3I92A

Structure of the cytosolic domain of e. coli feob, gppch2p-bound form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
257
Chain Sequence
MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the intrinsic GTPase and GDI activities of FeoB, a prokaryotic transmembrane GTP/GDP-binding protein
rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Ferrous iron transport protein B
total genus 80
structure length 257
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i92A01
4FXPA 4Q5IA 4KXFB 4BFZA 3V4RA 1L4YA 2F43B 3C41J 3QEJA 4U00A 5AJWA 2QTHA 3A6PC 2V9PA 1XF9A 4OI0A 1AS0A 1P2TA 2CHQA 1FUKA 1XX6A 1Z3IX 4Q47A 1GM5A 5CIQA 1F6BA 3K53A 2ZRAA 2XOKA 1JPJA 1MV5A 3B1WA 2GXUA 1S9HA 2FOLA 4KODA 3TUIC 4HZUB 5GADl 2EWWA 4MYUA 5ELXA 4LYHA 1JJVA 5IK2D 1IOZA 1XU4A 1ZP6A 5LBIA 1Y3AA 2BDTA 2W2TA 4YMTA 4U7DA 1VG8A 3QXHA 4BFUA 1II8A 2C9OA 2ZUBA 2H7VA 5HR5A 1MO4A 4I81A 4EPYA 1EGAA 2A78A 2R62A 1XD8A 3TSWA 4ASUD 2WJGA 2C78A 2Q3FA 4ZKDA 2XTNA 5JRZA 2IHYA 3WP1B 3CWZA 3B9PA 4BE7B 1MO6A 1T5IA 2HEIA 2Z43A 1EX7A 3CRVA 4QFMA 2G0NA 5IF9A 1AM4D 2IYXA 4N3NA 2ZIAA 4QRHA 1Z6YA 4HAWA 3QKRA 4PPNA 3TLXA 4B76A 2VHJA 2WBLC 3N2EA 4GP7A 5L3SB 2V1XA 3QG1A 3IILA 2CJWB 4FMCB 1EFTA 3VFDA 1ZNWA 2BBTA 3RHFA 4NYMQ 4HDCA 5FBLB 2JDID 3I92A 3EWAA 3DO6A 4Q1CA 1YVDA 2RMKA 4TTPA 1SKYE 3CKLA 1U2RA 4KJZA 3CF2A 3QEOA 1J8YF 1UBGA 4QKQA 1YR8A 3GJ6A 4XD7A 1Q20A 4IOMA 1J70A 1XTJA 3OZXA 4F93B 4E09A 5JJKA 1XMVA 2H1LA 1Q1BA 2VTKA 1A82A 3HWSA 4AKIA 4M1KA 1KAGA 2C03A 3QXSA 2OE2A 3TW8B 1X86B 1SKQA 4TT3A 5GVRA 5HKKA 3P1JA 3TUZC 2EFDB 4TQUS 2ZM5A 4B3BA 3DM9B 2AN9A 4TMKA 4DDWA 2JIZA 1PUIA 2JJ2A 4G1UC 3DZDA 5J4LA 1R5OA 4TQAA 1HQYE 4G5SA 1W5SA 4XVQA 1E2FA 4Q03A 3VKGA 5L3QB 2J5XA 5H1YA 4QGFA 2WMOB 4DUGA 3RAPR 2REOA 3MAAC 4NYIQ 5DYIA 3SI7A 1E4YA 4Q19A 5G3ZA 1XTIA 5JCPA 4WBSA 4JBWA 3CNLA 3SBDA 3LY5A 4UQOA 521PA 3THWA 1M2OB 1NRJB 2JJ8A 2C95A 3TR0A 1RYFA 4M0LA 3EX7C 5FI0B 2GVDC 2VPPA 2LCFA 2MMGA 1H65A 5JJIA 3BWDD 5DHAA 3TSZA 4TZ0A 2QA5A 3B8HA 1DAMA 2QTFA 2IYYA 4L9SA 2J1LA 1OXTA 3ICEA 1AS3A 4CEHA 4PC6A 4B3GA 1XXHA 2GBLC 4ERNA 4AG6A 1EWQA 1H8EA 1RRFA 4BPBA 2R6GA 3LRPA 4MKHA 3JVVA 2BWJA 3Q85A 4BEBA 5EZ5A 4HB3A 4I1SA 1E2PA 2ODEA 2DWPA 3GD7A 3T1VA 4YONB 2QL6A 1MOZA 2BMFA 1S3GA 2R6AA 1Q3HA 3BOSA 4WXRA 3EIHA 3TAHA 5EP4A 4BFWA 1OFIA 2QAGA 4NDZA 4ZIRB 4L16A 2V7QD 2XNDD 2FWRA 5CLQA 3CONA 1N0VC 1KHTA 3EZ7A 4RZXA 3SYNA 3CO5A 3UMSA 2O8DA 2KWIA 4MH0R 3CRMA 4ZDIA 1JPNA 3AF4A 4GZLA 4ITRC 3THWB 1HE8B 1QHNA 4X8MA 1NBMD 3TKLA 3AKDA 2B7BA 3NIBA 1ODFA 4RD4A 4PPFA 3AVYA 4M1OA 2GEVA 4JSTA 2ZJZA 1MKYA 2PMKA 1SKYB 3BE4A 3K09A 4M53A 2VHCA 3T61A 1ZCAA 2WAXA 1NBME 2NO0A 3NEJA 5HE9A 2BJWA 1XJCA 1ZW6A 4ZO4A 1XD2A 2FSHA 5KU1A 4QXAA 3U3MA 2W6JD 2ZU0C 1G7CA 1MO5A 1Q21A 5JMTA 5A0FA 4HDOB 1VYVA 4M8NE 4ON9A 1CF4A 1SXJE 1G18A 2IF0A 2RGBA 1E2LA 1PV4A 1P2UA 3P4XA 4EIWA 1E2QA 1E2HA 3B60A 3GLGE 2WIAA 1Q1ZA 2XZPA 1CULC 4IFEA 4PO1A 3P20A 2IYTA 4IJMA 4Z8YA 2BBWA 3O8CA 4LYFA 2JGNA 4JKYA 4P4SA 5KNBA 1QG2A 2ZQ5A 4ZCMA 4QNRA 2VP2A 4P3YA 3WP0A 2HF9A 3OFND 3Q5DA 3EIQA 3EIEA 4Q66C 4B48A 5EJEA 4QHTA 1KO4A 4WZBE 2HCJB 4GPTA 4P33A 5FUYA 1UAAA 1O87A 1XNJA 5M04A 1GP2A 3BBPA 1DTSA 1ZYUA 1M34E 4IDHA 5JWOA 1R8QA 1G3QA 1Z6XA 3CPHA 4DSTA 1ZM2A 4MUAA 5CB8A 1XMIA 3VMFA 3H2YA 2VO1A 2DR3A 5D3QA 3QPUA 2DPXA 3QXJA 1Q1QA 4D26A 4A2PA 3R9WA 4EPTA 2CVFA 4CF7A 3CR7A 4KITB 3CH4B 4HAZA 4L15A 5E7MA 4X8HA 3LXXA 2ONKA 1B0UA 5C4MA 1G41A 4TYNA 3R9IA 3RABA 2GF9A 4TZ6A 2ZYUX 1E1RD 1J7KA 1IN5A 1YKSA 2CHVA 4A2WA 1XTKA 2ZS7A 3UANA 5AUOB 4Q00A 3S1AB 1YZTA 2X2FA 3AVWA 1A7JA 3IEUA 3BS4A 1R10A 2O0HA 1OT3A 1US8B 3LAWA 4W5HA 1N5LA 4I4LA 1IN7A 3MRSA 5FBRB 1R0XA 3VNUA 3W3AA 2RGCA 5IK2A 2GCOB 4OQXA 3FHCB 4LJ7A 4D80A 2NIPA 2NO9A 1JR3E 1KI1A 2VRWA 3EC1A 3QF4B 1X8KA 4YMWA 3VR3A 4CYMA 3RS7A 2RHMA 4A6XA 3TJZA 4K46A 2HF8A 1G1MA 2OV2A 3HYTA 1EG7A 2FSIA 1XPUA 2DYKA 5K8LA 3CX7A 4OBEA 2F1IA 2V55B 5JFGA 4HAVA 4RFVA 3PUVA 5CLLA 3BFVA 3OIWA 4MQBA 2FPKA 3Q72A 4N0DA 5CJPA 1OFUX 1CEEA 4OJKA 3I3SR 1G3IA 8OHMA 1X1RA 1JI0A 1OFHA 1Q22A 2BBSA 2WICA 4KVGA 5E7JA 4YXWD 4IKEA 1VYUA 5CB6A 1LFDB 1Z06A 4P4TA 4QBHA 4NONA 4JLNA 2QTVB 1Z0FA 3LVQE 4LI0A 3WBJA 4RY2A 3VU9A 3U2QA 4QBIA 3UG6A 5BYKA 3LLMA 3A1UA 1M8PA 4ZKEA 1S3SA 2XOKD 2JASA 4NCNA 1UDWA 1XD9A 3TH5A 2GXQA 4LJAA 2G77B 2W0MA 3UMRA 1DELA 1TU4A 1CR2A 3LDAA 3JVUA 1KOFA 3AGPA 3THXB 4BRUA 1NL3A 3T15A 3CX6A 1KI2A 1AZSC 1R6BX 5KPJA 3A4MA 1ZUIA 3K0CA 4NU0A 3VKWA 1U99A 3IQXA 2AK3A 4DLZA 2JLQA 3I1FA 3P32A 3A1VA 1FUUA 1C9KA 4A92A 4D4KA 2GDJA 1LS1A 1SVOA 3CUEF 2F3RA 4I99A 4LWZA 4L4UA 1Z07A 1X8LA 1E79A 2BCGY 4DVGA 4C0AC 2G9NA 1TX4B 2IXFA 1UPTA 1P3JA 4M21A 5D3MB 4D0GA 3T1OA 1KMQA 4GBMA 1FNNA 4KFSA 3X1DA 2ZR0A 3WYAA 1T91A 3T5DA 1T9HA 3U5ZB 5TARA 1NG1A 2XXAB 2PLFA 3K9HA 3LNCA 2MSDB 4PC7A 2RAPA 1BYUA 2UKDA 5AK0A 4AG5A 4AYWA 4S2EA 1IJFA 2AX4A 4MDEA 3OHMA 2YOGA 4Z1MA 1W0KA 1V43A 3OEED 4PQFA 3AM1A 4ZCLA 3PJRA 5P21A 4Z51A 1EFUA 4NYIR 2BHRA 1GKUB 1PVOA 3KKPA 3D3QA 5TMPA 2JLRA 1CJTC 3ZD7A 1UBFA 1Z0KA 4LRWA 3DDCA 3KUDA 3GLGB 2ZITA 4XH9B 4QJ3A 1NNEA 1QHHB 5DLQC 4F91B 3ETLA 2ZPTX 