1UEJA

Crystal structure of human uridine-cytidine kinase 2 complexed with a substrate, cytidine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
211
structure length
205
Chain Sequence
EPFLIGVSGGTASGKSSVCAKIVQLLGQQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Uridine-cytidine kinase 2
total genus 66
structure length 205
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1uejA00
3CF0A 2RGAA 4RD0A 1P75A 1UKEA 4MYCA 3B1XA 2BEKA 3CX7A 3DMDA 1TF5A 1AJEA 1E32A 1J70A 1YE8A 3LXXA 3FKSD 5H8WA 2VIIA 5J4KA 2JASA 3QVUA 3A1UA 2A2ZA 3E5HA 1N5IA 2GBLA 4M1TA 2R6DA 3RWOA 5B57C 3U6KA 3KKOA 4CEHB 2BC9A 5KDOA 4V0KA 3FTQA 1KKMA 1DG1G 1G7SA 2J1LA 5TVKA 4GT1A 2ZJ2A 4JJKA 3K0AA 3K0AB 4RFSB 1COWA 1FOEB 2D06A 4A15A 3U44B 4U00A 2BIFA 3GJ3A 2J59A 1W49A 3RLFA 4KFSA 1FMJA 1KAOA 1YR9A 3QF4A 4TT3A 2WOOA 2IX3A 5FL3A 2ZJYA 2JJ8A 5J4VA 1OT3A 3IEVA 2W0MA 4EDHA 3IHLA 2G0TA 3K9LA 1U0LA 1ESMA 1P9NA 4L4UA 3JVUA 2R2AA 4PXAA 3MAAC 3QKSA 2ZRHA 4RCZA 1JR6A 3L0IB 3TJZA 1EX6A 5HE9A 2F55A 2C96A 1YR6A 4NYMQ 3M1IA 1Z0KA 2VL7A 2LKDA 4AYWA 2Z83A 3QKRB 4Z1MD 3DMNA 1IBRA 1ZRHA 1E2MA 5M04A 4AD8A 3SQWA 4GI7A 2A5FA 1RRPA 1LTQA 3LW8A 5FBQB 5L3QA 2PMDA 1TX4B 1HEIA 1J8YF 4A0GA 2IF2A 3PUXA 4NCIA 1I2MA 1PJRA 2ZRJA 3VQTA 3U4QB 1QZXA 1NJFA 5AJXA 4LC1A 2WV9A 2IS2A 2H7VA 4KLNA 5JCPA 3CH5A 3IGFA 4ZDWA 4V0MA 1I4TD 4POAA 2W6ID 5HE8A 1N6PA 1N5KA 1Z47A 2YVUA 1GDDA 3CPJB 1WCV1 4M9ZA 2NZJA 1FQKA 4Q4HB 4C0SA 3GJ5A 1GFIA 4JT2A 2FN4A 4DSUA 3K0FA 1XCMA 3AVWA 1X8LA 1G8YA 1CJVC 1G41A 4MKHA 1FZQA 4XSHA 4PHFA 5B30A 2JIZA 1KHTA 2A30A 2YV5A 3A4NA 3HJNA 5FFMA 5CB6A 1HT1E 4HB3A 4R2HA 2ZRMA 3MRSA 1QF9A 3U60B 4IW3B 2AWOA 4Q03A 4TTRA 2LCFA 3TR0A 3VMFA 2BVNA 4JLJA 4LJ9A 5HKKD 3RHFA 3AEZA 4EJSC 2I3BA 3VHLB 1XNJA 4JKYA 4RFVA 5E4FA 4UXHA 5JLJA 2OLJA 4DDWA 1Z07A 5EZ6B 3AM1A 3AGQA 2OESA 3NEJA 1N6OA 1C1YA 4TL6A 5CJPA 3GLFA 4NDZA 1OXVA 2BMDA 2GXQA 2FSFA 1JAIA 2NTYC 2AD1A 2AWNA 3BIFA 4RFSA 3G0HA 5J4YA 5FOUA 4HAVA 3GLGB 2HCJB 2V54A 5P21A 2CHVA 1SVWA 5C1BA 3UATA 1OW3B 3X1DA 1U81A 1MABA 1KK1A 1VCNA 4LSGA 1G3RA 1AIPA 5J4HA 4JIMA 2ZJZA 3K0SA 3U3MA 2ZJAA 1E1QD 2C78A 4MKIA 2XSZA 4DSOA 5JJKA 2AX4A 4HAWA 4PAMA 3EAQA 3OIYA 4NKRA 2B21A 3THXB 4U7DA 4DT1B 2NPIA 2CNWA 3B2EA 3HYTA 1KNQA 4I99A 1ZCBA 3JZMA 3WBKA 4W7SA 5JS8A 3Q3JB 5BWMA 1R5NA 1RVDA 5DHFA 2ZEJA 2WWFA 3JVVA 2FOLA 5KDLA 4AG5A 2GESA 5L3VA 4GOJA 3P27A 1E9BA 4AKEA 2FX3A 1CEEA 1ZAKA 3LLUA 2ZSAA 5UKDA 2XZLA 1HA3A 2YNMA 1N6IA 3TNFA 5JEDA 5HKKA 5K8IA 4EJSA 1R0XA 1T4GA 2BV3A 1T3LA 3CNLA 1E9AA 4QBFA 1Q0UA 4UNSA 2TMKA 4ERNA 2XNSA 5EP1A 3RSLA 1UF9A 1OFUX 1KI2A 1KO4A 4US0R 2ONKA 3IPXA 3CRRA 1JPNA 1G3UA 3CRVA 2ZR9A 1F2UA 2A3RA 2X2FA 4D26A 2IBMA 2O8DA 4GZMA 2D7DA 2P5TB 2XB2A 2WWXA 4ITRC 5JHHB 1HTWA 1I4LD 1W2HA 5FUWA 4C30A 1KI6B 4IXNA 4LHYA 5LDDC 1U9IA 1LFDB 2GJSA 2JLVA 1VCOA 3ND8A 1KO8A 2QN6A 5DI3A 2OXCA 4LJAA 5LBIA 3VTKA 1X8KA 4D4LA 1UKVY 2J5XA 3D6TB 3SJZA 1MRNA 1SVLA 2J46A 2OZEA 2G3YA 3TAUA 2BBSA 4IDHA 3CW2A 3KB1A 3CBQA 2F43B 2PCLA 4DSNA 2ZAMA 5KO2A 3REGA 1AS3A 1DG3A 3F8TA 4I4LA 1TF7A 2ZSBA 3GEEA 3V4RA 1IY1A 2OAQ1 2V1XA 4OK6A 5HCIA 4TL8A 3WHLA 1II8A 3CRQA 3EIHA 3C15C 3EC2A 4I1UA 1E9CA 1H8ED 2QT1A 1X1SA 2EYQA 3AF4A 4QNRA 1KMQA 4DB4A 4LYHA 1IAQA 1SVMA 3TIFA 4CT4B 4O2RA 4NYJQ 1RC8A 1W47A 1XD2A 3CR7A 1BYUA 3LDAA 3EPKA 1XPRA 2NMVA 1TQ2A 4QHTA 2R65A 1N6NA 2PLFA 4JL6A 3ND9A 4AKHA 2V7QD 3L0OA 1AGRA 4EPYA 5KTYA 1XMIA 4G0NA 1E9FA 1JECA 4IDQA 1A2KC 1TU3A 2IW3A 4RCYA 2G9NA 5EXSA 3Q5EA 1G16A 1NN0A 2P6RA 2D2EA 2XTZA 1AGPA 1G5PA 2JLQA 2Q9BA 3I5YA 1E1RD 1XPOA 4D81A 2XZOA 3L0SA 1H65A 1QHIA 1JI0A 2GCOA 4Q4JB 3UIEA 3ZDQA 4B74A 2FGJA 4EQ6A 2Z4RA 5FTLA 1G7CA 2WTUA 2PBRA 3EXAA 3H86A 4C0KA 2XXAA 4TMWA 4ESHA 2DFKB 1COWD 3CRMA 4PO9A 5F9HA 2AL7A 4G3XA 2C04A 4TLAA 1B23P 2ZRBA 4FCVA 5FOVA 2RGNC 2YOFA 4Z51A 1J90A 4DLSA 3CX8A 1S2MA 1E0AA 2DB3A 3PEYA 2YWHA 3IQWA 4BFVA 5CYOA 1FX0A 1OIWA 2FG5A 2PT5A 4H9GA 1NSFA 4LV6A 1Q12A 1ZNWA 2XJ4A 5G3YA 2L0XA 2FPKA 4B34A 4F92B 1Z0DA 4NYJR 1XRJA 1OJLA 4RD1A 3GCGA 2R6AA 2W0SA 3I4LA 1GWNA 3MWLA 1UKZA 4GSYA 5CK5A 3D31A 2G1JA 1YKSA 4Q4JA 1Z6YA 2C95A 4BFXA 1J99A 5KU1A 1YZLA 2VP5A 2GXAA 4UNRA 1PUIA 1T5LA 4BLSA 2YKGA 4V0NA 2P0EA 1N6KA 1SXJA 2WKRA 4KFUA 4ZO4A 4PZZA 2GBLC 2AN9A 4JLAA 1XD8A 4JZKA 4Q1EA 1PLKA 3ZIAA 5JSZA 4U02A 4RD2A 4NPHA 3HYRA 2V6IA 3Q72A 1RIFA 5DYGA 1UKYA 2ZE8A 3LBNA 3NKVA 1XEXB 1FW6A 3LX5A 2QE7A 4TYNA 4RD4A 2BM1A 4C2TA 3CONA 1W4AA 2IUUA 3O8BA 2O5VA 5KOYA 3K9HA 4WZAE 3O8CA 4GFDA 5EUQB 3ADKA 1HUQA 4KSCA 1Q1ZA 2C9OA 4CIDA 2EFGA 1S1CA 2FMXA 3OEHA 2QP9X 3H0KA 2F1JA 1AQYA 2R6FA 2PJZA 2EW1A 3AP1A 2IYYA 3EASA 4AWXA 2WAYA 4GNKA 3X2SA 1TTTA 1D2MA 1G64A 1ZW6A 1RJ9B 1UEJA 1Z2AA 1XTIA 2WKQA 4ZCLA 3C4JA 3EZ2A 4IEEA 4JS0A 4A8JA 4QJ3A 2WVJA 2IXFA 1KIMA 5KSOA 2HXSA 3GLHA 1XEWY 4P32A 5FH9A 5BN4A 1EX7A 1AK2A 1DAHA 3H4MA 1JB1A 5FBRB 3PXGA 3W90A 4K46A 4B44A 3A4LA 1KI6A 3ICEA 4V0ME 3L2OB 2WSSD 3LRPA 2Q3FA 4MDFA 1Z29A 1R0WA 2YJTD 2P5SA 2F1HA 2ZI4A 3NWJA 4IFBA 3R7WA 2N42A 1W0KD 2GF9A 5DE3A 1SXJD 5FL7D 2VQSA 4NL4H 1OYYA 4TLEA 1DO2A 1UDWA 5AUQA 4M9QA 3K09C 1CR4A 2KWIA 