2HF9A

Crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
211
structure length
211
Chain Sequence
b'KDILKANKRLADKNRKLLNKHGVVAFDFMGAIGSGKTLLIEKLIDNLKDKYKIACIAGDVIAKFDAERMEKHGAKVVPLNTGKECHLDAHLVGHALEDLNLDEIDLLFIENVGNLICPADFDLGTHKRIVVISTTEGDDTIEKHPGIMKTADLIVINKIDLADAVGADIKKMENDAKRINPDAEVVLLSLKTMEGFDKVLEFIEKSVKEVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable hydrogenase nickel incorporation protein hypB
molecule tags Hydrolase, metal binding protein
source organism Methanocaldococcus jannaschii
publication title Structural insights into HypB, a GTP-binding protein that regulates metal binding.
pubmed doi rcsb
total genus 81
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hf9A00
1G16A 3QSYA 4OQLA 3K1JA 1GFIA 3WHKA 2AL7A 3BORA 4HZUA 4F92B 4DB4A 1C1YA 2GKSA 3B2EA 4B2PA 1RFLA 3JVVA 2MSDB 2ZI4A 3RHFA 3CR7A 5AUPB 4FN5A 1HA3A 3CPJB 4KFTA 3ZLJA 1TF7A 2A7QA 3HPQA 3F3YA 3SBEA 2J7KA 3CX6A 4MRPA 1E0JA 1KOFA 5L3QA 4JSTA 1W48A 4LHZA 2NO0A 3VFDA 4Q01A 1IM2A 3ZVMA 1DAFA 4RJLA 2CL0X 4MYCA 1WA5A 1R5BA 3VKWA 4XWAA 4YDHB 3P32A 2FPKA 3DOEA 1CJMA 4MGIR 4Q7MB 4A0HA 4UNRA 1CTQA 1G8GA 3ETLA 4LK2A 1E0KA 1P73A 1UF9A 4KCGA 1W0KA 3GEEA 2ZSDA 1GUAA 1SULA 2OCYC 3LX5A 4D4KA 2PEZA 5JWHA 4BFVA 1D5CA 2P67A 2YOFA 3PEVA 2WIBA 2QROA 4GZMA 2AHOA 3GLIA 1ZINA 4PPQA 4QFMA 3ZIAA 1LS6A 5L3SB 5J47A 3PIRA 4ZIRB 1E2FA 1N6PA 3MUFA 5JBQA 1UEIA 3QEOA 4CEJA 4IOMA 1OFIA 3AQ4A 4G5SA 2NG1A 2ZS9A 3CH4B 2A2ZA 2IYYA 1OB2A 4L8GA 3W90A 3IIMA 5EE9A 5HZKA 1N0UA 4PC7A 4U02A 2O8EA 3UMRA 1WDTA 2XJ4A 1V5WA 3ZJYA 4CGZA 1CU1A 3JZMA 2VA8A 1RIFA 4LSGA 1N6LA 2EW1A 3DM5A 4LPSA 4TLDA 3KXLA 3AGPA 2P2LA 3U2QA 4TQUS 5AK0A 4WZ6A 1OT3A 1XJQA 1G19A 3T34A 1LNZA 2ZJ5A 5KPDA 2CHGA 2FSIA 2J0UA 2NO9A 3NHAA 4F7WA 4LYJA 4LBWA 2EYUA 4HDOB 3B85A 3CRW1 2V9PA 5HZHA 2QZ4A 4V0MA 3VHXA 1QVAA 3LXXA 2OV2A 5K8IA 1ZVQA 5E4FA 1P72A 3UATA 3IUYA 4BWYA 3S1AA 2WBLC 4ON9A 3IQXA 2RGCA 3L0OA 1IXRC 2WIAA 2ATVA 4XD7D 4L9SA 3HYRA 5FPSA 2ZPTX 3BRWD 1OXSC 3E5HA 1OIXA 2R62A 5TV2A 3V9PA 3FYHA 1R6BX 3LLUA 2W6IA 3VQTA 3N2IA 3SN6A 3V00A 2FDCA 5F9HA 2ZYVX 1TF2A 1VCIA 2CVHA 4HAXA 2JA1A 2PZGA 4TTPA 4AWXA 4B35A 4B43A 2XZPA 3WP0A 1X8JA 3MFYA 1CEEA 1CBUA 2JLQA 4Q4HB 3GEIA 4A4DA 1JR6A 3Q5EA 4LV5B 2DFLA 3HWSA 1UM8A 3CF2A 3GFTA 4PHHA 4AKEA 1Z6TA 1CJVC 3I5YA 3BH7A 3OFND 4KU4A 5EXTA 2GZHA 2EVWX 4KHZA 1U98A 4DZZA 1CRPA 1DADA 4QGGA 4QKQA 1GL7A 1P3JA 4Q48A 2FOLA 3GQBA 3R7WA 3HPRA 4JBWA 2OHFA 3PV0A 4B3DA 1A2BA 1XEXA 5BXQC 2WKPA 1NVXQ 3R9IA 1EFCA 4BUJA 3ZD7A 2VHTA 2V3CC 3IILA 4P4UA 3OIYA 1CP2A 1EFHA 5FOSA 4AURA 2A5JA 1RZ3A 4V0KA 2MMCA 1QHNA 2C8VA 1GVNB 3NBXX 2XNDA 2BKEA 4URUR 3SC3A 3KUCA 1JB1A 1XEWX 3B82A 2V7QD 1IHUA 4LY6A 2R6FA 3IKJA 2O8FA 2ZRHA 3THWA 2V7QA 1E94E 3DDCA 1R0XA 3ZQ6A 5KTYA 3N5CA 5FL3A 1F2TB 5CJ2A 2CCGA 3R7WB 1OB5A 2QM8A 2BBTA 2XNDD 1NLZA 1VHTA 3A58B 3F0TA 1A2KC 2QAGB 4BRWA 1ZD1A 3U3JA 1G8HA 3GJ7A 1OYYA 1BKDR 4N1AA 4QC2A 1P60A 2YINC 4Q7JB 2QBYA 1KO4A 1W5SA 5CYPA 1NMZA 4HAUA 4AY2A 3BH6A 2WHXA 3K09C 5SZJA 1N0WA 2PBRA 3KUDA 4C7OA 3BOSA 4CF7A 1NF3A 4JLPA 2O0KA 3GJ6A 4DLXA 2D62A 1SVWA 2CE2X 3CZQA 1T3HA 1XZQA 2ZRDA 3F8TA 4MA4A 4N3NA 1G3IA 4Q19A 3W8RA 3AVTA 4ZKEA 5H68A 1DS6A 3KKMA 2VP2A 4B76A 1QHHA 1UBFA 1NP6A 4Q9KA 4DSUA 3U60B 4TYWA 3SBDA 3RYTC 4CIDA 2F3TA 3RANA 2IS4A 4YLGA 3GLGA 4TMWA 4BLTA 1KSJA 2GK7A 4FWIB 2UZ3A 2BC9A 4P31A 2Q9AA 1SGWA 3B5JA 2G9NA 2PCLA 4P32A 4C0QC 4B3GA 3OAAA 2FWRA 4HLCA 4OQMA 5C2JB 3EPHA 1XPOA 1D2MA 5LDDC 3TQCA 1F48A 1HT2E 4MGYR 1MRSA 3KKOA 3WMFA 1L7VC 1DTSA 1NVUQ 5DI9A 2HXSA 1FMLA 3U7GA 5KNBA 1GOTA 3A36A 4TYPA 1IN8A 4JMPA 4Z8XA 1YR9A 4BFXA 3W3AA 1ODFA 2GTPA 1N5LA 2GESA 2A5YB 2HCBA 2PZFA 1P9RA 2ZITA 1E9CA 3QG1A 4XD7A 1FFHA 5JZVA 4KLZA 1MABA 4DC9A 2IS6A 4QGAA 2RH5A 2I1VB 4PSKA 4M9QA 3WYAA 4LX0A 1LV7A 3VX4A 1E2PA 2H8KA 1KHTA 1WRBA 4RZXA 4OBEA 3FE2A 3QKSB 3QF4A 1G21E 1YRBA 1Q22A 3MWKA 4FMDF 4P4TA 3X1YA 4ARZA 4D4JA 4XWKA 3OEHD 1E2HA 4FMDB 1WBDA 1ZM3A 4DJTA 1AJEA 2OSBA 1OF1A 1RPZA 1M7BA 3QVVA 4KVAA 1E9BA 1D2EA 1Z22A 2VP5A 1XX6A 2QMOA 3QKTA 2QAGC 1KAGA 3BAFA 1H8HD 2X2FA 5CK5A 4LRWA 1CXZA 4ITRC 3K0CC 2J0UB 1JR3D 2WVJA 4KITB 4I1OA 1U8AA 2Z6VA 2VBCA 2Z43A 5D3MB 4WA7A 4UJ5A 2H16A 3CM0A 4JLBA 3EIEA 3GLFE 3QBTA 5FPTA 1DAMA 3SNHA 5JFGA 2OEPA 3ZDQA 5H1YA 3NH9A 2BHRA 1W0JA 4C2TA 1KDOA 4YXWD 3LA6A 3KJEA 1EK0A 2FZ4A 1D9ZA 1GP2A 1S0UA 3MMPA 3TIFA 4RD4A 5GJCA 5HPYB 1YVDA 2ZE5A 4PQYA 3TVTA 1Z63A 3VKGA 1AM4D 2JJ1A 4RZ2A 4Z1MD 1N6KA 5TMPA 4ACAA 5DHFA 3E1SA 1P2SA 4IOKA 2J45A 2P6NA 1NMYA 2AK3A 2C77A 5FTLA 3U44B 2C5LA 5G3ZA 2ZUBA 4BRUA 5JEDA 2QMUA 4HB4A 4GNKA 3PENA 4WVFA 1JALA 4V0LA 1OKKA 3U3MA 2FH5B 3AKCA 3AVPA 1FL9A 2J0VA 3NKVA 2WAYA 4URZR 5KU1A 3M0EA 4WAUA 5HE9A 4LJ4A 4ZPXA 2QSZA 1II8B 2WAXA 1U8ZA 1Z0DA 2G88A 3SU8A 2WJHA 1VTKA 3L2OB 3QENA 1SZPA 3B1XA 1XTIA 4PPNA 3OIWA 4MH0R 4JSYA 1ETUA 4JBXA 2BMEA 4DB2A 1NKSA 3VR5A 2BCJQ 4DXAA 3ZQJA 2W0SA 1EWRA 4M0LA 2JDIA 2ZJ2A 4KI0A 5C4GB 1E2JA 5JWOA 4JIMA 1HYQA 4NYMR 5GADl 2DB3A 3GPLA 3RAPR 2FFAA 4LYAA 4A8JC 3PITA 4PC2A 3HU3A 1E0AA 3BC1A 3MWYW 3VR2A 5IF9A 3WBJA 2XOKD 3K70B 2G1KA 1JEDA 1XTRA 2Q3FA 3W5JA 3L82B 3VR1A 