3I92A

Structure of the cytosolic domain of e. coli feob, gppch2p-bound form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
257
Chain Sequence
MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the intrinsic GTPase and GDI activities of FeoB, a prokaryotic transmembrane GTP/GDP-binding protein
rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Ferrous iron transport protein B
total genus 80
structure length 257
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i92A01
1OPXA 4W7SA 1X8JA 3I8SA 2OEPA 1XMJA 3AF2A 2B21A 5KDDA 1Z2AA 3LXRA 4BLSA 1UM8A 4HB0A 2UVQA 3KTAA 4Z8YA 3THOA 3O8BA 1O87A 4UNNA 1FL9A 2ZJAA 1W36D 2PBRA 3U44A 1X1SA 4P4SB 1OB5A 1NBMD 2VF8A 2L0XA 2OLKA 2VTKA 1NF3A 4Q1EA 2FZ4A 2HV8A 1NIPA 2OCPA 3PUXA 4GZMA 4KITB 3P4YA 1M34E 1W47A 3AGQA 1ZD1A 1NVXQ 3NIBA 1KDTA 1DARA 4BZXA 4TMTA 2ZS8A 4C2UA 4IHQA 1V5WA 5JECA 4O3MA 2XSZA 4E09A 1OXSC 2C04A 2ZI6A 2QGZA 1NSFA 1G7SA 3LNCA 2BEJA 5H68A 1N0WA 4W5WA 2BKEA 4OHZA 1L8QA 3LY5A 2RCNA 4NL4H 2FSHA 1PLJA 2C5LA 5LD2C 3BRWD 3THWB 3CH4B 3KFXA 4Q21A 2CBZA 4ZDWA 1CR0A 1PLLA 2JLSA 4G3XA 4LV8B 1MABA 5TB5A 2NO1A 3CUEF 4LY6A 3DM5A 2G1JA 3RAPR 1DBSA 4TLCA 5FTNA 1E32A 1GILA 2IYLD 2DHRA 3ZH9B 1RYFA 1DPFA 1LVGA 1XNJA 2ZQ5A 2W00A 4JL6A 1XCGB 3ASZA 2NO7A 2VEDA 2BJWA 2PMKA 2R6AA 2VH5R 3A37A 4DVGA 4HUTA 2HUPA 3R7WB 4LRWA 2ANCA 2ZYVX 4PQFA 2F7SA 5EXPA 5AUNB 1XMVA 1OH6A 5DN6D 4B71A 1CR4A 3PR1A 4CW7A 2JLRA 1JR6A 3IEVA 4OHWA 1M1YE 4LJ5A 5TV2A 5CB6A 3MWYW 4D0GA 1FMLA 1E2GA 1DVRA 1Z0AA 4UXHA 5ANRB 3P32A 4KCGA 4C0HA 1A1VA 2PT7A 1UPTA 2FEOA 4QJ3A 2R62A 3HPQA 1T3HA 2V6JA 2AFIE 5IDVA 3GJ0A 2RGXA 2YWFA 2DYKA 3CNNA 2BHRA 3P26A 1VIYA 3ZLJA 2HLDA 4LHVA 1XPUA 2IS1A 3IDQA 3SBEA 4F4JA 5KOYA 1M7HA 2BJVA 2IF0A 3ZD7A 1GP2A 4C0SA 4TL9A 1A2KC 2VHTA 4PZZA 2J7PA 4TL8A 4KYIB 2OBMA 4QBIA 5FFMA 4D80A 4LX0A 3U60B 2HF9A 1HT2E 4PFSA 5JS8A 3BB4A 4LJ9A 1OHHA 3WMEA 2CCJA 3RVBA 4BECA 3CRW1 4E22A 3IUYA 1M74A 1ZIPA 4BRWA 4E03A 2IEZA 4MRRA 1E0SA 1ZVQA 2DR3A 1U0HC 4L5BA 3HR7A 4YMWA 1E6CA 3I92A 1KKLA 5F98A 4BLQA 3BK7A 4IXMA 2QP4A 2QSYA 4DLTA 3CZPA 3QKUA 1KHTA 2OHFA 5BYKA 3THYA 2ONKA 1J8YF 4EPTA 5KDOA 2H57A 1TEVA 3VKHA 2ZRPA 4OHXA 1WBDA 3LO5A 1KY2A 4D4KA 3ZZ0A 3TQCA 4NYJR 1OB2A 1HY3A 1Q1ZA 4EPWA 2IUTA 1J2JA 2WPDA 3VR4A 3KJEA 4BE7B 5DSZA 2QEQA 4HLCA 1KNQA 2IYUA 4YLGA 3FKQA 3K8YA 1GTVA 4PO8A 5EUQB 3RHFA 1IY1A 4ZKDA 1B0UA 2FJUA 1UAAA 1E98A 3EWAA 1CRQA 4IVRA 1FNMA 1NN0A 2D2FA 4GNKA 2QM8A 4A8JA 2WV9A 4A0HA 1XD2B 2YWHA 4JLDA 2WWIA 1GITA 1SKYB 2FGKA 3OFNA 3FYHA 2DPXA 3KJGA 3NH6A 3PEUA 1XEXA 4OBEA 4ZI3A 1UEIA 4Q4HA 1SXJA 2DWQA 1GKUB 2MMGA 2ZJOA 3D31A 3RABA 1YZKA 1Z6XA 4EQ6B 1AQYA 1A2BA 1E1QD 3QE0A 4W9MC 1XD9A 4QGFA 3UIEA 4D0LB 2QORA 4KHZA 1S1MA 1EFUA 3Q7QA 1RJ9A 2WVJA 2HDNB 4HB3A 3KDSE 2BBWA 1MT0A 1Z0FA 1GUAA 2YOFA 1SULA 1Z6GA 5J4KA 4A15A 2RH5A 1GSIA 1U2RA 2NQ2C 1YZQA 2VHUA 1XTRA 1TPZA 2FMXA 3LX8A 1NJGA 2JJ2D 4A9AA 3PUVA 1OKKA 3KX2A 4QM7A 4DSTA 3BH6A 2AD1A 1JAHA 4MA4A 3PVSA 1Q1QA 3QEOA 3TR0A 4TZ0A 1TUIA 1UDWA 1CS4C 1ZM2A 2HJVA 3BFVA 2CVFA 2WWGA 1MO5A 2ZRAA 2D7DA 1GRNA 4JJKA 2YC2C 4QC2A 1HE1C 3BJIC 5AUQA 3ZVRA 2JJ1D 5L3VA 3I5YA 4PHHA 4OJKA 3I62A 2C98A 4TMVA 4ZKEA 1XTQA 3TAUA 5KYKA 2CLSA 2Q3HA 3KQKA 1Q1BA 5HE9A 3ZZTA 3QPWA 4BGDA 4PSVA 1TQ4A 3KXKA 4R2IA 4LJAA 1Q0UA 1NKSA 5ELXA 4V03A 5FPTA 3B5JA 1OIVA 2C03A 3GQBA 4GMDA 4P4TA 2YVUA 3QQ5A 1KZGB 3SHWA 2RHMA 1E0AA 3BS4A 4JVLA 4AKIA 4JL8A 3OEED 4TZ6A 4OKSA 5TXGA 3U2QA 1F2TB 1ZM9A 4Q4AA 4TYWA 3Q9LA 5JBQA 4AYXA 1SHKA 1OV4A 5DYGA 3QIAA 4V0NA 2QENA 4BEBA 2VP6A 4LJ8A 5CDFA 4LI0A 3NTUA 4S35A 3NDPA 5DN6A 3MWJA 4CT4B 3EARA 4B76A 2PZFA 4G5OA 4L9WA 1KAGA 3OEHD 3ZQJA 1R5NA 4JLAA 1ZNYA 1AGRA 3GLHE 2YOGA 2H16A 1B23P 6Q21A 4NPHA 4B73A 1ZRHA 5BXQC 5FL3A 4B6EA 5EE9A 1N6KA 1P2SA 3VR5A 1ZNWA 5JLJA 1LNZA 4ON9A 1BMFA 3B13B 1FOEB 3I4LA 3W34A 4JKYA 1T5IA 4DLXA 5JWOA 2A5DA 1OF1A 3FGNA 1UBGA 3W8RA 3NHBA 4RD1A 1PLKA 2HCJB 3MWLA 2C8VA 3C4JA 4YONB 2F1IA 1XEXB 5DIFA 1JR3D 1TF2A 1YZLA 1KJZA 1NVUQ 3LQRA 1CU1A 1S9DA 2IHBA 3AV0B 2UKDA 4QNRA 4QXAA 5CYOA 3ZJYA 4DWJA 3K0SA 4AYTA 3T1QA 2AXPA 4JVSB 4XH9B 3PUZA 3FKSA 1Q20A 3VKWA 3AF0A 2HXYA 2GWHA 1XP8A 2XZLA 1Z0JA 3AP1A 3NC0C 3T5DA 3W90A 2RKOA 4JLVA 4RVCA 1DAMA 1T9HA 3A1WA 3A4MA 2IF2A 4CEIB 2J7PD 4OK6A 4DCTA 1ZD9A 2CNWD 2QAGA 3PCRB 1GL6A 3KKMA 1CJKC 3CPHA 1OHHD 3T61A 1ZM4A 3AKYA 5IHPA 2ZI9A 3KKOA 4EJSC 4ASUA 5E3HA 1G8HA 4S2EA 5FTJA 4JBWA 1WQ1R 3B6EA 4OHVA 5KNDA 3NDBB 4LPSA 4Z1MD 4B75A 1SXJE 1PV4A 2GZAA 2O8BB 4HUQA 1ZW6A 5SZHB 2QNRA 3TIFA 2OXCA 4OJQA 1SVWA 3OESA 5FBVB 4ZIRB 2ZRNA 4CEJB 3QPUA 3NC1C 3X2SA 5KTYA 4Z54A 3VQTA 3GFPA 2J0QA 3VNVA 5KPDA 4BLPA 2FPKA 4NBSA 3TE6A 4MYUA 2DY1A 4TMWA 3CX7A 2NG1A 4CT5A 2ATXA 2QBYB 1T4GA 1SVOA 1QHHA 3U7HB 3CONA 5GVRA 5DHFA 2W6JD 1DAEA 1G3UA 2XITA 2YKGA 4RD3A 5TMPA 1TU4A 4A1FA 3LH5A 1A5TA 4TYPA 4PPQA 4B3CA 3GJXC 2YOHA 4YXWA 4ABYA 3HYTA 1AM4D 5C4MA 1JAIA 4FCTA 3K70C 4L15A 2QL6A 4UJ3A 4DUGD 1QHSA 4D2IA 3U3OA 2Z4RA 4M8NE 3TAHA 4ZDKA 3LW8A 4F4IA 4HDCA 2JLWA 4BLRA 3THWA 4IDOA 1ZUIA 2HCBA 4U7DA 4NCNA 1E3MA 3W5JA 5J4LA 4HDQB 3PENA 4N1AA 3GLFB 4Q1DA 4BFSA 