5DEOA

Mycobacterium abscessus nadd in complex with nicotinic acid adenine dinucleotide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
198
structure length
189
Chain Sequence
ERRRLGVMGGTFDPIHNGHLVAASEVADRFALDEVIFVPTGQGRKVSPAEHRYLMTVIATASNPRFTVSRADIDRGGATYTVDTLTDLRTAHPDADLYFITGADALASILSWENWEQLFTLAKFIGVSRPGYELSSDHIAHADGLSLVEVPALAISSTDCRIRAGQARPIWYLVPDGVVQYVAKHRLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nicotinate-nucleotide adenylyltransferase
publication title Mycobacterium abscessus NadD in complex with nicotinic acid adenine dinucleotide
rcsb
source organism Mycobacterium abscessus
total genus 57
structure length 189
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5deoA00
1I6MA 3A05A 3ND5A 1O6BA 2PFSA 3C8ZA 1DNPA 1GN8A 3CLSD 2O8VA 4EG4A 2HGZA 5HUHA 3BL5A 2Z08A 1G8FA 1T6YA 5DASA 2QJTA 5TEVA 3AKZA 4A91A 3L93A 3DV2A 1KH2A 1PFUA 2QUKA 4RUKA 1YUNA 5K0TA 3NV7A 1TYDE 4MAFA 3SEQA 2V0CA 1O0CA 1HYBA 4KKVA 4WNYA 3NBAA 3UMVA 1H1TA 4JZYA 1P7PA 4AQ7A 2GM3A 2CYAA 5J58A 2Z09A 3IOBA 3QTTA 2DLCX 1JGTA 3ZIUA 2XRZA 2CV0A 1IRXA 5J59A 4EG8A 3MLBA 5IHXA 3CLRC 4EFKA 2J5BA 4MULA 5JBNA 3PNYA 2J4DA 4EG6A 2A84A 3DLAA 1JMVA 3RFFA 3KFLA 1VLHA 3IOEA 3P0HA 3TQOA 1IFXA 1V47A 3SEZA 3A04A 1MB2A 4ZCTA 3UOWA 3AIIA 1KAMA 2X0KA 3PNVA 1KR2A 4K0RA 5BNZA 3CLTD 4Q93A 1VL2A 4PBRA 2VTBA 1O96A 2D54A 5TGTA 1K4MA 3H05A 4DJAA 3AL0C 1OWOA 1TQ8A 1WJGA 1WXGA 2CYCA 4U8HA 1MB9A 2H2AA 4GU5A 2J09A 3GUZA 3HL4A 1OBHA 3ZGZA 4R2MA 1I6KA 2QUJA 1F9AA 1TYCA 1CT9A 1EFPA 3COWA 5DEOA 2X1MA 5LM3A 2ZUFA 4MW7A 3CLUD 4YP6A 4F3RA 3GLVA 3X1MA 4HJXA 2NSYA 1T6XA 4QREA 4XFJA 1TYBE 2J08A 1FFYA 4JYZA 1QNFA 1O97D 4MWDA 1KKUA 3K9WA 4DNXA 4MW9A 4FZJA 1G8GA 3COZA 5J5AA 3UY4A 3ZJTA 1JZQA 1XNHA 3ZUGA 4MWEA 3X1KA 4NATA 1PFYA 1T9GS 3SP1A 3I05A 3MXTA 3CVVA 3TNJA 4MW2A 4UZEA 4MUGA 1T9GR 4ARIA 3CR8A 3ZJVA 4DDMA 1WQ4A 2ZP1A 1B6TA 2H29A 1M8PA 3OTWA 2D13A 1WZ2A 2IP1A 4KPUA 2CT8A 4EG5A 3DPIA 5KCMA 1Q19A 1JEEA 4ARCA 2B7LA 3ND7A 1YIDA 1LI7A 5EKDA 3ZJUA 2GKSA 3FNRA 3IODA 2A88A 4MUFA 1N2OA 3PNBA 3Q4GA 4ND6A 4ZT4A 3TQIA 4ZT3A 1YIAA 3NBKA 1VBMA 4ND7A 1QRUA 3FG9A 4QBTA 2NZ2A 3FH0A 1ILEA 2G36A 1IQUA 2AG6A 1O95C 1O5TA 3G59A 3S3TA 1YULA 4H3SA 3AFHA 1XNJA 3TS1A 1YUMA 1COZA 4NDAA 2QUIA 2BYTA 4I6JA 4ZT2A 3PXUA 4AS1A 4U63A 2CV1A 4HK4A 1TEZA 1EE1A 4NX2A 1TFUA 1SURA 1N2BA 3AG6A 2VXOA 2CV2A 2DXIA 1J09A 3KT8A 1WOYA 3RJZA 3JXEA 1EXDA 3LCJA 4MUHA 2HZ7A 1J20A 3SYTA 2A1UB 5K0SA 3ILVA 1IQRA 2OV4A 1JEDA 1ULHA 2WB2A 2ZUEA 2QUHA 4EGAA 1MOPA 3MMXA 4WSOA 3FWKA 4YBRA 4L2IB 2EJCA 1FYDA 4I6GA 1PFWA 3VU8A 4K03A 3HGMA 4MUEA 1ZJWA 2PZ8A 4OUDB 1M1ZA 4J75A 4MW1A 1EUYA 1NUQA 4MW4A 4DDHA 4ZT6A 1U0BB 1JIIA 1H3FA 3RK1A 1J70A 2A7XA 2DR2A 2IELA 4ZCSA 1EFVB 1O94C 1KP3A 4ZCRA 1QU3A 1Q15A 1GTRA 3IH5A 1NURA 1M8KA 1I2DA 1ZH0A 1T6ZA 1N77A 4P2BA 1MRZA 3COVA 1KQNA 1NUTA 3IDFA 1QRSA 1M8GA 5KHAA 1OWPA 3KT0A 1JHDA 3ELBA 4TS1A 5FNZA 5HG0A 1OBCA 5H16A 4MUJA 3KT3A 3RBAA 5TS2A 1N3LA 4J76A 3RK0A 1KQOA 2D5BA 3ND6A 3TZEA 3CLSC 1Q11A 3IMCA 1M8JA 1H3NA 1WXHA 1MJHA 1PG0A 3ZXIA 1PFVA 3SZ3A 1KH3A 1JIJA 3COYA 5FO0A 1KH1A 2JANA 3IOCA 3N8HA 1N2GA 3SZGA 1LI5A 1NI5A 2CFOA 2A1TS 2RD2A 1VBNA 2CYBA 3HFJA 2Z3VA 4YMIA 5LFAA 3H97A 3CVWA 2A1TR 3FIUA 1N75A 1J21A 2A4MA 3FOCA 1R6XA 1G59A 1N78A 5H7XA 4KR9A 2AZXA 2X3FA 2IJGX 4ZCQA 4JXXA 1JILA 3X1JA 3IMEA 3IMGA 1D2RA 1QQTA 3H9CA 2VTBB 1O96B 3CLRD 3CVXA 2V0GA 2QTRA 4EG3A 4EF6A 1IH8A 4MUNA 3IVGA 2CUZA 4JXZA 1J1ZA 1OWNA 4MWCA 1R6TA 1EFPB 4DLPA 1VBKA 2YWCA 3CLTC 4MUIA 1WXEA 2PZAA 4ZT5A 3VRHA 1X6VA 3N2YA 2E0IA 2JAXA 3FY4A 3GMIA 3FETA 4MW5A 2BTEA 3E27A 4MLPA 2RE8A 2J07A 2E21A 4HJRA 1M83A 4BWVA 2XRYA 1J1UA 3OP1A 3P0IA 4OJMX 3CLUC 2E89A 1OWLA 3PRHA 3QE4A 1OD6A 5DK4A 4X0EA 1N2EA 1QRTA 3IVCA 1A8HA 2DERA 1N1DA 4MVXA 4MWBA 1N2IA 1OWMA 4RPIA 1O97C 1QJCA 3Q12A 4PY2A 1MC1A 4MVWA 2PIDA 3ISJA 1KQPA 3G5AA 1GTSA 1EJ2A 1N2HA 4G5YA 2O5RA 2PXHA 5HUJA 1K4KA 3N9IA 3DO8A 4KPUB 2PZBA 1EUQA 1GLNA 1NUSA 2YXNA 3H99A 2YWBA 4DE5A 3TZLA 4HPWA 1MBZA 4Q16A 4U7JA 1G8HA 1H3EA 4KR7A 3FDXA 4NAHA 2CSXA 2YY5A 4CT0A 2HMAA 2WQ6A 4G6ZA 4G5FA 2WQ7A 1F7UA 1U3DA 3L92A 3CA8A 1UFVA 1M8FA 3F3MA 5DB4A 2X1LA 1K97A 2WSIA 2GOYA 3IUEA 3KT6A 4ZT7A 3K32A 1QTQA 1WQ3A 3U1VA 1WKBA 4PBTA 2EL7A 1NSYA 4MVYA 3N05A 4ZCPA 4EG7A 4UZFA 1F4LA 2A86A 3SDBA 3HMQA 1MAUA 4EG1A 1MAWA 3CVYA 4I6EA 1NUPA 4JFAA 1R6UA 3D6VA 3MLAA 1U7DA 3UC5A 1O95D 1YI8A 1NP7A 1NUUA 3A4IA 3M5WA 1N2JA 3D6UA 4GRIA 1KORA 5LLTA 1F7VA 2QTMA 4YP5A 2JA2A 2C5SA 1QU2A 1IQ0A 1S4MA 1JIKA 3A2KA 4MUKA 5FO1A 2OQ2A 4CDNA 5F23A 2QTNA 4CQNA 4MW0A 1GPMA 1XJQA 3IVXA 3ZXSA 1TYAE 1KAQA 4XFDA 4R2LA 1LW7A 1NYLA 3QTBA 4NAUA 1IHOA 3UK2A 1GAXA 3HV0A 3LE8A 4F4HA 1JZSA 2DUMA 3Q10A 2QJOA 1KP2A 4MVCA 5AHWA 1O0BA 2DPLA 4PBSA 3G6KA 1WY5A 1RQGA 2A1UA 3FHJA 1GZUA 4NZPA 1ZH6A 1BS2A 5KWVA 3INNA 3LOQA 3P0JA 3VGJA 2I1LA 4MQ6A 2TS1A 3MUEA 4L2IA 4YP7A 2AKEA 4CDMA 1ZUNA 1Q77A 1IVSA 4R0NA 3RHSA 1U3CA 4E1AA 3IUBA 4DDKA 4KR6A 4MW6A 4QRDA 4OUDA 1O94D 1PG2A 2E18A 3AG5A 3H9BA 5TEWA 1JECA 2QJFA 1Y42X 4XSVA 2DEUA 1K92A 1I6LA 2PG3A 2R5WA 4S1OA 5IJXA 2DETA 1U7XA 1WXFA 1XNGA 1EFVA 3FI0A 1V8FA 3CVUA 1WXIA 3P52A 1X8XA 3HZRA 1NZJA