4ZV4A 1X8KA 2H92A 5JMTA 3A1TA 2JLRA 2IYLD 4PSAA 3RLFA 2G1JA 4V03A 3RS4A 1JI0A 4YONB 5HTKA 1S2MA 2ZJOA 2YV5A 4NHOA 1J8MF 3K0FB 5C1BA 1Q3TA 1ZP6A 3C15C 5J4LA 4CVNA 2PL3A 3V4FA 1R7RA 1D8TA 2OG2A 4WBSA 2F43B 3T61A 1G6OA 3VHLB 3DO6A 1W4BA 3FFBA 1GL9B 2IEYA 4I1VA 4EDHA 3THXB 4AK9A 1A1VA 2IUSA 4LGMA 5SZIA 3P20A 2NZ8A 5CJPA 3NXSA 1HQYE 3T15A 3AGQA 3QXCA 4TLAA 1II0A 3A37A 3OEED 2B92A 4QGFA 1I2MA 2R44A 2J0QA 1TAGA 3K70D 1Z6YA 1P9NA 4XTRA 4TL9A 1G1MA 3QPVA 1HUQA 4JT2A 1UADA 1OHHA 1EX6A 5IHPA 4OK3A 3O8RA 2VF8A 3Q72A 2C95A 2ZJ8A 5JJIA 1EFRA 1ZJ6A 4P3YA 4IEEA 2LKDA 1JAIA 4Q18A 5LBIA 3PEYA 2ZS8A 1S3GA 3ND9A 4Q02A 1Q3HA 3PUXA 1GM5A 1RYHA 1J70A 4M9SA 3AP3A 1KKMA 3A4NA 1J90A 2UVQA 5CB6A 5FI1B 5EXXA 4YMVA 1NIJA 4G5OA 3RNLA 3A8TA 3B7GA 4NE2A 2REXB 1IY2A 3MRSA 1ZIOA 3D8BA 3RRMA 5FTKA 1VG9B 4TL8A 4BFYA 4MKFA 1F2UA 1KI3A 4EIWA 3EG5A 3K0SA 1A82A 4X8MA 1YZKA 2IF0A 1FTSA 1N6IA 5FBLB 1FMJA 2GCPA 2EQBA 3BFVA 5FPKA 2H57A 4FIDA 4GRAA 4LBZA 4DEYA 3J81k 3C8UA 4DSOA 2GNOA 1OH7A 3KFXA 3U61B 4AKHA 2IK8A 2XNSA 1KIMA 2DBYA 3VMFA 1COWA 1N6OA 4CEHB 1P5ZB 1W49A 1Z0JA 2WJGA 5DGXA 2IW3A 4A8JA 4B6FA 4A8JB 4OHXA 5B58C 2PLFA 1YZUA 4EQ6B 1ZNYA 721PA 1UBCA 2ZRIA 5KNDA 2B6HA 2PMKA 1WMSA 3BWDD 4JL8A 4ZCIA 4EPTA 3I62A 4DRZA 2OE2A 3QEJA 2ZSFA 3SYLA 1MKYA 4BFWA 1N5IA 1H65A 2IC5A 3CZPA 2IWHA 4S2EA 1G3RA 121PA 1IJEA 1PUJA 5IK2A 3O8CA 1CR2A 2F7SA 2BBWA 4NONA 3L0IB 2CXXA 2V6JA 5B64A 1KSGA 2WMNB 1FQKA 4KODA 2AN9A 3REFA 1HQCA 2F55A 1G8FA 4QNRA 3IEUA 2QI9C 3LV8A 2IYRA 2YJTD 5FTNA 3AKEA 3KQNA 3L0PA 2QNRA 3A1UA 3EX7C 4NZYA 2H5EA 1Q20A 5E95A 1Z0IA 3SOPA 4PHTA 1Q1QA 5CM8B 4R2IA 1DAGA 2ZSBA 4HDCA 1KKLA 5P21A 4OI4A 8OHMA 5F3WB 2XOKA 3IHLA 4Q9IA 4B48A 4KJZA 5EP1A 1FUUA 1K5GA 3THYB 3ZGXA 2Q3HA 3K53A 4QNMA 4C3ZA 2R65A 421PA 2CLDX 4KBFA 1H8ED 4EAQA 2CJWB 1UKZA 2HCJB 4LJ8A 2I1QA 4EFLA 4PTLA 4F4CA 5K8LA 1E0SA 2ZETA 4M1SA 3MJRA 4H1VA 2F43A 3WBKA 3OE7D 1IONA 2QY9A 4EJSA 1W4RA 2XITA 2C03A 1SXJB 2AX4A 4TMVA 1RKBA 4PFSA 4W7SA 4XIGS 2ODNA 3DMNA 5FOXA 3GFPA 1HE8B 4D4LA 3FMOB 5FOVA 3QXJA 2HV8A 4JLNA 2KSQA 1ZM7A 2OBLA 2D74A 1VIYA 2VSOA 1IY1A 3HYTA 3I72A 4LI0A 4JVLA 1U0HC 1E9SA 4PZYA 1MR3F 2VEDA 5FTJA 3EPKA 3UMSA 1YR7A 4DCNA 3BERA 4OQNA 2F9LA 4RCYA 1F60A 5JRJA 1ZNXA 4DT1A 4OI2A 3KQKA 4BGDA 1XEWY 2MSCB 1F2TA 2IXFA 1Q57A 3HDTA 4D80A 1NVWQ 2ZRPA 4PZLA 1UBGA 2FSFA 4M1WA 1E2EA 4MYHA 1ZUHA 2NO1A 4OHZA 1SXJA 2OILA 1OH6A 4QHSA 3FMFA 3G0HA 5E7MA 2VO1A 1YZNA 2ZI5A 2IS2A 1O87A 3LW8A 1Z28A 4IOLA 2ZEJA 1UEJA 5M04A 3KJHA 2FPMA 4I1SA 3SYNA 2JIZD 4MUAA 1N25A 4PQFA 3U6BA 2QMHA 4RD0A 1QBKC 5A5GA 3AF0A 1XTSA 1VCMA 1N6HA 1P2TA 1VYUA 2GAOA 2ZSEA 4JVSB 4MGKR 3MAAC 4QBIA 4UXHA 4OQXA 3U7EB 2NZJA 1HURA 1NL3A 5KPJA 2DWQA 4XJXA 1LTQA 3I61A 2ZR0A 4HUQB 4R7ZA 1X1SA 2YHSA 4IDHA 1H8HA 3P26A 4G5QA 2YNMA 1OXUA 1M7HA 2V1XA 4XVRA 1E2QA 2G6BA 2VLIA 1DARA 4GL2A 4KXFB 4A0FA 1TQDA 1XTQA 3AF4A 1AQUA 5DSZA 1E4YA 3L8ZA 3TVDA 3PEWA 2IYXA 3U4QB 2VTKA 1BMFA 3BS4A 4UNQA 4Q9HA 3FTQA 4NYIR 2GILA 2IYZA 4F4IA 1HY3A 1WXQA 2ZRJA 3FPAA 2O8CB 3B6EA 1AA9A 3TW8B 4A6PA 3KKNA 4CYMA 3CX7A 4IXNA 3C14C 2ZVPX 3OIVA 1V43A 5B2ZA 1NMXA 2ZE6A 2QEQA 2ZUCA 3GLHA 2ONKA 3AV0B 5EZ6B 4DDTA 2ASEA 4K8OA 5FFMA 2Q3MA 4PAQA 2FFHA 3DZDA 1X8LA 5JHGB 5JHHB 1KI6B 3ZYCA 2BOVA 1GL6A 2HDNB 3CUEF 2HYDA 5AJVB 2RGXA 1XCMA 1U0LA 2WMOB 2E1RA 3KQUA 4BLPA 4EPYA 2ORVA 2BM0A 3PJRA 1XMIA 3OAAD 3QY0A 3OZXA 2BWJA 5BQ5A 1I4DD 1OIWA 3M6AA 3WY9A 4TZ0A 1EFRD 1UAAA 2QT0A 2ODBA 3ADCA 4L16A 1W0KD 4B6EA 4LJYA 3K0AB 1G5TA 521PA 2IUUA 1CULC 1KO8A 2PX0A 3KXKA 5FL7D 3FOZA 1TU3A 3QG5A 2WOJA 3PCRB 4M4SA 2CMKA 3WYFA 5KSOA 1PV4A 1P6XA 3OEEA 4WOPA 3KQLA 2RAPA 2VPPA 3ZZUA 3RSLA 3RS7A 3NHBA 5K8TA 4LHXA 3I8XA 4BFUA 3U5ZB 2C9OA 1Z3IX 2OLKA 3AF1A 4B71A 1WB9A 3SHWA 1TUIA 3BXZA 5FR2A 1DEKA 2RGBA 1YRAA 2NTYC 1FTNA 3W9YA 5KUTA 1WF3A 3CKLA 4ZCMA 1QG2A 4DLSA 3SHFA 1ZMXA 5CDFA 4EPWA 2XTZA 2ODWA 3B60A 2I3BA 2J41A 3U7HB 5L3VA 4RZUA 5DISB 1M34E 2ZUDA 1VCNA 4TMXA 3T12A 4ZCLA 1UDXA 2ZRFA 1AKEA 3CPHA 3GJ8A 3N70A 3H2YA 3SJAA 1BMFD 1CS4C 4HAYA 1N0VC 2BBSA 3LD9A 2FFBA 4AG5A 3U3RA 4Q03A 2GXUA 3HU1A 4RKFA 1MO6A 4C0AC 1X3SA 3X1XA 3L8YA 2SHKA 4O0MA 2YYZA 3X1ZA 1E2GA 1YKSA 4XOIA 1QZXA 4NMMA 3TSWA 3QUSA 4M1YA 1D9XA 3ICQB 5CK4A 5EQTA 1W36C 1R5NA 4DT1B 3REGA 2HYIC 3BB4A 5J4HA 1TQ4A 1SHZA 3W5IA 4QHYA 3CH5A 3QBVA 1VCOA 5DO9A 4O3MA 3IPYA 1NJGA 5JJKA 2ZAMA 4PPGA 1N5KA 2ERYA 1ANKA 4JVNA 4RD6A 3I8SA 4DLUA 2Q9BA 4GI7A 1KMHA 5EE0A 2MMGA 3THWB 4C9BA 2GAAA 3D7MA 3QXSA 2PH1A 4YMWA 3S1AB 5BYKA 4D26A 2Z83A 2ZI3A 1ZW6A 1O3YA 5TB5A 3SFVA 3HJNA 4UNSA 5FBQB 4LJ6A 3RWOA 2QA5A 2JLWA 3PUWA 4FWTA 1L4YA 2CDNA 2HF9A 3KTAB 3GJ0A 5KO2A 1QDEA 1G18A 5CYOA 2ZRKA 3LDAA 1TEXA 3O47A 2JLVA 2QAJA 2MSEB 2GJ8A 4TWZA 4Q4JA 4QXAA 3UMFA 4V0OA 2O0JA 4JL6A 3VR6A 4JYCA 5G53C 2PMDA 2O8EB 1P62B 3NBZC 4URWR 5A4JA 4B44A 3RS3A 1Z5ZA 4QBHA 2Q6TA 3EC2A 4DEXA 1NNEA 1G64A 3BJIC 2GJAA 1CJTC 1VG1A 4F93B 1KMHB 2BMJA 3DPUA 2BVNA 5EZ5A 2D7CA 4D0LB 5HCNA 4QOSA 1KK2A 1Z83A 3GFOA 1G4UR 4UXJA 4V02A 3CB4A 1EFUA 3DZ8A 2CE7A 3NVAA 4HB0A 4CT4B 1OH8A 3KJGA 4LYFA 1ZUNB 3WRYC 2ZXUA 2OCPA 1ZM4A 5DYGA 4G3XA 2RGAA 4IXMA 2QTFA 4RY2A 