HA 4KODA 1CF4A 3U7FB 3R8CA 3TQFA 1YZUA 3LLUA 2WJGA 3I3SR 1AA9A 3KQHA 4LGMA 4S2EA 2VL7A 1VG0B 1B23P 4GSYA 2VP5A 1CJVC 4FWIB 3K70D 1F2TA 5B30A 1GSIA 2ORVA 4LOAA 3QI2A 3VAAA 1CLUA 2GHIA 3EASA 3P27A 2IC5A 1OXXK 2DFLA 2OE2A 3I62A 1DPFA 2F43B 1G3RA 5ELXA 3R9XA 2D06A 2H8KA 1N5LA 2IA5A 1JXOA 3L0OA 4IXNA 4PX9A 3AF3A 4JLNA 2BMJA 3THWA 1QHHA 1AJEA 3GFTA 3LW8A 1HTWA 3Q85A 1OJLA 3R9IA 3RC3A 2GCNA 1OH7A 1HYQA 1N0UA 2BBWA 2OFXA 3BJIC 5FOVA 4GOJA 4C0JA 2JIZD 2FDCA 1UBCA 1PVOA 3TR5A 3A4LA 2ZRDA 2J7PD 4D4JA 2JDID 1VECA 3AM1A 4KFTA 3L82B 1AGPA 2FPLA 2IYUA 1S3GA 4Y0AA 5HE8A 3CRMA 4OJKA 3D7MA 1FX0A 3OIVA 1G7RA 1Z47A 2KSQA 5J4VA 1RKBA 5JEDA 2VLIA 3B13B 1YR9A 4ZO4A 3MAAC 1AZSC 1QHNA 2ODNA 4R2HA 1AQUA 4XVUA 1E3MA 3QSYA 5A4JA 4JL8A 4AYXA 1GNRA 3NIBA 3PJRA 1LY1A 5EXXA 2O0JA 3UKDA 4WA7A 1OFTA 1CULC 4M1YA 2MMGA 4HI0E 4AI6A 3X1ZA 3U44B 4UNRA 1YR8A 2F43A 5J47A 3GLGB 4DCNA 4C3ZA 3TUIC 2A5FA 3WYAA 1X6VA 2NO7A 2QE7D 4M53A 2W0MA 3KKMA 3KUDA 1HA3A 2N1BA 5UKDA 4A9AA 2WWYA 5FPTA 4I1UA 2JEOA 3RSOA 4MGZR 3SHWA 4K81B 1WMSA 3VKWA 3NBZC 4UXIA 2A3RA 2QPTA 2FF7A 1F5NA 3M1IA 3ZVNA 3GEHA 1XD8A 4EQ6A 2KWIA 1TQDA 1RW4A 2FSHA 2ZRIA 3THXB 3CNOA 1NVUQ 1SXJA 4DRZA 4ZPXA 3DZDA 5LBIA 3AB3A 3QENA 4URUR 3GJ8A 5KPDA 1BOFA 1EX7A 3K53A 4EPTA 2TMKA 4YMWA 3U7EB 4O25A 3BH7A 4RFSB 3ZJYA 3K0FB 2WICA 5BW8A 3EIQA 1BH2A 3ZQJA 1J99A 1KI7A 1R0XA 4HLQB 5AJZA 2A9KA 4ACAA 1GDDA 3IEUA 1N6HA 2BDTA 2IXGA 3GLGA 4FMCB 5HKKA 4Q4HB 4HB2A 4RD1A 1Z83A 5LD2C 4F4CA 3W3ZB 3KQUA 3IKJA 2F1JA 3HU1A 4FCVA 5FPYA 2WSSD 1GOTA 3GEEA 3TGPA 4OI0A 1GKIA 2J0VA 2J0UB 1CXZA 3OZXA 4US2R 2OSBA 2VSXA 4M21A 4QRHA 5FFMA 4JBWA 3THXA 1G3UA 1ELOA 1E0JA 3A4NA 1ZNXA 2BBTA 3GJ6A 4FMBB 2HLDD 4G1UC 4GP6A 3QPUA 3X2SA 4A2QA 2CHVA 3SU8A 4F4IA 4M9SA 1NN5A 1VHTA 4WAUA 1MRSA 2IYWA 2W58A 2XSZD 5B57C 4TLEA 1OB2A 1VCIA 4V0NA 5CIWA 1P2VA 2AK2A 2VP4A 4DSTA 5J4LA 3H1TA 4PHFA 1L7VC 5FUYA 4QM7A 3OEHA 3KTAA 3I8SA 1LV7A 5F98A 1Z3IX 4TLCA 1FUKA 4LV5B 2RCNA 3LX5A 2QMUA 1CR0A 3BB1A 3PUZA 1KOFA 4NZYA 1EFRD 1M8PA 4Q4HA 4UXHA 4FMDF 4JIMA 3PEWA 4BLOA 2P6RA 1D9XA 5EXSA 4B76A 2IYVA 2AXNA 5J4HA 4LYAA 4DJTA 1L4UA 4DLUA 3NBYC 4QHTA 3TMKA 1P75A 2IYQA 1KAGA 3WBJA 1KHTA 3GFOA 1Q1QA 5IK2D 1AKYA 4LC0A 3TW8B 2WVJA 1P6XA 1OLOA 2AN9A 4D0LB 1KSHA 5JSZB 3FMIA 2JLVA 2D62A 1XTSA 2P67A 4JLVA 4OHZA 1R8QA 1BO6A 3SBEA 4CVNA 4K8OA 3PIRA 3U3OA 4MRVA 4M1OA 1T9HA 4JSYA 5KSYA 5GJBA 1RZ3A 2LKDA 4MDFA 2UZIR 2Q9AA 3DMDA 4LBZA 4B2LA 3TKLA 3ECCA 3DEFA 1FQJA 4RD3A 3K0SA 3MJHA 3A1UA 2XOKD 4DB4A 1R7RA 2FU5C 2BVNA 4JL5A 4LC1A 1DAFA 1R2QA 2BJVA 4IFBA 3Q72A 4M1SA 4P3YA 1DG1G 2QM7A 3X1DA 1S1MA 1OXUA 3QVUA 1DVRA 4YDSA 4XJXA 4GMDA 1XMSA 3ASYA 4KAXA 3SHFA 3TUZC 3KFVA 1VG9B 2GXAA 3EG5A 4H1UA 1QBKC 2Q9BA 2ZI6A 3K1JA 3REFA 4A0HA 1ZCBA 2OCYC 1ZP6A 2EVWX 2O8FB 1AK2A 1E2LA 3AH8A 3DM9B 4TYYA 1ZM9A 2ZRNA 1FPMA 1YE8A 2GF9A 3X1XA 3U4QB 3K9LA 121PA 4NYIQ 3U2QA 2GCPA 3SE0A 2QENA 4US1R 4NYMQ 4EPRA 4BFZA 1N5JA 1TTTA 2C9OA 3WY9A 1H8HD 4ABYA 3F3YA 3BRWD 4HAYA 2B8TA 1IOZA 4QJ4A 4AYWA 1XXHE 1BYUA 