1UEJA

Crystal structure of human uridine-cytidine kinase 2 complexed with a substrate, cytidine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
211
structure length
205
Chain Sequence
b'EPFLIGVSGGTASGKSSVCAKIVQLLGQQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine-cytidine kinase 2
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 205
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1uejA00
2DWPA 1E98A 1ZD9A 2Q21A 1RRPA 5HE9A 2ZRHA 4XD7D 4M9XA 2OG2A 3CWQA 4AKEA 5HZHA 5M04A 5CDFE 5F98A 4Q9IA 1Y3AA 4D81A 4DEXA 2RGAA 2CK3D 3U3OA 1ESNA 2WWYA 4FD2A 3U2QA 3FPAA 3A4NA 1P6XA 1CU1A 2XZLA 4DDWA 1GKUB 5FOSA 2FV8A 4RD4A 2B6HA 2ZRDA 2F9MA 1T5LA 1TU4A 2PH1A 1XD8A 5FOWA 4Q03A 1GKIA 3H4MA 1I4DD 4B75A 3OE7A 2VP4A 2WIAA 5E95A 2OCYC 4I1UA 3VX4A 3KFVA 4JT2A 3EPKA 1JEDA 3QXHA 2DB3A 1JECA 2B8TA 2ZVQX 3FYHA 2ZJ2A 2A5GA 4AURA 1F6BA 3B7GA 2W00A 4QXAA 3TUIC 4CGZA 4O2LA 1KO5A 2J0UB 4GRAA 4HDCA 5FPHA 2AWNA 4HUTA 5AJZA 2R65A 1UFQA 2ZRKA 3EA0A 3LXRA 1NN1A 5FPYA 2EFHB 5L3VA 2R62A 5AUOB 1SVSA 4NZYA 2QQ0A 1NN0A 3U3MA 1ZC3A 3MJHA 1DE0A 1E2QA 4JBWA 3EPJA 4PX9A 1JEEA 4A36A 4DCTA 3FDIA 4HZUB 3PV0A 2PEZA 4HLUA 4PHHA 1F2UB 4ARZB 4PAMA 5CLQA 4YMTA 2CL0X 1G20E 1T0HB 2QT1A 4KVGA 5BXQC 4NYIR 2FFHA 3AVXA 3AUYA 5FL7A 4N0DA 1P2SA 1YR7A 4XVRA 4BFTA 4F7WA 3CLVA 4DCVA 4G5QA 2GVDC 1D2NA 2ZRFA 4LK2A 5JMTA 5JI3E 1G64A 1M34E 2AXPA 2OFXA 2N1BA 1GWNA 2WBLC 2WWWA 2AFIE 1S3GA 1E4YA 2RGDA 4NCNA 3WMGA 2EYQA 2JCSA 3RS0A 4QHSA 3EC1A 4GFDA 1E9RA 4EJSA 2D3WA 1DAFA 1GP2A 3OEHA 2E9SA 4AYTA 4ESHA 2C99A 4Z1MA 1E2GA 2ZUDA 4PQYA 4TMTA 4LSGA 1YZNA 2A5JA 4JLPA 4L9SA 5AUNB 1XPOA 1EWQA 4GBMA 3CRMA 4LYFA 2C04A 1BMFD 1E9CA 2QPAA 3NXSA 1H8HD 1N3BA 3FFBA 5L3RA 1XTSA 3TAHA 1XXHE 1CJUC 2F7SA 2LWIA 1G3MA 3K53A 2W83A 4IFEA 4PO9A 2QGZA 2TMKA 3AVTA 5AWFC 4HZIA 1VKJA 1ZM2A 1G16A 2OAP1 3PQCA 3RRMA 5JCZA 1ANKA 3PR1A 1A2BA 2IYSA 2JJ2D 1N6OA 2QP3A 1Z08A 4GP6A 4Q4LA 2DPXA 1XBTA 1HT2E 2WMNB 3FE2A 1FMJA 3IUYA 3OAAA 1W0JD 3QNUA 2HEIA 2WAXA 3K0FA 2A78A 5H1YA 2IC5A 2O0HA 3HR7A 1JI0A 3RRZA 4OK5A 1FQKA 4BASA 1Z6XA 2GXUA 3ZLJA 2WZQA 2YV5A 3EC2A 3THWA 4LCBA 4Q1AA 4QJ4A 1LS6A 2IF2A 2NO1A 3K09C 3AKCA 2ZROA 4PZLA 4PSAA 2NPFA 2PCLA 4BLOA 4DT1B 2B8WA 1YR8A 1C1YA 1G9XA 3ADCA 1N5JA 4URXR 3QEOA 1HA3A 1QZXA 4QM7A 2REBA 1YE8A 3BRWD 3DPUA 3QPWA 1CIPA 5JJIA 5LD2C 2FZ4A 2QTVB 4HLCA 3S1AA 1XZPA 1QVRA 1G5PA 2A5YB 4ZDKA 1EXMA 4MRSA 3NWJA 1ZM7A 1FW6A 2ZRIA 5B57C 2PZEA 4M1OA 2LKCA 4EIWA 1NBMA 4PSVA 1CJTC 1HTWA 4NONA 5B2ZA 4U00A 4EQ6B 1SXJB 3CBQA 1HV8A 3BB1A 2VHQA 3E70C 3O8DA 4M1YA 2O8DB 1E2KA 3DZ8A 2VIIA 3KQNA 1WBBA 3PEYA 1YZQA 3A1VA 3VX3A 1Z6TA 3TQFA 2FSIA 4A8JA 3Q7QA 1KAOA 4HLDA 3M6AA 3C5CA 1NVVQ 2ODWA 4ON9A 3KQLA 5A5GA 2JATA 3ND9A 4NPHA 5IDVA 5A4JA 3LQQA 3EZ7A 3LY5A 3KFXA 3QBTA 5JZVA 3ADDA 4FN5A 5DIFA 2JLSA 5FBRB 2VHJA 4D0GA 2REOA 5HPYB 4E07A 3U4QA 1IY1A 4TLDA 1WBDA 1V43A 1UBFA 4PFSA 3REGA 3QKRB 1G5TA 2RMKA 4HAUA 1Q3TA 1Z83A 4JS0A 3HR8A 5EE3A 1SGWA 4LC1A 4A4DA 1O3YA 2BCGY 2GDJA 3H1TA 1KI6B 3TVTA 3RHFA 4Q7JB 2BBSA 1DOAA 4MYCA 1F48A 1RRCA 3ICQB 4V0MA 4AC9A 2D2FA 4LPKA 3JVUA 3KB1A 5EQTA 1YKSA 1VCIA 3EXAA 3P26A 3UK6A 5AJWA 1UJ2A 3QBVA 2ZANA 3I4LA 1K6MA 4L8GA 5JJLA 4TT3D 5ELXA 4TLBA 4LYJA 1P2VA 2WWFA 5FUXA 2GJ9A 1E1RD 2QENA 3AUXA 4IFBA 3TIFA 4B3BA 5GJBA 1ZP6A 4DJTA 3SDZA 1ZUIA 1KK0A 3KL4A 1TMKA 2AN9A 4I1SA 4ZPXA 5GVSA 2VF7A 3IO3A 2GCNA 3KDSE 2IT1A 1E9BA 2XNSA 3F5FA 4URUR 1E2MA 2P67A 4GI7A 1XEXB 2QN6A 4TMZA 3HYRA 1E69A 5FPTA 2PJZA 4E22A 3Q8XB 3QE0A 4LDJA 3W6OA 4XWKA 2XJ4A 2VEDA 4QL3A 3PUZA 1ONBA 3GLIA 3L0SA 5A0FA 2F1JA 3GLGA 1OXXK 2VP6A 1XTKA 3FMIA 4A2PA 2DCUA 2A3RA 3RABA 1XB2A 3C4JA 1LW7A 2QE7D 1LF0A 3GEIA 3LD9A 4FWIB 1VYUA 5J4YA 1HYQA 1P5ZB 2ERYA 2J7PA 3RDPA 1N0WA 1KI9A 1VPLA 2YWFA 1UDWA 5FTNA 1L4UA 4HLQB 3T1TA 2FFQA 1QHSA 4PPNA 4Y0AA 5LD2B 1D2EA 2JJ1A 4DSTA 4CEJA 1D5CA 1U9IC 1RJ9B 5E7MA 3QEJA 3PUWA 4M1SA 3U5ZB 1E2PA 1EFTA 2C9CA 4HAWA 1P72A 4A9AA 3DL0A 2O8CB 5JEDA 3A36A 3GD7A 3KZ1E 3KB2A 3UIEA 3WNCA 1KAGA 1JXOA 2GBLC 3G5UA 2X2EA 4PQFA 2G6BA 1CS4C 2ORIA 1W4CA 4Y0VA 2PZGA 1SULA 2VH5R 1Z0KA 2O0KA 4ILEA 2V9PA 1HE8B 1TNDA 3PCRB 4C0QC 1E0SA 3P4YA 2PMDA 4Q18A 5FL3A 5TMPA 2OLJA 3P27A 4Q9LA 4C30A 4KFRA 4OQLA 1OJLA 2QU8A 2AD1A 1CJMA 1S4QA 5BQ5A 1A1VA 2AK2A 3T12A 3EA5A 4II7A 4B33A 4X8LA 2WKRA 2VRWA 4XIGS 4H9GA 4B6FA 2VHUA 4HATA 1UM8A 3WHLA 2XOKD 5K8UA 4D25A 3A4MA 2D2EA 1F2TA 4M1WA 3E1SA 1WDTA 2ZEJA 4C0HA 3LV8A 5BYKA 3I73A 4P33A 2CXXA 2G1JA 4PHGA 2ONKA 1U90A 2B21A 1NY5A 4B2PA 1NJGA 4D4LA 4ZIRB 4G5RA 1CEEA 4V0NA 1KKMA 4A0RA 3B1XA 4DLUA 4UJ3A 2FH5B 1X6VA 1UKZA 2QRZA 2WWIA 4G01B 2GETA 4MKIA 1NKTA 4ERNA 2JIZD 2C8VA 4UNSA 2ORVA 3GQBA 2ZI4A 4C3ZA 4D4JA 1NLYA 2NO9A 3QKSB 2F1HA 2G0NA 2P3SA 2NO6A 4G5SA 4FCTA 3QI2A 4KXFB 4B76A 1NSFA 2J59A 2V6JA 3HPQA 4Q4JB 3UMFA 1SKQA 1ZNZA 1J70A 2ZREA 3FHCB 4DB4A 3LA6A 1TQ6A 1RKBA 4URWR 1OSNA 2BM1A 4TYPA 4CW7A 5BN5A 2QM7A 4OK6A 5J47A 1E4VA 3UATA 1S9DA 2EWVA 1E0KA 1S0UA 1SVWA 2WMOB 2F1IA 1VCOA 4BE7B 2FWRA 2HT6A 4QGFA 4WAUA 1ZM9A 4B73A 1U0LA 2IS2A 1D8TA 1LV7A 2VSFA 3D31A 2XNDA 4FI3C 4L4UA 3CZPA 