1UEJA

Crystal structure of human uridine-cytidine kinase 2 complexed with a substrate, cytidine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
211
structure length
205
Chain Sequence
EPFLIGVSGGTASGKSSVCAKIVQLLGQQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine-cytidine kinase 2
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 205
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1uejA00
5J4VA 1CEEA 2J7PD 2CVHA 2NQ2C 1UEIA 1OFUX 1E9CA 5EXXA 1DG1G 4GDFA 4P4SB 3GJXC 5DHFA 3VU9A 1FQJA 1KGDA 1KO5A 3ZZ0A 1ZD1A 2QAGC 3EW9A 2ZTSA 1MO3A 4NONA 2C5LA 4IFEA 4JSYA 4JL5A 1KSGA 1TQ4A 3Q7PA 3IEVA 5TXGA 1ZM7A 4Q1DA 1V43A 4MRSA 2RGCA 3ZGXA 3PUXA 2ZYUX 1VYUA 2ZI3A 4FW9A 1FX0A 1B23P 3EPHA 2ZRBA 1GITA 5J4YA 1E2KA 1A4RA 4PPGA 1UBGA 2ORVA 2GK6A 4PXAA 2R44A 4QGGA 3C14C 3KXIA 2C99A 3AP2A 3CW2A 1Z22A 4C30A 1MH1A 1T91A 5B58C 5IK2D 1X8KA 5EXPA 3W8NA 1Z06A 1R5BA 3AM1A 2KBFA 2GXUA 1ELOA 2O0KA 5JWHA 2QGNA 2YNMA 1N6LA 1NN5A 3LQRA 1Z0DA 3LH5A 4NE2A 1XMVA 2HT6A 2ZVQX 4FINA 2P5TB 3PR1A 4DLSA 1KJWA 2HJVA 1J2JA 1SVOA 1VIAA 4MDEA 4MRNA 3G0HA 2DY1A 3AVTA 4Q7MB 1P5ZB 1M34E 1NKTA 1G7SA 3EPLA 1N25A 1M6NA 1X1SA 1G5PA 2QM8A 3DKVA 2MSDB 1R5NA 2A78A 1XTJA 2WWGA 2NIPA 3TH5A 1BMFD 2QPTA 4MGYR 4M53A 2QQEA 3REGA 3CNOA 4ILEA 4KHZA 1S0UA 2UKDA 1JNYA 1H8HD 3WY9A 3O8DA 2ZETA 1OXTA 3QNUA 2AKAB 4B6FA 2P5SA 1XZQA 4LHYA 3KUDA 1ESNA 5E7IA 2ZJBA 3U3RA 2J7PA 5C2JB 3PXGA 1TL7C 2IA5A 4R2HA 1P2TA 2GAOA 1N5KA 1AGRA 1ZW6A 5TVKA 4DHEA 2CHQA 3NXSA 4LBVA 1RRFA 1DAGA 5KNDA 4BRUA 4D25A 1KI6A 4IOLA 5EE0A 4OHVA 5SZJA 4ZPXA 3U3KA 2ZRPA 3NHAA 1AIPA 1GP2A 3VQTA 1IJEA 3H0KA 4G5SA 3T1QA 3L0OA 4M2LA 1XMIA 4ARZA 1N3BA 1XFAA 4LX0A 1G18A 3FOZA 4ZIRB 1EX6A 4TTPA 3TSWA 3P20A 1US8B 4HZUA 1NN0A 1TX4B 1E2IA 621PA 1Z0KA 1ZCAA 2ZRNA 4KYUA 3QVUA 2QE7D 1RYHA 2B6HA 2ATVA 4BFYA 2ZI7A 2GTPA 2W0MA 5IK2A 4XIGS 4ZV4A 1UFQA 4Q7KA 4HUQA 3BXZA 1G8HA 1KDRA 4QOSA 1FP7A 4DBLC 2A3RA 4QL3A 1ZINA 4DT1B 1U8AA 1ZIPA 2GCOA 1HYQA 2GETA 2ZRMA 4HZUB 1N6OA 2P0EA 3PEVA 3QXHA 4NKRA 3B6EA 5CK4A 4BLSA 4ZDJA 3AUYA 4OK6A 5KU1A 1UAAA 3K70B 4E22A 2EFDB 1HTWA 1RIFA 3AGQA 5AJXA 3SJBA 2GBLC 3FGNA 4U02A 4CRWB 3CX8A 4LJ6A 3ICQB 2RHMA 4HUQB 1E9RA 1P9WA 2WJJA 4PFSA 3HU1A 1CS4C 4UNNA 4W9MC 1OKKD 1BMFA 4QG7A 2ERXA 4M21A 1RJ9A 3W3AA 2VF7A 2UZIR 3A6PC 3MJRA 4OI2A 1H8HA 1BKDR 1YKSA 4URUR 3A1SA 5D3MA 4ASUD 5D3QA 1HT2E 3FVQA 4P3YA 5FPKA 5C46F 1ZIOA 3SZRA 1T5LA 4JVMA 3LW8A 4JZKA 4N0EA 5CJ2A 5J4KA 3A1VA 3LD9A 4QFMA 3TNFA 4DDUA 3B13B 4PX9A 3QEOA 4V0NA 4TN1A 4C0QC 3I8XA 4I1VA 3QVVA 5D3MB 4IEIA 2I1QA 2XAUA 3EWSA 3U5ZB 4KI0A 4PHTA 4BGDA 3OIYA 4EUNA 2LKDA 2ZAMA 3NEYA 1U9IA 4CEJA 4W5JA 1SZPA 1YR8A 4AKGA 1W44A 3HP1A 3QKSB 1G3IA 2IYZA 5JHHB 1OHHD 2F6RA 4LJ4A 1FL9A 3HU3A 1IN7A 1KDTA 2LKCA 2QE7A 4ZDIA 1TQ6A 2ZREA 4KSCA 5EZ5A 2NZJA 2VYFA 3VKWA 3OHMA 2ASEA 1E98A 1GG2A 1W46A 2NG1A 3N2IA 3ND9A 2KBEA 1DE0A 3AKDA 4BFTA 1OFIA 1G8FA 1S1MA 2JJ1D 4FMBB 1OF1A 2JCSA 2IW3A 3CX6A 4A9AA 1NLYA 2QROA 5CYPA 3SS8A 1D9ZA 3LLUA 2V55B 2V7QD 3KQNA 3U7EB 2H1LA 1TF7A 1ZM4A 5DYGA 4KFSA 1CRQA 3L0IB 1WCV1 1E2QA 3PEWA 3OE7D 2OCYC 3BE4A 4WAUA 3Q85A 1SHKA 3W6PA 5FPTA 4A2WA 5DGXA 1OKKA 3VR6A 4IDHA 3CWZA 1E96A 3GMTA 4HYYA 5L3SA 4WA7A 2HEIA 1NF3A 1FFHA 3B1ZA 3SBEA 3KQLA 2QTHA 4C2TA 1JBKA 4O3MA 4PSAA 2HF8A 4IKEA 1N6KA 4S2EA 3RABA 2F9LA 4ASUA 2EWVA 4DEYA 2MMGA 2BBTA 4GP6A 3PJRA 5E4FA 1W0KA 1W5TA 2FEOA 1E6CA 2GILA 3DDCA 2NO9A 3IPYA 3K0FA 4Q4AA 4W5HA 5F3WB 1NVXQ 1E0KA 2P6UA 2B8WA 3AP1A 5TB5A 3KXLA 1EX7A 3BRWD 2EVWX 5DISB 3ADBA 1U8YA 1FUKA 4QRHA 4RD1A 1ZRHA 2REOA 3QF4B 4DLUA 4O2RA 2C9OA 1OB5A 4TLAA 1SVMA 3B2EA 4QXAA 4IOKA 2IS1A 5JCPA 1NJGA 1OW3B 3QKTA 3O8RA 2QMHA 2B7BA 4RD3A 4QNMA 1RRPA 2ZI5A 2IYRA 3OZXA 1IONA 1OHHA 3MFYA 1ZP6A 5F98A 4HB4A 3U3OA 2DPXA 3WHKA 3RS2A 1VECA 2QI9C 4DUGD 1SKYB 3AVOA 1W49A 2CL7X 3EG5A 1JQLB 3KTAB 3UK6A 4GZLA 1KZGB 4B3CA 2XNSA 2R9VA 3K0EA 4YONB 2JA1A 2BC9A 3I5XA 2JJ1A 4FXPA 2IYQA 3E2IA 4PO1A 1OH8A 4LJ8A 3UWOA 4HATA 3ZQ6A 4PC2A 1TAGA 1KY2A 1KK3A 4URZR 2V7QA 5H70A 2GCNA 3TUZC 4HAZA 3AF4A 4PAQA 4BZPA 1ZD9A 4DWJA 1OXSC 3GJ3A 3SFZA 1LF0A 3TJZA 3C41J 4K8OA 4QHSA 4EPYA 1OSNA 1FP6A 3BB3A 4FMDF 4A2QA 2CHVA 3SYLA 2V6IA 1Z29A 2O0JA 2VRWA 2ZRDA 3CRMA 1VTKA 1JQJC 3B1WA 3G82C 1W2GA 4EJSA 1FUUA 2OFWA 2QA5A 4DLRA 2H16A 3K0CC 3DVLA 1GKIA 3FKQA 4IXNA 1XEWX 4Q48A 4Z51A 4JJZA 4G5RA 3HR8A 1UDWA 3X1DA 2ZRHA 2YWFA 1ZMXA 1WB9A 3CPJB 2H57A 4URWR 3WXMA 5HZHA 3E5HA 5DN6D 3QPVA 2YWEA 4DEXA 4CDGA 3EIEA 1YRBA 2OEPA 2P6NA 5FH9A 1Z8FA 3TMKA 5SZHB 2K5UA 3PVSA 3QQ5A 2G88A 3QKRB 5A0FA 1EESA 2DFTA 4A0FA 5KYKA 4GT1A 3IHWA 3PCRB 4XWOA 3AVQA 2FEMA 4KO8A 3I5YA 3CPHA 1XDBA 1GIAA 3Q3JB 4JSTA 4UKDA 3FE2A 3UG6A 1GNPA 4A8JC 4DUGA 4B74A 4LHZA 2IUUA 2RGNC 1EWRA 4A6PA 1M2OB 3JVUA 4H1UA 3AF3A 4LDJA 4NCJA 3BWDD 4PHHA 4HAYA 2J3EA 1X3SA 2NPIA 5C4MA 4GL2A 4CYMA 1BIFA 1NLFA 1Q1BA 2P2LA 5KTYA 1IN5A 1ZU4A 3RRZA 4G3XA 4PAOA 2OXCA 1NN1A 2OAP1 4K46A 4URXR 2EW1A 4IDQA 2C03A 1PUIA 1ODFA 4TMKA 4JMPA 1QHSA 1II0A 2IUSA 4NCNA 5JLJA 2PMKA 5BWMA 4LHVA 4GRAA 1F2UA 3D7MA 4DJTA 1A2KC 2IS2A 1JR3D 5EQTA 5KDLA 5FI0B 