1E2IA 1HY3A 4KHZA 1RIFA 4ON9A 4XH9B 1LW7A 3MD0A 5KSZA 4LHVA 1G291 2CLSA 3BORA 2ZI7A 2UKDA 2IF0A 3AF2A 3I72A 5DLQC 1VG1A 3C41J 3CONA 3IHLA 2V1XA 2QGNA 1GL6A 4AG5A 2FSFA 2FN4A 1P2UA 4HLUA 4JVNA 4TQ9A 4KXFB 3IUYA 1FTSA 1S1CA 1B0UA 1OW3B 2QSZA 5FUVA 2MSDB 5JWRA 3B8HA 4EFMA 5JZVA 1V43A 2FG5A 4EPWA 5KPJA 1BIFA 3O47A 2ORIA 4F38A 2KB0A 3HPRA 3LXXA 4WVFA 2O8FA 5GVSA 5CDFE 1ETUA 2WJIA 3HYTA 1G9XA 3VKGA 4C4PA 3MFYA 1AIPA 1VKJA 2QTVB 3ZYCA 3U4QA 1IN4A 2WWHA 3CX8A 3QEJA 3NEYA 4MGYR 4B3FX 1BS1A 1DAIA 1TQ2A 3CWZA 1PLJA 2REOA 4JLJA 1YZKA 2RAPA 2FX3A 1SVIA 2GA8A 1UKVY 1D2MA 1E9BA 1PUIA 2WM9B 3JVVA 3OE7D 3LQQA 2H7VA 3U3JA 1E2MA 3AEZA 4R71A 1I4DD 2ZJ5A 3NKVA 2NOAA 1VHLA 4OKSA 1KJZA 1CIPA 3WMGA 4OK3A 2G88A 2ZSEA 5EP3A 2NO9A 2YWEA 1ZC3A 1ZM7A 2Z5FA 2Z0MA 1ZCAA 2VHUA 2H18A 4ILEA 1HT2E 1W46A 4Q9HA 2FMXA 1CR2A 3SI7A 3BOSA 4OK5A 1GRRA 2V55B 4NTZA 1OIXA 1G6OA 1O3YA 4FCWA 2GXQA 1Z2AA 1W36B 4Q1BA 1SGWA 3CIOA 4PAMA 1AQYA 2WKQA 3TRFA 3QNUA 4ZI3A 4LBVA 1K6MA 3PUYA 1ZD8A 1NL3A 3KXKA 1P5ZB 5K8IA 2PEZA 1N2CE 4QJ5A 2ZRCA 2VRWA 4W5WA 3R9WA 2FOLA 2AFIE 1Z63A 2ATXA 4AKHA 3J81k 3CRVA 4JT2A 4AKIA 3T1QA 2D4HA 2W6IA 4HZIA 5KOYA 4Q02A 3QXJA 3CZQA 5C18A 4TL7A 2IXEA 1XMVA 2V7QA 5CITA 2PZGA 2X2EA 2LWIA 1E96A 3M6AA 4AURA 2DWQA 4UKDA 3GLIE 3B9PA 2ZYTX 5CYOA 2YV5A 2BEJA 2FFBA 2ZJOA 2WPDD 3FMOB 4X8MA 5KHOC 1E9DA 2H16A 1E2JA 4LBWA 4FN5A 2D2EA 1VYTA 4PAOA 2ONJA 1IXZA 4V0OA 4OQLA 4PC7A 2O8EB 2DR3A 5FPSA 4OHWA 3AF0A 2VIIA 2C9CA 4MUAA 1RE0A 5AUOB 4C0HA 4DZZA 4DDVA 1R6BX 4HAZA 2J45A 4C0AC 1DS6A 4NCKA 1XJQA 3OHMA 1SHZA 1N6LA 4M1TA 4NCHA 4DLWA 4Q5IA 2CCJA 1G21E 4ZDKA 4WXPA 5FBLB 2V54A 1XTJA 4QBIA 1E32A 1WBBA 4US0R 4XSGA 1OFUX 2V6JA 1BKDR 2VA8A 1OIVA 4IXMA 1R0WA 5EJEA 4Q1AA 1JI0A 1OHHD 1T8TA 2OO7A 3SYKA 2HJVA 2ZUDA 3V4RA 2BJWA 1G18A 1JR3E 4B71A 2YWHA 4OL0A 1Y3AA 1N6OA 3QXHA 3T35A 3LXRA 4JL6A 3CKLA 4RSGA 3W34A 2JLYA 3U6KA 2NPIA 3AVTA 2HUPA 1M7GA 2CXXA 5FL7D 4G0NA 2ZJZA 3TBKA 2CDNA 1SKYB 2O8EA 1ONBA 3W6PA 4AKEA 3U7HB 4MQBA 1H8EA 3BWDD 4D80A 3FHTA 2D3WA 3KKNA 5KSOA 4QM6A 1TL7C 4ZV4A 5FTNA 3WMFA 1XD2A 2ZIAA 3ZH9B 3FMPB 1UBFA 1DADA 1NG1A 4OK6A 4B35A 4YMTA 1N6RA 3P26A 5BN3A 2XITA 1W5TA 1GG2A 4OI4A 3QJYA 4G5QA 4RZXA 2AHOA 1W36C 1UKZA 1U8ZA 1ZJ6A 1KI8A 3TW4A 2BC9A 2YC4C 4PPNA 2XTNA 4P33A 2QPOA 2W2VA 4LSGA 5C1BA 4Q9KA 5DHAA 2F7SA 2IYYA 3BH6A 3IQXA 1R10A 1S4QA 2XTMA 4LV6A 4NCIA 3BXZA 5GJWC 4F7WA 1WB9A 1ZMXA 2IT1A 4RCZA 2GK7A 3RSLA 2ZI5A 2ZR0A 4MGIR 4GFDA 4PQFA 4RZ2A 5DISB 2WMNB 1Q1BA 5CK5A 4G01B 3SS8A 2Z83A 1DBSA 4RFVA 3LVRE 3D6TB 3KL4A 1T8UA 2C03A 2JATA 3TE6A 1GP2A 1Q1EA 3LD9A 3CNNA 4LI0A 3VR6A 4DCSA 2BKEA 4CF7A 1YVDA 4Z1MA 2B6HA 5EZ6B 2JASA 3I4LA 2WKRA 3GLFE 4DLSA 1BMFD 2W2XA 4IOKA 2E87A 4TT3D 2Q3HA 1Y63A 3TJZA 4HDCA 2BHRA 4PO1A 1JQLB 1S96A 2GNOA 4Q1EA 5FTJA 5FTKA 3AP3A 5B2ZA 4HDOB 2HJGA 2WZQA 3FYHA 4K46A 3I5XA 2PLRA 3W6NA 4BFWA 3PFIA 5KTYA 4LJ4A 1KK3A 1DAMA 3U3MA 1OH6A 4V0LA 3PR1A 4BFVA 2QTFA 5EUQB 3BD9A 2Q6TA 3RWMB 4LWZA 1Z0DA 3DOEA 2C96A 1E79D 5FR2A 2H5EA 2N46A 2ODWA 1PLKA 1RYHA 2VQSA 2F1RA 3CPJB 2GTPA 4B75A 1ZINA 5J5CA 4CEHB 5HE9A 1JAHA 5JWOA 621PA 1RC8A 4YXWA 3N70A 5HR5A 4MYTA 3NHBA 2ZR9A 1KK0A 4TQAA 1OT3A 1G64A 4LHWA 2PCJA 4HUQB 3D8BA 3L0IB 1M2OB 2R62A 4ZKDA 2EFGA 4EJSB 5BN5A 1SKQA 5KDOA 1W5SA 4QG7A 4NHOA 3IEVA 1KKMA 5EE3A 2IUSA 2JCSA 2ZU0C
