2HF9A

Crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
211
structure length
211
Chain Sequence
KDILKANKRLADKNRKLLNKHGVVAFDFMGAIGSGKTLLIEKLIDNLKDKYKIACIAGDVIAKFDAERMEKHGAKVVPLNTGKECHLDAHLVGHALEDLNLDEIDLLFIENVGNLICPADFDLGTHKRIVVISTTEGDDTIEKHPGIMKTADLIVINKIDLADAVGADIKKMENDAKRINPDAEVVLLSLKTMEGFDKVLEFIEKSVKEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into HypB, a GTP-binding protein that regulates metal binding.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase, metal binding protein
molecule keywords Probable hydrogenase nickel incorporation protein hypB
total genus 81
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hf9A00
1US8A 1Z6TA 4PXAA 2P0EA 4PR0A 1OE0A 2VIIA 4DCNA 2QA5A 1AA9A 1VYTA 1KAOA 4LBVA 3K0CC 2WWWA 2JLZA 1RKBA 3VKGA 1CKEA 4PPQA 1SKYB 2QGZA 1M7GA 3K53A 1BMFA 1DG3A 3AP1A 3U6BA 1XMIA 3MD0A 1N6LA 4B3CA 5AJWA 2P5TB 1Z29A 1TF5A 1XMJA 5G3ZA 2D62A 2ZR9A 1P72A 2OFXA 2WTUA 2ASEA 1KO4A 3UMFA 2EYUA 2RB4A 3IBGA 1IAQA 2BWJA 2ZR7A 4B6EA 3D3QA 721PA 2R6GA 3TAHA 3VAAA 2CJWA 1TL7C 2RHDA 3GLFB 2ZPTX 4M1TA 3AGQA 4HAZA 3NIBA 2H18A 4NCKA 4RD3A 1XPRA 2XNDA 4LWZA 5JFGA 2DYKA 2ZETA 3AF1A 4QRHA 3TAUA 1VPLA 3ZGXA 5JWHA 3AF0A 2AK2A 1KSFX 1WDTA 1UM8A 3T12A 3QE0A 2P3SA 1D2MA 3CNOA 3GJ3A 3KXKA 4EDHA 5DN6D 2GAOA 3WMEA 1Z2CA 2XNSA 3EG5A 3OZXA 4HAVA 1G8GA 2W6ID 4BUJA 1ZC3A 2JCSA 5F9FA 4LJ7A 1I4TD 1Q3TA 3UIEA 1R0XA 2PT7A 1R0ZA 1P2VA 4PSAA 4DLTA 4BFSA 4RD4A 3MFYA 4GNKA 4B44A 3A4MA 2WWIA 2XSZD 4DT1B 3FHOA 3OE7D 1W4AA 1KMHA 3EA5A 1KK0A 2J7PD 4GZLA 1P2SA 1JR3A 2ZRLA 4FMCF 4P32A 3WXMA 4CDGA 4XWOA 4P3YA 4BFXA 2HYDA 1R8SA 4OHZA 5KDLA 2ZEJA 1E0SA 4I1UA 3T1QA 2NGRA 4QBGB 3CWZA 2R9VA 1OXXK 1WB9A 2ZYVX 3RC8A 2A5JA 2BM0A 3BJIC 4L8GA 4V0KA 2VP5A 1F2TB 3P1JA 3KFVA 4WA7A 1SVOA 5AJVB 1ZM2A 4FINA 3U3MA 4G5QA 1XMVA 1WP9A 2VH5R 1IN5A 2F1HA 2FNAA 2IT1A 1G8YA 3AQ4A 1XEFA 3EW9A 4JJZA 4IOLA 2C9YA 1KIMA 3TUZC 1A1VA 1QVRA 4BQSA 4GI7A 2AWNA 2ZYUX 4UXJA 1E98A 1KO1A 1X8JA 4ESHA 5P21A 121PA 1C1YA 3RC3A 4Q4JA 4LHWA 4PPNA 2ZQ5A 1OLOA 4GT1A 1QG2A 2NZ8A 2ZS9A 1WA5A 1G8PA 3EPKA 1RYFA 2WOJA 4D0GA 2N42A 1DAEA 3LV8A 2ZJBA 1RE0A 5HCNA 4YLGA 4BFTA 4LPKA 1XCGB 3OFNA 3A58B 2EWVA 4N1AA 4NKRA 5FTKA 2J0VA 4MYUA 3IKJA 4JKIA 1H8HA 3BK7A 3QENA 1GSIA 3ADKA 3G0HA 2FEOA 3LX8A 1XBTA 3TW4A 2FU5C 2J0UA 4GMXA 1W4RA 2IWHA 4JLMA 3VR2A 2GBLA 1G3QA 2BKEA 4B2IA 2ORVA 3C4JA 1ZD9A 1KZGB 4LI0A 2XTZA 4A0HA 4Z1MD 3T61A 4B3GA 1D9ZA 4BECA 2C96A 3OEED 1N5IA 3UG7A 4FWIB 2D3WA 3AVTA 1KYIA 2CL7X 2QU8A 2R62A 3GPLA 1SXJD 4AKHA 2IUTA 3QKRB 4DSNA 4Q03A 3GLFE 4QHTA 4IVRA 1AQYA 3FWYA 4DXAA 2RHMA 4KJZA 2YWHA 4Q5IA 4AK9A 3KDSE 3PITA 5FBWB 1T0HB 2QM8A 1YQTA 5J4LA 3AVXA 4BZXA 2WHXA 4TMWA 3MG9A 3TE6A 3B5JA 3ZDQA 2NPIA 1SXJC 5AJZA 3V00A 1VCIA 5EE0A 4IOKA 4TZ6A 5FTLA 1KJZA 1DOAA 4LY6A 2VQSA 2CLSA 3W5JA 3VX4A 4KXFB 4LYJA 4UNPA 4OL0A 4QHYA 2D06A 4GDFA 3QG5A 3EC1A 1MOZA 1MV5A 4OHWA 5JS7A 4MRVA 2OO7A 2V6IA 3IQXA 3TJZA 3MLEA 3U61B 2ONJA 2FZ4A 2P65A 5LD2C 3FMFA 1TQDA 621PA 2FOLA 3LH5A 1EFHA 4DLSA 2PX0A 5AJXA 1KI6A 1EFCA 5FBRB 3EPJA 3LFUA 4Q4AA 3PCRB 1Z63A 4D25A 3NDPA 1OHHA 4HB3A 2AFHE 2PZEA 2WICA 1GRRA 4QGHA 1ELOA 4L5BA 1XTIA 2QAGC 3GLHE 3T34A 2CCGA 3Q5EA 4BRUA 3WBJA 2G1KA 5FPYA 2FDCA 1NLFA 1EWRA 2OXCA 3FE2A 1WE2A 4QGAA 5L3QB 4BFUA 2JLSA 4TMKA 2WBLC 4D4MA 3ZLJA 3AVVA 4JLKA 2YKGA 1NVVQ 1XEXA 2HLDA 2BJVA 2PCLA 3CIOA 1ZC4A 3QKTA 3TNFA 2C5LA 4WW0A 1XF9A 4GFDA 4JKYA 3B13B 4F92B 1YJ5A 1KO7A 1TADA 5CYOA 1KI8A 1EX6A 4D4LA 1S96A 5BN4A 2OESA 4UJ5A 3TMKA 1RRGA 4FWTA 4UJ3A 2ZRFA 2JJ1A 1OHHD 1AZSC 3OESA 4TSFA 2O8EB 3QJYA 1UKZA 4DLUA 1E2JA 4JLBA 2RMKA 3OF5A 2HUPA 3UWOA 3WNDA 5KSZA 2F55A 3MMPA 4JBWA 3H86A 4MKIA 1OB2A 2NO7A 3VHLB 3GJ5A 1Q0UA 2Q3HA 5C4GB 2FFQA 4MUBA 4PZZA 4M9ZA 2G9NA 3K70B 1GL7A 4BLOA 1Z07A 2DWOA 4V0NA 4LRWA 2C9CA 2VP2A 2HLDD 1GITA 1IY2A 1IY1A 1OYWA 5JEEA 1AKYA 3RWMB 4QJ5A 3LXXA 1ZNZA 2OEPA 2VA8A 2ZRPA 5E7IA 2A5FA 2WSSD 4Q4AB 5EXSA 3A1TA 4EPWA 1F3OA 2BV3A 1J8YF 4O0MA 4PX9A 1UF9A 1Z83A 4HI0E 1OYYA 2BMJA 3I8SA 1H65A 2N1BA 1EFRD 3W3ZB 1M7BA 3EZ2A 3CF0A 5DNYB 2LKCA 3NDBB 3QEJA 1M2OB 4W5HA 4RCZA 3RHFA 1G20E 3LLMA 1CP2A 5GJVC 1ZU5A 4JJKA 2EYQA 2DBYA 2IBMA 4M1SA 5BYKA 2JLXA 1OXSC 4RZUA 2O5VA 1MO5A 1AS0A 4RZXA 2OAQ1 2QAGB 1TEXA 1W4BA 2CNWA 2O8BB 1E32A 1RRPA 3I8XA 4C7OA 1N3BA 2YC4C 4GPTA 2IS4A 1NP6A 1CEEA 3IEUA 4UNQA 2WWYA 1AS3A 1BKDR 3TGPA 4LGMA 2PL3A 3BH6A 2WIAA 4F7WA 4AKGA 3WMGA 4KHZA 3TUJC 5DLQC 2FPKA 2IYVA 3M6AA 1OKKD 3X2SA 1HA3A 1XEWX 5GJCA 2VBCA 2X8AA 5KDDA 4A6PA 2BMFA 3PEVA 1DEKA 2F9LA 4BEBA 5CIQA 4JLPA 2NPFA 4ABYA 3ZZ0A 2YV5A 1TU4A 3AP3A 1J8MF 2WMOB 4IEIA 4C9BA 1LNZA 4KLZA 4MQBA 2DR3A 1CULC 5FOXA 1E9AA 3CKLA 2NQ2C 4EFLA 4MYHA 5JRJA 4Z51A 2B7CA 4PSKA 3B2EA 5TVKA 2HT1A 3HWSA 1SVWA 3QBTA 4PAOA 5JI2E 3GLGB 5KU1A 2GXQA 1CTQA 5HZKA 2W2TA 1OKKA 1XX6A 2QZ4A 1GP2A 3KJHA 1EK0A 5K8TA 1YU9A 3KTAA 3R20A 4YONB 1NBME 1RRFA 2W58A 3K9LA 1BYUA 4U02A 5CM9C 3CF6R 2R6CA 5G41A 2GVDC 2ZTSA 1MRSA 2WAYA 5EXTA 1W0KD 1R2QA 1KMQA 3LY5A 4M1MA 5E4FA 1D6JA 1E2FA 3E70C 4NCIA 5CLLA 4URZR 2F7SA 3OIUA 4IVPA 5E7MA 3IDQA 3U7HB 2QENA 2WWHA 2RH5A 1NN0A 1A4RA 3B1YA 