3I92A

Structure of the cytosolic domain of e. coli feob, gppch2p-bound form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
257
Chain Sequence
MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Structural basis for the intrinsic GTPase and GDI activities of FeoB, a prokaryotic transmembrane GTP/GDP-binding protein
rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 80
structure length 257
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i92A01
1YZKA 1KI2A 4HAVA 4BFYA 1JEDA 3K9GA 4QM7A 4FCTA 1ZINA 4Q48A 4KAXA 4MITA 1QG4A 5KNCA 2VBCA 4ZDWA 4HI0E 5GJCA 4TTRA 5EP4A 221PA 4TMVA 6Q21A 2OBNA 2WICA 4Z1MD 1IQPA 2CHQA 3HDTA 1XJCA 1LV7A 5KDOA 3LVRE 2RAPA 5SZHB 5BN3A 1E96A 4LPSA 2DY1A 4OL0A 3M1IA 5BW8A 1E2HA 4U7DA 4DSTA 1II9A 2C2HA 2ATVA 4L4UA 2FGKA 2NOAA 4S2EA 1XXHE 2JLYA 4RD1A 4ON9A 1UDXA 1RFLA 1QHSA 4QFMA 2DBYA 5DIFA 1KI4A 1RRGA 2DWPA 4EJSA 2H8KA 1OFHA 4ZPXA 1PVOA 2DHRA 2QEQA 2BV3A 2F1IA 4B43A 4D2IA 3RWOA 5E7JA 2HT6A 2DB3A 2BMEA 4TLEA 4LHVA 1G3UA 1T0HB 1VMAA 2NTYC 5GVRA 4FIDA 4CGZA 3FE2A 4A92A 2J0SA 3AVTA 4P3YA 3REFA 3P4YA 1Q20A 2H16A 1ZIPA 2EYUA 4DCTA 2FPKA 4AD8A 3ZLJA 5BN5A 1EWRA 2O8CB 1GZSA 2HXSA 3T61A 1SKYB 1R0WA 3OEHA 3Q5DA 5LD2C 3PEYA 5D3QA 3TW8B 4TLCA 3A6PC 1JXOA 4CIDA 5B58C 4DHEA 4PPNA 1ZM7A 2QMUA 2ZVQX 2QE7D 4IXNA 4KYIB 2WWWA 2YWGA 2ZRGA 1NJGA 1P3JA 5FH9A 2ZRFA 2AFHE 1YR9A 3REGA 2O8FB 2Z5FA 1KNQA 4G1UC 2GJSA 3VX3A 1SVMA 3U61B 1LNZA 2PX0A 3FMFA 4PC6A 3VU9B 2OBMA 2P67A 3BBPA 2JDIA 4QOSA 5JI3E 4OQMA 1CJUC 3VR4A 3FB4A 3QEOA 4M1KA 4JBYA 4Q18A 2P5SA 2OFXA 5A5GA 3SEAA 1CJTC 3K1JA 3I61A 1M34E 1L4YA 3LVQE 3CX7A 3QXHA 1T8TA 2C78A 3P26A 4I1OA 2ZJZA 3IEVA 2ONKA 1S9DA 3WRXC 3GD7A 3GP8A 3ZD6A 2VHTA 2IS1A 1IXZA 2QM7A 5LBIA 2O8CA 3U3OA 4PPFA 1JAIA 3BH6A 1XD9A 1AIPA 1GTVA 5JBQA 3GJXC 3VNVA 4G5GA 4U00A 1X8KA 3RWMB 1QDEA 1W0KA 5BXQC 3MWYW 1XMJA 2IYZA 3AP2A 4XSGA 5J5CA 4ZKDA 4RVCA 1E99A 2W2VA 2IUUA 4AIIA 4QHTA 3UPUA 3K0CA 5KU1A 3W6OA 1NIPA 1ZRHA 2AN9A 3NH9A 3SYNA 5KOYA 1D9ZA 3IEUA 2IUSA 4WIAA 2Q3HA 1NIJA 3VFDA 3PEWA 4EPYA 4D4LA 2R62A 1Z29A 4DB2A 4C3ZA 1I4TD 2O8FA 4PX9A 2OILA 4AKGA 1Z83A 2IS6A 1CBUA 2QY9A 3K8YA 3L8YA 2F7SA 2HCBA 1F2UB 5BYJA 3VU9A 3OHMA 5KYKA 2R9VA 5FTKA 2JDID 5AJWA 2C77A 1WXQA 1LF0A 3LO5A 1E2LA 3O47A 3BXZA 3SJAA 5EE0A 2G1JA 3EC2A 2FU5C 2YZ2A 2J7PA 4M8NE 1KSGA 2QROA 1HQCA 2OFOA 1Z6YA 2ZEJA 2IYVA 1IN5A 5E95A 2CVFA 4NE2A 2B21A 2ZRKA 3FMOB 3AV0B 4XJXA 1XTSA 3ZJYA 4EKDA 5LB2A 4EUNA 4A0RA 3HYRA 3A4MA 2CLCX 2O0HA 2XEXA 1T6NA 4WXPA 1Z0AA 3B1XA 4QGHA 4A36A 1XCMA 1G4AE 1NL3A 1YZTA 2VQSA 2EWVA 4TLDA 5FPTA 2J9RA 3CH4B 4DSNA 4OQLA 2VA8A 2FFBA 2GXAA 3SHWA 5J47A 2JLQA 3P20A 4BZPA 1UDWA 2EFEB 2O5VA 1YU9A 2NO9A 2VSXA 1QF9A 4LBWA 4W5WA 1Q3HA 3QJYA 2A30A 4FI3C 3SJCA 2BM1A 1SULA 5DNYB 2ZR0A 2R6GA 1E1RD 1NSFA 3RHFA 1Z2CA 5TB5A 1DS6A 2OXCA 1ZIOA 3TAUA 4ZIRB 5E4FA 1PZNA 3PG5A 1AZTA 1F2UA 2VEDA 3EWAA 4RFVA 2FA9A 4Z51A 3GLIB 4G3XA 1E4YA 1GVNB 1HY3A 1R0YA 1W48A 2DFTA 3BFKA 1V43A 3DKVA 1SKQA 3N5CA 3P32A 3PR1A 4O25A 1HE8B 3T35A 2QRZA 4OQFA 2OT3B 1G16A 1BS1A 1XPUA 4P4SB 2Z83A 4PHFA 2JJ1A 4Q9IA 2WMOB 1E32A 3NG1A 4IDHA 2DCUA 3B60A 1XEXB 4OJKA 5AUQA 2J87A 5DYIA 5JJLA 1IJFA 1UKVY 2FG5A 3FKSA 4PHTA 2P5TB 4QJ5A 4V0NA 4F4CA 1VCNA 3MJRA 4F38A 1W44A 1Q0UA 1NVWQ 2X77A 4BFWA 1QHXA 4E22A 3AF1A 3MWLA 3UATA 4PC7A 4JLMA 3RS5A 4HSEA 5K8UA 4R7ZA 1GNPA 4CRWB 3C41J 3QBVA 2AFIE 4ZIRA 1A2KC 1ZYUA 1JPJA 2F1HA 3P4XA 3GLIA 1YR7A 1W47A 4NYJQ 2IHBA 3X1WA 4V0ME 2XJ9A 3GFPA 1RIFA 2E9SA 3OIUA 4GZLA 5HCIA 5DGXA 3FHCB 3ICEA 4OHXA 3E1SA 2MSCB 3EA5A 1II8B 2V8OA 4YMTA 2P6UA 1KDOA 3RRZA 3VHLB 1BMFD 4EAQA 4P4SA 1OV4A 1AZSC 2AKYA 2G3YA 3NXSA 4P4TA 3T06B 5K8IA 1PLJA 3IIKA 1XEXA 5KPDA 1E79D 2OXRA 3AUXA 4JYBA 4J0QA 4Z54A 1YQTA 4PC2A 5SZJA 3GLHE 4URXR 2D7CA 5TV2A 3D8BA 1LS6A 4KO8A 3MJHA 3PUVA 1TUIA 2WWHA 5JFGA 1E2QA 3AB3A 2FEMA 1KYIA 1E9SA 2ZRDA 4F91B 1S3SA 1LY1A 4GP7A 4L8GA 1QRAA 3SBDA 2A5DA 4KVAA 3L43A 3LBNA 4JLAA 2RGGA 3DOFA 2CHVA 4JLNA 2ZYWX 3EIQA 3GFOA 5FBRB 3K0SA 2W2TA 3CONA 3B5JA 2G83A 3W6PA 3TNFA 1OPXA 1G3IA 1RJ9B 4PXAA 1OIWA 3EIEA 1G6HA 3CPEA 2CHGA 4L9WA 1ZUNB 1II8A 4DDUA 1IY0A 1E1QD 1XMSA 5DI9A 3P27A 3RS4A 3BH0A 1XD2B 2RGBA 2F3RA 4Q4LA 3CNNA 1FOEB 3SQWA 5FOUA 2REXB 4MGYR 1UKYA 1Z06A 4Q4HB 3ADCA 2ZRJA 3W5JA 2P65A 3C5HA 4URZR 3ZQ6A 2NPIA 1JXMA 5CLQA 3L0PA 1YRBA 4HZUB 3QXJA 3A4LA 3IQXA 4LJYA 1Q22A 1OIXA 1CU1A 2FOLA 4D4MA 2PT7A 4IW3B 3AVVA 1KJZA 4GMDA 4NYJR 3AF3A 4V0OA 3HU2A 4TYPA 2VIIA 2QU8A 5CK5A 3RVBA 2HF9A 2CCKA 4IEIA 4PHHA 1Q57A 3W34A 3FWYA 4IDQA 3GEEA 3ZZUA 3WHKA 4GOXA 1SGWA 2NGRA 1DO2A 1ZW6A 1DOAA 4II7A 2YOGA 2BEKA 3PENA 1KI3A 4WZ6A 1D2EA 5CB6A 1KDRA 2AD1A 3LLUA 1RKBA 3KKNA 4LRWA 3VKWA 1RJ9A 1EFRA 2QTVB 4LDJA 4LJ9A 1N6RA 2KSQA 1E9RA 2GJ9A 1HTWA 2OHFA 4HLUC 4K46A 2V6IA 3QVVA 3ASYA 2V7QA 3LQQA 4QXAA 2NO7A 1G8YA 1OHHA 1XD2A 4RKFA 4HAYA 4LHZA 3S1AB 4X8OA 1W46A 1CF4A 2OAQ1 3PITA 4Q4HA 1OW3B 3CNLA 2EQBA 4JSYA 2WOJA 4HZUA 3IILA 4DT1B 2F55A 3L0OA 4JLPA 3TMKA 2V9PA 3ONWA 4M1TA 3F5FA 3W8RA 4BLRA 1DEKA 3FFBA 4RY2A 2Q0HA 2WJVA 1KIMA 2E87A 4BFSA 5LPNA 1W1WA 2GCNA 3N2EA 3U6KA 