3I92A

Structure of the cytosolic domain of e. coli feob, gppch2p-bound form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
257
Chain Sequence
MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ferrous iron transport protein B
publication title Structural basis for the intrinsic GTPase and GDI activities of FeoB, a prokaryotic transmembrane GTP/GDP-binding protein
rcsb
source organism Escherichia coli
total genus 80
structure length 257
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i92A01
4OHVA 5FPYA 4WZAE 5EE3A 2F9MA 5FTKA 3QXSA 1KI6B 3P20A 4WOPA 1G64A 2WWWA 3TW8B 1KKLA 3GJ3A 1MT0A 1VIAA 3RHFA 1D6JA 4HUQA 4A8JB 2O8DB 2ZSFA 2XOKA 1R5BA 3AVYA 4JLJA 4JVNA 1GG2A 3K70C 1II8B 2B21A 4S35A 1W4CA 3HPQA 3GLGE 3THWA 2GZDA 3BRWD 3IHWA 1E79A 2REXB 1HY3A 5FFMA 3L0SA 2QMHA 1A1VA 4D4KA 1G3IA 3FKSA 3O47A 1TPZA 2YWGA 2F3TA 4QJ4A 1GILA 1NG1A 2HDNB 4L5BA 1NSTA 2LCFA 2QAGC 3D3QA 2WIAA 2IA5A 1E9SA 4N1AA 2HF9A 3F3YA 4UXIA 5HZHA 2NZ8A 4AK9A 3AKEA 4A0HA 3EC1A 4JLBA 2CK3D 2F1RA 3OIYA 3ADBA 3CF0A 2IXEA 5G40A 4RFSA 2WOOA 3W90A 4DCNA 4QBIA 2W2TA 3WBJA 1KO8A 3AVQA 4KYIB 3GJ4A 5CIQA 2QPTA 4LYHA 3HWSA 1LW7A 2V1UA 1P73A 2NOAA 3W3AA 2GXQA 4KFUA 2WVJA 1S1MA 1TX4B 5DNYB 2ZAOA 1SXJD 3KJGA 1SVWA 3BE4A 3D6TB 3GFPA 1E2NA 1SVSA 3U5ZB 1RE0A 1JJ7A 5JSZA 3P4YA 1KAOA 1JPNA 2BOVA 4P32A 3L2OB 3KKOA 1P7CA 4NYJQ 4DVGA 3SR0A 1OSNA 1T3HA 4D0LB 3K8YA 1GKYA 3C5CA 3W8RA 3LXXA 2FPKA 1XTKA 2KE5A 2ZJBA 2VTKA 4JVSB 3BIFA 1U8YA 3AGPA 3RAPR 2OXCA 4B6FA 2ERYA 1ESNA 2HJVA 3CPEA 1DTSA 2YOHA 4XWOA 3M1IA 2VHJA 1TF7A 3L0OA 2JEOA 2YHSA 4OK3A 5DISB 5JS8A 4MRPA 2RGAA 2FEMA 1EFUA 5FPTA 1E1QA 4HB4A 4R9UC 4MITA 2ANBA 4DCTA 4K46A 4AYTA 2YNMA 4JLMA 3GFTA 5F98A 2OBNA 3QEOA 4LYFA 5L3SA 1YE8A 2P6UA 1QHHB 4M2LA 4F93B 3CWZA 3P27A 1KSJA 2V3CC 2ZYTX 1ZP6A 4RKFA 4OI0A 2ONKA 4W7SA 2VQSA 5EP4A 3D31A 1XPOA 1EX6A 1YZLA 2Q3HA 2YVUA 1R0ZA 3KXKA 4Q21A 4Q1DA 4YXWD 1NVVR 2SHKA 4OQMA 1W5TA 3NH9A 2IUUA 4HATA 2VRWA 5HKKD 3VNVA 3EW9A 1G7SA 3AF1A 1EFRD 2PCJA 3WNBA 1TAGA 4FMCB 5D3QA 3MFYA 1W5SA 2WIBA 1G21E 4UXHA 3K09A 3KKPA 4QGAA 1ZAKA 1CTQA 2WSSA 2GXUA 1E9AA 2ZE6A 3ASZA 3SEAA 2AXNA 4A6XA 3FFBA 3JVVA 1A2KC 2AD5A 2FZLA 4MKGA 5F3WB 3RS2A 2XZLA 2HEIA 4NU0A 4XWAA 5F9FA 3HR7A 2V4ZA 4DB4A 2ZR0A 4TL9A 2ZRHA 5BYJA 4XOIA 1J8YF 1XMSA 3CWQA 5L3VA 4NYMR 1IN5A 4OK5A 4LSGA 4IHQA 4URWR 4QBFA 2JJ1D 4FXPA 5H8WA 2PJRA 1I2MA 1W2HA 2D7DA 4EPTA 4F92B 3IBGA 4MRRA 3CUEF 1R7RA 4Z54A 1RPZA 3RANA 1R0YA 4Q1BA 2QMEA 1FUUA 5CK5A 3MCAA 3U60B 2W2XA 3B7GA 2GJSA 4BFYA 1X8KA 4HAYA 2D74A 1GRRA 2OFOA 5EP2A 3SC3A 2EYUA 5D3MB 2VA8A 1M6NA 5SZKB 5C2JB 2QY9A 5EXXA 3AVXA 1E0JA 1VPLA 1SGWA 3B9QA 4HI0E 1F48A 4IVQA 1Q22A 4I4LA 4IXNA 1XF9A 3CF2A 5B57C 4PPQA 5TMPA 1SVIA 1AQYA 2X1VA 1CJVC 1S0UA 3CRMA 1LS6A 4PQRA 2OFWA 2OG2A 1XEWY 2HLDD 2PL3A 2X77A 1ODFA 2IYZA 1NVUQ 1WDTA 2C2HA 3TAUA 3VU9B 3GLGA 3EG5A 3R8FA 4UNRA 1TUEA 1GZSA 1NN5A 1GNPA 2WMOB 2C04A 2GAOA 1A2BA 2NO6A 3VKWA 3UWOA 3NDPA 3NHAA 3I4LA 1E2JA 2ZRJA 2VLIA 3AVPA 4BZPA 4KFSA 3LQRA 4X8HA 5DSZA 4AYWA 1UBEA 1OIWA 2PMKA 1G20E 2WKPA 3NXSA 5FOSA 2QBYB 3X1XA 2OLKA 2R44A 1T5IA 5KDDA 1GDDA 4F91B 1CF4A 5JMTA 1T3LA 2DYKA 1CS4C 3K9NA 2R9VA 2HCJB 5FL3A 1KOFA 3K0FA 3QG5A 5KUTA 4G1UC 2P5TB 1OHHD 1AGPA 3H4MA 3NBFA 4FMBB 4XD7A 5JHHB 1KYIA 5LBIA 3SHWA 2ODNA 2IBMA 2BEJA 3P4XA 1FP7A 5JJIA 1W2GA 1KMQA 1NSFA 3PQCA 1YZQA 3DMDA 3KQHA 1K6MA 4P4SA 2FV8A 4Z1MA 1Q57A 4M4SA 2QEQA 4RCZA 5DO9A 3SDZA 4IW3B 2JIZD 5JS7A 3WRXC 2GESA 1YRBA 1Z28A 2H16A 1UBGA 3CRRA 1KIMA 2BMJA 3THYB 1M7BA 4Q4HA 1JPJA 1Q12A 4GSYA 2C95A 2Q3MA 2QQ0A 3QF7A 1ZD9A 4X8LA 4LRWA 1NLFA 4V02A 2W6IA 1JB1A 2I4IA 3L43A 4EUNA 1W0JD 4J0QA 4ASUD 4EPRA 2ZJ8A 5LB2A 2UZ3A 3Q3JB 1ZNYA 3QBVA 4AC9A 1N5LA 2L0XA 3MUFA 2PLRA 3B1XA 1NLYA 3U7FB 1BH2A 2IS2A 4G5SA 1E2FA 3NWJA 5GJBA 3UK6A 1NN0A 2RGNA 3WNDA 1ZJ6A 2XNSA 5FPSA 2ZTSA 3B9PA 3UMFA 1AQUA 4W5HA 1MKYA 1ZD1A 1W1WA 2Y8EA 2E87A 4G3XA 1KZ7B 1Z47A 1F5NA 1LS1A 4MGIR 3AVTA 3I61A 2HF8A 2RGDA 4Q4AA 5FH9A 1T8UA 4ZO4A 5LD2C 3U44B 1E9EA 1HT2E 121PA 2VYFA 2FA9A 4PHHA 2KJQA 3D7MA 1JXMA 3PITA 4LPSA 2R6FA 3Q5DA 2NO1A 4O3MA 4I99A 2RGGA 2QTFA 1ZC4A 3QKTA 4QXAA 3AEZA 4MQBA 4UNQA 2J7PD 5IRCD 2J0UB 4HSEA 2XXAA 3CRVA 3K70B 3MAAC 5EUQB 1FQKA 2QL6A 3X1DA 1E2MA 4WXPA 1VCIA 2BIFA 2R62A 4W5JA 2GCOB 1TQ6A 1U98A 4K8OA 2J59A 4QG7A 5EE9A 2BVNA 3L82B 4L16A 4TMVA 2RGXA 2BKUA 2Z4RA 4TYQA 4OHYA 1US8A 1OXXK 2C9CA 1VTKA 1ZCBA 3F0TA 2NPIA 1P5ZB 1U94A 2OM2A 2ERXA 2N42A 4CT4B 2QAGB 1HTWA 4F7WA 2RCNA 1ZIOA 4ERNA 4N0DA 3X1WA 4Q1CA 4TZ6A 4CW7A 2B6HA 1WB9A 1N5JA 3PEVA 1I4TD 4FINA 2Z83A 2OILA 1Z0JA 1N5KA 2HYIC 4BZQA 4YDHB 3ONWA 1NRJB 3FHCB 2Q0HA 1E2HA 2NZJA 1ETUA 2FSIA 3TQCA 4DCSA 1DARA 1OH8A 5CLQA 3QF4B 1DO2A 1E0AA 2PT5A 4DDWA 4F4CA 4BECA 2RGCA 1E32A 3IIJA 2EFHB 4LV5B 3TKLA 2GJAA 2DHRA 1A4RA 4ESVA 4O2LA 2QI9C 1XTQA 2GZAA 1KNQA 2DFTA 5AWFC 4TZ0A 2FFQA 3IO3A 2OLJA 3ZH9B 4PXAA 5FBQB 3TUIC 1LF5A 3C16C 3RLFA 4DEYA 1P62B 5L3QA 1TNDA 4LC0A 5BN5A 5HCIA 1UADA 4JVLA 3I5YA 4GI7A 1XNJA 2QRZA 4OQNA 1QVAA 1K8RA 2AKYA 4HB2A 4YMWA 2O8EB 4GMDA 1G1MA 5G3ZA 1LF0A 3MWKA 1JAHA 4IJMA 