chains in the Genus database with same CATH superfamily
2IVZA 4HDNA 4A91A 1V11A 3QOXA 1SOWA 1Z6GA 2C5BA 2Z5LA 1L4YA 2IGTA 1QTNA 3INRA 4DE5A 3KKLA 5H9VA 1PRYA 4ZQFA 521PA 5E6UA 1F6WA 2BT4A 3CZ5A 3L77A 1EXWA 4NBKA 5EIBD 3RSFA 4AY5A 2FK7A 1L5HA 3WYFA 5EE0A 3E48A 1CZNA 2WIJA 3FFAA 3DONA 3KKEA 4G0UA 4MRSA 2TRSB 2JKVA 2Q3LA 1B8NA 4L16A 4JYCA 4MSUA 2IYAA 5ALFA 5PGMA 4EWLA 4AX4A 1XPUA 1JFLA 4GX0A 1COWA 2NZYA 1I5EA 1PJTA 1FRQA 3LDHA 1O4VA 9LDBA 5KWEA 1H4SA 4MGKR 2B20A 2W4QA 3HO6A 5FPHA 4BJ5A 1P1CA 3FNEA 3DDZX 3A2NA 4HPJB 4BTEA 5KOJB 1XNJA 1D0IA 1OKKD 2WWXA 3JW8A 1ZHHA 3NWEA 1QYIA 4G9EA 4GKVA 4JB8A 2WZCA 4LTMA 2WSBA 5DX8A 3TRJA 4CV3A 1EMDA 4PYJA 2DX7A 3GRYA 4Y6SA 3LVFO 1KI4A 1IRXA 1L7XA 3L8EA 4LDZA 5E7JA 5SZJA 4WRRA 2B4YA 2HNBA 3GDOA 3M3DA 1DE0A 5EE9A 4YJKA 4AZ3B 2G04A 1G5RA 1VKOA 1VGQA 4EJSA 3HN6A 3H7AA 2ZK7A 4OPMA 3M6UA 3PUWA 4Y2HA 1LDYA 1T36A 2V9PA 2VNHA 4QXPA 3WXMA 4C6RA 4BC0A 5BNZA 4BMNA 3HNPA 2I78A 3BD7A 3A6LA 4V0MA 2RONA 3B7GA 4JJKA 4O4HB 4AWBA 4ML3A 1DDIA 3MQ4A 3EAFA 4LHZA 1W34A 4GWGA 5CLQA 3UWDA 1TO6A 3NI2A 1CR1A 2COKA 4CGZA 3FBGA 3FNGA 2JIBA 2M9MA 2UZ3A 5TX7A 2OLJA 4WGFA 3D8SA 1S2MA 3A4YA 1EEXB 5E2IA 2Q8NA 1GNLA 4G0PA 1NUUA 1UZMA 2FQ1A 2ISQA 4GM4A 4UVDA 4QUDA 1X1SA 1XA0A 5SZIA 1MC5A 3UMFA 4IH9A 3FOEC 2J3MA 3E4DA 1PGQA 4DLKA 1DC5A 4RL4A 4J16A 5E6SA 5B2FA 3C3KA 1Q7CA 3PGKA 4CHTA 5IHPA 3AKZA 2X13A 5SICE 3FAZA 1JDBC 4EO4A 5KO2A 2CLFB 4FFWA 1FZTA 3GPIA 3IPXA 4R4JA 1QONA 5E4FA 2VEDA 3SJAA 1QG4A 5HF5A 4RC9A 3D3EA 4MPRA 2ZRJA 3Q9SA 1JXMA 4WSOA 5DSZA 1RCUA 1TMYA 1UZLA 2CBZA 1HDYA 2HMTA 2P65A 2HRRA 3M34A 3L8MA 2INGX 1OBOA 4HDQB 4IQ0A 2QEQA 5JYBA 1CVLA 2OBMA 4LV8B 5K3EA 1EUZA 3H0CA 3JR7A 3BB4A 2JA1A 3JQEA 1CW2B 4QECA 4FD2A 4Y0VA 1B7GO 1EDOA 3SBOA 3VR5D 2DEUA 1TYDE 1XU4A 3ET5A 4EQ6B 1D1SA 1OI2A 1RYBA 2WD8A 5JG7A 3B5IA 3NJ4A 2I76A 1XLTA 2SHKA 2ZYVX 4JLBA 4NEGA 1SCQA 1TEXA 1XBTA 4RETA 3SF8B 4R40A 4EJSC 3C74A 5DH9A 4LWOA 1C8LA 1Q83A 2I2BA 2AWNA 2B2XA 2BIFA 2Q5HA 2Z2ZA 4L50A 3WRYC 3Q6NA 1KDTA 9ATCA 1UOOA 3B1VA 3KEQA 3DZIA 1M8GA 5MN6A 1CJSA 4QE3A 4CU2A 2VYVD 4LJ6A 3KEFA 1DKUA 5KDLA 4ZZ0A 1B6GA 4BE9A 4MVJG 3CU5A 1MH9A 1M72A 1SBZA 1XEWY 5CA1A 1GZ5A 1YR1A 1XRNA 4KXNA 3F67A 3AM5A 3U5ZB 4FB4A 3K94A 5HDQA 4K86A 4TSFD 3WK8A 5KQMA 2JFZA 4DIFA 4U6QA 5J2TA 4YPFA 1F8UA 2HRQA 1M7HA 4JNKA 4OFXA 3IQZA 4QBKA 1Q7BA 1WPGA 2QD5A 1HZZA 1JE0A 3R9KA 1EX6A 1GPKA 1M0TA 3T1HB 2GLXA 3H9EO 1A77A 4PGHA 2C4MA 4RJKA 4J16C 4JENA 2E7ZA 4DJFC 5KYVA 3LLSA 3E4CA 3ZE2B 1TAGA 4U2EA 4N01A 1KP9A 2V98A 3GNSA 3RO7A 2PXAA 1M2KA 1OH8A 2V7TA 2R8XA 5LXTB 1LQUA 5DEIA 1H3NA 5SY6A 3RYTC 3MWYW 4BB0A 5C5IA 2PO5A 1SCNE 3DCNA 3AUYA 1W5EA 3BK2A 4GO1A 4AJ2A 1N1DA 4PZZA 4NBSA 3B3FA 3UMSA 2V5UA 2A9VA 3A3YA 2VDMB 