1UEJA

Crystal structure of human uridine-cytidine kinase 2 complexed with a substrate, cytidine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
211
structure length
205
Chain Sequence
EPFLIGVSGGTASGKSSVCAKIVQLLGQQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine-cytidine kinase 2
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 205
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1uejA00
1KZGB 2QEQA 5A0FA 5KNBA 1P2VA 4DRZA 2YWEA 2ZXUA 3DDCA 3QKRB 2CLCX 2W2TA 4JLKA 1OHHD 4OHZA 3RC8A 1CLUA 2BBSA 1NF3A 4CEJA 1N0WA 4PPGA 4ZCLA 1QDEA 2WMNB 4RKEA 3B7GA 1M1YE 1TU4A 1X6VA 2GK6A 1XDBA 1D5CA 4HATA 4BASA 1N5IA 1KY2A 4QRHA 3ADDA 3EPKA 2OXRA 1Z0AA 2PCJA 1SHKA 2PT5A 5AJZA 1N0UA 1TQ4A 2R6CA 1FPMA 3LBNA 3EC1A 1JXOA 2W00A 4I1UA 4KYIB 5TY0A 4M53A 5FPSA 2X8AA 1G19A 3CUEF 2ZRBA 5B2ZA 3PEWA 1XCMA 1QZXA 5HKKD 2G9NA 1Z8FA 3PCRB 1CJMA 3UMRA 5IF9A 1C4OA 1DG3A 1RIFA 2VTKA 3CWQA 3B9PA 5DI3A 1N6PA 3NBZC 1GNRA 4OHXA 4TLAA 4YDSA 1QRAA 1EFUA 3M4YA 4B3BA 3THXB 4QL3A 1MO6A 3B1ZA 4ZI3A 5KO2A 4Q4LA 2A5DA 3EIQA 2G77B 3ADBA 1P9RA 3VFDA 2XJ4A 5AUNB 1CKEA 3ADKA 4PO1A 1E9BA 1E94E 4GOKA 2FPMA 4GRAA 3B6EA 2GTPA 2AFIE 1LS6A 4JJZA 3CBQA 5D3MB 1MKYA 2BMEA 1JR3A 2HEIA 3OAAA 4NONA 4EUNA 3CPJB 1X8KA 3FMFA 2GBLC 3R20A 4GT1A 4DDWA 3B1YA 3CWZA 2ONKA 3EPJA 1FX0A 1II8A 2J5XA 4NYMR 1OLOA 1XWIA 3RHFA 1YU9A 2YVUA 3DHWC 3LA6A 4D25A 3EPHA 1Q0UA 3AVTA 3ETLA 2PLFA 5CM8B 2LKCA 4B3FX 1TF7A 1VCOA 4YMUA 1AJEA 3WBKA 1ZBDA 3CX7A 2W2XA 3Q8XB 1WBBA 1PLKA 1AQUA 4G5RA 4FCVA 4JLDA 1GTVA 1TF5A 4A1FA 2REOA 1SKYB 2JLXA 1K5GA 4QHYA 4ILEA 3MMPA 2O8BB 1ZD8A 3ZGXA 2REBA 3UATA 1W0JA 2YC4C 1KO8A 1JQJC 4LBVA 2PBRA 5JJIA 4EJSB 1E2IA 3ZLJA 4TTQA 1CEEA 1Z07A 3RWMB 3IUYA 2G0TA 1GSIA 3AF4A 4WBSA 2V7QA 1XMSA 1IXSB 1C9KA 3VQTA 1BOFA 4F38A 4ZIRA 2JGNA 3ZD7A 1KKMA 1KZ7B 1W4RA 3BJIC 4C0LA 5C2JB 4DWJA 3FPAA 1ETUA 2VHCA 2GBLA 3SS8A 3U3JA 5JZVA 3W90A 1YZQA 1EGAA 2R44A 3K0EA 3VR6A 1GL7A 4MYCA 1N5LA 2ZE8A 1VPLA 1OFIA 4B6FA 3W6PA 5LD2C 1YR8A 4M1SA 4IOKA 3CRQA 1SVWA 2VSXA 3NXSA 1ZC3A 4PX9A 5G40A 3EIHA 3TVDA 4LJAA 4EFLA 2JLUA 3RSLA 4G5SA 3DEFA 3GJ0A 3SQWA 4BLRA 2VPPA 4E5UA 2ZRKA 5JRJA 2XEXA 1SQ5A 4V0OA 4AKEA 1GAJA 2A5JA 2H5EA 5DIFA 2RKOA 3T1OA 2OCAA 4OK3A 2QMOA 4LJ9A 2DYKA 2JEOA 5BN5A 3FKSA 4BRWA 4X8LA 5AJVB 1VKJA 4CEJB 2JJ1D 3OHMA 1TQ2A 3EIEA 4JLPA 2QP3A 2BMJA 1E98A 1Z6AA 2GEDA 4IVRA 5FR2A 3RRMA 2IYZA 4JYBA 3SN6A 3THWB 4LY6A 4LSGA 1UBGA 1GNQA 4N0DA 2QM8A 1AK2A 3EZ7A 2YOHA 4JBYA 4C2TA 1GIAA 2ZPTX 3FHCB 3MRSA 4ESVA 2ZYWX 5FPTA 4JLOA 1OXVA 3RS3A 4TL8A 2O0HA 4FD2A 1KY3A 1Z0IA 1YZTA 1AZTA 4A0GA 4MKFA 2ZJZA 3DMDA 3K9LA 1XU4A 1DAIA 5E95A 4P31A 1OXTA 1WF3A 1XXHE 1G64A 2OFOA 2H8KA 4LC0A 4NL4H 5HCIA 3SFZA 1VHLA 5FBVB 2ZRJA 1VMAA 3I61A 1RRGA 3O8BA 3SBDA 3KDSE 5TDHA 4UXJA 3L0IB 3K0AA 4NE2A 4ESHA 3M6AA 2IEZA 1NMXA 2Q0HA 2J1LA 3FMIA 3WNBA 2BM0A 2BIFA 2FJUA 4FMCB 2CVFA 4NCNA 2ZE7A 4NYIQ 4XVUA 3W5IA 4NBSA 3O8DA 4JLMA 4UNSA 5BW8A 1XMIA 1E9CA 2LKDA 2PMDA 1SGWA 3QIAA 1PUIA 3CPEA 4WZAE 3A4NA 1YR7A 2RHDA 5EUQB 1CTQA 1II8B 1NVVR 4EPYA 1Q20A 4Q9KA 2CDNA 2C98A 4B6EA 2NO6A 1M74A 2F6RA 3UANA 1PLLA 3GLHA 1KJZA 1NVUQ 2CNWD 2OCBA 2OSBA 2QG6A 3V00A 1WBDA 4MGZR 3GLGA 1BH2A 2PZGA 1KI6A 4LJ8A 4C0HA 2GZDA 2H92A 1OKKA 2GJKA 2FPLA 3E5HA 1DBSA 1MABB 4DLTA 2QPAA 2WAYA 3KL4A 4G3XA 3WP1B 4DIDA 2OHFA 4MGIR 1XZPA 4Q9HA 2OM2A 1W0KA 2IYLD 2P6UA 4XD7D 4QC2A 2D74A 2DFTA 4GOXA 1XB2A 2JLSA 2ZTSA 1SXJE 1I2MA 3KKOA 3FHTA 3U3OA 2JJ2D 4KODA 2OXCA 2VIIA 2HF8A 2J59A 2ZYVX 5JI3E 4TYYA 1CRQA 3RLFA 4RCYA 3V4FA 1LVGA 4AG6A 2CLDX 2HLDA 1KO7A 5FTKA 3BERA 1KDPA 2WKQA 5JRZA 4R9UC 5J5CA 1DE0A 1R8SA 2FGJA 3NDPA 3FKQA 3OIVA 1JJ7A 4V0LA 1H8EA 1QG4A 1N5KA 1TADA 4IFEA 1G7SA 1XEFA 1YHNA 3K9GA 3I4LA 3UMFA 5DYIA 3U5ZB 1GM5A 1CBUA 4KFUA 2J7PA 4N0EA 1II9A 2C2HA 1KK1A 1KIMA 4LPKA 2GEVA 2IWHA 4W5WA 4G0NA 2RMKA 4UNRA 3NG1A 5G41A 4DCVA 3QXHA 3UKDA 3H86A 3ZQ6A 3AKCA 3L8ZA 5CJ2A 3QPWA 2Z5FA 1WCV1 3WHKA 1ZMXA 4PZLA 2RB4A 4KYUA 1ZUNB 1TAGA 4QGFA 4XTCS 2ZVPX 3Q7QA 1S1MA 1OFHA 5EXPA 5J4KA 1AGPA 3S1AA 1KDOA 3MGCA 3WMFA 1T3HA 5ELXA 4HUQA 1Z29A 4KJZA 4URWR 4XWAA 2OT3B 3TAUA 3ZIAA 3RS2A 3P26A 1GNPA 1Z0DA 2XOKD 2IT1A 3NBXX 1SKYE 4KVGA 3CONA 1G3MA 2BV3A 2KJQA 1P73A 3GFOA 4Q4HA 3UG6A 5BXQC 3KFVA 4TSFA 2QT0A 3T35A 1T91A 4YXWD 1PZNA 2WIBA 4PC3A 3IBGA 1H8HA 2P2LA 1COWA 4OI4A 3QVVA 5CYPA 5G53C 2V1UA 3VR2A 4DC9A 3NVAA 1TX4B 2TMKA 3L0PA 2AKAB 1OFUX 3I92A 3NEJA 2ORWA 3KQHA 1W36D 3U60B 4KHZA 2FV8A 4MKHA 4D4LA 4HZUA 3DOFA 1TUIA 2RCNA 3E2IA 4TL7A 4BZQA 2FA9A 2ZSFA 1T3SA 4Q18A 5EZ6B 2B8TA 3U2QA 2IS4A 2PMKA 5L3RA 2YWGA 3OIWA 4Q5IA 3KUCA 2O5VA 1EFRA 1LW7A 2JAQA 5EJEA 4S2EA 3AGQA 1ANKA 1F5NA 3LQQA 1W4BA 1W7AA 4FW9A 1NY5A 1D2NA 1E96A 1ZW6A 3RS7A 3ZVRA 1N2CE 3CZQA 4M1OA 3BOSA 3CKLA 3GLHB 1CRPA 2WJHA 2PH1A 2C9YA 3U3MA 4B3CA 3GLGB 1KI6B 2F1RA 2FZLA 1KGDA 2OILA 4RY2A 2VSOA 2IYWA 5IK2D 4TMXA 1ZU5A 4QJ3A 1Z47A 1J8YF 3B60A 1J2JA 4P33A 4AURA 4TLBA 3A1UA 2FG5A 2ZEJA 1JXMA 4EPTA 3BB3A 1UFQA 2KE5A 3MG9A 4AK9A 1IJFA 1T0HB 2GNOA 1D2MA 1OIWA 2JDID 3THOA 3ND9A 3SZRA 4CW7A 2E87A 1DS6A 3VKGA 3U7HB 1WMSA 