2HF9A

Crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
211
structure length
211
Chain Sequence
KDILKANKRLADKNRKLLNKHGVVAFDFMGAIGSGKTLLIEKLIDNLKDKYKIACIAGDVIAKFDAERMEKHGAKVVPLNTGKECHLDAHLVGHALEDLNLDEIDLLFIENVGNLICPADFDLGTHKRIVVISTTEGDDTIEKHPGIMKTADLIVINKIDLADAVGADIKKMENDAKRINPDAEVVLLSLKTMEGFDKVLEFIEKSVKEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into HypB, a GTP-binding protein that regulates metal binding.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase, metal binding protein
molecule keywords Probable hydrogenase nickel incorporation protein hypB
total genus 81
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hf9A00
2OUKA 3DOEA 1XB2A 3P1JA 4LJ7A 4LGMA 1W4BA 3LO5A 1XDBA 1XEXA 4BEBA 2OCAA 1II0A 1R7RA 1W4AA 1EXMA 1G7TA 2A5GA 1KDOA 5EXTA 1YR8A 3CB4A 2QE7A 5CJPA 3L0IB 4OKSA 4A6PA 3K53A 1XNJA 1YU9A 2CXXA 2PT7A 3FMOB 2JLSA 5BYJA 4AKEA 3W8RA 2GESA 2DPXA 5DIFA 1KO7A 2G9NA 2C99A 4MDFA 4JL8A 3VR3A 1KO8A 2V3CC 3QEJA 4TLCA 1N25A 1TUIA 4ZIRB 3CX8A 2VP6A 4BEJA 5DYIA 1NN1A 4B2IA 2H17A 2XZPA 4Q9JA 4XWKA 4YDSA 2XB2A 1F2UB 4OQXA 1GKYA 4LV8B 4LHZA 1KZGB 2V9PA 1AJEA 2DFKB 5TB5A 5F9HA 1HQYE 1RE0A 3CRQA 4CYMA 3U6BA 4W9MC 2GJ9A 4GOJA 1A2BA 2NO7A 1FPMA 1QG2A 4L9WA 2BEJA 4Q1DA 4FMDF 2EYQA 3SFVA 3ZIAA 2YV5A 5HR5A 3EAQA 1P75A 2I4IA 5BW8A 4PANA 4B3DA 4Q48A 3V4RA 3IDQA 2VSOA 1MT0A 5TARA 3PITA 4JLPA 4A4DA 1KMHA 3AVUA 1L8QA 1FFHA 3T15A 5FH9A 2NIPA 4X8MA 4Z1MD 3U7GA 5TDHA 4A36A 1NLZA 2CJWA 2RKOA 4TTPA 2ZIAA 2Y8EA 1CIPA 2OM2A 3ASYA 4P3YA 3W8NA 4PC6A 2O5VA 1NLYA 2ZRCA 3GQBA 4C3ZA 3B6EA 1FL9A 4G01B 3IHLA 3N2EA 1NMYA 1YZQA 3AH8A 3PR1A 3BK7A 1G3QA 3BB4A 5CM8B 2VF7A 4LSGA 2FV8A 2GILA 4GRAA 1KDRA 1NVUQ 2AK2A 2DBYA 2IXEA 4B3BA 5K8UA 2B6HA 5K8LA 4KSBA 4OJQA 5K8IA 3F8TA 2Z4RA 3FMIA 5FOXA 3VR1A 1NN3A 2FEOA 2OLJA 2X2EA 4HDCA 1G16A 2FSHA 4LUCA 1JPJA 1NI3A 4NZYA 2L0XA 1MOZA 3KJGA 5H1YA 2OFOA 2RGNC 6Q21A 1K8RA 2P6NA 2IXFA 1LV7A 1T6NA 1OPXA 4FW9A 4EJSA 4ZCIA 3UWKA 2PBRA 1E0KA 3RNLA 4NH0A 4NYIR 1KAOA 4DSUA 5KDOA 3QSYA 1OXXK 1E0AA 3U61B 3VKGA 1Q57A 1IN8A 1TQ4A 3B8HA 1G3UA 3MWJA 4KODA 1GM5A 3KJIA 5C1BA 4QBHA 2XAUA 1VCOA 3JVVA 3TNFA 2XGJA 3K8YA 4JLNA 4D2IA 2AWOA 1EFCA 1MH1A 3G5UA 1CKEA 4O25A 1F3OA 4AYWA 1OT3A 2ZE6A 3MJHA 3NEJA 5FUVA 4BLTA 5KO2A 3HR7A 3GLIE 1WQ1R 3GPLA 1KYIA 1MO3A 5DN6A 3KKMA 5FOUA 5C4MA 2IS1A 2NO6A 2VP9A 1YHNA 5IHPA 3RVBA 1SGWA 4DDUA 4D80A 1Z0FA 3EZ2A 1NY6A 4URYR 3J81k 4I1SA 1G21E 1TPZA 2OLKA 3I8SA 1EGAA 4FXPA 4QXAA 3EPLA 4M21A 2J45A 1UJ2A 1VCIA 1KI6A 2ZI3A 5JHHB 3LLMA 2ANCA 2QU8A 4R7ZA 5DYGA 2ORWA 4C2TA 1XMSA 1Q12A 5J4HA 1NG1A 2PT5A 4JLJA 5EE0A 2O8DB 4R9UC 4UNQA 1OH6A 3REGA 1GAJA 1YZUA 2PJZA 1H8HA 2ZR9A 3OE7A 1FW6A 4XH9B 3GLIB 1Z08A 2EFHB 2WWHA 5FI1B 2XZLA 4X8OA 1LS1A 4P31A 3SZRA 2REBA 1OXTA 4JVNA 5J4YA 2Z83A 3H0KA 2VEDA 1T0JB 2ZSAA 4Q18A 3WRXC 3VU9A 1OB5A 1KY2A 1TNDA 2O0KA 4FMDB 1UPTA 1YE8A 1YRBA 4G5GA 4KV9A 2CL0X 4RZUA 1KI7A 4IKEA 1G8HA 4GI7A 1P9NA 5HTKA 1E2QA 4G1UC 1IHUA 1OHHD 1Y3AA 1P7CA 1PVOA 2IUTA 3KDSE 1CJMA 3TR0A 1T4GA 4F7WA 4PC3A 1XCGB 2QMOA 4UNPA 1ONBA 1NKTA 4ACBA 2BOVA 1RRGA 4KBGA 2Q3HA 3W5IA 4BASA 4YDHB 1ZD8A 1COWA 2FOLA 2GF9A 4YLGA 5DSZA 3T12A 1GKUB 2O0HA 3EASA 3T5GA 1Q1BA 3TSWA 1CLUA 4Z8YA 4DCSA 1BMFA 4AIIA 4KAXA 2FGKA 2OAP1 3KFXA 3SDZA 3T1VA 4TT3D 4ZKEA 4WBSA 1N5LA 1V5WA 3MAAC 1QZXA 2D7DA 3KJHA 4LK2A 3H2YA 2J0VA 3L8YA 5J40A 3A4MA 4PSKA 4B2LA 2XJ4A 2AKAB 2VO1A 3HDTA 2CHGA 1P2TA 4TYQA 1NJFA 4EJSB 3K0SA 4Q4AB 4TSFD 1KI6B 2ONJA 1J90A 2BCGY 3Q7PA 2MMCA 3CWQA 1JXMA 1XTRA 3QVUA 4PQYA 3VMFA 3ZQ6A 1KJZA 4DRZA 4B76A 3T1TA 2O8FB 4PO9A 1Q1QA 2PZFA 5GJVC 3WBJA 1JECA 4PAQA 3HU2A 1RZ3A 3TMKA 1G8GA 1DAKA 3LY5A 1DBSA 4AI6A 2DFNA 1G291 3LRPA 4FMBB 1LS6A 2ZI6A 3RLFA 2F6RA 1FP7A 3UXMA 2G1KA 1Z0IA 2FMXA 3OEHA 2YWFA 1QHNA 2BEKA 3PUXA 3KXKA 2GRJA 4QJ3A 2LKCA 1XWIA 4B3FX 3I73A 2JAQA 4BFVA 3WY9A 5L3VA 2XJ9A 5L3QA 4P4TA 3THWB 5L3QB 1DEKA 3UMFA 4EPXA 4LJ8A 3ZH9B 4FINA 1GUAA 3NWJA 5DN6D 3IIKA 2NPFA 621PA 1E79D 4Q7JB 3CNOA 2GA8A 4QG7A 2J59A 1KJYA 4B32A 2YWHA 4BRUA 3PUVA 3SEAA 3IKJA 4IEEA 1UAAA 2BBOA 3KFVA 1D9XA 3RAPR 2UKDA 3QPWA 2QE7D 3D7MA 421PA 3KQHA 2QEQA 3I5XA 3HP1A 4JBYA 2QTHA 5JLJA 3L43A 3TSZA 2GCOA 1U0HC 1XTQA 2ZI5A 4M1WA 5HZKA 1YQTA 2RGBA 4LHVA 3K70B 3AKEA 5KHOC 4OK3A 1W1WA 3KJEA 4IOKA 4G5QA 4NDZA 3BGWA 4KU4A 4DIDA 4OJKA 2FFAA 2W83A 1R6BX 4HDQB 4A0FA 2REXB 5KDDA 1V43A 3A6PC 2BIFA 1IN5A 1RW4A 5EJEA 3WYGA 4CEHB 4DDTA 2F1JA 2WVJA 5CIQA 1CJVC 1M7BA 3TJZA 4Q01A 1CXZA 4BFWA 4CT4B 4QKQA 3VFDA 5ANRB 1XEXB 2BBWA 3EA5A 1UFQA 4V03A 2ZTSA 1ZU5A 2OAQ1 1C4OA 1IY0A 1G6HA 1W44A 2BBSA 3PQCA 2GNOA 3KQNA 4BRWA 3AKYA 3CX7A 4Z1MA 4TYPA 5AUQA 4M1KA 3KUDA 4TWZA 5JRZA 2ZRMA 4KFSA 1BYUA 3CPJB 4PHTA 1H8EA 5JFGA 1KK3A 1UKZA 3DVLA 2NTYC 1TMKA 4LOAA 3K9NA 2YWGA 1ZD1A 4UNSA 4XD7D 4LJYA 3U7HB 1N6LA 2ATXA 4OQNA 1W0KD 4MGIR 3GD7A 1KNQA 5P21A 5JWOA 4TQUS 4PXAA 4C30A 4TLEA 2HYIC 4A2QA 3I61A 4GP6A 3O8CA 4Q1EA 5IK2A 2WMNB 1U9IC 1KI9A 2D06A 3MRSA 3N2IA 3QE0A 1NNEA 5EE9A 4JLVA 3NEYA 1G3MA 2RHDA 3OIYA 4KBFA 1OXVA 1UADA 1X8JA 4LV6A 3WMFA 2QPAA 3U7FB 5F3WB 1AKEA 3Q7QA 3VU9B 1E2JA 4WXRA 2QNRA 