4RJLA 1AKEA 2VBCA 5FOSA 4YDHB 4Q1DA 2KE5A 5KSOA 2CJWA 5J5CA 4Z8XA 3BAFA 3I61A 2YKGA 4GRAA 2AL7A 2NO6A 1VDZA 3W5IA 3FKSD 1CIPA 1NY5A 1W0JD 2CMKA 4P4SB 1PJRA 4C30A 3U44A 2NGRA 3BB1A 5EE9A 1BH2A 2AWNA 4NHOA 2GETA 3BERA 3SC3A 3K0EA 3QF7A 2Z6VA 1ZNYA 3LX5A 4LPSA 1U81A 3PUXA 3RVBA 1EXMA 1S9DA 1P9RA 3K8YA 4NYJR 1SXJC 2IYSA 4R9UC 1P75A 1OB5A 2J41A 2GAOA 2O8EA 1E2KA 5DISB 2EU8A 2GJ8A 3FE2A 4DB2A 5IRCD 2ODWA 1W36B 1YR6A 1NVUQ 3UXMA 2IYUA 4I1VA 2A2ZA 2XAUA 2XJ9A 3CRRA 4MGKR 1WMSA 4L5BA 5LD2B 3QY0A 5FTKA 1AGRA 1DAKA 1KDRA 3HR7A 4J0QA 3NBXX 4QGGA 1AZTA 1E96A 3MCAA 1IBRA 1PLKA 2ZREA 5E7IA 4C0QC 2OFXA 1RW4A 2PLRA 2H18A 2V7QA 3FTQA 4C2UA 2IXGA 2P6NA 1GL6A 1BMFA 4JMPA 4DLSA 2OCPA 3L0OA 3ICQB 3PR1A 2J87A 3FHOA 5FPYA 4LPKA 5TVKA 1FFHA 2EYUA 2D62A 3OE7A 1EFCA 2IUSA 2RGDA 5TY0A 1LF5A 5GJBA 4US2R 3EPLA 5TXGA 1SHZA 2EFEB 3QNUA 1RIFA 1NKSA 2ZI4A 3H4MA 4BECA 2JLXA 2B6HA 1QHIA 4UNPA 4G0NA 2WWWA 2AD5A 1G21E 1MABA 1Z22A 1Z29A 1N6RA 2AFIE 2C9CA 3GLIB 4POAA 2VF7A 1II9A 2W58A 3K9NA 3LW7A 4KFRA 1I4TD 2BMDA 3BXZA 2CLDX 1GG2A 1Q1EA 3K0AA 3L8ZA 4C7OA 1P5ZB 2FF7A 1VIYA 1I2DA 1P9NA 1T5LA 2XNSA 4PO8A 1Z0JA 1IN8A 1UADA 3IHLA 2GAAA 4RZ3A 2J59A 4C0HA 2EVWX 1E4VA 1FZQA 2OESA 3EZ9A 5SZKB 1ZM4A 4A8JA 4QM7A 4Q4JB 3W6PA 1U0HC 2PT7A 3PUYA 2X8AA 1BOFA 4E5UA 3CIOA 2EWVA 4C0JA 3L0IB 4DIEA 4JLVA 1GTVA 5CM9C 3KFXA 4MDFA 5H70A 1N6NA 3QENA 3HU2A 4JVLA 1ZAKA 2O52A 5HKKD 1G19A 1NIJA 4M2LA 3KKQA 2WVJA 1J2JA 3TK1A 1KK0A 4CEIA 3FDIA 1DARA 2VF8A 4V0ME 2WTUA 3MWJA 1R4AA 4YQFA 4M1MA 5JEEA 3QF4A 1E2JA 3LQRA 1KO8A 3KUCA 3AF0A 3CLVA 2PX3A 3GMTA 4R7ZA 5DI3B 3CR8A 2IS1A 1VCNA 1V5WA 3ZZ0A 721PA 2EFCB 4LHXA 1M6NA 1NY6A 3BFXA 3BH6A 1N2CE 3P4YA 4LCBA 3HYRA 1G7TA 3ASZA 1IHUA 2QEQA 2VEDA 3HJNA 1U90A 1E9BA 1OYYA 821PA 1G5PA 3KXKA 1N6OA 2FFQA 5B57C 2FV8A 4F4IA 1RJ9A 4FMCF 4MRNA 2F9LA 3EAQA 3TIFA 4U5XA 1OLOA 5JBQA 3AQ4A 3GLFB 2JLSA 3MG9A 4C7OB 421PA 4GZMA 1U94A 3V9PA 3AVVA 4EPVA 2WWYA 2IL1A 2P6UA 4RD0A 5F9FA 1XXHB 2J0VA 2PCLA 3SDZA 2ZSEA 3RRMA 3SQWA 4QHSA 3PEVA 2O0KA 3CF0A 1T0HB 3ZZUA 3IKJA 2CXXA 1Z6TA 2YJTD 2OBLA 3GCGA 2WWFA 3A37A 5JS8A 1NF3A 1KO7A 3MWKA 2SHKA 3T35A 4A0FA 5FH9A 1QZXA 1P4SA 5KSYA 2NPIA 4XTCS 1T4GA 4KHZA 1G8PA 1VYTA 2OCYC 2W83A 4MGZR 1TQ4A 2LKDA 2DFNA 1TAGA 3SU8A 1CRPA 1SVKA 1UFQA 1FP6A 1T0JB 3AKYA 3PV0A 4DRZA 5CIWA 1B23P 1CRQA 5FOWA 1ZIPA 1YZQA 4A1FA 1TTTA 4Q9LA 4KVAA 1CBUA 3UWOA 2HYIC 2WJHA 1LVGA 2ZR9A 5AJXA 3U4QB 3TSOA 5EP3A 1KKMA 3C7KA 2ZU6A 4PX9A 1CR1A 4URUR 1K5GA 2ERXA 4H9GA 5FFMA 3ZZTA 3EPKA 4TLDA 1DG1G 4R2IA 1I4DD 1EFRA 2AKYA 3U7EB 1FPMA 4MYHA 1Z8FA 2QMHA 3K9LA 1F5NA 1NJFA 4JS0A 4XJXA 4B44A 2EQBA 3QKSA 4IFBA 1CTQA 2D74A 3AVQA 4HLUA 4TYYA 3CH5A 1C4OA 2ZE5A 3OEHA 3IIMA 1SULA 3CRQA 1GIAA 1XEWY 4JLDA 3DOFA 4XVRA 4F4JA 1E1QD 2VH5R 2RGGA 1GKYA 1U8AA 2WM9B 3DOEA 4LK2A 2YC4C 2A5FA 3FMPB 1FOEB 3ADBA 1XRJA 1W7AA 3AF1A 3CNOA 4ILEA 1G3UA 3A1TA 2O8FB 1FP7A 1SVIA 1D2NA 1HTWA 2HYDA 2WKPA 4UKDA 4PHFA 2J46A 1ZM9A 3GLFA 2IA5A 1WDTA 1N6IA 3EZFA 2Y8EA 4HAUA 3WRYC 1QHHA 3I5YA 3Q3JB 1E2IA 4ABYA 1Z0IA 3L2OB 1OXSC 4QL3A 5EE5B 2UZIR 3OEEA 1M7GA 5C1BA 1GL9B 4X8OA 1YRBA 5TB5A 4RFSA 4NH0A 4WVFA 4MA4A 2PZFA 2JEOA 4ASUA 3CWQA 3AP2A 4UNQA 2IEYA 3OEHD 5DE3A 2R6DA 3DKPA 2KBFA 2FZ4A 3BGWA 3E1SA 1L2TA 3X1XA 2O8BB 2BV3A 2OCAA 2N1BA 2UVQA 1I4LD 2DBYA 2WWGA 3FGNA 2P2LA 3KJGA 5EE1A 2WJYA 4DT1A 1II8B 3REGA 2QSZA 1TU3A 1MH1A 1DO0A 2RCNA 1KK3A 1FMLA 3EARA 4DSNA 5L3VA 4IOJA 1KZ7B 1QBKC 2VP6A 5DI3A 2D7DA 1IY1A 3BRWD 1D8TA 4V0KA 5AWFC 1IJEA 1IN4A 1E0SA 3K70D 4QG7A 2AKAB 3BFKA 1G7RA 4JJKA 1TUIA 5DSZA 1Q57A 4CEIB 1D6JA 5CK4A 4WA7A 2ZETA 5EUMA 2BIFA 3VR2A 3QOFA 4OYHA 3ADCA 3QG5A 2F43A 3SE0A 2H8KA 1II0A 3CNNA 2RGXA 4DCTA 1HA3A 3E5HA 3SHFA 3ADKA 2IF2A 4B32A 5FPSA 4XD7D 1KMHA 1AQUA 4ZCIA 4WIAA 1F48A 1HH4A 2ZRCA 4LJ6A 4Q18A 221PA 1E9SA 2CLSA 2IYLD 4YLGA 3T12A 4EPXA 4Y0VA 1H8HA 3K0FB 4M1YA 4G5QA 3U3KA 1MABB 2QE7D 1VKJA 4PC3A 2B21A 4TTQA 3GLIA 3BK7A 4EPRA 2HDNB 3A58B 3QPVA 2O8CA 1EFHA 2KB0A 1Z6AA 1AIPA 4OI2A 5EXPA 3IO5A 3BH7A 2O8FA 3VTKA 4TL7A 1KYIA 4IVRA 2O5VA 1PUJA 1RRPA 2QNRA 2H5EA 2JJ2D 1NVXQ 2ZTSA 4B3XA 3VAAA 4LX0A 5LDDC 1XXHE 5J4KA 3KKNA 4RVCA 3WMGA 2PH1A 4UNNA 2BBOA 1QDEA 2QROA 1HURA 2GZAA 4F7WA 1Z2AA 4F92B 2F1RA 2QUZA 4GMXA 4XIGS 4B2LA 1D2MA 2GEUA 4DJTA 3PEUA 5KDLA 1FX0B 3AVPA 5DIFA 2XX3A 3RWMB 4C4PA 5F9HA 3SBEA 4IVPA 2Z4SA 2IT1A 3WNDA 1VHLA 2QPOA 4KBGA 5C18A 1JECA 1N5JA 2GRJA 4FMDB 5EE3A 3KJEA 3NEYA 5L3QA 4TL6A 2CL0X 3NBYC 3EW9A 621PA 2PL3A 3LLUA 3GLHB 2ZRPA 1N3BA 3KJIA 1GFIA 3DEFA 4LV8B 3MLEA 1PLLA 5EXXA 1LNZA 5FL7A 3RS2A 3FB4A 3HU3A 5GVSA 1K8RA 1TQ2A 4WW0A 4QNMA 2K5UA 4F38A 1OF1A 1OW3B 1KSJA 4HB2A 2A30A 4L9WA 2DWQA 4A15A 4EFMA 2FE4A 5B2ZA 1NLFA 4BQSA 4BZXA 4LC0A 1VG0B 3NTUA 3TRFA 2C2HA 4C3ZA 1PLJA 1J90A 3IIKA 3UMFA 3VR5A 4C9BA 3DHWC 2O0JA 5CJ2A 1G20E 1OXUA 1Z5ZA 2V8OA 3KQLA 1UBCA 3K1JA 1AJEA 4JIMA 4JL6A 3ECCA 4LHWA 3VR4A 4NE2A 4P4UA 3D8BA 2ZSFA 2A5GA 2PEYA 1G4AE 1A4RA 4PZYA 4OI1A 3LV8A 2XTZA 3AF3A 3O8RA 1ZD8A 1U8ZA 1ZU4A 2FX3A 4AKGA 1KAOA 4B43A 4Q4HB 2FEOA 2MSCB 5FL7D 2B8WA 1VG9B 4PHTA 1MT0A 2ZJYA 1JR3D 3VX4A 