2OXRA 3CRW1 4A0GA 2QAJA 2AN9A 3EX7C 5DGXA 3MJHA 1T0HB 3DM5A 2Q9AA 3OESA 1CBUA 2GK6A 3AF4A 1JR3A 3ETLA 3CX7A 4DHEA 1Z0DA 3DZ8A 2FMXA 3Q5EA 1AGRA 1VCNA 1TTTA 5E7IA 4C0HA 4HAWA 3SI7A 1AK2A 3LW7A 3GCGA 4FIDA 3SE0A 4JKYA 1T4GA 5CB8A 2ZUCA 4Q02A 1SQ5A 1CR1A 3EPKA 2Z5FA 4EPWA 3NC0C 1Z08A 1P61B 3EXAA 4GOXA 4US1R 3O8CA 1LTQA 3R9XA 2Z43A 1XJ0A 3BWDD 5AUOB 3QKRB 3QXCA 4RD4A 4XVUA 3KX2A 5J4LA 4LJ8A 2A5FA 1XCGB 3B6EA 4Q47A 1UF9A 4DLTA 2A78A 2ORVA 4GFDA 2ZRBA 1EK0A 2XB2A 5KO2A 2QRNA 2J7KA 4M22A 1SHKA 2AXPA 1IN8A 1EFTA 3FYHA 4KFRA 4WAUA 2CVHA 3A1UA 5B2ZA 3W5IA 3ZQ6A 3ZVRA 1CRPA 3RSOA 5EP1A 2ZRKA 5H70A 3UG7A 2ZS7A 3S1AB 3R9IA 3V00A 1ESMA 2BMEA 3U3KA 3K0CA 3U4QB 5J4YA 1RVDA 3W3ZB 5LPNA 2H57A 1SXJE 1KI4A 2C9YA 3NG1A 2PX3A 4V0NA 1DVRA 2RHDA 3KXIA 4JVMA 2GVZC 1JQJC 1M1YE 5C4MA 1KY3A 1BKDR 3LBHA 1XMJA 2C96A 1IY0A 1MOZA 1NLZA 1XTSA 5K8LA 1N25A 1V43A 1OT3A 2W00A 1YU9A 5ELXA 1BMFA 2PBRA 1O87A 4JLDA 2BCJQ 1P2UA 4UNSA 4B43A 2R6GA 4OKSA 2J1LA 4IRUB 2BDTA 2CBZA 1E96A 2O5VA 2OE2A 2TMKA 4PQFA 1RW4A 2V7QD 1U8ZA 1KMHA 3U3JA 1XEXB 2AK2A 1GAJA 4B3DA 5BWMA 3SOPA 1ZU5A 2WPDD 4LBWA 2D2EA 3HU2A 5TB5A 2ZXUA 4MYHA 1CR0A 2ODBA 4RFVA 2FOLA 3THXA 1ELOA 3PIRA 3SYNA 1Z0AA 3SN6A 3ZZ0A 4CDGA 1GL9B 3QQ5A 3SBEA 3BXZA 2WWGA 1IXSB 3HYRA 4C0LA 4YC7A 3B2EA 3ZS8A 1NBME 4PR0A 4B3GA 1EGAA 1GKIA 1XXHE 1G3MA 1Z6TA 2GEUA 4BQSA 4M53A 1VYUA 1XXHB 2OUKA 2CHQA 1VCOA 3SZRA 1VG1A 3CONA 4DLVA 4QKQA 5JCZA 1J7KA 2YINC 2WKQA 3SU8A 1S3GA 4A2QA 2PX0A 3IILA 2W0MA 1JR6A 2B92A 2GCPA 1FZQA 2ZI4A 2KBFA 3C15C 1TQ4A 1W0KD 1IJFA 2DBYA 4UNNA 1MV5A 4X8OA 2QMUA 2X8AA 2REBA 5JLJA 1GTVA 2ZPTX 5L8VA 2CL6X 1VKJA 2J0SA 4Q9KA 1XB2A 4JSYA 2KBEA 1W46A 4FD2A 2G1JA 4OL0A 1XU4A 3UATA 1N0UA 4TMXA 1WCV1 3F5FA 1LFDB 4RZ3A 4Q9JA 1NP6A 2C77A 2HXYA 1XD8A 2AHOA 2ORIA 1N0WA 4II7A 4ILEA 4MDFA 1ZU4A 4DSOA 3KXLA 4PHGA 2ZRCA 2DR3A 4E07A 3E5HA 3T06B 1G8FA 4DLSA 2P3SA 2CNWD 2ZI7A 2ZUBA 3WMGA 3SNHA 1GRNA 3ZZUA 1II0A 1J90A 4C4PA 4AKHA 4HLCA 4D4LA 4AKEA 1YHNA 2P5SA 4B48A 4MGZR 3U3MA 5EE0A 3CLVA 2VSOA 3NHBA 5CLLA 2H1LA 3K70D 4HDOB 4TMWA 2ORWA 4DKXA 3GPLA 5KNDA 1DPFA 5KNCA 2G88A 1OFTA 4HB3A 2XNDA 1XTJA 2FWRA 3OFNA 4LBVA 1LY1A 1QVRA 2F1IA 1U90A 1Q3TA 2EFGA 2V6JA 4PPGA 2F7SA 2WJVA 4DDUA 3FMFA 3TVTA 3SS8A 2GCNA 3L8ZA 2V6IA 3NKVA 5J5CA 3RC3A 3SYLA 3UG6A 2PZGA 1RKBA 2ZI3A 2ODWA 3W34A 1JEEA 3TRFA 1SVMA 4IKEA 2K5UA 3G0HA 1MO5A 2NQ2C 4NH0A 5DN6D 5JFGA 2OEPA 3KKNA 2PEZA 4LI0A 3R9WA 2AD1A 4PC2A 3R7WB 4I1UA 3PJRA 2QSZA 4WXRA 4PC1A 3VAAA 1QHXA 3EARA 1JBKA 4D80A 2BM1A 2DCUA 1P60A 4G5OA 1S8FA 2D2FA 4BFSA 2FE4A 1G8GA 3QKUA 4MGYR 3EA5A 2J0QA 2H18A 3EIEA 2OCAA 1G6HA 2WBLC 5LD2B 2CK3A 2WV9A 4QC2A 1NIPA 1KSGA 2O8BA 2FEOA 5KSOA 4UKDA 3LAWA 4BE7B 3AP2A 2VHUA 3MSXA 4M9XA 5M04A 4JLAA 5FTNA 5EXTA 4EJSB 1WMSA 3LX5A 1G4UR 4NCHA 4EQ6B 4F4JA 2ZJYA 4POAA 3QKSB 3KDSE 4BLOA 5KYKA 2QE7D 4LJ7A 2OBMA 5DHFA 5KSYA 3ZD7A 1W7AA 3LRPA 1SXJA 4KSCA 4Q66C 4ZDWA 4TTPA 2AL7A 1Q44A 3RWMB 4A1FA 1OV4A 4TQ9A 4NKRA 1GM5A 1E2KA 2ZS9A 3GLFA 2FFBA 1GITA 4OBEA 1SHZA 2A5JA 5KSZA 3GLHB 2PH1A 1S9HA 1KO1A 1YVDA 3IDQA 3K0AA 4GL2A 3TW4A 1OB2A 1KSFX 2NO0A 4DT1B 1J8MF 1UKVY 2DFNA 3U6KA 3KJEA 3EAQA 2R6CA 2BJWA 1XEWX 3I1FA 1CIPA 4TTRA 3TSOA 2BM0A 4N3NA 1JQLB 1YR9A 2WAXA 3TJZA 3AVVA 4AI6A 1Z29A 1ZUHA 4MDEA 2CEAA 1G7RA 1FX0A 2VO1A 4DLRA 3B5JA 3RC8A 4M1WA 2OAQ1 5TARA 1Z6YA 2GBLA 3B60A 2QP3A 3RABA 3KFXA 1IY2A 4U5XA 5IF9A 2W6JD 1N5IA 1ZW6A 4QM7A 5BQ5A 4ABYA 2O8FA 1QDEA 2A7QA 2RAPA 2B7BA 2BBSA 1KI2A 3P1JA 1E9CA 4QHTA 2C8VA 3JVUA 4GDFA 1DAGA 1GSIA 2CMKA 3C8UA 1W36C 1X8JA 1CJTC 1U81A 4MUBA 4NBSA 3T61A 2QENA 2UKDA 3PG5A 4A82A 2FF7A 1T91A 5C4GB 3WYAA 1W48A 1QRAA 3MJRA 3OAAD 3QENA 2YWHA 2F1HA 3AQ4A 1EFRA 5BW8A 2KI5A 5E7JA 2QU8A 2QTHA 4L15A 4JBWA 3CO5A 1G41A 1H65A 3UPUA 2VP6A 4FW9A 4ZV4A 1XD9A 4BLRA 3OEHD 2IW3A 5HCNA 5BYKA 1DEKA 4LX0A 1RYHA 4DB2A 3CPHA 2I1VB 3KKQA 4C2TA 1U0LA 2MSEB 1IXZA 5A0FA 3AF3A 5CYPA 1G8PA 3HP1A 1ZIPA 3VR3A 3W5JA 4ARZA 2QP4A 4BUJA 3B8HA 4Q1AA 1KJWA 4RSGA 1MABB 4Z51A 1RJ9B 5AJWA 3A1SA 1NBMD 421PA 4NYIQ 3ZVNA 2JJ1A 1IBRA 1R8QA 4C7OA 3AB3A 3PUXA 3B1VA 2RB4A 3AKCA 4KBGA 3GEIA 4FWTA 4CEJA 4Q7JB 1X6VA 4EIWA 5IHPA 5P21A 1XP8A 2IHBA 5BN4A 2WMNB 3SBDA 1C4OA 3H1TA 3SHFA 4HZUA 4V03A 2R8RA 1E9DA 1MO3A 1Z0KA 4TWZA 3BOSA 3TMKA 2ZM5A 2F43B 4GNKA 5JWRA 4TLAA 2YYZA 2Z6VA 2OFXA 4LJ4A 1DG1G 3WRYC 4PHFA 4C30A 3SQXA 2VH5R 5E4FA 5G3YA 4DSNA 1DOAA 3T5DA 2IUTA 2IYTA 4ZCLA 3KUCA 1KGDA 3PUYA 3TBKA 3U2QA 2ZVQX 1QF9A 4MUAA 2ZJ5A 3CW2A 1SULA 1ZYUA 5SZJA 4E5UA 4JLNA 4YMTA 3LY5A 1N6NA 2VSFA 1OKKD 1B23P 1R5OA 1B0UA 3G82C 4M9ZA 3V9PA 1WE2A 2HLDA 4LWZA 2JLVA 2VIIA 1L2TA 4M1SA 4WA7A 5FBRB 2G9NA 2ATVA 5CIWA 2FDCA 3CX8A 2D4HA 1L8QA 2ZRNA 1YRAA 3GEHA 1E99A 3KZ1E 3PFIA 4MA4A 2C9OA 4W9MC 1GFIA 4LZZA 2DB3A 1N6PA 2I1QA 4L9SA 4GP6A 3K0EA 1FPMA 1QG4A 4FMDB 2NO7A 4LOAA 4LY6A 1KNXA 4M9SA 1NI3A 4Q9IA 4DCUA 1WBBA 3BH7A 2YWEA 2XZOA 2J9RA 3GD7A 1Z2AA 2X2EA 1IN4A 1YZGA 4OQXA 1KI6A 4I1OA 3AM1A 1KTVA 1EFHA 3UMRA 4BLQA 4PTLA 2CLDX 1KJZA 1QZXA 4B3FX 5A4JA 1UJ2A 1HUQA 1KDOA 3WMFA 1OHHA 3HR8A 5FL7D 3CR7A 5FI0B 4A8JA 5HR5A 2O8DA 3RNLA 4M21A 3Q7PA 