2IXEA 2QL6A 1E4YA 4NPHA 2PX0A 2QNRA 2CMKA 2NQ2C 2ZI4A 4HAXA 4C0BA 3AUYA 1MRNA 2YOGA 4ITRC 1OXXK 4GPTA 2X2EA 4FMCF 4C3ZA 2GILA 2ZI9A 5L3SA 2A5YB 2I4IA 4NCHA 1A82A 3U3KA 1Q1ZA 1Q1QA 1ZM7A 4OQFA 2P6RA 4TLDA 5TXGA 1KO5A 3PENA 1ZCBA 5JEEA 4A2PA 4PR0A 1DAGA 3OE7A 3EG5A 4TN1A 2LWIA 3GJ4A 1P2UA 4KVAA 2NOAA 2GJ9A 3PEYA 4B3XA 1R0XA 4KCGA 4C9BA 4ERNA 1DPFA 4W5JA 3CF2A 3LXRA 4C0KA 2WJGA 2XNDD 1JR3E 2F1IA 3GP8A 3T1TA 4RZXA 3OIUA 3BD9A 1O87A 3SFVA 1NN5A 2V3CC 4RZUA 1K8RA 3TR0A 4LWZA 2WOOA 3U61B 3CO5A 1DG1G 5E7MA 1T0JB 4XOIA 2HT1A 4Q00A 4PAMA 1KI8A 1VIYA 4RSGA 6Q21A 4A0RA 4Q21A 3TUJC 2DR3A 3S1AB 5FL7D 4HUQB 2BC9A 3NC1C 1D2EA 2XAUA 2FWRA 1FNMA 2WWFA 4Q4HB 1IHUA 1QHNA 3UMSA 1IJEA 2FNAA 4RD0A 5EUMA 2YWFA 2NG1A 2VEDA 3PUXA 3QENA 4IXNA 3T1QA 4FIDA 1XXHA 4ACBA 4B75A 4URZR 4LK2A 4NCKA 3T06B 4H1VA 4AYWA 5A4JA 3N2EA 4Z8XA 5HR5A 4OI1A 3VTKA 4A6PA 1NG1A 2YNMA 4NKRA 3TGPA 4S35A 1XTKA 2JLYA 4WA7A 5EE0A 1G3RA 2QZ4A 2WSSD 1NBMA 1ESMA 4TT3D 4OHYA 4DUGD 3OFNA 4AYTA 4HZUB 1U8ZA 4FXPA 1TQDA 1GRRA 1I4LD 2AHOA 4D4MA 2JA1A 1JECA 1G5TA 2J0VA 1KNQA 2VP9A 4X8MA 5GVRA 2EU8A 2O52A 3ZVMA 4C0AC 1S3GA 4NYJR 3CZPA 4UJ5A 2HXSA 4OBEA 3QSYA 3THYA 2HV8A 3TJZA 4B2LA 5KPJA 5LPNA 1YRAA 2IBMA 2C77A 3BIFA 1G41A 2DHRA 1E2HA 2SHKA 2QN6A 2IWRA 3HPRA 1U0JA 1X1SA 2IC5A 2FE4A 3HU3A 5C4GB 4QOSA 5CK5A 3PITA 3ZD6A 1IN7A 3PR1A 2QTFA 3C41J 3QOFA 2XGJA 4RVCA 3EXAA 3T5DA 1ZJ6A 2V6JA 4D4KA 3SU8A 4JVLA 4L9WA 4MGKR 5FBWB 1IAQA 2ZUCA 4PC6A 1DAEA 1GWNA 1RVDA 2CL0X 2OO7A 3A4MA 4PO9A 4OKSA 2JLZA 3LFUA 4JVMA 3M0EA 2ZREA 4HAUA 2WJJA 1RKBA 2QBYB 1TEXA 3W3AA 5JCPA 4QJ4A 4XSGA 3BE4A 3Q85A 3KKNA 4TMVA 3EAQA 2GDJA 3DPUA 3PJRA 4JLBA 1YR6A 1GITA 4A0HA 3ZQJA 4NU0A 3ADCA 4QGHA 1F3OA 1GKYA 2WBLC 4U5XA 4I81A 5L3SB 4R98A 4Z1MD 4KBGA 1JI0A 4Q9JA 5JI2E 5EXTA 3LV8A 3FFAA 4MGYR 5E4FA 3WXMA 3RRYA 1T5IA 1RRCA 1OT3A 2DCUA 2BHRA 2CJWB 3X1YA 3FWYA 3GEEA 5CDFA 3LH5A 3D8BA 1JQLB 1QVRA 1LF5A 3G0HA 1E0AA 1KJWA 3TH5A 3TRFA 1KSHA 3M1IA 2FSGA 1ZU4A 4YMTA 1E2DA 1G7CA 4FCTA 4HAVA 3R9XA 3KUDA 1UBEA 1X3SA 4WZBE 1P9NA 4UXIA 3WMGA 1M6NA 3A58B 3W8NA 2WWHA 2F1JA 2FFAA 1Z5ZA 1JAHA 1VYUA 1AQYA 1MRSA 4JKYA 4RZ2A 4Q9LA 2F3TA 1Y3AA 3QKTA 2B7CA 4XVQA 2W83A 4QBGB 5CM9C 1FW6A 1DOAA 2Q6TA 1G8GA 4PSVA 2QE7A 4QHTA 3B8HA 2BBTA 4OQXA 2QORA 3RS4A 3GLHE 3O8RA 4TL6A 1W49A 3GLGE 2IS6A 2H16A 2Q9AA 3KKPA 1DELA 3KXLA 1RE0A 4DIEA 3BK7A 3SE0A 3BAFA 1M2OB 5JEDA 1YKSA 1F2UA 1UJ2A 2ODNA 3JVUA 5BYKA 4K8OA 1XEWX 4LOAA 4TL9A 2FGKA 2J0QA 1CXZA 2C95A 5FOTA 3BBPA 2D3WA 1YVDA 3EASA 1II0A 1XXHB 3NH9A 3EWSA 4XSHA 1OW3B 1VDZA 3U7GA 4GMXA 5JCZA 3UXMA 2ANCA 4B3GA 1TQ6A 1EESA 2YWHA 1US8A 4BLOA 3SYNA 2HT6A 1W5SA 2AN9A 2RAPA 2DWQA 2GXQA 2JIZA 1ZNZA 4Z8YA 4AYXA 1PLJA 3K0CC 1E2FA 1MV5A 5FTLA 4GP6A 1UEIA 2RGEA 1RRPA 2WWWA 5F2EA 2BMDA 1W4AA 2NGRA 2GVZC 3IO3A 4FMDB 3TE6A 4IDOA 2ZI5A 4I1OA 3PEVA 3EZFA 4TYQA 1Z2AA 1M7GA 4JLJA 5AR1A 4QM7A 1KSJA 3ICQB 5E7JA 4D80A 2AXPA 3THYB 1Y63A 3FMOB 1Q44A 1ZVQA 1R6BX 1Z6YA 2RGGA 2GZHA 3MCAA 3QF4A 4XTRA 4QM6A 3A1WA 2IS2A 1CULC 4PSAA 4W9MC 1HE1C 1KSFX 4POAA 2QTVB 2WWXA 3L0OA 1E4VA 1HY3A 4I1SA 1S8FA 2QMEA 3NIBA 1Z63A 4F7WA 1KAOA 1E99A 1OB2A 1Z6XA 4RZ3A 5JMTA 5DN6A 4G5OA 4BUJA 1SKQA 3TUZC 2GJ8A 2P65A 1RYFA 4TQ9A 4P4SA 1TU3A 1RPZA 1SXJB 3HU1A 2YINC 1K6MA 3K0CA 5HPYB 1M7HA 1OH5A 3GLIE 3G5UA 2R8RA 1VCMA 3IKJA 4OK6A 3OESA 1SHZA 4DLSA 2WTUA 3I5XA 4AKHA 3RAPR 4O3MA 3LX5A 4MDFA 1NIPA 2QT1A 4N3NA 3LVQE 4LYJA 4GOJA 3LDAA 5FFMA 2W6JA 1U98A 5F9FA 2V1XA 2WPDA 5GJBA 4WW0A 3GJ7A 1AS2A 2Z43A 1G4UR 1Z0FA 2ZI6A 3QG1A 2W6ID 4HZIA 2R9VA 4P4UA 1FL9A 2NTYC 3ZVLA 3P32A 1Q3TA 1N6RA 3B5JA 3ZS9A 3AKYA 4A82A 3A37A 1A7JA 2ORVA 2WMOB 4M21A 5K8IA 2JATA 5LB4A 2QSZA 2WJVA 3FKSD 3BXZA 3KB1A 2WKPA 3KKMA 3AKEA 2ZS8A 4FN5A 3K0SA 1BMFA 2FH5B 4BPBA 4BGDA 5FTJA 1F2TB 3IHWA 1WB9A 4F93B 1U90A 4MYHA 2W2VA 2I1VB 1R10A 2LCFA 2F7SA 1QHYA 2VP6A 3IIMA 1E2KA 1NSTA 2HUPA 4FMBB 3L82B 3E70C 1IXRC 3EX7C 1XBTA 2GA8A 4ASUD 3FVQA 1QHXA 3SC3A 2X1VA 1G18A 3O47A 4TYNA 4GI7A 1ZC4A 2C9CA 1KI1A 2G0NA 2YZ2A 2ZRHA 2REXB 4M22A 4Q47A 1CJUC 4WOPA 3PQCA 3OIYA 3VR4A 4KAXA 3CNLA 2PL3A 2EFHB 1OXUA 3TR5A 2QAGC 3EZ6A 2UVQA 4UXHA 1S3SA 2EWWA 3KTAB 1G6OA 2QGNA 1US8B 2JLVA 2VP5A 1OHHA 4AKIA 1DAMA 3DKVA 1QF9A 4IJMA 3W9YA 3MWYW 4A4DA 2XSZA 2BBWA 1JR6A 1KI7A 2G83A 4DDTA 4JT4A 2ORIA 2ZE5A 5EP2A 1G6HA 2UZIR 3U44A 4MYUA 5F3WB 4IHQA 4JLAA 1GP2A 3TSWA 4BFZA 5FOSA 5JSZA 2ZUBA 3B85A 3KX2A 3A1TA 5EP4A 5IRCD 2OLJA 2YKGA 2HYIC 4E03A 4E07A 2XB4A 5FL3A 4LHYA 4A36A 1IY0A 5HE9A 5HKKA 4Q1BA 1BIFA 4B43A 4DDVA 1OV4A 3QF4B 3C16C 3ZZ0A 1SVKA 1CIPA 1E79A 2VF8A 4JKIA 5FH9A 2E9SA 2OESA 2P6NA 4R2HA 4NYIR 1ZNWA 2R65A 4KSBA 1TMKA 2XXAA 2IXGA 1YE8A 2IS1A 2W58A 2GVDC 5P21A 5FBLB 2QAGA 2WJIA 4Q19A 3F8TA 4OYHA 3WRXC 4FWIB 5FOXA 4DSUA 2EQBA 5KSYA 4IOJA 4DSOA 3R8CA 2WM9B 2ZRGA 1E0JA 1X8LA 1Q22A 4ZV4A 1HUQA 2JLRA 1ZIOA 2ZANA 2FU5C 1FTSA 4KITB 3WNCA 1UPTA 4R71A 3HYRA 2D2FA 3DOEA 5DI3B 3KQNA 1JB1A 4KFTA 2FN4A 5IHPA 4AD8A 4FMDF 4U02A 1IN4A 4O25A 4GZLA 4KFRA 1ZIPA 5KSOA 1N5JA 3NHBA 4L15A 3IO5A 3P4YA 3I32A 1P2SA 4GZMA 1H8ED 5KNCA 2ZVQX 2CK3D 1G5PA 