3I92A

Structure of the cytosolic domain of e. coli feob, gppch2p-bound form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
257
Chain Sequence
MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Structural basis for the intrinsic GTPase and GDI activities of FeoB, a prokaryotic transmembrane GTP/GDP-binding protein
rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 80
structure length 257
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i92A01
1YQTA 1OXSC 2ZJYA 4M8NE 1CJUC 1J70A 2ZYVX 3ZS9A 4C3ZA 5FBRB 1Z3IX 4OK3A 3CF2A 4JVSB 1N6LA 3THYA 4KHZA 4Q1AA 4MKIA 3L2OB 4Q18A 1XTSA 5AUQA 1FFHA 3PEVA 1CKEA 3WBKA 1D8TA 4ZKDA 3KQHA 4ABYA 2A5GA 2JIZA 2QMOA 4QG7A 4V0ME 2CK3A 3BJIC 1CULC 4IEEA 1GKYA 2A9KA 1NIJA 3SS8A 3WMEA 4DDUA 4OHWA 2QU8A 3NC1C 1P72A 1I4DD 2J45A 3HWSA 1P73A 4BEBA 4GBMA 3BOSA 4DB2A 1G3MA 2HLDA 4X8HA 1JB1A 1OH5A 1GRQA 3ND8A 1LFDB 1NN5A 3FKSA 2BMJA 3CX6A 4NONA 3ZQJA 4JL8A 3A1SA 3ZVRA 4CEHB 3FHTA 4M1TA 2JJ1D 1UBFA 3B85A 4Q4AA 4Q21A 1E2KA 2SHKA 1CS4C 2ZYWX 4QKQA 2KE5A 1W1WA 2QE7D 3GLFA 1ZU4A 2P5TB 2X2EA 4JYCA 3ADKA 1Z83A 1PZNA 2IYVA 4QJ4A 5DN6A 3W34A 2QAGC 2B8TA 3NBXX 2IBMA 4DIDA 1R5NA 3QPUA 2B7BA 4D0LB 2EYQA 2DWQA 4WW0A 1QVRA 1XCGB 3DO6A 4RD2A 4PSAA 3DDCA 421PA 3OFND 3OAAA 5HPYB 4IVQA 3V4FA 1TUIA 3L8ZA 2ZREA 1HUQA 1ZM2A 3I4LA 4Q02A 4EPRA 3B60A 4YMTA 1OF1A 1UKZA 5A4JA 4ZKEA 4JLAA 5AUOB 2X8AA 4KV9A 1AQUA 2IA5A 3O47A 4CW7A 4DKXA 2ZRIA 4G3XA 3T12A 1E2HA 2R8RA 3THYB 1JR6A 3A1WA 3ZZUA 3H4MA 4JLVA 4IOKA 5H8WA 2O0KA 1G3UA 1Q1ZA 3C8UA 4GI7A 2R6DA 5F9FA 2REBA 3L0PA 5E95A 3GJ3A 4TMKA 3OESA 2OCAA 4IVPA 3DMDA 4Q9HA 1S3SA 4QFMA 1VHTA 1FQJA 1J99A 4FCWA 4DLVA 2XAUA 3SQWA 3K8YA 2F1HA 3U61B 2XNDA 3AUXA 3VU9A 4D26A 2X1VA 4DHEA 5L3RA 4DUGA 3PIRA 4NYMR 2OBMA 2ZR0A 2FSGA 4TQ9A 4WZ6A 1WMSA 3KQLA 4Q4AB 5CIWA 1UKEA 4TSFA 3IKJA 4Q4JA 3V4RA 3EPLA 5JEEA 5BN5A 4XWKA 1QZXA 4LUCA 1M8PA 3TVTA 3KQKA 4D4JA 2WZQA 3Q7QA 1EX7A 4ACAA 3V00A 1LF5A 1Q44A 1S0UA 1U98A 2C9YA 5DO9A 1WBBA 2KBEA 1T8TA 2ZPTX 4U02A 4YMWA 2G77B 3BH0A 4C0LA 4OHYA 4IHQA 3LX5A 2JLQA 2ZVPX 4MKFA 1NLFA 2QG6A 1XEXA 2BBOA 3EPKA 1IN8A 1CLUA 2ZUCA 2XOKD 1VYVA 4CZ2A 3ADDA 2I1VB 4LZZA 2QPOA 1V5WA 1G8YA 1OFHA 2GJSA 4Q00A 4FIDA 5GVSA 2ODWA 2ZSBA 3A1UA 3GLFE 1IHUA 5KPJA 1KI9A 1WXQA 2UKDA 2ZE6A 1W36C 2C8VA 1BYIA 2ANCA 4FWTA 1AGRA 2EQBA 3A36A 4LI0A 2QZ4A 2FGJA 2L0XA 2Z0MA 2RGEA 1ETUA 2JLVA 3LY5A 4BZQA 1XCPA 3AVWA 5FTJA 2G6BA 3F3YA 2D3WA 2E9SA 2RAPA 4V02A 2V9PA 4A4DA 3LDAA 4F4CA 4MDEA 1R8QA 5LDDC 2VSOA 1EK0A 2ZJZA 3W3AA 2ZE7A 2J9RA 2JJ2D 1EX6A 2WKRA 3I92A 3L8YA 5JCZA 3AF1A 3QENA 2FOLA 3FB4A 2VHUA 1G9XA 2XEXA 3C16C 4NMMA 3QKUA 3H86A 2OLJA 2W2VA 1G8FA 1YRBA 1W0KA 2ZSAA 4C0JA 2IS2A 1XFAA 1UKYA 5CM9C 1S4QA 3WMFA 4U00A 3GLIA 5JRZA 5FOSA 4Q4JB 1F60A 3CR8A 4FCTA 4JBWA 2WJGA 2P2LA 1QG4A 3SZRA 2GCOA 1TF5A 221PA 1VG8A 2VHCA 3IILA 4QGHA 1M7BA 1DS6A 1WF3A 1VG0B 2Q6TA 3JZAA 2BIFA 1LV7A 3AF2A 1H65A 4G5RA 1HT1E 4JLDA 3W90A 2Q3MA 3FGNA 4BFUA 5KDDA 4KVGA 2G1JA 3ADCA 2WJYA 2VP0A 2ORWA 3AKCA 1E2JA 1XEXB 2N42A 2WIAA 4MYCA 1F2UA 2AXPA 1OW3B 5FPYA 4EFLA 1MRNA 1GILA 2J7KA 5DI9A 1G6OA 2CHVA 1KSHA 2O52A 1N5LA 1E32A 4G5QA 3N2EA 5FBVB 1RJ9A 2W6ID 3BORA 2W2TA 4L5BA 1GWNA 3I72A 1KI3A 2JATA 2OCPA 2P6UA 4A0HA 2CVFA 2V6IA 1N6NA 1NP6A 1E2MA 3P4YA 4X8MA 4CYMA 3PEUA 4RJLA 4LOAA 4P33A 2J0SA 1QHGA 1W5SA 4KXFB 2I3BA 3CM0A 2CJWA 4WZAE 3I61A 1U0LA 1VYTA 1GNQA 3HPRA 4RD1A 2I1QA 2J7PA 2XTZA 4HAVA 4JKIA 1DAEA 4XH9B 4QHYA 3UXMA 3GJ4A 3M0EA 1YJ5A 5LPNA 1TAGA 1E2IA 3EA0A 3OHMA 5FL3A 2P65A 4URZR 4A8JC 3WYAA 4HATA 1AQYA 2RCNA 1CJVC 4V0KA 5CLQA 5GJBA 1NRJB 2GBLC 3E70C 3FMOB 4O0MA 4HB2A 1KSJA 1L7VC 1YRAA 3BH6A 3GLIB 1OH8A 1C1YA 2YINC 2BC9A 4KLZA 4OL0A 4RCZA 2XGJA 4HZUA 3GJ6A 4FMDB 3UG7A 2XXAA 1NN3A 2AK2A 4GSYA 3KFXA 2GCNA 2BVNA 2OUKA 1QBKC 2QT0A 4LC0A 1OIVA 4MRNA 1G8HA 1KI4A 1Z0AA 4Q1EA 3CZQA 3O8RA 3A6PC 1G8PA 1IXRC 3NDPA 2RGGA 3VHXA 2WICA 4B3DA 1EFCA 4J0QA 4MUBA 1UAAA 3G82C 2HCJB 1NVUQ 3WYGA 1Z0KA 1CF4A 4BZPA 4BUJA 2QSZA 4IOJA 1NSTA 1FPMA 4TYYA 1A1VA 1F2UB 1GP2A 2DR3A 3TRFA 3CRW1 5AJYA 2JLWA 4Z1MD 2NZ8A 4GNKA 2BOVA 4ZDWA 3F5FA 4H1VA 2FEMA 4TMTA 1WA5A 3WY9A 1OSNA 1SXJD 2IUSA 2IYZA 4NHOA 1XTIA 3VR5A 1E2EA 3W3ZB 1OXXK 3AP3A 5FBWB 3P26A 4UNPA 4EPWA 3PCRB 1P2VA 3TUIC 3NHAA 4PHFA 1JJVA 1FNMA 3EA5A 4PSVA 1J7KA 5JJKA 2FF7A 3PUYA 2A5FA 2CJWB 4JIMA 1G1MA 3BIFA 2QTHA 1O3YA 3VKHA 2CLDX 3RS0A 4OQLA 2REOA 1G5RA 2RGDA 3IDQA 2IYSA 1VYUA 2YC2C 5CK5A 2VBCA 2VP6A 3RNLA 4F92B 3TVDA 2J0VA 4QGAA 2DFTA 4M4SA 3GFOA 4E09A 3GEHA 5H1YA 1G41A 2IK8A 2NGRA 1J90A 2ZVQX 4LJ5A 1G3IA 3E5HA 4MRVA 4M53A 5FL7A 5KTYA 3K70D 4C0HA 2G1KA 4MRPA 1TTTA 4MKHA 4LX0A 2JDIA 1R8SA 2NZJA 2CHQA 4HZUB 1Q57A 1PUJA 2QN6A 2XXAB 3ZD6A 1R6BX 2UZ3A 1NBMA 3U3MA 3ICQB 3QQ5A 2EFHB 4CF7A 3F8TA 3RABA 3U7HB 2ONKA 4UXHA 1LF0A 2QM7A 2LCFA 1QHHA 1H8EA 3GJ5A 1GIAA 2VF8A 3NBYC 1LW7A 4C0BA 2BMFA 4YLGA 4QGFA 5SZHB 1Z47A 2ZSEA 4MRSA 4B35A 4OJQA 1X6VA 1ZMXA 2Q0HA 5FFMA 1CEEA 2CVHA 3IEUA 4TYQA 5EP3A 5LBIA 3WNDA 2EFDB 1U94A 4IXNA 3GLGB 1JPNA 3FVQA 3KXLA 5E7JA 2GWHA 4LYHA 2VSXA 2QT1A 1NVXQ 4LK2A 5BYKA 3U44B 