3OCVA 4JC0A 1CR4A 4P58A 5DT2A 1FDRA 4BE7B 4ECAA 3HTXA 5A4FS 1YL7A 3CISA 2ODBA 2VATA 3OX3A 1SR8A 3B85A 3TINA 1FUYB 3SEZA 3PGMA 4PYKA 1ZD3A 5FYQA 3TVYA 3COVA 4GMXA 4HATA 1VKNA 3C8UA 3WVNA 2I71A 1WV0A 3O0DA 3L02A 2JCGA 4NH0A 4EQZA 1B1CA 1XLTC 1ZW6A 2IHBA 4EMBA 3KSDO 4YWJA 2PSDA 4BUJA 2ZVJA 3D5QA 2ZJ4A 1YWGO 3VR2A 3E6AA 1RWQA 1NG9A 1DEXA 4NMHA 4L78A 4YV7A 5K7SA 3KXLA 3AILA 5F9MA 1WP4A 2VF2A 4BOYA 4X85A 1B8VA 2WE7A 3GLVA 3ZW8A 4DW8A 1EFTA 3O3NB 3Q0EA 3WICA 4EPYA 1Q0RA 2QVCA 2OQRA 5DN6D 3ND6A 2BWJA 3C87A 3PEEA 3QKRA 3M4JA 3WBFA 3MUOA 1O94D 3BE8A 5CX1B 1NR5A 2HSJA 3U4HA 3V7NA 2XRZA 4YUYA 4EDHA 2RAVA 3PNBA 4H7PA 4DWOA 3U31A 2GVZC 4TKUA 4YJ3A 3BMCA 3FJ1A 3A2MA 2QLTA 4IZ6A 4DPLA 3UK0A 1AVTA 3OKCA 1KR5A 1XTPA 5J58A 2QHXA 1HZZC 2BSXA 2YQ4A 3HRIA 3HVKA 1BCRA 2O2EA 3Q7IA 4RMGA 3H97A 1DAKA 4WBSA 2E4YA 2ZCVA 5AW6A 3BKWA 1ZWKA 1ECGA 2GRUA 4BCCA 1N75A 3I23A 4FLFA 4BATA 4OV6B 2AN4A 3VR4A 4QVIA 3KWLA 4RVSA 4BGDA 1A2OA 4RQBA 4C0KA 2JD0A 4M1KA 5FPQA 3IV6A 5D01A 1TGYA 1JJFA 1U7XA 3CF0A 3Q0IA 4IIYA 3U7IA 2HDWA 3G0DA 1TAUA 2AA3A 4KQGA 3UJCA 2VHTA 2A2ZA 1UJ2A 2X6QA 4ARVA 3X43A 1L7BA 3JZMA 4YX9A 4KFSA 2TECE 1O58A 3QFSA 4L5JA 2VUUA 1KFKB 1Z33A 5AK6A 2BEUA 3RG2A 5KWSA 4WKGA 1W0CA 1KEEB 1C2YA 4HFMA 4PIPA 1VYVA 1IXSB 4ND8A 1HC7A 3EXAA 5A3VA 1K6JA 3DPUA 2CXPA 3R5HA 5KNCH 3JWGA 1U81A 3V1MA 1HNXB 2DWOA 5TQ0A 5HF6A 3UOWA 2ZYAA 2W11A 1XZPA 5CAEB 2H1WA 1RXYA 3HYLA 3WB2A 1FVXA 2EZTA 2KHZA 1P0CA 2YINC 5A3QA 4AMYA 5IN4A 3RVNA 5LM3A 4M7WA 5A9SB 1J2TA 2WMYA 3RSSA 2BN4A 1FFXB 3L1HA 3TQIA 4E94A 3EZNA 5JECA 4PC3A 3SQLA 3WWEA 3P9IA 2YV3A 1OTYA 2QK4A 2ZKIA 1XPJA 4H9GA 2XSZA 3RFVA 4EP1A 2IXFA 2ENWA 3NH6A 3T99A 2Y68A 4U9UA 2OYSA 2O3UA 4FDVA 4BU1A 2P1DA 3KNZA 4D6XA 2QN7A 1LSJA 1B16A 1CYDA 4PYRA 3W9UA 4F9FA 5JS1A 1RYYA 2XMRA 5F5XA 4K88A 2XCSB 2C5AA 1D09A 3FPSA 4H0NA 4D43A 1XNHA 4O2AA 2JLXA 1AZTA 3PFWO 4DNPA 4J1TA 2XMCA 4EKNB 5KWJA 4OMDA 1U4SA 1GAXA 1EX1A 3LUAA 2HA7A 3MS2A 4MARA 4YDHB 4F5EA 4YAGA 5C1DA 3GT3A 5FD8A 2P41A 1CFJA 2C4WA 2EZ9A 2OXEA 3RSZA 3TLAA 5KREA 1U90A 1E8MA 3BX1A 4L8VA 3T5PA 1E1NA 1GFWA 2CUTA 4N47A 3DE7X 4ACBA 1N8TA 4F1WA 4H1VA 3OCCA 1GO2A 1N2ZA 5KQSA 3FUUA 5B4VA 4O4IB 4BKRA 3M33A 4QGGA 2C0CA 1Z4OA 5AVXA 1CFZA 4J91A 1Z5UA 3KP1A 2QN3A 2D7CA 3AGQA 3FDXA 1C0EA 2WI8A 4HAOA 3VYRB 3GFVA 4C4XA 1QCDA 3SJCA 3TLKA 2XUGA 3TNDA 4M6WA 1IZYA 1ZA2A 3HKDB 3TH5A 5ALZA 1EP2B 4LDNA 3WDSA 2CVFA 1QV7A 4KPEC 1D7AA 4TWRA 3QHAA 2H92A 2WYUA 1CE8A 1NBIA 1P0MA 3WK5A 4DBZA 4AF8A 2PGDA 2XOKA 1YRHA 2QMEA 3HCCA 4IP0A 5F76A 3I42A 3WK7A 3M81A 2JG3A 2FH5B 3TF5A 3DE4X 1LS6A 1TECE 3U7GA 1Q44A 2FMKA 1RHQA 1TLTA 1U2PA 3UAGA 1FQOA 3H9GA 3EH2A 3GRRA 1TA4A 1TX4B 3IELA 1PL7A 3MT8A 4PYQA 4Q00A 2OLEA 4OFWA 3FG9A 3BZWA 2P5UA 2CD9A 4KMMA 5YASA 1EP1B 1N5OX 1EG7A 4EB8A 3NWBA 2JFFA 2ADFA 4DPKA 5IBPA 4ER0A 5C8XA 2WU8A 6ADHA 3PT5A 1L6RA 3L6CA 5IJ9A 4BMSA 3CV3A 3RV4A 1FUIA 3ZGYA 1YACA 3L41A 5ANRB 5DMXA 4NL4H 1I3KA 5CUQA 2CVZA 1SIOA 2DGDA 5ALGA 3JQAD 1ORDA 4O08A 5LOVF 1L3IA 1LK7A 1I6MA 3RF7A 