5DI3A 3RAPR 1CR1A 3REFA 4LHZA 2JDID 3BOSA 1OXTA 3QIAA 1NIJA 1ZIPA 3A1UA 1T8TA 1IXRC 4Q9JA 2BMEA 3A37A 2CHGA 3RVBA 3QY0A 3BAFA 2QPOA 2ZR9A 1RPZA 4PZZA 4RZXA 3IQWA 5TDHA 3LBNA 4LBWA 4B44A 3MFYA 2OBNA 1VG9B 3T1QA 3T5DA 1XZQA 2Z5FA 5CIQA 3M1IA 4LYHA 5FTKA 4A0HA 1Z5ZA 5H8WA 1TPZA 2CBZA 3GJ8A 3O8CA 1ZUHA 3W9YA 3AEZA 2EQBA 4Q7LA 4JLMA 1KTVA 3RS4A 3HU2A 1OF1A 3TR5A 4OHWA 1VYVA 5LDDC 5EXXA 3CPHA 3SQWA 2XXAA 4KJZA 2ZJOA 1WP9A 1W7AA 2CLSA 3LAWA 1ZU4A 1GNQA 1M6NA 2REXB 5GVRA 3W6PA 1EK0A 1W36C 3U44B 2PL3A 2V6IA 3ONWA 1PLKA 2FZLA 2HJVA 2GJ8A 2QP4A 3KXLA 5JFGA 4BFYA 4TLAA 3IGFA 1R0WA 1GRRA 2WTUA 1YQTA 3DVLA 1OV4A 3FMOB 1CRPA 3O8RA 1DBSA 1ZD1A 2IYYA 2OV2A 2HJGA 4F91B 2EWWA 2A2ZA 2AFHE 4LJYA 3SEAA 3QF4A 1P9WA 1XCGB 4NKRA 1JPJA 2MSCB 4BRWA 4DCSA 4TL7A 3V00A 3VKHA 4KU4A 4UNPA 4C2TA 4Q00A 1EESA 1R8SA 3RNLA 1Z0IA 5E4FA 3BH6A 5BW8A 3OIVA 4HB2A 4O25A 3KKPA 4FINA 4JVNA 3SI7A 3ZVRA 3VR3A 1Q1ZA 1CULC 4HLUC 1S2MA 1W36D 1IN7A 3E2IA 1T6NA 3GJ7A 2IA5A 5IF9A 4LGMA 4DEYA 4OQXA 5C4GB 3CONA 3QSYA 4AKGA 3R8CA 3C15C 1K8RA 1W4BA 2F43B 4JZKA 1FTSA 1TF5A 5CJPA 2Q9BA 3VR6A 3WBJA 4RD2A 4LJ7A 5FUWA 2WAYA 3AVVA 1Q1QA 2OXRA 4BLRA 2J0SA 4DUGD 3QQ5A 2ZYVX 2JLYA 2Q3FA 4GOXA 1B23P 2XSZD 1OFUX 3A58B 1TQDA 3ZH9B 4BEJA 1Z6GA 1E2DA 1XPRA 2PLRA 1AKEA 1S8FA 2IEYA 3K0CA 5AJXA 1JBKA 1DO2A 3V4RA 4WXPA 3KTAB 4IXMA 1PV4A 4JYCA 2WJJA 2PLFA 3THXB 1QHGA 1P2UA 4LJ8A 3IEUA 3W6NA 5D3MB 2FFBA 3K0EA 1GRNA 2YKGA 3THOA 3CRQA 1E9AA 4Q4HA 1OH7A 1CF4A 1NP6A 1TEXA 4Q9KA 5E7JA 2PEYA 3NDBB 2RH5A 1WCV1 3A1SA 2ZS9A 1N25A 2FNAA 3I3SR 5JEEA 1ZNYA 4V02A 1Z47A 2I3BA 5LB4A 5F3WB 2O8BB 1X86B 4EPWA 1OKKA 2VP0A 1DPFA 3GLHA 3B82A 3QF7A 1TX4B 1QHIA 1S9HA 5SZIA 3RS2A 2GEUA 4WIAA 4NH0A 4MGIR 3TK1A 3RC8A 1T4GA 2Q6TA 2QRNA 2GF9A 4MDEA 1KI2A 1NBME 1NVVR 3TLXA 3SBEA 1N5IA 3VHXA 1DAKA 1MABA 5EJEA 4AG6A 2ZSAA 2FEMA 2IYQA 4IVPA 3M0EA 2D4HA 3ZVMA 3IEVA 3ZJYA 1L4YA 1SZPA 2C77A 3H2YA 2UZ3A 3TMKA 4YONB 2ZJZA 1G4AE 1VYTA 5EXSA 1W36B 4HB0A 3THYB 4MUBA 1U8ZA 3B85A 3VR1A 3KXIA 3EZFA 3NHAA 5JSZA 1IONA 4HDOB 4LJ9A 3KJGA 3F0TA 3QG1A 4M8NE 4XWOA 1XCMA 1IHUA 4LBVA 4OHZA 3HWSA 2QMEA 3BH0A 4D0NA 1A82A 2W2XA 2V7QA 4B3GA 1E2JA 3C14C 3EW9A 1II8B 4WBSA 4NHOA 3ZS8A 2DYKA 2RAPA 1KMQA 3ADKA 3GLFA 3EPLA 1T0JB 1J8YF 1G21E 3OFND 1KSFX 2BKUA 5FFMA 4Q5IA 4DCUA 3KX2A 3EX7C 3NVAA 2KWIA 3K70C 1X3SA 3F3YA 2XJ9A 5CB6A 1GVNB 4KAXA 2XAUA 1XD2A 4A92A 2BMJA 2QG6A 3MG9A 5HTKA 4C2UA 1EX7A 3PEVA 3UWKA 1B0UA 2W58A 1C9KA 5FBQB 2WIBA 4JJKA 2XITA 1PJRA 1AS0A 3DMDA 2MSEB 5KPJA 1TAGA 3RANA 4LHWA 3K9LA 2EU8A 1NMXA 1TEVA 3BB4A 3B60A 4LJAA 4OHYA 3DEFA 4B48A 3BK7A 2VL7A 1XJCA 1BH2A 2H5EA 2QMUA 3ZIAD 5CITA 5SZKB 1YJ5A 1FUKA 5F9FA 4UQOA 4OI2A 4F4CA 1DG3A 3T61A 2IL1A 2JASA 4RZUA 5LB2A 4JBYA 3K70D 2QSYA 1COWD 4IRUB 4RCZA 2B92A 1IAQA 1ZM3A 1VTKA 4Q1DA 5EXPA 4QC2A 4P4SB 1KK1A 2BV3A 2FPLA 5AR1A 3CX8A 4PXAA 1RRFA 4JLVA 1XMVA 1ZYUA 3H0KA 2GF0A 1NVXQ 2IHYA 3ASZA 4C0AC 1ZCAA 1HUQA 4IVQA 5UKDA 1ZBDA 1TF2A 4QRHA 4E5UA 2GWHA 2QUZA 3Q85A 2ZRGA 4D4KA 3GJXC 4LY6A 3M4YA 4S35A 4Q9HA 4B2IA 3FWYA 721PA 3U7GA 2QBYB 3C16C 2HDNB 2QY9A 2AKAB 5AUQA 4K81B 2WJVA 2ZIAA 3NC1C 4PC1A 2RGBA 2VQSA 2N42A 1EFRD 2ZR7A 5GJWC 2CJWA 4X8MA 1W0KD 1BO6A 1Z2AA 3AF4A 3CPEA 3PUYA 3W8RA 3W90A 3P32A 3TW8B 4KYIB 2F1RA 1J90A 1UEIA 2J3EA 2H57A 4YXWD 3PITA 3BS4A 3MWKA 4AYWA 3X2SA 2G83A 2I1QA 1DAGA 3TH5A 1XD9A 4Q02A 1ZAKA 5HKKD 4CEIB 1G1MA 1QHHA 4JJZA 5TXGA 4JT4A 2IXGA 3VR5A 2EFCB 4A15A 3WMFA 2R8RA 2KBEA 5IHPA 1NVWQ 4FCWA 5EZ6B 1KO8A 5P21A 3B8HA 2HYIC 2YOFA 2QTFA 2RGNA 3ZZ0A 2QNRA 2D62A 4N1AA 1ZNWA 3VFDA 2CVHA 2OBMA 1Q44A 2VSXA 4M1KA 2H92A 2ZVPX 3OIWA 2WV9A 3VAAA 1YVDA 2AR7A 2GJSA 3GJ4A 3OEEA 4NU0A 2QTHA 1WXQA 1FTNA 1XF9A 3AKEA 1E79A 2IWRA 1QHYA 4NYMQ 4DC9A 4JSTA 2O0JA 2RGGA 3IILA 2J7PD 5KTYA 1E2FA 3EIEA 3IHLA 2C95A 4XJXA 3B1WA 4V03A 1NF3A 2J87A 3KKOA 3SJBA 1E3MA 1GITA 2AKYA 2CLCX 3LVQE 2WSSA 1OFTA 1J99A 4LI0A 4OJQA 5CK5A 1EFHA 1Z07A 3GJ0A 4Z51A 1VDZA 1NL3A 1SVIA 4PC3A 1CJVC 2O8FB 1G8GA 4Q1CA 4RD6A 1QF9A 4J0QA 4QG7A 1D9XA 3QKUA 2ZE5A 5J40A 1LFDB 1XMIA 4TYNA 5L3SB 2J46A 1E9FA 2QAGC 3AP2A 1KDRA 5EUMA 3T06B 4AYXA 2AK3A 1G6OA 1UDXA 3RWMB 2DWOA 5KSOA 1W5SA 1OIXA 2ZETA 5EE1A 4TN1A 2WOJA 4QHTA 3R9WA 3BB3A 3EWSA 4Q21A 1EWRA 2EW1A 2BIFA 3ETLA 2ZRBA 3BE4A 3Q5DA 4S2EA 4YC7A 5FOXA 3SHFA 3IQXA 1F5NA 3T34A 4DLXA 2GK6A 3NIBA 5FR1A 1RW4A 3W34A 2D7CA 4HB3A 4MRRA 4O2RA 4ZCMA 1M2OB 5JWRA 3PEWA 1GAJA 2R44A 2GTPA 4DDUA 2VSOA 2ZE7A 1A2KC 4LOAA 2NO0A 2DFKB 1I4LD 3TUJC 4OQNA 4MGYR 3X1DA 1MR3F 2CLDX 3PJRA 3L0IB 4JL6A 2GXSA 3HU3A 3MRSA 4LJ4A 1T3HA 1HEIA 5FBVB 2UVQA 3UG6A 1MV5A 3I92A 2CL7X 1D6JA 4MA4A 2J0UA 3GEEA 2I4IA 4M2LA 2OXCA 2OILA 1OH8A 2ZRCA 1YZLA 421PA 4D6PA 2P0EA 1R5BA 4GOKA 4CRWB 4P0TA 3I32A 3KJIA 4RSGA 2QPTA 1G3RA 2QAJA 4GP7A 5TY0A 4MYTA 4F4IA 3VR4A 2CE7A 4HZUA 2OO7A 2PCJA 2GA8A 1GSIA 3CIOA 4JLOA 5ANRB 1VECA 1F2UA 4ARZA 1T5IA 4BRUA 1KO4A 3O47A 3IBGA 1Z0DA 4MGKR 4A2QA 4JBXA 4YLGA 1ZVQA 1W2HA 2ZPTX 2BJWA 3B1YA 3GFPA 2WPDA 4JKYA 1XMSA 4HAXA 3ZZUA 1ESMA 4DKXA 2ZM5A 2ZUCA 3VQTA 4TQ9A 3A1TA 2CE2X 1KJYA 4KI0A 5BWMA 1XWIA 2BBWA 