1E69A 1KDOA 2RGGA 1IJFA 2GETA 4FD2A 4BZQA 1PLJA 2VHUA 2Q21A 1XJ0A 2A5DA 4LK2A 1WCV1 3U3JA 2OT3B 1GKYA 2C04A 2JDID 3CBQA 1F2UA 2WJVA 1EWQA 3RS4A 4NCHA 4XSGA 4OHXA 2XZOA 1HUQA 2IYSA 2CL6X 4IXNA 2DFTA 4OYHA 4K81B 5F2EA 3UKDA 1C9KA 2ZXUA 2ZS8A 3BRWD 3QF4B 4LBZA 4XD7D 1D8TA 4KBGA 1KI2A 3GJ6A 4QGGA 3R9WA 2QSYA 1ZNXA 1R0WA 3DHWC 2ZRAA 3LA6A 1A2KC 4TMVA 2BEKA 5JZVA 3IIJA 4URXR 1FX0A 3PEUA 5FBVB 2QE7A 1XXHB 4OK5A 1HE1C 2EQBA 3K09C 2QBYA 2O8DB 1FP6A 4DC9A 1DS6A 1Q44A 5H68A 4F4JA 4DDUA 4NYMQ 4TTPA 4US2R 4LJ4A 3SFVA 3W34A 2ZE5A 2OCPA 3SOPA 2CVFA 3HR7A 5CK5A 1YZUA 3K0AA 1ZVQA 2BCJQ 4OI0A 2CHGA 1MRNA 3CR8A 5D3QA 3AVUA 4JYBA 2NOAA 2GA8A 3F5FA 2I4IA 1E9EA 4MKHA 4ARZB 1JR3E 1NRJB 1PLKA 1UFQA 2GHIA 5DHFA 2O0KA 2ERYA 1G7SA 5AUPB 2EWWA 5FBQB 3UMSA 3UMRA 4PO1A 4URUR 3M0EA 1GFIA 4C0LA 5AK0A 5FR2A 2YWGA 3LW8A 1II8A 3B1ZA 1Z8FA 4AYWA 4C0BA 4IDHA 2IF2A 1ZBDA 1QDEA 2OCAA 3GJXC 1K6MA 3UK6A 4IHQA 5C4MA 5FOUA 4G1UC 5FTMA 5CB6A 1US8B 5KHOC 4BWYA 3LQQA 2OBMA 3W3AA 4D80A 3CNNA 1SVKA 1E2EA 2ODNA 3TW8B 1XXHE 2RKOA 1JAIA 1SGWA 2ODWA 4TL9A 5JMTA 2Z5FA 3AH8A 1A5TA 1SHZA 5DE3A 1IHUA 4DCVA 3U60B 2OE2A 3TSZA 2QRZA 5C2JB 4B34A 4HUQB 4URYR 4EAQA 4CYMA 5JLJA 3K0FA 2XAUA 1DELA 1HTWA 1Z0IA 4DDWA 1XXHA 2ATVA 3JVVA 3SYLA 5LDDC 5BXQC 5FPSA 3SEAA 5FOSA 3C41J 2G83A 2V55B 2ODBA 4BPBA 4TQ9A 4JLJA 1R6BX 3OEHD 1CJVC 4A8JB 2CCKA 1RFLA 4IDPA 2EFDB 5CDFA 3VR1A 3X1ZA 2DWQA 5LB2A 1YZNA 3GLGA 4V02A 4EQ6A 4U5XA 1DO2A 4BZPA 3RDPA 2C95A 2Q3FA 4A8JC 1P61B 3KTAB 3BFVA 1ZW6A 2ZE8A 4US1R 2IEYA 2R44A 4AYTA 4URVR 3FDIA 4QC2A 2SHKA 4NYJQ 1T3SA 4LBYA 1XJCA 4E22A 2ZRNA 1U9IA 1KSGA 4FMDB 3SN6A 2JATA 1JPNA 3A1SA 4ACAA 2G3YA 2GNOA 3QQ5A 1RPZA 1ZINA 1V43A 4Q66C 3T5DA 4TL7A 4BE7B 4DT1A 3QVUA 1AS2A 3O47A 4QGFA 1XRJA 3PUXA 1E79D 3KXIA 3QG1A 4TMXA 2F1JA 2IXGA 1B23P 1KI4A 3U44B 1XD2A 1N5KA 1FNMA 2JLWA 3EZ6A 2H5EA 1OIXA 5ANRB 4DDTA 4Q1CA 2J7KA 5E7JA 2XB4A 5AR1A 2CHVA 4A82A 3AKEA 4P4UA 4TLAA 4XTRA 1BIFA 3AVYA 3HU3A 5DH9A 2QAJA 2B8WA 2IK8A 2ZS7A 4O2LA 2FV8A 1ZJ6A 2ZROA 4HLDA 2CVHA 3X1WA 5BW8A 1MR3F 3MWYW 4BLPA 3RS5A 4RKFA 2XNDD 3I32A 1TQ4A 1LFDB 4Q1FA 4NL4H 4DLVA 1E2IA 1SQ5A 4EPYA 2X77A 1Q22A 4RVCA 4XVQA 1NSTA 3L0OA 3THYA 1YZGA 3LQRA 4MA4A 5KNDA 1WXQA 1E79A 1U0LA 2JJ2D 4JVNA 4PQRA 4CF7A 3D7MA 5HCIA 5EE3A 2OG2A 4GRAA 5HKKD 4BLRA 1XPOA 4AI6A 2L0XA 2W6IA 4W5WA 1KOFA 2XJ4A 5J5CA 1UAAA 1GDDA 3O8BA 1E9BA 3AUXA 1KY3A 3SFZA 1KMHB 1GIAA 3IQWA 4OQMA 1Z0FA 1M34E 2ZI3A 4NYIQ 2PEZA 4NZYA 5J4VA 1Y3AA 3T1VA 4DZZA 2Q3MA 2A9KA 1AZTA 5UKDA 4US0R 3K70D 1JXOA 4MKGA 4JSTA 3UXMA 3BFKA 4KLNA 2HCBA 5CITA 2HDNB 3B1WA 3PJRA 3ADCA 2J7PA 4GOXA 2HJGA 2PT5A 3Q3JB 5FH9A 4C30A 4OQLA 3GJ7A 4N0DA 1G3UA 4V03A 1NY6A 3VX3A 5B58C 4ZKDA 5L3SA 3OIVA 1X1RA 5JRZA 3QY0A 4PC3A 2FF7A 2JJ2A 2MSDB 1P3JA 1SXJA 1KI9A 4NH0A 4F93B 3QVVA 4FXPA 3HR8A 1II0A 1G17A 2FZLA 421PA 4IRUB 1PUJA 4YQFA 4PFSA 2GCOA 4TL6A 4Y0VA 2RGNC 2QTVB 2BMEA 1ZYUA 3QKRA 2VHQA 1OH6A 2E9SA 2XZPA 1N6IA 4JL8A 1XDBA 2QP4A 1OH5A 1N6OA 1XCPA 2ANCA 1RVDA 1N25A 2FFAA 2OSBA 2B6HA 3KQLA 4QJ4A 4QNRA 4POAA 2OILA 4PO8A 4QBHA 5FOTA 4AC9A 3W8NA 5GJBA 1P60A 3GEIA 1E0KA 3P4YA 3EIQA 4JMPA 4TQAA 4P4SA 3GLGE 1M8PA 1L2TA 5D3MA 1SKQA 1ZCAA 1H8ED 3W5IA 1W47A 2VTKA 1E1QA 1XNJA 4A8JA 5SZJA 1TPZA 4NDZA 2VHTA 1CXZA 1S1MA 1E4YA 4KVAA 1E2GA 1ZUHA 2D2EA 4FCVA 5SZIA 3Q9LA 3UPUA 2OBNA 1HT1E 1YRAA 1SKYE 5FFMA 4Q48A 4IXMA 1M1YE 4PTLA 1GL9B 3T1OA 1IONA 3AKCA 4ERNA 1NG1A 2ZIAA 3FKQA 4CT5A 1MT0A 1XWIA 1G21E 4HYYA 2HXSA 3QBVA 4ITRC 4M53A 5EUMA 1PVOA 3QEOA 5CJ2A 4KO8A 2WKRA 3IEVA 3DZDA 2IL1A 1XD8A 4LYAA 2OLKA 3SNHA 2FGJA 1WBBA 1LS6A 1ZM7A 4BEJA 4Z1MA 1KK2A 3I73A 5H8WA 3ZQ6A 3K8YA 4OJQA 1H8EA 2F9MA 5DIFA 4XVUA 1MH1A 4Q4HA 4LV6A 3I1FA 1UDWA 4DLRA 4TLEA 4XVRA 4YMVA 2GCOB 5FUYA 4NP6A 2JJ1D 3TSWA 5TV2A 2RAPA 1RIFA 2EFEB 4KYUA 4II7A 4PANA 2XB2A 1XTQA 4TSFD 2VP9A 1XP8A 2BEJA 3DKVA 1VIYA 1MO4A 1R0YA 221PA 4CW7A 3PV0A 3D8BA 2DY1A 4HDQB 2ATXA 2Q0HA 1J7KA 3B78A 3IGFA 1SVLA 4UXIA 5F98A 2O8DA 1OXTA 3R7WB 1DADA 4PPFA 4W5JA 3SJZA 4DCTA 3J81k 1ZM9A 3DOFA 2DCUA 3A4NA 2F1RA 4G5OA 3MRSA 4E5UA 1T5LA 3I5XA 5KOYA 1W36B 4HAXA 3RRNA 2ZANA 4Q7KA 1G7RA 5FI1B 1VDZA 4C2TA 3AM1A 3QXJA 3NBXX 4ACBA 2R6DA 1JAHA 2ZSFA 1E2HA 4I99A 4MYTA 3TRFA 2D7DA 2PMDA 3KKQA 1AN0A 1KDPA 2E1RA 3BBPA 3PENA 2GJKA 5HTKA 3R9XA 1VYUA 4Q00A 3SDZA 5AUNB 4R98A 1W44A 2IA5A 3DVLA 5E95A 1T6NA 3ASZA 1TQ6A 1PUIA 1YZTA 2GJAA 3BD9A 2GEVA 2KJQA 2PH1A 3X1XA 4E09A 4L15A 3I72A 5AUQA 3U3OA 1KI7A 3K9HA 4L9SA 5TXGA 3TBKA 1D2NA 3EXAA 2LKDA 4B73A 1U94A 4Q21A 4WZ6A 3CX8A 4Q4HB 4N3NA 3PEYA 2KE5A 1E0JA 4P31A 2DPXA 5JSZB 4MRSA 3SHFA 3ICQB 1WMSA 5EE9A 3EZ9A 3WYAA 2IYRA 1X3SA 1P7CA 1F6BA 1Z6AA 1NIPA 4C7OB 1ZIOA 3CPJB 1NY5A 2PLRA 4LV5B 4FW9A 3B9PA 2DFKB 2QPAA 5JWRA 3TVDA 5HR5A 4EJSA 5F3WB 3PQCA 3GLHB 4OI2A 3R7WA 5JEDA 4BLQA 1T0JB 1GAJA 1GRQA 3FVQA 2V7QD 4H9GA 4IDOA 4B3DA 1OT3A 2FSHA 3HYTA 4NE2A 2MMGA 2CE7A 4JVSB 4WXRA 2JLQA 1XD9A 1FMJA 2ZUBA 1S9DA 2QPOA 2LCFA 3KKMA 1YR7A 3QIAA 5JCPA 3EC2A 4L16A 4OI4A 2ZE7A 2H8KA 2PX3A 2NO1A 2IS1A 1LF5A 1TNDA 5CYPA 3RAPR 3FHTA 1EFRA 3L8ZA 1FUUA 2VSOA 2W6JA 4IEEA 1UJ2A 1U8AA 1L7VC 1CBUA 