5AUNB 2HCBA 2YWGA 1NN3A 2XB4A 3AF2A 3TQFA 1AK2A 3BD9A 2ZRMA 4KLZA 5K8UA 1MO3A 4C0BA 3FMOB 2RGNA 2WWIA 1NVVQ 2J0UB 4MRSA 4BFTA 5KYKA 2MSEB 2HV8A 3A1SA 1SVWA 2IWHA 4GP6A 3B1XA 5DGXA 2J3EA 2WSMA 4TSFD 3TUJC 4HAYA 4Q7MB 1Z28A 3KQHA 2ZR7A 3PQCA 4QHYA 5EXSA 1ZU5A 5FPKA 1E0AA 3P27A 1EX6A 1D2EA 2P0EA 2D3WA 4EUNA 4JLKA 2CNWA 1WCV1 2P5SA 3QXCA 3T06B 5JS7A 1GRRA 4G3XA 4MRPA 4AURA 5CITA 1SVSA 4N0EA 1G8YA 1HUQA 2ERYA 3PUWA 2WAYA 2ZEJA 4CW7A 1WBDA 4AKEA 3TNFA 3ND9A 1PZNA 1XD2B 1RC8A 2OLKA 3UG7A 5JSZA 1X6VA 2IEZA 4ZDKA 4LJ5A 1VIAA 1LV7A 4KO8A 5CYOA 2H57A 3R7WB 2IS4A 3B2EA 1VHTA 3NWJA 4HZUA 5G53C 2WPDA 1ZC3A 2RHDA 3TR5A 4OK5A 4IRUB 1HT1E 3FFAA 1E6CA 3AKCA 4DLTA 1X3SA 2FGKA 2X2EA 4URYR 4JLJA 3CPEA 1R5BA 2ODNA 1W0KD 3PIRA 2F1HA 1SGWA 3RWOA 4OK3A 1FL9A 2WSSA 3OIVA 1E94E 1OSNA 2GK7A 4IDNA 5HE8A 3MGCA 1RRCA 1F2UB 3KQKA 3AP1A 2QP9X 4NYJQ 1JB1A 1QF9A 4OKSA 2ZYWX 2O8CB 4UNRA 3X2SA 3I5XA 4FCVA 2IS2A 1DO2A 4RKFA 4PSVA 4QJ5A 1U98A 1MRSA 4M1WA 4JLBA 2NPFA 2ZSAA 3QQ5A 2P65A 3KB2A 4Q7LA 3SEAA 3IPYA 4EDHA 4DEYA 2J7PD 4RD6A 4DLWA 2G1KA 4ESHA 2AK2A 4HI0E 2CVHA 1KMHB 1VECA 3SNHA 2I4IA 2I1VB 3MUFA 3T1TA 1UEIA 1JNYA 2D2EA 2OAP1 4R2HA 4CIDA 4P31A 3I8SA 2DCUA 3BB3A 4A2QA 4IVQA 4PZZA 4JLAA 3RC3A 2R44A 4Q9HA 1AQYA 4OJQA 2YV5A 4HYYA 5FTNA 4O2RA 3TE6A 1UDXA 2I3BA 2WJIA 1N6LA 2VSOA 3U61B 3I72A 1GDDA 4TSFA 1OIXA 3D31A 4JKIA 4GDFA 1U0LA 4IW3B 2QM7A 4DSUA 2NO1A 1G9XA 1UKVY 4FINA 4C0SA 2XSZD 3FHTA 1W44A 4TN1A 4DLYA 1ZD9A 4A4DA 4AWXA 5JSZB 4A0RA 3V4FA 4PSAA 3RRZA 3OF5A 2W2XA 2V3CC 4IOLA 4PAOA 1IY0A 4A0HA 3U4QA 3QE0A 2FEMA 1GNRA 2GCNA 4LC1A 2OM2A 4NCHA 5J40A 3U60B 3ZD6A 1AGPA 3NH6A 4Q9IA 5KSPA 2ZI3A 4NKRA 5KHOC 1WE2A 1XWIA 4RZ2A 4GMDA 4LBWA 4EAQA 4DSOA 4LJ4A 2C5LA 3T1QA 1R7RA 1XEXA 1JQLB 2BMEA 2VP0A 4O25A 5GJWC 3AKEA 4Q4LA 3R20A 1HY3A 2A7QA 4LBVA 2IX3A 2ZYVX 1FX0A 1G6OA 1RFLA 1XZQA 3VHXA 4XVUA 4GSYA 4Q1EA 2QAJA 1W4AA 2Q9BA 4LV5B 3PEYA 1N25A 3H1TA 4XSHA 3QSYA 1LB1B 3GJ0A 2QU8A 2AWOA 1NIPA 5ANRB 1XJ0A 3GPLA 2ZXUA 3MMPA 4KYUA 3EZ6A 4HUQB 1KI6B 4M9QA 3B82A 3QBTA 2ZRNA 3G5UA 4PHGA 5L3SA 2OCBA 3SZRA 1P72A 3KTAA 4Q1AA 4PQYA 2IWRA 3KQUA 1UJ2A 4NL4H 5E4FA 4CDGA 3QKRB 1XJQA 4II7A 3TW4A 2Q3HA 2PBRA 4O2LA 3NHAA 2ORIA 4NCJA 1NKTA 5B30A 3U6KA 1TF2A 2FFBA 2CDNA 4JL5A 2CK3D 4DCVA 5A5GA 1GOTA 2P67A 2AHOA 2WOJA 3THYA 1CR0A 1EWRA 3RS4A 1RKBA 2A9KA 2OHFA 3LBNA 1JXOA 2WV9A 4CT4B 2CBZA 3FVQA 3K0CC 5EUQB 5LB2A 4BFSA 2KBEA 3SYKA 3I73A 4DLUA 5BXQC 4AIIA 4CT5A 2GJAA 5FUVA 1VCMA 3LD9A 1XCPA 1XTQA 3IGFA 4TL9A 4N1AA 3X1ZA 2LKCA 1COWD 2ATVA 1G16A 1XEWX 3AP3A 4D4LA 1KJZA 1OXVA 2JJ1A 3QXXA 2JLYA 4ZDJA 2NQ2C 1DAHA 2FU5C 1KNQA 2QE7A 5GJVC 4LJ8A 2EFGA 1T8UA 3ZH9B 2O8DB 5IDVA 5LD2C 4JLOA 4PXAA 4GOKA 3WHLA 4ZDWA 1W4RA 1GRNA 1SXJA 1T3SA 2ATXA 3LVRE 4IOKA 4G5GA 4PPGA 3W9YA 1TEVA 1TL7C 2QZ4A 4EFNA 4BLSA 4BRWA 1ZMXA 2ZVQX 3IPXA 2CEAA 3K09C 4AI6A 2QQ0A 4E03A 3CX8A 4A8JB 3MWLA 4MGIR 4EQ6B 1E9EA 5JRJA 1JEDA 1HEIA 2G88A 4TYPA 1YQTA 5FPTA 1KDPA 1DAEA 2R2AA 2VSXA 2ZRHA 2P6RA 2ZRLA 1P7CA 3NDPA 3AV0B 3B78A 3ZIAD 1AS2A 2X1VA 4HLUC 1ELOA 1BKDR 2GF0A 4WOPA 1UF9A 1ZUNB 2J7KA 1T3HA 2ZJ8A 2CLCX 1L8QA 3FKSA 3K0FA 1ZINA 2PZEA 2W2VA 2GEDA 2OFWA 2PJZA 4OQLA 5KNDA 2QT0A 4IDQA 4CVNA 3U7FB 2GA8A 2Q9CA 5GJCA 3B13B 4Q9KA 3LH5A 1W4BA 3IUYA 3W8NA 1TPZA 3NVAA 3NH9A 2OSBA 2QENA 5AUQA 5AJYA 1XTSA 3LO5A 4DDUA 3FWYA 4EQ6A 1E32A 1NMZA 4QOSA 2GVZC 4M9SA 1E1QA 4URVR 3T5GA 2QGZA 5FOVA 2FFAA 1OB2A 2R65A 2YHSA 3SR0A 1YRAA 3ZS9A 4EJSA 3NBFA 4FW9A 4JL8A 1SXJB 4DDTA 5JJLA 2D7CA 1TUEA 3QKSB 2C9YA 4B3CA 3KJHA 1P9WA 3FMIA 1E99A 3TAUA 4DBLC 1FW6A 4Q1FA 1DAGA 1CJUC 4LBYA 4QBFA 4K81B 1VCIA 1VPLA 1WP9A 2JJ1D 2DFLA 2D2FA 3HDTA 5F2EA 4JVNA 2QMOA 3R7WA 1COWA 1EFRD 1KSFX 3MSXA 3SFVA 2HLDA 1JAIA 3NHBA 1NMXA 4YDSA 1CS4C 4LDJA 1J99A 3O47A 4TMVA 4ZV4A 2FH5B 3DZ8A 3CBQA 2A5YB 5JHHB 1CU1A 2IW3A 3PITA 4Q4JA 2Q6TA 4KSCA 2YWHA 1KY2A 1E3MA 1WQ1R 1YU9A 3QI2A 2GNOA 2V54A 4G01B 3KXLA 1BMFD 1YE8A 4LJYA 3C14C 3FFBA 1W5TA 1E69A 3DKVA 1ZD1A 3HPRA 1L7VC 2G83A 3FOZA 3KTAB 4HLDA 4JT2A 3M6AA 4KSBA 3THYB 1G6HA 5DO9A 3EXAA 3KB1A 3B5JA 3F0TA 2QG6A 3W3ZB 1X1SA 3Q5EA 3RDPA 3RRNA 4A9AA 3NC0C 3KKMA 1G17A 1G64A 1EESA 1H8HD 1OXXK 4XWAA 2N42A 4FWTA 4HB4A 1DG3A 5CDFE 4Q48A 4BFYA 1VTKA 1DPFA 2GK6A 3B85A 4EKDA 5HPYB 1KI6A 4HUQA 1OFTA 2ZE7A 4Y0AA 3ZVMA 4OHYA 4Q9JA 3HU1A 1Z63A 3RSLA 1QVAA 1VCOA 1AKYA 1S8FA 1U9IA 3R8CA 5FOUA 4OHWA 5JWHA 1YZNA 1H8ED 2IK8A 4LYJA 5EE0A 1Z0DA 3B6EA 2Q3MA 4MRVA 1ETUA 1LTQA 4GNKA 1XP8A 4ZPXA 1G5RA 1KK1A 2CCGA 4B6FA 2GBLA 2PJRA 1YZGA 1KNXA 5KTYA 5G3YA 3CF6R 1P62B 3QJYA 3U7GA 2H16A 1U0JA 2AXNA 1D9ZA 2FPLA 1BO6A 4OI4A 3NKVA 4FI3C 2I1QA 4RCZA 1OHHD 5IHPA 4B74A 4CEJA 2JA1A 4EFLA 3A36A 3OFNA 3B1VA 4DB4A 3SN6A 2V6IA 3I4LA 4NP6A 4PQRA 4V0LA 4Q21A 2G1JA 5DN6D 2PZGA 2XNDA 2D06A 3EG5A 3CW2A 1FTSA 2P3SA 1TMKA 1DS6A 2GZHA 3GQBA 1QVRA 3GP8A 2KJQA 4U02A 4B73A 2B7CA 2ZRDA 4W5WA 3VR6A 2ZJBA 1IXRC 2WJJA 1HQCA 3WNCA 1ZIOA 1YR9A 2IXEA 1UEJA 2GJSA 4V03A 2XGJA 1U8YA 3SJCA 3WY9A 1W36C 2QPTA 1S0UA 1NSFA 4W7SA 4PANA 4BLQA 4NCIA 5FI1B 4JVMA 1TF7A 2Q21A 2RGNC 1M7HA 2CK3A 2GZDA 3SS8A 2GJ9A 1SQ5A 