2W2TA 4BWYA 3I8XA 4NYMR 4ASUA 2WSSA 2EFGA 2XEXA 4KO8A 3FHTA 3MWLA 4P0TA 3OEEA 2EWWA 2IS6A 1P2SA 1G9XA 2WWIA 3UPUA 4K81B 4LHYA 4TSFA 2XNDD 3DDCA 3PG5A 1BYIA 1UF9A 4TMWA 2G77B 3SJZA 1UEJA 1EK0A 4XOIA 2FEMA 1IXRC 3SU8A 2VA8A 1XU4A 1DAIA 1Z29A 2VQSA 1YVDA 5FOVA 4E07A 4K8OA 1Z22A 2WIBA 3BD9A 4CGZA 5DO9A 3QUSA 3CNNA 3GEIA 1G19A 2BM0A 5CK4A 1JR3E 5FTJA 5A5GA 2G83A 1P9WA 1Z0DA 1KMHB 4JLBA 3FOZA 1WP9A 2JGNA 2NZJA 4PZYA 1XTKA 3M1IA 4A15A 2BC9A 1RC8A 2FX3A 2FPKA 1E69A 4M1YA 3CKLA 2E87A 1YZKA 2ZU0C 5HE8A 2ZUDA 5FUWA 1XPUA 1IONA 2VL7A 4JBXA 3EPKA 2J87A 4JVSB 1UBGA 2BM1A 2P5SA 4E09A 3U44A 4MYUA 2JIZD 1SKYB 1ZNZA 3C14C 5JHGB 3CUEF 1SVLA 4HLQB 4ZKDA 4XSGA 2XTMA 4DBLC 1IJEA 1N6RA 4ZCLA 2O8BA 2ANBA 2VHQA 1Z6GA 3ZVLA 5JBQA 1GSIA 4RCZA 1PLKA 2V7QD 4D0GA 2DFLA 2KI5A 2JLRA 3QNUA 1OB2A 1VCMA 2IHYA 1QF9A 2J0UA 2R2AA 2CCJA 2R6DA 1S4QA 5JECA 1OYWA 2TMKA 4GDFA 1Z2CA 1X1RA 1G8FA 2QGZA 3FTQA 4PPFA 2KSQA 2J3EA 4Z8XA 3VAAA 4JJKA 3VHLB 5HCNA 2R6CA 4D6PA 1EX7A 1OJLA 4H1VA 5FBQB 2QPOA 3NDBB 2F3TA 2GJKA 1E2KA 5TV2A 3Q85A 1TQ2A 8OHMA 3TK1A 3S1AA 1VCNA 4M1OA 1C9KA 2P3SA 1W5TA 2V4ZA 3B2EA 4RSGA 4BFUA 2FDCA 4B43A 2H57A 1MABB 3MGCA 4HAUA 2ZR0A 2FH5B 1SVKA 2ZJAA 1TX4B 1ZVQA 1N5IA 4PAMA 4B48A 4I1UA 1WF3A 4DVGA 2V8OA 4DB2A 2N42A 3D6TB 4M22A 2WWGA 4OHYA 2A5DA 4C0KA 3A1TA 1TF2A 2IEZA 2YKGA 4FCTA 2EWVA 1Z3IX 3SJCA 3KKOA 1LB1B 3U60B 3K09C 2DB3A 3LBNA 3NBFA 2QSYA 2Z5FA 5EUMA 2LWIA 2GZDA 1DG1G 1OIWA 1DELA 3DL0A 3ND9A 4IFBA 1XJ0A 1Z07A 3TW8B 5B64A 4KI0A 4DSNA 4RCYA 2W6ID 1XCMA 3KKNA 4MKFA 4UXIA 3RS5A 1N0VC 4Q9HA 3THOA 1KO1A 1GOTA 1KO4A 4A2PA 1DTSA 4NL4H 5FR1A 4N3NA 1CRQA 4J0QA 1GZSA 4Q5IA 121PA 5E4FA 3TQFA 4C7OB 2WICA 2F43B 2HUPA 1OFUX 1ZCAA 1CEEA 2QMHA 1J8YF 3L0OA 3VNUA 4OI1A 1RVDA 1AZSC 1BKDR 3QKSA 4HB4A 2FJUA 2F3RA 4HLDA 5D3QA 3ZZUA 2WWWA 2HCBA 3D3QA 1M34E 2NOAA 1HT1E 4NYJQ 721PA 4C9BA 5B30A 4Q4JA 2J7PD 1N6OA 1XZQA 3OEED 4AG6A 5KNCA 3PUYA 4V0NA 5AJZA 1ANKA 4WOPA 1IXSB 1OFHA 1Q0UA 1YR9A 5AJVB 3A1SA 4URWR 2AN9A 4JKYA 4GFDA 3GJ0A 2BWJA 2ZU6A 3TBKA 2NQ2C 5IT5A 1G18A 1M7GA 1FP6A 2RCNA 1IBRA 3OFND 5FR2A 1Q21A 2IYZA 4PZLA 1AA9A 5GJWC 3RC8A 1G3RA 1X8KA 4YMSA 2HF8A 5HKKA 1G8PA 4EFLA 4TQAA 1KSJA 2VTKA 2A5YB 2QY9A 4D4MA 4WXPA 1WA5A 1J70A 5L3RA 3B1VA 2ZPTX 4MITA 2GK6A 5C18A 4D0LB 1DVRA 4PQFA 3AEZA 5EE3A 3PEYA 3RS4A 3P4XA 2RGNA 3CONA 3TR5A 1OSNA 4M53A 4GSYA 2FNAA 3GLHA 2ZANA 3FKSD 2WAYA 3MCAA 4EFMA 1EFUA 3AVTA 2ZRPA 1U0LA 2OT3B 1W36C 4TYYA 1N0UA 1XMIA 1Z2AA 4EJSC 3BFVA 4B2PA 2QUZA 3I4LA 821PA 2VSXA 2GAOA 2P5TB 3SC3A 3FKSA 2SHKA 1H8HD 3P4YA 2P6UA 2PMKA 3FE2A 4OHWA 2P0EA 2ZE7A 2WZQA 4DDWA 3PENA 3OESA 1UKEA 3TIFA 3WP0A 2R6AA 4Q1FA 4DUGA 3SYLA 4R71A 1K5GA 3O8BA 2ZJBA 1R5OA 3ONWA 2OV2A 1KSFX 3AGPA 4DLRA 2ZYTX 2ZS8A 1N6NA 2B21A 2CVFA 1XEWY 2HF9A 2RMKA 2YC4C 3A36A 3EC2A 4RD6A 3DO6A 1XZPA 5FFMA 4W5WA 4QGGA 1G7RA 3W9YA 2ZRDA 1YR6A 3MG9A 4POAA 4IXMA 4NCKA 1GL6A 2OXRA 1FZQA 3BB1A 2JA1A 3VNVA 2XOKD 4KHZA 1QHSA 1RJ9B 5CYOA 4YMTA 4PTLA 3RS3A 3T06B 2C78A 4KLNA 2JATA 4A8JA 1W48A 1R10A 1FQJA 3EC1A 4OQMA 2ZSBA 2V1UA 4NP6A 3WXMA 4QHTA 1GVNB 2BBTA 5GVRA 1SXJD 1GDDA 4IVPA 4A92A 4LBWA 1OH7A 1YZNA 5ELXA 3OIWA 3QKRA 2PX3A 1MRNA 3SYNA 1FUKA 1L4UA 3BOSA 3SNHA 4UNNA 2J41A 5LBIA 3CW2A 4C0AC 1Q1EA 2R44A 3OIUA 1GILA 1W0JD 2ZRKA 1W4CA 1KZ7B 1G8YA 1E9AA 3R8CA 4LC1A 1JR3A 4DKXA 4MYTA 4LWZA 4CEIB 4TLDA 5AJXA 3SOPA 3E1SA 4ZV4A 3ZZ0A 3DHWC 1KK0A 1HH4A 4TL6A 5E7JA 2QM8A 1Z6AA 1KDPA 5J4VA 5KNDA 1DAGA 2D2EA 2CLCX 1E2DA 2IYQA 4WZBE 4LDJA 4JMPA 5EP3A 4BFXA 5AUPB 3EX7C 3TLXA 2QT0A 3P26A 5KNBA 1G7SA 3UMRA 3CRVA 1OKKA 4LJ9A 1XRJA 1KI8A 2WJJA 3OAAD 2CLSA 3B9QA 4URUR 2CL7X 2ZSFA 2ZR7A 4MKGA 1SXJE 2LKDA 5EXXA 1W4RA 5J47A 3AF1A 1FQKA 4XVRA 3DEFA 4KCGA 4ZDKA 2KBEA 2V6IA 1LY1A 3KKPA 1ELOA 4IDHA 2VHJA 2WBLC 5AJWA 1T91A 1W5SA 1YZTA 3RDPA 4A82A 3EPHA 1HUQA 2ODBA 2D2FA 4GMDA 5E7IA 4B74A 2GWHA 2EU8A 1XXHB 3QJYA 5FTKA 3CNLA 1R2QA 2I1VB 2V54A 2FU5C 2GAAA 3CBQA 2GVZC 2AK3A 3GMTA 3RYTC 2HDNB 1U98A 3ASZA 5SZHB 3AVXA 2V6JA 2RAPA 1S3SA 4TYNA 2O8CA 4ABYA 2H7VA 1OF1A 2R9VA 2F1IA 1FTNA 4PSVA 3DOFA 2VHTA 2OFWA 1JEDA 1E9EA 1T3HA 1GNQA 2IXGA 3R9WA 4A2WA 3X1DA 1HURA 2Q9AA 1I4TD 1SKYE 3H1TA 4AK9A 5JEEA 4RD3A 1E1QD 1E0SA 3C8UA 1GITA 2IF2A 1QHIA 4FMCF 3SBEA 4LHWA 4RD2A 5JWHA 2ZITA 3X1ZA 4L8GA 3K0FA 4F4IA 1M8PA 4B44A 1A5TA 4QL3A 4M9XA 2Q3FA 4JS0A 1KI2A 1JQJC 2GZHA 1Q44A 2WWFA 3MUFA 1BS1A 4YC7A 3K9LA 4DLXA 1Q3HA 4MUBA 2RHMA 1B23P 5GJBA 2GEUA 2HLDA 2PLFA 3AUXA 4TQ9A 2HXSA 4HAXA 3R9IA 1E9FA 3Q5DA 1US8A 1F48A 1Q1ZA 1CU1A 1LNZA 4OK5A 1WRBA 2GVDC 4AKHA 3SJAA 5EP4A 4OK6A 1E2PA 2RGGA 4Y0AA 5JJKA 3NIBA 4HB0A 2WSMA 2MSCB 3GLHB 5J4KA 5JI2E 2W2VA 3K9GA 4LBVA 1MRSA 4I1VA 4I4LA 2QROA 2A2ZA 1ZBDA 3F0TA 3P20A 5EXPA 3BS4A 3FFAA 1KKLA 1XTSA 4PR0A 1XF9A 3RS7A 2HV8A 4LJAA 2FFHA 1ZNWA 5G3YA 4KITB 4GL2A 3BH6A 3RRNA 3W6PA 3T61A 4DWJA 3ICQB 2ZJYA 4QGHA 3KB1A 1N3BA 1UDWA 4URXR 3SFZA 1DG3A 1XTJA 2QQ0A 4JSYA 5G40A 4AC9A 3N70A 1ZP6A 4Y0VA 4Q4JB 2WKQA 3B13B 3B1WA 3DPUA 4JL5A 4MGZR 3L8ZA 1JPNA 2A78A 3LBHA 3X1YA 4EIWA 1SXJB 3M4YA 4NCHA 1SVWA 4JIMA 4U00A 4AURA 1OFTA 2D74A 4E5UA 2DHRA 3DZ8A 2ODWA 4MRRA 