1Y63A 1U9IC 2A5FA 2Q3MA 2RCNA 1G7RA 2ZYTX 2PCLA 2ZI3A 1D5CA 4GPTA 4EFMA 4P31A 2DPXA 4H1VA 4C0BA 3OEEA 3TH5A 3X2SA 1U8YA 3LW8A 4Q21A 1CR0A 2JIZD 4N3NA 1NLFA 3NWJA 1JPNA 1PLLA 3DO6A 5L3RA 4GZMA 4NPHA 2LKDA 2O52A 4R9UC 2L0XA 4G5SA 4D80A 4A4DA 2WJHA 3FTQA 5FPSA 1W2HA 2ZRBA 1AKYA 2JLWA 4WOPA 3RANA 1XEWX 3HU3A 1XTQA 4E07A 3SR0A 1TQDA 4W5JA 4TMTA 1OHHD 3IUYA 3S1AA 2FJUA 2VTKA 5EXTA 2ZRAA 3UMFA 4O3MA 4MYCA 1Z28A 2P3SA 4YMUA 4XOIA 1TNDA 3Q3JB 4JS0A 5HTKA 4DT1A 2RHDA 4Q1DA 3OE7A 5GADl 1QHNA 2WAYA 4QJ4A 3CZQA 1Z0FA 1FZQA 3FDIA 1IXRC 2X1VA 1H65A 3X1XA 3GMTA 2VH5R 4Y0VA 1HA3A 2O0KA 3D7MA 3EIHA 3QPVA 1TPZA 1RVDA 2MSEB 2Q9CA 4QNMA 3OEED 4JBXA 1YE8A 4C0SA 1YR8A 1U9IA 2A9KA 2FPLA 2HCJB 4FMDF 5EJEA 2GF9A 2OV2A 4FWIB 4PAMA 2WBLC 3TK1A 2OZEA 3VR2A 1N6PA 5JJIA 3CRVA 4NYIQ 1TQ6A 1M8PA 3AKCA 4I1SA 1XJQA 4G01B 4OKSA 4IXMA 1KZGB 1BYIA 1NKSA 3UMSA 4HAZA 1KK2A 1E4VA 1KI7A 4LK2A 4POAA 4FWTA 3EC1A 3IIJA 1CULC 5E7MA 4NHOA 2PJRA 3LD9A 1W4RA 1J8YF 1A5TA 1KZ7B 3KFVA 4RD4A 1LVGA 1F3OA 4ZKEA 1FTSA 2H1LA 2GDJA 5FTMA 3ZVRA 3BAFA 5KDLA 2R44A 3RC3A 4GRAA 4A8JB 4KFRA 2BDTA 3MFYA 4IJMA 1T5IA 4ZCMA 1J2JA 4IDNA 5J4HA 4JSTA 4B3BA 1FQKA 3B13B 1HUQA 1XTIA 2ZJAA 1LB1B 1CRQA 1R8SA 1XZPA 3B1YA 1R6BX 1MO3A 3OIVA 3RS2A 4BASA 3SQXA 3EW9A 5AUNB 1N5JA 1P7CA 2BBSA 2BJVA 4OQNA 4PSKA 1SQ5A 2BC9A 1DAMA 1DARA 1QHHB 2NZJA 1Q1QA 2QAJA 4JBWA 3IDQA 3WMEA 2Z4RA 3DMNA 1GIAA 2PJZA 2JJ2D 1NG9A 2WPDA 1R7RA 4N0EA 3GJ8A 4DIEA 4BFUA 1WE2A 1G8PA 4FN5A 3QI2A 4BLQA 4DIDA 2QAGC 2W6JA 4V0KA 1P73A 3ZYCA 1ZM9A 3UKDA 4PR0A 2GJAA 2GXQA 2YNMA 4KBGA 5JHHB 4JL8A 2RHMA 1TEVA 2ASEA 3QOFA 2FGJA 1L4UA 5IK2D 4UNRA 4D4JA 3OESA 2F9LA 1XZQA 2WAXA 1I4LD 2R6DA 4R2HA 4WZAE 4M1SA 1S96A 2FV8A 3H84A 2ZETA 4FCVA 4JVLA 4A8JA 2LCFA 3G82C 2F43B 2CLSA 3ND9A 2XB2A 3TUJC 2CK3A 2ZRHA 1VECA 2BVNA 2KE5A 1R10A 2QA5A 4XD7D 1TU3A 5SZKB 1F60A 1UAAA 2H57A 5JEDA 3U3KA 4PC1A 1QHHA 3KJGA 1KI1A 4ASUA 1S1CA 1Q1ZA 2GESA 2OG2A 3SFZA 3D6TB 3LLMA 1AGRA 3PUYA 4JJZA 2WHXA 1TQ4A 4D82A 1B0UA 1E2FA 4TMWA 4W7SA 3BS4A 2IC5A 4UXIA 1SVIA 3LRPA 1LS1A 2ODEA 3MSXA 4HYYA 3AVXA 1CJMA 3K9NA 1NMZA 1IBRA 1GL9B 4G0NA 1GM5A 1XBTA 4B6EA 1MO4A 2IYLD 4HAUA 4OI4A 1G3MA 1DTSA 4BFZA 2GAOA 4YMWA 1HE1C 2MMCA 3L2OB 4BQSA 3BOSA 4Z8YA 4LYAA 3PQCA 2ZJYA 2B8TA 2A5YB 3C14C 4DLVA 2F43A 2VF8A 2IX3A 4TYNA 2ANBA 1Z6TA 1PUIA 2GVDC 3GJ4A 2YOHA 3ZD7A 2GILA 2H5EA 4QNRA 1M7GA 1JR3E 3U7EB 2VYFA 2XOKD 2YYZA 1E2MA 3KUDA 4TYQA 3VR6A 2VLIA 1NJFA 2HLDA 4QHYA 2IYXA 4MKHA 4ASUD 4B34A 4DUGA 1N5IA 1OE0A 4TTPA 1G7SA 1Z63A 1OXUA 5DSZA 4JVMA 4PPQA 1VG8A 1GL7A 4LV6A 3U5ZB 3X1YA 1AK2A 4HDCA 4EJSC 3GJ0A 1H8EA 3ADKA 4NU0A 2HDNB 1JAHA 5E3HA 4HAWA 4BWYA 2YKGA 1RZ3A 3GLFB 2VO1A 1P2SA 4ZV4A 5H68A 4M1WA 2QTFA 3V4RA 1IY2A 4BE7B 2V54A 1G4UR 4JLKA 5KSZA 2WKRA 4HB2A 4Q66C 2IXFA 4MYHA 2EFDB 4US1R 4GMXA 1RYHA 2GCOB 3SYLA 1SVWA 3E5HA 1LTQA 2W0SA 4JLVA 1M74A 2GNOA 1S3GA 3TRFA 2REOA 3DPUA 3KZ1E 1G9XA 2PCJA 1E98A 5JRZA 1ZMXA 4O0MA 1JR3D 2FSGA 4IOKA 1XMIA 3MWKA 2KBEA 4DLTA 1MKYA 1EESA 4YXWA 1XX6A 4G5QA 3DOEA 1VYVA 3RRMA 3GEHA 2BIFA 4D81A 4PTLA 4NCHA 1P72A 1U94A 5DYGA 4DUGD 4UNPA 2ECKA 3I62A 1O87A 5KO2A 2ZS8A 1QBKC 2VSFA 3Q7PA 4MRRA 2GTPA 4XWAA 2ZU6A 1GKIA 2CMKA 3O8RA 1HH4A 3C4JA 1J8MF 2ZSBA 1H8ED 1AQYA 2VF7A 2QNRA 3GLFA 3PCRB 2JLXA 1QHYA 1VCIA 3BC1A 4B6FA 2ZIAA 4NH0A 4A2QA 1P61B 2GK7A 4TQUS 1KY3A 3DKPA 4M4SA 4GOJA 1N3BA 2GCOA 1N0VC 3CPHA 3QF4B 5DHFA 4DCSA 4Q02A 1E2JA 3PXGA 3P1JA 3RRYA 4DDTA 1JB1A 1VIAA 4M0LA 3KQKA 4IFEA 2QGZA 2V1UA 1WQ1R 1Z0IA 3RRNA 3MGCA 1G8FA 4NTZA 4RZUA 3EXAA 3WYGA 4D6PA 3H86A 3QKRB 3QVUA 3K0CC 1E2EA 4MDFA 2P2LA 2B8WA 2C95A 1IAQA 2ZI9A 3I1FA 5EP2A 2IYQA 4YXWD 3TKLA 3GLGB 4TL6A 4DLUA 2AK3A 4XWOA 2OO7A 2J0QA 2B7BA 3EZ6A 4QBGB 5AJVB 5KHOC 3QKSB 3W8NA 5AJYA 1G3RA 3U4QB 1X1SA 4JMPA 5EE9A 4OK3A 1NN3A 1QVAA 2DFLA 1JALA 4DLRA 2NG1A 1PJRA 3VR3A 1G17A 1XEWY 3EZ7A 2F1JA 2CLDX 2WWYA 1CJVC 5IT5A 1DBSA 3B7GA 1FP7A 4B32A 1MV5A 1O3YA 4GSYA 3V4FA 3W6NA 1S4QA 4PAQA 2ZI7A 3JVVA 4Q4JB 3WP1B 1KGDA 5KSPA 3RNLA 1N5LA 1TF2A 1G1MA 5ELXA 2FPMA 1MR3F 2ZS7A 2ZPTX 4ZCLA 2GA8A 2WM9B 1NP6A 1MO5A 3I4LA 1L7VC 1Z0DA 4EPXA 4RD0A 2J45A 3QF4A 1W5TA 1Z2AA 3KB2A 3LXXA 2ZITA 1E9CA 2AHOA 2J0UB 1SVLA 4AYWA 3B8HA 2FEOA 2W6IA 4XTRA 5DE3A 1N6NA 3QKRA 1W5SA 2EFHB 2MMGA 2I3BA 2XNDA 3CUEF 3K9HA 4NCNA 4Q1FA 3THOA 3ZDQA 4TZ6A 4IEEA 2AR7A 2FNAA 4KSBA 1VYTA 4YLGA 3MRSA 1NF3A 1SKYE 1VG0B 2UKDA 3OEHD 4TL9A 3GLGA 3IKJA 2QL6A 4PHGA 5IDVA 4BLSA 1Z3IX 1AKEA 1GNQA 2N46A 5FUWA 1KO8A 1N6KA 2QMOA 3QKSA 3W5IA 3U4QA 3BFXA 1KKLA 3T12A 5A4JA 1V5WA 2QRNA 3V00A 1M2OB 4UQOA 1GL6A 4JKIA 1E0KA 1NMYA 1OIVA 3BK7A 3A1VA 4KODA 4TLAA 5F98A 5FBLB 4A0GA 4LJ4A 621PA 4MYTA 1C4OA 5DH9A 1ZBDA 4Q4JA 1KAGA 2O8BB 3UANA 1ZNYA 3M6AA 4QL3A 4FMBB 4QC2A 1YZQA 2ORWA 4GP6A 4OBEA 1GITA 2ZYVX 3PUXA 2OLJA 3QXSA 3MWJA 1E9DA 2JEOA 2N42A 4HUQB 4C0LA 3AVOA 2J0UA 4A1FA 1CTQA 1COWA 1DAHA 1Z6GA 4HUTA 4URYR 1NKTA 1Z22A 2C9CA 2W6ID 2ZJBA 1NMXA 4HB3A 2FZ4A 5F9HA 1CRPA 3C8UA 1BO6A 2XNDD 1SZPA 4FCWA 4LBYA 4MRVA 1VCOA 2XAUA 3LDAA 4M53A 4PQFA 2QUZA 1TADA 3LXRA 2EFCB 4NYMR 4DZZA 4B35A 3NDBB 1G3QA 