1PUIA 2ZM5A 3O8DA 1XDBA 2ZJOA 4KBGA 2PZEA 3WP1B 3NBFA 3B82A 4KSBA 4Q1CA 2ZRKA 3CX7A 5AJXA 1GRNA 1S1MA 2F1JA 1AM4D 5C1BA 4Q7JB 3B9QA 1SVMA 2I4IA 4TTPA 1KK1A 3I73A 3OF5A 1FZQA 3VMFA 1S96A 1TUEA 1A2KC 3BH7A 2PX3A 2WAXA 4QHSA 1XPUA 1G17A 3KZ1E 1O87A 1BS1A 1DAKA 4EPVA 5K8UA 2H16A 2WWIA 1ZU5A 1E79D 4DSOA 3MWJA 1Z08A 1HH4A 1AKYA 4G5SA 4OHXA 3KJHA 1XRJA 2FPMA 3BC1A 1US8A 1YZKA 1H8HA 4X8OA 1P2SA 2YOFA 2XTNA 5AR1A 4B74A 5B30A 3LH5A 3P20A 4B33A 4BEJA 2A30A 5G41A 2AX4A 3SHWA 4AIIA 1SKYB 4DCNA 4GP7A 2ZRCA 3CRQA 1QHHB 2QGZA 3IIMA 3VFDA 2P6RA 3QJYA 1UM8A 3K0CA 3T5DA 3G5UA 3VHLB 4B73A 1ZD8A 3CR7A 3CH5A 1IXSB 5HKKA 4IOMA 5CYPA 1NL3A 1UEJA 3SYKA 4V0LA 1SVKA 1NMXA 2CCGA 3DPUA 3ONWA 3OEHA 1XEFA 4R2HA 2WM9B 1II9A 1YR6A 3D8BA 4KU4A 4CRWB 2CCKA 4RD3A 4CDGA 1U0JA 2GVZC 1E2LA 2WWHA 3SE0A 1W0JD 1EESA 2QBYA 4A82A 5JWOA 1U90A 2R65A 3C4JA 2JJ1A 2QAJA 4Q19A 1E0KA 1HTWA 2WV9A 3ASYA 4WOPA 1UPTA 1G16A 2J46A 4FD2A 4GPTA 4PZZA 4BLOA 3WRXC 2QE7A 5FTNA 2ZJBA 1N6PA 5L3QA 4FMCF 2IYQA 3TSWA 3VR3A 4AD8A 4S2EA 4BFWA 2IT1A 1ZCBA 1S9HA 1UDWA 3GLHA 3U3JA 3GJ0A 1P2TA 1ZD9A 4MUAA 2GZDA 5KOYA 1A5TA 1KKMA 2IHYA 3RS5A 1NSFA 4JBYA 1BMFD 8OHMA 3TAHA 2O8FA 4LV8B 2WHXA 4TYWA 3AH8A 5EE9A 2XSZA 3RDPA 2P5SA 3K9HA 3RRMA 2Z83A 1PV4A 2A5DA 2OSBA 1W48A 4I1SA 2R6FA 3MJRA 1F48A 1RRCA 4MGIR 3KJEA 3R9XA 2PX0A 4M1SA 2ZE5A 3X2SA 5C4MA 1OB2A 4PPGA 2IYUA 1US8B 3MGCA 4NCKA 3SN6A 3W6OA 5FTMA 2ZJAA 5FPKA 1QRAA 1NJFA 3QE0A 2Q9AA 3U2QA 5B57C 1P4SA 3HP1A 2ERYA 5LB2A 2VYFA 3IQXA 2C95A 3OE7A 4PFSA 1KZ7B 1SHKA 1NVVR 1E1QA 2H7VA 4B6FA 1ZJ6A 3NEYA 5JFGA 5DIFA 2W0MA 4EFNA 2C9CA 4NBSA 4QRHA 1L4UA 4QGGA 4PPFA 1G6HA 2GESA 5CB8A 1W36D 4EKDA 3DM9B 4LV6A 1MO4A 2GF0A 4S35A 2FPKA 4A1FA 3Q9LA 2HCBA 3TGPA 1FMLA 2QBYB 4PZYA 4URYR 1DG1G 3A4LA 4I99A 2C04A 1G64A 2VEDA 2GEVA 1SVLA 4LYJA 2G83A 2H18A 1YZQA 2OXRA 2FMXA 4NCNA 2O8BA 1M74A 1OYYA 3ADBA 1D9ZA 5L3QB 4LHXA 4GMXA 4HYYA 3QNUA 1VDZA 4W5HA 2DYKA 2ZI3A 4Z51A 5G53C 1XMVA 1ZUHA 2HF8A 2DB3A 1ZUNB 2EFCB 3CH4B 2PLFA 3GLHB 1OLOA 3SJZA 2ZQ5A 1XMSA 1KO7A 3J81k 1GL9B 3QVUA 3RS2A 1MH1A 1W4BA 4ZDIA 2CBZA 1PLJA 3R7WB 3QKRA 2O8FB 1JR3D 2XX3A 1Q1QA 2Z5FA 2WJIA 3CW2A 3IO3A 1F2TB 2FSIA 3B9PA 4DLRA 1FW6A 3LD9A 1MKYA 1JQLB 1A82A 4TL7A 1XD9A 4JSTA 2ZITA 1QG2A 1Z6XA 2J3EA 3K0EA 3EX7C 2ERXA 5D3QA 5A5GA 2ZS9A 1EXMA 3EIHA 4OK6A 1S3GA 5IDVA 4OI4A 1WDTA 2JEOA 4MITA 4TL8A 3VQTA 2IS1A 3A1VA 2GXQA 4ZIRA 4MQBA 3WMGA 1A7JA 1RE0A 3QXXA 2V4ZA 4TQUS 2OLKA 3BFXA 2GJ8A 3Q72A 4EDHA 3UPUA 1G7SA 4WXPA 3VR1A 2VLIA 4M22A 2QSYA 3C5CA 2F9LA 2JLRA 1R10A 2BDTA 1Q22A 4JYBA 4URWR 1CR1A 1EFTA 4PAOA 3FHOA 1VCMA 2OILA 3THXA 1JNYA 1M7GA 2Z43A 2BKUA 3QEOA 4PZLA 2IYLD 2D74A 2W6JD 3KJIA 4ARZA 1JPJA 3LQRA 1KNXA 4QBIA 4CIDA 1T0HB 1FMJA 4QJ3A 4A36A 2WMNB 4ILEA 4IOLA 5FI0B 2O8BB 3LWNA 1N0VC 1G7TA 4QXAA 1IBRA 1E9SA 3U4QA 4JJZA 1J8YF 4E07A 1N6HA 2CNWA 3A4NA 4OQNA 4AYTA 4KYIB 1AS2A 4CVNA 5FUVA 4Y0VA 4YONB 1N5IA 4BWYA 1CR2A 4OQMA 1COWD 3MSXA 3O8BA 3KQUA 3LLMA 5HZKA 2O8CA 2J0UA 621PA 4G0NA 3TUZC 2NPIA 4Q9IA 4KSCA 2HYDA 4XD7A 3I8XA 1G4UR 5KPDA 3RWMB 5FOVA 2H92A 1R0ZA 2VH5R 3E2IA 3NKVA 1Q0UA 2QP4A 4DEYA 1IJEA 1YZTA 2XZOA 1IONA 4FINA 4BRUA 3A1TA 2PEYA 5CJPA 1X1SA 4RZUA 4NCIA 1J8MF 3T1QA 1DAFA 3AF4A 3AVTA 2W6IA 4K81B 1XZQA 1D2NA 5JS8A 2O8EA 1KY3A 1GNPA 4FCVA 4B71A 3RC3A 4ZO4A 4YMVA 5ELXA 2CL6X 3DOEA 3PG5A 5F2EA 4RVCA 1M1YE 3NIBA 5TVKA 4ACBA 2IF0A 4IXMA 4NDZA 4ZIRB 1T5IA 3QXCA 4HDQB 5IT5A 4D2IA 1GDDA 4JLBA 3VKWA 3D7MA 3EXAA 4TMXA 4B3XA 1OIXA 2ZYUX 4O2LA 3KKQA 2FFQA 2GJAA 2ZU0C 3HR8A 3KJGA 1KMHA 4Q7LA 4TT3D 2ZRPA 2XZLA 2IYRA 3KXKA 2G3YA 2WWXA 4KAXA 1QHSA 1T3HA 2RH5A 4DLWA 3THXB 4E5UA 1II8B 1XMJA 2ZRFA 721PA 1Z28A 1FX0A 4IKEA 3AV0B 4RD6A 1DOAA 2C78A 4Q47A 1R0YA 2QMHA 2XITA 4K46A 4NZYA 1XTRA 4AC9A 2ZR9A 3WYFA 1P5ZB 1B0UA 4RZ2A 1VIYA 2Z4RA 3WP0A 3U4QB 1OE0A 1GFIA 1NG9A 4M9XA 5GVRA 1E4VA 1TNDA 1YZUA 4OK5A 2E87A 3CLVA 3SOPA 3CBQA 5E3HA 3U5ZB 4ZDJA 1Z07A 2ZRBA 4Q1FA 2C9OA 521PA 1U8ZA 2BBWA 5KU1A 3GP8A 4CEJA 2O8CB 4A2WA 4IDHA 5FUXA 2D2EA 3T34A 2J0UB 2J41A 1Q21A 1W7AA 3RHFA 1Q12A 2FWRA 3B1XA 3LRPA 1VMAA 5EJEA 2WOOA 2K5UA 5BQ5A 4Q7KA 4RZXA 4MYTA 2CE7A 3NHBA 3R9IA 3HU3A 3U3KA 4DJTA 1HT2E 5FOXA 5CLLA 5G3ZA 4W9MC 1E2FA 1E69A 3T06B 4ZCMA 1HE1C 3L0IB 2Q21A 2IF2A 4CT5A 4MGYR 1MABA 2O8EB 1OHHD 2A2ZA 1GZSA 2WPDD 2HJVA 2PT5A 2BJWA 1EFRD 1P7CA 2IYYA 3EZ6A 4HLCA 4G01B 2XB4A 1GITA 2R6GA 2D2FA 2Q9BA 3QBTA 3ZQ6A 2YWFA 5SZJA 3GLFB 3X1YA 2XJ4A 1RRPA 3FHCB 3EWSA 1DAHA 5HE8A 4L4UA 4QNRA 1CP2A 3SR0A 4ASUA 5CITA 4KFTA 5EP1A 1Z6AA 1KMHB 3EAQA 2WKQA 2ANBA 2VPPA 1GTVA 4DLSA 2GKSA 4PAMA 1XP8A 4LHVA 2ZYTX 1WRBA 2CMKA 1S1CA 2GTPA 4UXIA 4LHYA 3NH6A 3AF0A 3PVSA 1AGPA 2MMCA 2Z4SA 4WA7A 2W2XA 5FOWA 4HAXA 4LBWA 5DNYB 1FX0B 4KO8A 2OHFA 2D7DA 5KDOA 3SEAA 1FQKA 4IDPA 2C96A 2ZRMA 4PAQA 1WQ1R 5CYOA 5J4LA 2C99A 1Q1BA 3SU8A 2KB0A 4DSTA 3I62A 3B6EA 4BLQA 4Q4HA 2BBTA 1L2TA 3NDBB 1E4YA 4Y0AA 5IK2D 5G3YA 2B6HA 1LY1A 1TPZA 2IL1A 2R6CA 1ZINA 3GEIA 2RGNA 5H70A 3FMIA 2F3RA 2ZANA 4NU0A 3PXGA 2QMEA 4X8LA 3ZIAD 5EXXA 1UJ2A 2OM2A 5HCIA 1XEWY 2D4HA 4JLNA 4LPKA 5EE3A 1CXZA 1DO0A 3OEEA 