chains in the Genus database with same CATH superfamily
1I6MA 3HP4A 3LU1A 2PFSA 3CLSD 4BNTA 3VH4A 4EG4A 2HGZA 3OE5A 4MP3A 2FFRA 3KSMA 4UMFA 4WOBA 4F06A 1JH9A 1V4BA 1OB2A 4B75A 2LNDA 3LHFA 3HJUA 1YS4A 3KWFA 4K6GA 4L9SA 1NL3A 4C9BA 3ZCSA 4DUGD 1RXVA 1KETA 2IYEA 3C3YA 4KSBA 1J4AA 5LXTB 1SBYA 2ZBFA 2HXSA 1TAGA 4MRAA 4BNZA 2HMWA 4PGAA 4DOMA 1V5EA 3BHNA 1BKYA 1XF1A 3TI9A 1IXKA 1HORA 5E1BA 3T95A 3H1EA 4K3UA 4DEYA 1TAQA 2F43B 3DAFA 4XX1A 2CYAA 5EMKA 4RANA 4XGQA 3QTTA 3TTUA 1XFAA 5SYNA 5KTOA 5IF9A 1A9PA 1QJ4A 2XRZA 3AERA 1GTG1 1KYWA 1IBCA 3N3BC 2V7QD 1YJCA 4B2LA 1T8YA 4BJ3A 4EFKA 1L6RA 2FUG6 3VDXA 4I55B 1FYEA 2EV9A 4QYIA 3H0EA 3FB1A 3M70A 4NOLA 4OXRA 1UZNA 1ZCBA 3L79A 3PNOA 5LQDA 1X7ZB 1G4HA 1K66A 2Z6VA 1E2LA 2UUBB 1Y7LA 3W78A 2C96A 4ZIRA 4KGVA 1SUAA 1X1EA 4WY5A 4DCMA 4DPMA 1DTEA 2PGLA 3A04A 3B1VA 1UXJA 4NCAA 3UOWA 1A5TA 1KAMA 2X0KA 3K9CA 4LY0A 2QD5A 1IY1A 3TDKA 3ZWQA 2UYHA 3M9LA 2D6FA 4JFRA 2BKUA 1J2RA 5EG5A 4NXMB 3K0EA 5B55A 2D54A 4IQGA 1YB6A 3GX1A 3GUVA 3HKEB 1E1NA 1XSEA 2NUAB 4AJ4A 4DJAA 2WMNB 3TG8A 1F48A 1HL7A 3IIIA 3CV3A 4G86A 1IDN1 4CMIA 3GLFE 4P38A 3LX4A 4OSOA 4TM7A 3V8MA 3EIFA 2P2GA 5BYBA 4IZ6A 1I1HA 2GZSA 3NLLA 3U7QA 2ACVA 1O89A 5JT1A 2DBVO 4D81A 2IU6A 1FX0A 1G63A 2C0PA 2YZKA 1WM1A 1NVMB 1FNNA 3WBFA 1XXHB 1Y1SA 3OQMA 1G3QA 5EJ7A 1AK9A 2RH9B 4B3FX 4C01A 3HB4X 2CUKA 4NCIA 3UH1A 1PP4A 1CE8A 4MWDA 2IH2A 1BE1A 2YIJA 3NHPA 1VRWA 2WDZA 3T7EA 4LF8B 4GPTA 4JBXA 5E6RA 1XNHA 1FFXB 1SMKA 3E3AA 3JSAA 2ZEJA 3JZDA 4J16C 3B9QA 1Z74A 5EYPB 4ZOQI 3KJXA 4LWPA 1PBNA 5FP0A 5EHIA 4L74A 3ZCUA 3B8HA 4L5BA 3WYEA 7ABPA 5GV7A 4U7WA 3M9XA 1K6EA 4A0RA 2P9EA 2XSZD 3A1WA 4CV0A 1PTKA 2VJMA 4BNDA 2QLMA 2I5PO 1X7XB 3IAS1 1VB3A 2P6NA 1BWRA 3TVDA 1XO1A 3ESZA 1Q1AA 3U3XA 4DQ0A 3A28A 1ZFNA 3GI1A 3PC8C 3CG0A 1IWPB 4IQ4A 5DEIA 1E1CB 3LO8A 4CEHB 1G6OA 1PCXA 4L4ZA 3L5KA 4FQ7A 4JC5A 1V41E 3DNFA 3QOFA 2FOXA 4KC0A 1WULS 1XCGB 2ILTA 5KVSA 1C9DB 2IYOA 2ZI3A 1C4XA 2OG1A 1B1AA 1H2FA 3EDCA 1RQLA 3QLEA 4Q02A 3L9XA 2WLTA 5B12A 2WKPA 3QBJA 1V95A 1G4UR 4PSAA 3HXTA 3RFXA 4GHWA 5CLFA 1N2OA 2ZVQX 3ZE6A 3JQ9A 3ZJYA 2PSSA 3S0JA 4DB4A 2J7PD 2GESA 2FMTA 2XH8A 8GPBA 3C6ZA 4Q1AA 1CS0B 2I0FA 2ZRHA 2FPXA 3FG9A 4QBIA 1ZUD1 5KMGA 3DFKA 3AI1A 2F3PA 2W83A 3HVHA 1G8AA 3MBIA 1A97A 2P5TB 4XPIB 5FBHA 2VTDA 1NHGA 2FSPA 1RKQA 1H66A 1QCZA 2P40A 4H3SA 4B7CA 1EH5A 2YYZA 3LUJA 2LKCA 1E6EA 2QUIA 5CFZA 4P32A 4II7A 3DL4A 3QXGA 5B4UA 3LKBA 1FSSA 4Q3OA 2Y92A 5SYMA 1UK6A 4BO5A 3HJBA 1ELOA 5EVJA 3R20A 4B2YA 1R0YA 1SURA 3HVJA 3QBDA 4GLFA 4IDPA 4ISCA 4KHZA 3V7WA 1C7QA 3G2MA 4UC0A 2CV2A 1I32A 1RU3A 1RMYA 1T3SA 1WTCA 2RHGB 3EQ6A 3KG2A 4QX6A 4QM6A 3FPAA 1BKSB 1U0NA 3LWDA 3VV3A 3NUGA 5JZBA 5A06A 4XWOA 1GRNA 2Y27A 2D0PB 3S28A 1S3IA 2ZSHA 3JXEA 4JAVC 1M74A 1CG6A 4DAEA 2AN9A 3TB4A 5MGBA 3PGMA 3DB2A 2B1IA 3JRNA 1L1QA 4ZC1A 4ICIA 4OK5A 1SIUA 2OGUA 3FCOA 3RG2A 1CY8A 1VG1A 1ISIA 3B6JA 4PYKA 5CEFA 1MA0A 3H87A 4BQEA 1R74A 5BURA 1QVWA 3W1VA 3AY0A 3N59A 4Z4HA 1UPCA 1US8A 3U7GA 1FDOA 3WFZA 3U40A 3NCTA 2VS1A 5JSQA 2NGRA 3GFGA 3PTLA 3DLBA 1Y1QA 3L6CA 4MP6A 3LT5A 4DDHA 1C9NA 3R3XA 3NP7A 4JDPA 1A5SB 1WX1A 1Z12A 3ZVKA 2O8DA 1RAAA 4HUQB 3MOGA 2GD2A 2EOAA 4ZZ2A 1GSAA 1IBSA 2R00A 1EX7A 2R6HA 1T3LA 2WJZB 3IP9A 3PC3A 3QK7A 2G1KA 4WE3A 1SBTA 4YRCA 2ONYA 5HE8A 4IJ5A 5TX7A 4E08A 4JU8A 4YTEA 3WWCA 1DJLA 2FEOA 4AX8A 4NPAA 2N1BA 5JNWA 3K09A 4HDKA 1YC2A 2YN0A 1ZL2A 1T6ZA 1TCVA 4F4FA 1EJ6A 2O3SA 2HSDA 2WRZA 3QXHA 1FSGA 1E7SA 4EVQA 4TS1A 3ELBA 4X62B 5AW1A 3RADC 2QUBA 4J0JA 4YJFA 3ZY2A 1JIUA 1VJ5A 4MS3B 4WT7A 1B8UA 4ZMBA 3K2QA 3GLFB 1C8BA 1ZAKA 3UAYA 4K3VA 1DOHA 4EYEA 2G76A 5E7JA 3T1TA 2D5BA 4X84A 3ELWA 4PN7A 2Z5FA 1A76A 1TZMA 3I0MA 5A3JA 5I51A 2JJMA 1XJWA 2O23A 3R5SA 4KBGA 5JSHA 4B6OA 1Y3IA 3ETGA 4HSEA 4OVKA 4Y2UA 4ZYUA 1C4OA 4FHDA 2BJHA 1R8JA 2XRFA 4JOSA 3MTAA 1KMIY 3PF8A 3CKMA 3W6PA 1M2EA 1VSQA 3WXBA 4YMUA 1JIJA 3AF4A 3W77A 1JQ5A 2XE8A 3NKFA 4WBXC 3SC3A 5ABPA 3ZNNA 4GVXA 1CUBA 1ZOPA 4UEJA 4MCHA 2W2TA 3G9XA 4ZK6A 4L51A 3KAKA 1UJ5A 1MPXA 2ZRGA 2BZ0A 4Q37A 3ZDRA 5AW7A 3P0RA 1J39A 3QOYA 3VR5D 1PLJA 2HWYA 1QE3A 2JJ1D 3ZCTA 3RGGA 4K9PA 2WM3A 5AVKA 4Y2RA 4E2XA 1RAHA 3A4LA 5DT9A 5IZCC 1KC1A 4CEJA 1B4DA 1J2YA 3GGSA 1FZTA 5DN6A 1DCFA 2Y0DA 3WOVA 4DQXA 2CVOA 1X39A 4NYIR 5DZSA 2OYCA 3W7AA 4B3RB 1PJTA 3H2KA 1GQQA 1V71A 3GDWA 3AUYA 3BZUA 3I04M 4MV7A 1E3TA 4WWHA 3GRAA 2BJWA 3HG7A 4MUYA 5LP6F 3CZ4A 2D1RA 2GBIA 2Q3HA 4RZIA 5ENVA 1M34B 1WCIA 4BWYA 5F5LA 4A15A 3VNVA 4JJGA 3VMMA 1MV8A 1CD5A 1VZ2A 4MS4B 4DLPA 2WVJA 4D96A 5LQNA 5EXSA 1ETHA 1Q84A 3ZCRA 1A95A 1LU9A 5I7OA 3CEJA 1V5GA 3LX8A 1HDCA 2BFEA 4CQJA 1W88B 4MCAA 2QXUA 5JR3A 1R8SA 1F51E 2YW9A 4RS4A 3MJTA 1K7CA 2E49A 2H3HA 2IYFA 1IY9A 2J07A 2OHIA 2WHPB 4Q3KA 3KB1A 2V4UA 3WO0A 3GEDA 3OCXA 4X8HA 1BQ4A 4PQRA 3W34A 3BSYA 2I2FA 1QIHA 2OHJA 2EKZA 3E9QA 2AUTA 3JD3A 4KO1S 1XCOA 2Q3MA 4R7GA 3OZTA 4PN3A 1CCWA 3HDVA 2Y66A 2V4ZA 4YASA 4MVXA 3RU2A 4RH1A 4DQLA 3Q8KA 5KIAA 1S8AA 4JR1A 2BMFA 2C78A 3AQ4A 2Q1WA 3NP9A 1FMJA 1MC1A 3EZGA 4ILEA 3U7FB 3K15A 2PIDA 3EOBI 5K0LA 1GR1A 4I2NA 4ZP1A 3T8YA 4F72A 1QWSA 1A1VA 2WI8A 