2GKSA 4ASUD 2XZOA 4WBSA 3CX6A 2FNAA 1N6NA 2ZI3A 2FWRA 5CIWA 1VYUA 5FR1A 4PTLA 5B2ZA 4RD4A 1XJQA 4HLDA 5EP1A 2FV8A 1FP6A 3SC3A 2CXXA 2ZSEA 3ICQB 4A92A 2X77A 2CJWB 3WMFA 5FR2A 1Z6TA 4OK5A 5C4GB 5K8TA 2JLVA 3CKLA 1N6OA 2XX3A 4CDGA 2A5YB 4ESVA 1ZCBA 4HSEA 2J5XA 4DLUA 4ACAA 1GKYA 2RMKA 1OJLA 3HPRA 1HYQA 2QI9C 3B1VA 2FG5A 3EIHA 5BQ5A 3O8CA 3FHOA 1J99A 4V0OA 3DM9B 5CJPA 5LB4A 2ZRKA 4QNMA 4UNRA 2ZU6A 5JFGA 2QPTA 2WJGA 3IQWA 4CRWB 2NOAA 1HUQA 2HJGA 4OL0A 3CNLA 5FUVA 2H8KA 2GTPA 2R8RA 4ESHA 2ZRBA 3LAWA 2IXFA 1SVSA 2OSBA 1YR6A 2RGNC 2BM0A 3KKQA 4Q7KA 4OYHA 2WAYA 2KSQA 5BW8A 1EX7A 3DPUA 3K9LA 2YZ2A 1NN5A 5E7JA 3E70C 3B1ZA 1XXHA 2VLIA 2ORIA 2A2ZA 3T1OA 3UPUA 4PSKA 1GKIA 3JVVA 3GLIA 1FPMA 2QU8A 1IHUA 2CK3A 1FX0A 1ZJ6A 2DFNA 2RGAA 2ZM5A 4G1UC 3WY9A 3G5UA 2ODWA 3D6TB 4WAUA 4RFSB 4O2RA 1N5LA 2F1JA 1JR3A 1ONBA 4IJMA 3CH5A 4TN1A 3O8RA 3SQXA 2ZI5A 2O0JA 1JECA 3RS2A 1BKDR 3BB1A 4RZXA 1Z08A 3KUDA 4TTPA 2G6BA 4XVRA 2BWJA 3KTAB 1UF9A 2QAGC 3BWDD 4AG5A 1Z22A 2I1VB 1Q12A 4BWYA 3I32A 4KBGA 4Q5IA 3ADDA 2GILA 2QT0A 2QQ0A 4B43A 1VECA 4W5HA 4MGYR 1XTIA 3DKVA 3CB4A 1GVNB 5E4FA 3WP1B 1AZSC 4QKQA 5FOXA 1SVIA 4AY2A 4HAYA 3EASA 1JXOA 2GCOA 2WZQA 1LY1A 3IO5A 4QJ4A 2ZROA 1P4SA 2VA8A 2QMEA 2P5TB 5E7IA 4HI0E 1KI6A 3KKNA 3OIWA 4HDOB 4KBFA 1E9AA 1AKYA 1JNYA 1R7RA 4C30A 3PV0A 4AD8A 3ZS9A 2VF7A 1ZNZA 4AYWA 2V1XA 4Q4HB 4M1OA 4Z8XA 3RANA 1Z07A 5DE3A 1G64A 4RD0A 2OAQ1 3N2EA 1VCMA 3UXMA 5A0FA 2B8TA 1G1MA 3UATA 3ZIAA 3BC1A 1R0XA 3H1TA 1LF5A 5J4YA 1WA5A 3X1XA 2GJKA 4KODA 1JPNA 2BOVA 4A2WA 5TDHA 2OO7A 1KJWA 1OH7A 1W1WA 1Z0KA 2F3RA 5CITA 1E79A 1ZU5A 4FCWA 1Z3IX 5HTKA 1Q44A 3ZZUA 1GNPA 3BGWA 3UWOA 1XTSA 2VSFA 3T35A 1Z63A 1N0VC 2REXB 3N70A 4F38A 4UXJA 1HURA 2H5EA 4H9GA 1XD8A 2FF7A 2J41A 2HEIA 1UKZA 1ZC3A 2ZE5A 2ZJZA 1BYIA 1W4AA 2ZPTX 1E2EA 3U7FB 2FFAA 5FOTA 5HCNA 2QM7A 4Q1BA 2XZPA 4JLNA 1GNRA 4XJXA 5FPYA 5AJXA 2BKUA 2HF8A 4MKHA 2ZR9A 4JLKA 2QG6A 3EA0A 3QI2A 3WRXC 2GBLA 4XSGA 5G3ZA 4KFRA 3K09A 1M8PA 3NBFA 1J8MF 1U99A 4D26A 4D81A 2Q0HA 1UBEA 3QF7A 3FKSD 4PZLA 3OHMA 4PX9A 4RSGA 2XB2A 1TQDA 1E2QA 1YJ5A 2F55A 3L0OA 2OCAA 1IJEA 1FX0B 3CPJB 5DGXA 2OXRA 1CKEA 4MKGA 4MDEA 4B32A 3NEYA 1QHIA 4DT1B 4URXR 4UXIA 2RGCA 3AVQA 1VIAA 1UADA 1JJ7A 3NVAA 5KU1A 1YHNA 1R0WA 3E1SA 4ZDJA 2YYZA 1IN8A 2A5JA 4O2LA 3X1DA 5JWRA 2JLYA 1P3JA 3GEEA 3EX7C 2CEAA 221PA 4NZYA 1HQCA 1NP6A 2FPMA 3TW4A 3AQ4A 1U94A 3K53A 1IN7A 3Q7PA 4ZPXA 2EVWX 2YNMA 1XXHE 3EPHA 2OBLA 1Q1EA 1E0JA 4AK9A 2ECKA 3OF5A 4DEYA 2QQEA 2REBA 4IRUB 1EFCA 4EPVA 1XZQA 5BN5A 1E9SA 4DB2A 4HAUA 1NIJA 4TWZA 4LHXA 5JZVA 4LSGA 3TBKA 3MD0A 1U0LA 1E2IA 1CIPA 2ODEA 1FUUA 2J9RA 4OQMA 3U7EB 2AK3A 2FU5C 4M9QA 1ZAKA 3VHXA 4B35A 1R6BX 2FX3A 1QHXA 1TF7A 1F48A 1WDTA 2B7CA 2GA8A 3B78A 1CF4A 2WJIA 2EYUA 3AUYA 4A8JB 2C9CA 3SJBA 4GP6A 2P6UA 4PAMA 2IYSA 4Q9IA 1O3YA 2WOJA 4RZUA 1IJFA 4AIIA 3OAAD 4WW0A 3X1ZA 2JCSA 3PXGA 1AZTA 2CE2X 5CLLA 4UKDA 4IW3B 4DXAA 5IT5A 4GI7A 1XDBA 1RYHA 4BFVA 1T8TA 1DAHA 1GL7A 3NG1A 4D0NA 1G5PA 5TY0A 3QPVA 1GAJA 1NY6A 4EJSB 5J4HA 4L4UA 3G0HA 4QG7A 1KIMA 1UKYA 3TR5A 1V43A 2J59A 2G9NA 3U6BA 3V4FA 4Q47A 4AKHA 3LDAA 4QBFA 2GJSA 1SVLA 2R2AA 3FTQA 2WWHA 3QENA 2HT6A 3KL4A 3WHKA 1KI3A 4XWKA 4KFSA 4IDQA 5EZ5A 2Z4SA 4YQFA 4Q4JA 2ZI4A 5TARA 2VL7A 3L2OB 1VMAA 5FOSA 4ZDIA 3RRMA 3CIOA 3R20A 3AVXA 1G8PA 2J87A 3PEWA 1TL7C 3RS3A 621PA 4Q48A 1CLUA 2OE2A 3Q85A 4KV9A 1D9ZA 1G9XA 1J90A 3QKRB 1EESA 1E9RA 2O8CA 1R0ZA 2ZR7A 1E4VA 1U8ZA 1P62B 1EFRD 1FQKA 1N3BA 4PAOA 1E2LA 1XXHB 3TH5A 1KI9A 2IYVA 4Q7MB 1WP9A 3F3YA 1W2GA 2ZUBA 1J70A 3UMSA 2CVHA 3B1YA 2XAUA 3TNFA 1H8ED 2WWFA 4CGZA 3W6NA 4I99A 2GXSA 2J7KA 1KKMA 1U9IA 3EC2A 4KVGA 4YC7A 1XTKA 3K0AA 2KBFA 2B8WA 3JVUA 3GMTA 2JLQA 4DHEA 2O8EB 4ZI2A 3CF6R 1XMSA 2XNDA 2ZI7A 2NZ8A 3L8YA 3F8TA 5D3MB 1GNQA 1EXMA 4BRUA 2EW1A 2QPOA 3L0IB 3SJZA 1CJMA 4R98A 5SZIA 2A7QA 4HZIA 2BV3A 3ASYA 3KQNA 4Q02A 4TTQA 2G83A 3SZRA 4M53A 1TMKA 4NYMR 2D3WA 1JJVA 3K0CA 3QXCA 5AUOB 2G88A 5B58C 3GJ8A 3LVQE 1P5ZB 4BZPA 3W6OA 1S4QA 1JEEA 2ZE7A 4FMDB 4C0AC 4BPBA 4O25A 4Q1FA 4D82A 4QGAA 4MRVA 1KI6B 2G1KA 5AUPB 3AVUA 1XPOA 1MABB 1NG1A 4US2R 2IHYA 3DOFA 1E2MA 2V9PA 3AEZA 1XCPA 4NYIR 2WWYA 2ZJYA 2V4ZA 1YE8A 2WMNB 4NDZA 5JJKA 5K8UA 5KNCA 1G7RA 1CR1A 1YR9A 3WMGA 1CXZA 2PEYA 3DOEA 3QXXA 3GFOA 3NKVA 4PO1A 3GJ5A 1G6HA 1YRBA 3GJ4A 2IYZA 5FTMA 2GXUA 2FFHA 2UZIR 3LA6A 4QGHA 2QMOA 2REOA 1T6NA 3IIMA 2XGJA 5DH9A 1Y63A 2F9MA 4I1SA 3NEJA 4UJ5A 1ZP6A 1W44A 1BOFA 2QE7A 3K9GA 1KI7A 4PHTA 3EIQA 2PL3A 2LKDA 2QZ4A 1DAFA 3EPKA 2ZVQX 1E94E 1SZPA 5FH9A 2V8OA 1MV5A 2WKQA 4URZR 3RRNA 5SZKB 2E87A 1PJRA 2VRWA 1S3GA 3KQUA 4QM6A 1AGPA 1XJ0A 1KO1A 5GJVC 2FGJA 5J5CA 721PA 2XJ4A 3PUYA 1GL9B 3CF2A 4URYR 2PCLA 5FL7A 3NXSA 3FMOB 1KSFX 4MRPA 2Q9CA 4LHZA 1GFIA 4KU4A 2F43B 4ERNA 1CTQA 1LTQA 2RHDA 1ESNA 1HE8B 1L4UA 2F1RA 4WA7A 2XOKA 1KK0A 3OE7D 1EX6A 4JZKA 4GZLA 4Q9KA 3LBNA 3QKSB 3R8FA 3UMRA 3X1YA 4CVNA 1DE0A 1ZYUA 3QF4B 2E9SA 4A82A 4GP7A 5JJLA 4Q9LA 3X1WA 1VCNA 3REGA 4R71A 4B33A 5JSZA 2ZS7A 2W0SA 4C4PA 5LBIA 3RC3A 2GXQA 2QP3A 3SYLA 8OHMA 3MLEA 3SDZA 4NMMA 1EGAA 5D3MA 2W83A 2QSZA 2H17A 4EFLA 