3RC8A 1XXHA 2PEZA 1JJVA 2ZS8A 3PIRA 1LW7A 3QVVA 1S9HA 1R2QA 3MCAA 4KBGA 3I5XA 3ZH9B 3DKPA 3EIEA 1VECA 2FWRA 3EIQA 2EWWA 2VP2A 1LS1A 4N0DA 1R10A 1GOTA 1NG1A 3NH9A 4H1VA 5HR5A 1A1VA 1GL7A 1E2FA 4KI0A 1ZUIA 1OIXA 2PLRA 4P33A 3P1JA 4OI1A 3K9GA 1VDZA 2V9PA 5FR1A 4DCTA 2G77B 4NBSA 4JL8A 5GVRA 4DLUA 4HDCA 2RGBA 3NXSA 4I1SA 2CJWB 1XXHE 2OFXA 2OEPA 2ZR0A 3HU3A 3SBEA 5TARA 3TQFA 3E2IA 2Z43A 4S2EA 2O0JA 1Z28A 5SZIA 3EPLA 2RGDA 1YR7A 1M8PA 3U61B 2BKUA 1KDOA 4HLQB 1WQ1R 2QMEA 4DB2A 1ZU5A 5KDDA 1L4UA 2NO6A 1HURA 5JJLA 1KGDA 3P32A 4DWJA 2HLDD 2ZREA 2GILA 4BLQA 2IS1A 2D74A 2W2TA 1BIFA 3BBPA 5IRCD 2GJAA 1OXUA 4BLOA 1ZD9A 2ODNA 3OE7D 1GL6A 1S3GA 1G4UR 1U8YA 2GEDA 4EFNA 1KZ7B 1NNEA 5AUPB 3BOSA 2ATVA 1M7GA 1Y3AA 2QEQA 4NYIQ 4URZR 3U6BA 1ZC3A 3I62A 1G20E 3ETLA 1D5CA 4MITA 2H1LA 5FPKA 4EAQA 1J8MF 2FF7A 1Y63A 5L3SA 3FHTA 1N5JA 3ZVRA 2XNDD 1E4YA 2DWOA 3FYHA 4FWIB 4W5HA 1NP6A 2BJWA 3DDCA 4KJZA 4Q4AB 1T5IA 1X6VA 2H5EA 3W8RA 1UM8A 1ZMXA 1JJ7A 4WZ6A 1TAGA 2V55B 2PZFA 1R6BX 3MWKA 3Q5DA 5IHPA 5C18A 2G88A 5H1YA 1FL9A 1G19A 3W34A 3TVDA 2OCPA 3BE4A 1II9A 4UJ5A 4BFSA 1OV4A 4PPGA 4DLXA 3VHXA 4KYIB 1FMLA 2D62A 2X2EA 5F2EA 3QF4B 1CXZA 2C98A 2ZSDA 2IXGA 5KNCA 1G18A 2UVQA 4JVSB 5CIQA 2BWJA 2DBYA 2QG6A 3PEWA 4HAXA 4C4PA 1GITA 4BFZA 4PTLA 2HF8A 4OJQA 1Q21A 2W58A 3KZ1E 5EUMA 1TPZA 1U98A 2ZUDA 3VAAA 4BFWA 1C4OA 1ONBA 3CWQA 3CB4A 2C77A 4PSVA 3PJRA 1ZD8A 2J7PD 2F6RA 5SZKB 3SQXA 2GF0A 2OFOA 1CP2A 1Q1BA 2PZGA 2F9MA 3SE0A 2CJWA 3GPLA 2HT6A 4JVNA 3BORA 1GIAA 1UPTA 3TE6A 3KKNA 3IIKA 2YINC 3ZD6A 2BCGY 1ZIPA 2EFEB 3I8SA 4KCGA 3NDPA 3GJ0A 4QBGB 3OIWA 5KUTA 1R0YA 1US8A 4Q4AA 4LHWA 3T5DA 3V9PA 3GLGE 1QBKC 4JBYA 1KO5A 2BBOA 1YHNA 4RZ3A 5FUXA 3PV0A 2ZE6A 5CDFE 2OLKA 1OF1A 3O47A 1R7RA 4IKEA 1MRSA 2CVFA 2QL6A 1GRRA 2HUPA 1BOFA 1ZNYA 3AVOA 4DDVA 2CK3D 1XCGB 1SVSA 1U99A 3W5IA 4Q19A 2YYZA 2GKSA 2I1VB 2IC5A 3CX6A 3WNDA 2NO1A 3THOA 2J3EA 4LC0A 1KNXA 2ZTSA 1M6NA 2G1KA 1E99A 1SKYE 1E0KA 4HZIA 5HZHA 1JAHA 1QHHA 1XF9A 2ASEA 4EPXA 1YZTA 4WW0A 3IBGA 4JT4A 1E2DA 3TUZC 2QQ0A 4WBSA 3ZZUA 2JA1A 2NQ2C 2OBMA 1ZM9A 4PQRA 1ZVQA 5G3ZA 1AKEA 2X1VA 3X1YA 2DCUA 3KKMA 3QKRA 3ZS8A 1S1MA 4JBWA 3RRZA 4A6XA 5JFGA 4Y0VA 1G8FA 2HLDA 4PZYA 4Q1DA 5FTMA 3B5JA 4FINA 4AKGA 3U5ZB 2OO7A 1MV5A 2OM2A 1K5DA 3AVPA 4C7OB 5FL7A 1KYIA 2WOJA 3CH4B 3LAWA 1QHSA 1G6HA 1LV7A 5JWRA 1DAIA 4QGGA 3HPRA 4D25A 4KLZA 1Z6XA 4NTZA 1Q1QA 4DHEA 1NMYA 1W4BA 4P4TA 1GNRA 2NPFA 2IS6A 1KSJA 3KUDA 2IWHA 2CMKA 3DM5A 4LHZA 3TH5A 5JRZA 1CJTC 1N0WA 4YMWA 1XEXA 3KTAB 2R62A 1NLZA 1WP9A 2ZIAA 4ABYA 3EX7C 2FDCA 3ZVMA 2FFBA 4DIEA 3DZDA 3TVTA 1MO5A 4NU0A 2RKOA 4P0TA 2BEJA 1KMHA 2BMJA 3IKJA 4JLDA 3P4YA 3FHOA 4CGZA 5AJVB 3K70C 2PL3A 3KB2A 2FZ4A 4XD7A 4A82A 1RYFA 4R7ZA 1DPFA 2FZLA 3CIOA 3M4YA 2QAGA 2AFHE 1OPXA 2B7BA 5A0FA 3U3KA 1CR2A 3RS5A 2A5GA 1EXMA 2WAXA 5JSZB 1SKQA 5DI9A 2XAUA 4AURA 5KSZA 1ZJ6A 4LHXA 1DADA 2WPDA 4E5UA 4F93B 4M1MA 4XVUA 4KFRA 1W7AA 4AK9A 2O8BB 5EE5B 1X86B 2Q0HA 5BN5A 3LO5A 1JEDA 1HV8A 1BKDR 2WJJA 4N0EA 2JATA 3ZQ6A 1FP7A 3I61A 3M6AA 5A4JA 3ZZ0A 3WXMA 4Y0AA 3U3RA 1XEFA 3SYNA 5EE9A 1ZD1A 1ZM4A 2O0HA 3PEVA 4X8MA 2XXAB 2MSEB 4TMXA 4LJ5A 3FMFA 2ODBA 5CLQA 2ZI7A 3NTUA 4HUQB 1U0JA 2QM7A 3BAFA 4B6FA 4MYHA 3DOEA 5HCNA 5LD2B 4KO8A 2XNDA 1FNNA 4DCNA 4KBFA 4DLZA 2AK2A 3QE0A 4NCKA 1RRCA 2H92A 3W8NA 2SHKA 1N5LA 1R8SA 4TT3D 4A36A 1UDXA 2FPMA 3SNHA 4PC3A 3AF1A 3PUVA 3SDZA 2DWQA 3TR5A 5E7JA 3F0TA 4IVQA 2AKAB 2XGJA 1Z06A 3RS7A 3A36A 3AVXA 1E2NA 4LWZA 4A8JB 2O8EA 1OFTA 1SQ5A 3SYLA 2WJIA 2IYWA 2NZ8A 2XZPA 4G5OA 4F4IA 3IUYA 3TSZA 5B2ZA 1DVRA 4OHVA 1F2TA 2ZRDA 1QDEA 4ZI2A 1L8QA 4DEXA 1G3IA 3A6PC 1M7BA 5AR1A 4HZUB 3THWA 2IS4A 3GJ7A 3IEUA 4V0OA 4B75A 1Z0FA 3AVYA 2QTFA 2IYLD 1OB2A 1CRQA 1G291 3TLXA 5JBQA 4FMBB 2HJGA 4FW9A 2FV8A 4YMVA 3TBKA 1IN7A 1MO6A 1NVVQ 1VPLA 2DFLA 3X1WA 3E1SA 5FOTA 4LJ6A 1CR1A 2IEYA 4A92A 5LD2C 2HV8A 4Z8YA 4UNNA 3QPVA 3R8FA 1Z0AA 1BH2A 2VHQA 2FNAA 5H68A 4TMZA 1F5NA 1P2TA 5FBWB 2D2FA 4LBWA 3SFZA 2ZYWX 2A7QA 3AB3A 3KL4A 3UANA 2YWEA 1NLFA 4GMDA 2Q3HA 2A5JA 1IXRC 1Z83A 3UPUA 4TSFA 3LWNA 3FPAA 4URUR 4MYUA 4IXMA 1FUUA 3CZQA 4TMKA 4A0HA 4JSYA 2O0KA 3R7WB 2QBYB 3QOFA 2W6JD 2CCGA 3LVRE 5DNYB 3LNCA 2V4ZA 5FOXA 4ASUA 5F9FA 1YU9A 1OHHA 2ZRLA 1LF0A 4Q01A 2VSFA 5DN6A 3A4MA 1S0UA 3NDBB 2XX3A 3LA6A 3W9YA 4NH0A 1AS2A 5CJ2A 2A5DA 4B73A 2CEAA 1DOAA 1FNMA 521PA 2RGCA 2ZAOA 2N46A 2AXNA 4QFMA 1GKUB 3TRFA 1PLLA 2J0SA 2FSIA 5FTNA 5JHGB 1GUAA 1NBME 3A1WA 3TUJC 1MO3A 4MGYR 3M0EA 5BQ5A 2QRZA 1KJZA 4BASA 4G1UC 3WYGA 3W6OA 2KI5A 1DE0A 3OF5A 4NCJA 1IN8A 4PQFA 3AVQA 1JQJC 4HATA 4DBLC 3CKLA 1VHLA 1F2TB 4R9UC 2JLXA 3B60A 3ASYA 3B9QA 2ZI3A 2ZRNA 4ZCMA 1KMHB 5G40A 1E0JA 1ESNA 4FN5A 1E79A 2WM9B 3RYTC 3UXMA 5EP4A 3GLHE 1D2NA 1N2CE 1W4RA 1P6XA 4MKGA 4GRAA 3AV0B 3BRWD 1KDPA 4WXPA 3CPEA 2KBEA 1TADA 4ZDJA 1F48A 3CNNA 2CE7A 3LV8A 2P2LA 1R4AA 2R8RA 2FSGA 4KV9A 2EWVA 3RAPR 2NG1A 1IONA 4C2UA 3JZAA 3PUZA 2VHUA 4D4KA 4JJZA 1X1RA 1E2HA 3D7MA 2UZIR 3C16C 4JYBA 2WIBA 1L4YA 3GLFE 4MUAA 5IK2A 2ZJOA 2Q3MA 1KDTA 4URVR 1CBUA 2P6NA 2RGGA 5JMTA 1JNYA 3T1TA 1E96A 5KPDA 1XCPA 4F7WA 