2IC5A 3PG5A 4R7ZA 2Q9AA 4YDSA 3TLXA 5GADl 2V3CC 1EFTA 1MO4A 3CLVA 1QG2A 1TU3A 4WOPA 3IIKA 4MDFA 1U81A 2MMCA 3CPEA 1HQYE 1WDTA 3BH0A 4D0LB 1CULC 2A5YB 3ICEA 4A0HA 1TQDA 1NIJA 1TF5A 1XD2B 3W9YA 2EYUA 1F2UB 5K8UA 1MRSA 1RVDA 3A4MA 3QG5A 2FSHA 2FOLA 2JEOA 2BVNA 1PLJA 2PEZA 2H7VA 4NMMA 5CIWA 2Q3HA 2W2TA 5DE3A 2X2EA 4AI6A 2ODEA 4TLCA 4QM7A 4EQ6B 1PVOA 4ZCMA 2W83A 1UKEA 3KKPA 5DN6A 2RGGA 4I81A 1TEXA 3CRQA 4P4TA 1L2TA 4D4LA 3EA0A 4GP7A 4F4IA 4POAA 1CBUA 2BM1A 2O0HA 1AZTA 4JS0A 4JLKA 3E1SA 1NMZA 4MRVA 4MKGA 1GDDA 1I4TD 3KZ1E 2C8VA 5EXSA 2ZRCA 4TQAA 1KIMA 3IHLA 2FPLA 2GXQA 3DMNA 3LVRE 2CK3D 1DBSA 3IO3A 5F9FA 3MD0A 4M9QA 1M8PA 1IN6A 1JJ7A 5DI9A 5FBWB 2C77A 3B1XA 1RW4A 2FNAA 2IF2A 4QGHA 2C2HA 1S4QA 4DCNA 1QHXA 2YC4C 3REFA 1Z5ZA 2BEJA 2G6BA 4HZIA 5EUQB 1JAIA 3SHWA 3O47A 5FUXA 4MQBA 1G41A 1EFCA 3LAWA 2IS6A 1TUIA 2FFHA 4C0AC 1LY1A 1CJUC 5LD2C 4US2R 1GL7A 4B48A 1L4YA 5TDHA 2HXYA 3DMDA 2QAGA 2RGDA 1G8PA 3BS4A 3MCAA 1Q22A 3N70A 4IOJA 4X8LA 2GAAA 3T12A 3FWYA 4UNPA 2IXEA 5DIFA 3H2YA 3N5CA 1E79D 2PT7A 1E1RD 2GWHA 1Q0UA 5FTNA 3RS5A 3X1YA 1G3UA 1G3RA 1XPRA 3IKJA 1LTQA 2D62A 3K9LA 3B7GA 2XZPA 2ZYTX 4ITRC 5FOUA 2W2VA 2JJ8A 4ZI2A 1GVNB 4QC2A 1QVAA 4TYPA 4PPFA 1J8YF 1JEDA 1JALA 4QHTA 2ODBA 1KO4A 2ZS7A 3KKQA 5CLLA 3UG7A 3I62A 4HB2A 1DAKA 1LS1A 2KB0A 4YC7A 2ZSDA 3WRYC 3B9PA 3WNCA 4DLZA 2V1UA 1E9SA 1HQCA 1E9AA 3M6AA 4ESVA 3V4RA 1W47A 1GRNA 3VR5A 1T8TA 5DNYB 4D0NA 1KK2A 1RZ3A 2JIZD 3A4NA 4WZAE 2NO1A 3A1UA 3CBQA 4G0NA 1IAQA 1YE8A 1UBCA 2G0NA 3C15C 2QNRA 5KPDA 2XX3A 3K0AA 5FUYA 3MGCA 2VP2A 4LYHA 1JR6A 1QHHA 2ZE8A 4EPVA 1NG1A 1UBEA 1W36B 4Q5IA 1CR0A 2EFGA 1KK1A 2CK3A 2N1BA 1J7KA 2DWPA 2BBSA 5GJBA 2CLSA 4TLDA 5IDVA 1RYFA 4LV8B 2O8EA 4LBZA 4Z8XA 4AYXA 1E0AA 5SZIA 4UJ5A 2O8CA 3VFDA 1N6HA 2AK2A 4AY2A 4A6XA 1QHHB 1NG9A 4IW3B 4I1OA 1HEIA 3U3JA 1H65A 4G01B 2GEVA 3RSLA 2XOKA 4TMZA 4Q4HA 1OE0A 2WJGA 4PO9A 5CM9C 3ZQJA 3FHOA 1DAFA 1SHZA 3DM5A 3EZ9A 2IT1A 4WXRA 3NKVA 2O8EB 3MAAC 2FWRA 2JASA 2G1JA 2JGNA 1E79A 2MSEB 2PCLA 1JECA 2ZUBA 3GJ8A 4XSGA 3QG1A 4AK9A 2O8CB 4JYBA 2KWIA 3Q5DA 5KUTA 4JLBA 5LPNA 1KYIA 3UMRA 1VYTA 2R2AA 1OYYA 4A4DA 4EIWA 1J90A 4HLQB 2I1VB 3QPUA 3T35A 2ZSAA 1KHTA 2CLCX 2YYZA 2IBMA 4N3NA 4Q02A 3AH8A 1Z0IA 5AJZA 4C2UA 4D80A 4DSNA 3SC3A 2DCUA 3B78A 5FBLB 2HXSA 4Q9JA 3ECCA 5KOYA 2CE2X 2XTZA 3EC2A 4TSFD 2NTYC 1Q44A 1T6NA 2UZ3A 4ACAA 2D4HA 4GOXA 2IEZA 1VG0B 3RVBA 3S1AB 3ZS9A 4MUAA 5EE3A 5EP3A 3TW8B 5ELXA 3BB4A 3L8YA 4O2LA 1I2DA 4JVSB 2VSOA 2JIZA 1SXJC 1RC8A 4LHWA 3SNHA 2B92A 2QMUA 4DDVA 2P6RA 4UXJA 2V4ZA 1JI0A 1EGAA 1E4VA 2HYDA 1TMKA 3I3SR 2GBLA 3I4LA 2B7CA 1NMYA 1D2EA 2ZYVX 1PLKA 3TIFA 3J81k 3AVXA 1K5DA 1AA9A 1CJKC 2A9KA 3SR0A 2IUTA 3CUEF 1ZNXA 1AS0A 1KKMA 3MMPA 2WOOA 2QG6A 1IN8A 2X19A 3EIQA 3TAUA 1HUQA 1JJVA 3QXCA 5KNBA 1KMQA 3PUZA 5HCIA 3U7GA 4OK5A 4G5GA 4OQMA 3VU9B 4RD0A 5BN3A 4XVRA 4IDNA 1GL9B 1G291 1GILA 1AQYA 3BERA 3MWJA 3PUYA 3W6NA 1QDEA 1BH2A 3AV0B 4F4CA 1IJFA 1WP9A 4JVNA 1XJ0A 2CDNA 2P65A 5H1YA 4KITB 3CWQA 4S35A 2JLVA 3AF0A 2RGEA 3TVTA 1NRJB 2GXSA 3BK7A 3ZJYA 1VG9B 3AVPA 2ZM5A 2FZLA 1FX0B 3H1TA 2D7CA 3FMIA 1R2QA 1YR9A 1COWD 1KTVA 1KNXA 1OV4A 2R6DA 4PC3A 4D82A 2ZE6A 1DO0A 4MA4A 2H8KA 5FPYA 4M22A 2ZAOA 4EAQA 2JLZA 3TVDA 1XPOA 4JVLA 4RKFA 5G41A 4X8OA 1ZC4A 4KJZA 1HY3A 2WPDD 2OAQ1 5EP4A 4Q01A 4JYCA 5CLQA 2WWIA 5JEEA 1A5TA 4L9WA 3I1FA 821PA 5JECA 2JJ2D 4M8NE 1AQUA 1W0JD 3P32A 4DSOA 1C1YA 1NVVR 4B34A 1S8FA 5DH9A 4GBMA 4TSFA 2GZAA 3EXAA 5A5GA 2J0UA 5CIQA 2DBYA 4FCTA 4B3BA 4G5OA 5LB2A 4WZ6A 1Q3HA 1NIPA 3QOFA 2WWWA 3T1OA 1M7HA 4DC9A 3CZPA 1RPZA 2XZLA 1XWIA 4WIAA 2GXAA 5CJPA 2YOFA 3NBFA 2IL1A 3IO5A 1R0XA 3T34A 4B3XA 2ZRLA 1R5OA 2I3BA 5AK0A 2ORIA 4JLMA 2J0UB 1N0WA 2XGJA 1W1WA 1SVWA 3LLMA 4BASA 4MYHA 3QI2A 3WYFA 1W4BA 2WV9A 5HKKD 2FA9A 3RWMB 5L3VA 4US1R 3OEED 5CK5A 2WJYA 3CIOA 3C8UA 1D2MA 2ZJOA 5JS8A 1Y63A 1J99A 5FTKA 1D8TA 1NSFA 4LHXA 3AQ4A 1Z2AA 1ZC3A 1MR3F 8OHMA 1G3MA 1T0HB 5DO9A 1YQTA 2A7QA 1KI6B 2GEUA 2AR7A 1TUEA 2FGKA 2QORA 3V4FA 2CL0X 5F9HA 1J8MF 3GJ4A 5HTKA 4Q9IA 1X86B 4UJ3A 4GMDA 3GCGA 4GPTA 3GLFE 4BFVA 2YINC 4ARZB 2CMKA 1P61B 1M1YE 5AWFC 4Q18A 5FUVA 5BQ5A 1E4YA 1NJFA 2AWNA 4LBWA 1COWA 5HE8A 3Q5EA 3L0PA 4QJ4A 1QG4A 3CNLA 3SQWA 4I99A 1VCNA 1OB2A 1UKVY 2QU8A 4FIDA 1E9DA 5FR1A 3TKLA 3EZ2A 3UKDA 3MSXA 2WPDA 2QPAA 2GCPA 2IYTA 4OHWA 3KJGA 1OLOA 5BN4A 3RS4A 4OI1A 1Z2CA 1C4OA 4R2IA 4OQLA 4LUCA 3B85A 2JJ2A 3KFXA 2QRNA 4LJ7A 3RS3A 1OXXK 1P7CA 1HH4A 1ONBA 5FBQB 2GCOB 4C9BA 1DADA 3U2QA 2FN4A 4DSTA 3LDAA 4CT4B 1OT3A 3IGFA 3RWOA 1IXRC 2GNOA 2RAPA 4EFNA 4DXAA 1B0UA 2QP9X 3AKCA 2XJ4A 4E5UA 4O0MA 5J40A 2EQBA 1CF4A 3A1WA 4XOIA 3RANA 3D31A 1BOFA 4MYTA 2HUPA 4F4JA 4RD2A 3WRXC 4LJAA 2WIBA 4DLTA 2ZXUA 2WTUA 2OT3B 3RRYA 1RJ9B 1P62B 4KAXA 4PHFA 5DYIA 5IRCD 4V0ME 3ZVLA 4B2LA 4QHYA 2HT1A 2BMFA 3A37A 1NBMD 4CW7A 1MRNA 1SXJE 1KY3A 4LYJA 4Q47A 3GLIE 3OEEA 2PMDA 1G7RA 1U0LA 4Q1EA 4XTCS 4B44A 4HB0A 3GEHA 3THWA 2O8DA 1Z47A 2FPMA 2RH5A 4TYQA 4UXHA 2JLRA 1XBTA 3UXMA 4BUJA 5AUPB 2ZRIA 2A5GA 1NL3A 3HWSA 4OBEA 2V54A 3SJZA 1VG8A 4D4MA 2KSQA 1M7GA 1XX6A 3K0CA 2GVDC 1QHGA 2WJIA 