3W6OA 4ZDKA 3AVOA 1YZLA 4FMCB 1W44A 4R9UC 2GEDA 3D31A 1XPUA 2FGJA 1Q44A 4G0NA 2BDTA 2JLZA 2Q21A 2ZIAA 2NOAA 4BEJA 5JJLA 3CWZA 1XPRA 1JJVA 4NDZA 4FW9A 1XRJA 1GRNA 4BFZA 1OV4A 1ZBDA 2RHDA 1T5LA 2KJQA 3A1VA 3WNBA 4I1UA 3VX3A 5J40A 3NTUA 1E9RA 5D3QA 3A1SA 2O8CA 5SZHB 4HYYA 5JEEA 4JLJA 2RGEA 3T1OA 3LBIA 4HZUB 3F5FA 4YC7A 2ZYTX 4AD8A 1XZPA 4IKEA 5C46F 3WHLA 2KBFA 4ARZB 4WZBE 3VNVA 621PA 2XTMA 3TNFA 1BS1A 1R8SA 4CZ2A 2EWWA 4LHYA 2ATXA 3ZD6A 3VR3A 1ZU4A 2VSFA 4ABYA 4B73A 1Z0AA 3ASZA 4M9ZA 4MKHA 4UXIA 1RVDA 4ASUD 2OM2A 2V8OA 1T3LA 2IEZA 3AVQA 2IYWA 2QENA 2NGRA 1NY5A 2F9MA 4KV9A 5DN6A 4NYJQ 4D81A 3U6KA 3WP1B 2GF9A 5DI3B 1YU9A 3UWKA 3LVQE 3EC1A 3AVUA 5TY0A 3B8HA 4HLQB 4NYIQ 3FMIA 1QHGA 2GK6A 2ZI6A 3C5HA 4AIIA 4FD2A 2GETA 1P7CA 4OK6A 4Q4AB 3C16C 3MWLA 3WYGA 5L3QB 2VHQA 4FCWA 2RCNA 1R0ZA 4EJSC 4E22A 4HATA 3KXIA 1YHNA 1P9WA 4KVGA 5BW8A 2R9VA 2N42A 1KDTA 1OXVA 1JEEA 4GOXA 4NU0A 5GJWC 2VHUA 1OH5A 1JXMA 1Z07A 1Q12A 3TSZA 1W2HA 3GMTA 3GCGA 4ZI3A 3BGWA 5FOTA 4A9AA 4A2WA 1FPMA 4B47A 4A82A 1GAJA 1YR6A 3IGFA 3IIJA 2R6DA 2WWHA 1J8YF 5G40A 2OBMA 4E5UA 4D4MA 2OAQ1 5L3RA 3T5DA 2L0XA 3NIBA 2YWEA 2ZAOA 2P3SA 2I4IA 2WSSA 3EAQA 3FHTA 5DNYB 3AVVA 4MRRA 4M8NE 1QVRA 2ZANA 2JLXA 3I5XA 3CRRA 1KO7A 1NN1A 3HP1A 2ZU6A 2E9SA 2GHIA 3A6PC 1JECA 3R20A 4UJ3A 3KQHA 4Q7LA 2XJ9A 3PQCA 4S35A 4XSGA 1SXJD 2WWXA 3CBQA 3GLFB 4EKDA 5FR1A 2A3RA 1PLKA 3TKLA 5TARA 2CJWA 5EJEA 1OPXA 2DR3A 4IOJA 4TZ6A 5GJBA 4B33A 4LBYA 1YQTA 3SQWA 1ZRHA 1W2GA 1G6HA 1OIVA 2C99A 2H17A 2ZJAA 1T8UA 2J7PA 2J87A 1VG0B 1E2DA 3JVUA 2ZR7A 2IYUA 2NPFA 3WNCA 2ZS7A 4QRHA 1KDRA 4FINA 2WV9A 5EP3A 2J9RA 3EA5A 3K09A 2IBMA 5BN5A 3ZVNA 1PVOA 5FUWA 4RCZA 1CLUA 2XTNA 2IT1A 4IEIA 2BJWA 4B2LA 1ZM9A 3I3SR 3LLMA 2B8WA 3ONWA 3PR1A 2ZRBA 3UIEA 1E3MA 1TEVA 1XWIA 3EZ9A 4OHWA 4C4PA 3OE7A 3K9GA 4MKGA 1IAQA 1SKQA 4CEJB 1SVMA 2IA5A 3FGNA 1E4VA 3LH5A 2BMDA 5CM9C 4AI6A 3CPEA 3RRYA 4X8HA 1XTJA 4KFUA 1Z2AA 2Q0HA 2GVZC 5UKDA 1W4AA 4GOKA 4WIAA 5HR5A 2QM7A 2XAUA 2QT1A 1Z6AA 3QNUA 3BB1A 2LWIA 3PG5A 4TYNA 2REOA 2P5TB 2G83A 3GLGE 1UDWA 3ZVRA 3FMPB 3A1WA 3T06B 2NO7A 3IBGA 1IBRA 2P0EA 3H84A 1P2VA 5AJWA 1NSFA 1G41A 4L5BA 3TAUA 4DLVA 3IPXA 3HR8A 2QRNA 4L9WA 2HLDA 4NTZA 3CR8A 1KK1A 3NBYC 1P2UA 3THOA 4RSGA 2BV3A 4JLMA 1G3QA 5AWFC 3I32A 2LCFA 2WKRA 4LJAA 4A2PA 4JKIA 1DG1G 1NN5A 2CEAA 3ZIAD 1OHHD 4IVQA 2RGNC 2IHYA 4ZO4A 4C0KA 2O8DA 1W47A 1Z8FA 2A78A 4GT1A 4M1OA 4A2QA 3O8DA 1OE0A 4TMTA 3AKDA 221PA 4NP6A 4QHTA 3LBNA 3LQQA 5AJZA 4B3XA 1DBSA 2JAQA 2OT3B 4M22A 4V0NA 1T3SA 5FL7A 4LC0A 3ZH9B 3IQWA 4D2IA 4DUGD 1GSIA 4QG7A 1PLLA 3AVXA 4KSBA 3RDPA 4P33A 3MD0A 4WZAE 2DY1A 4RD1A 2PLRA 4URXR 3EPLA 2Z4RA 1CF4A 1GILA 1JR3A 1T4GA 2IF2A 2JJ2A 3RRZA 2HLDD 4B75A 1OLOA 3K9NA 4C0LA 2ZRMA 5H70A 2J59A 1M8PA 3D3QA 2O52A 3TAHA 5LD2C 2B8TA 1Z47A 4O2LA 1EESA 3R9XA 2IHBA 5KYKA 3EWAA 2JJ8A 1KO1A 2A5DA 3KX2A 3SR0A 3EARA 3VR4A 1LF5A 2AKAB 5BYJA 2GDJA 3TR0A 2P65A 5G3YA 3CONA 1NRJB 4URVR 4ZI2A 4UQOA 2C2HA 3GLGB 2FFQA 3Q3JB 2WICA 1R8QA 3FKQA 4M2LA 1ZCBA 4KYIB 1MO4A 3NC0C 3SE0A 3THXA 3FFAA 4JS0A 2ZJBA 4K46A 3BBPA 2GVDC 4LCBA 3EZ7A 4LOAA 4QGHA 3V4RA 3A4LA 2QN6A 3ZZTA 1CRQA 4OHYA 1TL7C 4BEBA 3KKQA 1NSTA 1XCGB 5CIWA 2R6GA 4B3CA 4TYYA 2RMKA 1VHLA 2LKCA 1FQJA 4HAVA 2EFDB 1OKKD 4YQFA 5B57C 1WQ1R 1U99A 1RJ9B 2FV8A 3MSXA 2QBYB 1TX4B 1YZQA 1RRPA 3B1YA 1RRCA 4LV8B 1TUEA 3P4XA 4QBFA 2WWIA 1NI3A 2OUKA 1NG9A 2YOGA 4JVMA 1JAHA 3Q7QA 4CDGA 1FX0B 5KSYA 5FBVB 4WW0A 1R2QA 1UJ2A 1G3UA 1F6BA 1SHKA 3OIUA 5EP2A 1OXTA 4I99A 4IW3B 1CKEA 2ORIA 3AUYA 4DCTA 1JQJC 4G5GA 5KDDA 5FPHA 3DOFA 4HUQA 1KK3A 2V6IA 3CNNA 3SI7A 2IX3A 2ZYUX 1II8A 3U7FB 1BH2A 1LFDB 3QF7A 5CB8A 1GDDA 4US1R 5CLLA 2D2FA 2WJIA 4GDFA 1JR3E 1J2JA 5TVKA 3MCAA 1E1RA 4CW7A 2CVFA 4DIDA 2WSSD 4P0TA 2YVUA 2AD5A 4HB3A 1LY1A 2CLCX 2RHMA 1XP8A 5K8UA 3EZFA 1S1MA 1XEXB 4MRNA 3TGPA 2GXSA 5GVSA 1QG4A 4Q1DA 2FA9A 3FHCB 3OESA 1AK2A 4B2IA 5JECA 1JJ7A 3HR7A 4GBMA 1T8TA 2EU8A 4Y0AA 2WZQA 4LZZA 4EFMA 3LVRE 1ELOA 3Q8XB 2J0SA 1ZIPA 5FUYA 4WXRA 3KKPA 1Q1ZA 3CNOA 3GJ5A 3NG1A 3TLXA 2HF8A 1KI7A 5FI0B 3TR5A 1IN7A 4OI0A 3EIHA 1U9IA 2P6UA 2N46A 3H0KA 3NDPA 3EIQA 4IFEA 4OK5A 3GLIE 1KJZA 2XSZA 4YDSA 3M1IA 2GXQA 2J46A 1KNXA 1XNJA 2XB4A 1E79A 2YKGA 2W2VA 5FBWB 3VU9A 2QTHA 1Z08A 1TTTA 4H1UA 1E1QD 3QKRB 2C98A 1XCPA 3EWSA 4ESVA 2Z4SA 4Q9JA 3FDIA 5JCPA 4BASA 2HXYA 1KI8A 2W2XA 1UKEA 3B1VA 2DYKA 4RVCA 1R0YA 5FUVA 5AUOB 1MOZA 4MRVA 2CBZA 2V55B 2W6JD 1QHIA 1XF9A 3THYA 2A5GA 4MYTA 2B7CA 4Q4AA 3VKHA 1ZM2A 3C4JA 4YXWA 4BECA 3P4YA 3GLHB 2QMEA 3K9LA 4HI0E 1MV5A 1GRRA 1XFAA 2NO6A 3QKSA 1EXMA 1ZAKA 2EFHB 3C41J 4O2RA 2RB4A 1T0JB 4XH9B 4DLRA 2O0HA 2OLJA 2HT1A 4C0HA 2AR7A 2NIPA 2AKYA 1L4UA 2FG5A 3Q7PA 5DI3A 1D6JA 1XXHE 3ZVLA 2QSYA 2WWFA 1Q1BA 4DIEA 1P75A 1PLJA 2W6JA 2BM1A 3WXMA 4TTQA 1RW4A 2QPAA 3SJBA 3AUXA 2AXNA 4LBVA 5L3SA 1COWD 2FU5C 2QU8A 3SFZA 5J4KA 5CITA 4RD3A 2JASA 1CJUC 1S9HA 1VYVA 2ZE7A 1VECA 3GLIB 4PPFA 3C5CA 1KSHA 2ORWA 5G41A 1VYTA 4MITA 2GF0A 2C9YA 3LY5A 4RD2A 4AYXA 4HEJA 4OJKA 2QRZA 3QVUA 1VIAA 4DLTA 1R0WA 2GWHA 3DM9B 2F6RA 5TXGA 1SQ5A 2V54A 1XU4A 4DCVA 3T5GA 3A4MA 2XEXA 5C18A 4AYWA 1JBKA 1UBEA 4XVUA 