1VCIA 5HPYB 3KFXA 2JGNA 3DEFA 1W48A 3SJAA 1XFAA 4HUTA 1W5SA 1ANKA 2CE2X 5FPSA 5JWHA 1RFLA 4OQMA 2KSQA 3KJGA 3RABA 4PHGA 1Z0IA 2QQEA 3NBFA 3CZPA 3R9IA 2JJ1D 5CB8A 2P67A 5J47A 2ECKA 3Q7PA 3B6EA 3VFDA 4YXWA 1NG9A 2WSMA 3DVLA 3L82B 1KSFX 2ZPTX 1QRAA 4QJ5A 1XMJA 3TGPA 1E9SA 3S1AA 3T35A 1Z08A 2AHOA 4EQ6B 1W36B 2CBZA 3OAAD 3R9XA 4D82A 4R98A 3QXJA 2C5LA 3CWZA 1TUIA 2J7PA 1I2DA 2WMNB 4BZPA 4N3NA 1AQUA 1OKKD 5TV2A 2F9LA 3OEHD 2CK3A 1SVKA 4BZXA 2B92A 3GJ6A 2DR3A 2JLRA 3ZJYA 1NMXA 1XJCA 2ZUCA 1A2BA 4GP7A 1QHGA 4KITB 4XOIA 1F3OA 1G7RA 1HH4A 4JBXA 1KKLA 4L9WA 3TMKA 3GLGA 2PT7A 4BRUA 4IFEA 4OI2A 2QPAA 1YRAA 2GDJA 2UKDA 3GJ8A 4HEJA 4QHYA 3VR6A 4HAUA 3MLEA 4B2IA 1U94A 2QSZA 1K5GA 3ZS9A 2QROA 3SZRA 1IXZA 4RJLA 1OKKA 4HLDA 4EPRA 1G6OA 1GRQA 4UNQA 3ZLJA 4QBHA 4QNMA 4D0NA 3WMGA 4QM6A 1WXQA 2QORA 4Q9JA 1A4RA 2GZHA 2WWHA 3EC1A 3O8RA 1GRNA 3BH6A 4B3CA 2CNWD 2XEXA 4G5RA 4OHWA 3TAHA 2IF0A 1OLOA 5K8UA 1BMFD 4ZI3A 4LPSA 2GVZC 1T0HB 1Z0JA 2RHMA 2IHBA 3AP3A 4NE2A 3AF2A 3U7GA 5BYJA 1P60A 4H1UA 3LBIA 1IJFA 3BH0A 4V03A 1E4VA 3H2YA 4Z8XA 1P61B 1EK0A 2ZVPX 4LUCA 1T8TA 2ZYVX 3IQXA 2REBA 5DLQC 2ZROA 3KQHA 3R9WA 1QG4A 4LBYA 1YZNA 2AK3A 2W83A 2GRJA 2Z0MA 2HXYA 4HUQA 4OK5A 1P2VA 3IPYA 1YQTA 4NHOA 5EE0A 4P4UA 3B13B 3MD0A 3VR5A 1FTNA 4C7OA 1ZINA 1JXOA 3UWKA 1E2JA 3VX4A 2ANCA 4JSTA 4JLKA 2GCNA 1IHUA 1ZC4A 2GNOA 3ONWA 4TYPA 4B48A 4LYAA 4QXAA 4FMDF 2HDNB 3QKTA 2ANBA 4LHVA 1ZP6A 5AWFC 2ZE7A 5AJWA 3BS4A 1RYHA 1E2KA 3DPUA 3MGCA 3NC1C 1SVOA 3EA0A 4XWOA 3VR3A 1LS6A 4QRHA 2ZETA 3TUIC 4DLRA 1WRBA 1OYWA 3SJCA 2JEOA 1Z5ZA 3I73A 1VHTA 2O8BA 3HU2A 3BXZA 2RGEA 1NN5A 3GLIB 1XP8A 3EW9A 4RD3A 3LQRA 4QM7A 4K81B 1NIPA 1YZQA 1G5RA 2VO1A 1SHZA 3QY0A 5C4MA 4KAXA 1VG0B 2AFIE 3GMTA 2E87A 4YDHB 1S4QA 4MRNA 3U7FB 1UBEA 3U4QA 1BMFA 3NG1A 1P2UA 2ZU6A 1W36C 2GA8A 5FBLB 2RHDA 2RMKA 5FPTA 3GJXC 1XJQA 4EFMA 5ANRB 2QMOA 4TZ0A 4DRZA 1UBCA 2PMKA 3RWMB 1PZNA 4TMVA 5CM8B 3REFA 3V4FA 2RAPA 2Q9AA 3I72A 1DTSA 4WXRA 1UBGA 3HP1A 3LVQE 4CEHA 3AF3A 1GNPA 2H16A 3BFVA 3IO5A 4F91B 1W4CA 3WYAA 3B7GA 3CF6R 5AUOB 3J81k 1KJYA 2R6GA 3SBDA 4MGKR 4RSGA 3NBZC 1KJWA 4HSEA 3PVSA 3KQNA 1XJ0A 2YWFA 3T1QA 2PCJA 1CRPA 3FFBA 1UADA 3B1ZA 2ZI9A 3U3JA 4E07A 4LBVA 1WBDA 4GBMA 1E2EA 1OXXK 2ZANA 4LGMA 1P72A 3KJIA 4MRPA 1KZGB 4ACBA 4DSTA 5JJIA 3T12A 2ODWA 2IUTA 2WICA 3ZVNA 3AH8A 3T34A 4HLUC 4XH9B 4M53A 2YOHA 2QA5A 4A0FA 1W44A 2QTVB 5IK2D 1NVWQ 2ZM5A 3DO6A 3OZXA 3BC1A 4NONA 4X8LA 4DCSA 1IXSB 1KI4A 3ADCA 4B2PA 4AC9A 1JPJA 2NO7A 4L8GA 721PA 2ZS9A 4B43A 2ZUBA 4DDTA 4S35A 2GEVA 1NBMA 2OCYC 4LX0A 3AVUA 3FWYA 4GZLA 2R6CA 3KFVA 4OI4A 1GL9B 1LF5A 3HR8A 1TMKA 3LH5A 2H18A 5FTKA 4BFYA 2ZXUA 3THYB 2WHXA 2NO9A 3HR7A 4LCBA 2ZQ5A 4XTCS 4M1OA 2BOVA 4BRWA 4PPNA 3PUWA 1N0VC 5TB5A 3A1TA 1A7JA 4ACAA 1E94E 3SN6A 4B3XA 1E2PA 2IYSA 2PH1A 1DAFA 3LY5A 5KNDA 2Z4SA 2A5YB 2DHRA 3P4XA 1ETUA 2GXUA 2W2VA 4J0QA 1CJKC 4JYCA 3C41J 2CDNA 1EFRA 1M7HA 1X3SA 2VRWA 4E09A 4B32A 2IYVA 2WJHA 2MSDB 2WJYA 3SR0A 1JBKA 2WJVA 1OH7A 4M8NE 1TQDA 2F1IA 3W3AA 4HLUA 3AKYA 4Q7LA 2YOGA 4DLTA 4K8OA 1P2SA 2FE4A 2J0UA 3DM9B 3B78A 3QENA 4Q9LA 4JLBA 1KK0A 1ODFA 1G17A 1Z6GA 3K0CC 3SFVA 4B3DA 1PVOA 5JS7A 3LFUA 1KDRA 1SXJB 5H70A 4PQYA 4TWZA 1VYVA 4AY2A 3SOPA 2LKCA 5EXTA 4DC9A 4F38A 3K8YA 4MH0R 4JVMA 4IOJA 2O8CA 5KYKA 1ZM7A 3QBTA 3NEYA 3QF7A 1EFUA 1G8GA 1JR3D 1NBMD 4FD2A 5EP3A 2OFWA 1J2JA 4PC2A 1IN4A 5EZ5A 1DAMA 1W0JD 1IN5A 1OB5A 3OFNA 3W3ZB 1PUJA 1GKYA 2QU8A 3G82C 4AI6A 3NHAA 3SJBA 2BMEA 2ZYUX 1XTRA 3OEEA 3BJIC 3LX8A 2E1RA 4KHZA 2F1RA 1Q1EA 2R9VA 3P26A 4UXIA 1OE0A 2FFQA 2GJ8A 2OHFA 3AQ4A 3EWSA 3T15A 2GWHA 3B8HA 2QNRA 1NY6A 4X8HA 4BLPA 4HB4A 3UG6A 1N0UA 3LD9A 4A4DA 1RRGA 5E7IA 3AKDA 4C3ZA 2QGNA 1YJ5A 1EFRD 4WIAA 1NF3A 3Q9LA 4LYFA 4PPQA 4QBIA 4BLTA 1XZPA 3ZYCA 4CW7A 4OK3A 2WBLC 3I8XA 3VU9B 1Q22A 1JEEA 1NL3A 3EZ9A 3OFND 3CR8A 4UKDA 3KXLA 2AKYA 1HQCA 1UFQA 4KU4A 4NCHA 3C5CA 2QTHA 1GNQA 3K0CA 5JZVA 1TQ6A 1RRFA 4IOLA 3BB3A 2CHGA 3L8YA 1TNDA 1VG1A 2BBTA 3WMEA 4F4CA 1L7VC 4BEBA 3PFIA 4US1R 5CIWA 3CO5A 4CF7A 4HI0E 1NVUQ 4MRRA 5AJYA 3IO3A 4CT5A 3QEOA 3UMRA 1E0SA 4CDGA 3G5UA 4A2WA 1S96A 1KO1A 4MRSA 2J0QA 1EESA 2JDID 3L8ZA 4B71A 4EFLA 2PZEA 5KSPA 2EFDB 4LK2A 1EFCA 2VBCA 3QXCA 2REXB 3X1XA 2QMHA 3TW4A 4HLCA 2MMCA 4XWKA 1E9RA 2BHRA 2K5UA 2DFTA 4PC6A 4Q9KA 4DVGA 2GZDA 3N5CA 3R20A 3OIUA 4LY6A 1XMVA 3Q8XB 3RS4A 4PSAA 4A6PA 2WWGA 3OESA 4DUGD 4URXR 4Q5IA 5A5GA 3B1VA 2PJRA 1Q3HA 1DEKA 1KK3A 1LVGA 4QL3A 3H1TA 4G5SA 4CEJA 2ZYTX 1NKTA 4Z54A 3AGPA 1GILA 4GOKA 2WWYA 1GVNB 2W6JA 4IRUB 4LOAA 1JR3E 2QBYA 4KVGA 4MGZR 2GVDC 1DARA 1F2UB 3CM0A 4YQFA 5BXQC 1AN0A 2Z5FA 5D3MA 2OUKA 4WA7A 5TY0A 3VR2A 4D2IA 2HYIC 2QSYA 4O25A 4JKIA 2B7CA 4IJMA 4XSGA 2ODEA 3SS8A 3O8DA 1T91A 4PSKA 2BM0A 3HPQA 3VR4A 1N6RA 4L15A 1NJGA 1WB9A 5L3RA 4TMTA 4NP6A 3WNCA 5KSYA 4ZPXA 5EE1A 3VR1A 1V5WA 2GHIA 1YZUA 3PITA 4XD7D 4A8JC 4O2LA 3RVBA 2ZRKA 2CLSA 3DL0A 3CRW1 3RS0A 3B82A 1RJ9A 5CITA 4Q47A 3T06B 1WDTA 4LBZA 1XZQA 2R44A 2HCBA 3BK7A 5D3MB 1VKJA 3OIVA 4LJ7A 4W5WA 1CJMA 4D4MA 4JVLA 1R8QA 1EWRA 3WRXC 2ZR7A 2G6BA 3OHMA 4LYJA 2CCJA 4MA4A 5GJBA 1KI1A 