4JR2A

Human procaspase-7/caspase-7 heterodimer bound to ac-devd-cmk
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
247
structure length
224
Chain Sequence
b'ATYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Procaspase-7
molecule tags Apoptosis, hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation.
pubmed doi rcsb
total genus 87
structure length 224
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jr2A00
2C2MA 4QUDA 4JJ7A 4JB8A 1CVRA 5I9TA 3SIRA 3EDQA 4AWAA 5IABA 3EDRA 4QUHA 4EHNA 2CJYA 5LUBA 4JR2A 3PCXA 4N6GA 4JR1A 1RWNA 4NBKA 1RWKA 4NBLA 1I4EB 4M9RA 2QL7A 2QLFA 4QTXA 3V55A 1I3OA 3OD5A 5I9BA 1RWMA 3H13A 2P2CA 2QL9A 1RWWA 2C1EA 3IBCA 3GJSA 2WDPA 3NR2A 3R6LA 4ZVSA 2FQQA 5IAEA 5IBRA 1SC4A 4DCPA 3UOAB 3H11A 3DEIA 4EHAA 3DEKA 4PRZA 4AWBA 1RWXA 1RHRA 4I1RA 5IANA 4HVAA 4HQRA 4PS0A 4EHDA 4ZVOA 3S70A 4LSZA 2J33A 4QUBA 4ZVQA 5IBCA 5JFTA 5LU9A 4QULA 1RHKA 3R5JA 4JR0A 3PD1A 5IARA 3H11B 4ZVPA 5IASA 1ICEA 1PAUA 2Y0BA 3R7NA 2C2ZA 1JXQA 4NOJA 3KJFA 4JQZA 3H1PA 3RJMA 1RHJA 1NMSA 2K7ZA 4N7MA 3ITNA 2CNNA 1RE1A 2XYHA 4QUJA 5IBPA 2HBRA 1K86A 2XYPA 2H4WA 4JJEA 4N5DA 4QUAA 3D6FA 1RWVA 2H4YA 1M72A 3KJNA 1RHMA 4QU9A 5IC6A 2HBZA 1GFWA 1GQFA 3V4LA 4D3XA 2H54A 4D3YA 2J30A 4NOLA 4FDLA 3V6MA 2J31A 1CP3A 2CNKA 2H5IA 4IYRA 4AW9A 2Y1LA 3SIPA 1SHJA 1RWPA 3BIJA 4NOMA 4QTYA 2H65A 4DCOA 3NS7A 3R5KA 2XZDA 5LUAA 1KMCA 2CNOA 1BMQA 3KJQA 1QX3A 1NMQA 1F9EA 1IBCA 4N7JA 3S8EA 3K7EA 4EHFA 3QNWA 4EHHA 4EHKA 1NMEA 2FUNB 3H0EA 2NN3C 5H0IA 4HQ0A 5IAGA 2CDRA 4QUEA 3NKFA 2C2OA 5K20A 4PRYA 2QL5A 4ZVRA 1RWOA 2XZTA 3GJTA 4JQYA 4ZVTA 3R7BA 2XYGA 4I1PA 2HBQA 2AR9A 5IC4A 3GJQA 3UO8B 1I51A 4NOKA 4QUGA 4DCJA 1SC1A 4EJFA 1RHQA 2FP3A 1K88A 2QLBA 4NBNA 2H51A 3DEHA 2QLJA 5IAKA 4PS1A 2C2KA 2H5JA 1RHUA 3P45A 4EHLA 1F1JA 1PYOA 4IEFB 1NW9B 4QU0A 2CJXA 4D3ZA 4QU8A 4FXOA 4QUIA 4FGUA 5LU8A 3V3KA 3DEJA 3V4OA 3IBFA 1QDUA 1QTNA 1SC3A 4N6OA 2HBYA 1SHLA 4FEAA 4QU5A 3R7SA 4ZVUA 3PD0A 3V6LA 3GJRA 3D6MA 2DKOA 2CNLA 2H48A 3E4CA 4N6NA 3R6GA 1I4OA 3P4UA 4JJ8A 5IAJA 2J32A 3D6HA
chains in the Genus database with same CATH superfamily
4HX5A 1V35A 4M88A 3PFWO 1CVRA 3HVJA 4AZ0B 1P45A 1Z0KA 3PHBE 3EQ8A 1CJTC 3ITKA 2CJWB 4QELA 2DXIA 2NX2A 3O21A 1W4ZA 4D26A 1A7AA 4EPTA 2R2AA 5AJWA 2PMBA 2XGMA 5JEEA 1K7YA 4EG1A 1EU1A 2HT1A 2HK9A 2JAUA 2PY6A 2BPOA 2E3JA 3MCZA 3OQHA 3VQTA 2R8OA 2ACEA 1GZ7A 3D1JA 1R6AA 1XVAA 5CVVA 1CHNA 2AK2A 5HUJA 3UGJA 3ZIAA 4LE2A 4NEHB 4B3MB 5LWHA 2ET6A 4X8LA 1ORDA 2RHHA 3GGGA 2RSLA 4UTRA 3HZHA 4PN7A 2DR0A 2RAUA 3IILA 4FFPA 4PBSA 3D64A 2FOIA 3MCWA 1W8DA 1J90A 3DMFA 4QQKA 3TSCA 1U9ZA 1Z8HA 1K66A 4MUXA 4LOJA 1U0TA 3BD7A 1DLJA 1VJRA 4DV7B 2Y1XA 3AR7A 4HDAA 4GRAA 1CDZA 3MUNA 5L3RA 1OB2A 1USUA 2BMVA 2QN3A 3D4IA 5JYEA 1YBHA 4IV0A 3EWAA 2FUEA 1YHZA 3HJGA 3II6X 3WICA 3WR5A 1BDHA 4YCJA 1F2VA 3LRPA 3COVA 3IEMA 3RABA 1O8BA 2ATVA 2DHQA 2P40A 3F9RA 5LP1A 1EAYA 1XR3A 4P34A 1JIKA 1QIKA 2OCDA 3NWOA 1FU4A 4O2BF 4Q18A 1Y4ZA 4G41A 3VO9A 4LG1A 2CSXA 1JSLA 1OUMA 4D4HA 3M6FA 3PVSA 3R0IA 2FRDC 4U7TB 3ZLVA 4KQHA 3K0AA 2ZTSA 4ZFNA 4Q4JA 1B2RA 1BWRA 1TE2A 2AMLA 1Z0ZA 1Z88A 1EHCA 2J4DA 5HK8A 2I4LA 3G0BA 2HLPA 3A6KA 4JY7A 4UMVA 4YJ2B 3IQGX 4JXKA 3RANA 7ABPA 4H3SA 4MIEA 1V8DA 5HCUA 4DR7B 1DUIA 2GBCA 1E2QA 1MEOA 3SAJA 1G8AA 3KJEA 1JEJA 2GEFA 2IOYA 1XZGA 2BJHA 3GJ5A 3ZH9B 1DADA 2OAP1 2M6SA 2ZJ1A 3DLCA 2B5VA 4C01A 1UBTS 3NKLA 2ZBDA 1NUQA 1PJLA 4EYGA 4N54A 4DYDA 2V1XA 1P9WA 3FDZA 2AZDA 1KPIA 3GGOA 5AVYA 3K8OE 2F43B 1SVNA 2O3SA 5KZMB 3JQ9A 2ABWA 2CJXA 1AKUA 2JGIA 3W7VA 