3LBHA 5KPJA 3SOPA 3SFVA 2ZI6A 1W0KD 3WNBA 3X1ZA 5L8VA 4WW0A 2ZI4A 1E0JA 1T0JB 3AVYA 1HT1E 1SVSA 4YC7A 4I4LA 4MUBA 2YINC 2K5UA 2XJ4A 3GJ3A 4H9GA 1SXJB 2ANCA 1A1VA 3KDSE 3NVAA 2ZRCA 4FMDB 3KB1A 3AVPA 1AS3A 1NBMA 2JLUA 2VP4A 4E03A 1OYWA 1E2DA 3I72A 2O8BA 3OIWA 2A5JA 2ZSAA 1IXSB 1Q3TA 4YONB 2CXXA 3SNHA 2JLZA 3CH5A 2GZAA 2EYQA 3CR7A 5JHGB 3SI7A 2DYKA 5DO9A 2Z6VA 1QHGA 1G5TA 2QPTA 1K5DA 2J7PD 4HUQA 1XTRA 4N0DA 3U60B 4IDPA 4NMMA 1U0JA 4D0NA 5JECA 4LJ6A 4RSGA 4DCVA 4JL6A 3GFTA 1ZNZA 1OXTA 1U8AA 4X8LA 2O8EA 2E1RA 4U02A 2GJ8A 2KWIA 3QF7A 3TR0A 1N5KA 4MKIA 5HKKA 2R2AA 3I8SA 1KMHB 3IIMA 1JR6A 2QPAA 3JZMA 4EPWA 5C4MA 3BRWD 2YHSA 4Q03A 2VHJA 4UXHA 2WWIA 4DSUA 1ZUIA 2B92A 2ZS9A 5EP1A 3RS0A 4Q1AA 3NC0C 1ESMA 1GSIA 2ZRNA 2XNSA 4YQFA 2NZ8A 1ZAKA 3A4NA 3R8CA 1SXJA 1AJEA 2WKPA 4QBFA 3T1OA 1QZXA 3QBTA 4KXFB 4ACAA 1EWQA 5HCNA 1NBMD 4D0LB 2B6HA 2GK6A 3NH6A 3ZS8A 3GLIE 2XX3A 2P6RA 2XSZA 2BBTA 5FPKA 1JQJC 4OHVA 4P32A 2CNWA 5TY0A 1D2MA 3SYKA 3D3QA 4LUCA 1F6BA 5BYKA 4Q7KA 4XTCS 2RGEA 2QP3A 3A58B 4TMXA 4WXRA 4X8MA 3TR5A 3WXMA 3K70B 4A9AA 4TTQA 2V3CC 3LW7A 5EXXA 4LZZA 2JJ1D 1N6IA 2BOVA 4F4JA 2J3EA 1ZVQA 4A15A 3UG6A 1BKDR 1FNNA 4GNKA 1CXZA 2BEJA 5J4KA 1KMHA 5HKKD 3CM0A 3FKSD 1KI6B 1AS2A 4HDOB 1TF7A 1YZNA 3ZS9A 1G6OA 3L0SA 4YDHB 2FE4A 5L3SB 2JLSA 3Q8XB 4PFSA 3FVQA 3QENA 4OK6A 4UXJA 1IY1A 3B85A 4ZDKA 3BD9A 4K8OA 4LY6A 5JS8A 1SHKA 1SXJD 2BWJA 4GBMA 4TQAA 2R8RA 3HR8A 4ARZB 2FSFA 2NQ2C 1GRNA 4IRUB 1EX7A 1OYYA 4LC1A 4B3FX 3IPXA 1NLYA 1ZP6A 5AWFC 3WYAA 4F4IA 3LWNA 5G41A 2XSZD 3EZ9A 2CNWD 1LF5A 4A2PA 3NHBA 1HURA 4B71A 3QNUA 3NHAA 3AP3A 2JJ8A 4LHWA 3CR8A 3RLFA 1BOFA 4HB4A 1EFUA 5KTYA 5J4YA 4I99A 1X3SA 1NN5A 2EFGA 2RGAA 1JJ7A 2RGNA 4H1UA 4PAOA 4QGAA 2JLVA 3VTKA 3CRW1 1UADA 2AWNA 3R9WA 5AUPB 3R20A 5GJBA 1KI9A 1N6OA 2CDNA 3I5YA 1KO1A 5FOSA 2GBLA 1W0JA 3UWOA 2J41A 4UNNA 1KI6A 4MRNA 5CDFA 4V03A 2DR3A 3KTAB 2P6NA 4WA7A 4Q5IA 5L3SA 4DDVA 1P2UA 3GEIA 1G7CA 2G0TA 2XZPA 2BCJQ 2Z4SA 3BB1A 3CF2A 2VP6A 1HYQA 2YC4C 2QORA 5H1YA 4QBHA 4ARZA 4DJTA 4M21A 4R71A 2RB4A 3KXKA 2IEYA 1N0WA 4Q9HA 4WAUA 1ZU4A 3RS3A 4BZQA 3PV0A 3KJIA 3AGPA 5UKDA 1YZUA 4TT3A 2AK2A 5CYOA 1ZNXA 2IEZA 3AGQA 3TUIC 4D4KA 1WCV1 2H92A 5FBVB 4XSHA 4B74A 3LNCA 1TX4B 2YVUA 1X8LA 2FZLA 3TQCA 3EZ2A 5LDDC 4AURA 1FL9A 1I2DA 3G0HA 5KNDA 2Q21A 5FOXA 4RZ3A 2WIBA 4LV5B 2G0NA 5CIQA 4DCUA 1MOZA 3WNCA 5JEEA 3U3JA 4TZ0A 3KJHA 4F7WA 3NBZC 3L8ZA 2W83A 3LX5A 4AI6A 3KL4A 3CZPA 1W0JD 3U6BA 3QXCA 4PZYA 2CCJA 4A0FA 3KTAA 2BCGY 1BIFA 4TQ9A 1E2NA 4LWZA 4UNSA 3RAPR 4A6PA 5HZKA 1RYFA 2WMNB 1C1YA 1TUEA 1KSFX 3OFNA 4Z8XA 3ZVLA 2CBZA 5DN6A 3IO3A 4V02A 3KKPA 1DAFA 1ESNA 2A2ZA 1SVKA 3R9IA 4AKIA 3TVDA 5JCPA 4NCJA 5FUXA 4PO9A 2YWHA 2ZE5A 1M6NA 5JMTA 3BWDD 3I73A 3IHLA 4MGZR 4TSFA 1HV8A 1KI8A 1EFRD 2C9OA 3U3RA 4B3GA 1OSNA 2C04A 3Q85A 4BFXA 1NN1A 2BJWA 4UKDA 2CJWB 1UF9A 1RRPA 5FUVA 4D0GA 2V7QD 1L8QA 4BGDA 2IA5A 4UJ5A 3ZZ0A 1EFTA 2HYDA 3K9LA 3PEUA 5A0FA 1ETUA 3QUSA 1WMSA 1F48A 2GKSA 2QN6A 1XDBA 3UWKA 3HPQA 2PL3A 3R7WB 1W7AA 2OFWA 3LA6A 2ZJ5A 3T5GA 5BQ5A 4IOLA 3LV8A 3SN6A 4CEJB 4P4UA 4TMZA 4EPTA 2WSSA 2D3WA 3OFND 2IXEA 1WDTA 1U81A 5KSYA 4C0KA 5DN6D 1KDTA 3BGWA 4YMSA 1NRJB 3TE6A 4C0QC 2PZFA 4LV8B 1OFIA 3NDPA 1HT2E 1GAJA 4GT1A 4KBFA 4FW9A 4P33A 1KJYA 1YR6A 1YRAA 1S8FA 2QQ0A 1P4SA 3B1VA 2GJKA 2V1XA 3FPAA 4TSFD 1OKKA 3RYTC 1OH8A 2D62A 1ZCBA 4W9MC 2CE2X 1T3LA 5EXSA 2F6RA 2CJWA 1FPMA 2VSOA 3CRQA 1E9EA 1KSJA 3SC3A 3LAWA 4QRHA 4A8JC 2GXUA 1MH1A 5FL3A 2I4IA 5H70A 4XWKA 2FDCA 3OF5A 1CJKC 2PT5A 3UMRA 1QHIA 5AR1A 3R7WA 5FPHA 3T1VA 1VKJA 3OE7D 2VP0A 4MYUA 1Q44A 4M9QA 1W36B 4M2LA 3KQUA 4ZDJA 2QG6A 1FW6A 4CEJA 4LBVA 3HYTA 3B9QA 1E9AA 2GZHA 2WSSD 3CWQA 2D2EA 4RCZA 1G8HA 5TARA 4PZZA 1ZD8A 2G88A 4ZCIA 2GRJA 2GCPA 1FMJA 1UEIA 4ACBA 1GKYA 1T3SA 3AVQA 5G53C 4Q7LA 1OXVA 2XTZA 1JBKA 2ATXA 3PIRA 2RH5A 4KHZA 4XIGS 4URUR 3RSOA 1FTNA 3AF2A 3FHTA 1DVRA 3AVWA 2NPFA 3AH8A 4DEXA 2OUKA 5JI2E 3THXB 1II0A 4AG5A 3U7HB 4CW7A 5L3VA 2A3RA 2QM8A 2HUPA 1G19A 5FI0B 4CEHB 3IBGA 4G5OA 3E2IA 4PSVA 3KKOA 4MDEA 3WY9A 5IRCD 5JWHA 2TMKA 2BM0A 1ZCAA 2P0EA 5FR2A 4E5UA 4ERNA 4RKEA 3TGPA 4IKEA 4LJ7A 4BFTA 3ASZA 2ZROA 4Y0AA 5CIWA 3HR7A 3EX7C 1D6JA 1J99A 1NY6A 5EE1A 5GVSA 3AKYA 3VMFA 4LX0A 5HE9A 4MKGA 1WB9A 1NSTA 2ONJA 4A82A 4ZI3A 4M1YA 1GWNA 2GEUA 3CX8A 4GI7A 3E70C 1WA5A 1TU4A 1D9XA 5TXGA 4B76A 2F3TA 2VP2A 5BN4A 3VKGA 2IXGA 4XVUA 5C18A 4C0HA 5JWRA 2GF0A 3ZH9B 4L5BA 5EZ6B 3TJZA 2WPDD 4DCNA 4TL7A 1XNJA 2BBOA 3KXIA 1XCPA 1P9WA 2W6JD 1ZJ6A 1SHZA 2IYTA 2ZUBA 4YMVA 4Q00A 3THXA 3BFVA 1ZC4A 3EAQA 4CEHA 4TYYA 4Q1BA 2DWQA 3QG1A 4B44A 1ZM3A 5JCZA 4OI0A 4JVSB 821PA 2REBA 1P2TA 1J70A 1N0UA 1NVUQ 1G64A 2AKAB 2D06A 2IYRA 2ZAOA 1VG1A 3CRMA 3CNOA 4JT2A 5JRJA 1DAKA 2FFQA 4MKFA 2FSIA 3NEYA 1X86B 2CL7X 1OFTA 4Q1EA 1QVRA 4QGGA 4I1VA 2CK3D 1W36D 3QKTA 1KTVA 3CX6A 4W5HA 4C9BA 2HV8A 1X1RA 2PX3A 4BUJA 1P6XA 1G21E 4PQRA 3MD0A 4KVGA 1EX6A 1U90A 5KNBA 1G20E 4NCKA 1P62B 1X8JA 4QJ3A 1RE0A 1DAIA 1AQUA 4LC0A 2IWHA 5C4GB 5H8WA 4C0AC 1KDPA 3FMIA 2IL1A 4IHQA 4HB0A 3H1TA 4K81B 1ZNWA 2HF8A 4QKQA 1KNXA 2UVQA 3MCAA 4D26A 1N25A 2N1BA 3NBXX 