3I92A

Structure of the cytosolic domain of e. coli feob, gppch2p-bound form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
257
Chain Sequence
b'MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Structural basis for the intrinsic GTPase and GDI activities of FeoB, a prokaryotic transmembrane GTP/GDP-binding protein
rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 80
structure length 257
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i92A01
4QBGB 3KXIA 4I1OA 4WVFA 2X8AA 3M0EA 4V0MA 4TYWA 3DKVA 4JIMA 1SQ5A 4PO1A 4LX0A 3NBXX 1L7VC 1P9WA 2J0UB 3IILA 2NO7A 5EXTA 4OI0A 1XZQA 2AXPA 2FFQA 5ANRB 4C7OB 1P5ZB 1W0KA 3WBJA 4QBFA 1G18A 2YV5A 3NHAA 4A6XA 3BH6A 2O8FA 5JS7A 3TVTA 3LBNA 4D26A 4F91B 4LJ4A 3RRZA 1M6NA 121PA 4PHHA 1F3OA 2YKGA 1G7CA 4EQ6B 1R8SA 2N42A 1GL9B 2AD1A 2Z0MA 1B23P 1ZUNB 3LXRA 3KKNA 5JJIA 3EA0A 2QEQA 4EPXA 5DISB 1VECA 2IT1A 4BQSA 4KFTA 1QBKC 2MMCA 3VMFA 4AKIA 1YR8A 1E1RA 4GRAA 1XU4A 4ARZB 4DRZA 3GLHB 2WWWA 2EWWA 3ZYCA 1Q3TA 1WB9A 3H2YA 2IWHA 1NVVR 4FN5A 4M1WA 1GL6A 4GOXA 4KLZA 4LPSA 1N5JA 1MH1A 4B2LA 5JHHB 3WHKA 2DR3A 3O8BA 4D81A 3QEOA 2DFNA 1NNEA 2XJ4A 1Z3IX 3OIWA 3IO3A 5D3MB 3U3MA 4FMDB 3L43A 4L8GA 1OV4A 1E2JA 4V0LA 3BK7A 4IDHA 4UJ3A 4RVCA 5DYIA 4EIWA 3PUYA 1AIPA 1Z6AA 1SXJB 3B6EA 4Q9KA 3U44B 3OIUA 1SVOA 3FMIA 2GILA 1NVUQ 4DDUA 1IXZA 1QHSA 4RZ2A 1RC8A 2UZ3A 2ZJ2A 2EQBA 1ZCBA 3M4YA 3T12A 5FUXA 3VKHA 1N5IA 2ZJZA 4OI4A 2FGKA 4NU0A 1QDEA 1A2BA 1AM4D 3FHTA 2BDTA 1GTVA 4Q7KA 4NMMA 3I4LA 4MGIR 4ACAA 3AGPA 1SKYE 4BWYA 5EUQB 5DI9A 4OI1A 3W9YA 4DLRA 3FGNA 2ZVQX 3ICEA 2CE2X 2UKDA 2G1KA 2O8FB 1W36D 2GJ9A 1H8HD 4ZI3A 3BFVA 1OXXK 1SHKA 1V5WA 1E0KA 3CRMA 4U7DA 3ND8A 4OK3A 5AWFC 2IS1A 1P2SA 3IKJA 2JJ1D 5CB6A 3C4JA 2FV8A 2CL0X 3GJ4A 3IHWA 2OSBA 4R7ZA 5DHFA 3W3AA 4IEIA 2N1BA 5BXQC 5DGXA 3TQCA 2WJYA 2GZDA 1G7TA 1J8YF 4L15A 1S9DA 5IK2A 3K70C 4B48A 2VL7A 4BEBA 5L8VA 3TQFA 3ND9A 4GL2A 1E2DA 4L9SA 5KNDA 1US8B 4H1VA 2XSZA 5FTMA 4DB4A 3Q7PA 3EARA 1OB2A 4S2EA 1ZUIA 1CLUA 4MYTA 2P5TB 1VHLA 4M8NE 4PANA 2D4HA 2QT1A 3LRPA 4QM6A 5G53C 3OEHD 1GNPA 2J7KA 4LCBA 2G88A 4WW0A 3QKRA 3GLGE 2WKPA 1W4BA 4MUBA 3HPQA 4EAQA 2WSMA 4DXAA 2OBNA 3KX2A 4KAXA 3NEJA 1P6XA 3A6PC 1UEJA 1E79D 1BS1A 1D6JA 1FNMA 2FOLA 2GWHA 3ZZUA 2C8VA 3KB2A 3VX4A 1OXSC 3I61A 4OBEA 2IYUA 1SZPA 4RD1A 4NCKA 1EWQA 3P20A 4A9AA 4TN1A 3MRSA 4PZYA 3OESA 1Q57A 1TQ6A 4QJ3A 2FG5A 4IJMA 3AVOA 3U3KA 2ZJ8A 3THWA 4BFSA 4DHEA 3P32A 2IX3A 3BH0A 2V9PA 4FCWA 5FOSA 5A4JA 1Z2AA 2QP4A 1P61B 1QRAA 3ECCA 3OIVA 1UBGA 3VKGA 5A5GA 2NO6A 4UNRA 3U6KA 3TVDA 4R9UC 1DO0A 1E4VA 1G41A 2V55B 1NMXA 1S3SA 3TUJC 4DJTA 1VTKA 3OF5A 4PHGA 3AQ4A 5TB5A 3CPJB 1G3QA 2H7VA 5HCIA 2BJVA 2TMKA 4HUTA 2ZANA 5FFMA 1T0HB 2AD5A 1Q0UA 4KFSA 2ZI3A 2SHKA 1VIAA 3N70A 4OYHA 1KK3A 4F7WA 4OHZA 2CK3A 2QMHA 2ZRPA 2ZRJA 3BORA 1Z0FA 4IDQA 5FPYA 3WRYC 3CX6A 3JZMA 2ZJAA 3DOEA 1KZGB 1TL7C 4GOKA 1M7GA 1UKVY 3CB4A 3RRNA 1MABA 3W5IA 1TEVA 2XNSA 1M7HA 2A5JA 1GG2A 2C96A 2F1RA 3ASYA 3QKRB 4TYYA 4OI2A 3W3ZB 1D2MA 2AL7A 1YZLA 1HE1C 1F5NA 5J4LA 2WM9B 1KK0A 5J5CA 2ZRIA 4LBVA 4RKEA 1T5IA 1OPXA 3KXKA 2FA9A 3LBHA 4P0TA 1Z5ZA 4R2IA 1QZXA 1W5SA 3GQBA 2R6FA 3UANA 4URZR 5BN3A 4FMBB 1XCMA 2AFHE 2RB4A 4TWZA 4OHXA 4OQXA 3B78A 1LS1A 2XX3A 3L0IB 3NEYA 4TL6A 1MO4A 1MO5A 1ZM9A 4P4TA 1KSJA 1P62B 3MWKA 4JSTA 3THWB 3K0CC 3KJEA 3E1SA 5DN6A 3W6NA 5A0FA 3RS4A 4C4PA 1WE2A 2JIZA 4BFTA 1D2EA 5L3QA 1UKZA 2ANCA 4GP7A 4TMZA 1I2DA 4LYHA 4NP6A 1CR2A 2DFTA 3OFND 3P1JA 4BEJA 4KJZA 3GLFA 4Q66C 5J4VA 2QTHA 1QHGA 1R2QA 3WP0A 4F4CA 1UEIA 1E9BA 2EFEB 3QXXA 1NN3A 5E7IA 5GVRA 4RD2A 3SJCA 4DSNA 4LV8B 4JBWA 1G3IA 3LD9A 4WZAE 2IYYA 2BBWA 1G7SA 3PG5A 1KZ7B 3QOFA 2XAUA 3U7EB 2F6RA 3K9GA 3MWLA 1QHYA 2D2FA 1IJEA 5JCPA 5ELXA 2ZR0A 4UJ5A 2PMKA 5JRJA 4M2LA 1IXSB 3WNCA 2JLZA 2IYTA 1MABB 4DWJA 1RFLA 4RKFA 5L3SA 3IPYA 4DZZA 4HAWA 3U6BA 1NG1A 4OK5A 1I4DD 3PUWA 1KGDA 2Q3FA 3ETLA 4YDSA 2ORVA 5AJVB 5G41A 1KO5A 3O47A 3LX5A 4Q18A 5BQ5A 4DIDA 3BFXA 5KDLA 5JMTA 2IYXA 2JJ2D 4B43A 4P32A 1QVAA 1KKLA 2HF8A 1AQUA 3C15C 1MV5A 3B1XA 3WYGA 2ODNA 2FGJA 1E9RA 5BYJA 1GZSA 2FE4A 4N3NA 1QG2A 1ZIPA 2W6JA 3GJ5A 4RZUA 2K5UA 3CZPA 1IM2A 1H8EA 4QRHA 4DIEA 3LAWA 2C95A 3L8YA 3W8RA 3C41J 4O25A 3WHLA 1IY2A 2WIBA 2OFWA 1XEWY 3I32A 2WWFA 1VCOA 4LK2A 2YOHA 3TK1A 2ODBA 1YJ5A 2OBMA 3TSWA 4PO8A 1RW4A 3ONWA 3K8YA 4AKHA 4AKGA 1FMLA 1S3GA 4AI6A 3LA6A 2QPAA 4BE7B 5L3QB 2RH5A 4LY6A 1ZCAA 1KI6A 2UVQA 1R10A 3GLFB 2O8DA 2A5FA 3AP3A 4II7A 3LY5A 3RVBA 3W6OA 1VG1A 4MYCA 2FPMA 4HLCA 2J0SA 2ZJBA 4UXJA 4FXPA 3UWOA 2O8BA 2GXUA 3KQLA 1DAHA 1WA5A 2CCKA 4E07A 3QKTA 4LHYA 2B8WA 4CGZA 1ZYUA 4DLZA 1UBEA 1EFTA 4BECA 2Q9CA 4N0DA 2XZPA 1GRRA 1PUJA 3GP8A 1U9IC 1II0A 2PT7A 3CBQA 4RD4A 5L3SB 2BC9A 3BIFA 3TLXA 4CZ2A 3FKSD 1NY6A 3LXXA 4GNKA 4EFLA 3N5CA 4QNMA 1FFHA 3KTAA 4QHYA 5HE8A 3U3JA 1KI9A 2QPTA 4A0RA 4DLUA 1Q1BA 3SQWA 4JLNA 4MYUA 2D62A 5KSPA 1XNJA 2EFGA 2YWEA 2IS2A 5AJWA 3K70B 3VNVA 4HUQB 2J87A 5F3WB 1NL3A 3AVVA 1NLFA 1R5BA 1WDTA 4C0KA 4KYIB 2V1XA 3I8XA 2FJUA 2IK8A 3K0EA 4WBSA 5L3RA 3V9PA 5TXGA 1A4RA 2OFOA 2IYZA 2VHQA 2FX3A 3SDZA 2IUTA 3QY0A 1F60A 