1DAFA 1UDAA 4OHPA 3BCSA 1OWPA 3JQDA 3V3KA 2HADA 4MHSA 4ZI2A 1I8TA 4OJQA 2V7XA 1L7XA 2ZFUA 2Z9DA 3W34A 3GEEA 4D8YA 4C0LA 3R7SA 2NWQA 3KPUA 2O14A 1CK4A 2WJ4A 1QHNA 3IB3A 5IRCD 3H3XA 1QYVA 8ATCA 1N2CA 1YASA 1NQUA 2ID9A 3OKCA 3P9PA 3MGAA 5B3AA 4RHYA 3WSTA 4CT5A 5AR1A 3Q7EA 2GYUA 3LZDA 2C2YA 1ZPDA 2G8LA 2FW0A 4F8EA 1QGUB 2CE7A 4BV9A 3UXEA 3I4CA 1J25A 1NFFA 2F90A 2XUKA 3UAWA 5TVGA 1DOZA 3GC6A 1DXYA 1HF3A 3D3QA 1H3EA 1DCMA 3RVLA 3WISA 5KOYA 2G36A 3CLUD 3W3ZB 2OZEA 2W58A 1N9GB 3OESA 4X0EA 2YUIA 4QGFA 4PM4A 2AX3A 1ZISA 5DISB 3DBOB 2YTZA 4KLCA 2QL7A 2BE7A 1Z5UA 3DJYA 3H7AA 3EBPA 3OIWA 3SP1A 2N3ZA 3ZV4A 4BQRA 4DMMA 2W0SA 1H6CA 4G5YA 2PD6A 1PVVA 1R64A 4RK1A 2ADOA 4ZI7A 4WW0A 2R6AA 5L7TA 2QM0A 3MCVA 4L78A 2B1JA 4L4RA 3UV7A 5IM5A 5B7QA 4N7RA 2B98A 3DTVD 5L7YA 3KBBA 3ZHYA 2I4NA 4FYMA 4OOFA 1T9ZA 2Q6KA 3D8UA 2YY5A 2RJOA 2VWGA 1FU8A 3TAXA 1ZW1A 3I4LA 1I13A 1OXTA 4IDBA 4H1UA 2NU7B 3R9KA 4YX9A 1CUDA 5KNDA 3QE9Y 5BRAA 4CQNA 5CITA 1L8AA 5IJ0B 1KL7A 3EQ7A 4MTCA 5M5BA 2VZLA 3TZCA 4XRGA 2A9JA 3LK6A 1HKUA 3A4NA 1QBGA 3NDIA 4R9NA 3C3EA 1TD9A 1M1ZA 1DBPA 2HRQA 4P54A 2Q3BA 3K9NA 3LHDA 4JSRA 1QPBA 4NOLA 2X4LA 5A4DA 3G9XA 4GR9A 1EAMA 5KKAA 3O6VA 3BSFA 4Q7EA 4XX0A 2MSLA 2NW6A 1CCWA 3A4VA 4Y2SA 1Z2DA 1WETA 3L6UA 1ODFA 4K5QA 4K9KA 3A3PA 3AEYA 3I6MA 1XCBA 3I83A 3UQYS 2BI4A 1FFBA 3OUZA 2VYND 1EXVA 1VC2A 3V3TA 1VXRA 4WLVA 4QPJC 3OCJA 1C3EA 2EGGA 1QZUA 4W63A 5ARCA 5DM70 3NDPA 3EZ6A 4MITA 4X64B 2VTBB 1T3SA 3DS8A 4GLJA 3HCWA 2NSJA 3MJRA 3PCTA 1NKVA 3G2LA 3TLXA 1XFAA 1BWQA 3SFTA 2G77B 2GDZA 4L73A 4BMCA 4B73A 2KPOA 3HY4A 5I8ZA 4WLFA 3TD6A 4MGHA 5HVNA 1W85B 2JCXA 1KJWA 1XXLA 2MHCA 4LUCA 4YRPA 3B5JA 2G63A 4MGYR 5B58T 3T99A 1HMPA 1U0OC 4S04A 1JL3A 3TJMA 4IIDA 4GI3A 5CNIA 2BHRA 2CLIB 3W5JA 1GQQA 4LTDA 3ZNPA 2X8WA 3F6RA 1Y1PA 4R9UC 3HXQA 3P45A 3HADA 1E2HA 3NCTA 3QSGA 3FCCA 4MQUA 5AM1A 3TRIA 1UWKA 2PO5A 4D9FA 1YA8A 3ES9A 3K5WA 2PU5A 5E7JA 5KWIA 1V7ZA 4PQGA 5CLLA 5A4FS 4O2AA 4KX5A 3FFBA 4AYTA 4YXWD 2WYHA 3GMIA 4NY1A 4UUOA 4Y7DA 2JS7A 1MIOA 3JD4A 4IGFA 4ZARA 4EUHA 1QHXA 5IU6A 4QARA 1N2OA 1U7TA 1UAAA 4FN4A 2EX0A 3HN7A 1SRQA 1G3IA 2OO7A 4JYBA 4ZTBA 2OTCA 2OBBA 2XMBA 4R8VA 4E51A 1OROA 2ZTHA 2RAPA 4RUKA 2WAOA 3KZMA 3TKAA 4Z3OA 2DGDA 4XSVA 4JI7B 4CL0A 4PXYA 3L8FA 4G1MB 2KBFA 1ZGBA 3NM6B 3EDRA 4DCUA 1WW8A 5MFPA 1J0EA 3E8MA 3IMFA 3WHPA 1EEXB 4CV0A 3VOTA 1I7DA 4RNCA 3PCXA 1RABA 3DFZA 1QAQA 5KYKA 1MVLA 3S1LA 2BM8A 4IRXA 1MA3A 4XRRA 3WMRA 1NJGA 3Q85A 1RQXA 3R5SA 5TMBA 2WKQA 4A8JB 1BVHA 4TLBA 2BAGA 1YDWA 1GITA 2Q0HA 4PFSA 1SPXA 2GWRA 2ZSKA 4YC7A 2Z95A 5LLSA 5FOQA 4EX7A 4R1PA 3ZCQA 3CUWA 1JYEA 5I9SA 4KR9A 5IBQA 4FMDB 1YR6A 1WDWB 1XCGB 4QO7A 5LBTA 1WWKA 1P1HA 3OU7A 4TS9A 4YQFA 3GRPA 5EFOA 4U39A 4WXEA 5BT8A 5FBKA 3Q8LA 3MTAA 4CEHA 3CHYA 7YASA 4JGBA 3ZCUA 1TGYA 4ZIRA 3CZCA 2AUMA 5DXAA 3PK0A 3IOCA 3KLBA 1FDUA 1SKYE 3Q3JB 3MGKA 3W5UA 1QONA 5LQRA 5HYVA 3LLSA 1LI7A 5CLHA 5AKKA 3L7IA 1IQ0A 2EF1A 5C8VA 5KYWB 3CVJA 5LOVF 4PC3A 4D9GA 4Q4LA 3WB9A 1OXKB 2DOKA 1ADYA 1NXVA 4Q19A 3CUTA 2FG7C 3KJNA 4B76A 2VDMB 2YHIA 3TPCA 1Q17A 4RHTA 2A33A 1N7HA 3EOBI 3R0QA 4NULA 1SMKA 3FKSD 2F67A 5J4VA 1QTIA 1GUDA 2MSNA 4EG6A 2XQFA 1K4KA 1XMVA 3VFDA 4QG3A 4K6MA 3AL2A 2Q4OA 4IILA 5E9QA 3QVKA 3ETLA 4D1YA 4JU9A 1QB7A 3FUVA 4QE3A 3O03A 1MV5A 1UUFA 5K3AA 3KTDA 3OEYA 4HZUA 4L8VA 2KJQA 4OJTA 1D2MA 4PC7A 1Y89A 3CPSA 2IYYA 5F2NA 2OORC 2XX3A 4IXTA 2RHMA 3IEPA 4C0JA 4EB0A 3QYJA 1B16A 5FOWA 4UCXA 3TIVA 3OOHA 3PNBA 3CEMA 2QZSA 3PT5A 3N7TA 4MTLA 1BXRA 4J2HA 5TSDA 1XDWA 3HVKA 3ERCA 4Y9SA 5DNEA 3V1TC 