2HF9A

Crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
211
structure length
211
Chain Sequence
b'KDILKANKRLADKNRKLLNKHGVVAFDFMGAIGSGKTLLIEKLIDNLKDKYKIACIAGDVIAKFDAERMEKHGAKVVPLNTGKECHLDAHLVGHALEDLNLDEIDLLFIENVGNLICPADFDLGTHKRIVVISTTEGDDTIEKHPGIMKTADLIVINKIDLADAVGADIKKMENDAKRINPDAEVVLLSLKTMEGFDKVLEFIEKSVKEVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable hydrogenase nickel incorporation protein hypB
publication title Structural insights into HypB, a GTP-binding protein that regulates metal binding.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase, metal binding protein
total genus 81
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hf9A00
2IA5A 3CH4B 1VIAA 1NY5A 3OESA 2QGZA 1F2UA 4GOXA 2YHSA 3ZD7A 4QBIA 2DPXA 3B82A 2PJZA 1CR4A 4AKEA 3J81k 1SXJE 2D3WA 2DFLA 1CLUA 2TMKA 2IYVA 3PUXA 3R20A 3KJGA 4YLGA 1EG7A 3UWKA 2QT0A 2IC5A 2XZPA 1VCIA 2BEKA 5FBVB 2Q0HA 3BRWD 1T6NA 3P32A 5AWFC 2CL0X 3CIOA 3GJ8A 3HP1A 3MRSA 3RVBA 4LJAA 3A8TA 1VHTA 3MWLA 2EWWA 2DHRA 4TTRA 3I8XA 3EZ6A 1YR6A 3QG1A 5FOWA 4D4LA 4MYTA 3T1TA 2JCSA 2V1XA 4M9XA 621PA 3EZ9A 4Z8YA 1W1WA 2CVHA 2HJVA 4XD7A 4BFXA 3GLIA 2F1HA 1NRJB 6Q21A 4CYMA 4CDGA 3ADBA 3SHWA 1AGPA 1OXTA 3QXSA 4LBVA 4DIDA 3EZFA 4IOKA 4A0RA 4XSGA 4LJ5A 4D6PA 1XMJA 3GLGB 3THWB 1G18A 3N2EA 4GDFA 3BERA 3WRYC 4HUTA 1NVWQ 3HPQA 2GETA 2CJWB 2GXUA 1H8HA 3REFA 4ZO4A 2OE2A 2QGNA 5EUQB 1UBEA 4G5SA 3GCGA 4HAXA 4NCNA 5E7IA 5F98A 4QHSA 5B30A 2Q3HA 4PO1A 4MYUA 1XTRA 5L3RA 3CX8A 4PHHA 4O25A 1G21E 1XTSA 5FBWB 1BKDR 2QT1A 4R71A 3I73A 2VIIA 1HH4A 2A5FA 2ZRCA 4A0GA 1F48A 3EAQA 4DBLC 1JR3E 3BXZA 3ADKA 1P2SA 3TSOA 2FOLA 2JJ8A 3GLIE 3QY0A 2OCYC 3B1XA 4PXAA 1OIWA 4XTRA 1VCMA 1G1MA 3NEYA 4BZPA 3BD9A 1KY2A 3AB3A 3LH5A 3VKHA 3IGFA 2O8DA 1P2VA 1YU9A 1L4UA 1Q0UA 5HPYB 2ZJZA 3IBGA 4BUJA 2ZUDA 5FL3A 4DT1B 4ZKDA 3QEOA 4H1UA 1RRCA 3TAUA 2AK2A 2GCNA 1JQLB 4AWXA 5J4LA 1UBFA 2JAQA 3RNLA 3T34A 1NY6A 2OFOA 2VSFA 3KKNA 4QGFA 4YQFA 3C15C 4LYAA 2PT5A 2J0VA 2ASEA 3TUIC 4B6FA 3GLFE 1XJQA 2PL3A 4RSGA 4QNMA 1WMSA 1E2LA 3THYB 5GJCA 2FGJA 1CJMA 2ERYA 3G5UA 1QVAA 5UKDA 3W3ZB 1OFTA 2OG2A 4PAQA 3WMEA 4MRSA 2WSSD 4RFSB 4M1KA 1YQTA 4M1YA 2X8AA 1HT1E 1U98A 3EPKA 3ICEA 4YDHB 4BQSA 5JJKA 2J7PA 2ZJ5A 1MABA 1UPTA 5HKKA 5KSOA 5KDOA 5JJLA 1N6RA 3KFXA 5AK0A 3IEVA 5LPNA 3K0FB 4FI3C 4B2LA 1KTVA 4KFTA 1DAIA 2ZE5A 5FTJA 4YONB 3O8RA 2NGRA 4A1FA 3DMDA 4DCNA 2RGGA 3AVUA 4DIEA 1R4AA 4A2PA 2ZPTX 4LHZA 4PO8A 2G1KA 2PLFA 4KVGA 2QE7D 4BLRA 2LCFA 5F3WB 1WRBA 1LY1A 4YMTA 2C9CA 4UQOA 3GJ0A 4O0MA 1R0XA 3W5IA 1R5BA 2ORVA 2RGNA 1RW4A 5TXGA 4PZZA 2J0SA 3T06B 1OFIA 3TSWA 2PEZA 4OBEA 5HR5A 1LB1B 5EE1A 5BXQC 1W36B 4TLAA 2VSOA 4LV6A 4XVQA 3HYTA 1B0UA 3OIWA 1RRGA 2B7CA 3BGWA 2JATA 1XMVA 3LQRA 2ORIA 1JR3D 2KB0A 3FDIA 3FKSD 1KI4A 1WBDA 4FWTA 1YR7A 1XCPA 4JKYA 2AKAB 1E79A 3CONA 3ZZUA 4EPRA 3E5HA 5FFMA 5JWHA 4WIAA 4OQLA 4EPXA 3SS8A 3NBZC 2ZJOA 2GK7A 4EPWA 1OPXA 1TF2A 2RH5A 3LA6A 1D2EA 5HCNA 4KBFA 1G8YA 4DT1A 1XTJA 1N6KA 3CPHA 4B44A 4B3GA 1COWA 3T5DA 3PQCA 1ZU5A 4P4TA 3B1YA 1W46A 2VP9A 4C0KA 3KKQA 3K0SA 2G1JA 4B48A 3X1XA 4V03A 1PLJA 2V6IA 2R2AA 2YWGA 2DR3A 3F3YA 3S1AA 1MO3A 4PC7A 2J7KA 3B60A 1JECA 3TW8B 2RGAA 3C8UA 2BWJA 4O3MA 1T4GA 4N0EA 3THYA 1K8RA 4PHFA 2FJUA 1NSFA 1XD2B 4TMVA 2QA5A 2OXRA 2KBEA 2ODEA 4A15A 3JVUA 4RFSA 3W90A 2IYLD 1Z83A 4DLSA 3R9IA 2V8OA 2ZI7A 2RCNA 4IEIA 2REBA 4US0R 2AXNA 5JS7A 2GVZC 3KDSE 3PV0A 4EPVA 1CXZA 1G8GA 2ZYTX 1WB9A 3ASYA 4LV5B 2IF0A 5JHHB 3K0FA 1MR3F 1E2PA 5KYKA 4G5OA 2YZ2A 1R8SA 3FMPB 3SJAA 2C95A 4FIDA 5EUMA 1JR6A 4IOJA 5FTLA 5IK2D 4BLSA 4L9SA 1Z6YA 4Q9KA 2NTYC 1LVGA 2HEIA 3W8NA 3LLMA 3UMFA 1UJ2A 5BN4A 5GVSA 2FEMA 1VYTA 1VYVA 5DIFA 3LY5A 4I81A 3U60B 4KU4A 4QBGB 2FSFA 3AF4A 1XP8A 2UKDA 5KU1A 2RAPA 4PPGA 1BH2A 2ZRAA 2IT1A 3FHCB 3QNUA 3ZQJA 1M7BA 3KXIA 4KVAA 1NBMA 5HKKD 4MYCA 1QG2A 4H9GA 4LSGA 1P9RA 2ZI9A 2P67A 4EUNA 1P60A 1GDDA 5L3SB 2F1JA 3T1QA 3EARA 1MRSA 3F8TA 4BASA 3RRNA 4HB3A 4DLUA 2BJWA 3MGCA 3IDQA 5BYJA 1OLOA 3VR2A 3G0HA 3VU9A 1E0KA 2W2VA 4FW9A 4IXMA 1KJWA 4L15A 3U4QB 4EPYA 3WBKA 1R5OA 2QMEA 1XTQA 3ADDA 2LKDA 1GL6A 1VG8A 3I62A 2GJKA 2O8BA 2IL1A 4YMWA 4DC9A 2ZVPX 4F7WA 1FPMA 2H92A 2NQ2C 2QP4A 4TWZA 2ZE7A 3A4MA 1GP2A 1BOFA 1MO5A 1W0KA 1QHYA 4UJ3A 3TVDA 4BRUA 3BFXA 4TSFA 4LGMA 2BBTA 4QXAA 4U02A 5SZKB 4EFNA 1XD2A 3U6BA 2JJ2D 1NBME 1W0JA 2WSMA 4Q9HA 3WMGA 1KNQA 1CU1A 1FNMA 3DZ8A 2B21A 2IBMA 4Y0VA 4LYFA 4HB0A 1NIPA 1A7JA 2WJIA 2ZYWX 3X1DA 4FMDB 4C2TA 4D0NA 4CEHB 2IYRA 3QE0A 4HLQB 1LV7A 3CUEF 4MGIR 4ASUD 1T91A 1RVDA 4RD6A 4D25A 4XWAA 3L8YA 3QG5A 3QKSB 1LS1A 1MV5A 1YRAA 5EE0A 2BBOA 3UG6A 2C5LA 1P73A 4A8JC 2OFXA 4LJ9A 2Z4SA 2XZLA 1U90A 2WWIA 4Q1FA 3W3AA 1TQDA 2D2EA 3L0OA 1XJCA 2WHXA 4PPFA 3TNFA 1G291 1VHLA 4IXNA 5SZHB 3TMKA 1IXRC 1S8FA 4FCWA 1HYQA 1II8B 1QHXA 2FDCA 1C4OA 1PJRA 3THOA 3PCRB 1ZUIA 2CLCX 3BWDD 4DCTA 1FW6A 4A92A 2HV8A 4JIMA 1ZYUA 3MFYA 3FPAA 3NHAA 2ZXUA 4AKIA 4MRVA 1G6OA 4IOMA 1J70A 2IWHA 2O8FB 1WP9A 2G6BA 2ZRDA 4OHVA 5FOSA 5FBRB 2G83A 5DN6D 4ARZB 1AN0A 5H8WA 4MKGA 3RS3A 2BKUA 4OJQA 5G40A 1E4YA 2RGDA 3TKLA 3HU3A 4HZUB 1Z0JA 2QPAA 5L3SA 1NKTA 2QG6A 