2PMDA 1ZNWA 1SVWA 4LJ6A 2FDCA 4Q9LA 2AKAB 2GEDA 1Z0DA 2CHGA 1SULA 3K0FA 3TJZA 1D2MA 1CJTC 2QPAA 3ICEA 3OIWA 1MABB 3VU9B 2EVWX 4TZ6A 3EC1A 5DH9A 1MO6A 3QKTA 3T1VA 4XWOA 1ZNZA 4MYUA 4Q1BA 3PUVA 1WP9A 2AFHE 3DKPA 4YXWD 4BPBA 2O0HA 4D6PA 3P32A 1FUUA 3FFAA 4HSEA 4NTZA 1GOTA 5JZVA 1JXMA 5IHPA 1OJLA 3S1AA 2O0JA 2D7CA 1VPLA 2GVDC 3A37A 2ATXA 1GRRA 1NMYA 5EE5B 1T0JB 2BEJA 4DCVA 4KBFA 1TL7C 3LQQA 4CEIA 2IW3A 1ZRHA 4HZIA 3DHWC 4HB3A 3H84A 4B6EA 4PSKA 3K70B 2ZR7A 2XTMA 1R7RA 1NN1A 4A15A 2JGNA 1TQDA 2WJJA 3ZVLA 1E1RD 4DEXA 1C9KA 3GFTA 3SHFA 4MYHA 3BBPA 4P31A 4JVNA 4I1VA 4Q4HB 4P3YA 1Z6GA 3VNUA 1YZNA 4LYFA 3K0SA 1RZ3A 2QEQA 2B7CA 2DFKB 2WSMA 3M4YA 3MLEA 1I4TD 4N1AA 3U7EB 3CKLA 2CK3D 1VCIA 1VHLA 3CPHA 4NYIR 2ZI7A 3ZGXA 4EPTA 1G20E 3PENA 2VHJA 2F6RA 3LVRE 2ONJA 3I5YA 1Z5ZA 4NH0A 1PLLA 5TB5A 4LWZA 2B92A 2XB2A 1XPRA 4XWAA 3SBEA 1U9IA 3JVVA 3EZ2A 4HAZA 4KVAA 2HLDD 3QF4A 2ZXUA 4ZCIA 2J87A 3BFKA 2OAQ1 2J59A 3K0FB 3NXSA 4MRRA 3FKSD 3HR7A 3HDTA 3AVQA 4AG5A 3SDZA 1GL7A 4Z8XA 2YOGA 3AF3A 1CR0A 4DC9A 4F93B 1KHTA 1YZLA 2IWHA 3G0HA 4EPXA 2FFHA 2VF7A 4HAUA 5HR5A 4DBLC 2GCOB 1TQ2A 3B1VA 4HEJA 1ZM4A 1E9EA 2YVUA 3S1AB 5FTKA 4HUQA 4AG6A 2G9NA 2LKDA 3L0OA 1KI6A 1KZGB 2QMUA 1E2GA 5J4KA 1PVOA 2HXSA 1NG1A 2ORIA 2ZRGA 1BYUA 1YR8A 2DPXA 3OAAD 4GOJA 4CEIB 1DAGA 1P75A 1IN4A 4TLBA 4GRAA 4QBHA 4KFRA 2ASEA 4NYIQ 5EZ5A 4HUTA 2DWPA 3IHLA 3K0CC 2EW1A 3K9GA 2V54A 3VTKA 1NKSA 2DWOA 4MH0R 2CCJA 1FNNA 1LTQA 1G291 1LB1B 1RJ9B 3QPVA 1CRQA 1UBGA 1NLYA 1CIPA 2GA8A 3EZ9A 4OJKA 3TH5A 1J2JA 1JEDA 1Q20A 3FYHA 1D2EA 5DYIA 4BRWA 4YQFA 3R8FA 2AL7A 3EASA 3TLXA 1DG3A 1Q1EA 2W00A 4A92A 3R9WA 1HYQA 3SC3A 1JBKA 3PUXA 3TSOA 4HAWA 2BMDA 4BLSA 1E98A 3D3QA 1DE0A 1Q3HA 1MOZA 1ZW6A 4Q4LA 1GM5A 1DARA 3V9PA 1E0AA 2W58A 2J1LA 4AURA 2XNDD 3RS7A 1SVIA 4OHVA 3SFZA 4DUGD 4US2R 3ETLA 4KITB 1AIPA 3KB1A 4TSFD 2JAQA 2KSQA 2E1RA 3IUYA 1Z6TA 1HEIA 1XZPA 2FPLA 2VHQA 4LY6A 4C0SA 5JEDA 5KSZA 2VP5A 3B5JA 1WE2A 4TL6A 5A0FA 2HXYA 2NTYC 2PCJA 2JCSA 1UF9A 3AP2A 5E7MA 1GSIA 3WNBA 3UKDA 3H1TA 3VX4A 4HUQB 5BN4A 4FI3C 3W5JA 4XTCS 1KI6B 1XTKA 3DZ8A 4ERNA 1E9DA 1N5KA 3RRNA 1NMZA 4GOXA 5EQTA 4BECA 2PBRA 1UADA 4PC6A 3CRRA 1KYIA 5JI3E 2HYIC 4E22A 2WWFA 2DCUA 5E7IA 2WBLC 3RRYA 1KMQA 2C2HA 2FFBA 2GAOA 1VTKA 4II7A 3GQBA 2IHBA 4M21A 2HF9A 2FV8A 4D4KA 2P67A 1T5LA 4FW9A 1P62B 1Z2AA 1R5OA 2VHTA 5AK0A 3A58B 4WXRA 2VO1A 3DM5A 4BFTA 4L8GA 4IFBA 3BS4A 1P9NA 1XBTA 2RMKA 1DAIA 5FUYA 4I1UA 2YOHA 2QP3A 4KODA 5HZHA 4HLUA 5KHOC 4AWXA 1W5TA 1XD8A 3LW7A 3DMNA 1KK3A 2CE2X 5IRCD 4LGMA 4EAQA 1DPFA 1YVDA 4DCSA 4O3MA 1D5CA 4R9UC 1CR4A 5DISB 4DSUA 4U5XA 4WBSA 2UVQA 4DCUA 3GMTA 1IAQA 4JT2A 3K9LA 1M6NA 4QM7A 2JA1A 2V8OA 4AKEA 3N2IA 3TKLA 1RW4A 1R2QA 5CDFE 1KO8A 1KKLA 1JI0A 5JWRA 4A6XA 1E2DA 3Q5DA 5AJZA 4A8JA 3KKPA 3DEFA 2VA8A 1N6RA 3TW8B 1KK2A 3P4XA 1N2CE 3IEVA 3IIKA 1A2BA 2AHOA 4JKYA 4D0GA 4UNRA 1RRGA 2MSEB 1COWA 2FZ4A 3OIYA 1KJZA 2ZETA 3B7GA 4JZKA 2IX3A 3Q8XB 5FOTA 4B76A 2OFWA 1WB9A 1K8RA 1OFUX 3QUSA 4C4PA 1ZM3A 1E2NA 4V03A 4HB0A 2BBSA 1KO4A 3AUYA 4QC2A 3KQNA 1IY2A 1DO2A 1C4OA 3FMFA 4KJZA 3MWKA 3UMFA 3SYNA 3B13B 4B43A 2WOJA 1U0HC 2OAP1 2QTFA 2BM1A 2QRZA 2J5XA 1VECA 1EWRA 2ZTSA 4JLJA 4OBEA 1R0XA 4Q9KA 4BGDA 2ZUBA 4DZZA 5F9HA 4XSGA 5FPHA 1E2QA 2B21A 3FFBA 5C2JB 1XCMA 4ZPXA 4N0DA 3K53A 4R7ZA 3UWKA 1JECA 1UKVY 2AR7A 3BGWA 3MWYW 3RC8A 2FGKA 1ESMA 3MMPA 2J7PD 3C7KA 2DHRA 1R0WA 2DBYA 5KUTA 2IWRA 5GJCA 2YYZA 1P60A 2YV5A 3UMSA 1SQ5A 1FTNA 3LXXA 5EUMA 1RPZA 4G5OA 2WWYA 1E2PA 3VR4A 3ZH9B 3VR6A 4LHZA 5JI2E 4LJ8A 4IDNA 1KDPA 5L8VA 4PX9A 3CNLA 1E0JA 3OFNA 4FMCB 1G8GA 3ZVMA 1LVGA 5DLQC 1KI1A 1OKKD 3PR1A 1E9RA 2ZJ2A 2BM0A 3TSZA 1G18A 1QDEA 5JJLA 1GKIA 4Q01A 2EWVA 4B2PA 3KB2A 1WBDA 2GXUA 1PLKA 4DDWA 3CNOA 3KTAA 2KJQA 3H2YA 1SHZA 2F1RA 2YKGA 2OBNA 2LKCA 4BQSA 3U60B 4G5GA 2ZE8A 5JBQA 2F55A 2Q3FA 3EWAA 5C18A 5EUQB 3RANA 2OXCA 4PQFA 3UMRA 2YWGA 4QL3A 1Y63A 4A2QA 3U6KA 2AD1A 1N5JA 2YJTD 4LYAA 1LS1A 1U8AA 2IUUA 5LB4A 4B2LA 2H5EA 3I8SA 3LFUA 4WAUA 2V3CC 2RGXA 4M1OA 1EGAA 4BZXA 2QENA 1AS0A 3EG5A 2H17A 3U3OA 5FI1B 2WWWA 1K5GA 3K0AA 2OV2A 1QHIA 3HU1A 2Q9CA 1IY0A 2BCGY 1JXOA 5KDLA 1EFRA 1W4CA 2JLYA 4L9SA 4RFSA 3EARA 1GUAA 1R4AA 3HJNA 4A9AA 3GFPA 2WSSD 2VSFA 4N0EA 3EC2A 3IIJA 4DWJA 3QKSA 3CO5A 5JECA 4TYNA 1XXHA 4XOIA 2ZI6A 3BFVA 3BB3A 3PEWA 2QORA 3U7FB 1TMKA 3P1JA 4M1MA 4TYPA 1TF7A 2VRWA 4C30A 2HT1A 3T15A 1AA9A 4GZLA 4R98A 1Z6YA 1AZTA 5DYGA 4JLMA 1QF9A 4NP6A 3CUEF 1DAMA 1ZC3A 5DE3A 5FL7D 4D82A 3MAAC 3FOZA 3KX2A 2XOKA 4P4SA 4K8OA 3AEZA 2MMGA 5J4VA 1V43A 2OFOA 2JDID 3TAUA 4C0KA 1LS6A 4UNNA 4Q48A 2QA5A 2VP2A 4DRZA 1N0WA 1NBMD 4NE2A 3KTAB 2H8KA 3KXIA 1ZD1A 1G3QA 2IXEA 1SVSA 3PEYA 2ZJ5A 4PHTA 1Z29A 4JT4A 2GRJA 3MWLA 1E9AA 5GJWC 2HV8A 1H8ED 3PUWA 1ZNYA 2CDNA 4M9ZA 1K5DA 3TK1A 3MUFA 4UNSA 3NVAA 1X3SA 3KUDA 3P27A 3LLUA 3L0SA 4EQ6A 2NO0A 4OQXA 3U7GA 1ANKA 1NY6A 3AB3A 1KI2A 5EP2A 4BLPA 5DGXA 3WXMA 1VIAA 2JLSA 1E9FA 4YDHB 2JJ2A 3ECCA 4NCHA 1XF9A 2F9MA 1MRSA 5CIQA 4LBZA 1IOZA 2ZRAA 4B47A 4BFYA 2HDNB 4FWIB 4L9WA 3KUCA 4GMDA 2X77A 1XJ0A 4M9SA 4Q1DA 5B64A 4A2PA 4HLDA 4RFSB 1XNJA 3IQWA 4NYJR 