2X1VA 4PZZA 1DVRA 4JT2A 4BLRA 4LK2A 2F7SA 1UJ2A 3U3MA 3JVVA 1JR3E 1W4RA 4V0OA 4DLYA 1EWQA 2O8DB 2VSXA 4JLAA 3ZLJA 5EZ6B 4YXWD 1P75A 3FHCB 2VP4A 2BBOA 3SYKA 4CEJB 2W00A 2AL7A 3GLGE 1IOZA 1U94A 4KCGA 4V02A 4DB2A 4KFTA 1YZNA 2W6ID 4WW0A 4RCZA 2GKSA 2OILA 4Q4JA 3K9HA 1E1QD 4B2PA 4EDHA 221PA 3MWYW 5CM8B 2W2XA 4V0KA 1NSTA 4KU4A 1P9RA 4NCIA 3NBYC 5AJWA 3FTQA 2WAXA 2BMDA 1Z0AA 2R6CA 5B2ZA 4UNRA 4C0SA 1U8ZA 1UDXA 5KSPA 5KSZA 4PQYA 2WMOB 2WVJA 1RRGA 4A8JA 1E2LA 4FMCF 5ANRB 2RGNA 4BRWA 1OYWA 2V8OA 1II8A 1OXUA 3R8CA 1H8ED 5G40A 1N6IA 3BFXA 4X8HA 4L16A 4V03A 3FMFA 2GJSA 4GSYA 1F60A 4NCKA 1KSFX 4X8MA 1OXVA 3GJ6A 1WXQA 2RGBA 4MKHA 1NVVQ 3F8TA 3CF0A 3PFIA 3VR3A 1XEWY 1Z6XA 1N5IA 5BW8A 3DPUA 5L3SB 5TY0A 2CJWA 1GSIA 1SVKA 4PZYA 4WBSA 4Q1FA 1II8B 1EFHA 2VF8A 4OL0A 1S2MA 1P9NA 1DARA 4PSKA 3QSYA 1NBMA 3H86A 2AX4A 1GAJA 5BYKA 3CRVA 5TMPA 3ZVNA 1YZLA 4JIMA 4Q4AB 4L9SA 3K0FB 3SJCA 2Z5FA 5AJYA 3ADKA 1BYUA 4JT4A 3TQCA 2VH5R 3NIBA 1O87A 1E94E 1XCPA 1L8QA 2BV3A 1W4AA 4BFSA 3THYA 1UPTA 2WM9B 2XTNA 4TYYA 2CCJA 3O8CA 1ZM9A 2ZR9A 5EJEA 4RSGA 2G77B 4CEHA 2EFEB 1VYVA 3RRMA 3ND8A 3I92A 1Z63A 5HE9A 4EPXA 2WJHA 4LCBA 2OE2A 5KSYA 4YXWA 4HDQB 5JWRA 4TL6A 4U5XA 1P2VA 2FZ4A 2ZJ5A 3THYB 1T3LA 1N6PA 1G4UR 3U6KA 3K9GA 2YV5A 1S3SA 1KNQA 1Z0JA 2W6IA 3B1YA 5B64A 4BFWA 1SGWA 5JZVA 4CEHB 3IBYA 1E1QA 3LQQA 4PPNA 2QZ4A 2PCJA 1SVLA 3EWAA 4TMTA 4DDTA 3A36A 4P31A 5JI3E 1KOFA 4LPSA 2OUKA 1XXHE 4ZDWA 1TPZA 2BWJA 4IDOA 3RC3A 4AYWA 5J5CA 1GL6A 3DZ8A 3SYNA 2WOJA 3WMGA 1LFDB 2DYKA 1AKYA 4HI0E 3OE7A 2OBLA 3DL0A 1XRJA 1KO1A 3CX7A 2BDTA 2BJVA 2PLRA 2QT0A 2RGAA 1UADA 2F1JA 1CP2A 4OK3A 1PJRA 1H8EA 5AUNB 4RKEA 4A36A 2Q3MA 3K1JA 2OO7A 4D4JA 1K6MA 3AEZA 5K8IA 2F43A 4M1KA 5P21A 2VHJA 2PX3A 2NO7A 3QPWA 2VSFA 5JJLA 2ANCA 3VMFA 1XCGB 3WP1B 3U7FB 1ZU5A 4ZO4A 3TUJC 3SFVA 3TSZA 4C7OA 1R6BX 4E09A 1XEXA 2W0SA 3ASYA 4JJKA 2YOGA 3AGPA 2HYIC 1ZCBA 3PUVA 4XTRA 5C1BA 4UQOA 4Q9LA 4EJSB 4M1SA 2KE5A 4BPBA 4HDCA 2QP3A 5HPYB 1L4UA 1YVDA 5LD2B 4D6PA 2ZIAA 1YZTA 2BKEA 2QMOA 4GI7A 1YZQA 3LWNA 1XP8A 2C9YA 4IXMA 4L4UA 1NP6A 3ZZTA 1XEXB 1TADA 3LBIA 2ZSFA 2REXB 4UNQA 3K8YA 3M0EA 1YRAA 1OIVA 3GJ5A 4CZ2A 3AVWA 1DAEA 2J87A 3F5FA 1ANKA 4JL8A 3MWKA 3TQFA 1W2HA 1KI7A 2OESA 5JRZA 4EFLA 1SXJD 4NTZA 2ODWA 2DFNA 1UKZA 4M9XA 2VL7A 3CKLA 4Z8YA 1EG7A 2PH1A 2PBRA 3GFTA 2OM2A 1NMXA 4KFRA 1AS3A 4PO8A 3RNLA 4Q9KA 4G5QA 3BB1A 4KVAA 3SHFA 5EP1A 2R6AA 4NHOA 5BN5A 1XZPA 3FFAA 4BECA 3GLHE 1NVUQ 1NVWQ 1XMSA 2WAYA 1LB1B 1P72A 3Q8XB 4GOKA 4P4UA 4ZDKA 1CR1A 3R9WA 3HYTA 2C95A 4QBIA 1G7TA 1JB1A 3ZS8A 2IYSA 1KI3A 1W4CA 2VHQA 1Z6YA 3NH9A 3OFND 4N1AA 2BJWA 3WBJA 4ZCIA 3GLFA 3A1TA 4EPRA 3BIFA 1PLLA 3NHBA 1TTTA 4M9SA 4LY6A 2QENA 1D5CA 1WF3A 5KDDA 1Z0FA 2ZI9A 5AJVB 1YZKA 2OLKA 4F93B 4D0GA 4L8GA 1ZUIA 2GJAA 1GNQA 4Q4LA 5LB4A 1ZJ6A 4OI0A 1DAMA 2VTKA 1L7VC 2ZANA 4YMVA 3TW4A 3JZAA 4QJ3A 4LBYA 1T0JB 5L8VA 2CCGA 3KKMA 4A0GA 2XB4A 3LX8A 3GLFB 4QNRA 2WJVA 4LYFA 3D8BA 4NYIR 4C0KA 5CB6A 4MUBA 4DLXA 4LGMA 4OJKA 2AK3A 3EA5A 3RAPR 4BZXA 2OCPA 4QBFA 5GVRA 2GJ8A 2ZJ2A 4C4PA 2Q0HA 3L2OB 1KMHA 4QKQA 5DSZA 2FFBA 3ZVMA 2AD1A 5FOTA 3I32A 1CIPA 4OJQA 5IHPA 4OYHA 5FTJA 2OV2A 4A82A 4TMWA 4JKYA 4JLVA 2FMXA 4DB4A 1R0WA 4BEJA 4D26A 4R71A 2J1LA 521PA 2PEYA 4ACBA 1XTIA 2IHYA 3GEIA 1G5TA 2X2FA 4Z1MD 2QRZA 1S9DA 1GZSA 4A2PA 4V0MA 3QY0A 4O25A 1S9HA 1F48A 2DWQA 3EZ6A 1A82A 1D9XA 2OCBA 3AB3A 3QXXA 4W5WA 4CT5A 4Q7JB 2FSIA 2O8FA 2VPPA 1SXJA 1XU4A 1DPFA 3GLIA 1J70A 2X77A 3EZ7A 4OHYA 4C0JA 4JBWA 5HZKA 5TV2A 2ZI6A 1ETUA 4PQRA 3T61A 5FOWA 1I4DD 5FOSA 3ZZUA 3SDZA 1CU1A 1S1CA 1DG3A 2ZI4A 4FWIB 2D74A 2EYQA 3K09C 3MRSA 2ZS8A 2RCNA 4M1WA 1Z6AA 4IRUB 3AVVA 2ZJ8A 1AKEA 1Q57A 2VBCA 3NDBB 4I4LA 4PZLA 2DR3A 2O8FB 1SXJB 4DDWA 2GA8A 3GLIB 1JR3A 3OFNA 3KXKA 4U7DA 5F2EA 1EFRD 4LV6A 2NO6A 1QHYA 4DCUA 1GWNA 3A4LA 2WSSD 3PENA 1CKEA 2ZR7A 3L82B 3NEJA 4FMCB 1LVGA 2QAGB 4OQFA 4IHQA 3GLGA 2CLDX 2WKPA 1W48A 2CVFA 1NNEA 5J47A 2GJKA 1DAIA 3TGPA 4Y0VA 2YWHA 3A8TA 1T9HA 5J4HA 1FQKA 2F3TA 1PUJA 2FSFA 3FFBA 2HV8A 3FYHA 2Z43A 1ZAKA 2BBWA 2BEKA 4TLBA 4QBGB 1V5WA 5FUWA 4BE7B 1MOZA 1IXZA 3GLGB 1FPMA 1LV7A 2D7DA 4LWZA 3ZD6A 4K81B 4YMTA 3QUSA 1QHNA 2YHSA 2ZITA 1CLUA 5TARA 3QIAA 2ATXA 4PR0A 3ZVRA 1OPXA 4IVQA 4DZZA 1U98A 3MG9A 1XJQA 4JLPA 2RHDA 1JPJA 4Q7LA 1BS1A 5L3RA 2QAJA 3U4QA 4RJLA 4BLPA 3KX2A 2I4IA 1DELA 1T3HA 3R9IA 3W8RA 3W5JA 1F6BA 3LW7A 3FDIA 2WHXA 1UM8A 2PJZA 3LBHA 4YDHB 4Z1MA 3IBGA 1AN0A 2AFIE 1GNRA 3QENA 3K0AB 1KDPA 4JBYA 4MH0R 4PPQA 4E03A 4ON9A 1P2SA 2GESA 3P1JA 1MO6A 3U44A 1E69A 1AZSC 2VHUA 2J5XA 4DKXA 2VP6A 4TL7A 2VP0A 4XVQA 3U4QB 1U0JA 1G4AE 1KKLA 2QSZA 3LVQE 2AXPA 4P0TA 3FMOB 3KB1A 2B8TA 5EXTA 5B30A 3EARA 2WKRA 2REBA 3BORA 4HAXA 2QGZA 1Z08A 6Q21A 3QKUA 4EKDA 1E1RA 1KI2A 2DWOA 2FH5B 2GZHA 3AP3A 4PSVA 3WYGA 1UBFA 4QBHA 1MABA 2PL3A 2R62A 1T4GA 1EFRA 1GFIA 2Q21A 4RY2A 4Q4HB 3CNNA 2A5JA 4FMDB 4KXFB 4RCYA 1ZUNB 3IQXA 2AN9A 3SBDA 121PA 4AKEA 3GEEA 1KI1A 1NBME 4DIDA 5GJWC 4QJ5A 2BCGY 2VQSA 4DIEA 3I8SA 1KI8A 2ZJAA 4M1YA 3I73A 1MABB 3CM0A 1XXHA 2SHKA 1JXMA 3T15A 2GK7A 3BGWA 3CONA 4JLOA 3RS0A 2OFOA 3M4YA 