3GMTA 4KO4S 4CM8A 1WMDA 2GHRA 2G9UA 1KI7A 1Z2CA 5I8PA 4LKOA 3TMYA 1ZMOA 4D8WA 1OGJA 4QDXA 2AQIA 3GAMA 4AXBA 1KDRA 3CO5A 4G3XA 4KPUB 4M88A 3IT2A 4B3XA 1ECGA 4IDGA 1T43A 3W5DA 2Q3BA 4L95C 1NU6A 3LC1O 1FP7A 1D8TA 1OZGA 2HJGA 3FUWA 4M1MA 2YY6A 1V7ZA 2JEOA 3Q6NA 4XUCA 3FZYA 1CY2A 2C5LA 3BKWA 1C29B 2J9YB 4EA6A 1RRCA 1YJ8A 2OAGA 3QVVA 1T2UA 4NFLA 4CT0A 5JJLA 1YCHA 3AB7A 2A2ZA 1S6YA 3R3HA 1ODTC 2J3DA 1V3TA 3VAYA 4RH0A 2FDRA 2Q21A 3UK6A 1AU9A 3ACDA 4GMHA 1FY2A 1A3CA 1J7KA 3CA8A 5DLDA 2FWNA 3OICA 5ARDA 1YGPA 2R2AA 2IOQA 4DNPA 3DFFA 3OUTA 3WRXC 1XRPA 1BNCA 1Z36A 4GI5A 1V8OA 1WO8A 4YBZA 5IJ9B 1PSDA 4RVOA 1LBEA 3TLGA 1TEHA 2AVNA 1CEQA 2PDAA 1XJ5A 4TPKA 5AOBA 2O06A 2UYCA 3U2QA 4JZKA 2QMEA 5AO9A 5GM2A 4MVYA 4B80A 4CM7A 3FTQA 1K75A 3EEYA 1DUSA 3ICVA 4EG7A 1BVYF 2VN8A 2PX4A 4FHZA 3G5UA 1KJNA 3BFJA 3W2IA 2RI0A 3JARB 5KNBH 1G38A 3F5QA 4Z99A 1PGJA 3CZCA 2ZBPA 1WUIS 4O8ZA 4XIFA 1MAWA 2VJYA 1P44A 1ZEMA 1KI2A 1R6UA 2X5JO 3MLAA 5E9WA 2QRPA 1E60A 5EE9A 4ZK2A 3WHLA 2G7MC 3O75A 3BM5A 3TUJC 2Q4BA 1U4NA 1FNCA 5DTRA 1W2HA 1MG0A 3LHKA 4CV2A 3HCBA 5IVIA 4TV8F 3UV3A 1F7VA 5JCXA 4YDQA 1RSZA 2J6BA 2G9VA 3HXQA 4HEQA 4EO9A 1Q83A 1YHYA 4DLVA 4MQMA 3TUIC 4EY4A 1D8AA 2O2CA 2ODQA 2OGZA 2GJAA 5BY2A 2GTHA 3ZS9A 1S4MA 3ZD9A 3FOEC 3A2KA 3TEFA 2H31A 4Z54A 4KH1A 3U4QA 1U2TA 3AEUA 4CEIB 3MTJA 2P2SA 2GK6A 2QTNA 3QI2A 3PIRA 1GPMA 5E9AA 4ALKA 1Y4SA 9LDBA 1O5OA 4MR9A 2IA5A 3PZBA 2WJVA 3GJZA 2PUEA 1KYXA 3N2KA 1NW3A 3T1OA 4LXUA 2X4LA 4DB2A 1BGVA 5AQ1A 3OZXA 3LE8A 4R9SA 3RB8A 3DAYA 1JZSA 3RVSA 1PDOA 4MVCA 3VDQA 4NJEA 1MVLA 4P83A 2FPKA 4Z3DA 4NE9A 5JD5A 3IQWA 5GJVC 1XVTA 4LF5B 3RTAA 3VC3A 1WG8A 2W8BB 4DLWA 2DPLA 2UYQA 1EPUA 3GVHA 3SJUA 3BE5A 3AOEA 4POOA 4MGEA 1YAHA 3AJAA 5L8VA 2O3QA 5LU9A 2B37A 2PJUA 3A10A 4MQ6A 1V8PA 1FDIA 3LXUX 2IHKA 4GOKA 4PCUA 2AZMA 1N7GA 3K05A 2C97A 3CZ9A 4FMBB 4RNCA 4EJMA 1TT5A 3CSSA 3SVLA 1PR5A 2WIBA 1QQ6A 3T3HA 4I4TA 2Q3FA 5KJCA 1MRNA 2OWDA 3TIFA 1EFAA 3TZCA 4W5NA 3AG5A 4C06A 3LFTA 1K6IA 2H1WA 1Y42X 2JIZD 1CETA 3TBHA 4G5RA 3GHYA 2IDZA 5JRZA 2QZ9A 2DT8A 4QFBA 4M9ZA 5E0KB 1BVUA 4WY2A 1PJRA 4QPNA 3N8KA 2PUHA 1ZXXA 1Y8ZA 3M1IA 3W2FA 4FK8A 5CVCA 2P79A 3CVUA 1MF7A 1HZJA 1E9BA 1W96A 3EODA 1U8YA 1X8XA 2M2IA 1MO3A 3HZRA 1PR9A 1O08A 3AVQA 1KQ3A 1EUDB 2XNHA 1SOWA 3FBTA 2FTKE 1XLTC 3HNOA 4GEKA 4P4TA 4BEWA 3WLLA 2BSXA 1KJWA 2P30A 4RHFA 3JAMA 5AD1A 1T6YA 2IE8A 1DHRA 1WOMA 2WFMA 1RDFA 4W82A 3AEYA 2Y0CA 4C29A 2VRBA 1T2AA 3QYAA 3WWZA 4XQEA 2EX4A 1J8DA 2QUKA 3IYLW 3UENA 5K0TA 5HNKA 3EUWA 1PDVA 2VT2A 2V9CA 3ZHCA 3W06A 4WNYA 3LHIA 1MVOA 2WK1A 3DVRX 1K98A 4M46A 1SCUA 2NAFA 4YO8A 1UPBA 1W5FA 4WDQA 1AKVA 3THOA 1JGTA 3LUKA 4A27A 5DF1A 3GFVA 4C7BA 4UTRA 3D7NA 3R9XB 3OAAD 3P9QA 1VL0A 4EG8A 2IUFA 3T34A 1AN9A 3MLBA 1L1RA 3NNDA 1OI3A 3CLRC 4NE7A 4FFOA 5NULA 4BS9A 1CV2A 3D6HA 2I1WA 5KC9A 1W4AA 2OAP1 1H6AA 4Q4HB 4C04A 1FTSA 5JBNA 3CUKA 1JJIA 1E1RA 1H94A 1OFHA 2VUTA 4NWIA 5AJHA 3RG8A 4EIWA 2XZLA 1EX6A 3C5VA 3BRWD 1L1FA 2F8TA 4RY8A 3WX0A 4ARZA 2IUTA 4G5HA 3A6EA 1SUCA 1QFMA 2RGCA 3MWYW 1QGUB 4J91A 4UUOA 1IFXA 3STHA 1V47A 2JCSA 1QO0A 3S27A 1K8YB 4FD3A 4ONEA 1BDJA 1TO6A 1DAPA 3IT1A 4GM4A 2J30A 3RBZA 3EZNA 3HB0A 2YN4A 3WGOA 5B5SA 2QRVA 4B45A 2WKSA 1PEKE 1ISJA 2Q4TA 3AIIA 2NX2A 3AU9A 3E48A 3HLYA 4GPBA 3T4XA 1OW3B 1I14A 3ZH9B 2JGJA 2EX0A 4QVIA 1YTUA 1VL2A 1O96A 3H86A 1TKCA 2CHFA 3QUAA 5LJLA 5JTUA 1X19A 5F9FA 2GGSA 3QVWA 4NBUA 4UXJA 1PRYA 2FMXA 2A78A 2E4ZA 2VQDA 3EEFA 1ISRA 3M33A 3ZR4B 1X1QA 3MOSA 4XQ0A 4CR8A 3SEAA 1B2LA 4JCOA 4Z3KA 3A7DA 3F96A 1GQRA 4AF6A 3RABA 3KVNA 4DA4A 1XJCA 1PFKA 1QIMA 3NHWA 1IPHA 1C81A 6NULA 3DDWA 2POQX 1OPXA 2NPIA 2CF5A 1ESNA 1VA4A 2QZ4A 2VCHA 3IIEA 4RE5A 3GEGA 3H18A 1TYBE 2GD6A 1HE5A 5IAJA 4CIWA 5DMXA 3QLVA 3UAVA 4JYZA 4YRDA 1HYHA 1I51A 2ZPTX 4D99A 1CR0A 3RQSA 3U44A 4NG4A 1NVTA 4HEA6 1Z13A 2O8NA 3I9V1 3M2TA 4J9VA 4QASA 4UQOA 3R8XA 3ORFA 3AEQB 4Q34A 1S3GA 1XCPA 2PQMA 2BI8A 3PUHA 4QUHA 1U80A 4HN9A 1TLFA 3BHMA 3J7AC 4TYPA 1PKEA 2VQ3A 3HRKA 1Y37A 3UXMA 2ZAMA 3OPNA 3V42A 4AKHA 4GSKA 2MCFA 2X77A 2XDYA 3NTXA 3MXTA 1NF8A 1Z56C 2BBTA 2UV8A 5JCJD 1LNQA 3G0CA 3HBAA 4ZOCA 4BOYA 1BXGA 1U2QA 3AFMA 5T3UA 4CKBB 2F55A 3MUOA 2GPWA 5BW8A 4F4JA 2QRUA 2ZP1A 1X7HA 2XUAA 2P6RA 3WICA 4Z2AA 4RLHA 2R00C 3T7AA 2GF2A 2OEPA 3F47A 3ZBPA 1HFWA 1NDUA 2E7ZA 5E4YA 4CM6A 1J0EA 1C7EA 1TTQB 2G71A 3DPIA 3EIQA 1YBAA 4OY3A 4PWZA 5CH8A 2JGNA 1QDLB 2ANBA 5T4EA 2W6PA 1TM2A 2B7LA 3KPVA 2GNAA 5FFFA 1PGOA 5GQSA 4CG2A 5KHLB 1PWHA 1RBZA 4QTZA 1E9EA 4C4AA 1OBOA 1Z68A 4MPDA 5T67A 4JEIA 4Q1CA 4DMRA 3G1UA 1L3IA 2P2CA 1T5IA 2V7WA 3LYLA 4I5FA 3ZV4A 4QRHA 1TCAA 1Q7CA 1RABA 4EUEA 5FA5A 1ZISA 3NEYA 3AFOA 4RA9B 3WK7A 2R4QA 1JQJC 1W19A 1XTZA 2AR7A 4K6KA 4BN5A 4C43A 2IUYA 2DH5A 2IY7A 4Y2HA 5HVNA 2FPPB 2HBRA 5B1YA 2AEFA 4FN5A 2VNIA 2YS6A 2G8NA 3L0IB 2BGMA 3WNBA 2QX4A 4U9IS 5IYZB 2XY4A 2GAJA 4KYUA 1VPTA 2HBZA 1EAYA 3PXUA 4HDAA 4NARA 5AJVB 1DIHA 1FLDA 2HC9A 3I2HA 1SGWA 1EXVA 3H1BA 3GZNA 1I3MA 2VSOA 3B8EA 3P9YA 5FBZA 5FPYA 5IP5A 2WZDA 2ZSKA 4AF7A 2AIRA 1BVHA 4GGPA 3UMJA 4ER6A 4MDEA 2ZBUA 3WLSA 2ZJ5A 4RZQA 1UWKA 3VOTA 2D3TA 4L73A 4CDGA 2WINI 1M0EA 1XX6A 1JR3A 