2Z4SA 3Q9LA 1JXMA 4E09A 5JZVA 4BFZA 4BLPA 4JLJA 4LV5B 4ZCIA 4J0QA 1PV4A 1QG4A 3A1VA 4IOMA 4JKYA 1U0JA 2VPPA 1NJGA 2ASEA 2GXSA 1X3SA 4I1SA 1XD8A 2J9RA 1KSFX 2GXAA 2ZRLA 5FL7A 5KYKA 3GJ7A 2FWRA 4XH9B 1HT1E 2I1VB 4QBIA 1RYFA 2CNWD 4U02A 3QSYA 2EYQA 1TUEA 1KI6B 1E9FA 3AF1A 1YZKA 4PQRA 1JEEA 3CLVA 2O8DB 5GJBA 1HE8B 4B32A 3GEIA 4TTPA 1OFIA 4YMTA 2VF8A 1W49A 4JT4A 3J81k 1ZM2A 3EWAA 1ZNYA 1E9SA 1OHHA 5D3QA 1ZM4A 5JWHA 2WSSA 3K0CA 1M74A 1J7KA 3EIEA 4M1KA 2O8BB 4PC6A 3ZS8A 4Q9LA 3TGPA 1N6NA 4R98A 1P2VA 1CR4A 1N6PA 4L9WA 4DEYA 1VDZA 2XNDA 3EZ7A 4Z1MA 1ETUA 2NO0A 2W00A 4OQMA 3WYAA 1XPRA 2OLKA 2Y8EA 1JNYA 4OQFA 2ZE6A 4RD3A 1KI4A 1GKIA 1NMZA 3OZXA 2ZRHA 4PSKA 4K81B 3CX7A 1CULC 3BE4A 721PA 1GFIA 3CPEA 4KBFA 3B82A 4LJAA 4UQOA 5JLJA 3THYA 3H1TA 1KMHA 3Q5EA 5LD2C 3HPRA 4LZZA 4IW3B 1OKKA 5FUVA 1N5LA 1FQJA 2IHBA 3ASZA 4D4LA 5KNBA 1CJMA 4PQYA 2J7PD 1R0YA 4US2R 2CHQA 1A7JA 4DCNA 5FPSA 4Q1AA 4LOAA 2IC5A 6Q21A 4UNPA 1DVRA 5F2EA 1II8A 2A2ZA 2R6DA 3KKPA 4M1SA 3F0TA 3PEWA 2VHUA 2AKAB 5BW8A 3QG5A 3MWJA 2FSIA 1A82A 4LDJA 2HT1A 4HYYA 3MJRA 3THOA 4JLAA 3IQXA 1G8PA 3FMFA 3ZIAA 3AVXA 1U8ZA 1VHTA 2GDJA 3BS4A 4Q7MB 4LBWA 2OCPA 4HZIA 4MRPA 4KV9A 3W8NA 4P31A 2C9CA 3KFVA 4Q4AB 4A36A 2CDNA 2ZSDA 4DLYA 3R9IA 3BFKA 1XJCA 1Q1EA 2ZTSA 2OLJA 3NBFA 4DCVA 3Q72A 3SEAA 1CR0A 1JPNA 1GL7A 3QF4A 1GNRA 2GNOA 1TQ4A 5JWOA 2R62A 2WPDD 2HT6A 3K53A 1Z0IA 3BB3A 4L16A 3V4FA 2JDID 3EWSA 4TZ0A 5TY0A 1NN5A 1YRBA 5JJKA 2X2FA 3VR6A 1KAOA 4Q5IA 2NQ2C 5HKKD 2CVFA 1EK0A 3GFOA 2RGXA 4C0LA 3T5DA 1XTQA 2QGZA 8OHMA 2B21A 2A78A 5KUTA 1CBUA 2ZI9A 2H1LA 3TNFA 2Z4RA 4YXWD 1EWRA 2IXGA 4Q47A 2BMEA 2G83A 1NP6A 3H0KA 2QMOA 2P5SA 5H68A 3THYB 4B3BA 1KMHB 4NCIA 1EFRA 3KJIA 1NI3A 3EG5A 4TMXA 3AVTA 1E96A 3PEUA 4QL3A 5IHPA 5LPNA 3BD9A 2ZYTX 4IHQA 3ZVLA 1MO3A 3SOPA 1KTVA 2F43A 4TLAA 1II8B 1U9IA 2KBFA 2NIPA 3SN6A 1CKEA 3OEEA 4O3MA 1S8FA 3CPHA 3E5HA 3TH5A 1RJ9A 4N0EA 2KE5A 1SVIA 2PBRA 5JCZA 4C0JA 4G5OA 4C2UA 1XP8A 2HJGA 4HDOB 2XOKA 1NLZA 2QAGB 4I99A 3FMOB 3FMPB 1RRGA 2VP2A 2C9YA 2QL6A 2ZUCA 1Z07A 1COWA 3B1WA 4JBYA 1T9HA 2NPIA 4D2IA 1ZVQA 4Q03A 2J0QA 2JLRA 2REBA 2O52A 3PITA 1XTRA 5DO9A 1CS4C 1OW3B 4HAUA 1MKYA 4TT3D 1BIFA 3ZZ0A 4BLOA 3FFBA 1P4SA 2A7QA 2J41A 5EUMA 4UXIA 1WBDA 4HLUC 4OL0A 4PPQA 3QQ5A 3EAQA 4XTCS 3TUIC 1G64A 3QPUA 3LV8A 4BRUA 1KI2A 1E9DA 4LUCA 1SVMA 2MSDB 3QF4B 3EPHA 1XXHA 3BAFA 1VCMA 4MGYR 4TZ6A 2ZQ5A 1T3LA 4UNQA 1L8QA 4NYJR 2VLIA 5FTJA 1NVXQ 3T06B 5KHOC 3A1WA 2QM8A 3K09C 1E1QD 4B47A 1JR3E 1FNNA 1IJFA 3RSOA 1Y3AA 4M21A 4OHVA 2R44A 4KYUA 1W36C 2UZIR 5HE9A 5FH9A 2CHGA 3B2EA 4CT5A 2Z83A 3F3YA 3NG1A 4JL6A 1IOZA 2KI5A 4YC7A 5F9HA 3SYKA 1F2UA 1FOEB 3X1XA 1E4YA 1BMFD 1QVRA 4I81A 3WYFA 1E69A 2PZGA 4LPKA 3H4MA 5B2ZA 1W0JA 2HEIA 2XTMA 5CITA 4DLSA 2PJRA 3QKUA 4B2IA 1JXOA 1CF4A 3WNBA 5KU1A 3FFAA 5JI2E 3QVVA 3RNLA 4AYXA 2JLXA 3T34A 3ICQB 4UNNA 1EX7A 4ZPXA 3LQRA 1GITA 2FEMA 5JEDA 3KQKA 5CLQA 2F43B 3GD7A 3NIBA 5AUQA 1ZM3A 2FN4A 3RANA 2VF7A 3QXJA 4XVUA 1RJ9B 3AF2A 2WWXA 1HY3A 1OYYA 3SFVA 5JWRA 4ASUA 2A5YB 4WXRA 2NO9A 3VR1A 4PC2A 4Z8YA 3H84A 2HLDA 3PJRA 1IN5A 4GFDA 3A1SA 3AKDA 1PLKA 2QPOA 2W6ID 2FFBA 4B71A 1RRPA 4CVNA 4URXR 1TEXA 1MRNA 4IDPA 4YONB 2RHDA 2HUPA 4XVRA 2ATVA 5DI3B 4KVGA 1JQJC 3O8CA 4A1FA 4E22A 4OK6A 1XPUA 1MR3F 3IDQA 1N6RA 4NDZA 1NBMA 4X8OA 1XXHB 2QT0A 4GZMA 1KDRA 1TQ2A 2IA5A 4ILEA 2P2LA 5HPYB 1OSNA 2QA5A 4HI0E 3T5GA 1VKJA 1VYVA 4LHXA 1QHHB 4MKGA 4NHOA 1RRCA 3T1OA 3RC3A 2XTZA 4JJKA 1G3MA 3Q85A 1AA9A 1Z06A 2MSEB 4PZZA 3AKYA 1AS2A 521PA 3RABA 1SHZA 1NVVQ 1F2UB 3HWSA 1Q20A 2QTFA 3CNNA 3E2IA 3PEVA 4GMXA 3I5YA 2IL1A 2ZRKA 3SE0A 4N1AA 3HP1A 2ZAOA 4EPRA 4XWOA 4URWR 4ZDJA 5JI3E 2EFHB 3EZ9A 4AKEA 5GADl 3LDAA 1P9RA 2WJIA 2BMFA 3HJNA 3VU9A 4BASA 2ZJ5A 1UDXA 4QGHA 4L5BA 4PAQA 5CK5A 4GPTA 4X8HA 2W0MA 2PZEA 5FOUA 1TF2A 3R20A 1OIWA 4L4UA 2WZQA 1E9AA 2H5EA 3ZLJA 5CIWA 2ANBA 1N6HA 5FOXA 1P72A 1KMQA 1PUIA 1YVDA 2XZOA 5LBIA 3AVUA 4LHWA 4LC1A 4F93B 4KFRA 1YR9A 3CH4B 4XTRA 4Q1DA 4JVLA 1E2NA 1Z47A 4NTZA 5CLLA 4Q00A 4AC9A 2IW3A 2NGRA 4BUJA 1JQLB 2IYLD 2VP0A 4DKXA 2Q21A 2OO7A 4FW9A 1C4OA 3AKCA 5CDFA 4DB2A 1EESA 5TDHA 4DDTA 2V8OA 2B6HA 5J4HA 2HF9A 5G40A 2X2EA 3SS8A 1GUAA 2A30A 3NH6A 2ONJA 4C3ZA 1YR6A 2YWHA 3C16C 3BOSA 4QFMA 3QBVA 1W44A 4CRWB 5F98A 4URUR 2GETA 4B35A 3CRRA 2ZS8A 4BZXA 2FPKA 2WMOB 1LW7A 2FNAA 3PUZA 4PPFA 5GJWC 4FMCF 4B75A 2GVZC 1SVKA 3B1VA 5LB4A 3CF0A 5H70A 5FBLB 4B73A 4MYHA 2VBCA 1PVOA 1ZM7A 2D7CA 4O2RA 1NMYA 3ZVMA 2AXNA 2D06A 4RSGA 2BEKA 2VIIA 2HDNB 5AJZA 2BCGY 2LKDA 3SU8A 1YHNA 1XB2A 4HLUA 3UATA 1JALA 3GMTA 5H8WA 1JR6A 2OEPA 1PLLA 3SYLA 3VX3A 5FBVB 2IXEA 3I8SA 2ZSBA 2FSFA 2EVWX 4RZXA 1P3JA 4DLVA 5E7JA 3SNHA 3UG6A 3PUXA 4V02A 3WMGA 2W2XA 821PA 3IPXA 1DADA 3L82B 1FW6A 2RGEA 4BFWA 4QXAA 1IQPA 3HU1A 2C04A 4CEIA 1ZU5A 1JEDA 3SJBA 2QZ4A 3GLHE 3DVLA 2LKCA 2WTUA 2PX0A 2BJWA 1H8HA 1HQCA 4D0GA 1X6VA 1IY1A 3U5ZB 2DY1A 2V4ZA 2GAAA 4LYAA 4NPHA 2I1QA 2JJ1A 2ZRGA 4XWAA 3I3SR 4WXPA 4DUGD 2ECKA 5BWMA 2ZS7A 1Z8FA 1N2CE 3K0FA 5FTLA 5JHGB 1Z2CA 1E94E 2JLUA 1ANKA 3TAHA 1OXUA 3MSXA 3GPLA 1XRJA 2GEDA 2OM2A 2WWGA 3GLIA 4ZO4A 