2CCKA 1DOAA 1XEFA 4GT1A 3OIYA 3L82B 4GL2A 3U3JA 5BN3A 3AVTA 4DLVA 4KFTA 2IYVA 1R0YA 4HB0A 1OIWA 3RLFA 3THXA 3QPWA 2YOFA 3TVDA 4I1OA 3GLHE 4RD3A 3SHWA 3KX2A 1E2EA 3ZQJA 1AA9A 2E87A 1NG9A 1E2GA 3IBYA 2RGEA 1C1YA 2ZSDA 1Z08A 2IUTA 2ZI7A 1QHGA 2BKEA 2QRZA 1F2UA 4RCYA 1YHNA 5L3RA 3H0KA 4PFSA 4P32A 4EJSC 1GVNB 1FNMA 4LHZA 5TV2A 3WRXC 1M74A 1DBSA 4WAUA 4F4CA 3GEEA 4M4SA 3CB4A 4D0LB 5JI2E 1NJGA 5JI3E 4IDPA 3SYLA 4TT3D 1YZLA 3O8DA 1XPRA 2XZLA 4WZAE 1KO5A 3IDQA 4A36A 1YJ5A 1E98A 4KCGA 3E2IA 4URWR 2FDCA 3NC1C 4Q7KA 2BCJQ 3EASA 1JBKA 1UKZA 3ZDQA 5D3MA 3LBHA 3G0HA 3JZAA 5JECA 5H68A 2R9VA 3WHKA 3GJ5A 2AFHE 3CM0A 2F9MA 2OO7A 3LA6A 4V0NA 5SZHB 3V00A 3U3RA 4GOJA 2EFHB 2ZS9A 2C98A 2YYZA 1XTRA 4LY6A 4DZZA 1DAFA 2ZRBA 4HDQB 1WA5A 1NP6A 4PC1A 4ESVA 3AVUA 3U7HB 1WRBA 2YZ2A 4TLCA 2IYWA 2ZRFA 1G8HA 4TYQA 5FOTA 1E2NA 3IEVA 2JDIA 2PEZA 4W9MC 1RVDA 2JAQA 2QBYA 1OYWA 3HR8A 4TMXA 5FUWA 1CXZA 3T34A 1WBBA 2O8BA 3C4JA 3K0SA 1W47A 4TLEA 1KO1A 2PCJA 1MRNA 3GJ8A 3GJ4A 4JJZA 2R6CA 1ZNXA 3DPUA 2IUUA 2J0UA 2G6BA 4CGZA 1S96A 1U9IC 2QORA 3ZGXA 3VQTA 3LBIA 4MKIA 3ZVRA 2VA8A 1E0KA 3PEWA 1LY1A 2WSSD 3DL0A 5FBVB 3W8RA 2R8RA 4AD8A 3AGQA 4BLTA 1ZM3A 3F8TA 4NPHA 2F3TA 2TMKA 1IXZA 1HT2E 3RS3A 4A82A 4B2PA 1JR3A 5HTKA 4Q4HA 4UXJA 4GOXA 2ECKA 3W6OA 4YXWA 3IIJA 1FQJA 1R8SA 5HCNA 1XFAA 5BYJA 3H84A 4US1R 2WWHA 2YOHA 5A4JA 2JLUA 1ZCBA 5AJVB 3NG1A 3R9XA 1UM8A 1NN1A 2L0XA 1W2GA 2UZ3A 1G291 2BKUA 3QUSA 4HAXA 2XZOA 2WWXA 1IAQA 4DEXA 4QM6A 2BEKA 4R71A 3QKTA 4C2TA 1A2BA 3OAAD 2FN4A 2QSYA 4MKGA 2HJGA 4BEJA 4IEIA 4JLMA 2C8VA 1CP2A 1R0ZA 5IT5A 2CNWD 3VX3A 4BFXA 2OXRA 1HYQA 5JZVA 4NBSA 3WYFA 3K70B 4PSKA 1GITA 1CKEA 4D6PA 4URZR 5KNCA 2HT6A 2GWHA 5HZKA 1NBMA 4MYCA 3WMEA 2J7PA 1QHSA 2OFOA 5JLJA 4HEJA 3X1WA 3REFA 4RKEA 2VHTA 1Q3TA 3MWYW 3UKDA 4LBZA 2QQEA 2FZLA 1NVWQ 3ZLJA 2XJ4A 2W6JA 1KTVA 5E3HA 4BGDA 1OKKA 2Q9AA 5DH9A 4KFUA 3C5HA 3RS5A 4NMMA 2NMVA 3W90A 1K6MA 2HXYA 2J0QA 2QP3A 2JLZA 3GEHA 4E07A 1NI3A 4MYTA 4RD1A 4BASA 2ZRGA 4UJ3A 3AVXA 1W46A 3U44B 3AUXA 2NOAA 2RGAA 1OPXA 2Q0HA 3M0EA 5TDHA 2QP4A 2ZJAA 4M1TA 3BH0A 2PT5A 2J9RA 5F98A 2G3YA 1FTNA 3PXGA 1JXMA 1GAJA 3FMFA 4OHVA 3NDBB 1GKIA 2ZANA 4QBGB 1A1VA 1O3YA 2DB3A 1UKEA 5KSZA 1CR4A 4R98A 5CDFA 3KDSE 4BWYA 5KUTA 1KI9A 3AB3A 5KDDA 2BJVA 2B8TA 2GXSA 2WIBA 2GTPA 5BN4A 2CHGA 4UJ5A 3PENA 1GNQA 3ZS8A 4OQMA 4X8LA 4TWZA 5KO2A 4CEHB 3UATA 4Q4AA 2RKOA 2W0SA 2AXPA 2GJKA 2BVNA 3ZQ6A 3ZVLA 2FJUA 4OQFA 4LSGA 1KIMA 1IQPA 1TADA 2ZSBA 4LJ9A 4HATA 3LFUA 4XTRA 1HV8A 4LUCA 4MITA 1T6NA 4MUBA 2HLDD 3DM5A 3LWNA 1JJ7A 4AY2A 1A2KC 1KGDA 2OUKA 2RH5A 3D7MA 5FBWB 4V0OA 3TGPA 2OG2A 2H92A 4LHVA 2F6RA 1ZC4A 4EPWA 5DN6A 4PHHA 2V6JA 2HJVA 4KYIB 3K70C 1W0JA 5C2JB 2JCSA 4B47A 1EK0A 2WKRA 3GFOA 4FWIB 2OLJA 4EJSB 3GEIA 2QRNA 4G5OA 1E2MA 2PX0A 3I32A 3GLFE 1ESNA 1TQ6A 2ANCA 1NLYA 1T8TA 4S35A 5SZJA 1ZJ6A 1US8A 2WZQA 2ZJ5A 1ZNZA 2FGJA 4KI0A 4TTRA 1NN5A 4FD2A 4HLQB 1TNDA 3S1AA 1DVRA 4V02A 4CEJB 2FMXA 1RE0A 1OHHA 4PC2A 1NN0A 1KI4A 5BN5A 2Z4RA 3BORA 4ZIRA 1GRQA 1GWNA 4AYXA 1XCMA 4Q4AB 2VSFA 2E1RA 5EQTA 1NMYA 2W6IA 4PZLA 3GFTA 1N5IA 4RSGA 2ZUCA 3MFYA 4RZUA 5CK5A 3KQNA 3NBZC 1JALA 5DNYB 4UXIA 3W6NA 1IONA 1W48A 1VG1A 4OL0A 4A0GA 2ORVA 4UNSA 2GESA 4DCSA 1K5DA 3L0SA 1BYIA 3DMNA 3VHLB 4QC2A 2XITA 5FPHA 2IYRA 3K9GA 2FG5A 4RD2A 3KXIA 3KZ1E 4XSGA 4FMBB 4IXMA 1F60A 3A4NA 3QKUA 2CE7A 4L8GA 2ZAOA 2OAQ1 1GNPA 1QHYA 3I62A 5CM8B 1OE0A 2WPDD 5BQ5A 4DCNA 3TMKA 2ZRIA 1E9RA 1OH7A 4URXR 3F5FA 1RZ3A 3IQWA 1LW7A 4QGAA 5FBQB 3GFPA 1KDTA 1N6KA 5EP2A 4B3FX 3ASYA 4C0LA 1S4QA 2IHBA 4AYTA 4B71A 1WF3A 2QN6A 3WBKA 4QGHA 3MJHA 1ZBDA 3CPJB 5SZIA 5KOYA 1FMJA 4YC7A 4BLOA 3IO3A 1AN0A 3IHWA 4K8OA 4Q7JB 2IYQA 3J81k 2C77A 2WMNB 3RC8A 1QG4A 2H17A 5FOXA 3AEZA 2QGNA 3RYTC 4DDVA 3L8YA 3P26A 2ANBA 2J45A 2ZRKA 3N70A 5B64A 1ZRHA 5HZHA 4YMSA 1RRGA 4XWOA 3ZIAA 1IXSB 2IBMA 4PPQA 4D0NA 1CJVC 2OT3B 3DVLA 1VMAA 2BC9A 1CJKC 2OXCA 4TMTA 4TL8A 1Z47A 121PA 1DE0A 3N2IA 2VIIA 2ZVPX 3UK6A 1R2QA 1W4CA 4XOIA 4JVSB 3EZ2A 4US0R 5DI9A 1GL7A 2VP9A 3W34A 1P2SA 4NZYA 1G8FA 1SZPA 3PCRB 1S1CA 3PUZA 1G7SA 1N6PA 1XCGB 5L8VA 2X77A 1Q0UA 4MKFA 1D9XA 3Q7PA 4AK9A 1TF5A 2CCJA 3I8XA 3GJ3A 3ND8A 1KSGA 4DKXA 2E9SA 3KKOA 4O0MA 5KPDA 3Q9LA 2DFTA 5B58C 3A8TA 4NTZA 4ACBA 2ZAMA 3M1IA 2BM1A 3HP1A 4HSEA 4LZZA 4V0MA 1E0JA 4ZI3A 3PFIA 4OQNA 4YMVA 3QVVA 4P0TA 3QVUA 1NSTA 1ANKA 3MD0A 4TLAA 1G4UR 5J4VA 2QAGB 2YWEA 3FPAA 2F55A 3RNLA 2ZUDA 4BLPA 2FPMA 3SJAA 4C0KA 4D82A 4DCUA 4IDOA 2Z0MA 1ZM7A 4B75A 2YNMA 1RJ9B 1N6HA 2ONJA 3QIAA 3GLGA 4I1UA 3R8FA 2NZJA 4H1VA 1Q44A 1XZPA 4TLBA 4NCKA 2YC2C 5EZ6B 2GHIA 5G41A 3OESA 3W5JA 3HPQA 4PR0A 2RB4A 3SFZA 1E9DA 4BUJA 3C8UA 2VP4A 5E95A 2A5DA 3EPJA 2WOOA 3JZMA 3ONWA 2REBA 2Z5FA 6Q21A 1W1WA 1E1RA 4GI7A 3C15C 3ZYCA 1M1YE 2OEPA 3WXMA 3D6TB 3TVTA 1ONBA 2GXAA 3A4LA 2JLVA 3FYHA 3LX8A 5JHGB 4QJ4A 4G5RA 5K8IA 1FQKA 1BIFA 2VLIA 1SVMA 3A1WA 2QM8A 3UIEA 5JCZA 2QAGC 3MJRA 2ODBA 2FNAA 2C96A 3AUYA 2OILA 2VP5A 4DXAA 5AUPB 1W36D 2EYQA 4IXNA 1JQJC 2WKQA 3U6BA 3RS0A 4DWJA 2V4ZA 1XB2A 3F3YA 4KAXA 1DEKA 5KDOA 2QT1A 4B34A 4DHEA 1XMJA 3THOA 5EP1A 2N46A 2JIZD 5AR1A 