2VUUA 4G8DA 1ACMA 1QJCA 4QG7A 3TLKA 4CODB 1NF3A 1XHLA 2XTZA 4MA0A 4X7PA 3ZE7A 1MQSA 1YD7A 1ZCJA 5J2UF 1FFWA 1C4OA 3FTQA 3GH3A 1NKTA 3UJ3X 4FMBB 1GT91 2GZSA 3CT4A 3FWNA 2QLJA 1KWKA 3S6JA 3F78A 1VI2A 1W73A 3EH2A 3VR0A 1DRKA 2D1RA 2FB9A 1OX4B 4DLYA 3MRTA 2PD4A 4OHVA 3RUPA 2PGIA 4O1IA 5ALPA 1JKXA 2WI8A 1UAYA 1PFKA 4GWKA 5GGYA 5DNDA 5C4GB 3OT1B 2B36A 1II8B 3BGOS 1PK8A 4I4LA 4KXWA 3DUFB 1W0KA 4MJ3A 4R2JA 3SYKA 4MEJA 1WXQA 2Q2WA 2YW2A 2ZRJA 3A4IA 2D74A 1ZJZA 2OENG 3NEAA 3MF4A 3STWA 4C0AC 5JQGA 1L6IA 5KOHB 1G63A 1CSEE 1P7CA 2ZROA 3L41A 1E9RA 1XZCA 1FS5A 2E9SA 4M55A 3W0LB 2BHSA 4RD3A 2BGKA 3VTKA 4DDKA 1V7PC 2ASVA 2QT9A 4ESVA 2ES4A 1GQOA 4AWAA 3MBKA 2II6A 1HKHA 5A0TA 3HR7A 4MQ6A 4PSAA 4XIIA 2CMDA 3QGMA 1M8PA 5LUBA 3K3PA 4WV3A 4J29A 4AKTA 3BGSA 5IPFA 4RTKA 2QIOA 3I30X 3UAGA 4F5DA 1AQYA 1T3GA 1RXYA 1WABA 2H92A 2QAGB 1W93A 1QZTA 3COYA 2ST1A 1BFDA 1MCZA 1FZQA 4ZT4A 1QIHA 2AL7A 2AN3A 2J45A 3H84A 3AB3A 4GUDA 3T3NA 1JLRA 3OIGA 3X1JA 3RKSA 2G0TA 4MYRA 1TVEA 1EFCA 4IIJB 3BSSA 3L02A 4MS1A 1XZEA 5FQOA 1MT3A 3LOUA 4JDPA 4P4SB 1G7TA 4ILEA 3K2EA 4O33A 4E0BA 5KSYA 3WGMA 1N92A 4OU5A 3UXYA 2VJDA 1KMIY 5CNKA 4ZEWA 1FL9A 1N2ZA 3EVBA 4BATA 4Q93A 3DVSX 2F17A 2CLKB 4WZZA 3THRA 1KQGA 3ZIDA 5KJCA 1JE1A 2IYNA 2DR3A 4DWOA 2IIBA 5A9RA 2OR3A 3H1EA 4HD8A 3KVVA 5UKDA 1MHPA 1ADGA 4J1TA 5CVTA 3IBYA 1EZ4A 3OX2A 5CM8B 2FMKA 1RWVA 1U9IC 3RARA 1KZYC 3E05A 1KJZA 4I50F 5IF9A 4YDRA 3F3YA 3LA8A 2A84A 5H83A 4FI3C 2YNMC 3QQ5A 5D1NA 1Z56C 1ZI9A 1FX0A 5LMZA 3FWYA 3VKGA 2EZ9A 4LV6A 5ER9A 3AVQA 1YDGA 2QPAA 2WFMA 5FWNA 1UBOS 1TX4B 3Q8MA 1VSBA 4O2AB 1HT0A 2I6QA 1FQKA 2FUG1 1X0XA 2QRLA 3EXG1 4KV7A 4O1MA 1RRCA 1FNBA 4XLZA 5EERA 1COWA 1NAIA 2ODAA 3QOWA 1O6FA 2G1PA 2J0SA 1NGSA 3R8XA 3I9MA 2RHJA 4LTNA 3LQQA 1LVHA 5PGMA 4XGIA 3R8CA 4R6XA 1I6KA 2C5LA 2ZTMA 3FDIA 3NV9A 2ZKIA 2FOXA 1BA3A 2Z8XA 3ZHVA 2BISA 5CFPA 2P3SA 1GPH1 2EYQA 4H7KA 3SKVA 3O8LA 3UH0A 1UDRA 1JG4A 5JJCA 1YOVA 1SC1A 3WXMA 3ICVA 1FW6A 1E1QD 2F6RA 5BO5A 5AQ1A 1XQWA 1EDBA 5GVRA 4N03A 3I2GA 2ZATA 5ER6A 1VHTA 1JFRA 3O3CA 5KTKA 3FNHA 1M7HA 3RIHA 1SIOA 5BSUA 4FXOA 4E15A 2DULA 4UW9A 4Z0TA 1F2TA 5C8DA 2UZAA 5BN5A 1JDZA 4GOXA 3SYRA 3UPUA 5TS2A 4YP5A 5E4FA 4YAGA 5HJ7A 1NQVA 5AK6A 1GEGA 2A8YA 3FMIA 5LQUA 3TBHA 1TB4A 4JLKA 4OI4A 1DC4A 3N5CA 4WJKB 3H5LA 4KE8A 3RRFA 2ZJ6A 3ENQA 3ZCPA 1NU6A 2PT5A 3WQSB 2R0QC 3FETA 5ICEA 1UOOA 4WUVA 2INGX 1N1EA 4Y2VA 3U9LA 4O4HA 1QWSA 5H3LA 4J76A 3ZXIA 5AM3A 5HZKA 1NNEA 1X1AA 4X54A 4JNKA 2C94A 3HA3A 3U2QA 4BO9A 4JXZA 1DG3A 1PHPA 2MSKA 3EN0A 4D6YA 1CJUC 1FRNA 3DTVB 4DE5A 1LPPA 4DPKA 4F9FA 1KH1A 4KXYA 3ONNA 5E8RA 2V5UA 3DXYA 3VU3A 5FA6A 4ZI3A 5BVHA 3KZXA 2XY4A 2ZB2A 5BR4A 1UF9A 1K27A 2WHXA 3OFSA 3AR3A 3E4DA 3HDGA 2H4XA 3IIMA 3RO7A 3VKVA 4J3NA 1IY9A 4MMZB 3WRVA 3IOEA 2ZUBA 3NPAA 3BBLA 4JCOA 4MVWA 4IVRA 4RZIA 4UULA 5E6RB 4BBZA 2V3CC 5FD8A 1EFPA 1WVMA 4U0KA 4J0HA 3CY6A 3ZWWA 2DPYA 1U8ZA 2E6KA 4HCJA 2V7EA 1XF1A 2V58A 4C1NA 3M8KA 4ENSA 4ZVQA 5JSQA 2Z8ZA 3KQYA 3QA3E 4QULA 5ELLA 2I80A 2E37A 5GIPE 1PJ8A 2NZ8A 1YS6A 2C98A 4FJ1A 3ZYCA 2BBTA 1HFWA 2IDZA 1PGQA 2HDWA 4H17A 1A9TA 4HNSA 1Y7IA 4TXNA 4YACA 3SD7A 3WLNA 2VDWB 4D79A 3DC7A 3E15A 3KQSA 5BMVF 2WUDA 1RKQA 4N3NA 2PLFA 1KJ9A 3PEVA 1P2BA 5JPDA 4AU1A 2WPDA 4F9TA 3DHYA 1OZAA 2CKDA 3AEZA 3JQBC 4MEBA 4JLNA 1KHHA 3LYLA 1GILA 3MFYA 3VVLA 4JI4B 3JQEA 3ORHA 5FPHA 4PLGA 4WZBB 4MV4A 4YWJA 1H8HA 5D1HA 3J80A 1INLA 1TUEA 3H1FA 1V3TA 2IBMA 3IUQA 3L79A 3NOQA 2EW8A 2FWJA 2VP2A 5TLSA 1TTTA 1E1LA 5CVCA 5K2MA 3CJQA 1OW3B 3DLIA 1AO0A 2IYSA 4QIHA 5K7SA 