1UEJA

Crystal structure of human uridine-cytidine kinase 2 complexed with a substrate, cytidine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
211
structure length
205
Chain Sequence
b'EPFLIGVSGGTASGKSSVCAKIVQLLGQQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine-cytidine kinase 2
molecule tags Transferase
source organism Homo sapiens
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
total genus 66
structure length 205
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1uejA00
2GEDA 1H8HD 2VO1A 4ZCLA 5DISB 2Q9BA 1IOZA 5KDOA 5D3QA 2VHUA 1A2BA 1FQJA 4POAA 1P62B 1QHYA 3A1SA 4IFEA 1SXJB 4IOMA 3SYLA 5DN6D 2YHSA 4EPWA 1GIAA 2UVQA 4G0NA 4PFSA 5LD2B 2FPMA 2WWXA 5FTJA 1RE0A 4GL2A 4S2EA 4AYTA 1ZC3A 5JWRA 2WJJA 4JJZA 2FEMA 4BE7B 1E98A 4S35A 1WBDA 2AXNA 2VHCA 4KBGA 1Z07A 4I99A 4LK2A 3U3MA 4BLOA 1GDDA 5KPJA 2O8CB 1VHTA 2ZROA 1KHTA 4NKRA 2RGXA 1EG7A 1NJGA 3TR0A 2G77B 4K8OA 2ZJ8A 2V55B 5E7JA 4AURA 4DT1A 4OYHA 2OUKA 1XCPA 1HY3A 3ETLA 2XSZA 1NI3A 5CM8B 1YE8A 2EVWX 4GRAA 2AL7A 1JPNA 1PZNA 3DHWC 1OH5A 3VNUA 2MMCA 3PFIA 1G3IA 4B6EA 4F4IA 1E9FA 4Q1AA 5J4KA 2F3RA 5CYOA 3RS2A 4LJ5A 5FL7A 4PAMA 2AXPA 2UZ3A 4YDSA 4AG6A 3BERA 4LUCA 4YONB 1J7KA 2WJYA 2JLWA 3QXCA 3K0FB 2BM0A 4UJ5A 1DO2A 4MKHA 2DR3A 5FBRB 4IVPA 4IEIA 2ZR7A 4KVGA 4AKEA 3SQWA 1S9HA 4FMCB 1X8JA 2AR7A 3R20A 1XJQA 4KYUA 2F1IA 2Z43A 2JJ2D 1W2HA 1CS4C 2ZJYA 1B23P 1IN8A 2FZ4A 1VG1A 4JLDA 5FOVA 1I4TD 3QF7A 3DM9B 4EJSC 2FPLA 1W5SA 3QVVA 5BWMA 5JJLA 2IYLD 2WZQA 5CM9C 3L0SA 5KTYA 3AEZA 3VAAA 2XZLA 2PBRA 2BC9A 1TMKA 2IC5A 2P3SA 3KB2A 2FJUA 1KSHA 1GL6A 2RGEA 3AF4A 5EQTA 3ZLJA 3AVWA 1HV8A 1G19A 3FDIA 2W6JD 1T0JB 4I1VA 3B78A 3LW8A 4RZUA 4DRZA 4WW0A 4PTLA 3MWLA 2GK7A 2PCJA 5FL3A 1ZU4A 1PJRA 2Q3MA 3U7HB 2A5GA 2IXFA 3SEAA 2C9CA 4MKFA 4NYIQ 2AHOA 4OBEA 1Z47A 4AYWA 2ZEJA 4YLGA 1Z6XA 2Q3FA 2D06A 3NEYA 4B3XA 2VPPA 4EDHA 2IXEA 1YR8A 3AV0B 1FPMA 4FMCF 5CIQA 3VR4A 2H17A 5HZKA 4HLDA 1YR7A 4JSYA 4GZMA 1S96A 2QZ4A 3OESA 4TZ0A 1TNDA 2A5JA 3OEHA 4WZBE 4QOSA 5D3MA 1D6JA 1DOAA 3TUZC 1KMHA 1NY5A 5L3SB 2J3EA 1GWNA 1XEWX 2PEYA 3PEYA 2WWFA 4OJKA 3PQCA 4D4JA 3ZJYA 3PG5A 1N5KA 1D2NA 3K0AA 4IHQA 5L8VA 2GHIA 2V7QA 3A37A 2O5VA 5CITA 4ARZB 1E2NA 1G5PA 4N0EA 2CHQA 4N3NA 1QF9A 2QMUA 3IILA 1AS3A 1CRPA 1Z0IA 4URXR 4MRVA 3UPUA 1XD2A 2BCGY 1NF3A 5AJWA 3B9PA 2B92A 3OZXA 2ZE7A 1HT1E 2QTVB 4C0SA 2RGAA 1OHHA 4O2RA 4RSGA 2HJGA 4FCTA 1JJ7A 1R4AA 4LX0A 3KJEA 2GVDC 1KY2A 2F3TA 4GI7A 3TUIC 5JCPA 4OHYA 4DZZA 2O8DA 5GJVC 1T91A 1DAFA 2W00A 2VP2A 2J0SA 2WKPA 2QAGC 1KK2A 2D2FA 4C30A 3SQXA 4AG5A 3RC8A 4OHXA 3UG7A 4Q7LA 3BOSA 2YYZA 2DYKA 3BWDD 2QPAA 4WXPA 4DDVA 2IYYA 1E4YA 1AS2A 1ZUIA 1NMXA 2BCJQ 1ODFA 3PIRA 2W2XA 4XWOA 4H1VA 5FOUA 5J47A 2J0QA 4JS0A 3MWKA 4PC3A 3GJ4A 3A4NA 2HXSA 3HPQA 4FMDF 1BS1A 1DAGA 4KU4A 1DTSA 1ZIPA 2CJWB 3CH5A 3ONWA 1W7AA 1JBKA 4LV6A 2OXRA 3TBKA 3GJXC 3EPJA 1AZSC 2QSYA 4LCBA 2ECKA 4JLPA 1VECA 3KQHA 3MG9A 3FPAA 5HZHA 1N0VC 1SXJD 2TMKA 1Z63A 2R62A 4TQ9A 2J45A 1T4GA 2PX3A 3LLMA 3UWKA 5FR2A 2IYWA 3DO6A 1OB5A 4EQ6B 4I81A 1M7GA 2XX3A 3A4MA 2QMHA 3FGNA 2OAQ1 3C41J 5CDFA 3U44B 2JASA 2J87A 2IS1A 3BH6A 4RD0A 4Q7MB 5TDHA 2C99A 4PC1A 3AM1A 3IDQA 3W3AA 5GJWC 4CT5A 3GP8A 4QNRA 2OXCA 1GKYA 4RCYA 3SFVA 5M04A 2ORVA 1UDWA 3CRW1 1NNEA 3AB3A 3OIUA 3L82B 1H8ED 1N6PA 1W46A 2AD5A 1Z83A 2ZSBA 3NEJA 3KDSE 3QJYA 5JMTA 1XXHB 3DZ8A 4KO8A 5FOXA 1W36B 4JBWA 1DAEA 2HV8A 5C18A 2PZFA 1NSFA 2XOKA 3A1UA 3SN6A 2ZPTX 4A6XA 4BZXA 5A5GA 2AFIE 1W36C 4MGKR 1O3YA 2QAGB 3IPXA 3RWMB 2ZRPA 3QY0A 2I1QA 1G8FA 1NBMA 5H1YA 3BJIC 3M6AA 5K8TA 2BOVA 1NVUQ 4FIDA 2ZR0A 3HU2A 1Q22A 4HAZA 1HE8B 2O8FA 3WRYC 4U02A 4JKYA 2GZHA 2IYZA 1XXHA 3DPUA 1JECA 1V5WA 4M1SA 2NQ2C 3FOZA 2ZYUX 2RGNC 2F43A 4NYMQ 2GCPA 4PANA 1NVWQ 2XJ4A 3ZQ6A 4HB2A 5DO9A 2Z0MA 3I61A 3EPHA 1XJ0A 2GCOA 3T15A 1U8ZA 5FTLA 2HYIC 3QBVA 2CMKA 3WYFA 1IHUA 2ZVPX 3LVQE 1R0ZA 3KXLA 3RSOA 1KO4A 1WP9A 2V6IA 3GD7A 1KDRA 3KKQA 1BH2A 4B47A 5KO2A 3THYB 1IXZA 3CO5A 3RRNA 5EXSA 4B76A 1X8LA 3GJ0A 3FKQA 4UXHA 4EJSA 3SYKA 4P4SA 5L3VA 2NPIA 4HLUA 1G7TA 3SC3A 2IEZA 1II8A 2QP3A 5IHPA 2R6GA 2GCOB 5EUMA 4A0FA 2YJTD 2OILA 2VTKA 1CJVC 4URZR 4M9ZA 5GVSA 2WWWA 1Q20A 2DWQA 5G40A 3MD0A 3CF2A 2C9OA 3RDPA 4EFNA 3O8DA 1N0WA 2PJRA 2VP9A 3M0EA 2ANBA 1DG1G 2JGNA 2LWIA 3V4RA 3I92A 1G3MA 4LYAA 4U00A 3A1VA 3QNUA 2QGNA 1CJKC 4D0LB 4WZ6A 1QHGA 5EE3A 3R9WA 1IY2A 4KVAA 1UM8A 3OFND 4DLSA 4L8GA 1E0SA 4B34A 4AIIA 4ERNA 5SZJA 5K8IA 1XP8A 4Y0AA 1GKIA 1T5IA 2ZU0C 3BORA 3FHOA 2F9LA 1NMYA 4X8OA 3I72A 4V0ME 1N3BA 4G01B 1LV7A 2BJWA 1J90A 3GLGA 1GG2A 2WSMA 5AJYA 1KI3A 1W4RA 3GCGA 2GJAA 5HE8A 2VEDA 3X1WA 1TEVA 1F60A 2RH5A 2ZANA 1NLFA 2ASEA 2ZS8A 2GJSA 2ZETA 3VFDA 3B7GA 2YWEA 2J7PA 1QDEA 3X1DA 3EPKA 4IDOA 1QG2A 3MAAC 1FTNA 1FX0B 3FFBA 2FSGA 3X1ZA 5FPHA 3HDTA 3IEUA 2GAOA 4TL8A 4KCGA 2Z6VA 1FW6A 3CPHA 4LC1A 3QUSA 2ZREA 2W58A 4DLWA 5KPDA 4EQ6A 3PEWA 4TSFD 1Y3AA 5DLQC 3SOPA 1DELA 1SULA 2WMNB 1A82A 5DYGA 2EYUA 1G7SA 1G9XA 2VSXA 4URVR 2F9MA 1GTVA 3LLUA 1N6KA 4CDGA 4GPTA 5CK5A 4TMVA 2Z4RA 1US8B 1JB1A 2V1XA 1S4QA 4NDZA 1UKZA 2NO1A 4HAUA 4WIAA 3NBYC 1CF4A 5CLQA 