3BXZA 3K70C 3TNFA 1FUKA 3SFVA 3QKSB 4Q66C 1NN0A 2D06A 2Q3HA 1XXHB 2A7QA 1KAGA 2OZEA 2WVJA 2ZRLA 3REFA 5GADl 5J5CA 2FFAA 2ZU6A 1UDXA 4C7OA 2PMKA 2BJVA 1W44A 3E1SA 4XIGS 2GCPA 2OCBA 2ORVA 3CF6R 4UNQA 3EZ7A 3O8CA 1OB5A 1CTQA 4BASA 5F3WB 1E6CA 2RGNC 3QKRB 3K09A 3PUZA 2X19A 4B3FX 2C5LA 4P4SB 2BCJQ 1XWIA 4LJ7A 3L43A 2ZRNA 1KY2A 1P6XA 5FPSA 1KNQA 1NY5A 2JLZA 1G5TA 2BEKA 2QUZA 4DSNA 1H8HD 4JBXA 2PZFA 1KGDA 1E1RA 5C4GB 3AVVA 1XXHE 3RSLA 1BO6A 1GL6A 1JAIA 1M34E 3C14C 3H0KA 3N70A 2GJ9A 5FBQB 3ZZ0A 4BFVA 2ODEA 2R2AA 3QG5A 2IEYA 3DL0A 3BERA 1Z06A 2NPFA 1BIFA 4KLNA 3RS4A 4PC1A 3LBIA 1I4LD 2AN9A 3AVUA 1K6MA 4R71A 1GAJA 1FP7A 2D62A 1AN0A 2EFGA 4HDCA 4M9QA 4U7DA 4G1UC 3MFYA 4EQ6B 5HKKD 4NYJQ 1N6IA 2F43A 2AWOA 4FN5A 1HURA 4PR0A 1ODFA 4PQYA 3IHWA 5DSZA 3OEHD 3SJCA 1X8LA 4PO1A 1CJMA 1M2OB 3SJAA 3TUJC 4NL4H 5AJVB 3QXSA 3AVOA 4GOKA 3GJXC 2R6AA 4WZBE 5EZ6B 3T1OA 3ND9A 1CU1A 5CM8B 3F0TA 6Q21A 1AKEA 1FTSA 4ARZB 1KI8A 1RVDA 3LA6A 1GVNB 5JLJA 1R5BA 5K8LA 2IEZA 4GZMA 3TR0A 4TL9A 3A8TA 2W0SA 5DHAA 3RAPR 3BWDD 2CL0X 3D6TB 2C77A 3VNVA 3B8HA 1X8JA 4C7OB 2GEUA 5FH9A 2N1BA 1HA3A 2FEOA 4UKDA 5D3MA 2O8DA 3K9NA 3Q85A 4TTRA 2XSZD 1D9XA 2CXXA 1OXVA 5CB6A 4B44A 4NPHA 4I81A 4P0TA 4D4LA 1YZGA 5KNCA 1DADA 4AKHA 4Z1MA 3TQFA 4JVMA 5KSYA 2VP4A 2ZRDA 4TLCA 2REXB 1SXJA 2ZJ8A 1RYHA 1U8YA 1OFTA 1U9IC 4TLDA 3NH9A 4N3NA 3AVXA 1ZNXA 1DVRA 4MGKR 4RKFA 2PJZA 3LBHA 1XMIA 2KWIA 5K8TA 2EFEB 3QF7A 1G7CA 1UEIA 4OI1A 2ZS8A 4QJ5A 3W8NA 2VQSA 2DFLA 1X8KA 3RWOA 3OE7D 1ELOA 2EWWA 1W2HA 4E03A 1E1QD 4A0GA 2O5VA 4H9GA 3CRMA 3ZZTA 1E96A 1ESNA 2F43B 2QM8A 3Q5EA 5HE9A 2VP9A 5JWHA 1P9RA 4BLRA 4WVFA 3B78A 2QP9X 3HYRA 3IBGA 2QNRA 4W5WA 3NEJA 4XJXA 2WTUA 3SI7A 3QG1A 4B3CA 1XTQA 3BE4A 1E94E 3GJ7A 2IS6A 2WJVA 3I3SR 1TF2A 4PANA 1SGWA 4C0QC 4LJYA 3EPHA 2R62A 3UATA 3AVPA 5UKDA 2IYWA 2QROA 4AKGA 1N6OA 4BFXA 3X1DA 2G0NA 3QBVA 5JJIA 2Z6VA 2GHIA 1YR9A 4EJSA 5IF9A 4QNMA 1TEVA 2GK7A 2WMOB 4CEJB 4L16A 3NG1A 3PV0A 5D3MB 2O8DB 2RGAA 4JSYA 3BD9A 4GT1A 3D31A 1YE8A 3FTQA 5CJ2A 2WAYA 3ZLJA 4ZI3A 3B1ZA 3W5IA 1W4RA 3VKGA 4RKEA 2AFIE 2N46A 3WBJA 2FSHA 1ONBA 1SVOA 2IYXA 4A0RA 1X1RA 4MKGA 4XSHA 5M04A 1SXJB 1T3LA 4QM6A 4B32A 1NIPA 4F4JA 2BV3A 5LD2B 4DDTA 2OT3B 1P3JA 1U2RA 2OG2A 4QBGB 5TV2A 3SBDA 4L15A 4NYMQ 1JEEA 5BN3A 1RC8A 4JLOA 4P4TA 4MDFA 2KI5A 1OT3A 1CJKC 1RFLA 1KO5A 1NJGA 3I1FA 4UJ5A 3EW9A 3EIQA 4YDSA 3FPAA 3EIEA 2ECKA 4OYHA 4O2RA 4LRWA 4Q03A 1W4AA 1QHYA 1TADA 4US0R 5C46F 4IEIA 4RSGA 2V7QD 1HV8A 3QVVA 4DCTA 3T35A 3SQXA 1SXJE 3THWA 1U81A 4M1YA 4OHZA 1ZBDA 2AKYA 4TMZA 5GJVC 1E79A 4IVRA 2TMKA 5L3SA 3PITA 3IPYA 5EE1A 1AZSC 2DY1A 3DZDA 2PLRA 2CEAA 3MJHA 2GETA 2QAGA 3ZJYA 2F7SA 3NC0C 2CNWD 1E3MA 1ZM7A 1YR7A 1QHXA 2A5YB 3LX8A 4LSGA 4DT1A 4PO8A 1KOFA 3C5HA 1NF3A 2UZIR 2ZEJA 4EJSB 1OPXA 4BLTA 5AWFC 1OH7A 4IDQA 2OO7A 4KCGA 2JIZD 4XD7D 3CWQA 4DLUA 1F5NA 3DOFA 1XD2A 2FNAA 2JLXA 4TN1A 2J0QA 4NCJA 2FN4A 3CPEA 1W47A 4ZI2A 2V1XA 4EIWA 4HLUC 2PZGA 2GZAA 2GDJA 4B2IA 5P21A 4HDOB 1Z0FA 4D0NA 5HCNA 3QXJA 4PO9A 2YZ2A 4M0LA 3REGA 4ZV4A 4C2UA 4URXR 1W0JA 2ODBA 2BHRA 3K1JA 2GZHA 5KNBA 3QI2A 1G5PA 2GF9A 2IC5A 2R9VA 4NKRA 2JASA 1BH2A 4ZCLA 2PL3A 1D6JA 2F3TA 3PFIA 5B2ZA 3RRZA 3THOA 4TZ0A 4LBYA 2LWIA 2A5JA 5DN6D 5AUNB 3VX3A 2BKEA 5EE0A 1I2MA 1T9HA 2RHMA 1HQCA 3AKEA 1DTSA 1E99A 1ZCAA 2RGBA 4FMDF 3UG6A 1BMFA 3PJRA 4Q7MB 4XVRA 2DFNA 3THWB 2WWGA 1AJEA 4TMVA 4HI0E 4PTLA 2QQ0A 1OKKA 2PCLA 1T8UA 5L3SB 4ESHA 4F91B 1AK2A 4QHTA 1UBCA 2AXNA 3GEEA 3SNHA 2ZAMA 2QAGB 3BK7A 2GXSA 3BB1A 2GILA 5J4YA 2FA9A 3W6PA 1G7RA 4RFVA 1OV4A 3CF0A 1IY1A 1QVAA 3C41J 4P4UA 4DT1B 1L8QA 1T4GA 5KO2A 5CDFA 1QHNA 2X2FA 1HY3A 3AKYA 1XTJA 4YMSA 5J4HA 3IPXA 3KFVA 3R20A 4I1OA 4DB4A 3OIVA 4LV5B 1XD2B 3UIEA 1F6BA 1NKTA 4LPSA 3ZYCA 2AWNA 5HTKA 3ZS8A 3GLIE 2ODNA 4Q5IA 2XZPA 121PA 3QIAA 4JL5A 2ZROA 2RHDA 2OFXA 2BWJA 1G21E 5JRJA 3GLGA 2HT6A 4AK9A 3QF4B 1T6NA 1MO3A 2GAAA 3A4MA 5DHFA 4PC2A 3GD7A 3T5GA 4GDFA 4V0OA 3OZXA 4ON9A 3U44A 3CPJB 3KKOA 4TMWA 3FKQA 5B58C 2KBFA 1RYFA 2PH1A 1LNZA 2V6JA 5JS7A 4KFSA 3IGFA 2RB4A 3DKVA 2JJ8A 2WSSA 1SZPA 4B3GA 3EZFA 4B3BA 3TMKA 2QL6A 2ZI9A 1IN6A 2HJGA 4ASUD 1W2GA 4JJKA 1VG1A 5TDHA 3LNCA 1MO5A 1Z8FA 3QXHA 2FH5B 1KDTA 2CLCX 1EWQA 4LJ4A 2NIPA 4LCBA 3VAAA 5KNDA 3TBKA 3AQ4A 2MSDB 2G88A 3QY0A 1G4AE 4HAYA 4M1KA 1VKJA 1JR3A 1WCV1 3BRWD 4XVQA 4PPNA 1KJYA 5EXPA 3GJ8A 1GNRA 2OCYC 1IM2A 5EXTA 2EYUA 4EPYA 4QOSA 5SZKB 4JLKA 2A78A 3B1YA 4HLQB 4PC3A 2H1LA 4LJAA 5J40A 1RRFA 5TXGA 1KSGA 4FXPA 3RLFA 5FTLA 1TQ4A 4LDJA 1IJFA 4OKSA 3LVQE 5FR2A 3WRYC 3T1TA 2NQ2C 2HUPA 3OIUA 1E0SA 4H1UA 3BAFA 3LAWA 4US1R 3JVUA 4IRUB 5BW8A 5BYJA 3MCAA 3TR5A 5L3VA 5E4FA 2NO7A 3Q3JB 3RYTC 3X1XA 2WKPA 2V55B 1P9WA 3ASZA 5CK4A 3OEED 4RD4A 2CLSA 2RGCA 4GP6A 3WHKA 2ATVA 2A3RA 1W36B 2ZIAA 3AVYA 4GFDA 3UK6A 4B34A 3U3RA 2RKOA 2WJHA 4JS0A 2YHSA 1AS3A 1RKBA 2NOAA 4AI6A 2EU8A 3TW4A 4DLTA 4RD0A 3GCGA 3U6BA 2W6JA 4ITRC 1W0KD 5DI3A 1U99A 4OI0A 2IUTA 4B48A 3M6AA 1ZC4A 2QY9A 821PA 2FX3A 3CWZA 1Z63A 3LW8A 4WIAA 1BOFA 1DELA 4LC1A 4BFZA 1S8FA 2C03A 4IW3B 1FOEB 1ZAKA 5EP4A 5FUWA 4YMUA 3IO5A 2QI9C 3TIFA 2GBLA 2ZI4A 