4RK4A 2E2WA 2H1HA 5J2TF 1DV1A 5BV2P 3H4MA 3ROQA 4EQ6B 5LZ9A 2V7WA 1ZC4A 4DDMA 1QF9A 2QI9C 3A9CA 3N2YA 5K0LA 3F3MA 4ERXA 3LBIA 4MLZA 2CVQA 3JATB 5CDFE 4HAVA 1X1SA 4CQMD 1L5QA 5L3SA 1XTSA 4NQRA 4QSHA 1DFGA 4LMAA 3G85A 2G72A 1CR0A 1YQTA 2GJ9A 4O4IA 5KYWA 3P2IA 2FPSA 4PZZA 2VP6A 3ZY3A 4CUJA 4DQUA 1FYXA 3FBWA 3MXOA 2J3KA 2YHUA 4DR1B 1L7EA 1OBVA 1SCKA 1C3VA 2QN6A 4N12A 4YS6A 2XLBA 5LZ8A 4CFZA 1R8SA 2F3RA 3SC2A 4ZYVA 5HR5A 4RPLA 2YXLA 2BEWA 4PR0A 1T5LA 2PG3A 3G8BA 1BXGA 5BWCA 3VNQA 1DWOA 3SF0A 4F21A 3RUCA 2XCSB 1QVAA 1JNYA 2B4KA 4P4GA 3C41J 3GYGA 1RVV1 1E60A 2GKOA 2XWJI 3H9CA 4F3YA 5KOJB 2V7GA 4LDJA 1SA0A 2Q5JA 4OKSA 3T9FA 4BJHB 2XRMA 3AVVA 2FY8A 1U2RA 3ZXSA 1V3QE 4FGUA 1ZIYA 3IDSA 4EFLA 4YRKA 2NYRA 2YZMA 621PA 2AN5A 2LWIA 4LZJA 4HAXA 3L7OA 5CEJA 4B4OA 3CVUA 2AJTA 1MQ8B 4YV2A 4H6VA 2EFEB 4P82A 2WM8A 4UM5A 4HNRA 4P3KA 1FPQA 3P4YA 1OTYA 4CVNA 1OMOA 4Y2UA 3IT2A 2ZWMA 1M67A 4DRXB 1IVSA 4I3FA 2IH2A 3WRXC 4BP3A 5LXTB 3V32A 1UPTA 1YTLA 2XA1A 3PNSA 4YI5A 3T9EA 2O8FA 4CV1A 1YB7A 3LPAA 5I47A 2C20A 4HRYA 2CFIA 1LV8A 3GQBB 1RWNA 3ZWVA 3OZVA 2VQEB 3OQJA 1PLJA 4F04A 2VQ6A 2DWOA 1P31A 3RW9A 1RWMA 1NZJA 1IQUA 1I30A 2JEOA 2HJSA 2QE6A 2VLBA 3LXMA 1CB0A 1MABB 3HNRA 3ZZTA 1WF6A 4H35A 2FX3A 1PTKA 2X1MA 4CETA 5JAOA 2R11A 3JALA 4HWTA 4K46A 4PZDA 4PPYA 3HSKA 2ID8A 3PR3A 2G82A 3VH1A 2P7HA 3RYHB 1KAEA 1ILEA 3VR2D 3AUFA 3M2PA 1T1IA 3DFUA 4NKRA 3EEBA 4PG6A 1K4YA 1PR3A 1T6XA 4FVTA 1PK7A 2YHSA 3H1PA 3IVRA 1L5HA 1EESA 4XCVA 1GGNA 3UY4A 4Z51A 4CLDA 4QGAA 4CLXA 3DAOA 3I9FA 4Q15A 2OORA 1E9VA 3U09A 3AJAA 5CAEB 2Y0EA 3I2FA 2BTOA 1T9KA 2WFLA 2IWHA 2UDPA 2B83A 3ZW7A 1FTYA 2Y92A 1B76A 5K8LA 2C88A 3JQ8A 1XDZA 4N40A 1Z07A 2RGUA 3K0KA 1I6LA 1KS9A 1XKXA 5G1NA 4TWAA 3ZXUB 5FWYA 5AFSA 3ID6C 5AUOB 2GAJA 2OQRA 2DY1A 3KX2A 4ND2A 4IJUA 1ONBA 3HDQA 4D5EA 3TF5A 5H70A 2BFAA 1AGRA 3DT9A 1POXA 4MO2A 4UMFA 1QYDA 3I1YA 1U02A 3P2KA 4U8GA 1PR4A 1JU4A 1XTVA 3IBTA 4IOKA 4XEUA 3G1UA 5BYJA 3C5EA 1VMKA 4WFIA 5A3RA 1DIAA 2NXCA 5CBPB 1G60A 2H1VA 3DE6X 1SZJG 2XYRA 3M3PA 2CXXA 3OUUA 2ISSD 1NBHA 4ZA2A 4PICA 3ZQJA 3KFLA 3RRYA 4C3OB 4TV9F 1RXWA 1O4WA 3Q3EA 1K3UB 1ZMBA 4ZXPA 1IATA 3UNXA 3U5ZB 2BSAA 3JD0A 4TUYF 3GEBA 1EEHA 2LW7A 4TLCA 4ARUA 2CXRA 3F8WA 3IVMA 1A72A 2HF9A 3BHMA 4ZZ3A 3L8YA 3B20A 3GQVA 3WK9A 4EJFA 4EGSA 3KELA 2IYXA 2A0KA 4BLWA 5JMTA 4IXMA 3NBYC 1NVUQ 2P2ZA 1JHDA 2P9YA 1F1JA 4UU7A 3UICA 4Q7QA 1RJ9B 4Z7QB 3SBXA 3O1JC 1ZO8A 4CKCA 3TQHA 1ZN7A 2LGJA 4KBFA 3WZ2A 1MXFA 2OGUA 3W06A 5JH7B 5HCIA 5DHPA 3X0DA 3EAFA 1ZGJA 1ZONA 4R9SA 3E9RA 3CA8A 2HHAA 4J0FA 1NURA 4ASUA 2LIPA 1QNLA 2MYTA 4OHUA 1NBMD 2UU9B 3E9EA 3DOIA 3F90A 1Y4UA 2DSTA 3SS9X 3HKCA 5C31A 5I9TA 2FN4A 4DSAA 5E6UA 3SLRA 2I54A 3BJMA 2ZANA 1HX7A 1C8LA 1TQHA 2QLMA 3NHJA 4XTCS 1J8MF 2JI6A 4GOJA 4HOYA 5SICE 4EHNA 4R1OA 2IPNA 5F21A 1ZHFA 4OQEA 2IHJA 3V55A 2RHGB 4Y6SA 2X2EA 1MO4A 4BNHA 3O84A 1D3AA 3NUQA 5C7OO 2ZJ8A 1EFHA 4CKYA 3AJ8A 1NA5A 3CF0A 4J9VA 4OY3A 4R1MA 4IMIB 3RYFA 2I03A 4NFHA 1FQOA 2A5GA 1YCDA 2HV8A 4HGQA 2YDYA 4DQDA 1DMSA 1WG8A 2FWRA 2VA8A 2ZE6A 1Y1QA 2OA0A 4ARAA 1KPGA 2ONZA 3FYTA 1KKUA 2GCGA 4MQEB 1XDBA 4ZVOA 1J6UA 2NVBA 1R4AA 2WUEA 2Z57A 3EEIA 4FOOA 4HAOA 4GPBA 4MI6A 2ZJZA 4YAUA 5DOZA 4MLPA 3IAFA 3Q5EA 5ICGA 1GU7A 1N2HA 4Q7JB 4AYXA 1GLGA 2REQA 1JFFA 1EP9A 1PK9A 5DHRA 4GOLD 2I99A 4UHBA 2M6LA 2Z2YA 1ZLXA 3CNBA 4DVJA 1FYWA 2VHJA 4RJTA 1HM5A 1LSUA 3PA8A 2JLCA 1D8TA 3GLHB 2Y1GA 2JJ1D 4O4LF 4DYHA 5BVGB 3NDBB 1B43A 1LW6E 1FP4B 1U3TA 2GH1A 1N2JA 4H4CA 4HJRA 4ZQEA 1XZ8A 3FPLA 2H08A 4HH1A 1YAHA 4B75A 2BZ1A 4LMRA 