3QKUA 4CEJB 2GTPA 1MT0A 3CLVA 2GCPA 3GD7A 3UMSA 4Z1MA 1Z3IX 2AD5A 1Q3TA 3LXRA 2UZ3A 4ILEA 3RRMA 1P7CA 1ZM3A 2IK8A 4Q66C 1CIPA 1KTVA 1L2TA 1QHYA 2V6JA 3BB1A 3FFAA 4PZLA 4TYQA 5LB4A 4M0LA 2JAQA 1NN1A 4FMCF 4RY2A 4OI0A 1CF4A 2EU8A 3NH6A 3MFYA 4Q18A 1TQ4A 3MWYW 4MKFA 2QP3A 3WNBA 4DJTA 121PA 2EYUA 3SU8A 4A1FA 4BEJA 5KNBA 2QAGC 5EJEA 4UQOA 1KSHA 5FOWA 1KOFA 4TL9A 2IYRA 4M4SA 3VU9A 2G0NA 3WP1B 3I92A 1II8B 2IEZA 4EUNA 2DY1A 2FA9A 2JLYA 2V3CC 5CDFA 3TW8B 1LY1A 3CNOA 1NVVR 4I81A 3B1WA 4TL7A 2WZQA 1G9XA 1SGWA 4V02A 4QG7A 1NVXQ 4M2LA 4LZZA 3LBHA 5IT5A 3CUEF 4Q48A 1G1MA 1DAKA 5FUVA 3D3QA 3KJHA 4DCVA 3UMFA 2RH5A 2B6HA 2OBLA 1G8PA 3TK1A 1D9ZA 1XB2A 3ECCA 4Q9IA 5FR2A 1II0A 2OV2A 1QHXA 2X19A 5LPNA 4CEIA 4O3MA 2REOA 4B3FX 3PR1A 2EQBA 3MSXA 3PQCA 4WVFA 4DLYA 2IYXA 2ZJBA 3ZD7A 4A2PA 2MMGA 3F5FA 2IL1A 2Q6TA 3PENA 5TXGA 4IOKA 3LLMA 4OQXA 1QHHB 1J7KA 3N2EA 4M22A 4P31A 1CULC 4OJKA 1FUKA 4FXPA 2O8DB 2P65A 1XMSA 1TU4A 2CLDX 2VP4A 3KXKA 4L9SA 2F7SA 4BGDA 1CU1A 4XVRA 3WHKA 4HDQB 3OE7A 2LWIA 4OQLA 1M74A 5KHOC 4BE7B 3RANA 3TSOA 4XTRA 1IY0A 4FCTA 5FPYA 5J4LA 4GOXA 1XTKA 2NO0A 1T9HA 3CF2A 1NN3A 1OXTA 2J0UB 2QENA 1DAEA 2BDTA 1FP6A 2CHQA 4BECA 1NLYA 1IQPA 1GZSA 3GFOA 3KTAA 4RKEA 1G7TA 4M1SA 1PLJA 5JRJA 4D6PA 2D3WA 2D4HA 4TQAA 5DHAA 2QGZA 1DELA 2AXPA 4LPKA 1Z6AA 4TQ9A 6Q21A 2GAAA 2BBWA 4LRWA 1E2QA 3GEHA 2WWIA 2JJ1A 4PPFA 4ZV4A 1KI8A 2IXEA 4HB0A 4XVQA 1P62B 3RS3A 5DN6D 3RNLA 4YXWD 1Q44A 1WA5A 2OT3B 5IDVA 2JLUA 4LV5B 1AZSC 1W36D 4YC7A 4OQFA 4HAYA 2CVHA 1AA9A 5JCZA 2ZU0C 2F43A 3FHCB 1OIVA 2W6IA 3UWOA 2ZS7A 4ESVA 2VPPA 3U3OA 2GJKA 2XOKD 3MG9A 3THYA 1XWIA 5B58C 1YR8A 2YWGA 2ZSEA 4MYTA 2FH5B 2RGNA 2DYKA 4D0GA 1TUEA 3KXIA 2GXSA 4HAZA 1QHNA 1FPMA 4JLNA 3FKSA 3I3SR 1W1WA 1VCMA 5CM9C 2CLCX 3RC3A 1UBFA 2OAP1 4RVCA 2EFHB 2QT0A 3VNUA 1YZGA 3QXSA 1GM5A 5FI0B 3FKQA 3QQ5A 4II7A 4OL0A 4I1VA 1OXSC 2JLZA 2Q21A 3BERA 1R0ZA 2YC2C 4EIWA 2W2XA 1D6JA 3GLIA 3SHWA 4BQSA 4DZZA 2C99A 5L3QB 3UG7A 2IYQA 4C0JA 4FCWA 1SXJC 4Q02A 821PA 1E2IA 1US8B 2QZ4A 5AK0A 3ZVLA 4B3BA 1RKBA 4A2QA 4B2LA 2VHCA 3NHBA 4MGIR 2XTNA 5SZJA 1DAGA 1Z6TA 3QIAA 5CLLA 2XB4A 1VG8A 4U5XA 3I32A 2OE2A 2QUZA 4ARZA 3THXA 3QKSB 3WMFA 1S3SA 5K8TA 1D9XA 2FFHA 2KJQA 2O8CB 2FEMA 4O0MA 5FPHA 2QAGB 4TSFD 2OCBA 3NVAA 4W9MC 4AYXA 3ASZA 1CS4C 5GVSA 1BYIA 2XITA 4IDNA 1R5BA 1KI3A 2ATXA 3U2QA 3KQLA 5JI2E 3KQKA 3MWJA 5F98A 1AM4D 2Z6VA 1TF2A 3IDQA 2NOAA 3PG5A 4GMXA 1WE2A 1XTSA 4QGAA 3FOZA 3SEAA 1HE1C 1KO7A 4QGHA 1NSTA 3OEED 2O8FA 2IA5A 3GLFB 1N6HA 3NBXX 3OAAA 4YMTA 4D80A 5JECA 1KY2A 5SZHB 3N2IA 4C0BA 5JI3E 4PAQA 2XJ9A 3KDSE 4R71A 4XIGS 3PEUA 2IYZA 4FMCB 4NMMA 4OBEA 3RSOA 5ELXA 3TSWA 4YDSA 4E03A 3MJHA 2QAJA 2N1BA 2ERXA 1IJEA 1ZIOA 2BCJQ 2X77A 3QPUA 1UEIA 1A5TA 4PO1A 1T8UA 4ZCIA 1S9DA 4IEIA 3U44A 4M1KA 3WYFA 4BLRA 3F3YA 2QMUA 3ICQB 1ZUNB 2FGKA 2YHSA 4B6EA 1WMSA 3GEIA 1OH8A 1T3HA 4X8OA 3AUXA 3SC3A 4C9BA 4Q4HA 1ELOA 4A0RA 4RZXA 4FI3C 2VP0A 4Q21A 4CRWB 3BWDD 4IVRA 1AZTA 5DSZA 1SXJE 1HE8B 2NGRA 2FU5C 2FPLA 4PFSA 2HEIA 4LDJA 4URWR 1Q57A 4CYMA 2WJGA 2V1UA 3K0EA 3QSYA 4IHQA 2P3SA 3KJEA 2VEDA 2PX0A 2ZRPA 1K6MA 2IYUA 1YRBA 1ZYUA 3VKGA 1TEXA 2A78A 3A58B 3QJYA 1R5OA 4TLCA 2GAOA 1MKYA 4MDEA 1E2GA 1GKIA 1F60A 2QM8A 4OYHA 3DHWC 1XEWX 1NIJA 1E1QA 4G5GA 1E98A 1QVRA 2E9SA 2D7CA 2JLWA 4XWAA 3FMOB 5DO9A 3P20A 4M9SA 5EQTA 4M1YA 1JR3A 1M1YE 2ZRFA 1N3BA 3SI7A 5F3WB 5TDHA 2ZJ8A 5EXPA 1GTVA 4RZ2A 1P3JA 3QXXA 4ASUD 4ON9A 5GJCA 4QKQA 3CPHA 1KI7A 5BYKA 5FI1B 3EPJA 1P9WA 4LJ8A 5DH9A 3AVVA 5DISB 1IM2A 1HQYE 1OFHA 1G4AE 1SHKA 2ORVA 2H8KA 2KBFA 4PX9A 3ADBA 4URYR 1RPZA 1AS0A 1O3YA 3AKCA 3VKWA 4DLVA 4ZIRA 1BS1A 2FSHA 3BFKA 3BD9A 4GPTA 1NI3A 3FDIA 2ZITA 4TTQA 3B85A 2WPDD 1HY3A 2I1QA 5E3HA 4DXAA 3IIMA 3K53A 3L0PA 5G53C 1CJUC 1T6NA 4MRVA 4Q9HA 1P9RA 5FTJA 3DOFA 3W6NA 1VMAA 3HU1A 4AIIA 1XXHB 1MH1A 1EWQA 3X1ZA 3ZQJA 2JIZD 3EG5A 2DWPA 5JEEA 1F6BA 1PV4A 5FOSA 4TTPA 1MR3F 4BUJA 4CZ2A 4P4SA 3C7KA 2C9YA 2H57A 1NKSA 4PAOA 3S1AB 1FFHA 1GG2A 2GEUA 4ARZB 2WKPA 2PEYA 1IOZA 3KKQA 4ZKEA 3MMPA 3PCRB 4AYTA 1ZM2A 1Z2CA 3EZ6A 3LQQA 3QNUA 1HT2E 2EVWX 1ZUHA 2CCKA 3V00A 4Q00A 1EFHA 2V7QA 1IN6A 4TYYA 4KFTA 1CTQA 2WIAA 4GL2A 1JQLB 3GLHB 5AJZA 2GJ9A 4JLVA 1E1RA 5L8VA 4CEIB 3RRNA 4LJ4A 4L16A 3K70D 1GAJA 5L3SB 1Q20A 2ZI6A 1Z22A 2J45A 1B0UA 1ZU4A 3QXHA 5G41A 3QUSA 4PC7A 4UJ3A 4WZBE 1E3MA 1EGAA 1U2RA 2CXXA 2OXRA 1JXMA 3N70A 5JWOA 4YLGA 2C03A 4HB2A 4OQNA 4FWTA 4WAUA 2XSZD 4YMSA 2ZJ5A 5J5CA 4B3GA 2ZVQX 2VF7A 1LB1B 1Z8FA 3QG5A 3B9PA 1XPUA 5C4GB 4QGFA 1E69A 2BJVA 3IIJA 1U8ZA 2Y8EA 1RW4A 1BO6A 3K09A 4UXJA 4Q7KA 1LNZA 1U90A 2OG2A 4RKFA 3TKLA 1O87A 2ZSFA 4C0QC 4DCUA 2VP9A 4NYMR 4F4JA 1K8RA 1YVDA 5K8LA 2CL7X 1NY5A 1WBBA 3EZ7A 4NCNA 1WF3A 3VX3A 1VIAA 3MJRA 4GDFA 1H8HD 4OHZA 3AP2A 4D4JA 1XTQA 1V43A 3W6PA 3VKHA 1D8TA 4G01B 1GSIA 621PA 3NIBA 5BN3A 3FE2A 2Q9CA 2RCNA 4QJ4A 1DBSA 1VG9B 1W0KA 2VLIA 4B47A 4N1AA 1VTKA 3GJ4A 2ERYA 5EE3A 4DIDA 4YMUA 1S8FA 1TEVA 4R2IA 1FX0B 4C0HA 3BGWA 2ZRGA 4EPWA 5BW8A 3VNVA 4NYIR 3AUYA 1VIYA 1FTSA 3RDPA 3BB4A 4DLWA 4KYUA 4PR0A 4XJXA 4US2R 2IUSA 1KI9A 2ZI5A 4AG6A 2A9KA 4FMDB 