4ARZB 2NTYC 1OH8A 4LGMA 1LF0A 1G5TA 3CZQA 2CE2X 4JBXA 4D4JA 3QBVA 4TYWA 1WXQA 3SJZA 3EC2A 3ZVNA 3BC1A 4NYMR 4CZ2A 4RFSB 1W2HA 2ZRJA 3VNVA 1IM2A 2HXSA 3K0AB 1DADA 4MGYR 2ZYTX 2XB2A 5LPNA 2FSFA 3BJIC 3BB4A 4ACAA 2NZ8A 2D4HA 4BFVA 1KY3A 1KDOA 1CLUA 4CRWB 1Z0AA 1P6XA 2VHUA 5FTLA 1ZVQA 1SHKA 2C99A 3Q7QA 2MMCA 1E2DA 3GLIE 2DFKB 1N5KA 2LWIA 3AVOA 4JSYA 2GKSA 1KJYA 4FIDA 4DC9A 3VU9B 1SXJD 1UBEA 2NO7A 2P5TB 4WZ6A 2A5JA 3EWSA 3PVSA 2B92A 2ZI9A 2XXAA 4B2IA 2YVUA 2CL7X 2JLWA 4Z54A 3KFVA 2OZEA 4JYBA 2VHQA 1OIVA 2OBMA 3LW8A 1YR7A 2JATA 3OE7D 3ZJYA 4KBFA 2EW1A 5FTJA 4FCWA 1F2TA 1KKLA 4TQ9A 4B33A 2AR7A 4Q02A 1XMSA 3RANA 3CZPA 3WYGA 4D4MA 3EPHA 2BEJA 2G0TA 1XEXB 3PG5A 4M1SA 5UKDA 2VYFA 3B1ZA 4LOAA 5DHFA 2XTMA 1XPOA 1Z2CA 1IN6A 3X1YA 2HT1A 5BW8A 1Z6GA 2NG1A 1QRAA 3UWKA 1KI8A 2QMEA 4B6EA 2IS6A 2GCOA 4DLXA 4IEEA 1E79D 2C04A 1OJLA 2R6FA 2X19A 2O8EB 4KV9A 2QI9C 3TQCA 2FSGA 4JYCA 4M9XA 1W49A 3EA5A 5BWMA 5C46F 2VQSA 1I2MA 2PMDA 4LHYA 4HUTA 2ZROA 3Q8XB 2BOVA 4FN5A 1N0UA 1R0WA 1NLZA 4JZKA 4OHXA 3L0PA 2A3RA 5G40A 1OV4A 2CL6X 2KSQA 4BLRA 1BS1A 3WMFA 2F1JA 2ZJOA 1G3RA 2GILA 4B35A 1Q12A 3OIUA 1N0WA 2AD1A 4M9ZA 4OK6A 4IHQA 2IYZA 3SOPA 1JEEA 2XEXA 2WJVA 4XWKA 2DY1A 4PAQA 4Q1BA 2FFHA 1JAHA 4BZPA 4OHZA 4JBYA 2ZE8A 3EA0A 1S2MA 3U3OA 1G3MA 1RYHA 3WNBA 1QHXA 1OH6A 3IBGA 5FR2A 2V1UA 1E9FA 1YZKA 4AKHA 1R5NA 2DHRA 4DUGD 4D25A 2ASEA 3BIFA 4YMUA 4B3DA 2YWFA 5FR1A 1KZGB 1T3LA 5H8WA 2HUPA 4HZIA 2XSZA 1JR6A 5C4GB 2ORWA 1GILA 1KK2A 3SJBA 4BZQA 4LV6A 3N5CA 1E9CA 3M4YA 2QBYB 3VR1A 1KI3A 4KU4A 4PO9A 1P61B 4D81A 2J0SA 1KJWA 2VL7A 2F7SA 2W6ID 3C16C 3RSOA 2YINC 5J4HA 4Z1MD 3SQXA 3G82C 1X8JA 1CJMA 3ADDA 1Z83A 2W00A 3E70C 3LQQA 4HLCA 3KL4A 3OAAA 5F3WB 4Q01A 2ZE6A 4ARZA 4A6PA 1P73A 4LYAA 4TMWA 3FKQA 3C5CA 4DIDA 4DLRA 1KSHA 2QPAA 1S1MA 3GLHA 2REXB 4GFDA 2ZJ2A 1TQDA 5JWRA 5HCIA 5DYGA 1M7BA 1NVVR 2QMUA 2QY9A 2FA9A 4E22A 1P60A 1E9AA 4ZI2A 5FTMA 2ZI6A 1Y63A 4MRRA 3AH8A 4JT4A 1F2TB 3NXSA 4PAMA 1A5TA 2OBNA 1OH5A 5J47A 2BM0A 4DT1B 3CRW1 4W5JA 3GJ7A 3DMDA 3VKHA 1MR3F 4O3MA 2BMJA 5FL3A 2Z83A 1L4UA 3B1YA 4JLPA 5FUXA 1P2VA 5LB4A 1ZUHA 4M22A 1HE1C 2ZI5A 1ESMA 1RPZA 1WB9A 3B7GA 5K8TA 1D5CA 1YZUA 3O8BA 1GSIA 1TEXA 3H86A 4PTLA 2IC5A 1J8MF 1F3OA 2ZS8A 4AC9A 1GZSA 4TMZA 5AJZA 5EXTA 3RRYA 1DAIA 5CYPA 4KLNA 4WXPA 2WHXA 4UXHA 3UPUA 3L43A 1SVLA 4D2IA 2KI5A 3LXRA 4FCTA 3GJXC 1XBTA 3TBKA 5J4YA 2DWOA 5JEDA 1KI7A 3B9QA 2GCPA 1OKKD 4H1UA 1G8GA 1UKYA 1GUAA 1LS6A 4FMDF 1IY2A 4A8JC 1XDBA
chains in the Genus database with same CATH superfamily
2XF8A 4FXPA 3GJYA 4J2HA 3VNRA 4BVKA 2R1TA 3ISVA 3C41J 4U00A 5LOVB 1CRLA 2GO7A 4RIHA 1QMPA 2NU6A 3TGWA 2HF2A 3QV2A 4NDAA 4OI0A 1RXUA 4RV9A 3OT1B 1KQOA 4GC9A 1JDTA 1WSDA 1XX6A 4GEGA 1QK3A 2FDXA 3MJTA 4X71A 4C7XA 1NQ5A 3TFWA 1SUCA 4UTPA 1HOTA 3CINA 5ITWA 4GSLA 5EZYA 1BXGA 4OKIA 4EX7A 4Y1FA 3I52A 2XWSA 3A6GA 3TUIC 1YQDA 1RIIA 5GADl 1RXYA 2EWWA 2I80A 1NXOA 4HNQA 4MYUA 2HK7A 4RVSA 1Z34A 4TTSA 3IIIA 4CTKA 3I2YX 5LBIA 4LXYA 2RB5A 1BU8A 1FYXA 4BFUA 3T94A 3A3OA 1II8A 2C9OA 3THSA 2GHQA 4JU8A 4DSAA 3GQVA 1N8TA 1MO4A 1EGAA 1DOZA 3EG9B 1UWVA 1Q0ZA 3RS8A 4U39A 2B4RO 2C78A 1DBVO 1PZMA 2YMMA 4CU5A 5JRZA 1B6GA 1QDLB 1QP0A 4MWOA 3DQZA 2RK4A 2HEIA 1T5IA 3NONA 3OOEA 3C45A 1AM4D 2C31A 3LGAA 3OM9A 4N3NA 2F8LA 4Z99A 1V47A 5IXSA 1C7IA 1G6KA 2YQZA 4HH4A 3ND5A 1UKCA 3OLQA 3C70A 5LYYA 3WDKA 3TRJA 1YJBA 1KDYA 3VVBA 4Z1OA 3KXPA 2C2XA 3HZRA 3O5AA 1DQZA 1RWKA 4DBZA 1HFKA 2WBLC 5CCEA 3SXPA 2AQIA 3B36A 3BXHA 1NQUA 3MPOA 4DBLE 1ISRA 1K92A 2FMKA 3L49A 1NURA 4FMCB 3OZDA 3CVYA 4NYMQ 4M60A 1XK6A 1E6LA 4AY4A 1Z7YA 2ATCA 1JJIA 4NARA 2CZCA 3CUTA 2JDID 5DTIA 2P5UA 4CMHA 3O1LA 5K4HA 1ID8A 1XZ8A 4C20A 3D59A 4COKA 4HY3A 3KT8A 1Y4AE 4TTPA 5ESDA 1U2RA 2G5CA 1WKCA 2VSYA 4KJZA 5GOTA 1FBTA 1L7QA 3FUWA 3P2YA 5KYWA 4XRGA 1NE2A 4X1IB 3JWJA 1UBGA 3Q15C 4QKQA 5M2QA 3NTOA 2PRSA 1MC4A 4R3WA 4EWLA 3QX9A 5D1HA 4UZEA 2QYHA 3HVJA 1O9GA 5AKEA 3WA7A 1NM5C 4W99A 5JJKA 3NO4A 4U2KA 1A82A 1EFKA 2AJTA 4ZEOA 3GP3A 3U7QA 4M1KA 4KXNA 4AN4A 5I47A 3J81A 3A4VA 2C03A 2N1MA 2VEOA 3QUBA 3F4BA 3VXKA 5BN1A 5THKA 3E9DA 3ELUA 3MRTA 3C87A 3TVYA 2EIXA 1JKFA 1SKQA 4TT3A 4UUAA 3OVMA 4IIGA 3TUZC 1QYDA 3F73A 2HRRA 2P41A 5JXGA 4ER0A 4B3BA 3WICA 2A0KA 2H85A 1OTXA 3CXRA 1KDZA 3RLIA 4JIGA 3RVKA 3TSYA 4EB0A 3N7AA 4QUJA 3TTWA 4FHCA 4GHWA 3WMXA 3ZU4A 1U8UA 1WD7A 1XTBA 1FXWA 4O59O 4XVQA 1DCKA 1E2FA 4ZRDA 2OHVA 3Q6MA 4Q03A 2BZSA 3UAXA 3IQFA 3S2UA 5L3QB 1YI0A 5GQSA 4DUGA 3U4IA 1MAUA 2REOA 1QTRA 4Y6PA 2J4DA 5DNCA 3UGTA 5DYIA 3T7DA 2JFUA 3OQHA 2WUDA 4FD3A 5IJXA 5BV7A 4CKBB 1PL6A 2VDJA 4QASA 4BKUA 1JZSA 1A8QA 5JDCC 5K4AA 4UQOA 5CBPB 4K9KA 4GPBA 3GA5A 3AUUA 1RYFA 3TQSA 3CHYA 3F9RA 1O5IA 2PR2A 5TQ0B 4DV1B 2IEIA 2MMGA 3A6KA 4O4JB 3PWZA 5HQJA 1O7JA 2AG5A 3BWDD 4KP7A 3TLGB 1HI9A 2XCTB 2FPUA 2EC5A 2QA5A 4KQ6A 3RKRA 2I29A 5LXTF 1DAMA 1SQ6A 4L9SA 2B69A 4PXYA 3LPAA 4D56A 1SQSA 5JTUA 3CEMA 4X1YB 3ICEA 3SSOA 1AS3A 4QSMA 4PC6A 5IU6A 4CEHA 1Y1SA 3B9BA 3QUQA 1TJ3A 2ZB3A 4AG6A 4ERNA 1EWQA 1YRLA 1H8EA 1B6RA 2P6MA 4BPBA 4F97A 1VP3A 4MKHA 3TS1A 5EZ5A 3SD7A 4HB3A 3IPCA 5KTSA 1S3FA 