1II8A 1AS0A 2IEYA 4YMSA 3AUYA 5FTMA 5L3QB 3VR4A 3U6BA 3CNNA 2JLUA 4LJ5A 3W9YA 2P2LA 4V0KA 1P75A 4IEEA 1J99A 4CF7A 1YJ5A 1U9IC 4BRWA 4ZIRA 1XX6A 4LC1A 4AWXA 3A4MA 1T8TA 2JIZA 4JBXA 3I32A 1NF3A 4A0FA 2GEDA 4CZ2A 1VCMA 3ND8A 2IXGA 2QG6A 4CT5A 1YR7A 2BHRA 2ZROA 2ZRLA 1VECA 5FBLB 2F1JA 2PMDA 3HPRA 2G3YA 3Q8XB 2YOFA 4DLYA 2VPPA 4Q48A 1W0JA 4ASUA 3BD9A 2O0JA 4WZ6A 2BBOA 1ZNZA 3G5UA 1H8ED 3PEYA 1UKZA 3NC1C 2IYQA 1IN6A 3BH6A 3QXHA 2JLXA 4CEIB 5JRJA 4M1OA 3KJHA 2X19A 4TYYA 4KVAA 1NVXQ 4A6PA 4QL3A 2WWXA 2VHTA 2XJ9A 2OO7A 2OESA 2RHMA 4LK2A 5SZHB 2IYXA 3B13B 1CJUC 3IEUA 2Q9BA 1NG9A 1J70A 4URVR 2IS6A 1HURA 2VF8A 3RDPA 1C9KA 4RKEA 3BS4A 1X3SA 1VHTA 1X1RA 5LDDC 4ACAA 1L4UA 4FWIB 5CB6A 3U3OA 1DS6A 1OXSC 4EAQA 5HTKA 5J40A 3ZIAD 4BFXA 2QT1A 3AVOA 2Q6TA 4PSAA 4XSHA 3REGA 3OE7D 1UAAA 1DAKA 2JLWA 2ZJAA 2J7PA 1E9FA 3QIAA 1AKYA 2ZYWX 1F60A 3MRSA 3CKLA 3AP1A 2CJWB 3GFOA 2GXSA 1X86B 5JI2E 4KHZA 1RZ3A 4TSFD 3VKHA 5FUYA 4XJXA 4NCJA 3ZQJA 2JLQA 1TEXA 2IS1A 2VP2A 4R2HA 3GJ0A 4G0NA 2F55A 5L3RA 4MKHA 3WMEA 1V5WA 3NIBA 1OIXA 2ODEA 1M7HA 2WWYA 1NJGA 3BJIC 3EC2A 2I3BA 3VMFA 4LUCA 4IEIA 1QHHA 3ZVMA 1EXMA 3C14C 3SJBA 1NN3A 3X1ZA 2FG5A 2HUPA 4Q9HA 3RS5A 1ZM9A 2VL7A 4BFZA 4Q19A 3UXMA 4DUGD 2ZRDA 3FE2A 2WICA 4KJZA 2WSMA 4GOJA 1OE0A 4YQFA 2JLYA 1CR4A 3FMIA 4UQOA 4U7DA 1R0WA 4EJSC 2RMKA 4FCVA 4RZXA 1IN7A 2GAAA 1BOFA 2P67A 4QFMA 2KWIA 2CCJA 1EWQA 5HE9A 2A5GA 4EFMA 3CB4A 3HDTA 5GJWC 2IWHA 4ZDIA 1XBTA 3I8XA 1E0SA 5FBWB 1AZTA 4MKIA 5JECA 4LGMA 2GTPA 2QPOA 4Q4JB 1XTIA 3KTAB 1IXRC 1II9A 4TLDA 4DZZA 1E98A 3EIHA 1S3SA 4DLWA 4WVFA 2WKRA 4D4JA 1XD2B 2P0EA 2IX3A 2BKEA 2YC4C 3DEFA 4CEHB 1KK2A 2ZVPX 1E3MA 2YOGA 2O0KA 1NY6A 4IDOA 4LYAA 3P32A 1GUAA 5TY0A 3TE6A 4IDQA 4OJKA 2IYWA 3GEEA 4YDSA 1IQPA 3VX3A 1R5NA 3ADCA 3LNCA 1EWRA 4PZYA 4B76A 3QXXA 2ZRIA 1ZD8A 1G8HA 3IHLA 1KJYA 2QP9X 5FR1A 3EPLA 1YQTA 1ZM4A 1HE8B 4KI0A 4RZ2A 1CU1A 1IHUA 2BBTA 3U61B 4NTZA 4UJ5A 4Q9LA 4PAMA 3KB2A 1W4RA 4Q5IA 4XWKA 3FHTA 5TV2A 3X1YA 5JJLA 1G291 4DC9A 5EP3A 3GMTA 1N6RA 1SKQA 3VFDA 3ZJYA 2OZEA 3SFVA 4HLUA 3DHWC 5DYIA 1W36B 4B2PA 4BFTA 2QORA 2QN6A 2CL7X 2LKDA 5AUQA 5JRZA 3VR6A 3P26A 5AJYA 4IFEA 5FOWA 2JLRA 4LJAA 3IBYA 1CRQA 1E4VA 1XDBA 2C98A 3N2EA 3GLIE 1P9RA 1KO4A 5JZVA 2WJJA 5HZKA 1P9NA 2B7CA 3GLIB 1T5LA 3EWSA 1HA3A 1RRGA 4MRNA 4BRUA 1F2TB 3F8TA 3PUVA 2V54A 3Q9LA 4KLZA 2XITA 1ANKA 4JL8A 2YJTD 4JMPA 1D9ZA 3Q72A 4OQFA 3VU9A 1AKEA 3LQQA 4AIIA 3K0SA 2JCSA 3CF6R 3I73A 5FUWA 4TQUS 4URYR 2MSCB 5J4VA 3QEJA 4BFUA 4Q03A 4PO1A 5F9HA 1CULC 3A4LA 4GT1A 1WBDA 3JZMA 1KDRA 2Z4SA 1I4LD 4C0SA 3PUWA 2QBYA 3N5CA 3C41J 5DI3A 1P6XA 1U0HC 3SYKA 2R6DA 1JECA 1OH5A 2FNAA 3I8SA 5KOYA 2V7QA 2YV5A 4RD3A 2AK3A 2V55B 3FFAA 4HAUA 4QNMA 4AURA 4R71A 1UPTA 3ASYA 3VKGA 2ZITA 5KPDA 1E2QA 3DL0A 2RGNC 2WPDA 2ZRPA 1X8LA 5GJVC 4S2EA 3T35A 5JWOA 5AJVB 1DAMA 2IXFA 4TYWA 1YZKA 1OFIA 5CDFE 1R6BX 2DFKB 1K5GA 4TMKA 1TF2A 2ATXA 3I92A 2IUSA 2EU8A 1XJCA 3M0EA 5E7MA 1QHGA 1N0VC 4QNRA 1M34E 2AWNA 2YZ2A 3KQLA 1KO7A 1XCPA 2ZI6A 1Z0FA 4HUQB 4EFLA 3THYA 2ZRMA 2EWVA 1L7VC 4OHWA 4ZPXA 1Z07A 2QPAA 3B85A 3KQUA 1KI1A 4UNPA 5FOXA 3THWB 1FUKA 4XTRA 1W0KA 4D4MA 3IQWA 1OXVA 2OBLA 4I1SA 1UDXA 1Z8FA 2NG1A 1RIFA 2OT3B 2FJUA 3AUXA 1KI3A 1HQCA 4EDHA 4Q7KA 5J4KA 3ADKA 4DIEA 4Q4LA 2VP4A 1BYIA 1KDTA 3PENA 5EJEA 4XVRA 1RYFA 4QJ5A 3ZGXA 2PZEA 1CXZA 2IYYA 3NBYC 4Y0VA 3T34A 2EVWX 1HV8A 3R20A 1GIAA 1OYWA 1KHTA 2ZQ5A 2OCYC 1G3UA 1XJQA 2MMGA 4LV6A 4US2R 3B78A 2CHGA 2XSZD 2OCBA 1J2JA 2XTZA 3BGWA 4BLSA 2XAUA 2LWIA 2BJVA 4RFSB 4HUTA 5JBQA 4BPBA 1FX0B 3T1VA 3U44A 2CNWA 2CHVA 1COWD 4PC7A 1QHSA 4TL8A 1XTRA 4CRWB 1FW6A 4IOMA 4URZR 4URUR 2GJ9A 3VR5A 4TLCA 1TEVA 2ZRGA 3DKPA 1QBKC 2OSBA 4JJKA 5C18A 1FP6A 5EE5B 2V8OA 2J0UA 4Q7LA 2FSFA 4QGFA 5ANRB 5FOVA 2EYQA 4URXR 1PZNA 1Y3AA 3FGNA 4JLVA 3W6NA 1AS3A 3EPJA 1BIFA 4Q18A 4LJYA 3E2IA 1L4YA 2GCOA 4RD1A 2CLSA 2XZPA 5IK2D 3TSZA 5JSZB 3QVUA 1TUIA 4JIMA 2HV8A 5EXPA 1JJVA 1KDPA 5FR2A 4A2WA 1TL7C 1Q1BA 4BEBA 1FTNA 3IIMA 2QAGA 3LLMA 1EG7A 1DE0A 3AVWA 1TU4A 3QPUA 4HAXA 3J81k 2ZYUX 2JGNA 1SKYB 2J45A 4LHYA 1MR3F 3U7EB 4QRHA 3VTKA 4PC6A 3O8RA 2RGEA 5JCPA 5FPHA 1U99A 4TLBA 2IWRA 5DN6A 2DWPA 2QGNA 3MGCA 1GL6A 4FMCF 2HXSA 1AS2A 1Y63A 5TXGA 2WJHA 3C4JA 2GJ8A 2WHXA 3ND9A 4B6EA 1LV7A 4B44A 4LJ9A 3OF5A 4ZI2A 5C46F 3LH5A 1IOZA 1ZUNB 2G0TA 2WWHA 3QF4A 5SZIA 3A4NA 4RD6A 1NKTA 1EFCA 1U0JA 3VR2A 4JL5A 1XPUA 1ZMXA 5L3SB 1IAQA 2ANCA 4OJQA 1HH4A 3WNCA 2JDID 3KL4A 1A7JA 4EFNA 4M8NE 5AUNB 1U8AA 3ADDA 2J5XA 4JZKA 2H92A 5DHAA 1LNZA 1SVOA 4EPXA 4C7OB 3CNLA 4XIGS 4PPNA 1NL3A 2IK8A 4GZLA 3DZDA 1OH6A 2O8EA 4ITRC 4NYIR 4A92A 4Y0AA 3KFVA 1TQDA 2IL1A 3DM9B 3EPHA 3CPJB 2DFLA 2BMDA 2G77B 4DDVA 4E03A 4YONB 3TUZC 2VHCA 2PT7A 4LV8B 1CKEA 2ZRAA 1RRCA 4P4TA 1RRFA 2EQBA 2QE7A 1AJEA 1E6CA 4GOKA 1G3QA 1OIVA 3LVQE 1K5DA 1KO5A 1TADA 4LHZA 4PZLA 4D26A 3VR1A 4ZKEA 4BWYA 3PVSA 4TL7A 1NMZA 1ZBDA 4OHXA 2XB4A 4IVPA 2ECKA 2R6AA 2CE7A 3CRQA 5B64A 3BFXA 2O0HA 4RJLA 1WA5A 2G6BA 1YZTA 3REFA 2MMCA 3QKRA 5E95A 5EXSA 3RRMA 1UBCA 1OYYA 4C0KA 2WWIA 4P3YA 2ASEA 3GJ7A 4QBHA 3W8NA 3PEWA 2VP9A 1W36D 4B71A 2JJ2D 1FNMA 