1TC1A 2O5VA 2ZT7A 4M0CA 4UU1A 5CJJA 2HZ7A 4GUDA 1KO8A 2GDJA 1CNFA 2WB2A 2JB9A 5K05A 3T9EA 3F7TA 3ER6A 1I0ZA 2FETA 2J85A 5FPTA 4CJXA 4F56A 3ZJ4A 1NR5A 3CPSA 2H8KA 2HQBA 1Q0SA 3WLJA 2EJCA 2R87A 4I4TF 3NVAA 4Q39A 3RTBA 3HY4A 2JBAA 1M1XB 3PDCA 1JSLA 1L5RA 3SC6A 3JYPA 5KJEA 3DUFB 1W5SA 2P9HA 1SIOA 1JKJA 4BNFA 1GU7A 1DXQA 1J8FA 1CX9B 1SEVA 1T34A 1UXGA 3EQ9A 1PR6A 1TUIA 1A8IA 4KR2A 1V3VA 2R1TA 4BXOB 2OZVA 1KZ9A 3EN0A 1M7GA 2C03A 2ECPA 4UFPA 4RQBA 2XXJA 1JIIA 4IOMA 3IKJA 4OU5A 2DJ5A 2J41A 5AM4A 4DPKA 1KERA 2GMWA 3HUUA 4CLHA 5MGNA 2XKBA 2OQVA 2NP6A 2JG3A 2ADMA 2ACKA 3OCCA 5F4ZA 1T26A 2FEPA 2Q1SA 1CEEA 5FTKA 2JAPA 3CIOA 5B53A 4EHLA 3GIDA 4TUYB 4AY5A 5GZ3A 3CEAA 3W79A 1GTRA 2J0QA 1NURA 3AGPA 1PL6A 1KVUA 3VU9A 3L7JA 4WOCA 4ENPA 3MGBA 2FQWA 1LRJA 1M2FA 4LCEA 4YALA 4MJ7A 2NU8B 2EC5A 2XITA 4AQYB 3SXUB 5IS2A 4YT5A 2BGWA 3Q8MA 2W9XA 4O4JB 1R6AA 4N12A 4NBWA 4RKRA 5EUMA 1QV7A 2ZK7A 1M7HA 4QWMA 5FULA 5GONB 4YCCA 4MUAA 4GRAA 2ZS7A 1U8TA 1WXHA 4QO7A 1U3VA 1CDZA 2IHUA 2DWUA 3JQBC 3ZWPA 4CTOA 2ECFA 2QMQA 1MDFA 1ZIOA 3NGMA 4NYMR 5L4LA 1G291 1M5TA 2YYSA 2PSEA 3PUIA 1DQZA 4L5IA 4DPLA 1DWQA 1I1QB 1QIGA 4HNUA 3DV0B 5FJJA 5KWIA 1D4OA 3GDOA 4RGQA 4Q24A 4EI8A 5BPHA 3W6UA 4YLEA 2OBFA 3OPYB 2YOHA 3M0EA 4OATA 5AJYA 2BUAA 3KOYA 5BSMA 4BP8A 1I1NA 2VPPA 4EP1A 5JV5A 2AEMA 1YNSA 3SKVA 4J8PA 4RJKA 3GP8A 5KOJB 2H2GA 1HTBA 4N18A 3FM9A 1BD4A 4WZBB 2KJQA 4JL8A 5AQEA 4H7IA 1C50A 2KB0A 2OCGA 1VQ1A 4K40A 3I8XA 5CUQA 3TNLA 5KVVA 2X5OA 1NQOA 2J3JA 2OAQ1 3FNIA 3M6IA 3QLUA 221PA 1TGYA 3ZVLA 4UU8A 1U9YA 1R1DA 4QSMA 1RM0A 2JLCA 2C57A 2YFKA 5BMOA 3IC5A 5CIYA 4UU7A 1HDIA 4H60A 3K7EA 4NJMA 5CT8A 1WMSA 2DG2A 2PJZA 3R4CA 4PF1A 3IX7A 3OPVA 3FKJA 4D02A 4HXEB 1E2EA 1MCZA 3HJRA 1AF7A 3BORA 5AXAA 4X1YA 1QYWA 3WGJA 1IY2A 1V43A 1YOVB 2MSDB 3VR3A 3H8VA 1BGXT 2V0GA 1GZ3A 2BE9A 2XMDA 3CXRA 1ODKA 2WUGA 3LBIA 4I50F 4V0ME 5CVUA 1E61A 4FEYA 1EDZA 1P3DA 3IVGA 2WBLC 4O2RA 5AKYA 1W0JA 2V7BA 3HCOA 1Q5PA 1LLUA 3CH7A 1CHDA 4YJ3A 1EFPB 1MFPA 3G2OA 1M6VA 5I45A 3ADBA 3CLTC 4XYGA 1KEUA 4CKEA 1I33A 4U02A 5EPEA 3L0DA 1FQJA 1EE2A 1MD9A 1TA0A 3AY3A 2B98A 4X8OA 1CF2O 4RGVA 1Z6AA 3S5UA 1ZQ9A 2C20A 4Y2QA 5EUQB 3PKJA 2NPFA 1C14A 5CBPB 5I4BA 2BTEA 2KQUA 4DABA 4YHBA 1K1EA 3NR2A 2VDWA 3DD1A 1XZIA 1ZD8A 2WJ6A 1P19A 4RPKA 4RMIA 5GGYA 1VDMA 3DKIA 3PXEA 5ALEA 1IBKB 4LE0A 1YO6A 2R66A 2PS3A 1SPXA 1JYEA 3ECAA 3S8YA 1QF9A 1JAXA 1VFPA 1A8HA 3K31A 2YFQA 5DYYA 2AHOA 3RT7A 4RD6A 4JITA 3NBXX 1XEWY 4R68A 1IUNA 4RTJA 2IUEA 3LUFA 1G2OA 1YK1A 1H6CA 2ZB4A 2OBMA 4A10A 3ZHXA 2DY1A 3UEOA 2BFWA 2FPGA 3T1NA 4Y1RA 4YT4A 3G5AA 2WHEA 2W5UA 3IOMA 3Q9LA 1L1EA 1TYZA 1ZVJA 2V7XA 2Z56A 3L8HA 2IZ0A 4MKHA 4RBNA 4MGHA 2R44A 4YN3A 5FKJA 1QFXA 1JBQA 1XGKA 2XTAA 2BZ1A 6YASA 1LLCA 1NVVQ 3I9LA 5EIWA 4XYEA 1ODCA 1NW5A 2QYOA 3OT1A 4KH0A 2AI3A 1GLNA 4N0QA 1SWWA 4MYRA 1P74A 2WC1A 4J0EA 4FBGA 1S2GA 2F1HA 5IH7A 1W48A 3EPRA 3E1GA 1P6UA 4QYSA 4ZZ3A 3RFCA 3DVQX 2OMKA 4QARA 4KO8A 4Q16A 3DHWC 4GZMA 3ZHQA 1FNMA 4CLOB 3O4JA 3PFHA 4G5FA 2Y4OA 2ETVA 1S96A 4MX8A 1BRMA 3TW6A 1BJKA 5DI3B 1U3DA 5LZ4A 3MT9A 4MQ4A 1G21A 1M2NA 5AJUA 2KLHA 1M8FA 2IXBA 3UWKA 4BFXA 1MABA 2BGLA 1VJTA 1XZAA 3WWYA 3CLVA 4G36A 3ESCA 4JGIA 4EHHA 1T1JA 4CF7A 2QBYA 1J25A 3ML1A 4BBPA 1KZ4A 2PA0A 2UUPA 4YK7A 3D81A 5CPFA 3W2TA 1WEKA 3IR6A 1O7JA 2W2KA 4Q4JB 1I7NA 2FR8C 2IZ7A 3A4MA 4EZIA 4WHMA 4Z4EA 3V97A 4TS9A 1FFDA 1A4RA 1F4LA 5JAUA 3C39A 2EG9A 1Z5UA 1DG9A 2GARA 3KPWA 4OFWA 4MA4A 4QG7A 5EMLA 5AYVA 2R86A 3FF4A 4KUGA 1JLHA 1XKXA 1NUUA 1QR6A 3UJ3X 1GGVA 4RWZA 4JSRA 4MA0A 1BDIA 4PG6A 3RV4A 3R40A 3MJSA 1KZ7B 3FR7A 1GRCA 3GAFA 2ISCA 2JA2A 1YGYA 2JARA 5AW2A 1ZA2A 2C2XA 1M2KA 1M67A 1DC3A 1JPNA 1ZMBA 3OZ7A 4XIJA 1K27A 3NT5A 4WGGA 3TOXA 3PGLA 4G1CA 3DOUA 4MHTA 1N2SA 2Z8YA 3L6DA 3K6SA 5BQOA 1JQ3A 5F23A 1VYVA 3PQ3A 4GLBA 2C7QA 5BV1A 1EAMA 1W25A 5E4JA 3KE9A 4UM7A 4F5WA 2OSBA 3HYLA 4HZUB 3PR2B 5AKZA 5A5GA 4CTJA 4Y7DA 3WKEA 1LW7A 1NYLA 2O4UX 1JMKC 1YS6A 1ZJZA 3F7NA 3H6HA 3QF4A 5TPWA 3UK2A 2ATXA 4I4IA 2ZJ6A 1HSZA 2P8JA 4MEAA 4OOEA 4P86A 2VTBB 2UVQA 3NNSA 3O8DA 2OD2A 4DV4B 4LBYA 3I23A 5LD2B 2C4NA 1GNTA 1W4LA 4IF4A 4YRPA 2E6KA 4DHEA 2A1UA 4ENWA 4HNTA 1OX6A 4I3GA 1RMTA 3CCCA 1P62B 2GBFA 3A1NA 4RX1A 5JH7A 1TUBA 3GA5A 4KN5A 4B73A 4L9AA 5AOAA 3ASUA 2QX6A 2VZ9A 3MTDA 4J1QA 3LT4A 5A5VA 3O7MA 2FZKA 1PJ2A 4L85A 1ULSA 3EE6A 5HGJA 3ZBUA 4TYNA 1ZC4A 4RSMA 1GU0A 2OOKA 4ZO4A 3SZMA 3WY9A 3IDOA 1H5UA 1U2SA 2HHAA 2ECKA 3NGLA 1QLJA 2NZYA 3H5AA 4GBJA 2G5GX 3M6FA 2OK7A 3L7NA 3VSBA 1ADFA 1EFKA 4U7FA 4PXYA 5FOQA 2DEUA 4R31A 1HI9A 2X1VA 5BR7A 3FKQA 2VJBA 1HG1A 2WWFA 3KXLA 3GAAA 3BK1A 3HDYA 4OLAA 3IVAA 1P73A 1V25A 3ANYB 3ZBTA 2GX6A 1WXFA 1F20A 2DQYA 2PQ6A 3LDAA 4FZRA 2YMPA 3FI0A 1ZN9A 3FTNA 1XP5A 1KSJA 3QLVC 2FPOA 1AURA 4DR2B 4G0WA 1GM5A 4R69A 4ZXFA 4JSTA 4FZ3A 2HHJA 4IIDA 1PS8A 1NBAA 4GI3A 4Z4CA 1G8FA 3BB3A 3H11B 2GK4A 3LL4A 1EVYA 3O2NA 2XAUA 3B9BA 3G8CA 3SGLA 3VO9A 1R0WA 1TKBA 5BN4B 1XVLA 4DUGA 1U8XX 1E59A 2XOEA 3D2BA 3UHJA 3BD7A 3GU3A 1A8PA 1G8JA 4P6VF 4Q3NA 5IBPA 3KOMA 3RRZA 1BTOA 1JLRA 3GC6A 2EVWX 2VHJA 2WYOA 4NVRA 2OBLA 4DQVA 3MGGA 5LN1A 3M1YA 1H1TA 1XRMA 4D9NA 