2ZQ5A 2XB2A 1GG2A 1N6NA 5DIFA 5GVRA 2WWWA 3AVYA 2EFGA 2IUTA 4Q47A 4F4JA 3RABA 4RZ3A 1SXJE 5ELXA 1FUKA 2CK3D 3ZZ0A 1NN0A 4KO8A 4NCKA 1NBME 4TL7A 1XJ0A 1E9FA 2QUZA 2FSGA 2WJJA 3W6NA 3B1ZA 4L15A 4B3BA 1KSFX 2R6AA 4EPRA 3LXRA 2QQ0A 3PVSA 4W9MC 2XX3A 1MH1A 4EUNA 4IVRA 1T6NA 1IY0A 5CLQA 1G17A 2OFXA 4II7A 3QF4B 4Z8YA 1QHYA 1G20E 1LS1A 3QKUA 2AFIE 1AZSC 4JLKA 4ZDWA 5KHOC 3UPUA 2ZR9A 3U3OA 3QQ5A 4NL4H 4AYTA 1EGAA 2OCBA 1YR8A 4U00A 4B32A 1KI1A 4N0EA 1MABB 2VP6A 1DAEA 3ECCA 1UKYA 5BN3A 4CEIB 4PO1A 2ZU0C 2A30A 1G3MA 1NIPA 1FP7A 1N2CE 2YWFA 3MJHA 1S9DA 3UG7A 2QORA 2JGNA 1EG7A 1DO2A 4DWJA 4FMBB 4C30A 1GKUB 1GTVA 1US8A 2D3WA 1SVIA 4LDJA 5A0FA 1E2LA 2W6ID 1ESNA 2KE5A 3NEJA 2AK2A 1QHXA 3EPJA 3NC1C 3LAWA 2AXPA 3HU2A 1RC8A 4Y0VA 4NYMQ 5H8WA 4A15A 4PAMA 3I4LA 4HLUA 2V1UA 4BLSA 1XBTA 4IRUB 4A0GA 4JYBA 5HKKA 1UKVY 2HJVA 2H18A 2GEVA 2VHCA 2ZRLA 1C4OA 3G5UA 1KTVA 1I2DA 2CK3A 1G9XA 2FF7A 3NH6A 5EUMA 3TK1A 2ZROA 1XTKA 1I4TD 1PZNA 1UPTA 4JLDA 2JLSA 1G8PA 1RYFA 2H1LA 1Z6GA 3QJYA 821PA 1XMVA 3K0FA 4JZKA 4NYJR 4BZQA 4P4SB 4RKEA 1ZNZA 4ACBA 1KI4A 2ZJYA 1U81A 1S4QA 4IDOA 2ONJA 4C7OB 2A5FA 4Q7KA 3IDQA 2PX3A 3N2EA 2ANBA 5BN4A 4X8LA 5KDOA 3GD7A 1G7TA 3I73A 4G01B 2CL6X 2GZAA 2VL7A 5EXPA 2QP3A 2GJKA 4LWZA 1NBMA 5EE3A 1ZD8A 5DN6D 2W0MA 1Q21A 3O8BA 1VKJA 2O8DB 1W46A 2H7VA 4HAZA 5AR1A 4ASUA 4PSVA 5F2EA 2IYVA 3ADBA 3AF2A 3CRMA 1MO5A 2OO7A 4IDQA 4DLWA 2J5XA 1G291 3LO5A 3KDSE 4MQBA 4EQ6A 2JJ2D 1AGPA 2ZVQX 3AP1A 3FKSD 1KJWA 1Z0FA 2AFHE 3TW4A 1TADA 2NQ2C 4HSEA 3TRFA 4DSNA 1W0JD 1JPNA 3DHWC 2OAP1 1B23P 2BMFA 2G0TA 4PQRA 3TQFA 2ZRCA 1N6RA 4DUGA 2KBEA 4MDEA 4QM7A 4JLVA 2C96A 4MYUA 4DDWA 4GFDA 1RRGA 1GIAA 2G77B 1S3SA 3X2SA 2IXGA 1ZU5A 1WBBA 4QM6A 1TNDA 1Z0KA 4GP6A 2D06A 1G7CA 3RRNA 2VP9A 3B13B 3T1TA 4JKYA 3LX8A 2FEOA 4P4SA 3FHOA 4KFRA 4TMZA 1A4RA 1ONBA 4NH0A 4QBGB 3FKSA 3W8NA 5GJVC 1RE0A 3EXAA 2FPLA 3AP2A 4X8OA 1Y63A 1IN5A 1VMAA 3TBKA 1NKTA 2ECKA 2DPXA 1E99A 3I92A 3KFVA 1TPZA 2CNWD 4TQAA 1SKYE 4PX9A 1G7RA 2ZM5A 1XD8A 4M53A 2WSMA 4Q4JB 1SVLA 4Q9LA 3C7KA 5JSZA 1NBMD 3X1DA 2F1JA 5LPNA 1AS2A 3CWQA 2HEIA 3LRPA 2FJUA 4JJZA 2GCNA 1EWQA 1AS0A 5ANRB 3RC8A 4Q1CA 2VQSA 4NCHA 4IFBA 4TN1A 3SS8A 3VNUA 4FI3C 1NG1A 2BKUA 4HAWA 4A0RA 3CLVA 4PO9A 2YWGA 1E69A 1U8YA 3Q85A 3U3KA 1KI6A 5IDVA 2P5SA 1U90A 1QHHB 2G0NA 3DKPA 3IBYA 4XVQA 1W36D 4URYR 1M7GA 2K5UA 5EUQB 1WP9A 2QGZA 2W2TA 1SVOA 2VSXA 2QPOA 4W5HA 2QQEA 3UKDA 1LB1B 4GZLA 4E09A 4HZIA 3BD9A 2ZI7A 4LJ7A 3DL0A 5HE8A 2D2EA 5KSZA 3P27A 4DCUA 4YMSA 3AVWA 4CRWB 4ZDIA 2PZEA 3LWNA 4PHFA 1M1YE 2J7PD 1CR4A 2CHQA 3B78A 4FCTA 4TT3A 3PUZA 4IJMA 3TUZC 3QPWA 4MRSA 1XMJA 3MG9A 4OI1A 2QAGA 4PR0A 3UG6A 4ESHA 2NMVA 2QGNA 1HTWA 1GITA 1SVSA 2BEJA 3NEYA 2X1VA 2WOOA 1G5PA 1HEIA 1IN6A 2VIIA 1LVGA 1ZC4A 4PXAA 1OYWA 1Z6XA 1DG3A 2WWGA 3KTAA 5FUXA 1WCV1 2BIFA 1KZGB 1AS3A 4Z54A 3W34A 3EZ2A 4MDFA 3L43A 3M4YA 1IXZA 2C9CA 1DAIA 2FGKA 4DLZA 4CT5A 4Q4LA 3EZ6A 2QE7A 4D0GA 2OFOA 3L0SA 1M74A 4PAOA 1FZQA 5E7JA 4XSHA 4NBSA 1CJKC 4FMCF 4ZDJA 4LYHA 2PT5A 1KI2A 1Q1EA 1DELA 1DVRA 5LD2B 4B34A 3SZRA 5L8VA 2ZREA 4JLOA 3TMKA 3WMGA 4HDQB 1FX0A 4G1UC 4KBGA 4Q1EA 1G4AE 4I81A 1AIPA 4LJ5A 5EE1A 3T1QA 2AWNA 4MUBA 1SKYB 1E9DA 5EE5B 1U0JA 1RJ9A 4JBYA 1DO0A 4D0NA 1FW6A 4R2HA 1M2OB 1DPFA 1BYUA 3NDBB 3G82C 4R98A 2CNWA 4B3FX 3K0AA 2WPDD 5E7IA 2ERXA 4PANA 2EWVA 3RS2A 4BLQA 4D6PA 5JS8A 4D25A 3R8FA 1Q0UA 6Q21A 1YZGA 5TDHA 3IO5A 3Q9LA 3VTKA 2GRJA 2O8FB 1N3BA 1PJRA 1TQ6A 4TMKA 4DDUA 4GOJA 1NVVR 2R8RA 3BH0A 1IJFA 2FNAA 1ZYUA 1KI9A 4RFSB 2JJ1D 4GPTA 4Z1MA 5KNCA 4U5XA 4LPKA 2O8BB 4UNNA 3OFNA 1U2RA 4US0R 4QL3A 3SQXA 5IK2D 5DHAA 4D82A 1XXHA 2GBLC 4TSFD 3KL4A 3KJIA 3K0CA 4L4UA 3K8YA 4BPBA 3H86A 1G8YA 4O25A 1YJ5A 2RKOA 2GA8A 4PC1A 1E9EA 2OZEA 3SYKA 1D2NA 1LF0A 3BIFA 3NWJA 5JSZB 3ICEA 4PC6A 3Q5DA 4YMTA 2XXAB 1T9HA 4E07A 5HCIA 1XD2A 4R71A 2W83A 2OXRA 3CRVA 2GEUA 1L2TA 1OJLA 2GCOA 4V0ME 2CL7X 3U4QA 2P6RA 1NVVQ 4W5JA 4A6XA 1A5TA 1XMSA 1IOZA 2KI5A 3OF5A 2RGNA 2O5VA 3JZAA 2KWIA 2OBNA 3EASA 1KO5A 3UANA 1C9KA 1XDBA 1J99A 2ANCA 3ZS9A 2QP4A 1HE1C 4HLDA 1R5OA 3GJXC 2ZRGA 3OEHA 1XXHB 3TUIC 3RSOA 4EPXA 2RGGA 1GRQA 2J3EA 2O8BA 1KK0A 4F38A 1ZD9A 4EPVA 5J4VA 1MT0A 3K70C 3B9PA 2X77A 1P4SA 2IWRA 4KSCA 4LJ9A 1CIPA 2IYSA 5KDLA 2UKDA 4ZKDA 2XZLA 1JPJA 1K8RA 4E03A 1NLFA 4FCVA 4OKSA 2JATA 4Q1FA 3IEVA 4MKIA 3PEUA 1VG8A 2OXCA 2JLYA 1PUIA 5JWRA 4LC1A 1XD9A 2IL1A 4MGZR 1IN4A 2QPTA 4JL5A 4EFNA 4BLRA 1E1RD 4C0SA 2JIZA 3GEHA 2IXEA 4TLCA 1NN3A 4A1FA 2KB0A 4DBLC 1R4AA 3KB2A 2HUPA 2WJYA 1DAKA 2CHVA 2QL6A 3CW2A 1E2IA 1SXJC 3BFKA 3DVLA 5AJXA 1KYIA 5J5CA 2XZOA 5JRZA 1S1CA 3B1WA 3IHWA 3WMEA 3QXHA 5FH9A 3UXMA 2VF7A 1G7SA 2ZJZA 4IDPA 2ZSAA 1AGRA 4DKXA 1KDPA 4GSYA 1HH4A 3AEZA 5AUQA 5DYIA 4EJSB 2DFKB 4AKGA 3AKYA 4XTCS 2YOHA 2FE4A 1B0UA 1F3OA 3WNDA 4Q21A 4M1MA 1AZTA 1R10A 1U94A 5FPYA 1XB2A 3BE4A 3RS0A 2QG6A 4Z51A 1U9IC 4DCSA 4BZPA 4ERNA 2WWYA 4OL0A 3BB3A 4Q00A 1EX7A 3PUVA 5DE3A 3AM1A 4PO8A 2EFEB 3B9QA 3CNLA 1OW3B 4JLAA 1FOEB 4AG6A 3D6TB 4NCJA 1BOFA 4YMUA 2VH5R 3CRQA 2FEMA 2JDID 3QOFA 2GJSA 3H1TA 5JLJA 3LBHA 1GKYA 2ZE8A 4BQSA 1A7JA 4RFVA 1E32A 1H8EA 1TQ2A 1NY6A 2C04A 1OFUX 