2ONKA 1NIJA 3DPUA 2RGCA 1XWIA 4B3DA 3P4XA 1BIFA 3MWKA 1UEJA 3NC1C 4RZXA 1S3SA 1RC8A 4X8HA 3CPJB 4NU0A 1QZXA 4PFSA 1VDZA 3KUDA 4NHOA 2WTUA 4JT4A 4N1AA 4NKRA 2O52A 3U7EB 2H7VA 3GP8A 1IN7A 4M21A 3FWYA 4I99A 4RKFA 2XB2A 2QAGA 3EC2A 4MYHA 1AQYA 3SYNA 2BCGY 5P21A 4M1SA 3I1FA 2QU8A 4W7SA 1TF5A 4HSEA 5LB2A 3K0CC 4ZDWA 1CBUA 5M04A 2A5JA 4A2QA 4S2EA 5BQ5A 1TNDA 1ZM7A 2JJ1D 4YXWD 1U0HC 4F93B 2OCAA 1UEIA 4RZ2A 3RS0A 3BB1A 1W47A 1OXSC 2F6RA 5EJEA 1ANKA 1Z08A 4CEHA 1KAGA 4QJ3A 3LV8A 5ANRB 4QGGA 2OSBA 2AK3A 3M6AA 2C9OA 3PUWA 1E6CA 4JJZA 3QKSA 4CF7A 4GL2A 1D5CA 3BAFA 1XZPA 1JEDA 1Q1BA 4F92B 1NLZA 4MH0R 4OK5A 2A9KA 1RFLA 2H5EA 4F91B 3X2SA 2WZQA 4L5BA 4A4DA 1HURA 1OKKA 1XEXB 2JGNA 3EX7C 2GXAA 1OE0A 4MA4A 3B1ZA 4ITRC 1II8A 4US2R 3Q5EA 2A5YB 2GZAA 1Z2CA 4XOIA 3RS4A 1W0KD 5TMPA 2ANCA 3NIBA 5FOTA 1Q1QA 2D4HA 4CGZA 4HLUC 4TSFD 4AIIA 4BE7B 4A6XA 1KOFA 4DLYA 4JL6A 1JALA 2YWFA 3PG5A 1R0YA 4G5GA 3Q7PA 1QRAA 1KYIA 1DAKA 4M9SA 1BS1A 1F5NA 3B8HA 8OHMA 4QJ4A 1M1YE 1T0JB 2BBWA 1N6PA 2NZJA 3C7KA 1DAHA 3BIFA 3QPWA 4M1WA 4B3XA 1CJTC 1YHNA 4KHZA 4ARZA 1SVLA 4B76A 4C9BA 4Y0AA 2ZUBA 3RS5A 2J59A 1U8ZA 3ND8A 5CM9C 5K8UA 1E2HA 3K0AB 4IVRA 3NDPA 2FX3A 3CRVA 3TR0A 3CBQA 1DO0A 5KSZA 3NDBB 2OEPA 1U0JA 3TJZA 1DEKA 2O0KA 1KI9A 3W6PA 3AVYA 1JPNA 3JZAA 3EPJA 3R7WB 3H86A 4L9WA 1EX6A 3JZMA 1FMLA 2GAOA 3MUFA 4Q7LA 1MOZA 2CEAA 2XB4A 3EIHA 4RD4A 3SOPA 4DHEA 2JA1A 2ZJYA 1KZ7B 3B78A 1YKSA 3DEFA 1QHGA 1FQJA 3H0KA 2FZ4A 4N3NA 5CJPA 4EQ6B 1JAIA 2IF2A 1YRBA 3SZRA 3CRQA 3T15A 5DI3B 1ZMXA 1DO2A 1SZPA 1Z6AA 5CYOA 2O0JA 3Q72A 1LFDB 2CMKA 3EWSA 2W0MA 3TQCA 2FSIA 2CCKA 2VHJA 2PCLA 1T8UA 4RFVA 3LBNA 2IW3A 3Q9LA 1KK2A 2N1BA 4NH0A 1TX4B 5JZVA 1NLFA 1G3RA 4PAOA 3TAHA 1GKIA 5JSZB 3P1JA 1W5SA 1HTWA 2VLIA 2ODNA 221PA 4W5WA 1AK2A 4TLBA 4V0MA 5FBQB 1NG1A 4TL9A 2IXGA 1MRNA 4K46A 3W5JA 4ZI3A 2LWIA 4PZLA 1U9IC 1GNPA 3AGQA 1CJUC 4IDPA 1IHUA 4K8OA 3SYLA 3KXKA 4TYPA 1NJGA 1XEXA 3EZ2A 3IIJA 2VSXA 4LC0A 4QFMA 3T1OA 2CLSA 1VIYA 2DYKA 2EVWX 1AS2A 1P6XA 3BB3A 5IT5A 2IYTA 4M1MA 2R65A 1M8PA 2ORWA 2OCBA 4RCZA 4EIWA 1WA5A 3I61A 3RC3A 1GFIA 1V5WA 3EASA 3PEUA 3LX5A 2JLZA 2PZEA 2ZSBA 4LUCA 3GJ3A 4K81B 1TU3A 4UXHA 4BFSA 1IXSB 1GKYA 1SHZA 4NYIR 2BM0A 2WKRA 3CH5A 3HU2A 4KSBA 5FTKA 4YDSA 3QF7A 4F4IA 3SE0A 1RE0A 5FPKA 2XXAB 4BZQA 4EKDA 4A6PA 2ZJ2A 2W6JD 1HQYE 1T5LA 2C77A 4YMVA 4GP7A 3U7HB 2Y8EA 3UANA 4UNSA 1ZUNB 1XRJA 2ZS7A 2BCJQ 1XDBA 2QPOA 4V0ME 1IJFA 1FNNA 2HXYA 4FMCF 2IYYA 4PC2A 1A2BA 2EQBA 4I1VA 1KMQA 3K09A 3DM5A 1VG9B 5JCPA 3SQWA 2FMXA 2GXSA 2WKPA 2QP3A 3TR5A 4AY2A 1JXOA 3R7WA 2AL7A 5AJXA 2O8CA 1E94E 2BVNA 1Q3TA 5JFGA 2GBLA 2WOJA 1RKBA 2WSSA 2D74A 2WMNB 1NF3A 4EQ6A 1UF9A 2V9PA 1RJ9A 3QQ5A 3SN6A 4HDQB 3WHKA 2XEXA 4Q1CA 4XVRA 3VNUA 3FVQA 4NMMA 5DHAA 1NMZA 4OHXA 4DKXA 1YR9A 3CZQA 5DI3A 5DYIA 1P62B 3FKQA 1XFAA 4JSTA 5GJVC 2IUSA 3QF4B 2CL6X 1CULC 1XTIA 2QTVB 4OI2A 4R98A 1E2MA 3IUYA 3VNVA 1CTQA 2HCBA 5DH9A 4TYWA 2W0SA 2W2TA 2J0QA 2QE7A 4QBHA 3VR5A 3RLFA 2JLQA 1N6HA 2GCPA 4KCGA 1EGAA 1NMYA 3LVQE 1NN0A 3VX3A 2BV3A 3X1YA 5A4JA 1KI3A 3EPLA 2XITA 1WBBA 3HR7A 5JSZA 4IDQA 3EWAA 4DVGA 3NXSA 4Q21A 4OHZA 3WNDA 3B5JA 3L43A 4B33A 2HF8A 2I1QA 4L8GA 2VHTA 2IUTA 3NH9A 3U7GA 2H8KA 3TBKA 3ND9A 1HV8A 4M9QA 4AD8A 4M4SA 5FTNA 2QQEA 1JR3A 3IILA 3FKSA 2ZRGA 1Y3AA 5L8VA 4IFEA 3ZD6A 1SHKA 2HT1A 2BEJA 5FPYA 2OZEA 1UBCA 1E2KA 3IIMA 3NBXX 2ZAMA 3OIUA 1XD9A 1Z6GA 3P20A 2Q9CA 2IS4A 4BLQA 2Q3FA 4HUQA 5TARA 5CITA 2GJSA 4Q01A 1ZIPA 1F3OA 2OILA 1HE1C 5K8LA 3BS4A 5LD2B 4JVNA 5EQTA 5FI0B 1ZD1A 3UKDA 4E09A 4C0SA 4TLDA 3RAPR 1KO8A 1TU4A 2C99A 1G8FA 3CWZA 3H84A 4M2LA 2ZRBA 2ZVQX 3ASZA 5CYPA 5JCZA 1U8YA 4Q48A 4Q1AA 3RDPA 3M4YA 2MSEB 4HDOB 2IYXA 3GLFA 3WYGA 4MGZR 3FE2A 3FTQA 5FPTA 1AA9A 2MSDB 2V54A 1IXZA 1IM2A 1DE0A 2PZFA 3KB1A 3OFND 5FUYA 5G3YA 2GDJA 1F2TA 4TTQA 2DCUA 1KI2A 2WPDD 4G0NA 4DCVA 1Z29A 2CHGA 3NH6A 5JWRA 1AZSC 3GJ5A 1LNZA 3T61A 2CDNA 2VL7A 2ZETA 1KY3A 2GK6A 3AF3A 1G9XA 4QJ5A 4F4JA 3FHTA 4OQFA 3VKWA 2O0HA 1P75A 4PPNA 2OT3B 5DO9A 2XJ4A 1AS0A 4DJTA 1R6BX 1FP7A 4D2IA 4C7OB 2XOKD 4EDHA 3Q8XB 2N42A 1WXQA 1G3IA 3D3QA 5H70A 1S1MA 2X2EA 3HU1A 4DDUA 2V1UA 3A58B 2NG1A 3CF6R 3ZS8A 1F6BA 2BIFA 3IHWA 3I5YA 2CLDX 5IK2A 1W4CA 2J46A 3K9GA 4LZZA 5DI9A 2CCJA 4DDWA 1ZM3A 4GOJA 5BN5A 5LD2C 4W5HA 2F1RA 2ZRIA 1X8KA 4QGHA 2VP2A 2GTPA 2OCPA 2J3EA 2RHMA 2BMFA 3UK6A 3EG5A 1G4UR 3LLUA 1EX7A 2C96A 1ZCAA 2QTHA 2V7QD 1Z47A 3AVPA 3QOFA 4JYBA 4NL4H 1CIPA 2GA8A 3DKPA 2ZU6A 1CEEA 2HT6A 2P6NA 4OK6A 1YZGA 3V00A 3AVXA 2YVUA 1AGRA 4Q4HB 4ON9A 3VR3A 1RYFA 4NCIA 5EP3A 4V0OA 2RGNC 1E0AA 4KFUA 2IS6A 1VCNA 3AKYA 3WHLA 1GNQA 3U44B 4KJZA 1XD8A 3T35A 4A0FA 1IBRA 3AM1A 3NVAA 1XPUA 2XTNA 1LTQA 4B75A 5TV2A 3F0TA 3GLGA 4IDNA 2ZRKA 3THWA 2B8WA 421PA 4B3CA 3RSLA 3MMPA 2CJWA 3ZVLA 2R6FA 3WMFA 4Q4AB 1T5IA 2XJ9A 2FGKA 3EXAA 2EFEB 3DOFA 4LYHA 4DLVA 5C2JB 1X86B 4TYNA 4BZXA 1AKYA 4JLDA 4YC7A 1A4RA 4AK9A 1TEXA 1XMSA 3KFVA 1G17A 4JLKA 4B32A 4MRPA 5KO2A 5AJWA 1RZ3A 1ZUHA 4JLVA 4PZYA 4NTZA 4D82A 3DVLA 1YZUA 4WZAE 4AYXA 5LDDC 2Z83A 3SR0A 3ZS9A 3KUCA 3U7FB 2JJ2A 2ZUCA 2FPMA 4GRAA 3W6OA 5EXTA 3QJYA 4LJYA 2ZRNA 3PJRA 1ZD8A 4RZUA 2X77A 