3QG1A 2BOVA 4MDEA 1S9HA 1RZ3A 2FFHA 3G5UA 2VA8A 2B8TA 1T4GA 3WY9A 3ZDQA 1SXJE 3W5JA 1YR7A 2QSYA 2A5GA 1HYQA 4W5WA 5FTKA 2IYVA 3VAAA 1F2TA 1IHUA 3OEHA 3DZDA 2ZSAA 4H1UA 2QNRA 4XVQA 5CK4A 2C03A 2AR7A 1J99A 1RVDA 4V0ME 4OHWA 1IN6A 1E79A 2VRWA 1ZD1A 4DSUA 3OAAD 2Q3MA 4Q19A 3LX8A 4H9GA 4G5SA 1OB5A 2OCYC 1E2MA 2ZRAA 3LO5A 3CWQA 4RY2A 2G1JA 4NCNA 2G77B 5JRZA 4MGKR 3AV0B 3REFA 4LJ5A 3EIQA 3RC8A 1RYHA 1TADA 1KJWA 2QE7D 3PCRB 3SJAA 3PR1A 3TJZA 1XTIA 3TW4A 4KLNA 5EJEA 4HLQB 5EXSA 1DELA 4CEIB 1XMVA 2WWIA 4Q1FA 1YZTA 4V0OA 5JFGA 1DAFA 3WBKA 2IUUA 1W36B 1ZNXA 2CEAA 5JEEA 2QSZA 1P7CA 1KJYA 4DLXA 1Q21A 4MDFA 4AK9A 3ADDA 1ZINA 1R7RA 1OXVA 4RD0A 1NSTA 3K0FB 2V6IA 3F5FA 2PT5A 1DAKA 4QGAA 3TSOA 1W4CA 4IOLA 2ZRBA 2IWRA 4US0R 3GLIB 1IXRC 2J1LA 3NTUA 3D6TB 3JVUA 5DE3A 4O0MA 2YOFA 3LNCA 2KWIA 4JLPA 4B34A 4TLDA 1XDBA 3GJ0A 4BRWA 4OQNA 1F2TB 4HLDA 5FBQB 3DHWC 3IHLA 4ZIRA 5KTYA 4ESHA 2WJHA 2GF0A 3FTQA 1E2KA 4UKDA 2JLYA 4KSCA 3BJIC 3EPKA 5IDVA 1KOFA 4PC3A 4TMKA 1G5TA 4ZKEA 1TF7A 4TL9A 1KJZA 2GZHA 3FYHA 3SC3A 4EJSC 2WICA 1TNDA 4LJ8A 1P2TA 2Q6TA 1LB1B 1S0UA 5AR1A 2RCNA 2QUZA 1M34E 2BM0A 5L3VA 4PPNA 2D7DA 3CNLA 5FI1B 4M9XA 3U3OA 1G7RA 1BYUA 5TMPA 3I62A 5EE3A 5HR5A 5KSYA 1UPTA 2JLVA 2R6GA 3DDCA 3KXLA 4GSYA 4Q9HA 1D5CA 4PC1A 1TUIA 2IBMA 1TMKA 1UKEA 2ZS9A 5HZHA 4F4IA 3Q5DA 2ZE7A 4BLRA 2OV2A 2Z5FA 1KYIA 1GDDA 3ADBA 3CNOA 1CJTC 3SQXA 2WJGA 3GEHA 3D7MA 2ZR9A 5AJXA 2P65A 2E87A 1SULA 3QPWA 2OBLA 4I1VA 1WQ1R 1U0HC 3OFNA 4BLQA 4EPTA 1UADA 2VHCA 4CF7A 4NL4H 1IBRA 3C8UA 3OE7D 4B6FA 1ZBDA 1G4AE 3CH5A 5H1YA 4Z8XA 1P73A 1E2EA 2ZRDA 1GKUB 1LNZA 3A37A 3ZQJA 4NYIR 3K0AA 3UK6A 1ESMA 3DOFA 4B74A 2JLQA 3Q8XB 3TUZC 1CU1A 2ZE8A 3QEJA 4PPGA 4GBMA 4JLVA 1OJLA 2AWOA 1TAGA 2F7SA 3BB1A 4FIDA 2AFIE 3H86A 1CJVC 1N6OA 5EQTA 2XZLA 4G5RA 2JLWA 2CCJA 4QBHA 3EZFA 1EFUA 4Q4HA 4KVAA 5K8TA 3CW2A 4ZIRB 4KITB 1YZNA 1XWIA 4PSAA 1W7AA 4V0KA 5EE9A 3HDTA 3AUYA 1GNQA 2W83A 1KNQA 4JZKA 1LS6A 4A0GA 2P6NA 1CIPA 3ZD6A 2JJ2A 2BV3A 1JR3D 1B0UA 3CZQA 2DCUA 2IHYA 1G3UA 4HB0A 1NSFA 3IBGA 2VEDA 5FOWA 2JATA 3QNUA 3EX7C 4IVRA 3LFUA 3AF0A 5EP4A 4JLKA 3Q7QA 3KUCA 4P4UA 1ZD8A 4TYQA 5AUPB 2QRNA 5FR1A 2OE2A 3X1WA 3EZ2A 2DWQA 4F4JA 1DARA 2W2TA 2YHSA 1HQYE 2CLCX 4IDNA 1XTKA 2V6JA 1GRNA 1X86B 2HCBA 3OIYA 4KO8A 4RCYA 4B3GA 3WP1B 3MMPA 4YMUA 1K8RA 1P2UA 1UFQA 1E9CA 4DSTA 4DDWA 2AHOA 3CKLA 1X8KA 3V4RA 4Q4LA 2L0XA 4LHZA 3A1TA 1GSIA 1IAQA 2GESA 1W4AA 2ZYVX 4HDCA 1V43A 2H16A 4Q02A 4KODA 2OAP1 3GJXC 2H17A 1NKTA 1R6BX 4M1TA 3ADCA 2QMUA 3K0AB 4BZPA 4ZDKA 1E0JA 4TYPA 3B8HA 1Z83A 1Z6TA 2QMEA 3CO5A 4E5UA 4BZQA 2YOGA 2ZUDA 3FHOA 2J3EA 2FU5C 4G5GA 4Q4HB 4PR0A 1CRPA 3PENA 4QHSA 3FKSA 2P0EA 2ZROA 1WXQA 2ERXA 2WIAA 4A2PA 3G0HA 1Z6XA 3K9HA 3MCAA 4TLBA 2PCLA 2W58A 2ZREA 2R2AA 3SHWA 5KOYA 3U2QA 2XTNA 4EPVA 2O8EA 3B5JA 3IIMA 2PCJA 3A58B 3CRVA 2HV8A 1ZNWA 4PFSA 1KY2A 3KTAB 5G3ZA 2GJSA 3D8BA 4MH0R 5FOVA 5JJLA 2WAXA 5FPKA 3GLFE 1T8TA 2F9MA 2V7QD 2BMDA 1SXJC 2E9SA 1KI3A 3OHMA 4NCHA 4GT1A 1D9XA 2ZI4A 3K1JA 2DWOA 4Q7JB 1D9ZA 3CWZA 1FPMA 3QENA 2EYUA 2GKSA 1NVWQ 3DZ8A 3RAPR 2XXAA 4YQFA 1RIFA 1UKYA 1EXMA 1X1SA 2CNWA 3A4MA 3NDPA 1XFAA 4KSBA 4UXHA 2GCPA 2H18A 1Z0JA 3EIHA 4B6EA 3AH8A 3QXHA 1X8LA 4TQAA 1OH6A 3IEUA 1AZTA 1YZUA 2CLDX 1KK2A 4G01B 2BHRA 4LRWA 3W90A 4FMDF 2ZI6A 2QQEA 3A8TA 3I72A 4MA4A 2FZLA 1DAIA 4Z54A 3THXA 4BPBA 3L0OA 2WMNB 4WIAA 2GAOA 2ZRNA 1M1YE 2FSHA 2QORA 4I4LA 4PAOA 4Y0AA 3VR4A 3X2SA 3BBPA 4JVMA 5CYPA 3CRW1 3QXSA 4CIDA 1AS3A 1Z6GA 3EZ6A 4F38A 3ZVNA 2CL6X 4TSFD 2DWPA 1GP2A 1J8MF 5P21A 4Q4JA 2JLSA 4RFVA 4KHZA 2VO1A 4OKSA 4Q9JA 3B9QA 4AIIA 4C0QC 2LCFA 4O2LA 3U7HB 4URYR 4FWIB 1QHXA 3X1YA 5HTKA 5FPHA 1KI7A 3DMDA 3RWOA 2HYIC 1YQTA 2P3SA 2YC2C 2F1IA 3LVQE 4Q48A 4M9ZA 2RGBA 4TL8A 3WXMA 1NIJA 2GRJA 4MUAA 5UKDA 3QF7A 3RS0A 4P33A 2J7PA 1N5KA 2R6CA 5JECA 3L0SA 4XD7D 4MKFA 2FSGA 4D4KA 3P4YA 1QHNA 2FPLA 3SR0A 4EPYA 2FEOA 1E2HA 3QKSA 1XCGB 2EFCB 2YWFA 1DG1G 1PZNA 1ODFA 3AP2A 3K0SA 1Q3HA 4FWTA 1UJ2A 3BH7A 2XEXA 1HTWA 2RKOA 5J4KA 2F3TA 1NG9A 4QHTA 3UMSA 2OAQ1 1X1RA 4URVR 2XXAB 4LC0A 2FZ4A 5FL3A 1OFUX 1G8HA 2GJ8A 3V00A 4DSOA 2V3CC 5C4GB 2AN9A 4C0SA 1FMJA 1U8AA 2OFXA 3T1QA 5EXXA 4PHTA 3JZAA 1KO8A 3RHFA 5EE0A 1JI0A 1YZQA 2DB3A 1LF5A 4Y0VA 3RRMA 5JSZA 3RDPA 3UIEA 2WPDA 2JA1A 4G5QA 2J46A 3DL0A 3WNDA 5E7MA 2JDIA 5EZ5A 1EX6A 4UNSA 2IYWA 1AKYA 2VQSA 3LVRE 4TMVA 5HKKA 1UF9A 3NKVA 3KKMA 1KO4A 4TMTA 4ITRC 1JPJA 2QROA 4Q4JB 5C1BA 2VSOA 1SXJD 1VYUA 3KL4A 5J47A 3IGFA 2CVHA 2GCNA 4RZ3A 4YXWA 1G6HA 2VSFA 4M1OA 2BEJA 2ZYUX 1W48A 4QC2A 1T5LA 2HYDA 4JVSB 1EFCA 2GK7A 3GLGA 1Z0DA 2BWJA 2IEZA 5B64A 1CXZA 4MKIA 3DO6A 4NYJQ 5K8UA 5BYKA 4WAUA 3RRYA 3MFYA 2I4IA 3FOZA 1E99A 4U00A 4QKQA 4US1R 4AYWA 2KSQA 4B3CA 3PV0A 2BBSA 1KSHA 1W0KD 1M8PA 1TU4A 2ZPTX 4Z51A 5SZIA 1IY0A 2A5DA 1MT0A 2RAPA 2IXFA 3QKSB 3G82C 3FE2A 3TKLA 1M2OB 4FCVA 421PA 1K5DA 2PX3A 1I2MA 1XEFA 4EFMA 2F3RA 5KNCA 1QF9A 3VHXA 5IT5A 1DEKA 1RKBA 5JBQA 2X1VA 3CRQA 4XSHA 2Q9AA 1WCV1 1SKYB 2D2EA 3NBYC 4X8MA 1E1RD 1KO1A 4TT3A 5B57C 3PVSA 3VKWA 2CCGA 1C9KA 1KO7A 1FQKA 2D74A 2G6BA 1G6OA 1E98A 1YU9A 4WOPA 3T35A 1PLJA 3T61A 