3WV4A 5CCXA 3CVVA 1A4RA 1SXIA 1TYZA 3AT1A 5EHZA 1PV1A 5JAQA 3TN7A 5EKTA 3AR3A 2A7XA 2ONKA 4NF2A 1NVTA 3QNWA 1OWMA 1NVBA 2X2FA 5IH3A 3VYWA 3ZXUB 4C0QC 2NZ2A 3OLZA 3I1FA 3QFHA 3QE9Y 1XMOB 1PJAA 4A6PA 1WKCA 2QUJA 2R96A 4L4ZA 1H2BA 4NMMA 1LRLA 3I0ZA 5EXTA 3OHPA 4CLXA 4DN6A 2R7NA 3NLLA 2DFNA 2C5LA 1T91A 2PLWA 4IV0A 4PBRA 5CXXA 5ALTA 2OD2A 2OFPA 4M1WA 2R9VA 2Y8EA 2GN8A 2XNDD 1GPH1 2C7PA 3LBNA 3GPDG 2HCTA 3QLUA 3ZZTA 4DJJA 5KYWB 2YJTD 2O0HA 2J6BA 821PA 1XTUA 2FUG1 2JFQA 3CF2A 1V39A 2O7RA 4RQTA 4WY8A 4BN0A 3QHQA 1YHNA 1ENPA 3K1AA 1AKWA 2FW1A 4GMFA 3VPGA 2CB9A 3D4IA 4KO2S 2O06A 3NOQA 1V4VA 1VCHA 3BHMA 3EGXA 4I4LA 2BEKA 2J32A 2CY0A 2VT7A 3A1EA 2EWWA 1QFJA 4IM7A 3ZDAA 1KQOA 2JZOA 2X1VA 5K3FB 1QHIA 3M4NA 4Q7KA 1X7ZB 3O8RA 4YJ2F 5CIYA 2VYNA 2NTVA 4KN5A 1MQSA 1V2GA 2FB9A 1A9PA 2ZTVA 3K9CA 3R41A 4KACA 3AHHA 3MB5A 5DULA 3AOGA 1KR2A 5J5AA 3WLNA 4JUAA 2VRCD 3M3PA 3CWQA 3P9KA 3PDWA 4CV1A 1HE8B 1PQWA 2A9OA 4BWGA 4EG8A 5A3JA 3CUSA 3O4RA 5LMUB 1Z0SA 1FVOA 2AJBA 3V7FA 4ARCA 3IIMA 3QTBA 4PSAA 3K6SA 2ZTUA 3EFOB 3ZHUA 1WW2A 3W5CA 2PX5A 4O1HA 2OGSA 1E58A 3OE7A 4KP7A 2P7HA 4EG3A 3OH8A 2VSFA 1EB9A 3CRRA 3QELB 3AVYA 3U13A 2EDCA 4QQ8A 1FDTA 1RKVA 1SEPA 1XL0A 5F78A 1RWBA 4KYIB 1UJNA 3GFGA 3O9MA 4OQ4A 1DAHA 1HE2A 3A05A 4BPBA 4WGGA 4ZDWA 1DWOA 4GOMD 2G1JA 4UHBA 4XVQA 3KSMA 3QA3E 3CC8A 4P4SB 3VR5H 3KOOA 1T2NA 1DCKA 3BGSA 1BHQ1 3JQDA 3VKVA 4DCCA 1TKRA 1IL0A 2ZWIA 4G0OA 2QT0A 3VAZA 1W36D 3LAWA 2GPTA 1C5KA 4FQ5A 1REQB 1YMUA 2CK3D 5GV8A 2QDKA 3QVKA 4HEA6 1CZUA 3NCTA 2FEOA 2IPOA 2ZBFA 3O83A 1NBWB 4HZUA 3OIYA 3BJZA 3JAWA 3M49A 3SNHA 3QLUC 2FW9A 1GUAA 2XNKA 2ZPTX 3PKJA 5ALHA 4DVJA 4B34A 2Q62A 1BEZA 1T3GA 3UAXA 4NBWA 4JR1A 5KZMB 3OUUA 2O0MA 5LU9A 1KOGA 4J94A 3GO4A 2M6LA 4BO6A 2YBEA 3TXAA 4CUZA 1QRRA 5DHFA 1XXHA 3RVRA 4J49A 5U4QA 1QIEA 4GOOD 4JQSA 3SFTA 4BKPA 4XSHA 4GI2A 2Z3VA 5LA6B 4BO7A 5EJ5A 3KOUA 2BGIA 2FHSA 3QX3A 1YZYA 3Q88A 3WA6A 4EYKA 3DPIA 4DLPA 4JBYA 3LNTA 3T9EA 1RRGA 2VYFA 4YEDA 2PKWA 4EEXA 2DH5A 1A04A 1M73E 2XF2A 4JBHA 1EFLA 4EL5A 2EERA 1HV8A 2I6QA 2NW6A 4I9NA 3E70C 3LS2A 3K71B 2OP0A 2FP4A 4WOCA 3DQPA 4OXQA 1C1DA 2W2KA 4GI7A 2BL4A 5G0UA 3D5TA 4MUYA 4EW2A 1EK2A 1NN3A 4KH0A 3TZEA 1KI3A 5FBRB 1RLMA 4ZEOA 3P2YA 1USUA 4AG6A 3AKDA 3V55A 1GU1A 4YIHA 4YCLA 5AT1A 2IBSA 4MWGA 1F8GA 4P5DA 4X8LA 5FAKA 1XTQA 4PZDA 4YN3A 3CG4A 4RSRA 1P17A 2V7VA 1U8YA 3ETLA 3H2IA 1YDFA 3T5CA 3TJRA 2XGGA 5BYJA 1Q17A 1K5DA 2DPLA 3QW2A 4QGSA 5LMCA 4P2GA 4AYTA 1GVNB 1P1IA 3E81A 4P54A 5ALVA 1C8BA 1DARA 2IU6A 1CG6A 2NZXA 4L0QA 4X94A 2RBEA 4AD8A 2D7DA 1JMKC 1TE2A 2GEVA 1X1QA 1DX9A 3EMDA 3PCRB 4RVHA 4CQMD 4ENVA 1IJKA 1BXGB 1TEHA 2WV7A 3OFSA 1KSGA 2OECA 2H2IA 2UVPA 3WLQA 4HXEB 4MB6A 1V7ZA 2JF0A 3IOBA 3T0IA 1T2EA 3LK7A 3RGGA 1KZ7B 3ABQB 5TEVA 4HF7A 3R7NA 2GO1A 3PZBA 4JYZA 4KE7A 1JS1X 4RHYA 1XQXA 4HFNA 1Y5NA 3D3NA 4UBOA 2GETA 1QOPB 2CVOA 2ZS7A 3IJEB 3L9XA 1ORHA 5GMOA 4YCCA 2NU7B 2UUPA 2XIQA 1HDEA 2H2HA 3A1VA 3PIDA 3L7JA 5GV7A 1O1YA 2Z43A 1Z2OX 2YXNA 4UNIA 4D96A 5FL7A 3QX9A 5JWHA 1QG2A 