2ZYWX 1EWQA 4DLWA 2PCJA 1KI3A 3IPYA 2ASEA 2ZXUA 4QNMA 1FNMA 4LYAA 3FMFA 2CCKA 3OAAA 4KVGA 2NZ8A 2BHRA 5TXGA 2F9MA 4DHEA 4B35A 4A8JC 3VKHA 4ASUD 1DAHA 2QG6A 1VYTA 4IFEA 3T1QA 3U3OA 2OILA 4HAYA 1W7AA 4C0JA 1P4SA 3GLHE 2CLDX 5K8TA 2XOKA 2WWXA 2PMDA 2VIIA 1DOAA 4EPRA 2QAGC 5EP2A 5IK2D 3AP2A 5KDLA 221PA 4BZPA 4QHYA 4CZ2A 3HU3A 4EUNA 5LD2B 2IT1A 2BJWA 3LWNA 2IWRA 3KUCA 2EFCB 1R4AA 5FI0B 1S1CA 4Q9IA 1IY1A 1U8AA 3SN6A 5DNYB 2OCBA 3FKQA 1I2DA 2YC2C 2C95A 5B57C 3V00A 4P33A 2IYWA 4Q00A 2FSIA 2J7KA 1E2HA 5FL7A 3VKWA 2WKRA 3CRMA 4YXWD 1R8QA 3UIEA 4WAUA 2GXSA 2I3BA 4CF7A 4JZKA 521PA 3SYKA 5JWRA 2GKSA 2VLIA 2GZAA 1QRAA 2NO0A 4W5HA 3R9XA 3GCGA 3NBYC 5BYKA 3ND8A 5IDVA 3FYHA 2WJYA 4D82A 1W36D 3ETLA 4BZXA 2JJ1D 1T3SA 3EPJA 3UWOA 2JLXA 4LY6A 3BBPA 2X77A 3L0PA 3QEOA 2HJGA 5DGXA 4LJ5A 1AZTA 1G7CA 4NPHA 3TUJC 1S2MA 4MKIA 3TKLA 3I5YA 4C7OA 2RB4A 3CF2A 4IOMA 2XXAA 4YXWA 1KJWA 2WV9A 1T9HA 4R98A 3WMEA 4XWOA 4P32A 2YVUA 3B1YA 1ZC4A 2HLDD 4IDOA 1PLLA 3DMNA 4M9ZA 2FPMA 3SS8A 2C98A 3GFPA 4DIEA 1IXZA 4W7SA 4QGFA 3QIAA 2D4HA 1U9IA 1A82A 2WMOB 4ESHA 1E9RA 1ZINA 3I62A 1HE1C 2IS2A 2QZ4A 2ZI9A 1FMLA 3EWAA 2IYYA 3LFUA 5DISB 1T8TA 1TUEA 4RFVA 3THXB 1G5PA 1P9RA 2FZ4A 1E9DA 2QGNA 1NN5A 2QRZA 1E1QA 2AHOA 2QENA 1KIMA 4ZDJA 2QAGA 1N5KA 4D4LA 4EDHA 4DLUA 1OKKD 1N6HA 1S8FA 1VHTA 3ZVMA 2OBLA 2BCJQ 5LB2A 2Q9CA 3EARA 2PZEA 4QJ5A 1YJ5A 1AN0A 1OIVA 2ZRHA 3THWA 1AQUA 3AKDA 4Q02A 2ZJ5A 5AUOB 3FFBA 3NH6A 4OI2A 1KAGA 4QBGB 4B75A 4U5XA 3EZ7A 1AS0A 3BFXA 1SVIA 2OG2A 4N0DA 1LW7A 3CH5A 4DLYA 3K0AA 4V0KA 1XD2A 1E2NA 4OHVA 4QBIA 1L2TA 3CR8A 2ODEA 3K9HA 5EE5B 5CK5A 5G53C 2J0SA 1QHYA 2J7PA 4DB4A 3GJ8A 1QHGA 1PLJA 2G0TA 3CF6R 1RRPA 2XTNA 1E9CA 1I4DD 4BUJA 1NP6A 3C5CA 4M1MA 1XPRA 1UBEA 4PPNA 4E22A 1L4YA 2EW1A 1DE0A 2E9SA 4NU0A 2WOOA 2YHSA 5DHFA 5EZ6B 3THYA 1EFHA 2ZRIA 5B2ZA 1OHHA 1R5BA 2C04A 2W0SA 4ON9A 4HLUA 2UVQA 4P4SB 3BH7A 1LFDB 1Z0KA 3KQKA 1E4YA 2KB0A 1COWD 1WCV1 3K0FB 1D8TA 1E0JA 2QAJA 5SZIA 3EA0A 4PHGA 3Q72A 5LDDC 1SQ5A 2BMFA 1OLOA 2QORA 1ZW6A 3B1XA 1P2UA 1GIAA 1RFLA 3IUYA 3R7WB 2O8BB 1JEEA 4QGAA 2BMJA 3VX4A 2OESA 3NDPA 3LDAA 4JVMA 5E95A 1R8SA 4UKDA 5CB8A 1IOZA 1OIXA 3BFKA 2A9KA 1IY2A 1IQPA 2J0UB 3IILA 3SJBA 4Z54A 1A1VA 2FA9A 3GJ4A 3U2QA 2YZ2A 1P2VA 4IOLA 2H8KA 1TQ6A 3U4QA 1VKJA 2CJWB 2ZEJA 4ARZA 4BFTA 3UATA 2ZJZA 1XBTA 4CW7A 3B85A 1HA3A 4ZPXA 1YKSA 3HJNA 3QXXA 4L16A 2KBFA 2IUSA 1TAGA 4ACAA 1JBKA 1MV5A 4WZAE 4MRVA 1EFRA 3DMDA 1FNNA 4F38A 4DEYA 3FVQA 3R7WA 4IRUB 5L3SA 4HEJA 1W2HA 1A2KC 3SHFA 2W0MA 1ZUIA 1VHLA 5AK0A 4QM6A 3TRFA 4HZUA 2GJSA 3PIRA 2QMEA 1GG2A 2A5FA 3C7KA 3MSXA 5FOSA 5G41A 2DR3A 3LX8A 4D4JA 3W6OA 2GXUA 4JYCA 3N5CA 4GBMA 3QF4B 1JAIA 4NMMA 2CL6X 3THYB 2C9YA 4TMTA 3EIHA 4C4PA 3UG6A 1GL9B 1NMZA 2IYRA 1E99A 3BH0A 3I1FA 4PC7A 1NVVR 4L9SA 4PHFA 4NONA 2I1QA 4YONB 4TMXA 4L4UA 1PZNA 4O2LA 3MJRA 2WIAA 1E1RD 2V1XA 1HQCA 4US0R 1N5JA 4D25A 5KUTA 2QN6A 1X1SA 2RGCA 1GFIA 3NVAA 4GOKA 2FPLA 1VMAA 2CNWD 2WJGA 5HKKD 1D9ZA 1ZC3A 1ZM4A 2F55A 2QI9C 1DAFA 2D62A 4TL9A 3C4JA 4UNRA 2PL3A 2IYUA 3ZZTA 3WHLA 2QTVB 5KSZA 5F2EA 1K6MA 2E1RA 2WHXA 3L0SA 4OQLA 2GEVA 4TYWA 3RC3A 1R5NA 2Q0HA 4RKEA 1G5RA 3MFYA 5JSZA 4O0MA 4TL7A 1XTIA 1BMFD 1P3JA 1TEXA 4TZ6A 3BAFA 1ZAKA 1JR6A 1W49A 3FMPB 3QOFA 1ZCBA 2AXNA 3WNCA 2IHBA 3H86A 1M7HA 4DCNA 2J1LA 5FPYA 3C15C 4G0NA 4ZO4A 1IN6A 1ZJ6A 2Q9BA 4F91B 1QG4A 5KYKA 1ZIPA 4ZI3A 2CE7A 2OEPA 2ZE8A 4PQRA 3RRZA 3WBKA 3QPUA 1XFAA 4KSCA 4B6FA 1W0KA 1NSTA 2ECKA 2ZS7A 4TN1A 3VX3A 1I4LD 2CVHA 2YINC 1NLFA 2C2HA 2ZRAA 3LXXA 4IDQA 4X8LA 3UG7A 4KJZA 2ZVPX 4BLOA 3LVRE 3I92A 1ETUA 4HUQA 1NIJA 2AD5A 5E3HA 4L15A 4II7A 1U94A 4UXJA 1XMJA 2C96A 3GJ6A 2BMDA 2FFQA 1G5TA 1X8LA 3LAWA 4JLAA 1AS3A 3O47A 2QBYA 2RGEA 4Q1CA 3JZMA 4MRNA 5JMTA 4B6EA 3NXSA 3GLIA 4Q9KA 5GJCA 4ZCMA 1SVOA 5AJYA 1M6NA 4DJTA 2GEDA 2IA5A 4WIAA 4KFUA 5EXSA 4ITRC 4AG5A 4A1FA 2GETA 2ZI7A 1OXUA 3JZAA 3ZS8A 1SVMA 4TTQA 4XVQA 2ZM5A 4EPYA 4FCVA 3LX5A 5SZKB 2WKPA 1T0HB 4JVLA 3ZVRA 3CO5A 3QG5A 2WPDA 2ZSDA 2ZAOA 1ZUNB 4CDGA 4DT1B 3PXGA 3GLGE 1E2MA 4F93B 3LW8A 2REOA 3ZVNA 4NCIA 1AM4D 1YR7A 1FX0B 1NN0A 1J7KA 4ZIRA 4BECA 2B7CA 1ZU4A 1OH5A 1LTQA 4DDVA 4A0RA 1T3LA 2GK7A 4UJ5A 4EQ6A 3A4LA 3U44B 4P4SA 3B1ZA 2KWIA 5EZ5A 4D4KA 2O8FA 4JKIA 5KPDA 1OV4A 3VHXA 4TMZA 1UDXA 1EWRA 3PVSA 1CR2A 1RKBA 3TUIC 1ZMXA 1GNPA 2MSEB 1E96A 1ESMA 3FGNA 5AWFC 1E79A 4IVQA 5CLQA 4F92B 1BOFA 1CJUC 3KTAA 2IYSA 1QHHB 1VDZA 4R2IA 3IIMA 3IBGA 2WWYA 4ERNA 2FF7A 3AVQA 1Z28A 2VBCA 4A8JB 3NBZC 2AFHE 2WPDD 2QRNA 3KB2A 4B71A 1SHZA 4B33A 4HI0E 4JLOA 5JS7A 1IN4A 1ZM3A 2KE5A 3BC1A 4M2LA 2H1LA 5C2JB 3ZJYA 1E2EA 2DWQA 2NO9A 1VYVA 3A4NA 4MH0R 2IL1A 1U99A 1X3SA 1D2EA 2JJ1A 1Z0JA 2FE4A 1XXHE 3FPAA 5LB4A 4RD0A 4XWAA 2EQBA 4KYIB 4RZ3A 1P6XA 3TE6A 3NH9A 4LJ4A 2ZQ5A 4JT4A 1CR0A 4MRSA 2AD1A 1P61B 1X86B 1XEWX 2XNDA 1JQLB 5TY0A 1CBUA 3REFA 2GF0A 4JYBA 1KSHA 3SQXA 1KK1A 1N0WA 5KSYA 4G5SA 1CJKC 3BWDD 1II9A 4IEIA 5KPJA 2R62A 4KFTA 4RFSA 4FWTA 2GJAA 4QHSA 4C0LA 3AGQA 1ZD9A 3R20A 2HJVA 2ZS9A 2JLQA 1TADA 1YZLA 3IHWA 2FG5A 4LPKA 4HLCA 4XVUA 4DLTA 3I3SR 3HU1A 2GCPA 3I32A 4Q4HB 1XJQA 1U90A 3PJRA 4GZLA 4PFSA 1JR3D 2FZLA 2DY1A 