1P9WA 1T5LA 2OFWA 3EZ6A 3ICQB 1P9NA 4PHTA 2NO9A 3QVUA 4F92B 3DKPA 4F7WA 1QG4A 1XCGB 2BDTA 5FUXA 1UKEA 2J41A 4XVQA 3VKWA 4JYCA 2WHXA 1AS0A 4U7DA 2LKDA 3G0HA 3DZDA 2GILA 2P5SA 5CB6A 4RCZA 5JS7A 3DMNA 2B7BA 3FMOB 1E1RA 1TAGA 1H8HA 2YINC 5FBQB 4R9UC 3RNLA 3HPRA 1T8UA 3CX8A 4CW7A 2QBYB 1YZTA 2YWHA 3GEIA 4KFSA 3DOFA 2J46A 2FU5C 1WB9A 4DCUA 1NIJA 1P75A 2EWVA 4Q4HB 3LW7A 1Z6YA 4HDOB 1KSJA 1DARA 1NN1A 3DDCA 1ZP6A 4JSTA 4O0MA 2GK6A 2NO7A 3EX7C 1OYWA 5JI2E 3ZVMA 2GBLC 4XD7A 4KSCA 3KQUA 3WMFA 2CK3D 1G21E 1T0HB 3UMFA 4LHYA 5CJ2A 1E9SA 3L0PA 3O47A 1E79D 4P4TA 1G8YA 1BIFA 2IL1A 2WV9A 1J99A 1ZINA 4B71A 4C9BA 2PL3A 1W4BA 1QRAA 2GRJA 3L0OA 1IN7A 3B1XA 1OXSC 5HE9A 1KZ7B 1OHHD 1G3UA 3EA5A 3PV0A 4NTZA 1P4SA 3RSLA 4EPXA 2EW1A 4DIDA 4M22A 4TTRA 4ZO4A 3O8BA 2CNWD 1KMHB 2PJZA 5L3SA 5E7MA 1U81A 2A5DA 2V6JA 5H70A 3RHFA 2AK2A 1E2GA 3O8CA 4JLKA 2ZRDA 4D4LA 5BYJA 2OHFA 5C2JB 2AWNA 1OXTA 2CE2X 1OXXK 4JLOA 3THOA 4GFDA 3KX2A 4QGHA 5AJXA 3J81k 1TQ4A 4LV5B 2ONJA 2WSSD 3NTUA 4JL6A 1OSNA 1M8PA 2OE2A 1RJ9B 3IUYA 3U6BA 2BJVA 2BBWA 3KZ1E 1Y63A 3HU1A 1J70A 4A2WA 1P3JA 1ZYUA 3KJGA 5E4FA 1OH7A 3EZ2A 1XFAA 2J7KA 4HI0E 3UWOA 3PUXA 4JVNA 2Q6TA 3NWJA 4OQXA 5C4MA 3W9YA 4JIMA 1XEXB 2QENA 3Q3JB 1JAIA 3KL4A 1E96A 3AGPA 5BYKA 1YZGA 4CGZA 1OV4A 2CLDX 2GAAA 2ZVQX 2FPKA 4Q1CA 3TE6A 2NZJA 1D9ZA 2QP4A 3AKCA 3QSYA 5HTKA 2XSZD 2ZJ5A 4PSAA 621PA 1GSIA 4TMTA 3BH0A 4GP7A 4LBYA 1ZUHA 5KSZA 2DCUA 2REOA 4FN5A 4G1UC 4D4KA 1MABB 4TLBA 1G4UR 2WJIA 2ZS9A 2H7VA 3GJ3A 4DEYA 4ZIRA 1VG9B 2CHGA 3CR7A 4IJMA 1N5LA 4TSFA 1SXJA 2CCJA 2ODEA 4A6PA 3FWYA 1BMFA 2RGNA 5K8LA 2IK8A 1IONA 4I1SA 1KO5A 4JLBA 2MSDB 1OFUX 1E0KA 1IQPA 3R7WB 4EJSB 4B2LA 4W7SA 3GPLA 3B2EA 1PLKA 4PZZA 1LS6A 2QAGA 1L4YA 2XOKD 2BIFA 3WP0A 3G5UA 1EGAA 4MUAA 5D3MB 1DBSA 5FPKA 3ADDA 5LB4A 4TLDA 5HR5A 1ZCBA 3TVDA 1PUIA 3H0KA 2NMVA 3M4YA 2P6NA 1G7RA 5AJVB 4RD3A 4B2PA 2NGRA 4NL4H 3LRPA 4TN1A 5SZIA 3VNVA 4JT4A 2WWGA 1DAHA 3T5DA 4EPVA 4Q4AB 2WM9B 4QHYA 2ATXA 4UXIA 1Z0AA 1Z06A 3WNBA 4RFSB 4A0RA 3MSXA 2WKRA 4GMXA 3FKSA 1Z22A 4G5RA 4XWAA 1ZNXA 4C0KA 1IN5A 2QI9C 1COWD 3E1SA 1N5IA 4NE2A 2V1UA 1NSTA 4AY2A 5DI3A 3DVLA 1DAMA 3NC1C 4G5OA 5BQ5A 3N2IA 2QRNA 2ZJ2A 1T9HA 3TW4A 4ACAA 1CTQA 1UF9A 2FGKA 3NC0C 2RGBA 2IYTA 3GFPA 1G7CA 5HKKD 2ZXUA 3CUEF 1AN0A 4HUQB 2RGGA 1HQCA 4I1OA 4URUR 1VPLA 1VDZA 1WA5A 5HKKA 2W0SA 1U9IC 1DAKA 4DDWA 1N25A 1DVRA 2WMOB 1EFRD 4JJKA 4EPTA 4NCIA 2G3YA 2QL6A 3EASA 4DB4A 1FOEB 1UPTA 2ORIA 1Z8FA 4OI4A 2CK3A 2VRWA 3K9LA 2JLSA 2PLRA 1E2HA 5A4JA 5L3QB 3LO5A 2B6HA 2V8OA 1E2QA 3AQ4A 3B1VA 4HAXA 2BBSA 1E0JA 1NBMD 1MT0A 3K1JA 4H9GA 1Q57A 3TQFA 5HPYB 1YKSA 3BFKA 4M0LA 3FYHA 4E09A 3W6NA 3OEED 1X86B 5K8UA 2V9PA 2ZRHA 1F2UA 4FWTA 1KK1A 5FUYA 2YWFA 3HR8A 1I4DD 3BAFA 1HTWA 3QKRA 4LRWA 3X1YA 2GXUA 1P9RA 4CEJA 4PSKA 4Z1MD 1OFHA 2IW3A 3GMTA 2F7SA 4C0AC 3QF4A 1MO6A 5F9FA 4G3XA 1AA9A 4Z8XA 3RRMA 1R6BX 2QT1A 2XEXA 1E2PA 4RD4A 1Q0UA 2ODNA 2OO7A 3K0SA 1FQKA 2JLRA 4UXJA 2W6IA 3H4MA 1R8SA 1SHKA 4X8HA 2JLYA 2JLXA 3C5CA 2O8EB 1OYYA 4B75A 3EWSA 4OK3A 1E6CA 1U98A 1ZAKA 2XNDD 3AP1A 1RPZA 2BMEA 1G4AE 4Q00A 1T8TA 1EESA 2JJ8A 5DH9A 4GMDA 3AP3A 3DL0A 1K5GA 4KITB 3KJIA 2CEAA 2P6UA 4Q4LA 3FTQA 4C4PA 3BE4A 3THWA 2P2LA 4WAUA 1XWIA 5H8WA 4RVCA 5IDVA 3IQWA 3TH5A 1NJFA 4EPYA 2E87A 3C8UA 4LHZA 4TYQA 4EUNA 1G6HA 3BXZA 1E9RA 2BV3A 2CJWA 2D3WA 2D62A 2GKSA 5JRZA 4OI0A 2OEPA 2G0TA 1EFTA 1GUAA 4JLAA 2P67A 2ZI9A 1PLJA 5GADl 3WHLA 3HU3A 1R5BA 5LDDC 3JZAA 1CJTC 3C15C 4ZI2A 2NG1A 2XAUA 1U0JA 2N46A 4LJ9A 2DFLA 4GNKA 2BWJA 2VF7A 3VKGA 1S3SA 4WOPA 4LYFA 2ZE5A 3L43A 1ZVQA 1TX4B 2ZE8A 3OE7A 1KIMA 2ERYA 2RHDA 1E2DA 2AD1A 3QEJA 3U5ZB 2ZU6A 2J59A 3NBXX 1CR0A 5ELXA 2R6CA 1LTQA 3LQQA 1NBME 2QE7A 1GL9B 5J40A 4M1MA 2IEYA 2ZRCA 2QROA 2EFEB 3AF2A 1TL7C 1YZNA 3C14C 4A0GA 4DCTA 1MH1A 2CE7A 1HA3A 5JSZA 2WICA 4LYJA 3I73A 1W48A 4W9MC 1K5DA 1MR3F 4DXAA 2F6RA 2FSFA 1XU4A 2ODBA 4Q21A 4H1UA 4URWR 5EJEA 2QN6A 3BIFA 3U60B 1XTJA 2H57A 2R44A 4MYHA 3I5XA 2IXGA 3QG1A 5AUNB 5KDDA 1GOTA 3BB1A 1N6OA 1W4CA 4JVMA 2PCLA 4EIWA 3WBJA 3EC2A 3WBKA 1PV4A 1P72A 4ZDIA 4QGGA 4OHWA 1NKSA 1YRAA 2GF0A 2X19A 3PCRB 1EXMA 2OG2A 4JLVA 4US2R 1KO1A 4TTPA 4QKQA 1E2KA 3U2QA 4KYIB 2D4HA 1KNQA 3I3SR 5AUOB 1SZPA 4XJXA 4G5QA 2EFDB 4DLTA 5LB2A 2JDID 2FSHA 3MLEA 2X2EA 4BZPA 5P21A 1S8FA 3B60A 1TF7A 2Y8EA 1KJZA 3KXIA 4JL5A 4D26A 3Q85A 2IWRA 4NP6A 3QPWA 1RYFA 2XJ9A 2A30A 4YC7A 3R9XA 2WWYA 1MOZA 3GEEA 1D8TA 1OE0A 2V7QD 3DKVA 2OBMA 1DEKA 3QI2A 2HF8A 3TGPA 1VTKA 1NMZA 4QNMA 1E94E 2GDJA 1ZJ6A 2W83A 5TARA 3TRFA 2HLDD 4TMKA 4UNPA 1K8RA 3K70C 5F3WB 3SNHA 3WYAA 4ZKEA 2O8CA 4PC6A 1XRJA 3E70C 3IQXA 1U0LA 1EX7A 3L2OB 4NCNA 4BPBA 5FUWA 4MITA 3TLXA 2IHYA 2CXXA 5DGXA 3AH8A 1ZM3A 4BRWA 3D7MA 3HYRA 3GLHE 3IBYA 1G8HA 3L8ZA 4BZQA 3W6PA 1GL7A 5KUTA 5FPYA 1EX6A 1W1WA 3B5JA 1BO6A 3GLIB 4PPNA 2C2HA 1KI1A 1UJ2A 1E1QD 5HCNA 4FMDB 1KI8A 1LNZA 3UXMA 2Q3HA 1JQLB 4OHVA 3VHXA 1PVOA 2J0UB 4GBMA 3IEVA 2OZEA 2YZ2A 2JLVA 5CB8A 4NCJA 3PVSA 1TF5A 3EIEA 1E0AA 4I1UA 1UADA 1UBCA 3SR0A 2ZYWX 1J8YF 4AWXA 1P7CA 4DJTA 2ZRIA 4LBVA 3WRXC 1KZGB 1S1CA 2WPDA 1XNJA 2KBEA 2ZRMA 4BQSA 1S2MA 