3VNUA 4LYFA 4M22A 3FWYA 1Q44A 4KXFB 2VP5A 5JSZB 3KUDA 4C30A 2CHVA 3LBIA 1KK1A 3HYTA 2JEOA 1IN7A 4Q7LA 1SGWA 2P6UA 3TIFA 1BOFA 2PLFA 3KFXA 1E1QA 1KKMA 1OIXA 1W2GA 1E2PA 1T3SA 1Z0KA 3HR8A 5K8IA 1VG8A 4C0HA 4TQUS 4MRVA 1VCNA 2WVJA 1R8QA 3AEZA 5LB2A 3D31A 4DCUA 4KFUA 4PZLA 5SZJA 3ZH9B 4PQFA 1GAJA 2BM1A 5SZHB 3VFDA 1BMFA 1P75A 1NJFA 4F92B 3GLGB 1HEIA 2NG1A 1FX0A 1W1WA 1XJQA 1JAHA 4RFSA 2CL7X 5DHAA 3QUSA 2ATXA 1CR1A 2VHTA 3BXZA 3L2OB 4JLBA 2C9OA 3B1YA 2R9VA 4D0NA 2RGNC 2YNMA 1N0WA 2WOJA 1XD9A 1DAEA 1Z22A 4MRNA 3KQUA 2YC4C 5BN4A 2O0KA 3FKQA 3WRXC 1US8A 1NIPA 3EC1A 3I73A 1ESNA 2B7CA 4I1UA 2ZE5A 2AK3A 1G16A 1DAGA 5EE1A 5HCNA 4JJZA 3U7GA 1O87A 2R6AA 2AWNA 4CEJA 4B76A 2XJ9A 2C77A 2GEVA 1A1VA 1WF3A 4AY2A 1DAMA 3IO5A 2WHXA 5IK2D 2W6IA 5G3YA 2J5XA 4LYJA 4NBSA 3RS7A 2CXXA 3HR7A 5KDDA 5GJVC 4ZDWA 2XSZD 4JLMA 1MRSA 3Q3JB 4BFXA 2ODWA 4Q01A 3LLUA 4HAXA 3I92A 4NH0A 3T15A 4IDOA 4AYTA 4HSEA 1F6BA 2F9LA 1UAAA 3HYRA 5LD2B 3GJ3A 4JL5A 3EPLA 1BYIA 3PIRA 4QJ5A 3KJHA 3RSLA 4IKEA 1G8GA 4YLGA 1XMJA 1J90A 4FCTA 1G17A 4TYNA 3VQTA 2HJVA 4G0NA 1WBBA 1E6CA 3CR7A 4YMWA 3X1ZA 1W2HA 3P4XA 4TLEA 3ADKA 3B60A 1J70A 2ZJOA 2QQ0A 3CF6R 2ZI7A 2QP3A 1VG0B 3NWJA 2CLSA 1E0SA 1K5GA 4FINA 4C0AC 3AVPA 3U60B 1KI1A 1QHIA 4K8OA 3DKPA 4RFSB 1FX0B 2YJTD 1ZP6A 4HZUA 3U4QA 1XEXA 3NC0C 2EFDB 4YMSA 5DNYB 1XJ0A 3DM9B 4IVPA 2JASA 1AN0A 4WZ6A 2REXB 1XX6A 4ESVA 4ZCLA 4A0HA 3U7FB 1UBFA 3B1ZA 4XOIA 3WMEA 1E0AA 1E3MA 4IVQA 1G21E 2PEZA 2P6RA 1YZGA 1EG7A 2EWVA 3CONA 4PTLA 2ZSEA 3VU9B 4D6PA 4JMPA 1XXHE 3K09A 3NH9A 1S2MA 4ABYA 2NPFA 4IOKA 4DCTA 3MLEA 4CEJB 2ZVPX 5CM8B 1SVLA 4D82A 3E70C 3T1VA 4U5XA 1DE0A 4PSVA 4D80A 2QBYA 4GI7A 2G9NA 1KY3A 3SI7A 4X8LA 2CK3D 1C1YA 1L4YA 2OHFA 3A1UA 3GJ6A 5FBWB 2YWGA 3JVVA 5M04A 2RMKA 4R2HA 2QI9C 2GBLC 3AB3A 3LLMA 3SBEA 4B44A 4JSYA 1DS6A 1ELOA 4LV6A 3AVWA 3R8CA 1OH8A 3C5CA 4QOSA 4BGDA 2BIFA 2C99A 2BBTA 3SYNA 3FB4A 2C5LA 2XB4A 3QXCA 4M53A 3EPJA 4ZV4A 2DBYA 5DH9A 4DC9A 4A82A 1U94A 4HB3A 1U2RA 3KDSE 3CM0A 1G9XA 4W5JA 1VYTA 1XMSA 2DFKB 2BBOA 2WBLC 4S35A 2VH5R 4MRRA 1E2QA 2VP4A 2YVUA 3TMKA 2XGJA 4CW7A 2WWHA 2IYQA 1E9EA 4HZUB 4MITA 4AWXA 4QJ4A 3U4QB 1XEXB 4PXAA 2BMJA 2MSCB 4LWZA 2GXQA 5DN6D 3U61B 2I3BA 3ZJYA 2P67A 4LHVA 5CM9C 1I4TD 3B7GA 3VR3A 1ZRHA 5HZKA 1N25A 1GRQA 1WMSA 2JIZD 3KB1A 3GEEA 5FR2A 3L8ZA 3W34A 2QENA 2G0TA 1S96A 4OQLA 1O3YA 4TMWA 1LFDB 1YKSA 1N0UA 2WJJA 2ZU6A 1NBME 2PL3A 4DUGA 3MJHA 4Q9IA 4D4MA 4QM7A 3I1FA 3QPVA 5EXPA 1AJEA 1Q1QA 3IUYA 1AGRA 3NVAA 3MUFA 3TBKA 5C4MA 5CYOA 2ORIA 1WP9A 1NKSA 2NTYC 3KQHA 2QBYB 1T8UA 2HXSA 2X77A 1SKQA 4LGMA 1FUUA 1TX4B 3R8FA 1W5TA 1HA3A 1KDPA 3BC1A 4OHYA 1KDOA 2EU8A 2RGNA 4TQ9A 1FTSA 2WKRA 2ZUBA 4G1UC 3R9XA 3P26A 2MMGA 1HUQA 4YDHB 3LQQA 3DM5A 3K9NA 4M1YA 3X1DA 2OUKA 3EASA 4A2WA 2QTVB 1GIAA 1TTTA 3ZGXA 4K46A 2C98A 2RHMA 1S1CA 2C2HA 2OZEA 3ZD7A 1JBKA 3K70D 2GVDC 3OAAA 1OFHA 2OG2A 3QVUA 5F9FA 1DG3A 1L4UA 1LV7A 3AF4A 2OXCA 2Q9BA 1FP6A 1OXTA 3VR5A 4NYMR 1U98A 3DMNA 2OESA 2W6JD 3BGWA 3SFZA 1AK2A 1H8ED 2FDCA 4POAA 5KSOA 1L2TA 4NYMQ 2QE7A 2FH5B 4EFNA 4A8JC 1SVWA 2ZYWX 3EC2A 5C2JB 4ZI2A 3AGQA 1Q22A 1ZNZA 3UXMA 4GMDA 5E95A 1HT2E 2O5VA 4DCSA 2JCSA 2ODEA 3LW7A 1K6MA 5FPTA 3WMFA 1DO2A 1UDWA 3QE0A 5CDFE 4Q1EA 4DT1A 1FP7A 3IQWA 4JYBA 1KHTA 1CJUC 1R4AA 3QBTA 1KSGA 3FHCB 3O8RA 5FBRB 3TW8B 5C18A 2IF0A 1D2NA 5DLQC 4A0FA 4B3FX 4QG7A 4C9BA 5TVKA 1XD2A 4W9MC 3A36A 3GFPA 1D8TA 1GOTA 5LDDC 3PEYA 1AGPA 2N46A 3AF3A 2DHRA 2G3YA 5AUNB 4ON9A 1HV8A 1LVGA 1RRFA 1OIVA 4A15A 4P4SA 2AKYA 4D0LB 2Z43A 3B9PA 4HEJA 1G3RA 1IN4A 2QAGC 4NCJA 1GWNA 3N2IA 3ZZTA 3PFIA 2GTPA 3IBYA 2NOAA 2ZITA 3W6PA 4HUQA 4IFEA 2R65A 1LF0A 2IS4A 2CE7A 4M4SA 1N0VC 2ZSFA 4PHFA 4GZLA 2QN6A 4DVGA 1J2JA 1R0XA 1XMIA 1SVSA 4EUNA 5K8LA 1Z29A 2V1UA 3AVYA 2IYRA 2QP9X 5CJ2A 3CR8A 4IXNA 1WRBA 2A9KA 4NYIQ 1LTQA 2J45A 2VSXA 1Z08A 5EP2A 1T0JB 2WOOA 4FMCB 1AKEA 2ZXUA 5EZ6B 5CB8A 1JB1A 3VTKA 3TSZA 1G5RA 2REOA 5KDOA 2DYKA 4PC7A 4YMVA 4AG5A 1DBSA 2RGGA 5IF9A 5EP1A 5DYGA 2B92A 2GJAA 5KSZA 3PXGA 1XTJA 2PLRA 1EGAA 2AX4A 2QU8A 2GBLA 3MWYW 1IN8A 5FTNA 2OILA 4ZKDA 2RGCA 4AURA 2QRZA 3IIKA 2D3WA 1JJ7A 5TV2A 5AUOB 4ACBA 5J4YA 1TF5A 1II9A 3GLIE 2VTKA 4E03A 1ONBA 3K9LA 5FL7D 1G4UR 2H92A 2ZU0C 4RJLA 4DT1B 4PX9A 4Q1BA 2FF7A 1ZMXA 5SZKB 2ZRFA 3TE6A 1HURA 2CBZA 3OE7A 3SJZA 3HU3A 1I4LD 1DTSA 1XD2B 1ZC4A 1NRJB 3EXAA 4LSGA 3UMFA 1OH5A 4GDFA 2QG6A 1OHHD 1G20E 1XF9A 2WSSD 4OJQA 1OF1A 2GJKA 4DBLC 1VG9B 3U3RA 4ERNA 3MG9A 2IS6A 4P4SB 4NE2A 1KNXA 2GZAA 1JJVA 2J59A 2XNDD 3LH5A 5TARA 4B2PA 4ZCMA 2PH1A 4Z1MD 2BVNA 2JJ8A 4Q21A 5FUYA 5FOTA 2OCAA 2KB0A 2W0SA 1Z6YA 2R8RA 3QJYA 4HB2A 3TR5A 3B85A 1TQDA 1FTNA 2BKEA 1G291 1R0ZA 4TTRA 1KI8A 2C78A 4JVNA 3MD0A 1TU3A 2A3RA 2GEUA 2ZRMA 4CDGA 5GJCA 2JAQA 2GF9A 2V54A 1XEWX 3NHBA 1G5PA 4PO9A 1FZQA 3SHFA 4GP6A 3T1TA 2WWYA 3NDBB 2PMDA 3BERA 1M7BA 1OKKD 1JR3A 2ZIAA 1GVNB 1DOAA 1OT3A 1BKDR 4LI0A 1JECA 4LJ9A 4JL8A 2PZFA 2GK6A 4IFBA 1VPLA 2VHJA 3AM1A 4WA7A 1P9NA 2BCJQ 2H8KA 4NKRA 3RS3A 4B3DA 2CJWA 4Q4AA 4DLTA 1CEEA 3GFTA 3RS5A 4TLCA 4CEHA 1YE8A 3REGA 2ZM5A 4ZDIA 1ZC3A 3C5HA 1X8JA 2XB2A 1NN1A 1ZIOA 