1JI0A 1TQ2A 1YZTA 4FMCF 4TLDA 5AR1A 3FDIA 1VDZA 2Q3FA 5EE5B 2BCJQ 3WBJA 4QHYA 5FBLB 1COWD 2IS4A 4ZO4A 2EWVA 3MFYA 2GZDA 4P32A 3UKDA 1W0JA 3LBIA 1R5OA 4PPNA 2W2VA 3ZS8A 5AJZA 4LYFA 4V0ME 4M9XA 1XJCA 3A4NA 2IWHA 2WWWA 2ANBA 4DZZA 2AR7A 1Q3HA 4ZCLA 2BC9A 4MUBA 3MCAA 4D4JA 3U7GA 3JZAA 3NBZC 4GPTA 4MITA 3I1FA 1CULC 4PC3A 4RZ3A 3HWSA 4GMXA 1Z28A 3BD9A 5CK4A 2Q9AA 3Q3JB 2IYTA 5FTKA 2MSCB 3SJCA 4V02A 1RW4A 2DFKB 3TLXA 2O8DA 1N5JA 3BH0A 1RRCA 4B34A 2HYDA 2QN6A 2W2TA 1KO8A 1GRQA 3EAQA 1HV8A 4UNPA 4X8MA 1ESMA 5FL7D 5B30A 2V55B 3GJ6A 2HXSA 3U4QA 1OLOA 2R65A 3KB1A 4UNQA 3KXLA 2PMDA 1II8B 1MRNA 2QUZA 4JVNA 3GEHA 3FWYA 3EG5A 3RC8A 4KLNA 1E2FA 1M7GA 1KK1A 4P31A 4OI0A 5CLQA 4B3DA 1XU4A 1FTSA 2J0UA 2GEDA 5JI3E 1R4AA 2AK2A 1N0UA 1W49A 1R0YA 2BDTA 2WPDD 3WP0A 5L3SB 1L2TA 1W0KD 4HEJA 1I2DA 2V54A 4R2HA 3CRRA 3CWZA 2JA1A 1SVMA 2MSDB 5IK2A 2F6RA 2OZEA 1BS1A 1RZ3A 3LBHA 4EKDA 2V1UA 2IS6A 3CLVA 3L43A 4XD7A 3WNCA 2F1HA 2ZETA 5BN4A 4MKFA 3QXHA 4X8HA 4OQLA 3ZIAD 1XWIA 1LS6A 4G0NA 1G41A 3LWNA 4GL2A 4D4LA 4QBHA 2TMKA 1OIXA 1EG7A 2IYWA 5EZ6B 3FOZA 2BMFA 2GJ8A 2JEOA 1XPRA 3C15C 2ZYUX 2IYRA 2ZRGA 1E99A 4LOAA 3WNBA 4DUGA 1JR3E 5JSZB 4B2PA 2BVNA 1H65A 4HLQB 1F3OA 5JHHB 1MO6A 1UBCA 3CPEA 3FB4A 3TUIC 2X2FA 3L82B 3BH7A 1Z06A 3AP3A 4QGGA 4LWZA 4KXFB 1W5TA 3DO6A 4YMTA 3IBYA 1Z0DA 4FCVA 1P61B 1N5IA 3RWOA 2DFTA 1N6RA 3FPAA 3I3SR 3DDCA 2RGGA 4URWR 1KY3A 4MKIA 4II7A 4PQYA 4DSUA 3K1JA 4DSOA 2YHSA 3LLUA 4DCUA 2VQSA 3AVTA 2QA5A 2I1QA 4DCNA 4A6PA 1ZUHA 1IY2A 2GDJA 4A2PA 3AKEA 3SQWA 4D25A 3QKTA 1OKKD 3U61B 2ORWA 1N6IA 3CW2A 2P67A 4MRSA 4DDUA 1P9WA 1KOFA 4I4LA 4IVPA 5F2EA 4CEHA 3KXIA 2JLUA 1F60A 1LW7A 1OXVA 1SQ5A 2D2EA 3GJ3A 4NCKA 1U8AA 1OFHA 3EIEA 2NPIA 4CIDA 4Q03A 2FSGA 1P72A 1KTVA 4M22A 4F4CA 4XTRA 2XB4A 3AKCA 2O8DB 2NIPA 1FMJA 1II9A 1ZM7A 2IA5A 3IHWA 1P75A 1JQLB 4XSHA 4AKEA 3BBPA 4IOMA 2WJHA 2WBLC 2VHCA 1AKEA 4XWAA 5LD2B 1OFUX 4IFEA 4I1OA 1EFRA 2WSMA 4JLBA 5C2JB 3QSYA 4OI1A 5UKDA 4DKXA 4M1KA 2IW3A 3M4YA 3D7MA 3LVRE 4HB2A 1A82A 2IBMA 1CJVC 4IFBA 4XTCS 1Z0IA 2BMJA 2X19A 2IYQA 3QBVA 4BFYA 2QTVB 2ZJ2A 2OBNA 1W2HA 2P5SA 4LYHA 4YMSA 2FSIA 1F6BA 2GHIA 2JGNA 1ZCAA 2YWGA 4US1R 4LDJA 3ZVLA 1NN3A 2BEKA 3GFTA 1FW6A 5FUWA 1SXJB 3QBTA 3QKRA 2XTZA 3TVDA 4PC1A 4TSFA 1ZINA 3SS8A 4MYHA 2Q6TA 1COWA 1BH2A 2AXNA 1U90A 4JVMA 2FPLA 2WJVA 1TF5A 1W0JD 2KWIA 2DWPA 3EXAA 4WVFA 1KMQA 5G40A 5JRZA 3I61A 2XXAB 4ZV4A 1VHTA 2WAXA 2YWEA 1E9FA 4C7OB 2IC5A 4NTZA 5CJ2A 3FMPB 5A4JA 1AN0A 4LCBA 4DDTA 4BEJA 1KDOA 1NMXA 2R6DA 1JXMA 5L3QA 4FI3C 2DBYA 4TQ9A 5GADl 1T91A 1XZPA 3RSLA 1E1QA 1E9DA 1U0JA 4F92B 1Z5ZA 4Y0VA 5M04A 3I5XA 4JIMA 1KYIA 3AP2A 1G8GA 5FPSA 5AWFC 4AI6A 2FSFA 1GIAA 2A30A 3BORA 2H7VA 1LV7A 4K46A 4PXAA 4URVR 2AX4A 1SKYE 1G7CA 2C99A 3C5HA 3QVUA 3GLHA 3OIUA 4P4SA 4EPXA 1D2EA 4GBMA 2FEMA 1ANKA 5EP3A 1G5RA 1SKQA 1W4CA 2VHJA 4DT1A 3AVVA 1CP2A 1KSHA 3VR6A 3VR3A 4ITRC 1GDDA 3OZXA 2FZLA 3FHCB 4AG6A 1UEJA 3IKJA 3PJRA 4BASA 1D6JA 4JT4A 5FBWB 2AWNA 4GRAA 5EXTA 2NMVA 1S0UA 3RRZA 4CEHB 1N6LA 2XOKD 1ZUNB 2IK8A 1E79D 1US8A 2O8FB 4PPFA 3AB3A 3P4XA 3RNLA 2GK7A 4WXPA 1YRAA 2XJ9A 1QG4A 4O0MA 1RRFA 4V0LA 1NSTA 5FPKA 1MOZA 4U5XA 5KO2A 2OFWA 2Y8EA 5FUYA 5GVSA 1RKBA 2CDNA 3SYKA 3OIYA 3TSZA 2JLZA 3PUWA 2BM1A 3H84A 5JCZA 5AJWA 1SHZA 2OM2A 2JDID 3H4MA 1DTSA 1C1YA 4TYYA 1L4YA 1Z83A 4F91B 2ERYA 3IGFA 2GVZC 2F3TA 3K0FA 4PHGA 3OE7A 4BLOA 4EUNA 4JYBA 1IM2A 1P9RA 4XVQA 1PVOA 2OFXA 2BBSA 2FOLA 1KO7A 3GLIE 3QUSA 3CM0A 3D8BA 2ZYTX 3L0PA 2EFCB 4ILEA 3EZ2A 1KSGA 3RWMB 2JASA 4EJSA 1XX6A 2JIZD 2WJYA 2IXEA 3AVPA 3L0SA 1GG2A 1TAGA 5SZJA 1FTNA 2IYYA 4IEEA 2BIFA 2J3EA 2CK3D 2IXGA 4RKFA 4FIDA 4DLWA 4JL5A 1KI8A 4AC9A 3KQHA 4B2IA 2F43A 2YC4C 4Q66C 1G3QA 1NLFA 1OE0A 1YR8A 2XXAA 1CEEA 2O52A 4NCJA 1VG9B 2BBOA 4E07A 1JQJC 1XMIA 3ADCA 1FFHA 1M7BA 3RS4A 4A8JC 4E5UA 4UNSA 1PUJA 1VG8A 2ZU0C 3RS0A 4DLYA 1ZMXA 3KZ1E 4LC0A 1TX4B 3C16C 4EFNA 4MYCA 1OXTA 2YV5A 3WRYC 3N2IA 2Q21A 4LZZA 1P73A 4CEJA 2GEVA 4GSYA 4KFTA 1G20E 4Q4JB 2ZRJA 4MGZR 1G6OA 4LK2A 4B74A 3U3JA 5EE3A 4PR0A 1G7TA 1FZQA 4Q7LA 2O8CB 3K0AB 1QVRA 1YR7A 1XEWX 2A9KA 3AVYA 4QHSA 1Q21A 3GD7A 2EU8A 1IBRA 4M1SA 5JJIA 4P4UA 1CBUA 4HATA 4GT1A 1GZSA 4RKEA 4NHOA 1CR2A 3FMIA 2YJTD 2R6CA 3W3AA 3U3KA 2ZSBA 3A58B 1E69A 2BCGY 3TSOA 1NL3A 1R8SA 4P3YA 4BUJA 2O8FA 2V7QA 2XNSA 1SXJD 1Q57A 1G18A 2ZRLA 3CZQA 1W0KA 2ERXA 4OI2A 1G5TA 2BMDA 4RY2A 4DB4A 1VKJA 3MGCA 5JCPA 4EDHA 5G41A 1QDEA 2CHVA 3AVWA 5IK2D 5FTLA 2GBLC 3A36A 1ZU4A 2RGBA 1RC8A 121PA 1VPLA 3EZ6A 4OQXA 1MO3A 2CHQA 4G5RA 4WIAA 4P0TA 2VSOA 5C1BA 3BAFA 4YDHB 1QF9A 3W9YA 3U44B 4W5JA 3GJ7A 1WMSA 1DELA 3MG9A 1ELOA 3RLFA 3EZ7A 1RVDA 3TRFA 2OLJA 1UJ2A 2ZRMA 1G3IA 2D7CA 1T3LA 2G0TA 4EQ6A 3TUZC 3B9QA 4PO9A 3VR1A 5JEDA 4B6FA 1IQPA 1XF9A 1VCIA 1LFDB 1Q3TA 3P27A 5CM8B 1ODFA 1WE2A 3R8CA 4A0RA 1WBBA 2KBEA 1YVDA 4YDSA 1YZUA 3CBQA 1EK0A 4MYTA 1NBMA 4Q4LA 1H8HA 4M4SA 2EFHB 4DIDA 1Z6AA 3R9IA 1AK2A 1T0HB 2PH1A 1E4YA 4L16A 2X8AA 3KKPA 2CHGA 3B7GA 2OCBA 3M1IA 2XTMA 4KO8A 1VTKA 4RD2A 1RRGA 5EXXA 3IO3A 1GOTA 4A0FA 4BZQA 5F3WB 5CIQA 1NMZA 4EAQA 4JT2A 2VSXA 1M2OB 2PX0A 3QVVA 4EPYA 