3WMFA 3OZXA 4MGKR 4OI1A 4Q9LA 4AKHA 2ZAMA 4PC3A 4M9SA 1KO7A 5DHAA 2J46A 2IS4A 1QG2A 3TSOA 4Z1MA 1E0SA 1OXXK 4MQBA 1F2TB 1FX0B 1U0LA 1KK0A 1W4BA 1J90A 2QPOA 1IONA 4AY2A 3NBYC 1Q12A 2ZQ5A 421PA 5B30A 1UKZA 2W58A 1JEEA 2J7KA 1XXHB 3HP1A 1ZD9A 5B57C 3D31A 4DEYA 3HWSA 4AWXA 5JZVA 1DADA 2OE2A 2HLDD 4PANA 2O8EB 3DL0A 5K8LA 3RDPA 1XD8A 4B2IA 2FWRA 1PV4A 4LBZA 2FN4A 3SBEA 2A78A 1ZD1A 1JJVA 1FMLA 2C98A 1Z0KA 3NEJA 1W2GA 3K09A 4BRUA 4C0JA 3DDCA 3RC8A 2Z43A 2C9YA 3IHWA 1PLKA 5CJPA 5TMPA 2ZM5A 1OF1A 3GCGA 5CM8B 1KO4A 4LHYA 4QGFA 2ODBA 4DSOA 2WTUA 3ZZTA 1LW7A 5TVKA 2DFKB 3GLFE 1VIYA 2ZVPX 3KQLA 4KLNA 2SHKA 4NZYA 3KQNA 2D7DA 1R5BA 4JLJA 2ORVA 5SZIA 2QE7A 2C99A 1F2TA 1TQ2A 1FX0A 1IJEA 2ZXUA 1VG9B 2J59A 1XFAA 3SU8A 3ZIAA 3B6EA 1UBGA 2IYWA 1CR2A 4HATA 2JATA 2ZJ8A 2FH5B 4I81A 4IVRA 3OIYA 2BKEA 4LPKA 3WRYC 3PJRA 2JA1A 3O8CA 3IPYA 1EFCA 4NP6A 3SHFA 1XXHA 3BORA 1NI3A 3TBKA 1S2MA 2HJGA 1U8ZA 1KJWA 1XRJA 2RGCA 1US8B 3A8TA 3FMPB 2FMXA 3BB4A 4CZ2A 4LOAA 3C15C 5K8TA 4JLDA 4LGMA 1RW4A 1YVDA 3FYHA 3NIBA 1SVOA 3C16C 4JIMA 4B2LA 1K8RA 1NVVR 1UM8A 2OAP1 3IBYA 2D74A 3MLEA 3MMPA 3WBJA 2IS2A 4B48A 3Q9LA 3Q72A 3PVSA 5AUOB 4NL4H 4IDOA 4MH0R 5CB8A 3B1WA 3FFAA 4NYMQ 2WJYA 4TYWA 4JT4A 5L3QB 1KKMA 2OSBA 3T5DA 4L16A 4KYUA 1WRBA 2V55B 4LJAA 4TWZA 3R9XA 2XITA 2PLRA 2Q9AA 2QGNA 1CLUA 2F1RA 4O2LA 4HLCA 1EGAA 2R6AA 4P0TA 3CLVA 1KAOA 4OHWA 3KXLA 4US2R 1IN7A 2XB4A 1HEIA 4FMCF 5LD2B 3ZIAD 3Q5EA 5DLQC 2ZANA 1A82A 1ZUHA 4DDWA 1U98A 3GQBA 5AK0A 2WWXA 4Q01A 3VAAA 4ABYA 1C9KA 2UZ3A 3THYB 1OJLA 1US8A 1TMKA 5FTLA 1KSHA 4QHSA 3W3AA 4EIWA 3GLGE 2KBFA 3NTUA 3F3YA 3THWB 4BZXA 2H17A 3QIAA 1ANKA 1NY5A 5EXPA 4WBSA 3SE0A 1XMVA 3ND8A 3BB3A 1DE0A 1I4DD 1IN6A 1DELA 1Z6AA 1E6CA 5L3QA 1RC8A 5EUMA 4IOJA 2BBWA 3CW2A 1FP6A 1XTJA 2GHIA 4LHXA 4DBLC 2AXNA 2V6JA 1UJ2A 2QSZA 2NO6A 2G77B 1Q1EA 3GJ6A 3O8BA 3HU1A 5CITA 1P9RA 1J7KA 4RD3A 4B3CA 4C4PA 2ZSEA 4KSCA 2OM2A 4BFVA 2PZGA 1VYUA 1MRSA 2ZUCA 3DMDA 2EVWX 3QXXA 3AF4A 1CKEA 3L0IB 2KB0A 5J40A 4S35A 4RJLA 4BLOA 1E1RA 3I32A 4Q7MB 5CYPA 4EPRA 3VR5A 1B23P 1L2TA 1OB2A 2W2XA 2PH1A 4DB4A 4OK5A 2PMDA 2WZQA 3WMGA 3SJBA 1GRRA 2RKOA 2WKQA 3THYA 3C7KA 1DO0A 3MG9A 3TUZC 2OESA 4URWR 2PEYA 4IFBA 1Z6XA 3B82A 2UZIR 1SXJC 4QG7A 4F93B 1OH7A 4KFSA 4NONA 5BWMA 4E09A 3TQFA 3THWA 1E0AA 2A5GA 5FFMA 1DPFA 3A1SA 2AXPA 1N6LA 3AEZA 1P60A 1BYUA 3AVUA 1EXMA 2PBRA 2FSHA 3KJEA 3PEVA 4WVFA 5G3ZA 4Q47A 1NBME 1T8UA 3WNDA 3VKHA 1DG3A 1R4AA 5AJZA 2NO1A 1JI0A 2PZEA 3A1TA 1E2GA 2IYUA 3EARA 5KSOA 4M22A 4DWJA 1MABB 1TF5A 2NO0A 1COWD 1Q21A 3QQ5A 2NIPA 1AGPA 3WHLA 4A0HA 1K6MA 2VPPA 4RCYA 2H18A 4OQXA 1D8TA 2WIAA 2ZSFA 2O8DB 4ZO4A 4NBSA 4WZBE 1Z8FA 5G40A 1ZU5A 2ZSDA 3T34A 5DI3B 1D2NA 5F2EA 3FGNA 1UPTA 3WBKA 4BPBA 5GJVC 2QT1A 1R5OA 3F8TA 2ZU0C 2BMDA 5C2JB 4ITRC 1BMFA 1G5PA 4ZDIA 2XXAB 4V0LA 2I1VB 1SXJE 4XVRA 1E79A 4FXPA 3EPHA 3BH7A 5J4LA 3K70C 1E69A 2IHYA 3GLHB 1M7HA 1IN8A 2R65A 3TAHA 5GJWC 3H4MA 5CK4A 3LFUA 2RGNC 2WV9A 2ZR9A 1M7BA 5EQTA 1KY2A 3JVUA 4BLPA 1P2VA 2ERXA 1MRNA 2JAQA 3LBIA 4L15A 2PEZA 3CRRA 1MABA 1R8QA 3GPLA 1U99A 2GBLC 3N70A 4JL5A 1E9BA 1IM2A 4QBIA 1G8GA 2WJGA 3T1QA 3C5CA 4DRZA 2O8DA 4B73A 4FD2A 3U3MA 3O8DA 1P75A 2Y8EA 1XU4A 4V0MA 5DI3A 2IUTA 1G18A 2JGNA 2LKCA 2WJIA 1Z07A 4JYCA 5FR1A 2NMVA 2YWEA 3LH5A 1YHNA 1E1QA 2WVJA 1N6HA 3EWSA 3KFXA 4UNQA 1R0ZA 1Z0JA 1T4GA 1E2IA 2XXAA 2ZUDA 3VR1A 1CR4A 2PMKA 4CDGA 1WP9A 2GEDA 1NNEA 1OH6A 2IF0A 3CIOA 3MAAC 4LCBA 3SJZA 3V9PA 4DLWA 4Q1CA 4NKRA 3KKQA 2AWOA 3GLHA 1CIPA 1E2PA 1JECA 4AG6A 1R2QA 3A36A 3U44B 1FNMA 2WJJA 2ZE7A 1KOFA 4C7OB 1WBDA 2G6BA 2C5LA 2ODNA 3QEJA 4QM6A 4DXAA 3MUFA 4D25A 2VHCA 2VL7A 2HJVA 1W4AA 2OCBA 3EASA 3AM1A 1KK3A 3DEFA 2JCSA 1GKUB 4R2IA 4URVR 2ZE8A 4IVQA 2AL7A 3IO5A 4HEJA 3RABA 3DM5A 4HZIA 3A1UA 1RRFA 1GOTA 2J1LA 1VTKA 2KJQA 4PPGA 1GNRA 5CDFE 3PUWA 4EPVA 3WP0A 4ZI2A 1KHTA 2VHUA 4MUAA 1G41A 4B47A 3EZFA 1UEJA 2KI5A 2ZE6A 4M9ZA 2ZRIA 2ZYUX 1VHTA 4DC9A 1OH5A 1AN0A 2DWOA 2GETA 1XJ0A 5JJKA 3WYFA 2DFNA 4Q4AB 3DHWC 1OXSC 2HT1A 3T1TA 2QMEA 5F3WB 1GFIA 4M1OA 1ZC3A 3BERA 3U44A 1TTTA 3T15A 3TW4A 3ZVNA 4IVPA 3CB4A 4C7OA 2ZRPA 3K70D 1XWIA 1NLZA 4BEBA 3JZAA 3U7GA 2OCPA 5HR5A 4C2TA 3RSLA 3KKMA 3TIFA 5HZHA 2V4ZA 1S1MA 2CL0X 2O0JA 1UFQA 1CP2A 2JIZA 4HLDA 1DAGA 1R0XA 3LQRA 5KDDA 3BJIC 3H0KA 1K5GA 2BMFA 1XB2A 4LSGA 4JVNA 3TLXA 4HDQB 2RGXA 3CBQA 1FQJA 2QTHA 3W3ZB 5IF9A 4CF7A 4M9XA 2JASA 4N1AA 4JKYA 1A4RA 2CE7A 4BEJA 2VP9A 4LI0A 4LYJA 1AA9A 1TL7C 4KV9A 1ODFA 3EPJA 3K53A 4Q4AA 4B3DA 521PA 4DLYA 4KITB 4RFSB 1OFUX 1ONBA 3CF6R 5ANRB 3AF0A 4CT5A 2IW3A 3TSWA 1TAGA 5C1BA 4TT3D 1DAEA 2ZJ2A 2ZRLA 3W9YA 2HYIC 1GRQA 2C96A 2IYYA 1KMQA 2Z0MA 5EE3A 3I3SR 4JLOA 3CPJB 4BECA 4RZXA 1AS0A 2W0MA 4PO8A 3I92A 3QY0A 2W00A 2F9MA 2ZRMA 3FKQA 1Z47A 2C03A 2ORIA 3ZVMA 1M1YE 2HXYA 1G291 4EDHA 1UBFA 1ZM2A 3HJNA 3LY5A 3ZQJA 1GG2A 1Z08A 4TN1A 2EW1A 2J5XA 1VCMA 3EA0A 1FUKA 4M1MA 5HPYB 4EFLA 1VDZA 5JSZB 5F9FA 3M4YA 2YOFA 2D4HA 2HEIA 3QE0A 4EQ6B 2OBLA 4XVQA 4US0R 2G9NA 4O2RA 4Q19A 1W4CA 1ELOA 4X8HA 2VP5A 1OLOA 4AKEA 1NG1A 4UJ3A 4HLUA 1WBBA 4BLTA 4LYFA 3NC1C 3H2YA 4RFSA 4B33A 4JLBA 