4PHGA 4D4MA 3GLGE 2QGNA 2QPTA 3CNNA 4TLEA 4D81A 1A4RA 1T91A 5F98A 2PT7A 1OFIA 4TLAA 4LHWA 5SZIA 1N25A 3RSOA 3FMPB 2ZSDA 1XJQA 4IFEA 4URUR 4Q9JA 3W8RA 3B1WA 4W5JA 1M7HA 1KK0A 1UFQA 2GNOA 4AYXA 5FPTA 2GK6A 4PHHA 5JHGB 2YNMA 4UQOA 4TWZA 2FG5A 1TQ6A 4W7SA 4ESVA 5AJWA 1KAOA 4OQFA 1HQYE 3QSYA 5BWMA 5H68A 3AM1A 4O25A 2Y8EA 2ZAOA 2FU5C 2VIIA 3CZPA 4XTRA 1TEXA 4C2TA 5TY0A 2FZLA 1MT0A 1KDOA 1JR3E 2OBLA 3LBNA 1JALA 3LXRA 3NTUA 3MG9A 2ZUDA 3RS3A 1RIFA 4TT3A 4B75A 3KDSE 3TE6A 1G19A 1OXTA 4EUNA 1NBME 1ZIPA 1BKDR 4KI0A 4M2LA 4DIEA 1NNEA 4I4LA 2P0EA 1EG7A 2C98A 4JMPA 3CIOA 2W83A 5DI3B 1NI3A 3WNCA 1DBSA 1SKYE 4QBFA 1ZM9A 2AK3A 2XJ9A 3L82B 4CT4B 3W6NA 3K09C 1CBUA 3DVLA 2NO9A 4V0NA 1XB2A 3R8CA 1Y3AA 3JZMA 1XPOA 4DLYA 4A8JB 5JSZA 1VG9B 2YC4C 4AY2A 3PQCA 1UBEA 4MA4A 3FE2A 3N5CA 2NO1A 2ZI5A 4FMBB 4TQAA 4C9BA 4DLZA 1E9CA 3W9YA 3CONA 2OEPA 3R7WA 1JAHA 4OI2A 4BE7B 4ZDKA 4JL6A 2YWHA 1ZP6A 1ZIOA 2P6NA 1YHNA 3MRSA 3B2EA 1F2TA 5G40A 2OESA 1Z0IA 2ZS7A 1XJCA 2NO6A 3KL4A 4F38A 3SYLA 1W46A 3LO5A 4Z8YA 2ZRJA 4LBVA 4UJ3A 3SJBA 5K8IA 2P3SA 1ZUIA 4A0FA 4JLPA 5JHHB 1F3OA 1VCOA 4PC7A 1XEWX 1P2UA 3CX8A 1GG2A 3UWOA 1OHHA 3WHLA 3X1ZA 3EPJA 2WPDA 1N0UA 5KSOA 4LJ9A 1KTVA 1PJRA 5ANRB 2PJRA 3AGPA 1IN7A 2IYTA 4C0AC 4UXJA 3HYTA 4DXAA 1FP6A 5J47A 5JCPA 2IS4A 1MV5A 1VCNA 5AUPB 1X86B 1NVWQ 2ZRHA 2NMVA 1Z0JA 3AP1A 3C15C 4A6PA 5BXQC 1FL9A 3NBZC 4PPQA 3ZVNA 1EFHA 1B23P 1ZYUA 1EFUA 5JMTA 1KJWA 4MGZR 5FOUA 2FSFA 4DLXA 3NWJA 1G3RA 2WIBA 4V0MA 3I5XA 4PQRA 1TU4A 4Z54A 4YC7A 3GPLA 2QQEA 4R2IA 2FJUA 3BB4A 3LV8A 1N6KA 4EFMA 2NG1A 1GKUB 2VTKA 1IN5A 2CL7X 5FBLB 3UANA 1JQJC 4PXAA 4KYUA 4F7WA 1TU3A 1KDRA 1P61B 4M1WA 1OIWA 2GJKA 4URVR 3X1WA 2QRNA 1T3SA 2H57A 5JSZB 1SXJC 4IJMA 2JLUA 1Q3TA 3QOFA 2YWEA 1JJ7A 1KSFX 5IK2A 5LD2C 2AD5A 2ZSFA 5TMPA 1I2DA 1XX6A 1HE8B 3ZIAA 3ZDQA 3QEJA 4POAA 4TTQA 2F1IA 3RVBA 1S2MA 2FE4A 1NVVQ 2VL7A 3FWYA 3I32A 1ZVQA 2PEZA 5TARA 4IDOA 3IBYA 3HPQA 4D25A 4GL2A 3AKDA 1CRPA 2IXGA 1IQPA 4AYWA 3KKNA 3K0AB 3HU2A 4CEHA 1TX4B 3AGQA 4XVUA 1II0A 1Z2CA 3GLHE 1E9BA 3M1IA 5EXSA 4DDVA 1KIMA 1S9DA 2HEIA 2QTVB 4RY2A 4YXWA 4P32A 1YKSA 4KFUA 2BMEA 3KKMA 1KI7A 3CRVA 4CGZA 1W49A 4DVGA 3QPWA 1IXZA 5KSPA 4AKIA 2XNSA 2IXFA 4BFSA 4D80A 1DEKA 4F4IA 3ZD7A 3T61A 1OH6A 3FDIA 2V7QA 3VR2A 4HB4A 4RZ3A 4EJSC 1XU4A 1OYWA 2G0TA 2R44A 1II8A 1NLZA 1L4YA 3Q7PA 1KO1A 1OXUA 2B8WA 1N3BA 1YU9A 4RCYA 1MR3F 5FR1A 1Z22A 2MSCB 3TQCA 3CB4A 2OE2A 4JVLA 5KYKA 2V1UA 2GXAA 3MD0A 1SKQA
chains in the Genus database with same CATH superfamily
2VKTA 2GBIA 3CZMA 3ZS9A 1CJUC 1J70A 2ODAA 4BNDA 1PQYA 4C3ZA 4MW1A 5DTJA 1PBTA 1WDWB 3ES9A 3NATA 4MVJG 2B1QA 2EQ5A 1POWA 1TD9A 5U4QA 4PLYA 4MKIA 3CEAA 1XTSA 2H52A 2J9FB 1FFHA 1FJXA 3CLRD 3P9KA 3QGMA 1D8TA 1A8HA 3OZTA 1DKNA 1SKUA 1V11A 1F9EA 2JIZA 4QG7A 1J00A 4V2IA 1F51E 1N9KA 3RVSA 5JBIA 1CULC 3ZZMA 3ED1A 4RPKA 4FIZA 1GKYA 4Y6RA 4GR5A 4G85A 1V3UA 2ZDHA 3NC1C 1P72A 2JVIA 1F12A 1WU7A 2J45A 1H4TA 2NVBA 3HWSA 4FFPA 4UD6A 5AW9A 3TNDA 4GBMA 4YGXB 4DY6A 1SBHA 3DBRA 1G3MA 2W2OA 2HLDA 1K68A 2CW5A 2B5WA 1I1OA 5CIYA 1OH5A 4RKQA 4DLBA 4ARAA 3EG9B 4I66A 3GQVA 3T1HB 3VTAA 3FKSA 1GCGA 2BMJA 1OI3A 3O3NB 2GM3A 4GXNA 3OZCA 4RE5A 3ZVRA 4YV7A 3FHTA 2WIKA 3FHJA 5LP6F 4MVJM 1MQ9A 4KQIA 4ZTZB 2PNFA 2Q3DA 3ZDZB 5FX2A 2ZYWX 1GL3A 3VR5H 4DZRA 2EJUA 3MWEA 4GPIB 3Q8KA 1GPUA 3OT5A 4GVLA 3D7NA 4UTPA 1Z39A 2X2EA 5A6VA 1PZNA 3ENNA 4O2BA 3CCCA 2IYVA 5DN6A 3HXMA 5EZSA 3TPZA 1R64A 3MQ2A 4QQNA 5I01A 1C9MA 2CFOA 1CY8A 3ZDAA 1E6MA 2VDUE 3VR4D 5CA0B 4ER5A 1RTKA 1Q84A 1MHTA 2BRUA 5EP1A 2FLKA 4PIVA 1XCGB 3AUUA 4WW0A 5A3SA 3SG0A 4UDOA 4BN5A 1IE3A 2LDXA 3OFND 4FXOA 4XWGA 5KVSA 4ND8B 4OKNA 2HRQA 1TUIA 1HUQA 5GOZA 4K5QA 3WKBA 1NDHA 4DCGA 4YUYA 2ORED 2Q4EA 3R5XA 4E5KA 3VPGA 5A3VA 1A3CA 4JXXA 4QXMA 1MA3A 2BKAA 1WB6A 1TTQB 4CKBB 1IXKA 3FYUB 4P86A 2X1LA 4CW7A 4QEZA 2ZRIA 3D81A 4DKXA 1S89A 2XB6A 4HL6A 2Z9BA 1E2HA 3THYB 3A1WA 5CRIA 2W2LD 4P7BA 4WXMA 3VYRB 4JLVA 1LA2A 1B73A 1E5DA 3G0IA 4DMHA 2O0KA 1L5NA 5F9FA 5JYEA 3SICE 3L0PA 3KLNA 4HT3B 2C83A 4Q9DA 1QZZA 5E95A 3HXPA 1QFJA 3GJ3A 4MRMB 4PRZA 1J1UA 4RVFA 2C9BA 4J0GA 3UMGA 4FFBA 2REQB 1GKLA 3ER8A 3LPAA 5J9FA 2OA0A 5AKGA 1S3SA 3U40A 3P9NA 2P90A 1VHTA 2OLEA 3AHFA 1J99A 5LMUB 3DE5X 2UYGA 5ELLA 2X9GA 3KQUA 2XAUA 4IRXA 2WJ6A 3A10A 3PTLA 2F1HA 3BWBA 3WQBA 4J0CA 3UWDA 3VU9A 2X1VA 2HMUA 2Z4TA 2VUTA 2BLLA 3GGPA 3ILHA 1AZLA 1TJ4A 2OBMA 1DIBA 2FWPA 2ZR0A 4D92A 4TQ9A 3OQIA 2XNJA 1OBOA 3KQLA 1EXNA 4TSFA 4EVSA 3RR2A 5AI6A 2BEWA 5A4AA 3V4RA 3V5NA 3DVAB 4R1UA 2RE8A 1B43A 4ZOAA 1QZXA 3OURA 1FRFS 3WB9A 1YDMA 3FTNA 2QD2A 5HP4A 5CG2A 4GMHA 2WZQA 3BMNA 5LBTA 1H05A 1OZFA 1RAIA 4MYSA 3ESCA 1LF5A 1S0UA 3HXLA 1GTG1 3HC7A 3V00A 4Y2HA 3BJRA 5F3RA 4F04A 3JAWB 2KBEA 2JW5A 5IVIA 2G77B 3EQ7A 1LWOA 3L0BA 1VP3A 2H9AA 2VNAA 1DLIA 1JTEA 2JLQA 2M9MA 2YXEA 2ZVPX 4MKFA 2GEBA 1O9GA 1O5TA 2BBOA 3PVZA 4INAA 2DUUA 1M83A 1IN8A 1CLUA 3K5IA 4JI3B 4EMBA 2Q2OA 2XOKD 5FOQA 4CZ2A 4J76A 1IFXA 4TTVA 2ZIZA 2PHZA 1OFHA 3T94A 4FYHA 3V46A 3GLFE 4IY1A 3NYWA 3HVJA 2V58A 2UKDA 2ZE6A 3DEHA 3WKCA 2AI1A 3DF9A 3HZRA 1BDBA 1BN7A 1VIMA 3I52A 