3V4RA 2WIAA 2RHMA 4M1YA 3HP1A 4BZXA 2J7KA 1XTSA 1BKDR 4AIIA 4JYCA 3L43A 1KI4A 1NBME 3C14C 2J7PD 4RFVA 1GFIA 3GMTA 2ATXA 3BC1A 3CNOA 1NP6A 2CXXA 2D7CA 1WP9A 1XJ0A 5TVKA 1P60A 2KBEA 4EPVA 5F98A 1E9AA 4D4JA 4D0LB 3D6TB 5H70A 4BLQA 1FX0B 5CB6A 4U00A 1ZM9A 1FMLA 3QBVA 3SYLA 4MRNA 3TIFA 1ZAKA 1E9DA 5J4VA 4QG7A 2AWNA 1FMJA 2EFDB 2K5UA 2P0EA 2G6BA 1HQCA 4HEJA 1Z6TA 3VR3A 4QJ5A 3UWOA 3CR7A 4Q7LA 4P0TA 4ZDKA 1YQTA 4DCNA 4IDQA 4CEIA 2VHTA 2EFEB 2N1BA 2QRNA 2R6GA 5LDDC 5D3QA 2I1QA 2IL1A 2ODEA 1FP6A 2OBLA 2HJVA 3GJ6A 1G7TA 3BB1A 1FUUA 1I4TD 3K8YA 4I4LA 1E2JA 5FOVA 3U7EB 1G3IA 1R0WA 2F9MA 1T4GA 4TSFD 3IPXA 5EXSA 4BFTA 3IQWA 2VH5R 5DGXA 1A2BA 3QKUA 1SVMA 1XMJA 5FR1A 1KO1A 3JZAA 1IN5A 4FI3C 5FUXA 1P72A 1R8QA 3W8RA 1G291 2O0KA 2VBCA 3KFXA 4ZIRB 1W44A 3TQCA 2IA5A 3SR0A 2ANBA 4NCJA 1ZRHA 1NI3A 2ERYA 2FX3A 4IVPA 1PV4A 2JJ1A 3NHAA 3QY0A 1HH4A 4M9ZA 4P4TA 3X1DA 3QI2A 1ESNA 1TL7C 4G1UC 2IEYA 3DM9B 3U44B 3G82C 2A7QA 5K8LA 5L3QA 1ZNYA 2ZRLA 2VA8A 2C99A 1JBKA 1EFRD 2QTHA 1PUJA 1NIJA 2ZR0A 2ZSDA 4GSYA 1Q21A 2QU8A 1EX6A 5CDFE 3X1ZA 5JWRA 2GK7A 3E1SA 1KI3A 2QPTA 2OCYC 2IK8A 3Q3JB 5E7IA 2OFXA 3BB4A 3SOPA 1UF9A 4Q1EA 2AR7A 2VYFA 3CH4B 2ZQ5A 3GJXC 3PUYA 1OB5A 1M7BA 3QXJA 2YYZA 4RD6A 4C0SA 1E9RA 2BBOA 4DLUA 2CVHA 2A30A 2XXAB 3U3RA 2EWVA 4GDFA 3HJNA 5CB8A 4LGMA 2H1LA 2QAGB 4DBLC 1Q1BA 4AI6A 4DSTA 2PZFA 3I73A 3P20A 4KBFA 2DWOA 1CF4A 3UIEA 4LCBA 5FOWA 1KAGA 1IQPA 4IOMA 4K46A 3AQ4A 1TTTA 3GLIA 2VQSA 1VTKA 4I99A 5AWFC 3SYKA 3ZJYA 4RD1A 2AX4A 5GJCA 1EWRA 3LVRE 2EFGA 2BVNA 3ZZTA 5LD2B 4QXAA 4TMTA 4URXR 2ZUDA 3T61A 1E9SA 4LUCA 2ZSAA 1XEXA 1FQKA 1MH1A 1ELOA 1AA9A 3CRMA 4Q03A 1VYTA 3W6NA 1XNJA 3HU2A 4EPXA 4Q4AA 1T9HA 3R7WA 3MJRA 1EXMA 1P5ZB 4YMVA 1NLYA 2CNWA 5H68A 2YJTD 2OZEA 5FBQB 4JIMA 4QNRA 2AK2A 2AWOA 1O3YA 1W5TA 5FTMA 3LW8A 2D06A 3A4LA 1QHIA 2G3YA 2ZR7A 1R5BA 3K0AB 3QQ5A 4YC7A 5SZJA 3O8CA 1AM4D 1E32A 1RZ3A 3VKWA 2IYXA 4IDNA 4IW3B 3LW7A 1U8AA 1W48A 3DKPA 3I8SA 4RD2A 4WAUA 4XD7A 2V4ZA 2H17A 4A2QA 4D82A 1TUEA 1E1RD 2WAXA 4DVGA 2Q3FA 2V8OA 2Z0MA 1OYWA 1RYHA 2JJ2A 2WJYA 3CF0A 3CIOA 1XRJA 3NBYC 5CLLA 2NPFA 2O8CA 4IFBA 4NZYA 4CEIB 2D62A 2ZRDA 2JASA 1N25A 2FFQA 5G3YA 1TEVA 1GDDA 5LBIA 5F9HA 2NMVA 4CF7A 2A3RA 1LV7A 2F9LA 1P2TA 3D31A 5TARA 1UBCA 4PPQA 3UK6A 3W5JA 3PUVA 2G1KA 1AGRA 3B13B 3GFTA 4R2IA 1G8YA 3K9NA 4KSCA 3EARA 4M4SA 4EPWA 2ZR9A 1XF9A 3HWSA 1M8PA 1G21E 2NO0A 2VP4A 4PC2A 3BRWD 1FOEB 3TLXA 3AB3A 1P4SA 2QP4A 3AF2A 4QKQA 5K8UA 4MRPA 4BLSA 4LBZA 2GRJA 4CT4B 1W36C 3X1XA 2WWIA 5HCNA 4TLCA 4MUAA 2ZJOA 1EFTA 4O2RA 2ZE6A 3EW9A 3PG5A 3MSXA 4DB2A 4KV9A 1CR1A 3CR8A 3MUFA 4JT2A 2AK3A 5L3QB 1F48A 3GEIA 4QGGA 1YZGA 2YV5A 3DM5A 2FEMA 4DEXA 4PAQA 2IX3A 1DAFA 3LX8A 1SVIA 2IUSA 3BWDD 4PHTA 1UEJA 1T6NA 4TMWA 2OG2A 2ZRIA 2AXNA 1J90A 4GBMA 3TMKA 1Z6GA 2XOKA 3FFBA 3KJIA 1S1CA 2AD1A 2VHUA 3H4MA 4NCIA 1GKUB 3B78A 2EVWX 4DB4A 1OPXA 4DHEA 1V43A 1J7KA 3K53A 1KMHA 4YXWA 2BKUA 3LRPA 2C5LA 2N42A 4LYAA 4UJ3A 1E2GA 5FUVA 2ZYTX 4AG5A 3PV0A 4M1MA 4EAQA 1HA3A 1NRJB 3MD0A 4US2R 1TNDA 1FZQA 2J0UA 3I1FA 4IRUB 3OEHA 3AVPA 2MSDB 4NDZA 2F43A 4QBHA 1SXJD 2ZRMA 4Y0VA 2ZU0C 2BEJA 2VHQA 3GLIB 1RC8A 5BWMA 4DLWA 3WP0A 5KDLA 1P6XA 3LO5A 1GL9B 4WVFA 5KHOC 2IW3A 3UG7A 5TV2A 1KSGA 1RW4A 3AKDA 4ZO4A 1XJCA 2GJAA 3EZ9A 4Q4AB 4B35A 1NMYA 4KLZA 3R7WB 2ZITA 3ZVNA 1J8MF 3UWKA 4JL6A 2DFNA 3KKQA 4Q1CA 1L4UA 5KDDA 1YZLA 1W47A 3AF1A 5FTNA 1PVOA 4B34A 1E2NA 1A4RA 4PSKA 4Z51A 521PA 1HT1E 5IK2A 3IIKA 2ZS9A 2B21A 3CF6R 3PEUA 4WXPA 5CITA 4CVNA 3TW4A 1Q1EA 5GJWC 1IY1A 2HCBA 4PC1A 5EP1A 4OQMA 1AS0A 5IT5A 4M2LA 3R9WA 4HDCA 3BS4A 3MAAC 4F91B 3TVTA 3ASYA 3ZH9B 2GCOA 2GCPA 2J3EA 5FUWA 2IUUA 2VLIA 1DARA 2XTMA 1E2EA 1QHHA 3K70D 2ZJ8A 3WYGA 4GP7A 1SZPA 1NN3A 3C4JA 4LJ6A 1XCGB 2IXFA 2FSHA 5AUQA 2ZRPA 3CPHA 2FDCA 1CJKC 2EW1A 4OHWA 3ASZA 1WA5A 3FE2A 1XD2A 3F0TA 3LQRA 1A2KC 4Q66C 1I4DD 5B64A 2KB0A 8OHMA 5GVSA 4Q4JA 5L3VA 1GVNB 2W0SA 3N5CA 2B8WA 3CNNA 4DKXA 2Z83A 1BYIA 2GCNA 5TMPA 3GCGA 4DCSA 1GL6A 2XNDA 1UDWA 4JSYA 4O2LA 1FFHA 1AIPA 3ZYCA 3MJHA 2IYUA 4MRRA 5KOYA 1BYUA 1AN0A 2J87A 3P27A 3OEEA 4LJ5A 2DB3A 2QY9A 3SQXA 1KI9A 2JLWA 3NEYA 1W46A 1KNXA 4LBWA 3A1VA 2BMFA 1S4QA 1FQJA 2QENA 4L5BA 5FL7A 5CYOA 3IBYA 1XP8A 3IPYA 1IM2A 3T15A 5FUYA 4B73A 2Q21A 4ZDJA 2W0MA 3K9HA 4QHSA 3BFKA 3MLEA 1KTVA 3VHXA 2MSEB 1KDRA 1LNZA 1KMHB 3AF3A 2C96A 5B30A 2NZJA 1NNEA 4D26A 3LBHA 3ZZUA 3VU9A 4BFVA 5JLJA 1H65A 4DSNA 4OL0A 5J4YA 4RD3A 1UKEA 4V0KA 4HDOB 2ZAOA 1MT0A 3Q5EA 4BECA 2ZETA 1IN6A 2QPOA 4EJSC 1CP2A 1E9EA 1VG9B 1W36B 2J0UB 1OH6A 4TT3A 1DADA 2WSSA 2RGDA 3PUWA 2F43B 4DUGA 1N0VC 2NO9A 2ODWA 2C04A 4RKFA 1E1QA 3LAWA 2ECKA 1ZNXA 3RS0A 1EFCA 4V0MA 1JEEA 4MRSA 3F3YA 4LV8B 5EE3A 2XNSA 1NVWQ 3A8TA 4HB4A 1V5WA 3ZDQA 3GQBA 2QRZA 2IF0A 4TYPA 2XZLA 2WPDD 3KXIA 1QBKC 1CS4C 1R0ZA 4URUR 4PFSA 3D7MA 1EK0A 3DZ8A 1LB1B 3JZMA 3VX3A 2CL6X 4UQOA 3RC3A 3D3QA 3QKSA 4UNPA 3QPVA 2P5SA 1RRFA 4D0NA 3R8FA 3RANA 3I8XA 1KKLA 4CYMA 2ZU6A 2ERXA 5CIWA 2O8FA 4JMPA 2YHSA 1XZQA 2PJZA 1N6NA 1YZUA 3BH6A 1IBRA 4L4UA 4TLEA 5EP3A 4CGZA 1JR3D 3QE0A 3OAAD 4EJSA 2HXYA 5JJKA 2EFCB 2BOVA 5M04A 