1ZQ9A 4R0NA 3NBZC 5KVVA 1PQYA 2WD7A 4L07A 2Y1LA 2OFPA 2RGCA 4XAQA 2NV0A 3QUSA 4RETA 1VCNA 2WU1A 4BZQA 2CV0A 1CR2A 3PC7A 1K7CA 1DRUA 4OFXA 5JE8A 4B2LA 4CQLA 3O8NA 1MO5A 1TEXA 3O9ZA 4RIEA 2OZKA 5DLQC 1NIJA 4LNUA 2JLQA 1CRZA 3NOOA 2OXRA 3TDNA 4TQAA 4M7RA 1J9ZA 4CM1A 5E3HA 3LJKA 2KS6A 3W7AA 4JT4A 2YQ5A 4ENUA 4NJMB 1RKBA 3NONA 1TLLA 2PJDA 4C7VA 3D1VA 4EJSB 2V9CA 3H17A 4RMGA 2ISCA 3BORA 3PFFA 5A7GA 3PFGA 1MABA 3RUFA 5IJ9A 3OPYA 3LVQE 4I08A 3PUWA 4IH9A 4I50B 4A4DA 3QPBA 4X1KA 1XSEA 3ZZMA 1SC6A 2R68A 1LTHR 2XEXA 3NGMA 4GGOA 2ZRNA 2QD2A 4GZ3A 4TMTA 1XTBA 2YFYA 1QVWA 1VMDA 4YRAA 3IUMA 1PZFA 1U9IA 4AX8A 4FT4A 2GETA 1PYOA 1ESMA 3R75A 4HUTA 1L8QA 2QXTA 4L74A 5ENZA 3ZE9A 4KQGA 4B33A 3WKCA 3T1YB 5KYVA 3PC2A 5DYGA 4CIXA 3EAGA 1THZA 2ZRCA 2NT4A 3K1ZA 4K3VA 4ZCSA 4P58A 1M6VA 2I34A 5M34A 3KHSA 4H2DA 3V4RA 1EQAA 1ADJA 4WPGA 4RZQA 5IDWA 2Z2KA 1CS0B 4XIFA 4XCXA 3QG1A 3UAVA 3OCUA 3LVBA 4EBFA 3W3AA 1ZD9A 1M5TA 3TLJA 4NG4A 1F4VA 1KNXA 1NBIA 3A28A 3G5UA 5EQDA 5HJ5A 3CNOA 3K6RA 1NBAA 3RAPR 3SJZA 5CEEA 3ZWKA 3OT4A 1VMAA 1XZQA 5KQSA 1W35A 4DCSA 2JAPA 2PWBA 2V6FA 2QTWB 4FKMA 1GNQA 5C3MA 4ZC8A 3FKSA 4OBEA 4YJGA 1EK1A 3AEKA 1X1TA 1JXOA 2CJYA 1Q7GA 4GI2A 4LF8B 2HIMA 3VH2A 1KO7A 2RCNA 5I3ZA 2WNSA 4JWKA 1W0JA 1XN1A 3T38A 4JUIA 3Q5GA 1E3IA 2VSYA 1NVMB 4FNGA 4RW0A 4UATA 1FJGB 2ATXA 2ODWA 3CONA 3QIAA 4LCBA 3HCCA 1UFVA 2YWRA 1D0SA 3SCZA 3GT0A 4GAEA 1PFWA 4KWIA 4DIDA 2QQ5A 5CU7A 1TMGE 1QE0A 3K92A 2OBFA 4QQFA 5I7AA 4KH0A 4MJXA 4UM8B 3EY9A 4YWHA 3SQWA 4LIPD 2J3JA 3R0JA 1NUPA 3ESZA 3SM3A 3JAMA 1GFIA 4LHEA 3SICE 1K1EA 1MDFA 2QTVA 1RKVA 3QA9A 2HWXA 4BX8A 4CCAA 3TQQA 5CLJA 1HO3A 1NVFA 3ZUPA 1IZ0A 1DX9A 1UP4A 3MJDA 2R4QA 3ODPA 4FIDA 3GCXA 4PAMA 2OK8A 1SVIA 1MOPA 2NU9B 4QODA 4EATA 1ESDA 3TLGA 4L5IA 2DM6A 2DYKA 2V74B 4IQ0A 1VA5A 2O2GA 4KQ6A 1LWNA 2B30A 2C3PA 2XHEA 3JAWB 4J75A 3FPSA 4ZI7F 4U9IS 5HTKA 3NJ8A 3TMKA 2AZMA 3LPCA 4GECA 3KSZO 3VSCA 4A16A 1O6GA 4J4HA 1J06A 3BXFA 2FQYA 4AJPA 3V1NA 4AJOA 3ADBA 2O59A 5EP1A 3OIFA 4GU5A 4W5TA 1A0OA 5B2EA 4N3GA 4Z0NA 4NYMQ 3TXAA 3VISA 3U3MA 4GWLA 1N2SA 3GBPA 2P1ZA 1XU7A 1VJGA 2ZIUB 3DOFA 4RQBA 3RSFA 3G8AA 5BSTA 1D1SA 2BFFA 4DCOA 3CRQA 2C4VA 2Z8YM 1X9IA 5D6OA 1Z3IX 4V0OA 3B9QA 5C18A 1RYYA 3QNWA 5AI5A 3D3JA 1IWOA 3MLEA 1JVNA 3E23A 4OQNA 1K92A 3MFQA 4PLTA 3STHA 1MQAA 4BKOA 3M82A 1HE3A 3AHJA 1JDPA 4ZDKA 3OCCA 3VPXA 3LAWA 4YRCA 1ZBQA 5BSEA 2ODBA 1UIRA 5I5EA 1Y82A 1G2PA 4WOCA 2D5BA 3LO8A 3ZZUA 1H05A 2RGNA 2ONCA 2OXIA 5JTTA 3I73A 4EKEA 4MW5A 2EARA 1LY1A 1X38A 3WMFA 1KH2A 1FUKA 1A88A 2WT8A 2I0FA 1MGPA 3U7RA 4DUGA 1Q57A 3HVIA 3SC6A 2FWIA 3HO8A 4G86A 1RYFA 5CBPA 3DOJA 1R00A 3PA6A 1CQZA 3ND8A 1EHIA 4OJMX 5DM2A 1HFJA 2H0RA 2WD9A 4FGWA 4U4AA 4I1UA 1GPAA 1LLFA 1N0VC 2OE2A 1TQ8A 3QFCA 1UP7A 4LE0A 2FWAA 2BVNA 5CRIA 3GFGA 2GPBA 4J3JA 2Q4DA 2YJNA 4DR4B 1KVRA 1NQWA 4I7EA 1XU9A 1ZCAA 4J4BA 4FN5A 1B6GA 1GZHB 1TM7E 4MR8B 3K32A 4MQBA 4S0XA 1I1OA 3I72A 4B48A 2PSSA 1Q6YA 2JD2A 1AUOA 2ZR7A 4GOMD 3H2YA 5L6MB 2C04A 3ZBUA 2LR0A 1HLPA 1Z17A 3D7RA 1FEZA 3INRA 1T8RA 3PFKA 5EIWA 4XYEA 1CRQA 3HYRA 5CB4B 1AHPA 3ZDCA 2C7BA 2H06A 3V8VA 3B1JA 4UHHA 3FF1A 1ZK1A 1SKAA 1YRAA 4UHKA 4DEXA 2DHCA 1JR3D 3RTGA 1L4GA 2QN7A 2COEA 4OA5A 4S1NA 3OHSX 3UJBA 4CG0A 2C7QA 1XPRA 3H7IA 2Z3WA 1GQYA 1QM5A 3ZCTA 2K2QB 3QOXA 2O1WA 4JEIA 3TX2A 3SIXA 2GEKA 1A9RA 4TSKA 2FQWA 3WBFA 1M10A 5EUBA 1JYSA 2B8EA 4YHHB 3ZS9A 2QUKA 4YJHB 4R1UA 4OOEA 2K87A 4LJ9A 5CLGA 1BN6A 4LJ5A 3A7DA 4BGIA 1ECBA 2Y68A 3RSGA 3U5TA 3D1LA 1ZQ1A 2OBMA 4UBMA 1LJ8A 2WU4A 3IUPA 4U2KA 3BKXA 1RXUA 