3IO5A 4FMCB 2IUUA 2QNRA 5KPDA 2CMKA 2QAGA 3EWSA 4D0LB 1EFUA 3RS2A 1R5NA 4LC0A 1GOTA 1Z06A 2J3EA 5J4KA 1G16A 4IDNA 1GNQA 3ADDA 3GFOA 1O3YA 1D9XA 2FN4A 2REBA 3GJ8A 4B47A 4FCTA 4EFNA 3MCAA 3VKWA 2CNWD 1II9A 3THXA 1ZCBA 4R7ZA 1AM4D 2YINC 3L2OB 1TQ2A 4TL8A 3U7GA 4RD6A 2VEDA 2ZAMA 4MGKR 2MMCA 1R8QA 3WHKA 4XIGS 3NHAA 2OFWA 3KKPA 1YR8A 4TYQA 3L82B 4V0LA 4GP6A 1EX7A 1DPFA 1N0UA 4D6PA 2AD1A 4Q1BA 4C0HA 2CLDX 3BH7A 2R6FA 2OZEA 2G77B 4QNMA 3HDTA 1G6OA 4B2LA 4RJLA 1UEIA 4ASUA 1YVDA 3TQCA 4XH9B 1R5BA 4C3ZA 2F1IA 3Q7QA 5CK4A 3TK1A 2AL7A 4KYIB 1L8QA 4A36A 1N6RA 1QHNA 4IKEA 2GDJA 2B8TA 1Z47A 3BIFA 1Z3IX 3GQBA 1IY0A 4G3XA 4HLUC 4UNRA 1BOFA 4TQUS 1XTSA 4Q1EA 1FP7A 3SS8A 2ORIA 3BB4A 4RD1A 1FQJA 3P26A 4LV8B 3ZYCA 3H0KA 3HP1A 5DHAA 4NPHA 2NZJA 4M2LA 2NTYC 3EZFA 4I1VA 1G18A 1U8ZA 3KUDA 1NBMD 2G0NA 1E2DA 2WJHA 4LHXA 4A2WA 1KNXA 2BVNA 3B1XA 4L9WA 5BQ5A 3TQFA 2CEAA 2FFBA 2WAXA 2V4ZA 3VKHA 1XTKA 4AG6A 3QXXA 3QPVA 3ONWA 5J40A 2GK7A 5L3SB 4TYNA 3FPAA 3MJHA 3LW7A 1PLLA 3BGWA 3MWJA 4OK3A 2ZE6A 3NWJA 4Q7LA 1VCNA 1FQKA 2QEQA 1W0JA 1E0AA 2FE4A 3SR0A 4HAYA 2BHRA 1K5DA 4M1KA 1G5RA 1YZKA 1ZD8A 3SYNA 3VR5A 3HPRA 4ZDWA 1DAFA 1D2EA 2JDIA 1DAHA 1VG0B 3PIRA 2QQEA 1Z0AA 4NCJA 1LTQA 2RGBA 4HEJA 2OAP1 4TT3A 2IYZA 4CEIB 3AVPA 3AP2A 1E9FA 4NBSA 1B0UA 5L3VA 3AF4A 4RY2A 4Z8XA 5M04A 5ELXA 3GFPA 8OHMA 5SZKB 2GKSA 3DM5A 1HQYE 4B74A 4HATA 4C2UA 4M1WA 1KO8A 4NTZA 4DCUA 2O8EA 1YZQA 2QQ0A 2NG1A 1DO0A 2QSZA 2GJSA 1W48A 1COWD 1R10A 5EP4A 3R9IA 4MGYR 1EXMA 3WYGA 1NN1A 2ZAOA 3LD9A 5C18A 2ZRHA 5DI3A 4Z54A 4M9XA 1GRNA 1BMFD 4GBMA 1W46A 2IYXA 3DDCA 4LJ5A 5GVSA 4LHVA 1W36D 4A4DA 1IBRA 1NLYA 1P62B 4TN1A 1FW6A 2C99A 4AURA 5JWOA 3MSXA 2ZJ5A 2J41A 1YR6A 4OKSA 3KJGA 2QN6A 1CF4A 3RS7A 4A15A 4B71A 2FEMA 3SJBA 2FSIA 4M21A 3RWOA 4D81A 1E9DA 2ZJYA 4P0TA 3SJAA 2BBOA 1ODFA 1NVVR 3DOEA 4WIAA 2J0UB 2OCBA 3PUVA 1YHNA 1G9XA 3DPUA 5J4YA 1JBKA 3T35A 1NJGA 3TR0A 1G3IA 4KAXA 3V9PA 1W1WA 1UKVY 1JJ7A 4PSVA 5GVRA 1R7RA 4GOJA 4DIDA 5DN6A 3AUYA 1JECA 2V6JA 3ZVNA 1VYVA 4CEIA 2Q9CA 2RGEA 2NMVA 1ZNYA 4R9UC 1W2GA 3K0FB 1XTRA 2OHFA 1JQJC 3N2EA 1XD2B 4RZ3A 4B6FA 1J2JA 2KI5A 4PHTA 5JJIA 1J90A 2Z83A 2ZU0C 3RRMA 2X1VA 3BB1A 1RC8A 4KVGA 2VF7A 4FIDA 3PUZA 2PJRA 1QHGA 2MSCB 4PPGA 4LOAA 2HJVA 4LPSA 4GOKA 2PMKA 2QRNA 4LYFA 5H1YA 3KQUA 3WP0A 1CIPA 3A6PC 1SULA 4L4UA 5FBLB 2KWIA 2ZYTX 3THOA 5KNCA 4C4PA 2AKYA 4RFVA 4A0GA 4UKDA 2F6RA 4FI3C 3TUIC 5G53C 5HKKA 1LW7A 2CDNA 3K0SA 3IILA 2P6UA 5FL7A 2R6AA 3K0CA 1W49A 4ON9A 3H4MA 2PJZA 4B75A 2Z4SA 1S0UA 2BCGY 1NVUQ 1AGRA 4K46A 4I4LA 3FGNA 1XB2A 3BWDD 2FSFA 4CEJA 1TEVA 1ZAKA 2CL0X 4WBSA 4HLUA 1I4DD 1Z0DA 3HU1A 2VO1A 4MUAA 3P32A 3RSOA 4ZDJA 5L3QA 1LVGA 4OQNA 1JEDA 4ZCMA 1T9HA 3U44A 1N6HA 1WF3A 1HE8B 3WP1B 2GJ8A 2AN9A 2RCNA 4I1OA 4PAQA 5K8IA 2EVWX 5KSYA 1T3LA 1P5ZB 4UNSA 3TIFA 4DSUA 2FSGA 2GCPA 1Z5ZA 2CCJA 3KB2A 2FPMA 1TF2A 2QGNA 2UZ3A 3RLFA 1ZNWA 4I1SA 1VMAA 3AEZA 3ADBA 2GRJA 4IJMA 2XZLA 1SXJB 3LVRE 5K8UA 4EJSB 4LUCA 2REOA 4DBLC 3EX7C 1W5SA 4QG7A 4QM6A 1UDXA 3BFXA 1DVRA 4JT2A 1H8HD 4HZUA 4Q02A 3THWA 1NN3A 1T8TA 1E2NA 1GILA 3LVQE 2GZDA 2O8FA 3WHLA 1EESA 3LDAA 3WNBA 3WRXC 3ASYA 4GMDA 3BOSA 1Z28A 3QXSA 3O8RA 2W00A 1E6CA 2IYLD 3NBYC 4V0ME 2QG6A 2PLFA 1ZM4A 3OIWA 3RS0A 1EG7A 2IYTA 4XSHA 4BLSA 4NYJR 4LJAA 3U5ZB 3MUFA 2R2AA 5FUXA 1QHXA 4V0OA 5CLQA 2B92A 2OV2A 821PA 5JHHB 3AF3A 3QKUA 3GLIE 2NO6A 4DJTA 4JL6A 3IIKA 5KYKA 4GZMA 3KQNA 4M0LA 4DB2A 1QHIA 1T3HA 2QMOA 3KQKA 3CW2A 1HV8A 1T5IA 1O87A 3C5CA 2WKPA 3SQWA 3D6TB 3K9GA 3EIHA 1U0HC 4M8NE 2VRWA 3X1YA 2R8RA 5TMPA 4QXAA 2JLRA 2IYWA 4ZDKA 3TVTA 4O3MA 1XZPA 3VR3A 2BC9A 2W0SA 1VKJA 1YRBA 1Z2AA 1IXSB 1G41A 1II8B 2VLIA 2N46A 3L43A 5DYIA 5AUOB 3V4FA 3EIEA 2WPDD 1VIAA 4QBFA 2GESA 3SBDA 4C0KA 2WWXA 3FKSA 2IUSA 2G6BA 5GJWC 1E3MA 2J87A 4RD2A 4OQFA 2YC2C 5FI0B 2ZI5A 3A1VA 4LDJA 1OJLA 3QF7A 2QTFA 2GXUA 3SI7A 1BS1A 1CS4C 3MGCA 4XWKA 5B2ZA 4QL3A 4LZZA 5JCZA 4W7SA 4Q9IA 1HQCA 2PCJA 5JJKA 1JPJA 3I4LA 2VSXA 3B9QA 1ESMA 2QMEA 3A8TA 2PZFA 3GCGA 2IYQA 1S3SA 1U81A 1I2DA 3QXCA 3IIMA 3WRYC 4FMDF 1GZSA 3OHMA 1Q1QA 3U4QB 3OAAA 3B85A 4C0JA 4F4IA 2HF9A 2RGXA 1NMYA 3OEEA 4TWZA 1E1QD 4RFSA 3ZS9A 4W9MC 3LXRA 3VTKA 2WVJA 1JR6A 2NIPA 3H84A 1E1RA 1ZIPA 4RD0A 4JL5A 3N2IA 2PEYA 3C15C 2V1UA 2IC5A 1XCMA 1ANKA 4S35A 2QT1A 1QRAA 2AK3A 1XEWY 4JIMA 3WBKA 1M74A 5EE5B 3FMOB 4MRPA 3RVBA 3QSYA 4NU0A 1QHHA 3FYHA 2JEOA 1XMSA 3I92A 2A3RA 4ZO4A 4OJKA 4PZYA 4BGDA 4B3BA 1IQPA 1A2BA 2WWGA 5B64A 1KGDA 3C8UA 2B7BA 1TX4B 1IOZA 1AGPA 3F0TA 1DAMA 4JYCA 3CNLA 3PUYA 2C77A 3CWQA 3QPUA 3CRVA 3DKPA 4OI1A 3REFA 3T15A 3EASA 1YKSA 3VFDA 4QJ3A 2A78A 4NYIR 2V1XA 521PA 3SHWA 2D74A 4YXWD 3TR5A 3REGA 1E1RD 2W2XA 1U99A 2BIFA 2H7VA 3QOFA 3RRYA 1Q21A 4AKIA 1IN7A 3OIYA 1PZNA 4XJXA 2EW1A 3RABA 1ONBA 1UBGA 3THWB 1A82A 3CO5A 3QF4A 4PHFA 4RSGA 3W9YA 1DBSA 4D2IA 3B8HA 1ZD1A 3BERA 1Q12A 3K0EA 1Q1EA 3RSLA 2XXAA 2IF0A 2REXB 2ZSBA 3PFIA 4QM7A 3MWKA 1XU4A 1G3RA 3IPXA 4BFYA 2ZITA 3KUCA 2WSMA 3LRPA 4OHYA 4AIIA 4A0RA 4DB4A 4NCNA 1VG8A 3Q72A 4PAMA 3WMFA 4Q7MB 2AXPA 4MYCA 4WXPA 4YXWA 3H1TA 1Z6YA 2V54A 4IOJA 4DLWA 4ZI3A 4JLDA 1AJEA 2CK3A 2BBTA 1U8YA 3TKLA 2A7QA 