3PEYA 4WAUA 3QBTA 1KKLA 1U2RA 3PEWA 3GLGE 4C7OA 2B7BA 3QPUA 4G01B 3MJHA 4ASUA 4TQAA 3A4LA 1HQCA 5C4GB 2VF8A 3ONWA 1X8LA 2FPKA 3EC1A 2FH5B 4V0NA 3RYTC 3QEJA 4IVQA 2IHYA 1X1SA 2QI9C 1IN4A 4M8NE 2RGXA 5EXPA 3NHBA 5B64A 2YWEA 3AEZA 3GD7A 5JWOA 2NMVA 1OHHD 2QN6A 2IYWA 2WVJA 3GEEA 3CM0A 2GJ9A 4UXJA 4A0HA 5B57C 1DAEA 1XU4A 121PA 1NL3A 1E1QD 1KI7A 3TH5A 4Z54A 2NO9A 2R6GA 5EE3A 1P9NA 4FWIB 1G64A 2AN9A 3RHFA 4KYIB 2J5XA 4NYIQ 4U5XA 5JJIA 3M1IA 1X1RA 4EFMA 1XNJA 3L2OB 5FPHA 1DARA 2FE4A 2KWIA 2AXPA 2WAYA 1GRQA 4LV8B 5DN6A 2QMOA 5CIQA 3ADCA 1CR2A 4HATA 3AKCA 3U44A 5BN3A 4PTLA 2OHFA 3VAAA 2VHCA 2C2HA 5K8TA 5IRCD 1TQ2A 1A2KC 2ZANA 2YOFA 4NE2A 2C8VA 2PZGA 3LXXA 4AKHA 1Q44A 4POAA 1S9HA 1JI0A 2QM7A 4JYCA 3B9QA 4LRWA 2QRZA 2FFBA 5E4FA 1KSGA 2R8RA 1AJEA 2FU5C 4PR0A 1KSJA 4ZI2A 2VHQA 1LF0A 4B43A 1P5ZB 4KYUA 4BFZA 3EZ7A 3HWSA 4LPSA 4TT3D 4ERNA 3EPHA 5CDFE 5AUNB 2Z5FA 2BMDA 4URUR 5TDHA 4OHYA 1DBSA 2HF9A 4AYWA 3VKGA 4PQRA 1I4DD 5J4YA 5JBQA 4ZCLA 3SJZA 2OFWA 1SVMA 4PQFA 2WAXA 3CLVA 1TUIA 2A78A 3MAAC 1VYUA 3I4LA 1OH6A 1ZRHA 3SJCA 1WCV1 3B1WA 5HE9A 5KNCA 1H8ED 2WWGA 2C78A 5FUWA 2JJ1A 3AVWA 4YXWA 1KKMA 1OH7A 1GL7A 2E87A 3WYAA 1NVVR 3BORA 1H65A 4BLTA 3RANA 3THXB 3IO5A 1E2JA 1HUQA 4B73A 2ZSDA 4JL8A 4KLNA 3VHLB 2FG5A 3GJ6A 2DFTA 1D2MA 4A8JB 2DWOA 5JRJA 521PA 2Z6VA 5E95A 2Q9BA 2VBCA 1GIAA 2VH5R 2P5SA 4MKHA 3FHOA 1Z63A 2L0XA 3T12A 1EFHA 2HYIC 1IAQA 2GILA 2HUPA 2ZI6A 5AUOB 4QNRA 1E0SA 3LD9A 2A30A 1P3JA 1IQPA 3F5FA 1ESNA 3O47A 4LHXA 4O2RA 2Z0MA 3CW2A 2YC2C 1MO4A 1XEFA 2ODBA 3LVRE 3FFBA 1ZINA 2XAUA 3IQXA 1W4RA 3H4MA 2CK3D 4JMPA 4HYYA 4PHGA 4DCUA 1ZM4A 4YMUA 1PUJA 1XEWY 1KHTA 4Z1MD 3IKJA 4MRNA 4RD0A 1PLLA 3GMTA 5EXXA 1Q12A 3O8BA 4EPTA 1SKYB 5BW8A 5EZ5A 2CNWD 1HT2E 2WJGA 1R8QA 1ESMA 4BEBA 4WA7A 1E2DA 4I1UA 2J87A 3TIFA 3LXRA 1EXMA 4ACBA 1XPOA 1J8YF 2ATXA 5DLQC 4PAMA 1UDXA 3PITA 4CEJB 3LFUA 4QC2A 5CB8A 1QG4A 2R6CA 2G3YA 3TUZC 4OI0A 4RY2A 1RPZA 5KTYA 1ZW6A 4Z8XA 1W7AA 1KDRA 4S35A 2G88A 4FINA 3U3JA 4AG6A 4TMKA 1NLYA 4P4UA 3FFAA 3SFZA 1G6HA 5C4MA 2EFGA 1U0LA 2I1VB 4LCBA 5EP2A 3LO5A 3DHWC 2XNDD 3I92A 1CRQA 3N5CA 2FZLA 2KE5A 3ZGXA 1YJ5A 2I3BA 2KSQA 5TY0A 1W49A 2PCJA 2IS1A 2AR7A 1T3HA 4GZMA 3THXA 4TMWA 5FL7A 2GNOA 3KQNA 3DOEA 4L4UA 4TLEA 4AC9A 3KB2A 2MMCA 5J4HA 4HAWA 3GJ7A 2MSCB 2N46A 3SQXA 3O8CA 4A8JA 1SULA 5HTKA 4DLRA 2AFHE 4OKSA 2REXB 1FTSA 4OQNA 1XXHB 4LHVA 5JRZA 1KK3A 3U4QA 1UKVY 5HZKA 4Q47A 3UWOA 2QBYB 4HAYA 3TSZA 4M9ZA 3KJEA 3DDCA 3HYRA 2WWXA 1A5TA 2GZDA 3KJIA 3BJIC 2ZE6A 3I72A 2DWQA 1OFHA 3ZIAA 3AVQA 4GMXA 4URZR 2ZAOA 3KTAB 4DB4A 5ELXA 1LF5A 3K0EA 2GF9A 5GJWC 4CIDA 1E2FA 1Q22A 1G19A 2VYFA 1M34E 4XIGS 2QTFA 2WBLC 4U7DA 2H1LA 2HYDA 2CE2X 2HLDA 4KO8A 3QXHA 4LBZA 5SZIA 4JLJA 4EJSB 3Q7QA 1W44A 1YZQA 1DTSA 3CR8A 1TPZA 2G77B 2W6JA 4IJMA 1XCGB 3PXGA 4E5UA 1TF7A 4TQUS 2NZ8A 1PLKA 4CRWB 5DYGA 2IEYA 1JQJC 4IKEA 1EESA 1Z22A 4B2IA 2GKSA 3NTUA 3PUYA 2D2FA 4L16A 2YC4C 2JDIA 1Q1EA 1VMAA 2XSZD 2YNMA 5JI3E 1QF9A 2GCOB 1E69A 1ZAKA 3Q85A 3IHLA 4CEJA 4MUBA 2WJHA 2QNRA 5E7MA 2R44A 3CWQA 1ZIOA 1NVXQ 2GVDC 5DE3A 1FTNA 4G3XA 3QPVA 2D06A 3U3RA 1ZC3A 2J41A 3K0CA 2AFIE 2PLRA 4D80A 5FOUA 3AGPA 5DSZA 4MKIA 2QAJA 4KITB 4RD1A 4Q1EA 1E9AA 2FN4A 4JVMA 2DBYA 4XWKA 1C9KA 1GSIA 2P2LA 2UZIR 2ZRFA 4QKQA 1DS6A 1FX0B 3WP0A 4P0TA 2FNAA 3KQKA 5JEDA 4EJSC 3DL0A 2JLRA 4OI4A 3RSOA 3Q3JB 2WWYA 2RKOA 1Z5ZA 4BEJA 4HZUA 4DWJA 2J0UB 3K9NA 4GNKA 2D62A 2C03A 2OESA 4NBSA 2QSYA 1DAGA 2EFHB 4KODA 2ZEJA 4Q7MB 3U6KA 1OB5A 2X1VA 5JI2E 2BMJA 1OJLA 3GEIA 4V02A 2AWNA 3C5HA 5G53C 2GEUA 3IEUA 4DLZA 2ZYVX 4HLDA 1XXHA 3BBPA 4AKGA 4HAVA 5FI1B 1EFRD 5LB4A 4KI0A 4Z51A 3NKVA 4ZDIA 2XGJA 2QEQA 4W5JA 1ETUA 1YZLA 4NPHA 1T9HA 4U00A 1L7VC 4HLUA 5B2ZA 1KI8A 2ODWA 1X6VA 1P2UA 3R8FA 4P31A 4XSHA 4WZBE 4CEIB 1G8HA 2WMOB 1D2NA 1XEWX 2P6UA 4DLTA 1R0WA 4TZ0A 2NPIA 3KQLA 2C9YA 3CNNA 4JLNA 1VKJA 2HJGA 3CPEA 1FL9A 2QENA 1CRPA 1B23P 2MMGA 1E2EA 4RCYA 4P4SB 5FL7D 3A1VA 3A1SA 3WXMA 1PVOA 3QKRB 1US8B 4NONA 3GLHB 1RYHA 1Q20A 3QVUA 2IWRA 3E1SA 1X8JA 3FB4A 1FOEB 1GNRA 1WF3A 1MKYA 1OSNA 1XX6A 3BE4A 1N5IA 4ABYA 1XXHE 2ZIAA 2ECKA 4M0LA 2YOGA 3OFNA 1J90A 5EE5B 4LJ6A 2WPDA 2ZI3A 3RS7A 1Q21A 2IS2A 3OAAD 1GITA 1DAFA 1JXMA 4ESHA 1N0VC 3ZIAD 1XB2A 1E1RA 2WJYA 4PC3A 3OEHD 1WQ1R 4R7ZA 2P0EA 1NVVQ 5SZJA 3CR7A 4DDTA 5JLJA 2VF7A 2O8FA 2IEZA 1FUUA 1SVSA 1NKSA 3C16C 4OI1A 2VP6A 2XOKA 1JB1A 1M7GA 1SXJC 2IYQA 2HLDD 3OHMA 4ZKEA 3KQUA 1E98A 1UFQA 4UJ5A 2ZRJA 5FH9A 4M1TA 5A0FA 1TADA 2EWVA 3QUSA 3BH7A 4LJ4A 4MQBA 3K0AA 4C0HA 5A5GA 4GP6A 4KLZA 5AJYA 5EZ6B 5DISB 3TK1A 4PC6A 1U94A 2FWRA 5KDDA 1PUIA 3I32A 2JDID 1EWQA 1GRRA 2IYSA 3AP1A 3ZH9B 1EFCA 2V7QA 3H1TA 3LW8A 4P33A 1U9IA 1IY0A 5HZHA 3AVVA 4IVPA 3REGA 2ZSEA 3TLXA 4DUGD 1BMFD 2K5UA 2YWHA 1OW3B 4URWR 1IY2A 1KNXA 1N6LA 1QBKC 3FYHA 1DAMA 1W5TA 1UDWA 4Q02A 2WWHA 4DLWA 5IF9A 5FUVA 3A1TA 5FOVA 1SGWA 4LJ8A 4DRZA 2XZOA 1CS4C 4BFUA 4RKEA 4BWYA 3KKOA 1E9FA 2FPLA 2ZR0A 1OB2A 1EK0A 3L0IB 2JLSA 4KV9A 4LBWA 1N0UA 1E9BA 4XTCS 1D6JA 4C0QC 3N70A 2OLKA 1CP2A 2F43B 2ZRHA 2ZJAA 4Q1BA 5J40A 3WYFA 3E2IA 3I8SA 2WWWA 5CK4A 3WP1B 3NBFA 3LWNA 4HLCA 3IPXA 2GESA 1T3SA 