2BH2A 1QP8A 1UPXA 2B92A 2PRYA 5D3MA 3TL3A 4J0DA 2H9YA 1IBSA 2BELA 2NSDA 4KGZA 5DIZA 4C3UA 1U7TA 3KQSA 4FDMA 5K2MA 3SFZA 5IG2A 1RM5A 3AHGA 5BUCA 1P5JA 1RVV1 3ZW9A 4ESHA 4Q3DA 4RZHA 2H5LA 2Y0PA 2FNAA 2PMWB 3QE2A 4FVTA 1G21B 2AFHE 3DNFA 1FXSA 1JKMA 3AVOA 2FSPA 4ZV9A 2Y1LA 2Z6QA 4M0CA 1Q22A 5JD3A 4PPGA 3EPJA 1E0DA 1OJ7A 3HLYA 2IXAA 2IGBA 3UV7A 1I4WA 1ADFA 1FYDA 3ER6A 2P1ZA 5BRJA 4A2CA 3CW2A 3UGTA 2IZ7A 3PP8A 4DEXA 4Q16A 1XRSB 2O52A 1TT5B 2JARA 3LGSA 3Q8LA 1EJ0A 4G4SP 2V96A 1ZHFA 4H7IA 16PKA 3RU2A 3ZPXA 5F2OA 2W8ZA 2ZTLA 3KWFA 3AMVA 5EE5B 1CJKC 2IZ0A 1DKPA 1EBFA 2A1UB 1S0UA 3GC6A 4H4CA 4OI2A 4CLHA 4DA4A 3FLEA 2GPNA 2PKRA 3EVAA 3GLIA 4GM0A 4BMZA 1ZIOA 3OCXA 3M0EA 5EUBA 4UTNA 3DXXA 2DY1A 3H1PA 4B6FA 1YS6A 1FB5A 5EFOA 1OLSB 4IOJA 3V2HA 5AIBA 2VOJA 1LDNA 3IPYA 2WK1A 3KQWA 3ZZ0A 4AZWA 4GZ6A 3AKEA 4P3PA 5ICCA 3MW8A 4LDJA 1LH0A 3WIOA 4BX3A 5IS2A 4TLDA 3WZLA 2KQUA 4YVFA 1E2DA 2Z5GA 4XX0A 1FMCA 1Z4KA 5F23A 1EAYA 2R6DA 5H3CA 2C7OA 3EUFA 2XUPA 5JD6A 1EWQA 4X3CA 2QX4A 3V4VB 4BQSA 1AS0A 1J8MF 3TLGB 3V1UA 1SN7A 3UA4A 4K6MA 3NCHA 3WIBA 2ORYA 5JBQA 1XEXB 4LOJA 3LDAA 3D6VA 1Q6YA 5HVNA 1R5OA 4PYNA 1KQNA 2VK4A 1IUKA 1Q1NA 4G1EB 2C2HA 3H8SA 4HGOA 4I3GA 3TWOA 3TVTA 4BX9A 1S4MA 4UJ5A 3AVPA 5JNUA 4UMEA 1JU4A 4NRDA 5IVKA 4P0QB 3E2MA 3X0DA 3HN2A 4DLVA 3SKYA 5C8DA 3KQKA 2WWTA 5DIFA 4MRPA 5GGXA 2NXEA 4F12A 1CUXA 3BXHA 1IM2A 3PI6A 5LP6F 4C2AA 5I9BA 3IVMA 2KBFA 1U4NA 3T54A 3TOSA 2BE9A 4GRAA 1ZIXA 1KEWA 3ELBA 1WUTA 5DK6A 1ULTA 4B3SB 3C3DA 5FR1A 1X77A 4UDYX 3E3OA 1ZFNA 2G40A 4JJ7A 4N6OA 4ZI7B 1JN0A 4FFBA 2W6JD 3Q7PA 5KJ6A 1GHTA 5ADWA 3Q8MA 4D8VA 3EVBA 4U8HA 4N8EA 4NP6A 3K1ZA 3GLFB 2C8KA 3LSTA 3AETB 1Q12A 1QYVA 3V1YA 5IVPA 1ODTC 1PJLA 4LA4A 2NO6A 1R8YA 3VBEA 1V4BA 1NKTA 2PLAA 3DFIA 2AEJA 5EL0A 1MW8X 3PQ7A 4G5GA 4GICA 4ZVTA 5IVHA 1V5WA 2J3JA 2ZE8A 3WL6A 4DMGA 1WCXA 2GYUA 3SBDA 2OENG 2VZLA 4OMFG 5TB5A 2EWMA 2F00A 1DX4A 4IHJB 1P1FA 1UDCA 2HOQA 1RSZA 4LYJA 1Z63A 4B3JA 3EZ9A 3DL0A 3NIWA 1S7CA 3T4EA 2R6HA 3GAAA 2E49A 1B3RA 1GCAA 2B1IA 1JG7A 2C07A 1YNOA 3HCEA 2NQ2C 4JSRA 3OM1A 2ZZNA 3FFTA 3PYMA 3VYSB 1NKSA 1SBQA 4UVEA 2ODEA 5BPHA 3GF4A 2D5CA 1SCJA 3UG6A 5C7OO 1GGKA 1E2GA 5BMVA 4XLLA 2BCGY 3M5CA 1MH1A 3O2NA 3O8DA 5JTUA 3N2YA 4AJOA 2I8AA 3K70B 2ZIVB 3IXLA 5LL6P 3L05A 4C6SA 2RKBA 2F9LA 2I55A 2DPXA 1ZUWA 2NLOA 5K3SA 2WRZA 5FWYB 1JQKA 1PK8A 1Y8QA 2H4HA 3WGMA 1SQSA 1F1JA 3QVSA 4HMQA 4IIJB 2WAXA 2H54A 1U9ZA 4FMCF 1YCDA 2F8LA 3CH4B 1B42A 4TTTS 1I2BA 2E1RA 1YOVA 3WGGA 3KTDA 3K5WA 4MH0R 4F9TA 1XZDA 2WIAA 3ADKA 3GRVA 4DQVA 3AF1A 4HNQA 4GZ3A 3OJFA 2Q1TA 3GMIA 3ZEIA 1YS2X 2X19A 2VP6A 3ZZMA 3GT7A 2R6AA 4QYXA 1YJBA 5E3HA 4J43A 4KLAA 3AI3A 1MB9A 3GZTB 4XDZA 4EL0A 4EBBA 2OCAA 1JEDA 2AZMA 2WM3A 3FCUB 4RA9A 2BFDA 2PAAA 1GFSA 1QMGA 4RKFA 3WS7A 4B0OA 5JNSA 3S40A 2RGEA 3R6TA 2IIVA 3OMWA 2D5AA 2CHEA 1ZICA 2QM8A 2CJPA 4GBED 5EJMA 4GI5A 3WLHA 3QWFA 5IDQA 2CWWA 4FWTA 1Z5NA 2QR2A 4B3BA 1OWPA 3QUCA 1FXWA 3EIXA 1NVAA 4DA7A 3C4QA 1E2PA 2QP4A 3DOOA 4EPXA 4MHTA 3FBWA 1N1EA 2BEWB 3T52A 