2OLKA 1WF3A 1Y3AA 1X6VA 2YV5A 4B2PA 2C8VA 1RRCA 3TSZA 2OCAA 1EFHA 2J0VA 1IHUA 2Q3FA 5G3YA 4KU4A 8OHMA 1G5RA 1T9HA 2VHQA 1T5LA 4I1UA 5EP3A 2I1QA 4AK9A 4U5XA 5E7IA 3NKVA 4KFUA 4JJKA 5EZ5A 3EPLA 4OJQA 4CT4B 3ADDA 2QSYA 3KQHA 3IQWA 3BIFA 1MO6A 2R6CA 2QT0A 4OYHA 1OB5A 1W36C 3B9PA 1KK1A 2JJ2A 1UKEA 2YWFA 1NN0A 2A7QA 4FMCB 4B75A 2XTNA 4RZ2A 3I8XA 4PSAA 1Q1BA 2IWRA 3DZ8A 4LYHA 3ZGXA 1XEFA 5KUTA 2X2EA 5LB4A 5JSZA 1UBEA 1S0UA 2ZJOA 3B2EA 4EQ6A 1XPOA 2IF2A 1A7JA 4DLSA 4GOKA 5AJXA 2IK8A 3AUYA 5IK2A 3QG5A 3TVTA 2CCGA 1YJ5A 4PZLA 3SZRA 5TDHA 3FHOA 2GEVA 3X1DA 2ZTSA 1LFDB 4PO1A 3U2QA 2XZOA 2AD5A 1XTKA 5D3MB 4GDFA 3PFIA 1JQLB 1VHLA 1ZM4A 4CEIB 2BMJA 2Q9BA 1OKKD 2QENA 3DZDA 4CYMA 3K0FB 4TMKA 4XD7A 1F5NA 2IBMA 4LJ8A 5IHPA 4MRSA 3DM9B 1P9NA 3Q7QA 2X8AA 2GZDA 1T3HA 3K0AB 3QKUA 5FOVA 2IT1A 1AM4D 1EG7A 1W49A 1H8HA 2QP9X 4IOMA 5JWOA 1YKSA 2ZREA 2QBYB 1RPZA 2FF7A 2CL6X 1TEXA 4RD6A 4Q7JB 2AX4A 1N2CE 2WSMA 4AYTA 4KFTA 2GAAA 4G5RA 3ADBA 1E9FA 3W90A 2FFHA 2B7CA 1YZGA 4TL8A 3SDZA 4ILEA 3UG7A 4KI0A 3ECCA 2WWFA 4BRWA 3UIEA 3NBFA 2QP4A 3IGFA 3QPWA 5FBWB 1XPRA 2EU8A 1S9HA 5C46F 4Q9JA 2YJTD 1NVXQ 2QAGB 1HQYE 3CKLA 4A6XA 4MA4A 5P21A 5D3MA 1DG1G 1GP2A 1IN4A 1KO5A 3F0TA 4Q9KA 1BH2A 2ZR7A 721PA 4CEIA 4FINA 2MSDB 2QI9C 4CVNA 3A37A 3AKDA 3K0FA 4MGIR 3EPKA 4DLXA 3BE4A 2XOKA 1EK0A 4NYIR 1A2BA 1FFHA 4HLQB 5J4VA 1E2KA 3K0EA 3EG5A 3ETLA 5FBQB 4YDSA 3K0AA 5FUYA 121PA 1U2RA 2ZI5A 3VNUA 5JLJA 2VRWA 4KLZA 3CF0A 2GXSA 1H8HD 2ERYA 1Z5ZA 2QZ4A 3LX8A 2QQEA 4ESVA 2OEPA 5FOTA 2QBYA 3SS8A 4HAXA 5FI1B 5CM9C 2BKUA 5HE8A 2X19A 2R6FA 3AQ4A 2IYSA 3R8FA 3GJ7A 3L82B 4JZKA 5FOWA 4A2WA 1R5NA 1FUUA 1OT3A 1VPLA 2XGJA 3QSYA 1U0HC 3CWZA 1PUJA 5FL7A 4GFDA 1I2MA 4EFNA 2BHRA 2YC2C 4RD2A 4OI2A 2XZLA 2GWHA 2G1KA 3KX2A 1E3MA 5B2ZA 3K09C 5FPYA 5DISB 2GVZC 2QAGA 3OAAA 2Q6TA 1JNYA 4B3XA 1UBCA 4R98A 2RMKA 3CO5A 2WWGA 4AC9A 3UK6A 5EUQB 1G7TA 3HPRA 4KCGA 3J81k 1CEEA 1XCGB 1CR1A 1JR3A 4OHYA 2XTMA 4NCIA 5JS7A 4GL2A 2QMHA 4TLBA 3KUCA 4F92B 3VX4A 3QPUA 1XF9A 3M0EA 1NVVQ 4AYXA 5B64A 4C30A 3DVLA 4KJZA 4LJ5A 4OHZA 3UXMA 1E94E 2RGDA 2OCYC 3U7FB 5CLLA 2CVHA 5CJ2A 2JLRA 4XH9B 4ESHA 4DVGA 2ODWA 3G5UA 2WOOA 1XP8A 3GJ5A 5FTNA 1GILA 3PUZA 2CEAA 2H7VA 1YZLA 5FTJA 3N2IA 3FOZA 1MT0A 1GUAA 1T91A 5FL7D 2LWIA 3RS7A 2D2FA 2EWWA 2X2FA 4MRPA 2FFAA 3VHXA 3ICQB 1CS4C 1GDDA 1P5ZB 3AP1A 3B78A 5M04A 4EJSB 5EE5B 4DKXA 3I5XA 3OAAD 4C2UA 2FX3A 3AKEA 3B1ZA 4NDZA 4PQYA 1IOZA 3A1WA 2PLFA 3VQTA 4DLZA 4L9SA
chains in the Genus database with same CATH superfamily
2H2AA 4EF4A 3JPWA 3Q2IA 5KQRA 1QZ3A 4HFJA 5J58A 2G76A 3LNTA 3CA8A 1TAUA 4QM7A 1H6CA 3SSOA 2GM9A 3B12A 3ANNA 4XAQA 1P44A 2GR9A 2Q07A 3LF1A 1LKZA 1ZH2A 3FPJA 3IVGA 1PZGA 2OFPA 3MGBA 5HRUA 2W2KA 4HI0E 4PX2A 3LUJA 3O4JA 4TTRA 1J5EB 4FHZA 4MWSA 2I4OA 2G08A 3IMKA 2BGLA 3QEMB 4G4GA 1Z38A 2Z30A 3KRTA 2Y9PB 1ADJA 2YN4A 3OPYB 4QUGA 3VZDA 2FWNA 4RH1A 5K8CA 5KDOA 4LPSA 2I3GA 3QPCA 4HXGA 2X9VA 3D0RA 1LUAA 3R7DA 1PW5A 3NYWA 5AOVA 5TQ0A 3E9RA 1XXHE 4IY1A 4A5SA 2JLYA 5K3FB 3MUEA 4HXEB 1UDXA 4Z3OA 1QUEA 1QHSA 1RFLA 2NTVA 1H6AA 1BXGA 1B4DA 4EJSA 2YV4A 4NFSA 2Q5JA 2EGUA 2MSLA 1DCTA 2WV7A 1Y3DE 2DFVA 3FH0A 4CDMA 4D2IA 3I0NA 1J2YA 1WUIS 2DHDA 2Q46A 2FKAA 2Y3IA 3GT0A 3WL8A 4CMHA 2NWQA 4TLEA 3COVA 1T0HB 5EIBC 4CGZA 2J0SA 3FE2A 1WUYA 2ZYHA 5KYNA 2VOJA 1TTPB 3FUTA 4B2YA 3C3WA 1A9RA 3QMPA 2VZ0A 4PLWA 1M1ZA 3D7SA 4XWGA 4NCAA 2EYUA 4O6VA 1PWEA 1HFJA 3ZLJA 1KDZA 2BUAA 1GZSA 4Y2RA 2HXSA 3Q5DA 3D8SA 3PEYA 2Q28A 3TW8B 4BC0A 2R00A 4I6JA 3Q9NA 1GARA 3GAMA 4Z4CA 1J8VA 1JA1A 4QUDA 1VJRA 4LFAB 3QEMA 4Q24A 4DUYB 2QE7D 3V4PB 2FFJA 2G36A 3OPYA 5EUBA 3OKFA 4M83A 4J0DA 2D5CA 1E3SA 2ZRGA 4ZO6A 1TW2A 4H3HB 3RHSA 2ZRFA 1KE2A 3IEPA 3TNYA 3TX2A 1YUMA 3LGXA 3USCS 2O8FB 1KNQA 3GK3A 4WSOA 2DLNA 3TIIA 3V8VA 4G1FA 3CLSC 2QRQA 3FNHA 3GZNB 5HIMA 1SVMA 3U61B 4PC6A 5K3FA 1SA0B 3RVMA 1NF2A 1ZOOA 5B7GA 3FWNA 2WZDA 5ALOA 3SXPA 5D2CA 3V97A 1T6BY 4Q18A 4YP6A 1PYOA 5A5GA 3SEAA 2BPOA 3E9NA 3AIMA 1RAEA 3JQPA 1M34E 2BR5A 2VT3A 3LVQE 4MB6A 1FDSA 4RWZA 5GQSA 4CDNA 1UC8A 3VSCA 3P26A 3IEVA 2E89A 1CY0A 2ONKA 1P0FA 2P6PA 4GR4A 4BX9A 5ILOA 4NXNB 2ZB7A 1OWNA 1WKBA 3GD7A 3AEQB 1K8XB 2VHTA 1O77A 5LWHA 5MDHA 4J3JA 5AVTA 3FUVA 5LBIA 1RRVA 4MKXA 1S5PA 1JAIA 3PA8A 4CGYA 3TW8A 4G5GA 3RWMB 1NUPA 1QDEA 3VDQA 4DPLA 3IP3A 3MWYW 3AP2A 3WL7A 5A1JA 1TJPB 1J21A 4UTXA 1QTRA 5F73A 2OENG 4RLHA 1NR7A 3UPUA 2L69A 1FUYB 3FOCA 4FLFA 5AM4A 2CNBA 1QYWA 3OOSA 3CVXA 1NIJA 5FWNA 2GBGA 4J0KA 1SUWA 4RSHA 2DBVO 4C01A 1Z29A 5CW2A 3UVEA 3I9FA 1I4TD 2VDLB 2WU1A 4LX8A 1ZQ1A 4K9OA 5NULA 3D2BA 2O8FA 1B8UA 3W5SA 1U0FA 1YQUA 3WI7A 1PO7A 1S7CA 1VMIA 2VUUA 1K6JA 2QY9A 1E5QA 1ZSYA 3GZNA 1I7DA 2IS6A 4R54A 1JIJA 1F2UB 5BYJA 1SA0A 2JGDB 4BNIA 3IDZA 3CV3A 2OWEA 3SOZA 3RD5A 4UQLA 1LF0A 2C3UA 1R5JA 2HAEA 3Q3EA 3SJAA 4BNKA 1F8FA 2B5WA 2OQRA 4GVPA 5EHNA 4RANA 3EC2A 4OQYA 4DCMA 3TECE 4M8NE 4GKJB 2QROA 2OFOA 4ITUA 1HGXA 2CVFA 4KIWA 4NE2A 1A9ZA 3ICOA 5FADA 3QLEA 3AEQA 5CDSA 3FHJA 4YS6A 3DBLB 2IW1A 1EVZA 1KYVA 2DSNA 3DHVA 4E46A 4K3UA 4NEQA 4YJ2F 2GBCA 2O0HA 1R18A 2XEXA 3G2QA 3GLVA 4WHMA 4YMIA 5EOVA 