1QG2A 2R62A 4A15A 2A9KA 4D6PA 4LHZA 3ECCA 2GCOB 5EE5B 3X2SA 3AVXA 1U8YA 1AKYA 1IOZA 1I2DA 3WBJA 3KQKA 3TUIC 4DT1A 5KUTA 2OLKA 5HZHA 1XPRA 3AGPA 1G5RA 5JWHA 3A1SA 1ZCAA 1ZINA 1HURA 4A6XA 4TQUS 1Z06A 421PA 1Z08A 1HEIA 2RGNC 2VL7A 3NTUA 3CW2A 1A1VA 4B2PA 4ARZA 4HYYA 5BN4A 1ZUHA 5J47A 1KYIA 3MWJA 1FNNA 5BYJA 1UM8A 1XD2B 1W0JD 1E69A 1ODFA 1Z0JA 1XD8A 2C8VA 2WICA 4XH9B 4N1AA 1P75A 4Q4JB 5E3HA 2VO1A 1XJQA 2V7QD 1R2QA 4WXRA 5FPYA 4IEEA 3W34A 1OIVA 1E3MA 1G4AE 4AKGA 2E1RA 2XSZD 4A9AA 2PZEA 1SVLA 1NMZA 4HAZA 4Q7JB 4TWZA 5FBRB 2C9OA 3H1TA 3FB4A 3ZS8A 3L2OB 2CHVA 1ZM4A 2QUZA 4BFWA 5BN3A 3THWA 5HTKA 3B9QA 2R6AA 3QXXA 2JCSA 3EZ2A 2OBMA 3WYFA 5AJWA 2GEUA 4TZ6A 2NIPA 3LBIA 2ZIAA 1F6BA 2RGNA 2WHXA 1S2MA 4NMMA 4DDUA 4X8OA 1VG0B 3SDZA 1E79D 1NN1A 2CE7A 2XZPA 4XWKA 4YONB 2ZRAA 4W7SA 3DL0A 1L7VC 4B2IA 3KZ1E 3VU9B 2QMHA 5HZKA 4IVQA 2GXUA 4WIAA 3CH5A 1G17A 5KSZA 2GETA 4MKIA 4D0GA 2F55A 1DO0A 3P4XA 1NY6A 1T8UA 4RFSA 2ZRNA 721PA 4UKDA 1GZSA 2H57A 1KK0A 2PT7A 4OQNA 1N6OA 1S9DA 1Z22A 1G3QA 2BDTA 2VHJA 1U0LA 1XMVA 3EC2A 4PQYA 2ZI7A 1HQYE 4WZ6A 1RJ9A 1W2HA 4MRVA 4JBWA 4D2IA 3NBFA 3VNVA 4RCZA 1M34E 1F2UB 4PXAA 4TYWA 4B44A 1UDXA 2QQ0A 2HJGA 1G1MA 2QP9X 4OK5A 3FYHA 4BRUA 5C4MA 3QXCA 2WOJA 2CEAA 2MMGA 3B82A 3T34A 4GMDA 2DWPA 821PA 3AH8A 2IYSA 3PIRA 1KDTA 1LY1A 4TMZA 3RNLA 4BFXA 2HCJB 3QKSB 2ONJA 5J4LA 3TW8B 3PVSA 1MABA 3N2IA 1W4CA 1MO3A 2O8FB 2DBYA 3GJ3A 4JVNA 4HAWA 2ZAMA 1Q57A 2F1HA 3R9IA 4F4CA 2RGAA 4KLNA 1JNYA 4HLUC 3NDBB 2V54A 5AJYA 3QNUA 3C7KA 1E2PA 1UKYA 1R5OA 4YMWA 3RS5A 1G7RA 3BFVA 4PQFA 1AS3A 5EE1A 4LJYA 3QJYA 3GD7A 4PHHA 4DT1B 3CM0A 2GHIA 3V9PA 5JS8A 5BQ5A 2H7VA 1L2TA 3DVLA 4EKDA 2ZRFA 2QAJA 1F60A 1UKVY 1BS1A 1OXSC 2KWIA 2ZYUX 4CIDA 1IY2A 1OKKD 2QA5A 4ARZB 2ZJYA 1LF0A 1QHGA 4NYMQ 1JALA 2V55B 2PEYA 3W3ZB 2W6IA 1VECA 1E2LA 2OUKA 1W0KD 221PA 1VG1A 2X2FA 1EWQA 3KJEA 1NKTA 3CRW1 4P4SB 1GUAA 3DZDA 4G5GA 1R5NA 3PFIA 2YOFA 2VF7A 3U6KA 2XTZA 4XVRA 4DLYA 1R4AA 4PQRA 2AL7A 1E2QA 2XTNA 2J0SA 4HLUA 2OCPA 4LDJA 1XTRA 2HLDD 2CL7X 2JJ8A 4QFMA 3RRNA 4G01B 1XX6A 1Z0KA 5KPDA 4Q1DA 2O8EA 1DVRA 2HDNB 1YR9A 1B0UA 1VHTA 2IYRA 2IF2A 1ZM2A 4LBYA 4Q1FA 3I72A 4HB3A 2IYYA 2WWYA 2VRWA 2QM7A 2Z4RA 4ASUA 3AP1A 2CHGA 2MMCA 1XTQA 1T8TA 2BCGY 3TNFA 2ZSBA 2RGCA 4NHOA 1GG2A 1VCNA 4ZDIA 2P67A 3FMPB 3GLFA 2I3BA 2GF0A 5FI1B 3KQUA 3HDTA 4A8JC 1N3BA 1UADA 5LB2A 2FOLA 4TZ0A 1DAHA 4IOLA 4Q7MB 4LJ7A 1TF2A 1CR4A 3H84A 4L16A 2OAQ1 1N6HA 4JVSB 1E2MA 4RFSB 1Z28A 1SVOA 4ON9A 3EWAA 2WVJA 2D2EA 5KYKA 4BEJA 3HYTA 5IDVA 1NG9A 4OI2A 3B1VA 3Q9LA 2QQEA 1Q3HA 4DZZA 3ZIAD 1RJ9B 4JSTA 2VP0A 1XD9A 4GNKA 2PCLA 3RYTC 2A5GA 2Q9BA 3IQXA 3FHOA 4OHVA 2CCJA 1X1RA 2FFHA 5KSPA 1H8HD 1OF1A 1COWD 2CE2X 2KSQA 1E6CA 1JJVA 4NH0A 3IEUA 3KB2A 4B33A 2XZOA 1W2GA 2KBFA 4MA4A 4LRWA 5CJPA 4A8JA 3RVBA 4EDHA 1NLZA 3C15C 1UKZA 3VR5A 4B3DA 1VIAA 3WYAA 5DHFA 1Z3IX 2RGBA 121PA 1MR3F 1P62B 3K0FA 4CZ2A 4MITA 5JHHB 3DMNA 3SNHA 2FSIA 3AVWA 2GKSA 4B74A 4US0R 5JSZB 2MSCB 1LS1A 2GZAA 4LHWA 4QBFA 5AJXA 5JFGA 4OJKA 3T1VA 4LYHA 4ZKEA 1YZKA 2WKRA 4HLQB 5DO9A 3QF7A 2GXSA 4Q1AA 1HYQA 1DTSA 3RDPA 2OEPA 2VSFA 3QEJA 4ZKDA 3NKVA 4L9SA 3SI7A 2NO1A 3IDQA 3QG5A 3TAHA 1ZYUA 2PJRA 2J41A 1CR2A 3U7FB 1G8HA 2F3RA 3MWKA 2HF9A 5L8VA 2V9PA 3B2EA 3KQLA 1NVVQ 4DJTA 1P3JA 3SJBA 2CK3A 4CRWB 2X77A 1T3LA 1U9IC 3W6OA 2ZJAA 4XWOA 2ZS7A 2OFWA 4UNNA 4HLDA 2UKDA 4C0JA 2DY1A 5G3ZA 2HYDA 1OSNA 3LWNA 3Q5DA 5DLQC 4DLRA 5AK0A 2IHYA 3IEVA 1R0YA 2Z4SA 4GFDA 5C46F 1W1WA 2ATVA 4EIWA 5TB5A 2J9RA 1G8PA 4V0ME 3GPLA 1E0KA 2AKYA 3L8YA 4IDPA 3AP3A 4BQSA 1VCIA 3AVVA 1Q12A 5K8TA 3OZXA 5FI0B 4Q48A 2ZRCA 2EYUA 2YC2C 1DO2A 3H0KA 4JS0A 4LHXA 4OJQA 2QI9C 1X8JA 2JLQA 3F5FA 4E09A 2O8EB 1QVAA 2FSFA 2GESA 4C4PA 5GADl 3LLUA 1HTWA 3OE7D 4PPFA 4CEHA 1XTIA 4C7OA 5DH9A 1HT2E 1ZD9A 4HDQB 5JJLA 3REFA 2PX3A 3AVUA 4HI0E 1CJVC 3NWJA 3IHLA 1ZUIA 2Q3HA 4BZPA 4B76A 5DE3A 3GLFB 1KMQA 1RFLA 1G8FA 3AEZA 5DNYB 4LHVA 1U9IA 1DAKA 3MFYA 4EQ6A 3VX4A 1YJ5A 3CB4A 2VP2A 5DSZA 4J0QA 5JBQA 4IXMA 1NN0A 3A36A 4P32A 4QBIA 2NO7A 2OE2A 2R6DA 3KXKA 3NC0C 4ABYA 4HAYA 2B92A 4F92B 1EFHA 3GJ5A 4LI0A 3WY9A 1IONA 4PHGA 3OEHD 2B7BA 2R6FA 1NL3A 1KI2A 4HB2A 1GKIA 5EE9A 4OI0A 1L4YA 1XFAA 2QROA 4IEIA 3VHLB 1AKEA 5SZKB 3HR7A 4JJKA 1SVSA 2NZ8A 2IUTA 1OJLA 2BCJQ 4L8GA 5SZIA 4KFSA 4BE7B 3HR8A 4R7ZA 4DXAA 5C1BA 4H1UA 4C30A 2XB2A 4JZKA 1K5DA 2H18A 4B47A 2P5TB 4M9XA 4E22A 3WHLA 1A5TA 3B1WA 5J4HA 3I5YA 2GF9A 4Z54A 4LPSA 4AWXA 4HB0A 1U99A 4IDHA 3AM1A 4KO8A 1EG7A 3GEHA 1U2RA 5JS7A 1AZSC 2Q9CA 1IXZA 3H2YA 3RRZA 4PAOA 5CLQA 4BLTA 5DHAA 4A8JB 4YDHB 3CRRA 3KJHA 3QPUA 1NBMD 4AC9A 1T5LA 1KHTA 4QNMA 3OFND 4X8HA 1NVXQ 2P3SA 4PPNA 3RSOA 2WWGA 2XX3A 4JLVA 3K0FB 4ZI2A 4OQLA 4ZPXA 1WXQA 3BH7A 3AVQA 1HE8B 2A2ZA 2C03A 5KNDA 2BEKA 2IYQA 2QBYA 4M0LA 4MQBA 4D81A 3U6BA 4PC7A 2PLRA 3GJ8A 1NJFA 1NSFA 1GILA 1XEWY 4DCUA 5EZ5A 4Q01A 5B57C 4K81B 2ZSEA 2QMUA 4AY2A 3BH0A 3VAAA 4US1R 5KDOA 4JLNA 1NJGA 1OYYA 1WRBA 1S96A 1ZD1A 3EA0A 4YMSA 3QEOA 3IIJA 4NTZA 1S9HA 2IYTA 2RH5A 4M9QA 5B58C 1WDTA 2CJWA 5SZHB 2BWJA 4JL8A 1G3UA 4YQFA 2G88A 3FOZA 1TPZA 4LYFA 4NP6A 2GXAA 