4L16A 4G3XA 4QGAA 1HE1C 2ZRJA 2ZI3A 3SJZA 3DDCA 5D3QA 1DAIA 3V9PA 3HDTA 1YR9A 4US0R 4W9MC 1R5NA 5G41A 4R2HA 4C0SA 3BH7A 1XEFA 3LX5A 3N70A 2RGCA 5G3YA 2CK3A 2Z83A 2YZ2A 2NZJA 1NSTA 4JLBA 3ZQ6A 3K0AB 1IY2A 3SYKA 2IYRA 2WOOA 3KJHA 2ERXA 4B3XA 5LBIA 5JRJA 3I1FA 4V0OA 1WE2A 2DY1A 4JLNA 2YYZA 4DHEA 3VNUA 2H17A 1E32A 2Q0HA 4JLAA 1AS3A 1W4AA 3AVUA 1OYYA 4NCIA 4B6EA 4G0NA 4CF7A 5CK4A 2VA8A 1ZD8A 4LX0A 3WXMA 1N6NA 5JS8A 1A4RA 4OHXA 3UWOA 2QAGB 3EZ6A 1LVGA 4MKGA 4PC7A 2DBYA 4URZR 3FKSD 1HH4A 3L0PA 3TSOA 4ASUA 1AA9A 1XTJA 2CDNA 1N6IA 1NMZA 5TARA 1JAHA 4EPTA 3LLUA 4TTPA 3VKGA 1XXHB 4Q7KA 3EASA 1OIVA 4DT1A 3IIJA 4KBGA 1TTTA 1LF5A 1W1WA 1XX6A 3LWNA 4DSUA 3KKQA 2ZSEA 2JLZA 1GFIA 4FMDB 1KOFA 4AWXA 3FFAA 2ZUBA 5KOYA 8OHMA 3NH6A 1KK2A 1U0JA 1KJWA 3RS5A 1JXMA 2ONJA 1JB1A 1P7CA 3AKYA 2YWGA 4ZI3A 4LJ5A 4MITA 3PVSA 3R7WB 1MO3A 5FUYA 4QBGB 4EQ6A 1SXJA 4GSYA 4CT5A 2FG5A 3CX6A 3NHBA 1E2NA 4ZDWA 4AD8A 3D6TB 2O8DA 2OCAA 3QVVA 1G17A 3D3QA 3OF5A 3OIUA 1OW3B 5CM9C 1KI1A 2GZDA 1ZJ6A 1HT1E 1UKVY 3SJAA 2IW3A 3VMFA 2ZQ5A 2XX3A 3CH4B 5KPDA 1NJFA 4P3YA 1KMHB 4EDHA 2GILA 2ZYTX 5J4LA 2FU5C 2W6JD 4IEEA 2BEKA 2JLQA 4AY2A 2YC4C 2IUTA 3B9PA 1RFLA 2ATXA 2HCJB 5EP4A 4DLSA 2Z6VA 3BJIC 4DXAA 2ZRAA 3MAAC 1OFIA 2R2AA 2Q3HA 3R9IA 2NPIA 1N6HA 2IX3A 2ZJ5A 2YOGA 4FMCF 1BMFA 3SS8A 2O8EB 2C9YA 4IOMA 4X8OA 3I8SA 2GVZC 1JNYA 3FOZA 4LJ6A 2KJQA 4MRPA 5FUVA 2FE4A 2IUSA 5C2JB 1N6PA 3R20A 1KY3A 2DR3A 3EAQA 3QXJA 2CMKA 1R0YA 3MMPA 4NL4H 2ZRMA 1K5GA 2E87A 4RD0A 1AN0A 2IS6A 3QKRA 4WW0A 3GPLA 1II0A 1G8YA 1W0JA 1QDEA 2HLDD 2NOAA 1BKDR 2BBOA 1KI6A 4URVR 1VG8A 2GAOA 1G6HA 1OKKD 4PPQA 1CP2A 4JVLA 1QRAA 1W46A 2MSDB 2UKDA 5CYPA 5FOUA 4CVNA 2FSGA 5EP1A 3VU9B 1KKLA 5FR2A 2H1LA 4GL2A 4HSEA 2VTKA 3CKLA 1W5TA 2QGNA 1S1MA 3PUXA 4PO1A 5C46F 4TMKA 4A2WA 5KU1A 3BD9A 4FXPA 2IHBA 4CEHB 2P6RA 2CCKA 2FJUA 1R0ZA 2ZAOA 1JR3E 1W49A 3CRRA 5JWOA 1UKYA 5C4MA 2NQ2C 4US1R 4IDHA 1GG2A 2GAAA 1T8UA 1E1QD 4XH9B 4DWJA 4ACAA 3Q7PA 5JS7A 3AB3A 1TL7C 4HDQB 3CR8A 4C7OB 3UANA 2JA1A 2ZRNA 3AVQA 2HUPA 3TR0A 4Q66C 1BOFA 2ZU6A 1XEXA 3T35A 3X1YA 1IN6A 2G77B 3HJNA 4XSHA 1NNEA 4TMVA 4Q4AB 4A82A 2R6GA 1U81A 1FX0B 3CWZA 1SKYE 3NC0C 5IK2A 1JR6A 4RY2A 1MO6A 2BEJA 4RD3A 1YR6A 2W6ID 4OYHA 4BLPA 1EX6A 1I4TD 5CLLA 2EFDB 4DLRA 3LBHA 1GIAA 4I1VA 3GJ3A 3DMNA 4NCHA 1KY2A 4R98A 1HY3A 1NG1A 4LZZA 1DARA 4M9SA 1RJ9A 2QZ4A 4L15A 4PTLA 3PFIA 2O8CA 2XZOA 3W3ZB 4KFSA 4OJKA 4BLTA 4XTRA 1E9DA 4HI0E 1IXSB 2L0XA 3K1JA 3U7HB 1EGAA 3OESA 1JR3D 3IHWA 3ZZTA 3QUSA 2FX3A 2PJRA 3SFVA 4BFSA 4Q1FA 2ZJBA 2XB2A 4D82A 4RFSB 2FEOA 1Q22A 5JWHA 3ZD7A 4OI0A 3R9XA 5L8VA 1MT0A 1Z29A 3K9GA 2IYZA 3ZVLA 4RKFA 4PHTA 2V1UA 2Q3MA 2RCNA 2P5SA 3B13B 4YMVA 4AKIA 3CW2A 1P62B 3FTQA 1G8PA 1R6BX 4WZAE 4NYMR 3AP3A 2CL6X 3PG5A 5L3QB 3U3JA 4EPYA 4HUQB 1ZNXA 2EFEB 4TMWA 1QVAA 1US8B 1U8YA 1HQYE 2KBFA 2RGXA 3LQRA 4DIDA 1L2TA 1E1RA 3T5GA 3C41J 5FOVA 2BC9A 2PBRA 3OE7D 2YWEA 4ZIRA 1NLZA 3CF0A 1G5RA 3L0OA 2H16A 5BN4A 2R6AA 2XEXA 1KSHA 2P2LA 4ZV4A 4C0LA 4IDNA 1UADA 5JJKA 3AV0B 2V55B 2OZEA 4B3CA 3QKSA 5C18A 3I62A 4BZQA 5CB8A 4ESVA 4Q4JA 2DWQA 2ZRLA 2I1VB 2EYUA 4D2IA 3LW8A 3WRYC 4MH0R 3CR7A 4Q7MB 1RYFA 2VF8A 1IJEA 2ZJ8A 5EP2A 2V4ZA 1FP6A 5FI0B 4EJSC 3IIMA 2G88A 5AJYA 5DN6A 2JLVA 1AS2A 1IXZA 4BQSA 5B64A 1IN5A 3AF2A 2ZI7A 1X1SA 4M1TA 2FGJA 3U6KA 1JQJC 2JAQA 4IOJA 2XTMA 1Z0AA 4KCGA 3O8BA 2CCJA 5FL7D 2J9RA 2MMCA 3NTUA 4LV5B 2GESA 5JRZA 1J7KA 2ZS7A 4KVAA 2GCOB 1KJZA 3IKJA 4QBFA 5K8LA 2GZHA 3PUVA 3CF2A 1KI3A 3MWJA 2C03A 2QROA 3OEED 2FA9A 4G5OA 1E79D 1Z0FA 3NH9A 5KYKA 1XRJA 2EVWX 4QHYA 3L82B 4C4PA 3FGNA 3IO5A 1CLUA 2RHMA 2ZE8A 3OEHD 4HAVA 4PAOA 1A7JA 3MWLA 4Z1MD 2BMDA 1I2MA 2BCJQ 2QM8A 4Z8YA 4CT4B 2IYTA 1X1RA 2R6FA 3NG1A 2GXAA 2GJKA 1YZGA 3CPJB 1U9IA 4IXNA 3BIFA 1GTVA 2B7BA 4K8OA 5DE3A 3KUDA 4YDHB 1SKYB 2HXYA 4YMSA 1N5LA 3SZRA 3A8TA 3U44A 3JZAA 2GBLA 1KGDA 2G0TA 1GL6A 3K9HA 4PPFA 1JAIA 2VO1A 2OEPA 1G7TA 2G1KA 1KZGB 5DI9A 2ZE6A 5BYJA 4HYYA 2ZI9A 2WJHA 5DYIA 3CB4A 3RS7A 3MCAA 2V8OA 2CEAA 3EZ2A 1RIFA 3CNLA 4Q19A 3ZDQA 1WB9A 1UAAA 3OAAD 2J0QA 1H8EA 1ZU5A 2GK7A 3U3RA 5C1BA 3PENA 2JIZA 1G18A 4R7ZA 2J41A 2HV8A 2JEOA 4QGGA 4KITB 3RWOA 1U94A 1ZW6A 5KSPA 1KNQA 4GPTA 1QG2A 3MJRA 2VP5A 1WRBA 1OHHA 2J5XA 2Y8EA 2QA5A 4LV6A 2JLWA 2YC2C 2XTZA 1T91A 4QM6A 3TW4A 3VTKA 1CR2A 1EG7A 3QPVA 4P31A 1JQLB 1Y63A 4V0KA 4CYMA 1W47A 1XEWX 1FOEB 3GMTA 1MOZA 1P9NA 3B78A 4A8JC 5B58C 3RS3A 1ZRHA 1KDOA 2QSZA 3I72A 3NBFA 5CYOA 1PUJA 1WMSA 3MSXA 1CKEA 3AF3A 4RZ3A 1UBGA 4DCNA 4NMMA 3U61B 5TV2A 4NE2A 3ZYCA 2F43A 3B1ZA 2H7VA 4NP6A 4XWAA 2NO7A 1OIWA 3OHMA 4ZKEA 4ZKDA 2W0MA 3T1VA 2JDIA 1NBMD 2J7KA 4V0ME 1NN5A 5J4KA 1AQYA 3QPUA 1MO5A 3UG7A 2IYLD 4DSNA 1Q57A 1NN3A 5DHAA 2LCFA 4UXJA 3KQKA 1KYIA 2C5LA 5G53C 1IQPA 3T1OA 4CZ2A 2CNWA 3KTAA 3W3AA 1IBRA 3J81k 1RRGA 3THXA 4M21A 3UMSA 1X8JA 1E99A 4EJSB 1HURA 1P9RA 3HYTA 4MKFA 5D3MA 3RSLA 3A6PC 4FWTA 1G3QA 3C7KA 4XSGA 1TADA 1AKYA 2ZTSA 1M7GA 121PA 2GRJA 2XB4A 4F92B 2QT0A 4LHVA 4ITRC 4DBLC 1T3SA 3ZQJA 3TQCA 1ZMXA 1KO1A 2A5DA 2X8AA 1DEKA 4DLTA 3GLIE 3DKVA 1BIFA 3GLGE 5FTMA 4JL8A 4RD1A 3KQUA 2O8BA 