2R6GA 1F2UA 1ZRHA 3RRYA 3AM1A 4I99A 4Q9LA 1E2LA 4DCUA 4KVAA 4BLRA 5FBRB 2IC5A 1S9DA 1QVAA 2XSZD 3IQWA 4QC2A 2WSSD 3P27A 2ERXA 1WBDA 3UMSA 3KQLA 2HYDA 3KTAB 3OF5A 4IOJA 4TLBA 2D3WA 4HYYA 5CJ2A 2JJ8A 2GXQA 3OIVA 5JCZA 2NPIA 2JLVA 4V0LA 2WOJA 2UZIR 1CRPA 5H68A 2VF8A 2VHUA 3CR7A 2N1BA 1W47A 3BE4A 3GEHA 4WZ6A 1RYFA 2PZGA 3ADBA 2BDTA 4URZR 1E1RA 3LA6A 3IIJA 3GJ5A 4LYJA 4NBSA 1WBBA 3UKDA 4FMCB 1I2MA 3Q8XB 4KYUA 2JJ2A 4CEHA 4Q19A 4R2HA 1KY3A 3TVTA 3HYRA 4ESVA 4PO1A 3AF3A 2XZOA 1K5DA 2DCUA 2O0JA 3ZDQA 3QKUA 2F7SA 2WTUA 3TVDA 3A1WA 1AK2A 1G64A 3JVUA 2OZEA 4MA4A 3B78A 1BH2A 3LQQA 3PCRB 4BE7B 1UBFA 4DLSA 2DFTA 4JL6A 4XD7A 1G41A 4LCBA 1ZYUA 4QNRA 1Z47A 3SHWA 3A58B 3K0EA 5FOTA 4JLMA 3DM5A 2Q21A 1XCPA 2UZ3A 3QXCA 1OYYA 2X19A 1NRJB 4LV5B 3X1XA 4AKIA 2ZETA 2QBYB 4CT5A 1DAMA 3PUWA 1S3GA 4BQSA 5FPHA 1VG9B 2C03A 1KO5A 2QSZA 3CPHA 2P65A 2XX3A 3IQXA 2Z43A 2O8DA 2A30A 1O87A 2AX4A 4PAOA 1XJCA 3O8DA 1NF3A 4CEJA 3M6AA 3CIOA 1AGPA 2VSFA 3SE0A 2EFDB 3KXLA 2RH5A 1SVSA 4MYHA 3NC0C 4BFSA 2YJTD 5FUYA 5KU1A 1Q22A 2ZJ8A 1D6JA 3AV0B 5CLLA 2CHVA 4BFYA 4W5JA 5HE9A 5BXQC 3AVWA 1RYHA 4XTCS 1TU4A 5CITA 4M0LA 3QBVA 1ODFA 5JCPA 4H1UA 4I81A 5H70A 5JSZB 2Q6TA 4IHQA 4FIDA 2DWOA 2VP2A 2AKYA 1FOEB 1TU3A 3X2SA 2QP9X 1Y63A 3TH5A 1XX6A 3LBIA 3W34A 2G0NA 1VTKA 3I72A 1AS2A 1XD2B 1JB1A 3LV8A 2IS4A 3RS0A 1OH8A 1XD9A 3D31A 2ERYA 3WYAA 2XB4A 3KQUA 1LVGA 1UEIA 2BV3A 1MKYA 4HZUB 1Z6XA 3EW9A 1ZIOA 3VR6A 5JS8A 3IEVA 3E5HA 3E70C 4IDPA 3C5HA 4PPGA 2C77A 4PZZA 4LRWA 2KJQA 4AYTA 5FBVB 1GNRA 4BLPA 1XPOA 1VIAA 2CCGA 3TAHA 4LPSA 2ZYUX 1MO4A 1X6VA 2YWEA 2OBMA 3AUYA 3UK6A 3AF0A 1VECA 2BVNA 2ZREA 1BIFA 4E03A 1DS6A 2ZJOA 3QXSA 2BMEA 2GTPA 3GJ7A 2R8RA 1CF4A 4HSEA 2ZVQX 5C46F 3SR0A 3K0CA 5B58C 5G3ZA 3IGFA 4NTZA 1DADA 3WHKA 5JJIA 4AKGA 5DI3B 1HEIA 4CIDA 4US2R 3LD9A 3BJIC 1IAQA 2GCOB 3QPVA 4TLAA 4ZDWA 3NTUA 1RRCA 4QOSA 1TTTA 1EESA 3NKVA 4DEXA 4DCVA 2W2XA 3GFOA 1A4RA 4TT3A 1UKYA 1SULA 1E6CA 2IEYA 3VR4A 4JT2A 2WJVA 2CBZA 4ARZB 5DI9A 5BQ5A 2ZI4A 5FUXA 4EQ6B 2JLUA 1GKIA 2CDNA 3RSLA 3K09A 5J5CA 2W6IA 4S2EA 4A9AA 3NC1C 2EFEB 2ATVA 4HAVA 4JBWA 5EQTA 3PEWA 3M0EA 4M8NE 1QVRA 2OO7A 2W00A 4HAZA 5CDFA 1UBCA 4BLSA 1R0YA 4PO8A 3B5JA 2BKEA 4DLVA 5BWMA 3KZ1E 3QXHA 4Q47A 2ZUCA 4RKFA 2Z4SA 1Z06A 1O3YA 2YYZA 3EXAA 4V0MA 2O8CB 3GJXC 5HCIA 1NSFA 1T5IA 1E2IA 3EZFA 2VHCA 4TMKA 3U4QB 3PEVA 2OCYC 2P2LA 4LZZA 1FUUA 1CS4C 3BIFA 4Q4AA 2W6JD 3DM9B 2P67A 5BN5A 5JJLA 4HATA 3KKQA 2H16A 3DZDA 1DO0A 1M2OB 4NYJR 4N0EA 1NVWQ 3PFIA 3KXIA 4D81A 1A7JA 5H8WA 3L82B 3AQ4A 4YMWA 4BLQA 3LH5A 4XSHA 1Z5ZA 2Z0MA 2IYTA 3GJ3A 1YZGA 1R0WA 3TQCA 4EKDA 2A3RA 2X8AA 3K0CC 3AKCA 3AVOA 2EYUA 2QL6A 3QKSB 2H5EA 4HZIA 2NGRA 5CYPA 1LF5A 4F4CA 3B82A 4OI4A 4IJMA 2B8WA 3LLUA 4G5OA 4O2RA 1J99A 1KDTA 4CVNA 2X1VA 2ZYVX 2XTZA 4HAWA 3T34A 3K70C 2CEAA 4XJXA 3WNDA 4HDOB 1NG9A 1RRFA 3O8RA 2W6JA 1PV4A 4LBZA 2ZAMA 4NCJA 2OSBA 1CULC 2Z6VA 2N46A 3B9PA 3QENA 3GP8A 1NJGA 1G4AE 3RHFA 3QBTA 5J4LA 2X2FA 4M9SA 4DSOA 2ORVA 2ZROA 3RS2A 5CIWA 2O8EB 4FI3C 3CF0A 2ZRJA 1T5LA 4TTRA 1N6PA 4LC0A 2F43A 1B0UA 1KTVA 4HUTA 3CPEA 2OHFA 5C4GB 4I1OA 3A1UA 3NG1A 3ZQJA 2CE2X 5KSPA 2FSGA 4JLKA 3W6NA 4PSAA 1SHKA 1SXJC 2B8TA 5HZHA 1E9BA 4F4JA 1US8B 1C1YA 3B60A 5FPSA 4B47A 1ZNXA 1P62B 3QG1A 3ZD7A 2O52A 2OBNA 3F3YA 4GPTA 5EP1A 2IF0A 1KNXA 3ZGXA 5EE1A 3WYFA 1HTWA 1GP2A 1G17A 2GBLA 3HYTA 1ZNYA 4FD2A 1S1MA 1OE0A 4O3MA 2QP3A 4G3XA 1PUIA 3RSOA 3LXRA 2A5JA 1VIYA 3QXJA 1SKQA 4DC9A 1W36B 4CEJB 4DSTA 5KSOA 1G3IA 1RJ9A 1UKVY 4N1AA 4Q21A 3B7GA 2R6FA 4M1TA 3ZD6A 1G1MA 2JASA 1FTSA 1RPZA 1M1YE 2QAGB 2W58A 1KHTA 4OYHA 3GLGA 4D26A 2AL7A 1GL7A 4HB3A 5GADl 5E7MA 1JJ7A 1Q3TA 4AWXA 4M9QA 1AIPA 1KK2A 4BZQA 1J2JA 3G82C 4RZ2A 3HPRA 3AVPA 4AY2A 2WM9B 2PEZA 3NBXX 4Q7MB 4URVR 5L8VA 1M74A 4C0BA 3ZS9A 3FHCB 4GP7A 3MLEA 2IYVA 1N6KA 1TQDA 3F5FA 3OE7D 2C5LA 1MABA 2LCFA 3KX2A 2J46A 1ZM2A 2FWRA 4OHXA 1KSGA 2QT1A 1D5CA 4C0QC 1E2FA 4LX0A 2OFXA 3R8FA 4U7DA 2G88A 3MWKA 4PX9A 3C16C 4MUAA 3QQ5A 3KL4A 4KXFB 4CRWB 1GRQA 4Q7KA 1IM2A 5A0FA 1G6OA 3GLFA 3WRYC 2G3YA 2J5XA 1SZPA 3AVYA 2ZRNA 1U2RA 3FWYA 2C8VA 5FTNA 4OI0A 4MKHA 3QF7A 1KOFA 1SXJA 5KTYA 1E94E 4RVCA 1U0JA 1P5ZB 2AWNA 3K1JA 4C2UA 4X8HA 1E3MA 5SZJA 1HYQA 5IF9A 1Z6TA 1D2MA 4QRHA 3THXA 3RRMA 5FPKA 1KGDA 3T35A 4PPQA 2O8EA 2G1JA 1VYUA 4G5RA 3TSOA 1BO6A 3WNBA 1WDTA 4HLUC 4EFNA 3OHMA 2FN4A 4NCNA 2QM7A 3A37A 4B73A 1OW3B 3BB3A 3SQWA 2JDID 3EIEA 2OE2A 4B34A 3AP3A 1ESNA 4PHHA 3WMGA 3C41J 3Q9LA 2PH1A 4AYXA 4LJ6A 2V55B 4RJLA 2ZSEA 3IO5A 5JI3E 2OXCA 2QA5A 4Q4HA 1F2TA 5FL7D 4D0NA 2IX3A 2ZRFA 1UM8A 5BN3A 1VG8A 3ECCA 3Q3JB 1TF5A 2CK3D 1E32A 4RFSB 4BPBA 4DT1A 2YOGA 2FGJA 1IN7A 2HXYA 2QTFA 1ZM7A 5BN4A 1CP2A 4NYIQ 2B92A 2BJVA 4BFZA 4OHZA 3GLFB 1NBME 2EVWX 2IUUA 4OL0A 3A8TA 5JZVA 4DCTA 3ADDA 1FMJA 4Q1AA 1QHXA 5TVKA 3RWMB 3S1AB 1TEVA 3CWZA 4JLDA 1NBMD 3BERA 4RZXA 5AUNB 4Z51A 1D2NA 3D8BA 4IW3B 1J8MF 4MGYR 2NG1A 2XSZA 5CB6A 3W3AA 3UANA 4QBFA 4MGKR 5F9FA 1S96A 1OFIA 1WB9A 3PEUA 3Q5EA 2GDJA 1NVXQ 1II8A 3SI7A 1FX0A 1JI0A 1T8UA 3GLFE 3RANA 4QM7A 2YOHA 3CLVA 1S0UA 3ZIAD 3EG5A 3OZXA 3QF4A 1U8ZA 1CTQA 1NBMA 4JJZA 3W5JA 4DXAA 5TMPA 