3HWSA 4A2PA 3AF3A 4PXAA 4XH9B 4CEJB 1C9KA 3AKEA 2JIZA 4O2LA 2OM2A 3K0CC 3ZVNA 4BFUA 2G1JA 4Q48A 2GJ8A 1II8B 1MO5A 4LJ7A 3BRWD 3CB4A 1YU9A 2IF2A 2YC4C 1KKLA 3CRRA 4TL7A 4FW9A 4BFZA 2QY9A 4IW3B 4W5WA 2VA8A 4Q66C 4D82A 4DUGA 3P1JA 5JCZA 3SFZA 4CF7A 4GOXA 4DLZA 2YV5A 3P27A 2RCNA 4JVSB 3CF0A 1E9BA 5EZ5A 1FMLA 4ON9A 2V4ZA 1AIPA 3W8NA 1KO8A 2R6DA 4M9SA 3VMFA 3CLVA 4E07A 4A15A 5EXTA 3D6TB 1VCIA 3ZD6A 3QQ5A 3SBEA 1RRPA 2QE7D 3LX5A 2IA5A 4CZ2A 4OHZA 5J4LA 3T12A 1Z0KA 1WE2A 2MMGA 2O8DB 2J0VA 2GXSA 1JALA 3CRVA 3VR3A 3U44A 3GLGB 5FI0B 5UKDA 3C5HA 3WXMA 1KK0A 3IHLA 1KMQA 3GFOA 3Q72A 4QFMA 1Z08A 2G83A 2F55A 2JLZA 1EK0A 4QRHA 2YC2C 3KKNA 4L9WA 4MRSA 4PAQA 4Q1BA 3TNFA 4B3DA 3I5YA 3KKOA 4QHSA 4Q4JA 1E9EA 1SVMA 4UNSA 4HZIA 2GZAA 4QBHA 4DDTA 3EXAA 4QL3A 2OFXA 3FMPB 2ZSAA 4YMVA 2H18A 2UKDA 1GVNB 3AVXA 5FI1B 2VSOA 3DEFA 2IX3A 2PMDA 1T3SA 5L3RA 3CH4B 1XBTA 1MO4A 2A3RA 2GVZC 3VQTA 2FG5A 4KFTA 4Z1MA 3SJCA 2F1JA 4B3CA 2GBLA 5FR1A 1QVRA 1VG0B 3F5FA 4WA7A 4AKHA 2G0NA 4MKGA 1W0KD 3ADCA 3IO5A 5CK4A 1JEEA 3O8RA 4Q4JB 4NYJR 2EFHB 2ZTSA 1ZUNB 2JEOA 4TLAA 1W0KA 1Z0JA 4OK6A 4FMBB 4TLEA 2I4IA 1E2MA 4ESHA 3BD9A 1Q1BA 3A36A 1CJMA 1XXHE 4LI0A 3IO3A 1OIWA 1WCV1 2ZUDA 1KOFA 2OV2A 4FWIB 3HP1A 3UG6A 2RHMA 1X1RA 1H65A 3AVTA 1HUQA 5ANRB 3ZD7A 1JJVA 4XTRA 3SYNA 3WMEA 4LPKA 1N6IA 4E03A 3W5JA 1E2IA 4AD8A 4BECA 1HURA 3E2IA 2QU8A 3ZZ0A 3NBFA 5KSOA 2BBOA 4Q1FA 3K9GA 1GKUB 2J7PD 4M8NE 1GRRA 3G82C 2EFGA 1GZSA 2FMXA 4Q9JA 3RC3A 4LC0A 1FTSA 2FX3A 2IT1A 2D2EA 2XNDA 3T61A 4PO1A 3CPEA 3K0AB 5DSZA 3TMKA 4CEHB 1G5RA 1LF0A 1WXQA 3B1WA 1R5OA 2XTNA 3LV8A 3CBQA 1CR2A 2J5XA 3NBZC 2DFKB 4MKIA 3B9QA 4GOJA 2B8WA 2BVNA 3ZZUA 2WOJA 2C77A 2H5EA 1M34E 4QGAA 3T1OA 4PSVA 2C04A 4KLNA 4WXRA 2CVHA 3THWB 1WDTA 3Q5DA 1QHSA 5GVRA 2RGCA 1MABA 1SVWA 4Q47A 1CP2A 4F91B 4QGFA 4D25A 4HATA 1L2TA 1E9DA 4DLVA 2F1HA 4ZI3A 4BUJA 3EIQA 3ADBA 1XPUA 2ZE6A 1SXJC 3Q8XB 4M9QA 3EG5A 1D2MA 1KGDA 2IYRA 4ABYA 5FBVB 3WMGA 1JXMA 1OXVA 2HCJB 2QQ0A 4XOIA 4B44A 1W36D 2OFOA 4QG7A 4MRRA 5G3ZA 1KI7A 4QBIA 4ASUA 5FOSA 221PA 1SHZA 3MGCA 2WBLC 1RYHA 2GF9A 4LHWA 3W6OA 2QP9X 4B43A 1NG9A 3ADKA 1NIPA 2AKYA 3OAAA 2ZAMA 1NP6A 2KJQA 1U2RA 2KSQA 2AK3A 2ZI4A 3NXSA 4CEIA 4V03A 3C16C 3LVRE 4US0R 2ZM5A 2VP0A 4A9AA 4D6PA 3K09C 2BKEA 4M1KA 2FEOA 4A8JA 4Q7KA 3AVYA 3LNCA 2XB4A 4FCWA 3GLIE 1OH8A 2HF9A 1GILA 1UEIA 4BGDA 2IUTA 2GTPA 2REXB 1DE0A 1FNMA 4KBFA 2A2ZA 3LFUA 3OF5A 3MCAA 1G64A 2G88A 4TT3A 1AK2A 2GJKA 2QM8A 2X2FA 4ZDKA 1UAAA 5JHHB 1UKYA 2VIIA 821PA 3CKLA 1XX6A 2O8EA 3BFVA 2FA9A 3FFAA 4PQFA 3PEUA 3NG1A 4D4MA 3LA6A 5FFMA 3EA0A 3RRYA 1C4OA 4L4UA 3U7GA 5B2ZA 3QXJA 4KJZA 3NVAA 2MSCB 4LHVA 3IBGA 5KNBA 3KUDA 1RKBA 2J1LA 4NMMA 4C3ZA 4DCNA 5FBWB 5FPSA 3ZIAA 4LOAA 1GRNA 1HEIA 1SKQA 4EPRA 3GLHA 4GT1A 1W4AA 2VL7A 2YKGA 1S0UA 1XTQA 1Z6TA 5B30A 4Q4AA 1ZM2A 4MUBA 2VP5A 2VP4A 3BB3A 4NYJQ 2XB2A 3EZ9A 1U94A 3ZVRA 5FPTA 4F38A 3RRZA 5J4HA 1XEXA 2UZIR 5FH9A 4LWZA 3BC1A 3KQLA 1D5CA 1DAIA 2IYQA 5BXQC 1FP7A 3LQRA 2ZSDA 1W49A 5KSYA 1TPZA 4TYPA 2IS2A 4ITRC 3CIOA 4HEJA 3UMSA 1XJCA 4XSGA 1XZQA 2XITA 5KNCA 1S9DA 3X1XA 4ZCMA 1KDPA 3ASYA 3GLFB 4NHOA 1CR4A 2JJ2A 1ZD9A 2RGDA 4IDPA 4V0LA 4CIDA 2GWHA 3B1ZA 4ZIRB 3H86A 4YMUA 1VHLA 1KJYA 1XD9A 2QPOA 3U3KA 3ZVLA 2G6BA 4ARZA 4KI0A 1U0HC 4C0BA 3A6PC 2O0JA 4EKDA 3QXSA 4TMWA 2CL7X 4Q7JB 1Z6AA 1PLLA 1MRSA 1YZQA 4Q01A 4R7ZA 4JBYA 4P32A 2W6ID 4DKXA 3K9NA 4C0QC 2DPXA 3I1FA 5IK2A 1ZRHA 1BMFD 3NDPA 3EWAA 2QGZA 1I2MA 2FFHA 5EUQB 1OJLA 1M1YE 3BGWA 4YMWA 4WVFA 1E2EA 3MWJA 3RANA 5C1BA 1H8EA 1VIAA 4HB3A 3U7FB 2D7DA 2YWGA 4BLQA 4HAWA 4PQYA 4ZCIA 2YOHA 2QMOA 2A5YB 2QBYA 3CX6A 2ZIAA 1CRQA 1N6HA 4E5UA 2QNRA 5JFGA 3K0EA 1NKTA 2OESA 1KO7A 1TF2A 5FOTA 3Q5EA 1Z6GA 1LFDB 1HQYE 4QM7A 3S1AA 4NBSA 3HR7A 3WP1B 1QZXA 4RD1A 4TYNA 1YVDA 2CL6X 1NVXQ 1KI4A 2ZRBA 1R10A 3KXKA 3PEVA 4PO9A 4IDHA 2JJ1D 2PLFA 4U5XA 3ZS9A 1OPXA 1E32A 4A1FA 3Q9LA 5B58C 1L4UA 3SJBA 3SJZA 1XEWY 1U99A 4M1YA 3CPJB 2ZRJA 1SKYB 1PUJA 2WWIA 2Q9AA 3P26A 4Q1EA 3RS4A 4KLZA 3I32A 3IGFA 3QPVA 1K6MA 2VH5R 1U90A 1VYVA 5DHFA 1JR3D 3QXXA 2OLKA 3C7KA 4TLCA 1SXJE 3VU9B 1VKJA 4XD7D 3FMIA 1RRCA 4ASUD 3W3ZB 2O52A 2AWOA 4PPQA 2N42A 1LB1B 5BW8A 5IRCD 4LJ6A 5JZVA 3U3JA 1CXZA 1XCMA 1F48A 4HSEA 1GNRA 3FKSD 2E9SA 3TAUA 1G17A 4PHHA 3A58B 3H84A 5F2EA 2RB4A 3RS7A 5EXPA 1ESNA 3EPLA 4RZ2A 3QKTA 2C98A 2IS4A 1F5NA 1ETUA 1IJEA 2FZLA 1TQ6A 1YZUA 3AF1A 1ELOA 1FL9A 3MWYW 4TT3D 5A0FA 2ZRFA 4B73A 5JI3E 2CDNA 4M4SA 4DDUA 4OL0A 2WJHA 3EC1A 1R2QA 1Q44A 1U8YA 3GFTA 4P3YA 1DADA 2FFAA 2HEIA 5FTKA 5JWHA 1R5NA 3ZDQA 4JL8A 2QG6A 4FCVA 2WSSA 1UBEA 2QPTA 2X8AA 3QENA 3P32A 1FP6A 5CJPA 3LDAA 2CHVA 1Z5ZA 2HXYA 2O0HA 1P5ZB 1NY6A 2KE5A 3H1TA 4HUQA 1Q12A 4YXWD 5JJIA 4V0KA 1ZIOA 5GJBA 1LW7A 1GAJA 5FUVA 3KFXA 1SKYE 5EP3A 5JEDA 3AVVA 2C9YA 1E2LA 2WAXA 2QEQA 3RVBA 5SZHB 2EWWA 3JVVA 3VR6A 1GM5A 1JR6A 4C0HA 3N2EA 1ESMA 1F2TB 3WY9A 2ZSEA 4IOJA 1SVLA 2OBLA 1X1SA 2IBMA 2ZI6A 2MSEB 3T5GA 3QIAA 4KV9A 4JVLA 1J2JA 1CEEA 4RFSA 3KQNA 4BFYA 4D0NA 2C78A 1CULC 1F2UB 3FVQA 4BRUA 4TQUS 1YZLA 5G3YA 3NDBB 3QKUA 5FTMA 1P6XA 4YQFA 1RC8A 2XXAB 3OFNA 5FBLB 4OQNA 1J8MF 