2ORWA 3GJ7A 3LO5A 4BLOA 1XEFA 3D3QA 2DB3A 1EK0A 3I61A 4RFVA 1UF9A 1CJMA 4A92A 3BH6A 3VAAA 3EZFA 1E32A 2JLXA 3DOEA 4AYTA 3W3ZB 1KSHA 3EC1A 2F1HA 4M4SA 3LY5A 4FI3C 4NYIQ 2GDJA 4NYMR 1Q12A 5FBRB 3ZIAD 4UXIA 3LA6A 2BOVA 3CH4B 1TQ2A 5C4GB 3QBVA 3KQUA 1D6JA 4GNKA 1GKYA 3GP8A 3X1WA 1YR7A 2IWRA 2G1KA 2ZJZA 5JHGB 2HCBA 1VHTA 5JJKA 5HCNA 1G17A 4DCVA 1AGPA 3VX3A 4HLUC 2C78A 1I4LD 1ZVQA 1XTQA 2N46A 4LJYA 4MGIR 2IWHA 1HT1E 3TRFA 4JLJA 1WA5A 4D4KA 1XF9A 4BZQA 3VKHA 3B82A 5KDOA 2R65A 2GHIA 2IS4A 2IYLD 4F92B 3VNUA 2QP4A 3UWKA 2C04A 2Z6VA 4PHGA 5G53C 2VHTA 3NBZC 3HU2A 2NZ8A 1P2UA 3NBXX 1OIWA 2GF0A 4TT3D 2YC2C 3LV8A 2V9PA 3G5UA 2E87A 2CBZA 4Q1CA 3K70D 5AUQA 3OIWA 4OKSA 2LWIA 1JAHA 1ZNZA 3MUFA 4KV9A 1P3JA 4LPKA 2FU5C 5CDFE 5GVSA 2BMJA 1F3OA 2FE4A 3DHWC 4C0HA 2RGXA 3TBKA 1Z83A 5E95A 2ZJYA 5KHOC 3ZH9B 1VG1A 1W36C 2VO1A 4LJ9A 3PUWA 1W7AA 2GJ9A 3IIJA 1CXZA 3UIEA 5FFMA 4KYIB 4NYJR 5AR1A 5FI1B 4CIDA 3GLHA 1G7CA 1KZ7B 3P27A 1IBRA 1EFUA 4BLQA 2MSCB 1G21E 2TMKA 3TSOA 1AS2A 3W34A 1FNMA 1G8GA 1R7RA 4XWKA 4HEJA 1KAOA 3NH6A 4AG6A 2QPOA 4E07A 4EPTA 2Z0MA 5JJIA 1LNZA 3GD7A 2O8BA 3RLFA 1XB2A 1X6VA 4Q1BA 2VP9A 3T06B 1SVSA 3GLHB 4URYR 1XNJA 1QVRA 4LSGA 1XTRA 3ZIAA 3N2EA 5EP2A 1E2PA 1ESMA 2QQ0A 2N42A 3IUYA 1LS6A 2WWFA 2CEAA 4FWTA 3PV0A 4LOAA 4DLWA 3CRRA 4MRRA 5LBIA 2BIFA 4WVFA 4Q00A 3QXSA 4ZCLA 2ONJA 4B33A 4J0QA 4PC7A 4ESHA 2WWYA 1MT0A 4JLNA 5M04A 4ZIRA 2O8BB 2LCFA 4M1OA 1US8A 4H1VA 1FW6A 1N2CE 2IXGA 2PZEA 2ZRJA 2ZUCA 3HYRA 3DOFA 1Z07A 2WICA 3KJEA 2G9NA 2HJGA 2YOHA 3K53A 1F5NA 4DCTA 4FN5A 2OSBA 3CF2A 1KO8A 1E2NA 3C16C 3SE0A 4DT1A 2D2EA 2ERYA 1Q1ZA 1TF2A 1UEJA 4DRZA 3CH5A 4G1UC 2QEQA 5EUMA 4F91B 3OIUA 3LXRA 2D06A 2FPKA 5DLQC 3UATA 4TT3A 2ZPTX 2DFLA 1CJTC 1G64A 2IYWA 2O52A 3TAHA 3TK1A 3IEUA 1TEVA 2CE7A 3RYTC 1XTKA 1FTNA 3GQBA 4NZYA 5G3ZA 5IF9A 1W0JA 5KPJA 1NLZA 4IFBA 3LBNA 2QY9A 4NBSA 3BJIC 2OZEA 1HURA 2AXNA 3SEAA 3WYAA 5JI2E 4TTRA 5JSZA 2QBYA 1KSJA 4LC0A 4BFUA 2L0XA 1JXOA 3NG1A 4B2IA 2V1XA 3EPKA 4TQ9A 3QJYA 1X8LA 3GFPA 4AIIA 1DO2A 3IIMA 1DAHA 4KSBA 3R8FA 2QM7A 4NPHA 4AWXA 2EU8A 2XEXA 4AG5A 4RZ2A 4M1TA 4BFZA 3EPJA 2F1IA 4AC9A 2NMVA 1R8SA 3CB4A 1TU4A 2IK8A 1ZM2A 1YR6A 4XWAA 3SI7A 2OCAA 5FL7D 5JSZB 2QBYB 3GPLA 1Q1QA 1S3GA 3DKPA 3NDPA 5H8WA 2D3WA 1GUAA 3OF5A 4RD4A 2IHBA 3CR7A 1N0UA 3CO5A 5HKKA 2PJRA 4MKIA 4RZ3A 4WXPA 1IY0A 1PV4A 2P3SA 4ZI3A 1GRRA 1W0KD 2CHGA 3KKNA 3QXJA 4JKIA 1RFLA 4Q9HA 5G3YA 4URVR 1E2JA 3CF6R 4JLDA 2QTFA 2G3YA 2IXFA 3T5DA 3AVUA 1G6HA 2H17A 2GRJA 1F2TA 5JWOA 3H4MA 2ZU0C 4NYMQ 4Y0AA 3QKSA 1IY2A 4M9ZA 3UANA 1JPNA 3KJHA 5JRJA 3U60B 1HE8B 1Y3AA 1E2DA 4ERNA 3THWB 2ECKA 3HJNA 2ZSEA 3P4YA 2H18A 5B57C 1KK0A 4YLGA 1FTSA 3KQHA 1ZBDA 4TZ6A 2FFQA 3VTKA 1F2TB 4AD8A 1IHUA 3DO6A 4II7A 2A2ZA 2NPFA 3PEUA 1ZNYA 3SOPA 1PZNA 4CVNA 5J4LA 4PQFA 3RS7A 1ZNWA 2EFCB 1AM4D 1GKUB 2JLQA 4MGKR 1KO7A 2CL6X 2G83A 3TR5A 2UVQA 4OI4A 3NVAA 1KJYA 1NKSA 1D2NA 2VA8A 1A2BA 1E2HA 1G3QA 2WSMA 3BAFA 4Q4JB 2J9RA 3ONWA 3EAQA 4IVPA 2A5DA 1E99A 2R6FA 4ZKEA 4B47A 1E3MA 1OH6A 1E0JA 1VCIA 3KUCA 2BCJQ 5JMTA 5HR5A 3THOA 2EWWA 2A30A 4A8JB 4LJ5A 2NGRA 4BEBA 4DLVA 1Q1EA 5FL7A 3QBTA 1XTSA 4Q66C 3O8BA 3P4XA 4D81A 3Q9LA 4BWYA 4HAWA 4NYJQ 1K8RA 4KBGA 3QF4A 5FPHA 3F0TA 3OIVA 3GJ0A 2V6JA 2E9SA 4KLZA 3WNDA 2JLUA 1QBKC 1YZGA 3AKYA 1RE0A 4P32A 3B5JA 2OBNA 2IF0A 2YVUA 4Q1AA 2NOAA 1E2MA 2JDID 3GFOA 3IQWA 4HAVA 3K70C 1Z3IX 2CJWB 2CCKA 1E9FA 2IX3A 3PIRA 3EASA 4LC1A 5C18A 4WZBE 3L43A 2XZOA 1IY1A 1WE2A 2WZQA 4NP6A 4NH0A 3VKGA 4MYUA 4RZUA 4KVGA 2JLYA 4KODA 4V0LA 2FGJA 3V00A 1CRPA 2O5VA 3HR7A 5L3QA 3HDTA 3THXA 3KTAA 3X2SA 4MYCA 3KL4A 1E9BA 3OAAD 1SKQA 1BYIA 2GEDA 4NDZA 3VR2A 3PITA 5A4JA 4CF7A 1ZYUA 2PZGA 1VHLA 2YWGA 3BBPA 2DHRA 2C96A 2J0SA 3HPQA 2XITA 4RD6A 1LF5A 3BFKA 3QE0A 2ZRFA 4R98A 2AWOA 5JEDA 1Q20A 4IDPA 3ETLA 4Q19A 5L3QB 2KJQA 3RSOA 1HE1C 1YU9A 3W6OA 3THXB 3KKOA 3B60A 1UKYA 4BLTA 5BYJA 3Q7QA 3VNVA 2ZQ5A 1W5SA 4YQFA 3R20A 1I2MA 3AUXA 2OG2A 3L0SA 2JAQA 3E70C 2W58A 4IOMA 1P60A 2QN6A 3CR8A 3WMFA 1MV5A 1T8UA 2J0QA 3R9XA 3KFVA 3ZDQA 3IPXA 2FG5A 5EE1A 2GVZC 3VX4A 2QUZA 4B3FX 3WNBA 4XJXA 1OH5A 3T1TA 1OH7A 4M1MA 1CR4A 2DFKB 1WBBA 2WKQA 1BO6A 4I1SA 2WWHA 1OIXA 2ZRKA 3RDPA 3K09A 4B75A 5KNCA 1M7BA 1VPLA 5SZKB 5JFGA 5CDFA 1WRBA 3X1XA 4HLCA 3TR0A 1P4SA 4F38A 5KSOA 2B21A 2X8AA 1GRQA 2VEDA 4LI0A 1U9IC 5BXQC 2JLWA 3T1VA 4LZZA 2HF9A 2F43B 2E1RA 4ABYA 1HA3A 3FKSD 5JBQA 1XD8A 1CR2A 3K0SA 2JDIA 1KJZA 2Q9BA 2QSYA 3QKRA 3WHLA 1U99A 3UPUA 1SQ5A 4Q03A 1AJEA 2RB4A 3SQXA 1R4AA 2Q6TA 1P6XA 2XXAA 4C7OB 1G9XA 4W7SA 2RMKA 2ZU6A 2KI5A 4US0R 1QRAA 3BC1A 2GF9A 4AKHA 2H5EA 2XTMA 3VR4A 5FOXA 3DEFA 1N5JA 1N6NA 2ZSBA 4MITA 1Z6GA 1XD9A 4TQUS 3VR1A 4LRWA 4D2IA 2D2FA 2FSGA 1KAGA 3WBKA 2XSZD 1VCMA 2C98A 4IVRA 4HUTA 721PA 3OAAA 5CITA 2XXAB 1E2FA 1M74A 1U0HC 1G8YA 3SU8A 2F1RA 1A1VA 2HDNB 4MGZR 4M0LA 1R0ZA 2IYUA 2NO0A 4C3ZA 3IDQA 2J59A 3FPAA 4GOJA 2WBLC 1G20E 4HAUA 5JS7A 4RZXA 1FMLA 4DVGA 2QTVB 4QGFA 1C9KA 1G19A 2QT1A 4BFXA 1KDOA 4CEIA 2XB2A 4A0RA 2BKUA 1Z6TA 2IEYA 3EIHA 4B73A 1KI9A 3P26A 2ZR0A 4HB3A 1G1MA 1G6OA 4HLDA 4OHZA 2ZRAA 3U61B 4B6EA 