1D6JA 5UKDA 3LXXA 4TQAA 3U4QA 2CCGA 3QVUA 4W5HA 3GFPA 4Q7KA 3PXGA 1R7RA 1G20E 1KK2A 4LX0A 4ZCMA 4PTLA 3VKHA 2X19A 3TSZA 3AVYA 4P3YA 2DPXA 4M9SA 5A5GA 1XTJA 1G9XA 4A2WA 2FF7A 4PZZA 3NH6A 4FWTA 1UAAA 2J45A 1XEXB 4C2UA 4M8NE 1XCPA 2ZJ2A 1E1RA 3WNDA 1Z83A 3SEAA 4BWYA 2PEZA 4GL2A 1JPNA 3OEED 3CLVA 1BO6A 3T5GA 3TQFA 2FMXA 1LTQA 3BORA 1U81A 4TTRA 4DLVA 4URVR 2FEOA 2RGXA 3FTQA 1XPUA 2UZ3A 1E0SA 3A6PC 4FINA 5J40A 4Q9IA 4CEHB 2BM1A 621PA 4C7OB 1U0HC 1LFDB 3TK1A 3ONWA 4QGAA 4BEBA 4XIGS 4MUBA 1OH7A 3VNUA 3EPLA 1QHSA 5CK4A 1YRBA 5DYGA 2FPKA 3LD9A 3QBTA 4URYR 3LY5A 4EQ6B 2JDIA 5EXXA 5JWOA 4TMKA 4EFNA 2R2AA 4ACAA 2WZQA 3P1JA 1OH8A 3C8UA 2O8DA 3SJCA 3K09C 3FDIA 3HPQA 3JVVA 2D4HA 1L8QA 2QE7D 4O0MA 4CT5A 1SXJC 2A5FA 4HSEA 1P7CA 2O8CB 4A0FA 1JEDA 1N6IA 1EX7A 1E1QD 2J46A 1JAIA 4M1WA 1X86B 1FUKA 1OIXA 4II7A 4H9GA 1B23P 1OE0A 3K1JA 5H8WA 3AF0A 2Y8EA 2ZJBA 4KU4A 3QXSA 3SHFA 2ZI3A 4RD4A 2GJSA 1D8TA 3LLMA 4LC1A 1C1YA 2AD5A 1KJYA 3I62A 3C5CA 4M1KA 3WRYC 4C0QC 3QKRA 2XITA 4LJ4A 5FOUA 4I1VA 1XPOA 1WE2A 1JPJA 2C78A 1YZNA 3AUXA 2CCKA 2ZJ5A 3OF5A 1HV8A 2JIZD 4HLCA 4EFMA 3WMEA 4U7DA 4DLXA 5JHGB 1MO5A 4RJLA 1PJRA 4V03A 4KXFB 3K09A 1GRNA 4DCTA 4DEYA 1SXJA 3N70A 5AUOB 4KI0A 2ODBA 2DFLA 3IGFA 2ZM5A 3SHWA 1FP7A 1KO4A 2ASEA 3LNCA 3SJZA 2CLSA 3REGA 5CIQA 3K70C 3C5HA 2G1JA 4CDGA 4MH0R 1OFTA 3J81k 1ONBA 4B71A 2D7DA 1G16A 1CR0A 1SULA 3GLFE 3CX8A 3THXA 3ICEA 4JL5A 4MKGA 3RWOA 1MO4A 2OV2A 2WSMA 5ANRB 3AVOA 2FFBA 1KK3A 3CX6A 3L0SA 1J99A 4NYJQ 4DLZA 4F4JA 4HUTA 5DN6D 4PO8A 4UNQA 1DEKA 1ZM3A 4V0NA 1WQ1R 5GJVC 5FPKA 3SJAA 3U4QB 3AP2A 4FCWA 4TTPA 3KJGA 2V6IA 2XJ9A 3BFXA 5D3MA 3VR1A 2IHBA 1P9WA 2DFKB 4G5QA 5C18A 3TSOA 5JECA 4PZYA 2ZROA 1J70A 3UPUA 4A92A 4B48A 4F4IA 4XJXA 3SBEA 3X1WA 1ZP6A 1CU1A 3FGNA 4LV6A 5HE8A 2BKEA 1F2TA 1MOZA 1FTNA 3K70B 2W6JD 5AUPB 4PHFA 1VYVA 2GWHA 1S0UA 4BFUA 4EPRA 4JBXA 4BFSA 2GAAA 2O0JA 1NLFA 4M1TA 2FZ4A 5KTYA 2Q3MA 3T12A 3BGWA 3ND8A 3VMFA 2IYVA 3EA5A 3TKLA 4BFYA 1IN8A 3RABA 3Q72A 1D9XA 1E9FA 4V02A 5DISB 4LZZA 4Q02A 3TBKA 5KU1A 2O8BA 1GOTA 2OBNA 4Y0AA 1Z2CA 2KI5A 2N46A 4ZCIA 2BJWA 2CHQA 2L0XA 1NKSA 1BMFD 3KTAA 4MDEA 1N6LA 4YLGA 5DI9A 1UBFA 2O8DB 4B32A 3MWLA 4BLPA 5EQTA 1D9ZA 1U94A 1P61B 1VG8A 2CBZA 2OAP1 2Z6VA 1QHHB 3B1XA 2QSYA 3Q7PA 4PANA 3QUSA 1N6KA 2EYQA 4ZDWA 2AFHE 3DO6A 2GAOA 3AV0B 2NPIA 3PUZA 1CJTC 4Z1MA 1KOFA 3IILA 2BJVA 3CRVA 5FPHA 2A78A 2WV9A 3I3SR 4LV5B 4MYTA 1GRQA 2B6HA 5H1YA 4IKEA 2QGZA
chains in the Genus database with same CATH superfamily
3U4GA 3RGGA 1P2VA 1N7IA 2XMPA 5JFTA 1RQPA 4LQLA 1RCUA 2RHJA 1ISFA 2JFZA 1NZDA 3DDCA 4BQPA 7ABPA 2CLCX 4N8EA 4V0QA 4DIKA 3HKDA 4ZOBA 4B9EA 2FDXA 2NVUA 4TROA 3NKLA 3EGEA 5EGNA 1NR7A 2CB0A 2CUTA 2QZPA 3CVOA 4QYTA 1NF3A 1T9KA 2QQFA 4ZT5A 1EA7A 4KBYA 3ZHSA 1QTIA 4CEJA 2R7KA 2ZR8A 1TU4A 1DBPA 3DGEC 4QDUA 3R0QA 4RLFA 5DCUA 4DHWA 2SNIE 1N5IA 1KY2A 2V6GA 4J76A 1SXPA 2XYVA 1WQ4A 4TRRA 1Q16A 2YFHA 4BU1A 5COBA 1FPMA 3EC1A 1DOHA 5I9BA 5KREA 4KYIB 2A33A 3OTHA 4E5VA 5HOQA 2FUG6 5TPZA 1ICIA 1D0IA 2PRSA 3BMNB 2ZRBA 4WOKA 3B1KA 3RCBA 1QQBA 1Z8FA 7REQA 1A8SA 4J07A 2I6QA 3EFBA 1C4OA 3KAKA 1RIFA 4UNIA 4MIYA 5F1OA 1MPXA 1S2DA 4K9PA 5DI3A 1Y1LA 2XRMA 1N6PA 4OHXA 3RSQA 3GFVA 4BNFA 2QZZA 3M4YA 1C7EA 4V24A 4CTJA 4UOZA 1A9SA 4QL3A 4QUBA 2ZZKA 1HBJA 1GAEO 1LK0A 1QYCA 4H15A 4Q4LA 3EIQA 3ZW8A 4F3YA 4YRMA 1H1TA 1P9RA 3R23A 2XJ4A 5AUNB 2V5AA 3PNOA 4YRPA 2YIDA 1VBFA 1JQKA 3DUFA 1GGMA 3RK0A 1QNLA 2YCBA 3H7AA 1KYXA 5DGTA 3B6EA 2VG8A 3PXDA 3OLQA 3U37A 1M6HA 1LS6A 2CMHA 4JJZA 1K1EA 1PBNA 3T3IA 4AS3A 3F2VA 3TEJA 2WQ7A 1YXMA 3HXPA 1PHRA 4CUZA 4KE7A 4WUTA 1JR3A 5ALTA 3AERA 1HDEA 4EMUA 4EUNA 3O94A 3FRHA 4GT1A 3H04A 3NZEA 4YIKA 2ECQA 5REQB 3JQPA 2FMUA 5K5EA 3ROKA 2ONKA 3UWPA 3ZZNA 4NYMR 5FWXA 1FF9A 3PE4A 3RHFA 2CF6A 4AMVA 1FU4A 1V6AA 3AVTA 3ETLA 2PLFA 5KJEA 2LKCA 3V2HA 3AK4A 3R44A 3VJMA 4YMUA 4ZOQI 2AMVA 2VS1A 4RIFA 1RD4A 4Y1EA 4GX5A 3T6KA 2J4FA 1CQIB 4GBGA 1O4WA 5A2QA 5KNCD 4MZDA 3WL3A 2IE8A 1CDEA 1Z4NA 1UBLS 5K51A 1GTVA 1QV6A 1TF5A 4AJKA 4G8JA 4WVLA 4R54A 4EZBA 4CMIB 2IGTA 4O1HA 1JQDA 1ZD8A 2E3JA 2A84A 3OUUA 2Z8ZA 3C6MA 5EI5A 1UBOS 3UATA 1CZKA 1JPVA 1KO8A 1W0JA 5DB4A 2PBRA 1GZ5A 1R5JA 3LZDA 3E35A 3PF9A 1CEEA 1E20A 2LW7A 2Y92A 4P98A 1J0BA 3B1FA 3IUYA 4WBSA 9LDTA 2V7QA 3QM1A 1C9KA 1EM6A 5A4AA 3BJMA 4NDAA 4ZIRA 3ZD7A 3KZMA 1W4RA 1PJLA 2VCYA 5IANA 1BMQA 4R0VA 1JDPA 1RKUA 3JD1A 2ZQZA 1GL7A 1VGQA 1KKUA 4AJEA 3BREA 1DEOA 2ZE8A 2YUIA 3PE6A 1KY4A 1ZOSA 1OFIA 4QOHA 3IR7A 5LD2C 1EFVB 2NZUG 5J9FA 1MJGM 4ZVRA 1T6BY 3HM2A 2C2WA 5DHUA 5CA0A 3CRQA 4PLVA 5IM4A 1SVWA 5B55A 1ZC3A 2EGHA 2Q7DA 2DFVA 4LJKA 3AJEA 4EFLA 2JLUA 5JS2A 1P8JA 2EP5A 3PNPA 4G5SA 5ITVA 5ILQA 3QHPA 4BLRA 4MW9A 5LOVB 1LI5A 2XEXA 3R5KA 1PUXA 4WE3A 3T7EA 4GOLD 5CD9A 3SKXA 4C7XA 1EE1A 4D57A 1OAOC 2RKOA 4OK3A 2V74B 4MIOA 3CC8A 4LJ9A 4NV1A 3UA4A 4YRIA 3F47A 2YS6A 3COVA 3NJRA 5KINB 1WXIA 2DHEA 2JCBA 4BGEA 2I7XA 2JJ1D 1O6BA 3QTBA 4QBKA 5K6RA 4RM3A 2AR0A 1TQ2A 3PPVA 3DVSX 4CR7A 4D6YA 1PNVA 2Y71A 5A3RA 1FFXA 3WSVA 5JSFA 3JD2A 5M29A 5JADA 4HN9A 4JEHA 3I4CA 1Q0QA 2GUGA 2TSYB 1J39A 1DWOA 