5HKLA 5KC9A 2VAMA 4LI0A 2FGJA 2L0XA 1BXRB 2W37A 3HCFA 3BILA 5AO9A 1ZH4A 2XE4A 1ETUA 1M0EA 2JLVA 2HDWA 3MOGA 5C7OO 1XDGA 2G6BA 3CLSD 3F3YA 3G1WA 1QB7A 1O5IA 1O4VA 5EHQA 2RAPA 4V02A 4XM0A 2V9PA 3UAZA 3SBOA 3LDAA 2X7JA 2QG4A 2DH5A 1M2NA 1R8QA 2IYNA 4BX9A 2B69A 3W3AA 2ZJZA 3RVOA 1C8VB 1PX2A 1U3DA 1EX6A 1WZNA 2JJ2D 3NHRA 3I92A 3CEHA 3RJZA 4P0QB 3ETCA 2QQ5A 3AF1A 4LXYA 3VM6A 3CVJA 1HDIA 5DULA 2AA3A 4FZVA 2EZTA 4B3JA 2ZATA 3C16C 5D1HA 4C4ZA 3OE5A 1JLRA 3V7WA 4RYDA 2APJA 3H86A 2W2VA 1G8FA 3EGXA 1W0KA 3JTEA 2IS2A 1GRCA 2WSIA 1S4QA 1ULHA 1ACLA 5JRZA 1OLUA 3D6FA 4R9VA 4Q4JB 1F60A 4XJVA 1CUSA 2QVZX 5DBGA 4JBWA 3VSBA 3HB4X 5BN5B 4WJKB 1H4SA 3ZE1B 5C7YA 4ZTUB 2BD0A 4A8PA 2X9VA 1QH1A 1EQAA 5TQ2A 5KB3A 1JEYB 3LCCA 1DS6A 4GRIA 3G89A 4Y3UA 3UC5A 3WWZA 3JZAA 2BIFA 1I4EB 1LV7A 3KU1A 4PBTA 4J29A 4Y30A 1SBCA 4B6SA 3FGNA 2ON6A 2BYTA 3JQ9A 1A7AA 2HMAA 5BR8B 2GAFA 1ECJA 4YJ3B 3OLXA 4UBKA 1XEXB 1NJ8A 1OW3B 3KTOA 3W5BA 2AYXA 2ZG6A 2Z57A 2IBSA 4WN3A 3VA7A 1G6OA 5LQJA 3H3XA 4KG7A 4RORA 3I9V6 1JEAA 1E8DA 1K98A 3QPDA 5FBVB 3AL2A 2AEMA 3MF4A 5CM2Z 2IHVA 3CURA 4IIYA 4L5BA 4KW7A 3KD3A 4Z2AA 3QELA 1ODIA 1Q1NA 1JLSA 1XOIA 2AFRA 2JATA 2OCPA 4LE0A 4UHBA 2V6IA 1NP6A 1LPPA 4UBOA 4YUVA 4D46A 4TKUA 4P33A 2J0SA 4V1CB 1W5SA 3CE9A 4MQFB 2VA9A 2PXCA 1JHDA 3I61A 1NV8A 4XI9A 1CY7A 4M0UA 2AW5A 2YHBA 5JDCA 3HEMA 4HNSA 5JSUA 1T8WA 2I1QA 2Z5GA 3VZBA 3GJ4A 4RIGA 2G08A 1DX6A 2WY2D 3LA8A 3UFXA 3UKJA 1XNGA 3EA0A 3MS2A 3F1KA 4TSKA 4ENUA 3PTAA 3O4VA 1VHWA 4URZR 4A8JC 1E7QA 1SCJA 1T8YA 2CNNA 2JHPA 2XUHA 1H2XA 1IUOA 3R0XA 4HATA 4V0KA 3QBEA 5I4KA 5HBGA 5DJ5A 2VC2B 1FFBA 2GBLC 3C8DA 3FMOB 1PEKE 4FK8A 4O0MA 2PY6A 2YWXA 4PZAA 1HMPA 3BH6A 4AW9A 4JJ6A 3PQ7A 1W76A 1PGPA 4H60A 2GEJA 4RCZA 3VPAA 4BX8A 3RKSA 4FMDB 3D3EA 1NN3A 1J25A 4GSYA 3KFXA 5IJAA 4DNXA 4K26A 3FRHA 3AONB 4NPCA 5DTEA 1PSWA 4YP5A 2P11A 4DABA 2IUEA 5B3AA 3UMCA 2G5PA 1G8PA 1DKLA 4AL4A 4BZZA 4B3DA 2Q0SA 3QE4A 3RV3A 3WQRA 2HCJB 2ID9A 2EC5A 1J0BA 3RFFA 5KWVA 5DHUA 5TMBA 4EYSA 1NSTA 4PFQA 1F2UB 5KNCD 3B1JA 1Z18A 2HU8A 2JD0A 4G9BA 4IGEA 2BGRA 5AJYA 2HLNA 2Q9UA 4IQFA 1FSFA 1UZNA 5D86A 4TMTA 4H1VA 3K5HA 5B55A 1NQTA 2IUSA 1GGEA 1SCIA 4I4TB 3TD9A 1E2EA 3V1LA 1OXXK 2VFAA 4WVLA 1YQGA 4DLLA 3IR7A 1FJHA 2PTGA 3AP3A 5AKZA 5FBWB 3DBHB 1WY5A 3MA0A 2CVQA 1DBIA 1K75A 3HJRA 3DEJA 1ZXXA 4EPWA 5KWEA 3KK0A 3NHAA 1KMNA 4PHFA 4H16A 2X8LA 4FN4A 5AM4A 5JS2A 3VV3A 2CJWB 4X97A 2ECQA 1C30A 1G1MA 4BPRA 4DG9A 2FPIB 2OV6A 1T34A 5T3UA 3GRVA 4LVNA 3MZ0A 4O1HA 4LNUB 2MYPA 1S2GA 2REOA 1G5RA 1A1SA 2V96A 2RGDA 2YC2C 3KBBA 3AY0A 2F62A 1V47A 5CK5A 4F92B 3RHZA 1PL8A 3TVDA 3T0GA 4NJEB 5EIBD 4D98A 1HR0B 1YRYE 4DLAA 1QYCA 3NRJA 2YJGA 5IKEA 1GUFA 1I94B 4DSZA 1XVVA 2B94A 3S28A 1ORVA 5JUWA 4RGBA 1J90A 2Z6AA 4RA6A 2B4AA 5HQTA 3ROFA 1VSBA 3I4FA 1OU0A 4MB6A 2BTEA 2G1KA 2GD0A 3HM2A 4XPZA 4MKHA 4XXHA 4EG5A 4LX0A 2JDIA 2NZJA 1B3RA 1LRJA 2XMZA 4HZUB 5KOIA 1T9DA 2ZB8A 1VB5A 3CXRA 1TI7A 2YXNA 1OWNA 2BTQB 3ICQB 3L6EA 4CT5A 5CD9A 3L93A 3QQ5A 3HA3A 1Z6PA 4E6PA 5CB0A 4E33A 4HS4A 1TAQA 5ESXA 5J2TB 5TT1A 3GJ5A 3HCPA 1OZGA 1XU9A 4MS3A 3O0TA 4HDNA 2B4YA 3AHIA 1X77A 2JGAA 4LGCA 2ZSEA 4RHXA 2PXXA 4OHPA 4JJEA 3R7SA 2Q0HA 2YHUA 5DHSA 4DR4B 3A6GA 3PE3A 2XGGA 4BX2A 5LU9A 1CYEA 3F9CA 4TYQA 4YASA 5EP3A 1VLVA 3BCHA 3C5EA 3CYFA 4O4LF 3N2YA 1OASA 1U94A 1UT8A 3R0IA 1JPNA 3KXLA 4KE8A 4YT8A 1GA6A 2H06A 1RQ2A 2VSXA 1PIWA 2ZWAA 4LK2A 5F5LA 2FUKA 1PUIA 3CRZA 3PNBA 2JJMA 4B4OA 2E5LB 4KBGA 2ZJOA 1ESEA 4Q1CA 3PZRA 5CB4F 2FDXA 2DM6A 2ZRKA 4G89A 3CX7A 3D6HA 1ZMOA 1GRNA 4PO3X 2CMGA 4RJ2A 3RBVA 1UJ6A 1TZJA 4Q7JB 3ABQB 3RSGA 3V6MA 3WMXA 1IVYA 1E3QA 4ALMA 1SVMA 2CXUA 1OV6A 2I4IA 2NVWA 4TTPA 1KK1A 4MVJF 2TSYB 2YIVX 1U1FA 1FZQA 3ZBTA 4Y1EA 3RJTA 3RFVA 4JP2A 1A2KC 4P82A 3TRIA 1X7HA 2GZ3A 4C76A 5BMVA 1NLMA 3KKKA 5LOVA 1DKOA 3S40A 3ZEAA 3BZWA 4WK4B 4XGRA 1A69A 1PQUA 2AW3A 2XBUA 4IDGA 1JWLA 1EUDB 3PLAE 3MWJA 2HIAA 1H2HA 5LMZA 4Z53A 1IM8A 1CB7A 2IOFA 1M2EA 4I6GA 2IDZA 3H19A 1V95A 4UQPA 3SHOA 4G5SA 3RT7A 4EF6A 3W1EA 4FE3A 3KJHA 4FEGA 1XRJA 4ZAXA 1US8A 1H8HA 2HU2A 5LZ4A 3EUEA 2BFFA 1Y1TA 1V45E 4O5AA 4NJMA 3ZIDA 2AXEA 3IXQA 4QVKA 3TLZA 1Y1PA 4B74A 4YRAA 3T3EA 1QTRA 4JEIA 1R4NA 2WJ4A 3QZUA 3QUTA 2GN9A 3T9EA 1EFPB 3AL3A 4QYWA 3IIMA 3JARA 5C1PA 3THYA 3QJYA 1E3DA 3FX2A 3K0CA 3FGPA 3IERA 3T5DA 1ZD8A 1TJ3A 2G17A 2G70A 2W4IA 3MOSA 3KZCA 1UDCA 3JQGA 4I46A 5CYPA 1UEJA 2ZBEA 4EYEA 1KZ1A 5JZOA 4MHOA 1XZEA 3TIIA 5JYCA 5GTDA 1WETA 3X1MA 1NMXA 4NMLA 1NW6A 3IKVA 1QUEA 5LYYA 3ONWA 2W2NA 4XLTA 2I8AA 1M3SA 4HZGA 3UJHA 1QH8A 1QORA 1YR6A 4WOJA 2CCKA 4RD3A 1CDDA 4ZRNA 4CRWB 5A04A 1P77A 2WWHA 2YN2A 1EP9A 4FYJA 3C48A 1AUVA 4Q0MA 2HK7A 1NVAA 4OA5A 4ZOEA 5FI3A 5A9SB 2QBYA 1XELA 4ZT2A 2PMBA 2IP2A 2JJ1A 2QAJA 1E0KA 4E2YA 3ASYA 4WOPA 4Y1RB 4DGQA 1CQXA 5JQGF 1TLFA 2J46A 1F1BA 4BLOA 5HQJA 3WRXC 2QE7A 3ZGVA 5ES4B 4TXJA 1PWXA 3SHVA 2FMTA 4C5CA 1K86A 1P0QA 2GPYA 2PO5A 3R09A 4WH0A 4B82A 4EB6B 3TDMA 3KQMA 4FMCF 3T7DA 2H5IA 4QTXA 3DT9A 4UREA 3VR3A 3SGLA 4LYEA 4S2EA 1BJTA 1TUGA 1OWMA 1ZCBA 3NTXA 2P78A 1UDWA 3GLHA 2YVKA 5KOYA 2QRVA 3K0HA 1FYWA 1O54A 2C4HA 