4BRWA 2ZB8A 2AJLI 3KZOA 1K4MA 4Q19A 3CLRC 1UDAA 3BFJA 3TCKA 1NBMA 3TR6A 3BA6A 4E5PA 2XH8A 4QVKA 1J0DA 2R97A 1VZ2A 3ND5A 4LF6B 1YDEA 1OYYA 1PS8A 4ARAA 5JAUA 4DTCA 2O54A 5F5LA 8ADHA 4G8BA 1YGYA 2BAGA 4GKKB 1E1QA 4AX8A 1QHFA 3S2ZA 1BGXT 3BM5A 5DBEX 3UB3A 1BNCA 3CRW1 3TRIA 3A11A 4G24A 2PLNA 2O14A 2FMTA 1J9EA 1RWKA 3S55A 4D4HA 5FI3A 4WQMA 2HT1A 1P7WA 3L01A 1E2QA 2JAOA 1PD0A 4O59O 3Q15C 2CMGA 4GNKA 3RRYA 4UM9D 2OAEA 3IQFA 4DV4B 4AICA 3PGXA 4E4YA 4Z7JA 4Q47A 1KDPA 2CV2A 2Y1FA 3KTOA 2W2MA 7MHTA 1FLVA 4MUHA 3V4OA 1Z4PX 2JAXA 1YK1A 1HEUA 1U9JA 5H4HA 1CEYA 3UANA 3FKSA 3G2HA 4KR6A 5LLTA 1PE0A 1P1BA 1Q57A 4IDFA 3WHIA 5L6LB 4A36A 1USVA 2XMDA 3LF2A 3R5FA 1N92A 5IH7A 3HXQA 3CVUA 1QG0A 1GN8A 1U2RA 2IOYA 4NKRA 2R751 2Q6LA 3DZBA 1CT9A 1QNLA 3NWJA 3IP7A 2OBNA 4U7TB 1SKUA 3GJ5A 2B7BA 3AINA 5G1OA 5G41A 3SG0A 4N48A 1P4JA 2QXTA 4JLMA 1ST2A 1NDQA 3IP9A 5HJEA 1OXVA 3VR2D 1M6EX 2ZVDA 1UIRA 2MWMA 3AHCA 3FETA 4JSTA 1W6UA 2D59A 1DBVO 2JZNA 2ZJFA 1OFUA 4G36A 2AJ8A 2XE4A 2HYDA 4MYHA 3VZQA 5HKKD 2BFAA 2Y1CA 4P5PA 1SUPA 4QBGB 1KJ9A 3U62A 1K1EA 3NO4A 3ZW7A 4BIIA 4NV0A 4R69A 4UBJA 3UOGA 1GNTA 2QE7A 1LA2A 2F64A 3U16A 1EUQA 4X63A 3SR4A 1XQYA 2DUMA 3A1TA 3IQWA 3O7WA 4Q1CA 3VPDA 2AZ4A 4DY6A 1TUIA 4QQRA 4V2IA 4I4NA 2ZI4A 4HX9A 5AVTA 3BGIA 2QLNA 5DNWA 5H7XA 1EZZA 3RNLA 2PH1A 3VDNB 3O9ZA 4JDPA 4FBMA 2RHBA 2IZZA 4IFEA 4RZQA 4AN0A 1XQVA 3L7CA 1YRYE 1R0ZA 4U5XA 3PDIA 1L5KA 2DQ4A 3E27A 3K0AB 5JJIA 3WLMA 2HPHA 2JH8A 1RBQA 2OO3A 2E4WA 1MPTA 1NXXA 1U0RA 4X8HA 2OEPA 3CSDA 2YW9A 3T9DA 4S0ZA 4C4OA 2Y6VA 4LX0A 4M76B 3OKPA 4BBPA 3OC0A 4LXIA 7AT1A 3Q8XB 4KO8A 1JQJC 4RWEA 2VPTA 1WUKS 3W8EA 3SIRA 1E4VA 1K3UB 2D2XA 1SUEA 3MCWA 4RF5A 3I12A 4AXXA 1IEQA 4C89A 5GZ6A 4FOLA 3PHJA 1JHMA 1OU0A 5JNLA 3BMQB 1QR6A 4MUJA 4IHKA 2H5JA 3IDAA 1M8FA 1JFSA 3BDAA 3WE7A 1JVSA 1OC4A 2C98A 4JI7B 5FOWA 4W5NA 3F8SA 5BOSA 2RB4A 4MQFB 2ZWVA 1A9QA 4JC5A 3QX7A 3VDQA 5J2UF 3WQBA 3G5TA 2WV9A 1JV2B 3JSXA 3O92A 1YZ3A 2VQ6A 5KYUB 1GSHA 3WB0A 3ABRB 4I1PA 1O7JA 3GEDA 5EP2A 3VZCA 4ARZB 3L8FA 3WAGA 3I9LA 2CLOB 1J7KA 1AKNA 2BI7A 1W7AA 4DLZA 1T3LA 1JIIA 4MKXA 4OQZA 1DO2A 4JQYA 4EMUA 1K5PA 3MJFA 4OSOA 2BKAA 1IAVA 3I64A 3PU6A 2WF7A 4G8CA 3OQ6A 2FYTA 3VNVA 1E3WB 2FSGA 2PYIA 1E3JA 5CEJA 1UBGA 3BB3A 4U0KA 3EZXA 4S1TA 2AE2A 1E2UA 2Y71A 2PZKA 2AV6A 2VXBA 3ZVRA 1ZGCA 4U00A 4D4MA 3KKKA 1G60A 4ZHSA 2F8TA 3JWPA 2EKLA 2J9FB 4DLRA 3A4VA 1SUIA 1XAGA 3ZTYA 4KCGA 1MTZA 1TF5A 1RWNA 1LZLA 1NMQA 1IN7A 4OOEA 1J0AA 4L6IA 3SSNA 4ZC1A 4BO9A 2A0FA 2J30A 3HYSA 3BTOA 4RXTA 1DLJA 1EKXA 2ZSIA 1NT4A 4H2DA 3MLBA 1QAMA 2P5SA 2ZJ6A 1JQBA 1AF7A 3VH2A 4Y2QA 2I3GA 1COZA 5JAPA 2OFWA 4JKIA 4RH0A 2NO4A 5F3DA 1C29B 3CVJA 3L8ZA 3T3EA 4DVGA 5P21A 4RK5A 4RLFA 1GNVA 4C4ZA 3PNLA 1UT8A 4BFLA 2RJ3A 1FSGA 1J4AA 1NE2A 2OBLA 4P98A 4WLEA 721PA 2HMVA 3QFCA 2D2FA 2Q4EA 2AMYA 3JD0A 3WI7A 3EXIA 4MW5A 1KEUA 4C4SA 3HUUA 4IOLA 1UL1X 4B45A 3RRXA 1ICEA 1AM4D 4DC1A 1HYBA 1A5ZA 3TFQA 4EEZA 5KIAA 2UXBB 2WJHA 4HGNA 4EW6A 1XTTA 5L3ZA 1U0EA 2PZEA 2Q5CA 1Y6RA 2Q41A 1Y89A 