1D1PA 4C7MA 1G4AE 1YZTA 1KXZA 4BO5A 5FPTA 3PUKA 1TJNA 1PJ8A 4PQEA 4JGBA 2XNCA 3SHWA 1TMYA 2EFEB 3D0QA 1U0GA 5KEIA 5MN4A 1DIBA 4LBWA 5IG2A 3YASA 2XA1A 4NLLA 1MJNA 2A30A 2OD2A 2ODPA 5DNYB 4UAGA 1IATA 1E1RD 5IJZA 2X86A 3MMZA 1X7XB 1WZ2A 3TAUA 3OQ1A 3TLMA 4IV8A 3PG5A 2VEDA 1F2UA 4RFVA 1BFDA 2JGDA 2R4TA 5TGZA 4HWGA 2BH2A 3QWHA 3W5CA 4MVJA 1XZMA 3U4AA 1R0YA 1W48A 4MJ7A 3BWBA 3EPPA 3H2SA 3IULA 3LQ2A 4JOSA 4C78A 4IHKA 3EISA 3SDSA 3FNGA 2GPTA 1HE8B 2RGWA 1G16A 3DZBA 1ECCA 4B40A 6ABPA 4P4SB 4PHFA 3GLGA 2JJ1A 4RPHA 5M5BA 4K6CA 2WIGA 3MTAA 2VDQB 3DBLA 2DCUA 3ORQA 1VSUA 3OLYA 3S8YA 1XKXA 3ED1A 3EDOA 5AUQA 1C0PA 1RWOA 3D8NA 1V8ZA 5LYYA 3ZBTA 1UODA 1G6Q1 5JJLA 1IJFA 2FG5A 4JJGA 4KOAA 4QJ5A 4V0NA 4DYHA 1VCNA 4Z49A 4F4CA 2VYVD 1SUCA 1RCTE 2Y1GA 1Q0UA 2ZWPA 3FYUB 2RI0A 1JFVA 2O6HA 1QHXA 3MWLA 4BYGA 1OXKB 1O94C 4DG8A 3P71T 5K45A 1IBLB 1NFRA 3O8NA 5K8UA 4R7ZA 5FIUA 1F0YA 3C41J 1WY7A 4Y1EA 1X7XA 3KEOA 4KX5A 2Q7DA 2AFIE 2ZUEA 1CHNA 3QOYA 2QJRA 1A2KC 1ZYUA 1GSOA 2P3OA 1JE0A 3CUUA 1SWWA 3L4KA 2DPMA 3MYYA 3VI4B 5A7FA 1W47A 2IHBA 1JDSA 1LNQA 2HA0A 1VYHA 4PSUA 4CG1A 4AJ2A 4CMGA 1E2BA 1BZYA 3V1TC 3OIUA 4GZLA 2IHKA 3CKKA 4H2DA 2IY8A 3FHCB 5DGXA 2OBYA 3ICEA 1W8DA 1VZ3A 1II8B 1U2ZA 2P6UA 1E2UA 1W1IA 3AX6A 4FOTA 4UU1A 4ARVA 4S1VA 2P68A 5DX8A 1BMFD 3GYBA 3TZQA 1FQOA 1OV4A 4GMGA 2AKYA 2C5SA 2G3YA 2ZBUA 4P4SA 4P4TA 4LFCB 3T06B 4YUYA 5HM8A 5K8IA 2IKSA 5ISMA 4WLOA 4UTNA 2PPLA 1JFTA 2NYRA 4G0MA 5IXYA 2LDXA 3P2JA 2ZCJA 1XK7A 1YQTA 2QUHA 1YQ9A 4HGQA 2OYRA 5CT4A 5SZJA 4UZEA 3PNPA 4QUBA 2D7CA 1NPDA 3FYUA 5J3JA 2HWXA 3KTOA 5TV2A 3PL5A 3BYZA 2BFEB 3OX4A 4XM0A 5JDCC 1QP7A 2R66A 3IKLA 4TV8F 3S7TA 2YFYA 3K3PA 2WWHA 4YJGB 3QFTA 1XA4A 2X5JO 4BCDA 4D9FA 2DGDA 2B1RA 2JHGA 3K05A 2VWQA 2FEMA 1KYIA 1E9SA 4ZFNA 4BCBA 4ARIA 1NT4A 4GP7A 4PBTA 3MIZA 4UVHA 4XQCA 3K9FC 1YQWA 4RQAA 1PYDA 2X0DA 1Q2UA 3L43A 3LBNA 3PC2A 2O54A 2AG0A 5EGNA 4DNPA 4ZAYA 1XLTC 3EIQA 3GFOA 3CONA 1ZH0A 3CNHA 3W6PA 1VGRA 3TNFA 3NKFA 1PK7A 3WOHA 1CS0B 1UINA 2V7GA 3EIEA 4GAEA 3GVCA 3CPEA 1KQPA 2P6OA 4IH9A 4L9WA 4LHSA 1II8A 4DDUA 5BW6B 1YBHA 4CMCA 5CVVA 1JDTA 5CJJA 1U0TA 4LG1A 1ZI8A 5KVAA 3U13A 4UM7A 3TTTA 3ZWBA 3BIJA 3SQWA 4J94A 2JEYA 4DIKA 1KOGA 4P3PA 1UKYA 2ZRJA 3PJDA 5DHTA 1U0NA 2KX7A 5DBGA 1DC4A 1GEGA 1RI3A 1V3UA 2J85A 2GO1A 2M98A 4MV1A 5BWLA 3A4LA 3UA3A 2PSSA 4LJYA 3OF2A 3TLZA 4BAZA 3DDZX 2IQ5A 1H0SA 4CQLB 1KJZA 1O5TA 2BFEA 4NYJR 4TYPA 5IJ0B 4YJGA 4F45A 1U1EA 2HF9A 4NF2A 5GZ6A 4IEIA 4PHHA 4J2OA 1M0SA 4IINA 2GASA 2CBGA 4GOXA 4LIPD 3H05A 2C7QA 4V2UA 4X63A 2GHRA 1DO2A 1T3GA 2QD4A 4RZSA 3V3TA 3ZCQA 2D13A 5ADHA 1KI3A 3K73O 3EDMA 4Y1RB 2MYPA 3W8FA 4OB6A 2Z2KA 4PWZA 3WMWA 1HK7A 3VKWA 2QTVB 3W5DA 2BUBA 1CS0A 4EW1A 3DJYA 3IQZA 1SIOA 1E9RA 1VIDA 3CZ4A 3KU4A 5I9BA 4ECAA 3J7TA 5ILQA 5DHSA 2V7QA 3PTZA 1LNSA 2NO7A 2JFQA 1OHHA 3PUIA 4JITA 3VJMA 2R7MA 4GC9A 3LP8A 4X8OA 3D5TA 3A9TA 1N33B 1OW3B 3CNLA 4GE3A 1PK9A 1XDWA 5JPDA 1MB2A 3FBTA 1QP8A 3IILA 1M75A 1M2KA 3L0OA 5DBEX 3D6JA 3NIGB 3HL4A 3TGWA 3TMKA 1NX9A 2I65A 4PNHA 5ALRA 3GCXA 3U4CA 5LSAA 1DEKA 2CUNA 3RSZA 1JLSA 2Q1WA 5CW1A 1W1WA 3PPWA 4CQLA 3CLHA 2XHZA 3B3QA 2WEKA 1Y8CA 2E7ZA 4F0JA 3VJKA 5EJ5A 1Z4IA 2O50A 5IJ0A 5AVOA 3DMFA 3ETGA 4G4SO 2PCLA 1Z13A 2VHVA 5JW6A 1FE8A 3DBRB 1U0EA 2M32A 3ABQB 4H1VA 5T7BA 1LEHA 1LBSA 1O9HA 1YTLA 3PWZA 4G8JA 3EF3A 4YWHA 3ISTA 3T1NA 3E7FA 1K9VF 4LZAA 3TH5A 2YJ6A 4C20A 5KWEA 1N3YA 4OAOA 4RY9A 4YO7A 2JIZD 4Y1RA 5CXSA 3CINA 2QZSA 1T1GA 1BFKA 1LTKA 4QSHA 2QTVA 4B4UA 4AU1A 4R9UC 4F2DA 1ZICA 2JJYA 4CTNA 3EVCA 1W2HA 1BKYA 4FOOA 5EIWA 3P9NA 2B2XA 2YRXA 4MIEA 2JLWA 3VPSA 1XEWX 2NSLA 4YT8A 4ZEVA 1PJ2A 4RKYA 2SKCA 3SR0A 3D2CA 2ZZNA 3JSXA 1NM5A 2FJUA 1YOBA 1RHMA 1L4BA 1Y1LA 2VTKA 4BDTA 7GPBA 5M7EA 2D5IA 3AKZA 3RTAA 4KFCA 1VE9A 3OTGA 1DAOA 2DH5A 3DH0A 3W7VA 4B6SA 1DGQA 4HSGA 4QOGA 3ZXIA 5MN5A 3R5KA 1V4BA 1AKUA 1TNDA 3Q3JB 2IU3A 5A9SA 4RVHA 1TIPA 2WUDA 4OAQA 1QHNA 1TB4A 3MCVA 1N2BA 3JYOA 4GYJA 4QJ4A 5JSKA 4CR8A 4HKTA 3D8RA 3FDIA 5JYCA 4I5EA 3TDNA 4NQRA 2VH5R 2AZXA 2OWDA 1RC1A 3OOJA 4IGKA 1W96A 3ZTYA 4IZHA 3T3NA 3DBRA 3EIHA 4KO4S 1Z35A 1DEXA 3ZTWA 1SOWA 1RVDA 3WV4A 4QNMA 2FZ5A 3KHTA 3JD3A 1PJQA 1WTAA 1U8FO 2FPLA 1ZN7A 1QTNA 4LXYA 2ZP1A 1E7QA 3VR4H 5DNAA 2GF9A 2XGMA 1P1CA 3CISA 4PAMA 2BF7A 3VR2A 3CRVA 1V8PA 1TQ6A 3FDXA 2HRZA 1AHIA 4FOLA 4HO1X 3UO8B 3G5TA 3AKCA 4I1SA 1UAGA 1OTXA 1OFGA 4PNEA 3OKPA 1R6TA 1BXZA 3LO8A 4N12A 1B0ZA 2LTAA 3SC6A 4DCGA 2X0IA 1M1NB 2EX4A 1P0MA 2GBIA 4N6NA 5E7MA 3TYXA 4MQFB 1WXXA 1J8YF 1R0CA 1SH7A 2XYGA 5AM2A 4AVYA 4NNJA 1OI2A 1SOVA 1LVGA 2QLLA 5ALYA 2D4AA 3ZGVA 2ZWMA 3KC2A 2H1LA 2GDJA 3LPNA 3RSCA 3R09A 3B8EA 1LWNA 4K9RA 5HG0A 1PTJC 4FWBA 3QY9A 5AK3A 3RJZA 4A8JB 3MFYA 2O2SA 4JX8A 4ZCMA 1AMUA 5F1KA 1J2JA 1R0SA 5BWNA 4N03A 1PSDA 1IZ7A 3B13B 1HUQA 2YN2A 2X0NA 1XZPA 1LB1B 1CRQA 1R8SA 1ECBA 1E3IA 3H5TA 3LGAA 4LSMA 4PE5B 4A6EA 1O0BA 3DVAB 3SQXA 1C0IA 2DERA 1P7CA 4NZPA 4PSKA 4OH7A 3F6RA 2GYYA 2I62A 3B2NA 1KZ9A 5DW0A 4QDZA 3IDQA 3EDRA 1MX1A 1THZA 2FPIB 2YFQA 2UV8A 3JYPA 3KDAA 3UXHA 5JXJA 4C88A 4FN5A 1N1GA 3V7FA 4DANA 4DIDA 3JZDA 1GA1A 4FNAA 