1OSNA 2GBLA 3E70C 4ILEA 5CIQA 2CCJA 1IXSB 3FWYA 2YC4C 2VP0A 2TMKA 5EP4A 2Z0MA 5KOYA 4POAA 3W3ZB 3EW9A 3ZS8A 5JI3E 1ZCAA 2VHJA 1BIFA 4H9GA 2WJVA 4Q4HA 3E2IA 2QE7D 1OFTA 4NKRA 4US2R 1Z29A 5C4MA 1BO6A 5JS7A 4A36A 1DAHA 2PCJA 4TYQA 4NCIA 1X6VA 5B30A 1W7AA 4HLUC 4AKIA 1QRAA 2R6CA 1WE2A 3ND8A 1GNRA 1P61B 3R9WA 2OCAA 3QIAA 1W5TA 1G5RA 2J1LA 4GMDA 3NBFA 1E96A 4C0JA 3I1FA 5J4YA 1GKIA 3LW7A 3K0EA 4BLOA 2WTUA 3DKVA 2DFNA 4Q1AA 5FOUA 4Q5IA 4OQFA 2E87A 4NCNA 3AH8A 4M1TA 2IS1A 3QKRA 1GNQA 3CF0A 4TT3D 3T35A 4QJ3A 1BYIA 2OFWA 3SJZA 5E3HA 2YZ2A 2FZLA 3IIKA 2F1IA 3OHMA 4TTRA 1T0HB 2BCGY 2W00A 3GLHE 4LV6A 4M9XA 5KSPA 3RWMB 2ZTSA 4CEHA 5IRCD 3LFUA 1I4LD 3FVQA 1S8FA 4LUCA 4WXPA 2ZRAA 5LB4A 3AF3A 1W4CA 2GJ9A 4UKDA 1Z06A 3VAAA 1LW7A 2VYFA 1MO3A 4OJQA 2IYTA 5FOWA 4GP7A 3R8CA 3TE6A 2FMXA 4TLBA 5EXSA 2ZRNA 1VDZA 3RS5A 4UNPA 3U44A 3PFIA 1T5IA 1RRFA 2GCOB 2Y8EA 4KLNA 1KY2A 3ADKA 3PXGA 1E2NA 3AB3A 2Z5FA 1E2MA 3K9HA 3UK6A 4N0DA 3FB4A 4DSTA 1JNYA 2WPDA 1CR0A 3MWJA 4U7DA 3CIOA 4ZIRA 3LNCA 2Q9CA 4BFTA 1DOAA 1E1QA 2CCKA 4LHWA 4OYHA 1IQPA 3TSOA 1JQLB 4J0QA 1E79D 5SZKB 2DWPA 4PZZA 1II9A 4XWOA 2PJRA 4HUTA 5AJYA 5AUNB 3SJCA 3QXXA 2G3YA 2NPIA 1MRNA 1Z2CA 2EYQA 2RGDA 1VPLA 2BBOA 5D3MA 4BE7B 3WRXC 2DHRA 2OESA 1ZUIA 2DCUA 1TMKA 2WM9B 4BFSA 3T1VA 1F5NA 2N1BA 2FSHA 1N5JA 1T91A 1ZC3A 2YWHA 4NPHA 4DVGA 5LB2A 4PHGA 2X19A 1S96A 2WKQA 2YC2C 2ODEA 1X86B 2AD1A 4TQ9A 5CDFE 4LHVA 2BEKA 1AQYA 1E9AA 2B7BA 2JLUA 2IYQA 3BFXA 1EFTA 3ASYA 2X2EA 3CF6R 1KNQA 2FX3A 1W1WA 2DWOA 2F1HA 1K5DA 1YE8A 2AWOA 2CLSA 3SEAA 4C2UA 2V4ZA 3TH5A 4IHQA 2F1RA 3KZ1E 4Q66C 1E2KA 1QHSA 2ZI9A 4TSFA 3VU9B 5F98A 1F2UB 4TLEA 2PT7A 2VRWA 1FP6A 1TF5A 2FN4A 4A92A 2XGJA 4QJ5A 2REBA 1QF9A 2A9KA 5BWMA 5IT5A 4JT4A 2X8AA 3UWOA 1KY3A 1GZSA 1NLYA 3QI2A 4FXPA 1W36B 1KAOA 5DLQC 1TU4A 5JI2E 2BJVA 1M6NA 2QP9X 3DEFA 3X1WA 3PUYA 4M1KA 1NJFA 3QPUA 1E6CA 4OHVA 1KJYA 4DLYA 1XD2B 2DFTA 3ADDA 2XXAA 1SVKA 2D7DA 1OFHA 2GZDA 4B74A 4KFSA 5FTMA 4IDNA 3GJ4A 4Q1BA 1JXOA 4AC9A 4W5WA 3W6PA 1ESMA 4F91B 5F9FA 4PC3A 3CX8A 1FNMA 3RC3A 2B21A 4I4LA 2F3RA 1X1RA 5JCZA 2HJGA 1GWNA 1CR1A 2JEOA 2XSZD 3CO5A 3RVBA 2GXAA 1US8B 1HT1E 2PEYA 4RFSA 4KAXA 2QTVB 4M21A 2EFCB 2R2AA 1DE0A 3EA0A 4DHEA 3TUJC 2W58A 3GLFA 3QE0A 1UFQA 4CEIA 1AN0A 1E98A 1KMQA 1XEFA 2JCSA 1HV8A 1YZTA 3H4MA 4G5RA 4GMXA 1KZ7B 3P1JA 4JJKA 2C78A 1L8QA 1ZNWA 3GJ3A 4KYUA 3TJZA 2ZYWX 4QJ4A 4DDVA 1K6MA 1XJCA 3DMDA 4TL6A 1AKYA 1Y3AA 2PJZA 3LQRA 3SDZA 2VP4A 1OXXK 2UZIR 5HKKD 3GP8A 1KGDA 2D4HA 3MLEA 5FBRB 4BZXA 3KB1A 2HT6A 5DH9A 1FNNA 3BK7A 1J7KA 1GNPA 3IO3A 4HB2A 4K81B 4C0BA 3MGCA 4IVPA
chains in the Genus database with same CATH superfamily
3VA7A 1GFIA 3WHKA 5IWCA 4HZUA 1L5GB 1J56A 4F92B 5HF5A 3KZMA 4R41A 5KYYA 1KEEB 3B2EA 3WGZA 2XYQA 4DR5B 2I54A 1SMKA 2LD4A 3HI4A 4RY9A 5JQGA 4PSCA 2KHZA 3UPDA 3ZBTA 4KFTA 3ZLJA 3O8NA 4R68A 1ODCA 4MRPA 4B4OA 3O4FA 3NEPX 5L3QA 4WLFA 1W48A 2IX9A 3IMGA 1BG6A 3E5NA 4Q01A 1PFQA 1HKUA 4IDAA 3T1YB 1KWGA 4D8YA 3SMQA 1CUXA 1P31A 1NYTA 1XRLA 3NHYA 5COAA 1E1YA 3VKWA 2EX0A 1CJMA 4A0HA 3CGWA 4Z3KA 4UUOA 1T2VA 3PRYA 1UF9A 4WDQA 3GEEA 4KMRA 2ZSDA 1GUAA 5ALZA 1QKIA 1SULA 3BTSA 4ZT3A 4JI5B 1W96A 2PR7A 2C5BA 1PRYA 4TWBA 4D4KA 5B7QA 2P67A 2QROA 5JPCA 4LHSA 1TA0A 1CUVA 1FBNA 4JIGA 1WKBA 2E4ZA 5C80A 5L3SB 3FKJA 2I8AA 5L53A 1B2LA 4WZAB 3HU5A 1N6PA 1B7GO 3MJTA 1E7MA 4YECA 1Z7YA 1E5DA 1VI5A 4IOMA 1QQ5A 4EJMA 2NG1A 3AHFA 5HOQA 1V4BA 4L8GA 3OQ6A 3HJTA 4O4IF 2HBYA 5D51S 3UMGA 1DJMA 1XZNA 4I8XA 1HR0B 2OG1A 4U02A 4DFDA 3PNMA 1WDTA 2XJ4A 1H6DA 3ESCA 3WK9A 2MWMA 1P81A 1H2RS 4LRUA 3ZJYA 2HSEA 3EMBA 1WVMA 1RIFA 4LSGA 1PGJA 4X61A 4PS0A 1KDVA 1A1SA 3LJKA 4TLDA 2OCIA 3GH3A 3UZUA 3ZXYA 4J9VA 1IJBA 4BBAA 5JR3A 5A4IS 1DJOA 3PYMA 1E92A 2PSHA 4FILA 4X66B 3U7QB 1OT3A 1XJQA 4U4AA 4ID3A 1LNZA 3PGKA 1H2WA 2NNLD 3HRHA 4UE6A 2CHGA 3TGWA 1QR2A 4ZAGA 2R25B 5EOVA 3V4SA 3W5AA 1Y7IA 1NXXA 3B85A 4FFVA 5YASA 3ROQA 2ZIGA 5HZHA 1XZMA 1FW6A 1RRKA 1ZVQA 2PQ2A 2BM9A 2FLKA 4F3NA 1TTQB 1H0SA 5E4FA 4BWYA 2IOFK 3FOBA 3DZBA 2RGCA 3IQXA 3PGMA 3FOFC 2WIAA 1ZA1A 3FPKA 2PDAA 4XD7D 3HYRA 4DJJA 3U7QA 1H42A 2INGX 4U6SA 1OXSC 2IYOA 2NQTA 2R62A 3TLGA 4R6WA 3PS9A 3NCTA 4JODA 4DM3A 3VQTA 2WE7A 4AMVA 1TT5A 4MK4A 2AJTA 4OQZA 4Q6BA 4D8TA 1U0FA 1VCIA 2HRDA 2I3AA 5IXSA 4B43A 3RSQA 2HLPA 1V8BA 2XZPA 1JVBA 3H3XA 4UBJA 1Z8DA 4N12A 3UWPA 3WP0A 1GZDA 3RT1A 1W8IA 1GFWA 3DL7A 4G6ZA 4Q4HB 1KQ3A 3H7AA 3JD2A 4A4DA 1QO7A 1GT91 5FWAA 4RTSA 2E7ZA 4LV5B 4QATA 3LLCA 1H85A 3KC2A 1UM8A 2HUNA 3E4DA 3U4MA 1QS0A 4JR2A 3ZZ1A 1XR3A 2BGRA 4ER3A 2VEOA 5CB4F 8AT1A 2SICE 2XA2A 2CUZA 4R01A 1WMAA 4PX2A 3BK1A 1UBSB 2NADA 4RDHA 3RTCA 4LXTA 1KJ8A 1U98A 3BA1A 4NFYA 4IGFA 3UENA 3MHTA 1CRPA 4FS8A 3SQNA 1ZICA 3M8KA 1GL7A 3OKCA 4EJ6A 5A9SA 2VDWA 3ZBQA 4JBWA 1YQEA 1SQSA 3M89A 5CYFA 2I2AA 4J16C 4Z53A 1OA0A 2WKPA 1VMKA 3KHUA 5BOSB 1YZFA 2O14A 4BUJA 3CKYA 4LXHA 4BQQA 3NI2A 2IZZA 4XFKA 4N18A 2V3CC 3DH0A 2BFWA 1D7AA 3TOXA 1CP2A 4YWHA 4RVDA 2AOUB 2OK8A 5IBPA 4QOGA 5FOSA 3H04A 2R86A 4AURA 1TCAA 5KTNA 4V0KA 4YNBA 2MMCA 1J8QA 3ISJA 1MZVA 3QE4A 1V9SA 2X23A 4WKCA 1NA5A 2XNDA 2J8ZA 2WP0A 3NV9A 2PUDA 4MV9A 2BKEA 