3ZYCA 4LHVA 4AD8A 4XTCS 2FGKA 2GA8A 4C0AC 4ESHA 4AKGA 4P4UA 2CCGA 3MLEA 1Q1ZA 2LKCA 3T15A 2VF7A 4HZIA 4R2IA 2HT1A 4V0ME 2FGJA 1E1RD 3S1AA 2BEKA 4P31A 2CL0X 5HPYB 1FQJA 2KSQA 3RRZA 1ZNXA 3U4QA 3KJIA 1RRPA 2HCBA 3DKVA 2P6RA 2W6JA 1XZQA 4JYCA 1DAIA 2FPLA 3OEED 2HJGA 1P2SA 4Z8XA 2OHFA 2Q3FA 3EZ7A 4KO8A 2JAQA 4KU4A 4WIAA 1DAFA 3D8BA 2IF0A 4QHSA 4AG5A 3DOEA 2CDNA 2D7CA 1PLJA 3EZFA 1P4SA 2H8KA 2GNOA 4IXMA 4JLOA 3RS3A 4I1VA 3GLHE 4GRAA 3NEYA 1DBSA 3PEUA 2VHQA 1E2PA 1PJRA 1W44A 1P9WA 3RYTC 3RSLA 2ZE8A 6Q21A 2XGJA 5BN3A 3TR5A 4MYCA 4IOLA 4TYPA 4US0R 4KSBA 2ZE5A 1AIPA 3GQBA 4G5RA 1G9XA 1A5TA 3OAAA 1KAGA 2H7VA 3H0KA 5JEDA 3TAHA 3GLGB 4D0GA 4ZIRB 4D25A 4TN1A 2GILA 3QPVA 4F4IA 4A4DA 1XEXA 1KZGB 1JNYA 1XPRA 4TT3D 2GHIA 2H5EA 3NH6A 2OV2A 4PZZA 4WW0A 4P33A 4PAOA 3UANA 4Q7MB 3OEHA 2HYDA 1HYQA 1XCMA 3A1VA 4JT4A 4B74A 5KTYA 4PC3A 3GP8A 2O8CA 4KV9A 4ACBA 3BFKA 3ZVLA 3PUZA 4LBYA 4TQAA 1H8HD 2D3WA 2R2AA 1E2GA 2RKOA 2DWOA 3UMSA 521PA 1N2CE 3OIUA 1C1YA 4NONA 5B58C 2XTNA 1NBMA 4Q1FA 3K0FB 4CYMA 3EZ6A 1S2MA 3BFVA 1DG3A 3B1WA 3LX8A 5AK0A 5AJZA 4A9AA 1BYUA 1XXHA 4B47A 2UZIR 4BLPA 4YMUA 3NTUA 4XVQA 2XOKD 2CXXA 4TTQA 1AN0A 1P2VA 1KY2A 3M4YA 4YXWA 3NBZC 2BBWA 3L8YA 3BB1A 5HKKA 3CBQA 2WJGA 2JLSA 1SZPA 1Z6AA 1E79D 2NPFA 1DAEA 1GL7A 3H2YA 5JI3E 4P4SB 3FKSD 2A30A 4DLUA 1UKEA 1U9IA 3CH4B 4IDNA 5FOTA 1DADA 3FPAA 1YR6A 4Q4HB 2EWWA 5FBVB 3VNUA 1F2UA 1NY5A 2ZJZA 3EZ9A 4B32A 1WP9A 4DLZA 1YKSA 4R98A 2IYSA 4JSTA 1JALA 2IYRA 5CM8B 5K8IA 1MH1A 4A36A 4V0LA 4HLQB 1E94E 2GJKA 2Z0MA 3LBNA 3K1JA 3QNUA 1GNQA 1OKKA 4DJTA 2JATA 3CZPA 3DDCA 4IFBA 4IOKA 5AR1A 3TIFA 1UBFA 2W58A 4MKFA 4W5WA 1S96A 1P3JA 2GZHA 2ZYVX 2GRJA 1A82A 2QM8A 5KDOA 4V0OA 1Q21A 4DBLC 1R4AA 1D2MA 2AFIE 4TYNA 2ZSAA 4BASA 3B1YA 2REOA 3A58B 3OZXA 3AF2A 4HAVA 3TSWA 1WF3A 1EESA 2V9PA 4Q4AB 1E9BA 3AV0B 1GRQA 1SVLA 1VDZA 2FFAA 2GK7A 1PUJA 2RGBA 3CH5A 4HB0A 1X1SA 3A36A 1XMIA 3IPYA 5AUPB 3TQFA 4KAXA 3MWLA 4NDZA 1Z6XA 2O52A 1PUIA 2WZQA 3DMNA 4FN5A 3QXJA 1M74A 4QGGA 2GXAA 1ZVQA 4IDHA 4AG6A 1G16A 1JEDA 2GDJA 1CP2A 4M1TA 2XXAB 2XTMA 4JJZA 4R7ZA 3UIEA 2WWFA 2WOJA 4C0BA 4NZYA 5FL7A 3L0IB 1I2DA 2NO9A 1SXJC 5EZ6B 1JXOA 4DXAA 1D9XA 1UDWA 1US8B 2G83A 1VG8A 1DO0A 5FUVA 3R7WA 1HE1C 3RRYA 1E1QD 1KI7A 1Z6GA 1ZM7A 4JKIA 3T12A 1CR2A 3RS0A 2FFHA 1TQ2A 3V4FA 2AWOA 2J0VA 1VIYA 3O8DA 1G8YA 3FDIA 1E2DA 5LB4A 3ZDQA 1BO6A 2AR7A 5EE1A 1M8PA 2C78A 2J3EA 1YZUA 2OAP1 4M1YA 3CR8A 1S1CA 1E69A 4G5QA 4JLKA 1Z0IA 2QQEA 1Q20A 4LJ6A 5K8TA 1T9HA 3QVVA 4TMTA 2GBLC 5GVRA 1H8EA 2VSXA 3ICQB 3BK7A 4C2UA 3GJ8A 3IGFA 5EZ5A 1QG2A 2ZI9A 3QE0A 3LBIA 2NGRA 4EJSA 3KQKA 3I5XA 1G6OA 3DVLA 1Z06A 2RH5A 4V0MA 4EQ6A 5GJCA 3IO5A 4NMMA 4PFSA 3QKSA 3A8TA 3ICEA 1XRJA 1UFQA 1CLUA 1KKMA 2IT1A 2WSSD 4GPTA 2XJ4A 4QOSA 5HE8A 5KDLA 3TUJC 4LDJA 4DIDA 4B3BA 5CYOA 1JR3E 3T5GA 1Z3IX 1R0XA 4GMXA 1UEJA 2X2FA 3GLHA 3ZIAA 3MWYW 1OLOA 3OE7A 3OHMA 1MO6A 4BFWA 4DT1A 8OHMA 2DPXA 2CE2X 4KVGA 4ZCMA 4B2IA 4DCVA 2IYLD 4TSFA 2ZANA 1N3BA 1E0KA 4KBFA 1WXQA 3OIVA 1HQYE 1T0JB 2UVQA 3FHOA 1OXUA 3EA0A 3DPUA 1ZNWA 2F3RA 1T6NA 4PO8A 4WZBE 4NCKA 2P6NA 3EASA 3BB3A 3BORA 3WXMA 5E3HA 2B8WA 1NVWQ 1GP2A 4PX9A 1GKUB 3QSYA 4B75A 2C5LA 4L4UA 5DI3B 3UKDA 5JJKA 1U2RA 1XZPA 1R10A 1ZM2A 1HT1E 1LB1B 5CITA 1G7CA 2GF0A 4DWJA 3BAFA 4M1MA 1NJFA 1KK3A 2FZ4A 5FPKA 2BV3A 4KYUA 4DUGA 2VP5A 4PSKA 3NBXX 4PAQA 3CNOA 1Z83A 3LWNA 4OK6A 1E9RA 1CJMA 4IOJA 5FTLA 2YKGA 1Q0UA 4OYHA 3X2SA 1ZRHA 2WAYA 4AYXA 5KPJA 2MSDB 4KITB 3A6PC 5JEEA 2GWHA 4O25A 5H1YA 3K9LA 1OXTA 2IS4A 3K09C 3QPWA 5FI1B 5C1BA 2ZE7A 4HYYA 1QHYA 4D0NA 1Q1EA 4QJ3A 3PR1A 4PHTA 1Z22A 1FL9A 3IUYA 1VYVA 1PLKA 1G5RA 4GBMA 4KFTA 4DSTA 1VG9B 3RRNA 4LPKA 3FB4A 3BH0A 3C5HA 3I72A 4TL6A 4PPFA 3W6OA 3MD0A 4JYBA 2ZR9A 3DOFA 1NMXA 2ZEJA 3EZ2A 1F3OA 3ZS9A 3IKJA 1KMHB 1IJEA 2QT0A 1MABA 3M6AA 3VHLB 3QOFA 1RJ9A 2FSHA 3RS7A 3FVQA 2F6RA 1NVVQ 3WY9A 4B33A 2GEVA 721PA 3THXB 3QJYA 4XD7D 4HDCA 1S9DA 1ZM3A 3V4RA 2V1XA 3QBTA 1W49A 1KK0A 2QA5A 2XX3A 3QG1A 4NHOA 5JWHA 3FMPB 4OHZA 3NVAA 4WBSA 2J41A 221PA 4QBGB 1G17A 5CJ2A 1MRNA 3BB4A 3L0PA 4Z1MD 3NEJA 4EPYA 2WJIA 2PZFA 5GADl 3U7HB 3TGPA 1FFHA 2F43A 5G53C 4FCWA 1AM4D 3B1ZA 3KKMA 1E2IA 1XWIA 4RCYA 2FPMA 3U3RA 1E4YA 2QGZA 4DEXA 1YR8A 2BMFA 5TDHA 3TVDA 4G01B 2GETA 2CCKA 2BWJA 3GJXC 3TR0A 4C0QC 3AH8A 4A8JC 4IDPA 1CJKC 4NYMQ 4OI4A 2W6ID 1XEFA 5F2EA 2F9LA 5KNBA 4HAZA 1FMJA 2IHYA 3MWJA 3ZZTA 1BS1A 2H17A 2ZJOA 3AF0A 1E2EA 2G0NA 5DI9A 3ECCA 1GNRA 1NMYA 5CM9C 4JLPA 4RD0A 3KUDA 2QROA 3OIWA 1N6HA 3LDAA 3A1WA 5FTJA 1PLLA 3TNFA 4BFVA 3IIKA 2ZRFA 3PV0A 4BLTA 1IY1A 621PA 1AA9A 3ZD6A 1Q3HA 4NPHA 3SQWA 4B3CA 5J4HA 4NE2A 3JZAA 3SJCA 3FMOB 3CZQA 4JL6A 5D3MA 3PXGA 4K81B 1P2TA 2D06A 4Q1EA 4CGZA 5DE3A 5DLQC 3RWOA 4U00A 3FKQA 3LLUA 4OI2A 1TMKA 2HT6A 3WP0A 2ZJ2A 4MRVA 3SJZA 2QM7A 3N70A 2EFEB 2C03A 4D2IA 1TF5A 2AX4A 1LVGA 2J87A 1KK1A 5FUXA 2AKAB 2N1BA 4QHYA 2NMVA 4OQLA 821PA 1VYTA 4HEJA 3LA6A 1XFAA 3IEVA 2ZAMA 3CM0A 2Q21A 1D2EA 2VEDA 1GOTA 2GKSA 1NNEA 1CEEA 3SJAA 4HLDA 3WBKA 4A15A 4X8MA 3MG9A 4G5GA 3T1OA 2IF2A 3FWYA 4JS0A 3WHKA 5GVSA 3LW8A 4H1UA 3FTQA 4H1VA 3H86A 4KODA 3U7GA 