5SY6A 2GHTA 3C6KA 4OBXA 3KZMA 3ZI0A 4RK5A 5IBRA 5LLDA 4DPKA 3ZE1B 3SM3A 3UKDA 1M1NA 2CMHA 3NU1A 3CH6A 4RNDB 4MQFA 1GUFA 2RHMA 3FGPA 3EXHB 4E2ZA 2NZ2A 1LVUA 1WW3A 1YL7A 3RS8A 1I4LD 2R6DA 4R2HA 4DJEC 3G49A 1WKVA 4FCVA 3HXPA 5F52A 3G82C 4A8JA 3HRIA 5AM5A 2P79A 1YIDA 4AF6A 4AFNA 5BNTA 3BCHA 3TUJC 2PQ0A 5JSUA 3DT6A 2E4YA 2LBPA 3KWJA 2FDXA 4YJ2B 3RUAA 4ZZIA 5CVTA 3DVAA 1V35A 4EHKA 2C1EA 1JHXA 4PTZA 1UAAA 1G21B 3U49A 4E5DA 2PXCA 1WZCA 1G20B 4DIBA 4EGSA 3VH3A 3N0XA 4CG3A 1NW3A 2ZUTA 2FPIA 3RU3A 4LDQA 4CV1A 5AFSA 2OG2A 1CUVA 1M0WA 3DE3X 3DE7X 3LUPA 4ND4A 1QRSA 3IQFA 2TECE 3RU9A 3CPSA 3LLMA 1AGRA 3NBUA 3PUYA 4X95A 3U3XA 2AJLI 1W0CA 2YN0A 3O3NB 1XQYA 1UDRA 4B5LA 2PA0A 4HS9A 1E2FA 1V6SA 1TFRA 4DCCA 4PIVA 3GHHA 5ITZB 3LRPA 2C3MA 2J3IA 3MSXA 2Z2XA 4JFAA 4JFRA 4RVFA 3P9ZA 3U9SA 4BO8A 1NVGA 5B3LA 1FCJA 1IBRA 2JRCA 1XP5A 2YNMD 2QN1A 3EXHA 1A7AA 1XBTA 1MO4A 4FFBB 4G0NA 3O21A 2IYLD 4HAUA 4KN9S 4M1EA 4ZV7A 1BSVA 3KJFA 3DCNA 3PHJA 3TZHA 3NHRA 3ZDCA 3PVCA 2Q5EA 1UWKA 3AV3A 1HE1C 2MMCA 1FK8A 1IC6A 2GGSA 2JFBA 3CW9A 3H8VA 3F47A 1GYQA 2CLOB 4Z8YA 3PQCA 5DV9A 5JG7A 2M6RA 2A5YB 3PXUA 4DLVA 3Q2KA 2ZK7A 1XDSA 4RPJA 2DT5A 4LOLA 2EG5A 1XHEA 2PUJA 1ECGA 2QNIA 3GJ4A 3N7TA 5IUKC 4YJ2A 2GILA 2H5EA 1R37A 3ACDA 3K9BA 3IR5A 2XEDA 5IWAB 2YYZA 3HP7A 3PE6A 1G21A 2A9VA 2VLIA 2XMCA 4P83A 1C9MA 3RVPA 3SHOA 2O5EA 1G20A 3CVWA 2HLDA 2RIPA 4EI2A 2IYXA 3RVRA 3WWZA 4F7DA 1TDJA 3K20A 4ASUD 3PRYA 4B34A 5LNK6 1L9KA 1N5IA 1PGOA 2DECA 1OE0A 4NX2A 4LKOA 1N2OA 1Z63A 1IQRA 1EUYA 4H7PA 4C0WA 1JMKC 2ZUSA 2B1JA 1F7VA 2BL4A 3U5ZB 3LYLA 1UBUS 4EJSC 3NAZA 3O94A 4EX6A 3LT1A 1H8EA 4E4YA 4NU0A 3CYFA 3M6XA 1JAHA 4GPIB 4R7GA 3WLSA 5ITZA 4OMDA 1DBQA 1TCBA 4BWYA 4DR5B 2H1HA 3WNZA 2VO1A 2JCYA 2QTFA 1NFQA 4FFBA 5FWYB 1AVTA 1IY2A 2DBQA 3V4RA 1BMDA 4ML3A 4HB2A 4GHWA 2A94A 4GMXA 3SYLA 3G0DA 2M6SA 3E35A 2DT8A 3W79A 1XRMA 1JQ3A 3WQQA 3P9RA 1SQFA 1RXEA 2W0SA 1B7GO 3C43A 1H69A 4FFRA 4YVFA 1WEKA 1S3GA 2GNOA 2R8EA 5ALQA 2R00C 2REOA 2I80A 3GDOA 2Z1NA 5EWLB 3RM3A 2POCA 4BQEA 1SK9A 1X70A 3OUUA 3UWSA 3UT0A 3ITKA 1GPWB 1YVPA 1MKYA 1VKHA 3VR6D 2GEBA 1JW9B 1XX6A 4G5QA 3DOEA 4K8RB 5ECGC 2BAGA 2P35A 4DGSA 4LE2A 4PTLA 4S1PA 4TV8B 3G8DA 5DYGA 1ZEMA 3F6YA 2W42A 4MRMB 3OWXA 3PDHA 5DASA 2WYVA 2ZS8A 2VSFA 3OFJA 1ABFA 5BW4A 2GTPA 4J0FA 4XWAA 2Z2ZA 3LI2A 3ZCVA 5L95A 1LW6E 4FMPA 1OAKA 1PD1A 3IIIA 1LTHR 3G7NA 3M4ZA 2F3QA 2J9GA 1T2UA 4LI3X 2VF7A 1UK7A 1Z4OA 1GQQA 2AN4A 1OZHA 1JIIA 1FYFA 1TU0A 1CZHA 3DAYA 4PV7A 4M8IA 4UU8A 7REQB 5FWYA 1UC5B 1XLWA 2BHLA 2V58A 4FJ1A 3CX4A 2BMVA 4A2QA 3DD5A 3TJRA 1QHFA 2VDMB 3EOAI 4M4SA 4DIOA 1GM5A 1FSPA 4CHGA 3DP7A 3QF4B 1PTKA 3UMJA 4Q02A 4BKMA 2O2GA 3BK2A 3C8DA 3PXGA 1U2GA 4CL3A 1JB1A 3NAMA 4WXHA 3R7NA 2O7RA 3E0QA 3UAZA 1Z0IA 3KB6A 5EWLA 3RT1A 4DSAA 3LTEA 2PFKA 3MGCA 4KDCA 4KXYA 4MLPA 1G8FA 4MTLA 3TNJA 3EXAA 3WWYA 1UKCA 5JBIA 4MDFA 2P2LA 2C95A 4OSEA 4U7WA 1IAQA 5DFAA 2ZI9A 3F9RA 3HXOA 4YXWD 1NW9B 2VJQA 1IOWA 4DLUA 2AK3A 4DARA 1AKMA 2OO7A 4XWOA 4XJSA 3UMBA 2B7BA 4TV8A 2HHJA 3OOHA 4EBBA 5KHOC 1W88B 3W8NA 1IN1A 2LV8A 4MRMA 5EVJA 4EO4A 1FLVA 3ZJVA 4WECA 4AT1A 1BXRB 1V4VA 1JALA 5IT0A 4ZP1A 1EVKA 1PJRA 1XCBA 1G17A 2X4IA 3E9DA 3JWIA 3KALA 3QVMA 2WWYA 5LOVB 1ICEA 5IT5A 3IUJA 4RHTA 1VL2A 4PBRA 3ONEA 4AJNA 3VKUA 4DA6A 2ZYAA 5I7SA 2OCKA 3AONB 3JVVA 5DZSA 7REQA 1DQYA 3KLNA 1KGDA 4JXZA 2PJDA 1E7MA 1U9YA 1N5LA 3CY6A 4BS9A 5A3SA 1EIZA 4WBXC 4JQYA 6GPBA 1WABA 2P4QA 3I4LA 4CL0A 1L7VC 1LU9A 1QE0A 1Z0DA 3MCTA 4U7DA 4GIBA 3QF4A 1IM8A 1W5TA 1B76A 1OI3A 1WZEA 4JK3A 1WWKA 1JSLA 2MYTA 1SVLA 2FEXA 3OQIB 1KC1A 2FEOA 2L2QA 3EQ7A 2W6IA 4XTRA 5DTEA 4W7HA 4BKRA 1P5JA 2JAOA 3L8MA 4Z9YA 4DV1B 1W5SA 2EFHB 1PVOA 3B1FA 4UCWA 3TW0A 4I5FA 4IEEA 2ECQA 4D57A 4PNZA 1I94B 1ZK3A 1DXHA 1VYTA 3MRSA 3NIWA 4ZHQF 3JTEA 4AZ3B 2W71A 2YWXA 3KUUA 2PX4A 2PV0A 1WPQA 3LF2A 1RZVA 2PAFA 4N0MA 5EHZA 5K5EA 1W88A 4MR7B 5BYBA 2QMOA 4EW3A 5A0VA 3BFXA 2JGJA 4IGAA 4Q3LA 3B5EA 4OFZA 1BXRA 3V8QA 1YFJA 3V00A 1Z4KA 3CXUA 1J42A 1JJIA 1GL6A 1E0KA 1VBFA 4L85A 3VR3D 3WOVA 2AEMA 5LOVA 3ACCA 1RQNA 1BHO1 2ACVA 3IEIA 5FBLB 5H59A 4MYTA 4C06A 4BIMA 1ORVA 4PGMA 5I9IA 1R64A 2XI4A 2YJ4A 1ZNYA 3BSWA 1BH6A 2WQ7A 2PJUA 4X20B 3VU1A 1RZRD 3S2FA 3DWGA 5LFAA 4UTZA 2ZYVX 3OCUA 2OLJA 1ZH6A 2R7LA 4TM7A 3CUWA 1EGMB 2Q6IA 2PD3A 2VK2A 4C0LA 2RAVA 4LMPA 3AVOA 3EYAA 3IUPA 3N7AA 1CTQA 1DAHA 1EDDA 1Z6GA 3I01A 3OQIA 5AH0A 5GONF 4MYSA 3U7JA 1NXVA 4S3MA 4HUTA 1LK5A 3F7OA 3SIPA 4BMZA 5CXQA 1DKRA 4PWYA 4PYOA 2IDMA 2IVZA 2B8JA 4Y2YA 1C7JA 5IXJA 3BD7A 1PWZA 3E8MA 3JQFA 3KHSA 3QLUA 4AMGA 3ZYZA 4CWAA 2X0KA 4DZZA 4FQ5A 3SR4A 2CB9A 3H9EO 1K66A 1SUIA 3OEWA 3DB1A 1G3QA 2NQ8A 1Z8DA 4NK4A 3RVJA 2MHCA 4AZ3A 1CB0A 5K01A 5CTJA 5GOZA 1W0KD 5FLEX 1YBMA 2ZBRA 3JYHA 3X1ZA 4D4IA 3W1WA 3TOCA 4MR7A 2FLWA 4RXMA 2V5VA 4X7MA 4BB5A 1T0JB 3HK2A 1HT1E 1BQ3A 3IAUA 1SVSA 2P40A 4TKLA 4YC7A 3D4IA 4I4LA 5CG1A 4ZVMA 4MUBA 1GTG1 4XGQA 2K5UA 1GYRA 1C5KA 1P77A 1XQ6A 5LUBA 3CVYA 1G2PA 3NVAA 3SKYA 1AS3A 4DW8A 3PXAA 1JXQA 1X42A 3MCUA 3P2OA 2JLUA 1KETA 1YJBA 3FYCA 4XUDA 1P19A 3OIWA 1PG2A 3U4HA 2ZSAA 3CNBA 3KSBC 4M49A 4X20A 3JQBA 