2NZXA 3VTAA 3DE1X 3G1WA 1QXSA 1K88A 3DNMA 5LM3A 2OHHA 1OWLA 1Q3HA 3N39C 4RDHA 5KAPA 1EXDA 5CW1A 4FJ1A 1M5TA 4QTXA 4XCVA 5I7EA 2QAGA 5HDQA 4PZAA 8AT1A 4OQPA 2QD3A 1CB0A 4PGFA 3UHFA 4JEMA 3WQRA 2V7QD 2VDMB 4IGKA 3UK1A 1NYRA 1VLZA 4RA6B 4FUQA 3O9ZA 4PTYA 2QVLA 4OMDA 3AEUB 2I8CA 5J5VA 3NUQA 4RZXA 2PUFA 2O6HA 1MENA 3LP8A 2RG1A 4BP8A 3VPFA 8GPBA 3HHEA 3VU1A 5EIWA 5JQWA 2EWMA 3CEAA 1VJ1A 2FQQA 3CRMA 1DEOA 1YTLA 3RTAA 4DFDA 2O54A 2I62A 4FIZA 3LT2A 3UK6A 1QHNA 1XNHA 3VYRB 1NBMD 4D3DA 1TIKA 1J8VA 1L7DA 4TGLA 5T7BA 3RFCA 4L08A 2GFHA 4M1OA 3KUKA 2UDPA 4OHKA 3K09A 1AGXA 4RWZA 3G2JA 4QUKA 4UUNA 3ZHUA 1UXKA 3EUWA 1ZCAA 3ES9A 4R9NA 5ARDA 1BVRA 5K8VA 1H42A 2NO0A 3F47A 3NEJA 2HA5A 5ALUA 4JOCA 1FYEA 1XJCA 4N48A 4R2XA 3K31A 1NBHA 1GZVA 3ET4A 3NETA 5KJCA 2Z95A 3RFVA 5KU1A 3FYTA 5DTMA 3W5DA 5C5IA 4S1OA 2I2DA 4QXAA 1Z56C 3OZGA 2A94A 2C3YA 2W6JD 2ZU0C 3ZHRA 4F06A 5TMDA 2H31A 4JC8A 1ENZA 1Q21A 4XJSA 2PBLA 4CNBA 5A0FA 1CVLA 4HDOB 1PL8A 4YRFA 4M8NE 4AJEA 4ON9A 4I5DA 4ND8A 1CF4A 1SXJE 1G18A 2IF0A 3GDHA 3IAUA 4G86A 4I6EA 2NUTA 1P2UA 3BSYA 3P4XA 2MHCA 3PA6A 3ZBQA 1E2QA 4HGRA 4OHMA 4TXMA 5GMOA 4F6RA 2GD6A 1A95A 3SF8A 5CFZA 2QTLA 2BBWA 1DDGA 2JGNA 2VNJA 5B5SA 5ALDA 5KNBA 4EHLA 3N0VA 4ZCMA 4N41A 4QNRA 3D8NA 3ZW7A 1KMIY 1ORDA 5ALIA 4Q66C 4B48A 1SUAA 4LJLA 3ANXA 4L95C 4WZBE 1GPMA 2Y76A 1Y5MA 1IZ0A 3E4DA 3IALA 4G9EA 4GPTA 3TNJA 4Q7QA 3P9YA 4LX8A 1GP2A 3UENA 4AICA 5GINE 4DWOA 1KQ3A 5FWDA 4IDHA 5AIBA 2NU8A 5IKMA 5JWOA 3B70A 1GL3A 3TLZA 2D7JA 4GOND 1XMIA 2P2GA 3KD3A 3HNRA 4I50B 1DX9A 1M1NA 1Q1QA 4B7ZA 1RLMA 1XZJA 4JJEA 2O8NA 3AJ9A 1U7WA 1JA1A 3R9WA 4MCJA 1FFGA 5TPWA 1W88A 1T24A 3CH4B 3PDCA 4F9EA 4H7IA 4L15A 4X8HA 3LXXA 4NE9A 4IIVA 3VH1A 1G41A 3R9IA 1HBJA 2EBHX 4MGHA 3RABA 4RIEA 1FDTA 1L5FA 3EGWA 1PG5A 3SHTA 3JARB 4NI5A 4J16C 4EA9A 4EITA 5MDHA 4X1KB 1ZISA 3C7AA 2ZS7A 1JHZA 1VM6A 3KYCB 3UANA 3DBLB 1WZCA 5AUOB 4BXOA 2OZPA 4Q00A 3S1AB 4KO1S 2QM0A 5IVHA 1GDHA 4FGJA 3IEUA 3BS4A 3K1TA 2O0HA 3CU5A 4ZCPA 1US8B 2FAXA 4W5HA 1Y7PA 1JHRA 4FHGA 4P92A 1GXSA 4Q6WA 4UDNA 5FBRB 1R0XA 3RVQA 5CA0B 4QBKA 3VNUA 2GCOB 4OQXA 3E61A 3VR3A 5CB4B 4ZMSA 3A10A 2IOQA 2PKQP 1E5LA 3G0OA 1SOAA 4CG0A 1PFYA 2XW6A 3B6JA 3KDAA 3RYHA 1CQIB 1U7HA 4K46A 3TJZA 2W8BA 2HF8A 2I7DA 1RWXA 4PICA 1Z5UA 4PBRA 5EGSA 1UBHS 1F51E 3QFHA 1XPUA 1Z4LA 2B82A 2DYKA 1EJ0A 2WJAA 4WLFA 1PKEA 1U28C 4DCMA 4BO3A 2V96A 4DDKA 2VQFB 1GY8A 3MW8A 1O2DA 3Q72A 1OBCA 4OJKA 3I3SR 2Q8QA 4G8CA 4DUPA 2A1IA 1CX9B 3ACDA 2WEKA 4LK3A 1BX1A 1X1RA 4MCAA 3RF6A 5DZSA 3S1SA 2I2WA 5E7JA 2WICA 2HCFA 1QFXA 4BBPA 3K6SB 4UDXX 1VYUA 4YAJA 1E8DA 3KC2A 3O3CA 5BVHB 3TINA 5AOBA 5F77A 5HP4A 5C34B 4ER7A 5C0OE 2CV1A 3LVQE 3MK31 3G0GA 4RL4A 3N07A 3T3GA 3WBJA 4LYEA 2PMBA 3T4PA 5F35A 3V2GA 1PFVA 4QBIA 4MJXA 3UC9A 4V39A 3SVZA 3P0IA 1Q1AA 2PGIA 3PDHA 5BYKA 1SBCA 2XOKD 2NXJA 2V5UA 1UDWA 2IYNA 1I32A 2GXQA 3TH5A 3ZDEA 2W0MA 3UMRA 2DJ5A 1DELA 1E66A 3JVUA 4PG7A 1NL3A 2VHEA 1MW8X 4H3HB 4X85A 5E2IA 4WTOA 4UMEA 2O1XA 2Y93A 4AJHA 4KN8A 2C7PA 5ERXA 3KLMX 3UO8B 2L18A 1QQ5A 3A4MA 3BFPA 3IBTA 3G9QA 2NVWA 3JSAA 4FVTA 3SHQA 1L4MA 1G20A 2AK3A 3DLPX 1P7VA 4G1CA 3HNOA 3EQ7A 4RZSA 3P32A 2NUBA 4PRZA 5M34A 4UQLA 5T6BA 2I4TA 1P0IA 1JFVA 3MMZA 1L4KA 1LS1A 3EGCA 1GPWB 4I99A 4L4UA 2IUFA 4DWWA 4EG0A 2CMDA 4GR4A 4CDRA 1T5DX 2YN2A 3CCBA 1D6MA 2HA0A 1U1IA 1TX4B 2IXFA 4XVHA 1UPTA 3ZCQA 3HB4X 4XLZA 3TLJA 2JI9A 1SKMA 3TJMA 4EB6A 4BIMA 1KMQA 2W2LD 3WK4A 3G68A 3B38A 4FWBA 1P1BA 3RSQA 1VMDA 2OXIA 2O1EA 1QRDA 1SPXA 4Q3AA 1DKRA 5A03A 1T91A 1MQSA 2WAMA 5DHRA 1BE0A 2YUTA 4CF5A 3I0ZA 5EHZA 5LMCA 1AHNA 2DFPA 1QQBA 2PLFA 1JP7A 1NOKA 1BYUA 4JLSA 1IJFA 1XA3A 5FJJA 3VAZA 4ZOEA 3OHMA 2YOGA 1NUPA 3NHPA 4JUAA 1V43A 1WDKA 4UD6A 4BNDA 1KC3A 1W6UA 1UMBA 1VZ3A 1R6DA 4ZCLA 3LOPA 1ZSNA 4OBBA 4W9NA 4YJ3B 4NYIR 2BHRA 4LAFA 1X7DA 2V03A 4NG5A 2VPQA 3G2OA 3T5PA 3OQNA 1CHDA 1E6UA 2JLRA 4EKNB 1FP1D 3VZPA 3D4LA 2IIPA 4S1PA 3WZLA 1KMCA 4EYEA 2HDWA 2CXHA 4R1SA 4W5TA 2VWHA 2H2WA 4XH9B 1NNEA 3ETLA 3V6MA 5EMLA 5F76A 1ID1A 3H8WA 1J06A 3FZYA 4Q1DA 2ZTMA 4FFVA 2YZ7A 4XPIB 1PE0A 3FJYA 3WL4A 3GWZA 4YRIA 3FN4A 3RHTA 5K0ZA 5KS2A 2Q1XA 2AL7A 2NO6A 1VDZA 5DM4A 3FKSD 1T13A 1C7EA 3N3AC 3VSBA 1W0JD 1P17A 1CHNA 3D6NB 4P4SB 3DDUA 4ZVUA 4C30A 3BB1A 5EE9A 4L5JA 4C0XA 4KREA 3KQYA 1J2TA 3SC3A 3BN3A 2Y05A 3IUPA 3O26A 5C80A 4RLSA 4ZZIA 5K6AC 3LX5A 4LPSA 2FW8A 3GX1A 1PCXA 5KQRA 3ESDA 3UPTA 3D0KA 4CM9D 3QFSA 1SXJC 1NUUA 1GQSA 4R9UC 5D1NA 3PVCA 4B81A 1QHEA 3FPEA 2BZ0A 3A9RA 4BGUA 2YQ4A 4LXHA 2O8EA 3HWWA 2X7XA 2IZ5A 5I7AA 1PBNA 1ZS9A 3GMDA 5DISB 5KTTA 1AQJA 2XT9A 1CNEA 4R16A 4UARA 4J0CA 2IYUA 1XVTA 3GUVA 1RWQA 1BHO1 2RK3A 4DDUA 3EHEA 3Q9UA 4P08A 4GECA 4IO0A 1EGHA 3OE5A 4XGKA 5AM5A 4MGKR 1EFLA 1W5AA 4FFMA 1WMSA 5JAUA 1J25A 3QY0A 5A5EA 4ENPA 1BQ4A 5FTKA 1AGRA 1IQRA 3GB9A 5CT4A 3WB0A 4BKRA 4QGGA 2FWJA 1AZTA 2XGMA 3MCVA 2JGKA 3P9SA 4ER5A 2ZREA 1DQNA 1PLKA 2A57A 2JIDA 3OFKA 2BKAA 1RW4A 2XUJA 3AEKB 3SSNA 3V46A 3QMWA 2V7QA 1SAYA 5J23A 5HUQA 1RQPA 4BBAA 3FPSA 4GO1A 3AXSA 1GL6A 4KRYA 4MPRA 1BMFA 1FFSA 3KOUA 5I7HA 4FZ3A 5EN4A 1FXWF 3PR1A 5LA6B 4EI9A 3DBHA 3FHOA 