5GJVC 4RVCA 2ZUDA 1EXMA 4FD2A 5FTMA 1E2GA 1K5GA 1ZUHA 3KJIA 3VHLB 3PEYA 3R7WA 4Z54A 4B3DA 2Z83A 4NCHA 1GM5A 2J0VA 1OFTA 1XD2A 2FDCA 4CEIB 3C4JA 4TL8A 2QL6A 4KBFA 3W90A 2ZE5A 2AKYA 4F7WA 3M1IA 2YZ2A 3MLEA 2FF7A 4XH9B 4OQXA 2IYVA 4HSEA 3MWLA 3C5HA 1FZQA 3C5CA 4EQ6A 3KDSE 1N6RA 3FB4A 3R7WB 2J46A 3QF7A 4A1FA 2VIIA 3U7HB 4EFMA 5FBVB 2R8RA 3VHXA 4B35A 3FKSA 4ZKDA 4L5BA 3F3YA 1IXSB 3SJAA 1U90A 3UMSA 4MKFA 2J41A 3B8HA 3QEJA 3KQKA 1A7JA 1DTSA 1T5IA 1Q21A 3OEHD 1XMJA 3ADCA 2AHOA 1Q3TA 1E9EA 1W36D 4TMVA 2F9MA 3BOSA 5CYOA 2ZEJA 2H92A 2VP5A 2PZFA 1II9A 1S96A 1VDZA 1DOAA 3LFUA 4KFUA 1KMHB 3NWJA 3LNCA 2PLFA 4B76A 4EPWA 4B32A 3LRPA 3X1ZA 2XSZA 2F3RA 1Z28A 4DSUA 1CJVC 5IT5A 3AKEA 1QHIA 2XJ9A 4JL6A 1TNDA 3JZMA 2ONKA 1N5LA 2BHRA 2HLDD 1YZUA 2WWXA 4AKIA 4Q21A 4C0BA 3DM9B 4AURA 3AF2A 2ZVPX 3K9NA 5E7MA 1E2EA 1FNNA 3W5IA 2F55A 2JLSA 1R0YA 4PAMA 2OFXA 2C9CA 2ZE7A 1G5RA 2CXXA 2IYYA 2A5FA 4PC1A 1MO5A 1MKYA 4XSHA 2WMNB 4TZ0A 2GZDA 4B71A 3WP0A 4TTQA 1JEEA 2BM0A 4EJSC 2G0TA 4TMXA 4TWZA 2XOKD 1N0VC 1VCOA 1NN3A 4UNSA 5DI3A 3DZDA 2CNWD 5K8LA 2ZYWX 1FMJA 4HLUA 3HPRA 3MJHA 4TL9A 2IYXA 4B43A 2OHFA 2W6JD 4OHXA 4KLNA 4L15A 4I1UA 4XD7D 5JCZA 5UKDA 4MRPA 1QZXA 4HDOB 1GTVA 3IILA 2Z4RA 4PC6A 5FR2A 4OQNA 1R10A 1GOTA 2JATA 1IN4A 2OLJA 3OESA 4IJMA 2J7KA 5DI3B 3AVYA 4YMWA 2Y8EA 3D6TB 3UMFA 2Q9CA 3ZD7A 1XJCA 3WMEA 5FL3A 4PANA 1R8QA 1VMAA 3LX5A 421PA 1P73A 2FX3A 1U2RA 3A58B 1X1RA 5DHAA 5E3HA 1T3SA 4YMUA 1OFHA 1OJLA 2XNDD 3TUIC 4BQSA 3OEHA 4TYNA 4B3GA 4R9UC 5EE9A 1QF9A 2J45A 3EX7C 3BD9A 3AF1A 2OBMA 2ODNA 5FTLA 1HV8A 1NY5A 4LV5B 4GZMA 3B1VA 5H68A 2R6GA 3ASZA 4H9GA 2QMEA 1SULA 3SN6A 1WQ1R 2FV8A 2VLIA 1E0SA 3LXXA 3NC0C 1CTQA 5CB8A 1WBDA 3FHTA 2FFAA 1LW7A 1SVIA 1DS6A 2Q3FA 2HLDA 1NI3A 1YJ5A 4LYAA 2YKGA 3ZYCA 1YHNA 2P67A 4C0LA 3L8ZA 3PQCA 2ZRGA 4N0DA 3KB2A 2FJUA 3CRW1 3B9QA 3U44B 2AFHE 1KI4A 2ZS9A 3NC1C 3H84A 4TYWA 2RKOA 5LDDC 1O3YA 4DCSA 3T5GA 4U00A 5FOVA 2Z4SA 3RRNA 2WSSA 4GFDA 4QGAA 3RHFA 4RFSA 4YMSA 1XCMA 4IEEA 4NL4H 1IM2A 1IQPA 5FPSA 2BMEA 2CNWA 2PX0A 2AD5A 1VIYA 2WIAA 2OXRA 3C7KA 1RRCA 2W6JA 4TLEA 5GJCA 3NTUA 1XPUA 4XD7A 1RKBA 3TE6A 1NY6A 4FCVA 4P33A 5KO2A 3S1AA 3CZQA 1DEKA 1FOEB 2YJTD 2ANBA 3V9PA 2VHCA 4RFSB 4FCWA 2HCJB 1WMSA 5AUOB 4CGZA 4JBXA 4NU0A 3U6BA 1AK2A 3BFVA 3FMPB 4P4SA 3ADDA 2ZROA 1SKYE 1ZD8A 4A15A 4PTLA 4XVUA 3RC8A 2EFHB 1XXHB 5EE5B 1X8JA 5E7JA 1VKJA 2XNDA 3Q72A 5K8TA 2PT5A 4QM6A 1ZM3A 1G16A 3BH7A 3I72A 4GMXA
chains in the Genus database with same CATH superfamily
3AT1A 5J4VA 1CEEA 5CAEA 2J7PD 4ZC8A 2GBIA 1E9CA 4M87A 2UXBB 1DG1G 4GDFA 5JZMA 4P4SB 5JCXA 1Z8DA 3TSCA 5DHFA 2HNKA 2UYCA 1MHPA 2WP8J 4A27A 2Y0BA 4NRDA 4C3VA 4DJEC 3DWEX 4L3VA 1BS2A 4JA0A 1C8VB 1MO3A 2WTAA 1DQNA 2C5LA 3IS3A 2YZNA 3W1VA 1LGYA 1TQ4A 4RA9B 4XYEA 3ZIUA 1DO8A 1ZM7A 1EP3B 4N7MA 3WMWA 1EDBA 1OR8A 4UW9A 3CE9A 4MRMB 1G1AA 3QE9Y 2ZT5A 1JAZA 3ZBUA 4CMEA 2FK8A 4UTZA 1QWOA 2J3IA 2Q4EA 3ZY3A 2UAGA 2J5BA 1E2KA 3F6YA 3OX4A 4D02A 3FIJA 3R44A 5J4YA 2GK6A 2QXTA 4LEIA 4QGGA 3C3DA 2HGZA 4NMXB 5FYDA 3TGWA 2C07A 4IXWA 4P08A 4UZFA 4RSRA 1Z15A 2E49A 2R48A 4X7RA 3CW2A 4OG2A 4XX0A 3OLWA 4DE5A 3HRHA 3QV2A 2DECA 2ORYA 3REQA 1R5BA 1HZZC 4TS9A 4G8BA 1ESEA 4CFZA 4DSAA 2PT9A 3MAJA 4KIFA 1PFQA 2YNMA 3IDFA 2FEAA 4JR2A 4BP3A 5JVDB 1XMVA 3DEZA 1DLIA 2P9FA 4PE5B 1S7CA 4DLSA 5A0TA 2HJVA 2P4QA 2WVAA 2QF7A 1VIAA 4HFMA 4PYNA 2FRDA 1W8DA 4ZVPA 1R37A 2I29A 4EGQA 4N41A 3G0HA 3AVTA 5LUBA 3LHFA 3ZE6A 2G63A 3NNDA 4NF2A 5TMEA 1M6NA 1X1SA 1G5PA 1KH2A 1BE8A 2GHTA 2F1KA 2MSDB 2BR4A 2R60A 3E3AA 4Y1FA 3NTLA 5A4IS 1Z7GA 1BMFD 4KUGA 4YP5A 1DDGA 2QPTA 4MGYR 2H2GA 3CNOA 5KYVA 4ILEA 1WWKA 2V65A 3I76A 3WY9A 3O8DA 4BMZA 2GTHA 1JI3A 2R7MA 1KQNA 4B6FA 2EGGA 4S3MA 3KUDA 4YJKA 1SUWA 4YJHB 4YUYA 1UDCA 3T7SA 2ZJBA 3RJTA 2Q1YA 3UM9A 4QLBA 4EUKA 4KIUA 1GR0A 3QKWA 1E7WA 3G2OA 3TKAA 2UZ0A 4ISCA 4ZVVA 1P2TA 1ZW6A 3L7IA 3Q3VA 3UHAA 4GWKA 5TVKA 3W9UA 2J3MA 5KNDA 4D25A 4BRUA 5JS2A 2YRFA 4HFJA 1KI6A 4IOLA 5SZJA 3RHTA 3U3KA 2DGDA 3DV2A 1IRIA 1P5RA 2O1SA 13PKA 3GT0A 4OMUA 3VQTA 4H0FA 1YAJA 4UUOA 4MS1A 1TAHA 3T1QA 1J2UA 3UWPA 4PGAA 4EB6A 1Q6ZA 4KN6A 4C7BA 2L42A 2B1JA 2O7QA 5I9TA 4EUSA 1TXGA 4HN2A 3MCUA 1TMYA 1RPNA 1XFAA 4LX0A 4N82A 5HF5A 3UHPA 6ADHA 2Q3CA 1EX6A 1UL1X 3TSWA 4W1SA 4BYMA 4RJKA 1PQPA 1E2IA 2WYWA 4LKOA 1FB5A 3DOJA 4F1KA 621PA 1ZNQO 1JSLA 4Y2RA 3STXA 4P4NA 3PIDA 1MJHA 4HT3B 3AY3A 4FFRA 3VOTA 2ATVA 1YRHA 5BR7A 2QYSA 2POCA 4ZEVA 3NATA 3O8OB 4XIGS 2PZJA 1UFQA 2H8GA 1RI2A 3BXZA 3ZK7A 3HWWA 2A3RA 3KQVA 1WCXA 4I9UA 3ZJUA 1U8AA 4BMXA 3TLKA 2CNBA 1WXIA 3N8DA 1HYQA 3M49A 3Q11A 5CK4A 3PEVA 1W5FA 1WXXA 3ACCA 5HFNA 4ZDJA 3G59A 3AUYA 4TXJA 5KU1A 1H4TA 2GX6A 1UAAA 4DRYA 5LU9A 5I7FA 1GJRA 1HTWA 1MUUA 1P5JA 2BHNA 2EFDB 2IKSA 3AGQA 3EVCA 4K6MA 5GV8A 3WLEA 1O94D 3I0NA 4U02A 1AKNA 3RBVA 2BSQA 4HUQB 5HILA 3KT0A 1P9WA 2WJJA 3WLHA 3ABZA 1CS4C 4RQAA 4CKBB 5DT2A 4W9MC 2FPPB 1OKKD 4YLEA 3UT5B 3HO8A 4NAVA 2L2QA 5EHQA 3GT3A 1YTUA 4P82A 2Q27A 1A88A 3MJRA 4OI2A 2G76A 4G2TA 1REQA 4K6FA 2AW5A 1YKSA 1Z45A 3BMOB 2AOXA 3E3MA 4FJ1A 4URUR 2WIKA 4E14A 2IHZA 1HT2E 2ZTUA 3FVQA 