4Y8VA 3FZEA 3G1UA 2QI9F 5HOEA 2QX8A 4CCSA 3C98A 3SI7A 5IKPA 2DYKA 5KTTA 4MHTA 3FD8A 4XJTA 5F9MA 1K5DA 2E49A 2PR2A 1XTRA 5JAMA 3U60B 3EFEA 4N4AA 4D0NA 1Q50A 5DMHA 1OFUA 4BU1A 3RF6A 5EN4A 4F97A 2W2MA 4DCVA 3FYUC 1IVYA 1LGYA 2GA9A 3LKZA 2NV2B 1IB6A 4FILA 1ZNZA 4I3GA 3JVIA 1F20A 1GUYA 2WJPA 4CMEA 3SLRA 2JCGA 4FR5A 1B15A 1I33A 1QRRA 1YCDA 2J07A 3I8SA 3MQ4A 4XDGA 5LKRA 2QPAA 1JR6A 3PYLA 2SBTA 2GAIA 4GPD1 2O3UA 5KJ1A 2VHJA 4NR0A 2WWIA 1RZUA 4XFJA 3REOA 1ZUIA 4IYJA 4MPRA 3UYLA 3W0LB 4Q1AA 1LDBA 1WZUA 2AJ8A 1ESMA 4KLAA 1GSIA 4GR9A 2ZRNA 2WUGA 4M89A 4RF2A 5D5PA 3KYJB 3OIDA 3UT6A 3TTSA 1V7QA 2D2IA 4C07A 3E9YA 1AJEA 4M9UA 4NENB 2WKPA 3QE4A 2B8EA 2IU0A 1ZPDA 2FN8A 4QBFA 2FI1A 2I2DA 2WRZA 4K2AA 2D1YA 3NH6A 3U39A 4P7JA 3D6UA 4GRIA 3A9UA 3CGWA 3HBJA 2BBTA 1IBCA 1ZBQA 1SPXA 1Y4DE 3QFRA 2G07A 4GKVA 4OHVA 3B6KA 1D2MA 4P32A 5LDDC 5FHQA 3TLAA 1F6BA 3CUTA 2B8NA 5BYKA 2BGUA 5HEKA 3HJHA 2QP3A 4WXRA 4V39A 1BEEA 3NASA 5IX8A 1TVEA 1WVMA 3EHEA 2V3CC 1TA4A 1YC5A 2O1EA 5EXXA 4DJJA 3RYCB 4NFYA 2BOVA 2OTCA 4QDJA 2Y66A 3UG6A 2W6NA 1EWKA 3PNQA 5L7WA 2FPOA 3ZOZA 2WWVD 2DUJA 4KUHA 1UMBB 4W9RA 2A1TR 3CM0A 4J29A 3E27A 1AS2A 4RZQA 2JCVA 3Q6IA 3RKSA 1SEVA 4JI8B 1B43A 1ESZA 3GLSA 3L0SA 4GX2A 1J1UA 1CZLA 3Q9SA 3Q8XB 5KOHB 4C04A 4JT9A 3TZBA 5KZMB 2VPWA 1WDLA 4X93A 1K2VN 3ZDZB 3ON5A 1Q0ZA 4GWKA 5D5HA 2V7UA 2E85A 4UM5A 4WASA 3PC4A 4NENA 5CT9A 3TLKA 4YP5A 2I4NA 2OHIA 5H83A 5HP4A 1ZX1A 3L0DA 4TTSA 2FSFA 1VE3A 5HBRA 1FDTA 4XKJA 2WUWE 1ZMOA 4IRUB 4F2WA 3BL6A 3L7JA 2Y1WA 4LC1A 4MW1A 3IPXA 3WB1A 1JEOA 1ZP6A 1U7PA 4WXMA 3L4EA 3WYAA 4KNVA 3X1KA 2XSZD 3E9EA 3F6EX 1MJGM 2OCGA 5DTIA 5AVVA 4UTVA 5NLLA 3BXGA 4B71A 5HMMA 3VO8A 2ZBGA 4IDFA 1EFUA 3W9BA 5J4YA 3IE2A 3QMWA 2RGAA 1NN5A 2ZWIA 3AIOA 1JJ7A 3O2NA 4H1UA 5LZ7A 2AG8A 1DZ3A 4BVHA 2JLVA 3CRW1 4H6VA 2LCQA 3R9WA 5GJBA 3I5YA 1CUFA 1ZOPA 3ITNA 1KO1A 2YY6A 2PSEA 1WMDA 2NUPB 5I4KA 2BDUA 4MAAA 4NBWA 3PNYA 1UMBA 4UNNA 4RESA 3UWOA 3OD1A 3BGSA 4F3RA 1R0BA 3IEMA 2BGWA 2WF5A 2P9YA 3TGLA 4UQPA 2XF8A 2XQIA 3FBWA 5K3EA 3HUEA 1WXDA 3GEIA 4GOND 3GVXA 4OPMA 5KOHA 1QMGA 1G7CA 1RFGE 4JOCA 2GZSA 4D9JA 2IPLA 1IWPB 4EG0A 3NHPA 2Z6UA 2Z4SA 1YQEA 3S1LA 4MV9A 4EP1A 1TJ5A 5KCZA 1USGA 5H1YA 1D6MA 3KPJA 4RC9A 8GPBA 4DJTA 4GP9A 5C8DA 4NBTA 3GPDG 3OE4A 2RB4A 4FZ3A 4J4TA 1YZYA 2XXBA 4Q9HA 1FYWA 3RS3A 3BTVA 2YVKA 1NV8A 5A7GA 1QYRA 2O5RA 1IDOA 1NM5C 4TXMA 4F56A 3PJEA 4KQFA 1ZNXA 1TZMA 1DRWA 3W1EA 4HG2A 1E1MA 4ZVNA 3LNCA 1EM6A 1TX4B 2A1UB 1U8EA 2FZLA 2YVUA 3V3KA 3VU3A 1PJTA 2FW7A 1I2DA 1Y34E 2FZVA 3QZUA 2Q21A 4P93A 3EHDA 2N9UA 4RZ3A 3TRDA 4YGYA 5KNDA 2WIBA 4EHBA 4YN3A 1TZ2A 3TB6A 5BMOA 1MOZA 4CXMA 3O74A 3PQDA 1X1QA 4B6GA 3PX3A 3VC3A 1PZMA 4F7WA 2Q3DA 1M1YB 3IVRA 2R60A 5K3CA 4A5OA 3ZJUA 2NUPA 2YYAA 3PXDA 1YRHA 1W0JD 4AZSA 1ZQ9A 1U02A 2AG1A 4PZYA 4ZD6A 4XVCA 2VYND 3N8DA 2BCGY 5B6PA 1YCHA 2C9DA 4UNSA 2W2QA 2VZ9A 4FR0A 4KX3A 4L8FA 3R5TA 3ES9A 2XT9A 1TLTA 3PGKA 3VI3B 4ZK2A 2DBZA 3HB0A 1TUEA 1KSFX 2C5EA 1QC5B 1U8XX 5DN6A 3IO3A 4ZZ0A 4S05A 3KKPA 1HSOA 3V48A 1DAFA 4B3TB 3EBPA 1BTOA 5BURA 3R9IA 1DU4A 1OZAA 1CK4A 1YQXA 1WZIA 2V4UA 4MMXB 4NCJA 1FBNA 4NE9A 3N05A 2CFSA 4V38A 4BFLA 2RDMA 4IWNA 4MGZR 3UV6A 2H5IA 4DEVA 3KQQA 1HV8A 2QX9A 3QRWA 4KR7A 2EBHX 2WUFA 1TRHA 2BKLA 2E0IA 1Q7BA 2E4VA 1D2GA 1EFRD 1GPDG 2QRHA 4CM5A 1VKZA 4JGIA 5EKUA 4B3GA 2I8LA 4IR7A 2PKEA 1SBYA 2BJWA 4IYRA 3ROPA 2A1UA 5DX1A 1EFPB 1J1ZA 5I5GA 2C0QA 1L8QA 5BPHA 1TFUA 1V7PC 4LYGA 3ZZ0A 1EFTA 4C21A 1X8XA 5A0FA 3K8OE 4PLTA 1APBA 1F48A 2GKSA 3V2IA 2OOSA 1XDBA 1NW7A 4QASA 1FP2A 3FYDA 2PL3A 3AHIA 2LRHA 2W98A 4OFWA 1OV6A 4RGVA 5IKOA 3DDNA 4FZVA 4P3KA 3NORA 3MLAA 3K15A 3DHYA 1WXEA 1KKUA 1N57A 1SBZA 4QPPA 3E7PA 5B53A 2VOEA 3QV1A 1WV1A 4FJ0A 4MUGA 3LV8A 4BJHB 3SN6A 4W4TA 5EKSA 1QC5A 2AA3A 3OFND 2IXEA 3OLVA 1EXDA 2UUBB 4C0KA 4EW6A 1NRJB 4C0QC 4C6RA 3L7BA 4FYMA 1WXIA 3LC1O 2ZZKA 2OD7A 1GAJA 3D3NA 4O2BF 3V1UA 1XZNA 2FMFA 3ABZA 4KBFA 4P33A 1KJYA 3FPAA 3INNA 4J1SA 3R41A 2VCHA 3ZCTA 3LCVB 5E7QA 4KXNA 4DG5A 3WTCA 1XTVA 4EYEA 4G81A 3CMMA 2K87A 5HHTA 1FRVA 4MA5A 3T4EA 1EFPA 3JWJA 1KSJA 3SC3A 2C2YA 2G1AA 1KA9H 2CGEA 2I6TA 2MOKA 4PX3A 4A8JC 3ENZA 4ALKA 3QFHA 1IHXA 4H7HA 1QYVA 1FIUA 4EHNA 4BNDB 3QWBA 4X5OA 2IP1A 4QVGA 3TXYA 2WA1A 1JS1X 2Z9BA 1NTOA 1QHIA 5AR1A 4EUHA 1QP0A 5G0TA 3T1VA 2QK4A 1WY5A 2IFTA 3AU8A 2HBRA 3I9KA 1T0IA 2VP0A 4M0DA 5EMJA 2XUZA 4YRSA 4KO1S 4AMUA 2XGOA 3QWIA 5A1TA 2VJYA 4PM4A 1P1JA 2N0SA 4ZDJA 2QG6A 1VZ2A 4JOBA 4NRDA 3HY3A 4YP7A 4B35A 4ZOLF 5FNZA 2ZXFA 3CWQA 2ACKA 4ZHQB 1G8HA 2XCRB 4J90A 1YDHA 5KTSA 1SCNE 4ZU6X 3ZLTA 3KYBA 4ZCIA 2NNWB 2GCPA 4PZPA 4ACBA 4OKNA 2I2XB 4ALJA 2C4TA 3I0MA 4I2NA 4CM9A 4ZHSA 4Y3UA 2GN6A 3B38A 4Q9NA 2HM7A 4Q7LA 5ALDA 2ZBDA 1UFRA 2LE0A 1J5PA 1Y3IA 2R5NA 3E2MA 1H3EA 4L28A 4IV0A 1FJXA 4RJKA 2RH5A 3H7AA 3LLCA 4BL5A 3EXHC 2NV0A 3VZQA 1Y9ZA 2AEEA 5LNK1 4CF5A 5LZ4A 3CVJA 3FHTA 2QVXX 3BIXA 3AH8A 3T5MA 2BM9A 3DBIA 3THXB 2JPDA 4AG5A 4RMGA 3ILVA 4OGGA 3ELBA 2A3RA 2P30A 1PN3A 1ACLA 4JB2A 3UICA 2MWMA 1NJ1A 3VZSA 1QFYA 1U8UA 4G5HA 2K4MA 5CXXA 4BNDA 1N2EA 1BX1A 4R2LA 1C3JA 3KZOA 4PVCA 3LX6A 4M9RA