3RSOA 3A1UA 3ZQ6A 4PQRA 4H1VA 5GJBA 3BIFA 3QG1A 4DLSA 3EPJA 1WB9A 3UG6A 5DHAA 3CRQA 1X1RA 1TNDA 2D62A 3ADKA 1C4OA 5H1YA 4WZAE 3T15A 821PA 3B85A 1A7JA 3IQXA 5G3YA 5EUMA 2C9YA 1ZBDA 4I1UA 4U02A 5B57C 2R9VA 3MMPA 3V00A 4A4DA 4NCIA 3AF1A 3Q5EA 2C96A 3QOFA 5K8IA 1OYYA 2AKYA 2J46A 3W5IA 4B3XA 2WWXA 3DHWC 1PUIA 4FXPA 3SNHA 3CR8A 2GCPA 1R10A 1G16A 2VHQA 2DWOA 2H18A 2IT1A 1E2PA 3U3RA 3Q8XB 2PT5A 4C0KA 5FBQB 1OIWA 3QNUA 2JDIA 2ZAOA 5HKKD 1IY0A 2ZVPX 2KI5A 1T8UA 4C3ZA 4ACBA 3CO5A 3PG5A 2QGNA 5HE8A 1DADA 2YINC 2JATA 2PZGA 3VMFA 1SXJC 4XD7D 1G4UR 2QMUA 3PQCA 1SGWA 3P1JA 1D5CA 5J47A 3R9XA 5F9HA 4TYQA 1P9NA 2WJJA 1NJFA 3DL0A 5KHOC 1IXRC 1OXUA 4PC2A 4Q19A 2PJZA 521PA 5KSZA 2C95A 4AKGA 1XFAA 4IDNA 1AA9A 4FWIB 3TJZA 4NKRA 1Y3AA 1IN6A 4HAZA 4C0JA 1VYVA 1KK2A 4DC9A 4M0LA 5KSYA 1G17A 3B9PA 1U98A 3TSWA 1US8B 2ODNA 1TEXA 4WXRA 1AQUA 4NH0A 3THYB 2PJRA 5CYPA 1VG0B 2K5UA 2NZJA 4FMCB 4BFTA 2OUKA 3IBGA 3EZ9A 1OW3B 4RD6A 2KB0A 3FFAA 4C0LA 1NRJB 2JJ8A 4Z51A 4RZ2A 1AS0A 2D06A 3J81k 2EFEB 4NYJQ 2Z6VA 4TQUS 1FNNA 4Z1MA 1NKTA 4NYMQ 1KI4A 4JSYA 4TL6A 3NHAA 4N0DA 3OEEA 2CLDX 1NI3A 3T34A 4GDFA 5EP4A 4JJZA 4CYMA 2KJQA 1D2NA 4V0KA 3T06B 4HAVA 3U4QB 3EWSA 1UBFA 2D74A 3QXJA 3RS7A 4RFVA 3ZYCA 4XVUA 1W36C 1I4LD 3E2IA 5H8WA 2OT3B 3T1TA 2WIAA 2IX3A 2J0UB 1RPZA 4MGKR 3AM1A 4PPGA 3KFVA 3ZVNA 3LLMA 5JWHA 5IF9A 2QTFA 1KO4A 5A5GA 3LV8A 2VP9A 5EE1A 4D6PA 5JRJA 2FFBA 4TLEA 2ZITA 3ZGXA 1Z2CA 4PANA 2GETA 2ATVA 2LCFA 4LJYA 5K8LA 4M21A 1QHHB 3F0TA 5HZKA 1WCV1 1KMHB 3U3MA 3VU9B 3TUJC 3LXXA 4ZIRA 3GPLA 3WBKA 1E9EA 4IDHA 2ZXUA 2KE5A 4OQFA 2I4IA 4BLTA 4MRNA 5JHGB 2ZE8A 5FPHA 1K6MA 4QJ5A 4JMPA 1YZGA 1BMFD 3IPXA 1FUKA 1WF3A 4OHYA 1S8FA 2H92A 4DLVA 4LYJA 4D4MA 1E1RA 4FMBB 4Q00A 4P33A 1R2QA 1W5SA 1BYUA 5FUXA 4K8OA 2A3RA 3PIRA 4BQSA 2MMCA 4I81A 3PFIA 4IVQA 5CB8A 5LPNA 3Q72A 1P7CA 2SHKA 5JS7A 4I1VA 3EA5A 3RYTC 3SHFA 4LBYA 4Q01A 4GOJA 1AS3A 4A2QA 5LDDC 3CX8A 3V4RA 2P6NA 3AUXA 3GLFA 2D4HA 1X8LA 3TVTA 1BIFA 2CE7A 3LX5A 3AF3A 2JJ1A 2IUUA 2N1BA 3RS5A 3U6KA 2WTUA 1T0JB 3HU3A 1CJTC 4IKEA 2J1LA 2CNWA 2QRNA 2R6GA 1MKYA 2OESA 1NMYA 1S1CA 2OCYC 3HYRA 4TT3D 2J0SA 3A1VA 3T1VA 2AWOA 2IS2A 4IOKA 5KSOA 3ADBA 4RCYA 2CJWA 2ZSAA 3BFXA 3OIVA 3T5GA 2IL1A 5EE0A 2O0KA 2Z83A 1K8RA 2VBCA 5HKKA 5HPYB 2B92A 3A4LA 1DO0A 4M1WA 1WXQA 3HP1A 3QY0A 3SR0A 4FWTA 3AF4A 3C14C 4A0GA 1KI1A 1VG1A 4BFUA 4M1MA 1G4AE 3SEAA 2ZSDA 2V7QD 3VX3A 4FD2A 1EWQA 4ZCMA 1E9CA 5DI3A 3IHLA 4IOLA 3S1AA 1JEDA 2ZRCA 2NTYC 5CK5A 2GAAA 3CWQA 3SU8A 3B8HA 3B82A 2WM9B 4TMZA 3W6PA 3BFKA 4KI0A 4F7WA 3DMDA 1KAOA 2GJAA 2WSSD 3E5HA 3IEUA 3PITA 2GJ9A 3Q5DA 2RB4A 4Q18A 5GJCA 1W4RA 3NWJA 3TMKA 4NE2A 2VP0A 5FBRB 3R7WA 4AWXA 1Z29A 1OH8A 3T12A 3ZVMA 2GRJA 3ND9A 3PEYA 1ZNXA 2AFHE 1DS6A 1M6NA 4DCSA 1HEIA 1KK3A 4CEIA 3K9HA 2CL7X 2GF0A 1DAIA 3BB3A 3UG7A 4DSNA 3OAAA 3G82C 4G5GA 1P6XA 1NLYA 3OFND 1NBME 1N5KA 2AN9A 4RJLA 4R9UC 4M9ZA 1XCMA 4LBVA 1KZ7B 3W3ZB 4DCVA 4RFSA 2OFOA 1QVAA 2AKAB 3M6AA 2ZANA 4WZ6A 3C7KA 3K9NA 4DLRA 4LJ7A 1Q22A 4KJZA 4CF7A 1F5NA 4NONA 3IIKA 4QOSA 3DEFA 1G3RA 2Q3MA 2ZRHA 2DB3A 5FOUA 1J7KA 3SFVA 2GF9A 3TW8B 5KSPA 4LJ6A 5L3QB 3AH8A 1IN5A 1NVVQ 5E95A 3K70D 2C9OA 4TLAA 5HR5A 1E0KA 3VTKA 4EIWA 4NYIQ 1R8QA 2AHOA 2CL0X 3ICEA 2B7BA 2A5FA 3ONWA 5KNBA 2WKRA 2WHXA 2CMKA 3DMNA 5FOWA 4ARZA 3NH9A 4MUAA 5JEEA 4NP6A 2Z43A 2VP5A 3ECCA 3MSXA 1SVKA 2IEYA 1MH1A 1VCOA 3GLHB 2CL6X 4ARZB 4DJTA 3HDTA 2EWWA 4Q7JB 4A6XA 4PC7A 2GEUA 4JLPA 1FP7A 4Q1AA 2A5GA 4OQNA 1RFLA 2HT1A 2I3BA 4C9BA 4JLJA 1QRAA 4B3FX 2IWRA 1XD2A 2ZREA 2W6IA 2XEXA 2B6HA 4M9SA 4OK3A 4QFMA 4X8OA 4POAA 4B48A 1U9IC 1MRSA 5DNYB 2Z5FA 3KQLA 4TSFD 4Q9JA 3ZDQA 3I72A 2E1RA 2W6JA 1HT1E 1KNXA 1DG1G 1KGDA 1X6VA 3B1WA 1JB1A 5TVKA 1XBTA 1OSNA 1RRPA 3K0EA 1EFHA 2QY9A 4KAXA 1W46A 2ZAMA 2G0NA 1QHNA 3THXA 4IDPA 4K81B 3CRMA 4BFXA 2ZR0A 3O47A 3S1AB 2NO9A 1E1RD 4RCZA 2PCJA 4TLBA 2ZTSA 1GM5A 1K5GA 2QT1A 2LWIA 4X8LA 4YXWD 3CNOA 4KLZA 4L9SA 3EW9A 3P20A 3MJHA 4FN5A 1IXSB 3K0FB 1W7AA 4US0R 4LUCA 4C0BA 3GLGA 1TUEA 2ZSFA 2ZE6A 4TMKA 1HA3A 2DFLA 3TKLA 1AJEA 4G01B 2ZS9A 3L8ZA 3VAAA 4R7ZA 2WOOA 2HYIC 3TQFA 3AKDA 3NBXX 4B44A 1W36B 1EWRA 1DOAA 1G19A 1W4BA 2Z0MA 1P2UA 3HU1A 2P0EA 2MSEB 4DLZA 4EFMA 3FVQA 5JMTA 1D8TA 2GNOA 4FW9A 4LBZA 2IUSA 3JZMA 5P21A 5BN3A 4TTRA 3LD9A 4IOJA 1JBKA 4F93B 1YU9A 2ZRIA 4IXNA 4CZ2A 2QTHA 1G8FA 2H1LA 1GWNA 3F5FA 1TADA 1G291 4MQBA 4HB4A 1PZNA 2FA9A 2FFQA 4BFZA 3VKGA 2X1VA 1I4DD 4Q1CA 2LKCA 5BYJA 4EPRA 4GOKA 1LF0A 2P2LA 3VHLB 3K0CC 2EQBA 2VYFA 3MJRA 5G53C 1NLZA 3A6PC 2RGNA 1F2UA 2QMHA 5AJVB 2JLXA 4HAWA 1T5LA 2JAQA 3SBDA 1KMHA 1ZM3A 1A4RA 5L3RA 3SI7A 3KUCA 5E7MA 1LB1B 4XWOA 4JLMA 3CRVA 3QKSA 4KSBA 4G5QA 2CLCX 4JYCA 1QHYA 1IXZA 5KUTA 1UKEA 1HQYE 4FMDF 3A1TA 3GLIB 5EQTA 2GCNA 5BWMA 3R9WA 4G5SA 1NG9A 2NO6A 4HLUC 3VR2A 1ETUA 1N2CE 4URUR 2ZYWX 2DCUA 2FN4A 2QAJA 4AURA 4KSCA 1QG2A 4YMVA 4JLOA 2PZEA 1L7VC 2PX3A 3GCGA 3N5CA 1JALA 1N25A 4C0QC 4HZUB 3GLFE 1KDRA 1D2MA 4LHWA 4TL7A 3TGPA 1RIFA 1CRPA 2ZEJA 3SFZA 2PEZA 3CR7A 4LHYA 3GP8A 4XOIA 1U8YA 2RGEA 1X86B 2XTNA 3BERA 3BOSA 4JBYA 1KJYA 5DLQC 3VX4A 1DAKA 1I4TD 2OILA 4WOPA 3WNDA 