4CVNA 3IBYA 2C9CA 1EFTA 3BFXA 1U0HC 4MUBA 4PHTA 2AR7A 3KUCA 4BFTA 3TQCA 3KX2A 4KSBA 2RB4A 3HWSA 5FBVB 1MO4A 2GCOB 2JDIA 3EPHA 3IILA 4TQUS 2IT1A 2RGXA 4BWYA 3IHWA 3KKPA 3L43A 4QOSA 3RS2A 3E70C 3QG1A 3C5HA 4QC2A 1KK2A 4C0LA 5E7MA 4JL5A 4I1OA 4V0LA 2FFAA 4ZKDA 4GP6A 4B76A 1ZNZA 2VHTA 4JLPA 2HYDA 3FVQA 5HTKA 3UK6A 2QI9C 1SVIA 3SYKA 8OHMA 1ZCAA 1XU4A 4WOPA 2JJ2D 3HDTA 4FIDA 4DUGA 1XTJA 1JALA 4TN1A 2VH5R 4EPVA 3K9NA 5AUNB 4RD6A 1G3MA 2KE5A 4QHSA 4TYWA 1ZBDA 4A9AA 2OSBA 3Q7QA 4EKDA 4P4SB 2BMFA 3GFPA 2W00A 2EFCB 2ZRCA 4G5QA 3FGNA 5EXXA 1EG7A 2H17A 4Q1BA 1E9EA 4RZUA 5TMPA 4Q4LA 1CKEA 1RE0A 3EARA 1MABB 2GK6A 221PA 3Q85A 2XTMA 5DYIA 1OSNA 3T5GA 1UJ2A 2ZRAA 5E95A 1P5ZB 1XD2B 2ZRIA 3PUYA 2VSXA 5DI3B 1FQJA 3QPWA 4IDPA 2CL6X 1CR0A 2O52A 4ZDKA 1SZPA 2JCSA 1M2OB 4JLOA 4Q1CA 1HYQA 2WMOB 4TLBA 4TZ6A 1RZ3A 5CYPA 1VYUA 3SHFA 3ADDA 2HT1A 2VYFA 2BKEA 3THWB 1OHHD 1X8JA 2B8TA 5DIFA 4M1WA 2JLSA 4PANA 3GFTA 3A37A 1XDBA 5HZKA 1E2LA 3KQUA 4ZDIA 2O8EB 4LV8B 2IYTA 2J87A 4IOMA 1ZNXA 1W46A 3WY9A 1G21E 4IVPA 3K1JA 1T3SA 4BPBA 4LJYA 4YONB 1DS6A 3A8TA 5LB2A 1XD9A 4IDOA 2F3TA 2ORIA 2QRNA 2DPXA 4BFUA 5GJWC 3WBJA 2YZ2A 4HYYA 4BZQA 4B33A 2NIPA 4DKXA 2GETA 2HJVA 4DT1A 1A82A 2KB0A 1MOZA 3C14C 4JLMA 1T0JB 3ZGXA 3QI2A 2QP4A 4Q1FA 1UAAA 4C0AC 2OBNA 3R8CA 2QY9A 1CLUA 2I4IA 1H8HA 3FMIA 5D3QA 2FJUA 2J41A 3GP8A 1KSGA 1U9IC 1D2EA 2V8OA 1U8AA 3WRYC 3GQBA 1G3QA 5DGXA 2C2HA 1TL7C 2X8AA 2ZE5A 3AKEA 1DO0A 5EP2A 4EJSB 3T1VA 2J0VA 1XBTA 2OILA 3AF0A 1G5TA 3A1SA 2ONJA 3K70B 1KAGA 1W5TA 2GK7A 4M9XA 4PC1A 2F3RA 5FUYA 3QBVA 2MSCB 3AVTA 4ZIRB 3ZZTA 1W2GA 2HF9A 1W0JA 2J7KA 3A1VA 2FEOA 3EA5A 3NC0C 1VYTA 2VF8A 3DZ8A 3FMPB 4HDOB 4B35A 4Q7MB 2VA8A 2IHYA 4EPTA 1AKYA 3EZFA 3BH7A 2G83A 4HZUA 2WSSA 5IF9A 2J9RA 3W5JA 4TLDA 4AKIA 1M34E 1NMZA 4DEYA 1XX6A 4W5JA 1OH6A 3I1FA 2VTKA 4JMPA 3MUFA 421PA 1C9KA 4UNPA 2O8FB 2CL0X 1KY3A 2VHJA 3EWAA 5J40A 1E6CA 2B8WA 2PX3A 1IY2A 3K0FB 4P3YA 1Z63A 3H84A 4OHYA 2VP6A 1I4DD 4E22A 3C8UA 4M21A 4KVAA 2OCAA 3T61A 4L5BA 2DFNA 4PHHA 2JJ2A 3U7HB 2QPOA 2GZAA 4KODA 2VSOA 4PO8A 1OFIA 3GLIE 1N25A 1N6LA 4LI0A 1GP2A 3WP0A 3UKDA 5GJVC 4D0LB 3DKVA 1NRJB 1E9DA 5CK4A 2IWRA 3U7EB 4KXFB 1SKYB 1G8HA 3RRYA 5KPJA 4Q7JB 2YC4C 3ZIAD 2ORWA 5B64A 1QG2A 3LW7A 4DDUA 1OH5A 2P6UA 2WWWA 3FB4A 1P4SA 3B1YA 3NBYC 4OKSA 3T1OA 1QVAA 1YZKA 2C8VA 1P73A 4MQBA 1SULA 5C46F 4OHXA 1E79D 3D8BA 5GADl 3QEJA 2QPTA 4Q1AA 5C2JB 1H8EA 4NZYA 2QE7D 2XOKA
chains in the Genus database with same CATH superfamily
3RFFA 4N3CA 3NHRA 1FU8A 3EUAA 5HYVA 1VSTA 4BMZA 5C3MA 1T2AA 3SSMA 2JI4A 2BEKA 3DMDA 2QDXA 2H9AA 5C8DA 1TF5A 5K3FB 3FM9A 3S29A 1E3SA 1AZLA 1FDIA 1UOOA 4L3WA 2HW8A 5JASA 3QIVA 4YJGA 5H8WA 2VIIA 4NAUA 2B30A 2JASA 1WUKS 3NM4A 3A1UA 3QVUA 1CT9A 3QTLA 4M9RA 1Z68A 2WFLA 3ZU2A 4YCMA 1HC7A 5BR7A 4M1TA 1EDEA 1USUA 1X7HA 4L1KA 3IP1A 4ED9A 3KKOA 1R66A 4PCAA 2BC9A 4Q0MA 5KDOA 3NHWA 4CEHB 2VYVD 3UWSA 5ILGA 1XTBA 1KKMA 1DG1G 4L7VA 4MUFA 3AF6A 4DAEA 4RVFA 5TVKA 1K6EA 4I1IA 1JLLA 4YPOA 1I0IA 1UBMS 3K0AA 1XN4A 4UZFA 2CWWA 3K2EA 4BO6A 3VC2A 3L0YA 5EVCA 2ERCA 4QPPA 2NZ2A 4U00A 4EX6A 3ZHRA 1E8DA 4RA9B 1WHSB 1KJJA 2B2NA 3B9RA 3OHSX 4K6FA 3RLFA 2FJPA 4S0ZA 1FMJA 5AXCA 2VTVA 1YR9A 2HA6A 4I19A 3U4DA 2IX3A 2C4MA 5FL3A 3T9CA 3NM5A 1SEPA 2G9VA 3RG8A 1KFJB 2Y68A 1FNSA 3H6GA 3Q9NA 1GFWA 4G36A 3IEVA 1Z75A 1CQZA 1JIXA 1OTHA 1U0LA 1WDLA 4PXAA 1PGNA 3FUXA 4DYVA 2ZLBA 4I66A 4M83A 3PDIB 2VUUA 5ALXA 2F55A 2C96A 1YR6A 2I2DA 5J9FA 4R9NA 5AW4A 3OMLA 3M1IA 1ZI6A 2VDJA 2PFSA 1B00A 1VSUA 2R8XA 4TVOA 5L3ZA 3UXEA 4EHKA 2N47A 4R2XA 3RYFA 1D4OA 3WLFA 5CVJA 5M04A 3NTOA 5CLIA 1Q14A 2A5FA 1OZAA 1RRPA 2BEVB 2GAFA 1LTQA 4Q24A 4Q6WA 4QNNA 4R9VA 1EB8A 2Y6UA 5KIAA 3C5EA 1BMQA 1XA4A 3LGAA 1PVDA 1ZL0A 3IMEA 4LA4A 4DDKA 2RI1A 1YQ9A 5YASA 4A0GA 3BEDA 3WYDA 4QAJA 2WW8A 5JANA 5IZCA 2ZRJA 3LT0A 5CA0B 1Z73A 3C98A 1NJFA 1PDVA 5AJXA 4LC1A 4CDMA 2IS2A 1RBMA 4KLNA 3UJ7A 1UL1X 1YRHA 2WU0A 1Y0BA 2FWIA 2A1UA 2XE6A 4P7GA 4Y2PA 5KOHB 1Y1TA 1CUHA 2EDCA 3GLUA 5A03A 1QHFA 3F6SA 4LZJA 5JZBA 4P5PA 2BMAA 1J33A 1N5KA 4EVRA 1GDDA 1GA4A 1WCV1 3SF0A 2V4MA 1NXXA 4M37A 4C0SA 5BV0A 1SBNE 4MA0A 1XZFA 4DSUA 2V7UA 1XCMA 4W7IA 3KCNA 4QT0A 4XSHA 5B30A 5AW0A 2H2WA 3A4NA 3U7JA 5CB6A 2WYVA 4QEKA 3ZU5A 1XMQB 1QP8A 1SMKA 1V1MA 2ATCA 4M8KA 1AQLA 4R5MA 4O4LB 1P91A 1FZTA 2BVNA 2HDOA 3RHFA 3AEZA 3CE6A 4YIKA 3B3FA 5DYWA 1CB0A 3NUGA 3E8SA 4WL0A 5AKIA 4AWAA 2F8LA 3R6LA 1EVEA 1OOEA 4RHTA 1Z07A 4DDWA 4CF3A 1K3UB 5ER6A 2OESA 1N6OA 4B3JA 3K4HA 1HMPA 4AN4A 2YIMA 1EK6A 1WLSA 2LZ0A 1AXEA 5K6TA 3RIGA 1JAIA 2B20A 2AD1A 1TM2A 3G0HA 5TGDA 3GB9A 5FOUA 5LZ7A 1JFFB 1REQB 3JD2A 3UY4A 4DC1A 5P21A 1KE1A 3UJBA 1YGYA 3CHYA 5C1BA 2X5KO 4EHNA 5IG2A 1IHOA 1OW3B 3I39X 2QVCA 1DFIA 2NU9B 4LRQA 4TV8B 3X1DA 3DAGA 4W1PA 3ZDXB 1G3RA 4BO8A 1B6RA 5EQJB 4I4TF 4MTCA 1V39A 3UEOA 4X71A 2XCQA 2C78A 1Y7TA 4AZ0A 5JQGA 4KPGA 5CB4A 2VCEA 2VTBB 1OFVA 3EVNA 3F90A 3M9WA 1ZOOA 4O4JA 3ZV5A 5FDFA 4QLAA 3LC1O 1G2OA 4NKRA 1I24A 1MEJA 4IUYA 3THXB 1KEPA 5DPMA 1XJWA 4LVCA 4U7DA 2QTCA 3BZUA 3HYTA 4BVKA 5GGYA 3Q0TA 4I99A 1ZCBA 3WBKA 1KAMA 4QXRA 