3UJ9A 4PN3A 3E8XA 3L92A 3QLVA 5FPYA 3U7IA 2Z1MA 4MEBA 1L8AA 2XYHA 4WHMA 2GHTA 2RH8A 3OE7A 1EFCA 2G17A 1C8KA 1L5LA 5I9TA 5TMEA 4MHOA 3C85A 3ZD9A 1LF5A 1IH8A 3EUAA 4HAIA 4US2R 5JAOA 1NP7A 1SHZA 2FEKA 1AGNA 3QNUA 1C3OA 4PU0A 2VFAA 4RAOA 3B48A 1RIFA 2BEUB 1NKSA 1XRMA 2J8ZA 3GEBA 3JVIA 2FWIA 4MQ4A 2B6HA 4B7UA 1QHIA 4UNPA 1E58A 4G0NA 1RXVA 3I6MA 4QICA 2XXAB 2AD5A 1G21E 1MABA 1WTAA 1Z22A 3HKDA 4MR7B 4PHCA 3KPJA 2VF7A 4UU0A 1I4TD 3WG9A 1N9GB 2CLDX 1H69A 4WBXC 2QX7A 3L8ZA 4FFSA 5L4LA 4C7OA 4AJ1A 2WA2A 1P5ZB 2P2CA 3M81A 1A4UA 1YBFA 4PO8A 3G2NA 1IN8A 1R6UA 3C39A 5THQA 1QH9A 4OQDA 3LK7A 1J8FA 4RZ3A 5I9MA 3FCXA 1XQXA 4QFDA 2YWRA 1L8LA 4IIJB 3W6PA 4X41A 1L7MA 4A23A 3JR7A 5K2OA 3UH1A 1BOFA 1XZHA 2Q5IA 2ORED 2X7HA 4M6WB 4C5AA 4EKGA 4DIEA 4XR9A 4M98A 5GGYA 1XO1A 1MGPA 3K0HA 1GQRA 3G8AA 3DEYX 1PWHA 3KFXA 4MDFA 4HG2A 1N6NA 3U56A 2PXHA 3EFOA 1E2BA 1DTEA 4MR8B 4EA8A 1CF9A 1GARA 4G4IA 1ZI8A 3H4VA 5E6SB 3TGLA 3KBBA 3RSZA 1Z5GA 3PNQA 1KK0A 3TXXA 3VOTA 5KWSA 1ECJA 1ENOA 3AFGA 3VSCA 3L9XA 2WTUA 1JSZA 4A7PA 1UBKS 5JEEA 1GCIA 5JH7F 2PSFA 4Q9AA 5FFNA 2LCIA 1WMBA 4JC5A 5JNRA 1KO8A 1SOVA 4J16A 3KUCA 1FVOA 1O54A 3GMTA 4R7ZA 4F3NA 4UBJA 5CDSA 4FYMA 1BZYA 3VTZA 3UWDA 1VCNA 1V5WA 1SUSA 3DDOA 2CF6A 3AEUA 1L5SA 1M6NA 3FNQA 1NY6A 1Q2XA 1G6Q1 3HBAA 3P4YA 4PEVA 3C8HA 3O94A 4LCBA 3SP1A 1T9BA 1IHUA 3W4IA 4L8YA 5CEJA 2GVNA 1SUDA 3C8MA 2ZUSA 3KYCA 4JA2A 1G2IA 2JKVA 5LZ4A 821PA 3KXKA 4HRAA 4PVDA 1ZH6A 2FV8A 4JEUA 3L7YA 1RJ9A 4L07A 2EKPA 5LYJA 5J2TA 4IF4A 5K0LA 4H4CA 3CWCA 4MRNA 1HLDA 3TIFA 1OLOA 2JLSA 1NNSA 1VJTA 1HYGA 421PA 3V9PA 2ACVA 1M1NB 2JFPA 3QVJA 5DTRA 3AVVA 3TQRA 3UMYA 1RE1A 1XXHB 1YDEA 2C9BA 4DA4A 5C8ZA 2QQGA 1U4SA 3SIWA 1GAWA 5BVHA 2BONA 5IJ9B 5KNDH 3E3LA 4JI0B 1Z6QA 4MKZA 3IKJA 1CE8A 1XUOA 3MUNA 3O4RA 1XHEA 1Z6TA 2ZCJA 2QTTA 4EMSA 5K01A 3BA1A 2F67A 3GCGA 5EJ2A 1Q0RA 3DBVO 3MWKA 2D6FA 2SHKA 1KIFA 1BWRA 3AJ8A 1O96A 2JFNA 3I23A 3FPJA 3EMBA 4C76A 1FFDA 3F7NA 4LG1A 1K1EA 2ILTA 3W5CA 2NPIA 4CMEA 4AO8A 4C3OB 4MGZR 4PCVA 1BE1A 2LKDA 3PPWA 1MAHA 3QKWA 2D1SA 2A4MA 2OM6A 3HVHA 4O6VA 1CRPA 3PV0A 1T26A 5CIWA 3LWZA 5E9WA 1ST3A 5ERYA 4EDFA 1B23P 3PQ7A 4C05A 3DV9A 3HYNA 5DHUA 3WHPA 4WLVA 4A1FA 1TTTA 4Q9LA 4EGSA 4KVAA 3WWEA 5KTRA 2GKOA 5AJXA 1EQ2A 1H0HA 5K2MA 1A2QA 3PHGA 1G98A 3TSOA 4U7WA 4URUR 5EMKA 3OZIA 4H9GA 4NEQA 4B7XA 2JFFA 5FFMA 4BNXA 2PMCA 1PJAA 3ZI7A 3WZ2A 3L84A 3D1LA 2VZEA 1AGYA 4LQCA 5JCOC 2YRXA 1A9ZA 3A2NA 2RDMA 4QUDA 5EQFA 3COJA 2B3TA 1BJRE 1F5NA 2HSDA 3IXQA 1BC5A 3MJFA 1ZMTA 4B44A 3VO9A 2AJ8A 4MMYB 3H5NA 3P9CA 1SCNE 5JYCA 1CTQA 1FFCA 1SZDA 5HJ2A 1Z37A 1SIUA 4GH5A 3AVQA 3IURA 4ZXPA 1QIIA 2WJ4A 2NX2A 3I9LA 3PKZA 3CH5A 1NJ6A 4HD8A 4ND6A 4QWWA 4YJGA 4CIXA 1E6EA 4RZQA 3PFBA 3IIMA 2V7WA 3ODPA 1BMQA 1EVLA 3IUQA 1ADCA 5E3IA 4LEIA 5BSUA 2I2XB 1KJQA 2HL6A 4XVRA 1IULA 2WM9B 2ZRQA 1GKYA 2BLNA 2I9PA 4MQ5A 4BEVA 2Q6OA 3MSCA 5DB4A 5EPUA 1R37A 5IJ9A 2UXCB 4KQMA 3FMPB 3L8MA 4ZD6A 1XRJA 2NU8B 1DMSA 1M8JA 2R00C 3KEGA 4MW5A 4ILEA 1W7AA 1ULZA 2C9MA 4JK3A 1FP7A 1D2NA 2HYDA 4N7BA 3ZDAA 4UKDA 1ZM9A 3DT8A 5DLDA 4KAFA 5JDIC 3EZFA 1KWGA 2JIRA 2Y8EA 3O7WA 1TKRA 4G84A 1AT1A 1GR1A 5HCUA 4TRRA 3PUJA 2PMFA 1WX1A 1E2IA 4MB6A 4ABYA 3T7IA 2V3WA 3L2OB 4QL3A 5EE5B 2UZIR 3D1VA 3MTEA 3OEEA 3OPYA 4JI3B 8ADHA 2EP5A 2ISQA 3L8DA 4QTUB 1YRBA 3OKPA 4RFSA 1NX6A 5FUQA 1AX9A 2I4MA 5HG0A 2XQFA 4EG7A 1EH5A 1NJ5A 1BMDA 1TJYA 2DHEA 2PQMA 2X9VA 4HEHA 2IXAA 4QELA 2IEYA 4UNQA 2H3HA 4KLRA 4BO8A 5DE3A 4BQOA 4ZO6A 3RW9A 5F7XA 2FZ4A 5K0SA 1UDRA 2GD2A 3BGWA 3DBRB 3EXIA 1L2TA 3OX4A 4JP5A 3TMAA 1IK6A 3UW3A 5A3QA 2O8BB 2OCAA 2WWGA 1POWA 1ZY2A 1OBVA 2DBYA 3BKXA 2BAGA 3FGNA 2AUNA 1NNUA 3LVFO 4K6HA 2HU8A 4NPCA 2JA2A 3BZBA 4X95A 3KUUA 4YECA 2GPNA 1L5HB 3GT4A 1RD4A 3NT4A 1J0XO 3R0ZA 1ULTA 1FMLA 4RORA 3AR2A 1HZZA 4RUKA 3L4SO 1RMQA 2XCIA 1PQWA 4MICA 3V34A 2MIIA 2OHOA 1GNTA 3AFNA 4HGYA 1EUCA 3IL2A 1IY1A 4KIJA 2MDTA 5H3HA 4E5YA 2WDPA 4DBVO 3DVAA 2I7XA 5JUWA 1YJXA 1TUIA 1OD6A 5LMUB 2E7ZA 5LU8A 1K27A 3NNDA 4CEIB 1RYEA 2JI7A 4WA7A 4G5FA 4M0DA 1I3CA 3G8DA 3V3KA 5DW3A 4CL0A 3ADCA 4KO4S 2C2KA 3SE0A 3DBRA 4XFJA 1CT9A 1BVYF 2W2QA 2Q1YA 4JASB 1YTUA 4HDMA 2RGXA 3AIMA 3JYNA 3RU3A 3OCZA 2XLBA 2IF2A 1L7AA 1HC7A 2HC9A 4CKCA 2AB0A 4LSMA 4F9TA 4ZCIA 1YQ9A 4WIAA 3WSVA 1F48A 2HD4A 1QH0A 1QIJA 1B73A 4LJ6A 5IULC 2CLSA 1ULUA 2JBAA 2WSIA 4Q3NA 3T12A 1UOQA 3IMKA 2OORA 2WG2A 3UAYA 1NC3A 5CDYA 3JQAB 3W6UA 3IT1A 4TVBA 1U0FA 4REMA 1YKGA 1VKJA 2EQAA 3V7NA 1HNNA 4R3NA 4H6WA 4MYDA 2X0KA 3BILA 4KXWA 3IKMB 3K72B 4WCFA 2UVDA 4MLZA 4X6LA 1AXRA 4MI3A 5DCYA 4RVNA 5EXPA 1E7WA 3ZOKA 3WWYA 4TL7A 1KYIA 2X9GA 4YRSA 2YNMD 5B1EA 2VCEA 2HMTA 2JJ2D 4REQB 1HNZB 1Q0LA 4DR4B 1OAOC 4ZK2A 4RTSA 3U4HA 4OYYA 3LYLA 4LMRA 7REQB 2PH1A 2BBOA 3LHIA 1KBQA 1XVUA 4UM7A 5KWVA 4ZVOA 4F6LA 3OY7A 3HH8A 4B2LA 5EIAA 3W1VA 2E48A 5FYDA 1UMDA 3PEUA 4PO3X 3AVPA 3M4XA 3BHMA 2XX3A 5DIFA 3JZDA 5JFGA 2GLUA 3I2JA 1AC5A 1HE3A 2AVDA 1UPCA 5CW2A 4ANFA 1Q0TA 5AW8A 2IT1A 3RRXA 1RYMA 1JECA 1N5JA 2FUG1 1Y0BA 2E1PA 2QX8A 1EJ2A 2IU0A 4PRLA 3ZC3A 4BNMA 2CL0X 1G5QA 2AW3A 1B0PA 2X8LA 3RROA 1XLVA 1UXHA 3LLUA 4E08A 