5LBIA 3NBFA 3WY9A 3CM0A 1GTVA 4A0FA 1QHHB 3T1TA 2FH5B 3CONA 4KI0A 2QROA 5TB5A 1ZUNB 2FX3A 1P73A 2ZR0A 3LO5A 4QHSA 2D2FA 5EXXA 5LPNA 4UXHA 2VP0A 2ZRDA 5LD2B 1KDRA 4KV9A 5JSZA 1ZM3A 2GBLC 4OQXA 3KQHA 2GK6A 3H2YA 3PG5A 2WJYA 4PO9A 1NF3A 1RW4A 4H1UA 4KODA 3BAFA 4JVLA 1IN8A 5H70A 4CVNA 5BWMA 1YE8A 3Q5DA 2ZUDA 3IUYA 3N5CA 2JLVA 2RGNA 4CGZA 1SVIA 3SE0A 2CXXA 4PC6A 4MRNA 1Z6GA 3RRZA 3GLHA 3VR6A 5KDOA 1P4SA 3GFTA 2AKAB 4Q1DA 4MDFA 1NI3A 2F43A 2ZUCA 1CU1A 1LB1B 2BDTA 4ASUD 3IHWA 2Q6TA 3AV0B 1DE0A 4BLTA 2GXSA 3EAQA 3ND9A 2A30A 2V7QA 3AF2A 3CLVA 3CRRA 3RANA 4RFSB 4LJYA 1Q20A 4P4SB 5D3MB 4AD8A 1U0JA 1N2CE 1E2LA 2C8VA 1OSNA 2XEXA 4FN5A 4GL2A 1QHSA 2IXFA 4IW3B 3CZQA 1RJ9B 2Z43A 3LBHA 1SVSA 2BJWA 3G82C 4RKEA 4WZBE 5F9HA 2VYFA 5EZ6B 2FPLA 1Q57A 1DAKA 1E2PA 1S9HA 2J9RA 4JVMA 1E9RA 2W6JD 1FL9A 2ZRMA 3B7GA 1G7CA 4XD7A 1LV7A 3IO3A 5TY0A 2VP4A 2GEUA 2FGKA 4JLOA 2YWEA 3KXLA 3SU8A 5AWFC 3EZ7A 4LCBA 2EFHB 5E3HA 2ERXA 5IK2D 3CRW1 2O8BA 2X19A 4D4KA 2FWRA 3W6PA 5SZHB 1JI0A 3CF2A 1G6HA 2H57A 4KBFA 1NKSA 4LBWA 5DYGA 3S1AA 3EWAA 2Q9BA 4YMTA 4I81A 3VNVA 1QBKC 2GILA 2QTHA 1HY3A 2FMXA 3CB4A 4KU4A 4Q18A 4EFMA 2CE2X 4U00A 5FL3A 3ZVLA 5IHPA 4KFRA 2O8CA 3ZVRA 3NH6A 3VU9A 4HZUB 2HXYA 4R71A 2D4HA 1S1CA 2AX4A 1A7JA 4B2PA 4B3XA 4M1OA 2C78A 2BMDA 4NONA 1VCOA 3BB3A 3DEFA 2ZI6A 3U2QA 2KBEA 2P2LA 2UVQA 5A5GA 1GNPA 1HT2E 2GCNA 4DRZA 1UBCA 4Q4JB 2H16A 3GLIB 1SXJE 4PQYA 1NN5A 3VQTA 1COWA 1VECA 1OF1A 1MABA 4KITB 1RYHA 2IYYA 4F38A 4ZI2A 5KSPA 5CDFE 1SZPA 2Z6VA 1Q3HA 4X8MA 4PZLA 2WJJA 4DVGA 2VL7A 1G8FA 1C4OA 4B35A 4CZ2A 1RJ9A 2J5XA 4JSYA 4M22A 4DLYA 1WRBA 4MDEA 2PBRA 2IX3A 3MJRA 2IWRA 2A2ZA 4HB0A 4XWAA 3FMPB 4JS0A 2QMHA 1NBMA 5FUWA 1HH4A 5IF9A 1S4QA 3AGPA 4G5GA 4Q19A 5FUVA 1Z22A 2VHJA 5DI9A 3P4XA 5EUQB 1XJQA 2I1VB 2OFOA 3NBZC 4G01B 3AB3A 3DMNA 1Z0JA 1DARA 4E03A 1G19A 4DUGD 2HV8A 1G1MA 2ANBA 3E2IA 4Q9KA 3KB1A 2OXRA 2IEZA 4GSYA 2XOKA 3ETLA 1GWNA 3A37A 5EP1A 1HURA 3OEHA 2GTPA 4B33A 2QP9X 5C46F 1LY1A 1EGAA 3FOZA 4WOPA 4TT3D 4EKDA 1PJRA 2O8CB 4HLQB 4YMWA 4MKFA 1UPTA 2IW3A 2DWPA 4IDQA 2ZM5A 1XFAA 1N5JA 4DEYA 4S2EA 5L8VA 3GEHA 4Q1AA 1UKYA 2F43B 2I1QA 3GD7A 1QF9A 2VPPA 5JBQA 2X2EA 4LHZA 5L3RA 1X86B 3MAAC 1X8LA 4P4TA 1KI3A 3GLIA 3QI2A 1KO5A 2C9OA 1KNQA 4LSGA 4A9AA 3RYTC 2B21A 2E87A 1IM2A 2DFLA 3UANA 2HT6A 1TTTA 1MO3A 4FMBB 3WYFA 2AXNA 1G8HA 4ZKEA 3GLFA 1I2MA 1G5PA 1KI6B 1XZQA 4OBEA 2WKQA 4TLDA 3THYB 1QG4A 4WAUA 4DLZA 3LWNA 3L0PA 5JI3E 3QKSA 2Q9AA 3L0IB 5EE1A 4XOIA 1GKIA 3ZIAA 4M9SA 3EARA 1OFIA 3Q7PA 1NVWQ 3IHLA 5FL7D 5FTNA 4NYMR 5TDHA 3BORA 2J59A 2YWFA 4O25A 2QUZA 5KUTA 5JJLA 3SBEA 1P6XA 3IBYA 1X8KA 4ZCLA 5HPYB 4AY2A 1ZUIA 1KY2A 4X8LA 2G0TA 4R2HA 5EJEA 2AD5A 3NHBA 3Q85A 4LJ6A 1CJMA 2XSZA 6Q21A 5JS8A 4DSOA 4PC7A 1TMKA 2QY9A 5IRCD 3LX5A 3K09A 1P9RA 4TYWA 4EJSC 2MSEB 2WMNB 1FMLA 1DG1G 4DEXA 2CLCX 2K5UA 1KSJA 1P9NA 2ZRCA 2JASA 1NVXQ 4DDVA 1XPUA 1GG2A 2H92A 2ZRIA 2IHBA 3KZ1E 5B57C 1FUKA 1ZMXA 4IVQA 1N6NA 4F91B 3ZIAD 3SQXA 4MRRA 1CR0A 4OK6A 4WVFA 3LLUA 1CJUC 1OIWA 1U98A 3NXSA 3KFXA 2ORWA 3WNCA 3EPHA 3CR7A 4IOMA 4E07A 5JECA 2A5YB 4LJ9A 3Q8XB 4ZDIA 1F2TA 2KB0A 1GUAA 3U7FB 1UKEA 3ZD7A 4YC7A 3ZD6A 2WWFA 1OV4A 4DLXA 2C2HA 1FX0B 4HSEA 4RCYA 4IFBA 4JZKA 4Q9HA 3KL4A 4CEHA 2WJIA 5JHGB 3NEYA 3FFBA 2J46A 5GADl 2QORA 1E94E 2O8FB 3P20A 1DAIA 2GZHA 3MWLA 1Z6XA 4IFEA 4EPXA 1UBFA 4CEJB 4JT4A 4A2QA 2G88A 2P5SA 3FFAA 2VP6A 3VMFA 2RGCA 2CBZA 4U7DA 3RNLA 1OB5A 1JEEA 2WM9B 4A1FA 4KFUA 1X6VA 4PQFA 5KPJA 3VNUA 2AFIE 1I4LD 2KBFA 1OH7A 3OE7A 2GZAA 1KHTA 1Z08A 2ZRGA 4Q01A 3FB4A 1JR3D 5FOVA 2O0JA 2BOVA 3O8DA 2DHRA 1IJEA 3L0SA 1MKYA 1QZXA 4DHEA 3D31A 1WQ1R 5K8LA 5G3YA 1E4VA 2UZIR 3ND8A 3B1VA 4HAUA 2QP3A 1ZRHA 3ZZUA 2V9PA 2XGJA 1RRCA 3KX2A 1XTJA 1R5OA 3PXGA 1L4YA 1Q1ZA 4DIEA 4M1YA 4RZ2A 3TH5A 4D82A 2RGAA 3ZS8A 3N70A 3C14C 1NSFA 5CM8B 4ZPXA 1E2KA 1E2MA 1G64A 4HUTA 2GVZC 3VR4A 3K70C 4DSTA 1TU3A 3AVWA 1EFTA 2J0QA 1NMZA 2RGDA 5CJPA 4URWR 5EP3A 1U90A 4A92A 5BN5A 3M4YA 3ECCA 1OFHA 4JBYA 4OHVA 3OAAD 3JVUA 1UEJA 1FFHA 1VCMA 3CX7A 3SYKA 2JJ8A 2ZI7A 1OFTA 4G0NA 3FTQA 5DI3B 1P9WA 2EFGA 2WJGA 4F4CA 1KK1A 1CJTC 3FHCB 5FPKA 3CPEA 1ZU4A 2J0SA 3OFND 4AG5A 4LHYA 2GXAA 1U9IC 3RS3A 2ZVQX 4AKEA 4ILEA 1F48A 1KTVA 3FMIA 1W2HA 3NTUA 5KSOA 3HPQA 3CH4B 3KJEA 3G5UA 2HCJB 1FTSA 1IXRC 2WV9A 1U2RA 3NC0C 4Z8YA 2WIBA 4BFVA 3ZVMA 1Q1BA 4TMZA 2JIZD 2WPDA 1VG9B 4PHGA 2A5GA 1JQLB 1KJYA 3DL0A 1E9CA 5FPHA 4AWXA 3B6EA 1DAGA 3FKSD 3U7EB 1N5LA 3U6KA 1J99A 3VU9B 2ZJ2A 3BS4A 5HZHA 4JLVA 1LF0A 1YZLA 3DMDA 3I3SR 2HEIA 3AKYA 4R2IA 1M6NA 3UG6A 2YOGA 3BXZA 2XJ9A 3PR1A 3TLXA 4KFSA 1J70A 5KTYA 1N0VC 1NNEA 4QBIA 4PC2A 4H1VA 1AIPA 3ZJYA 4QKQA 4HDCA 2QBYB 1N6PA 2NO0A 4JBXA 4CEHB 4YDHB 4EIWA 2J1LA 4C0AC 2CJWB 3AVOA 1MO6A 3KKOA 2QT0A 3KKNA 5FR1A 2H17A 3I62A 2O52A 2JA1A 5A4JA 2JIZA 1JJVA 1GKUB 2AHOA 4Q47A 2ZYWX 3SC3A 4TTQA 2QI9C 1AK2A 3C5HA 3CPHA 4YMSA 2QMUA 1OXUA 1M7HA 1JNYA 4BRWA 3CUEF 1W36C 2DFNA 3F3YA 4UQOA 3LBIA 1K8RA 2WOOA 1P2TA 1ETUA 5EP2A 2W83A 2I3BA 4X8HA 2QPTA 3P27A 3I61A 2YYZA 3X1DA 4D4JA 3W8RA 3NKVA 1JALA 2BM1A 1XEXB 2Z0MA 4HZIA 1PV4A 3PVSA 2QL6A 3B82A 4FCWA 5KO2A 5FOWA 1CR1A 