1PAUA 1QF7A 4BQFA 1RQGA 2O8BB 3J7TA 1TZKA 1CUZA 3LDGA 4OM7A 1CUWA 2I7VA 3MMZA 4PFJA 1SBYA 3RAGA 3UJ3X 5F3RA 3DYBA 1JDPA 1H42A 3A31A 3ZWNA 2GUGA 1J0EA 1R27A 1T34A 1LTQA 2HK9A 2ZYHA 4YMIA 2ID7A 3EF1A 4EA7A 2GYWA 2G5GX 2E89A 1VLMA 3QXXA 1KNQA 1LQTA 3P4XA 4TTAA 5LYJF 5J1SB 3KB1A 2NAFA 4QYSA 2QRUA 5JFGA 2RFLA 1LZKA 1Z0FA 3HU2A 5DEOA 3T3PB 3DCJA 1CY4A 1AGYA 2IPNA 3E8XA 3N7TA 4L6CA 3TW8A 3E9CA 1Z8DA 3IUBA 5EJIA 3EZLA 3GNTA 5B53A 3RDPA 3J7AC 2O05A 2XUDA 3G9XA 2X0NA 4LECA 1RMQA 2A5GA 5K9ZA 5LQCA 5AHOA 2FZLA 4C4YA 2I9KA 4W6QA 1BDMA 1Q1AA 3OWOA 1YRLA 2FEAA 3INYA 1KETA 5G0TA 1Q2XA 1QTRA 1LWOA 1U94A 4ASUA 1NW6A 1TIBA 2HQBA 3FWYA 3FYUA 3V97A 4GWLA 1PL6A 3JARB 4J2TA 4AWAA 1K3TA 1K8YB 4ECEA 3ML1A 3M7IA 4LE1A 1E7SA 1V7PC 1VE3A 2ZI3A 3WNBA 1ZW1A 1C14A 2VNIA 3FX2A 3MCAA 2C78A 3HCPA 4K1XA 4DDHA 4DS3A 2JL1A 2SKDA 2XDAA 4PHTA 2CLHB 2QS9A 5CG2A 2OT3B 4CMCA 2HO4A 1ZC4A 4X7PA 5ISMA 3KLPX 3K9HA 4OGWA 3E2IA 5DV9A 3GUCA 3P94A 3QYFA 3THYB 1Y8CA 1W29A 2VPPA 2FN9A 2V7GA 4OA5A 5LYYA 4H6WA 3W7BA 10MHA 1RPZA 1EGQA 2A1IA 3V4ZA 4XVCA 2BD0A 3PWKA 4CPDA 1XQ9A 5FUWA 1SU4A 1Y5IA 2NQTA 3TZQA 5JJKA 3MF4A 4YGXB 4BNIA 2Y4NA 1F7VA 4QULA 1OTXA 4JCOA 3JWHA 3WYBA 3DZHA 3L49A 5F35A 3FDFA 3QVVA 4FOPA 2E4XA 4KIUA 2QGFA 5DWVA 3NYRA 1TJ5A 4YP1A 2IWHA 3UUFA 2PIDA 4UCQA 4YRFA 5E0OA 5BQ3A 1JAZA 4Z7NB 3AUAA 1SCUA 2B0CA 1XK7A 3I9NA 2PUGA 2X4DA 2CVHA 1LFDB 4ZVLA 3AWDA 1LXCA 4W5HA 4AY6A 4R8KA 3EIUA 3A3KA 2NZUG 1KAQA 1TJYA 1V26A 5BT8A 5M34A 1GXSB 2WIFA 5EWJA 4HH4A 4R8VA 1XWWA 3KKZA 4QDTA 1ISRA 1TM4E 3AHJA 4V0SA 1Q0ZA 4MINA 5AW4A 1KMNA 2C9BA 2YY7A 3ZDEA 1ID1A 1NT2A 2PT7A 2VBFA 4WJKB 1U3DA 1SBNE 2L42A 7YASA 3I2GA 4W1SA 1F8XA 3C3PA 4H18A 5JV5A 2W6ID 4LGVA 4WKOA 1FMTA 1ZGHA 2AQHA 3F6PA 2XX3A 3U4MA 3JPWA 3QP9A 2B94A 1E7QA 3FYUC 5AH0A 2RK3A 2V7QD 1TO2E 1PK9A 2QL5A 3IL2A 4JY7A 1OA1A 2WW8A 2BV3A 4KX3A 1EFHA 4TWJA 5JNVA 3IAAA 3RYCA 2HTFA 3AY0A 1JIXA 1JLSA 4K6HA 1EGAA 1HFWA 4X61A 2CFTA 3LK6A 4AKTA 1GM5A 3TQTA 5B1SA 5EYPB 3EZ7A 3MQFA 5JATA 2HSEA 4QOIA 2YXPX 1RE1A 2I22A 4E11A 3NM4A 4TRMA 4I50F 1S89A 3HJHA 1QCYA 1QGUA 4HLNA 4LY0A 4RS3A 3SFVA 3HXLA 3GL9A 3MGKA 4DBVO 3PNOA 3W1WA 4EG4A 1DXQA 2DHQA 2F1HA 1KAEA 3IUNA 3OUTA 2G8NA 1ULUA 3ZCTA 4YV2A 5KUTA 3WSWA 3K4QA 4ZANA 3SSMA 1Y1LA 1U8FO 2RH4A 4JI6B 3U7QA 2GZ3A 2G77B 3UJPA 5IXSA 5HW0A 1RYFA 2NZ8A 2BFCA 3BF7A 3CZAA 4YJHB 1LD3A 3REQB 3VZPA 3W8RA 4K9LA 5FUQA 4TXNA 1UK8A 4JLKA 1CQIB 1IBCA 5BR8B 1F0PA 1CRZA 4Y98A 3GARA 4IWXA 4CMEA 4V02A 2Q7OE 4ZYUA 3GQBB 1TEVA 1Z82A 4A7PA 4MRMB 1QB7A 3PBKA 4LSWA 1R74A 1V3QE 3WBKA 1Y1SA 1YQ9A 2AR7A 1W19A 3BGDA 3TSZA 5AHXA 3KB8A 1B0ZA 2GM4A 3W5VA 3MJ4A 4NJEB 3A1CA 4MCAA 4BTVA 4OGFA 5FF9A 3EXEB 4YAUA 5HHTA 2B7CA 2YZ7A 3C98A 3G9QA 1ZUHA 4Q3AA 5FFFA 5HMLA 5LB4A 4B84A 1TADA 1L5VA 2M1XA 1GIAA 1KVUA 1PQUA 1WF3A 2V74B 1DHRA 4X6YA 2C57A 4F04A 4PQRA 1GRQA 1T9GS 1N9GA 2YZKA 3DOFA 5DO9A 1K5HA 3OEWA 1M6VB 4Q18A 4HQLA 2JFNA 1JE1A 1OX4B 2CYAA 2X77A 3K1YA 1Z0AA 4ZVOA 1N6PA 5K8TA 1TLFA 1TZMA 2PZAA 2K7ZA 1H8ED 1EFPA 1TF7A 4PCUA