1P1IA 1IN5A 3CT6A 3L8MA 5DNAA 1RPJA 3KVYA 3IKTA 4MLZA 2C1XA 3IP8A 4HCJA 4LOKA 3D0QA 3E23A 1X7YA 2V7QA 4EYQA 1JE1A 4EAQA 4AJOA 1JS1X 1C7RA 4NK4A 5HFNA 1CQIA 3VKVA 5AW0A 1F4PA 1JIXA 1J9ZA 1RXCA 4KQGA 3MRXA 5TPZD 3MJHA 2UZ0A 2I9PA 4H27A 1NP3A 4M8SA 4OMFG 4X5OA 4ZVLA 2P9QA 3M6MD 4K0KB 2VDOB 4M8KA 3AIOA 3QPWA 4YCJA 3EGXA 1CVIA 1U2ZA 2O1WA 5H5JA 2X8WA 2Z0MA 3CBGA 2BRUA 3VA7A 1SVLA 3U60B 2P2YA 3A11A 3AINA 2ZU6A 2VZ8A 4LGMA 2RI6A 3K1YA 3OHSX 4Y2GA 4CQLB 5CLJA 2J4FA 4GQIA 3E22A 4B4UA 4A2QA 3PKZA 4QXMA 1QONA 1YBMA 1BFDA 5LQKA 4OQEA 3VNBA 1GL6A 5HKKA 2FRVA 3VR0A 2PJDA 2YZ2A 4KPFC 2VTBA 5KYGA 1XT6A 4HBGA 3C3CA 1NW9B 2CHGA 4RKQA 2DUUA 3DXFA 1NAHA 3DXZA 3G23A 3PNQA 3V8VA 5HCUA 1FL9A 2CYCA 1HE1C 2GN9A 4S2EA 3UKOA 5B3KA 3ZGZA 2X76A 1L6IA 2OFWA 1R10A 3QEOA 2OQRA 3EG9B 4QEZA 2NLOA 3ZLTA 3X0DA 1MC8A 1U04A 5I7HA 1KXJA 2ZRQA 621PA 3GLVA 5JAQA 4UTNA 4PC7A 3VMFA 2QJRA 3FX2A 4QREA 2C82A 4QT0A 4DCUA 1L2TA 1T5DX 1KK3A 3GPDG 4X92A 4S12A 1YR3A 1RS0A 2V55B 1QNFA 3KOZA 4H3KB 4UD2A 3WE7A 4EW6A 1KBOA 1R0CA 2PVSA 4PO9A 3SQDA 4F2GA 2QS9A 3SQNA 3IUNA 3WL7A 3ZDAA 2B5WA 1JDTA 1OI7A 2FQYA 2QLJA 1FLVA 2W4IA 3OO1A 4MJXA 2YWGA 3W2GA 5FWNA 1TW2A 2LD4A 2VDVE 3TSYA 1JDVA 4XQCA 3WQSB 1OAAA 4MZDA 2H4HA 2D1TA 2JRLA 3DM9B 3LKVA 4ZRDA 2RIPA 2CCGA 3CVVA 1W94A 1MB0A 3D8HA 4ZYWA 2XSZA 2ORWA 3B20A 4BP1A 4JIGA 2GN1A 3B13B 1EK1A 1WF6A 1XF9A 3M4ZA 3MVEA 7MDHA 1AXEA 4G97A 4ARIA 1OXXK 3M1LA 5EGSA 4DDMA 4MS1B 4YRNA 2DCMA 1SK9A 3GLQA 4ZVTA 1Z6TA 1OVMA 1NRJB 1JHZA 5C4MA 2I6SA 3BFXA 4G65A 1GA1A 4IDOA 4Q15A 3RYIB 4DMGA 2ZXUA 3UJHA 4EG5A 3VR4H 3JQPA 1P81A 3MJEA 3B1FA 2I6XA 1WXDA 2J9GA 1PVOA 2DPYA 4OI2A 1XMOB 5A0TA 2M6LA 4ZVSA 5CT9A 3ZJUA 4OHPA 4M83A 4UVEA 4NABA 5BR1A 1GD1O 1QNLA 2EU8A 1CZHA 2J7PA 1CP3A 2WWIA 3IODA 3KDAA 4I5GA 4V39A 4A6EA 5FBVB 3FRJA 3LKZA 4ZQBA 4DUPA 2Z5VA 4L6AA 4WKPA 4OB7A 3KJZA 4LSMA 3KEOA 3CUEF 2W0SA 5KU1A 1Z6ZA 3RIMA 4M0LA 3K8YA 4NV3A 3C8DA 4UEQA 4V0KA 5AHKA 1XQ1A 2AN3A 1UMCB 4EUFA 1IQUA 3HEBA 1XRQA 3W8NA 1HE4A 5AI6A 2R65A 5INTA 3G59A 1RKVA 4XYMA 3EHDA 3OWOA 2PUCA 2HQ1A 3F6YA 4PONA 3G5TA 4OA8A 5FV7A 2ZBRA 2F6RA 3BFVA 4QC2A 5BXQC 2FPMA 5JY1A 2ENUA 4R05A 1LY1A 4YFVA 4RD3A 4IGAA 5CAEA 3A2NA 5JUWA 3O2JA 2BMVA 2XMGA 1M3SA 3KZKA 4UHDA 2PA3A 3NIFB 1V6CA 3HUFA 4FEAA 2XMQA 1L0BA 1LVGA 2WWRA 3KT8A 1NUHA 3O6VA 3C3DA 5EP3A 4HB2A 3PFFA 2OFOA 3QLUC 1T91A 2Y67A 4C0QC 4DSUA 7REQA 5JH7F 1KMQA 4N5LA 1EXDA 1QCDA 1TJ3A 2YRFA 3DPUA 1GLGA 3D0KA 4JK3A 4K05A 3RS0A 2ZZMA 2O8EB 5COAA 3SJZA 3EA0A 1F8FA 1KI6B 2WPDA 4NU5A 2HCFA 3K16A 4DCPA 4HL6A 4X90A 1Y6GA 1SHJA 4AZSA 1A98A 1TLTA 2D7JA 2O50A 5ILOA 2M6SA 1UBMS 3C3PA 2P11A 1E6WA 1KDOA 2I6UA 3E7WA 3JAWB 4FE3A 4C0KA 4F7WA 4O0MA 1MO4A 2GHTA 3FSGD 4L3VA 3RANA 4RTLA 4CDRA 1K7XB 4NCBA 1OE0A 1OI4A 4RZXA 2PZ8A 4YAFA 3IB3A 1INLA 4UHKA 1I9GA 4J75A 5TQ2A 13PKA 3FPSA 3PS9A 1J7JA 2AQHA 1MU0A 5DW3A 4BE9A 2JATA 2KM1A 3HJCA 1A9QA 5BWMA 5CA0B 1UKVY 2M32A 4JB2A 1JMYA 5A7GA 4ZDIA 2VCYA 1ZONA 1M0TA 3CJQA 3L7CA 1L5LA 2D7CA 2IELA 1I2CA 2V65A 3HJNA 2O2IA 1FSFA 1UT8A 1YI1A 3E81A 3VI4B 4EA7A 3V1TC 4LF6B 4JLNA 1U8FO 3A9SA 5LQSA 3PXXA 5CYGA 2QA5A 1DEAA 2JGFA 4MYTA 5PGMA 4PC6A 2GKOA 4NPCA 4S1VA 1FB5A 2HX1A 3DZ8A 5F35A 4BLOA 5A04A 3K0AB 1EDBA 1U8UA 2JCVA 3N8NA 4JBWA 3R24A 1F8GA 2HRRA 2ZAOA 3CTPA 4ZOLA 1YFJA 2M1ZA 1P4AA 1F6WA 3CINA 3IDSA 3STXA 5H16A 2WZCA 2JLUA 4IW3B 3QZUA 5DCYA 4BTLA 2VL7A 5IXYA 4J76A 1PFGA 1KQOA 1GUBA 5JSYA 2GWHA 5TE9A 2D7DA 3FFTA 2OFXA 3GVPA 3AR5A 3EXAA 1DBSA 4JEUA 4RJLA 4Z9YA 3TLKA 3TF5A 4H1HA 5D2CA 1F3LA 4PG7A 4M1QA 1PFVA 1FVOA 1KVRA 3ORHA 4NDNE 4ESEA 3ZGOA 4O2LA 2YIVX 1ONNA 3GRPA 4HF7A 1ZD5A 1S02A 2C92A 3BWMA 1PZEA 2LWIA 3DV9A 1FUUA 3QKSB 4QPDA 4QXQA 1JFRA 1KH1A 2VHZA 2C31A 2R47A 3ET5A 1PZMA 1XAJA 3WL8A 4AG5A 1CF4A 4I4NA 3SIXA 3GD7A 1OV6A 2GPYA 5JFTA 3C6QA 1NN1A 1UMDA 4ZAZA 4DBLE 1UT5A 1ZIXA 3LXMA 1G5PA 1UBLS 2JJ1A 2B8TA 3VR5A 4CN8A 2QVYX 3S2UA 4A16A 3BDVA 4L1KA 4WV3A 3RUIA 1ZGAA 3FIUA 4TL8A 1JA0A 1TK9A 3LBYA 2PWPA 2PT9A 5C2JB 1RI2A 3FOCA 4K5QA 2Z2KA 3ETDA 1G59A 3PYMA 4LE1A 1EESA 3Q6MA 5SZHB 1FVHA 4I81A 5LXTA 4WK0B 3UM9A 3CRVA 5H9WA 3H9CA 4BLRA 2Z57A 3D4OA 4LMBA 4BYMA 4AJ2A 1XRJA 4IIJF 2F43A 4XGRA 3FHCB 4AJHA 1XUOA 4IHAA 4QU5A 1T1EA 2W2LD 7ADHA 3KL4A 2G63A 2COUA 5JIBA 3ZCXA 4M36A 1WVGA 4JJ8A 4K46A 4TL6A 2UZAA 1ZI8A 1L7AA 1Q95A 5FI3A 3DE6X 5EZ5A 2DU8A 3OQPA 4ZI3A 2EP7A 2FE1A 2FZCA 1EVLA 2FX5A 2VJLA 2WJ4A 4A73A 4XM1A 4KG7A 4KLCA 2YNMD 1EXWA 1U4OA 3ZOZA 4L5YA 1DS6A 3B3FA 3JX9A 4OPMA 4I55A 4P22A 4N47A 4V3BA 2OE2A 3MCAA 1C3VA 4G2NA 2RE8A 1X7ZA 3H3JA 3ONVA 1VI5A 1EK6A 2H1RA 1CY1A 3U31A 4YEDA 3WIUA 5JQGB 3H5RA 5EZ6B 3VYTB 4NPHA 4DXHA 2H57A 2UXDB 5GJCA 2FF7A 1M0SA 3V2HA 4MPPA 3AP2A 1KPGA 1OTHA 4LRYA 2IHYA 5BWNA 2CLSA 2BOVA 1RRKA 1VI2A 4IH9A 2BI4A 4U7PB 2HFKA 2Z1DA 5EMNA 5IAEA 4QTTB 2I29A 2JZOA 3FNGA 4OJQA 4UEKA 1DRKA 1SU7A 2AYYA 2NUAA 3HKEA 4MRPA 2RG1A 3IJPA 3E7PA 1CUVA 1Z73A 1K8ZB 1P17A 1KEEB 1L7QA 2NV2B 2QM3A 1XZFA 3GFQA 4JUAA 4KJZA 4O25A 4BKQA 4DREA 1ORTA 3INRA 4KNWA 3UPDA 2QL7A 3WZLA 5C0OE 1OH5A 4JT2A 3N0VA 1YR1A 4N7BA 1C3XA 4C6TB 1B8PA 1QKIA 1V26A 4WZZA 2PXHA 4ZKEA 2G72A 3Q5DA 3OBIA 