4KQJA 2EX1A 2YUIA 1ZIOA 3JXEA 4K40A 5CDHA 3WG9A 1QIMA 3BGIA 1EVZA 2VQ6A 4JZKA 4NCXA 5CJ2A 2QZSA 1XYVA 1Z73A 4KQ9A 3A1VA 3LD9A 4HXGA 3HWRA 3OHSX 4OYRA 5DU2A 4GX1A 1U2TA 2NVOA 3DKKA 3HJRA 3MTEA 4BP8A 4EK9A 3ZHUA 2QSJA 4JC5A 3HRKA 1D4AA 3GEMA 3N0TA 3DV0B 4NMHA 2DUMA 1ABBA 1VJ5A 5HVNA 3RVRA 3UMYA 3EWSA 2UUCB 4Z9BA 3U5ZB 3EG9B 3F71A 1CZHA 1IHYA 3OIYA 3MCTA 2WUWE 1JSZA 3OT1B 1U9IA 5BUZA 2B25A 2UUOA 2ZM6B 2VHZA 1K6JA 1SZPA 4QUAA 1YR8A 4HMQA 2W70A 4DIUA 4AKGA 3D64A 4IPTA 4MGHA 2BISA 5AW2A 2OSVA 3AERB 4RQUA 4UPVA 3FNFA 4EF5A 3EGOA 3F96A 5DM1A 2BKXA 1FL9A 3EOZA 3S7ZA 3LUKA 3L1JA 2WINI 1YJQA 3MGBA 3HEBA 1NW3A 5JNUA 2PWYA 4ZDIA 1A5ZA 2ZREA 2YXLA 4QDTA 1ML3A 5DYTA 2QM0A 4ZREA 4Z7QB 1D6SA 2NZJA 2VYFA 3DOOA 3SHOA 2C7PA 2YXNA 4HDNB 1GG2A 4KPUB 1OBVA 4OA8A 4L2IB 4BFTA 2P4UA 1G8FA 1QGYA 1S1MA 1S8AA 2JJ1D 2PL9A 1J2TA 4NK5A 3CURA 3CX6A 3IURA 3BMXA 4RTMA 3SSOA 4ZHQF 2EEZA 1NLYA 5CT4A 3C3YA 4QWWA 3WLIA 4WXHA 3G9QA 2WF7A 1D9ZA 3C70A 1H94A 1AHPA 1UM9A 1WDKA 1YVRA 2V55B 1VP3A 4OJMX 2V7QD 1TVKB 5EERA 1ATIA 2ISCA 3BSFA 1TF7A 5COQA 3K05A 4YJGA 5TQ0A 5DYGA 3A9UA 4QYTA 3RNOA 4W5OA 5TVGA 3PEWA 1E2QA 1U3UA 1GG8A 3NONA 2SKDA 4AF7A 5B4TA 3VA7A 3KB6A 5FPTA 3B6ZA 4KQCA 3VR6A 3WJAA 1SU4A 4RV9A 1E96A 2CHEA 2ZBFA 4HYYA 5L3SA 6REQA 3V2IA 3B1ZA 4UNIA 2QTHA 5FJIA 5LIPA 1DMRA 5DSXA 5K5EA 2I2FA 2V3WA 3RU2A 4S2EA 1FFEA 2GFIA 3VUFA 2I71A 3YASA 4X64B 1XA0A 3K30A 2GILA 3IPYA 2WUGA 4C88A 5KQLA 3OX3A 3U4IA 3AP1A 4NICA 4RAOA 5GGXA 5TB5A 3H5AA 1ZGCA 2EVWX 3LKBA 4FHCA 4HGZA 1FUKA 1QORA 2D13A 2EZ8A 2ZB3A 1FYVA 1WY5A 2X14A 4QRHA 4RD1A 1NBOA 1QDLB 1ZRHA 2JFGA 2REOA 4DLUA 3R6TA 4O2RA 4DLWA 1PWEA 4UUMA 1YS1X 3L6BA 5H0IA 3QFRA 1J06A 1SVMA 4BQEA 4EHFA 5IT9A 2EXXA 4BVEA 2XAAA 1XVLA 1OROA 1NXSA 1DC4A 3C3BA 3QHPA 3UEOA 5AO9A 3AYZB 2JZNA 3K8ZA 3KWLA 4Y6GB 3B48A 3D0QA 1T26A 4XYMA 3V4ZA 4YRGA 4L5JA 2B7BA 4KAJA 3TZKA 1ORIA 3R0QA 2EBHX 4GSKA 2IYRA 2ZDHA 3FBGA 2GF2A 3S99A 1QJCA 2QPLA 3MFYA 1MNQA 2K87A 4ZMRA 1FIUA 4G26A 3U4CA 5HUJA 4Q3EA 2XWQA 5F51A 2FMTA 1MO2A 5AOBA 4OXRA 3WGQA 3HL4A 4I4TA 1PSDA 5LP6B 4I5IA 3KIPA 3RI3A 1LDBA 1W49A 3DLIA 4PCUA 3ER8A 3KQPA 4MWTA 3G8AA 2P2ZA 3UK6A 4GZLA 3CVVA 1F20A 4ES6A 2VHVA 1ONOA 1QTRA 3LVBA 5FWDA 3K0EA 2FMIA 2PRIA 4CGYA 5U4QA 1TLTA 2IYQA 4MUFA 2YMQA 4F6CA 3A27A 4Z7NB 1E66A 1NWHA 1ZXXA 5EWLB 4LJ8A 3TQQA 3UWOA 3OJ0A 3IAM1 5K0CA 3ZCRA 4HMPA 1DXHA 4JGBA 3ZQ6A 4GOLD 4PC2A 2VHYA 4HWKA 4FZJA 1KK3A 1T8WA 4URZR 4BV8A 1L7PA 2EG9A 1UWLA 3TUZC 3RTGA 3H1AA 3TPZA 4LISA 2Q5JA 5AYVA 3IKLA 3PLRA 5G0VA 4DR6B 1EFPB 1MJFA 1P4RA 3Q2KA 3AEUA 3C41J 5BSEA 3DONA 4KNYA 1OSNA 2XA9A 1FNCA 3BB3A 4X1IA 1SJ9A 1LDMA 2V6IA 3SYLA 3SYRA 1TTPB 2Q5OA 4O4IB 4W1PA 3HJBA 3LQ2A 5ESDA 2PBZA 2ZRDA 1WPXA 2FDRA 4LTNA 1JQJC 1B4DA 1K27A 2R751 1W2GA 3DDWA 3WYNA 2WIJA 4KQMA 1X7WB 2IYAA 2OFWA 2B78A 3C45A 2ZPUA 4MEBA 4G4SO 4WXEA 3K0CC 2PX5A 1DKUA 4YX9A 2G8LA 1QE5A 1I3CA 3SJUA 3EGVA 1I0IA 4UHBA 5CRIA 2C4HA 4MYSA 4BVGA 4Z51A 2C7VA 4JJZA 7REQB 1T9GS 1NW7A 4I55B 3X1DA 2ZRHA 4AT1A 1TC2A 3SICE 1GKKA 2AE1A 2H57A 3DE2X 3OCUA 1JIIA 5HZHA 3E5HA 1B42A 2I4MA 3NDRA 3NKFA 4DEXA 1W88B 4B3TB 1YRBA 2P6NA 4LQLA 3DZIA 4MW4A 5IAJA 3KE9A 2I54A 3TMKA 3ZJTA 4MPJA 4Y2PA 4WESA 1S3IA 1A7KA 4OIFA 1K86A 3E1GA 1N9KA 4MUJA 2C83A 1P91A 2PR7A 4CLHA 4ZO6A 1EAYA 1ZHHA 4J4BA 1O94C 3AVQA 3FNHA 4ISBA 1SB8A 4KO8A 3N39C 4YRCA 3AUTA 1QIGA 2D1TA 3G6WA 3A06A 3CPHA 4H08A 1A9YA 4UKDA 3UG6A 4F60A 3CR3C 3RVJA 1GNPA 4DUGA 4WN3A 3A2MA 3DOHA 2JJYA 2Z58A 3CW8X 1KXZA 2VWPA 1M2OB 2WZCA 2IP2A 3JVUA 3CG0A 3HZHA 4DBZA 2AN5A 2ICAA 3BN3A 5A6SB 3WQQA 1JLMA 2QDKA 4R68A 1UDRA 5LYJA 4EJFA 3VZRA 5LN1A 2BMVA 3FHJA 4I4CA 5ALFA 4RJTA 3R3HA 5C4MA 2OBBA 1BIFA 2P2LA 4I7EA 4BTEA 4CYMA 1TYZA 1AKMA 1AF4A 1ZU4A 2PH7A 2ZB8A 3AJ9A 3AHEA 3DEIA 2OXCA 3H1BA 3I5UA 3HS3A 4CM1A 4JQZA 1Y3DE 3NGXA 4RV4A 5CVUA 4Q3BA 4ZVOA 2I2AA 1KGSA 4URXR 3FH0A 4JMPA 2OLEA 1LLCA 3HJHA 1OY1A 3R23A 2EG5A 4R7GA 1GXSA 4B7AA 5LQNA 1N2CB 2XBUA 3AF6A 2W90A 1RQ7A 2O2DA 3W6ZA 4YGYA 4MVJF 2M1XA 2IS2A 4TT8A 5JSYA 1IM5A 1OUMA 1VKHA 4N7BA 5EQTA 3TD2A 1PWYE 2JVKA 5GADl 3P9NA 2V3CC 2C5AA 1EFTA 1KIFA 2NU6A 5ECDA 4D9IA 2H65A 1TU3A 4WOPA 4F72A 2R0QC 4MDFA 1U81A 1HQYE 2V58A 2GPSA 5CD9A 3EA4A 4HNVA 1T5HX 4YAWA 4JGGA 4A0HA 1AD2A 1B2LA 1XD2B 3WOHA 1DKMA 4YAJA 5M34A 3V8BA 4OGFA 1F2UB 2X4GA 1MRSA 3A4MA 2IY7A 1XU7A 3DDOA 4AXBA 1KTIA 2FOLA 4YS6A 1PLJA 3AESA 1U28A 2H7VA 5T7BA 5BPHA 1O95A 4C5BA 4YT4A 4TKLA 4PLWA 4G0QA 3IQIX 4QM7A 2GN0A 3GWGA 4ZCMA 4UM5A 5F2NA 2J6HA 2WQ7A 2XRZA 2RGGA 1C3JA 3GO4A 4I81A 3GG2A 2QUKA 2WHRA 3U7IA 1B16A 4JR1A 4P4TA 5IAEA 3VHXB 4MUKA 3ZUGA 2Q1SA 3WL7A 4BATA 2M32A 3RASA 1NUPA 3OX2A 2VXCA 1RXSA 2O0HA 1AZTA 4MGEA 4Y0NA 3C43A 4MKGA 1GDDA 3D6FA 3TXAA 1N1MA 5BRNA 1YK1A 4TTSA 1QK3A 3FF1A 2JVIA 3TN7A 4YEDA 3JRNA 3QX3A 1XVIA 1U4SA 3MD0A 4M9QA 4O08A 4D0SA 2F8SA 1NURA 5FBWB 2JCBA 3AUFA 3L8DA 2FNAA 3JYPA 3ZHQA 4C78A 2GVNA 4QGHA 1R6TA 1S4QA 2MSWA 4HG2A 5F1PA 1QHXA 5D7BA 1Z5ZA 2G6BA 1V8BA 1XRSB 2QRLA 4HTFA 2DR2A 1JAIA 4RELA 3IAEA 1M0EA 3MUNA 5FUXA 4YJ2A 4ETMA 1IK4A 1EFCA 2FUCA 4GE0A 4XIYA 4C0AC 4ED9A 1V7QA 