4F04A 3TRJA 1R5NA 3CUSA 5DHFA 2WAOA 4EG7A 2QJFA 1M33A 2FOLA 1OWMA 4ND8A 1E7WA 1GKKA 2GESA 2Q1SA 1CPYA 1GPNA 4BNYA 1P18A 5AVUA 1WUHS 3N8NA 4EHBA 3OUZA 8ATCA 1UFKA 3T7DA 2YNMA 3TNFA 1TJ3A 5K8IA 5FT9A 1XAJA 1T4GA 4QBFA 5CDHA 1O08A 5I7UA 5JY6A 1B8OA 3KAPA 4TKMA 2BT4A 4KXWA 1KI2A 1M2NA 3RCBA 1M2FA 1QH9A 1UJ4A 3FUVA 3C74A 2ZB7A 1U3DA 1ABBA 2IQ5A 1CD5A 2D7DA 2WTMA 4O08A 3C7TA 4WZBA 4L75A 4ITRC 5TF0A 3OUUA 1PBTA 1W2HA 2Z57A 4LSMA 5HF5A 4M86A 4LHYA 5J63A 2QTBA 3CN9A 2CVQA 2VJQA 4UM7A 2GJSA 4X1OA 3BX1A 5KCZA 1MJHA 1KO8A 1P33A 2D5AA 2QN6A 1J2UA 5DI3A 5DMHA 5LBIA 3RJMA 1X8KA 2HN9A 3VTKA 4D4LA 5KS2A 1QVVA 3LCUA 2J5XA 3D6TB 5D1HA 5JZSA 3N3BC 5C1PA 1NOIA 5JQGF 2G3YA 1L5GB 4C6TB 4ENVA 5A1TA 2AMJA 1JX6A 3CBQA 4NULA 4FYHA 1KVTA 1T2DA 2ZAMA 3EDQA 1NI4A 4D41A 4BMSA 3REGA 4G67A 5KO2A 4I4LA 4J0FA 3CLTC 3OKFA 4FKBA 3WSWA 1DINA 2KYRA 2ZSBA 3INGA 5FLXA 1Z7BA 1KRHA 5BW6B 2V1XA 1K8QA 3G02A 3L07A 1DKPA 4OGFA 3DAFA 3MINA 3CRQA 1NM5A 1SU4A 4TL8A 1A9TA 4DIBA 1ORDA 2QV0A 3COPA 3R3XA 2FMHA 2SICE 4WBXC 4X7RA 5F35A 1E9CA 1CX9B 2QT1A 4G41A 4RVNA 3AF4A 1KMQA 1U1DA 3QUCA 5FI5A 3VZPA 2FVXA 2DT5A 5DCYA 1SVMA 2G5CA 2AFRA 3Q10A 4X3OA 1UXHA 4CT4B 4D92A 4ETIA 3K4PA 1EFVA 2P0AA 3EDOA 1RC8A 2E4ZA 3OZFA 4YWJA 3CR7A 1BYUA 2H4ZA 3CLUC 1C7JA 4IX9A 3R7BA 4EHAA 4ALJA 4JL6A 2PLFA 3ND9A 3ESAA 1M6WA 5CXSA 4B4WA 2JAXA 1A2KC 3E3AA 3Q5EA 5D87A 3ETNA 2P6RA 1L1EA 1UMCB 2XTZA 1V8BA 2ZWIA 3GHHA 3REQB 1JSLA 2Q9BA 3T1NA 3I5YA 3R2JA 1XPOA 2IHVA 4RVSA 3GJRA 1T2EA 1WBJB 2XZOA 3ZDQA 3D2BA 2C8KA 3PNPA 2Z4RA 1G7CA 4FDMA 4BNLA 4WZZA 5C8XA 3JQAA 2YW9A 4UQPA 3JQRA 3AOEA 3PTLA 2XKAA 2G36A 1SB9A 5KWSA 4W5OA 1D3AA 5AVRA 1FTYA 1N2SA 3VNSA 1G9TA 3MS7A 3ZWCA 2H1CA 4G3XA 4NG4A 3U37A 2NT4A 3UUGA 4EHFA 3DULA 3H4TA 4FFRA 2F4VB 4X1KA 1XN1A 4FFSA 1FDUA 2WAAA 4DLSA 3CX8A 1S2MA 1LJLA 1ADJA 1DKOA 2FLKA 2FQWA 1OIWA 4KQXA 5CD1A 5BQXA 4H9GA 1MRZA 3OT1A 3DV0A 2IYFA 4X1IB 5FBZA 2IU0A 1ZNWA 2B1IA 4NVRA 3UT5B 3KO8A 4JEMA 2FPKA 2Y99A 1IEXA 1Z0DA 3QYJA 1OJLA 3UH0A 3AL0C 3QUAA 3GCGA 4IKOA 4BMNA 4EITA 2R7KA 2X3UA 3MWLA 3NHJA 5DZSA 2BELA 4FX5A 4RE6A 4R1PA 5DNWA 2WE8A 3UKOA 1S01A 1WV1A 2G1JA 2XV1A 1C1DB 3RTAA 5KNBD 4Q4JA 4R2WA 1A4XA 5KWEA 1J5PA 3FJ1A 3MOSA 4QRDA 2VP5A 1ZSNA 4NZZA 2ZZKA 1KRWA 4V0NA 2AC4A 2JVKA 3EEIA 4RZSA 4EM6A 4HQFA 1JFTA 2WKRA 4ZYVA 2O3UA 3G2HA 1PWXA 1SCNE 4PZZA 5PGMA 1O96B 2ECPA 3PGLA 4N4AA 2W8BA 4JZKA 3ZIAA 1Q6ZA 4N41A 1I4OA 3NRJA 3IDOA 3QUQA 5CH5A 4HNGA 2PUDA 2MTBA 4BQOA 3HYRA 3Q72A 4JUFA 4TXMA 4C87A 1XDWA 2VDUE 1FW6A 3FWNA 4OHOA 2EAUA 2PWYA 2QE7A 1MJNA 1C8LA 1ZONA 1R8JA 3DUWA 3TGLA 5LL6P 1NQUA 4RD4A 2BM1A 1T4MA 5CX4A 3CONA 1W4AA 2IUUA 2YNMC 3VZRA 3ZGNA 6GPBA 1P44A 5ARCA 1RI2A 4G5YA 3K9HA 3O8CA 3BXFA 5EUQB 4CG2A 4EGFA 2YJZA 5B6JA 2HK6A 2VG8A 3JYHA 2G9RA 2DFVA 2XRZA 1GADO 2C9OA 1S1CA 1FP4A 5B3LA 1UODA 1WZIA 1RZVA 3H11A 3AM3A 1JFRA 1T26A 4GNKA 4WJLA 1D2MA 1G64A 2NADA 1UEJA 1V1MB 2WKQA 4XW2A 4WASA 4I4TB 2XH8A 4JS0A 2FN7A 2GLTA 2FZWA 1I2BA 3LO8A 4A8JA 5ITWA 1RXUA 2H3EA 5DP2A 5IZ4A 5CCBA 2DH6A 1KIMA 3W5BA 2FK7A 4IVNA 3GLHA 4CCYB 4P32A 1K4KA 4X9XA 1T13A 4YT4A 2GZ2A 1T9CA 1SC9A 4JXXA 4HWGA 2ZB4A 4KZPA 2WMYA 2XY4A 4JC5A 3W90A 4B44A 2H7CA 1KI6A 4ZJUA 2FZGA 5KQPA 3K94A 4INJA 2KQUA 1QORA 1M8FA 2QRGA 2WSSD 3PFCA 4BN0A 5EY5B 1R0WA 4H16A 2F1HA 3LUJA 3R7WA 5AOCA 3LT5A 3WQSB 3STYA 2FETA 1RWXA 4LGVA 2H9IA 1NZJA 1WWKA 3H8WA 2AEMA 4NL4H 4DA0A 2DHQA 4J0KA 4DM7A 5HQ3A 1N1MA 1DO2A 3F3SA 3FBGA 3N53A 4ZRDA 3RI3A 1Y5NA 3A0RB 3K09C 3P19A 5B7GA 2PE5A 3RC8A 4M76B 1ILWA 3W4IA 3MCAA 1PR1A 1R2QA 2IZ0A 3I5XA 3DKPA 2K2QB 1RYNA 4FOSA 3I5UA 1SOUA 4JBHA 3EIQA 4DRXA 4YV2A 2CT8A 2BDUA 3NHFA 3QOXA 4BASA 2AMLA 3N8DA 2JVIA 1FS5A 1IBKB 1R10A 1GOTA 2CLIB 5IC4A 3NH9A 2FSVC 5EXDA 3PWSA 3COSA 4CCAA 1ZRMA 1GL7A 4EYKA 3GMIA 1JE0A 2L18A 5IMBA 4OI1A 2PLRA 4DQDA 2BM9A 4YAWA 2FAXA 2UYOA 4BQPA 3RVJA 3WX0A 1BWRA 5K6AC 4BO9A 3GC6A 3NXSA 4NFYA 1ZUWA 3D8UA 3TQFA 2Z43A 4OM8A 4S2EA 4NAVA 4O4LA 5SZIA 1Y1LA 3KHTA 3P45A 1H9BA 4XJVA 3EHDA 3ETCA 4KQMA 4LZAA 2PANA 3ELWA 1Z5WA 1W6UA 3FWPA 3M2PA 4NU5A 3B48A 5EIFA 3C2QA 3UBMA 1ZU5A 5LLDA 3ZDAA 1YK0A 2FPIA 2HA3A 1NF8A 3BGOS 2JFYA 1BU8A 1HURA 4IHKA 5JJLA 1MAVA 3K6SA 4YAJA 4ZQHA 3HXOA 2P6MA 3AZPA 1E1DA 1GPWB 3FNRA 3NC4A 2W2TA 5I4KA 4G1CA 1JZTA 2GJAA 1JU9A 1QC5B 3DMFA 3E9NA 3BSYA 4U2BA 3AERA 2FMFA 2E18A 3LVBA 1GL6A 3QVMA 4R1NA 2ZK7A 4YRLA 1Z2EA 1N0IA 1JMYA 3CLTD 4E08A 5KOHA 3RUDA 1XKTA 3SSAA 4U7FA 3MB5A 1P19A 4JOSA 5BMOA 4IQ4A 5JCOC 1XMOB 3AEKB 3KWJA 2FRDC 2H1LA 2HRBA 3GNLA 3M81A 4B6RA 4EAQA 5FPKA 5JU6A 3HJHA 2R8OA 2Z8XA 5A3SA 3AEQB 3JTMA 4NV3A 4YP0A 3P0RA 4L50A 3FYHA 2BFDB 1EFKA 2G76A 3FPGA 4JXJA 4L8YA 3V7FA 1BHSA 2V98A 5AKKA 1U5BB 1WXWA 4Z0HO 1ZMTA 2PKEA 5JSKA 5REQA 1VPVA 1NURA 4NIMA 3WFZA 4CN8A 3WLNA 1JJ7A 2X86A 3JY6A 3CEAA 4OYYA 1R6BX 5LXTA 3ZWNA 4V1CI 2AG0A 4LXXA 1M0EA 1N3IA 2DPLA 3TVDA 3IDSA 1JXQA 4ZJPA 3U62A 2ICAA 4HNAB 2AI3A 2EZ8A 3QX8A 5FFFA 4UOZA 1EVKA 2OP0A 2AZMA 4HBZA 4ZMRA 2WTBA 3AHDA 4DLXA 1TYBE 4YRMA 1LDMA 1ORHA 5CA0A 4BP8A 4UE3S 1YRWA 5C80A 4KYIB 5K0TA 3ZWYA 5CFZA 2KHZA 4REQA 4DRYA 2C98A 3K2BA 