2QIOA 2XEDA 3A06A 4J0KA 2AJLI 4ND8B 4JBYA 4C2AA 2I62A 4C2TA 1V5EA 3QMPA 4JI6B 5FHRA 1UP7A 3ZNNA 1GPJA 3SSAA 4WLFA 3LYAA 1O96B 1VKOA 1CZLA 1ZG3A 4RK0A 3WIEA 1NXXA 4RVDA 3CURA 3NGLA 3BL5A 4FYYA 4JXJA 4FD2A 5KYXB 1ISJA 4YP7A 1KY3A 4JH0A 1SA0A 3C87A 1PIWA 1XRSB 4ZMSA 1ZMBA 3ZDCA 2B4YA 1NXTA 2XPCA 3HMKA 2E6KA 3DMDA 3S5JA 2J0EA 5D1NA 2O3UA 1J25A 1V7ZA 1U0TA 1LRKA 1WF3A 1XVUA 3HKEA 5ABPA 5KTNA 2Q4TA 2QLMA 1VHLA 3PXCX 4JB8A 3T4XA 5JS6A 2ZRJA 2PUFA 3C7DB 3QVSA 4FR0A 4N5DA 4BCDA 3I61A 3O8BA 3PNYA 3JQGB 4CNBA 3AJDA 3R4CA 1GCGA 3L0BA 3G8CA 4NE2A 4OQZA 1JMVA 4WZBA 3KR1A 2J1LA 5HJEA 2BM0A 1LC3A 1YQXA 4FMCB 4NYIQ 5H4HA 3TJRA 1R4MA 4XVUA 1SU8A 4MQEB 5BW8A 2FAXA 1DC3A 3JQ9C 3L8MA 1A5BB 3G9ZA 4PTYA 3O9MA 3QIAA 4DTIA 4E5SA 3IELA 3A4NA 4XEHA 1KOJA 1TVKA 4OHBA 2EG5A 4S0XA 1E6MA 4XR4A 3TGLA 3TINA 1FA9A 1H0KA 2C98A 4NBUA 5BNFA 1E7YA 1M74A 3IEKA 4YAWA 4YT4A 1WU7A 2JIMA 5BPHA 4KPEC 3DB1A 4P7BA 1SQGA 5K0GA 1PLLA 3I5AA 2EJTA 3CZRA 3BQNB 1WBDA 1B6GA 4UMFA 2BI4A 2GWRA 5F64A 4QTYA 4XCQA 2AN5A 2PZGA 2R1VA 3GLGA 1KI6A 2J8ZA 4A6DA 4O8CA 3H11B 1IVNA 1XR3A 1GHTA 4BAGA 1OKKA 1EU1A 2HPZA 3WKCA 3E5HA 3S29A 5JJCA 1DBSA 2DSTA 3ICWA 4GM1A 4IDAA 4IIUA 4ZQCB 5ESRA 4MTLA 4YDQA 1GQQA 2WAYA 1QAMA 1W9HA 3RUAA 3L46A 5A6VA 8ABPA 2CFSA 2OHFA 3GUUA 3NYQA 5LC1A 5MN6A 2CC2A 3GMDA 1W0KA 3V34A 1ODCA 1RAFA 3OJCA 2FXVA 4XD7D 4B3JA 5CPBA 2D74A 2DFTA 4GOXA 4YREA 2CDCA 3RIHA 2OYSA 2WD8A 3J7TA 1ZD3A 3NT4A 1P1IA 1QYVA 5JTTA 1JH8A 4WMLA 3W5BA 3LCUA 1Y82A 1ADJA 3U3OA 2GA9A 5HQTA 4HQNA 2HF8A 3PC8A 2J59A 3NJ8A 1PK8A 2VYNA 3R3HA 1A8IA 1F8UA 1SXGA 2QR2A 2Q3BA 1OAAA 3V4FA 3IPCA 3IKLA 3AYXB 5CA1B 1N75A 1KO7A 3ELWA 4CR6A 1D4ZA 3M4ZA 1BHO1 2IYNA 2PZKA 3E5MA 3PPXA 3C45A 4R9UC 3C3YA 1MZVA 3PPYA 1ZISA 1Z2OX 4GGOA 4K88A 3AWDA 1DE0A 1R8SA 2ZYDA 1M2JA 3DBLA 4MI1A 5BYBA 4BNLA 1JJ7A 1X15A 2CMGA 4TS1A 4JC5A 3T5AA 2RBEA 1QG4A 3Q98A 3E4DA 4IFEA 2B2NA 1G7SA 3C6XA 2XUPA 4BBJA 4G67A 4ZJPA 3BM5A 5KCMA 3ERCA 3T5PA 3MBKA 4G0XA 2ZIWB 3I4LA 4EGQA 3UMFA 4BAUA 4BHTA 2EJUA 1YK0A 2LVBA 5DYIA 1MW8X 1CBUA 2QZSA 2QTBA 2CNBA 4KFUA 5T6BA 5K03A 2C2HA 1KK1A 1KIMA 2I2DA 3DONA 4Z5XA 1CG6A 1EAMA 1RWNA 2IWHA 4W5WA 2C5AA 4G0NA 3HO6A 4YCMA 5EJAA 4IM7A 4IZOA 3FROA 4DA9A 3TZ6A 2Q3DA 3K1YA 5F1YA 2VUSA 5FHQA 4I55A 1QVVA 2C9MA 4ZT3A 5G41A 3UKOA 3ZQ6A 3PS9A 4RHYA 5C8ZA 3U39A 4G4SP 4K9SA 1XAGA 1PJ4A 4XFKA 4P35A 2RB4A 2FFJA 1UQTA 5ESWA 1OFHA 4IBOA 1AGPA 3S1AA 2JRCA 1FSPA 3WMFA 1T3HA 4CODB 4KJZA 5KHLB 2OT3B 2AC2A 2GUWA 3MJDA 2BTEA 1AC5A 1W4ZA 3BCSA 2HGZA 5HUQA 1Y3IA 1SKYE 4KVGA 2JFGA 5BSEA 4QDXA 4DIUA 3GFOA 4RV9A 4RW0A 3UPDA 1GGHA 2YVLA 4TSFA 4Y6SA 2QT0A 3RSSA 1T91A 4YXWD 3TOCA 3IBGA 1H8HA 2P2LA 3C3KA 2ILVA 3ZQKA 5EVJA 1NXPA 1K6IA 3HA5A 3L0PA 4MVJH 1ISMA 1S7GA 3IXMA 1NUPA 1OFUX 3FCCA 3E61A 4IV5A 3WA6A 4BZWA 5IKMA 2XE8A 1U5CA 3KQHA 4BVAA 3IODA 4QOGA 5IX8A 4GSKA 3HHPA 4DDKA 1JWAB 4AIRA 4QG3A 5FA5A 4EYGA 2QRUA 4A8PA 4HQ0A 5IH3A 4D4LA 1YJ8A 4YAIA 1UXGA 2QLBA 3E2IA 4TUYF 4UM9B 1XMQB 3GXOA 3IP1A 5KYYB 2BGUA 1RXUA 1C0EA 5KI6A 4P7JA 1WB5A 3KUCA 5ICMA 4R0MA 1EFRA 1Z5NA 4GBED 4HWTA 1ZI9A 1QO0A 3AGQA 4XWWA 3LQQA 4HXGA 4M54A 4FW9A 3KS9A 4YCBA 2YCLA 3RQSA 1G2QA 1GADO 1D2NA 1JIVA 2QLLA 3RS7A 1EUDA 3RVPA 4HRAA 5HF8A 2WF5A 2MU1A 4YJ2F 4M1OA 4NJEB 2JAUA 3GLHB 3UW3A 3MUNA 1JJAA 5ELMA 1NT2A 2F1RA 2CXRA 3CUTA 3IHTA 4J29A 4QU8A 3WAJA 4RY2A 4IGEA 3FWHA 5GV7A 1ZRMA 2WIGA 4J16C 5CX1A 2C20A 1AGXA 2OP0A 3DCYA 5LMCA 1JEYA 3E1KA 5T4HA 2QX6A 3B60A 1J2JA 4MQMA 2O54A 3SP1A 2AZXA 2PSEA 3BB3A 1UFQA 5CLIA 3NB0A 1XQVA 1REQA 1ORVA 1T0HB 3UV6A 3CJTA 1FYEA 1D2MA 3M6LA 1V25A 3ND9A 4KH1A 3IUNA 2V5VA 3VYUB 2XDQA 1W1UA 4HWKA 5ALGA 3ZE0B 2I87A 3IAXA 3INNA 1TRKA 1BJKA 3ZWPA 4N5HX 4CCWA 4ALIA 3U7HB 2O05A 1VFPA 2V6FA 2IXEA 4NPHA 4ZGGA 1KY5A 2NQ2C 1JAXA 4IG4A 5CDHA 5I7UA 4KXMA 1MRNA 3LQ2A 4Q37A 4JU9A 3ZGOA 1MB2A 2W2QA 2ZI9A 2Q6IA 2LRHA 5T64A 4J0HA 4WN9A 3JYLA 3RJZA 2I4IA 5BQOA 1A82A 5C5IA 1ZM7A 3OIFA 3CMCO 3B3FA 3JQ7B 4GDMA 1C9JA 1KO5A 2EJWA 3AR3A 2P6RA 4LF4B 2EZ4A 4IHAA 1IATA 3A31A 2AOUA 4LMAA 4QRDA 4ABTA 3SX2A 3TWOA 1QIFA 3EG5A 2C4KA 3CYFA 4MVJG 4KK3A 2F9FA 4TN1A 2LWIA 1LUAA 3HNOA 5LZ8A 2JH9A 3WFIA 3GJ4A 1VIMA 1P2UA 1VE5A 1KYZA 2NOAA 4HVAA 2X8JB 3KZCA 2OA0A 2HRQA 3K15A 4BVBA 4B3XA 4KCGA 4XQ0A 4ERNA 4FZJA 4HYEA 2YZ7A 1L0BA 2YNMC 5K45A 1Q2UA 3LXRA 3ZBUA 3MLAA 3ZOZA 1JR3E 3SY8A 2F1IA 3ZU5A 4RZXA 1XWFA 2HNKA 1W30A 2P4UA 2P2DA 3BD9A 1O87A 3KSZO 4HXYA 4PNEA 5GONF 1X7WB 2HPVA 4DY6A 4XDYA 1Z6QA 3CXUA 4WCDA 4MPDA 2ODTX 4OXIA 1KP9A 5DULA 3LPAA 1MX9A 1H1LA 2VATA 1VIYA 4ZCTA 3FX2A 1BC5A 2VOEA 2YBEA 4P1ZA 2DR3A 1FVFA 1YR1A 3TUJC 5FL7D 4BYMA 2VQEB 4ANFA 2XE7A 2C5BA 2BC9A 1QOPB 2QJTA 2J6BA 1NMSA 1QP4A 4RQBA 4H27A 5EKDA 1V8FA 2GD0A 2WWFA 4FIZA 4LS3A 3W2FA 1QXSA 4WL0A 4OHOA 2EOAA 3H19A 1BGXT 1PNRA 5EUMA 4P53A 1Q11A 4JQSA 5THXA 3BRWA 3CCFA 4IXNA 4LMPA 5TGDA 3RV4A 2M1ZA 1KVQA 2NU7B 4B75A 4JQCA 4WA8A 4H1VA 3EOAI 3EISA 2W93A 3VTKA 3VXKA 1NG1A 4J03A 3CJQA 1XTKA 4BDSA 2JLYA 2Z2IA 3P9SA 1GTZA 5EE0A 1G3RA 2QZ4A 4D9JA 1NBMA 3FPHA 4RHFA 3KBBA 1C7FA 4KPFC 3G2LA 3OZBA 1AF7A 3FUUA 3K7EA 2AHOA 3D6AA 