2G6BA 1LF0A 4QJ4A 1RIFA 1F2TB 3GFTA 4P4UA 4A0HA 1AKYA 2D7CA 5FBWB 5FL3A 3V9PA 3E2IA 2QP4A 2ZE5A 4UQOA 5L3SB 1Z8FA 3W90A 2H92A 3ICEA 1JJVA 1G4UR 2Q3MA 4A0GA 1JALA 1H8ED 2VPPA 3DKVA 3IPXA 1DARA 3IBYA 3U3MA 3X1WA 5JRJA 5LPNA 1E2GA 1HT2E 2JEOA 3W3ZB 1MR3F 2VRWA 2CK3A 2BKUA 4LI0A 2H18A 4HUQB 1KI4A 1P60A 4C0SA 3H4MA 4MRPA 5HPYB 1E98A 3EZ6A 1KMQA 3VQTA 2ODNA 3U6KA 2JLZA 3CM0A 3IO3A 3DKPA 4MYCA 3U3RA 4LYHA 4JSTA 1XEFA 4Q66C 4ZI2A 3TGPA 4Q1BA 3U5ZB 1NKSA 3P32A 1GTVA 4S35A 1G20E 4EPVA 1JAHA 4GOXA 3BRWD 2K5UA 3WP1B 1QDEA 3H84A 2RGAA 3HPQA 1S9HA 4YMUA 3LW7A 3CZQA 2CHQA 4V0ME 2PCLA 4PC2A 2XNSA 1L7VC 1NIPA 3L2OB 4AD8A 3BXZA 3HWSA 3OFNA 1CR1A 4RD1A 4ILEA 5KOYA 3QY0A 4EPTA 5A4JA 2P6RA 1NVVQ 2QQEA 3EWSA 3RABA 2PEYA 4TL8A 2ZRGA 3CZPA 4RY2A 2IWHA 3NHBA 3G0HA 1EX6A 4NHOA 3MWYW 2MMGA 4IDNA 3CRRA 2NO1A 4M4SA 2JLYA 4TZ0A 5LD2C 3VTKA 1TF7A 1F6BA 4TMVA 2ZRBA 4MDEA 4V02A 1XMVA 5DI3A 1WE2A 1MO6A 3QVVA 3AB3A 4Q4LA 3OEHD 1EFRD 1Z6YA 1JXOA 3QI2A 1QHHA 3TAUA 1DAEA 1KKMA 2YOFA 4WVFA 1WXQA 4OBEA 5FTMA 4FCWA 2C9CA 4LHXA 2JJ2D 3EIQA 4WA7A 4PC1A 3U3JA 5M04A 1YRAA 3FB4A 3GLGB 2J0QA 2PX0A 5DLQC 3GEEA 5F98A 4LYFA 5EUQB 1IJFA 2JLWA 5UKDA 2F1HA 1EG7A 4IVRA 1HE8B 4U02A 1XP8A 1E4VA 2GHIA 2IYXA 2B7BA 2GCNA 3CX6A 4GT1A 1R0XA 3T5DA 1GWNA 3AP1A 1DPFA 5CDFE 3AF2A 2HT6A 1GRNA 2RGDA 2IK8A 1N6IA 5DHAA 2HEIA 1XXHA 4KLZA 2WJHA 4HB2A 3PUZA 2FFBA 5D3MB 5D3MA 1CR4A 2NMVA 2OCPA 5DE3A 1CJTC 1Z83A 3EZ9A 2RGXA 4NE2A 5CM9C 2IW3A 3SBDA 2XXAB 1P73A 2ONKA 4K46A 3FHOA 1II8B 4ZDIA 5GVSA 1TL7C 4GMXA 3LQRA 1PUJA 3K70D 1DO2A 2VYFA 2ZJ2A 3QKRB 4RD4A 3QKTA 3ZYCA 2AFIE 1AGRA 3MMPA 1Z63A 1R0ZA 1MO5A 4XTRA 3A1VA 2HT1A 3IEUA 4EAQA 1VG1A 5FTLA 4UXHA 2AXPA 1H65A 2ZUBA 3T1OA 4YMVA 3FDIA 1P72A 2WJIA 3MD0A 3HR8A 4CEIA 2GJ8A 3CH4B 1KI1A 2CNWA 3BORA 2IYLD 2FSFA 4FWIB 1VPLA 4LBYA 2DYKA 2VH5R 3U3KA 5DH9A 2IBMA 1NL3A 4DLZA 2QPTA 4Q7LA 2GXAA 2JDIA 5JEDA 1W0JA 2YNMA 5FBLB 3NHAA 3ADKA 4V0OA 4FN5A 4GZMA 5FOWA 1U8YA 4A6XA 1NY5A 4H9GA 4KFRA 4XIGS 3U7EB 3AVVA 4L5BA 4YQFA 2C9OA 3LNCA 5IRCD 2A7QA 2VP4A 3TW4A 2WAXA 1U81A 3LVQE 1NMXA 4B3GA 1OXSC 2JIZA 2F9LA 2JCSA 2CMKA 1AQYA 3VR2A 1QBKC 4MQBA 3VR5A 2F1RA 4DUGD 4EPWA 1N2CE 2ZRLA 4UJ3A 3RWOA 1GRRA 3ADCA 4BGDA 4M1SA 4B3XA 1EFTA 1Z0AA 1PJRA 1ZUHA 2V7QA 1E9SA 2PJRA 2GBLC 1VG0B 2AR7A 2ORIA 1WMSA 1F60A 2QMUA 1W46A 2VP0A 1F5NA 1W2GA 3TUZC 1XD8A 1ZM9A 4B3CA 4US1R 2VP5A 4NKRA 4NYMQ 1JNYA 5AR1A 2XITA 4QFMA 3CRW1 4DZZA 1HY3A 4IXNA 2R65A 3PV0A 3V4FA 3ZLJA 4Q03A 4GNKA 2MSDB 2HCJB 1HV8A 4WW0A 3AF4A 4OQFA 4C0HA 2J9RA 2PLRA 5FPTA 1Q20A 3K0AB 2DWPA
chains in the Genus database with same CATH superfamily
2OUKA 4QXQA 1WP4A 2PJDA 4LGMA 4FX2A 5TF0A 1XDBA 2AFRA 4BEBA 3IUJA 4UPEA 4WECA 2PH7A 4KREA 1W4AA 2RAUA 4GXNA 1M83A 1KDOA 3GAMA 3G85A 2H4FA 3V7WA 3V8QA 3CB4A 2GLUA 5EHNA 1C3XA 3L0IB 5CDHA 1VL6A 1K6EA 1EHCA 1XNJA 3K53A 3STWA 1D04A 1JIQA 3FG9A 4Y9TA 5JMPA 5LKRA 3U16A 2C94A 3AYZB 1QE3A 3W8RA 3KSMA 1KO7A 4YP9A 4EO9A 1S7CA 3CINA 3WQQA 5HJ2A 3MILA 2V59A 4XYMA 5IARA 1TUIA 3MERA 3O2JA 2R7NA 3OX2A 4R5HA 2VP6A 4BEJA 1V3QE 3IS3A 1SIBE 1TZCA 1VKNA 2IDZA 2NSHA 3R1IA 2GTHA 4LK3A 3ML1A 4U7WA 3WLNA 3EAFA 2H17A 4G0WA 1Z5OA 2V5UA 2XB2A 1VLQA 3M6MD 1NYTA 1KVTA 3OKCA 4LHZA 4H60A 4TKVA 1UM9B 3J7AC 3TDKA 4ND8A 3SXJA 2HF2A 3WLAA 1HQYE 1RE0A 2VBIA 1KR5A 1V11B 3CRQA 3V1UA 4CYMA 2QUHA 3ILSA 1O5TA 1PEAA 5BW4A 4FQ8A 2OGUA 5IJ9B 1YA8A 2TMDA 3IB3A 1FPMA 3NVDA 1CLEA 4AZSA 2PS1A 5EJIA 4Y2TA 3EAQA 3PQ8A 2XPCA 1PWXA 4Q48A 2VSOA 5TARA 4ZMRA 1XDGA 4NK4A 3G0IA 3AVUA 1FFHA 3Q9UA 3R0IA 1Y3DE 2ILVA 1A95A 2E4YA 1J07A 1F8YA 5A4FS 4ZQIA 3TQQA 1YNOA 2C31A 2Y8EA 2OY0A 4HRVA 4UEOA 3TZCA 4JD5A 2O5VA 4UW9A 1NLYA 1P1CA 2ZRCA 3WV5A 1FL9A 2C2GA 1M73E 5E2BA 4AROA 1B0AA 2G07A 3FB1A 4YRQA 1DQPA 1RI3A 4NNPA 2GEFA 1MJGM 4IH4A 4LSGA 3OEYA 2NV0A 1A9TA 4PE5B 2DBYA 3HBMA 4B3BA 5K8UA 1DMSA 2AMJA 1X7XB 2HUNA 1IJKA 1H2EA 3AEXA 2O50A 5K8IA 4JI0B 2ZRQA 2OCIA 2Z4RA 3FMIA 2J30A 5FOXA 4LUCA 2FFJA 1ZZGA 1VGRA 2JCVA 1G16A 3DVRX 3HCPA 1JPJA 4FYKA 4HWPA 4NZYA 1MOZA 5AHWA 4QYWA 4HNQA 5F51A 4CDRA 1HNWB 1GL3A 1F5SA 2IXFA 3B1FA 4O5OA 2XYGA 1WUYA 2WU4A 1R6AA 3PD7A 3MJVA 3ND7A 2PKXA 2DUNA 5T5QA 4OX9Y 1USVA 1Y0BA 2PBRA 2WAOA 1E0KA 2P2YA 3KQSA 4NH0A 4NYIR 3RNLA 3UXYA 1WS6A 4DSUA 3UTCA 3EPRA 1OXXK 1JR2A 2NAFA 3HWWA 1XTZA 4KWCA 3DWIA 6GPBA 4IGFA 1DDOA 1NMSA 2HWKA 3DVAB 3O3MB 4AKSA 1GM5A 1I7DA 4DLBA 2XAUA 2Q50A 3EHDA 3TNFA 1IY8A 3K8YA 4YRGA 2CLMB 1CKEA 3I37X 3OUUA 3ROKA 2ID7A 1OT3A 3AI3A 5FUVA 5HZMA 1WKBA 4NFYA 4CKZA 2DETA 1WY5A 1UC9A 2HA7A 3C7TA 4FGUA 4H3SA 3OQIA 5C4MA 1G9SA 1B1CA 3RVBA 4EYSA 5IHPA 4D80A 5FB3A 1JR4A 1IYZA 2MCFA 4RTRA 2AI2A 3EGDA 3PU6A 4J8PA 1G21E 4FDUA 4NICA 4UUMA 1Y6FA 1KQFA 3T0GA 3W8EA 4YAUA 5IM4F 1B23P 3LU1A 1DJLA 4NCAA 5F5XA 1LRKA 1VCIA 1GLVA 3FSGA 4TVBA 4EUEA 5K4AA 2PNFA 3UJAA 3KPVA 4OGLA 3JAWB 4MWDA 3VXKA 3KD2A 4XPIB 2ZBPA 5DX1A 2QU8A 2ZBUA 2ORWA 5GAJA 1EU1A 4F9FA 2ZVJA 3I9LA 4QUDA 1J22A 1NG1A 5E6SA 3KHSA 5H3LA 1GAJA 2QIPA 1MXFA 1VQ1A 2VK4A 3H1EA 4OU5A 4URFA 4Y6GB 4DA6A 3GLIB 1FW6A 1XZHA 1QWSA 1UMBA 1Z08A 2EFHB 2G76A 3UOGA 5FI1B 1GT6A 4JYPA 3GLRA 4K1LA 3BQNB 1OXTA 