5EXSA 5EJEA 4B3GA 4C2TA 1FQJA 4U00A 1XEFA 3KB2A 4HAXA 3H86A 1DEKA 3WYAA 4IEIA 4JKIA 3V9PA 1KI2A 2G77B 3QEJA 1TTTA 2GZHA 2PLRA 2R6FA 1KDPA 2ZJ5A 3MAAC 1NVWQ 5FI0B 3THXB 1ZD8A 1BO6A 1OT3A 4PZYA 2FDCA 2HLDD 5C46F 4LPKA 5DYIA 3SOPA 3WYFA 1II8A 4PAQA 4MDFA 4JSTA 1Z6YA 1HH4A 2QAGB 3WXMA 2QRZA 1DG3A 2BBTA 4DEXA 5IRCD 2C78A 4N3NA 4DBLC 5HCIA 5L3SA 2P3SA 1LS1A 3MRSA 2VIIA 2FE4A 4ZCIA 1P2TA 1S96A 1Z47A 4V0MA 1E2HA 3HJNA 1E2JA 3O8DA 3PEVA 2ODBA 4M2LA 3VFDA 4J0QA 1XB2A 1DAGA 4MH0R 3SYNA 1VHLA 2GXAA 5DO9A 1KO5A 1YKSA 3A8TA 2P6RA 4QBGB 5H70A 4A36A 4N0EA 2QPAA 3LW7A 3ETLA 1VYTA 3UANA 2UZ3A 2XSZD 5AK0A 2IYXA 2RAPA 4HLUA 4Y0AA 1RJ9B 1XEWY 2OAP1 1C9KA 3UK6A 1E2DA 4LYAA 2BMEA 1YQTA 2N42A 1NVVR 5J4VA 2F9LA 4HYYA 2QP9X 2EFGA 2WIBA 2ZJBA 3C8UA 2ZUDA 5CM9C 3IIJA 1QBKC 2CCKA 3MUFA 1UFQA 4FINA 2W6ID 3H2YA 2C2HA 2O8BA 4HUQB 421PA 1NNEA 3SN6A 2ZJ8A 3B2EA 5GJWC 2EFDB 1CJUC 1OXXK 3FFBA 3LQQA 4QRHA 3BE4A 1ZIOA 2VPPA 2NO0A 5B64A 2JIZA 5C18A 1TU3A 2NGRA 2W0MA 3VNUA 3IILA 3I8XA 4PSAA 3EPLA 3EC1A 2O0HA 2WKPA 1W48A 2ZRFA 2QBYA 1OFIA 2W58A 2RGDA 1Z8FA 1KSJA 4M1YA 1R5BA 1IN4A 1S3SA 2ASEA 2V6IA 2O8EA 1JPJA 1IONA 2G3YA 2ZIAA 2V3CC 1WRBA 1P60A 1X3SA 4TQAA 1P2VA 1G3MA 3MWKA 1II0A 2OV2A 4UQOA 3U5ZB 5L8VA 2AD5A 5EP2A 2GESA 1N6HA 2GK6A 4HZUA 1G21E 3H0KA 5DISB 1E2KA 2VP4A 4LJ4A 2WSSA 5AJYA 1H8HD 1MR3F 3TK1A 4GFDA 3HR8A 5LB2A 2A78A 5CDFE 2ONJA 4B2LA 4WZBE 3FHTA 1S2MA 3UWKA 3LFUA 1QHGA 2N46A 1G8YA 3DZDA 3WYGA 1QZXA 2QE7D 3B1XA 3RDPA 1F2TA 2VP2A 3LRPA 3ND8A 4Q4AB 3K09C 4LV5B 4TYNA 1OFTA 5DI9A 3GLGE 3RRYA 3C5CA 5JI2E 4KVAA 1GRRA 1H8EA 3QJYA 2R44A 5DI3B 1IOZA 3DZ8A 1I2MA 5F9FA 2OG2A 1N6PA 2EYQA 2J0VA 5KDLA 2O5VA 3W8NA 3KJIA 3UMFA 2WMOB 1T3SA 3K70B 4LGMA 4JS0A 4PC6A 1D9XA 1EFTA 4DDVA 3A1SA 2GVDC 4BFWA 3FMFA 3AVOA 3IPYA 3DKPA 3REFA 4GOXA 2CCGA 1AIPA 1DO2A 3B60A 1UKVY 1IAQA 2ZRDA 2ZUCA 2XNDD 4B47A 3GLGB 3DVLA 3CF0A 5HZHA 3QXSA 2Q9BA 4TT3A 4B3BA 1OYWA 1YZNA 1XTJA 1S9HA 1E9BA 3NBYC 2QROA 1U81A 3M0EA 2NPFA 1HTWA 1E2NA 4QL3A 3SE0A 4C7OA 4TMXA 4XIGS 4YMUA 4QHTA 2ORVA 5FI1B 4PHFA 4JBXA 2FH5B 2W2XA 4DDWA 4LBWA 4LV6A 2X2EA 2P65A 3GEIA 5J40A 1UDXA 5KPJA 1NY5A 1K5DA 1OH5A 3VU9A 4NU0A 2AL7A 3AGPA 4M1TA 1RE0A 3KJHA 3FE2A 4KFUA 4OI4A 3HU2A 1TQ6A 4LC1A 3OEHA 4MGIR 4Q9HA 3QF4A 3C41J 3SJAA 1F2UB 3QG5A 3BXZA 2PLFA 2J45A 4L8GA 1AS2A 1NN1A 4NCHA 1XRJA 4DIEA 5FOVA 2C77A 4H1UA 2VO1A 5D3QA 3WHLA 3ZD6A 2WICA 1ZC4A 1X8KA 2GCOB 2JJ2A 4KYUA 2GAOA 4DRZA 3EZFA 1MO4A 1E96A 3D3QA 3I73A
chains in the Genus database with same CATH superfamily
1OPXA 3L8HA 3N8KA 4ODIA 2OEPA 1XMJA 3AF2A 4HD8A 3JQQA 4OUKX 1Z2AA 2ODPA 1ECBA 3JD0A 2WZBA 3LUAA 3ZXXA 5KVSA 3E8MA 5EJ4A 2AG5A 4G85A 1EFPB 2C2BA 2UVQA 5B7NA 3BIJA 4UNNA 3IOCA 2FPWA 2PBRA 2DLNA 2EEPA 2OA0A 1X1SA 5I7HA 2OOKA 1OB5A 2VF8A 3INNA 2XB8A 5ALNA 1Y5RA 2OLKA 2VTKA 5JASA 4FZVA 1NIPA 3EBLA 1CY7A 2OXIA 4FGJA 1IM5A 5A6SB 3P4YA 4NR0A 4GGPA 1W47A 3F8WA 3AGQA 3E22A 3WG9A 2F00A 3L84A 1DARA 4KO1S 3FTEA 1EBUA 2ZS8A 4TMTA 4C2UA 5CH8A 1V5WA 2BW0A 2V58A 3IR6A 2HQBA 2NXEA 1ZISA 3NAGA 3H8JA 4N49A 4DMCA 1G0NA 3OE1A 4G5HA 2JHPA 3L01A 2BEJA 5TEWA 2Y1OA 3WLEA 3HB7A 5JCJD 4AU1A 2A7XA 4JT8A 4W5WA 3E9ZA 2FMHA 3HWX1 2RCNA 4NL4H 4LWPA 2IU3A 3U09A 1H93A 2PLNA 1WCIB 4KMSA 4JT9A 3A1FA 4AM8A 4V0SA 5K0SA 4KGDA 2VDWA 4YK7A 5DB4A 5G0WA 4WKCA 3R0ZA 4ZDWA 5K4GA 1CR0A 4G3XA 2BAGA 2I4TA 4X94A 4MW6A 5BOVA 3DE1X 2GD2A 2NO1A 1PD0A 2WILA 2A1UA 3KE9A 4P35A 5C37A 1CQIB 2PANA 3O73A 3DM5A 4LY6A 3RAPR 1AE1A 4ICIA 5A03A 3L7DA 4CV3A 2G7ZA 4JL6A 5AOVA 3ESAA 1FJGB 2R6AA 2JGKA 3E3NA 5IKOA 1Y8QA 2VH5R 1H1LA 4HUTA 5KC8A 1F1BA 3AR6A 1J25A 3SKVA 3MMSA 3MINA 4FEEA 4TTSA 2Q2VA 4PQFA 3ZEIA 5AD1A 1XMVA 4I14A 3UOWA 3X3HA 4I1RA 1Y1SA 1CR4A 1JVNA 2OV1A 2NYVA 5A71A 4E21A 3BWCA 2JLRA 5T8KA 4EVSA 1KR2A 2PMEA 1M1YE 5TV2A 5KAMA 2N9UA 3DEAA 1FMLA 4ZVSA 4AROA 4MUNA 4LXGA 4DG5A 3RIEA 5AOBA 4FYVA 4C0HA 3GPCA 4HX2A 4O4IA 4UMDA 1LC3A 1OBOA 1Y8AA 1K7CA 4YX9A 3QVSA 3HPQA 1T3HA 2V6JA 2VPZA 3CX3A 4R9RA 4FGZA 5IDVA 2CNLA 1OWMA 2XE8A 3GJ0A 3P7MA 2QT9A 3AM4A 2X1LA 1F8YA 1FVFA 2XF2A 1GZHB 1TLTA 3CNNA 4HNQA 4UU8A 3G0DA 4RNDB 4GKJB 2HLDA 1FFAA 4LHVA 1WB4A 2WJPA 3P71T 2IS1A 4IHJF 2WF6A 3CCFA 1M7HA 2Z95A 3GRYA 3ZD7A 3WGUA 2QQGA 5FTWA 1IEXA 4KQMA 3EZXA 1NRIA 4WN3A 2X2PA 4WPGA 5KWSA 4QBIA 4AJKA 2FWIA 5G1PA 4D80A 1EM6A 3V48A 1YULA 1ORWA 4JITA 4J2TA 5LU8A 4PFSA 1VFNA 2X9LA 3HKBA 3ZBPA 3RVQA 3L1JA 4X20B 2ZAIA 3AERB 4XPIA 4BO6A 1ZIPA 2Q07A 4MRRA 1NXOA 2W2LD 1ZCJA 1ZVQA 3C3PA 1U0HC 4MUHA 4L5BA 4NC9A 5CTAA 1OY1A 2C07A 4YMWA 4B0PA 4DRXA 4ERXA 1E6CA 2W6ZA 2PUFA 3RAEC 3E9RA 4E5MA 2FWJA 4CDNA 1GL3A 1KRHA 1DXOA 2QP4A 4HJXA 4DLTA 1Y1PA 3QKUA 1BG6A 4DR1B 5JMWA 1K75A 2OHFA 2XT6A 1O97C 2Z5LA 5IUNC 1WG8A 2WYVA 4XGNA 2ONKA 5T5QA 3WK6A 1PT5A 5HJ7A 2WYWA 4EPTA 1DSSG 5F9MA 3ZKWA 4GXQA 4ZYZA 4BIIA 3VKHA 2ZRPA 5LUAA 4Q3DA 3ZZ0A 3TQCA 3TS1A 4NYJR 4DTCA 1HY3A 4I55B 1P45A 4K9KA 3PC4A 5U1PA 3DDZX 3ENWA 1PW5A 2WPDA 4MW9A 1NT4A 3VR4A 1J49A 3KJEA 5C5IA 1Z4QA 4BKMA 5E1DA 3JQGA 5BSTA 1TT5B 1G9TA 2XD9A 5LXTA 1KNQA 4RTNA 1UFKA 2ZB3A 4N7MA 1MO2A 1V96A 5DHRA 2O50A 1T6ZA 3FM9A 