1XTQA 4RVCA 1Q1EA 1S1CA 1AM4D 3Q3JB 2WWXA 3CNNA 3U7FB 1AGPA 1TU3A 2GHIA 5EE0A 3BFXA 1DELA 2ZS8A 4KLZA 1NMYA 1OPXA 2C78A 3EG5A 1Z28A 1E2EA 3K0FB 1J8MF 1E2HA 1SHKA 4U02A 1P3JA 3WP0A 4IEIA 1N6KA 5JHHB 4BLQA 1SXJE 2O5VA 5LPNA 4IW3B 1UBEA 3THWB 1R7RA 1G7SA 2Z4RA 4UXIA 2NIPA 1XTRA 1KNXA 2VHCA 2Z0MA 4Q01A 4QFMA 3U60B 1N5KA 1GOTA 2ODEA 1FP7A 2RGEA 3THYA 2GJAA 3TRFA 3SNHA 2YINC 4B2LA 3TNFA 1FZQA 3WNDA 2IS4A 2FF7A 2FOLA 2F55A 1G7RA 4W5JA 2F9LA 1NKSA 5DLQC 3WYGA 4ASUD 3S1AB 3ZVNA 1G291 2FMXA 3QXXA 1SXJC 3UPUA 2VP2A 1NVUQ 5EZ5A 4A0GA 1OXSC 2ZJYA 2AWOA 1UBCA 4HB4A 4TLEA 4DUGA 1II8A 2WJIA 3HP1A 2XSZA 1E2IA 3H86A 3KKNA 1U98A 5JBQA 1G8FA 3QG5A 1G4UR 4K46A 4WOPA 3LBIA 4RKEA 4RJLA 3I5XA 4TSFA 4EUNA 2C9OA 3B6EA 4UJ5A 5EXTA 1KSGA 4OQMA 3WBKA 3NBZC 2VP9A 4MYHA 1PUIA 4AKHA 1P60A 2KB0A 3CO5A 4A8JB 3ECCA 3P1JA 3C5HA 3UXMA 3JZMA 4OQFA 4KV9A 4RFVA 3QVUA 521PA 4BFWA 4B71A 1Q12A 4KODA 1Q1BA 3VR2A 3K70B 3LNCA 2E1RA 4IVRA 2JJ1D 4KFUA 2AL7A 1OH6A 4Q1EA 1SXJD 3GCGA 4LPSA 4B34A 2HYDA 4DRZA 5HCNA 2QEQA 2FPMA 3DOFA 3SJCA 4YMUA 3SHWA 4FIDA 5K8TA 2YOHA 4MGZR 1M74A 3U4QB 2W0SA 1DO0A 4DDVA 4LHXA 3EZ9A 4QOSA 2ZSFA 3LX8A 1VIAA 3BWDD 4ABYA 2IYVA 3RSOA 1T3LA 4NYJQ 4OHVA 1PZNA 4AI6A 4PHFA 3N2EA 2ZSBA 1UKEA 1FMLA 4DLZA 1BS1A 1GNRA 2HT1A 1JJVA 2D74A 2RB4A 5DO9A 5FBWB 2AXNA 3PIRA 2X19A 1G7CA 4LC0A 1P2TA 4TL8A 3WYAA 4BFZA 4BFUA 1UEJA 3ICEA 4P4SA 4E03A 1QG4A 4KO8A 1MO4A 2NG1A 1SVKA 1G41A 4G1UC 3AP1A 4UXHA 4PANA 5KNCA 1U8AA 3SC3A 3KUCA 2A7QA 3LW7A 4R2IA 2ZI5A 4EPVA 3SYNA 2YVUA 3Q5EA 1YZTA 2IUUA 4GT1A 5FTLA 3TAUA 2O52A 1Z8FA 3ND8A 4FW9A 3I61A 4JLKA 3I5YA 4TYYA 4E09A 4KYUA 2C2HA 3TJZA 3WMEA 2QBYA 4OBEA 2PT5A 1CXZA 4MRVA 1SHZA 4TYWA 1Q20A 3Q72A 2RKOA 2GCPA 4IDQA 4PC2A 3AVOA 1N0UA 3SR0A 4B3FX 4OL0A 3SBDA 2XZPA 4KSCA 4BECA 3ZD6A 1R2QA 1OT3A 1JALA 2FN4A 4BUJA 1S3SA 3N5CA 2A5FA 2OESA 5AJVB 4IKEA 3U6BA 4MKHA 2ZR0A 4CEJB 1NY6A 4BEBA 1IN8A 3TE6A 2IYUA 4W5HA 1Z63A 5FH9A 3GLIB 4KFTA 3OFNA 2RHDA 3GLGB 1OB2A 1KHTA 4TTQA 5KHOC 3SU8A 5CJ2A 4QJ5A 2ATVA 3L43A 4NDZA 2X1VA 4CEIA 4D0LB 4EPRA 1UPTA 1DTSA 4KHZA 1YU9A 1E9SA 4QNRA 4KSBA 2X2FA 1LS1A 1R4AA 2C98A 1TF7A 3H84A 4IOKA 4RCYA 5F2EA 1BYIA 1DG1G 1N0VC 1ZINA 1DADA 1KI8A 2WWHA 3KXKA 3SYLA 3WRXC 2FDCA 2ECKA 1GRQA 3ZS9A 4MDFA 3UKDA 3MGCA 2XNDD 3E5HA 4LWZA 4TQUS 5IK2D 1XTIA 4NCKA 1XCPA 4R71A 4DZZA 3R8FA 1P75A 3LDAA 2VYFA 4XD7A 1SVLA 1SQ5A 5KO2A 3ZIAA 3I8XA 5GJCA 2WWGA 1KSJA 2VHTA 1NI3A 2R9VA 5DHFA 1JJ7A 1M8PA 4MRNA 4B43A 4WA7A 1XDBA 3L8ZA 5EP3A 2NMVA 1COWA 3KKMA 2BWJA 1TUEA 3NKVA 3DM9B 1E2LA 2IXEA 3IDQA 2W2TA 1W48A 4L9WA 5FTJA 3GJ5A 2O8FA 1W4RA 1ZM4A 1VCMA 3WP1B 3BC1A 3L2OB 4JIMA 3A4LA 2FGKA 4M1MA 4WVFA 5FPSA 2OCPA 1TQ4A 2R6CA 5L3SA 5GADl 1GDDA 3MLEA 4M4SA 1F2TB 3V4FA 5DISB 4L5BA 3BFVA 4IDPA 4I99A 1OXVA 2ORWA 3CX7A 4M53A 3OZXA 5TB5A 2Q9CA 2YHSA 3R7WA 5KDDA 4PPGA 5F9HA 2IEZA 1FPMA 4BGDA 2V1XA 4YDSA 2XGJA 1EFRA 4A6XA 4D80A 4F4JA 3X1ZA 2YWHA 3AQ4A 1W0KA 2BM0A 2DFNA 4JL5A 2P6NA 2VPPA 2J0VA 5HCIA 4N3NA 2GZAA 2J45A 5JHGB 1M1YE 5IT5A 1K5DA 3DOEA 3HPRA 3AF0A 1ZUNB 4PC6A 1CTQA 1AK2A 1C4OA 5G40A 1OXUA 1W44A 2QMOA 4RZ2A 4YXWA 5AUPB 1VG0B 2EFGA 2VBCA 3K0CC 2ZSDA 5CDFA 2FFAA 1KO7A 2DFTA 4O0MA 5HKKA 4OI4A 3W8NA 4PAQA 1GUAA 1FUUA 4NTZA 4JVSB 4IDOA 4DLWA 2QL6A 2FSHA 3EPHA 4UNNA 5BN3A 221PA 3GLHE 2OHFA 2CVFA 3FHOA 1ODFA 4IOLA 1E0AA 1IM2A 2HF9A 2N46A 1MRSA 1J2JA 3AF1A 3TGPA 2BDTA 2F3TA 3FMFA 4JMPA 3CUEF 5H68A 5DI3B 4DIEA 4ZDJA 3C8UA 2BVNA 3WHKA 3CRVA 4DLYA 1U0HC 2HXSA 2WKQA 2IXFA 3B1VA 5TVKA 1R0XA 2V54A 4OI1A 1D2MA 5JI2E 3F8TA 1Q0UA 1PVOA 1CBUA 1XEWY 1YHNA 5EE5B 5DN6D 2NTYC 4BPBA 4W7SA 5J4VA 4GMDA 4Z8XA 4US2R 2LKDA 5CIWA 2D7DA 3FB4A 1H8HA 2C96A 2IYWA 3B5JA 2WVJA 4TQAA 5JCPA 1VHLA 3T15A 2GNOA 3CRW1 1VIYA 4DLVA 4I4LA 3LVRE 1YRBA 4DDTA 1BYUA 3ASYA 5E3HA 2XXAB 1ELOA 1IN4A 3BXZA 4M9ZA 1WQ1R 2Z4SA 4PQRA 2IS1A 1E94E 4LUCA 2JJ2A 1DAHA 2OFWA 2H8KA 4UNRA 3GLFE 1H65A 4C0KA 1P73A 3TVDA 3K0AA 1A5TA 4U5XA 1W2GA 3TKLA 1II9A 3NDPA 4ZI2A 2R6DA 1G8HA 3LRPA 4P4TA 4XOIA 4X8HA 3SE0A 1NRJB 2KE5A 1HQCA 1R10A 1F3OA 1M7HA 3QF4B 4OK3A 2ODBA 4I81A 4GZMA 3QXCA 2QORA 4TYQA 1ETUA 2ASEA 5JECA 1XMJA 1SVMA 2B7CA 1Z0JA 1DVRA 2VLIA 1OYWA 2OBLA 1QHXA 3NBYC 3AVWA 4A1FA 2GEVA 4NYIQ 3B9QA 4PZYA 5K8IA 4CDGA 1AZSC 4B35A 3DM5A 1FNMA 2QAGA 3EWAA 2GXQA 4JYBA 3LLMA 1T9HA 1V5WA 2GEDA 4IHQA 4LV8B 1LNZA 4DSOA 1H8ED 4BFVA 1KIMA 4XVUA 2BMFA 4EFLA 1KK3A 2OLKA 2AHOA 1I2DA 1F60A 1XXHA 3NEJA 4B3DA 5SZHB 4QJ3A 1RC8A 1OHHD 2PX3A 1LTQA 3LH5A 1D9ZA 1G3IA 1AIPA 1M7BA 1X8KA 3LO5A 5KNBA 2V7QD 1Q21A 3K09A 4NCJA 1GL9B 5DGXA 5E7IA 2HF8A 3K8YA 3VKWA 3QOFA 3UMRA 3WYFA 3FVQA 1AQUA 3QXSA 4ZDIA 4G5GA 4TTRA 2G3YA 4P4UA 4PR0A 2V3CC 3AVYA 5CM8B 2QI9C 3DHWC 4POAA 3X1XA 5KNDA 5HR5A 1L7VC 2ZXUA 621PA 1JPNA 2UZIR 3CF6R 2A30A 5H70A 3W5JA 1FFHA 2BHRA 4R9UC 4Q4HB 4D4MA 5KUTA 1KMHA 1R8QA 1KDTA 4UNQA 1XU4A 4JSYA 2YNMA 4GOJA 3ADBA 4LBYA 2ANCA 1N6RA 2BKEA 4B47A 4TWZA 4B32A 2CCGA 2CNWD 2P6UA 4FMBB 4LRWA 1Z06A 5DSZA 2O8EA 3NBXX 1KI4A 4WZ6A 1DAMA 3RRYA 4W5WA 4QBHA 3U7EB 4EKDA 3AGPA 2BBTA 1GKYA 3FKQA 3RYTC 4EPXA 3GLHB 4F38A 5B30A 4TMXA 