4LYJA 4P4SA 4QOSA 1V43A 3A37A 2W2XA 1GWNA 2Q9AA 4HDCA 3E70C 3QKRA 1US8A 4M53A 5LBIA 5AJVB 3IO3A 2H57A 3PVSA 3GLHA 3ZQ6A 1GZSA 1I4TD 2VEDA 3UXMA 5D3MB 4ZDJA 1KO4A 3NEJA 1S4QA 2EFCB 1NNEA 1ZD9A 3B85A 3Q5DA 5EP1A 4W9MC 2CBZA 5CLLA 1U8AA 2VRWA 3VR1A 1OYYA 4NP6A 3SC3A 2PJRA 1KDOA 1N5LA 3ZZ0A 2JASA 4BFYA 5FOXA 1BYUA 3RC8A 4CVNA 2VP5A 4Q5IA 1QVRA 4KSCA 4D4JA 2VA8A 3VR6A 4JLOA 2NO1A 3LAWA 2KJQA 4MDEA 4UNPA 3ECCA 1QDEA 3NG1A 4Q03A 1PV4A 5GVRA 3A1WA 2FV8A 5E3HA 1GVNB 3EA0A 4HB4A 5KNBA 1LS6A 4FD2A 4KFSA 3RWOA 4BLOA 2DWPA 3OZXA 4QHTA 4QRHA 2EW1A 4OJKA 4MITA 3V9PA 5DNYB 1SQ5A 3AQ4A 3GPLA 2XXAA 2GF0A 4GBMA 1KDTA 1KJYA 1F60A 2IX3A 1MABB 2Q21A 2OBNA 2FSGA 4PSKA 3GLHE 3AF0A 4PO9A 1JAHA 5CM8B 4ZV4A 2NO6A 3R9XA 1OHHA 2W6ID 2JIZD 2EYQA 3RABA 4B47A 4D81A 1G3MA 2ZR9A 2F1IA 3H2YA 1ZM9A 1E1QA 4Q4JB 3CF0A 3AVOA 4GSYA 3OE7D 2BDTA 4WBSA 1W4BA 5CK5A 3SNHA 1UKEA 1EWRA 1E1RD 1S1CA 2PX3A 4MUAA 4E07A 5BYKA 1Q3HA 2VO1A 2V3CC 1YR8A 4HZIA 2NPFA 4B6EA 4QBFA 3W8RA 1OT3A 3CRW1 3T5GA 4XH9B 2F55A 2G9NA 1Z07A 3WNCA 4BPBA 3V4RA 2BMEA 2WKQA 4FCTA 4XWOA 4Q9JA 4DDVA 1FQKA 3IPYA 1VTKA 5D3QA 3QF4A 1A1VA 2DY1A 1DOAA 1OXXK 2XNSA 2JEOA 2WJJA 1SVKA 2F43A 3MSXA 2VQSA 2AKYA 2ONJA 2REOA 3CRRA 5KSPA 1TMKA 3KZ1E 4ZCMA 3B13B 3CX6A 2WM9B 2H17A 5KSYA 4RZ3A 5KNDA 4Q9LA 1IONA 2DB3A 2YV5A 1UBGA 2OLJA 5CJ2A 3VFDA 2ZR7A 5FTMA 3NWJA 4TT3A 3OIYA 4FMCB 3RS2A 4LHWA 1ZU4A 4DLXA 1CJKC 5D3MA 5KDLA 3CRMA 5G41A 1GUAA 1EFTA 2F7SA 4CW7A 3UMSA 2ZRLA 5G3ZA 3B1VA 4NDZA 4TZ6A 2A3RA 3OEED 3TW4A 1TTTA 4DEXA 1ZVQA 1M7HA 2IHBA 4TQ9A 5EXSA 3S1AB 2ANBA 3LDAA 1H8EA 1VG0B 2ZE8A 3L0SA 4JBXA 4LI0A 4B35A 3UPUA 3QXXA 4DB2A 4LX0A 4WVFA 1SXJD 5J4KA 2VPPA 2ZJ8A 4JBYA 2ZRPA 5C18A 3EW9A 3SBEA 2OAP1 2HCJB 1QHNA 5K8IA 2O8EB 3JVVA 4DSOA 1BO6A 4BFWA 2F3TA 1N6OA 3AP2A 1VECA 2OM2A 4DSUA 1KO1A 2LKCA 3RRYA 2A5DA 3ICQB 4CT5A 1G8PA 4A2WA 2G0NA 2CCGA 3CZPA 2YOHA 1ZNXA 3SU8A 3A36A 2VP0A 4JVSB 1NN1A 2PBRA 1S2MA 4QGAA 3C5CA 1R2QA 4D26A 3WY9A 4UNRA 3GQBA 3D6TB 1QHSA 3TUJC 3K70B 4Q4JA 3SEAA 1HEIA 5IDVA 2QY9A 2GXQA 1NJFA 4G5RA 3GJ4A 3CO5A 3BB4A 2FF7A 1IOZA 2YJTD 4NYMR 3LNCA 4GZLA 1IN8A 1Q1ZA 2ATVA 2CK3A 3UMRA 5J5CA 1P7CA 4B71A 1TQ4A 1AIPA 1Z0DA 4V0KA 4H1VA 3QKTA 2J9RA 3KJHA 5FBLB 3QXCA 4UNNA 4Z1MA 1AZTA 1XTKA 3NC0C 1OIVA 3K53A 4ZPXA 2JLWA 1Z0AA 4B2PA 4I4LA 3KX2A 3L82B 2CNWA 5AUQA 3RWMB 1UAAA 2GWHA 3KKMA 3QENA 3GFOA 1CJVC 3AV0B 2CXXA 2O5VA 4XD7D 1CF4A 1E2GA 1II9A 1GM5A 4FMDF 3SDZA 1YVDA 1M2OB 3ZYCA 3HDTA 1NN5A 3MWYW 4M22A 2E1RA 2XTZA 4PX9A 2W00A 1ZP6A 4YMSA 1E9DA 5H1YA 5E7JA 5CDFA 4DCSA 2ZYUX 3AKEA 1N5JA 3D7MA 1H8HD 2FA9A 1TQ6A 4TYQA 4P3YA 4HEJA 3VU9B 4A36A 4FCVA 3I5XA 1XCMA 1OXUA 3MWJA 3K70C 4HAZA 4Q4HA 4IOLA 4JLMA 1IJEA 4I1SA 5J47A 2GAAA 1E96A 3IBYA 3O8DA 2JLVA 2V6JA 2NOAA 2XNDA 4NYJR 1W36C 2AX4A 2O8BB 4BRWA 1MT0A 5GADl 4TL8A 4GMDA 2W58A 2NIPA 1ELOA 4V0LA 1G5PA 2FFQA 2I4IA 3CNLA 4KBGA 1XF9A 3TVTA 3ZJYA 1RIFA 2NO0A 4C0AC 2P3SA 1Z2AA 4NCHA 4Q4AA 4US1R 5CIWA 5EP4A 1UKYA 3U61B 4QHYA 2F9LA 2O8EA 2GJAA 4JS0A 1YZTA 4DZZA 3X1ZA 1E4VA 4RVCA 4ZCIA 1R0ZA 4C2UA 3X1WA 2BC9A 4IHQA 4MGKR 5C1BA 3B2EA 2PX0A 1KJZA 3ZVMA 3U5ZB 1ZNZA 3P27A 4OK3A 3MD0A 1GKUB 2PMKA 1P61B 3LRPA 3GFTA 4JLPA 4LDJA 1TL7C 1ZJ6A 4PQYA 4DXAA 3SI7A 4E03A 2P6RA 4C0BA 5JECA 1Q57A 2ZS9A 3BFVA 5DGXA 2EYUA 5J4VA 2WJVA 3SJBA 3FOZA 4PSVA 3SYKA 4URXR 1X3SA 2BHRA 1P72A 1RRPA 3C41J 5KPDA 3CKLA 4BGDA 2JLUA 4TYYA 4JKIA 4JL5A 2QPTA 1Z06A 1WDTA 3KQHA 1FMJA 1YZKA 1E9EA 1L8QA 5AUPB 3VTKA 2XX3A 2IUUA 3CF2A 5L3QB 1PZNA 1D9ZA 2BOVA 1KO5A 1JPJA 4LHYA 1MH1A 1CR1A 2CVFA 4O2LA 4UXIA 4BLPA 5EE9A 1P4SA 4TMXA 3BFKA 2ZREA 3AKDA 4C30A 3RRZA 4KAXA 3R9WA 2F3RA 4NCJA 2J7PD 2FEOA 2CHQA 2IYZA 1G7SA 1W2HA 1O87A 1SVWA 2PH1A 1OFUX 4HB2A 4TLCA 1S3GA 1OH5A 2XSZA 4JLAA 4DSNA 1K5DA 2Z4RA 2QQ0A 2WWFA 1N6IA 3UATA 1N0WA 2QSZA 1GRNA 1N2CE 3AF1A 3OIVA 1RRFA 3K1JA 4NCKA 2YYZA 3QBVA 5HE8A 1U99A 4N0DA 3AVTA 4ZDKA 2QORA 2XTMA 4LC1A 1NI3A 2P5TB 3PR1A 4C4PA 2VP4A 1G20E 4Q4LA 4PC1A 4I1OA 3AH8A 3QXJA 2QAGB 4OHWA 1T3LA 2F9MA 2C04A 1OIXA 4Q9IA 3VHXA 4WW0A 1E9SA 1E2NA 1IN6A 1NN3A 1XMIA 5AR1A 3QI2A 4BFTA 2CHVA 3ZVRA 1JNYA 4TMTA 5FR1A 4IDOA 4Q7KA 3C4JA 3QIAA 5FUXA 2KI5A 2Q3MA 4WXPA 4TN1A 1KI6B 1P9WA 2BM1A 3HJNA 1E99A 1KK1A 3CX7A 3A4NA 1E79D 3K9HA 4IRUB 4TL6A 1J99A 3AF2A 1FFHA 2ZS8A 4KXFB 4WOPA 3A6PC 1G41A 5DHFA 4GFDA 4F4CA 1EFRA 3VX4A 3PIRA 1K5GA 2IK8A 4IW3B 1G3UA 1GOTA 1Z6XA 1JJVA 1HY3A 1XZQA 3HR8A 4XVUA 2H18A 1COWD 1ZNYA 4RD3A 1HE8B 1GTVA 3QKUA 4PPQA 2GEVA 3D31A 1DELA 4ACAA 2C98A 1E2IA 4Q1DA 4JLBA 4II7A 4Q18A 4OQMA 2DFKB 2ZSFA 2QZ4A 1G5TA 1N5KA 3D8BA 2GRJA 2QAGC 1FP6A 3GEHA 4XJXA 3FGNA 3G82C 2BBSA 5FPSA 3I3SR 4Q7JB 5L3QA 1NP6A 3ZDQA 3N2IA 1AS3A 1ONBA 1W2GA 1OF1A 3ZZTA 2B92A 1D8TA 4GOKA 2ZROA 4QL3A 2GZHA 3CNOA 4IEEA 4A9AA 1UADA 5B58C 2ZRMA 3KL4A 5CLQA 1R5NA 2WV9A 2DFNA 3C14C 4ILEA 4MGYR 2RGBA 4ZIRB 1I2DA 1Z8FA 1QHIA 2E9SA 1Z0KA 2GJ8A 2ZI5A 2A2ZA 1E32A 3MG9A 3PFIA 1NSTA 3GJXC 3OAAA 1OV4A 2KBFA 2IYUA 3QVVA 3UIEA 2WIBA 1AM4D 1L2TA 2CL7X 2G0TA 4GI7A 4E22A 2NO7A 2RMKA 4BECA 4MRRA 3MCAA 3U2QA 3OEHA 3K70D 1J2JA 2B8TA 2D7CA 3HPRA 4R9UC 1TAGA 2X2FA 3W34A 1YE8A 1KMHB 