1CRLA 3OUUA 2VUUA 2QX7A 5CVVA 3KXDA 2YXNA 3CNNA 3FDFA 5AIAA 5EP2A 1XXHA 2D74A 2OO3A 3MUNA 1BEUB 5F77A 3CB2A 1IC6A 3L0ZA 4GW3A 2OT3B 3EY4A 3II6X 2HIAA 5ERYA 5LNK1 1B2RA 1U3FA 5DYWA 3V1NA 1ECCA 4IIYA 4DLLA 1IZ7A 3EHEA 4WASA 1JLMA 1W5AA 3OTQA 1FFXA 1WF3A 1XMXA 3DS8A 3JVDA 4P54A 5EYPA 2WQ7A 1MAVA 4RK0A 4N3NA 2TMKA 1G5RA 1I7QB 2Z8XA 1EA5A 4GZ5A 3GVXA 1ONBA 3EDMA 4KAJA 1SQ6A 3WI7A 421PA 5CDGA 1IB6A 2E4VA 1JSRA 1PNTA 2Y1GA 2ZUWA 5T64A 3ZI4A 5DB4A 1OAOA 4TTTS 3SOZA 1CJUC 3ZY4A 1P1KA 3CPHA 3ZHSA 4ZT7A 4LEIA 4ALNA 5IVKA 4S0ZA 4JJFA 4Q19A 2AFIE 4AJPA 1D2NA 1X7XA 4OH7A 3ZXYA 5JRDS 3TG2A 1JNXX 1U02A 1MJFA 2LXNA 2NQ2C 1Y3AA 4C3UA 4FSXA 3EPKA 4OHRA 2LUOA 3AHCA 3PVCA 1FMCA 1E1CA 4CEHA 4QHSA 5BXYA 4FOLA 2CHVA 4WK6A 3AP3A 4KIGA 3H8WA 4XLLA 4E30A 4GOXA 4GBMA 4EG1A 1UM9B 3D3KA 3Q3EA 2BKEA 2Z8YM 4KUHA 2OECA 4R2JA 5DGDA 4F97A 1DXHA 1ARZA 2AXQA 4NQZA 5CXUA 4K28A 2C7OA 2EDAA 1P2FA 3O93A 3STUA 2D06A 5HUQA 4E5VA 2WAYA 1XPUA 1H05A 2NOAA 3O4RA 1U11A 4D6XA 5BQXA 3IQDB 3VI3B 4M9RA 3V7FA 1CS0A 2ZB7A 4HSGA 2EL9A 1L8LA 1ZM3A 2GAFA 1ZK2A 4ESVA 1AZLA 4UBLA 4XPIA 1XA0A 1KEVA 2QAJA 3ME5A 3QFSA 4HGPA 5DNEA 4FDMA 4LGCA 2GJSA 3UB2A 1VPVA 2GJ8A 2OQ2A 1S0UA 2WYHA 1JI0A 1KI1A 1C8VB 1QH0A 3BEDA 3HFGA 1HFEL 3IFSA 3KALA 3BH7A 3KXPA 4CQNA 4PE5B 3U80A 1N5DA 2JFPA 3IPYA 1KAQA 1SIWA 1PGPA 3BSFA 1EG7A 3JQRA 4NNJA 4R2LA 4GQBA 4MXDA 4QOJA 4UW9A 5K01A 4F6RA 2QTZA 3GLTA 4HQOA 2BMJA 2PMBA 5TGZA 1X8JA 3X2SA 1DBWA 4E51A 1OA1A 4XVQA 1JAHA 2G4CA 4M1SA 2XMRA 4BY9E 1R3UA 1VOTA 2RAVA 4RMJA 1KWGA 2OZLB 3LCVB 4X7RA 5A1JA 1GQSA 3B36A 4ZOLF 3B78A 2OPHA 3WIDA 4LF7B 4EWLA 3FHJA 1V6AA 4BMSA 1YL5A 2D5IA 2RAPA 1QOZA 4Q1EA 1PEDA 2OLKA 2KSQA 5IAGA 3IE1A 3A9UA 1A8UA 2W93A 4PLPA 2GTIA 3KD3A 1IBMB 3QEKA 1C8KA 4WY8A 2AL7A 2C88A 1WU8A 1X77A 4LVOA 3RC3A 1WDWB 3NIBA 1ZNZA 4Q18A 3WLAA 3EVEA 5D1NA 1X74A 4WJKB 4H4CA 4KMOA 4REMA 5JAIA 2FUEA 2VP6A 1QMPA 1GO2A 2C9BA 2QRKA 5A9RA 3AHHA 4G8CA 4D5GA 3RSHA 3EJ6A 4EQZA 1O94D 3AVXA 2B7CA 3WGKA 2C4TA 2JIZA 1ABBA 1PG2A 2SICE 2VF7A 3TXAA 2A3NA 4XSVA 1N7HA 5LNK6 1H2XA 4DNOA 1QKJA 1FFGA 3MBOA 3U3ZA 3EPJA 1BH6A 2WFZA 3ZD6A 3MCVA 3NRCA 3Q9UA 3X2EA 4HUQA 4BNMA 1U9ZA 1TAUA 4FT2A 2ZTUA 2NM0A 5BYAA 3L0SA 2YHAA 3LDUA 3CX8A 3L8YA 4ZGWA 4MPTA 4ENUA 1ADYA 4XTRA 3BGSA 4W1SA 5DGXA 1DX4A 1AOXA 4HYEA 5B36A 1Z26A 5DM0A 2XCIA 1B0UA 1H9AA 4ZEVA 1N9KA 5BSTA 2AJBA 2WJJA 1E1MA 5C3UA 3WRYA 3DG9A 4KK3A 2OR3A 2WWYA 3EISA 1DCTA 5AXDA 2PZJA 2VBIA 3URKA 4A91A 4MS3A 2LE0A 3EZ9A 2QN9A 1CNMA 2W71A 3WMGA 2ZWOA 3GLFA 3DTVB 1X0VA 5FPHA 5J47A 4MGIR 2PXXA 5CFQA 3LQQA 1DC7A 2YWDA 3C1OA 3DDNA 1ONPA 2HFJA 4PTZA 1KR5A 3BF8A 1J8QA 2OQIA 1LH0A 2BMAA 2IKSA 4HGZA 3VJLA 1TEVA 5CLHA 3OF3A 3U0BA 3DH0A 3OAAA 4U0KA 3WDSA 2DLCX 1U0GA 3FWYA 3TR6A 5GPBA 1U31A 3F6SA 5G0VA 3TYXA 4YACA 1TQHA 1UFOA 2H7VA 2PLRA 4FEEA 1I94B 3ESAA 4EARA 2G9ZA 2BEJA 1VIYA 2KE5A 3FCUB 3ITNA 2OBXA 1HDOA 5IAKA 4ZAXA 4BNWA 5ELMA 3BRWA 4KRYA 1U9IC 2H5JA 2O0KA 3PNYA 2J4DA 4AF8A 5KO2A 2LR0A 2A84A 2F1RA 3DLAA 3LC0A 3N2IA 4YUXA 3LIIA 4FP9A 1VHJA 2JJ2D 4R1QA 2UVDA 3KJGA 4YT2A 4IHQA 3ZIAD 3J80A 1GG2A 3Q88A 2QX9A 4CKYA 2IEZA 1MENA 4LNUB 3CN9A 1GN9A 3GZTB 4A6DA 2Q99A 2H4XA 4L76A 1MA3A 2O14A 1Y5NA 4MV0A 3CR3C 1XD9A 4M2LA 2CVPA 4Z8XA 1I0IA 2EDCA 3V2GA 4IHJB 4BJHB 3TWOA 1YB5A 3THWB 1LPOA 3NM4A 3OQIB 1Y3CE 4JBHA 4BNJA 1G8MA 3H05A 3KQMA 2NP7A 1SVOA 2PUWA 2ENWA 1E92A 2QRGA 3PF9A 4Z0HO 2F2TA 3IAAA 2RDMA 4TQGA 3O8OB 4FSDA 3WJ1A 1OFVA 1C1HA 2GFQA 2G83A 2X86A 3PYLA 4QYTA 1RXUA 3N3AC 1M34A 4LXYA 2ZBQA 1TYCA 1JFVA 4ISBA 3DEHA 2XUGA 4MHOA 3STTA 3UHOA 2YR0A 1TK3A 1NF9A 4MS4A 1XEFA 2FW9A 3M8KA 4F3RA 4TMZA 1Z63A 4P31A 2HZBA 1W88A 1SUPA 1XTKA 3NEJA 5IRCD 5LZ8A 1Q14A 1A8QA 2OXCA 2P7HA 2PMWB 2PLFA 2SKDA 2YHSA 3FCEA 3LDGA 4RPCA 3V46A 4X6LA 3R2JA 1IHPA 2BISA 4M54A 1UK7A 2PSHA 2WHPA 4I8DA 4DNXA 4K9QA 1NQTA 3AUJB 3HBNA 1ZW6A 3GNLA 4U2KA 2G07A 3EEQA 3I9FA 1N6OA 5FUXA 4Q4DA 2PN1A 3PJEA 4FGUA 4M0KA 3CJRA 4GX0A 3OZUA 5JCJA 2ZYGA 2ZI6A 3GEPA 2X0RA 1ORVA 4TYWA 3I05A 3TBKA 1D3AA 2A9OA 4BRZA 5HIIA 4NFHA 5I7VA 1PE0A 4I1RA 5IWCA 1MAHA 2F48A 4DN6A 3A1VA 3OM9A 2QN7A 3K0BA 1PK9A 5HFAA 3L8ZA 4M1TA 5LD2C 4UHBA 3BC1A 4QL3A 2O1EA 1HE8B 3HZOA 4BRUA 4QOIA 3V7YA 2W98A 3O90A 2X4GA 4X8MA 1AB6A 4RKYA 3X1XA 1E1YA 1KFKB 4KPUA 5CCDA 1ESMA 3IURA 3M5PA 2NYRA 3V1UA 2IY9A 1R8XA 4FDAA 1R9MA 4YUYA 2OXRA 3DEKA 3KSDO 3CEMA 1M5UA 1NP6A 5UKDA 4ZI2A 1BJTA 2H07A 4QATA 5ITWA 1D4ZA 4FWIB 4OFZA 1QO7A 5JDIA 4PVDA 2BFFB 1IRIA 3SZUA 1PW5A 4CCYB 4Q4CA 4EPXA 5CD9A 3MWFA 3RFUA 1GVNB 1PFQA 1ZS9A 3KKLA 4KPGA 1VBMA 3ADCA 3EJWA 1KTVA 4ND7A 3VC7A 1SZPA 1GVHA 1KYZA 2C8JA 1L8AA 3LSTA 1GCGA 3AL2A 4QBTA 3LWBA 3GJQA 4BNLA 2YS7A 4DJTA 4BVLA 3KYIB 4I19A 4DDTA 3TTWA 3T06B 4RF3A 3T1YB 3S8EA 3RRYA 1YA4A 2O59A 2IXGA 4KK4A 3I9KA 3LS2A 5IJ9A 2PAFA 3NWPA 4ZTZB 5BSUA 4LJ4A 4PTLA 5JD3A 5KINB 1E3LA 2DFPA 8ADHA 1Z5GA 3SZOA 1B3RA 3H7IA 4A0QA 3DWGA 3KLMX 3SLRA 1NJ6A 4OH1A 3NXSA 4WFJA 4ZC8A 1RZ3A 4ITVA 2GBLA 1VE3A 2CBZA 2WIKA 3JARA 5DTMA 3I5YA 4Y6OA 2JC3A 1WOYA 2QVGA 1OZAA 3GQVA 4KXMA 4X44A 1FIUA 3F49S 1QG0A 4GAEA 1T5LA 3AUKA 4OL9A 1P9OA 2BFBB 2IIQA 3KQTA 3P32A 3PCTA 4LQDA 