1KK3A 2GAAA 1VHLA 3U3KA 4N0EA 1E96A 2XX3A 4MH0R 4BFZA 4LX0A 2IS2A 1JXMA 2ECKA 2ZRJA 2P6RA 4G5RA 4LC1A 4B3FX 4Q9LA 1OIVA 1S2MA 3K9NA 4O2RA 4YMUA 3THXB 1N6KA 2V3CC 1CRPA 1F60A 4BASA 2OM2A 4KSBA 1GL6A 1OXVA 2OLJA 4EPVA 2GJ9A 2PZGA 4Q7JB 3GMTA 2GF9A 1NIJA 2Z4RA 1E99A 4HUQA 4LJ8A 3GEEA 2ZSAA 4Y0AA 1CR2A 5BYJA 1W4CA 2AR7A 2OCYC 2F3TA 1QVAA 3UATA 1BH2A 1Y63A 3GJ0A 4WZAE 3F8TA 2KSQA 4AYXA 1P2UA 4ZIRA 1OH8A 3HYRA 5EQTA 5BN3A 4Q9JA 1NJFA 5HE8A 1AQUA 3R8FA 1E2QA 3QKSB 4MGIR 3LBNA 3SJCA 3CRMA 2J45A 4C0SA 1OFUX 2ZJZA 4UNNA 2DB3A 1GNRA 2VHCA 2XTNA 1TAGA 4EQ6B 2JAQA 2WSSA 2F3RA 4GP7A 3NEJA 4HAWA 2H1LA 5DGXA 4TLCA 2QM7A 2CK3D 1F5NA 1GVNB 1KSHA 2O0HA 3BC1A 4TZ0A 1NG9A 1IN6A 1WBDA 1T4GA 1X1SA 2ONKA 3HJNA 3NG1A 2Y8EA 1FNNA 2GF0A 4JLNA 2G1JA 1LS1A 2D7CA 3M1IA 1G7TA 4BFWA 2ZJOA 4PHHA 3E5HA 2X2FA 4DKXA 1IXZA 2ODEA 4DCSA 2JLYA 3K1JA 3VHXA 1ZP6A 2P67A 5IK2A 3I5YA 2FFHA 2ZI4A 4NMMA 2ZSEA 2XITA 4HLCA 4QFMA 2HYIC 2ZU6A 1G5TA 5FTJA 2VSFA 1ESNA 1G4UR 2EFCB 1SHKA 1NKTA 1R4AA 2ZI9A 3TSOA 4YDSA 3HU2A 3ZQJA 4CRWB 4G5SA 2WZQA 5B30A 3ZH9B 4B76A 3PUWA 2W0MA 4TTRA 1NLZA 4A6XA 4XTCS 2LWIA 4CIDA 3S1AB 5DSZA 2FJUA 2ZJAA 3EPLA 3C16C 5IDVA 4C0QC 2AWOA 2GEDA 2IHYA 1SVMA 3NH9A 4NHOA 4TMTA 2GWHA 2ZRKA 3BE4A 4QOSA 3AVQA 1KI1A 1QHYA 2YVUA 1DTSA 3QNUA 3KJIA 5FPTA 4JLAA 4M4SA 3CZPA 2W2VA 5G40A 2YOHA 3GJ4A 3PEWA 4DWJA 5C1BA 1L4UA 2FA9A 1BO6A 2NO9A 2QE7D 2IS6A 3LNCA 1HYQA 1W0JD 4B32A 2ZJ8A 3W90A 1Z0KA 3LAWA 1TUIA 2VF8A 3QXHA 4HB4A 3CRQA 3JZAA 3U4QA 1W5TA 1KZ7B 3UWKA 1MABB 3CX6A 5KNBA 3A36A 3QUSA 2C98A 1UBEA 1NMXA 3T5GA 3ICEA 2CHQA 5CIWA 4TYYA 4TLBA 3A1UA 1NL3A 1P75A 1G4AE 4X8OA 3JZMA 3QPWA 1KDTA 4ARZA 3C7KA 1VHTA 3DO6A 1FTNA 1VTKA 1W0KA 5LB4A 2YOFA 1YR9A 4D26A 2C03A 1CR4A 4LYHA 1N0WA 1TUEA 4KCGA 2YZ2A 5TARA 3ZZTA 1V5WA 4DUGA 1AKEA 3IPYA 5CB8A 3EA0A 5AJYA 3V4RA 5EXPA 1F2UB 2OBLA 3NC1C 1JB1A 1KKLA 2XOKD 4PC1A 3W6NA 1IN4A 4A2PA 3R8CA 4ZV4A 3SZRA 2BBWA 4Q4LA 2ZSDA 2FG5A 1G291 2YHSA 3DM9B 4ZCIA 1FPMA 4P33A 1HEIA 3NVAA 2UKDA 1OW3B 4KFTA 3BH0A 5DO9A 5A0FA 2XTMA 4K8OA 3L8YA 4B43A 4EPTA 3AKDA 2IYUA 1KJWA 2ZREA 3T06B 1D5CA 1KAGA 3B60A 1TF7A 2IXEA 4ZIRB 3E1SA 3GP8A 1RZ3A 1S3GA 1W7AA 1K5GA 2YNMA 2ZRBA 1OPXA 4ESVA 3K0AB 1E9SA 2HF8A 2XXAB 1S8FA 2JGNA 4J0QA 4D0NA 2V8OA 3A1WA 1CLUA 1T8UA 4MGZR 5EZ5A 2EU8A 3O8CA 1CJKC 5IT5A 2OUKA 1G3MA 3CH5A 1FZQA 5J47A 5J4HA 1BYIA 1UADA 2R65A 1T91A 2YJTD 1VG1A 4V0MA 4MITA 1KKMA 4TYPA 4B48A 2P6NA 3W6OA 4EPRA 3DZ8A 5HE9A 3A4LA 4M9QA 4EUNA 1GM5A 1CRQA 4KSCA 1FOEB 2BKUA 4CT4B 4HDOB 2BBSA 4HB2A 3U3RA 2JLUA 2ZVPX 5DISB 2TMKA
chains in the Genus database with same CATH superfamily
2BAGA 1L4KA 3NAZA 3WRWA 3FTDA 2I2DA 2LDXA 2VDUE 5EKSA 2HV9A 2P0EA 4PR0A 2QYOA 5F51A 4DCNA 4YR9A 1VLJA 2A35A 3BIOA 4RA9B 4XA8A 5IAJA 2A1UA 2CUNA 1DZ3A 3IUMA 4FOOA 3VKGA 1PK8A 2XVAA 3KTFA 3BQ9A 5IKMA 1ZFNA 1H2ZA 2H6EA 1ULTA 3JR3A 4E5SA 1M7GA 5IM4F 3P9PA 5BWOA 2AC4A 3MINB 2Q7XA 3U6BA 1NE7A 1N6LA 2JGDB 1YB7A 4Y2JA 1Z29A 1C7IA 4FHCA 4OBXA 1XMJA 5E0KB 5G3ZA 3U48A 3WZMA 4QRIA 4EHKA 1FC0A 1P72A 2OFXA 3P9XA 3HZRA 3LL7A 3MJCA 1KO4A 1GVHA 4ZK2A 4S12A 2EYUA 5CVTA 5JC1A 1P5HA 4MS3A 4ZGWA 2PA3A 3UAZA 2BWJA 1PT5A 2WZDA 4H4EA 3IUJA 2JIQA 4HPXB 3CZMA 4FNOA 3D3QA 4TS1A 721PA 5HZGA 5DBFA 1C41A 3DT8A 4QOEA 2D1TA 1FU8A 1MJNA 1TL7C 1W85A 1R0KA 2IEDA 2DHEA 1KEWA 2AUMA 2JHAA 2ZPTX 3AGQA 4IIJB 4PTYA 2H18A 4X1IA 5L7WA 3OFKA 1XPRA 4LWZA 2CWDA 2DYKA 3MWEB 2ZETA 3AF1A 4MUKA 3I3OA 1O96A 3TAUA 1VZ3A 4EJFA 4B6PA 1GUBA 3O3OB 3E4CA 4EI2A 3T12A 4GI1A 1W94A 1D2MA 3CX3A 4WD3A 1YOVB 5DN6D 4GKJB 1I7QB 1BSVA 3TLMA 2XNSA 2RKWA 2EBHX 2R6HA 4HAVA 1WSWA 4PU0A 4BO0A 3NVDA 1QOPB 2I7XA 1CIVA 2I7DA 1TJ4A 2GEFA 2XCUA 3ILYA 1Q3TA 3MUNA 4LJ7A 1U7WA 5J2UA 4TTSA 4MWSA 2PT7A 4F8EA 2GJ4A 4PSAA 5TPWA 4DLTA 5CFMA 3RB8A 4PWZA 3U80A 4GNKA 2RKBA 5ER6A 5G1NA 3NGLA 2WWIA 2XSZD 1IC6A 4MWZA 4OJMX 2JCYA 4PINA 2XYHA 4CE6A 4DT1B 1KMHA 5JAOA 3EA5A 2R48A 3FWZA 5B37A 2X0DA 4LVCA 2BKXA 2BP7B 5KYXA 3KQTA 4UUOA 1R6UA 1KK0A 4RQBA 3WL5A 5AM3A 2WFZA 3WXMA 3GVIA 3R6LA 1FS4A 2XEDA 4FN4A 4QU0A 4WZZA 4K9KA 4B9EA 2WV7A 1I5OA 4FGUA 5JIBA 2J07A 1ZWLA 1J2RA 4C0WA 3I1YA 3E2PA 5CT4A 4OHZA 3KEFA 1L5VA 2QN3A 3L6RA 2LW7A 5KDLA 5ISMA 1H2YA 1A8UA 2AYYA 2WYIA 3NEAA 4HEA6 4I1UA 3T1QA 4F4HA 5LNK1 2QRJA 1PVVA 5DULA 3BJIC 1MFZA 4OB7A 4I4CA 4V0KA 5FNVF 3WLNA 2VP5A 2WJWA 4ATNA 4QELA 4GOMD 2ASVA 3HV0A 3KFVA 3P1JA 1SVOA 5AJVB 3U3MA 3C3JA 1HE2A 1XMVA 4OIMA 1FVFA 1FJHA 3PCTA 2ODAA 2E6KA 3B6MA 3KWJA 2Z2ZA 3CH7A 3LHSA 1WP9A 1B2LA 5K0LA 5A6SB 2NU6B 3RIXA 1KPHA 1IN5A 2F1HA 4EY7A 4BVEA 1KL7A 3PTAA 1JKFA 3G0IA 2C9YA 1KIMA 1U8XX 3ZN2A 1QVRA 4BQSA 4LMRA 4YAOA 3C3YA 3KSZO 4HQRA 2AEMA 3RT1A 1SBQA 5K0ZA 5BSVA 3SQOA 2M1XA 1KO1A 1WZIA 3HMQA 1ECGA 1NDUA 121PA 1E63A 1QTIA 5P21A 1OVGA 3CVUA 4PPNA 1WU8A 4MYRA 2ZQ5A 3UGQA 1YDHA 1U65A 1C9EA 1MRZA 2Q1UA 1V0JA 2YIDA 3NBKA 3EPKA 1VCHA 2QVYX 4X41A 4UTVA 3MMNA 2HK9A 2N42A 4I9HA 3TMYA 3WL8A 4QGSA 3W5CA 2LXNA 4I55F 1VA5A 1UDCA 2GN6A 5HCNA 1M2VB 4DLPA 2BGJA 1ND5A 2VDWB 1H6CA 4B0PA 3ZIDA 3A58B 4WKGA 2JS7A 2ZQYA 1PN3A 3I8OA 3LOPA 1RYDA 2CXPA 3A6EA 1ZD4A 1HTTA 1EK2A 2VXOA 3I0ZA 1CFJA 