3UG7A 4DEYA 3B9PA 1W36D 1P2TA 3W6NA 1Y63A 5JEEA 4JT2A 1GAJA 1KSHA 1JBKA 1VG1A 5KOYA 4D0LB 4EFLA 5KHOC 2OBMA 4ESVA 1KIMA 3LBHA 1DG3A 1G4AE 1VCOA 3IQWA 3U3MA 3PEVA 4A82A 1QHHB 5CB6A 1A82A 4Q00A 4IDHA 4Q66C 1KI6A 1NBMD 3WBJA 1VPLA 2PT7A 3PUVA 4LY6A 3WNBA 2AD5A 2CE7A 1XBTA 2HXSA 1LW7A 2FFHA 2WICA 3DM9B 1NG9A 2FFAA 3DKVA 4IFBA 1T0HB 2OO7A 3IIKA 3FMOB 4JJKA 4MKFA 3SBDA 4DUGA 1BMFA 4PHTA 2ZI4A 4WXRA 1E2QA 3BOSA 4FN5A 2JLXA 4EAQA 2AHOA 2WIAA 2FSHA 4C3ZA 4NYMQ 1SVOA 1EFUA 2GEDA 1Z28A 4AI6A 2ZTSA 3DZDA 1E9CA 2SHKA 3T1VA 4UKDA 1KAOA 2R6DA 3CB4A 3K9LA 2JLYA 4BFVA 3LW7A 2WOOA 1JJ7A 1W48A 2Z43A 4QM6A 2YINC 2A7QA 1Z0FA 2RGEA 4URVR 2EFDB 1SKYE 1ZNWA 1M74A 2QL6A 4PSAA 4JVLA 3TGPA 4OQXA 5F2EA 2J45A 3LBIA 1W0JD 4R2HA 4D4MA 3V4FA 4FXPA 4FMBB 3L8ZA 2UZ3A 1TUEA 3BK7A 1BYIA 1O3YA 3PUZA 2P65A 2W83A 2IXEA 2AD1A 2BKEA 1KGDA 3SFVA 5JHGB 4ZIRA 3ZVNA 1KO7A 2R62A 3BH6A 5TB5A 5FR2A 1XJ0A 1ZCBA 2A5GA 2ZU0C 3RRMA 5KUTA 1G7TA 2QBYA 1MO6A 4D4KA 3TQFA 1CKEA 2VTKA 3MLEA 4JZKA 4RD2A 1S96A 4QG7A 4TMZA 1K6MA 3ETLA 4B34A 1XPRA 3PENA 1J8MF 4NYJQ 5JMTA 3LQQA 2ZSAA 5TVKA 4RJLA 3AUYA 4B3BA 3W9YA 1SXJB 3DO6A 3KTAA 4G5QA 3K8YA 2O8CB 3AUXA 3MJRA 4GT1A 2UVQA 1KMHA 4OL0A 1Z0IA 1CR0A 3KXLA 4Q19A 1S0UA 1UKZA 2QMHA 4EJSA 2RHDA 3EA5A 1C1YA 3EIQA 1RJ9B 1U81A 1WE2A 1I4LD 3TE6A 2V4ZA 1KDPA 2ZJBA 4JBWA 4LBYA 1DPFA 1S9DA 1G3QA 4GPTA 4OYHA 2ZM5A 4MDFA 2ZQ5A 2QM8A 3KKPA 4LJ7A 1IY1A 2J1LA 1G16A 1QHHA 4HI0E 1HA3A 2EU8A 2W6IA 1M6NA 2HDNB 4C0LA 2JIZA 4LPKA 4PANA 4NZYA 1N25A 1NMXA 4JSYA 2GCOA 5H68A 1E0JA 1F2UB 2OAQ1 4R2IA 4LK2A 4X8MA 3OE7A 4B74A 4B3FX 1KZGB 1N3BA 3WRXC 1G5RA 3M0EA 1GG2A 1IN5A 4AYTA 1DVRA 5KPJA 2IXFA 3K09C 2V55B 4TL7A 4CT4B 4QM7A 3U3KA 1KI1A 1OH8A 3VMFA 5BWMA 1DADA 4M1OA 4G1UC 1II0A 2OV2A 5F9FA 2PEYA 5JS8A 3VQTA 5AJZA 1FX0A 1AKEA 3SHFA 1R10A 2GBLC 3FMFA 3L0PA 1R7RA 3GLIB 3P26A 4AURA 1D9XA 3LX8A 1OXVA 4P32A 2OBLA 2AWOA 2J0UA 1TEVA 2PMDA 3TRFA 2X19A 3EIEA 1OYWA 2ZITA 4UNQA 4KFRA 3B7GA 2YKGA 4HUQB 1E3MA 2BJVA 1I2MA 4WZ6A 1GL9B 1ZM2A 4AG5A 1YZNA 3BH0A 1GILA 2QUZA 4X8LA 5HCIA 3B6EA 1UM8A 4F38A 1JEEA 1G7CA 1G7RA 2RB4A 2QMUA 3NBYC 3OEEA 5IHPA 1J7KA 1FUKA 3GLFB 1N6NA 5F9HA 2Q6TA 4LWZA 3OF5A 4URYR 4CEIA 3BC1A 1AQUA 1KSFX 1FZQA 1SVIA 3DMNA 1F2TB 1OKKD 2VHUA 2GHIA 3QSYA 1SXJA 2R9VA 3P4YA 4X8OA 1ZC4A 4D0GA 3A1UA 1W4AA 2D7DA 4C0JA 2OUKA 2B6HA 4LOAA 4J0QA 721PA 5C46F 3GFPA 2H16A 1ODFA 1T8TA 2ERXA 3FMIA 5GJBA 4DSTA 1KK0A 3ZLJA 3R8CA 2O8DB 2QRNA 1DG1G 1Z6TA 2OXCA 1L4YA 5L3VA 1E9RA 1ZBDA 4TTPA 3U3OA 821PA 1Z3IX 4CZ2A 2R6AA 3VR4A 2QP9X 2QROA 3AP3A 1NVUQ 4HAUA 1SKQA
chains in the Genus database with same CATH superfamily
3HY6A 4K9LA 3P2IA 4P3PA 4JENA 2XDWA 3HNRA 4URXR 1F2UA 2JFQA 2PLAA 3D8SA 1HBJA 4KN9S 4H7KA 2QYOA 2QTTA 4MB2A 4UU7A 3MXTA 2XCTB 3FSGD 3SM9A 3GDHA 5B7NA 5K6TA 1ZEJA 4D3ZA 2M98A 1RP7A 2C9DA 4GW3A 2D3WA 2DFLA 1U4NA 1Q0LA 3H9QA 3PUXA 3R20A 1HDXA 4R8SA 4U4AA 1G21A 4YLGA 4BVFA 3KV1A 2IC5A 5EMNA 1VCIA 2E85A 4N8DA 5IT4A 1ZKMA 3P32A 4QWMA 4QAJA 1ZMOA 3HP1A 1UC5B 4LJAA 3H2SA 2ZG6A 2X4LA 3GF4A 3LGSA 4TTRA 3I8XA 4XR9A 5D6NA 1YR6A 5G0WA 3QG1A 5FOWA 1Y8RA 3ZHOA 4D4LA 1XAGA 4MYTA 3U80A 3ZJTA 5TMDA 4E88A 4FU0A 3I6ZA 3EZ9A 4WKPA 4XGKA 4XD7A 3OY2A 4Q82A 3UGJA 1GGNA 4CYMA 1UJ4A 2A88A 4CQJA 2I6XA 5BOSB 5D3ZA 1X0VA 4ZANA 3F5SA 4C4OA 4XWYA 1G18A 4GDFA 2YASA 3V55A 1IATA 4AJHA 1KPGA 3F98A 3WRYC 4MUFA 1L7EA 2GETA 2C31A 2CJWB 3DDNA 1H8HA 2FUNB 2QTAA 3O2JA 4PG5A 7GPBA 1E1MA 1U2GA 2OE2A 2F17A 3GCGA 4HAXA 5E7IA 2A0FA 1CUSA 1A8PA 2NAFA 1F1JA 1V11A 1WXFA 3GLSA 5BV2P 1U2DA 2P5UA 4JQSA 2R8YA 1J0AA 5HRAA 1KMMA 2AQHA 3FVWA 4AJLA 2QT1A 4KQXA 4R71A 3ELDA 2DBZA 3PCXA 3UBTA 1Y8QB 5CHEA 2ZRCA 3L4BA 1XSEA 3EAQA 1V1RA 2X0DA 4FEEA 4DBLC 5KVAA 4FFBB 3ADKA 5CB4A 3GA7A 2NVOA 3IEKA 5A7GA 4E94A 2AC7A 3GLIE 3VVBA 3QY0A 2B37A 1P7PA 3DW3X 3LG2A 2VHZA 3VTAA 3IT2A 1FDUA 2Y0PA 1OIWA 4H17A 3WWOA 3Q8LA 4RDXA 4D56A 3MQ2A 2VDOB 3L6BA 3I2YX 5KX5B 4HX5A 3OTOB 4J9VA 1MORA 2EEPA 3G9TA 4ALIA 3V3KA 4F06A 3PS9A 1GADO 4YJ3F 3EDOA 4DNPA 5CDTA 3F4KA 5KU7A 1LVUA 3HKEA 1A76A 2X4DA 5TEVA 1WW2A 2JD2A 1NLUA 1FE8A 3VC3A 1JHXA 3IRUA 2CT8A 1EQUA 5ITZA 3TEJA 2AK2A 6YASA 3EMBA 3PI7A 4UMEA 5J4LA 3OT1B 3ZNQA 2C2GA 2XRYA 1NY6A 5TX7A 5LU9A 3B51X 1QFSA 1XDGA 3C15C 3RVPA 4B80A 2J0VA 4B6FA 1YJXA 3N58A 1SXQA 4ECAA 1Q83A 1S3FA 3JVIA 4C76A 1SOUA 5AVOA 4IDFA 2AQKA 1E2LA 3PNVA 5KHLB 3W04A 2I9PA 3B70A 4J75A 4AW9A 5GJCA 1EE1A 2ZJ6A 1BE8A 3R5TA 4IIFA 4JP5A 1EP2B 2P68A 4S12A 1CJMA 4U9HS 3UHFA 3W3ZB 2R8BA 3OZAA 5IVKA 2JIQA 4PAQA 1PR5A 3WFZA 1W25A 2W11A 1CV2A 3D2BA 4MRSA 3CLUD 1QV6A 2HNAA 4FUQA 4RFSB 1YQTA 3N0WA 2X8AA 1U98A 4M1YA 3ITEA 2Y1XA 3NT5A 4CU2A 5AESA 4HRVA 2W8BB 4TGLA 4BQSA 1NJ8A 2TECE 1K6IA 2ZPAA 3AEKB 3HA5A 4GQIA 5F23A 2XMBA 5IANA 4FZ5A 5GONF 4MP3A 1GTG1 4IGEA 4UAUA 5KDOA 4S2UA 4PLHA 1N0HA 2VJYA 1Y6FA 3ZXXA 2M9MA 1PNQA 1AK9A 2GT1A 1CUAA 2XTJA 3BKXA 4N7RA 1OZAA 3E2MA 2FRXA 3TEFA 1ZBQA 4EELA 1JN0A 4GR5A 2RC6A 1KDZA 2G1KA 2ONCA 4WCFB 5DK4A 4CM3A 2VTBA 4K9SA 5F3WB 1LY1A 1NUSA 1QGED 4NZ9A 4WKNA 4YMTA 4UQOA 1N3LA 3PCTA 5BN4B 2RGYA 2ECOA 4IHJB 3W5IA 1NUUA 4YB8A 1R5BA 1L3CA 2AN4A 2RGNA 