2RGAA 4XWKA 3AP1A 3ZIAD 1GILA 1FL9A 1OLOA 4PAMA 4FD2A 5FI0B 1G1MA 3F8TA 1XZPA 1R0WA 1E32A 4RD6A 4C0BA 4CT4B 3SZRA 3BWDD 1UM8A 2ZAMA 2QY9A 1N6KA 4MGZR 2E1RA 1CTQA 1R5OA 2Q3HA 4W7SA 3KJGA 5CJPA 4BFUA 3RYTC 4M1MA 1YRAA 2GHIA 1H65A 4A8JA 4EJSA 3UKDA 2EW1A 1PJRA 1KIMA 2IF2A 1IONA 2F1JA 1N3BA 3KKQA 1CRQA 4G3XA 4EPWA 1Z63A 3N2EA 4IXMA 1AZSC 4LBZA 221PA 3GCGA 3RWMB 3DEFA 3UPUA 2IEYA 2DFLA 2WJVA 2ZEJA 2FFAA 2NMVA 3NXSA 1CJKC 2Q0HA 4JKIA 3S1AA 1E2LA 4FI3C 3SBDA 1ZD9A 3R9WA 4MQBA 4A2QA 2KJQA 4A4DA 1BH2A 4BFVA 4DEXA 4LJYA 2YINC 1EFRD 3TAUA 2JGNA 3R7WA 2J0VA 3A4LA 1NF3A 1XPOA 2ORWA 2QAGA 1FUKA 4LJ6A 2AK2A 1W47A 2HXYA 3IIJA 2O0JA 1EFHA 1OFTA 1VMAA 1E2FA 1U0LA 2NZJA 1U90A 2NO1A 4IOJA 2B7BA 1RPZA 1N6LA 2XITA 3A4NA 4M9QA 5KPDA 1ZU4A 4A92A 3HU2A 3OEED 2V7QA 4HAVA 4TTQA 3TR0A 3IEVA 5B58C 1OH7A 2CJWB 4HAYA 5C46F 4A6PA 4CEHB 2GCOA 5EP3A 2XOKD 2O8EB 3UG7A 4P3YA 2X19A 4V03A 3TRFA 2QM7A 1COWD 1N6IA 1RE0A 1ZUHA 3UMRA 3VR2A 4DLWA 2ERYA 4QGFA 5CIQA 2H57A 1ZAKA 2F1HA 4R71A 4RCZA 4M0LA 1Z0AA 2W2VA 4HB4A 3ZVRA 5J40A 2IYSA 4XIGS 4HDQB 4GOJA 2VP6A 4XJXA 3FPAA 1TPZA 3AUXA 3C14C 2O8CA 4V0NA 5GVSA 1DPFA 3AVQA 1UBCA 1KDTA 3C7KA 1T6NA 3LWNA 4CYMA 2OT3B 2OXRA 3M6AA 4JLOA 2YZ2A 1XTSA 3FDIA 4A8JB 4EJSB 4BLSA 2OCBA 3PQCA 3PUVA 3M1IA 1JAIA 3O8DA 1VCIA 4AG6A 4M9SA 4AD8A 5E4FA 1A5TA 1LY1A 4KCGA 3VHLB 3CX8A 3KZ1E 5JS8A 4MKHA 4XSGA 3EA5A 4TSFA 2CMKA 1U81A 4HAZA 4TL7A 3THXB 2RGDA 2ZETA 4JS0A 4QGGA 4LJ7A 2QAJA 4D25A 2ZRCA 3CIOA 3S1AB 3NBZC 1G8FA 1OYWA 3EW9A 1F48A 1OE0A 3QIAA 3P27A 5DIFA 1W0JD 2KBEA 4B3XA 1XCPA 4JT2A 4JLDA 3RLFA 4WZBE 3R7WB 2VP9A 4MRSA 3BB4A 1G8YA 4Q1CA 5AJYA 5IRCD 2GA8A 2HCJB 1U99A 1MO6A 2VYFA 1AQYA 5DSZA 1ZJ6A 2J0UA 1VIYA 2Z6VA 1R5NA 4EDHA 1Q1ZA 4C7OA 5EE5B 3MAAC 4IRUB 3KQNA 4XD7A 2FMXA 3RS2A 3QI2A 621PA 1MOZA 2G0NA 4KI0A 5FUWA 1Z28A 1S1MA 4DDVA 1G19A 2WKQA 3I5XA 2ONKA 1BO6A 3LW8A 1HH4A 4C2TA 2LWIA 5DI3A 4EQ6A 2GCOB 1P60A 2IUSA 3ZQ6A 4EKDA 2BKUA 1E2IA 2PJZA 4ASUD 1NN0A 5E3HA 2HLDD 4D4JA 4W5HA 5BN5A 1W46A 1ZW6A 3L0PA 1KAGA 2PEYA 1E2GA 1GKYA 4ARZA 2ZR7A 3GLHA 2O0HA 2QGNA 3KKOA 3GJ8A 4BLTA 4NONA 4QNRA 2YYZA 1CP2A 1A2KC 4LBYA 5AK0A 2F55A 1QHHA 2O8CB 1NLYA 4JBXA 2ZI5A 3CUEF 1NBMD 1NY5A 3B13B 4IEEA 1GM5A 3NC1C 1XBTA 4JYCA 4NZYA 2DPXA 5B30A 3AKEA 1U8YA 5D3MA 1W4RA 3ZS9A 1T91A 1Y63A 3CF2A 1AS0A 3MGCA 3DPUA 4HATA 3FVQA 4BFYA 5KPJA 3UWKA 1SXJA 4B33A 1S4QA 2WAYA 2WV9A 3BRWD 4OJKA 3U44A 1T3HA 2ZJYA 4KU4A 5KO2A 4KBGA 2NZ8A 3D3QA 1Q12A
chains in the Genus database with same CATH superfamily
2QVBA 3TINA 2SICE 5K6RA 3M6MD 3C3XA 4WVFA 1MEOA 1MBZA 1SPXA 2IPMA 3GRAA 3SDBA 2B37A 2EJWA 5ABPA 3DZJA 3SF0A 4G8BA 3QW4B 2H4HA 2Z04A 3DP7A 3H9JA 5FF9A 4YUYA 2J0UB 4EJFA 3PD1A 2G70A 3LL7A 4KE8A 2AXPA 3DTVA 2FFQA 5ANRB 3ZPXA 4OI0A 4O4IA 4FCCA 4EGJA 3AL3A 1N2XA 1M0SA 1YS9A 5ALYA 2HN9A 1VA5A 2YV5A 1N9GB 1U1CA 4KIWA 4RTLA 2O8FA 1J22A 3KWMA 2QSJA 1NPYA 4NARA 1THMA 5FWXA 1A9TA 4ABTA 4F91B 1GG5A 3RRZA 1GQSA 3HP4A 121PA 3PJDA 4PHHA 2YKGA 1LLFA 1VL6A 2HWXA 3T0GA 2WFLA 1ZN9A 2GYWA 3KVRA 1OX4B 1XCBA 2PWZA 1NJSA 2Z0MA 2YJ3A 2PRIA 2BM9A 3HNOA 3LSYA 3WB9A 4CQNA 3BXOA 2RHGB 3PPXA 4N8SA 5BN5B 4KFTA 4AKIA 4B3SB 1YUNA 1YR8A 1E1RA 2XQVA 4GRAA 1XU4A 1RJEA 4IGFA 4K0RA 4O3FA 3TOVA 5B7QA 5BQFA 1C1HA 3GRCA 5DBGA 1ZUWA 2VPIA 4X64B 3PNQA 2IWHA 2FSVC 2I8CA 3FVVA 4FN5A 4MAMA 1FDVA 1N5MA 5D84A 3A3KA 4KLZA 2XKKA 3C85A 1L1EA 4LPSA 3P2EA 4EGQA 1JHUA 3PHGA 5JAZA 1VXRA 1X80A 3MWEA 3O8BA 3PI7A 5T4EA 1GA6A 1V1MB 1NNEA 5BW6B 5FLYA 3ROPA 1FUEA 3Q7IA 3H5VA 3KVNA 3CSUA 2BKXA 1SB8A 2NSHA 1E2JA 3BK7A 4TWRA 4UJ3A 4RVCA 3FPEA 5K51A 3V8EA 2PVPA 2Q7XA 4MVJM 3KAJA 3KYCB 5COBA 1SXJB 2PX5A 3MTGA 1TCAA 4GXNA 4NJOA 4H3SA 8ADHA 3OU7A 1P1CA 4U2BA 3X43A 4J1SA 1T8WA 3A1CA 2EQBA 3T12A 5FDFA 3VYUB 5FUXA 3IBCA 3VKHA 4GOND 2P1RA 4MV9A 2NZUG 2WJAA 2FGKA 2C7VA 2H9IA 3R5HA 2WTAA 4IPTA 3C45A 1SQ0A 4UDYX 4RM2A 1SKYE 4BWYA 3DTVB 4O4IB 1M2EA 4X91A 1NNUA 1TLTA 5ALDA 3UUWA 3TF5A 1CDDA 1OGJA 2UKDA 2QN3A 4Y2QA 2O8FB 1VE3A 3W0LB 2GJ9A 4ZI3A 4MW0A 3RW9A 1M2WA 1OXXK 3BFVA 5FWXB 1OWNA 1WB5A 1E0KA 4R9VA 4U7DA 4OK3A 4MXDA 4QJBA 4AF8A 1C0LA 3IKJA 5BPFA 3E5MA 1WP4A 1WW2A 2NTNA 2FV8A 2WFLB 2Z3WA 3MBOA 4BBJA 3KE8A 3RVPA 5CDTA 2OSBA 1SQSA 5DHFA 3G8YA 4UDXX 4IEIA 5K0SA 4N7MA 3V7YA 3DF9A 3DW3X 3CRZA 1JWBB 5HA5A 3AL0C 2IPLA 3IESA 3ZUGA 3HBFA 3R0JA 3BMOA 3IHKA 5IK2A 2VL7A 4N4AA 5ENZA 1W581 3ICOA 1FJGB 4GL2A 1NXTA 4L9SA 5KNDA 2FHSA 2XSZA 4F86A 2HHJA 4KO1S 4UFOA 4Y1RA 4YV2A 2D2IA 1IJKA 4S2EA 3GDHA 1O8CA 1YIOA 2EGGA 3M9XA 4OLAA 1PSZA 2VDJA 5G1OA 3S8EA 3KJZA 1NNLA 4RK7A 3CUSA 4M8NE 5LOVF 2D4HA 4HNSA 4XFJA 2FPWA 2UZ4A 2OYCA 3OEHD 2IPXA 3DLCA 1X80B 1KZYC 1FUIA 2G88A 4WW0A 2QS9A 2WKPA 1W4BA 4OGGA 1G8MA 3HPQA 3R0XA 4EAQA 5EIBC 1HPLA 4BGEA 1KFJB 3WGMA 3BWVA 2GHRA 2AEMA 4YS6A 5IUKC 3AK4A 1BS1A 1NZFA 4X1YA 6CHYA 3LX4A 4MRAA 1WXHA 1DKOA 1D6JA 1M6WA 2GWHA 3LUHA 3ZZUA 4D5GA 2C8VA 3BF8A 3C4QA 1WSAA 3KB2A 4HHEA 1TA9A 3I61A 1FNSA 2EP5A 2IYUA 1JKFA 3VC3A 4RD1A 2J08A 4NCKA 1LJ8A 5HOQA 3CT6A 1UDBA 2XMRA 3OESA 1X9GA 1Q57A 4PZYA 5GONF 2OA0A 2IITA 3F7NA 4IJMA 4OKIA 3U3KA 5C31A 4D45A 