3SEAA 3VO1A 4B2PA 4C07A 4WESA 3K94A 1Z06A 2GT1A 3DA8A 5I01A 4OQQA 3OPNA 2AJLI 2ZAOA 2QUJA 4QVGA 4O4HF 5TPZD 2ZRQA 4KYUA 1KI9A 2G4VA 3VR3A 1GZ4A 1M72A 2QYHA 2WM2A 3OLXA 1GGVA 4R2IA 1E1CB 4OG2A 4WGGA 4WCDA 5T4FA 3CWCA 3PX7A 4K9RA 1W0CA 2IKQA 3E8XA 2XB2A 5HE8A 3KAPA 2AOUA 2P5TB 4LI3X 4XI9A 5K6AA 4WADA 3SN6A 2P0EA 5BSGA 3DPSA 3WDLA 4E33A 4RMJA 3UH1A 3L8EA 2OHVA 3B5IA 4B0PA 3EXHC 1RWPA 3O2JA 4XQ9A 2CFTA 1V96A 1LF0A 4UBOA 4TXHA 4Z4HA 5L4NA 2IGTA 3S2SA 1DARA 3AUJB 3IRUA 2ETXA 4K8RB 2WTUA 4D99A 3UAXA 2QHXA 1V0JA 4JODA 4PO8A 1QIFA 4MQFB 2R1VA 1PZNA 3EFBA 3GDWA 3NKFA 4PVCA 5DWVA 3SDBA 4DA7A 5KHLB 2GA8A 3ZVRA 1DQSA 1S7CA 4IMJB 4YPOA 3JQRA 5JFOA 1EG7A 3FYSA 3UHPA 4HVCA 5J47A 2GFQA 1CY1A 2V7QA 1D1PA 4KGDA 3UT5A 3ZWAA 2HX1A 1LQ2A 5KNCA 1VHWA 4DUGD 2QRVA 1SU6A 4KE9A 1XB2A 1OBCA 1JLLB 3KFVA 1A76A 1UBSB 5LQJA 1EUCB 1JQDA 3L1HA 2VPZA 2C2XA 1I2DA 2HJHA 3KPWA 5I4CA 1TKRA 1AC5A 3D54D 4FJ2A 2ZK7A 4JKOA 3D5QA 3MJTA 4X91A 5AKYA 4DDWA 5H8WA 1SHZA 5A4MS 1P81A 2EIHA 3V97A 4G0OA 1V5GA 4HQLA 3KWFA 4RZ3A 3V6LA 1BWPA 1FFXA 5C8YF 4RVUA 1QUEA 4P9NA 4UTXA 3KXDA 2PLWA 1ECLA 1PFVA 3CTPA 2O2ZA 2BCJQ 3BMXA 5BYAA 1OT3A 4Q3CA 1OPXA 1UBLS 2EW2A 2YFQA 2PMFA 1E9FA 4TV8F 1JA9A 2AOXA 2JGMA 2W6OA 3ER6A 3JPYA 3LO5A 3Q3IA 3PBKA 4XZ3A 4EGQA 4YRIA 2BOVA 4YMLA 1BRTA 4TV8B 4ALIA 1EFAA 5IJXA 1CQWA 3I01A 4BO1A 1MB3A 4IIJF 1L7BA 1X1QA 1N9ZA 2AFIE 2X13A 1FC0A 3LX8A 5CLFA 1FYDA 4UAJA 4P0PB 2SICE 4H3HB 2P8SA 4GYWA 5H59A 4NFYA 2IEZA 1FYEA 1X7ZA 1RLJA 2P11A 3GJ6A 3T95A 1WP9A 1KY5A 2M9MA 3PRKE 1ZD8A 5E6SA 1I7QB 2CLEB 1OVGA 3DEIA 3QKRA 4LRUA 4OKIA 4AWBA 2KSQA 2X8JA 2O8EA 5GM1A 2PM8A 3Q1LA 3C3MA 3ZWPA 3CZ9A 5LQAA 2X4DA 4MV6A 5ALKA 2GSWA 5LJLA 3JARA 1ND5A 1E1NA 3VKUA 2ZBGA 9LDTA 3HV2A 4BLPA 1DJMA 3DMPA 1P7ZA 1VFNA 2P78A 2RHWA 1F2UA 2FFQA 2UAGA 3H8SA 4YP0A 1PS8A 1L7MA 2VJMB 1RLIA 1W4BA 2X9QA 5E0KB 4XQGA 4HATA 1RZUA 2G0AA 1P4HA 2O1EA 2IP2A 1T8WA 4IRUB 4W7SA 4XLTA 3HLTA 3ILYA 5AUPB 1TAQA 3DZFA 3CUUA 1TFRA 2EKPA 1NZDA 3TGPA 1KZ4A 4UMEA 3S2FA 3KKOA 4KDEA 3ZK9A 4LDRA 1RHMA 2VHXA 3VPFA 1ZD1A 1TW3A 3ANSA 1I3MA 4PYRA 1HYGA 1XJ5A 5ILQA 4NYIQ 5YASA 3ADPA 3BH7A 4RENA 1KVUA 2CSUA 2EWWA 4JK3A 5HHTA 2W0MA 3EASA 5JAUA 2Y76A 1JSZA 3L5KA 3LCJA 4IQ4A 1RAIA 2QTGA 4HQKA 1VLMA 2XNHA 1RPZA 3CEAA 2HIHA 2J3EA 3R5TA 4E2WA 2NU9A 1J42A 4HL6A 4K88A 2AI3A 3FH0A 3WRYA 5CB6A 2DFPA 2OECA 3LYAA 4K0RA 2C7GA 4NBSA 2CVFA 1ORTA 2ORIA 1Y7TA 2QRKA 2XEDA 3LP6A 4GBED 3PHJA 1DC7A 5IZCC 2OK7A 1QBKC 2VS1A 2V45A 4KUEA 1DKMA 1XEXA 2CDRA 3IJ5A 5G2OA 5BUSA 2QGZA 5K20A 1G3MA 4ZVRA 2X6QA 3WLIA 1ONSA 3NIFB 3B9PA 1N8KA 2NZUG 4JBIA 5LQCA 3PICA 2VQ3A 2XMQA 4CL8A 1WD5A 4LJKA 4RGQA 4X6YA 4QAJA 4CQMB 1DAPA 3B8HA 4QO8A 4AKGA 2RI0A 1RHQA 2AOWA 2GK4A 3E22A 3IMEA 2J6BA 1BDBA 1V5EA 3AXTA 2CW5A 5L8VA 4BKUA 3A37A 5BWBA 4GI5A 2AQKA 4NZZA 4EOGA 1P17A 4ETIA 3OTWA 4QUIA 3RRBA 5EKXA 1SXGA 2QQFA 4QRDA 1A4IA 1W29A 3UGKA 3IAM6 3BZUA 4I1OA 1JKJB 4C7OB 1KIFA 2FSPA 1XCJA 1K3TA 1EP1B 1YT5A 3ECSA 3IV9A 3HO6A 4KQ2A 3T9BA 2ISQA 4ZQFA 2PUEA 3TD9A 2GEJA 4PGHA 5T57A 1PNOA 4OFWA 1T6YA 3HCPA 2DWPA 1OZ0A 5ANRB 4BU0A 3GUVA 3Q3VA 3V4SA 4DQKA 3GMSA 4MUHA 4AMBA 1XKQA 2L19A 4HEQA 4IFTA 1SUPA 5DH9A 2IEDA 1E1YA 4X1IA 5JJLA 1SK9A 3I42A 5TMDA 4XVUA 2XMZA 3AHIA 3BMNB 4N39A 1WMSA 1MJGM 2WP8J 3F71A 3HSSA 1U1GA 1EQUA 1HDRA 3IOYA 3KAKA 3PD7A 1DEKA 4LFCB 3SF8B 4IGKA 1NN0A 4XB6B 4DT1A 2ZQZA 3L1IA 3IO3A 4G4SO 4Q82A 1T5DX 5AI6A 2ZB7A 3CGWA 2X0RA 4BV2A 3IBCA 4KXQA 1AMNA 3DTVA 1W9HA 3X1MA 1EWYA 5BUQA 3PJGA 4CMHA 4IEIA 3E1SA 4MJ7A 4ID9A 4MRMA 3WX0A 3DH0A 4XH9B 