3HZHA 3RBAA 5BRNA 3T4UA 5G0UA 4KGVA 1LB1B 5BXQC 6CHYA 4DR2B 2VSOA 1T43A 4H0NA 4EUFA 3HJUA 4N18A 5A3JA 1NP3A 1B14A 4HZGA 5JMPA 2A92A 1CYEA 5DNDA 2XE7A 2BFCA 4ZVMA 3H19A 2VHXA 3JAWA 3CR3C 3BGWA 4ENVA 4RTJA 1RXWA 2ORIA 4NZNA 1X7GA 4F6CA 3L8GA 3FDIA 4MVJH 3FKSD 1MIHA 4LMBA 4NJOA 1G98A 1H0KA 2NTEA 1WBDA 4FWTA 4XYLA 4EG4A 3BFJA 1PHRA 2NQ8A 3FM9A 3GGDA 3SHTA 3U0BA 2AKAB 1E79A 1A8HA 1G5QA 3CONA 3D0QA 3EXEA 2PL9A 4MV0A 4R69A 4WWHA 4EPRA 1N3IA 3E5HA 3EVZA 4YAIA 2F3SA 2LIVA 2PL5A 4LYEA 4QWWA 4WIAA 5J9FA 1RRKA 4JP2A 3FI9A 1KS9A 5JQGB 2QJRA 1SA0A 4EPWA 4YPVA 2GK7A 4Z6KA 5HJ2A 1TF2A 3R0IA 4DDMA 1LVHA 5TPZD 4KBFA 3G8CA 4M1ZA 1G8YA 2E4YA 2O2GA 4B3GA 3CPHA 2ZLBA 1NU6A 3O93A 4YH1A 2HMAA 2BKXA 4JQYA 4ZV7A 1I2ZA 4ARBA 1JKIA 2PT6A 3GL9A 4QU0A 1ZU5A 1MPXA 3B1YA 4NICA 1W46A 1XMXA 4F56A 1RYZA 2G1JA 4X7PA 2W5UA 4I7EA 1W30A 4YK7A 4V03A 5E6SA 4ZT6A 2R2AA 3AW8A 3D3KA 4JI0B 5FD8A 3IJPA 1MO3A 1UPCA 4EL0A 3ABSB 3HMQA 3TW8B 2YY7A 5ECYA 4C5AA 2P78A 1WM1A 2RGAA 3CH7A 3GJZA 3C8UA 3IVXA 4KPGA 4QXRA 1JQAA 2FW6A 2XOEA 3RC1A 3T7TA 3UCFA 4E1BA 1DCTA 4W8OA 1W581 4E30A 5JH7F 2B6NA 3O73A 2LZ0A 5AVXA 2HA5A 3MA0A 2DGDA 5L95A 5D2CA 1T5OA 3IV7A 3H9EO 3STYA 2WYUA 2IPOA 2KBEA 2O48X 5SYNA 1LJUA 3W90A 3WL4A 4F60A 2P69A 2IYLD 4IIUA 1Z83A 2WYVA 3JYHA 4YFVA 2XE6A 4NNOA 3C8ZA 4IEIA 4KUEA 4R7TA 4RL4A 2AXNA 5JS7A 4UARA 3PV0A 3DDZX 1U1CA 1G8GA 4EPVA 1O95C 4UQPA 1JEOA 3ILVA 1HNZB 2FW7A 2IF0A 1RYDA 1JHDA 4C08A 2CDAA 3K0FA 1MR3F 4Q3OA 1K63A 2I7TA 3O4GA 4B7UA 3LX4A 4O59O 3EFEA 3FBTA 4IMPA 3SM3A 4CQLA 5K0CA 1EX1A 4NMWA 3WWYA 1FRVA 3RFFA 5IK2D 5LZ9A 1O6BA 1LJLA 3KUKA 4UUQA 3U40A 2IP1A 4EF6A 2DUNA 2DBRA 4KXMA 4EVIA 2HEIA 3CJQA 3G49A 1V5IA 1BKYA 2OO5A 3OP1A 1KE2A 1P8AA 5CCDA 3TZBA 5GVSA 2IQ5A 1JUDA 3DE6X 3VJRA 1ZONA 2Q28A 1I1NA 5DIFA 5H83A 4BMPB 1ZUD1 2JKVA 4OQYA 2OHXA 2CNDA 1J09A 5KTRA 1N92A 1WDWB 2Q0QA 2BEWA 3HABA 1YZHA 3H17A 4AZ0B 4AXBA 1XNRB 3IDAA 3KEFA 4BPRA 2G09A 5FUQA 4J7AA 3PNKA 1L5NA 3D81A 4PGGA 2RAPA 2X1MA 3K9CA 4PPGA 1DIBA 3KOYA 1LH0A 1I5RA 2AUMA 1C9EA 2Z95A 3PKJA 4EGFA 3ZQJA 2JGEA 3AHHA 3NR2A 5AYVA 5BV7A 3K9WA 3MWFA 5E0OA 5HKKD 4MYCA 1EFVB 2VA9A 1QG2A 1KZ1A 1TCAA 1N7JA 1LPMA 1XVUA 1YZ3A 2J9FA 4LSGA 2OMEA 2Z3WA 5DASA 2X2OA 3C97A 4YLEA 4E46A 1PAUA 2RG7A 2WYIA 4BNFA 1EG2A 2XW6A 3DP9A 4OBBA 4PU0A 3A0UA 1XQVA 4J2TA 2FZKA 4MHOA 4HB3A 8AT1A 2BJWA 5IM4A 2VDWA 2A9VA 3HJHA 3AI1A 4M7OA 1ZCFA 2Q2QA 4DARA 4FW9A 2PGNA 1KRWA 1JDNA 4IXMA 4EHBA 1KAQA 3HKDA 2IYFA 2IZ0A 3LTEA 3LIIA 4JT9A 4DLAA 1R5OA 3L05A 4O02B 5G02A 1F3LA 1U7ZA 1XTQA 2VHYA 3DJYA 4BNIA 1VG8A 4RTNA 2O8BA 4BZZA 5CDHA 4YMWA 4DC9A 2ZVPX 1UBTS 3USZA 5J5AA 3TI7A 4BMYA 3PL1A 3P2OA 4H77A 2OSVA 1JB9A 4BRUA 2YS7A 3IIEA 3UB2A 4E5VA 1MOQA 2B4RO 3BFXA 1Z39A 2BBTA 5CIYA 5SZKB 2YY5A 3WLKX 4K3VA 2ZUFA 1OC4A 2JJ2D 4MPDA 2XQFA 3L1UA 2RSLA 1CU1A 1NZDA 4LYFA 2TRSB 1T0IA 5CA0F 4DMLA 3IVAA 3KYCB 1X70A 2WJIA 2HU8A 4CEHB 1JQ5A 2RBGA 4BNZA 2NPOA 3IP8A 4ID9A 4A10A 5LU8A 5DYYA 3VYUB 1D1SA 3DLCA 1ABFA 1LV7A 4YMIA 1VLQA 2BHSA 1JU3A 2DM6A 3CUEF 3NT4A 1T91A 3OT4A 4NOKA 2UXCB 2PGDA 3DAFA 3KXPA 4CE6A 4XWAA 2E0IA 3L8YA 4FLMA 1LS1A 2BBOA 2AX3A 2QF7A 3UG6A 2D2IA 1C3XA 4CG3A 3HCEA 3P52A 3JASB 1JKXA 3D2CA 3HE3A 3HEAA 4LJ9A 4RF3A 3TZHA 4GM1A 4O4JB 1E20A 4Q1FA 2R1UA 3W3AA 3D6VA 4ZVQA 3NFRA 1XALA 3F90A 3ZH2A 4D8VA 1T4MA 4DV4B 5MDHA 2H1OA 3LDHA 2PANA 4GPBA 4E3WA 1GTMA 3TMKA 1S8FA 4FCWA 1HYQA 5HUJA 1VQ1A 1XFDA 1MGOA 3HDQA 4Q3KA 3E8SA 1PJRA 2J33A 4OF4A 3PCRB 4R5HA 3B3JA 3BWDD 2XF2A 2G1PA 1CQXA 2EP8A 1ZYUA 1F8UA 1M8JA 3NHAA 4Y2TA 1K06A 3P0FA 2ZXUA 1P77A 2C94A 3C3AA 5BURA 4IOMA 1J70A 3ORQA 3Q1LA 4FCCA 5CP8A 4B09A 5HJ5A 3PT9A 1WP9A 3GR6A 5H3LA 3BCHA 1JMYA 3FFTA 4CIXA 2M32A 4DQLA 1AN0A 2QE6A 3L4SO 1AT1A 3VISA 1IK4A 1VPEA 4D9HA 3JYPA 2BKUA 3OLVA 3SXJA 2WA2A 3INNA 3ACDA 1WB5A 3NAQA 1XRPA 5CT5A 2B20A 3RYFA 1CSEE 4M8KA 1N75A 4ZEOA 1MW9X 2X8BA 5DHQA 4KQHA 3ZI0A 5I51A 3WK4A 4RSRA 5E6UA 1BIFA 1UEJA 2Y1EA 4L51A 4RKQA 2RK3A 3ESRA 2ZXEA 4D42A 1QGUB 1XCLA 4X8HA 1XF1A 3CPJB 4NU0A 4C7BA 4TXNA 3RR2A 3AF6A 1I6LA 1QZXA 1U8XX 1VDZA 2B1GA 1BHQ1 3ETDA 2WMYA 4RMJA 4EKIA 2YNMC 2WTUA 2O52A 3BMNA 3GP8A 2H7VA 2JLCA 2XOXA 3KQTA 1RTKA 1IN7A 4I99A 3U13A 4C6TA 3CXUA 4J1QA 3ZLBA 1AQYA 4U3JB 4LGVA 1FA9A 4UBJA 3O3NB 3OPYB 4X95A 4TQGA 1BU5A 2JH9A 3HB1A 4CM4A 4ALJA 4CL2A 3I1FA 3QGMA 1ZH8A 3DSRA 3VR6H 4OH7A 3ZCSA 3CVYA 4NOLA 5LB2A 4FHGA 4C4SA 3P9ZA 4E5YA 1BEUB 2B2XA 1QFZA 4S2EA 1ZQ9A 1MH9A 3LVBA 1QGYA 2A0UA 3RU2A 4YXWD 5KNBH 1CDDA 1YDGA 2GTHA 3B6KA 1YV9A 2OCAA 3OU6A 4EGAA 3CZMA 4BNMA 1V35A 1W47A 2O2JA 4MIKA 1OXSC 3L41A 4YRTA 2HRZA 4DWVA 5EJEA 1HR0B 5CBPA 4AZSA 1TYCA 3SXUA 3K8ZA 5KJCA 2O5CA 4QGGA 4ER5A 2Z2IA 3L8DA 2HF7A 2C9OA 3AIKA 3I30X 1H2YA 3DE5X 3PUWA 4GLBA 4RE6A 2B2NA 2OZVA 1TMYA 3QKSA 4JJZA 2XKBA 5DW3A 3ZN2A 3RSHA 4E7PA 3PQ7A 2C2YA 1P5RA 4EF5A 1JEDA 3V3TA 2CMHA 5F2KA 3PUKA 3ER9A 2H5EA 1OUMA 2WZQA 2AJLI 3DMFA 4HF7A 2AHRA 1OKKA 4OGWA 5CVCA 4QXQA 1M6YA 3NGMA 4KVZA 9ABPA 8ABPA 5D1HA 1OE0A 3O0DA 4MA4A 3BQ9A 1HFWA 1ORDA 3B1ZA 4FJ2A 4ITRC 3FFWA 4G09A 2A5YB 2X9QA 4JB8A 3H5NA 4XOIA 1AKTA 1Z2CA 3Q9SA 1CUCA 1W0KD 1DCMA 2PSJA 2E5LB 1QB7A 