4Z54A 4JKIA 4D26A 2AD5A 1G3UA 1PLLA 5DH9A 2SHKA 2QP9X 4MYUA 3AM1A 1L8QA 2Z43A 1G19A 2WM9B 1Z3IX 3Q9LA 3OIYA 4AIIA 3IBYA 2FPKA 1GZSA 4A0FA 4TT3A 5J4HA 1NLFA 1YRAA 2Q9AA 1MABB 4HAZA 1AGRA 1ZIOA 5FPKA 1QHNA 2A9KA 2QMHA 1MRNA 1VCNA 4C9BA 4H1VA 2NGRA 1XJQA 4GMXA 3D7MA 1WF3A 2GKSA 4HAYA 2ZU0C 3VU9A 3FKSA 4QBIA 4HEJA 3EIQA 1IOZA 1XNJA 4LBZA 4B74A 1OFHA 1N6LA 4Q47A 5JSZB 2OT3B 3U3KA 3QKTA 4JLDA 4M0LA 4A6PA 1IY0A 3TUZC 3PXGA 3AH8A 1EFCA 2F3RA 2RGNC 4ZCLA 1DAEA 1E9EA 4NYJR 3A1WA 4WXRA 4YQFA 821PA 4C0BA 4CEHA 5IRCD 3LFUA 5EE9A 1OLOA 5GJVC 2HCBA 5HE8A 2OAQ1 4LYAA 3L8YA 4BLSA 2IWHA 3DKPA 1YZUA 5EUQB 2QE7A 1CJKC 3JVVA 3GLFB 2X77A 3IPYA 2IK8A 2OFOA 2PMKA 2JLXA 4C7OA 1OB5A 4WZBE 1RZ3A 3RRNA 1N2CE 1XJ0A 2BOVA 3BBPA 2WJYA 1Z6AA 2WJGA 1S96A 2ZRPA 3MWYW 4KBFA 4DB2A 5KDLA 3W5IA 1XP8A 4GDFA 1TQ2A 2ZAMA 3AVPA 1VHTA 5SZJA 4O3MA 3EARA 4AK9A 1QBKC 4Q4AA 1XD2B 3GEHA 5FI1B 1LY1A 1WA5A 3CH5A 3IIKA 1FX0A 1LB1B 2WICA 3P4XA 3SFZA 4PSKA 4FCVA 3KJEA 2W6JA 4GNKA 3WY9A 2P65A 4KLNA 4TSFD 2WSMA 1E0JA 3SOPA 4EAQA 1CRQA 3AKDA 4TZ0A 4QKQA 2IBMA 2QQEA 3PEUA 3DO6A 4CIDA 1E6CA 2IF0A 4BFXA 2PT7A 3GP8A 1E96A 1P61B 4AG5A 4U7DA 1FNNA 2FSFA 3BERA 1KDPA 3FMPB 4MQBA 3G0HA 3LXXA 1R5OA 2BJVA 3CM0A 4EFNA 1XPUA 2WSSD 3GFTA 3TSWA 1AJEA 3CZQA 1OH5A 4M9QA 3TBKA 2XOKA 1Z2CA 3VNVA 3D8BA 5DYGA 1XFAA 1FL9A 2W2VA 3IPXA 4RFSA 3ZGXA 2HLDA 3K9NA 4F93B 2JLUA 3DZDA 1MKYA 2OSBA 1VG1A 2PZFA 4LHYA 1RVDA 4P32A 4BWYA 3SQXA 4MUAA 3BFKA 3K0SA 3MUFA 1CR0A 3KQHA 2JGNA 4PO8A 2WKPA 4V0LA 2IYXA 4M22A 1U2RA 2ZJAA 4URYR 6Q21A 3QJYA 1PLJA 2OUKA 2D06A 5L3QA 1ZCBA 4XVQA 1P4SA 3N2IA 3P20A 4HUQA 4TL6A 3QENA 1US8A 4I1OA 1IJFA 2CJWB 2KSQA 3TSZA 4Q48A 2ANBA 5FOTA 3VHLB 4QGHA 1NIPA 3EIHA 1Q3HA 4N0EA 2MMGA 4YMWA 4ZO4A 5KDOA 2J1LA 4QNMA 1E1QA 5HZKA 3BORA 2ZI6A 4IJMA 2XTNA 5JLJA 3AGQA 3RC3A 1Z6YA 2ODNA 2JLRA 1SVOA 2CHQA 3CNOA 4JLJA 1EFUA 1GL7A 2K5UA 2F6RA 1QHHB 3RLFA 2H18A 4BZXA 1AZTA 1ZC4A 4EFMA 4GZLA 4FMCB 4NBSA 2NZ8A 2ZYUX 1X8LA 2OE2A 2P5TB 2ZYWX 1OE0A 1TUIA 1DS6A 2KI5A 1YZKA 3GFOA 2PX0A 2W6IA 3MD0A 3X1WA 3HU1A 4H1UA 2G9NA 4OKSA 2JJ8A 4ACBA 1RE0A 3WNBA 1CR4A 2YJTD 4ZCIA 2AX4A 5J5CA 1GILA 2OM2A 4UKDA 2WHXA 2ZITA 5KSYA 1U99A 4BZPA 3SN6A 5KSZA 1VMAA 1O87A 5G3ZA 3G82C 5FBLB 1MH1A 4C0JA 4XTCS 4DVGA 3FHTA 1GM5A 4Q1BA 4TL9A 2DFLA 2WPDD 1UF9A 3NEYA 4TZ6A 1GNPA 3GJ6A 2CHVA 2GCOA 4TLCA 1KI7A 1Z22A 1JR3A 1FQJA 1NG9A 2OCBA 3B2EA 1KZ7B 5AK0A 3BGWA 4FMDF 2DHRA 1RYHA 4JVMA 5DNYB
chains in the Genus database with same CATH superfamily
3WLAA 2Q21A 4GLLA 1RRPA 4N48A 2ZRHA 2ZYRA 3ADOA 1YI0A 3VNAA 1IK6A 2OG2A 4GOND 4FPXA 5HZHA 2P41A 4ZAFA 4HV4A 4KXMA 4Q9IA 3ZI4A 3TI9A 2Q5LA 1I1OA 4OM7A 2EC5A 1IL0A 2XWSA 5FTWA 1ESNA 5KAMA 3ESDA 3BWVA 1J2UA 5AKIA 4DZTA 4L4XA 2A0WA 3IAFA 1Q3KA 4HWPA 4XIJA 5CUQA 4ZQHA 3U2QA 4B85A 3D7LA 4MKXA 3ZWNA 4FS8A 3NPMA 3TN7A 5K0LA 5A0TA 4G41A 4YFVA 4EKGA 1TC2A 4BO5A 5FOSA 1CIVA 1IFXA 4RD4A 2F9MA 3PXXA 4FYJA 3PX7A 4ZT7A 3LT5A 5FOWA 4Q03A 3WGOA 2KLHA 3KXDA 4M0KA 1I32A 4C5AA 3UICA 3FDZA 2OQRA 2AZ4A 3H4MA 3C7AA 3D3WA 4B6OA 3IVAA 1ODCA 1WM1A 3OE7A 5E95A 1V37A 2O7NA 2AZDA 4EATA 3UK2A 3EXG1 4JT2A 3EPKA 5LQNA 1SBCA 3PC6A 3A9SA 1PEDA 3RK4A 1JECA 1ODKA 3CZCA 5IUJC 2NZYA 3FYHA 4IH1A 3CLSD 2JZOA 1U9JA 1LBTA 1YBAA 4AURA 2BP7B 5DOZA 1F6BA 1VJCA 3KYBA 3EODA 3FUTA 3TUIC 1A2OA 4CGZA 1K7XB 4MWZA 4RORA 4GRAA 4CMCA 4HUTA 2AWNA 1IAVA 2QTAA 3LXRA 4P4LA 4E6PA 4LQLA 3V33A 1DWQA 1QGYA 1XKTA 2ZGVA 4UC0A 3GAZA 1AHPA 5L3VA 5AUOB 2QQ0A 3PFNA 3KT6A 3V48A 4ALNA 4NPAA 2Q29A 4BAGA 1Q6ZA 3Q9NA 5AW4A 4P84A 3IJPA 3Q8MA 4O4HF 5T64A 3SXPA 4A36A 3NLLA 2XWQA 4H7EA 3H5OA 2QZPA 3IDFA 4IHJF 1IMJA 2PEZA 1SIOA 3S44A 4PHHA 4AMVA 1F2UB 2VDPB 1W93A 4G2NA 2DH6A 5I47A 4PAMA 1OC2A 1IOLA 3IUNA 3OFKA 3QZUA 4OHOA 4X61A 5M3BA 4WZAA 2AEEA 4JC4A 3PDJA 4KVGA 3COZA 1LPOA 1C1DA 1EGQA 2FFHA 3JQFC 3AVXA 3DL7A 1DIBA 1P2SA 1P7YA 4LEIA 4AQYB 2RHCA 5KNCH 3LLVA 4G5QA 1EWYA 1D2NA 3ENZA 2WABA 4H15A 4JASB 3T1YB 3P4UA 1H3EA 4QRDA 5JI3E 2R8PA 1G0OA 1XRPA 1H0HA 2N1BA 2X3UA 3WRYA 2X9LA 1E1DA 2C9MA 3E61A 1C0KA 2ZKIA 4PIMA 4ARBA 1E4YA 4NCNA 4FFMA 3R3SA 4QHSA 4OHPA 1CZLA 4WNCA 1YD7A 3ST7A 4LF9B 1E9RA 4ZV9A 3CVYA 1DGQA 1DAFA 3OEHA 4M49A 3WXBA 2FG7C 5FQOA 4AYTA 1Z2OX 3GGPA 2ZUDA 2DVMA 4NG4A 4JLPA 4L3WA 4L9SA 4GBMA 1DEXA 1RZVA 5C5IA 3DJFA 2QPAA 1JDTA 3B5EA 3NXSA 1N3BA 4O29A 3W2GA 2Z8ZA 3NU1A 1NF2A 2F7SA 1H1LA 4HXEB 1VLQA 1IWBB 3N59A 4AN1A 2GZ1A 3KALA 5AWFC 4OAOA 5JCZA 2OAP1 3WTCA 4D5GA 2V5VA 3LUAA 4A0QA 3BBLA 1RZRA 1Y1TA 1NNI1 4DV4B 1YDGA 4JU9A 2IYSA 4OJTA 1FJ2A 4BMVA 4JI2B 1GG5A 4Q4LA 3W6UA 1I80A 5IVDA 4EI7A 2C5EA 1RXSA 3EUFA 3IUYA 1XBTA 3OAAA 3QNUA 5AKZA 1FMJA 4N4AA 1EBBA 1J5PA 1ZHFA 3BZUA 5COQA 2HEIA 2YUTA 4ZI7A 5IM4F 2C94A 2HU2A 2QX7A 4RK1A 3L1VA 3NUQA 2O0HA 1QH9A 3GRCA 5CNMA 2B30A 1E63A 4MIEA 3PGVA 4R01A 3ZU4A 3DHVA 4F60A 3H04A 4F4HA 4OK5A 4Q4DA 1L7DA 3KOYA 1Z6XA 3BCHA 1Y6FA 1KYWA 1IHOA 2A1TR 3A6DA 2QXTA 2XPCA 4QJ4A 3BMCB 2IF2A 2V5UA 1M9NA 3K09C 3OZWA 3SF0A 4E2ZA 4GG1A 5JNLA 1Q0RA 4PZLA 3X2FA 4LKRA 1PU2A 1GHTA 3HBMA 3PPWA 4WKBA 1C1YA 4C22A 4GX1A 1G9XA 2QDKA 1SCUB 4URXR 3WSTA 