4WECA 3WMRA 4C3UA 1D4OA 4ZVRA 4LY6A 3IKJA 5BOSA 5DN9A 4FBLA 2GK3A 2ZPUA 4TWRA 2IZOA 2W48A 2V7QA 1E94E 1FVHA 3DDCA 4RVOA 3GL9A 3LM8A 5JXGA 5AXDA 4DV3B 3LQYA 3R7WB 5CDYA 4EB6A 3D4PA 1VHTA 3GGJA 4EHLA 1F4LA 3C3WA 1XAIA 2GOYA 3HKBA 3MTIA 4PV7A 5LDGA 4O1IA 5KYYB 1SAYA 2HHJA 2FPGA 4UBKA 1ZD1A 1I0LA 3RUEA 3PFFA 1G8HA 4YUXA 1BOOA 2PA3A 3T94A 5HRAA 1FDRA 1LNSA 4M0DA 3WMXA 4C2AA 4G4SP 3VPBA 3V1UA 3I28A 4A8PA 4O8CA 3B3QA 3G8AA 3JYQA 4AY2A 3IKVA 4M89A 2QD5A 3LYLA 2EKPA 1V8ZA 4PLHA 3RSSA 1N0WA 2PBRA 3KUDA 4OH7A 1TUBA 1EFDN 4G0PA 1J7JA 4EGQA 5K4AA 5KVQA 3EAFA 3UC5A 1JDSA 1BC5A 1SVWA 2W8BB 5CDGA 2CE2X 4GPBA 2OAGA 3PK0A 5T8KA 1UZAA 2AC4A 3F8TA 2CXSA 3UMMA 1FDVA 3M3HA 4KW7A 1G3IA 2VKQA 3P71T 4IPTA 4MARA 4M88A 5H68A 3UV3A 1DS6A 5TMDA 3OM8A 1PYOA 3GBSA 1NP6A 4QBKA 2H4JA 1JX6A 2OFPA 3DDUA 1ZW1A 3E1KA 1EVQA 2C29D 4C21A 1GPJA 2J6HA 3O94A 4TMWA 5EKXA 5JDIA 1MVNA 2UYGA 1FVFA 2VJDA 4ECAA 2BC9A 1BHO1 3JQ9C 1VSUA 4P31A 4NWIA 1FS4A 5EWJB 1SGWA 4M7PA 4DV7B 5KTRA 1GRVA 4KPUB 4B3GA 1BGWA 1X1AA 4BNDB 3A7DA 1IUNA 4HLCA 4OQMA 3M9LA 1D2MA 4MLDA 1XPOA 1C0PA 4CNQA 1F48A 1HT2E 3UUEA 1MRSA 4WH0A 5KI6A 1Y8QA 4MVXA 3VPAA 1CZRA 4EUHA 5F5NA 3V46A 1FMLA 2FVYA 2C57A 1GADO 1L1QA 1GOTA 1PJ3A 1ECCA 2JHFA 2ZB2A 3BSWA 4TYPA 1YR9A 1Z6QA 3BXPA 5CH5A 5CVVA 5HRCA 1J49A 4EI9A 1N5LA 4P36A 4Y2RA 2HCBA 3PUIA 4HFRA 1GZ3A 2FETA 1RXCA 2WFZA 1MABA 2PO5A 2PRJA 4ZK2A 1OBOA 2IS6A 2H8GA 2EF1A 2RH5A 1JG3A 3QVGB 4M9QA 3QOWA 3SOZA 1DC6A 1IEQA 1UJNA 2DF8A 2CBXA 1E2PA 4FZ3A 4DNOA 4YDRA 2WZCA 3FR8A 4OBEA 2NO4A 2QWXA 2EBUA 1KH2A 2UYOA 3K1YA 4X62B 2AOTB 1KEKA 3U4IA 1K06A 1GQ2A 3FNRA 3MBOA 4WXYB 1CNFA 3GA5A 2H2AA 2J31A 3L3BA 3QEKA 3OEHD 4I50B 3TLGB 5CX4A 4P7GA 1V3TA 4Y67A 4IDCA 1LVUA 5GAJA 1RPZA 4EG8A 3VNQA 4ZO9A 4TPKA 1U8UA 2BFCA 4D0SA 2K4MA 1Z22A 1ZVMA 2D0PB 1WDKA 3EE6A 4RPKA 3GLRA 3P19A 4XWWA 2BR5A 3NJ4A 1KAGA 3DYBA 4E4TA 2X2FA 1ZIXA 3OX1A 5E1MA 1X7GA 2G1UA 1PFUA 1SUWA 2X0IA 1FS6A 1JR3D 2WVJA 3OKAA 4JI2B 3H2HA 2LCQA 2FKAA 1I5EA 2WT4A 2Z6VA 5CCXA 2WJWA 2EKQA 2Z43A 2W2KA 4J7AA 4UJ5A 5BR7A 5CB4A 4NE9A 3CM0A 4JLBA 3QFRA 2YHIA 3QBTA 3QE3A 1DAMA 3TFWA 3N28A 2EJBA 3SNHA 3STTA 3B2NA 5K0ZA 1ACMA 2I22A 4HRXA 4XQGA 1W0JA 2H5JA 1ZITA 3ENVA 3LA6A 1KBZA 1KYYA 2XGMA 4CG1A 4OA5A 1DUSA 1MTOA 5CA1F 1LDEA 1LWNA 1WV1A 4MQFB 5GJCA 5HPYB 4PQYA 3VKGA 5B2EA 3JQ8A 4BX0A 1SRQA 2JAWA 2ZFUA 3VISA 1P2SA 2I4MA 3C3DA 1JH9A 3HYNA 2PKEA 4FYHA 5IC6A 1KRWA 2NXNA 3PE4A 3WQQA 1Z16A 2AI3A 1NMYA 2P6NA 3LQ4A 5DOVA 2LDXA 2C5LA 5G4KB 3OHPA 3ZU6A 1DAOA 4B7CA 4DV2B 3V3KA 4JOSA 5CBKA 4UPVA 4D9JA 2CYAA 1FRNA 3PENA 4GNKA 4WVFA 4DA8A 4NNJA 4A5SA 2CMGA 5LJIA 3T7RA 4DSAA 3CUVA 1U3CA 1FL9A 1TVKA 2FB9A 3PYLA 1G2OA 1GN8A 5F78A 3WGIA 4G1MB 4H7DA 3M0EA 4WAUA 3ZWAA 1L9XA 5CLJA 2ZB7A 3JQDA 2QSZA 4G41A 2AX3A 3FRIA 4MR9A 4UM5A 2G88A 3RD5A 3SU8A 3BJMA 1S7GA 2BF4A 3DLTA 4RMHA 3NWEA 1F2DA 3TE7A 2WD7A 4K9KA 4INJA 3N8HA 4PPNA 4WXHA 1ZESA 4KR0A 5E3IA 4JSYA 4WESB 3OM9A 1NKSA 1RAIA 1X2EA 4WK0B 2DBRA 5AVZA 1N32B 3R6LA 4OQEA 1AUQA 2VR1A 2FJPA 4L5IA 2ZJ2A 1ODLA 3HKCA 4KI0A 5C4GB 3ZW7A 5JWOA 3TECE 1EIZA 3RSFA 5LYJB 4PLTA 1I9GA 3WBBA 1VKOA 3DFFA 3KT3A 1B3RA 1E60A 2H7CA 4YJDA 5FV7A 3ZR4B 1RC1A 4KREA 4HWOA 1C9JA 3M70A 2IYFA 3QGMA 2X8WA 3KZKA 3L6RA 4JX9A 3L82B 5EQFA 3W6UA 2P35A 3ZNPA 4BX3A 4ZV4A 5DTEA 4OHPA 3A1TA 5CEJA 2VDRB 3RLFA 3SSAA 2MSLA 3EH2A 3JVEA 3MWEA 3RS4A 4UEJA 1SCUB 1S2MA 2YV5A 2R1VA 5C1BA 1J8MF 5THXA 1ZP6A 3ROPA 3R40A 4CVNA 1IK4A 2AOWA 3MTGA 1BX0A 2VSNA 3NTLA 5DCUA 4F8EA 5I9LA 2F43B 1G6OA 4MWTA 4LMPA 1HNXB 5TS2A 3EQ7A 3ZJ5A 4AMUA 4JB8A 3DO6A 8ATCA 4I1VA 2IEYA 3THXB 4GM1A 1IZ8A 2X15A 1INLA 2V3VA 4RE5A 4NJEB 1PNVA 4OQYA 2OMKA 3U9SA 3QX7A 1PD0A 1HQYE 2Q27A 2FWNA 4MV6A 1G20A 1NMSA 2HF2A 1WD5A 4UTXA 2DR2A 3QEAZ 1RAGA 2B92A 4X7RA 3CZ4A 3NPMA 1IHDA 3EZNA 1V41E 4MR9B 1DIAA 2HK8A 5TPZA 1C1HA 4MV4A 1XRPA 2M1XA 3PIIA 4BQFA 1HUQA 4JT2A 4XYBA 3HA7A 3OEYA 4U5QA 4G67A 5EJMA 3CUUA 4BMPB 2VF8A 3S81A 3HB9A 2ZJ8A 2R0QC 1NJ2A 4X97A 3E9DA 4NPAA 5JSYA 3BRWA 4IEEA 2LKDA 3HE3A 4Q18A 1T36B 4KX3A 3ND9A 1V5IA 3BMNB 3E0QA 4M0KA 4PYRA 4M9SA 3R77A 4WUTA 3TPZA 4OHKA 4D3YA 3AP3A 2JC3A 4P7JA 4Y2UA 2QD2A 2UVQA 3JYNA 2YUIA 1NIJA 1VM6A 3G8CA 3RRXA 3HYLA 4TLLB 1ABBA 4R9SA 3F6CA 1X8XA 2G5CA 2EL9A 3K0BA 3BZUA 3K6JA 4M99A 4NECA 4OPMA 1X7YB 1NV9A 4GU5A 2NT3A 1UJMA 1VG9B 1PQPA 2ZBUA 4BB9A 1MW8X 4Q3LA 2VPQA 4XCVA 4I4TB 1F2UA 1KI3A 4EIWA 4CQNA 3P5BA 1Q91A 2NNWB 2YXEA 4MHOA 3KBOA 1TJPB 4OXIA 4X8MA 2C1EA 1FTSA 1N6IA 1W5FA 2A58A 2Z30A 3BFVA 3EVFA 4LRQA 5FBLB 5FPKA 4GRAA 1DWUA 1FFGA 2YHIB 3RSCA 1YAJA 1GPUA 2FP3A 3MXTA 2GNOA 3UHOA 3ZHZA 1K27A 2Q4DA 4BN0A 3U61B 2F1KA 5DZSA 2CUNA 2DR0A 2W37A 4RACA 2Q0QA 1COWA 4WKOA 3ER6A 3VMFA 1UIRA 2GGSA 4B82A 5AD1A 4CKZA 2XDQA 3NZEA 1M6VB 3U4GA 5M5BA 2EX4A 2WJGA 2BN4A 4LISA 3OTWA 1EVZA 4O2AB 4MAMA 4WL0A 5TE9A 4C3VA 4OHXA 4TLMB 2VPTA 5B58C 2CXOA 3PLAE 1QFJA 1E1CA 2AZXA 3HKDB 3ROKA 4BNNA 3JARA 2G17A 1H05A 1XT6A 1UK9A 3HV0A 1DB3A 4MQ6A 5AOBA 5G0TA 3SC6A 5F51A 1XMQB 4H35A 2WD9A 4LNAA 1YRHA 2E85A 3C1UA 1J1IA 3PXXA 4UDXX 5J23A 3BWDD 3JW8A 5AKIA 4FGUA 4JYPA 2C9ZA 1F2VA 1T15A 2OO5A 4X60A 2OE2A 2HGZA 