5AXDA 1QGUB 2XYRA 2JA1A 4I8IA 1G5TA 2J0VA 3JZFA 4L5CA 1SEVA 1AF4A 1KNQA 1RXYA 5GVRA 3V1YA 1E7QA 1QM5A 1SZCA 4NYJR 3G2QA 4DJ5X 4F2WA 3QSYA 1MAWA 4UBIA 3T95A 3LT2A 2I7DA 1Y8QB 3S8EA 1QRSA 3ZDEA 4AP6A 3ELYA 3DNPA 4LHEA 3FVRA 4BLWA 2WHPA 2QNBA 6GPBA 2QN6A 5F7OA 1U0JA 1X1SA 2A57A 2IC5A 4HGZA 5LA6A 5C4GB 4X0EA 5ITWA 3PITA 1G5IA 5EFZA 3ZD6A 3PU6A 2RHOA 2O57A 2GPBA 5I9TA 1EFKA 2QDKA 2QW1A 5KWEA 3IPAA 5CM2Z 2D6FA 4BV9A 2E21A 3G8DA 4XSVA 4EZEA 1OUMA 1J1ZA 5IC6A 2JGDA 5CLJA 3JAMA 1QR6A 3SVTA 2JGEA 1GWNA 3DFZA 1GFWA 2I03A 1B15A 3KQWA 4UC0A 5THQA 5BR8B 4K2HA 4HAUA 4M7WA 1VGVA 2WJJA 1QH1A 4TGLA 2ISQA 2NXCA 4XGKA 5BMVF 2FEWB 1HORA 5B36A 2QBYB 2I9PA 4PZAA 4C7BA 4QJ4A 4Y9TA 3BE4A 3Q85A 1WB4A 4MW6A 2AZDA 5AXCA 5HX7A 1Z2PX 2GDJA 3N74A 4Y8VA 1E2UA 4EJ6A 3PJRA 4AZVA 3NX4A 4B3RB 1YR6A 1ZH8A 2I76A 4AUEA 1NBIA 1BA2A 1SBYA 4NU0A 2OGSA 4QDKA 4TVKA 3DFUA 3T9DA 2Q2OA 1RIIA 4Y2HA 2B6NA 1V1MB 1VZ2A 4DV7B 2O07A 5LR6A 4UU7A 5L45A 1C1HA 1G98A 4RQUA 4R98A 1Z18A 5EXTA 2PKCA 4EBBA 2X58A 3FFAA 3WXMA 1O2DA 3RYIA 3K2EA 1N9GA 2AQHA 2I78A 1HPLA 3RRYA 4YRNA 1OT3A 4WHMA 1BE0A 2DCUA 4UU1A 4U2BA 5BP7A 4DEVA 3Q3IA 3WK5A 3O90A 1JQLB 3H2ZA 4DG9A 3BZWA 4DLKA 1QHFA 1YAHA 1RYYA 1X9IA 1VRVA 3TH5A 1EVQA 4GZ6A 1ZU4A 5GADl 1E2DA 1G7CA 4INAA 5K6AC 4FK8A 1PVDA 3PHIA 4JENA 1X3SA 2VJDA 1CP3A 4U6NA 2HLPA 4WZBE 3GVXA 4UXIA 4YWHA 1OTXA 1SBIA 2HNBA 5AI4A 3A58B 4LXGA 3SF8A 3VR4H 3W8NA 1QFJA 2R4UA 1A4UA 1Z5ZA 1JAHA 2ORYA 2WF8A 3B6MA 4KMSA 4B0OA 4BJ3A 1MRSA 3ZLUA 2F3TA 2AOVA 1D4AA 5JC8A 1DKOA 2AZTA 3H9BA 4QBGB 3DXYA 3AR6A 5IYZA 2VTBB 4RE6A 4PSVA 5FP0A 3FGPA 3LG2A 5DNUA 2BFAA 5J2TA 2H51A 1IJBA 3UHPA 3E7PA 2AJ8A 3GP5A 4I50A 4EL5A 4G1CA 1YQWA 5JVDB 4ZO7A 4TTAA 4DYVA 3JY6A 1W49A 3FOCA 4OHRA 3T9BA 4TKUA 4QUKA 4MVCA 4DCOA 4E3WA 3GLGE 2IS6A 2YDXA 3HDHA 2O5CA 1DELA 2XUZA 1BG6A 1TDJA 2Q1UA 2ZUUA 3WNQA 5CFZA 4LOJA 3BAFA 2OBYA 3Q8MA 4DA4A 1O1YA 1UJ2A 1ML4A 4AU1A 5IJXA 1X87A 2OBXA 4R8RA 1YC2A 4UTVA 1RXWA 2E5LB 2ILTA 5CFMA 2J0QA 4JDUA 5FOTA 1SKUA 4HFNA 2DPGA 2D3WA 3UOGA 3BHIA 1XXHB 3PX7A 3EWSA 2R11A 2FPWA 3AX6A 4IGAA 3Q3GE 1LV8A 4E21A 2ANCA 4B3GA 1TQ6A 2Y99A 4BLOA 3WKDA 2WQ6A 2PD4A 5AK3A 1L1QA 3CUVA 3EXG1 2FZEA 1VB3A 5EWJA 1IOWA 1SIWA 3UB3A 2GXQA 4IGKA 2H7YA 4GI3A 3ZV3A 3KAQA 5H7XA 5FTLA 2H2AA 1IOLA 1BVUA 2FW1A 4NG4A 4JITA 5F2EA 1Y9EA 1NZFA 1SHLA 1L5LA 2PLWA 1HNWB 1ZH2A 2AMFA 2ZI5A 2QK4A 3VOTA 5K3FA 1MNAA 1Z2AA 4MPJA 4OYLA 3V1UA 4RVHA 1HMYA 5AR1A 2W70A 2VJLA 5L3ZA 3L6OO 2QX4A 1CUBA 1Y63A 1LCIA 3R3JA 1Z25A 1S02A 4BNUA 4P08A 1QG0A 1LBTA 4W99A 4OJNA 5LLDA 1LSSA 4N3AA 2TMGA 2GZHA 3MCAA 3QF4A 4TRNA 7AT1A 1E77A 1FXWA 4QM6A 4H77A 1KFCB 2WNIA 3LBAA 4POAA 3M3DA 4DKJA 1TCUA 2QRPA 4IX9A 5BPFA 1HE4A 3L8GA 3L6UA 1HFEL 2BTQA 4FOOA 2IU0A 1U7XA 3INTA 4YCJA 4DCMA 4G5OA 3Q7EA 4A0SA 2EJVA 3MM4A 3TUZC 4RTKA 2HN9A 2GM5A 4TQ9A 5J23A 1HFJA 4LXYA 3HRHA 3W2IA 1RPZA 1ZMTA 3HU1A 2WE7A 3A1EA 2FN8A 5E1DA 1LRLA 4P4GA 4EB0A 3IIIA 3HE3A 3OESA 4XB2A 5JPIA 2JIDA 4BCCA 1SHZA 4DLSA 3ICCA 3DWIA 3LPMA 5K7SA 3LMKA 4MLZA 1J56A 1P17A 5AP9A 3RFFA 2M2IA 3TNJA 2QT1A 4N3NA 3ZE2B 3K73O 6YASA 2IH5A 4GOJA 1FFDA 2P3LA 1ZI6A 5FFMA 2LD4A 1NF2A 4GOOD 2OYRA 2ZSUA 3UJHA 1BXZA 1CIVA 3DL7A 1TIPA 3DWFA 5GJBA 1AS2A 1PT9A 1SKAA 3G5TA 5GM1A 1ADFA 2OM6A 2ZI6A 1QYRA 3HA2A 3ZLTA 1FL9A 4M87A 2WUFA 3L7YA 3W8FA 1EX1A 4F3CA 1NGSA 3F78A 4RQAA 5G0WA 3VPDA 4HH3C 2ADMA 4DRXA 1PQPA 3CO0S 1TKCA 3PVZA 4U9IS 5FT9A 1A7JA 2ODAA 4R1SA 5G0UA 2C58A 2ORVA 3JQFC 4CIVA 1EMDA 4MWOA 3HM9A 3ZXYA 5A03A 1VJ5A 3MT0A 3FKSD 4WNAA 5BUZA 3JPYA 4YALA 2FR0A 2RONA 3KB1A 1Y4UA 1OBVA 3OPYB 3KKMA 2J3DA 3AKEA 2MSNA 2ZS8A 1V8OA 1BMFA 2NTEA 3H5IA 3M1AA 4QBTA 4FSXA 3LRXA 1F2TB 5FTJA 1RAEA 5MHTA 1YT5A 1DC5A 4QREA 1WB9A 2V9ZA 5DEIA 1QAOA 3T7RA 2R96A 3L82B 2VP6A 4FMBB 1J6UA 5JMPA 3M2TA 3O82A 2FQXA 1NSTA 2GAIA 4K6OA 1MGOA 4RKWA 1IQ0A 4PZ0A 2X0EA 3EX7C 5C3MA 3X3HA 4DJDC 1TMGE 1WSBA 1ULSA 3SC3A 4MCAA 2IBTA 1AVTA 3PUJA 2Y1XA 3C3DA 1KAEA 3M4NA 3O3MB 3ZU6A 3MQ2A 1KQGA 4HMPA 4AJPA 2X5NA 5IC5A 1M2GA 1SQ6A 5BNZA 4GI7A 4CM9D 2ZIXB 4B3FX 2REXB 3UYKA 1CJUC 4WOPA 1U3CA 3PQCA 1MHPA 4KPUA 4H6PA 5I51A 4CN8A 2V03A 4G09A 4MWDA 3TR5A 2B3DA 2ZTLA 2JHAA 4IV0A 4ZREA 4UTZA 1ZCJA 2BFEB 1Y5IA 3HTXA 3HLTA 2JLVA 1QQAA 1OHHA 3KKZA 4IJMA 1K3FA 3AT1A 3N3BC 4A4DA 5I3ZA 4JFRA 2XSZA 5BSHA 1KE1A 1JUDA 4BP8A 1JR6A 1T9CA 3E3NA 4RA6A 3NYRA 3VU1A 1CQZA 3P52A 3KJXA 3AJRA 3N7UA 4XCXA 3PCXA 4E0BA 3U44A 4MYUA 3IAHA 2VTDA 3HKBB 3WICA 4JLAA 3N6VA 1GP2A 4JWKA 3M6FA 5DHSA 5LMNB 1A97A 2BFCA 1F8XA 3NRJA 5JSZA 3DHNA 3A1TA 1KVSA 2PL5A 1OC4A 4UAVA 5HMMA 2HYIC 4ALNA 3DG9A 2I6UA 4PFKA 1NBHA 3GT7A 1U2EA 5FL3A 3WJ1A 2C3YA 5EPEA 1JJIA 4LHYA 5EYPA 5HKKA 3DMHA 4KLRA 1MVOA 4B43A 5EHXA 1V11A 4JI4B 4R3UC 1SVKA 3PJDA 1E79A 3KTFA 3MVEA 3IV7A 1QLJA 3HXOA 2OESA 3JR7A 5A2GA 3R74A 4G0WA 2R65A 2BYTA 1BHJA 2C7BA 3UF0A 2FSUA 3RJMA 5EJ4A 5EJMA 1R9NA 3NTVA 4NOMA 4X00A 1IEVA 1BCSA 4QYXA 2OMEA 3BICA 5E2IA 2BLLA 1ISSA 1HZZC 1Z0ZA 5FBLB 5P21A 4D7AA 3ANTA 5BNTA 3FTFA 2WJIA 1NW7A 4YRCA 3ESCA 4WADA 1JLMA 2JEYA 4OFWA 4LSZA 1JVNA 4IOJA 5D2CA 5H5JA 1QE0A 3WIOA 1SB9A 2G76A 