2SKEA 4R9SA 3CE9A 3F5QA 3GF4A 3W06A 5EJ5A 2BWJA 2QG6A 5U4QA 4HAXA 2NACA 4N5HX 3BF7A 1GITA 4WLNA 1Z0UA 4NOMA 4B7ZA 4DM3A 2ZM6B 2JZNA 1S89A 3FNHA 4UOQA 1WDKA 1TIPA 3NDJA 1Q21A 2W58A 1DSSG 3KAJA 3KZ1E 4FFVA 5EUMA 5JS6A 3UJ8A 4HMPA 2X0JA 4BFWA 3HN6A 4WZAB 5E3IA 1WZ2A 1L7QA 1LI4A 1WD5A 3CWQA 4X94A 3CB4A 4M1ZA 3HXMA 4ARUA 1ZD8A 2Q4OA 1JTFA 5SZKB 3IAFA 4DQKA 4MLCA 1NA5A 3MRTA 5JISA 3R7DA 3LTNC 1L4LA 1XVIA 1P2GA 4KHPB 5HMMA 1OD6A 5IH7A 1PNVA 1EIZA 2J31A 1KQNA 4JVNA 3UCEA 3LZ6A 3MMSA 3SNKA 5EPUA 5AVOA 4AFNA 3WA7A 1Q92A 4L4YA 5CFQA 4PVCA 5CNKA 3WWOA 3RIHA 3I8SA 2PBZA 3DZCA 3NDPA 1C3XA 2CUNA 2A9VA 3D0RA 5EJGA 5KUTA 5MN6A 5HRCA 1ZR4A 1FXWF 1BOOA 3V9PA 4DRXB 3EFEA 2Q1XA 3GLGE 1QBKC 1CY1A 3M3HA 3OOHA 1KO5A 2BBOA 4QYIB 4GYJA 4BYGA 1T5HX 3PD1A 1JIUA 2ZE6A 1OF1A 1NX6A 3EQZA 3U4GA 3DO5A 3QVXA 3P2KA 1R7RA 4BNJA 2AFIB 3GNQA 3GVPA 4TV9A 2HUPA 1BEEA 1BOFA 1ZNYA 2IOFK 4DDVA 2N3ZA 1XCGB 3MD9A 5H81A 4L5JA 4Z0NA 1ZK0A 3H4VA 2AE2A 1E1CA 4L73A 4XWWA 2BFOA 2XB8A 2XYRA 2ECQA 4HH3C 1R74A 3ZK8A 1KNXA 4BUZA 1E99A 1T6XA 1E0KA 3I23A 3EE6A 2NUPA 1C80A 4HPWA 2FSUA 4PIPA 1YZTA 4WW0A 4D9HA 1Z88A 3IBGA 1IOVA 1VIMA 5DBIA 1U0RA 1U2SA 1UP4A 2NQ2C 1A8HA 3G5AA 4FWBA 4GX1A 4MP8A 4PZPA 3ZZUA 4H0CA 1I14A 5I4IA 3P0HA 2OO5A 4LXYA 5K0NA 4XUGB 3V55A 3X1YA 4CUZA 3DL2A 2DCUA 3A11A 3LZDA 2FFJA 3RPEA 4JENA 3H2GA 3AFNA 2HJSA 3ISVA 4DKJA 4PZYA 3TS1A 1WMAA 3WZLA 1DQSA 3U5ZB 2OO7A 3DWEX 1DEAA 3CLSD 2I2AA 2NTNA 2CL5A 3FTCA 1H2AS 3MJTA 4KG7A 1Z4JA 4HYTA 1U3FA 3OX2A 2W98A 4C7OB 2MINB 1KYIA 4DA4A 5CCEA 5JH7B 3TLZA 5FEUA 3CH4B 1EHIA 1HSZA 1CQPA 1DAIA 3SKXA 4DQVA 5KC8A 2C2ZA 1GPLA 1Q11A 2VBGA 4NTZA 4ZICA 1PEYA 4HYQA 2HRDA 2ZJ3A 3D6HA 4AY3A 2WU3A 2CMKA 2Q5IA 3P9KA 1M1YA 1VBMA 2EARA 2G9QA 4RQBA 1KOGA 5TQVA 4EYGA 4Y2YA 1RACA 1FS4A 1NLZA 1NYQA 1WP9A 4ABYA 4QXMA 4ZQIA 4TKVA 1R18A 1Z39A 2ZFUA 3DZDA 2JAPA 4V3CA 4ZQEA 3RU9A 3STHA 4F86A 2YN2A 2O19A 2J5QA 3TB6A 3KTOA 2B82A 2E49A 3DE2X 3OLZA 4M8SA 4O2AF 2RKOA 4P0TA 2MYPA 3MELA 4UUPA 2BMJA 2LTAA 2PRJA 1UMBA 2BTOA 5DGTA 4DIFA 2FZ4A 2H52A 2QIOA 3LUKA 3TM5A 2O5RA 1MX3A 2VYVA 1CDEA 3E61A 1TC2A 3BA6A 2B7BA 5J2UB 1CR2A 3EMKA 2A5GA 4XPIB 4KP7A 3V48A 3CZMA 2A7XA 2Y1WA 4KPYA 3MTGA 2B78A 1JQ5A 4AURA 1VSQA 1ZJ6A 1AUQA 2WPDA 4M1MA 3BSFA 2O8BB 1DXHA 1UANA 1L5ZA 3BDAA 1PT9A 5EE5B 1G8KA 3PVZA 1CEQA 1UIRA 4YAFA 3T3EA 4AMZA 5IS2A 2GEFA 5FAKA 2WJ6A 1DIRA 4N0EA 2OECA 3EPPA 1Z5VA 1EEHA 1RMQA 2EP7A 4O2BF 1KZ9A 1TIKA 2PGXA 3ZZ0A 4GXTA 1BDHA 1R0BA 3R3ZA 4B4UA 5FBHA 4EEZA 3U3RA 1X1TA 3NOVA 1XLTC 1OXKB 1CUXA 1Z38A 4CQMA 3RUHA 1GQ2A 3SYNA 4KOEC 2O0HA 2A9PA 4D43A 1L4EA 4X8MA 4QDZA 4EYEA 1YHZA 4MOWA 5CCDA 2V6FA 3KSZO 3OQHA 3P5SA 4I55A 4TMXA 5TSDA 3WV5A 2ZXEA 1UFVA 4HUQB 4E51A 3OZSA 2QM7A 3BAFA 3PYLA 1ES9A 1D0VA 3JQQA 2D59A 4Z4HA 2QOEA 5CTAA 5IH3A 4DS3A 2P5YA 1FNNA 1UXJA 1WR8A 3IT1A 2J6HA 1SBTA 1CE8A 4KBFA 1POWA 4O59O 3TW6A 4FE3A 1GKLA 1IB0A 4DLBA 5KWJA 5LYJB 1WQ3A 3NHPA 4KB5A 2I8CA 3BA1A 3K6SB 4TT3D 1XTZA 1XZEA 2DFDA 2WYOA 4C3UA 2BISA 2OWEA 2HSGA 3FFWA 4OSPA 3AF1A 3PUVA 1M5UA 4F3TA 5F5LA 3UUWA 2O8EA 4LWZA 5JAHA 1OFTA 3DL7A 5F5NA 1G21A 3SYLA 2WJIA 2XZPA 2NZ8A 1E59A 3ICVA 1ISSA 1IVNA 2FLWA 2MSKA 3CGWA 3G2NA 5LQAA 2RGRA 4D8WA 1LPNA 2ZUVA 4OY3A 5E38A 1F2TA 2M98A 1QDEA 4WCFC 1G3IA 5DCUA 5AW7A 3L49A 4PRLA 5DXFA 5AR1A 5T4HA 3DHNA 1UBLS 4HMQA 1C8BA 3GUYA 4YPVA 2IS4A 1ZX1A 1A8UA 5JVDA 1G5QA 4BMVA 4B75A 4D5EA 4QEDA 1Z37A 2BZSA 3V7YA 4QBTA 3LGSA 2JJQA 5E0KB 3GVHA 2B8JA 1EVJA 1LSOA 2CNLA 1CRQA 1G291 1KEZA 2HA2A 2NSDA 2HJGA 2CFOA 2JGFA 4FMBB 2FV8A 4FW9A 1QIFA 3TBKA 3SHOA 2AV6A 1PKEA 4E5PA 3ZE7A 2PSFA 1MGPA 2IEYA 3TECE 3B1FA 4OUDB 5LBTA 3ZE8A 5B1EA 4X7PA 4A92A 1FRNA 3VPCA 1EYZA 2ZIXB 4MVJE 3PQFA 5IWAB 5MN4A 4X65B 2RBEA 4LZLA 5EJ4A 1F5NA 3F4LA 2BP7A 1CUDA 3A05A 2FTKE 3NCHA 1UP6A 4MPPA 1U7TA 3T7AA 1DXOA 2A9FA 3HL0A 1ORWA 2YWEA 2X40A 4O1IA 3WL6A 5LQNA 5BR1A 1Z62A 3NBUA 5TMBA 3WXBA 5KOJA 4X61A 4UPEA 3LWNA 3FPAA 1OREA 3RYIB 3Q3GE 4MYUA 4JUCA 3CZQA 1RC1A 3ND5A 3PC4A 4TMKA 6NULA 4JSYA 2O0KA 3R7WB 3QOFA 4EGQA 4Q39A 2LGJA 3DZFA 3LVRE 3UAXA 4X6LA 2V4ZA 3D4NA 2Q5QA 3ASUA 1D4FA 5F9FA 1YU9A 5K0CA 3P9NA 4RMHA 3OFVA 2VQDA 4ISCA 2I5PO 1SCKA 3WVNA 3NDBB 2XX3A 3FI9A 2RJ3A 3W9YA 3ZGOA 4NH0A 5THQA 1AS2A 3QPCA 3AOGA 4KXXA 1B3BA 3CH6A 4MPRA 4B8ZA 1KA9H 1E1KA 4RESA 2RHLA 3C8HA 5A1JA 5IABA 4X24A 1DOAA 4FNMA 4L0DA 2N46A 2AXNA 4QFMA 5I51A 1PJQA 1WIWA 4IYRA 4R1OA 5EKSA 3LS2A 3TRFA 2FSIA 2RFLA 5JHGB 1MC8A 1PT8A 1GUAA 1NBME 4LNAA 3JQ9C 2C5BA 5IDQA 5AI9A 5BQ5A 2YVKA 3Q11A 4CGYA 2IDKA 4MKRA 3VSCA 4TZ6A 1FTWA 1DE0A 2KI5A 2YIJA 3OF5A 5DGHA 3MEQA 5I3ZA 3PUHA 2R97A 1R0KA 2HLPA 4HATA 4GYKA 2WY2D 2Y1GA 1RD4A 1Z6PA 2ZYHA 5B6PA 3GLSA 5EHZA 2FW0A 1Q0HA 5DLEA 1GNSA 3ASYA 1TKBA 3T7TA 2ZSJA 2VHZA 2WQ6A 1AUOA 4JYPA 4A8PA 4ZCMA 5L4LA 4G0UA 1E0JA 1ESNA 4FN5A 2WM9B 3TQOA 1GQYA 5EP4A 4X44A 4IDGA 1F0PA 5CAEB 3O92A 3PRYA 3QLTA 4F45A 3BRWD 3WYEA 2Q1TA 1KDPA 5A0VA 1FLDA 3CPEA 2KBEA 1TADA 1NJ5A 3FNQA 1JB9A 1F48A 3H5WA 4UEOA 4HNTA 3DQPA 1QB8A 3ZCQA 3V7WA 2Q29A 2FSGA 3RAPR 1QWSA 2IZ5A 4C2UA 3JZAA 3PUZA 4WKOA 5CB0A 4D4KA 4JJZA 