1ZVVA 1BHO1 2EOAA 3OJFA 2IX9A 3V34A 4JYAB 2IX3A 3NP7A 3BH0A 1DPGA 4ZVLA 4EY3A 4FCWA 4LVOA 4O8ZA 5FOSA 1ZGAA 5A4JA 1H0HA 2VDNB 2QP4A 5DMXA 1P61B 1DRWA 3OIVA 3GH3A 1PVVA 2DTEA 5BN1A 3U7RA 2V6FA 5A5GA 3LUGA 4TX1A 4UNRA 3PXDA 4DNPA 1FSFA 1TCBA 2XKJE 3TG8A 1VYHA 1E4VA 1G41A 2XTAA 3FZQA 1F4LA 1WL8A 3AOEA 3OD1A 5F3RA 4DJTA 5A2GA 1A8IA 3OF5A 2AT1A 3IP3A 3BSWA 4QAQA 2BFMA 3NIWA 3G9ZA 3V2UA 9ATCA 3QEBZ 1G3QA 1W2WB 4DIBA 1PNQA 2AGVA 1YL5A 3GPCA 1I7PA 3BMOB 3R2JA 2QM3A 4OP2A 1BWQA 1WDMA 1Q0UA 2AD5A 3W6ZA 5HW0A 5KIAA 1N2JA 1VJ5A 4W6QA 1XKLA 3GEDA 1Y8AA 1KQ3A 2IZ0A 2ZRPA 3ZY2A 2HA5A 4IJUA 3JZMA 3AYZB 1AKQA 3SZLA 1R3DA 4YJ2F 3D4LA 1TL7C 2G4CA 3OD5A 4QREA 2J3JA 3HVUA 4KXVA 5DASA 2O3QA 1OCEA 2EEZA 3W5IA 4H31A 3M81A 2TS1A 3CZRA 3WKEA 2A5JA 3WTCA 1LPAB 1WB6A 2F1RA 2VVTA 3GEPA 2O14A 1S8OA 2JGEA 5JSYA 2QTWB 4R0VA 1M5RA 2WTMA 1KK0A 3WKAA 3I76A 4KL8S 4OQYA 4PLHA 2J31A 4U0KA 3TIXB 3U49A 1OPXA 3NKLA 2FA9A 2WSLA 3HVRA 1Z5ZA 1QZXA 1X7XA 4NJMA 3VPGA 5CH5A 3ZHYA 4IZHA 3P9CA 1RRMA 2HIGA 3HUUA 5FAXA 1ZHHA 3D8HA 1H2RS 3GOQA 3QLVC 4MP6A 4RJIA 5HDQA 4EB0A 5BN3A 4M8LA 4DLPA 1O94A 5BYAA 2G7MC 3OPVA 4L27A 3B78A 1LS1A 4YJ3F 4AWAA 4TL6A 4DOMA 1DC4A 3ISVA 3NBUA 1P62B 3MWKA 1SEVA 4JSTA 4LZPA 4BMCA 3ZLVA 3K0CC 1RAHA 2HGZA 3I6IA 4G81A 2PUJA 3BTOA 4OGFA 4MTCA 4R4JA 3V46A 5C3MA 2OY0A 5A0FA 2XA2A 2TSYB 3CR3C 4LE0A 4LCEA 3NEAA 4DR1B 1WE2A 3NR2A 2YRWA 1DFIA 2VJKA 2RGRA 1XCJA 5L3QA 1Z3CA 2HJWA 2M1ZA 3DOJA 1B73A 1JHZA 1UKZA 2OCDA 1TFRA 4JK3A 4QOEA 3BWXA 4TMZA 4DNOA 3R0ZA 2DFTA 4N40A 4KJZA 2GS9A 4X85A 4G0UA 4G4IA 3OCVA 2QTHA 3PQ7A 2W8BA 3SOZA 5J4VA 3IB3A 4PNHA 5SY6A 2Y27A 2WP8J 1NHGA 2QE6A 1I1NA 4I36A 1ZWKA 3RFFA 3RI3A 3L6DA 5E1MA 1VL8A 3KCQA 1A5SB 1JKJA 3DA8A 2IYYA 3LD9A 4WZAE 2J67A 1NDHA 2D0DA 1MJ5A 2X40A 4CKYA 1H0KA 2XAUA 5AK3A 1TYBE 3RU2A 3THSA 2F6RA 2R3SA 3HL4A 5LOVA 5FFFA 1QHYA 1SRQA 2D2FA 2XYRA 4FGJA 4FONA 4YTEA 3W9SA 5J43A 4EG8A 1YQWA 1WEKA 2SCUB 5JRJA 1IXSB 5LP6F 2ARKA 4H4DA 4QUIA 4HMQA 4UPEA 2A0UA 1QP0A 1NG1A 1DBIA 1KGDA 3PUWA 1JSLA 5G41A 3Q2KA 1JG6A 1CV2A 3PNBA 4AJPA 4GLBA 1QTIA 1AXEA 2IXBA 3OPYA 3OJLA 3UICA 1ES9A 3G6KA 1GUBA 3N6RA 1GTZA 2I8AA 3EN0A 3C48A 2GTHA 1T1GA 1F4VA 1X7XB 4MK4A 4P32A 4B43A 3K94A 1AQUA 5HDBB 2ODPA 3ESBA 4IH4A 1EX9A 2Q8NA 5AKKA 5BN3B 4RJJA 1KFCB 4RZUA 2K5UA 1NPTO 1PZHA 2Q3BA 3CZPA 1GARA 4ZEXA 2QNBA 3WLPA 3CNEA 4KWIA 3OT5A 3QP9A 3LAWA 4YRPA 1ISGA 1G8SA 5DHTA 4GI3A 3JWEA 4OF4A 1IBSA 3PGA1 3RARA 3D2AA 3TQSA 2G63A 4PGGA 3HK2A 1V9CA 2OFWA 1CNEA 5K0EA 2WWFA 2QNIA 2W8ZA 1X7HA 2QIPA 3DB1A 1YJ5A 3QWFA 3ONWA 5LLSA 2W2MA 3R74A 3BHMA 5ECDA 1FMLA 1S3GA 3LGXA 5PNTA 3ES9A 1J2TA 1Q0ZA 4LY6A 5L3QB 3LI2A 3DVQX 3L7JA 4UDOA 3HFGA 4KLRA 2ZBFA 4WK0B 4CI9A 1DEHA 1SG6A 3FUCA 3HI4A 4P80A 3UAWA 2BI8A 3RVBA 1HKUA 2O3TA 4TROA 5CMLA 3TMYA 2I0FA 2O7SA 2W8BB 1JHQA 4MYCA 3FW1A 3GH1A 3VOBA 4YJKA 4JQOA 5DOVA 5DTEA 3RJZA 2R84A 5LU9A 3GRKA 1F4PA 3STWA 4UXJA 4IMJB 4B8YA 2JFHA 3BE5A 2I4NA 4E1VA 2GXUA 1JKJB 1NQ5A 4YMLA 1VC2A 4IS3A 3L02A 1ST3A 3G0DA 4OFXA 3TXYA 4OMDA 3FSGD 5LOVB 4CGZA 5F21A 3NRCA 1L3IA 1UBEA 2I66A 4DLZA 4EJMA 4NZOA 1ZWLA 3U9LA 2PGIA 2R66A 2XZPA 1GRRA 1QO0D 3GX1A 5IP5A 2CDRA 2X1MA 5A0TA 2PT7A 2UYOA 3CBQA 3L0ZA 2Z8XA 4MUKA 5FQOA 4FSDA 3I05A 3KV1A 2J3DA 4MV6A 5TSDA 1I36A 4QNMA 4F8EA 1TU0A 5HE8A 4A0RA 2I6GA 1K7EB 1KI9A 3CISA 3DWIA 3HB1A 4OHRA 1B8VA 4XCVA 3A27A 3OPYB 4DLUA 4UBJA 1JDNA 2OENG 3SIRA 5AKZA 5CCXA 3SQWA 2DMRA 2YWEA 3BWEA 1E62A 3Q88A 2QGFA 3W3AH 4O8CA 4JOSA 2J87A 3C5WP 1GYQA 4JLWA 5F3WB 2I8LA 3HMKA 4UTOA 1LDBA 4PCVA 3FTDA 4WLVA 4JVOA 4KGXA 2ZWPA 4YJ3A 1TT5A 2EKQA 2FJUA 3I8XA 4PF1A 4WBSA 4DM3A 4F56A 1HNXB 3PFCA 1IXYA 1D5WA 3U9SA 5GMOA 4R05A 5TXGA 1A4RA 3NUGA 4JQYA 2R7MA 3O4VA 4U7HA 3BRQA 4YR7A 4GKAA 1AO0A 2CKMA 2YFQA 2V7TA 1E3IA 1QB7A 4ZP1A 1YC2A 3Q15C 1JTVA 1M2HA 1QG4A 2GXSA 1X3SA 1TW3A 3VHQA 1K7CA 4LN1A 4WOBA 1MPXA 5C5IA 2GXAA 3V42A 1Z26A 4XWTA 2C0QA 4N5LA 1WF6A 3F6RA 5DYWA 2XPCA 3HNPA 4PQRA 1KJ9A 1SBNE 1I94B 1I0IA 1ICIA 3Q40A 1KEZA 2JK1A 4J16C 5L7YA 4L9RA 1I3LA 1KQOA 2G5CA 3M82A 3OHPA 3J81k 3EWAA 1ZNYA 1ZM4A 1QH9A 4RAOA 5C8YA 1BSVA 4A03A 5JATA 2IOHA 3ZBPA 4PC6A 3TGPA 1Y5NA 5CJJA 1N6NA 3S2ZA 1DV2A 2ZBUA 1BDBA 1RKUA 2L82A 3F78A 3RRBA 4J29A 4ISBA 3WYAA 2FRXA 1XPRA 3FPKA 2Y8EA 2Y99A 4WFJA 2ZE6A 4N9QA 5SY9A 2A9JA 1QFSA 1B14A 1E59A 1SWVA 3S3TA 3TCKA 3UW1A 1NMZA 1NUAA 1SG0A 3JX9A 1NBIA 1ZISA 5T64A 2VYVD 4PSKA 4PSDA 1QR2A 3OU6A 3R4VA 3CX7A 1L7EA 4DVJA 4YCCA 1MX9A 4KBFA 4LJAA 4P7KA 4UQOA 2P4QA 2PA3A 1YRLA 3BSSA 3G2IA 3MMSA 5D85A 4URFA 2FW6A 3H11A 1USIA 3I0NA 5ECGC 4ZA2A 4D9JA 1HR0B 1GNSA 3LOPA 1N5LA 1FQJA 2IHBA 3ASZA 4DM4A 1A8SA 4EKNB 4YJ3B 1U3FA 2CHQA 1TT5B 4P08A 2GN8A 3PYLA 3TCXB 4US2R 3RJ5A 4LOAA 1EP3B 5T6BA 3KLMX 4G07A 2ZUFA 1RBMA 3ED1A 1FRVA 4AL4A 2L42A 3GCXA 1JIQA 3B3AA 3DQQA 4KPFC 1MCZA 3B70A 2NNLD 3KYBA 3MILA 3OZAA 4HYYA 2JKYA 2VNSA 4QPZA 3THOA 5HFAA 3U40A 2HT1A 3FOEC 4JUBA 2QJTA 5EKTA 4I9HA 3Q0TA 3TLMA 4KRYA 4H7JA 2VRBA 5C9ZA 3UAOA 1VHTA 2R4QA 4QYMA 1XAHA 1PR6A 3NYQA 4BMYA 3PHHA 5AXCA 4LBWA 2FR8C 4FGLA 2INGX 4KV9A 3KFVA 4A36A 2ZSDA 2P62A 2CFSA 3R9IA 