4QVKA 4BVAA 2QD2A 1PFVA 1T5TA 1ZUWA 2ZSAA 2D59A 2EBHX 4ZOBA 4AQ7A 1E1MA 1OB5A 2OCGA 4UZEA 3K6SA 1RQRA 1KY2A 1TNDA 3FX2A 4G5GA 4KV9A 4WCDA 1FDVA 2CL0X 1UOQA 3C3MA 1E7YA 1PE0A 3C6ZA 2Q7XA 5AKHA 1ZGZA 3ZNQA 4AUMA 2QTGA 5HM8A 4M0EA 1EM6A 2P9GA 3RTBA 2J3JA 1Y3AA 3AUSA 4M89A 2X8BA 4NECA 2IUTA 1TD9A 1CJMA 1W25A 2W2MA 3LUJA 1VOTA 2NTNA 2XMCA 1U5BB 1T4GA 2CW5A 2P78A 3L6RA 5CTAA 1H1DA 3L8DA 5DOZA 4ISCA 4YJ2A 2IEAA 2Z1DA 2BOVA 1E59A 4KBGA 3AI1A 3A9RA 1FYVA 1U3GA 3FHLA 3RVMA 4EGSA 2LIPA 2PLAA 2RHBA 4YQEA 3W2FA 2GF9A 1MVOA 1WXXA 2A84A 2FEPA 1DV1A 3DLCA 3A6FA 4NG5A 3RTDA 3L7BA 5KOIA 4J1TC 1F14A 3KR0A 4AUKA 2PT9A 3CH7A 4ZEWA 3V97A 3FR7A 2CXNA 1X39A 4BNUA 3H2JA 4CR8A 3GMDA 4WBSA 1N5LA 3MIZA 3MAAC 4IIFA 4KGDA 3OEWA 4ZD6A 2AG5A 3C74A 1PQUA 4IS3A 4XFJA 3DCNA 4I66A 4PSKA 3X2EA 2VO1A 4PRZA 4DJDC 1DXHA 1Y34E 4EJSB 3TKYA 2IP4A 1J90A 4YRJA 3Q7PA 2MMCA 3FCEA 2O2XA 3STHA 4DRZA 4ZZ3A 1Q1QA 5GJVC 3E9MA 3L5OA 4EO7A 3M5DA 4XYGA 4OHUA 5JQGB 5IH7A 3TPZA 3HU2A 3ND6A 3ZVKA 1QTRA 3LDFA 3SHVA 1SBYA 4L9AA 1TEHA 2OXTA 2H2HA 3TMKA 3DDZX 5ALMA 4MUXA 1CUGA 1RHQA 4IO1A 3TX2A 1B93A 2PRYA 4MUEA 3RJ9A 1DAKA 1G291 3A9TA 1JDSA 4BTLA 1YTLA 1LS6A 5K1ZA 1L7PA 1K7XB 1A0OA 1XCJA 1FP7A 3BGSA 3HDQA 2O07A 1L7DA 3RLFA 3ZHOA 5BNWA 2R0QC 1EFAA 1O9BA 4I5DA 1TKRA 3OEHA 5FFFA 2PRJA 3ZV6A 1R12A 2BEKA 2CDCA 5FO1A 5CCEA 2BFBA 4EK9A 1XWIA 1VJGA 2P5UA 3K6RA 4GGPA 3RBVA 3WY9A 1PR2A 4BQNA 1L5VA 3NYIA 1D1SA 4Q39A 1YCDA 5L3VA 3MJCA 2ETVA 3C1OA 5KHLB 4F84A 3OPXA 4ZYYA 5GZ6A 4LJ8A 1JGTA 4FINA 4BQFA 1GUAA 3PQDA 1G1AA 2B2NA 4Q16A 4F2PA 3IIKA 1E79D 4Q7JB 1YCHA 3CNOA 1E1CB 1ECPA 1ZA1A 2WMDA 4GPEA 4U5QA 5GONA 5LP6A 2BI8A 1KJYA 2I6QA 2YWHA 4BRUA 4N9QA 3CNEA 3IKJA 4OSPA 4L5JA 3RAPR 1PW7A 1QK4A 2FG7C 4HGYA 3N7TA 3KQHA 4OSEA 1AZLA 1DC8A 4ZCRA 5DLEA 5JLJA 5IT0A 1IQRA 3HB4X 1RXIA 1U0HC 3OOEA 1P39A 4EA6A 1YQTA 2FPOA 1V16A 4LHVA 3LKVA 3WMXA 3TM4A 1HPLA 3K70B 5JD6A 3SJUA 1YOBA 1P7PA 1XQYA 3R3ZA 5KHOC 1W1WA 1HG1A 2VNKA 4PZEA 1L7EA 1NC3A 1UDRA 2TYSB 2ZDHA 2F1OA 4KYTA 4BKOA 4LMAA 2FFAA 3KB8A 3MJTA 1BGXT 2H1SA 1IN5A 1RW4A 3CFYA 4LMBA 3WYGA 1C8VB 3CXUA 4QTTB 4CEHB 2F1JA 5CIQA 1QP7A 3H5RA 5K20A 3RF6A 3DGEC 1VL8A 1RLMA 4BFWA 1MQSA 4BNWA 5FXMA 4AJ9A 4QKQA 3VFDA 2B5VA 2PRZA 5ANRB 1G38A 4JI4B 3V8BA 3EA5A 3UV3A 3G2JA 1U7WA 2V58A 4IHJF 3SM3A 2OAQ1 1C4OA 3VOAA 2BBSA 4Z4IA 1WABA 3LYAA 2CC2A 2BZGA 3AXSA 3UF0A 4BRWA 2RHLA 1TZKA 1XKTA 2PM8A 2C92A 3CX7A 2FSVC 3HRKA 4Z1MA 3B7WA 5J43A 1XZMA 4TWZA 2RE8A 1Y7PA 1CFJA 5DBHX 4PHTA 3VZDA 3CPJB 1KK3A 3W3AD 2AYXA 2AG8A 1C14A 2NTYC 2PGAA 4HL6A 1TMKA 4HTFA 4MW2A 4WNAA 4XKJA 3K9NA 3UY4A 4A3SA 3HFJA 5HF6A 1ZD1A 1OBOA 2FX5A 4K26A 3RQIA 2RGUA 2H0RA 2JH9A 1U3DA 5GONF 2ZIWB 4G24A 3UK1A 2O7QA 2RCYA 2X13A 4FFSA 4G5FA 5LDGA 4I7EA 1FUEA 5P21A 2HR1A 3AG5A 4AN0A 4PXAA 4C30A 3FRHA 1E3WA 5DTQA 4A2QA 1JSCA 1GT91 1ULHA 2BZ0A 2H9YA 1U9IC 1HC7A 1Y33E 5MF6A 1KIFA 3GRCA 2X0KA 3IDAA 3N2IA 3QKIA 3BSSA 5EE9A 3VKUA 4Y1GA 3BILA 2YJ3A 2W98A 3NEYA 1GLGA 5FBZA 2RHDA 5F21A 5ADHA 2GUWA 5A9SB 3Q7QA 4R1MA 1TZMA 4J4TA 1E2JA 1IEVA 1RQNA 2XUHA 3SVZA 2AEMA 2UV8A 4NYMR 2O2CA 2WSSA 4KO8A 2XEXA 4MDYA 1YDMA 1IIRA 4RPJA 3M6FA 3IVRA 3DC7A 2Z8YA 4DUYB 4K81B 2ZIEA 4AO6A 3IBCA 1ZNQO 4IXWA 2EJCA 4E5YA 3PG5A 1BYIA 1UF9A 4D9EA 2G77B 2PS9A 1UEJA 1BN7A 4WKGA 1CF9A 1J0CA 1P80A 4F45A 4F4HA 4FM9A 3ENNA 5KIAA 1BWQA 2PZLA 2GS9A 4I3GA 2BM8A 5DWQA 2OP0A 3VYTB 2AQ8A 4AIRA 5LQRA 3BD9A 5DULA 4KXQA 1WV0A 5EMHA 2DT8A 4UQLA 1ZJ5A 2JIOA 3GEIA 2QMYA 3PC8C 4PS1A 2DMRA 3STUA 1JR3E 3HJBA 4XLTA 2G83A 2DSTA 4YT2A 3FVTA 1PTKA 1LUAA 2DUUA 4WCFC 3D5EA 1WP9A 3S4YA 2P9ZA 2NZJA 5ALNA 2UYHA 4PZYA 3P97A 1IEQA 1RLTA 3M1IA 3PD1A 3R4VA 4AKTA 4DSAA 5BYAA 5U9CA 4A15A 3PFHA 1PWYE 4C2AA 2V9ZA 1P31A 4IKOA 1Z25A 1YZKA 4DCGA 1K6XA 5BMVA 2WUVA 3L5KA 5KVQA 1X80A 4LDZA 4HLNA 3N3AC 4JBXA 4C0XA 5AW6A 3MTBA 4LXGA 3ZDZB 4YDQA 4YECA 1UBGA 1Y3FE 4ZJPA 1LNSA 2P3QA 3I52A 2BM1A 2P5SA 3NBUA 3Q40A 3R2JA 4RVDA 5ERGB 4QLOA 3TEFA 4BIIA 1RMYA 4BNDB 5K8CA 1LFAA 4PZ9A 3GV0A 3LPCA 1F1BA 4RVFA 1T3GA 3SAJA 1W9HA 2C4NA 1EVJA 3TLCA 2X8JA 1YVUA 1UBOS 2R1VA 4FR5A 1T15A 1Z6GA 2VHQA 1WXEA 2C20A 4KN5A 4FXOA 4QUKA 2QRUA 2QJOA 3W5HA 3KE9A 4IHKA 3OETA 3HUUA 4E2ZA 4IZIA 3GVXA 1JE1A 4NMLA 4C4XA 5C35A 4XE5A 1R6VA 2R2AA 2NO5A 4GDFA 2YV3A 4ZOEA 1X1RA 3FTQA 3NHLA 1NNLA 4M8IA 5CX1B 4F3YA 2VAWA 4Z8XA 3VHLB 3VOSA 1XUOA 2B2CA 3A11A 2YWJA 3AXTA 3AI7A 4HMQA 4K03A 3MQ4A 4KBYA 1UJ6A 4H1VA 4BV8A 1ZVJA 3KPUA 2F3TA 1VL2A 1E2KA 2CHFA 1O9HA 5IZ4A 2YWBA 1LDGA 5DASA 3PXAA 5DXFA 4NDNE 4LZLA 4MVJG 1ZOIA 3KR2A 3L06A 5KHAA 4NRDA 1QCCA 2PFSA 3UHJA 4EW6A 4IQFA 2C84A 2V4ZA 3H11B 3W3AH 3L4JA 4BCCA 3JW8A 3O75A 1EMDA 4HAUA 1ULZA 5ALHA 3A6ZA 2R6JA 1Z36A 2ZJAA 4Q6WA 1U9JA 5K3FB 2QUKA 1ULUA 1ZVQA 2PJUA 4PAMA 2DAPA 1WEHA 2I4NA 1X7XA 5IM4A 4I1UA 1BC5A 3RUFA 2V8OA 4DVGA 3D6TB 3E9ZA 1OWOA 1DFHA 4M22A 4JIGA 2F3QA 4W5NA 3TNYA 3QH4A 4LOKA 2EWVA 3TEJA 2G63A 2W6QA 3P0EA 3VR4D 1RAAA 4Z0NA 1UWLA 1EVQA 2H5JA 2QRVB 2WVGA 3ESQA 3K09C 4G5HA 4CLRA 4B0OA 3HVRA 1KQOA 4ZO9A 4YRAA 2LWIA 4UTOA 1NUAA 3KLBA 4HN9A 1SPXA 1NAHA 1GZHB 2JAWA 4WKPA 1C1DA 1EWVA 2OR3A 1XJ0A 4NR0A 4EABA 