1QBKC 2JJ1A 4BASA 1N0UA 2PT7A 1G8PA 1R0XA 1XTIA 3TJZA 2ANCA 1D9XA 2PZEA 4A2QA 3T1TA 1LVGA 1Q1EA 3FHCB 4DLYA 1EWRA 1ZNYA 1ZD1A 4QJ5A 4RD2A 3TUJC 4OI1A 3JVUA 1Z2CA 2NO6A 2JCSA 4B48A 1M7BA 3B82A 2QM7A 2AX4A 1XPRA 1HT2E 2KI5A 1R8QA 1WQ1R 2C96A 3LX8A 2E1RA 2ZYVX 1RW4A 4HZUB 1L7VC 4LGMA 1G6OA 3OE7D 1M6NA 1OH6A 2XGJA 2XZPA 5LD2C 2QSZA 2QMEA 1KNXA 1I2DA 4DC9A 1NLZA 3K0CA 4DLUA 2WPDD 5JRJA 4BFWA 5JHGB 3GLFE 2LCFA 1U9IA 2DY1A 3P20A 3THYA 3QOFA 3SHFA 4HLUC 2FFQA 4XVUA 5KOYA 1EFUA 3R8CA 5DNYB 1P73A 3TK1A 4B3FX 2G9NA 3W34A 3GLIA 3QE0A 4RZXA 1ANKA 1NN3A 2EYQA 3SS8A 3VX4A 2G1KA 3A4LA 3QF4B 4NZYA 4UNNA 3N5CA 4B35A 2CCKA 2A7QA 4N0DA 1B0UA 1ZM4A 4P4UA 2BM1A 4TMXA 1CBUA 1ZD8A 3OEEA 1JI0A 3P4YA 2VP6A 3CNNA 1QVAA 2ZJBA 1EFCA 3MJHA 1XMSA 3LBIA 4ZV4A 2O8FB 4FI3C 2FGJA 4US1R 1G20E 3ICEA 3WYGA 1SVKA 4P31A 2FOLA 4QBFA 4GSYA 4V0OA 2OCYC 3OAAD 4EFLA 3CRQA 1Z28A 3UKDA 4Z51A 4DHEA 2VHQA 2XZOA 3RWOA 3CF6R 3QBTA 5CDFE 1FUUA 3OEHD 3REGA 3AVUA 2W0MA 2XTZA 3NH6A 2CNWA 2ZR9A 3BB4A 5CLLA 2RKOA 3F3YA 3K70D 3ZS8A 5KNDA 1GP2A 2GCNA 2QTHA 5HCIA 3P4XA 2WIAA 2BMDA 2GZDA 2VSFA 4XTCS 1NG1A 1DPFA 3GJ8A 2VHTA 3A1WA 1ZMXA 3EIHA 3K0FA 1T6NA 3LBHA 3SJAA 1A4RA 1NN0A 3IKJA 4F4JA 1CU1A 1R7RA 2BHRA 4IRUB 4BFSA 2IYXA 3SE0A 3QKRB 1LF5A 2ZRLA 4JLMA 1WBBA 2QAJA 2NPFA 3FB4A 4Z8YA 3ND8A 4GOKA 1FFHA 1RJ9A 3N70A 3WNCA 1KDOA 4DCSA 1FX0A 2C95A 4CRWB 4LYHA 2Z5FA 1ZNWA 3C4JA 4URYR 2K5UA 1FMJA 2P6RA 3EARA 2Q0HA 1SVOA 4WZAE 1G3RA 3IIKA 2ZRNA 1CJUC 1DO0A 4MQBA 4XVRA 4TQAA 3TSZA 2V3CC 2W2TA 5DYIA 1Q21A 4B6FA 3EW9A 1BKDR 1G1MA 4YDHB 1AM4D 1OT3A 1DG3A 2AN9A 3CONA 2ZRGA 4IKEA 4R98A 3IIMA 1YR9A 3NIBA 2HDNB 1KI9A 5TB5A 2OCPA 1AKEA 4QJ4A 3WHKA 2AFHE 4TYYA 1ZBDA 4LJ4A 1FNNA 2GESA 4DT1B 4RD6A 4TZ6A 5IT5A 5GJCA 4KODA 2IYUA 4X8MA 4IOKA 4MYCA 3LD9A 2WJGA 3ZZTA 1KKMA 2LKCA 1ZC4A 121PA 2CLSA 2L0XA 1GNPA 4A8JB 5FL7D 2PMKA 2ZRKA 3Q7PA 1E3MA 1YHNA 1VCOA 2BEJA 4M1OA 2OBNA 2ONKA 3TIFA 3CZQA 2GXQA 4AK9A 4DSNA 2H1LA 1M2OB 3FMFA 4CVNA 1KI6A 1CKEA 1XDBA 3D31A 2DFTA 2GJ9A 2P65A 2VLIA 2ZYTX 4AKIA 1SGWA 4FD2A 4NCKA 4IVQA 3UMRA 3KQKA 2P0EA 5H68A 2HCBA 3CNLA 4MH0R 1XZPA 1JR3A 4OQMA 4QM6A 1EWQA 4FINA 4DLXA 4PHFA 4V0MA 4IVRA 1A7JA 3CW2A 4ZKDA 1II0A 4TL9A 3ZH9B 1KAGA 1WMSA 2H16A 3LXXA 421PA 3HYTA 4F93B 1SVIA 5G53C 2NOAA 1XTSA 1Z3IX 4D80A 5TMPA 4IOLA 4XSHA 3AVOA 5JLJA 1Z2AA 2BKUA 3UATA 1JAHA 1TUEA 2W2VA 1VCNA 4CEIB 3PR1A 4KAXA 3I8SA 5TV2A 3L0IB 3KKMA 4BLPA 5SZKB 5EXXA 3EAQA 4ZDJA 4HAYA 1MRNA 5AWFC 2KB0A 2WAYA 4HDQB 3DOEA 1F6BA 3KTAB 3K09A 4LZZA 5EE1A 1IJFA 4A8JC 1CLUA 1LY1A 5B57C 3AUYA 3U6KA 3ZIAD 3TAHA 1A5TA 2HT1A 1JEDA 5E7IA 3K8YA 3PUYA 3LH5A 4A4DA 1IBRA 1UBGA 3L8YA 5E95A 2OT3B 3PUZA 2CCGA 1RFLA 3VU9A 3KKPA 1A2KC 1T3HA 1M74A 3H2YA 4MGYR 4UNQA 2CBZA 4HZUA 1Z0FA 2YVUA 3FHTA 3KTAA 1EFHA 2Z83A 1XMVA 2OCBA 4Q19A 1BYUA 8OHMA 4B3GA 4PPFA 4LSGA 1YZKA 5AJZA 3NHAA 721PA 1CIPA 3QG5A 3Q7QA 1TADA 1W0JD 2REBA 5EP2A 3EZ7A 3ASZA 3ZYCA 1XEFA 3CWZA 2NIPA 1JR3E 2FWRA 4NYMR 3JZMA 3T1VA 3RYTC 2ZI3A 4HAVA 4HDCA 4LJAA 3GEHA 1GFIA 4C2TA 1QHIA 4KXFB 1AJEA 4A36A 1BYIA 3RLFA 1G16A 4BFTA 4Q9LA 4JLJA 1IN6A 4MYTA 3S1AB 3GJ5A 2JA1A 4NYIR 3GLFA 1P61B 3AVQA 4Q9KA 1W5TA 2C5LA 1TQDA 3SI7A 3SHWA 2HLDA 3QKSA 3PENA 5CIWA 4X8LA 4BLTA 3TR5A 2VBCA 4V0NA 5KDLA 1I4LD 1VG8A 1XF9A 1KY3A 1XD8A 2X1VA 4GZLA 1YRBA 3PJRA 5KU1A 4LDJA 1L8QA 2R8RA 4ILEA 5AR1A 3PUVA 5BN5A 1SQ5A 1G3QA 4K81B 3CR8A 5DIFA 1KK3A 2RMKA 4PC7A 1C1YA 1XTRA 1P2TA 5IK2D 1MKYA 3QXHA 4KSBA 3TKLA 3AUXA 3W5IA 2ZI7A 3LWNA 4HLCA 1N6RA 1NL3A 2Q9CA 4R2IA 1TU3A 2QQEA 4B32A 4C0LA 5BN3A 1ZM7A 1W44A 2NO0A 3M1IA 1E69A 4RKFA 4KFUA 5KYKA 3B6EA 1KYIA 3NH9A 2YNMA 1ZW6A 3VR5A 3FE2A 4MGIR 3VR2A 2IUUA 2VF8A 2XTMA 4M9XA 4BFXA 2R65A 4Y0VA 2RAPA 4RJLA 4P33A 1UEJA 2N1BA 2P5TB 1E2FA 4DWJA 3LAWA 1AQUA 4M2LA 1NVVQ 5TY0A 2YOGA 3TSOA 3BBPA 1P2VA 1P60A 2ZS7A 4W5HA 1QHHA 1KSFX 1GRQA 3VX3A 3OHMA 4AKGA 3LBNA 1D2EA 3KJHA 3GLHB 3SU8A 4Q9HA 1MV5A 4HUTA 2X77A 4II7A 1N6LA 3TVTA 1HE1C 1G18A 4M1WA 4TYWA 3I8XA 1E79A 2O0KA 5JECA 2FN4A 2ERXA 1E9AA 4P0TA 4CT4B 3KUCA 1IXSB 1W2GA 2C03A 2CVFA 2QUZA 4GP6A 1HYQA 1T3LA 1IXRC 1OIVA 4PQRA 4NPHA 3B8HA 1IAQA 1US8A 2IHBA 1Q1ZA 4IEEA 2Z4SA 1Z29A 2DBYA 2HUPA 4O25A 1VYTA 5CYPA 1G8GA 4B33A 2V54A 2EU8A 4LJYA 4E22A 5J4VA 4PX9A 3CZPA 3GLGE 1ZU5A 1OB2A 1OIXA 5EE0A 3R8FA 4JBXA 4Q1DA 3U3OA 1AGRA 5JWOA 2F1RA 1NLYA 2XXAA 3X2SA 4W5JA 1Q3HA 3UK6A 4PZYA 1F3OA 5G41A 4LBZA 2HJVA 3AKYA 3OIWA 5DI9A 2BEKA 2BMJA 4Q4HA 5DN6A 2HYDA 2B8TA 4BEJA 4RY2A 4MA4A 1E4VA 2ZQ5A 4MGZR 4Q03A 3ZQJA 1CR1A 1E2JA 3DMDA 2VQSA 6Q21A 3W8RA 2PH1A 4JT2A 3UANA 1VCMA 2GETA 521PA 1KDTA 4MRNA 1HH4A 3K53A 1LS1A 3T35A 2JLUA 4HYYA 4F4CA 3WNDA 3PXGA 1W0JA 1XD2B 4PAOA 1FUKA 2A9KA 3A1TA 3PUWA 2WWHA 1IM2A 3V00A 5C46F 2BMFA 3CWQA 5EP4A 2JIZD 3AP2A 3IPYA 3OIYA 3NHBA 5AUPB 4BEBA 1GITA 5JS8A 2OAP1 4AYXA 1RRFA 4UJ3A 3V9PA 3OIVA 1M7HA 4BLRA 2ZJOA 2DHRA 2B21A 3VKHA 1XMJA 3QEOA 1ZCAA 3BS4A 2PX0A 4JLNA 1KI2A 1X3SA 5EP1A 2Q21A 3U61B 4HB0A 1TEXA 3NKVA 2ZSFA 4D0GA 2R6FA 3LY5A 4UQOA 5FTNA 3QPUA 2R2AA 4PZLA 1FZQA 1V43A 2XNSA 2QTFA 4LPSA 2QORA 4M1TA 1ONBA 1UBFA 4BFVA 1X8KA 