2CLKB 1QZXA 3CXRA 3DZKA 3TLCA 1NQTA 2JIQA 1T35A 3DPUA 2Y1GA 2QD3A 3L8GA 4ZI5A 5JJIA 3UT0A 4N5LA 2C57A 3B9BA 3HN2A 2OD7A 3IQIX 2J9ZB 5LD2C 2FZ4A 5CVEA 1L5HB 2SCUB 5DHQA 1MOPA 1NE7A 1QVRA 2VSQA 1P5JA 1NPYA 1ZFNA 3GH3A 5CRIA 3DL4A 4MRSA 4M55A 1EXDA 1FW6A 4XQ9A 4NMXB 4C7VA 2FPWA 5HRAA 5KIAA 3RUIA 4EIWA 2X8LA 5KAPA 1QO7A 4PSVA 1CJTC 5MGNA 4IX1A 1IC6A 1NBWB 2I80A 3TL2A 3CBQA 1LLFA 4D3XA 4G84A 2VHQA 3EGIA 4ER5A 4FGUA 4JI8B 4UARA 2O8DB 4PX3A 2PL1A 3HCWA 4MVJP 4PAGA 3ZYZA 3M9LA 1ZQ1A 1UK8A 1B15A 1YZQA 3R6LA 3LWBA 3VX3A 5I5EA 2GN6A 4WX2B 2WJ4A 2P9EA 1L8LA 4HDNB 5T4HA 5AKHA 3L8EA 3TQFA 5A03A 2BPOA 4DV7B 3CPSA 5TR9A 1KAOA 3L41A 2XT6A 2Q2NA 3INYA 3T3MB 3ZWXA 4E2FA 5A5GA 1GV0A 3TIXB 3KJNA 3ND9A 3CGGA 3L0DA 5DX8A 1SELA 5AYVA 3LY5A 3ZH2A 4X9XA 4EM6A 1U8CB 1YJCA 5DM1A 3HZOA 2JLSA 2F4NA 4MLCA 2HOQA 2Z3ZA 3VR0A 2XY4A 3L8FA 3LC1O 2RONA 3ABOB 3ZZNA 2W4QA 1GPLA 1FS4A 4BX9A 2Q1WA 3D5QA 3R0VA 1OFUA 3MMZA 4R5MA 3U4QA 1G66A 1X7WB 1L3IA 1XXLA 2AQ8A 1QONA 1WBDA 4LF4B 1WOMA 4R1OA 3ZBTA 1V43A 4Q0MA 2YNMD 1XTTA 1RXEA 4GH5A 3WQHA 5EY5B 5AKXA 4WACA 2RMKA 4CLEA 4F7DA 4G8JA 3ZOZA 3T7TA 1Q3TA 1GQFA 5B1HA 1AXEA 1G8AA 3F67A 4J1NA 1CQIB 1RWOA 1OTHA 3FCYA 2BCGY 4I1YA 4LC1A 1ZI8A 5EE3A 4KMRA 4GUAA 3TVTA 3QVMA 5LWHA 1R16A 2KM1A 4P22A 1O5OA 2X9VA 5BQXA 4Y30A 1N92A 2DKFA 1DOAA 1AHNA 2WHPB 3PHLA 4HFJA 2FZVA 4MYCA 1Z9BA 4B82A 5CG2A 3DOJA 1B1AA 3GLSA 2H1SA 1U3UA 1QWOA 1XDDA 4L6CA 3UK6A 3WIVA 4D43A 9LDTA 2OFPA 1U1EA 2FZCA 1JFTA 2O4CA 2C3MA 2IOHA 2ZANA 1K6MA 4BVAA 1CF9A 3K9QO 2VDWA 2JFVA 3QMWA 5G0UA 3DDUA 1ADBA 1L7NA 4ZWNA 5IDXA 4CIYA 5JBNA 5LOVF 1DBQA 4C5BA 3D6AA 1SHTX 1U9CA 3HQ4O 3T7RA 2GTHA 4LCEA 4IFBA 3TSAA 4DLBA 5HBRA 1ZUIA 2GZRA 3RU7A 3SDZA 1KK0A 1WXXA 2B83A 4FEEA 4WCFB 1TMKA 1GQRA 2VDRB 1YWGO 4AUEA 2HJSA 1RR6A 1ZMOA 2NSYA 3II6X 4EUFA 5GVSA 3DZGA 1JQ5A 2X5OA 1NU6A 1WXDA 3MINA 3NCHA 4J0FA 1ZGGA 1NW5A 3O8QA 1EVYA 2GEBA 4KWCA 1XMXA 1E2MA 3JD2A 4GI7A 1NPTO 4TXJA 3TEMA 3UAYA 5LU9A 3HYRA 3AHDA 3ISTA 4J29A 5JG7A 3FWPA 3Q8XB 1MW8X 3QE0A 3TPZA 1M6VA 2PUHA 2XJ4A 5KX5A 3QU7A 3I04A 3L93A 1AUQA 1P1KA 5MN4A 2L17A 3ZV6A 5JSQA 3F47A 3L0SA 4ER6A 2UDPA 4NZPA 3LZCA 3WKAA 5KYXB 2DCUA 1ISIA 1LDGA 4YNBA 2NUAB 1LF0A 1LDBA 1XTVA 1ZH0A 5FRDA 3LIIA 4H3HB 5J4YA 5KYYA 1ZCFA 3GGCA 1T8PA 2ERYA 1VIMA 2J7PA 1HLDA 2CXSA 4PZAA 3SBOA 1VPLA 3AW9A 3SVZA 4OFWA 4HLQB 1MX5A 4FOOA 4DV6B 2BFBB 1MFZA 4NARA 2FFQA 1VPTA 4CEJA 4JH0A 4DSTA 3BCUA 2X9GA 3DBHA 5DULA 2WNHA 1U9IC 2BEWA 3GV0A 3WNQA 4L5CA 1UMCA 3M89A 1FRFS 4HAWA 5JAOA 5C8ZA 5KJFA 4GKJB 5A2GA 1XVUA 1VMIA 3TLMA 5IAEA 3WNCA 2DR2A 1ECGA 3GEMA 3SCZA 2PGLA 3G5UA 4NMLA 4PQFA 5IKEA 5JASA 3JQ8B 1DAOA 3I0ZA 1C3EA 1XKLA 2XH8A 1C4WA 1LPPA 2O0KA 3DPSA 3O9MA 1R4MB 3RTAA 1U3CA 5C1OA 1HE8B 3PCRB 1ZD5A 4C0QC 1EM8A 2QXUA 3HSKA 1E0SA 1K3FA 3I39X 3P4YA 2C3OA 1E7QA 3EIWA 4ZN6A 4UVDA 4TLMB 1YA6A 2OLJA 2ZWIA 3P27A 3DAGA 2VYVA 3R9XB 2K2WA 4U6SA 4C30A 2RGYA 1DBRA 1WMFA 3OI7A 4KFRA 5IABA 1LQUA 2AD1A 2SECE 3RGWS 5BQ5A 3JSXA 3D2BA 4JYZA 1AE1A 3A26A 1BCSA 1V1RA 4PAWA 3HL0A 4DMRA 4JUBA 1CERA 4H9GA 1SQSA 1IIRA 4HNQA 5KYVA 2VHUA 2HRCA 4HATA 1VJGA 2OV3A 3LUPA 2D2EA 4CFZA 3FSRA 3NOOA 5LYYA 1PTJA 1V1MB 1ESEA 3EZGA 4C0HA 2QRLA 3LV8A 5BYKA 4RL4A 4KUEA 4Y2TA 2G40A 2VUTA 2R7NA 3N0VA 1UXHA 5CJJA 4L76A 1EGVB 1QH0A 1Z2EA 1QBGA 2ONKA 4O4HB 1JEOA 1R12A 2IH2A 1NJGA 2A4MA 4D4LA 1JW9B 2XCSB 3LECA 1D6SA 2R7MA 3B1XA 5BN4B 3E5MA 4WLEA 2FH5B 3RS8A 2ZJ4A 3EVCA 4MCAA 4ERNA 3I9JA 2JIZD 3C3PA 1OFVA 4Y2QA 2ORVA 4D4JA 2GA9A 1N5OX 3W2HA 2HNAA 5T6MA 3S2YA 2Q4TA 3C85A 3S28A 4RZIA 3HTXA 1ZUNA 5LYJA 5CA1A 4FCTA 4KN5A 3QI2A 4LK3A 2VJNA 4IV5A 4UEWA 1NSFA 1U04A 2J59A 2IIPA 2PD6A 2V6JA 3BDIA 3HPQA 1O9BA 1J70A 2ZREA 3IIEA 2FZ5A 3T3IA 1M72A 2G28A 5ICEA 4BJ5A 1X74A 4QSMA 2G4CA 5EIEA 1UJBA 3A4TA 3N6VA 2X4LA 3AUSA 2I4TA 1T5BA 5AJHA 2XUKA 3WLNA 3DAYA 3QA3E 3V2GA 2QM7A 3LCUA 4OK6A 3ZOKA 2GNAA 4BO9A 4A16A 1QXSA 1S9DA 4ZV7A 1C1XB 1T5DX 1E0KA 2C7BA 1LLDA 2DBVO 2I6FA 2PXAA 3FMVA 3NIDB 4I7EA 4EW6A 4ZGWA 3ICCA 5CDGA 3NHFA 4OSOA 3SDSA 1Q7BA 4IXDA 3T41A 4WAUA 2VPTA 3O6VA 4PEVA 4FI3C 1RP1A 4ZEOA 4FBMA 3REFA 1TRKA 2ZJ7A 1CR1A 4BMSA 4GNRA 3BWXA 4R2XA 4D9EA 1ACJA 3BOSA 5TEVA 3UAGA 4MUIA 3ZHCA 5IAKA 3ZXIA 3U19A 4A0SA 3UC5A 3UMGA 3A37A 4G86A 5FNVF 2QPOA 3I8OA 1RPZA 1ST3A 4ZTZB 1NUHA 4DS3A 3IEIA 4FEGA 3LBNA 5TDHA 3H17A 5EIFA 3L8CA 2OG1A 3MFYA 3NX4A 1VG9B 4JGGA 1DQPA 4MCJA 4QGBA 5DNWA 3T1QA 3W3AD 2I91A 1JG4A 4Z4EA 2Z5FA 5ICFA 5CIQA 1Q74A 4KQKA 4D9FA 1YAHA 3QX8A 4RGQA 3GJ8A 3O8CA 1ZKMA 3DXFA 4MVXA 1O54A 1N2SA 4WV3A 4YJKA 4PRYA 3AEZA 5DEOA 2ZYSA 3VKFA 4CM9A 3DZJA 4JLMA 4F9FA 3O0DA 1VYVA 5DWVA 4C4RA 5BNWA 3QUQA 4YRQA 1TOAA 3R40A 1EB9A 5FBZA 2XUZA 2XXAA 2A9PA 2ZJOA 5JIBA 1W7AA 3DDWA 1GNQA 2EP5A 1O4WA 2ECPA 3OHPA 1POWA 4IIHA 4NBLA 3U44B 3WWEA 4PM4A 2V6IA 1Y3CE 3ONNA 5DM4A 1DKLA 1PQUA 2HJVA 3Q40A 2GJ8A 1W8DA 2QP4A 1PL6A 1QC5A 4MLZA 1N5MA 2Q8NA 3LGSA 3SK0A 1PSWA 4RSHA 5CVCA 1SH7A 4BFYA 1R0WA 1SHLA 4LNAA 3SSNA 4DNOA 3S81A 2VWGA 1OV4A 2H8GA 2BHNA 3JALB 3PXCX 3O8RA 1A9YA 1ZD1A 3VHRA 2EWWA 1PJSA 5DCLA 2A2ZA 4EGFA 5IWCA 1QCYA 4G25A 4S1WA 