4PV7A 3VU0A 4YWHA 3OFSA 3TFOA 1QOPB 4Z86A 5A02A 4WXYB 2O6HA 4TTVA 3WKBA 2BTQA 2OFFA 4E5KA 2FSPA 2BFEB 3QA9A 5JSQA 2RGGA 3DEZA 3LQ2A 4ZOLA 2DJ5A 2YZ7A 4MR7A 3PRHA 3ZDBA 2MYNA 1QCYA 3ZNOA 2EQ5A 3GA0A 3JQCA 4LXQA 1XDZA 3DEFA 4HCJA 1Y6QA 1XVAA 2FRXA 1W5SA 2CE2X 2OD2A 3L8GA 1A8QA 1O6BA 1RFLA 2CD9A 3PVCA 4Y2VA 3JWJA 3WO0A 4Z3OA 3OQMA 3UMYA 3OLCX 2QQEA 3IBTA 3NBFA 4GGMX 4PN7A 1YACA 3CZPA 5DGIA 1MBZA 2JJ1D 5CB8A 1G8SA 2AA3A 2Z58A 3W0LB 1E7QA 3B6EA 3EBPA 3HH8A 2JGMA 3A1DA 5B6IA 4F2DA 1ORTA 5EESA 2QX4A 4LGCA 3JVIA 4RY0A 5L7WA 4EMTA 1C4KA 1J2EA 4F6RA 4UBLA 3R75A 1QRAA 4QJ5A 5BQPA 3S1AA 5F3RA 3T35A 3OCVA 4EQ6B 2P1DA 1W36B 2HD4A 3I12A 3R9XA 1V9CA 2QTVA 2VJPA 1VKNA 1XQYA 4J0IA 4R98A 2X4LA 1TUIA 2J7PA 4CIXA 2AFIA 1H05A 1TYDE 2B37A 3E3LA 4MDHA 1AQUA 1YRLA 4MV3A 2O54A 4RPCA 1OKKD 5TV2A 2F9LA 3OEHD 4BNUA 3B53X 2ZYGA 2C7VA 4G0WA 1UPXA 3B9BA 3GJ6A 1XZNA 1H2ZA 4N7BA 5FULA 1O77A 1XJCA 5FA8A 1NUHA 3DLPX 3I2YX 1GZVA 1P1RA 1XZBA 2MT9A 3LQ1A 3QX9A 4OH1A 5ALJA 5F2KA 5LZ5A 1F3OA 1FLNA 4JBXA 2A8YA 4M36A 3TMKA 2FN3A 1AXGA 1RQXA 3NNSA 5J5AA 3B3QA 3UJHA 4D8XA 2Q5HA 3GFSA 5CR9A 4FGJA 4HAUA 1LLFA 4WKCA 5LQMA 2M2IA 2AYZA 2QSZA 4FOLA 5B4TA 1B2LA 3DZJA 1YA8A 4RJKA 3BG5A 1BXGB 1U1FA 4ME6A 2QUHA 1OKKA 5DGDA 5K4GA 4UNQA 1QOQB 1GZ6A 3TOZA 4B9EA 4BNWA 1P0CA 4D0NA 1XEAA 3Q7TA 3PXBA 5A5VA 3NBMA 1A4RA 5HK8A 3PGVA 1FLVA 2W8ZA 1HE2A 3HJUA 3O8RA 5AVXA 3A9VA 3E9ZA 4B3CA 2XEXA 2CF5A 1JDVA 2GEJA 2V3VA 3MILA 1BMTA 3OJCA 2BW0A 3TLJA 3OBBA 2GVZC 4KR6A 1Z0JA 3U7GA 5CDTA 1C7EA 2GYWA 2OC4A 3AF2A 1BHJA 1WPXA 2ODTX 1EGHA 1MQAA 1O94D 4V24A 1S4MA 1SUIA 1ZZEA 4MULA 3BH0A 3M5WA 1HF3A 5LP1A 3JVEA 2PBFA 1CE8B 1EK0A 1YASA 4LYGA 4QUIA 4E46A 2C58A 4F2GA 2ZVPX 3DFMA 4OA5A 1T8TA 2RGUA 2H6EA 2ZYVX 1LBEA 3IQXA 2ZROA 5DLQC 4KPFC 4CCWA 1QG4A 1S2NA 4CMGA 2W83A 2Z0MA 1A9XA 4HUQA 1U7WA 2JD2A 3O95A 1KZHA 4FDUA 4EFKA 1JEQB 3IPYA 3OZDA 5AKYA 1URPA 4J0HA 5I9IA 4R7GA 4Q1VA 3W04A 3L6OO 5KAMA 1I7NA 1JXOA 4NI5A 2OBYA 4JSTA 2VZLA 3JAKB 3V1LA 3LBAA 1PX0A 1N8TA 1D2CA 4LYAA 4QXAA 4HVTA 1M76A 1DIHA 2ANBA 3K6JA 5TS2A 3B1JA 4KQCA 5DN9A 4N6OA 5AWFC 1TIBA 2IV7A 2ZXFA 2IUYA 4DIOA 4MWTA 4C04A 3K20A 3MGCA 4KX5A 3RAJA 1SVOA 3ZCSA 4XWOA 4P1ZA 3VR3A 4QDUA 4MI6A 3TUIC 2R86A 3VO2A 4C14A 3T6KA 2O8BA 2XUHA 3AILA 2ZYIA 4EDFA 1CFJA 3GLIB 4U8HA 4RZIA 3I04A 4RD3A 1G63A 4QM7A 1NIPA 2Y1XA 1YFJA 3U5TA 2PKQP 1P4HA 4XPIA 4CF5A 1LPBB 2YJ6A 1K88A 4L2IA 3GMTA 3M6XA 1D0IA 2AZTA 3ELUA 1MAWA 1DAOA 1UT8A 4MZXA 4YJ3B 4A73A 3U7FB 2O59A 1YK1A 4M0DA 1BW9A 3I2GA 5A4AA 5IKPA 3AZOA 3T95A 2P8SA 3CU5A 3FZNA 4KPEC 1ODJA 1CDDA 3EULA 5BVGA 3DH0A 4K9MA 5D5PA 3I9MA 3VUFA 2C00A 4B6GA 5JR3A 3QJGA 2NNLD 3C8MA 1A5SB 1K92A 2CFIA 5FB3A 5IULC 5LP6B 5DX8A 1UBCA 2PMKA 4EECA 1Y4UA 4OF4A 2PL9A 3BWMA 4N0MA 4C3OB 5TQJA 3KZOA 3REFA 3RTBA 4CL8A 1LSJA 1RQNA 3KQPA 1W34A 3OTIA 2PAFA 1L1RA 3A04A 3LKZA 3P9CA 4WXRA 4PSDA 1PQWA 1UBGA 4L27A 3RVSA 4EFDA 2V0CA 2XA1A 3VR5D 2D3TA 2O2IA 3AF3A 2H16A 2H0RA 3TTYA 3X1MA 2B3DA 1C2TA 2HNKA 3KWMA 1JZSA 2B5VA 4Y2XA 1JHAA 1RI3A 5BQ3A 1F12A 2OZLA 2XDAA 5H0IA 3R09A 1YDEA 3CF6R 2R6GA 1J6UA 2ZT8A 3W9BA 4WH0A 5J23A 1Q0ZA 3WZ2A 3NB0A 1KJWA 1IZYA 4DY6A 3PVSA 3WYBA 1QTQA 3T1QA 1RWPA 1CRPA 3FFBA 1E2UA 2Z8ZA 3UA3A 1OI7A 3B1ZA 1BCSA 4D97A 3ZN2A 1EUYA 1QK4A 2H4JA 1WBDA 5AHWA 3HO1A 4FILA 2EIHA 4LDNA 1WABA 3HLKA 2ZANA 3FDZB 4IIVA 2A0WA 4MLZA 3C85A 4MRPA 4W1RA 4BCBA 1GLNA 3GJTA 4OV6B 4ACBA 3I6MA 4AO6A 1C0PA 2Y92A 1TRKA 2ODWA 2PV7A 2CEKA 2O7VA 3T12A 3UAGA 3ZCVA 1RZRD 1E3LA 1QP4A 3O1JC 3MBKA 2DMRA 1DHTA 2I4RA 2Q3EA 4JB2A 2GSWA 4M53A 1M8JA 1ZCJA 2YOHA 3GUVA 3NYRA 1TVMA 3I34X 2GPYA 4KKVA 4RKWA 3HDQA 1W44A 3L4BC 4B45A 4DNPA 3UMBA 1NVWQ 3ZCUA 3BC1A 3ENWA 3GBPA 4JOCA 2R11A 4BBJA 4C7JA 1IE3A 2D1SA 3OJFA 2QF7A 1L4HA 3W1WA 4BP1A 4N54A 1KI4A 1G20A 3H2ZA 4ZQFA 4AC9A 2NO7A 721PA 1Q3KA 4MO2A 1ZGZA 1GZHB 1L5NA 2H08A 3F97A 3HFSA 4HDKA 1Z4KA 2GEVA 4LX0A 1Z7YA 5CURA 1XKQA 4RANA 4GZLA 2HQSA 3A4VA 3OWOA 2QM0A 3TOSA 5CG1A 4AS1A 3H5LA 3F8SA 3HP7A 4JH0A 5EN4A 4BNKA 2WHXA 4MQFA 4X91A 1E5TA 4B5LA 2NO9A 4F97A 3DNFA 4RA6B 3I52A 5CDUA 1Q15A 2BOVA 2J07A 3PLNA 4BRWA 1N0VC 5BRAA 1PL0A 5ICCA 4Q9DA 1ODSA 1E94E 3N8GA 5E1OA 3Q7RA 3I30X 3M89A 1RP1A 2IYSA 1IVYA 3DEJA 3B2NA 3JQ9A 4LEIA 3A1EA 1YZFA 3IEXA 1YC2A 5FAXA 2CN1A 3P4XA 4BO0A 4DNXA 4F9GA 2C4TA 4GD3Q 3W7AA 1XDDA 5AM3A 2VWHA 2EJVA 2W2VA 4CKWA 5KYWB 4ABTA 4QEZA 2ARKA 2CDNA 3ZX5A 5B7NA 2NUAA 2VSQA 4B32A 2J6IA 4M8NE 2BFFA 2W37A 4R2JA 1I6MA 2WFZA 3NETA 2QY6A 3TM4A 4ZEOA 1UEXC 2FE4A 2P6OA 2HREA 2QYTA 1Y98A 5AM4A 1SZDA 4Q9LA 1Z6GA 5HFJA 4OXYA 4B3DA 1TZMA 3KKEA 3OA2A 3NVKI 1P5HA 3JPWA 1ZHFA 1TK9A 1D0SA 4K05A 4OJYA 4TWZA 1VYVA 2IY8A 5KVQA 4LWPA 5DNVA 3MPUA 3DLTA 1YULA 5EXTA 5F1YA 3WV4A 2B1GA 2PR7A 4JVMA 4QOIA 2O8CA 5KYKA 3ZY5A 1ZM7A 3Q9SA 3QBTA 4JP1A 3H87A 1EFUA 5IWCA 4ZTUB 1NBMD 2G6TA 2UAGA 4DSAA 2D5BA 1H2EA 3JQBA 3LMKA 4ZANA 4YROA 5C7OO 2P2NA 3TEMA 4HYEA 1W0JD 4AUKA 2VNJA 2H85A 4KMOA 3W3ZB 1Q2UA 1B76A 4P93A 3ANSA 2X0FA 3A6LA 5HJEA 3ICWA 4BO4A 4QQFA 1CFZA 3PGXA 4G4SP 1C2YA 1EQAA 4KLCA 3WNVA 1XTRA 4R8SA 4AKTA 3OEEA 3HMKA 4RXTA 5AW1A