3PC3A 3PT5A 3N39C 3PWKA 2XGGA 2HO4A 2W6ID 1XCMA 1WUJS 2Y1OA 4HRYA 5DPMA 3RS5A 3E9NA 3JTEA 2MR6A 2H4HA 5HKLA 1KO4A 3D4PA 5EMMA 1HDZA 2E82A 4HYQA 4IDFA 5ALVA 3N8DA 2AB0A 4N3NA 3RR2A 5AFSA 4FFLA 4IUYA 1UXKA 1JFTA 3GGGA 5D7NA 2RIPA 1B7GO 2HXGA 2R1VB 2UUAB 3NMUF 1ZCAA 2JCBA 2QMHA 3B6ZA 4ALNA 1J8YF 1N1GA 1NOIA 3NCHA 4ND7A 4WKOA 3VNUA 4KWHA 1DEXA 5F76A 3IFSA 3NT2A 2WWWA 2OQ2A 3AFHA 4HQ6A 4DDMA 4TKUB 4CCAA 1AURA 3VI3B 3AR6A 2X6TA 3GG9A 5A1JA 2HCBA 3D3QA 2FMFA 4NYJQ 4BPRA 3B52X 4RLQA 5D8DA 1AKRA 2ADMA 3S55A 4L95C 2QZSA 1K88A 4HF7A 1XZQA 1UPXA 2PU5A 2ZBRA 4J0GA 2B9VA 4GLOA 1I4WA 2UUOA 2G04A 1UFRA 3D7KA 4S1OA 1N2JA 1RS0A 4WOPA 1AHPA 1Q1AA 4MW5A 4U8HA 1J6UA 4GFDA 1YK0A 3JD3A 1XZLA 5DP2A 3TBKA 5IT5A 4JROA 4BX9A 3GGPA 1GUZA 1IBRA 3OFND 4YRRA 2AFHA 1JLLB 1YE3A 2IYZA 4A0QA 3W79A 4Y67A 5AKLA 2HHLA 3DZKA 1G3RA 1R4MA 1C30B 1AC5A 1UQTA 2X76A 3H1GA 3LMKA 4MGHA 3TS1A 3VZSA 2AVNA 1HR0B 4RH0A 3SSMA 1AGNA 4UU1A 1KSJA 4NC9A 5JT1A 4PBRA 2VUTA 4I46A 3MIIA 5HBRA 4U3JA 3PS9A 4M0CA 4U0JA 3ZN2A 4QECA 3SSOA 1SUBA 5IJXA 5C81A 1BW9B 1WG8A 4D0LB 1MW8X 1UC4B 4Q24A 5LU9A 4J90A 3TQIA 2VYVD 4EGAA 5IP5A 3GZNA 3GEMA 5GOTA 1IHPA 3P9XA 4OIFA 5JO9A 4FK8A 3CRZA 4M53A 1NASA 3ANMA 2FNAA 1VPWA 1OOEA 4JK3A 3GRPA 3GJYA 3CRNA 1EFUA 4N39A 1QUEA 4UULA 1IZYA 3NAQA 5HILA 5CDYA 2HWYA 1JSLA 1RBZA 1P0QA 1XMIA 1Z2AA 3QE3A 4N0MA 4EJSC 4GYWA 2QUZA 4Y6OA 3TW0A 5DZSA 2OCKA 4BN4A 2GAOA 5AK6A 2SHKA 5I47A 3P4YA 4CKBA 1TK3A 4OHWA 1USWA 4X1IB 2Q7OE 2JGAA 2WZQA 1YULA 2HIAA 2V7XA 3T5MA 1RDFA 4HWKA 3OESA 3HEAA 4YMGA 5L7TA 3WLOA 1L5YA 5HIJA 1C3EA 1KEVA 5AKKA 1WZIA 3RU7A 3SYLA 4DUGA 3H5VA 3L7KA 2A1IA 1K5GA 5C8YF 3ONWA 1R5OA 2NXCA 3LC0A 2I6UA 1JIXA 2VQDA 4TXMA 2HMUA 5AXDA 5BQOA 1N32B 3S7TA 4D46A 4PQEA 2O2ZA 3U7RA 5HWSA 4W5WA 4QGGA 2WFZA 3OA0A 1L5SA 2HSEA 4COKA 5ELMA 1PJBA 4E32A 4TVSA 5FWYA 3NT5A 4D9KA 3K96A 1T5HX 4KR7A 2A35A 1QB7A 1FZQA 4FOOA 4HEA1 2EOAA 3K8ZA 4JOBA 4AS3A 1RJ9B 4ZYTA 4I1YA 3RS3A 3R3XA 1PAUA 1YL7A 1SOVA 2A0WA 2JIRA 3RLIA 4C3VA 4ARIA 1MC1A 4BB9A 2GSWA 2X0FA 3RJTA 4DWVA 1W48A 3K9WA 3PWZA 4UHBA 1R10A 1KXZA 2ECOA 1WSDA 5E8JA 1ZN2A 3M89A 1AKUA 4CV2A 4NP6A 1K9VF 1Z2OX 2Y6VA 4KE7A 4QHTA 2V1UA 5GVRA 1Q2UA 4IVPA 1W88B 2CLHB 1TYAE 3AFIA 3FYTA 3C8DA 3MLBA 2B1GA 3G6KA 4MAMA 5K3DA 5HIMA 4U3JB 2PKYX 1Z16A 1T43A 2PX3A 3I3OA 1MIOA 2FWAA 4IRXA 3I0MA 3I9FA 3FCUB 2ZBQA 3K4HA 4GUAA 2WHRA 3DB1A 3D1VA 4R8SA 3SNHA 4HNUA 4KXXA 5JDIA 1K7FB 4XM0A 3WLMA 2P35A 2E5FA 3NOVA 1GADO 4PG5A 4WKBA 4YJFB 4BEVA 1QDUA 5E1OA 3NLLA 1Z5VA 2XCUA 2CXPA 3R8CA 1EVEA 4LC1A 3I05A 1JR3A 1L0BA 2UZ1B 1FFCA 3THSA 1ZJWA 3FFWA 3COPA 3B2NA 3I64A 3L77A 4TLDA 1OGYA 3E1SA 2J0EA 2QRPA 2IOFA 3R41A 2D4AA 4MAAA 4BQIA 3DHWC 2LP4Y 4P1ZA 5HG0A 4H35A 1QO0A 3OWXA 3P0FA 1JQDA 3SYMA 3CLRD 1R4NB 1DAGA 2D2EA 3FKJA 4QJIA 1LSUA 3JQ9A 2CLCX 5JG7A 1SELA 5CA1A 1E2DA 4BLUA 3OSUA 5JOQA 16PKA 5EP3A 5JAIA 5KNCH 1CY8A 3C45A 4MUKA 2QT0A 3BMNA 2Z58A 3UMRA 1OKKA 1NUSA 1J33A 4LF9B 3F96A 2PL5A 4R2WA 3RCBA 3USZA 1C1XA 4CG1A 1YTUA 1SXJE 1TO1E 4KZPA 4D43A 3ILXA 3BT7A 1FQKA 1P8AA 2GZMA 4GD3Q 1EP9A 1XROA 2FJPA 1JJFA 2ZJ7A 5SYAA 2M6LA 4RIHA 1QJ4A 3EPHA 1BQ4A 2VT7A 4MWTA 4Q00A 3SBOA 4C4RA 4C4ZA 4XM1A 5B37A 1WOYA 5E7IA 1HNZB 4Q4CA 2QR2A 4X90A 3K0KA 4EVSA 5I9LA 2WA1A 1ZW1A 2BTQB 4NS1A 3J80A 5JATA 3CNLA 5EWLB 2Q7DA 2I1VB 3JALB 1JYSA 4FQ5A 5EJ2A 2HPAA 5IVKA 2DPLA 3CBQA 3GVHA 2GVZC 3C3DA 1JHVA 1C9YA 3E48A 4ZVQA 5CB0A 1CCWA 3ASZA 3DFZA 3F6BX 3MWEB 2H07A 2QVBA 3AVXA 2Z4TA 3QHPA 2BFDA 1F51E 4ABYA 2H7VA 1BDMA 3T5TA 1O08A 1OF1A 4TVKA 2R9VA 3OPNA 3R6LA 2JRCA 2JW5A 3CLUC 3HLKA 5K05A 4KW7A 1SRQA 1RM3A 5JY1A 4R01A 3X1DA 1HURA 2CLEB 2Q3JA 3EXFA 1I4TD 1G8JA 5DGTA 4AN1A 1R5JA 1ZX1A 2VPYA 2YCBA 3A25A 1JDUA 2Z95A 4H2DA 2HLHA 2IF2A 4IIYA 4UUOA 4LHWA 2HA3A 2WTXA 3LLSA 4UFOA 4C22A 3X1ZA 3V1YA 1GNLA 3EWIA 2WU1A 3LCVB 2Z2KA 3RI3A 1SVNA 4KXLA 1A5TA 2OV3A 1M8FA 3BSWA 2H1RA 2Q6KA 3FPHA 2Q3FA 4GX0A 4M9RA 5AXBA 4RVOA 5K3FA 2MDTA 4JC4A 1W6UA 2P41A 4URHA 5HMMA 5AD1A 1T4DA 3K9LA 4DZRA 5E6UA 4LJSA 1TGVA 1D07A 1BJKA 2HLDA 2PLFA 2EW8A 2PPVA 3R9IA 2WQZA 4HAXA 3RFFA 3ZUGA 3Q5DA 2XYPA 4EELA 2X58A 1RXSA 1Q1ZA 1YS6A 1XQXA 4NBVA 1CU1A 2WI8A 1I3KA 3PR2B 4L5IA 3AUFA 5ALJA 3SJAA 4DY4A 4XQ9A 3UICA 1U5BA 1BNCA 4Y0AA 5I4CA 2MSCB 1ZUD1 4K9OA 4N6NA 5ALGA 4N3BA 5JI2E 5K4HA 2HO5A 3K9GA 4QLBA 3DWGA 3LXMA 3CC8A 3KOUA 3F0TA 1QRTA 3DDOA 3FFAA 3BIJA 4ZARA 2WD7B 5BQXA 2AQKA 5TNXA 4H27A 1ORHA 5DBOA 3ETJA 3IOMA 3LUGA 4YJ3B 2E55A 3HO6A 3SK0A 5AM2A 3FUTA 1PK9A 1Z88A 4MZXA 3R7BA 3TBFA 2FN3A 1PFKA 1SAYA 3X1KA 1DL5A 3IUNA 3OQPA 3FWHA 5K0JA 3QHAA 2J07A 4GL2A 2LUOA 2JIBA 1FYXA 1Q92A 3DWFA 3TB4A 1QFYA 4II2A 4BGIA 1F0PA 2HCTA 1LK7A 1U7UA 3IP6A 4JCOA 4M0MA 4QGHA 1FBTA 3KB1A 4X6LA 4YO7A 1UDWA 3QOXA 5EOVA 1LK5A 1VSUA 4QUAA 3SFZA 1DG3A 1XTJA 3WQRA 1W35A 3M2TA 4B4UA 3CVXA 2C4TA 1DRUA 1XDZA 5G40A 4OLAA 1QG6A 5H80A 3B13B 4RDXA 3B1WA 3H99A 1Z9BA 3IXLA 3L8ZA 2ZTLA 2B6NA 3CSUA 4MGZR 4UMDA 4FE3A 2AI1A 3MQFA 3G02A 4DJJA 4JIMA 5DWVA 4AURA 1KOLA 3JYPA 1EP2B 1UZUA 4E5UA 2ODWA 4ZT6A 1EWQA 2PMFA 3UN1A 1UAGA 3HVJA 2YQ5A 3ZWMA 2FPPA 1FNMA 1ETHA 1U9ZA 1R9JA 3OAAA 4LYAA 3H9GA 3HJCA 