1E1QA 5LPNA 2B7CA 2I3BA 4WBSA 2CLCX 1S3GA 3D3QA 4DUGD 1QHNA 3R9IA 5EE9A 4C7OA 1WF3A 3A8TA 4PPGA 5KSPA 3U7EB 1GNQA 4DBLC 2PZGA 1IY1A 2IYVA 3MUFA 4Q02A 2IYSA 4P4SB 3VR1A 4PC2A 4B2IA 2CL0X 2IUSA 2C8VA 4LHXA 4NU0A 4BLSA 4TMZA 5KHOC 4R2HA 3HJNA 1RIFA 4L16A 5FOWA 5BN4A 4ESVA 5TXGA 3RS3A 2DB3A 2O8BB 1OFTA 2ZUBA 3QKSB 5J4YA 1QHXA 4JYBA 4B74A 2BBTA 2J9RA 4TWZA 3U4QA 1NRJB 4R71A 1P2SA 3IIJA 4QC2A 4EAQA 2GXAA 3E5HA 4DCVA 3D8BA 3MMPA 4UNRA 3IHWA 1W47A 5LBIA 4D2IA 3I62A 4JKIA 4DLRA 2JAQA 4HB4A 4RFVA 4B3BA 4QXAA 1RVDA 1TTTA 4DVGA 1YQTA 1IY0A 3ECCA 3T06B 3VHLB 1EFRA 2QRZA 2KBFA 1OW3B 3B85A 1XB2A 4IXMA 3MJRA 1OXUA 2O8BA 2ZUCA 1N2CE 2D7CA 5E3HA 4QJ3A 4PR0A 2IF0A 1UFQA 2VHJA 3ZGXA 4M53A 4EFMA 4Q18A 1YJ5A 1VIYA 3RS0A 2ORWA 1WRBA 1XTKA 2FFBA 5F9HA 3CX7A 4NCHA 3BK7A 2ZITA 1JQJC 2R9VA 1Q1QA 3CRMA 3AVPA 3GJ7A 5JEEA 1AKYA 1NN5A 4NH0A 5DHAA 3UIEA 1E99A 3AGQA 4UKDA 4MDFA 1U8AA 2ATVA 3RS5A 4MDEA 1YR6A 2ODWA 4OQLA 2JATA 3I4LA 3PITA 4Z54A 4CYMA 1VMAA 1E9CA 3F8TA 4DSOA 4RKEA 4C7OB 1JXOA 5B64A 4K46A 2QA5A 4ZPXA 3T1QA 3W90A 4GDFA 2F43B 4YXWA 4AI6A 3R7WA 4ACBA 4IDNA 2H8KA 3MFYA 5F98A 4OQFA 1X6VA 5AUQA 2R6AA 1IN4A 2A5FA 5L3QA 2WTUA 1JNYA 4A92A 4YMTA 2NZ8A 1TU4A 2I1VB 2FH5B 1OF1A 2AKAB 2EFCB 1KAOA 2WOOA 4QHTA 4IXNA 2GEVA 2DFNA 1OLOA 2IWHA 3U4QB 2FV8A 1TQ2A 4I4LA 4PO8A 4LY6A 4J0QA 4G5GA 2SHKA 3KB1A 1RRGA 3BH7A 3GJ6A 1MO3A 1A1VA 5DI3B 1G291 1UKVY 3AF0A 4LBWA 3U3RA 3DM5A 1N6NA 4JMPA 4M21A 1AZTA 1OKKD 3ND9A 4TL6A 4L9SA 5EZ6B 1BOFA 4XWKA 5C4GB 1KTVA 3AKDA 3V4FA 2FDCA 4A82A 4V02A 4FXPA 2PEZA 1Z0DA 2H92A 2ZJAA 2FSIA 1NVVR 1RZ3A 1VYUA 2OLJA 4HLQB 3RABA 4C2UA 4OI2A 2VYFA 3B13B 4L5BA 1KSGA 1AQYA 4OKSA 3SBDA 2GA8A 2FE4A 4RZ3A 3VTKA 2QT0A 1QHHB 2JLQA 2KWIA 2WJVA 1UDXA 3TSWA 1COWA 2W6JA 1OKKA 1KI6B 3CM0A 3MRSA 1G41A 1II9A 2GNOA 3KFVA 5TVKA 3THXA 1R0YA 4XIGS 4DSTA 4IDQA 4DIEA 2HT6A 3GQBA 1KJWA 4KHZA 4MYUA 1DS6A 4OK5A 1XPOA 4BWYA 5JSZB 1OFIA 2WVJA 1P2UA 1SVSA 1TUIA 4CEHA 3SDZA 3SZRA 1ZM9A 2ZRAA 4NONA 3K70B 4O3MA 1N5JA 4PHGA 4TTQA 1S1MA 5JBQA 2WKQA 4DB2A 4DSUA 3B1YA 1XMIA 4Q9IA 1G5TA 4N1AA 2EQBA 2FF7A 5DE3A 4QBGB 2DWOA 3THXB 2GEUA 4Q5IA 1E1RD 3LXRA 4KFRA 4YMSA 2OSBA 3CNOA 5EE5B 2IS6A 1AGPA 2ZAOA 3TW8B 3F0TA 4LV8B 4G5SA 2A78A 1R0WA 2ZJZA 3K9HA 5IF9A 3BFXA 2D74A 4OJQA 5AK0A 4MRPA 1Q3TA 2WIBA 4IFBA 3REFA 1O87A 2NTYC 2OCAA 2YOFA 4AC9A 4LJ8A 4ZDWA 5JJKA 3TQCA 3RAPR 4D81A 4JZKA 2JDIA 1JPJA 2FNAA 2DWPA 4DEXA 4C0JA 3T34A 1ZNZA 3EZFA 2ZI5A 5J5CA 2J0UA 1F2TA 2PT5A 4A0HA 4L15A
chains in the Genus database with same CATH superfamily
2IHVA 1H8HD 2NADA 1UR5A 3I30X 4KBYA 1ISSA 2EKZA 1IOZA 5DISB 3ZC3A 3R5JA 4ZVRA 2P7HA 1PZMA 1PGOA 3G0DA 5IBPA 1QHYA 2FUNB 3SYLA 2CWDA 5BWOA 2PX2A 2YHSA 1P17A 2W4IA 4Z0HO 2FPMA 2NZYA 1RE0A 1CFJA 1KVUA 1Z39A 3AUUA 3HRIA 2FEMA 3ZU2A 1AV6A 2C2YA 4LDQA 4PICA 5ALIA 5T4FA 1FVXA 1IXYA 3D64A 1GDDA 1CZLA 5BQXA 1KHTA 3CTPA 1FRZA 1EG7A 1NJGA 4KDCA 2G77B 3TR0A 2ZJ8A 2HSGA 2QHXA 2V55B 2WZCA 5DN9A 4AURA 4DT1A 1SKMA 2H5JA 3SX0A 1B8NA 1XL1A 2XSZA 2QQ5A 2MR6A 4GRAA 4Z51A 2AL7A 4JUFA 1H42A 2WIFA 3DHWC 4I50A 4DAEA 3PFIA 4FYVA 2PZBA 4ZAXA 4KR3A 3E9DA 1GV1A 1PDWA 3MCZA 4MV5A 1SFRA 4AIRA 1C9YA 1E9FA 1NU6A 3LO8A 4CLDA 5J4KA 3A3NA 5CYOA 1CR6A 4M1EA 4PXSA 3I45A 1CRZA 1CS0A 3BM5A 4O4HB 1XDWA 5FL7A 3K4PA 4TV9A 1RZVA 1AF4A 3RU2A 5LFAA 5LU9A 3RH0A 3INGA 2APJA 1FPQA 5LP1A 4XYMA 2YXEA 1J22A 2D5IA 4I46A 1PT8A 1QE0A 4CR6A 4DIMA 4WCDA 4PZ9A 1UFOA 1PW7A 1XELA 4WY8A 1BDMA 4QBTA 4B4KA 2DR3A 4AKEA 1KIFA 1CUUA 2ENWA 3GGGA 2AR7A 3KXPA 4X97A 1H1DA 3V8RA 4KYUA 4CKWB 4H1WA 1X14A 2VWGA 4F9EA 3H3JA 2IYFA 1YC5A 2PUCA 2R84A 3JD1A 1MQSA 2D2IA 2INGX 3QF7A 4QRIA 2R5NA 4BVKA 4EJSC 1ULZA 4KGZA 3EWIA 2PD3A 2IP1A 5JJLA 1HT3A 2IYLD 3RAFC 3INNA 1U0NA 3I9NA 1E6UA 5CM9C 2A0YA 3L0SA 5KTYA 3TSAA 1QX4A 2VNJA 3E7XA 2BC9A 1P2BA 1D3AA 1TMKA 2NSYA 1C29B 1ZSVA 2J09A 1GL6A 2DGDA 2P3SA 2RGEA 3KB2A 4L7VA 3HCFA 2FW9A 4D9KA 1OR8A 1NQWA 2QXYA 2NACA 1W19A 2O3JA 3MT9A 1MA3A 4LRQA 4C7XA 1SZCA 5AM1A 3MWLA 2DPHA 2GK7A 1PJRA 4I9FA 2DSTA 3G23A 3LXMA 1XRPA 4D8XA 2IXFA 3OPXA 1UBLS 3K6JA 3TTSA 1HE2A 4EUHA 2C9CA 4JP3A 4OBEA 2Z2KA 1Z38A 1Z47A 2I29A 2ZEJA 1YDMA 3W5HA 1Z6XA 5CDUA 2D06A 5B6JA 3Q9SA 3WGLA 3MYRA 4B3XA 1YR3A 2OLEA 1YCGA 4WLOA 3Q3EA 2HMVA 3WQBA 1GGFA 2JVIA 1YVRA 1I3KA 4RTJA 1KJNA 4F2HA 3ITDA 1H9BA 2DQ4A 1WLSA 3HJRA 1IMJA 1L7EA 1U9CA 2CDAA 2YWBA 3OTQA 1CQZA 1YR7A 4HX2A 4MPPA 4RAQA 4DHWA 2Q28A 2QZ4A 4TZ0A 2A5JA 2BCEA 3OEHA 4NJEB 5D3MA 1DOAA 5AI8A 2JIBA 1XTVA 2MHCA 4U63A 1WSDA 1KMHA 4QUHA 5L3SB 2CFOA 3K1ZA 2HPAA 2J3EA 3HCEA 4FPXA 4CHTA 1PG0A 4FFPA 3P2KA 4HRXA 4PZAA 3NRCA 5E6SA 2M6KA 4PNEA 3WGIA 3PLNA 2QT9A 5JO9A 3GCXA 1DKMA 1NU8A 2ZZKA 3K0AA 3LHIA 5GGXA 2GHIA 1R0CA 5I9BA 5KHAA 1PWYE 3SIPA 3WG9A 4G81A 1E2NA 1G5PA 2A9PA 3WXBA 1TIKA 1MGPA 2Q5LA 4GYKA 2OP0A 2P0AA 1QF9A 3IILA 1PJ4A 1O9HA 1YR2A 2GO7A 3BA6A 2G9VA 4LMRA 1KBQA 5DZSA 1XJWA 3UJ9A 2NSJA 2E4XA 2Q1TA 3VSDA 2B92A 1GUDA 4J7XA 3OZXA 2JJMA 4D99A 2HD4A 2JAWA 4C0SA 2CNDA 4ZU6X 3GZ4A 1KH1A 4FCTA 1JIQA 1JJ7A 1R4AA 2UYCA 1M83A 3KJEA 2H6EA 4XJTA 3TZ6A 4CQLB 3GLSA 4DG9A 1XVUA 2X4LA 5YASA 