4TMZA 2B8TA 1G5TA 1OFUX 4D82A 2E9SA 1MO4A 1N6OA 2QNRA 1OJLA 2IYVA 2A3RA 2FU5C 3VHXA 2IEZA 2N46A 1W47A 2ZU6A 2ONJA 4DDTA 3HJNA 4CEIA 4E22A 5DYGA 1O3YA 1UM8A 1W4BA 3CX6A 4L9WA 4UXJA 3WHLA 4DLXA 5CJPA 4B3XA 5EUMA 1OB5A 2QSYA 3THOA 4ZDKA 4KCGA 3SFZA 1KI9A 3A1TA 3LVRE 2D62A 1D8TA 2VP0A 2XSZA 1G3RA 3E1SA 3DO6A 3VQTA 1UEIA 4M9QA 4C3ZA 2O8BB 2J46A 4A0RA 4FI3C 4XSGA 1COWA 2W83A 2FH5B 3BC1A 3LD9A 3KB1A 1NKSA 4M0LA 2A5DA 4MYUA 2ZUDA 4O0MA 4C0JA 1RFLA 3O8BA 5EQTA 5H68A 1XMVA 1JR3D 1I4DD 3A37A 4Z8YA 1VG0B 3UWKA 4FCTA 4HDQB 2C99A 2ZR7A 1G19A 2IC5A 3HU3A 4L8GA 3LXRA 3TLXA 1WRBA 4BZXA 2CJWA 3NDBB 1SXJB 4LYJA 5A5GA 3GLFE 2P65A 3AGQA 4U02A 5IK2A 3GLFB 3I3SR 1OFHA 2PCLA 2Q9CA 3H84A 4OI1A 2ZI5A 2QMOA 3K0AB 4N0EA 1ZC3A 1M2OB 4YMVA 1R8SA 3TK1A 3WYFA 5CK4A 2NTYC 2QZ4A 4ZKDA 3I62A 2ZSDA 3RVBA 3RS4A 2FN4A 2YWFA 2ZREA 3IQXA 1N6IA 2BCGY 1S4QA 2WM9B 4M1KA 1NIJA 2DWQA 4PSVA 1W4AA 5IT5A 5KHOC 3LO5A 2EFDB 4NCIA 1KSHA 4UJ3A 3TH5A 2O8CB 1IM2A 2A5YB 2JJ8A 2ZSBA 4NL4H 1G4AE 2O8FB 3QI2A 2W0SA 4C9BA 2IYUA 4LHXA 4RVCA 4QM6A 3Q7QA 2JDIA 2PJZA 3GJ5A 4D6PA 4HLUC 1Z63A 2FSGA 2PEYA 1JAIA 3BERA 4GZMA 4ZI3A 5DH9A 1BMFD 3B82A 4I81A 3GJ6A 4H9GA 2CVFA 4ON9A 1KI8A 2WJYA 4Q4JA 5FOUA 3KTAA 5G41A 4CIDA 2R65A 1SKYE 1EX7A 1M7GA 2DY1A 2QUZA 4RZUA 1VMAA 1P72A 3FOZA 4RY2A 3AKYA 1XD2A 1FTSA 3IPXA 1ZCAA 3R8CA 4Q00A 4CEHA 1PVOA 1G5PA 1D5CA 4GP7A 4B35A 1OF1A 1MRSA 4MYTA 1ONBA 5B30A 1N6LA 1R2QA 4MGKR 3QY0A 3AVUA 4B73A 3EIQA 1ZINA 1G18A 1N6KA 2ZSEA 3K9GA 1F2UB 4YLGA 4F38A 2JASA 4KXFB 2CLCX 3W6PA 4ARZB 4NYJR 4BGDA 3CIOA 3K53A 5AJXA 4AY2A 3WP1B 4RD2A 1E2LA 4O2RA 4JBYA 1SVKA 2A9KA 4A2PA 3QUSA 3N2IA 4CEJB 2W2VA 4BEJA 4NP6A 5BXQC 5K8UA 2ZIAA 4ZDJA 2JJ2A 4IVRA 2EFCB 4PANA 1Z5ZA 4LHWA 3K0CC 1NN1A 4EPVA 2GVDC 3E70C 1TU3A 3PCRB 3K9HA 1JI0A 4HZUB 4B2LA 2WTUA 1E1RA 1G7TA 1DELA 1HEIA 1YZNA 3GLIA 4TLEA 3KQNA 2FX3A 2KB0A 2YC2C 3LFUA 3ZLJA 3T1TA 3OEEA 1F2TA 1ZUIA 3AP3A 4LBZA 4FMDF 2ZU0C 5UKDA 1FOEB 4PQYA 4QGHA 3T1QA 1RC8A 4P0TA 4XH9B 1T3SA 1OW3B 2JA1A 4B34A 5IDVA 2VBCA 3VX4A 4E09A 4MH0R 1QHNA 1VHLA 1FNNA 1IONA 4JT2A 4KLNA 2GF9A 1PV4A 4PO9A 1QHIA 2EW1A 3EWAA 2A2ZA 1GVNB 1Z2CA 2E1RA 4DSUA 5KSPA 1DAHA 4DRZA 4LCBA 2XEXA 4AKIA 4MRSA 2JLZA 3MMPA 2G1KA 3LV8A 4Q01A 2PLFA 1OH7A 1D2NA 2ZETA 1UKYA 2NIPA 1WQ1R 3AKDA 4TT3A 2AFHE 5TVKA 2ZS8A 5J47A 3HYTA 1GWNA 5KU1A 3Q85A 3C7KA 2QTVB 1FMLA 4ZCIA 1OPXA 1Q1QA 2XNDD 1F6BA 4NCNA 3WYGA 4CVNA 4EKDA 5DIFA 1H8HA 1AZSC 3OFND 5CDFA 5JHGB 3HU1A 2OCPA 3BBPA 4D81A 2BC9A
chains in the Genus database with same CATH superfamily
1Z7GA 3DMTC 4NICA 1NRIA 3NJ8A 3QWIA 3IA2A 4WZAE 4TLLB 4ATNA 1I7SB 1YRHA 3PD0A 1D4FA 3QXSA 3PXCX 3P20A 1U28C 1X8XA 4OAPA 4UU1A 3W1WA 1Z82A 3EYAA 4JJAA 4U8GA 3GJ3A 3T7KA 2QD4A 1JH9A 3JQGB 4NE9A 2ZYRA 3P9IA 3WI7A 2O8DB 2XOKA 4M98A 3HFJA 4OKIA 4YRPA 2PMBA 1P1HA 5BORA 3Q6IA 4KQEA 3K70C 4XGQA 5E6RB 3BWCA 4NFLA 3W3AH 3MCWA 2J3KA 1WPGA 3K6JA 1NUHA 3BRWD 3F9IA 3B70A 1HY3A 2CFTA 5FFMA 3AESA 1GR1A 2FP3A 1A1VA 4D4KA 1G3IA 3FKSA 3PT9A 1ZJWA 1TPZA 1GSHA 3OQ6A 1MNAA 5I7FA 2F3TA 4H7KA 4B81A 3VU1A 2VC2B 4BB0A 2FR8A 1J1ZA 1XTBA 3LCRA 3L7AA 4HH1A 1TYDE 2QAGC 1A5BB 1D1PA 2JKVA 3LT4A 4XYBA 5LQDA 3GRRA 4B6JA 4YS6A 5B6PA 2C1ZA 2ID9A 3MTAA 3KOMA 2HF9A 4UXIA 1A98A 1QK5A 1H1TA 3H2GA 5HZHA 2ZWMA 1W85A 5JC8A 4MXDA 4LQLA 5IVPA 3B6IA 1USWA 4AK9A 1X3LA 3AKEA 3UUWA 2FZ5A 3W4KA 2IGTA 1FNCA 4JLBA 2DHQA 4XRGA 1JG4A 1WMEA 2HOQA 4RFSA 4DCNA 4K9OA 5B36A 2K87A 4QBIA 4UTZA 5C8XA 1KO8A 1K7EB 2Q3DA 3OG9A 4GZ6A 4J4TA 1QDLB 2ZB8A 3RC2A 5JO0A 3WLAA 2QPTA 1OXKB 4X44A 1YF3A 2VJPA 3RIHA 1VSVA 1WNTA 1O5IA 5A0VA 2NOAA 1N0HA 1EH5A 2BTOA 3K2QA 1NVTA 2HTEA 4L9RA 1L7RA 2C1EA 1SXJD 3MINA 3WL8A 3KJGA 3M1AA 1TT5B 2XYHA 3GEBA 1J8QA 1E3JA 3GFPA 1CDZA 3STHA 1ZJ4A 1VL8A 1T15A 4NJEA 5DXAA 4J8PA 3FWZA 1ZMOA 4NYJQ 2YJ3A 4D0LB 1M83A 4EABA 3W8RA 2ZJBA 4L4SA 2VTKA 1N8KA 2AQHA 1Y3BE 3BIFA 2O9JA 5CCDA 1WXFA 3AGPA 4I8DA 1Z74A 2BY4A 1PKEA 1RCUA 4DQXA 4BQRA 2ERYA 4LZOA 1BWQA 3H5VA 1CZUA 1SBCA 1XZIA 2VHJA 2YOHA 1XVTA 3PL1A 5CAEB 5NULA 3L0OA 3ADOA 1Z2NX 4OV6B 2A6PA 2YR0A 2FXVA 1V47A 3G13A 2XB6A 4JQOA 4V0QA 2RGAA 2WM3A 1Y9AA 4XEUA 5FPTA 4HB4A 4B5LA 4YR9A 2ANBA 1BNCA 3ICOA 3NHLA 4K46A 5KJCA 3GFTA 1O95C 1RAIA 2X0DA 3UOAB 4WKCA 1U02A 2FQYA 3D8SA 1YE8A 4FLFA 5L3SA 3PWTA 1FBTA 2P6UA 3ILSA 1QHHB 2I7TA 4IXWA 4M2LA 3X1DA 4LF8B 5KTPA 5DBFA 3CWZA 4XJVA 1KSJA 1H6CA 1RRVA 5C1IA 1K5PA 4EVRA 3LYHA 2ZYTX 4RKFA 2L2QA 4W7SA 5EJIA 1RI2A 3D31A 2FOIA 2EP5A 4FBLA 1YZLA 1XPOA 1SUDA 4EYSA 2P0YA 3UCXA 1GDHA 1TKCA 5F3DA 2WF5A 3KUKA 4Q3DA 1YCDA 2Q2OA 3CZ4A 3TDMA 3U49A 4CDMA 3P9NA 3EW9A 1GGEA 4ZI5A 1DMSA 3IBSA 4UEWA 1EX9A 2HADA 1NR1A 2PCJA 2J3HA 3AF1A 3Q3GE 4KRGA 1Z33A 4MWGA 1HKHA 5AM2A 3B5EA 3QOXA 1LK7A 4KQ6A 2B4YA 1FFGA 1TU0A 3Q1KA 1KE2A 1K7XB 2PSHA 1ZAKA 3D8RA 5LP6C 3NB0A 1CTQA 2OZKA 2GXUA 3EDRA 3UAZA 2ZE6A 3ASZA 2AXNA 3K35A 5COAA 2N47A 4QYTA 3JVVA 4E6PA 1J25A 1FDOA 3ZNPA 4B83A 5F3WB 3T7SA 5G0TA 1DRKA 1FFDA 1A04A 2YRXA 4XWAA 1IB6A 2EZUA 3TTUA 2V4ZA 2QVBA 4KDCA 2AXQA 1ETHA 3I2YX 4D92A 5TVGA 1FDRA 5CFLA 2JEZA 4TL9A 3IJEB 1SG9A 1IEVA 4MIEA 1J8YF 1XMSA 3B9BA 