1R0SA 1AQ6A 2C3YA 4XM2A 4HDMB 5JS8A 1CEEA 4WBXC 1MH1A 3K0EA 3N7UA 1TT7A 3U49A 3K30A 5HBGA 3GN2A 4ZAYA 4GQIA 3OQIB 5FHQA 3ZHRA 1WOMA 2GPJA 2PS9A 3DB1A 4YAFA 2R6ZA 2R96A 2YWHA 2WLSA 5DM4A 1XVLA 3CCBA 2HCTA 5FI5A 4CKWA 2R6DA 3AGPA 2XB4A 3GLGA 3QUCA 1G20A 4BJ3A 2XJ9A 4C3UA 2XBUA 2XWSA 1HL7A 1TMOA 2ZJ0A 1K86A 3OZGA 1JUDA 1Y63A 4QL3A 5FB3A 4RTMA 3IA7A 3MMXA 3PEUA 2ZSEA 5DBGA 4C5AA 4FLMA 3WYEA 2J08A 3N2KB 2QRVB 5PNTA 2YS7A 3SE7A 2QNRA 4DXAA 1KI2A 4F3RA 1OXBB 4JJZA 1JQAA 3C3BA 4H3VA 3KLPX 3IP1A 2K2WA 2PRIA 3EQZA 4V0LA 4X1KB 2BDUA 3S8MA 3KLNA 1RBMA 1IIBA 1E2NA 3WGZA 3R6WA 1Z6ZA 4LWQA 3QK7A 3VSAA 3FJ1A 2PWZA 2XMSA 3A7EA 1L5NA 5EE1A 1HURA 4YUVA 3HR8A 5JH7F 1NBMA 4PU0A 1AK2A 4U0JA 3KR0A 3EPKA 2IZ1A 3H2ZA 2B7BA 3KKMA 1P6QA 2VR1A 4WBSA 3VYRB 1KAHA 2FPGB 4D9NA 5C35A 2P77A 4BGDA 1H3NA 1WDKA 1S2IA 4YGYA 4HQNA 2QW8A 1Z12A 3HJRA 3S68A 1EBUA 2EBHX 1FJHA 5I4BA 1T5IA 5CVJA 2FUKA 3WQBA 3SIWA 1VA4A 4QOIA 1WMFA 2CFSA 1FXUA 3NHUA 2PUBA 3HTXA 1K2VN 4RHCA 1WV0A 2F9MA 4OK5A 3MIZA 3GPBA 3U39A 4EUSA 4P32A 1KU6A 4R05A 4TMVA 3H5WA 3A3KA 3KYBA 3OFJA 5IVHA 1XA4A 1YJAA 2H2AA 2J0UA 2R6JA 3DP9A 2I71A 3C15C 3QEBZ 2C8VA 2ILTA 4BQFA 3U4DA 4CLRA 2QQ0A 3UK7A 3PU6A 1IY0A 1A8QA 2LE0A 4IP0A 1Y9AA 2H1CA 3KKEA 1JP7A 2Q9CA 4F3NA 1LH0A 4RDIA 1Q2UA 4S05A 3RFTA 4W5HA 1UK8A 3ZKAA 4CKXA 3LV8A 2I1LA 1PV1A 1E7YA 1YZQA 2OAQ1 3NBFA 3NNDA 3IUBA 3I28A 4UTNA 4GKJB 1L4MA 1RRVA 1MFZA 4YQZA 4GC9A 3T3MB 3MJCA 4N5MA 4AS3A 2C31A 5DI9A 5ALGA 1YK0A 4P3YA 1J7KA 1PDVA 3IE2A 1VGRA 3C24A 3ICEA 4XX1A 5DYNA 4WZBE 2X0KA 1C4XA 1DDOA 2PT6A 3WL3A 1JDUA 5AKJA 3EIUA 2QK4A 4R71A 5LNK6 1NY5A 1KXJA 3DEAA 1MA0A 1HQYE 2YY7A 1PHRA 1V7CA 3R24A 1XYVA 4X41A 4WGFA 4WVFA 3U3DA 2PAFA 5F1KA 3D81A 1UBMS 2P1DA 4I4CA 2J0EA 2MYUA 1DTWB 2N75A 1T6ZA 3OWOA 1C3JA 3NUGA 4RJJA 1OLSA 1P1IA 4DSUA 3PGXA 8ADHA 3RSLA 2FI1A 4JGGA 1ZGAA 4KIGA 4R7TA 2YVLA 3E61A 3PLRA 3QTTA 1IAVA 2Z1DA 1PBNA 2WG2A 1FP1D 2WJZB 3K9FC 4EO9A 3E3OA 3VNRA 3C70A 1N3IA 1VSVA 1UZAA 4OXXA 5KNDH 1SVMA 3MJVA 4C89A 5DBEX 3PE3A 4DIOA 4IGEA 1GGEA 2HZ7A 4PLFA 2BEVB 3FE2A 4ZZIA 1P2UA 4IKOA 2XDAA 5KJ1A 3NYRA 2DUMA 4ZKEA 1BSVA 4B8ZA 4V0QA 4OHYA 1E94E 3OG9A 2KYRA 4RPCA 5FPYA 5TQ0A 2BI7A 1TCUA 2FPLA 3HDHA 5CB4F 3Q7TA 2Z5GA 2GARA 4PNHA 4WNIA 5ALZA 4EA6A 4AJLA 2BGRA 3PJDA 2WHEA 4PLCA 5AJUA 5U1PA 5DGIA 3PZBA 2I8CA 3JU3A 2FDXA 3SR4A 1H1TA 5BN1A 4ZQHA 4IMRA 4JBXA 2FCAA 1P0CA 1Q83A 1NE7A 1TA9A 3G5TA 3CSSA 3GLKA 2ZZKA 3TL3A 1GYQA 1DO0A 5AJXA 2G5GX 5AHXA 1DCKA 2A2ZA 2VHVA 1EQ2A 2P4UA 1EFVA 3SJUA 4QQRA 4EG5A 3EXFB 4EHFA 3NBQA 2H1IA 4YR7A 1Z8NA 4U3JA 4IDCA 2O6LA 1W46A 4CR8A 4F71A 5IVKA 1OT5A 2RGEA 3BD8A 1JEOA 2DVMA 1RZVA 3G17A 3PE4A 1DCFA 2P4EA 3I05A 2VC2B 1RPAA 4D8WA 2JIOA 3I2IA 5DKFA 1K7FB 3FZNA 2FSGA 2V3WA 5JAIA 2Q62A 3GMTA 3HWRA 2XIQA 3O38A 1PJAA 1VHLA 3CNQS 1DQNA 2DG2A 3A6GA 3FFAA 4KPGA 4R8SA 4R5MA 4YA6A 3BRWD 5HGXA 2YJ5A 4G1FA 4KHZA 3E27A 4CKEB 3S1SA 2JGNA 4I6JA 4QJ4A 5AWFC 3ZQKA 5L51A 3GGJA 5A6SA 2AH5A 1SELA 2UUOA 2XWBF 4IIYA 5FO0A 5TMEA 3OMXA 2QD1A 1TADA 1Q0QA 4WHMA 4WFJA 5I5GA 4KE7A 4ZWNA 5EHZA 1U2EA 2IF2A 1Z0FA 2O7NA 1PT8A 3DE5X 2X3FA 3TKLA 3KOWA 3NEPX 5AVXA 1WHTA 3QE3A 1XELA 1BDJA 2VTVA 2ZUVA 3HI4A 3BKWA 4JVNA 1ZRSA 3QU4A 1DC3A 4YIKA 1SQ6A 3DULA 4KL8S 1R9GA 2QV0A 4K86A 1C2YA 3G82C 3JR7A 2WJ6A 5J2UA 2OZVA 3U80A 3GLFA 1YQWA 1FUEA 1QH8A 4ZI5A 2Y3IA 2CLLB 1LBQA 2VRNA 4CTJA 4ER6A 3BX1A 3ZI4A 4M6WA 4N9QA 4II2A 4PG7A 4BWVA 2VPWA 3FNRA 3T52A 1KSHA 1QHEA 2P2SA 1EUDA 1VCIA 2QT1A 4GICA 2NOAA 1Z0UA 4MKHA 2FJ0A 4NZYA 4EG7A 4FGSA 3Q41A 2XH8A 2NV6A 3JWHA 