5GM1A 1RYYA 3KXDA 4H3HB 3RYHA 2OP0A 1GTVA 3NCTA 4PO8A 1P17A 4FEGA 4UE6A 5EUQB 1VKNA 2FPOA 3SNKA 2YASA 4BAZA 1KJ9A 4JBGA 3TTYA 5K01A 1IWBB 1NN0A 3H5NA 5AK6A 4WADA 1QWSA 4GNKA 1HZJA 2QM8A 5DTIA 1LFAA 1T2NA 1Z2EA 2FKNA 4R3WA 4EYGA 2WV9A 4JJ6A 5FV4A 3T94A 5EHQA 2P6PA 4UAJA 2C1EA 5IXYA 4JLDA 5CVVA 4PHCA 5JS2A 2XIJA 1SKYB 4PXSA 3OFNA 2VJBA 3EZLA 3OPNA 4DS3A 1K8ZB 3NH6A 2P2NA 1QO0A 4ZI3A 3K70C 2MMGA 3D31A 5FPSA 3RABA 1Y5NA 2QZPA 3DDSA 2A0FA 2CKMA 4JV5B 3PPWA 1AQYA 1ONOA 1TYAE 2NT4A 1GPJA 2OPHA 2OZPA 1E1QD 1H2RS 2Z9BA 1XD9A 3U7JA 3FTDA 3K15A 3R6LA 4H1TA 4GX0A 4KDRA 4QGFA 5I8PA 5IP5A 5LU9A 1KAMA 3DCIA 2WVJA 4YJFB 1O2DA 3ITEA 3KDSE 4UBMA 9ATCA 1UK7A 1XA4A 1FYWA 1FXSA 3WB1A 1H4QA 1O0BA 2I91A 1TM7E 5ABPA 5J4KA 4A15A 2RH5A 4I36A 3A6FA 1GU1A 2NQ2C 1UQUA 3KEQA 1X92A 3WA6A 2WJ4A 2C2WA 2GMWA 4L6AA 3T9BA 3RSHA 1OKKA 1GV0A 2IOYA 4MX8A 3AHIA 4F9GA 3J7AC 4TZ0A 1Q1QA 3IMGA 3V3TA 4FYXA 2L17A 1RP1A 4WBNF 1MX9A 1NW4A 1H3EA 2O54A 3L6RA 1L4BA 2CVFA 1MO5A 4NBVA 4EJ0A 4RVSA 5ISMA 4J43A 4DMGA 4WGGA 1M10A 2AG8A 3ADOA 4C05A 3QE4A 3V32A 1BHO1 1Z16A 2I1WA 2JGIA 1NQWA 3MJSA 4PZEA 4DLBA 5L95A 1WHTA 5EJ5A 1CPYA 2QE6A 3DBRA 5L3VA 3I5YA 1ZWKA 1OI2A 5LCXA 4CIAA 2HWXA 3DNFA 4CHGA 1XFDA 5B4VA 5KYKA 3OSZA 2Q3HA 3H5WA 1Q1BA 4FOSA 5HE9A 3QEAZ 2OCXA 3ZZTA 3QPWA 4YCNA 1HKHA 1PJ3A 3OOSA 1K5PA 2YFYA 3DDNA 4LJAA 1NKSA 4IDCA 2VDRB 1C9YA 3MJVA 4V03A 5FPTA 3B5JA 1DLJA 2VJDA 2X0DA 4B2YA 1U0RA 2OO5C 3RCBA 2FKAA 3V8NA 3U19A 3PVZA 3MD9A 1B8OA 1HDRA 4JVLA 3OEED 3SZUA 1ATIA 2QLTA 3BXGA 5BT9A 3DLIA 4Z7NB 2MR5A 1GPMA 5TXGA 1Y3BE 3VOBA 1VE1A 3ANNA 4G5YA 1GCAA 4OCZA 3ZHCA 5JBQA 4KFCA 1JJIA 4PLVA 5FAXA 5G0VA 2Y71A 2C3UA 5CDFA 2HR1A 5IKPA 2A67A 4LI0A 5C8YF 3OWHA 3MGBA 3MWJA 2CC2A 4M89A 4CT4B 4MUKA 2FG6C 3DGFC 2CFOA 3B3FA 4U2FA 1WVIA 4Y6LA 1R5NA 2BFAA 1ZNYA 2X2OA 1BWSA 1F51E 1K68A 1SFRA 2XMCA 3GLHE 1V2GA 4YB8A 3UGQA 1VOTA 5REQB 1CY4A 5GZ1A 1GU7A 1N6KA 1P2SA 1U02A 1Z5VA 2HHAA 3VR5A 2V98A 3B13B 3D0OA 2C5AA 1Q16A 2VXCA 3JYLA 3EC7A 4HK4A 3T9AA 3EVNA 4D92A 4R7GA 4U9UA 1PLKA 2HCJB 1TJNA 2GLTA 2HNAA 1B14A 3MWLA 5D5PA 2CMFA 1VIDA 2HDWA 2Q3EA 3UCEA 5FQNA 3LQRA 5BUZA 3EVAA 2VCYA 2XUHA 4AB1A 5AW7A 2UKDA 1E3QA 4QNRA 4QXAA 3TBHA 4DWJA 2RBKA 4ND7A 5HFJA 4ZMBA 4JOCA 3T1QA 2WM2A 2AXPA 4JVSB 4EF4A 1XHFA 1K63A 1XP8A 3AP1A 3NC0C 4FSXA 4B8WA 2IH4A 1I30A 2H0AA 4UAGA 3VJKA 2QN1A 4RVCA 3WGMA 3BXFA 3A1WA 3IERA 1JDUA 2HLNA 2J7PD 4KPEC 4MJ3A 4HOYA 4HQNA 3QBJA 3ZV4A 4BLWA 5CFZA 2NTJA 2VDKB 1GL6A 1CQWA 1JHAA 3FPSA 4HR7A 3CPHA 4P98A 1SHTX 3EXFA 1LBIA 1ZM4A 3ENNA 3EY4A 3HDHA 3HVIA 3KKOA 4COOA 5DEOA 2HREA 2ZZMA 2VZLA 3PDIB 3AUSA 3DZBA 3U0VA 1A5BB 2HSGA 2I4NA 1U7TA 4CETA 4S12A 1T8SA 2WG2A 4P7BA 2E3JA 3AETA 3L05A 5DW0A 4CTOA 4YT2A 4FNAA 4IDEA 3AY7A 4IO1A 1QQ6A 1H9CA 1RLIA 4B75A 2VH2A 2VWPA 2BF7A 1MIHA 4Z1OA 4BQRA 3C70A 1Q6ZA 3A9TA 1IWPB 1EVIA 1U9CA 3M4ZA 2G6TA 5F3DA 4HUQA 4TV8B 4CMIB 4WXYB 3RJTA 4EX7A 3TIFA 1MEEA 1U2DC 1N3YA 3F5DA 5T6BA 5IPFA 1OWLA 4KB5A 3RUPA 3Q6IA 3I4CA 3WL5A 3LFTA 1N9KA 2WY2D 1KU6A 3U40A 5JJCA 5KX5B 1Y42X 2EFYA 3OURA 1NZDA 1R6DA 4Z2AA 1NUPA 4EO9A 3VNVA 2FPKA 1UWKA 3JAKB 4LZPA 3V2UA 2NUTB 4JJIA 4MYUA 2P30A 3CX7A 3OT1A 4ZOEA 2ATXA 2QBYB 3VNSA 4H7IA 2H6EA 4HEA6 4EH1A 3OZIA 2DE0X 5DHFA 5BNIA 1DAEA 1EBFA 4ND3A 5DU2A 4CCWA 5JXHA 1M9NA 4G5XA 1Y5MA 2ZTLA 1CQXA 1IVNA 3DBOB 4YCBA 4A1FA 5TMPA 1VXOA 1A5TA 3NHJA 4LMAA 1ODLA 1NF2A 3FZNA 3GJXC 4B3CA 3QE9Y 1U2QA 3Q3GE 4IH4A 2H9AA 3L4KA 3E22B 5C4MA 3LQ1A 4PQGA 2O3JA 5IBRA 3NIDB 3CVJA 1GO2A 3PD1A 4FCTA 4RK0A 4O59O 1QJ4A 3WS7A 3ELYA 1V39A 2DF8A 3FCSB 3VZSA 1NU6A 2AT1A 3N2ZB 2NUPB 1UC8A 4UDXX 2E89A 2D0IA 3BMOB 5GONF 2CT8A 1Q84A 4D2IA 1ADJA 1KMMA 3TAHA 4NWIA 2PUAA 4ZVOA 3OZEA 4ZDKA 4UFOA 1XVAA 3RJMA 4HDCA 1RJDA 4B9AA 2JLWA 1G63A 5JO9A 3W2FA 1ZUIA 4U7DA 5I7EA 1SEVA 4KPFC 3FF1A 1VSUA 5LBUA 3ZXIA 3ITNA 2DRIA 1E6EA 2HW8A 4I3HA 3AF6A 5IDWA 4Q1DA 1FDIA 3JWHA 1FU4A 4MUJA 4ASUD 1PR6A 5EMMA 2AC2A 2XQIA 2IKQA 3DLTA 1J6UA 3N5KA 1N6NA 1GKLA 1JW9B 1MBZA 2ZI3A 3M4XA 3QFRA 4BJ5A 4PTLA 1TJ3A 1Y8QB 4RD4A 2ADOA 5FLEX 3IBSA 3D64A 4HLDA 3GMDA 4NBRA 3SC3A 4DZRA 3VV2A 3ICQB 4I50F 4LE1A 1UJ4A 2X77A 4I50A 4YV0A 1MOQA 4OK5A 3V3KA 1CF2O 1SZDA 2O1SA 4ND2A 4F2GA 1ZCBA 3REQA 4DLUA 3RFVA 1DZIA 3NIFB 4YHHB 1OJLA 4OP2A 1HYQA 2RAUA 1T8RA 3A3NA 1KEWA 1WW8A 4O4IB 3FHOA 1J99A 2FLVA 4V0OA 2XVYA 3DM9B 3QQPA 5LB4A 1PX0A 3CJTA 5BQPA 3E5NA 3EVEA 1GG8A 1U8CB 2G5CA 2ZU6A 3BQ9A 2QPTA 3PDIA 3VZQA 4XM1A 3WKDA 4DR2B 4QPDA 4CRWB 2JAPA 1XSEA 1GPNA 4NZNA 5KVVA 5KREA 4FXOA 2YS6A 4PNHA 1V7ZA 2IP4A 2OQIA 2ZRBA 3ECSA 1W4ZA 3KVYA 4ARUA 1T1IA 4UREA 4DABA 3RT7A 2Q46A 2XCSB 2BM0A 2QZSA 3KKQA 4ZJZA 1AD2A 2Y9MB 3B3QA 1ZDMA 1YBVA 2KSQA 3QWFA 5DT2A 5GONA 2VJAA 5BW8A 1ZOLA 1I2CA 2XOXA 3DPUA 3K9LA 3UTDA 3WTBA 3FZEA 3UMGA 1FMCA 2WEKA 3FZGA 3E70C 4GP9A 4ZQBA 1OWNA 4AZ0B 5LQRA 2NSJA 2Z2YA 2P91A 2AB0A 5AKXA 3OU2A 1DJMA 2FR0A 3HJBA 4RUKA 3F3KA 3DYIA 3GP3A 3OZ7A 1YA8A 3P0RA 4QG3A 1PTKA 3JVVA 4OSPA 3IALA 1FPMA 2A86A 5H81A 3VAYA 1QUFA 5DHPA 4F84A 4MKXA 1XZEA 3WKBA 3HGTA 1T9GR 3LOPA 4KBYA 4H77A 4B6QA 2XUKA 3Q8WA 2ZYSA 4L8LA 3K92A 2AHRA 4Y98A 