1RI3A 2IHZA 3H2KA 2ZTSA 5B3JA 4DCVA 1AO3A 4NBWA 5K3EA 2DLNA 2WKWA 4LDQA 1CR0A 2IJGX 2N9UA 1XGKA 3FIUA 3FZYA 2R62A 4YJFA 5C8YB 3TLKA 2HT6A 3T4PA 3ZJUA 3BB3A 2LW7A 4LXGA 5EHIA 2G5PA 4XYLA 1NM5A 5TY0A 1T6BY 3DUFA 5HRAA 1CZKA 1DCMA 1U1GA 1CUSA 4FJ2A 4F9EA 5JJKA 3NNSA 2NQ2C 5D6OA 2Q9UA 1HRKA 1V6SA 5ERXA 2XCSB 3LLSA 1USUA 3T5DA 1FZTA 1XTQA 2EATA 2QGZA 3WAGA 2O54A 1CEQA 5BSEA 2H1LA 3TNFA 3IALA 1DCKA 3D7KA 2DAPA 2Z4RA 1EWRA 2IXGA 1T5HX 1TUGA 4Q47A 4X84A 3B9RA 5K03A 5AK6A 1SZCA 3H0KA 5H68A 2A0FA 3IAS6 3LKDA 3B12A 3MWDA 2GUGA 4KB5A 2P2DA 3K5IA 4LTDA 1L5LA 3E9RA 1EFRA 3H11B 1NI3A 5FKJA 4JI1B 1ID1A 4MLCA 1VPTA 4AJEA 5CD1A 3PJGA 1E96A 1PG5A 4QL3A 3AFHA 3VO8A 1WDLA 3CEPB 4O0LA 4YGYA 1Y7IA 1QQBA 2ROQA 3V48A 3S2SA 4H6XA 4JBLA 1V39A 4QOGA 2R68A 5K20A 3GDOA 3OZUA 2PO7A 4CLRA 4KG7A 4OBXA 4EZEA 1GO2A 1V4NA 2WD8A 3K15A 4R40A 3AUKA 1EXWA 3T7DA 4DJDC 4D92A 3TH5A 1GTL1 1RJ9A 1N78A 2HBYA 4NY1A 4FW8A 2ZTVA 1BQ3A 1XTUA 2HJGA 3GJTA 4HDOB 3IV6A 3Q87B 3WG9A 1KIAA 1NLZA 4WLOA 1V7ZA 1Z15A 2B4RO 2H59A 2NZWA 1ISIA 4PG7A 1S2IA 2I67A 4ZOCA 1WETA 1N2IA 3IEIA 5TMBA 3UOWA 1T9HA 2WYIA 2HHHB 2O52A 1JSXA 2VJAA 1OW3B 1K7XB 4OHOA 4OH1A 4Q3NA 3S28A 4BP9A 4GRDA 5AI6A 4BLOA 4NV0A 3FFBA 2VF5X 4M8KA 3WAJA 3NRBA 2WTBA 3BIWA 3TUIC 1BMDA 1L5KA 5KC9A 3LV8A 3LQYA 1ZH8A 3SIPA 4RHXA 4CE6A 1L7XA 2GFIA 4MGYR 1CCWA 2C2MA 2HPHA 4ISCA 4YJFB 3UB4A 4BO2A 3QFHA 5AM5A 1HLDA 5FUMA 3T06B 5KHOC 2QM8A 1PP4A 3KZOA 2F8MA 3DUFB 2PZKA 4BV9A 4B0PA 4B47A 3OZ7A 3KOXA 4AS3A 5JAHA 5BNFA 1W19A 5HE9A 4DR2B 2XVMA 3QLUC 2BPOA 2CHGA 3QUCA 5ALRA 3B2EA 5H02A 3F3YA 3NG1A 1XTBA 2NXEA 3C4VA 4I0WB 4YNBA 1J0DA 1FOEB 2FPRA 2HKIA 2P7HA 4H7HA 3SYKA 1BE6A 1QVRA 3EBPA 4MSUA 4WUTA 1BDMA 3PLAE 4ZO9A 3H4MA 4HFMA 2XMCA 2IZ7A 3MWDB 3ZW7A 4FUTA 3L8DA 4Z99A 2KW5A 5CITA 5THXA 3A1NA 2FUKA 1A7KA 3IP1A 3EYWA 2IEDA 3JRWA 4LSZA 2CW5A 2GEJA 4AN1A 4OOEA 1A71A 1EX7A 4ZPXA 2YJ4A 2Z2JA 1V7QA 1DXQA 2I2AA 3LQRA 4YBZA 3ZH2A 1AGXA 4B7XA 3MT0A 3L93A 5JEDA 2G1PA 1SVNA 4CLRB 2JHFA 4KTTE 1FDSA 1JEJA 4UCXA 4LW8A 4TS1A 4ZVUA 4IDGA 5F52A 3NFRA 1E66A 2J33A 2ONCA 1E3TA 1RPAA 5SYAA 4AXXA 1S3FA 1RJ9B 4GXRA 1TT7A 2PS1A 2UYQA 3HA3A 1V5GA 2NUPA 5K0CA 1C9EA 3BUSA 4CTNA 2VPXA 1SUBA 3CSDA 3DEYX 1ZY2A 4OX9Y 3SQMA 2FKAA 2NO9A 1IOLA 1JR4A 4PC2A 3PJRA 1PLKA 3SIXA 4YAIA 1JHDA 1B1AA 3NETA 4P2GA 2YVKA 3AHDA 2P2ZA 1J07A 2E1PA 2ZIZA 3BTVA 3IT1A 3ZWQA 4CVNA 1C8KA 1TEXA 1Z38A 1ORWA 2RH8A 4PIMA 4XVRA 4Y6GB 4YRLA 5DI3B 4MWGA 3VH2A 1PJTA 1JQJC 2FQXA 2WC1A 4KVGA 1XKXA 4Q37A 4ZZ3A 3RJ9A 4TKMA 1MR3F 5F1OA 1XPUA 4WFQA 1P7ZA 6ABPA 3S6JA 4HWRA 1WZUA 4UZSA 3EIUA 2W6ZA 4NJEA 5DT2A 2X1HA 3RT7A 2HMTA 3A25A 4BE4A 4C22A 5HPYB 3AZOA 1K0FA 2WG2A 3LZDA 5LU8A 2N1MA 3LFHA 1VSBA 1VYVA 2ZWOA 3PTLA 3UT0A 4LHXA 1SCKA 3D2BA 3LPAA 4UM9D 3GCDA 4JROA 1WBJB 4Q9DA 4Z9YA 2YXLA 3Q85A 2QW1A 3X1JA 5BP7A 3LK6A 3AKYA 4DZTA 1SB9A 3PRKE 4CMIA 4XRGA 2XI4A 4XZ3A 1QVZA 2EJCA 3HKBA 1AQLA 1VJ1A 2IL1A 3IIIA 4RESA 4ETMA 1UIMA 3MXTA 1JE1A 4N1AA 4EPRA 4XWOA 4YAUA 2Q4DA 1CF4A 1NW3A 1UH5A 4RBNA 3WGOA 3L6OO 5FI5A 3TIGA 4BASA 2ZJ5A 4PICA 2PMCA 4L5BA 1U2QA 2VPQA 2K7FA 1SKBA 1EBFA 2PZEA 5FOUA 1QG6A 2PV7A 4WNYA 2QTBA 1OIWA 4KO4S 4BTLA 4MR7A 1VMIA 1MOQA 1YMVA 2H5EA 4GG1A 4QFBA 5EIHA 1N6HA 4QDZA 2UXBB 3PX2A 4NG4A 1BA3A 1PUIA 1CLEA 3I42A 5C53B 1MZPA 4AN0A 1XHEA 4D74A 2PSDA 4X3CA 4R9RA 4LC1A 2NUPB 3H9CA 4GU5A 1O5OA 2L18A 1FUYB 5JY6A 4G0ZA 3EGCA 5J2TB 1YR9A 4E3WA 1O97C 4JVLA 4L50A 1Z47A 2IE0A 4N49A 3WLHA 5CLLA 1KDZA 2CVPA 3ODPA 4X65B 1XJWA 2JFGA 4PAGA 4ZAXA 1ADBA 4QQ8A 1YVPA 1MMFB 3J7TA 3I2FA 1DRVA 2ZAGA 3EVZA 3NHZA 4DB2A 2P1DA 1PJCA 4R5MA 1SA0A 1TUBA 2Q49A 3LBYA 4QQFA 2O20A 4C4OA 1QVVA 1TM3E 4LF7B 2LV8A 4M0MA 3JQPA 4C3ZA 3C16C 3S99A 2VNAA 3PJFA 2Y1WA 4U2GA 1L4NA 3G59A 1PEKE 4URUR 2W2LA 3LUDA 4IZ6A 4NJEB 5F98A 3CRRA 4L74A 2ZS8A 4BZXA 1T4BA 5GJWC 4PPFA 5JD3A 1O95C 5LWQA 5ESRA 1SVKA 1E2UA 5AI0A 5LB4A 2I2FA 2IYPA 4NV1A 3W5AA 2B94A 1BFKA 1RZVA 1VE1A 2D7CA 2JFVA 4N6GA 4JI4B 2XHZA 1V8BA 4GPAA 4B2YA 5HS4A 1U5BA 2M9MA 4WKBA 2AXNA 1MC5A 4BE9A 2DGDA 1CIJA 4O1IA 3WWEA 5AJZA 5DM2A 2A1UA 1KPIA 2XQFA 2NP7A 2LKDA 4HLUA 4CMIB 2Y0BA 5H8WA 3GMTA 3X1MA 3FN4A 1N7GA 2TMDA 3HYCA 1GPJA 3I8SA 2ZFUA 4W7IA 4M0PA 2LR0A 1WR8A 4RZXA 4DLVA 3CNHA 1BXKA 2DTXA 3JQBC 3IUEA 4QLAA 5E7JA 1P2FA 1QFJA 3EXHA 4ZJYA 2W90A 3ABRB 2Q2NA 3IPXA 1DADA 4OQPA 4QXAA 1QAQA 1IQPA 1R16A 2FPPA 2GSWA 2O4UX 2PANA 2XYVA 3C7CB 3HUEA 3HU1A 4KOAA 4MLPA 3TBHA 1ZU5A 4I55F 4B1FA 3W8DA 2QX9A 5JASA 1RM3A 1RWWA 2QZ4A 2WTUA 3LX6A 4KRGA 1HORA 4MR7B 1H8HA 3DT8A 3MCWA 4WKPA 1X6VA 4YRFA 4D0GA 1JLKA 2H31A 1V3VA 2P3OA 3PUJA 3TW6A 1WCWA 3CYFA 1ORRA 2CDBA 3IT0A 4NPHA 1TKCA 2JJ1A 4QPDA 1IWOA 3I3SR 4WXPA 4B45A 1EVJA 5BWMA 2ZS7A 3E2PA 1FNDA 1Z2CA 2XLCA 4BWVA 1OXUA 1ODLA 4OP3A 1PNVA 4BBZA 5DV9A 4UOZA 3OY2A 2YVQA 3SSNA 3QG1A 2BOVA 4KQ9A 1TYDE 3I6MA 3G5UA 3UCEA 3UGJA 3K6KA 4EYQA 3ZWWA 1SA0B 1TUBB 1SXJE 4G25A 1Z6QA 3TQRA 4CLEA 2JHPA 1E89A 3OM1A 4W5WA 1AV6A 3VAAA 1F2TA 3DE4X 2ZJ3A 2OYSA 3LHKA 3P2JA 1I2AA 5HHTA 1R4NA 4ZMSA 4N01A 4H1UA 1PSDA 3EXFA 4M99A 1T1RA 1JSCA 4O4JB 1Z56C 1AMOA 3LYHA 2AR7A 2PBZA 3K31A 