3A26A 3ENQA 3IKJA 4MJXA 3CUYA 3OP4A 4Z9AA 1L1RA 3K1TA 1H8HA 4B09A 2IIPA 4NATA 5ADWA 1JKXA 2AQIA 4K9OA 3E0XA 3TW4A 1L1FA 2J0UA 3E8SA 4NS1A 1IY8A 3AYZB 4P83A 4N39A 4M38A 4B2IA 2GNPA 2SKEA 1WULS 2XTZA 3QWHA 3T61A 1KVUA 4M7OA 3N59A 5LCXA 2ZZNA 2EJBA 3OEED 4B3RB 1NURA 3ASVA 2FN9A 3AVTA 5CDUA 1QIMA 4XDGA 2QU8A 2R62A 3V8BA 4ARAA 1SXJD 1HR0B 4LSZA 2IUTA 5FT9A 1DG9A 2FEKA 1BG6A 2PLNA 3H9UA 4IVRA 4QASA 1XCBA 3LSTA 3VJKA 1CQIA 4KJZA 1SKBA 3ZDBA 3TCXB 3VR0A 3PITA 5LKAA 3PFGA 1KYWA 4ZQFA 4J3JA 3QMWA 2AXQA 1PV2A 3TE6A 4HNRA 4LMPA 4NJEA 1SXJC 2XZDA 3SHQA 3L92A 4YO8A 3EZLA 1KJZA 1KFBB 3LY7A 4LY6A 1GPMA 1OREA 2CLSA 2YTZA 3W5JA 1LTHR 5KYTA 1PW7A 1C4KA 1U3UA 1QG0A 2ETXA 3AEQA 3VJMA 4F4FA 2HU7A 1A77A 3G8YA 3QG5A 2V6GA 3CTMA 1MV5A 1RTKA 3DV9A 3Q4GA 1I6MA 5T7BA 2V6IA 3IQXA 3MNFA 3TZQA 2R47A 3MLEA 4KNVA 1KERA 1KXZA 3B6ZA 4O2BB 1X15A 2HCRA 3LH5A 1U7HA 1J42A 1U04A 1KI6A 3CGGA 3O82A 5DCUA 1L7DA 3X2EA 3A1NA 3W4KA 5FBRB 1J5XA 1Q91A 3LFUA 4Q4AA 2D00A 4K1LA 2QUIA 1WDWB 3DTYA 4MDYA 3TCKA 1N4AA 1OHHA 2WVAA 1UMDA 1GPAA 4HB3A 4HNHA 2A59A 2NV6A 2PZEA 2RI1A 4K6MA 1NXXA 2WICA 1GRRA 4REOA 2QW8A 3FR7A 2WWRA 4QVIA 4MSUA 3HXOA 3HXMA 2QAGC 3K32A 1HDGO 4YJFA 4BRUA 2JD2A 4BAUA 3A6DA 5CVDA 4EMTA 4C3VA 3FJYA 4C20A 5FJIA 1FFCA 5FPYA 3N6XA 1EWRA 1WE2A 2ABWA 3IDAA 4C01A 3KQQA 5HIJA 4LWPA 4QGAA 2Y1CA 1HE5A 4X9XA 3AVVA 1WDLA 3AKZA 2OCLA 1G1AA 5JH7A 4ZYZA 2PCLA 3CIOA 1ZC4A 2PKRA 3RVQA 3SBXA 3L06A 3QKTA 3R1IA 4H0FA 3VYRB 4PFJA 2HO4A 3B13B 1C7RA 4CLOA 1KO7A 1GQ2A 3TM5A 1TADA 2HQ1A 2D0DA 3I9V1 2HUNA 1KI8A 5BSGA 3HLKA 4UAJA 1JHYA 5KVSA 1ISHA 5LP6B 4TSFA 3RROA 4XRRA 3UT0A 1B14A 1GGHA 4DLUA 4JLBA 2O8EB 2JI9A 3WV5A 8ABPA 4M8SA 2IPMA 4E1VA 1SQ0A 3UWOA 4YV7A 5I7UA 4MKIA 1OB2A 3AOEC 2NO7A 1JU3A 4P9NA 1Y81A 2I76A 2ZJ6A 2Q3HA 3GJ5A 2FFQA 4BX2A 4E7OA 4QZVA 3F3MA 3TGWA 2DWOA 4CIWA 1UZNA 1V2HE 2AG0A 2C9CA 5C34B 2VP2A 3I9JA 3KR1A 5T3YA 3RUIA 2HLDD 4PRYA 2ZJ4A 5AKYA 4BJ5A 4BQFA 1JPVA 2Y93A 3BX1A 5JEEA 4HFJA 2E1PA 4N5NA 2HF7A 5K99A 3ZUGA 2YJ4A 3NCHA 1M83A 1FFXA 1CS0B 4D8VA 2MYUA 1PZFA 4CU5A 5E7IA 4E88A 2W70A 1VFNA 5HZMA 1EIWA 1HFKA 3CN9A 3A1TA 3IAAA 3CCBA 3CUTA 4LRYA 5AKZA 4EPWA 4XQCA 1UMDB 3AHEA 2BV3A 3O5AA 1J8YF 1I33A 5JD4A 3JYPA 1ZOOA 5SYAA 4CDRA 2I3DA 1FSPA 3DHVA 4MJ7A 2R8PA 5EJAA 2Z58A 2N1BA 2QRGA 4MV5A 2BFNA 1DWPA 3GDGA 4F1JA 4R1MA 3STXA 4YMLA 4RABA 4XFKA 4W5HA 5C8XA 2CYAA 3IAFA 4RCZA 3RHFA 3OTGA 1CQPA 4DMFA 1CP2A 2ZUSA 4JT9A 1ZU5A 1DIRA 3F97A 4B3TB 4X0EA 3GDWA 4C6SA 1FS5A 2DKOA 2IBMA 3O75A 1TIKA 3NHPA 6AT1A 5FWDA 3LOQA 3H2ZA 1MW8X 1IJBA 4PRKA 5FKJA 2OAQ1 2QAGB 1ARZA 4ZI7F 1B0PA 2O8BB 3HKCA 1ZO8A 2YC4C 1KBQA 3R0XA 3BDAA 2OZVA 4FHGA 2HNKA 1DFIA 4LQLA 4PLFA 1BKDR 3TGPA 1H5QA 4ER7A 1EPUA 1CUCA 4N5LA 2B20A 3G2MA 3WMGA 5DNEA 3HFGA 3VR6H 2F8MA 4CI0B 2FPKA 4UUMA 3GBPA 5A9RA 2X9VA 3X2SA 1KVQA 2UUOA 4A6PA 2RGUA 4UQPA 3THSA 5DGTA 1GSHA 2V58A 3HJHA 4DXDA 1CG6A 1DEKA 1ORIA 1JQ3A 1Z74A 2WIGA 3ET4A 4MPDA 1JWLA 2QRKA 3W8DA 1VKZA 4O59O 4JLPA 2NPFA 3NTQA 2IEIA 1C3EA 3N0VA 1TK9A 4RTMA 3ZHTA 3T38A 1TU4A 2PUGA 3N76A 5IDQA 3L5KA 4NFHA 1KEPA 3UUEA 1A8QA 3H5RA 1QAMA 2DMRA 5FOXA 1K89A 3CKLA 1P7VA 1GO2A 1P18A 1WP4A 4XFDA 4D44A 1GY8A 1XTTA 5JRJA 1PJLA 2B7CA 1SY7A 2OENG 1P6UA 4PSKA 5DBGA 2O8VA 2PUWA 1OU0A 4LXGA 3WFJA 3BHNA 3CF4A 1EFVB 3OZBA 1LC3A 3HWWA 4C05A 1NMSA 3T9CA 1CTQA 3HCFA 4OMCA 2VRCD 1XX6A 2QZ4A 2QT9A 1QO0D 5H5JA 4EABA 1G9SA 3PCXA 5K8TA 2WTUA 1J22A 3WGHA 4F2HA 5JDCA 1RRFA 2VT7A 1N0IA 5CM9C 5G41A 4E7PA 1SRRA 3PFBA 5F52A 1JTFA 4ZVOA 5EXTA 1JFRA 4WESB 4QEZA 1PNVA 1R2QA 3MERA 3RT9A 2WG0A 5GMOA 4URZR 4HQ0A 1V8BA 1XV5A 3BGDA 4IVPA 3IDQA 2QTAA 3CEMA 4PG8A 4J3NA 1NN0A 3GFRA 4MMYB 3B1YA 3T4XA 1RZRD 1RYEA 2A9JA 4WFKA 2RI6A 4ZOEA 1IJFA 4INPA 1J2EA 3GZNA 2Q21A 3Q3VA 5K8JB 5L40A 1XJ0A 3GG9A 2GN9A 1WCV1 3VOSA 5DM60 3CBQA 3C24A 5DOVA 1PR1A 2O3JA 3ISVA 4XSGA 1Q7CA 4OHXA 3NC4A 2IYSA 1TO6A 1TRKA 1G20B 2A9QA 1E7WA 3D9QX 3HKBA 1NMQA 1C9KA 1ZXXA 2G4VA 3C70A 1RBYA 2ZXUA 2ZS8A 3O94A 3BRWD 1UJ5A 1E1MA 1T9ZA 3CEAA 3QF4B 1B1CA 1T3GA 4LXIA 5CG2A 1QQBA 1R3UA 4S0ZA 2AOTA 4K40A 4QGGA 4ZYYA 4FOPA 2QSYA 4S1PA 2H4XA 3DHWC 4L02A 4YRTA 2R7AA 2EDCA 3DLTA 4TMVA 2D13A 3IIJA 3F73A 3DYIA 1XXHB 4OK5A 2K7FA 1HE1C 2HZBA 2EQBA 3K09C 1RXUA 2ZT7A 4DC9A 1Q44A 1EQAA 3L04A 5H68A 4F4JA 3BWCA 3A9SA 4YN3A 1N9KA 3ZK8A 1X1DA 4BAZA 3SFVA 3U1BA 1S3IA 2VQ3A 3HQ4O 1UFKA 1CDOA 3SM3A 1RACA 2R6R1 2I6QA 2CVFA 1O9BA 3HR7A 4WNAA 1KR5A 1ZVQA 2BCJQ 1SOAA 3B9BA 2C1XA 1MRNA 2G71A 5WRFA 4OI0A 1B3RA 1ZAYA 1DKNA 5TGZA 1VXRA 2C7PA 4MKHA 1V26A 2PXAA 3ECAA 1JR3E 4E32A 1PLKA 2BGLA 2O0KA 5A62A 3UK7A 4JH0A 3UMSA 2QXTA 1YULA 4URUR 3GWZA 3UMRA 2DULA 3M0EA 1OPRA 5ALVA 4C0LA 5AK0A 2PY6A 2IP4A 4C2BA 1Z8FA 1H69A 2B37A 3KCNA 2DLDA 4FSDA 5JCOC 2EKDA 4RETA 4FFBA 4IDHA 1Z63A 3DFIA 1FFBA 5A4KA 2FYTA 4E5PA 2OCAA 1WQ3A 2R60A 4TUYF 2CFIA 3NKLA 1IEXA 2GI4A 5T64A 5BNZA 5C4MA 5EEHA 2GN0A 1SR8A 4H4CA 1JDTA 5CB6A 2B4TO 1US8B 1B0AA 3GROA 4IIBA 4ND3A 2PMEA 2GKGA 4L78A 2ZR8A 3LPNA 2UZ0A 2ODNA 1RLOA 3PK0A 1TU0A 1KTIA 1BGXT 5TLSA 3AI7A 1R6VA 3I04A 1SGWA 1D7AA 3MBIA 2CDAA 2ZZKA 5GIOE 3THRA 1TVEA 1CZHA 3WISA 2R00A 4KPYA 