1KWKA 1FB5A 3PGXA 3ZHVA 3AHEA 4DV1B 4BRWA 4PX5A 3G8DA 2NTJA 4G1FA 4BO3A 4DCSA 5JAMA 3VKHA 2BFDA 3IAS6 1IG0A 3UWPA 2BGTA 1KEWA 1O0BA 1EESA 4NFYA 2AJTA 1Z0IA 1VL0A 1RWPA 2F00A 2I6GA 3IVMA 4YRLA 4IH4A 1E18A 1KE2A 5C80A 3T0IA 3QW4B 3QVGB 4TS9A 1AQLA 1DJOA 3L04A 2JS7A 3NKLA 4XQEA 3PLRA 3S0JA 2OYCA 5DMXA 2X8BA 2IV3A 5EIWA 3WK8A 1NBHA 2FPRA 2JK0A 5IF9A 1NDUA 3IVRA 2HRBA 1PL0A 2VDJA 1JHXA 3AHFA 3LKZA 1U7OA 3CW9A 5C4GB 3DEAA 1D1QA 1GFSA 3C15C 4RFLA 3U7IA 4AKGA 3PC7A 2XYHA 2HBRA 2NSHA 1FTSA 2XB6A 4JZKA 2JFBA 3VR6A 3JRWA 3NYQA 3RYFA 1IUPA 2EKBA 2PO7A 2GB4A 2PS1A 4IGAA 4MRMB 3KLPX 3QQ5A 1U3FA 5EKUA 4GL2A 4I9NA 2JLYA 4GBED 1L4MA 2Q3FA 1O08A 1NC1A 5D87A 1TQDA 3R7DA 1EBFA 4KIFA 2PLRA 2EZUA 3VYWA 2BF4A 4EUKA 4PW0A 3HDQA 3K0CA 2TMYA 4M0EA 2DLDA 5JC8A 3FRHA 1PFUA 1JEAA 2BE7A 1DO2A 2H08A 3RC2A 5TEWA 2YXPX 2E5WA 3THXB 3RT9A 2XUDA 3R2JA 3RT1A 4DCJA 5B6PA 1O97C 3OLVA 1FMTA 4FOTA 3VZRA 3W6NA 5D3MB 3V8QA 1KMIY 4AZVA 3ANMA 3OC6A 4YECA 3MC1A 4HEA1 1FNDA 2PZ8A 4Q24A 1RJEA 4Z0HO 4CR7A 2F2TA 2G5CA 5L4LA 4G81A 1SU7A 1KQPA 1YL6A 2VPYA 3RCBA 4C14A 1Q7CA 2AZXA 4RY8A 3P2IA 4FSHA 2L82A 1NP6A 3PF9A 1GQOA 2FFJA 2J5BA 2PEYA 4P7BA 5E7JA 1BN6A 4UZEA 5JCJA 2BKXA 4AMYA 4HFNA 1UQUA 1DC8A 1DKRA 2B25A 1N25A 5EMMA 4DV5B 2FNAA 5HK8A 2B82A 1P5HA 1W52X 3H2ZA 2ZIUB 1Z47A 2I3BA 1CUWA 3O4IA 4UHKA 4CV3A 4EPWA 5J1TB 3I12A 2C5SA 4J2OA 3I0MA 1ISSA 1S9HA 5SZIA 4DIFA 2KS6A 4NH0A 1R18A 4RMGA 1QRDA 3STUA 2WHYA 4Z9XA 1POXA 1XZGA 1CV2A 1P80A 4UHEA 3RFVA 4JCCA 3CO0S 2JPDA 2XMSA 1NVVR 3DJYA 4MWOA 3FR7A 1HFJA 4YLYA 1N5IA 3CT6A 1DAKA 2CJYA 4M46A 3RUFA 1BD3A 1MABA 5EJEA 4AG6A 4B4DA 1W9HA 4EB6A 1NDHA 4C2BA 2R751 4RACA 3A6LA 3H2YA 3T3PB 3OY7A 2QZJA 2WU8A 1VYTA 4QDZA 2O8NA 5EXSA 1PZMA 4OH1A 3THYB 3UJCA 3KXIA 3NHAA 4JFRA 1IONA 1REQB 1KOLA 3L1UA 1NKVA 3F0TA 3QG1A 2AOVA 5DBHX 1T5HX 4ND1A 3KZCA 2H1VA 2E4AA 1TCUA 1L5YA 3BH0A 3H1BA 3F90A 3TM5A 1S7CA 3M2PA 4K9LA 4X45A 2V7QA 2DG2A 2HPAA 3JQ7A 4U7HA 3EW9A 3ZS8A 1LVUA 2DUUA 2H59A 2JGLA 5T4BA 4IGFA 1X15A 3UPDA 3DMPA 5JQWA 4M0UA 2CYCA 1G21E 3S8EA 1ZI9A 3LHKA 5H4HA 3FZEA 1KSFX 3MWEB 2P91A 1SR8A 2KWIA 5GAJA 4IICA 3EK2A 5TT1A 1M67A 1EKXA 4RJJA 3ZGLA 3LJKA 5EC8A 4PBRA 4KAXA 4ZU1X 4G1VA 1WZIA 1VJRA 2ZT8A 5F35A 5ECWA 5HTKA 2QG6A 3UZUA 3DF7A 1KPGA 3I1JA 4ZRDA 4ZVUA 1EX7A 3R3WA 4GPZA 1MUUA 1S6YA 2QKYA 3PEVA 3ZWWA 5FBQB 1PWEA 2XITA 2X9QA 3F98A 3GUUA 4I9HA 1XZKA 4ADSG 4V0RA 3COJA 1EVKA 2CL5A 3M82A 3A2KA 4TN5A 5TMEA 4V0SA 1TAGA 3CZ5A 5LA6A 1LJLA 3CVXA 4LHWA 1QYWA 2PN1A 4Y2SA 1CX9B 3BB4A 5FWYA 1X19A 2JIMA 1H2WA 2ZIXB 3OKPA 4OHYA 2WA2A 3DEFA 4B48A 1CSEE 2HU8A 4EY4A 1ZR2A 2QMUA 4EYSA 3FVVA 1TA9A 1XAHA 1FSFA 2RHLA 3WFIA 4CMIA 1FUKA 4OI2A 3A4IA 4F4CA 1OX6A 2ZOSA 4UTOA 4IDAA 2M9MA 3K70D 3ISJA 4AJJA 4NS4A 2QSYA 1GUZA 1COWD 2Q99A 4UZFA 5IZCA 2R8XA 4X3CA 1ZM3A 5C5DA 1LBIA 1TZMA 1VTKA 5BMOA 4Q1DA 4YRZA 1QX4A 2EJVA 4P4SB 3TQIA 2I2FA 2BV3A 2FR0A 2R6ZA 2VF4X 5CFQA 1NYLA 3TBFA 2EP8A 4S1OA 3JAWA 4JLVA 4KGZA 4D9IA 2O54A 3Q88A 4JHLA 1MJHA 2BMWA 2V7TA 3LF1A 5IT4A 1Y8CA 4MQ4A 5J43A 4R16A 2ZWPA 2OV1A 5LQCA 4N7RA 4OIMA 4AMBA 1M2KA 1RIIA 2ZRGA 4MDYA 3BEDA 4S35A 1DHRA 5SY6A 2WEKA 2YHAA 4GGPA 3RRFA 1N78A 4D9GA 2G6TA 2JLAA 3L7NA 4ZHSA 2GPTA 5CMLA 2AKAB 3K73O 5T3YA 5HWSA 3SHQA 1QGUB 2WJVA 3MCTA 4LHSA 5I3CA 4P5EA 3A31A 1EFRD 1QANA 2PGOA 4R31A 2ZSHA 4OV6B 1T0PA 1E62A 1KZ6A 1XLVA 1G8KA 3UUGA 3F6CA 3KEMA 4M89A 3T0GA 3VV2A 5ADVA 1K92A 1T4BA 1QTQA 3TW8B 5DPMA 3QU9A 4FDAA 1UEIA 3RBAA 2IQ5A 3NZEA 4BNLA 2Q46A 5CVDA 3VPGA 1KH2A 1KAMA 2D1FA 1A8UA 4AYWA 1Y3HA 2R97A 5DYIA 3GZNB 2XA2A 1DAGA 3ZK8A 3A3PA 5LQMA 4R8MA 4MV4A 2X6RA 5EJ7A 5HKKD 3D2AA 4JJZA 2AW3A 2IXGA 3ABRB 3N8IA 3HEBA 1VFNA 3Q2IA 3HKDB 4PNZA 5H7XA 3VR5A 1WJGA 4FILA 4TS4A 1XHEA 2KBEA 3AEKA 4UOQA 2HRZA 1XKQA 4GLBA 1XDWA 4HMOA 2P3QA 4FCWA 4CBVA 3ZK9A 1YTUA 3B8HA 2QQGA 2ZP1A 1M54A 4RLHA 1Y33E 4EW1A 4AP6A 4K40A 3CVVA 3DKIA 1YMVA 1FU7A 3FIUA 1N57A 1K3TA 2OBMA 2VSXA 3JQ6A 4M1KA 5BSRA 4RWEA 4C6HA 1XC7A 3OIWA 1Q0TA 4J0KA 1ZZEA 1QS0B 2GJSA 4E5VA 3OEEA 3L7DA 2P1RA 4N01A 5JSYA 1XF9A 3AKEA 1KJIA 4F6RB 4NYMQ 1JLLA 1TM4E 1LJ8A 1QFZA 3FUVA 4KVFA 2BFWA 5EIHA 3TEFA 1NMQA 3R5XA 1N36B 3IILA 1UIRA 2PNFA 2XKBA 1BJTA 5EUBA 1GR1A 4N8SA 2XZDA 1TO1E 3JVIA 3P2OA 1F1BA 3A4VA 1KMCA 5KQPA 3FPCA 1KRXA 1P6QA 2O2EA 1JKMA 4ZVOA 4XJXA 1M0EA 5EYPB 1X87A 4V03A 4XCVA 1IIBA 4K6MA 4POOA 1GITA 1UZLA 4FOSA 4YAEA 4OX9Y 1AQ6A 4JNKA 2WSSA 2UUPA 1J99A 3U62A 1SUDA 1VE7A 4OJQA 5DXFA 1Z07A 2HR1A 5C53B 1VDZA 1NL3A 4ER7A 2ZTLA 2WYOA 4PC3A 1CJVC 5TF0A 5A7HA 2QLTA 3QQPA 1MH9A 5I8ZA 1GEEA 3N9IA 4J4TA 2DPMA 4N5MA 2FUG1 2X13A 2RJ3A 4J0QA 4QG7A 3UA3A 1TU0A 2AG8A 2Y1XA 4B8WA 1LFDB 3KU4A 3E1KA 4KDRA 2J46A 2J4FA 2QAGC 1URPA 1LPAB 3DOCA 5HTOA 1Z7GA 2AK3A 2ZPUA 5KSOA 2DWOA 1W5SA 1OIXA 4TN1A 4QHTA 3GP3A 4CIWA 3SHFA 4YC7A 3M8KA 3EQ8A 2OZLB 4WNYA 2NYAA 3IQXA 1EDBA 2CXUA 3EFEA 5ABPA 4EHDA 2DCMA 2GK6A 4NX2A 4H4DA 4ROSA 2JFZA 4LE2A 2G9ZA 3I45A 2W6QA 4HB3A 1N1DA 3BK2A 5ALOA 2J33A 4H18A 3U80A 3ZZMA 4ENVA 2V9CA 3AF5A 5ADWA 2QRVB 3PEWA 2D7JA 4Y6LA 2ZBPA 1O7JA 5HQJA 3TDNA 3S4YA 1J33A 3BE8A 4K9KA 4JEUA 