3OZWA 3DEFA 4LV8B 3RS2A 4RSHA 5EXXA 5GVSA 1LNZA 1QF6A 2B1QA 4MQ6A 1K8RA 1EFDN 1B7GO 4QNMA 3OJ0A 3O8LA 4JXJA 4V0RA 2JH9A 4BQRA 5LZ7A 4HB2A 2XTJA 1VI2A 2A30A 4HRVA 1RMYA 2DWQA 3MT9A 5JNSA 4EFMA 3RAFC 3LPMA 2P9CA 1R0LA 2JPDA 1BEZA 3GN1A 4MVYA 4XEHA 4FB4A 4BQSA 1VRCA 4C89A 3QRWA 3NTUA 1Z73A 1CRZA 3I45A 4C3ZA 4HEQA 2V7PA 2E49A 4KYVA 2OB1A 3DHWC 2FWMX 2HJ9A 4AMVA 5ICGA 3MGGA 5CJ2A 1UKAA 5M3BA 1TU0A 3ZHYA 3L0CA 4L1KA 1UBCA 2Z5GA 4AIIA 1XELA 5EWLB 3ECCA 2AVNA 5KVQA 3TMKA 1AURA 2Z6QA 3EVFA 3LHDA 3AY0A 5COQA 5EEHA 1YSCA 3GLQA 3H75A 4PZYA 1KJIA 1I4WA 3AF3A 1Y6QA 1FLDA 1Z2NX 1OT5A 1ZU4A 3BQMB 4X66B 2FETA 2V45A 4TUYA 4B43A 2FEOA 4ML3A 4U2GA 4E2XA 3I76A 4MI6A 1WY7A 4Q1VA 1V7QA 3L46A 5FL7D 2B8WA 5TVGA 3ZWCA 5LOVF 4L85A 3OQ6A 1TQ8A 5KB3A 2E82A 5AUNB 2VQEB 4OUDA 3U9TA 3ZWNA 5ICEA 4E33A 3ZZ1A 3AF2A 2N47A 5F1OA 1AK2A 5BUSA 3V4PB 3QU4A 2ZRMA 1V95A 1YMUA 3KPUA 4I4IA 3AJDA 4BFTA 4GXRA 4F8JA 5KYKA 2AJBA 5BR4A 2WQ6A 1XHLA 2EP8A 2MSEB 4IMRA 1EUQA 5K09A 5K0EA 1X70A 3INRA 2Q3BA 3E82A 5LLSA 2IWHA 4LF7B 4EB3A 1K8XB 4RADA 2JS7A 4HAYA 5EIHA 3KQHA 4Z7OB 3PQCA 1NKVA 3F1LA 4YREA 3UMBA 1WF6A 4PYMA 1TIPA 1Y3CE 1XROA 3P27A 5DV9A 3FNRA 1D2EA 2P0EA 3USZA 1A98A 3H8JA 3LWBA 4QD3A 2Z6UA 1O0SA 1D0VA 2XYGA 2XBUA 5B1SA 3T5CA 2ZJ6A 1G8AA 5H0IA 4ZEVA 5JS7A 4PIMA 4G3XA 1ZGBA 4IS3A 4MRPA 5TS2A 2NVOA 4AURA 4C4TA 1YS7A 2ZIEA 1HUQA 1Y3IA 4FX2A 4D9GA 3PUWA 4RPHA 1WBDA 2IH5A 1PQPA 3V55A 1RC8A 3E8SA 1V6CA 2A7XA 4WNAA 3T4UA 5LQKA 4G26A 4YVFA 1QE0A 1H6DA 2JCVA 4Q3KA 2CYBA 1QGUA 3BRSA 1XCJA 5I7UA 1LSOA 1RBMA 1J23A 4NEGA 1P4GA 1XZKA 4EGJA 1UJ5A 2IS4A 3B2EA 4HZUA 2LXNA 2YV4A 5G53C 3GVXA 3RK4A 2RHDA 4CT0A 2YIJA 2XMBA 2G82A 3QLEA 4YRLA 4QOHA 2RGUA 2JVKA 5BMVA 1XZBA 4EAAA 3DDSA 4YRGA 1V8FA 2GAFA 4Q3OA 3M6LA 2FGKA 3Q8WA 5MGBA 3FWHA 3VOBA 1FDIA 3SVLA 1PVDA 1R5BA 1W4ZA 4OJMX 4R83A 3DV0A 4J7XA 2A14A 3PQ3A 3PIRA 1T6YA 3VR4H 4MA0A 4KOEC 1JG6A 3RWOA 3H05A 1UOPA 1FL9A 2QS9A 3OIVA 2Z8YM 5LMZA 2CLLB 1OSNA 2Z5VA 3R3JA 3L7NA 4G1FA 4RJ2A 4ADSG 3A3YA 4BBJA 2ZAGA 4E30A 1RRCA 1F2UB 2I6GA 3L8GA 1IU9A 3SKYA 1FW8A 2WFLA 3QTTA 4KWTA 1JB1A 5IJAA 4AP9A 4F9FA 2ADOA 4L2IA 3IB3A 4NE7A 3ESCA 3NTVA 2UZ1A 2O8CB 1V8PA 1QO0D 2GFIA 4XAQA 5EKSA 2I3DA 3U7JA 2IS2A 2ZVDA 4TMYA 3GPCA 1A9XB 4MV8A 5FLYA 4ENQA 4ZAXA 1JHAA 3JD4A 4OIFA 4EW1A 3HKDB 1YNSA 4MR7A 4QULA 2YHBA 5KOJA 3MWEA 4HDAA 4B7AA 1O5OA 2O2XA 2CNLA 3U13A 4ESHA 1LPAB 3IBSA 4Q9DA 4KQJA 1V26A 4L9AA 1KMHB 4QIHA 1VECA 3EFHA 2PS3A 3NJ4A 2VZ9A 3MUFA 1WZIA 2I03A 3J7TA 5JT1A 1YL7A 3IC5A 1GZ3A 1IXKA 4QPPA 3LQYA 1UEIA 3I12A 4YQYA 2OAP1 2X6QA 1L1RA 2Z56A 2IPLA 3FZNA 3OP4A 4CIDA 3DZFA 3GI1A 3UFXB 4IVQA 4PZZA 5LA6A 5C7OO 3PK0A 3CH7A 1CIJA 3HVUA 4DV4B 2NVUA 1GA6A 1J42A 1RC0A 1L1FA 4ZGWA 3E84A 2G9UA 1DV2A 1N6LA 4GLFA 1V8BA 2O07A 3EFBA 1SC9A 2CHUA 2PV0A 1JKJA 2O23A 4GDFA 2XB6A 1I80A 4IW3B 1NP3A 2QM7A 3UFBA 4ED9A 1OX5A 1ZGZA 1G9XA 2NO1A 1P5FA 4FINA 2OO3A 3OPQA 4YT2A 1A7AA 7ADHA 1YZVA 1TYZA 4IX1A 3O74A 3VZBA 4DLYA 1YFLA 1EE9A 3FHTA 3W04A 2YXDA 3GRAA 4A4DA 3FG9A 1GQQA 3JALA 4FC7A 4H7PA 4HXFB 4M3NA 1O1YA 1BDJA 3V4FA 5F5XA 4MS4A 6PFKA 3KKKA 5KJ6A 1IY0A 1EDDA 3U4QA 4ND4A 1GNRA 3QV1A 4JWTA 4X1KA 2JI4A 1XOIA 4QYSA 4YUVA 1Y3HA 4CLEA 3D4OA 5KHOC 2H2FA 3WLMA 2A1TS 1SVNA 1U1FA 3ZDZB 1DU4A 2JGMA 4Y6SA 3WFZA 3T1QA 1BW9A 4MINA 5T4FA 3C74A 3EMKA 1JQLB 1UAGA 4JOQA 4IICA 1XLTA 4OX9Y 2XA1A 5FO0A 4YT8A 1QV9A 4I50A 1I3OA 1KQNA 1HY3A 2ZWOA 5KJ1A 3VV3A 2QJWA 2A7QA 4R81A 5I5EA 1X7WB 2VXOA 1PZGA 3TL2A 4EA7A 1DSSG 1XZQA 3IBCA 3TEFA 2OO5C 1I30A 1XA4A 4IIFA 2N0SA 3VHXA 5HW0A 1I7LA 3ABRB 4Q37A 3FB1A 1N2GA 4ZCSA 2EX4A 3QEAZ 3FTPA 2UZ0A 5JAHA 1HQDA 3GFGA 2PX2A 4LV5B 4E1BA 3WRXA 4KQKA 1R9GA 1O08A 2DJIA 4A8HA 1N25A 3H1TA 4FR5A 2OCKA 2CLEB 3GJ0A 2D54A 1Z45A 3VKVA 1NIPA 1O6FA 2KYRA 3KT6A 3FI9A 4P3KA 4GGPA 1RLJA 4KYUA 3VPBA 3ONVA 1WS6A 1OYOA 5LNK6 3P0HA 4HUQB 1N8KA 4MAAA 1JAZA 3B82A 4HT3B 4QEZA 1MIHA 2VDWB 3KTAA 3IP3A 1XTPA 2E89A 4TLMB 3TSAA 1ORRA 2ALJA 3EVGA 4DLAA 2A0YA 3WAGA 1UP4A 2JI6A 3IAM1 3ANMA 4PGMA 4BNDB 4CQLB 3TIXB 3UVEA 1WNFA 4IY1A 1XKTA 1DXYA 3U6KA 1MAWA 3HRIA 3LP6A 1EFVB 2AHOA 2WOJA 4B5KA 1EWRA 2HSJA 4FE3A 2WHQA 3R8XA 1K9SA 4LF8B 4BATA 4AFNA 2OHFA 3LBNA 1TT5A 2WV9A 5F7JA 1WL8A 3K0CC 5EUQB 3ZX4A 4GKBA 4QQKA 4NBLA 3RC7A 3UXHA 4CL3A 4D8YA 5DTEA 4J29A 3GPBA 2CVZA 2NUAA 5EQJB 3V9AA 5FUVA 3TTSA 1VCMA 1V5FA 1AQ6A 1XCPA 4TL9A 3X1ZA 1E8MA 1NT2A 4MLCA 4HDKB 3S70A 2FP3A 3LDUA 5EJGA 1COWD 3HSKA 4UM9B 1Z4OA 1XEWX 4D4LA 1KJZA 3ICWA 1RSZA 3JZIA 3BWCA 3PNVA 2AF4C 4DCJA 2CDCA 3DHEA 1P5JA 5EINA 1KNQA 2QE7A 1X87A 1ARZA 5IDQA 4ZWNA 4BJHB 3MFQA 1T8UA 2G9QA 3ZH9B 5IHXA 3PDWA 4CM6A 5IDVA 4BCDA 5LD2C 1RJWA 1V9SA 5ABPA 3SQMA 2AJCA 1D6NA 1W4RA 2ATXA 4FE7A 2YJ6A 1HRKA 3PNMA 4JI5B 3IP9A 5JZ9A 1TEVA 4G0UA 4UM5A 4B3HA 1KYWA 2GYUA 2HQ1A 1SR8A 1WXFA 2WAAA 3EXFA 3BDVA 4XWWA 2NTNA 2QQ0A 1GGJA 3DAHA 4LMAA 2LDBA 3CX8A 1NQXA 4A8JB 3MWLA 5H83A 3HJCA 4EQ6B 3Q3IA 1QLJA 4QPNA 1E9EA 1LNQA 3IDAA 2QVCA 1P7YA 1GLVA 5F73A 4DMHA 5JRJA 1Y3DE 1MEJA 5THXA 1BRTA 1DMRA 4NU8X 5FPTA 3ZTTA 4ARVA 3E18A 4RA9B 3T3NA 3O7MA 3PHHA 1D2HA 1I3KA 1CZUA 4KQGA 5BN4B