3ITNA 3FGZA 1NSFA 4JBYA 1BMFD 3TIGA 5BORA 2VOJA 4MTLA 4RPCA 2NSJA 2DHEA 2WHXA 2XUZA 5DNWA 4QPPA 4O1IA 1Y4ZA 5CDGA 3ZUPA 3M6IA 1E1KA 1PV4A 1PR4A 1CQWA 5AK6A 3H5OA 2Q4OA 2R6FA 4I1SA 4ZYXA 3A0UA 5DOZA 3PNSA 2A0WA 5FV7A 2QF7A 3L8FA 4RSMA 3LSTA 3R9XA 2F3QA 2YMQA 1I7DA 1ATIA 2PX0A 3MRXA 1JU3A 1CY2A 3KSAC 2EKBA 3OP4A 1KJ8A 3H6KA 2AYZA 3HV2A 4LSZA 5D3ZA 2VTBA 1U4NA 4GNRA 3QY9A 1NATA 5I9MA 1L5KA 2FK8A 2VJKA 2Y9MB 2PYDA 4R8LA 4DUPA 2Z09A 1LPNA 4WBXC 3INYA 2SCUB 1BX0A 4YR7A 4CQJA 5LB2A 2VYFA 3DE3X 3IQXA 2PVSA 2YW2A 3RUFA 3P71T 1XROA 4ETWA 1YR3A 4B6FA 1MRZA 4BP1A 3BWEA 4CR8A 2HSZA 2W0MA 2WHPB 2CLFB 2XUFA 4F56A 1LNSA 4CV1A 4PPFA 3TTSA 4FDMA 2V65A 1G6HA 4G26A 3ZWCA 3G5LA 2WAMA 4QLAA 4EKDA 5CB8A 3DM9B 4B8ZA 2J31A 4LQ4A 3FVVA 4ZU6X 4LV6A 1MO4A 4N7RA 2GLUA 4S35A 1V8BA 1VMKA 2VDQB 3QUBA 1X0XA 4O6VA 4U7PB 2K7FA 4IMJB 1ISGA 4N5DA 4G07A 1M1NB 2YJ5A 1YDWA 5IUNC 3EZGA 1XG5A 3HI6A 1DG1G 4I99A 1G64A 2PVPA 3EC7A 3HGTA 2VNIA 4RPLA 3WGMA 1IL0A 4JJIA 3JQAA 3U19A 4ZZIA 1JKFA 1TVCA 2FRDA 4UAGA 3KQYA 2FMXA 4Y0NA 3TOXA 1BMQA 5B6PA 5I51A 3RB8A 1M74A 2HNAA 3AHCA 4RPJA 3MRTA 2ISSD 3WDLA 5KC8A 5KVCA 4LHXA 2YHIB 3FRIA 2WZDA 4UU1A 2OCKA 4NAVA 3RTCA 4MUXA 5IULC 1D0VA 2ZULA 4L5YA 4REQA 1ZUHA 2Z3WA 2I7VA 4B79A 1IQ0A 2OHVA 2DB3A 3NIGB 1JKIA 2DLNA 2YUIA 1M1YA 4O63O 1XMSA 2X2PA 4OOFA 3ODGA 5CURA 2EGGA 3J81k 1GL9B 2OCIA 2X9NA 5KNDD 4U9UA 1HYHA 1W4BA 2XB9A 3ZV3A 4YXFA 2LE0A 2O8FB 4H08A 1JR3D 3DW3X 4AZ3B 1M0SA 2F3SA 3PDUA 3PHHA 5K3FB 1NPYA 3HHEA 2PVCA 1SZJG 3SIPA 3GUZA 4KMOA 3VC1A 1Z5VA 3Q9NA 4XWTA 4GGPA 5G0VA 4NJOA 3TOSA 4JB0A 4B2YA 2FSIA 3B9PA 1EFVA 3O21A 4GKJB 5DNDA 1L6RA 3C3KA 3DQZA 4GBED 8MHTA 1A82A 3LP8A 5T64A 5BVHA 4JSTA 2ZITA 3K0EA 4PCUA 4RANA 3I53A 3RBAA 3SVZA 3ER6A 1SRQA 4JOQA 4LFBB 3WGOA 4C04A 3I39X 4OK6A 4EY3A 3AUSA 2GN2A 3OO0A 4MITA 4TL8A 1XLWA 2GSDA 4JLUA 3VQTA 4AT1A 3UJ3X 5IWAB 3IDFA 5JNVA 4YWHA 1A7JA 1RYNA 1FBNA 3LUAA 4A5SA 3RV4A 2A1TR 4TQUS 1NXXA 3Q72A 3V34A 1BGVA 1PE0A 4WXPA 5LP6A 3C6YA 2VLIA 5MGBA 4M22A 4ZK2A 2RAVA 1U3WA 5HUHA 4GBJA 1EP3B 4I4IA 1E3WB 4FOPA 4LZWA 4URWR 2OM6A 1C4WA 1DQNA 2DOKA 2WLTA 5H4GA 1M7GA 4KEAA 1PFGA 3BXEA 4ZCQA 1FC0A 2D74A 3JZIA 3KJIA 3EGCA 2G0AA 3PR3A 3CEPB 4L76A 1M2VA 3PHLA 3AR8A 3LQRA 3MT0A 1KNXA 1ULAA 3L0ZA 4QBIA 4X54A 2W6OA 1T0HB 1FMJA 4E21A 1JHXA 4QJ3A 3IAS6 2WMNB 3AYZB 4ZWNA 2NSDA 1Z2PX 2Z5LA 5E2AA 2QL7A 1G7TA 1KEVA 1IBRA 4QXAA 3VYUB 5EJ6A 4JJZA 3FTFA 1J8YF 4UULA 2J3HA 1VMIA 3A4NA 1JFFB 4NEGA 3MUEA 1N5RA 5H59A 1G63A 1GPH1 4N8SA 4YONB 3DLBA 4RAOA 3QPAA 1COWD 1QYDA 1FJ2A 3AEUB 3MSXA 4PVCA 1XQWA 1JEOA 1ZGJA 2IIPA 4H6VA 4PNZA 3RCBA 4DIUA 3TEMA 3N7UA 2FPGA 4Q9IA 3AETA 2Y4OA 2Y99A 3L9XA 2VAWA 2OGZA 4KSCA 4XD7A 4UTZA 1G4UR 4HFRA 3KR2A 3ZE2B 5KPDA 1SRRA 3RQIA 2O59A 5I4IA 3FNHA 4R51A 1D2RA 3GUUA 3LLVA 3RYIB 1HBJA 1G9SA 2HLHA 1QV9A 3EXHA 4G2NA 1HTTA 4H7KA 3GXBA 1JDPA 1CQIB 3JVIA 4FINA 4UFOA 2JAXA 2PEYA 2PXAA 3A1TA 4KE6A 4KKXB 2LGJA 4LJKA 4N54A 4NCIA 4PZEA 4E3ZA 2W6IA 5FA6A 2DVMA 3BIJA 3FJYA 5FKJA 3W6ZA 1I2BA 1NRXA 4F11A 3LO8A 3KAPA 4DR1B 4Z6KA 1KY3A 3PDCA 3RC3A 4ZO4A 3J81A 5ELXA 3IMFA 2CL6X 2Z1NA 4HEHA 4LY0A 3ANLA 4FONA 6REQB 5DM4A 1GZDA 1I13A 3NNSA 1TA4A 1NTRA 1UPBA 5TVKA 1OD6A 5LVAA 4NDZA 2CB0A 1EPUA 4HDQB 5IT5A 3NDIA 3K20A 3QLVC 3VKWA 2CFTA 1C29B 4TMXA 2BZ1A 3I2IA 4O2LA 3E3NA 1SAYA 4O8CA 4BMOB 1PQ4A 3HR8A 4CMIA 2AB0A 4Q7LA 1ECFA 4TT3D 5DXFA 1D5WA 5JPIA 3IUSA 3HXQA 1PWZA 2I03A 3T4EA 4RVNA 4BWGA 3WLIA 5KYNA 2WWXA 1QIKA 4KAXA 3RUIA 5KJCA 4NHEA 4U6NA 3FUCA 3H1EA 2JIQA 1II8B 4CNBA 1D7OA 1PAUA 3IOMA 721PA 2PZJA 2IZ1A 2QRJA 2BEUA 2WYVA 2C78A 3EDYA 3GAAA 3MJEA 4Q47A 5K3AA 5TPZA 1N9ZA 3DE1X 3CG0A 3TBFA 1GR1A 1NYQA 1M6YA 3WWOA 5K9ZA 1VIYA 4WGFA 1WXWA 1PSZA 3L7OA 1DWPA 1PW5A 1OFUA 2GEKA 2VF5X 1Y9ZA 4TXMA 4M9XA 2G82A 1E4VA 5JT1A 3T52A 3ZX4A 2E5WA 2MWMA 5E3HA 1D1SA 1JEJA 1K97A 1VRWA 3IJRA 3Q1LA 4J0JA 2A5LA 4NBKA 5DYTA 4W9NA 4BNLA 5K6AA 5KU1A 4A2WA 4UQLA 2D2EA 3HEAA 2J0UB 3BWXA 5AMXA 3D7LA 4MLDA 1Q21A 2XF8A 1J9EA 1PV1A 3VNQA 1XZ8A 3G0CA 1U7WA 4CLOA 4JR1A 2WOOA 1Z4OA 2RHBA 4N5LA 4YCJA 4G0WA 2CE7A 1XGKA 4MW6A 3R9IA 2DMRA 1P0CA 2GYUA 2WSYB 4HO1X 5CLLA 1AUXA 3QVGA 3T06B 4IH9A 1ZCZA 2Q21A 1W34A 4UVGA 1S4MA 4JJGA 3Q3IA 4J7UA 1DAPA 2ZIWB 3P2OA 2E4AA 4MGYR 4O4IB 1BW9B 4X61A 4GAEA 4I4CA 2R751 2W11A 1GZSA 2D5IA 2GGSA 5IAGA 5CCEA 4PYLA 3B7WA 1GYRA 1P7CA 4HLCA 2IYYA 3EZ6A 5DVZA 4G01B 4M0PA 3F49S 3GEBA 4PIMA 4XYGA 2ZBDA 5G2OA 5BUZA 1V35A 4MV9A 4WEOA 3QBTA 1NBOA 1RMTA 2B1RA 1NXWA 1WSAA 2ISQA 2YWFA 3S44A 4BVLA 5HQ3B 3PWZA 2GM4A 2XJ4A 1RRPA 3ZI4A 3EWSA 2FMFA 4YWJA 1PV2A 3ENKA 3I30X 2Q45A 3HKCA 1DAHA 4FE7A 1GZ3A 3WX0A 2PX2A 5A4KA 5FWXA 1PJ8A 3EMDA 3H2IA 2O2SA 4L4UA 3SXUB 4AP5A 4ASUA 4DV2B 1R0CA 1KMHB 3EAQA 5EN4A 4ZVSA 3QOWA 1GTVA 1ZJYA 2CHEA 2GKSA 4EZEA 1SOUA 3TXYA 5JCJA 2I5PO 4MB0A 1W30A 3Q6NA 1WRBA 2PIDA 2AN3A 2OP1A 1PEDA 3AF0A 1NDQA 3NH6A 4HJRA 2MMCA 3HB0A 4IMRA 4MUMA 1DIOB 5FOWA 1VL2A 3BL5A 4HAXA 3RE1A 2NZVG 5DNYB 1U3FA 4HVCA 1BE1A 3P9ZA 4ZV7A 5KDOA 4H77A 1E5XA 3IQEA 3OT4A 4Y1GA 4PAQA 5AW1A 3WLLA 3SU8A 4YUXA 3TINA 3M89A 1ITZA 2Z2KA 1M5TA 4XGKA 1AKRA 1Q74A 