1D0SA 2O6HA 1PKXA 2V7UA 3T7JA 5TQVA 1E79A 3P0IA 1V6AA 1PE0A 5IC4A 3ZWNA 1E4EB 2Q3MA 1U5BB 3LX8A 2ZJ7A 4G5SA 1QGED 4JGIA 4NCAA 3ORQA 4WOJA 4KXQA 2YY6A 4EYSA 5IBCA 1IB6A 1E2MA 4I5DA 3IS3A 3CWQA 1EFVA 1YASA 3AR5A 4EI8A 1PQ4A 4HAOA 4U4AA 1HC7A 1SD1A 4FD3A 5JAQA 4NCNA 5B3AA 1ZKDA 3SC6A 4MGKR 3AV0B 3REFA 4LJ5A 2XB8A 1NVBA 3EIQA 3RC8A 2V7PA 1QGYA 2LZ0A 3MQFA 3EXHB 1NYRA 1KJWA 5K9ZA 3PCRB 3FDXA 3FYUA 1KVSA 2C4HA 3KVOA 2I4TA 3U0BA 2N3ZA 4WHMA 3D4BA 2I54A 4HLQB 2YN4A 1DELA 2QTRA 3IDAA 2Y1XA 2BI4A 1XF1A 4R54A 3HHEA 2XR1A 3HV2A 4G37A 2IUUA 2BUAA 1W36B 3C3CA 5BNIA 1YS2X 1NDQA 2BR5A 2FUNB 4FFBA 4X20A 5AVUA 3A06A 2FDRA 2F8TA 4MMZB 4CDNA 5JEEA 4DLXA 3FY4A 5AHOA 1BGVA 2D5IA 4TWIA 2YXDA 3UQYS 3ADDA 4AMVA 2PGLA 1KP9A 1CUDA 1NSTA 3PPWA 4UUPA 2I7DA 3UENA 2QVGA 3FWKA 3GA0A 3DTNA 3GL9A 1PTKA 5TS3A 2F3UA 5TC4A 4WN9A 3TSOA 2AF4C 2H0RA 2IWRA 2PD6A 4OQQA 4QA9A 4Z7OB 3TTTA 1IPEA 4J7XA 5LMCA 5LWHA 2H2GA 3FKJA 4L95C 3NTUA 1NULA 4FFPA 4DARA 3JVUA 4OOFA 2HQ1A 2YOFA 3DZBA 4JLPA 4RY9A 3HVKA 2YMPA 2A9RA 4IH9A 1ZD4A 1QRRA 3EFHA 3G0OA 1F2TB 4MV3A 1WDKA 3ZHTA 1HYEA 1S2LA 2PH7A 1RZRD 1R4NB 3DHWC 4X1OA 4YCNA 2J3IA 4YA6A 1B4DA 3D1LA 2WJHA 2GF0A 1E2KA 2JLYA 3GNSA 3GUZA 3HFRA 3EPKA 2B4YA 1I80A 5DWVA 1ABBA 3N2KA 4PC3A 3S2FA 3KDPA 4S04A 4QU0A 1G5TA 4QVKA 4KFCA 1NW7A 1P7YA 1T8RA 3BXGA 1BU8A 1YDEA 3RGWS 5TX7A 5IS2A 2H2HA 4IIBA 3N8IA 4LJ8A 1YBAA 1J25A 3CGWA 4MULA 4UVIA 5AKJA 1EFVB 3AFGA 3PHLA 2Q6TA 2LD4A 2QVYX 4NDAA 3DONA 4XB1A 5AR1A 4C7BA 1AKVA 2QUZA 4HTFA 4FP9A 4LQCA 4V2UA 2AUMA 4H1TA 5TMPA 1BYUA 2EZ4A 5SV2A 1ECLA 2YJZA 1YBVA 4CN8A 1UPTA 2GZSA 3GU3A 2JLVA 1G2QA 1OZAA 1D5CA 1TZKA 1TUIA 3D4NA 3FM9A 4J4HA 5HZHA 1M1UA 4KQMA 3Q5DA 2ZE7A 3O03A 2OV2A 2Z5FA 1KYIA 4CF3A 1YQGA 1V47A 4M88A 3EHDA 2H1FA 1IVYA 5DB4A 1QX3A 3CNOA 1EPUA 1UZUA 1RMQA 4YI3A 3SXJA 1HETA 2WJGA 3GEHA 4XA8A 4Y9DA 4FFBB 1NDUA 4X20B 3E9MA 1X15A 3DAHA 4I1VA 2A9PA 3IV7A 2CB0A 4RMNA 3C3EA 1F06A 1ZBQA 2OAGA 4QDXA 1V9SA 4R6WA 2XUAA 2AI2A 2OQVA 4DF3A 3KQOA 3C3YA 1YZFA 2UUCB 4WY5A 4YCMA 3KSAC 1U3TA 3G5TA 4QDKA 1FXSA 3RC2A 4JJEA 1YH3A 2VJBA 3ZE8A 2KPOA 3W2HA 2AJBA 4WN9B 1H23A 2VSQA 3A37A 4HF7A 3VZSA 3ZQJA 4BO8A 1K08A 3INNA 1MO2A 2WF5A 3K0AA 4J2HA 2JLQA 3TUZC 2WT8A 5IT9A 1ML4A 4XPIA 3TFQA 4JLVA 1OJLA 1GQRA 1SIBE 1TAGA 2F7SA 1DXHA 5ALXA 3TLGA 1D04A 1T2FA 3CLHA 5LNK1 4JP3A 4G5RA 4WZZA 2JLWA 4F3CA 2POQX 2QV0A 1Y6JA 5C8DA 4KVAA 3UT6A 2DKOA 1RLIA 1XWIA 4P5EA 1ONSA 4W9NA 1E1YA 1Z7EA 5GM1A 2MWMA 4Z49A 8GPBA 4P7GA 4ZK2A 4JBHA 2YTZA 5JZBA 3NX4A 1ZIYA 4MMXB 1QU3A 3N2KB 4RM3A 2Q5JA 1LS6A 2GZRA 4XQ9A 1KEEA 3ZD6A 1P4JA 1A0OA 3N2NA 3IUSA 3KBBA 3OZCA 1IFXA 2Z1MA 2BV3A 4WLEA 3CMMA 1JR3D 1B0UA 1HFJA 1W59A 2WUVA 4CFSA 5FO0A 1D2HA 5IKOA 3CIFA 1X77A 1T36A 5TJHA 4NFLA 5ADHA 3IBGA 4ZV7A 4HTFB 3EMBA 5FOWA 2C9DA 1E60A 4TQGA 4KPYA 1CQZA 2JATA 2I2BA 5HF9A 5KQMA 4IVRA 1IBMB 3W5HA 3HN2A 3EQ8A 2ZVDA 3Q7QA 3UO8B 3FWZA 5JAIA 1UEXC 1OLXA 5FR1A 2OSVA 2OE2A 4ENVA 5JVDF 4MP3A 2A14A 4YQYA 1H1LA 4BLVA 1K68A 2YHSA 5CXQA 1HQYE 3SZOA 4A5OA 2QZZA 4BUCA 3K8OE 1F1JA 1Y9AA 1DB3A 4INOA 1CY8A 1H1TA 1C0PA 1YQQA 3EVEA 3GC6A 3PYMA 4B3GA 4OUDB 3A3NA 3K6RA 3DZGA 3MMPA 4LX8A 1SC9A 1FYFA 1P2UA 1FYVA 2PYIA 3IMEA 3ZW8A 3C97A 3EZYA 2AHOA 4DCGA 5JTTA 2GF2A 2H7YA 4NE7A 2M2IA 2OK7A 3CKLA 5LIRA 1RWMA 1G98A 4UHEA 1HEYA 1OZGA 2O3JA 4MPTA 4Q4LA 4GVLA 2L0XA 3K1AA 1V11A 4LHZA 1Z0UA 3A1TA 4BGVA 3QNMA 2GESA 2XVYA 1MB3A 4HDCA 3G88A 1X13A 3HJUA 4HNUA 1M67A 1EWYA 1V43A 4GPD1 2MSKA 2ZRQA 3VU3A 1EUCA 1GZ6A 2PO5A 2V6MA 1JFSA 5ILGA 4KYTA 2OAP1 3GJXC 5HKAA 1R6BX 2AJTA 4HBZA 3ADCA 3HACA 2MCFA 1QQ7A 3K0AB 4BZPA 1XAIA 3AEQA 3NTVA 3R7AA 1L7AA 5EJ5A 2CNOA 4I4TF 4A2CA 4TXMA 1OVMA 1E1KA 3B8HA 4XPIB 1E3LA 1Z6TA 3CO5A 5LQNA 3TLGB 1YTUA 2Z2XA 3FG9A 4KMMA 3S70A 1YDMA 4UDNA 4ZTUB 1O0BA 1CRPA 3M1AA 1WXGA 1JU9A 5C37A 2VATA 3RTBA 4YN3A 1FP1D 2YYYA 5CB4B 2C57A 1WXQA 1Z5WA 2HHLA 3A9TA 3JPWA 2VNJA 4G97A 3MFQA 2WIAA 4LY0A 5GP1A 3E22A 3GGSA 1KEEB 2JLCA 1Z6XA 3K9HA 1MIHA 2IYNA 1U8EA 3LT1A 1Y3HA 4ARAA 4ZQGA 1H4SA 2G6TA 4K9LA 4N76A 3ZTTA 4FYXA 3AONB 4EPVA 1T36B 3WQHA 4ZCTA 2O8EA 3IIMA 5IXSA 2JGJA 2PBFA 3A58B 2HV8A 4PFSA 3BD6A 1KY2A 4M9UA 5G3ZA 3D8BA 3EMDA 1UQRA 3QVLA 2LCQA 3QE9Y 3ZWYA 2SBTA 4BKUA 4CF4A 3FCAA 3T52A 3DV9A 1EEXB 3OY7A 1FVFA 4IWXA 4C5CA 2Y1OA 4GR9A 2GPSA 1OLXB 4NPAA 3ACCA 3E7WA 1EH5A 3O75A 3CWZA 1JQ3A 4DZRA 1H1LB 2BHLA 4DY4A 4OYYA 1FPMA 1U7ZA 3PNOA 4JXXA 3E9QA 2YZNA 2L19A 4LF6B 1L3CA 5DTJA 1CSEE 1DRJA 1L6IA 3GJQA 2OYRA 1GG9A 1EXMA 1JN0A 2CNWA 3P0EA 4I66A 2YS7A 5DNCA 1P81A 2YN2A 4KSBA 4UXHA 2H18A 3FF1A 1Z0JA 1Z25A 1M5UA 4G24A 4I5IA 3RSHA 3T5CA 4B6EA 4IH1A 3QXHA 1X8LA 2EDAA 4KVZA 4BV3A 5H9WA 1HO3A 1YZUA 3K1AB 1RLOA 3PXXA 1V11B 3VC1A 2Q6KA 2XEDA 3G2HA 4FMDF 5B2EA 2CC2A 1KRWA 4MA4A 2FZLA 2HCFA 2XRYA 3EDOA 3VC7A 4DBVO 1EUCB 3IBFA 4WIAA 1GCGA 1L9XA 3FGOA 2ZRNA 4I4LA 4YRSA 2NU7A 5C8XA 3X2SA 4ZARA 1U2DA 3TDKA 4AZTA 3CRW1 5F78A 4QBTA 1QTQA 3C70A 4X63A 3KIPA 3O9ZA 3GT0A 2AKEA 2FK8A 2O2ZA 4KNYA 4JT8A 2VYND 2YNMC 4MAFA 1P4AA 3M4JA 4TSFD 1WXEA 3CJQA 2GCEA 3UPTA 4Z4CA 4AIIA 5JNSA 3KALA 3EOZA 1OA0A 3AFIA 4NLLA </