4KMSA 5IMSA 3KJNA 5JALA 4YVFA 4YJ3F 3QI7A 2VOJA 4OUDB 1DSSG 1DC5A 4GQAA 1E7SA 4HFJA 3W1EA 4DY6A 5LZ7A 3FOEC 3IBGA 2PU5A 4IIUA 3CUEF 4WLNA 1R7RA 1LJLA 3JD0A 3I6IA 3IX7A 5ALJA 1QIDA 3RANA 3F5SA 2QMEA 1FUUA 2H07A 4RK4A 3TQHA 2JLAA 3MCAA 1G6KA 3U60B 3A04A 3BULA 4OXXA 1NT4A 1Y5NA 2VJQA 5I7WA 3UJBA 3WA7A 1VE7A 2FVYA 1GQQA 4LNUB 1HE4A 3UAXA 3K1AB 3DCYA 1PWYE 3AEUB 2IYFA 3I5UA 3LTEA 1X38A 3HRIA 1GHTA 2QZSA 5EXXA 3R5HA 2FWAA 3V97A 1VPLA 3I01M 4XQ0A 2QTLA 4ZOLF 4GOLD 1Q22A 5HEKA 4WCFB 3CF2A 3LRTA 1P1IA 2VPZA 5I9IA 4M7RA 3B38A 4AX4A 5TMPA 3MWGA 1S0UA 3DE3X 4JN6B 1LS6A 4AJPA 4MVJG 1ECJA 3AK4A 3ZWOA 1OC4A 2OHJA 1QPGA 4LMPA 3U1VA 2X8JA 2COUA 5J2TB 2Z2YA 1Q0ZA 3VU9B 4E46A 3JCZA 4WKBA 4XB2A 1K06A 1L5WA 1TUEA 2B7LA 2NT4A 2OHOA 4Y3UA 5B3JA 2C04A 1A2BA 1UC9A 3FUWA 4WLVA 3TN7A 1G8MA 1V26A 1I3CA 4D8WA 5DSTA 1TT7A 2ZRJA 2VLIA 3AL3A 1MEJA 4TTIA 4KFSA 3WMXA 4BZPA 4FM9A 1TA9A 3RREA 5H16A 4DL9A 1OIWA 3KSBC 4Z1OA 3CVYA 2GUWA 3SF8A 2JKYA 1P18A 4ND7A 5E3JA 1P39A 4WXMA 1IH8A 1WW2A 3G23A 4QREA 3X1XA 3G2KA 4GM1A 5L4SA 1GDDA 3KETA 4C0XA 2CNNA 1N33B 5JMTA 3SGLA 4MHOA 2IUYA 3UJNA 4OLAA 3JAWB 1UJ4A 2EF0A 3FXAA 3ZHYA 2DE0X 4CN9A 1I5EA 2OHGA 2R9VA 4OQEA 4PLHA 4Y1RB 1CHDA 5KUTA 1RYBA 4G1UC 4OSEA 4CETA 1OLXB 4PAGA 5JHHB 1R3UA 1SCQA 1KYIA 3AI1A 1NDQA 3S2IA 5ERXA 2UV8A 4CDRA 1JFSA 2O3SA 3ZE9A 3ZW9A 2BEJA 3P4XA 3VR4D 1CJBA 1DBRA 1G5HA 1T2AA 3H0EA 3GUYA 1NSFA 2A35A 4AX8A 3PDIB 3KQHA 3CG4A 5HFJA 1K6MA 4U9UA 4P4SA 1KFJB 5DFAA 3ZCXA 4TUYA 4NENB 3UB2A 4CCWA 4XQEA 1UBGA 3CRRA 1KIMA 4JDUA 3DE1X 4ZZ3A 1M7BA 2ACEA 4KI7A 2AGVA 1JPJA 1FYFA 1Q12A 3EH1A 3B3AA 2Q3MA 1JR4A 3ZLUA 5IS2A 3FZEA 3PFBA 4YO7A 4X8LA 2RH4A 2H7CA 1NLFA 3I05A 4DZRA 2XD4A 2QX4A 3RYIB 2I4IA 4NMHA 4MWEA 2WSIA 1ONPA 4J0QA 1OI3A 3HEMA 2PWZA 4U2BA 3D5QA 4EPRA 2O3JA 2ZJ8A 3NWBA 3PCTA 4CMIA 4AC9A 3S2SA 4F56A 4KN5A 2WZDA 1YDHA 4R41A 4Y18A 3T99A 1J2EA 1X13A 3MUFA 4G4SO 3GOQA 1NLYA 4KO2S 5G0SA 2BRUC 3BMXA 1WL8A 4JR0A 4QUGA 1EXWA 5GJBA 4PZUA 2RHBA 4BO5A 1QV6A 2ZBPA 1O58A 2Q5FA 4TS3A 2RGNA 5DNWA 1NURA 1ZJ6A 2VF2A 3UWDA 4HHEA 1AQUA 1ZD1A 4UTVA 2E87A 4E1VA 2HHJA 2CHFA 2AFIA 3QSGA 1SVNA 2AEMA 1ISHA 3AVTA 1PK8A 3LU1A 4CQMA 5JUWA 2BFMA 1RZRD 5LD2C 3MTDA 4YJHB 3U44B 3FTCA 1PWXA 4N40A 1E9EA 1HT2E 121PA 5C8YF 2VYFA 1TRHA 1PEYA 2JAXA 2KJQA 3D7MA 4O29A 2XI4A 4Q7KA 2M32A 2BEUB 1GPBA 4I99A 2RGGA 4LIPD 5T6MA 4O3MA 4K86A 4QVIA 2VPWA 4MQBA 4EYOA 4HNVA 1RLUA 3Q7RA 5DYTA 1J0BA 1MW8X 4HSEA 1QU2A 2XXAA 3RBVA 1E4OA 1OX4A 1VI5A 5JARA 3P5BA 1FDTA 2RHTA 4LXXA 5EE9A 1TQ6A 2BUCA 5EEHA 2XQGA 5JO9A 4MWTA 4L16A 4HYQA 4PTZA 2JGMA 2Q2QA 1K27A 1WNFA 2Z4RA 3CUYA 3WKDA 5A4MS 4OHYA 3KRTA 4PLYA 3TI7A 1VTKA 3BJMA 1G21A 1SC4A 1ZCBA 2NPIA 2YZ7A 3F0TA 3Q1LA 1U94A 4L28A 4ZAGA 4OHMA 3MPOA 3REOA 3SJUA 4C3VA 3RFTA 1JSXA 1M8GA 1HTWA 4CT4B 4F7WA 4RZSA 5KYWA 2WG1A 3PNOA 3UTDA 3VJLA 3G0OA 5LOVF 1ZIOA 5AJHA 3TQRA 2KQUA 4CWAA 4ERNA 4F21A 3I83A 3ZEIA 4Q1CA 2AOTB 1SD1A 3FJ1A 3KAQA 3RT9A 3FI0A 2Z83A 4JB8A 4LZWA 4A91A 3DQPA 4YX9A 1Z0JA 1N5KA 4L72A 5FNVB 1L5QA 2BFPA 3LHDA 2C9DA 4JCCA 4C43A 2HYIC 1VDMA 2Q0HA 1VI6A 2ZAGA 1TECE 4BGVA 4DCSA 5JPCA 1P0QA 1EB8A 3HYNA 4ZO8A 5CLQA 3WWCA 1B6RA 1NQVA 3YASA 3U4AA 3COZA 4FQ7A 4BZWA 4E7PA 3SIWA 1RZUA 1Y6RA 3LQ1A 3QVSA 4AB1A 1MMFB 1Z16A 2RGCA 4WFKA 2ZIEA 3TKLA 4M60A 4ESVA 4O2LA 2QI9C 1XLTC 3P9CA 3EAGA 3RVJA 1X7XB 3WGHA 3ZGYA 1OAKA 1U9YA 5GONB 1QRUA 4DEYA 1IIBA 2HLNA 2UXBB 5HCIA 1UADA 4JVLA 5K3OA 3EEQA 4YMWA 1P5FA 1UINA 5G3ZA 5DXJA 1JAHA 1AHHA 1EK6A 1P2DA 1QO0D 2P2SA 4BCDA 4TV8F 4UVDA 4YLYA 4XARA 2FEKA 1Q7BA 1Z5VA 2ADFA 4L85A 4A27A 2Q9AA 5EWMB 5K0GA 4Q12A 2VYQA 5L7YA 3UAVA 2GK6A 2IEDA 3FPEA 3ETLA 1Z8DA 1I1QB 2I80A 3BXPA 4DHEA 5HRCA 1Z0DA 5KYXB 1YVUA 2F8SA 4GKJB 1C8KA 3WSTA 1N32B 2FMXA 1AGRA 2WHPA 4D9KA 1N2HA 4D8VA 1YULA 5HKOA 4LVNA 2PXXA 1AK2A 1NUAA 3GCGA 1ATZA 2B4KA 3JZFA 4FHDA 4MPTA 4RJIA 2YHAA 1VYHA 2QVCA 5LDGA 3BWYA 3WV4A 1SQ5A 4BV9A 1CR1A 4X64B 2PGIA 1JUDA 3Q3HA 4WE3A 4ARUA 3WGIA 2VATA 9LDTA 1C41A 2CXPA 3EXAA 3JYOA 2XYVA 4MV0A 5HRAA 4US1R 4OFXA 3CUUA 3FYTA 4DV6B 2Z43A 5JIBA 1EVEA 3HFRA 1QANA 3BWDD 3EIWA 4MUGA 3VPGA 1ISJA 4MV1A 3H3XA 1UH5A 1LLDA 1TJ5A 1XCGB 3PD1A 2ATIA 4Q47A 4DV7B 3M6WA 1VJ1A 4GFDA 1EK0A 4IUCS 4X1IA 2XB2A 3DC7A 4NK4A 2QRNA 3ZOKA 1QX3A 1SHKA 3VNSA 1W4LA 1T3ZA 2C42A 2JCVA 2CVHA 3A1UA 1IM5A 3PGXA 4KX3A 4UVEA 4V2UA 4RHUA 1AQIA 5CR9A 4KXUA 1HEUA 3L0ZA 1QRTA 1L5FA 4MMZB 5DYYA 3HYCA 2BR4A 4MR9B 1Z37A 4RPHA 4WKOA 5K3BA 1ESMA 1CUFA 3R9IA 3TRHA 4WASA 3ZHTA 1IE3A 3GJYA 2XVMA 2H57A 1SK9A 2ATEA 2O50A 4U2GA 5JADA 2PX3A 3OP4A 5GV8A 4V0NA 3KJZA 1KXZA 3EBLA 1DVRA 1E5TA 2GSDA 3BJRA 1PEKE 4JVMA 4MR7A 4N65A 5K0JA 1JQJC 4LF7B 1GAXA 3QVTA 2PSSA 4WV3A 5TQVA 1ZMTA 2F3UA 4N39A 5C4MA 1KY3A 4X7MA 1I7LA 5JQGB 3HK2A 1NLZA 5K8LA 2XVAA 5AOCA 1BA2A 1OT3A 4QA9A 1YU9A 4U2EA 4Y9UA 1GPNA 3AJ9A 3IAAA 5ECGC 5BN3B 4FOPA 4LWPA 4CKBA 2YYAA 5GWXA 3I53A 3EOBI 2R4TA 3GQBB 3HY6A 4J16A 1YZ3A 4JLDA 1XZGA 4P84A 3EUWA 2WIKA 3CZCA 2J1LA 4FBGA 1VLVA 2VWHA 1R0KA 2BDTA 2W6CX 2XCQA 2E48A 5HVNA 4W5TA 5IM4F 2TMKA 2O2GA 4PQFA 2V7QD 5EQJB 4QXQA 3IJ5A 1XEXB 3LLSA 4G1MB 3W6ZA 