2XMZA 2OHJA 1J00A 3G2KA 3CNQS 2WM9B 4IZ6A 4ME6A 4QAJA 2ZT5A 4RIHA 3A04A 3QSGA 3R8CA 4ZV4A 1HUQA 2NP7A 2XUOA 3H6HA 1GZUA 5DHQA 3S2FA 4O8ZA 1PR5A 3CSUA 4IXDA 4FFWA 5JSHA 2JHPA 1QMPA 2XT9A 3BD8A 1NJ6A 4MR8B 4OHUA 2FQYA 4G23A 1UMCA 4MLCA 3HYRA 4MWBA 4TXNA 2UZ4A 3OQMA 2GBCA 3MB5A 1EM8A 3QXGA 2FN4A 3FFTA 4AD8A 1Z8NA 3M89A 4S24A 1N1EA 4TLLB 5KNLA 3IP9A 5EINA 3WGLA 5BWBA 1IHXA 1ZIPA 1JIJA 4L15A 1JG4A 3E7DA 3IO5A 3CGWA 1P2SA 3P4YA 4MAFA 2JLCA 2ZVQX 4TV8A 3Q9SA 1D09A 5CHEA 4DMLA 5GTDA 3R1IA 2RHMA 4BZXA 4CM1A 5AW0A 3UMBA 1L4EA 3RYFA 1MAHA 4DV5B 3WRWA 4BWFB 1NBME 3VI4B 5BT9A 1AXEA 4R2XA 3H8JA 2VT3A 3IPRA 3GMTA 2P9TA 5K2MA 3IL2A 3BC1A 3CNOA 1NP6A 3SYMA 1SCAA 5D7NA 1LK5A 3EBOA 5TVKA 3SJUA 3KYCB 5F98A 1E9AA 3DMYA 4K9QA 4A7PA 2WB4A 3O4IA 3PTZA 4D0LB 2JGIA 3AI2A 1FX0B 4Z4EA 3QI7A 1ZM9A 3A9CA 3TPFA 4QG7A 3EXHB 1DJQA 4Z3OA 2AN3A 3Q11A 1IL0A 2P0EA 5TGTA 1EP9A 2JI7A 2W7TA 3AI1A 4HEJA 3VC2A 4C4ZA 4Z4CA 2JARA 1IPHA 4QJ5A 3VR3A 1M9NA 2P35A 3ZTWA 4ZDKA 3LX6A 1ZPDA 5JAQA 5I9IA 2R6GA 4ZOLB 4PX5A 3TTSA 3ETNA 3LK6A 4FPXA 3LCRA 2YWJA 1I24A 1PT5A 3BAZA 3EVTA 4YS6A 1V4VA 4XIJA 1P7PA 3FKJA 4IH4A 5FOVA 2VT6A 5JG7A 4N03A 5EXSA 1T4GA 3IPXA 2C4NA 2ZBGA 1QO7A 2UVPA 2BGKA 4HOYA 1LZLA 3ZNQA 1RWQA 2GHRA 5AI0A 3ABOB 3GA5A 1COZA 4CFZA 2I2WA 1N5RA 5ECDA 4EHBA 5IKXA 3NW9A 1M2VA 3I9V1 1IUOA 2FVXA 1VP3A 2JIOA 4FI3C 5C31A 2C2BA 5C5EA 2W42A 3W8RA 1G291 2QD5A 2FKNA 1EQ2A 5BSKA 1MX5A 1T0IA 2ZAIA 4GKAA 4NV0A 3GOHA 1HRDA 1Q6YA 2DT5A 3EGXB 4ND4A 5ES3A 5KWSA 3G82C 1RPNA 5BR1A 3U1TA 5ESDA 1XCLA 2O2DA 4IDFA 2C99A 3Q87B 5HDBB 3A70A 2VQDA 2ZSDA 2G8LA 1WZIA 1L4MA 1NIJA 2RI6A 1M1UA 4NBNA 4QD3A 3TRJA 3WZLA 4MV1A 3E1SA 4ZYLA 1C3EA 2E18A 3Q3JB 2F1OA 2IK8A 2I65A 2OCYC 2HX1A 3EZGA 4PG4A 3FNHA 4UUOA 2G07A 2OD9A 2OFXA 4MWGA 5E7IA 3SOPA 2IYAA 2ZQ5A 5JFOA 1MUUA 1PK9A 3PUYA 4FE3A 1AK1A 6REQB 3ZCPA 1E9RA 4OFBA 1TAHA 3OTWA 2MYPA 3SKYA 3W5AA 4J4TA 4A1OA 2B3TA 2EKBA 4LZJA 3U3RA 1V26A 1Z16A 4IIJB 4ETMA 3ZWAA 1JHYA 1RJEA 4YWJA 1ZNQO 2QAGB 3JRWA 5BY2A 2BE9A 3QUTA 4Q34A 1U0FA 1U5BB 3I73A 4DSTA 5A9SB 3CUSA 3VC3A 1CF4A 3FA2A 2C2KA 4E13A 2IIPA 4OGWA 1IQPA 5DU2A 1THZA 4WK2B 3N8NA 3RUPA 4K46A 2EL9A 3SX0A 4D99A 4DCPA 3HJBA 3GLIA 3RROA 1VTKA 3L0ZA 4NX2A 5DZSA 2XE4A 2OXFA 1TW3A 4NCBA 5K0NA 1NR5A 4K6GA 5GJCA 1I7SB 2YJNA 1N4AA 4O4LF 1JSXA 1L3CA 2CFIA 2Y76A 2PY6A 3NHPA 3T61A 5JO9A 1J2TA 4B80A 2ZSAA 1FQKA 1MH1A 1ELOA 1SHTX 4Q03A 3K31A 5TSDA 3W6NA 3I2HA 3EAGA 1B76A 4EPXA 2WD9A 3AUTA 4Q4AA 3ITDA 3QVOA 4D0RA 4PNZA 1T9HA 4PCLA 1EXMA 3FTCA 4XUEA 4HCJA 2WMYA 1MQAA 2WR8A 5EJ8A 1C41A 1YBVA 2CNWA 3M9XA 1KQNA 2ZB3A 3ZHYA 5FBQB 4Y18A 1RYDA 3DTVA 3PE3A 5MDHA 2GCIA 1XNGA 2SBTA 3IXQA 2VBGA 4L6CA 1PL6A 2OZPA 5LP6C 2TMYA 1DV2A 3LW8A 5FTMA 2XCTB 3DC2A 2G3YA 2H4FA 2QRQA 2Q5CA 4Q3NA 4BXOB 3I76A 1E32A 3CEHA 4AB1A 5LSAA 4FW8A 3LW7A 3U9LA 1KQ3A 4A27A 3DKPA 4IIDA 2HWXA 2V4ZA 3HUDA 2P1ZA 4A2QA 2BFMA 3KSBC 1E7WA 4HGPA 3DLTA 2CLKB 1DINA 2Z0MA 1OYWA 1Z7BA 5AVUA 2WJYA 3F74A 3PNQA 3CIOA 5CLLA 2NPFA 2O8CA 4A5OA 3BK2A 4RJKA 4IFBA 4JBNA 3MT7A 3ROGA 4RLQA 5G3YA 3K9WA 2CXQA 5F9HA 4CF7A 1LV7A 3W5JA 3D31A 5FJIA 2JS7A 4PPQA 1M34A 2G1KA 3ZWDA 1OXMA 4NARA 3STWA 3B12A 4GHWA 3WBFA 3EARA 1B16A 5D6OA 4DR2B 3TOXA 1M8PA 2NO0A 2VP4A 4FYKA 5FO1A 3JALA 1JHAA 1R9MA 3KALA 1D7AA 3GRAA 1VP9A 2QP4A 2HU5A 1ABFA 2V3VA 1J2UA 3AF2A 4LBZA 3DW1X 3GUZA 1S8AA 2O2XA 2NUTB 2Q4RA 1Q92A 1UM9A 5BUSA 1THTA 3X1XA 5HCNA 2PBLA 1TKAA 4MUAA 1UBHS 3LNTA 4FD3A 4IF4A 4BP9A 4F97A 3RT1A 1YH3A 4C0WA 3R6WA 3MSXA 4NHEA 1I2ZA 1A4IA 1KPIA 1TOAA 4G6ZA 2RE8A 3AILA 4Y9UA 4KV9A 1RWXA 1ECBA 3GR6A 3M4XA 1BA3A 4WXHA 2HPHA 2HZBA 1P7ZA 1YZGA 3DM5A 3RVLA 4FFNA 2QLTA 2QTGA 5DBOA 2IX3A 2Z8XA 1E60A 3LX8A 3ROZA 5CBPB 5DTMA 3H2KA 4ZHQB 5HXAA 3D0RA 2GAFA 1T6NA 2ADOA 1B8PA 2ZYSA 5DW3A 2ZRIA 3KZVA 4L74A 3CLUD 1B93A 5KYWB 2F48A 2XOKA 4KTTE 4C4AA 5IJ0B 1XK7A 4RA9B 4MRAA 3QVWA 3N2NA 2HQSA 4DB4A 1PV4A 3B78A 1KEUA 4BMNA 4L28A 4DHEA 3L4BA 2JGMA 3GEDA 3K53A 3VBCA 4BEVA 3LRPA 1OILA 2YZNA 4I8XA 2O2ZA 2E49A 3PDIB 4QA9A 1TK3A 2ZYTX 2CDRA 5FUVA 2EZ8A 3PV0A 1GQYA 3NU1A 4M1MA 1P7YA 2EDCA 1HA3A 3Q3HA 3ITKA 2JFPA 1N5DA 3D54D 3OEHA 2OHVA 3IKVA 4V3BA 3ACCA 3G6KA 5ALOA 1JKXA 2F43A 5IVPA 5L7WA 2C2YA 2P11A 4E2WA 2VHQA 1RM5A 4GG1A 3Q2KA 4F2PA 4GOND 3LDUA 4F4HA 1ILEA 3AB7A 4JY7A 2YJ4A 4QQRA 4XDHA 1QORA 4DLWA 3WP0A 4X65B 1P6XA 1QC5A 2JBWA 3IERA 2C83A 1QB7A 1U8XX 4GMGA 4L51A 5TV2A 2CSXA 3KB8A 1KSGA 4ZO4A 3V8PA 3CVVA 4RHCA 1UINA 1NVBA 2GJAA 4LYYA 3EZ9A 3QPDA 4B35A 4X20A 5KVVA 1FMCA 1NW8A 1TVMA 1CHDA 3L06A 3LUKA 3UWKA 5IM4F 5CA0F 1CUAA 1TA9A 2V6BA 3KKQA 1RM4A 4LRSB 1N92A 1N2IA 2QPLA 4UOQA 4DANA 4EHIA 1TM5E 1HK7A 1YZLA 2UUOA 3HR4A 3L5OA 5CFLA 4Y6QA 1PVOA 1MP0A 5ALHA 5HM8A 4FEGA 5CEFA 5LM3A 3C5EA 4S05A 1YMUA 2GYWA 4Z51A 3GDGA 5IK2A 2PG3A 3A0RB 3BEOA 3CF6R 3PEUA 1W0CA 1F4PA 1MJNA 1WHTB 4HTFA 4UCWA 3KKEA 2DPHA 1H85A 1L4NA 3NASA 4R7GA 5D1HA 5GJWC 2G5TA 5EP1A 3TL3A 3V8QA 4OLAA 5IT5A 1AS0A 1PEDA 1Z4QA 4M2LA 4HDCA 5H9VA 1B6TA 3MAAC 3ETEA 5EOVA 2A0KA 3RVNA 5C9ZA 2H4WA 4JJFA 1OFGA 3PIDA 1VHQA 2GCPA 4EWLA 5L4LA 2DJIA 2QRMA 2XYQA 2IUUA </