5JCPA 4OHYA 3F6CA 1L4BA 5LYYA 1JHDA 3TFQA 2BLLA 3PKZA 2O8DA 1DAFA 3OD5A 4YT4A 5AW7A 2J0SA 2HQOA 4D9IA 2D2FA 5IYZB 4J3NA 1XYGA 3IP9A 1TK9A 2DLNA 1EVJA 2PO7A 2Z4TA 5EVJA 4LHSA 2P91A 5T8KA 2ZQYA 3UJDA 1ZUIA 3WNVA 4C1NA 3OLCX 1XQ9A 1Z73A 5DULA 3VJMA 5ITVA 2J6CA 1XDDA 2VRBA 2BCJQ 3QVXA 4RAOA 4YCAA 3WB1A 4R1NA 4XWOA 2OECA 4HQLA 2J0QA 1S89A 4AX8A 4FHGA 3TB6A 2RG1A 5A62A 1ZQ9A 2QLJA 3TLKA 5GTDA 4XUEA 2N47A 1BS1A 1NW8A 3PK0A 1DTSA 1MOSA 1Z5UA 2WF7A 3M82A 3ONWA 2JI7A 1Z4PX 4N12A 4RMGA 4S1PA 4BBPA 2QG9A 1FXUA 3VPAA 3D3WA 1P1HA 4ND4A 3EPJA 4RMHA 3TOSA 5K1ZA 3NVKI 1M8FA 5LQDA 1XRMA 3L7KA 4CLXA 4UEWA 4X6LA 1VECA 4KXLA 1WO8A 3BSWA 1PJZA 2FN7A 3MG9A 4FSHA 1OVMA 3RVLA 5B4TA 8ABPA 4L8YA 1DDGA 2JFGA 3RUFA 1Z63A 2QJFA 4TQ9A 2C9BA 4DJAA 2PX3A 3RW9A 3LS2A 1LSSA 3UWKA 4OGKA 2OD2A 5FR2A 5IDQA 1E18A 3A4MA 1ZOPA 2QMHA 3CCFA 3FGNA 1BD3A 1G6Q1 4CKEB 2J87A 3BXEA 3MERA 1VKOA 3DEAA 2IS1A 1ABBA 1IWPB 5H82A 3OCUA 4WLUA 3RIMA 3WFJA 4FDLA 2JFHA 3B5IA 4ZGWA 3IAHA 4PC1A 1JDUA 3IDQA 1VPTA 3M2TA 4MQMA 1AZLA 1K7SN 4O63O 4RNDB 1XC7A 4HTFB 4X60A 5AJUA 2OXCA 5KNDH 4RCYA 2G9RA 4C04A 3WADA 1UDWA 1I3LA 2C0QA 4I1IA 4BFCA 1T36B 4JYPA 4DQ0A 3AB3A 3F6EX 4YRBA 1H8ED 1N6PA 1W46A 3NEJA 1Z83A 1SZDA 4GX5A 4IDBA 3KDSE 3CLRD 3NZEA 2W6ZA 4JQYA 1Q0RA 1X87A 1XXHB 3VM6A 3L4JA 4JBWA 1DAEA 1BSVA 2FAXA 5C18A 3EJWA 1RM3A 3NT4A 4C22A 4DIOA 1Y33E 2P4HX 4IDDA 2D7JA 4Z4EA 4Y6PA 1QWSA 1ULTA 4LXTA 5CD9A 1O3YA 1P77A 3IUBA 3RWMB 3VDXA 1ZXLA 5KVSA 4U3JA 4WNAA 5FNVF 2GHQA 3UGJA 2I1QA 1G8FA 3WHPA 3LPCA 4H60A 3C3CA 4P5EA 1HM5A 1CETA 3M6AA 1UP6A 5K8TA 1E8NA 4TM7A 2BOVA 3GYGA 1NVUQ 2EJTA 2ZR0A 2PZMA 1HE8B 2G4VA 2X7XA 3G59A 1O54A 4JKYA 2IYZA 4X6XA 3U31A 2G63A 5IUJC 4M1SA 2J6HA 3ZJTA 2JZOA 4ND8A 2H7CA 2JHAA 2B34A 4IJVA 8MHTA 1SB8A 1K63A 5HF8A 1KYQA 3ROTA 2GCPA 2BHLA 1R8XA 2A8YA 2A0WA 3MXOA 5D7NA 3ZQ6A 3SSMA 2OM6A 3DD1A 3EPHA 3U4HA 1VGVA 2YTZA 3R5SA 1QUFA 1Z0UA 4RVDA 1BQ4A 4RZSA 4MGHA 4BMOB 3UJHA 1N2OA 5HHTA 1R0ZA 3KXLA 4X6UA 1KO4A 3QEMB 1WP9A 1YTLA 4G4GA 5JR3A 1F1JA 1KDRA 3E05A 1EUQA 4QPJC 5K3FB 1KJ8A 1XGKA 4A16A 3RRNA 2OVFA 5CHEA 3X2EA 5CDSA 2JI6A 1X8LA 5TJ9A 1FFBA 1ZUD1 1V48A 3IVAA 3U40A 2NPIA 5CT5A 1E64A 3UYLA 2JGMA 3EHEA 3OY2A 3DLIA 4CXMA 2EKLA 1VL8A 3GCZA 4U7FA 2HV9A 3R3JA 1KEEA 1UWLA 3PDIA 4A0FA 5K0BA 2OILA 2VTKA 5AVQA 3I1IA 1NQTA 4EJ2A 4QAQA 3NHKA 4M9ZA 1Q20A 4UE6A 5G40A 3OX1A 4XVCA 3HTXA 4PSUA 3ZI0A 1E3EA 3GBSA 2IYAA 1ZFNA 1J49A 1AKQA 2I67A 2QRVB 2H1HA 3G8AA 4KRXA 2XQGA 3TLJA 3M0EA 1GZHB 3M5WA 2HJHA 1DG1G 3V4RA 4RELA 4U00A 3DF9A 3A1VA 3TBHA 3HJFA 2QGNA 2QJWA 3ITNA 3OU6A 3SKXA 4D0LB 3GK3A 4KN5A 5EE3A 3R9WA 4RY8A 5C81A 4N3BA 1UM8A 3LT0A 1E7YA 2F8SA 3ZNOA 1UXGA 1YKFA 1QFXA 4PGFA 2AW5A 4L8GA 3WB2A 4DZTA 1CUEA 4J1TC 2YJZA 4B34A 2A0KA 3DF7A 4ERNA 1VSUA 3AR4A 2KX7A 1A98A 4ZZ1A 2ODQA 2ZU0C 3FHOA 5F7ZA 5AQ1A 1NMYA 4OLJA 3DJYA 3KSUA 3OT1A 4V0ME 4KN8A 3GLGA 1W4RA 4RW0A 2GJAA 2VEDA 3TXYA 4Q82A 4NESA 2ZANA 4CQNA 4FNAA 4L72A 3PTAA 1NLFA 1W52X 2ASEA 2ZS8A 4JENA 1L6IA 3SEZA 1ID8A 2YWEA 2J7PA 3D7RA 1M67A 4TKVB 4EL5A 4IDOA 4O5OA 3J7AC 3IE0A 3X1ZA 1H5QA 2HK8A 5FPHA 4JJAA 2H2HA 2O7VA 2QTVA 1P1KA 2BKVA 5H16A 4D02A 3IEUA 2NUTA 2Z6VA 3BD7A 3Q8MA 2CJPA 1ZA1A 5AHOA 1AO3A 2EGUA 3G3EA 5KPDA 3EVGA 3OJCA 3NHYA 2DULA 4FLEA 2FQ1A 3SDSA 3PEWA 1Y3AA 3GD5A 3LZ6A 3SOPA 3TRKA 2B4KA 2CZCA 4AJ9A 2XCLA 4YNBA 1A82A 3KKZA 2EYUA 3KXDA 2VSXA 2WMDA 1L5KA 1L1RA 1Y1SA 3TZBA 4URVR 3OA0A 2CMGA 2F9MA 1ESEA 3LLUA 3DE0X 3MYYA 3CUVA 4CDGA 4MMZB 4OYRA 4HC4A 3UENA 1CV2A 1JB1A 1RMTA 3U1VA 3WZLA 4NDZA 1UKZA 4RWZA 2NO1A 1EBFA 1FP4A 1SBNE 1CF4A 1WV0A 1EHCA 1TAHA 2GBPA 3ESCA 3ICQB 3KE9A 2FCRA 3ZWDA 4DCMA 3MJVA 3ZXUB 3ZCUA 3DSRA 3QVUA 3DKPA 4N39A 1QG4A 4W1SA 4N0MA 5FUXA 3U9TA 1UKEA 4QU0A 2L19A 4O2AB 3ZLBA 3C3YA 1AV7A 1AS0A 2WHXA 2OXIA 2FMIA 3G0HA 1R3DA 3A1FA 3DZDA 3Q9UA 5CB6A 5MDHA 2QX7A 3N59A 4PG4A 3DMNA 2B7BA 1BE1A 2NV2B 3AUSA 3PWZA 4M8LA 5L95A 4ZVQA 2W2KB 4NZMA 5HK9A 1JEYB 1T8UA 2ZKIA 2CFCA 3CX8A 3LQFA 1B41A 1PJ8A 1Z68A 2ZTMA 4KFSA 5BOSB 3IPAA 3OQIB 1P75A 2EWVA 3K3PA 2A1TS 3UXHA 3U62A 2ZIXB 5AW0A 3FYSA 4CKBB 3GUYA 1QV9A 3ZDZB 4ADSG 4DTCA 3ROPA 2NO7A 2PX4A 3EX7C 2OFPA 1Y3HA 2P5UA 4YRSA 1OYWA 4BAUA 5LIPA 4MXDA 4LHYA 2I3DA 1ZONA 2N75A 3R23A 1IHXA 4DJ5X 3KD3A 3K5PA 1WP4A 3O47A 3ZQ4A 1DBQA 1E79D 4P4TA 4D9CA 1SZJG 2IL1A 2ZBDA 3MD9A 2C8LA 4XGKA 5HJ7A 4B71A 2GRJA 2V5VA 4CTKA 5C8YB 1BX0A 3L0OA 4BRZA 5HE9A 1EM8A 2G5CA 1KZ7B 3FY4A 4M8IA 2XDQA 5AW2A 4Y98A 1I7SB 2SNIE 1U0TA 2P41A 4GR4A 2A5DA 3RHFA 2AK2A 2ZP1A 5A7GA 2GN6A 3WLOA 3K6SA 4N03A 3ETCA 1JHRA 3G49A 3IA7A 4NDAA 1PVDA 1T6XA 1QS0A 1MHTA 2OHFA 1I7LA 2PANA 4PY2A 1OXTA 2CE2X 2I5PO 3KYDB 3LPLA 2H1FA 3D5EA 2B4YA 3KX2A 1UFRA 3IUEA 4TSKA 3THOA 1W9MA 2COUA 4HDNA 4NFSA 3NRJA 5IJWA 1G20A 2I7VA 4XGIA 3NTUA 4R68A 3EGVA 2FUG1 5DOVA 1S5PA 4XUDA 5BW6B 1POXA 1OSNA 2IEIA 2QRHA 3G02A 4YRPA 4J0IA 3WHIA 2JGFA 2CZGA 4R0VA 4R1SA 2O2GA 1OYOA 1J70A 4A2WA 1Z8HA 4LF6B 1D2HA 1XLTA 5E9QA 3H7IA 3AFMA 4FILA 4HDKB 3ESAA 4IXWA 4JCOA 4X7RA 3TCXB 3PUXA 1G2IA 4NE7A 2PYIA 3TI9A 4XIJA 2Z6AA 1WXWA 5FO1A 4DA8A 1H2BA 1P5FA 1E3DA 1YJQA 3IURA 3AGPA 