4DV5B 4KVGA 5KC9A 1V8PA 2NZ8A 3MTAA 3A3OA 5TXGA 3D3JA 1TQ8A 1YL5A 2XD4A 1YE5A 4G97A 4A8JC 3DBLA 2OKCA 4TWJA 3IR7A 3DTNA 4PVCA 3E0XA 2GD0A 4ASUD 2QG6A 3QPBA 5CVVA 4BO6A 1AUPA 2C4HA 3MELA 4LF7B 4HAYA 5CDGA 5FLYA 1P4SA 3JD4A 2Z3WA 5F5LA 2AN3A 1XCLA 3GLHE 4P5DA 1KEWA 3WZLA 4NOLA 4DBZA 1XVUA 2PMDA 2BGRA 1RFGE 3EUAA 2XKAA 4YUWA 4EAAA 2HIHA 3AP2A 4LIPD 1F9AA 4BZPA 4QHYA 3WQBA 4EI9A 1X8XA 4LC9A 3HU3A 1NI4A 4B80A 1YT5A 1YC5A 1DQRA 1OLUB 1P9OA 3DR3A 5G2OA 2PVSA 1IY1A 1U8AA 5DNYB 4NJMB 4ECEA 2OCBA 4IICA 4EKGA 4YP0A 2YC2C 3W0LB 5B57C 3WSTA 1T9GR 3BTUA 1NVAA 3UT0A 5IKEA 2WYVA 1UJCA 2X5XA 2G5CA 1PJSA 3P9PA 5ULLA 1UKCA 2LVBA 3HABA 3I45A 5JJCA 1R8QA 1M0WA 2B20A 3HYSA 5IWAB 4WAUA 1D7AA 4LI3X 4R8RA 3NBKA 4Y2RA 2GXSA 3QTBA 4AJ4A 4NIMA 3STTA 5JSKA 3KOZA 4CF7A 2NUPA 3RS9A 2VLIA 3PKJA 3V48A 4CV0A 4P35A 3MHTA 3RVKA 3LRXA 3GCGA 4MHOA 4AW9A 3NONA 5GP1A 5EGNA 2GLXA 2ACVA 1UFVA 2BEVA 1OGJA 1Q0SA 5HCUA 4CIBA 1X7ZA 1PO7A 2F9FA 1P7ZA 3PGMA 3PQEA 3V32A 5JZ9A 1W36D 3HKEA 4IV8A 2KW5A 1PYGA 4HWRA 3LRTA 3UWOA 2JLXA 3C7DB 1J21A 1K97A 3NBQA 4YAWA 1V96A 3QEOA 2HJGA 5JNSA 1O95C 4K2HA 1RKQA 1JKJA 3FUWA 5DGXA 3ROFA 4YAIA 1OC2A 1BE0A 1F2DA 4NPHA 1S2MA 4MKIA 1GKKA 3I5YA 4GPIB 1IVSA 2RB4A 5EWJA 2ADFA 3CF2A 3VOBA 3VPDA 2Y27A 1EXWA 5BNIA 2MINA 3E9CA 1IZ7A 3D6HA 1Y5MA 3NWBA 3WGKA 1KJWA 2NXJA 3H1PA 3R5SA 4XWOA 3DS8A 3C5WP 4P32A 1K2VN 2R25B 3SX4A 1M54A 3W2TA 4MRMA 4R2KA 2Y93A 5F78A 4HWTA 4UU8A 4KIFA 4KI7A 2Z9DA 3OCUA 1T29A 4F56A 3QV1A 4DIEA 3I9V1 4TRMA 4BKMA 4FFMA 2XKJE 5JAZA 1GCUA 2OZVA 1HE1C 5DK4A 2IS2A 2HRQA 2QZ4A 3DE3X 3WLQA 1LSSA 2DR2A 3S8EA 1T8TA 4WX2B 3N28A 2FZ4A 1LX7A 2VOEA 1DIBA 1J1IA 1E9DA 2QGNA 2W93A 3WKAA 4E5DA 5EI5A 5F7OA 1GPWB 1VM6A 3O91A 4X20A 3ZY2A 1QE0A 4D4LA 1N6HA 1S8FA 3BWEA 3TOSA 3HEBA 2JARA 3B3GA 1XQ1A 3L0DA 4Q1VA 2N9UA 2Q9CA 2PZEA 4JB0A 2L18A 3D81A 1CQZA 4QJ5A 3ROQA 2ZYIA 3THWA 4Q02A 3AKDA 3ORHA 4FHDA 5D5QA 4YR7A 2FUEA 4CQMB 4MLDA 1KAGA 5JLAA 4YS6A 3MS4A 2ONCA 1VSVA 4MA0A 4DCMA 3TG8A 1EZZA 2BGLA 2OG2A 4FDTA 2HMTA 2J4CA 3ZKWA 2BE7A 2XYQA 4N0DA 1X92A 1I7QB 5T6BA 1Q83A 4ZXPA 1XD2A 4KQXA 1USGA 1E2NA 1ODTC 1P1HA 1L2TA 1REQB 1SOAA 1YKGA 2ODEA 3BXPA 3K9HA 2ZJ1A 4G25A 3L49A 3FBGA 4DB4A 3CHYA 4CG0A 2VDOB 4C07A 3CF4G 4UTXA 1QHGA 1O6ZA 3FDJA 4JUAA 2I91A 3H8VA 1NNUA 1UMCA 1E9CA 1I4DD 1MDBA 1NP6A 1P0IA 1VSQA 2G80A 4H77A 4YTEA 4CG2A 4EB0A 3C5CA 5DT9A 1GDHA 3CA8A 2FW7A 1CE8A 4MLCA 4O4LF 2AG1A 4DDKA 4PPNA 1R9NA 2OZPA 2ZJ4A 4BMDA 2J8ZA 1F6WA 5EZ6B 3THYA 1FBNA 2V5VA 3DZGA 1P1JA 4OKNA 1UBJS 2ZRIA 4J4HA 5B2ZA 1R5BA 4MV1A 3ZI7A 4ON9A 1YVEI 4FFVA 5JZBA 3D8TA 4AJ2A 2V7TA 1R27A 2UYGA 2UZ4A 5HS6A 1F3LA 1PNRA 3B1KA 1P6UA 4L0DA 3TLEA 4A5SA 3DBHA 3QLEA 4EEZA 3BH7A 3STYA 1LFDB 4LDPA 1LBHA 1E4YA 1SVUA 2KB0A 3K0FB 2AKEA 1L7XA 2W2PA 1E0JA 3C3JA 3OJEA 1K3FA 4WXEA 4XFDA 1H6DA 4PHGA 3JWHA 4EB8A 3CH6A 2OQIA 3IAM1 1OLOA 1ZW6A 4E4YA 2O8BB 1RFLA 1UMDB 4HGZA 3IX7A 2VJDA 3C3YA 3FPGA 2BMJA 3H9CA 2OESA 3LDAA 1FA9A 4EHKA 5K45A 5CB8A 2A8YA 4RIEA 5TEVA 1I2AA 4QDZA 1U2QA 4Z54A 3NHMA 1THGA 1ECLA 3OPYI 4KQCA 4IOLA 2D0DA 2M98A 2COUA 2ZEJA 1CUJA 2JBWA 4I19A 1QFMA 4RKWA 3UATA 2VWHA 4D92A 1X87A 3WOHA 2BFEA 2AT1A 3VMMA 4CW7A 1U1CA 1HA3A 4AF7A 1CQJA 2TECE 3QWBA 2HV9A 2WU0A 3IQDB 4MW4A 4B82A 2KBFA 1PJCA 2O2JA 2R8YA 2JFYA 5BVGB 3LWZA 1IEWA 1P29A 3E7XA 4YUAA 2JHFA 4X62B 4NI5A 4MRVA 1QPZA 1I36A 3HN6A 5CCXA 4NZOA 4TMYA 3AHFA 2NZUG 2I5PO 4PYRA 4XUEA 4PYJA 1YS1X 3ICCA 1T9KA 5L3SA 3HR4A 1LRLA 1V45E 3I2FA 3EEIA 2W0MA 1ZUIA 2OMKA 2QS9A 3RE1A 1E3QA 4JBNA 4ZCTA 1J0DA 1NJ6A 1VIDA 3Q7RA 3SKYA 1D1PA 3TQTA 5CA1B 4ARCA 3UPDA 1Z82A 2QMEA 2BGTA 1IUOA 2A5FA 3ROXA 4IH9A 1TD1A 3KZVA 3WB2A 5TIIA 3LX8A 4D4JA 4OREX 5IDYA 4JYCA 4PZ0A 1Q7CA 1L1EA 3IAXA 4WLOA 3OO1A 3AHGA 3JQ6A 8GPBA 5KKNB 3R23A 1A5BB 4NMMA 5ER9A 2UVPB 3R7DA 3THYB 1C4XA 3KZKA 3WK5A 3W5SA 3R44A 4EKNB 1P5JA 3M3DA 4R1PA 2IYRA 3AUTA 1E99A 3TI9A 2PANA 3I1FA 4KN9S 1NVVR 1P9LA 4PC7A 4PHFA 2AOXA 4EB3A 5GIPE 3EZNA 2PE5A 2X41A 3KLPX 4O2LA 5I48A 1H22A 3MJRA 1HQCA 1N5JA 2I33A 2WJPA 1DI0A 3MCZA 4IXDA 4S1NA 5IF9A 1X1SA 2J48A 5KUTA 3LXUX 2IXTA 5DFAA 3PFFA 4YCJA 3ZZ1A 4D6YA 5JNTA 1EK5A 5HKKD 4B3IA 1Z39A 2FOXA 3WGLA 2D62A 4TL9A 5ENDA 1ORIA 2XYHA 4REOA 1YCGA 1JFFB 2QTVB 3AF5A 3K9BA 3EXHB 2WHXA 1GFWA 4TYWA 4FI3F 3RC3A 3N2YA 1HSZA 1R5NA 2WLSA 4IDDA 5JSZA 2IOYA 5B7NA 4KE6A 5E6SB 2DSNA 1C7EA 1SRRA 2ET6A 3QOFA 3H1FA 1EHYA 3H86A 4N8EA 5DW0A 1X1EA 2J1LA 4DCNA 4EKEA 3T0FA 4V1CA 1F4VA 5C5IA 3H87A 1VCHA 3G2HA 1IN6A 1ZJ6A 2A0KA 2E1PA 3F98A 4FFDA 4HG2A 1Z7YA 4I9HA 5FWAA 3UJBA 4X66B 3VJKA 1FFDA 4Y6LA 3C48A 2OEPA 3IR5A 4W1PA 3RRZA 2OXIA 3WBKA 3QPUA 1R3UA 1XFAA 4KSCA 2BGKA 3DE7X 1W0KA 3M82A 5AKEA 4YRNA 3MC1A 1WMBA 2JI7A 3HBNA 1QUFA 2I0FA 1RLUA 3E22A 4WI1A 3WL8A 1NLFA 2C2HA 3X44A 4A03A 3O0TA 1QX4A 3UG7A 2ZVPX 1XO1A 4MYSA 4BLOA 4D9JA 4DXHA 5CG1A 4L8FA 3OT1A 1KPIA 3I92A 1ETUA 2P3OA 1NIJA 4O6VA 4ARVA 5B1EA 4H1WA 2AD5A 3BX1A 4G4GA 4YHBA 4QARA 4E88A 2FFQA 2SKCA 1G5TA 1X8LA 4HDNB 3O47A 3ZPXA 1M1XB 2MHCA 3HYLA 5KMGA 1GU7A 4RTPA 4HBGA 4B6EA 2DERA 1UMBB 1J8FA 4H3HB 3NXSA 1XA3A 1F1JA 1B14A 2PG3A 2POCA 1EGMB 5GJCA 4IY1A 4XX1A