4CF6A 4B3DA 5TR9A 3CFYA 1XOIA 3HVKA 5J63A 3ESCA 4ZOEA 2BTEA 2W2PA 4ZRDA 1TCVA 2IZ7A 4BDSA 3ONVA 2BEVA 3KM0A 3THXA 1G55A 3SYNA 3N0WA 1Y1SA 3TW0A 3E7PA 2AH5A 2P41A 4UUMA 3SS9X 3ZZ0A 4D8XA 1QE3A 3B5IA 1GL9B 1WAMA 4NMWA 5AKZA 3SBEA 3UQYS 4AICA 4CCSA 3KKEA 5AH0A 4C0LA 1MAVA 2E18A 2IHZA 3LHFA 4M89A 3WK4A 4ARSA 4UDYX 1GGJA 1NF9A 1IOWA 2HK7A 3PR3A 3T7RA 1PX0A 1XZEA 2YQ5A 3SJ7A 4MSUA 5DM60 1Z6TA 1G3MA 4MVJA 3ZK9A 1PZFA 4G07A 5DT9A 1T5DX 5HKLA 4BQSA 2V4MA 1NR5A 3ED1A 1KVRA 4EKIA 1N3IA 2XUAA 4MW9A 4NAUA 1WG8A 1RP7A 5IAKA 4LZAA 1J7KA 4DLVA 1I24A 2WKQA 3SU8A 1S3GA 3PEFA 2PX0A 3MC1A 5CBKA 1JR6A 4FYJA 2GCPA 5D7BA 4FK8A 2JGKA 4WJKB 4YY3B 1GYQA 1P4JA 1V1RA 4TZ6A 1BXZA 3BCSA 2REBA 2JAWA 5L8VA 2CL6X 1F6WA 1XELA 3E7DA 4Y2XA 3FBGA 4Q9KA 3KE8A 3UXYA 2YV1A 1VJDA 4JSYA 4YTEA 5F1KA 1W46A 2UYHA 2BE7A 3GIDA 4ISBA 1N0UA 3OQPA 1CY7A 5ALXA 4UATA 5DTJA 5CFOA 2RK4A 3P2KA 1UPAA 2PLAA 4RZ3A 3V6LA 4Q9JA 4RZQA 1NQAO 2F8MA 4FDMA 4FI3F 2AHOA 4OMCA 3RH0A 1XDUA 4ZZ0A 5JROA 4TROA 4NC9A 4QPPA 2DQKA 1V3TA 1NQTA 4ZQEA 2ZRCA 3IVGA 4LRSB 2OZPA 1XQ1A 1F5SA 4AY5A 1TVKB 4DLSA 2ZUBA 2CNWD 3UMBA 3N2GA 3WMGA 1GRNA 1J90A 1RXSA 4AKHA 1BH6A 1H94A 2GN1A 1DIBA 3G8DA 4FZJA 1N36B 3VR5D 4AKEA 1YHNA 2JGAA 3OSZA 1C3XA 1U3GA 3RI3A 2R5NA 2P3LA 3D64A 1GZ3A 5A4DA 3PF9A 2OGTA 3P9PA 4L76A 3DJFA 3LGSA 4I6EA 3HVRA 2H1LA 3EBPA 3OOHA 3FFTA 4TMWA 2ORWA 2DKFA 3V8EA 5JH7F 1TVMA 1X7DA 3AHFA 2J9YB 1GV0A 4HJRA 5KNDA 2VRBA 3NVKI 1E3TA 1DPFA 2D0PB 3O92A 5IYZB 1QC5A 2XNDA 4H3HB 2NV2B 3O3NB 2NP7A 3AWDA 1MA3A 3JQBA 4LBVA 3L1VA 4ER3A 2R66A 4N76A 5G2OA 2P7IA 4K9LA 1U8CB 1OTHA 2ZSJA 3PQEA 4KAFA 4F2PA 3ILYA 3D9QX 1XRQA 2F7SA 3D5EA 4DDUA 5IAEA 3E5NA 3FMFA 4QTTB 2D1SA 3GZJA 4RIGA 3SS8A 1YQXA 3PFFA 1O94D 5COBA 2WD7A 5J5CA 3ETJA 3UG6A 1R4NB 4C05A 3HVHA 4F11A 1RKXA 1KQ3A 4EI2A 2W9XA 3VR0A 1LWOA 2GPTA 1SG0A 1SVMA 4IKEA 2K5UA 4QLOA 3G0HA 3HXMA 1MO5A 1BFDA 4BMDA 2OD7A 5K03A 1BXGA 1U2QA 1GRCA 2ILTA 1W0CA 2NQ2C 4NH0A 3H83A 4X41A 1P5HA 2PEZA 3HA3A 4CDNA 4CXMA 2NACA 1T5SA 4I1UA 2Q5OA 1L7PA 3DMFA 2DFVA 5CPFA 2WM2A 2C0CA 4J0FA 4RTJA 3AETA 5AHOA 1QYDA 1IRIA 2I71A 3A4TA 1CS0A 3ZLTA 2PZMA 1AXRA 2DCUA 3HKEA 3VPCA 3NTLA 2PV7A 3RTBA 1LPPA 5KOHB 1VHQA 3M6UA 4LOKA 1HNZB 4MGYR 5HS4A 1ZK2A 2VK8A 2H18A 2WY2D 2XTJA 3KK0A 1T6YA 2NUBA 2OCAA 3OC0A 2VDJA 4B0OA 1NI4B 4AXXA 3H5WA 2VNKA 3GBVA 2BKVA 3BXGA 1BG6A 1IEWA 5LXTB 4PSUA 4QC2A 3FY4A 4CQJA 4JXZA 1KSGA 3L79A 2EDAA 1LSSA 1BHQ1 3V4VB 2VLBA 2R00A 3GGDA 3LWDA 2G5PA 3AP2A 3FM9A 5C34B 4JLAA 1TZKA 5EXTA 4MRMB 1G4UR 1W25A 5B2FA 1N1EA 1CQXA 3QM1A 5EWJA 1NT2A 3DJYA 5KYKA 5DHFA 3ZD7A 4GF5A 1GZ6A 2AG1A 1Y7LA 1JIKA 1ADFA 4LZLA 3Q3IA 1Q44A 2GEJA 3TLJA 2Z9BA 3D8UA 1WCIA 4UU8A 3DMRA 2ZBEA 4TQ9A 4NKRA 2P9EA 3BSYA 3H9BA 3SM9A 1OFGA 2FFBA 1TLFA 1SHZA 3K0AA 3IDQA 3OJ0A 1SUAA 1DBQA 1J8MF 1X1AA 2DFNA 1KJ8A 3MB8A 4LOLA 1AHIA 1M2GA 3HCCA 1DCTA 3BDAA 3R7LA 1G8SA 4WFIA 3VDQA 4DV2B 2Q62A 4DYDA 4D6XA 4YP9A 3I1FA 5D8DA 1S89A 1CIPA 4TTRA 2X5NA 4C03A 5ALVA 2BM0A 4BIIA 1YR9A 3ROFA 3TJZA 5JTUA 3AVVA 3D1LA 3M3PA 4RPLA 4MDEA 5BYAA 2RHWA 4G1EB 4KQ9A 1G7RA 3FNQA 2VO1A 4G1VA 2VK2A 4N3CA 5AFSA 2VJCA 2W11A 1MJ5A 4R68A 3L9XA 1H3FA 2GPYA 2QL5A 4R2KA 2KHZA 1PQWA 2Y93A 1OZFA 4Q34A 2XCUA 2OTCA 2BGRA 2BFBA 1I7QB 5IF9A 2Q4OA 3NOQA 1VJRA 1JSLA 1YUNA 1WY5A 3N2ZB 4E33A 2O8FA 2UZ1A 1QDEA 2A14A 4UUQA 2C8VA 2O4UX 3DZBA 3JVUA 1DAGA 2CMKA 2FMUA 1PJ3A 2IFTA 5DX0A 5GPBA 5JAZA 3WL4A 1MRZA 3PKZA 4MUBA 2C4NA 1QQ6A 4NBSA 3PC8C 3T61A 1UM9A 4I4CA 4L73A 1CHNA 3PC3A 1N5RA 2QB5A 2X7XA 3BWBA 1LDYA 5EEGA 5HF8A 2O3TA 2EIXA 3SXPA 1T91A 5SYAA 1E3EA 1U1DA 4ZWNA 1XKQA 3OAAD 3QENA 4D45A 1AC5A 1PQPA 3AQ4A 2SKDA 3BTUA 5J59A 3SIPA 4DVJA 3UBMA 3ZDBA 1PS9A 1U4OA 3JTEA 2QU8A 2F64A 3GNTA 2PMCA 4DUPA 4GEKA 4JBWA 4I5FA 3CO5A 4N8EA 2V6GA 4U2CA 3UJ6A 3UPUA 4ZV4A 4EBBA 3N87A 2JIOA 1Q74A 1AGXA 2WYHA 3OEHD 5FYQA 2G07A 5HCNA 1W5EA 1Y8RB 1DKLA 1J97A 4C2BA 4Q39A 4L4XA 4FTWA 1G38A 4ZAVA 2F8TA 3KKQA 4DLPA 1B93A 4C2TA 3F6YA 2EKLA 3AF3A 5BUSA 1HG1A 1Y1KE 2QJRA 3B8HA 5B7PA 3ER9A 1SKAA 4RSGA 2D2XA 3RBXA 4ZK6A 2H1VA 1QKKA 3UMMA 1YCHA 1GZVA 2LCIA 4UD2A 421PA 3IXMA 3L7KA 4L4RA 3ZCSA 5HSGA 3KQMA 4HN4B 3TJRA 4TTAA 2PYZA 3PUXA 4ZVVA 4FWTA 1QZUA 2M9MA 3AY6A 4KBGA 2DEUA 2HMUA 1X6VA 2VJMB 4EIWA 4OGLA 5MGNA 2BFDB 1Q77A 3C45A 1GRVA 4J7CA 1XP8A 1D8AA 1R6VA 2HAEA 2FZCA 2PRZA 5BN4A 3H1TA 2GNAA 2PWAA 5KAPA 3AEQA 2O5CA 4XAQA 5KYVA 1XYYA 5KCZA 1SCJA 1E9DA 1R9GA 3HVJA 3PSHA 1IJBA 3BOSA 1XU9A 1I4OA 2F43B 3PQ3A 2MSLA 2PX5A 4NEQA 2XRFA 2YYZA 1VI2A 1V3QE 2EJTA 1T0BA 5TE9A 2NU8A 3FLBA 4BCCA 3GF4A 3OPXA 3WRYC 1E5QA 2YS7A 5EIBD 4OTZA 2VH5R 4IP0A 5G3YA 1QSGA 2DTDA 4NATA 4MK4A 2V0NA 4R5HA 2IUTA 4DSNA 2QN1A 4FNAA 4RTMA 2VYVD 3ZY6A 2ZJ5A 1SULA 1ZYUA 2V6FA 2XT9A 1YI8A 4ZHQA 5IDQA 4JLNA 2D5IA 1BW9A 2YVQA 5LQCA 1TC2A 5IAJA 1B23P 3N0XA 1Y8QA 1R5OA 1B0UA 5LIRA 2FUNB 2I76A 3QELA 3WGZA 2A9QA 2R6ZA 2VIIA 3PHBE 1VHJA 4LWZA 2JLVA 2G9NA 1VL5A 2ATVA 1T1IA 3QQPA 1UZLA 4UBIA 5BN1A 1CG6A 5C1OA 4LF4B 4EY3A 2VDQB 5C37A 2XQIA 4QOEA 4G2NA 2OQRA 3CGGA 3F6PA 1X70A 1YMVA 2XPCA 2K4MA 3R5XA 4WOJA 1AQNA 3I37X 2O7VA 4DWOA 1JFRA 3BMNA 1YB6A 