2M32A 4MQUA 5KWVA 4JOBA 2EKPA 2XA1A 2F1JA 4O2RA 4L3WA 5IUKC 4BNLA 1QZ3A 1XRPA 9MHTA 1XJWA 2L82A 1T5DX 1R0BA 1Z4PX 5E8JA 1JECA 2WIGA 1BKDR 1UFVA 1ZSVA 4GUAA 2X8LA 4XIIA 3E9CA 4XVRA 4C0QC 5I7SA 1UF9A 2QAGC 4I55A 4IRXA 5ERXA 4BNJA 5EJGA 1EHCA 5JQGB 3D3EA 3ADDA 1UJ5A 4PLFA 4RMIA 4B43A 1R18A 1XTIA 4BMDA 1G0OA 2WM8A 3HCNA 5E4FA 3SX0A 1XROA 3KD3A 3WP1B 4C01A 4HXFB 5L7TA 2O19A 3ZZMA 2ZCVA 4AY2A 4HAYA 2GCOA 1WXXA 5KOHB 1UBLS 4K6HA 2QYHA 2ZROA 1P4SA 4ETNA 5BURA 2CNDA 5E7IA 2ZXEA 5GTDA 3B1FA 1SCDA 3JQ8B 1XMPA 4RENA 4RH0A 4BP3A 1JX6A 2EX4A 1ECJA 1OGYA 1KMCA 3CUVA 3EGIA 3CEMA 3ZS9A 5JJBA 2QUHA 1ZNZA 2VF7A 3LNTA 1RI1A 1PR1A 2B6NA 4Y2RA 4AYWA 4PSDA 3I0NA 1JKFA 5B3KA 4DWWA 4KMOA 1Z07A 5DE3A 5IANA 1G64A 4A73A 3TB4A 3N2EA 4A8PA 3ODPA 1QCZA 3T7CA 1GKKA 4BX8A 3W2EA 3TIIA 4CUJA 4I50B 1LF5A 4U2KA 1WA5A 5J4YA 1NQAO 2DAPA 2YW9A 4KODA 1JPNA 4BNUA 1LNSA 1E64A 5TDHA 3REQB 3ME5A 1P3DA 1W1WA 3DVQX 4RK7A 3RFXA 2I2FA 1Z3IX 5GM2A 1XYYA 2CXQA 5ALYA 2H1CA 2ONYA 2ZBVA 5HILA 4N7BA 5A0VA 1XTSA 2PXXA 4MB6A 5ALLA 5IKMA 1I6KA 3N8NA 1ZH0A 2A6PA 2JGAA 3N70A 3OH8A 3PCTA 4MW4A 4QECA 4QELA 3DE3X 3E9YA 4ZOAA 2R97A 5CG1A 5LC1A 1OT5A 1MVOA 3IQFA 4QULA 2ZBQA 4HX5A 1UPBA 2W11A 4EKEA 2PD6A 2X13A 1W4AA 1XRSB 3EVCA 1HFWA 1C7EA 1E2EA 3DB1A 3F67A 1CFJA 1AKMA 2Z3VA 3K8QA 3ANTA 1B76A 3N2NA 3AUTA 1YIAA 3BPSA 2MR6A 4FC7A 2XZPA 4IV5A 3L07A 1PN3A 1TC2A 1KBOA 1ZJJA 3G5AA 3L9WA 4XJXA 3SICE 2I8CA 3ZCTA 1THMA 4YAKA 3CV3A 1U0BB 1DAPA 4MKHA 1JDVA 4JDPA 3OZBA 4GO1A 3EA0A 3TKYA 1XDDA 3LM8A 3WRXC 4XSGA 3U80A 4REOA 5AVUA 4KFRA 5D1HA 1N3LA 5CGZA 4KVZA 1K9VF 3OT4A 4U7TB 3HNOA 1Z45A 2HIGA 2X7XA 5DF1A 2XDYA 3PXEA 1A9QA 1C50A 4DPMA 1FFXB 2QX7A 3ZDDA 3MVEA 4FZ5A 1E2QA 1QC5B 3LQ4A 1YJ5A 1R3UA 4WINA 5KVAA 2PIDA 3PHIA 4AF7A 2ZTVA 5HFAA 1MJGA 1FY2A 3EMVA 2WDZA 4DT1B 5CBPB 2PGIA 2ZFUA 1TKAA 3JD3A 4EI2A 4EUHA 4URXR 2FHSA 4UXIA 3WHPA 1P5FA 1Y1RA 2ZWAA 4XUGB 5KI6A 5JMOA 5KU1A 1YHNA 4FYWA 2AOUB 1L5MA 2XVAA 1LC0A 2YYZA 3B48A 4MMZB 1MG5A 1LWNA 1NLUA 1P3JA 1UBMS 1MFZA 2CEAA 3GEEA 3L0BA 4Y1FA 4NZYA 1NP6A 4BMZA 2BFMA 3HE3A 2BL4A 3HP7A 3K53A 1IN7A 3BMNA 1E7MA 4RLSA 3FUWA 4ZVPA 4Z9BA 2W98A 5EIBC 4E6PA 2ECKA 3OF5A 4CKCB 1KXJA 4LA4A 1EFCA 1HNNA 3FJ1A 3KQVA 1JLRA 2NU8B 4LYGA 1DUVG 5AM4A 3A27A 4AT1A 1FJXA 1NIJA 3E9DA 4TVBA 1FYFA 2R66A 2WM3A 3EW7A 4LSGA 2R79A 3FOBA 4ZAXA 1XQ6A 3IUMA 4XKJA 2CLHB 1U0LA 1DBQA 3E7PA 3C97A 3L77A 4EKNB 1QORA 3EBOA 5E9WA 1CDEA 4QAQA 1IBKB 3SVLA 1KFBB 2J9RA 2ODEA 5BMVB 2AK3A 3GIDA 4G26A 1THGA 4U7GA 1E1DA 1H2YA 1T6XA 2PQ2A 3IKTA 4FHEA 4LGVA 3LF1A 5FWXB 1F48A 3B78A 4EA6A 5JSQA 4E5NA 2EYUA 1CERA 3AUYA 4QOGA 4HGNA 3SJBA 3DE2X 2JBAB 2P6UA 4PAMA 2IYSA 2PRYA 4RTKA 1KXZA 3OX4A 2MYTA 1NJ5A 2NU6A 1IJFA 3OAAD 4LF6B 1K6IA 1RWQA 3NTQA 3F78A 1XZJA 2IYEA 2JCSA 2GS9A 2OM6A 2XE6A 2XV1A 4IO0A 4KQGA 3E8SA 4NBNA 1YU6A 3AUUA 5EMKA 3WWEA 4BEVA 2BP7A 5IAAA 1H2HA 2B37A 2CE2X 4YJ2A 3G8BA 5FJJA 4ENWA 5IT5A 4LOJA 4FFWA 5HP4A 4RY9A 3RJ5A 4J4TA 1RYHA 5TSDA 1HOTA 3PHBE 4BFVA 5IC4A 2QN8A 4YRTA 4ENVA 4S1PA 1AF7A 1QU2A 2YXNA 5JVDA 4EJSB 1KE2A 3G0HA 4NH4A 3AETB 5LP6A 1V43A 3E18A 3U6BA 1B73A 3LDAA 5CDUA 2GN8A 3FRHA 3JWJA 5I7OA 1KC3A 2GJSA 3GH1A 1HG1A 3C3YA 2WWHA 2ZIWB 3LYHA 4Y2YA 2D4AA 2ZYAA 1FP1D 3DFUA 4I6JA 1KI3A 3HMKA 4J76A 4L4YA 1RABA 5E9QA 3TB6A 3Q0EA 4U1RA 5CXQA 5K8CA 4KAAA 5KQPA 1VMAA 4U7PB 4YP0A 1NGSA 4ZDIA 3H0EA 4PWYA 4EO4A 2NTEA 4NIMA 3AVXA 1PFVA 4H6WA 2J87A 1VJTA 1QB8A 1TL7C 2OV4A 4QVGA 3PEWA 1J9GA 3Q85A 1X1EA 3G23A 4KV9A 1G9XA 1J90A 1PO7A 3HACA 4QLAA 4YWHA 1E9RA 1UOOA 3GPBA 2VAXA 3IVXA 3QV2A 2RIPA 6REQB 4M1QA 5HF5A 4ECAA 1WSWA 4KE8A 1U3TA 3GYBA 3ZIUA 1N3BA 1ZK0A 4KXYA 3O31A 4PAOA 4A5SA 4AUNA 5J2TF 1KI9A 1ZK1A 1OI3A 1N2SA 3IE2A 2IYVA 2FPGA 4Q7MB 1SU6A 3TM5A 4LFBB 2FUCA 3RE1A 1BXRA 2BM9A 1QONA 2ZUBA 1C1HA 2VXYA 2XAUA 1GSAA 3NCHA 5D7BA 5ALOA 3UAXA 2HCTA 1P91A 4AZ3B 5KWEA 3TOZA 3NHZA 3OKFA 1L7PA 2H0RA 3TZBA 2J7KA 5CCBA 2V0GA 4P58A 5FIUA 3S27A 4ER0A 2O8NA 3LC1O 2B20A 4TMFA 4X97A 3V4OA 4DQLA 1CY0A 1SHLA 3O3CA 3F6SA 2H31A 1ZX1A 1FDUA 1GCGA 2Q1XA 2XWSA 1G20A 2ZI7A 2NZ8A 2ZG6A 3L8YA 2XEDA 3JPYA 1EXMA 5EJ6A 1VPTA 4XM0A 1JQKA 2IZ7A 3L1IA 1A4UA 4M0KA 2NU8A 1YB1A 2XDQA 1LPOA 2NNWB 3L0IB 3BD8A 1L5OA 3UJ3X 1GCIA 2F62A 4ZC8A 2FMUA 2LD4A 3M6FA 1SUBA 3S3TA 1YF3A 3ASYA 3FSGA 4HTFA 4TTQA 1LU9A 4NEGA 3FMVA 5MGBA 4MQEB 1N2ZA 2B5VA 4AZVA 3UFBA 1ZHOA 3RK4A 1DHTA 3W5BA 2D3WA 3JQAD 5EEHA 4QOEA 5LQKA 2H7CA 1T5TA 3QXCA 2G88A 1HETA 3GJ8A 2Y6UA 4G4SO 3KSDO 3W6OA 1S4QA 2WF9A 4HRAA 3V4SA 4AP9A 4YAIA 4TRRA 4N5IX 3OJWA 4QGAA 1J22A 3AO0B 4KQWA 5EL0A 3AVUA 1OX6A 2JBAA 3F7OA 5B12A 1ZW1A 2PG3A 3U39A 1KZHA 1DNPA 3D7SA 4KTTE 3PLNA 2BCEA 5GINE 2O2SA 2ZRQA 2VUHB 1X13A 4TUYA 2YN0A 3U4IA 1NJ6A 2ZJYA 2Q3JA 3N8GA 2Y1DA 4RHXA 2YYSA 2M6SA 2WIDA 5CMLA 3TQQA 4ZYWA 1G7RA 3U9LA 4NNPA 2D0DA 3WMGA 1DBIA 1WS6A 4D0SA 1RM3A 2DSTA 4GR9A 5A4FS 2CVZA 1ILEA 3CF4G 3HUTA 4V3BA 2P8SA 3M6IA 4MUXA 4P7FA 5K09A 3NV9A 3O8LA 2EAUA 3WMRA 3GOHA 3R3WA 3QMWA 5T57A 2P8JA 5AHOA 4C78A 1M6WA 4CMJA 2JFGA 1NYTA 1CQJA 1E6KA 1PZMA 2GPBA 2IYZA 5FTMA 2C9MA 3IOMA 3LA6A 1KPHA 3GWZA 2QMOA 4ME6A 2NZYA 