1YZGA 2GAAA 2CLDX 2Z9BA 2ZVQX 2ZKLA 2FPKA 3AI2A 3IP3A 1I13A 1IQ0A 1UBNA 1G20B 1D9ZA 5B1YA 2XWJI 2QP4A 4BNMA 3BRQA 3OX4A 2H65A 3ROFA 5HTKA 4PSAA 1JMVA 4XX1A 621PA 1GSIA 4TMTA 2D2VA 3D7KA 4IQFA 1QZZA 5KSZA 2DCUA 4BZZA 2VAWA 4G1UC 3EXIB 3HUUA 3PXCX 4FFLA 1MABB 4DA4A 2WJIA 2ZS9A 2IH5A 2H7VA 3Q7TA 3I39X 1UBTS 4LRYA 3DTNA 5BSTA 3IOMA 1SXJA 2IXDA 4TSFA 4A6PA 1KXJA 3ES9A 4E2ZA 1A4IA 3EK2A 1O58A 3H5VA 2XIQA 4I1SA 3CBGA 2QZSA 3IBTA 1I4WA 2MSDB 5IM4F 4J2HA 4R69A 4IZHA 2XF8A 1KEZA 4N47A 4E21A 4EJSB 4W7SA 3GPLA 3F6PA 3TIVA 2QAGA 1QZTA 3ENVA 3G5UA 1KDZA 1AKRA 4TLDA 5CFMA 1P1BA 1IZ9A 3FKJA 3A6LA 3LP6A 3LT1A 4EW3A 1RAAA 4GYWA 2HRRA 2ETXA 1O6ZA 4NL4H 5SZIA 2I6QA 3LRPA 2FPOA 1E92A 4U8GA 1ST3A 2RK4A 2REQB 3FOCA 1RXSA 3K94A 3UPTA 4YQZA 1Z0AA 1Z06A 4NJMA 4F46A 4ZYZA 3RTGA 2E5FA 4GMXA 4HFNA 3H5IA 1KJIA 1J6UA 1FYWA 2ZDQA 4C0KA 5H9WA 5HKAA 1IN5A 3IUSA 1COWD 9MHTA 5TQJA 2Y1DA 4KQHA 2Z5VA 5EWJB 4NE2A 3OPNA 4J91A 4CMCA 1NSTA 2C5EA 4RE6A 4X20A 5JQWA 3AFGA 4G23A 3BK1A 4N5IX 5I7RA 5T7BA 1U7UA 1N7JA 3HDHA 1HL3A 1NAIA 1T9HA 2HJRA 1P0IA 3TW4A 4JROA 1CTQA 2FGKA 3OUZA 4BYMA 1H2RS 4OL9A 4P9NA 5TPZA 3DNFA 2WI8A 1JZSA 4L4RA 5HKKD 2ZXUA 3P2IA 3HI4A 4Q9NA 1EE2A 1A95A 4HUQB 3USCS 4WBNA 1EU1A 2F3SA 4URUR 1N5MA 1T0PA 3UAZA 1U9IC 3KKLA 2OC4A 4DDWA 4J43A 3JARA 4TVSA 1N25A 3GN1A 3CKKA 3ORQA 3ROEA 5ICEA 1YL7A 4NCIA 4FDAA 4ND1A 2G3YA 3PYLA 1UPTA 3JRNA 2YQZA 4JC8A 3WQRA 1E2HA 5A4JA 5IXJA 3MGAA 1K8YB 1HDOA 3B1VA 4HAXA 4B4OA 2RC5A 5BP7A 3K1JA 3UC9A 3TQFA 4WK4B 1U3TA 2QD4A 2G08A 2FVYA 2YWXA 1LWOA 1PEAA 1VE5A 4E09A 5HQTA 1C3EA 4DW8A 4YP6A 1L4GA 2V9PA 2X8BA 2XMBA 3N8NA 5KNCD 1E1YA 5DMHA 4RTMA 1WV1A 2J33A 2YWFA 4CMIB 1I4DD 1OA1A 3BAFA 4LRWA 3X1YA 2B69A 5AO9A 4WJLA 1FJ2A 4B6OA 2C84A 4CEJA 2H2GA 2IPXA 1TJ5A 2I7XA 2IW3A 2OCKA 2F7SA 3FGPA 1PCXA 3MJFA 4P2GA 4B3MB 1MO6A 2QVCA 1A7AA 3DOOA 4UCWA 4JR2A 3RD5A 1TYZA 1WNFA 3RRMA 4Y6LA 5KSWB 3COWA 4KPEC 2QT1A 2XEXA 3TL3A 5ICMA 1T9DA 4EB6B 2DHEA 4RQUA 5CPBA 1CUXA 1AKVA 2C97A 2MTBA 1XZBA 2OO7A 1CQJB 2DPMA 2K2QB 4H1HA 4MZXA 4OBXA 3UW1A 4UXJA 4IZOA 1LU9A 2W6IA 1N3IA 4EHLA 1AMNA 2HB6A 4X8HA 2JLYA 2JLXA 1KOGA 5B2EA 1JSCA 3EWSA 1SU7A 3AERA 2J30A 1RPZA 3BCUA 1G4AE 4BO3A 3ZU4A 2A9OA 4TT8A 3A6DA 5DX8A 3RTAA 4IQGA 1MPXA 1UJ4A 3DL0A 1K5GA 5DXJA 4WN9A 2P6UA 3H42B 3EF1A 3FTQA 4C4PA 2EF0A 3U81A 2E4ZA 3AY7A 3OCVA 1WTCA 4ZFNA 2P2LA 5AKKA 4D6YA 4R40A 4MIKA 5BXYA 4RVCA 1IZ8A 1QWOA 4KMSA 3IQWA 2DU8A 1NYLA 1UK7A 3TH5A 1WL8A 1K7EB 1YL6A 1AXRA 2KHZA 1PJCA 2Y0PA 1QQ5A 1G6HA 1VE3A 1FTWA 5NLLA 1EQAA 5ADHA 2D62A 2NTJA 3EVTA 4HFMA 4UM8B 1Y7HA 2P2YA 5DGHA 4JLAA 4H3VA 4DREA 1PLJA 1YQEA 2JKYA 3ZHBA 3WYNA 2C92A 3MIZA 4X1YA 2CC2A 3HU3A 3TS1A 1BFUA 1YASA 3UWSA 3FN4A 5ITZB 2NU7B 1CJTC 3C15C 2HLPA 5L40A 2OK7A 2HOQA 4EB0A 5AHXA 1PHPA 5LKRA 2N46A 2DFLA 4OBBA 1PEYA 1B6TA 1DEOA 4P0QB 4TUYF 5C32A 4WOPA 3WKDA 1DJPA 1P0FA 1TKBA 1U11A 3ENZA 3FJOA 4ARSA 4UUNA 2IHTA 2ZE8A 1HRDA 1HTTA 1Y37A 3FM9A 3I9OA 1E2DA 1ZW1A 2AD1A 4MHOA 3U5ZB 2EFYA 5AJHA 3NBXX 1CR0A 4CMIA 1GGMA 1CS0B 1HYGA 1GL9B 5JNUA 4DV5B 1UOPA 2PJUA 1ZK4A 1VSVA 2C2KA 2C20A 2QUKA 2IVZA 2XF2A 6AT1A 1FMFA 2W7TA 1L5LA 3HP7A 1M2VB 1A9QA 1ECFA 2LNDA 3CO0S 1TL7C 3N6RA 2CLFB 3HNOA 5DHUA 3X1MA 2B4TO 1A8SA 1NUSA 1FK8A 1P39A 2CE7A 3ANYB 3CCCA 4QXPA 4Y2TA 1KFKB 1L9XA 3HB9A 1NBAA 1G21B 1O5OA 3AEKB 1PZXA 3D6HA 1SQSA 3F7NA 3X2FA 2VK8A 1TA4A 2B1GA 3QHQA 4TV8B 3S81A 4N4AA 3GF4A 4H1UA 4URWR 2H57A 2YWCA 3P9CA 2IXGA 3QG1A 5CH5A 5KDDA 1TEHA 2R0QC 1N6OA 4G1FA 1ULHA 4WZZA 4Z9FA 3S2IA 4EGJA 5JD6A 5JANA 3D7LA 3FTFA 2PX8A 1W4CA 2QIPA 4JVMA 5EUBA 1UXKA 4LZOA 3WBJA 1DCMA 3WBBA 3WBKA 1PV4A 2YY5A 3D54D 2VFAA 5EIEA 5K8CA 4QGGA 2Y1XA 4FEGA 1EUCA 4GP9A 1ISGA 1RQPA 2OG2A 3B1FA 3A3YA 3DKKA 4CTNA 1Z16A 5H83A 4US2R 1P0PA 5AESA 3RC1A 3U2QA 1XZJA 3WLTA 4BMCA 3RRBA 1QYVA 1ST2A 3E5MA 3WWZA 4E46A 4BEWA 1KNQA 1T9CA 2JA2A 4JUCA 1COZA 4QQRA 4KNVA 5BV2P 5AUOB 2Q6KA 3R6DA 4XJXA 4IJQA 5FWXB 1ZR2A 3KPYA 4B1FA 1YGPA 2QN2A 5LB2A 3MLEA 2I0FA 4QPCA 3O84A 2X2EA 3ZUPA 3P2EA 3MJ4A 4P6VF 1S8FA 3UUGA 3FD8A 3PUIA 4JL5A 4NENA 2G17A 1C9DB 1ZR4A 4O08A 2UUBB 2Y6UA 4EVIA 3UBTA 3H4IA 3R9XA 2GR9A 1MOZA 3GEEA 4EMBA 1D8TA 2V7QD 3DA8A 3DTTA 2JBAB 4NRDA 3C4VA 1MJNA 3WDSA 1DRKA 2OBMA 1DEKA 3QI2A 3SK0A 1I9CA 2HF8A 3TGPA 2V03A 1X80A 4OUDB 5TT0A 3ZWVA 2GDJA 4ILKA 4ZRMA 4B0OA 5KNDD 2HLDD 1JE0A 4QYMA 2P0YA 1K8RA 3I6ZA 2X4IA 2BRUC 2AB0A 3RUAA 4YCNA 4ZQFA 4II3A 3SQDA 1J0XO 3LYUA 1ESCA 1IU9A 4M0EA 3SNHA 3WYAA 2WE8A 2XDQB 3L4KA 2O8CA 3TINA 2E7ZA 1BH6A 2ST1A 3P9ZA 4UE2A 2HW8A 3E70C 3TLCA 1U0LA 2OB2A 2PD4A 3N0RA 3MTBA 4WGGA 4WLNA 4BPBA 5EZYA 2J4CA 2IHYA 4L8FA 1W5FA 3O26A 4G84A 1QH1B 3HYRA 1GEEA 2I4LA 2PS1A 2P4QA 1GR1A 2Q6VA 3ILSA 4NG4A 7REQA 1UBHS 5KUTA 4KXVA 1MC1A 2GWRA 1BXZA 2ACEA 3S0JA 1T6YA 4PPNA 1AB5A 4DR2B 4KRFA 3A2MA 3W8FA 1UJ2A 3HSYA 3V1KA 1W85A 1RI3A 3IJPA 1NUTA 3FJYA 1KI8A 1PYGA 3QA3E 3QMWA 2UVPA 4GZ3A 4IIJF 1R37A 1EVLA 4L6CA 3VHXA 4C6TA 2O2CA 2OZEA 3LPMA 5FWYA 4NCJA 4CQLA 1U3UA 1U5BA 5EZYB 4OH1A 4QDOA 4HYEA 2DUNA 4I1UA 4CM3A 4FDUA 4QD3A 3SR0A 3K0HA 4AWXA 1FS6A 1P7CA 1QGAA 5IUNC 2ZRIA 3R40A 3PHGA 