1XHFA 6REQB 5IPFA 1OFGA 2IEGA 3NHKA 2WUFA 3P5BA 3ZWCA 3ANMA 4B31A 2OV4A 2PZGA 4IAOA 3TAHA 3QVTA 5C7LO 1LQUA 2GQ0A 3E03A 4I9HA 3SCZA 4BFTA 1YQXA 4FN4A 1UFQA 1F0YA 2PH7A 2X5KO 3QX9A 2EGUA 3F6RA 3F4LA 3LQYA 1VCMA 4GOJA 4EKDA 4L3OA 5CCXA 5JAPA 1LBHA 4FGJA 3ROKA 1ZGJA 4D9BA 3H0KA 4JP2A 2YOGA 4H2DA 5CTJA 1E2HA 4LJ8A 4N01A 1JU3A 1LSOA 5B2FA 4CEIA 2I3BA 2Q29A 4NHEA 4QUDA 5F2KA 3CZAA 3MILA 4CT4B 1AA6A 4D3YA 5AI5A 3H7AA 1M1ZA 3E5MA 3Q5GA 4G9BA 2BL4A 4PPFA 3FPGA 1WB9A 4KVFA 5CA1B 1R6BX 5JC1A 3VH2A 3EFEA 3OQ6A 5EMJA 5IZ4A 1U0BB 3AHFA 1H3FA 5B3JA 3CRRA 4GBED 2BHNA 1NF3A 3G6WA 5B4TA 4BLSA 2RB4A 5HR5A 1JBEA 1YZVA 4ENTA 2W8BA 2VQ6A 4WINA 5JJIA 2HNAA 1E4VA 3BK7A 5AKXA 4J7XA 5L3QB 2AR9A 1ZXBA 5FBQB 3ZDCA 1W4ZA 1I8TA 1M8GA 2P62A 4JX8A 3DPSA 3EF0A 5KHAA 4WBNB 1HYEA 3G2PA 1WD5A 1JHDA 1XR3A 3IR7A 3EWSA 1ZW1A 2JIQA 4OYRA 3LP5A 3GJXC 3WIOA 5I7WA 2HCTA 4OQFA 1JEYB 2BGRA 3GRCA 2R68A 1SOAA 2ID8A 3OZEA 4URXR 3D6FA 4X20B 1JEOA 3ND6A 5C53B 2H0QA 2H7CA 3IMCA 4C0JA 4G4GA 1KYIA 1N32B 3Q7PA 3FZNA 4AZ3B 4LMRA 4AZWA 1FFEA 1E9SA 3REFA 4ILKA 3VHRA 2OB2A 3CPEA 2ZFUA 1Y34E 5GGXA 5LPNA 3MSXA 4LWOA 1ZCZA 2WM9B 2D3WA 1K7SN 3U7IA 3AVOA 5CNMA 4AQDA 2PLAA 5FL7D 1XCBA 3DMTC 3HCWA 4UDNA 4MVJA 1MQ9A 5B1IA 3LTNC 1UZMA 4AW9A 4BB6A 4DMHA 4HNVA 2R84A 1JJVA 1EZ4A 3EXIB 3TNYA 1YZYA 1YZTA 1H69A 3OT4A 5EP4A 2IXFA 3KZCA 1U3UA 1VHTA 4E2WA 5KUTA 5KSWB 3DOOA 4UM5A 4R4JA 1XQXA 2HMUA 1EUDA 1G98A 3IXQA 3SNKA 3WFIA 4UE3S 3ZU2A 4Q9DA 3BREA 2XYRA 4QOHA 2P9JA 3L04A 1TAHA 3BCSA 4NYIQ 3HYNA 1POWA 4HS9A 3QPVA 5FI5A 5H7XA 4KR9A 3MF4A 5AVRA 4BNKA 2PRZA 4FQ5A 4ZCQA 3HU2A 4DIBA 1YI0A 2QLTA 1N6HA 1OR8A 3DTVD 1GNRA 4H7FA 2J33A 1ZOIA 1XZCA 3LP6A 3QSGA 4X24A 3QKWA 5GOTA 5LOVB 1CVRA 4Y9DA 1IH8A 3P9NA 3FAKA 4MUBA 4BGIA 2NVBA 5JFOA 1ND6A 4CFSA 1WB5A 1QQ7A 4LPKA 2AXEA 3H3XA 2A35A 4DBLC 2A57A 5A4JA 4LW8A 3SWWA 2X2EA 1PYGA 2DFLA 3RIGA 3R9XA 1X1AA 5TQJA 3ESRA 4OTZA 1Z8DA 2PD6A 1VIAA 2YWCA 4IIHA 4OKIA 5EE1A 2NN3C 4D9GA 1W9HA 4J2OA 4YFYA 2A67A 2D2VA 4LTMA 1PD1A 3CRNA 2E0IA 2JAXA 3GMIA 3H9GA 3HI4A 1VPEA 2O7SA 4BFYA 4Q4HA 4BNXA 4E4RA 1EGHA 4HAZA 2Q6LA 1V1RB 3CSDA 3ZHUA 1X1RA 1ZXLA 3L1IA 4BPRA 5KOIA 1V4NA 2PXCA 1O9HA 1SA0B 2YMQA 4YMTA 4LYHA 4BO9A 5H9VA 1A2KC 4N40A 1QGUA 1U3WA 3OP1A 4HP8A 2Z2JA 4NF2A 4H7PA 4C6HA 2BLNA 2J3QA 4KB5A 1DC8A 2NVOA 3P2JA 5LIPA 1FQKA 4X0EA 2G09A 2ZBEA 1EHCA 4RQTA 4D56A 3KOOA 4O4IB 2F67A 3DMDA 2JAWA 1RQ2A 1N2IA 5C8VA 2N47A 2QWXA 3GMSA 5MN5A 5EZYB 1P2TA 1ZM9A 4MITA 4GH5A 2QD3A 3PQ8A 3ODPA 1KQPA 1KPHA 5HRAA 3SJBA 3NKLA 3KVRA 3TJRA 2H18A 4UDYX 1NT4A 1R15A 3NEAA 2FUCA 1O3YA 4UBMA 3LC7O 3FPEA 3CGWA 1S3SA 3TBFA 4LXXA 2O5RA 4DTCA 4ZOAA 2H5EA 3MD0A 4KYTA 5A6SB 4UBOA 3R5XA 3TJZA 2VNKA 1UJMA 4B4VA 2R11A 1NVFA 1P8JA 1IN6A 2EEPA 2PD3A 2PX6A 3A4TA 3MAAC 3E9NA 4OV6B 3G8BA 4R40A 3QVUA 4C07A 1G66A 1OXTA 4HPWA 4KQWA 5JLAA 4RMGA 2DPMA 1U8CB 1Q22A 2BJVA 4NAHA 5AJXA 4P7JA 3ADPA 2YHBA 2YJ3A 3AEQA 4G6ZA 1EHIA 4GOLD 1ONOA 2I2DA 1QK3A 2YIDA 3GA0A 3HACA 4MWSA 4RCYA 1N3YA 4RK5A 4US1R 2Q7OE 4UNRA 1GTMA 3ENKA 5KZMB 4DIUA 3FD8A 2FWIA 3HLTA 3QXJA 3R5TA 4BCCA 2AW3A 4D44A 1JR2A 2AWOA 3DDZX 4L5AA 4DCGA 3S29A 4H1TA 3K9QO 4HAIA 1WSWA 1XKQA 4YC7A 3PKIA 2A59A 4CKBA 1RYMA 1EVIA 2ZQZA 3NDIA 3BWVA 1F8XA 2QG9A 3IQZA 4GKVA 3U3OA 3JQ8B 3AJEA 5GADl 2YJZA 4LBWA 3CKKA 3VH1A 4H7KA 2P1ZA 2ODBA 4J6FA 3PEEA 1K89A 1ENYA 2OCYC 3QVSA 3SDBA 3GCDA 4JR0A 2QY6A 4JLUA 2D59A 3I1JA 3H4VA 3H6KA 3AK4A 4JFAA 4C4PA 2FRDC 3AFNA 3PG5A 2LCFA 4Q1FA 4Y6RA 3WLTA 1IY8A 3QVXA 2UUCB 2RAUA 3UT6A 2AD5A 3O9MA 1T9BA 2IBTA 3WRYC 3D6UA 1KDTA 3KB8A 3T5TA 3K73O 1KORA 4Q12A 2ORIA 1SBZA 4TXLA 4TZTA 5CB8A 1MJGM 2O2EA 1H4VB 1ODIA 2X3YA 5I7UA 5I3ZA 1VLJA 4RA9A 5JJKA 1UOOA 4C4TA 5C46F 3L43A 1S9HA 2AH5A 1L5QA 2V7EA 2FPPA 1X13A 3O84A 3WG9A 2DP4E 2I6QA 2O7NA 3OZVA 1QUEA 3OOHA 1RYFA 2XJ9A 4W1PA 1YDMA 1BX3A 5IYZA 2JCGA 4U4AA 3WMEA 4F0JA 4ES6A 3AKDA 1TNDA 3TR5A 1P60A 4NBLA 3UJDA 3I4FA 2N42A 2L18A 1JDJA 3A6ZA 4NAUA 4XJSA 5F7JA 2I3ZA 2XWQA 5D7NA 2CW5A 1YDGA 2AXNA 2VPIA 4M0MA 5K1ZA 4RK6A 2Z4SA 2GXSA 2FMKA 3M49A 5HCNA 1FYFA 2GJ4A 2ST1A 2RHOA 1M33A 4GYWA 3KE8A 4BP3A 2A7QA 1W4RA 3BH6A 3N2ZB 5AKGA 2BDEA 4GUAA 4MIYA 4AZ0B 1GZUA 3KQYA 4NZPA 3RC7A 4KITB 3EPLA 1D2AA 3HB1A 3IRUA 1UDXA 2QTBA 5JW6A 4PPQA 1RR6A 3BXXA 4WAUA 5ADUS 1JN0A 1E2FA 1ZJ5A 1ISFA 1S89A 2MR6A 2IFTA 2PL1A 3H13A 3MS4A 5CDUA 4ABTA 1BDBA 2F17A 2QL9A 5LIRA 1J2EA 3EMDA 1OBFO 1M7BA 5DCWA 1U3CA 4E1AA 2C2HA 3DUFA 5EWLA 2AT1A 2PYIA 3Q6IA 1WUKS 3GJ3A 4PHFA 2VYQA 5A5FA 1C7FA 1EK0A 2RJOA 2IW1A 3DT8A 4LWZA 4BXOA 1VCIA 4EJ2A 1NBHA 2R6ZA 2IXDA 2QJFA 1Z17A 2BFDB 3ESBA 4PYLA 2QNIA 1CLUA 1Y82A 4X97A 1MX3A 1AKMA 5EP1A 4BMXA 1AQJA 4Z51A 3UQZA 4BFZA 5HQJA 1S8NA 2QDXA 5IKMA 4YP9A 3QA9A 3OCJA 2WWVD 2ZJ4A 4ATNA 4BGEA 1WXIA 1J00A 3LYAA 3PQ6A 1QTIA 4TUYA 4RKFA 1E3DA 3KQPA 3MYYA 3TW8B 2XA2A 3JV7A 2W2MA 1LC3A 4NMLA 4OXXA 1DNPA 1NXQA 4IEEA 4I5EA 1RFLA 2VKTA 4WLOA 1O6GA 2NU8A 3IAUA 3VXKA 1P9NA 2DZDA 3PWTA 1WP4A 4GT1A 3SXUA 3TPCA 4QIHA 3AKZA 5ED0A 4EY6A 2ZJ2A 3CX7A 3ETCA 4O4JA 5BSKA 1JJ7A 2PNFA 3C15C 1NOJA 1QORA 1SZCA 5EJGA 1KH2A 4D1YA 1HH4A 5IK2D 1AIPA 3G9ZA 3ZLUA 1L5ZA 1GJRA 1ATIA 