3QE9Y 4XAQA 2Z5FA 4BMCA 4GR5A 3AH8A 1UBJS 4FE3A 4RJTA 1ICEA 3C6BA 3R6TA 1DU4A 1LRKA 2NTJA 3B7WA 4S24A 3U60B 1R18A 1MJGM 1SD1A 2GK4A 5JCJD 2AOTB 2JZOA 4JI7B 2E4VA 2QRZA 2XR1A 2D2XA 3P45A 5C2JB 1WCXA 2YUTA 4B34A 1W5EA 3BK1A 4QSHA 1SUFA 4YJ3B 1K5HA 3OCZA 3R7AA 3DV2A 1OVMA 1HTWA 3LUCA 4L4ZA 3OCYA 2HJ9A 2NV0A 4LI3X 3SYLA 1NUPA 5LDDC 2RIRA 1H5NA 1QH0A 3JAKB 1N9GA 3DT6A 1RBMA 1B7GO 1Z82A 1QO7A 1R6BX 2F8LA 9MHTA 2FPGA 3BXFA 4X6UA 1JHMA 1DRUA 5H16A 3HKEA 4DMRA 2CCKA 4M99A 4YX9A 3ROZA 3M82A 3PEFA 2EFDB 4FE7A 4DYHA 2V7BA 1IIRA 1DSSG 2X1HA 3IQDB 3QIVA 3VR1A 2I34A 1U6JA 2OGSA 4U5XA 4KOEC 4EQ6A 1O4WA 2Q3FA 2QSUA 4ARSA 1V35A 1L5MA 2FWBA 3K9CA 4HNVA 3FYUC 3T1HB 4Z7QB 3S2EA 4F5ZA 3OKPA 4H6WA 1YO6A 4US1R 2CN1A 2Y6UA 4URVR 3OE5A 3AJ8A 1JG3A 4O4LB 5D7NA 3BHJA 3RU9A 4I8IA 5JMWA 3G89A 1WUTA 2ZRNA 1DXHA 2NTVA 1BEUB 5LXTB 1KZ9A 1SKAA 4W6ZA 2JATA 3TI7A 1GA4A 2PPLA 2X86A 3A1SA 1XFDA 2GNOA 1L5KA 1LQ2A 1ZINA 2E55A 3T5DA 2Q5OA 1XRPA 3ICWA 3NT4A 2H51A 3PDIA 4XPZA 5EWLB 2JGLA 5TPZD 5HIAA 1A0OA 1AS2A 1DCKA 1E79D 1JQDA 1YAHA 2IXGA 4TMXA 3LPLA 4QG3A 1KI4A 1P5RA 2UUPA 3GDFA 5DKFA 5M3BA 3WYNA 2H5EA 1RM0A 1BVUA 4C7BA 3SQNA 1FQOA 2J7KA 2Q5FA 1SB8A 3JD0A 2XB4A 1PCXA 2WT9A 3CNQS 3H6KA 1HXHA 3ZJ5A 5K8VA 3DMGA 3AKEA 4P4UA 5DHUA 2OC4A 1IUKA 1ZKDA 4PG7A 4LECA 1H4SA 4FILA 3AVYA 4MJLA 2J3JA 3HU3A 3K73O 5DH9A 3LTNC 1CUHA 1MTOA 4GZ6A 3RU2A 3QKIA 1MR3F 2X4IA 5EJGA 3RS5A 4JI6B 5ADUS 1TQ4A 2KQUA 4Q1FA 2XCTB 2NXNA 1E2IA 3JQ8A 5DHRA 5DSTA 3ZBPA 3VOAA 4KR7A 4EPYA 3NBAA 4XVQA 4EA6A 3L0OA 4G8BA 3WLSA 4NOMA 1DC4A 1QRUA 2BGUA 4IQFA 1P7ZA 4JVNA 2Q5CA 5K6AC 2IHVA 5BSKA 2FW7A 5EJFA 4TTTS 3S2ZA 3X1WA 4F9EA 3LZCA 1T5BA 1ENOA 1X7DA 4IZOA 5GONF 3BN3A 1E64A 3TPCA 1E3TA 1KMHB 1Z4MA 2I67A 1Y1TA 4OQMA 1KQ3A 1HSZA 2WK1A 5E0OA 2IUFA 1DRKA 3CCFA 2A9KA 3FLAA 4Q6WA 5UKDA 4BO8A 1RBQA 4MKGA 3UXMA 4YHHB 1DB3A 3MGBA 3U4CA 2H1WA 1G8MA 2HCBA 4X54A 2FPOA 5CITA 3IP6A 1FB5A 3B8EA 4L5IA 5CPBA 2YV3A 2PUAA 4H17A 3LO8A 3Q2OA 3D4PA 2J7PA 3VR2D 1KQNA 1BKYA 2PT5A 2Q6OA 4GPZA 1S7GA 5B58C 1C0KA 3P9YA 3A31A 3C4VA 1PQYA 1IZ9A 1QLJA 2H4JA 3NAQA 3OIVA 4RMNA 4PC3A 5JRZA 2JJ2A 3K1AB 2MSDB 1P3JA 1SXJA 1KI9A 3EVTA 4NH0A 1TC1A 3RJ9A 1SBCA 2ZIGA 3KQMA 4RZSA 1B41A 1SVUA 1S2OA 4LE1A 4IRUB 4U9UA 3S6JA 4PFSA 3W5DA 3HUUA 2GCOA 2X9NA 5BWNA 4X7PA 4EYSA 1MTZA 1C30B 5B6PA 4JL8A 1IU9A 4OGGA 3JWEA 1YRLA 1XCPA 1TZKA 2ANCA 2FFAA 2ONYA 4CR7A 2OSBA 2VJCA 1CP3A 2G1AA 4QJ4A 3QX3A 5JTUA 2QWXA 4POAA 5DYTA 3TRJA 4PO8A 3ZJUA 3VSDA 1G59A 1WXGA 3H83A 3V2GA 2Q2QA 1P91A 5D3MA 1DIBA 1JZSA 2V74B 2XQGA 3UJ9A 3VYUB 1IATA 1W47A 4H16A 3EC7A 2ILVA 4ZVNA 4NDZA 1CXZA 1XSEA 3OLYA 5C3MA 4B0OA 1E4YA 4KVAA 4CQMD 1ZUHA 5SZIA 4YUAA 1BNCA 2J48A 3Q9LA 3UPUA 2V6MA 3FIJA 3DDSA 1GQSA 4PTLA 3V2HA 1IONA 4OF4A 2ISQA 2XCQA 3FKQA 5BVHB 2G7ZA 1MT0A 2B4KA 3NWEA 4PGHA 1P7PA 1KP9A 2HXSA 4ITRC 4POOA 2PT9A 3QITA 5EUMA 1DIHA 3GEDA 3IVGA 4Z86A 1RBZA 4E51A 1XMQB 1FXUA 1UDRA 3DXFA 4NCXA 4DNPA 3PDCA 3JQDA 3IEVA 1Z5NA 2HIGA 1KZYC 5DXJA 3V48A 2EBUA 5K8CA 3SNHA 3ICOA 1U5CA 1HNNA 1J0EA 3KHUA 2A4MA 1UQTA 2J5QA 1MEEA 5EIFA 1ZM7A 5ER9A 3U7JA 1T24A 4EO4A 1X7WA 3R3WA 4Z1MA 1Q92A 2HA5A 2JI4A 4EELA 1BWSA 2IZ1A 3DDZX 3K8YA 3L1IA 4KE6A 4DJEC 2R8YA 2WWYA 3S2YA 3ET5A 4EVRA 2ZSIA 2IODA 4LV6A 2YVLA 3BZWA 3W2TA 3HDQA 1QZTA 4C3OB 4DLRA 2PH7A 3LC0A 4RVUA 3KR0A 4TLEA 3AJDA 3WLIA 5E4JA 4NMHA 2OK7A 1ZEJA 3H8VA 4NP6A 5ILOA 2JBHA 4P36A 2OB2A 3HSSA 1CDEA 2WZBA 3TLZA 1RIFA 2EFEB 4II7A 2FMTA 2BEJA 3DUFA 5BN4B 1XU7A 1GEGA 3R5HA 3OQMA 3GJQA 4CW7A 3GGGA 1GNTA 5EHGA 5B4VA 2PANA 2YJ6A 4N48A 2Q0HA 1RM4A 1J7KA 3QHQA 4MTCA 4JA2A 1OXTA 2O8DA 3T5BA 1KPGA 3T0IA 3R7WB 1DADA 4OU4A 3GBVA 1FCJA 1L7QA 4O4LF 1K0UA 2X0JA 1GNSA 1LSUA 3A4NA 1LLDA 1RKQA 3DOFA 3EG9B 5KOYA 3DXZA 4GM0A 1XDWA 5D5HA 5CFQA 1K27A 4M76B 1PDWA 3RQIA 2F4NA 1LU9A 3WRYA 4QXRA 2NNWB 4I99A 1E2HA 4IJVA 5I45A 3ILHA 3HB4X 2D7DA 4IILA 2PMDA 5AHWA 1H6AA 3KKQA 3BBPA 3R9XA 2E1RA 2GM5A 2V59A 1NBEA 1TM5E 2YVAA 1SCAA 3EHEA 4HNAA 1OV6A 2BGNA 3DO5A 2AFRA 1A9RA 4Q00A 4CM7A 2DKFA 1XYVA 5AUNB 3CRZA 1V5IA 1YB1A 2ZPAA 3UB4A 2YQ4A 3ZW7A 5ALXA 1E7SA 5I01A 3O1JC 1TQ6A 4I1RA 5DP2A 1D1PA 3HA5A 1PUIA 1Y1LA 3BD9A 1T2EA 3GC6A 3GFQA 1DC7A 2GEVA 1RAAA 2KJQA 3DLAA 1I2BA 1WO8A 3FFWA 2P4QA 4KGVA 1VJDA 4YPFA 4E09A 4L9SA 5LBUA 2YZGA 3NDIA 5AVQA 1YFKA 3CX8A 1QDLB 3PEYA 4Y9SA 2BELA 4EKNB 3PWSA 1BXKA 1R4MA 3IBTA 3PDJA 3K31A 3SHFA 3FI0A 1CUZA 1WMSA 2G8LA 3AUFA 2QJWA 3D3JA 4L5AA 4PLVA 5EQJB 3O4JA 4F1KA 2BW0A 3T5AA 4FKMA 2B5OA 4L0QA 4MTLA 4RIEA 4Y9TA 1F6BA 1N1MA 5TNXA 3SEFA 1EB8A 3SLKA 3ZHUA 4C7OB 3ZWDA 2IHKA 3CPJB 1FSSA 5HRUA 3L7NA 3ZCSA 1NXVA 4GQBA 1PR6A 2PLRA 4FW9A 4LIPD 3KD2A 1X19A 1FTQA 3BD7A 3GLKA 2NZVG 3CISA 3PNPA 3VTZA 4E5NA 3UENA 2FSUA 4CKCA 5KREA 1NI4A 5AI5A 4LZNA 4XVCA 3ZQ4A 3I09A 5F3WB 4WBNB 1YQXA 2X4DA 3OJEA 3JAKA 5AH0A 2WEKA 3R9KA 2XUOA 1B2RA 3DCNA 4RK5A 4BLQA 4FEEA 3VU8A 4YRLA 4QOIA 1GAJA 3FVQA 4OMUA 4I1PA 1E5TA 1BW9A 1D07A 1UQRA 1IN1A 3HYTA 3N0WA 3ITEA 1CY4A 2MMGA 1XQ1A 3PC8C 4JVSB 1K7FB 4WSOA 2F67A 1I24A 1TXGA 1BJTA 4WXRA 3HJTA 3PXEA 2OYCA 1C2TA 2ZUBA 4L8WB 1S9DA 2VJNA 4FQ7A 2LCFA 4RSHA 3KKMA 3QVGB 3QIAA 