4ZK2A 3ZU3A 1QX4A 4ZZ3A 4R05A 1DQYA 5C34B 1NXTA 1C8BA 1Q1GA 1VBFA 4GSLA 1BOFA 3I09A 3K9GA 2QOEA 1M6EX 1HTTA 2QZ4A 5LQUA 4TXHA 3EPKA 1VMIA 3OLVA 4XGIA 1ZH2A 4DQXA 2FUNB 2J09A 2ZKIA 4O29A 5SY9A 3NWPA 1T5HX 3KJXA 3ZCXA 1LTKA 3SXUA 4DPLA 1QK4A 2ZIGA 4FUQA 4HWPA 3L0ZA 3HSKA 1CK4A 1AF4A 1BE8A 1S3GA 4W82A 1OI7A 2GB4A 4JQOA 2FGJA 3L7CA 1MVLA 4U7HA 1ARZA 2XJ4A 1LZKA 1Z8DA 3BRSA 1DWPA 1TUGA 2PU5A 3DT6A 3AB7A 4HGRA 1KSFX 4MRPA 4JXXA 4LHZA 1QGYA 4KU4A 2F43B 3WB0A 1DGQA 1ESNA 1HE8B 2RHDA 1L4UA 1X9GA 4HTAA 3IMEA 1U5BB 2RJOA 3AFOA 4N0QA 1K97A 1PSZA 5AI0A 4BBAA 3R8FA 3UMRA 4CVNA 1DE0A 3LBFA 3QF4B 1HLPA 1UMBB 2FXVA 4RLFA 4S24A 1AXRA 2Q41A 3FBTA 4Q9LA 3QTLA 3X1WA 4R71A 3K0BA 5JSZA 5C52B 2W0SA 5LBIA 5SZHB 2B4KA 2QUBA 2GXQA 2QP3A 3L4SO 4KQ2A 3T5AA 4OO3A 4XEHA 5F78A 4XLTA 2JB9A 2BLLA 3L1HA 3S2ZA 3UC5A 5HQTA 4URHA 1TQ2A 2H4XA 1XIVA 3HSSA 3WO0A 5AR1A 2RGRA 4KR7A 2Q3FA 5EE5B 1WF6A 2IHZA 5I9LA 4PZ9A 3VH1A 2VBFA 3ZCSA 1F0NA 5JQGF 1CUBA 5I7FA 2C3OA 2NYRA 1V3TA 3KNZA 5B55A 3UAZA 3AEXA 3MFYA 1M83A 1RYZA 4P92A 1Z5OA 5BMOA 1Q7CA 1R5OA 1NVAA 4PPNA 3WICA 3ZS8A 3NUZA 2BUAA 4J16A 5AJZA 1MH9A 4IMJB 4LYFA 4PAWA 3BGDA 1XJCA 2VJLA 3ITDA 3F9CA 5KAPA 3J81A 4XR4A 3LXMA 4XZ3A 1WDLA 4DZZA 2BC9A 3S40A 3LPLA 2QLNA 3IUPA 3VJRA 3SX2A 3I1FA 5CA1A 4RZ3A 3ANMA 2Q9AA 1OZAA 4X3CA 3CLHA 2MSCB 3G9QA 5FTKA 4BKUA 4GM0A 3GT7A 5HXAA 5K5EA 3ZGYA 3EVFA 3RUCA 3R2JA 3ILYA 2CF5A 2NVUA 4HC4A 2I7CA 2F8SA 3MRXA 3RSFA 2O8DA 3OEWA 1YS2X 3BH0A 3THXA 1D1PA 2BZ0A 2JGDB 5AP9A 1R0CA 4UQLA 4UCXA 4EZEA 2H8GA 4UNPA 4IDGA 5HQ3A 1Y9DA 4I5FA 1ESMA 4PZCA 3VU8A 1QRSA 1QS0A 3HUDA 2HXSA 4U4AA 3AM3A 3JQEA 4KN9S 1GZ6A 2R65A 4UNQA 3K4PA 2JHAA 5T3YA 3KXLA 2PMDA 1E5DA 3PC8A 4AICA 2XYQA 1WD5A 2RARA 4EI9A 4YMHA 3VU0A 1H1LB 4IXWA 5IG2A 1HNXB 1N2IA 4OI0A 2FPIA 1BX1A 5A4DA 2RKWA 3PGVA 4I8XA 2AK2A 3Q7SA 1N0UA 4K9DA 3W7BA 1R0YA 4OVKA 5L40A 1MHPA 2BDTA 1H6CA 4L5AA 4JI5B 4YAFA 4V1CI 3FRJA 1W0KD 3MJCA 3ASUA 1RVV1 4R2HA 3SZGA 3UXYA 3N6RA 2YDYA 5KHAA 4HDNB 3E7XA 5EMNA 4ZVRA 3SXUB 3GGDA 1YCDA 2OC9A 3BTUA 4XGRA 4DV3B 4TQGA 1XDWA 3HCWA 2V1UA 3MWDB 4NEQA 1J00A 3CLVA 1JN0A 4XD7A 2F1HA 2Q2WA 1GDHA 1KYTA 1YJQA 2ZETA 3QXHA 4KO4S 3QLVA 4MKFA 1ML3A 4Y2XA 4XE5A 4OQLA 5HDBB 3LCJA 3KSUA 1C9MA 2G17A 4MA0A 1G41A 1F6WA 3RVMA 1VA5A 4D4LA 4QBHA 4EB3A 4HDSA 2FZEA 5EZ6B 1TFUA 2PZBA 1P39A 5BYBA 4YRKA 2PKRA 2VNAA 4ITVA 1DWOA 2QMZA 5H3LA 2ZYUX 4L57A 3ZX4A 4OIFA 4CWAA 5I9BA 2OFFA 1GY8A 1S7GA 5LQMA 5JSZB 3FUVA 3PC6A 2OECA 1WV0A 1Z5WA 3MGGA 2ACKA 4B2PA 4YACA 5JH7F 3DVRX 1SXPA 4HLQB 2GZRA 4R6XA 3T5TA 1MO6A 3ZBUA 3HJUA 1QYDA 1ETHA 1JYFA 1DINA 1P0FA 3RYCB 4B8YA 3PXAA 2WWTA 1JFFA 1JWBB 1WXHA 2ECOA 3TOVA 1P80A 2FQQA 3U4HA 4O2AF 1DCTA 2G4VA 1Z06A 3AP3A 4QGGA 5BSWA 1DJNA 3LF2A 4KAFA 2XB9A 2IU6A 4YMTA 3RWOA 2E1PA 2DFTA 1VJ5A 3DDCA 3RF7A 1UMDA 1VMKA 1ZSNA 2ZPAA 1GPYA 3MB5A 5LQSA 1KY3A 4DSOA 1UOQA 2FUEA 2YHSA 2I1LA 3G2NA 4B09A 5LXTB 2QRPA 1A8QA 1JAYA 2IRWA 5ADWA 3DLPX 1ITZA 1ZUHA 2H7XA 4H6VA 4BVFA 2FLWA 4A2PA 1AK1A 4UUBA 2A1TS 3SQWA 4D6YA 1CCWA 2ORWA 3CW2A 1UZUA 3KB6A 1V8FA 1NNLA 4DDUA 5IM4A 4ZFNA 4GZ3A 1XZ8A 3H9CA 1KOFA 1NQTA 4B45A 1WPGA 2JBHA 2OGSA 4IVPA 5F2EA 1WMEA 1F60A 3GK3A 4TYPA 1SQ5A 3HHEA 3GJ3A 5BOSB 5EIWA 2NPIA 4F86A 2BMAA 4LJRA 3VHRA 3CKKA 1L7XA 1WZNA 4IFTA 3CURA 2QRJA 1KTVA 1U1GA 5BR7A 4M22A 2XB4A 1FE8A 2O8DB 1LI4A 2CEKA 3DL2A 1FMJA 1RWBA 2BP7B 1GADO 1ZESA 2JGDA 4JI7B 4KPUA 4IOMA 2ZPUA 4OQPA 2WJHA 4W1SA 1U0SY 1JIVA 2VT2A 4XWAA 4FS8A 2HH9A 2MT9A 3TLKA 1EFRA 4JLBA 4TWJA 4CUKA 1JHYA 3QSYA 4HL6A 4MIEA 3ROFA 4HB2A 3D7MA 5LIPA 1A82A 1FTQA 2IBMA 3AEQB 1NM5A 2G5PA 1E8MA 4XM2A 2A4MA 4Y6SA 4GOMD 4HQRA 4Q05A 3V4VB 2QTVB 4RV9A 5FORA 4CMBA 1PNVA 1PYDA 4RKQA 5F2NA 3QLTA 4YMSA 2AC4A 3HM9A 5EA2A 2GHIA 2H4WA 3TQHA 3QUQA 3EEOA 1EZ1A 4LDJA 4Y9SA 1PNRA 4CNQA 4EYQA 3OMWA 4DY4A 4MULA 1QCCA 5AK3A 3WQQA 4PC1A 1SU7A 4TSFA 1AQ6A 4F5ZA 3SS8A 4KLRA 3O2NA 1BH2A 3JW8A 1ZD3A 4N6OA 1CUEA 2UZ0A 1GPDG 1MRZA 2DWPA 4WVFA 1KMQA 3I61A 3EGDB 2XXAB 4ZV4A 1E9FA 4NTZA 3FJOA 3RFCA 1A8IA 4EAAA 5A4JA 1AN0A 3DW1X 2VJMA 1KBQA 4JUCA 2AVDA 1KDOA 1GEEA 1NMXA 2F3SA 5KNCD 1XZFA 1IMJA 2HBRA 4K6OA 3ZWKA 2QF7A 1T91A 4INAA 4DA7A 4DXDA 5EHXA 1E9DA 5GPBA 1TM3E 2ZJ1A 4Y0VA 4ENTA 4RH3A 3RYCA 1N2EA 1KYIA 4O4LA 1U3FA 3QEKA 5HWSA 1V48A 2IEAA 4M1EA 4N48A 5JDIA 4G37A 1NFRA 3GDGA 1AOXA 3I5MA 3EG9A 3KLNA 2A30A 3BORA 5EZSA 2H7VA 4AJ1A 1C0EA 3G85A 1XYVA 1GG5A 1YZVA 2ZIEA 4U7FA 1P81A 1ZXBA 3S2IA 3ZW9A 1SKYE 1VLMA 2X4GA 5LZ4A 1G7CA 2C99A 3C5HA 3QJ5A 3PUJA 4N7RA 3OIUA 1R37A 2WHEA 1M0TA 2FEMA 1NYQA 3UB2A 1V26A 4DUZB 4PLHA 4EG3A 5DNCA 2XUZA 3F5SA 1SKQA 2VHJA 2YFQA 3N59A 3OOHA 3ZQKA 1EUCA 4X45A 3AVVA 2J85A 1SY7A 3VR3A 1GUFA 4ALLA 1Z7GA 1N5DA 4M1ZA 1I7SB 3FHCB 1VLQA 3PJRA 3ZCVA 3BSSA 2JANA 4MQ4A 5EYPA 5C7OO 4JT4A 1EWTA 4GRAA 2J32A 3GI1A 1L5HB 3RRZA 3Q5GA 1HT0A 3VBCA 2ISCA 5JTUA 3IBFA 2FPRA 3GUVA 1TE2A 4LMBA 3QYFA 4I9UA 3PD7A 1XTPA 3A2LA 3IPCA 5CFMA 1OPRA 5TLSA 4X66B 2GWRA 2GK7A 2J6BA 3L0YA 2IYPA 4IIXA 1QG4A 1P74A 4AJPA 1NVBA 1TVKA 4EG6A 5BPHA 3MCVA 4U5XA 4OD0A 3FCAA 2TECE 1FLDA 1TXGA 4LYEA 1BGWA 1NFQA 5CFPA 5GVSA 1RKBA