1NXVA 4O6VA 5GONA 3QUTA 5AW4A 1HYBA 3K5IA 1UAAA 1RAFA 1OJ7A 4KDCA 5CVEA 1RBYA 1YL7A 4ZCIA 1UKAA 4JZYA 4YLGA 4LCJA 3RO7A 3BMCB 3QH4A 2FWRA 4W1QA 2FXIA 1XZQA 1NYRA 2CE2X 2F8LA 3A4YA 3IV9A 3DV0A 4NEHB 2AOUB 3EDOA 3A0RB 3KDPA 5K3AA 3TSOA 4B3CA 3MJFA 2XUKA 1PJSA 3T4UA 3DLPX 3OPYA 5J59A 3AO0B 1VFNA 1WZCA 2GO1A 2VRNA 1N5OX 3EFOB 5TPZA 5K6TA 2ZWMA 4JLVA 3ILHA 4H6PA 4IXMA 4JP3A 1ODJA 2A0YA 5KOJA 1WMFA 1LPSA 3B5IA 2OHVA 4WZBA 5FL3A 2TMYA 4PHGA 5ULLA 3GG9A 2IKQA 3LFUA 3VZPA 1E3WA 1T4BA 2H1VA 4O2BF 2YYYA 2LDXA 1U0SY 1VBFA 1L7RA 3NBZC 4Q1DA 2BONA 3ZZTA 4DIEA 4EEXA 1IZZA 1K5DA 2C4MA 2D1QA 2QQFA 1SXJE 2VDNB 1V3QE 3ZV7A 5TS3A 4KE6A 1YC5A 1L3CA 2Q1UA 4IX9A 4FFSA 1NNUA 4HWTA 4L8VA 3PVSA 2IU4A 4QLOA 1G7CA 3KTDA 1KS9A 2QNBA 1YD7A 3HSYA 4JQOA 3O8CA 3K0SA 2VHCA 3IE0A 4Q05A 1YOVA 3GOQA 4UNNA 1MORA 1M2OB 4XPZA 2VPQA 4CG0A 1RE0A 1HT3A 1OHHA 1WHSB 4KN6A 3AL0C 3ZW9A 1AXGA 5F2OA 4D4JA 4Y1GA 3HDHA 1JFFB 2CD9A 1YH3A 3ZI0A 4MRSA 2AE2A 3VGPA 4C5CA 3KLBA 3ONDA 2FY8A 5AM2A 1W8IA 1EFPA 1VJ1A 2ATEA 1UBEA 3AIMA 4JL5A 4K9LA 5LM3A 4X71A 1QF6A 3TLCA 4WACA 3I32A 1C1YA 2GPNA 2B5OA 5J4LA 5KX5B 3X1MA 2HHLA 2UZ1A 2W6NA 4BO8A 3MTEA 3IBGA 5KYUB 4S35A 4JQCA 1QWOA 1TMYA 3KAQA 5CBPA 4BLPA 3VSAA 1RC1A 2ZJAA 3M6UA 3ZDBA 2ZE7A 3TL3A 3PPYA 5ERGB 5EWJB 2Q07A 4ARSA 1QHIA 3KEQA 5HBGA 2FP4A 4MW9A 1Y3DE 1YR2A 3VDMA 2IRWA 1G8GA 4PFJA 5J5AA 3I6ZA 5F73A 1WP9A 3TK1A 1BXRB 4E5KA 1MEEA 1XP8A 1HNWB 5JAMA 2QAGB 2ETXA 4B33A 1U7TA 1Z8HA 2FJUA 5DI9A 5TMDA 2QRHA 2ZPUA 3LPAA 1E9CA 2G67A 1KAOA 4O2AA 4QPZA 1S3FA 4XB6B 3W7VA 3WNDA 2UKDA 4EO7A 5IVHA 4GDMA 4IJKA 5IXJA 1XMSA 3AEKB 1AH2A 3V00A 1MAAA 4D98A 4E4TA 2R79A 2PZMA 4NECA 1JDNA 1JYSA 1HZZC 1PYOA 3DL2A 5G0UA 3ZHRA 4F11A 2HNKA 1ZVVA 4BU1A 3P9RA 2H29A 3H2ZA 5B1SA 2VO1A 5MF6A 5B3JC 4ZPJA 2F00A 4YJKA 1KSFX 4PZLA 4ZAYA 4BB0A 4BQRA 4HLNA 3EXHC 1C80A 4EYSA 1N5LA 1KDPA 1V9SA 5BYJA 1NJ5A 1JEEA 3AXTA 2GHQA 1R5JA 3ZDYB 4XWYA 2GFHA 3GFTA 1ISSA 1I7LA 4F4DA 1VP3A 4N4AA 5D86A 1NXPA 1YR6A 3RGWS 2IYWA 1LZKA 3TQIA 1YIAA 2VYVD 3JQGB 3E9MA 1LF5A 3LNTA 2BCGY 4CLOA 2EYQA 2FN8A 5JD6A 1AUQA 2M9MA 2PRKA 3QIVA 2NUPB 5LP6B 4X66B 3VPHA 1K9VF 5DI3A 4GSYA 1EI9A 4M8NE 3TXXA 3PLRA 4L9RA 4YP1A 5IYZF 4HNGA 3M6AA 4JYPA 1JR4A 3CNOA 3ZV3A 4BN4A 4P4UA 2DGDA 2FUNB 5ALOA 3NG1A 4DANA 3QOWA 1P1HA 5FIUA 4U63A 4HFMA 4Q4JA 1DAOA 1TQ4A 1XEXB 1RZVA 2BT4A 3JASB 3P7MA 5JU6A 1YVPA 3HLKA 4ZQFA 3VJRA 5ICMA 5BVGB 1LNZA 4HTFB 1G6Q1 4CM1A 4UUPA 5CFPA 1DKMA 3R0ZA 1J09A 1I24A 1O6CA 2NYUA 3KHTA 5L45A 3VC2A 2VQEB 2EBHX 4EL0A 4AYTA 5JZVA 3LXRA 3T5CA 4LECA 3K2BA 3USCS 3CLKA 3KR2A 3OOYA 3EQZA 5FF9A 4L4UA 3DHYA 2CNOA 2Y1OA 3JPYA 3MMPA 1IJBA 3BAZA 4ZYLA 4ND8B 5KYWB 1WMEA 2ZIZA 1L7EA 3GBVA 3W5AA 2ROQA 2WV7A 1X14A 2NW6A 4K6FA 2H08A 2I91A 3I62A 2Z2YA 2CJYA 2FP3A 4PVCA 5T6MA 1F5NA 1D4FA 3R9IA 3WYBA 1ZUNB 1D07A 1R27A 3FSGA 3WNCA 4Z7NB 1LSSA 2RGGA 3FYHA 4K6HA 1H2HA 2WIAA 4PR0A 1FQWA 3O4FA 3RSQA 3VU8A 3ZD7A 2V1UA 2JFVA 2O0MA 3DNPA 1CWUA 3GFRA 4IVNA 3TO5A 3UMGA 1UQUA 1CQWA 2R6R1 1E64A 4N49A 5GOZA 4HZUA 4GKJB 1EFUA 2BKAA 1MC5A 1T5OA 3C4QA 3H42B 5JADA 2IYRA 1CUEA 2EW2A 4RPGA 5CDSA 1PJLA 1VL1A 3E5NA 2IGBA 4JT8A 2G0TA 1KZYC 4WXYB 1OROA 4ZCSA 5CLGA 3C3MA 2I3AA 3PFBA 3DYBA 3L1UA 1T0PA 1V5FA 1Z5VA 2XTJA 5DP2A 5JNTA 4FOPA 3MLEA 1Q0TA 1XDZA 1RLMA 1CUFA 1W1IA 2E5WA 3DE1X 1IL0A 1NN0A 3I52A 2P7IA 1I2DA 4UARA 3BCHA 5HMMA 4BO2A 3H2BA 3MW8A 5K6AA 1KQNA 5E6UB 5K6RA 4JUDX 3TZBA 3N70A 2FGKA 1BD3A 2NU9A 3PFKA 2CBXA 3BYZA 5JI3E 2XEXA 4KYIB 1E96A 1P77A 1OBCA 2AMJA 1SU4A 1GUZA 2GEVA 1Q0PA 3GJYA 3HA5A 2ZE5A 3JYHA 3O92A 4ITUA 4MVJM 4NZZA 5KTRA 4C87A 4NYMQ 3RK0A 3QFRA 2V6MA 1AJEA 3N74A 3PGXA 2NTYC 5AXCA 2P27A 3UYKA 1RHUA 4BEVA 4IJMA 1DJPA 2O05A 3DR3A 4J4TA 2P9GA 5JNUA 3DAGA 3HR7A 2KW5A 2Q6IA 2Q41A 4LYYA 1U28A 1ZD2P 2CFCA 1W47A 4QDZA 4C78A 4YB8A 1JL3A 1DKNA 2AQKA 4KXXA 4P3NA 4CV1A 1XMJA 5AOCA 2I4MA 3C87A 4EVIA 2MMCA 3N86A 4OO3A 3TNDA 3G2HA 3AR4A 2R6AA 3N8HA 3A9WA 4TV8B 3L4BA 3RRMA 2C54A 5JS6A 2YQ5A 4B9AA 2O3UA 4I08A 1C3JA 4HEHA 3FGPA 3MERA 1FA9A 4PLYA 4YMIA 4D3XA 5LFAA 4JOBA 3H75A 4A6PA 3QVKA 5KVAA 3CVWA 3DL7A 1LJUA 3C7CB 3H11A 2JFGA 2D5CA 3QXCA 4N9QA 3NO4A 4O4HB 4GBGA 3HQ4O 4XM2A 4V0RA 2I3DA 1B7GO 4KQKA 5BN4A 4BTVA 5KTTA 1FMFA 1FTGA 2C61A 4PM4A 4QJBA 3MB8A 5DWDA 4BFSA 4CN9A 3X1JA 4E4YA 1VIMA 2REOA 1QQTA 2EGGA 3BWYA 4U2EA 1JB9A 1BWQA 2W2LA 2O2XA 4W5HA 1Z7YA 2YXLA 1EVQA 1Y4ZA 3E3OA 4Z86A 5TR9A 1IOZA 2ADFA 3A3PA 2FV8A 4QECA 3RYHB 1YL6A 1OWNA 1XRLA 3T3PB 3BD9A 2ILVA 1W44A 3VPSA 2CMGA 5I9IA 1ZI9A 2WJYA 1TCUA 3ANLA 4LISA 4HAUA 2YNMA 5AKIA 1YRLA 2B5VA 2AMLA 3EIXA 3FYUB 2PZAA 4L27A 1KL7A 1MR3F 10MHA 2JIPA 4YUZA 4M1KA 1CSEE 3BMOB 1NR7A 3OQBA 3C3WA 3VX4A 5T6BA 1R88A 2I7TA 2R6DA 2B2NA 2W22A 4JDUA 2FVXA 2AI1A 1IAQA 4EMSA 3ZU4A 1LPAB 1SCBA 1T1GA 3LSYA 3HBLA 3NBYC 3OJLA 4QODA 2FEMA 4EEZA 3EPPA 4OJMX 4CQLA 1RQRA 3M6LA 2ZUBA 1CDEA 4JI1B 2HJ9A 2EW8A 3NBFA 1SUEA 2YCBA 2HA6A 1B0PA 3BHIA 3PPVA 2QD4A 4DGQA 5EIBD 5JE8A 3TTSA 3WO1A 2DFTA 4WFKA 1RBMA 3E7DA 5EJ8A 5JSZA 1AQYA 1KNQA 2HU8A 3BDIA 3OFVA 4PY2A 4RD2A 1E9VA 4UNSA 2CVQA 3P4UA 5IFKA 1DQSA 4BUJA 2PZKA 4NH0A 3HNRA 1G16A 3KUXA 4I1UA<