1A2KC 1C0EA 1ZICA 4LOAA 3OWXA 5FEMA 1L5GB 3ZGVA 2LCIA 1RLJA 3P9KA 1DWPA 4DTCA 3M5DA 3L0IB 4OLHA 2FW8A 4JL6A 2OXEA 1K2VN 2Z08A 3PB3A 4JR2A 1OR8A 1IXYA 5D7BA 2BN4A 2A86A 3JQQA 4D02A 4Y2RA 2VDMB 3D1LA 3UG6A 3AEUB 3JPWA 4MUEA 4X93A 3EN0A 3EXFA 3T9FA 4GIBA 2WK1A 1I3KA 4UE3S 2I4IA 3S68A 1EDOA 2DRIA 2OXCA 3GRRA 3I53A 2XE6A 1L5ZA 1U8FO 4FHGA 4WLFA 2H7YA 5DNAA 421PA 2VJKA 1D6NA 1R5BA 2BY4A 4HNAA 4BGVA 4J1QA 2XYPA 3OA2A 2QLBA 3I32A 4Q9NA 3W5SA 4IV0A 3GROA 1WCIA 5HIIA 4BVHA 1G3RA 1MHTA 4ROTA 1P0CA 1U3GA 3IC5A 4ZODA 1UBUS 3E48A 1DCMA 1K7FB 2OO7A 2GLUA 3TCNA 2A1UA 3R24A 4JLOA 4YRKA 3EZLA 3DQZA 5E4YA 4BQRA 4US1R 4YR7A 5FA8A 4BRUA 1KO4A 2ZIVB 1Z0DA 2Y2VA 1ZXBA 4AMZA 1T2UA 1ZVQA 1W2HA 4QLAA 4TX1A 2V6FA 1IUNA 3B1YA 3GFPA 4DR3B 4RPLA 5AVSA 1KL7A 4JKYA 5A02A 1WXWA 2FUNB 1XMSA 2R6JA 3D4BA 3FETA 1PZGA 5ALMA 3ZZUA 3S1SA 4TXNA 5KNDD 4YRAA 3FPKA 3WO0A 3R1IA 4OP1A 4KI7A 2UZ1B 2QVXX 4KI0A 5BWMA 1XWIA 2FQYA 2JGKA 3IT2A 4L16A 3FCSB 2HO5A 2ZRJA 1MVOA 3OJLA 3SJZA 1P4RA 1KMNA 1DAIA 3NHKA 3HDTA 1C3XA 1YR9A 2B4QA 4KEAA 2XXJA 4US0R 3VVMA 5LMZA 1RXYA 1R5NA 4PFKA 2NP6A 3IKMB 1Q91A 2X6QA 3LX5A 4WT7A 1PBTA 5J23A 2CK3A 2GAFA 2AF4C 2NZJA 1H2RS 2LXNA 4P08A 3ZLVA 4JEHA 2M1ZA 4JLBA 4Y6OA 4ZVVA 4V1CB 2CXNA 5LP6B 1IY2A 2WJAA 4L51A 3SYKA 1JEYB 3HL4A 2FMKA 1KS9A 2HQOA 2TECE 3K20A 2Q49A 1Z35A 3CZRA 3IUBA 3KO8A 4WY2A 3CS3A 4B3XA 1ZJYA 2GVNA 1N2JA 4E13A 4ZJZA 5EJFA 4OXYA 3RHZA 5EG5A 2X3YA 5J5AA 1KY4A 5BV1A 4JLAA 3QVSA 4Q3LA 4OQ4A 4YAWA 1E77A 1M34B 3MLAA 4GHWA 3BWMA 3SIPA 4NCIA 2P5UA 3V4OA 1N3IA 2FHPA 4MR8B 4B6EA 4ETWA 5E2IA 2Q28A 2BF7A 2TMGA 3LTEA 2JHFA 5CK4A 5E9JA 1MVNA 4UU7A 4CMJA 1N6NA 4DC0A 5JS8A 2I2WA 2JGMA 3GT7A 3UWOA 2JLCA 4CMEC 1KEZA 2Y1FA 4U2BA 2EG9A 4G37A 4WNAA 2DBYA 4URZR 3L0PA 2QI9F 1N5RA 4ASUA 1ABBA 1AA9A 2H48A 1XTJA 5BSEA 2CDNA 1CUGA 2ZCVA 4EJ0A 5TARA 5I4CA 3E4DA 1JAHA 2PMFA 1HDEA 2BUCA 2O2SA 3LLUA 4RQUA 1DTEA 4TTPA 4FE4A 3I0NA 4UM8B 1XXHB 4UDYX 1UOQA 4GM4A 1W25A 4NH4A 4Q7KA 1ZIXA 2Q2WA 4Y0NA 5COBA 4KBGA 4DCCA 5KHAA 3LWNA 1SXGA 1FJGB 1IMOA 1UBTS 4BMZA 3BAZA 5AI6A 2JLZA 3KVOA 4XB6B 4E11A 2BH9A 3PNOA 4AWXA 3FFAA 4YIHA 4RHUA 3D8RA 2ZUBA 5BMVB 4WOJA 4ABTA 5LDHA 5BV2P 1XZJA 3EF1A 5BSFA 2IOQA 5ALUA 3C6KA 4HDMA 1P7CA 3AKYA 2B4YA 1SBNE 4ZI3A 4LJ5A 4YAFA 1YDMA 4MITA 5BUQA 1X42A 3OBBA 5FI5A 4FR5A 1GU0A 3KFLA 1AXRA 2OGUA 3DD1A 2H4XA 5TPZA 2V0GA 1YOVA 3NHBA 2OCAA 4ZVSA 2WUGA 1WNTA 1MC8A 2HFJA 4L3VA 3UK1A 2OCDA 2J9FB 1ZJ6A 2BFNA 1HT1E 1XAIA 3LE8A 2XRYA 3CH4B 2XX3A 2CFIA 4RL6A 3VMFA 5BOSB 3IT0A 4RTOA 2A9OA 4EFDA 1JH9A 4RJKA 3WLTA 3LQKA 3RIMA 1QG6A 3R6TA 1SQ6A 2P9GA 4AY2A 3PCXA 2IUTA 4P7KA 3ZC3A 1TYBE 3TG2A 3K0HA 5EJ2A 2HCJB 3L4KA 3E81A 2Q7XA 4DXAA 2ZRAA 3MAAC 4OPMA 3VKUA 4KE8A 4DMMA 1X7GA 5TRTA 4BVFA 2IX3A 5IT0A 2O8EB 2YOGA 2JGDB 3GLVA 1E7SA 1SD2A 4IOMA 2W6OA 4X8OA 3I8SA 3TS1A 4YJ2A 1L4EA 2GVZC 3DONA 1JNYA 3LFTA 3N7UA 4KBYA 3KAPA 4KRGA 1J07A 1P8JA 2KJQA 3JQFA 5EHNA 4BIIA 3OZAA 2IUSA 2PTGA 2X8JA 4M88A 3X1KA 1J22A 3QXJA 2B1JA 3UW1A 3MMPA 3NHJA 2C84A 1BEEA 3IOBA 2E87A 4X94A 1P4JA 1AN0A 5H80A 3AJRA 4FBGA 4XEUA 2Q8PA 2AN1A 2Z3VA 5DLEA 1II0A 3HJBA 2VCYA 3N8DA 4YMGA 4UTNA 4CIXA 4CDRA 2JK1A 1I9CA 2JKZA 2FI1A 4HS9A 3HJGA 1LWOA 1B3BA 4CM4B 1KI6A 1STOA 1GVHA 5CB4B 3EGXB 1VG8A 1OKKD 5AI5A 3T7CA 3W4KA 1L9XA 4BC1A 1W46A 2R6R1 5CYPA 5IKMA 5JY1A 2R8EA 5FR2A 1VE6A 5D5QA 5FP0A 4A3SA 4DNPA 4PO1A 2C7QA 1H05A 5HF8A 5C46F 2Q45A 3PDUA 3GI1A 4PZDA 4WUVA 1GXSA 1CUEA 1BQ3A 1YMUA 2XVAA 4YRGA 2P2NA 1H85A 3JWPA 1I10A 1ULHA 2IHBA 1R6UA 4FEYA 1GA4A 2VTBA 4CEHB 3IX7A 4GKAA 1R0ZA 1JR3E 3RV4A 1WUJS 2NQ2C 1MVLA 1GRCA 3HHEA 5CAEB 4DWJA 5IAGA 4BE4A 1LSOA 4QYXA 4H27A 3N2ZB 2HA3A 3K8OE 4B81A 2BRUC 1BOFA 2GBGA 2QS9A 1T43A 3T9CA 2DEUA 1I24A 4KYTA 1EZZA 1QB7A 1XROA 1VKHA 4XSHA 1QORA 4Z2YA 1GTL1 3ETJA 4K03A 1QYRA 2CXQA 3STYA 1Z75A 1E66A 3DBOB 4QYWA 6YASA 5IK2A 3NC0C 5HVNA 4XYBA 3E9MA 2REQA 4MS1B 4RY2A 1JR6A 2BEJA 4RD3A 3KQOA 1W35A 4UREA 5M7EA 1TCCA 5DT2A 2W6ID 1BEZA 5CTJA 1B0PA 4HKTA 1EX6A 2HJ9A 2EP7A 3LCRA 3LBHA 4HWSA 1GIAA 2CUZA 4FYHA 1UM9A 2SKCA 3DV0B 4IYJA 2P6PA 3CLKA 4TT8A 4RELA 2BEVB 2JNWA 3HJHA 3BCRA 3SVLA 3DT6A 1JA0A 4R98A 1HY3A 3ZXYA 3OTQA 2RKBA 2CUNA 2EL7A 1ENYA 4K3UA 5KREA 1DARA 2G70A 3GNQA 1X94A 3MUEA 2NU6B 3NAMA 5A7GA 4O2AA 4PTLA 2BR3A 3PFIA 2I54A 3NTVA 3W3ZB 4YACA 1FFAA 4ISCA 4ZICA 4QTZA 4DUZB 3JAMA 4R9RA 1QQ6A 2HSEA 4H7JA 1UBNA 4U1RA 3JCZA 1YFLA 4TRJA 4HI0E 2L0XA 1TEHA 1VE3A 1RLTA 5E6UB 1H4TA 5AW9A 2ABWA 1ITZA 5MFPA 3TRHA 1NWCA 4AJKA 2V7PA 4BFSA 1HBJA 2M1XA 2PVPA 1NPDA 5DSXA 5AP9A 1V2GA 1W5BA 3OQPA 2XCIA 4D3FA 3TTXA 3ZKWB 2OYSA 1Q22A 1TJYA 2NZUG 2VK8A 1YE3A 3MMNA 2AJDA 4K1XA 3VSCA 1ZO8A 2UXCB 2BZSA 1EQAA 4C6SA 1U2ZA 3GJQA 5IMSA 2CNOA 2V1UA 3O93A 2Q3MA 4WFQA 2R48A 1X9GA 3B13B 1OZGA 4RANA 3D8NA 3DW3X 1A7KA 3CW2A 5JQGA 3USES 1P62B 1VA5A 3D4PA 1R6BX 3AP3A 1GNSA 2KMLA 4BN4A 2EL9A 2CL6X 2AOUB 1GFWA 5L3QB 3U3JA 4EPYA 2EFEB 3IJRA 4BX0A 4MWBA 3M7IA 1QVAA 1HQYE 1ZK3A 3LQRA 1MRZA 4BHTA 3RO7A 3A04A 1TYAE 1EFPB 2NVBA 2PBRA 4QQRA 1PR9A 4YRTA 5EWJB 1NMSA 3OE7D 1RWNA 3K32A 2ZDQA 4PZUA 3BL6A 4BX3A 3DQQA