3LUFA 3AR7A 4HYTA 4EUFA 1GT6A 2Y0PA 3FYUA 1KJNA 1Y37A 3GGGA 4LZZA 5LU9A 3AOEC 4X60A 3U1BA 4CFSA 2DB3A 4L6IA 3O5AA 3X44A 2NO4A 2NO7A 4FMDB 4RCVA 3T5BA 4EH1A 1RCTE 2VDLB 5CVJA 5EC8A 1D04A 1DTWB 2Y1XA 3PTLA 4RK6A 2J9RA 4ER6A 3HCBA 1Z2AA 2V59A 1JKFA 2ST1A 3EEBA 1I51A 3IRUA 4DIKA 4I1OA 2W2MA 4LKOA 2NYAA 5JSQA 4MZXA 3SX0A 3UMRA 4PHCA 3TPZA 3IT0A 3TW8A 5KTNA 5H9WA 5B58T 3O1HB 2W37A 1UJ2A 1KDOA 1BU8A 3AXTA 1H2RS 5HR5A 1Z5PA 2H4XA 3H1PA 3VMMA 4RY8A 3QLVA 1HSZA 3TSCA 4ETNA 3RVSA 1AS0A 1OMOA 2QZ9A 3AUYA 4GPAA 5FTMA 2EOAA 1BX3A 1BXKA 1RQRA 2WLTA 4A6DA 1J99A 3MTQA 3UWPA 3RUHA 2H1HA 3F49S 3I3OA 4AWXA 1S4MA 3FSEA 4C4XA 4CI9A 1JDVA 2HH9A 3SZLA 4LDQA 5JVDB 1HXHA 2GEDA 1SC1A 3TCNA 5JT1A 2G63A 4KG7A 3ND8A 5A05A 3IS3A 2IXGA 1EE1A 1XRLA 3I34X 1FFAA 1YR7A 2ZROA 1JFVA 1U4SA 1CLEA 3C39A 4M86A 4DUZB 5E6SA 3D8HA 3WYCA 1VL6A 2C0QA 1OUMA 2EGGA 2F1JA 2HN9A 2IOFK 3FTDA 2YCLA 4DLYA 1EFPB 1DQNA 1PNRA 5AW3A 2QTZA 1PQUA 3GFBA 4MQEA 4Q48A 3AR2A 1Z0ZA 4P3XA 3A6HA 4WZ6A 2CJPA 4NXMB 3G5UA 4I5IA 3PEYA 3K8QA 4FHCA 2PNJA 1Y7IA 5HW0A 2AE1A 4N8SA 3ELBA 2AC7A 3BTSA 4RVGA 1KY4A 3KJHA 4W1SA 5A3VA 2X4IA 3STTA 5IAOA 3QYJA 2F1OA 1W5BA 3CZMA 1FLVA 3II6X 4QL3A 2WWXA 2VHTA 3C24A 4RSMA 5DW3A 3ZWYA 2RHMA 1W59A 2XUFA 2YN4A 4LK2A 1RAAA 2IYXA 2VDRB 5IUJC 3TLAA 2FSVA 1KS2A 1J70A 3NQ41 3D2CA 3MXTA 2I6UA 3ESAA 2EV9A 2VF8A 1CC1S 4RKEA 4YRDA 3BS4A 4AP9A 2ZDHA 3PNYA 1DZIA 1FFSA 2WG0A 3S0JA 4AS2A 1VPVA 4FWIB 5ALHA 5CB6A 1OX6A 3MUEA 3ICVA 1PG5A 3EGOA 4U1RA 3WWZA 1RXWA 2QY6A 2WM8A 4MARA 4V39A 3SF0A 3CSSA 1X1DA 2QT1A 3MIIA 4XSHA 3OE7D 4TQGA 1UAAA 2JLWA 2ZJAA 1AKYA 4ETWA 3CKLA 4HRAA 3AP1A 2ZZNA 1P2FA 3GFOA 1QGED 1ZVKA 2M98A 2YW9A 3PX2A 4P1ZA 4R8SA 4X6YA 5JI2E 1L4BA 5K4HA 1NF8A 4EELA 1RZ3A 1HNNA 1P1CA 4JJ6A 1LRKA 2IITA 5FUYA 4D9FA 4MTLA 5HMMA 2NNLD 3WAGA 2JPDA 3L4EA 3T94A 3KELA 4TRNA 2EKPA 5EUCA 4EI9A 3WLQA 3ZQJA 4P3PA 2JLQA 3KZVA 5M3BA 5FAKA 4EVQA 2IS1A 1JAZA 3IOMA 4RQAA 4F3TA 2YZKA 1SBQA 5L3RA 1Z75A 4MKHA 4U2DA 1VKNA 3D0KA 5IC4A 5TF0A 2D13A 1TDJA 1T8SA 2ZYIA 1LZKA 2R87A 3AW8A 1V5WA 2WU8A 1OIXA 3I30X 3NIBA 3Q3CA 3QUBA 2ODEA 4C7BA 2O6HA 4PBSA 3BJIC 1WSWA 4IHJF 3VMFA 1A97A 5F73A 1RHJA 3BRSA 5CLFA 4YCLA 1KQPA 1UANA 4JDPA 2NVOA 1EXMA 2P9JA 3D6AA 4R84A 4D9CA 1NN3A 3Q8KA 1UMDA 1W29A 1NPDA 3DOHA 2FG5A 2HUPA 4BFZA 3BXOA 3UXMA 1DBVO 2VJYA 1GPJA 4G24A 1C2YA 3A2LA 2WICA 4XDZA 3GK3A 3LUAA 4FNOA 1OU4A 4GOJA 1KZ9A 1XJWA 2OVFA 4UQOA 1JWBB 2IIVA 3Q41A 1ZONA 4KMMA 5E38A 4EJSC 2RMKA 2DOKA 2OCXA 2P67A 4UU0A 2Z3WA 3DUWA 3EFHA 5BV0A 2A5GA 2C2WA 2PA0A 3K94A 1N5MA 2P2DA 2QLJA 2O2EA 3W5VA 2W2KA 5EWLB 3SXUA 2G4CA 5F2KA 3BRQA 3ELUA 3ESQA 4K88A 4EZBA 5LP1A 1UKAA 5JMWA 1YRYE 5FHQA 1E0SA 4PLVA 5H3LA 1K8YB 4PYKA 3W2EA 3W05A 3U1TA 4DZZA 1II9A 1EVLA 2B30A 5AVUA 2PSDA 2NVUA 4XPIA 4IVNA 1AXEA 1V71A 4D4JA 5CYFA 5K05A 1XD2B 2P79A 3PNVA 3HWWA 1OWNA 3NLLA 4WK0B 3DEFA 5DX8A 1KK2A 2Y0DA 3CEHA 2YOGA 4YBZA 2O0KA 4B8ZA 1M5TA 4CMAA 2IH2A 4IDQA 4OJKA 2X9LA 3NHWA 4YDSA 1YRWA 4CMEC 3CCBA 3ADCA 2J5RA 3LNCA 4WJLA 3IC5A 3PQ4A 1YZVA 4CM8A 3IHLA 2CZQA 4R3UC 5B55A 1T3GA 2QP9X 5FR1A 3KEQA 1UBNA 4LXQA 3UJ7A 5H4GA 4H59A 2GZSA 2ZJ3A 3FZYA 2OR3A 1S6YA 1F8FA 1HE8B 4KI0A 4KQIA 1CU1A 4WLUA 2BBTA 1ZI8A 2OB2A 2D3TA 3ANMA 3EQ9A 3HI4A 3N1UA 1J06A 4NTZA 4F5ZA 4PAMA 1TMGE 3MGKA 1B3BA 3IT3A 2FW0A 4BDTA 5AI4A 2VQ3A 4C6RA 3SICE 3GRKA 4H0FA 1UMCA 5D1NA 4DC9A 1AD2A 5JPIA 2IXTA 4N5DA 5BR8B 2R2GA 4HLUA 4KPYA 2EAUA 4QUEA 1W6RA 3R8XA 4E21A 3BTVA 3MK31 4YAFA 4JY7A 2FZGA 4DC0A 2QN6A 2CL7X 2LKDA 3O26A 4M0CA 2IEGA 3VYSB 3VR6A 1YBFA 3ZHRA 5IYZA 4H1TA 1P4GA 4KVZA 4TV9B 3IBYA 1E4VA 2ZQYA 4UAGA 2TECE 3R3WA 3HXQA 4IINA 4O5OA 5CXSA 1YQUA 4DFDA 4EGAA 3GLIB 2G7ZA 3GL9A 1V6CA 5SICE 3T9BA 4MRNA 4BRUA 4KLZA 2F9FA 3F8TA 3CCCA 3HLYA 2G25A 3KWJA 1NR7A 3Q9LA 2P9BA 4OGFA 3HJGA 3WLEA 3A3YA 1C9EA 1DC7A 3BWXA 1IBCA 4QXRA 4CKWB 3JQFC 4BNZA 1U7PA 2E5LB 1CB0A 5CG2A 2D8AA 3CISA 5EHQA 2JCSA 1FVXA 3I73A 5FUWA 2C9BA 4XA8A 3TXYA 3E2MA 4EB0A 3QEJA 4MI6A 3CH7A 3L7NA 5EYPB 2AV6A 1C1DB 5LA6A 2AA3A 3RTEA 1WCYA 3O4IA 1Z4LA 3QU7A 3G8YA 2E37A 4GT1A 5BQFA 5F9HA 3ESDA 4V3CA 3KALA 3FF1A 4JOSA 2Z4SA 2XBUA 4C0SA 4XGNA 4DPKA 5HIAA 3PUWA 2BI4A 1DRJA 5CCXA 1P6XA 6AT1A 4YB8A 2R6DA 4JEMA 3I8SA 3N6VA 5KOYA 2YV5A 2MSWA 2PPVA 4DQKA 4ZT3A 2BM9A 5KJ6A 1ZS9A 2IU4A 3UCFA 2ZITA 5KPDA 2J6HA 1W88B 1E2QA 1E1CB 2WPDA 2XGMA 3KC2A 3LYUA 4GBJA 4BWVA 2XBLA 4RZIA 5JWOA 3AU9A 4BGUA 5EFZA 4Y9SA 1PKXA 4DLBA 2IXFA 1OFIA 2C59A 4WXHA 3FDFA 3E58A 1PGOA 2QTBA 1J42A 1B8UA 1KZYC 1R6BX 4I2VA 4BAZA 2WTNA 4PFJA 1AKMA 1K5GA 4BNYA 4WFJA 4CCAA 5CYGA 4MEAA 3T0GA 2F48A 1TF2A 1GZ4A 2AOUA 1Z6PA 4L5AA 3BTOA 5FUBA 1G0NA 1UFVA 3KPWA 4GVXA 2RONA 3M0EA 4U9HS 5E7MA 4YCNA 1ZK1A 1QHGA 1HLGA 3CZAA 3ZHCA 5ED4A 1NP3A 5EZYA 5JDIC 1DU4A 1YS4A 2C7RA 1P81A 2R11A 2YZ2A 4KN8A 4MQUA 5K09A 1KO7A 2HNBA 3EVAA 3KE9A 3G9TA 4WNAA 3E0QA 1Q92A 1X80B 4H3VA 3BDIA 1VP9A 3B85A 3AC0A 3CVXA 2A0WA 4IJVA 5FOXA 5AESA 3CMMA 3O4VA 4RIHA 5JCJA 3IP1A 5A6SA 2PRYA 3VAZA 4D4MA 4GVPA 4CKZA 3AESB 1U5AA 1XZFA 5EINA 1UDXA 1Z8FA 2NG1A 1RIFA 2OT3B 4TRRA 1HQCA 2FPSA 2XUPA 4KOAA 5LWHA 4DIEA 1KRHA