1LY1A 2NN3C 2VKTA 3QX8A 4US2R 1L4YA 3DEHA 1QCDA 5F2OA 1BVUA 2QAGA 2RGDA 1G8PA 3N70A 4YAUA 1E1NA 2OKGA 2VNJA 1Q1AA 2WDPA 3IODA 5CX4A 4D3SA 4Z6KA 1I7QB 1FSPA 2C7OA 1U6JA 2IXEA 2OGZA 3L4BC 3O93A 4K9KA 1K6IA 1J5XA 2J5RA 2PT7A 3HJUA 4KQXA 5EYPB 2QRVB 1YIOA 4FFMA 2P1DA 3WGMA 4CLDA 3NVKI 1U0TA 1TO6A 1XKXA 1G3RA 1XPRA 1A8IA 2OB1A 4UAGA 3FDJA 2XZPA 1E1YA 1V9SA 1X1CA 1AOXA 3EHDA 2I3DA 3HCAA 5ESWA 4CDNA 1I1NA 1YDGA 4HL6A 4QC2A 1SCJA 2C3OA 2PU7A 4ZALA 3IPLA 3A05A 3CF4G 2BZ0A 1PS8A 3L1IA 3AETB 3TE7A 2IU0A 1EQ2A 3UG7A 1Z4JA 1DAKA 3DAGA 3HKEB 4YC7A 1L7BA 2BZGA 2EKBA 5AJTA 4AZVA 2VSYA 3BZWA 3A6JA 1T8PA 4GOMD 5DJ5A 3WLOA 2V1UA 1VMIA 3AM4A 3ZWYA 2I91A 2NO5A 3R6LA 4KXVA 1T6ZA 3GI1A 4PX2A 2GERA 8LDHA 1U3WA 3LCUA 5BSTA 2IPAB 2D2VA 1RM5A 3A4NA 1CK4A 2NO1A 4WZAE 3A1UA 2ZYRA 4B4VA 2NP6A 3F98A 4G0NA 5KVVA 2GBPA 3K2EA 3C15C 2AI2A 4E1BA 4DG5A 2XHZA 4H6PA 4NQRA 1X8XA 4J4HA 1NFFA 3O26A 3OPYB 4RK4A 1EFDN 4WLUA 5D3ZA 1WMDA 3LK7A 1J09A 5DVZA 2FN9A 2F17A 2VP2A 2BM8A 2D0IA 4LYHA 2PE5A 4JC4A 4BXOA 3E9CA 3WZMA 3CS3A 4EPVA 3IB6A 5KJ6A 3ZWPA 5ED4A 1H05A 2HXGA 1LSUA 1F4VA 1Q0SA 4G0VA 3KO8A 3LUHA 4O2AF 3AOEA 4JELA 1PFUA 4ARCA 5ALMA 3EXIB 1U2EA 1EVKA 1VMEA 5KNBD 5GJBA 1CY6A 3RUIA 4M0PA 1RYFA 2O05A 4N03A 2O8EA 1YRYE 4XM1A 4UJ5A 1KEUA 3OZRA 1V95A 5FBHA 3ZX4A 2ZIFA 2A33A 3G17A 3DBLA 3V7UA 4KH0A 5K3FB 1XQVA 1E2BA 4EO9A 2XVYA 5A4KA 2BFNA 4PFJA 2FB9A 4KIJA 4G01B 5ALYA 3SMQA 4Q4HA 3T94A 1KFJB 5CM9C 3EXHB 4C03A 4DKJA 3OECA 1OREA 1FFXA 4WXRA 4S04A 3F9RA 1JHUA 1I01A 1WUTA 2FWRA 1DEOA 3PEFA 1U9YA 2BPOA 2JGNA 4R3WA 4XSGA 5CEJA 2O8CB 4AK9A 1P9LA 1QR6A 3QG1A 1QU3A 1ADFA 1BJTA 1JIJA 4YP1A 2P9BA 3WLLA 2REQA 3WGVA 3UMRA 2R2AA 1ZONA 2XMGA 4L76A 4YROA 3HA3A 3NO4A 4BU1A 3N53A 2I1VB 4DYDA 2ZSAA 1FS5A 2YYZA 4Q02A 4N3NA 4QFBA 3AH8A 3RSCA 4ZCRA 4FYPA 1RPTA 4BO7A 5DHSA 1AMOA 4D80A 4TWJA 2JCVA 4LZLA 1P0QA 2FOIA 1Y5IA 2FYTA 4UBJA 3VH3A 3QYJA 2H9AA 3B38A 4C01A 3H8SA 4TSFD 3GV0A 2AN1A 2FJ0A 1YQEA 4BY9E 1BHO1 4Z2YA 3EUAA 4GOXA 1E89A 2IEZA 5ALTA 4JUIA 4MR9A 1VG0B 2J32A 1GPAA 5EEHA 4NARA 4N48A 5KMGA 1EP2B 2JGDA 4MUAA 5EP3A 1DZIA 4L0DA 3TW8B 3EMBA 1MQSA 1EINA 2X9GA 5PNTA 2QQ5A 4JVSB 3NP9A 2UZ4A 4YCJA 4XVRA 1SXJC 4YJFA 3LHIA 1RC8A 1MF7A 4UTVA 4G0OA 3SE0A 5THQA 1S01A 3MAGA 1EGAA 1E4VA 2OPBA 1OFUA 2XKBA 3UJ7A 1LK5A 5DTJA 2X1HA 3TIFA 1JHMA 1N92A 1VJTA 1CUVA 4FDAA 3CUKA 5TSDA 2HOQA 4H7JA 3UV7A 2BH2A 3CUEF 2AB0A 3E2PA 2HO5A 3G5LA 1J8FA 4KQ6A 1JSXA 1Y82A 2QG6A 1IN8A 4HV4A 4NOKA 4BJ3A 5ADWA 3AYXB 3TAUA 4YV1A 1WOMA 2WR8A 4HPXB 1RI3A 4EYEA 2HZBA 2WPNA 3G89A 3KD2A 3QXCA 3U9LA 1IL0A 1DWPA 3DBVO 1U6KA 4WE3A 4ZOAA 5HCIA 3DVAA 1VRCA 3LY7A 1O1YA 1GL9B 4X92A 1KYXA 3I9KA 3BERA 1HQDA 3MWJA 1QDEA 3AV0B 5HDQA 1IJFA 3CEMA 1LSSA 1WP9A 4JVNA 4X41A 5B55A 2EKQA 4YV2A 4MCJA 5EJGA 5IAKA 4EY5A 4KITB 4GU5A 2XUJA 2H7CA 3AF0A 2RCYA 3R3SA 4PRYA 3TVTA 3P94A 5F7OA 3ZDRA 3BK7A 1JJBA 5HMMA 4IDFA 3SP1A 3FPBA 3IR6A 3AVPA 4EA8A 1PBNA 1JHRA 1FXUA 2ETXA 2YXBA 3HG7A 3OP1A 4IUDS 5FP0A 1KTVA 2WFZA 4IWXA 2YIJA 4D82A 4DZRA 4ENQA 4MA4A 1GCAA 3OI7A 4LAFA 5EKTA 4CMBA 4EAQA 1K6XA 5IJWA 2FRVA 3BILA 1ORVA 1K88A 3IQDB 1H2AS 2IJGX 1HY3A 5B2FA 5CLQA 4V38A 2OXFA 1PHRA 4O4LF 1RXEA 3I1FA 4LE0A 1RIIA 5JECA 5B64A 5E9JA 1PKXA 2CEKA 2B5WA 5I4CA 5D1HA 1YH3A 1EWVA 1GLNA 3AILA 1TK9A 2EERA 3D8NA 3LKZA 1J0BA 1ODKA 3EXAA 3QRWA 3IJ5A 5EZYA 5A5GA 2R5FA 5JZOA 4OLBA 4MJXA 4WUVA 2OQVA 5KINB 1YBAA 5CA1A 2IZ5A 1YJCA 4HN9A 4WZ6A 4DMFA 5AVTA 1MFZA 1DWUA 1NIPA 3ESRA 2V5AA 2WWWA 4FWBA 4GQBA 4LRSB 1JPVA 1XWIA 1ULSA 4WIAA 2NU7A 4RTRA 2GXAA 3H1PA 4NAUA 1NZJA 3Q6NA 2YOFA 3ZPXA 3WB2A 3NBFA 2QZPA 3GVPA 4EF6A 3T34A 1N5RA 1R0XA 4IHJA 2CY0A 1QNLA 1R5OA 5I7WA 1V3QE 1N2HA 1NVAA 4D0RA 2PS0A 1WL8A 2XGJA 1W1WA 1SVWA 4BASA 4DM4A 3QI2A 4EGCB 4I50B 5D1NA 2FA9A 1K7FB 5HX7A 1EPUA 4PSDA 1VBMA 4US1R 4QEZA 2WJYA 3IIIA 5KCMA 5JMOA 3O3NB 4CKYA 5EJFA 1L3BA 4KXMA 3OLVA 4ZPJA 3SVZA 4MICA 3C6BA 1YRQA 1D8TA 2ZR8A 3W05A 4EP1A 3TQTA 5FQOA 1Z2AA 1MR3F 3MRTA 5EA2A 1UUFA 3UYLA 2P1ZA 5L7YA 4ZZIA 5DO9A 3EBOA 2AZDA 3AINA 3LT0A 5E3JA 4AZWA 1KI6B 2GEUA 1TUEA 2DX7A 3JQAD 1UIRA 1KC1A 5CT6A 5DP1A 4B3HA 1KFCB 1J8MF 2AW3A 5ES4B 5EESA 4GMDA 4BZZA 4I1IA 3WAJA 2FSVC 4W9NA 3UN1A 2OK7A 5JARA 5JQGA 5KQGA 3B70A 2CMKA 1P61B 5HGXA 2GZRA 4EEZA 2YFQA 5CA0B 5LXTF 1U11A 2EFYA 3OZAA 3LECA 1XAIA 5FUVA 4EHBA 5KZMB 1UJMA 4RVHA 4LBWA 1COWA 1X94A 1QG4A 1GD1O 1QRUA 5DW3A 4R8LA 1E64A 1NFQA 2GN8A 5FR1A 3EZ2A 4HX9A 2WPDA 3RSHA 4AO7A 3KJGA 4AZSA 1OLOA 3P0FA 4NBTA 4O4HF 2G82A 4OQLA 1M2VB 1UK9A 4JJ6A 3BEOA 4LUCA 4DCJA 2JJ2A 5JJBA 1H4QA 3CUWA 4QUEA 2QW1A 3P0HA 1ONBA 3F3MA 4JYZA 2NSJA 3UQZA 2WFLB 1C9NA 3MERA 1U02A 2FN4A 4DSTA 4IH4A 3LDAA 1DC3A 1FBTA 2E48A 1AKUA 3ACDA 2CDAA 2GNOA 1P8AA 2RAPA 3EIXA 3KHTA 2FN3A 5J9FA 1NASA 3ZZNA 3AKCA 3IUPA 4EFNA 5K8VA 1OMOA 1EJ0A 1D5WA 4B6RA 2X5NA 1JGTA 3LKVA 4E5UA 2E85A 5J40A 1MH9A 3A1WA 4I5DA 3H9QA 1QP7A 4C5AA 1JMVA 2CSUA 1H6DA 2FPXA 3D6VA 4P6VF 2D5BA 2WUDA 3LLCA 4UVGA 4M1QA 3FDFA 2WIBA 3MWGA 1D1TA 4DYHA 4K9NA 5I7VA 1A98A 2OT3B 3NAGA 1XK7A 3UF0A 1KC3A 4GYWA 3H8WA 1B6TA 1JHAA 1K66A 3BF8A 5K6AA 1RTKA 