1VLLA 2ZSFA 3MPOA 3D6MA 4GECA 4P83A 3ZDBA 1N5IA 1H65A 2FJ0A 2IC5A 4JH0A 4LVCA 5H3HA 1TI7A 2HZBA 5GWXA 4S2EA 4NBUA 3QOYA 121PA 1PW7A 4EB0A 3KKZA 3CRZA 4MV3A 4EW6A 1CR2A 2QRLA 4Q9AA 2Q4OA 4CIWA 4BNTA 3IB6A 4ARIA 4PRKA 3L0IB 3HUDA 2QL9A 1CZHA 2NN3C 2A1IA 3R7NA 2DPGA 3KE9A 4J76A 4MWCA 4WLOA 4G56A 5FA8A 3QUAA 4EG4A 1MTZA 3REFA 4B3MB 3PCTA 3HSYA 2Q7DA 1HQCA 3IIEA 4R8MA 2PY6A 1C3OB 5BW5A 4CHTA 1OI7A 4X95A 3FHJA 3IEUA 3ND7A 5E4YA 5HQ3B 4KH0A 2OCDA 2DG2A 2Z3WA 3H8VA 3COJA 3H8JA 1SIOA 3DEIA 3BYZA 5FTNA 5EJ8A 3AKEA 4YT2A 1KEPA 3ONVA 2H5EA 3VNBA 4I4IA 2OVBA 1Z0IA 5E95A 3EJWA 3FFXA 3PSHA 1SRRA 1GAEO 3NYIA 5IC4A 2IODA 1E89A 1NR5A 1WS6A 3Q1LA 3D1LA 1DIGA 4QPJC 1OROA 2WTAA 4R2IA 4MVJH 1I14A 8OHMA 1ZSVA 2A86A 4OI4A 5HSGA 2A0UA 3IHLA 2XUJA 1NBWB 2AC2A 3P97A 4G9EA 5EWJA 4B48A 5C31A 1MAVA 2HM7A 3PXBA 4X63A 1FUUA 4WBNA 1DINA 1XVIA 1HORA 4L85A 2Q3HA 2Y9PB 4GUDA 6CHYA 1HE4A 2F3QA 2QRVA 3P9NA 2CLDX 1QU3A 1L5HB 4AQDA 4EAQA 4EDFA 5L40A 2WIFA 2P4EA 4LJ8A 4K9NA 1V9LA 4TYMA 4PTLA 3WXBA 2F2TA 2ZWPA 3C5EA 3KR1A 4R51A 4CFSA 3U5TA 3OE7D 5JXHA 4QOIA 5CT8A 2QLBA 2QY9A 5TQ2A 2BFBB 3AILA 1F0PA 2FN7A 1VIVA 2H0QA 1W4RA 1T5SA 4I4NA 1SXJB 4RK7A 1NDHA 5IAAA 3GJYA 4JLSA 4F1WA 3EFBA 4C7VA 1RKBA 4PFSA 1QUEA 3M2TA 4YQEA 3RUIA 1HE8B 3ITNA 4KLAA 5K09A 3K9BA 2Y71A 5IT9A 1ZM7A 2OBLA 2O2YA 2D74A 1K7CA 2OFFA 3I72A 3IOEA 4BCCA 1WDMA 2BY4A 3FW1A 1WQ3A 4JVLA 1RI4A 1MR3F 2FWBA 3M9XA 2VEDA 4C1NA 5FTJA 4CM8A 3EPKA 4YCSA 3ORSA 4DCNA 4OAOA 1BCSB 1Z82A 2PGJA 4EFDA 3LDGA 4XX0A 4RCYA 1RI1A 1SC6A 2WTBA 3WGUA 5JRJA 2CNLA 1ZNXA 1BROA 4Z7OB 4EHBA 3VR3D 1Y8RB 4BGDA 4ZAXA 1C9EA 1VL1A 2IXFA 3LPCA 2DBQA 2BDEA 3ZV7A 2ZRPA 1JMYA 4M1WA 4FT2A 1E2EA 1E20A 3NX4A 2O59A 2XZTA 1QE0A 4OHZA 1OH6A 1VPWA 3Q41A 1C0KA 1L4HA 1P8AA 1TYDE 2ZIXA 3FMFA 1XZKA 3K3PA 4JC5A 3D0QA 4QAQA 1TYAE 2B30A 3WGNA 1RLTA 4DJAA 3U7RA 4IOLA 3LWZA 1WPQA 1CZOA 2PLWA 3TEJA 5M04A 3NUQA 4MPJA 1JFFA 4PQFA 3UQZA 4WXRA 4Q7QA 1HOTA 2GRAA 3BXFA 2NZWA 2A1UB 3QX9A 1EP9A 2GAOA 3MJDA 4AULA 4CQMD 3CSDA 2NZJA 5KPJA 2EP8A 3E81A 4BLUA 3DTVB 2ZR0A 1IQUA 1W76A 4J0JA 1Z38A 3VPXA 2WB4A 4LOKA 1VLVA 1X1SA 4EOGA 4ETIA 2AUMA 1JE0A 2IQ5A 3DPSA 4UULA 4EX6A 1JQ5A 4JI7B 1NHGA 1PBNA 2YNMA 2AQ8A 4MUEA 5K03A 2V1XA 2YY7A 3MLAA 4BEJA 4XVRA 1E2QA 1U8TA 1JSXA 2DSNA 3F5SA 3KOYA 5DP1A 4GL2A 4KXNA 3RU7A 2BCEA 4TTAA 3AF4A 1AQUA 3IAFA 7REQA 2A4MA 1BWQA 5DSZA 1NBAA 3UTCA 4Y7CA 3RGGA 1YDFA 3U4QB 3S8YA 2XCLA 1BMFA 2FE1A 2GZSA 3PQ3A 4NARA 4Q9HA 3FTQA 5BUZA 5ALSA 3PFGA 2BI4A 3THRA 3OQOA 1EUCA 1HY3A 1WXQA 3SXPA 1ZL2A 1RU3A 2O3UA 3ANXA 3FPAA 4FFOA 2IV2X 4AZVA 3JQCA 3UK2A 4JSRA 3DW1X 3KKNA 3SQDA 5HIAA 1Z17A 3TFQA 3CX7A 3ILYA 3C14C 3JASB 4OHUA 1J2UA 3OIVA 3ZE0B 5B2ZA 2XMGA 4BOYA 3IQHX 2B2CA 1HYGA 5EZ6B 1R0SA 1QYWA 2ASEA 4K8OA 2ZJ6A 5C1DA 1JS1X 4UOQA 3DE7X 2ZBQA 3DXXA 3TM4A 2FFHA 1SOWA 1XWWA 3OMXA 5JHHB 3AEXA 2VYQA 4N5MA 4RNCA 3UWMA 1LU9A 4MROA 5AJVB 2F4NA 4X45A 4P8RA 3BDVA 1AB6A 3B5EA 3IVCA 5FUMA 4FNAA 1E3WA 1HLPA 1CNEA 4KXMA 4MRMA 3NEAA 1KETA 2VTBA 1MP0A 1I6LA 2QG9A 1O57A 2JIMA 3FUUA 1L4LA 2BM0A 2BGNA 3R0ZA 4MJ7A 1X74A 2OV6A 1OIWA 2ST1A 3SDBA 3NNNA 4RETA 4YUZA 4PO3X 4ZHSA 3OX4A 4UEWA 2H7XA 4BV2A 1LLUA 3K0AB 4LJYA 3JZIA 4MVJP 4CM1A 5E1BA 1M2JA 2VF2A 1CULC 5G1OA 2VHEA 5H3CA 1ZD5A 3VZQA 2ATCA 2PAFA 4Q7EA 3HNRA 1IRIA 3GGCA 3FOZA 3PC3A 5KSOA 2WF5A 4M4SA 1PV4A 4DA6A 2CMKA 2EFYA 2EARA 1BVRA 1P6XA 3L06A 3OEEA 4PRZA 5CXUA 2RAPA 1AGNA 4XIYA 3LMKA 5H0IA 4WNIA 1U6KA 2VT7A 3FCOA 2AT1A 4LHXA 3U3DA 4BFUA 4B3SB 1Z3IX 2A35A 1QP8A 2OLKA 3AF1A 5T4EA 2NUTA 1ZGHA 3CXUA 1TUIA 1TZBA 3BXZA 5BSKA 2C9BA 3QP9A 1YA6A 3U48A 1UBTS 4GP9A 1PDOA 5D6OA 5FUBA 4ZCMA 2JG3A 3SHFA 3PGVA 5F73A 2SKDA 1M8KA 1XCLA 2IELA 2V0GA 5EUCA 3ZJ4A 4OLBA 3OJ0A 1PL6A 5L3VA 2DVMA 3OA0A 1X1QA 3KZNA 5DISB 2I55A 3HCEA 4RH3A 2HJWA 2NU8A 1A0OA 2AYXA 4YN3A 2CNNA 3N8KA 3PKZA 4F2WA 1AKEA 2A9RA 4F8YA 3RVKA 2IHJA 1BMFD 1PG5A 3LD9A 3DXZA 1L5VA 4ZVPA 1Y8ZA 3RT7A 1QDUA 5HDQA 3IDAA 4CDNA 5ITWA 1SHJA 4QUEA 2B4YA 1GPYA 2WV7A 1DBPA 4DLKA 4KRFA 2VXOA 4O0MA 5F77A 1IPFA 3W9UA 1E2GA 1YKSA 4NMMA 3ICQB 1TUBB 1J07A 1D9XA 3QUSA 4JBLA 1R4ZA 4BJHB 4XM0A 1R5NA 2Q0XA 4DT1B 5FWXA 1AKNA 4Z4QA 4R8SA 3KDPA 2HYIC 2IEGA 3KYCB 1LK7A 1MJFA 2WHQA 3O3CA 2VSQA 1FF9A 3EOAI 1L7XA 3RIXA 3D4LA 3KV3O 1EFKA 1V2GA 1HPLA 2FR0A 2X0NA 3W06A 4QT4A 2RG1A 5FWXB 5IS2A 4FX5A 2ACWA 2I3ZA 1DWQA 3UT6A 4JQOA 1T24A 2C92A 1NJGA 5HWSA 1H6CA 4H60A 4PPGA 3IEXA 4P34A 5HGJA 1STOA 3RODA 2ERYA 1N4DA 4J0HA 3GFSA 4JVNA 5EE0A 1KMHA 2IHZA 2HADA 2P9TA 3KU1A 4GRIA 1O6BA 4C9BA 3D7MA 3QXSA 2AW5A 3ESBA 3WLNA 1HE3A 2VYVD 1NURA 2JBAB 5FAXA 4FFBA 2KLBA 2OECA 3S7TA 2E18A 7GPBA 2K7FA 2XF8A 4Y6LA 5BSWA 1ZNQO 4RLFA 1ZW6A 1O3YA 5L4NA 1TO1E 1U5BA 5EJ4A 4GW3A 4K6MA 2KM1A 3MQFA 1IWBB 1N8SA 4LJ6A 3RWOA 5JMWA 3E5MA 4N82A 3UOWA 1O7JA 1I7SB 1TMOA 2H48A 2GD6A 4FWTA 5HILA 2BTQB 5F35A 2AZ4A 2CDNA 2HF9A 2TYSB 4ZCTA 3HNOA 5KYNA 5BQXA 1QDEA 1VGQA 1YA8A 2JB9A 2PR2A 1P39A 2R4QA 2WU1A 2YZNA 3I2HA 4UU1A 5EIWA 4AJ1A 1BWSA 2QAJA 2GJ8A 4XJVA 1A96A 2O4CA 5E1DA 3UMFA 5JCJD 4V0OA 2O0JA 1GPWB 4JL6A 1UBKS 1VHQA 4C6SA 4JYCA 2HGSA 2I1LA 2BGJA 1P62B 2VCHA 2Q3EA 5IUJC 3O4RA 