3ZY3A 2OZLB 2ZRMA 5LA6A 2PMFA 4DVJA 3HWSA 4KQJA 1ZMRA 4YN3A 2CKMA 2A9QA 1QP0A 4MPTA 1RTTA 3F6SA 1FW8A 3K0CC 2FEAA 3ZVNA 4Q0MA 1II8B 1SIWA 1Z75A 4G0UA 3CB4A 2GZMA 3MQ2A 2QLTA 2ECFA 1CY2A 2YL2A 1CC1S 3R0IA 4IIJB 5JS6A 1P81A 4PSDA 3BF7A 4OXNA 4PLHA 5CX1B 5ALOA 1QSGA 3GBPA 4IW3B 4TKUA 2VA8A 3TD6A 5JQGF 1H3EA 2ZAYA 2AQHA 1VJRA 4FS8A 3H19A 3DMGA 3H4TA 2VBFA 3AKZA 1JWLA 3VNQA 3SFZA 1SUEA 2VPTA 5CJJA 4BXOA 1EUZA 2M6SA 4GPZA 4GOXA 5A4AA 1OILA 1E89A 3W9SA 1H2EA 2IZOA 1SURA 2I2AA 2OQRA 4RLHA 2YW2A 3SF0A 2H1IA 4I1PA 2VTVA 4WXMA 2PKWA 1Q77A 3BCSA 1W75A 2AFHA 8LDHA 3O91A 1M66A 2O07A 2R6DA 4LX8A 2FW8A 4DR1B 2CXSA 2JHCA 5AKXA 1GO2A 1X9GA 3L6UA 4MJXA 4I6GA 5J4LA 1Z0KA 3M6MD 5I9SA 3M5DA 4NICA 2O8DB 4BGUA 4OMDA 4H59A 2AI1A 4J0HA 3VR3A 1ZGHA 5LKAA 3ZH2A 3P0EA 4BNFA 1JQKA 2G9QA 3A7EA 1Y9ZA 3Q72A 4QFMA 1G0OA 2G83A 4K40A 4MTLA 1WZIA 4X71A 4WXHA 5AM0A 1YB2A 1NUHA 1SVMA 3L7LA 3V55A 3O4FA 4PZDA 4AO6A 1H1LA 2UDPA 2ZGVA 2WU1A 4IH9A 2GZAA 4DDTA 3G2MA 2VJPA 3ROXA 5B37A 3Q6IA 5AKJA 5IUKC 2UKDA 3CEAA 1GVNB 3OM0A 2ZUFA 3HM9A 4HHEA 1L7DA 3M5CA 4M0UA 2SCUB 3OQHA 4UBOA 5CFNA 2AVNA 4QTXA 4X61A 5T3UA 2FG5A 3BTUA 3ZNPA 1EI9A 3KQVA 3HKEA 2QKYA 4Z2YA 3QKWA 4CM7A 2ZUEA 16PKA 1TZCA 1VG0B 5FT9A 1KWKA 1JHPA 2AX3A 1Z15A 1XO1A 2YZGA 2C7VA 3NTRA 4FHFA 4E2FA 4AKHA 2C2WA 1VL6A 2C4UA 2Q5CA 5PGMA 1W0KD 1DBPA 4COKA 3ADCA 1XDUA 1UJCA 3IO5A 1JEEA 5CK4A 3THRA 4NYJR 1AGYA 2EFHB 4UMFA 2UYHA 2NVOA 3AVWA 1WUYA 2I8LA 3IV6A 3FNBA 4AJOA 5G2OA 1WMBA 4TLEA 3WQHA 3S4YA 5E4JA 3BYZA 3B8EA 2FPGA 4ND7A 4TN5A 1V41E 4ESHA 5JDIA 4RABA 3BICA 1HDYA 4LI0A 1KRWA 2V4UA 2FHPA 1Y6GA 3H1PA 2E49A 5D6NA 5IULC 3HP1A 5DOZA 3UG6A 5EN4A 2RHMA 5ANRB 5I8WA 2DJ5A 1JJVA 2AMVA 3C3XA 1GAWA 1JH8A 1SHJA 3JTMA 1J07A 2P9QA 2AT1A 1N6IA 4LPKA 2W4QA 4E03A 3G2OA 5EA2A 3E8SA 4NBUA 4QDKA 4BECA 4GKJB 3ZZ0A 5KSOA 2O50A 3AIOA 3LBAA 4MSUA 3RUDA 2BBOA 5MN5A 1CG6A 3K9GA 1FE8A 3OZUA 2BR3A 3LTNC 3G82C 1MIOA 4JOCA 3RC3A 3WOHA 2B1QA 4LC0A 1FTSA 5FAXA 2D2EA 2G6TA 3N8DA 5KVQA 5AK5A 4IHJF 3KZCA 5DSZA 5LMNB 5JRDS 4I1YA 3KQWA 1G5RA 4C6SA 1I01A 4MQFA 5B53A 5CFRA 1MTZA 1E5VA 3LV8A 5AVUA 4U2EA 1V0JA 3X0DA 1PL8A 2CNNA 2ZAGA 4EWLA 4GOJA 1F9AA 2D3TA 5KWJA 3EGEA 2H5EA 3N2NA 1M34E 1QXSA 4XLZA 2C04A 1J2UA 2C0CA 4HH4A 4HVTA 5T4EA 5KVVA 5GVRA 1ZK2A 1B14A 3ERCA 1YUBA 1BEEA 1I3CA 1ONNA 4F91B 4JB0A 1OC4A 1TW3A 2KMLA 4QOHA 5D84A 2HBQA 1C4XA 4OSEA 4E7PA 1TUBB 2C3UA 4V3CA 2O20A 3FPHA 1XPUA 2TSYB 3A6JA 2QAIA 4BX9A 1ZJZA 1URPA 4CF4A 4M9QA 5F64A 1WY5A 1EH5A 2OHXA 4N5NA 1Y9JA 2OPHA 4PN7A 1G6KA 2OFOA 4LI3X 2R79A 3NPMA 2V1UA 4M46A 3PLRA 1OA0A 4MS3B 4QBIA 5KTOA 2XXJA 2IY8A 2WBLC 1RLUA 3VBEA 2GF9A 3FNIA 5B2FA 2DCMA 3HFRA 4L8LA 4B43A 5BMOA 3RS9A 3E9YA 1JWBB 3ADKA 3B6MA 3HVUA 3H83A 4CLRB 4JBIA 5C1DA 2OCXA 4UOEA 3DBLA 5BVHB 2MYPA 2FEKA 3BAZA 1U31A 4YCMA 3NXSA 2ZI4A 4V03A 2QRKA 3H8WA 3C16C 1YDGA 1Z7BA 4ZRDA 4RETA 4US0R 3KR9A 4AP9A 2ZM5A 2GM9A 1ZHOA 2BKEA 5A5EA 4F06A 4U2GA 3C1OA 2ZXFA 1E61A 2XB4A 1PYDA 2HF9A 2QTCA 4U3JB 1U8UA 2IUTA 4WNAB 4XE5A 1EXWA 4IINA 4JR0A 5F73A 5JXGA 2Z5LA 2G88A 2XE8A 3FWPA 4TT3A 1NNLA 2GJKA 4ZAYA 4UAJA 5JHHB 2BSXA 3SI7A 5EGSA 2VPQA 3FPGA 2R3SA 3CKLA 1RPAA 3TE7A 3KFLA 1GTJ1 4XB2A 2LTAA 1JFFA 3P52A 1ZGBA 2IHZA 5IAKA 1YO6A 3FFAA 1Q7BA 5HIIA 4FR2A 2IKQA 4DSAA 4IGEA 5B2ZA 2HLHA 1FLNA 4EGCB 2MSCB 1A76A 2GAFA 3SZUA 3RRFA 1RKBA 4G2TA 2AHRA 4NMMA 5LZ2A 1EHYA 4NFLA 3A1EA 2ZJ1A 5FBWB 4ZVVA 4LGVA 4LOAA 5ICCA 3S5JA 5FB3A 3TOVA 4EPRA 2XCTB 1CUDA 1QQAA 4GT1A 2PG3A 3E23A 3T95A 2YKGA 1WDKA 1S0UA 3AJEA 5CNKA 2C7OA 1Z6TA 4Q4AA 4H6VA 2VP5A 4NYJQ 1QRDA 5CAEA 2XB2A 2JFBA 3EZ9A 1KU6A 3QWIA 4M54A 4FN4A 2HWXA 1XEXA 2UZIR 3I5AA 4LWZA 5H7XA 1SCUA 1TUGA 3KUXA 2P2NA 3VSEA 3ILVA 5BXQC 2G8NA 1AQIA 2ZBGA 4FYXA 5F77A 2M32A 2XUPA 3GLUA 4S1NA 5IVHA 2IS2A 1HX7A 3ON5A 2VDWA 3O31A 3DMHA 3K8ZA 2L18A 3BF8A 1FFSA 3HKBB 3LKVA 3TTYA 3D3NA 3RHSA 1TI7A 3DQQA 1T2UA 2XITA 2C7RA 2EX4A 1DJNA 1S9DA 3W4IA 5LYJF 3D3EA 3ASYA 1H4SA 3OWHA 2NUBA 3UA3A 4GD3Q 1V1MB 1F06A 2HDOA 1K08A 2RGDA 3OPMA 1RAEA 2GWHA 3B1ZA 4IDPA 4MV1A 4V0LA 3H86A 4V24A 4YRDA 3SSNA 1EFPA 1X0XA 2MSWA 1ZL2A 3ESBA 3FZNA 2BHTA 1GUYA 3NHRA 4LNAA 1AURA 2VYNA 3WLEA 4ARZA 4C0BA 1U63A 2O0JA 3A6PC 1Q6ZA 1X8XA 3LKDA 5JQGB 3U56A 3HFJA 2FYTA 2W6CX 2C83A 3NUGA 2FEPA 2CL7X 4LTNA 5C8YA 1MRSA 4R7ZA 2Q4BA 3DEHA 3MPOA 5AM2A 1B8PA 2W6ID 3R6GA 1RJDA 2WB2A 1TEZA 5K3AA 5A9SB 5T67A 2I3ZA 3K9NA 1JILA 1BVUA 5BYAA 5JYBA 1XQXA 2BEVB 4Q16A 4YVFA 3ZZMA 4AULA 5EJ6A 3DMFA 2DPXA 2WM8A 3RASA 5IK2A 1ZRHA 3QU4A 1YNOA 2GCIA 3W2FA 2C2GA 3KKKA 5LWHA 2IE8A 1I2MA 4HL6A 5DDIP 3RANA 1P5JA 1CZHA 1VIAA 3TRDA 3T94A 4WBXC 2R1VA 2WD7A 4QU8A 3V7FA 1EE9A 3PQ4A 5GIOE 1OREA 3CX6A 3L1IA 4B0PA 1JLMA 1RPTA 2DHDA 1OCEA 2O3RA 4E5UA 2HF2A 1Y3FE 3K0EA 3I83A 3W1VA 3D81A 3U9SA 1CQIB 4AZSA 1P4GA 1H4TA 3RVPA 5FOTA 3Q5EA 4MHSA 4CIWA 1LVHA 4F45A 1CCWA 2GZRA 3C6MA 3MCTA 3T7KA 3WP1B 2DJIA 3PQDA 1DDIA 1XL0A 2CL6X 4CI0B 1FNDA 2ECOA 4KJXA 3PEVA 4RXTA 4IDHA 3T1HB 4BIMA 4LZNA 1K3FA 2JGAA 1E32A 1SOAA 1PK7A 1XHEA 3MTEA 3EFHA 4KPUB 3U39A 4G4SO 3DE2X 1H0KA 2D6FA 3RROA 3SJZA 1U99A 5DM2A 2OXTA 5IEJA 2ZRJA