1AXGA 4KWTA 4V0ME 2ONCA 3SIXA 3RRXA 4A91A 4EEKA 3KV3O 1DDOA 4CW7A 1JG4A 1I7SB 5KIAA 1B1AA 2G67A 4Q47A 2W4IA 1Q0ZA 2BHTA 2QRGA 2ES4A 1I0LA 4DCGA 3LE8A 4MV7A 3U56A 1XDGA 4XTCS 4B44A 3IR5A 4EZEA 4B9AA 3AWDA 4MNTA 1R27A 1PGNA 1JQBA 4UHCA 4Z9XA 1F7UA 3ZR4B 5D85A 1EVIA 3CW9A 3NVMB 5I6DA 1RYDA 8ATCA 1I3OA 1YB6A 2ADFA 3R5TA 3AL2A 3AHIA 3F74A 1BJRE 4WLOA 4X00A 1QPZA 1NL3A 1P0CA 2DCMA 4YPFA 3ZU3A 6ABPA 1VG8A 2BFMA 3VHQA 1QHGA 2ILTA 2WJIA 3OE5A 4N3BA 4YN3A 3TIXB 3CEPB 1ZISA 3BD8A 3NHPA 2F7SA 4HHEA 3NTVA 4LK2A 4B8WA 4BIMA 5I45A 4NFLA 5EJ4A 3GBPA 3PNVA 2V4MA 2WHPA 1H2YA 2OBYA 4NJOA 2VSXA 2Y0PA 4JLAA 1EP9A 3OUUA 2FAXA 4E7OA 5K0ZA 2X7XA 1MORA 3LUFA 4YXWD 1WSDA 4X54A 1JG6A 3PCXA 2I62A 1X1TA 2R1TB 1Z6PA 2Z30A 3ILHA 5F73A 2E4WA 4LWPA 1KEEB 1W36C 3HV0A 1O6ZA 3AEKA 5D84A 1PWHA 4HN4B 1PW5A 4B46A 4RCZA 3S5JA 1QG6A 2ZUUA 1H9AA 3E8SA 1E3SA 3MJCA 2A0KA 2CLHB 221PA 2XE6A 1ADYA 3FVVA 4JNKA 4V0KA 1JHVA 3RYFA 3ZDCA 2WAXA 1GYPA 1T24A 1VKNA 4PSUA 2R6CA 1T36B 4Z4HA 1OPRA 3DAHA 4OXQA 2XWPA 1QIDA 2AC4A 4R8SA 3IT1A 1Q1GA 1RYNA 5G4KA 4GLFA 3TOSA 1S8NA 3AFIA 1RRGA 4MQLA 3K1AA 4FMCF 3CHYA 5ANRB 3C3MA 1OYWA 3ROXA 5BV2P 2OV4A 2X40A 1QCZA 3R8CA 3A1CA 2XCLA 1H8ED 3I2KA 1RI5A 4IWYA 4X84A 5G40A 1DTEA 4X8HA 4BTLA 5EJ7A 1V71A 2EKDA 3WIBA 4V03A 2VF5X 5IW8A 1NI5A 4GSYA 1JXAA 1KSFX 1OXVA 1JFFA 1K97A 3RIMA 1QS0A 4YJGB 5DW0A 1WXQA 2RGBA 2YW9A 3G8DA 4AURA 1NVVQ 2A84A 4UEOA 1LPMA 2CVZA 1XEWY 1NM5A 1I10A 1QFZA 4EW2A 4R9RA 4LTMA 1E1CA 1KYTA 3SEQA 5L3SB 6REQB 2CJWA 1GSIA 3W8DA 4MCHA 1II8B 3GNQA 4TLLB 4G6ZA 1U7TA 2VCEA 1NBMA 4QXOA 1LW6E 2AX4A 2ZWOA 1IUPA 1VL0A 1PBTA 3V1LA 2PGLA 4AJIA 5JANA 4EL5A 2IY9A 3P2KA 4LZNA 2Q28A 4DMMA 3Q7SA 2BSXA 4F2HA 3IHKA 4PG6A 3G5MA 1U6IA 3SJCA 3FJOA 5AJYA 4JT4A 1BYUA 1T3GA 4FFBA 3TQCA 1V2HE 1LZLA 2FN7A 2JD0A 1HNNA 2D5LA 1O87A 3C2QA 3I4CA 2PX2A 1L8QA 2BV3A 1UMDA 1F2VA 2V0NA 1ZGJA 4J4TA 4P3XA 4G4SP 3RROA 1UPTA 3STUA 3THYA 2PN1A 2WM9B 5AKJA 4ALMA 1K68A 3VISA 1TT7A 3AC0A 3O7WA 3RKSA 1ZM9A 3SEZA 1WV1A 4GLJA 2E6UX 2XDWA 4M0KA 2FE1A 4G89A 4M0FA 4PCAA 2B37A 3E9ZA 1PKEA 3UPTA 4F3KA 3I6BA 3UW1A 2FWIA 3IP8A 2AEJA 3OQIA 5HE9A 3VPDA 1Z63A 1QH9A 1QGZA 5DOZA 3F8WA 3LDFA 4QUJA 4LCBA 3F7OA 1E5DA 5KSYA 1BDIA 1FE8A 2GOYA 4I3HA 4OJYA 4QRIA 3JZIA 4TLMB 2W43A 4JR0A 5TX7A 5K2MA 1P2VA 3B1JA 1KERA 1T3LA 4FX2A 5C7OO 1ZGGA 1KXJA 3K9GA 7ABPA 2YV5A 1S3SA 3B8EA 2W6IA 2JFXA 4H7PA 1WSWA 1EGQA 3DL2A 1UC5B 4CJXA 4DN6A 4DRXB 1SAYA 2C9ZA 1E1QA 4FHFA 3LQQA 4PPNA 4I4TB 3FOCA 1U2DA 2DR0A 3A36A 3WMXA 1GDHA 4LPSA 4BJ5A 4L0MA 4QPPA 2BWJA 3RC3A 3ZBTA 3H4VA 2PUHA 4AYWA 4BNLA 2HSJA 3QVMA 2GN4A 1YFLA 2Q1UA 2OBLA 3HFRA 3T3IA 1KJ9A 1BDBA 2I6UA 3IUQA 3N76A 4D5GA 2QT0A 1IG3A 1CP2A 4CQMD 3ABRB 3NNNA 4IDCA 1IBMB 1Y6FA 1OVGA 1J20A 3F1KA 4X5OA 5BT8A 1GSHA 4A36A 3VI4B 2HBRA 4IX9A 2FWBA 2OO7A 4D4JA 1VJCA 5AHXA 3L1VA 2F43A 3QXGA 4G9EA 4M1KA 1R6DA 4F2DA 3IR7A 1KKUA 3QPWA 2R86A 2GSWA 3PFGA 1AUVA 1G98A 2ANCA 3ZHSA 4DREA 5JAMA 5JJLA 1SU6A 4OB7A 3SX4A 3TTTA 1ZU5A 2C5BA 4RM3A 3VPSA 3WBFA 2YBDA 3SFVA 3QFCA 1R6BX 3F9IA 4MVJI 5ALOA 3FNQA 3AGPA 5JPDA 2PRZA 5C1BA 4UQOA 4Q9LA 1EVQA 2PX4A 2WI8A 1RAEA 3BCRA 3MOIA 1SIBE 4M1SA 3VSEA 5KYYA 3PNPA 2AS0A 4HDCA 1P44A 3D6UA 4BNJA 1OYVA 3M5PA 4R2JA 1ACMA 1YVDA 2NSDA 3NC4A 4X6UA 1SC9A 1YZTA 2PMFA 2BH9A 2VA9A 2QMOA 1XYYA 2IEAA 4WKOA 1AB6A 2B1GA 1VJDA 2QXUA 3E9QA 3L7LA 4L4UA 1LC0A 1JR2A 5EMNA 1QX3A 2P9HA 1GQSA 4Y9TA 1TADA 2AEMA 5EMJA 4UNQA 2W93A 3K4PA 2M2IA 2ZIWB 2Q0XA 3JQEA 3KLBA 1L5QA 3RADC 3T3GA 3ZVKA 5JW6A 5KKNB 1DAEA 1EE2A 3F5FA 1EUDA 1WCIA 1EE1A 5IU6A 2BMAA 4QODA 4P36A 4ZCTA 3VNQA 3LXUX 5JRZA 4Y7CA 4EFLA 3A3PA 3UC5A 4NTZA 4R1TA 4IDDA 1UKZA 1C0IA 1PR1A 2H48A 4M9XA 3SFTA 3P96A 1EQUA 3CKLA 2B8NA 2QVBA 3NYWA 2PH1A 4B81A 1ZK3A 3GFTA 5KBYA 1NBEA 2HO4A 2OM2A 1NMXA 3BMCB 4H3KB 4KFRA 4LG1A 1MFPA 4L6IA 2Z4TA 4G5QA 4WN9B 4GMHA 4KVAA 5EP1A 1LX6A 1QKKA 3O3MB 4NU5A 5I7UA 4WLVA 3TG2A 4JMLA 2WMDA 4OX9Y 2AHRA 3GAFA 3KCNA 5L7TA 1GT6A 3FFAA 3GRRA 4PVCA 4BECA 3GLHE 1XMSA 1V6CA 3WO1A 1T8YA 1LB1B 4GOKA 4HVTA 2Z2YA 4P4UA 3TMAA 1LBQA 3UAYA 4BEWA 2C4UA 5TJHA 2W6PA 3L9WA 1KI3A 4HNUA 4X66B 1P7YA 5JTTA 5JATA 4ZCIA 2FR8A 3G8BA 4EPRA 4Y1EA 1NULA 5GP1A 1M1YA 1CHNA 3RU9A 4P35A 3SXUA 1TTTA 1D5CA 4EX6A 2OP1A 3CUTA 2IBSA 5JVDF 3H3XA 3QM1A 1WCYA 1XN1A 3B3JA 4TVKA 4ZZ3A 4OHKA 2QR5A 1NXQA 1CE8A 2IU3A 2NT4A 2PH3A 4F93B 1L5RA 2JLCA 5LB4A 3KETA 1DAMA 5K9ZA 4D8TA 1X9GA 3IDZA 3SF8B 2O3UA 1H3NA 3WSVA 4JAVC 1O9BA 1OX4A 3QVSA 4JUAA 4NJEA 4AJLA 3HZOA 4IG9A 4A0GA 4EMTA 3OZWA 2XB4A 3LX8A 3GLFB 4E94A 3ZJVA 2RI1A 4LYFA 4WY2A 5CB6A 5FX2A 3ORYA 4WASA 1RLTA 2QLLA 3H3JA 3NUGA 3Q6MA 4BZXA 5BW4A 3T1YB 2IQIA 2SNIE 5GVRA 3P4UA 1Z5VA 2OG1A 2XMBA 3L2OB 4RNCA 3MC1A 2ECFA 4QKQA 3OZUA 1L4GA 3NTQA 3I32A 2GNAA 3T5TA 2PMWB 4U4AA 1MBZA 4HNGA 2YMPA 2X2PA 5FTJA 3W4IA 1TKAA 2GGSA 1YB5A 2GPBA 2C4VA 3EH1A 3ENKA 1XRMA 4D26A 1ZMRA 4RTNA 3OWOA 1XTIA 4M0CA 4X0EA 3RVKA 3DE4X 3V1UA 1LXCA 2X2FA 4Z1MD 2QRZA 5B3JC 1GZSA 4BZWA 5JPIA 1A72A 1AQIA 4OHRA 1F48A 2DWQA 3EZ6A 3AB3A 4HH0A 3IVRA 3QLUA 1P1BA 2X0DA 1JFRA 2O2JA 3FWPA 4J9UE 1J70A 2X77A 3DFZA