1Z5ZA 1T5TA 2Q6TA 4FFBB 4QBHA 4E1VA 4EG6A 1ZXXA 1IMJA 1G64A 2O2HA 3BJIC 3K2BA 3RPEA 3SJ7A 3UJAA 5K9ZA 5JSHA 2IH2A 3SEQA 3DPUA 3PHHA 3G0BA 1W6RA 4LE2A 3TLJA 3ZLTA 1L7QA 5EZ5A 4B3TB 1U7DA 3L7JA 4IGKA 4N0PA 3GFOA 5EJ7A 1F6WA 2Q5OA 1MEJA 1SNYA 2QT9A 4HCJA 1G21B 3A6LA 5WRFA 3FF1A 1ULTA 3M81A 2H7YA 3SIRA 1VPEA 2HA5A 1MJGM 1A2OA 4WA8A 1M75A 3TSAA 2YY5A 3W2EA 3ZCRA 4LNHA 4CT4B 3QEBZ 1Z5VA 4Z9AA 1OZGA 2XMQA 2NU7B 3H9GA 4FQ8A 2FPXA 2R96A 4D5EA 1N7JA 2QTFA 1H4VB 2QYOA 4FOLA 4K8RB 4ZDKA 1ZKDA 3KYCA 3LOQA 1JEOA 4IVNA 1FP2A 4FMCB 5C7OO 1PQYA 2VTBB 5K45A 1RXEA 3TQHA 1HDZA 1B1AA 1LLQA 3ENZA 1WUJS 4QJIA 1KEWA 1ZPDA 2FGJA 1J2RA 3M1LA 3UC9A 2BDTA 2GAFA 1SIWA 5JATA 3RVPA 5IJWA 1R9GA 3OY2A 1E3TA 1MDBA 2XBLA 3DDWA 2GD1O 3G9TA 4HZGA 4JJGA 3GUHA 3V8BA 1Z7WA 1CR6A 4NDZA 4UTOA 4DGSA 3LP5A 1BMQA 1UM9B 5ITVA 1QTRA 1YQGA 4F72A 4NZPA 1DCMA 5EMLA 4BMCA 5BWOA 3Q7SA 3JASA 3H5LA 1NVEA 1TZKA 3WDLA 3NOXA 5CXQA 3O0DA 3G13A 3QMWA 1M33A 1QRSA 5SZHB 2ZYHA 3FSRA 4BJ3A 1EVEA 4HQOA 2RGEA 5DNVA 4HZUB 2V5VA 1LX6A 1MCZA 1XZPA 1GAQA 4WN9A 4IKEA 3ZLBA 5FLXA 4OP2A 5KKAA 2PLNA 5I8WA 1Y48E 4CUJA 4FHZA 1TC2A 2OPHA 3RVRA 2FMUA 2EZ4A 3TNFA 1BS1A 2FQQA 2BD0A 2QYTA 1K0FA 3GU3A 5BNTA 3SM3A 4LHYA 3AFHA 3FTDA 1GTSA 1G2QA 4M9ZA 1Q2UA 1R15A 4MKHA 1CVLA 4ASUD 1IOWA 1BVUA 1YRWA 2OM2A 3Q7EA 4V1CI 4BNGA 5ALVA 4YR7A 3NMUF 4LFAB 2IEZA 3AVQA 3C6BA 3E48A 4KV9A 1T5DX 5EEGA 1Y1TA 2F9MA 5IDXA 4NYJQ 5I7HA 3U6KA 2Q3BA 4EF5A 1A8IA 4O6VA 3WP1B 4ND8A 5DI3B 5JH7A 2I9KA 2FFRA 3LVQE 4QQNA 2J9FA 4DUPA 5DEIA 3AVUA 5TY0A 1VJ1A 5HKBA 1NI5A 5CX1B 3BZWA 1T1RA 1DUIA 2YJ6A 4YRLA 1ZH0A 1XRQA 4FD2A 1L5NA 5BR8B 1QHEA 1XHLA 1KIAA 2GETA 2ZT8A 3GYGA 4OK6A 3FCYA 3IV9A 3MWLA 3L4KA 2L69A 2QR5A 2GZ3A 2RCNA 3IXMA 4ZTBA 2ZTMA 3KXIA 1P7ZA 4KVGA 1IHXA 1PK9A 3TZLA 3MUOA 3E8MA 1C14A 1GGVA 5BSRA 4GZ6A 2N42A 3B3AA 1LSOA 3S29A 2GN0A 3OQJA 4N3GA 2VHUA 2H0AA 2VRCA 2O50A 1KEEA 4MB2A 1M2KA 1Q12A 3TSZA 2EBHX 9ATCA 3EF0A 2PZLA 3BGWA 1ZGCA 1EEXB 4R0NA 4A82A 4FFLA 1YR6A 4QYSA 2WWHA 2R60A 2ZB8A 3EZXA 3D7LA 4E5UA 1ZQ1A 1DJQA 1J5PA 3MJFA 3EC7A 4CODB 4RNDB 5FI5A 2L0XA 2UUCB 1EWKA 2NU9B 3WHPA 5AM3A 3AONB 1RWVA 4RQTA 3GLTA 2IP1A 5HFJA 3UXEA 1TEHA 5A6SB 1W85A 1E5TA 3TMYA 4DPLA 5DNYB 1QVRA 1L8XA 2ZANA 5IYZA 3G9QA 2CMHA 4QGSA 3CRRA 1P91A 1XN1A 1P2DA 3MTAA 3UGKA 4V3BA 4Q05A 3RYCA 2A5LA 1NN1A 3HP1A 2ZU6A 3AFIA 3HBJA 2GHIA 1AV7A 2FQWA 1JECA 2Z5LA 3L6CA 2OM6A 2XJ9A 5IULC 4DV6B 1T25A 1SXJD 2XUHA 2Q5EA 2OD7A 4QU0A 1U7ZA 4HNRA 5FR1A 5IARA 4EKDA 3HBAA 3IRUA 4BVLA 3GGSA 4KN6A 5B1SA 1QGOA 3AFNA 4G0MA 1OPXA 1WQ4A 1VPTA 1YVEI 2Z3VA 3G5LA 3KQVA 4HT3B 4B33A 2CFOA 1N7GA 1OVMA 3QMPA 1OBCA 3ROGA 3V2HA 4BVGA 5KQSA 2AXQA 3EXIB 1SUCA 2ZJAA 2FUNB 2X76A 4YRDA 2J87A 3T5CA 2UYQA 1QF6A 4HXEB 4RK0A 2DQZA 2XUPA 2NPFA 4QRHA 3KCQA 3P9ZA 4W1PA 2WV9A 3EA5A 4BV3A 3PZRA 5EMKA 5KNDD 3IELA 1FFSA 5A3RA 4V0RA 4RCZA 1CLUA 3DAPA 5EJFA 5CW1A 4W5RA 4B2LA 4WLVA 2I2BA 3EGXB 3BDAA 5ECGC 3I3SR 3ZWQA 4X91A 3ONWA 4MUYA 2ZRBA 3HYSA 3KKLA 1G0NA 1H4QA 1REQB 1QGUB 3K9GA 2P62A 4IQFA 3DCJA 2IA5A 1E4VA 3LH5A 1Y8RA 1DKOA 2J5RA 4RTQA 1RXSA 4AI6A 3CPEA 1OBFO 4JQYA 4PBSA 3LFHA 5T3YA 2RAFA 1HBJA 2GVZC 4EEZA 3JATA 3ZBPA 5CVEA 5AKXA 4NU6A 1J39A 1AO0A 4CMBA 1GN9A 3NO4A 3X43A 3T5PA 4Y9TA 1RXIA 3AM4A 3LUAA 1MPXA 2LWIA 1X94A 2ZB4A 3EFEA 4L3WA 4TRMA 2REOA 3FMGA 5DTMA 4TYNA 2AG5A 2DAPA 1FFCA 3I76A 1X3LA 2ONYA 1V39A 3HLYA 3I2JA 3JU3A 4G8JA 3T06B 4ZCSA 1NQ5A 2P0EA 4QREA 2QSUA 1YBVA 2KW5A 1CY6A 4Z99A 3UT5B 3V6MA 4U0KA 1BA2A 1N2BA 2HIHA 3I6IA 2Q7OE 3VDRA 4ALLA 1KK1A 4UQLA 1P2UA 3D4IA 4J4TA 1N36B 1WXWA 4H1TA 1D1PA 5DMXA 3RYIB 4B7ZA 1ESEA 5LNK6 3AL0C 1CV2A 2PZKA 5AVJA 1G3QA 5AWFC 4BO9A 2LCFA 4LJAA 3WDMA 5AYVA 1CD5A 5EIHA 1NN5A 2CEAA 3S2EA 3EY9A 1OHHD 2B5VA 3H13A 1ZD2P 2QVGA 2RGNC 4YWJA 3UHJA 1K7XB 4C0KA 3N07A 2HRZA 4DDKA 2PMEA 4GT1A 4A2QA 4CI0B 5FT9A 1NNUA 3FLAA 3H9UA 3IDOA 4FD3A 2CDRA 1R5JA 1JIUA 1PK7A 1T3SA 2DECA 4DUGD 4RWEA 4F3CA 1J06A 1GSIA 1PLLA 3AVXA 4ZZ3A 3P5SA 4QDZA 4BTVA 5B53A 1VGRA 4OSPA 4H7FA 5TS3A 4Y2JA 4D45A 4KAJA 3MD0A 3ZDZB 4HXFB 3WLQA 4URXR 2IU4A 3JV7A 1ARZA 1WB5A 4K1LA 4PCLA 4JUCA 5JNUA 3EPLA 1TQ8A 4ZOCA 3DMFA 1CF4A 1GILA 3DQZA 1JR3A 5JS2A 4MQ4A 3RRZA 3BSFA 1E5VA 5ARBA 5ESWA 2YVAA 2Q29A 3AFGA 5AHRA 2FMFA 2J59A 2I33A 2RGUA 2O52A 3D3QA 3FYUB 5JZBA 4O2LA 5KQRA 6ABPA 3IFSA 4P53A 4UZSA 3ZC3A 5BXYA 5KYKA 3SPXA 3LBFA 1R4NB 4BYGA 5KWEA 1ZMBA 4M1EA 3VR2D 4AKTA 3VR4A 2B36A 2JJQA 2P9QA 5BYJA 2CDCA 1A4UA 1TQHA 3GT7A 1C2TA 3CONA 3OFSA 3AETB 4G25A 4UQOA 4X1KB 4XRRA 1MFZA 1GD1O 2XBUA 4V0SA 4YAJA 5ELMA 1R8QA 2R3SA 4M2LA 4TVOA 1BEZA 2B1JA 2IYNA 1H2XA 2C42A 3DC7A 4IH9A 4UE2A 4DM4A 1EBUA 4NATA 5EIFA 1XI2A 1KDYA 3THXA 1K98A 1G38A 2ZJBA 1P80A 3MS4A 4JUBA 4ZEWA 1OZHA 2VDKB 5KCMA 3KLOA 3EZ7A 3S2GA 4XYLA 4KH1A 5A1JA 3TG2A 2X4IA 1EFPA 1OLXB 2FUCA 5C5IA 4KPYA 2R66A 5KX5A 3KVOA 2CHUA 1DX6A 1H4TA 3PQ8A 1KAMA 3LUGA 5FA6A 3TDKA 5FO0A 3K05A 2XKBA 5DBOA 1NX9A 1MT3A 1NSTA 2W70A 4MR7A 3OHSX 3WRWA 3AO0B 1GZVA 4TYYA 1C7EA 3MMZA 4JEHA 1O97D 1V0JA 1EHYA 1VC2A 1XVLA 3BRSA 3NWOA 1FQJA 1CQPA 3CVYA 5CA0A 3NLLA 5EJIA 3WGQA 5F7JA 1OXBB 1E58A 3VZRA 1TX4B 1Z56C 2GJ4A