2D4HA 4Y2HA 1UT5A 4CGZA 2HLHA 2XCIA 4RMIA 1UFKA 4WINA 2NP6A 3B52X 2I3AA 2WFZA 3ONFA 4KJXA 3I1JA 4UAVA 4BX2A 3MB5A 1QRAA 4EKNB 1XAIA 5C1OA 3ZHVA 4MIEA 4JWTA 2Y1GA 3O9MA 3OM9A 1BS1A 1F5NA 8OHMA 4QJ4A 1L4MA 4ZREA 3C7KA 1T0JB 3EH2A 2O8FA 2NZJA 2DKFA 2JPDA 4IIJF 4B76A 4UD2A 1VGQA 4AO8A 4KHZA 2W2LA 2CEKA 1SVLA 4Z7OB 1CF2O 1MXFA 2I2DA 2ZUBA 3BHMA 1NTOA 2OC4A 4TTTS 1GR0A 2HKIA 5AH0A 1MC4A 3K0AB 4EW3A 2QVXX 2B78A 5E1OA 3S1LA 4EAAA 1YB5A 2DY0A 4R2XA 4BLVA 5BV1A 5KWSA 3NDPA 3IOBA 1ISHA 3CRVA 3PR2B 1O7JA 4FFOA 1KJIA 2G28A 2I33A 1E3DA 3A6LA 3ML1A 2GFQA 4OXRA 1E7YA 1DIGA 4OSOA 1DEKA 1N2SA 4QTXA 3GEPA 3E3AA 1PTJC 5DM4A 1EHCA 3RRXA 5J23A 1YK1A 1CNMA 3HM9A 1HOTA 2ZCVA 1EX6A 3JZMA 1FMLA 1TJNA 3DNFA 3R4CA 3B3GA 4Q7LA 1YC2A 1EEHA 4E08A 1TKCA 5B37A 4B83A 4HTFB 1WHTA 5CJPA 2FDXA 1V1MA 3LNTA 1QLJA 4YAOA 3TQOA 3V1YA 4KLRA 4OGFA 2Q46A 4KYVA 4BTEA 2ZBFA 3T15A 1MB9A 2A8YA 1HZJA 5H3CA 5DI3B 1TJPB 3L77A 1N2ZA 2CYCA 1ZMXA 2NZVG 3VJMA 1VLJA 5H02A 1NBAA 3MRVA 4B4WA 3HY4A 4IH9A 5LVAA 2XVXA 4ME6A 5K3EA 2WG0A 2FZEA 2P79A 4Z4CA 3L9WA 1NGSA 5JR3A 1CZLA 2BJHA 2PTHA 1PJ2A 1WG8A 2VHJA 1YHYA 1IY9A 2P7IA 4HNHA 1B93A 4D3FA 2B69A 1U2EA 3Q9LA 3RJMA 3TOZA 5CNMA 1BXRA 2YFYA 2ZUUA 2VYND 1I4OA 1A72A 2UUPA 4IH1A 3TAHA 2R00C 5F4BA 3LPMA 4K40A 4J16A 2O8VA 2YQ4A 2FUG1 2GTIA 3IAXA 1SK8A 3P1JA 3SKXA 4B9EA 1BHSA 4YRPA 5JSZB 1JDVA 2ODNA 3QXGA 1MO2A 4BNDB 2NO4A 2A1UA 2DLNA 1YULA 3BTUA 1WP4A 4YRNA 3CC8A 5BMOA 4QATA 4I3GA 5TT1A 2Z3ZA 3GLTA 4PZLA 1U9IC 4MR9B 2H2WA 1Q14A 3GN2A 4WV3A 3SIXA 3HB4X 1CJUC 4GBGA 4K8OA 3WTCA 1RWMA 4GO1A 1M73E 1U0FA 3PF8A 4NU8X 1GQSA 2BPOA 4TYPA 3EZ2A 5AKZA 4G0VA 2EVWX 1FYWA 1AS2A 3AY6A 1H6AA 4L27A 4UHDA 2ORWA 1O0BA 4JLWA 4RCZA 5LCXA 4C2AA 4LOHA 4EIWA 2BI8A 4ZCQA 4YP9A 4MVJD 5GZ1A 1FSPA 3NYIA 1M1XB 4NBUA 2ZIVB 1P0QA 2X5JO 4Z2AA 4LUCA 1IRIA 2Q6VA 4D92A 1OWPA 1ZNQO 2HIGA 2BT4A 1BVYF 4XWOA 1C1XA 1C2TA 5HS4A 1NXQA 4COKA 2D5AA 2DULA 2IGTA 4KSYA 3CH5A 4ID3A 4M9UA 4YDSA 5GAJA 1DKNA 4XCQA 4BZQA 4J0CA 4MUJA 1NNUA 1ZJ4A 1W93A 4RH1A 4MCIA 4D9CA 1HQYE 2GCEA 3FNRA 5AHOA 4D9FA 1FLAA 1WU7A 4DGSA 1A8IA 1N77A 1E3WA 5I45A 3IE2A 3WYCA 2B2CA 3RG8A 3TGWA 3U3ZA 3UB4A 2XDYA 5BW5A 2VJPA 3SEQA 2BCJQ 1XDBA 3WRXA 4D8TA 1JFFA 1EVJA 2GYYA 1Y48E 2ON6A 3L18A 4PPYA 3TNYA 3VYSB 2JZCA 5KKCA 2OV4A 3P9RA 4PEVA 4Y30A 4H3VA 1CUDA 2BGNA 2Y9PB 2W2NA 4Y8VA 5FBZA 3UH1A 3IR5A 4K03A 4KN5A 5JCPA 3OOHA 2FMXA 3RT1A 3LQKA 3UJAA 1L1RA 1JXOA 3LHDA 3BDIA 3NONA 1XEAA 1T9GR 3PXDA 2HPZA 1P19A 2BVNA 2JGJA 5ITSA 4WN3A 1UDRA 2XV1A 3N59A 4B6JA 1AV6A 3DTTA 1RKBA 2WSSA 3BICA 3N0VA 3NIWA 1EXNA 2V9PA 3QQ5A 4JFAA 4MLDA 4FX2A 1QZZA 4EQ6A 5IJ9B 2IXDA 3DXXA 1THMA 4XVRA 4YT8A 3VNUA 2MDTA 5DHAA 1NMZA 1Z82A 3F71A 3CZQA 4X3CA 4WBNF 4LYGA 4V38A 4PX3A 3GRAA 2G9ZA 1HK7A 2A6PA 2J48A 2WD7B 3F4BA 3KYJB 4WNCA 5AK3A 5GJVC 1RXCA 3EGXB 4FWBA 1EFLA 1CULC 2HRCA 3T5AA 3HLKA 4PYLA 1IEVA 3TLAA 3PX3A 3FZYA 4Q4CA 1CTQA 3KVVA 3LSTA 2ZAIA 5EIWA 4B7CA 4TYWA 2W0SA 2HEGA 3BBLA 2QE7A 1E5LA 4Z9FA 3VR5A 1IH8A 2JLQA 4KCGA 1OI7A 3LVQE 1J8FA 4EI2A 1FP4A 3EW7A 3X1YA 3WLEA 1OLSB 5F7JA 1DIAA 2HSJA 1WBBA 3HR7A 1MBZA 2IYAA 4EQZA 1GHTA 5I7UA 2Q8PA 1PG5A 2HO4A 4D0SA 3NXSA 1NQVA 1L7RA 1MG0A 1RQ7A 3HL0A 1B73A 2HX1A 3MGGA 5ALZA 4HP8A 4UHEA 3JARB 3R40A 4FYXA 1IHYA 3GUUA 2PQ6A 4INPA 3TBKA 1QC5A 4YQEA 2DG2A 3WQRA 4AD8A 5CX1B 3VYWA 1BD4A 2QQEA 2FQYA 1BFDA 4H6VA 1JR3A 2GNPA 3IILA 3NETA 4IXDA 2GYVA 4IDCA 3TPZA 4BKOA 2O7RA 2HC9A 2Z8YA 6NULA 4QTYA 4PRYA 3DE4X 1EWVA 5JATA 1KYQA 1WZUA 2QTMA 2WR8A 2OB1A 3HCNA 4QFCA 5JDCC 2OZEA 3FCYA 3OIUA 1L4KA 3EMDA 4EABA 1XD9A 1Z6GA 2C5FA 3F7TA 3P20A 3T7JA 2IS4A 4FLFA 3FI0A 4BLQA 1HETA 2FJPA 3MJSA 1X87A 3FAKA 3VPCA 4EYOA 5CITA 3CN9A 2Q1YA 1ZIPA 3M1YA 3UT6A 5K8LA 1M0SA 3SSOA 5EQTA 5FI0B 3ZGOA 1VMIA 3TMAA 3ZOKA 4ARCA 2QV0A 4F0JA 1KERA 3MBOA 1ZO8A 3UAYA 1KO8A 3H84A 4M2LA 1G8FA 4X6UA 1TFRA 5AW0A 5IZCC 3RDPA 2QWXA 3K1AA 2JBAA 2IYXA 2HHJA 4AIRA 2Z08A 4F4DA 4G8JA 1Y5LA 3KB1A 4GHWA 1IXZA 1IM2A 3UA3A 5G3YA 5EHQA 3VNAA 3WFJA 3WYDA 4E11A 2ZB7A 3X1MA 1FB5A 1H4TA 1JMVA 4EB3A 1RAGA 4TTQA 1A9YA 5ALTA 2WPDD 1L7PA 2X42A 4JEMA 4DCVA 3EXG2 1D4OA 4UM8B 4YA6A 1AZSC 1JAXA 2NVWA 1LNZA 3FCXA 1M8FA 1OAAA 1O9BA 4I55F 3L07A 1VFNA 2ZETA 2PJDA 2B5OA 4L0QA 1MA0A 5AJUA 3FHTA 4QUAA 1K8ZB 1VLZA 4OQFA 1SBCA 2O0HA 4DV7B 2HD4A 2XJ4A 5I7OA 4K8RB 3PNLA 2UZ4A 4OTZA 1KPHA 3PJGA 1E4EA 3KD3A 1FP7A 3PKIA 4D2IA 5EHNA 4H3KB 5E1MA 5EJIA 3GXBA 4EDHA 3Q8XB 1EQAA 3LU1A 3K9QO 4R6XA 1JFVA 4C6SA 3FH0A 4JGIA 3VH3A 1S1MA 3H2JA 2X2EA 1NG9A 1D2CA 2IOFA 3HU1A 5DM0A 5I9SA 3A58B 3DFKA 3WRYA 3TLMA 2NG1A 3CF6R 2V1UA 3ZS8A 4RYDA 1RLUA 1OX4B 2J46A 3KDPA 1ONPA 2CCJA 2W42A 5LD2C 4UTRA 1M1NB 1H9CA 2F1RA 3O38A 1PK7A 3GRCA 1OGIA 1PCXA 2GTPA 1DJMA 5TRTA 1P7WA 4LVOA 1KC3A 1R64A 4LWOA 3LLUA 3W5SA 1ZCAA 5AMXA 1IRXA 2Z3VA 3A9SA 3FN4A 2W7TA 3KTOA 4MUHA 3U09A 1N2BA 3DYIA 4NL4H 4H1WA 5I9NA 2CYAA 3VUEA 3DKPA 5E7QA 1EJBA 1SAYA 2PSEA 2P6NA 3TOSA 3IBSA 3V00A 3TG2A 5IKOA 3HO1A 4WZAA 2YVUA 3AVXA 3VR3A 1NDUA 4ON9A 4J8PA 3E4DA 4NCIA 5EP3A 4HBZA 4V0OA 2CL5A 1CETA 1E0AA 4KFUA 4P2BA 1KAMA 4QLAA 2IS6A 3DV0A 5LOVB 3U44B 3QPCA 2XQIA 5BN3B 2JGKA 