1Z26A 4BLQA 4Q37A 2BBTA 3BDVA 4Q4HA 3WGZA 4A6EA 2IUYA 5G3YA 4JHXA 4QXRA 4Q3AA 2X7XA 2PM8A 5CX4A 1E63A 2RGNA 3GEIA 3PXGA 2BHSA 1V96A 2QL9A 2ZANA 4NU0A 3LOUA 2QMEA 1YL7A 5DYYA 4D9JA 1OZAA 4FOOA 1UJ2A 4MIYA 1KU6A 2AOUA 2Y0EA 4JP8A 1ZESA 2ZYSA 1XTVA 4DS3A 1MO2A 5EE3A 3TZ6A 2C0PA 1Z16A 1DO0A 1ZEJA 2CC2A 4BKPA 5EHZA 4BGUA 1QV7A 1KFJB 5JNSA 2PMDA 3Q3CA 2EGUA 1Z82A 2BI4A 3JQBA 4E1VA 3RC1A 4YS6A 3WYNA 1A9XA 3AC0A 2H1OA 1R6UA 3R6TA 4G1CA 2K6GA 3BTVA 4F2HA 1ZD3A 2PUAA 2Q49A 1C3JA 1TZCA 1EHIA 2EVWX 2QRLA 3PC6A 1X80A 2M6KA 4RXMA 5LMCA 4I08A 2WUEA 3IUBA 3ONNA 4XWOA 4PLTA 2HXGA 2RB5A 3Q1KA 1RP7A 4M1EA 2VJNA 3E84A 2AFHE 4ENVA 4YXWD 5LM3A 4BPBA 2DUWA 2AC7A 1GQFA 2W6ZA 4EK9A 5FDFA 1YU6A 5IZ4A 1J4AA 2XCIA 5JD5A 3FFAA 4HSEA 4PVDA 3B2QA 1ODJA 2J07A 3GLQA 1SCKA 4F3NA 5B3JC 1YL5A 4LQDA 5IHPA 2NPOA 2EP5A 4IDCA 5JXJA 3TFOA 4IR7A 2D7CA 5DMHA 1XYGA 3DBOB 1MTZA 2ATXA 2VQ6A 3I58A 3PIIA 3L8HA 2P9HA 4YP7A 2CF5A 1HLDA 1T0JB 5EE5B 4ZVMA 4AF6A 4DCVA 4WZAB 4KBFA 4QXOA 1KA9H 1FU8A 1M5UA 4LZAA 5CNJA 1QQAA 4R1MA 5INTA 2WT9A 4PSKA 5KEIA 1BD3A 3KBOA 4WLEA 3K70B 4Z9YA 1XXLA 2ZR7A 3ESAA 1JKMA 4FJ2A 5IW8A 4MI9A 1R7RA 1NN1A 4Q3BA 3VDQA 3STWA 4MVJI 4YJ3F 2JGNA 2WKSA 4PLGA 5K0EA 2ZBGA 4WASA 1SN7A 5DPMA 3AI2A 4MYHA 3ABOB 2IDJA 4HDAA 4Y6LA 1VI6A 1V5FA 3I34X 4M60A 5LLDA 4EENA 1Y9DA 3K0SA 2ATIA 2QEQA 2O4CA 1BVHA 2DFKB 3M4YA 3WIUA 4BFLA 1I4TD 4HX2A 1TVKB 4KE9A 5F1KA 5BPFA 3CPHA 1KR5A 2ZI7A 1G20E 2BZ0A 3LKZA 5TB5A 2BI8A 2OOKA 5LQRA 3T3OA 1FFXB 4GLFA 1Z4NA 2DQ4A 1XLVA 1I7PA 3E05A 1E89A 4EMUA 3V8EA 1EZ1A 1U9IA 1NX9A 2ZVJA 1O57A 3JVVA 5FD8A 4EUKA 3IP3A 3S5UA 3HKBB 1IHXA 3OKCA 1U11A 3DPIA 4FHGA 4RVUA 4P5EA 1GQOA 1MVNA 1QGYA 2J59A 1RC1A 3NXSA 4MRRA 1ZIDA 5BOSA 4XEHA 2RGUA 4MMXB 5L3SB 5DBOA 3JAKB 1TOAA 1HLFA 1R0RE 2YJNA 2ZIVB 3AVQA 3VRHA 1XPJA 1M54A 3BIOA 2C7PA 3NVKI 3SDZA 5T8KC 1BWQA 3S0JA 4ZCTA 2AQIA 1U0RA 2RG7A 4Z8XA 4A23A 4BAGA 4DYHA 4YRGA 2PUEA 4RTJA 1KTIA 3ZOKA 1CR0A 4DC9A 1ZSVA 4GPAA 2POQX 4CNQA 5C5CA 2HHLA 5ED4A 2FFHA 2GKGA 3R40A 1CUWA 4QPNA 3WLKX 2XVZA 4WA8A 4DBLC 1XLTC 4UBIA 1TQ2A 4HEJA 1E9EA 3SSNA 2XLCA 3U62A 4F97A 5DWQA 4HRYA 4IIJF 4G09A 1Q1GA 4NATA 1KI6A 4JI7B 2NTEA 4NSNA 3N2KB 3C4VA 3PEFA 1SR8A 3MOIA 4AJOA 4QT0A 3DCYA 3IIIA 5NLLA 3OAAD 4GKBA 1N77A 4CEIB 4JQZA 4R68A 4IIDA 3NWPA 1P75A 3ITEA 2P6OA 3ZQ4A 1DCFA 2GPBA 3KALA 3MMXA 2DWPA 3IJEB 3KOYA 5A7HA 4EF5A 1T24A 4RHCA 2EW1A 3NNNA 2V54A 4KPUA 3L0DA 3V7UA 4MH0R 3OZGA 3SKVA 2BFEB 3BXXA 1UMDB 2CCJA 3O83A 2FN8A 2M2IA 3HKEB 4GP9A 2DQKA 4JELA 4ZMBA 1S2DA 4GQBA 2OZLB 4MZDA 3M4XA 4OJKA 5LN1A 1LVUA 3EEFA 4XX0B 1FP4A 3U9TA 2ACEA 3L8CA 1OLXB 4TRJA 5EIXA 3GT7A 4FZRA 2O06A 4AWAA 4YQFA 5HFJA 5DX0A 1GA4A 2AL7A 5LQAA 4O4LA 1T0UA 2Q41A 1Q1EA 3TQHA 1I9GA 3SC3A 1JBKA 3H99A 1J39A 4HAWA 1Q0SA 2AG1A 3FLAA 4E4RA 2BMDA 4EYGA 1DE0A 3QNMA 4X91A 4S05A 2OPHA 5FLXA 1E0AA 1ZRSA 2J1LA 3GNLA 2H5JA 3VU1A 3ZU5A 5CB4A 1UBMS 3MTBA 1AG9A 2XNDD 4BNNA 4ZJUA 1SVIA 3PLRA 4BNXA 5A02A 3LCUA 5D2CA 4US2R 3AFHA 3QFRA 1A76A 1AU9A 1LSSA 3AUAA 4MVJA 1N4AA 1B6RA 3DMHA 3EAGA 2R7KA 2VNSA 3FLBA 4Z7QB 5JY6A 1J7JA 2XQJA 1Z6TA 3CW9A 4C0SA 4PICA 5KSZA 1O08A 1T9GS 2V7TA 1PNQA 3T7IA 3B5JA 5K4HA 4TL6A 1VLMA 2R87A 2WM2A 2RIRA 3IBFA 4AN4A 1YCFA 2HXYA 2NTYC 4CF6A 1HEUA 2PCJA 4CFYA 5BSKA 1UF9A 2QAIA 3E58A 5IJWA 2PGOA 3WNBA 4FW8A 4HUQB 2GYVA 5BN4A 4FI3C 3ZLBA 5ENVA 4AMGA 1XTKA 3DZ8A 3WO1A 4NK5A 2IV7A 1ULZA 3F7TA 1AURA 1NMZA 4C4XA 1M6VB 3IXMA 2PBRA 4ISBA 1GSAA 1UK8A 1HE3A 4M0EA 3D3NA 3G2QA 4FYIA 2Y1XA 3VZRA 1Z17A 4MR9B 4E5YA 4E22A 5JI3E 4HH3C 5E7IA 5J2TF 2WBLC 1QVVA 4MCJA 4AY4A 2BM8A 5TRTA 1GG5A 2XMSA 3GQBA 2IHBA 2LV8A 5ALLA 4M21A 3K6SB 5BUSA 1N7IA 1GQYA 2FV8A 1O1YA 1TCCA 1T5LA 2ZB4A 2CLKB 3KL2A 5JS1A 1Z2AA 2R1TB 5TGZA 1MF7A 1ZD2P 1A8UA 1T4MA 1P39A 5EJ5A 4R2JA 4UM5A 5JZMA 1VFPA 1SK9A 3WFJA 1JFVA 2O7RA 4KDFA 3ERCA 1T5OA 2B8NA 4IFBA 5IASA 3CUSA 4PNPA 2O2XA 1BGWA 5FUYA 1LBHA 1CUFA 2ZTMA 3RH0A 2DETA 1RJWA 2QP3A 4QYXA 2J3QA 3HFJA 5DGHA 1W88B 3JYNA 1ISPA 2EAUA 1W5TA 4HLUA 2QLTA 3HN2A 3Q11A 5G0UA 1I36A 5IUJC 3DMNA 1HC7A 4XRGA 4LGMA 1KYZA 3B1KA 3L1KA 4PZUA 4AMYA 2BUAA 5JQGA 4H3KB 4JLSA 5E1DA 3VNRA 1PT9A 3URMA 4K9LA 1N7JA 3HUTA 1D5CA 1BS9A 4UZSA 1BQ3A 3V2HA 2X7HA 2H65A 5K45A 4WBSA 2UVQA 2EGHA 3EFEA 4PSDA 1RYZA 3K9LA 2P6PA 4YQZA 2V8OA 3EPRA 3N2IA 1TFUA 3TKLA 4AKEA 2OBYA 4RMGA 2ZRQA 4WOCA 4BZWA 5AW6A 1KO8A 1KKLA 1KEKA 1JI0A 2WIDA 4DN6A 1TFRA 1QYWA 1ULTA 3Q5DA 3C8MA 1WNTA 2RC6A 4O29A 2AH5A 1ZGZA 5AJZA 4F5ZA 4XGIA 6LDHA 1E5QA 2VA8A 1ATZA 2PUCA 3SC4A 1L7PA 1CPYA 5L7YA 2FZ4A 4OIMA 3OIYA 4MIKA 2G4CA 3A9VA 5AK5A 1EE2A 3GZTB 4B76A 1X7YA 4YLEA 4BJHB 1IZ8A 4DIMA 1IUPA 3JX9A 2EZ4A 5D1NA 3HJAA 4V03A 5CDTA 2WSLA 2FDRA 1NP7A 1IY2A 4QAJA 4EHBA 2NLOA 3FOBA 3IMKA 1Y4DE 3SYNA 1U8CB 3Q87B 4B43A 4RTOA 4FGSA 1UBNA 4FFWA 3F47A 4H27A 5JYBA 3IUQA 2QTFA 1B4DA 5EWMB 4DHWA 3WTBA 2BM1A 2D54A 2J4DA 1SVUA 1ZJ4A 3VBEA 1GZVA 1EAMA 3EVBA 1Y6GA 1EWRA 2RG1A 4JLJA 1R0XA 1YXMA 3JCZA 5JMWA 5IM4F 3OUUA 1DMRA 1QIEA 2P27A 1BEUB 2P40A 3GI1A 4XPIB 4DZZA 4BGDA 5F9HA 4TUYB 4XSGA 5JARA 3WIEA 3PCXA 5FPHA 4QU5A 2WNHA 1NUQA 4GPBA 4QOGA