1Q2UA 1R8YA 3GRAA 3STUA 3ZHCA 2E5LB 4F7DA 4W5RA 3O91A 4MMXB 4HDMB 2IS1A 1VLZA 1D0IA 3MZ0A 4IQ0A 4HV4A 1LF5A 1TNDA 2ZT5A 3RAPR 4MR9A 3X1MA 1LSSA 4OH7A 2QBYB 1UBTS 2X3UA 4M55A 3S8MA 2GHRA 3PQ2A 1EH5A 4ISBA 4NNPA 1V39A 1T36B 4XJTA 1WR8A 4BFLA 1CE8A 5LXTA 1ODKA 1UJ4A 4R2MA 1IQRA 5AI4A 2G70A 1M34B 4OQ4A 3EBPA 1EFUA 1T9KA 3ETCA 2R11A 3GRRA 3SEQA 4F72A 1VKNA 1GNQA 1SA0B 2HNBA 5CDYA 1HQDA 1DJOA 1THGA 4Y6QA 4F4UA 4J8PA 3TLCA 3VKWA 3WYCA 1VE1A 5AW9A 1OWLA 2Q5IA 1ZCBA 3KYDB 3UHFA 1SNYA 2DWCA 2C2MA 1WV1A 1TQ2A 2YINC 3I37X 4D99A 2VEDA 1JX6A 1M8KA 4LSWA 3LCCA 3PEEA 1YQQA 3RUDA 4CFSA 1U8TA 4GKKB 1WLSA 4MEBA 3V3KA 1PDVA 1YR8A 2G9ZA 3OE1A 2C0CA 2HHCA 2Q2WA 4GP6A 4V0LA 1N0UA 2AX3A 2QN8A 3CR3C 4MR7B 1LPPA 2GX6A 3RVDA 1ZGHA 2D2VA 2FMKA 3A2LA 2O2HA 4LWOA 4R69A 3R77A 4LGVA 5E6UA 3Q7IA 1Q0ZA 1UEIA 2AG1A 3P0RA 3TQCA 5I9LA 2VR1A 3IHKA 1DFGA 4TS4A 3Q7QA 4Y2YA 3OOWA 4R3NA 2AL7A 1RWOA 2CUZA 5MFPA 3A11A 3S0JA 2WLSA 1Y1RA 1ZICA 5DASA 5JISA 4QQRA 4I4IA 2B8TA 4F8JA 4DV6B 4UNRA 2WJ6A 5IKOA 2CV2A 4ZJYA 2I03A 1I5RA 4YPVA 1PK9A 4BWVA 1FP1D 2WSBA 2K6GA 3SS8A 3BB4A 1T0UA 4XJVA 1CDDA 3IL2A 1JE0A 1UQUA 3DDOA 3ITKA 4MV8A 3RC7A 4PX2A 2VF4X 2BGTA 1XJ5A 2B30A 3E84A 3HP1A 3QEMA 3R24A 4PICA 2RJOA 3R9XB 2JFUA 1X8XA 4R41A 1G18A 4RIHA 1LSOA 3P2KA 2JGJA 4WESA 5FWAA 3GUZA 3ODGA 4YCNA 2IV3A 4L6IA 5EIEA 4LF5B 2ORED 1L4BA 1NAIA 3BL6A 3NTLA 5BRJA 1C7JA 4UAUA 2J5KA 2RB5A 3KV3O 3T1NA 2FFBA 4YRGA 2WAXA 5AW6A 4UE6A 4AG6A 3QPVA 4MWBA 2G4LA 3KOUA 3NYQA 3WQRA 4TYNA 3FPAA 3MJHA 5F2KA 1RLMA 4MW2A 1RC0A 1ONOA 1FQKA 3NZEA 1QQAA 1NW7A 1XEAA 5CCEA 1D6SA 4BP8A 1XWFA 7ABPA 4PYKA 2SCUB 4ZVSA 3ETJA 4LGYA 2ZP1A 4U7PB 1ODSA 2HAEA 4ZDWA 3GLTA 1DAFA 1N5MA 2JDIA 1AKTA 2JFZA 2P2CA 4HXEB 4E30A 4TT3A 3HYLA 2OAP1 2V3VA 1E3SA 4OQQA 1IZ0A 3SC2A 1NUTA 4CEIB 4LFBB 5L3VA 3D6FA 5D2CA 2C58A 5SZKB 2GKSA 3CLUC 4JITA 1WTAA 3HJCA 5JD3A 4QAQA 5E6UB 1HQYE 2NUPA 2QF7A 4DC0A 4G24A 4RHCA 5IAGA 1Y3BE 1IOVA 1ODJA 3HCCA 1JLLA 4WBXC 1Y1PA 2JGMA 3BM5A 4WCDA 4R9VA 1UK7A 4BVAA 4ZI7A 1DO0A 2HU8A 4F6RA 2GJSA 4IKPA 4RW0A 2E4YA 4V0QA 5HUJA 5A9SA 3BQMB 2I8AA 5EP4A 3PS9A 2JFOA 4JGGA 2W8BA 4MGYR 4F97A 1ORWA 3GQVA 2ZAOA 1XA4A 4FZ3A 3LD9A 4HRXA 4YJ3A 2ERCA 3LKDA 3PDHA 4FOLA 4I6EA 5DI3A 1MU0A 4Z54A 3ACDA 4LC9A 4XI9A 1JAZA 3DDCA 4J07A 4PG4A 3WTBA 1NPYA 3SKXA 2NQ8A 1G5IA 3UTDA 3IHTA 2AMFA 4Y1RA 3QNWA 3VSBA 1DHTA 1P33A 2DKNA 1K7EB 3DEHA 5BPFA 1N2ZA 1VBFA 1YOVA 1T2VA 1UXIA 2F64A 3RTEA 3TXAA 4RKQA 1ZVKA 5JWOA 5IAKA 4B46A 3ED5A 1VGVA 2ZJ5A 2ZUWA 2J41A 2ZAGA 2IOQA 4F5DA 2O3RA 1VE7A 4I55B 1O54A 3VDNB 1ZMRA 4JP2A 2AE2A 2FEMA 2YN0A 3VNSA 2YIMA 4BL5A 3NIDB 4D81A 1JLSA 5C1IA 1XRRA 1E9DA 5FO1A 3GFVA 1L7OA 1X7WB 2EARA 1JLRA 1DDOA 1B6SA 3KOYA 2R7MA 2J0UB 3FLEA 3PUVA 4G36A 5KYGA 2HDOA 2BP7A 1Q7RA 3TR0A 2YV2A 2JFHA 1H0SA 4JC4A 3E3OA 1UL1X 2PVPA 2DG2A 5DTIA 4KAXA 2I6TA 1P2GA 2Q5EA 3MN1A 1UKVY 2G40A 1FLVA 5GVRA 1ZKMA 4DJDC 4AJIA 3CFYA 4KWCA 2JIDA 3TWOA 1URPA 2DPHA 2XGSA 2JKYA 2Z98A 2CDBA 4V38A 1E3IA 4MGHA 4D9KA 3ZVNA 5LKRA 3LXMA 1JB9A 3GA7A 5ED4A 5ESRA 1W2GA 3VPBA 5CEEA 4II3A 2DP4E 3CNBA 1T5DX 4CF5A 5P8WA 2KI5A 2UUAB 4ZT3A 1J90A 2Q07A 5JNUA 4GMGA 4EUSA 2R5FA 1HNZB 2OP0A 3BKXA 2ZU0C 3QOWA 1VMKA 2X1VA 3TX6A 3BB1A 4AJ9A 1BTOA 2PKEA 3MQFA 4TRRA 2RD2A 1I3OA 2QW0X 1B16A 1QHGA 2GN8A 2MSCB 2IXAA 2Z57A 3EWIA 1VGQA 3JWJA 4LPSA 4LOAA 4WFIA 4H3HB 5TQ0A 3SG0A 3T9AA 1ZH0A 3CMCO 3GJRA 2GD1O 3COYA 3GW8A 3WP0A 1CX9B 1IB6A 3D8UA 3A6PC 1SULA 3THOA 3TQHA 4C0XA 4L76A 1NVFA 3WKBA 1FDTA 4FI3C 4KIGA 1ZCZA 4YDRA 3IP5A 2CDNA 4FFNA 1N1EA 3JRXA 4BO6A 1W49A 3H4MA 1C7QA 4WCFA 2BCGY 1ID1A 1AGRA 3G1WA 1U9YA 5IABA 3FGNA 4MZDA 3BWDD 2GA9A 2FSFA 1K2VN 2RFLA 4HDRA 2CL0X 1Y8QA 1HORA 4RLQA 4ECAA 3O7WA 3PX3A 1V1MB 1XGKA 4HLUA 4YUYA 1OGIA 2NU7B 1T8RA 1CYEA 1F14A 3HU1A 1C4XA 4MUAA 4IMJB 1RAGA 4BB0A 4FB4A 2JAXA 4G1BA 3TKYA 1Y5MA 1N1GA 2YIVX 3U44A 1WF3A 4E15A 2VDPB 3A1CA 1NRXA 4DWWA 2PQ0A 1L7PA 2RCNA 5KSYA 5DLYA 2EVWX 1NPTO 1NUUA 3M5WA 2D1SA 4K6GA 4I6GA 2Z9CA 3LHFA 3L6CA 1GV1A 5AM2A 2FZEA 1YHZA 3LJKA 4OYLA 4Q3BA 3GRPA 5TS3A 1ZK1A 2GCPA 3QTTA 3L1KA 3UMCA 5ADHA 5JNRA 3WKAA 1Z4OA 2FPMA 3TN7A 1EZZA 2DH5A 4KNWA 3RLFA 1ZNWA 3Q0IA 2O2DA 1VMAA 4I1SA 3ADBA 2N47A 2WFMA 3AM4A 4CLDA 1SXJB 4RHYA 3AUKA 5K8UA 4LUCA 4TWBA 3A14A 4C2AA 1DAPA 3QGMA 1XZNA 4TMYA 1MV8A 1W5SA 2HRDA 4TRMA 4Y2HA 4DBLC 4OVKA 4FFPA 1DVRA 4HZUA 1I9CA 5IPFA 5IN4A 1NN3A 2OBFA 2PRZA 3TZLA 1GILA 1R27A 4KQGA 5AW5A 5KOHB 1Q6ZA 2OO5A 4IHJB 3L05A 3WAJA 2P1DA 3KZXA 3TZBA 3QXSA 3KR9A 3OUUA 2IYLD 3ITNA 2YJNA 4V0ME 4YFYA 5H9WA 5JUWA 2D7JA 2QG6A 4D56A 2PLFA 2CKMA 2VJYA 1RAFA 3CW8X 3AWDA 3JATB 1HOTA 3KXPA 4U8HA 3RS0A 5AESA 1GPKA 4RM3A 4ZO9A 4LJAA 4WXEA 3MWDA 1ZXLA 3WLTA 3MIIA 3IP1A 2DUNA 3JX9A 2B92A 4V0OA 4WUVA 2OV2A 5CLQA 1KOLA 5ICGA 3AF3A 2NZXA 5JHHB 4ZO7A 3R8XA 4JL6A 4PM4A 4ZVMA 3ZHSA 5KYKA 1A9SA 4WNAB 2O1EA 1ADGA 2H59A 4NPCA 4L08A 4YRPA 4WLNA 2DPGA 4EA8A 3RC1A 2W71A 4J76A 4YQEA 1L9XA 4DABA 3DOOA 1E5QA 3LUGA 1AU9A 2I6UA 4RCVA 3FMVA 1EDOA 4P7BA 2NSLA 3HB9A 4QDJA 1QUEA 3SQWA 1SQ6A 3ITDA 3K9GA 4L8VA 1U0HC 2I2CA 3X1YA 1CVIA 3DFFA 2DHCA 1M1YB 2FG6C 4X91A 4I5DA 4CIAA 1Z2AA