2ZJ4A 3DEAA 3FLEA 3G79A 1UPAA 1IBRA 1VIMA 2O7VA 1PJ8A 2V7VA 4JI2B 4DYVA 1RHJA 4B75A 4V24A 5TV2A 3F0TA 1E3LA 3EXHB 3HJCA 5EC8A 4WDRA 3QTTA 1C3OA 4QX6A 1APBA 5JAUA 2RHBA 4B3CA 3F2VA 4QOFA 3ZVLA 4F2HA 1FUIA 1YONA 2ILVA 2OBYA 3JRWA 4XRRA 3SSMA 3WMFA 1J1UA 4OKIA 3EXAA 4BEWA 3H75A 3U1TA 1XDWA 5THKA 2EX0A 2ADOA 2O50A 4F9EA 5C2JB 4MULA 2NTVA 1WSWA 1TQ8A 2UU9B 1AMUA 3L79A 1XMSA 1H6BA 3N2KB 1B6TA 4B32A 4MUKA 4MRPA 1RZ3A 1ZUHA 3E9DA 4FYKA 4PZYA 4R41A 5CW2A 2ZCJA 1ABEA 2X1LA 1Z15A 2R5WA 2VXBA 4OBWA 3DVLA 4TRJA 4TKUA 4ZQFA 1HYHA 2IFTA 4AYXA 4BQQA 4A73A 4F12A 2D4AA 1F0KA 3I9FA 3HCRA 1ZZEA 1AF4A 2EIHA 3U7FB 1WS6A 3QVKA 2MSLA 3RUHA 1PJLA 1JFLA 2ZJ7A 4HQNA 3VOTA 4YRQA 4UQLA 3VR6D 2KYRA 4CM7A 2ZRNA 4D3SA 2ABWA 2QLMA 4JJAA 4HEA6 4RZUA 3L4JA 1WVIA 2X77A 3MJFA 1MN6A 4WAUA 3GUVA 4DLXA 4ND8B 4ZAXA 3RG2A 3TLCA 3F6PA 2P9CA 2B7BA 5KNBD 3GLGE 2CVQA 3RREA 3AI3A 3AR2A 3ZPXA 1W29A 1GUDA 2PXCA 3MJHA 1X92A 4LCJA 4GNRA 4LRQA 4NDNE 5M5BA 1GQYA 2PXHA 3O1JC 2GF2A 4KVFA 4NBVA 4AJJA 5C4GB 2IZ7A 5CURA 1LLCA 4P38A 1FBTA 3QVTA 1EK2A 2AJDA 5AKHA 1RWBA 4NFYA 3WRWA 4IVQA 2HCTA 3U5TA 1P91A 2NT4A 3EIXA 5B64A 4DJJA 1OHHD 4F5WA 2IYWA 2WVJA 3OLCX 4G0UA 4I1YA 2B4KA 4F21A 1WKBA 3QU2A 5M29A 1SIOA 1PGOA 3GD5A 4I1IA 2I2FA 1DRWA 1RSZA 1XU4A 3SF8B 3CMMA 1NM5C 4X3PA 1KJNA 1KI7A 4HXGA 4Z54A 3E58A 2NO9A 4RF4A 3LQ2A 1P9NA 1CVLA 5A5FA 2JH8A 3RHFA 2AOUB 1SD2A 2IY7A 3NAGA 3WAGA 4AULA 2J5XA 4B4KA 1CZRA 3BIOA 1X1RA 3KE8A 3M1IA 5BWCA 1H3EA 4TMYA 1U7TA 1X7WB 1ONOA 2EERA 2Q7XA 1E64A 1GRQA 1BXGB 3PNMA 5CFRA 3K71B 4UU0A 1NFRA 1LC3A 4NC9A 3M6XA 1GV0A 1HYEA 1YMUA 4HATA 3AKCA 5C8YB 3K8QA 3CX3A 1EWTA 1Q7BA 3PJFA 5TT0A 5LQRA 5K8TA 1A2KC 2ZANA 1JLLB 2ZQYA 3LXXA 4ICIA 4ITVA 1IN1A 3ZDCA 3NPAA 2QM7A 1MC8A 3O4FA 4POAA 1RR6A 3WZMA 4M88A 2IVFA 2FFBA 5E4FA 4XXHA 1V2HE 2AMLA 3EZGA 4UE6A 2GBFA 3L06A 1VJ0A 3BMQB 1LF0A 1MJHA 2E1PA 3W7VA 4B43A 2P9GA 4ZI2A 4BFZA 3HXMA 1Y42X 2ADFA 1GGHA 3HJBA 5ILOA 1QCZA 3ED5A 2IDJA 3KYBA 4DW8A 1TLFA 5AUNB 4URUR 2HF9A 4R9SA 4M8LA 5ALIA 1C2YA 3OUZA 2CZCA 1I4DD 1Y9EA 2P5YA 5CX4A 4ZCLA 5EJAA 3W1WA 3I0ZA 1EVIA 3MT8A 2IU0A 4INOA 1TUIA 3DUFA 1ZHOA 1PN3A 2Y4OA 4FW8A 4ZZ0A 1RPAA 3I4LA 4I4TF 4P80A 1OH6A 1ZRHA 1SKMA 1DC3A 3B1WA 2BZSA 3NNDA 1UMDB 1M34B 4G85A 1Z16A 3OFVA 4R4JA 4F8YA 1Y81A 1OH7A 1E0DA 1O95A 2WUWE 2BDUA 4GM4A 1JSZA 1C0PA 4O4IF 1M2VA 1NVVR 3BORA 3F46A 3HKCB 4CN8A 1D1TA 1TZJA 3ICOA 5HRCA 2P2CA 2WTXA 2O3RA 2ZT5A 4Q24A 3LRTA 3V97A 3ME5A 1JA1A 3D6NB 2FTKE 2FG5A 3BILA 4JL8A 4BJ5A 1X15A 3N7AA 4G2NA 1YQUA 4UBIA 4BGIA 1EEXB 1ECPA 4G1EB 5C0OE 1YFJA 1S2DA 3VNSA 3S28A 1AVTA 1M66A 5B7QA 2IP2A 2XUOA 1N8SA 3KJZA 3LC0A 2O3JA 5FNVB 3UH0A 4BMDA 2IPNA 3DHYA 1IXYA 2CLKB 3IPAA 1IOLA 4HAOA 1RQGA 1CF9A 3GBSA 4U0KA 1XNQB 3U1BA 2FP4A 3CLTD 4FJ0A 5D6OA 4AY5A 4TKVA 3ZHYA 1Z8NA 1X94A 1LEHA 2YC2C 1XEFA 2GS9A 2WP8J 4P7FA 3LVRE 5ELMA 3FFBA 1A8UA 3KETA 3LK7A 5ERYA 3ZV6A 1BN6A 4BIIA 3GFGA 5BSHA 5EIBC 2GLTA 1W4RA 1SUSA 1T1JA 3H4MA 2A35A 2CK3D 3GU3A 4XM2A 2PUAA 4QXMA 1LLQA 3D7RA 4UVDA 4YMUA 1RYBA 4KKVA 4TV8A 3B8EA 4XWTA 4I46A 4CM9A 5KSWB 1AC5A 1KHTA 3QVWA 3RVKA 4HVTA 2E3JA 3HFGA 3QRWA 4ZU3A 3WWCA 3K35A 4XVCA 1JYFA 1HSOA 1PLLA 5EXXA 3O8BA 4EY5A 4B7XA 1QRTA 2P1RA 3TSAA 3I45A 1F9EA 4QOIA 1Y5RA 1ESMA 1QYVA 2QK4A 3AEUA 3TIFA 4Y67A 3UHPA 1HFEL 4WKBA 1J8YF 1EJ2A 5DLQC 4PAMA 1UDXA 4NBNA 2JCGA 3NRJA 3V1MA 1E6LA 1Q3KA 5ALFA 4E33A 3HCDA 5LLTA 1KKUA 2I0FA 5FX2A 1XOIA 3A9TA 1CQZA 3KR0A 4NE7A 2OOSA 3G0DA 4G0MA 3BGSA 2G9RA 4UULA 3SYTA 2GEKA 4M6WA 1BEEA 4J29A 3S2GA 5I4CA 1U6JA 1ZW6A 3MJEA 2HFKA 1QU2A 1Y0BA 3R7NA 2DHCA 2G76A 2VNIA 3MPOA 4V0QA 4YJHB 3B1FA 3ESAA 2COKA 4GVLA 4KO3S 2Q27A 4TTIA 3G1UA 4J4TA 1A5SB 3QHAA 3KTDA 3P0JA 4HQKA 2R0QC 4M8SA 4ND5A 2Y1DA 4OGKA 2WAOA 4LCBA 2IY9A 4WA8A 3DHWC 1IE3A 3R5FA 2QRKA 4L6CA 4OO3A 2VDUE 3E3MA 4MQ5A 4W9NC 5LNK6 3ZEIA 3ZY2A 2I3BA 3GT7A 3JAKA 4GL4A 5TY0A 5CFQA 3WTBA 3THXA 2LPMA 3KQNA 4WXMA 4L4UA 1ZY2A 3P94A 5KOHB 3RD5A 5JALA 3CEPB 3G7NA 4HAWA 4OYYA 4RHXA 2PQ2A 3LC7O 2N46A 5EZYA 1HMPA 1DQNA 1JLSA 2AYYA 3K31A 3LUGA 4TTVA 5AW3A 5HTKA 4DLRA 5KB3A 1CQPA 3RC9A 1FTSA 2C5HA 3WZ2A 1XXHB 4ZZIA 1F14A 4G36A 4V1CI 1NU8A 1O94D 1UZNA 5AXDA 4DFDA 5JS6A 5HZKA 1FRNA 3KYDA 4Q05A 4Q47A 1A8QA 3TSZA 3RVQA 3QX3A 3NU1A 3KJEA 4PBRA 3H1GA 3QFFA 4IY1A 1T8PA 7ADHA 5H4HA 2ZE6A 3T9CA 4FYHA 1GZDA 3ZIAA 4H4EA 3IUEA 3RROA 3HH8A 4EHHA 4PZ9A 3OE5A 1O4WA 2SKDA 4O2AA 3S2FA 1LF5A 4R2KA 2YS6A 3EIWA 3T95A 3K0EA 2GF9A 2KHZA 1T15A 2X0NA 2AFIA 1M34E 2CJFA 1VJDA 1P5JA 2QD5A 2F00A 2QTFA 3OQIA 4U7DA 2HYDA 3PQFA 1DX4A 1SN7A 2CE2X 4EUEA 3FLMA 4B4OA 1TKAA 1P1JA 1VGRA 1YZQA 4EUKA 4GWGA 1MIOB 1GTL1 2G77B 4HBGA 1XCGB 3PXGA 4E5UA 1CE8B 2HA4A 3GG9A 4UVEA 3VTZA 2NZ8A 5GINE 4O5OA 1J0EA 2IIVA 3OE4A 5DYGA 4CCAA 4Y6OA 3OJCA 1CUZA 3AT1A 4B2IA 3ANSA 2GKSA 2XMPA 4YO7A 1FSSA 2ZYHA 1P7YA 4L16A 4NBWA 3LCRA 2FPPB 3NWBA 4DGQA 1Y1QA 4PW0A 3B89A 2JDIA 4CM8A 4ZVTA 5DOVA 2ZWPA 1TM3E 2YNMA 1DT5A 4MWSA 4B7AA 5A3RA 1ZAKA 2FPGB 3NUZA 4B4VA 3Q85A 4DF3A 1X1BA 3D02A 4MUBA 3MD9A 2WJHA 2V6FA 4EHJA 5CA1F 3FHLA 4Y98A 5E7MA 1O54A 2IEIA 2R44A 5DE3A 2ISSD 1H2BA 2FXIA 4MW7A 1KEZA 1A7UA 4G3XA 1Q7GA