3OJEA 1ICIA 4UNNA 4A92A 3EAQA 2B4TO 4IINA 3PR2B 3H1BA 5DGCA 4EZBA 1SC9A 2XADA 5CG2A 4C6SA 4EA8A 1IG3A 1RYZA 3H11A 2HSEA 5KPDA 1Q0ZA 4HT3B 1H0SA 3IHLA 5JALA 2O50A 2RE8A 2JGRA 4IVNA 4RC9A 3L6RA 1ESNA 4J0GA 3SXUB 4A10A 3EZGA 3IJRA 3QX8A 2J33A 2XTJA 3A0RB 1OFVA 1JIJA 1WA5A 3C8DA 4IS3A 4BL5A 1F0KA 2OFXA 1QP8A 2W2QA 4XA8A 1MJ5A 2GN2A 5BWNA 4Q0MA 4WCFA 4YASA 2IKSA 5JCJA 3F46A 4IG9A 3GGPA 1X42A 3LNTA 2BKUA 2FP4B 2Z9CA 4IDAA 1HOTA 2VDVE 4N0QA 4AJEA 5BOSA 3FGZA 1AN0A 3L05A 4CXMA 3HUFA 4LY3A 4D82A 2YXEA 4TTAA 4C06A 3ONWA 2XDQA 3O7MA 3OFND 5LOVB 4KRFA 4M1KA 3K6SA 4LW8A 1S3GA 3TTWA 1M6HA 2YIDA 3Q7PA 2R6HA 1ABBA 3KQLA 4MH0R 4GLBA 2FG6C 1MAWA 4I1YA 1A7JA 1G8YA 2FW8A 2OKGA 2X9NA 4JP5A 5EEGA 4C2AA 4EPVA 1WXGA 4KQ1A 1WSWA 3FIUA 4RLSA 4K6CA 1JA0A 3EA4A 4II3A 1BW9A 1C7FA 3UPTA 3AVWA 1ZGGA 4OAQA 4G5QA 5DE3A 2X4IA 1HPLA 5DHFA 2X0FA 2CHFA 3PWKA 2HRZA 2GPTA 4AY5A 3PFNA 4HNVA 3S8EA 4J07A 3KP1A 5KDOA 5LKRA 1AZSC 1GU1A 1YCFA 4EPRA 3U56A 3ZE6A 2WAXA 4MHOA 4CQLB 3DWGA 1AA6A 2VBFA 4ZHQB 2RHTA 4LC0A 3SHWA 1KC1A 2F3UA 4FC6A 4UTVA 1SQ5A 4F8JA 4WJZA 4O2RA 4QM6A 4LOKA 2GM9A 1F5SA 3AFNA 3FAKA 1PN3A 2VUTA 4CCYA 5HUQA 2VJKA 3LKVA 5GINE 1OB5A 4ZHQF 2E82A 2FEOA 2PUGA 3ORRA 4WE3A 4YAKA 2MMGA 1B8OA 1ZM7A 5JCXA 5AUQA 1QZXA 4EZEA 2HMAA 4A7PA 3TUZC 1JSCA 2VEDA 4G5XA 1ZMOA 1U7HA 1REQB 1C9EA 1CB7A 3AB7A 3CR8A 5GV8A 4B3IA 4OYRA 3H75A 4ZOBA 4X60A 1XZLA 2DF8A 2ZETA 3LY7A 5ITZB 1CQIA 4CHGA 3ESXA 4F97A 1WEKA 3T34A 5DBFA 4FU0A 5BR1A 2OBLA 4MV5A 1XNRB 5KYTA 5H9WA 3WO0A 3ORYA 1OYVA 4BNTA 3AHCA 3FB1A 3H19A 3SC3A 4KN9S 3I2YX 1CEYA 2H3EA 4AMZA 1ST3A 2VHTA 1GRCA 3CUKA 2ZJFA 3CU5A 4MWCA 5GJWC 3B85A 4GOND 2D2EA 1MGOA 2C5HA 1DVRA 2C3UA 4GIBA 1SVWA 5BQFA 3OKFA 2VDPB 2PBLA 4ABYA 4MV3A 1QFJA 4MRAA 4OU4A 2ZYDA 1AKMA 2ANCA 4JHLA 4YB8A 3TW8B 3M70A 4D97A 1T0HB 4MZXA 4YQYA 2PXAA 3W5HA 1CYEA 1IVYA 1E79D 3EARA 4IVPA 1DEXA 3FYHA 4HEA1 3AM1A 1KRWA 2IXGA 2PJRA 1R0RE 1UEXC 4UOZA 3I12A 4J7AA 1QX4A 1X87A 2WHPB 4RY8A 4JP2A 5ALOA 5C9ZA 3FY4A 3TDMA 2J9RA 2CL5A 3RQIA 1MO3A 3G6KA 2ATIA 3BTOA 1Q7CA 3KQVA 3EXIB 5BSVA 1FDSA 2GB4A 4LZZA 3IX7A 4B87A 5H68A 5J4YA 1HE1C 4L5JA 4DL9A 1N1MA 4EW6A 1NRWA 3SXJA 1GA1A 1V71A 3DAFA 4NYJQ 3OQMA 1CY4A 4X93A 5BT9A 2IHNA 3ZDBA 5U9CA 5FHRA 5A0VA 1BU8A 4W8GA 1AKVA 3WWYA 3QTLA 4KB5A 4XFJA 3WFZA 5IEJA 3NC4A 5TPWB 3JWJA 4CJXA 3QVGB 5ALWA 5JNLA 3PQ2A 4X8MA 3IQFA 3L7JA 5AVWA 1CULC 4BNYA 2F3QA 4GI1A 5KTNA 3R4CA 8LDHA 5EIEA 3JVIA 4DLUA 5E0OA 1U98A 4ENVA 1FS6A 2J30A 2EP7A 1V8PA 1RQRA 2V6JA 1MW8X 2JLBA 3PDIA 4A6XA 4BU1A 3R8FA 3T0GA 4WIAA 7GPBA 1UJ6A 1Y3FE 4I4TF 1MO2A 1XF9A 5KJEA 2JLZA 1R5NA 3EK2A 3OY7A 1LA2A 5GIOE 2GCOA 4LAFA 2P6OA 5E9WA 2W2XA 3BE8A 2FEWB 3QY9A 3R1IA 1OXXK 3O75A 4X3PA 2KM1A 3GZNA 2DHEA 1ZCZA 4PCLA 4X6LA 4BMYA 3DTTA 5KYXA 1SM4A 3ILVA 1WKVA 4MVJP 1T5OA 4E5UA 1UWCA 1YQGA 2ORVA 3RYFB 3USZA 1L3IA 2X0IA 3KKLA 5JNVA 5KYGA 1NJ1A 4A6DA 3JX9A 4UREA 3KQTA 1C9NA 2AQHA 4MKRA 4QX6A 3PKZA 2DWCA 3OZFA 1HXHA 5TRTA 3W1VA 4QZVA 1V47A 1L5HB 4F5WA 5LLTA 1JAZA 4N48A 1UK6A 3H42B 2GTHA 3IKTA 4LBYA 5C8XA 3RT1A 2B1IA 4DLRA 1IM2A 3MB8A 4MP6A 5FBLB 2HPZA 4FFBB 2C7RA 1LI5A 1FLAA 2I8AA 3GT7A 3LQKA 3ORSA 4NK4A 2GCEA 3DHNA 4ESEA 3MTDA 2JL1A 5AK3A 3R7WB 2FQ1A 3BQMB 1B26A 4ARSA 1M1NA 3ELYA 1BAPA 2IYFA 2DZDA 2FEPA 3TLCA 4UUNA 4L8YA 3WLRA 4DHWA 2HA3A 1SXHA 1GU0A 2VTDA 3C8ZA 4AQDA 1BVYF 2BFCA 4CMIB 1NJ8A 4AY6A 5CJ2A 4AK9A 3ZBQA 1VYHA 1W87A 1XQ9A 1ADFA 1G3UA 3CCFA 3QEKA 2AQ8A 1EDDA 2IU4A 2PD3A 3DGFC 1KYXA 1RJ9A 2VNAA 3AERB 4HMQA 4JLDA 5JY1A 2ECOA 5ULLA 3L7DA 1QGZA 3A6FA 4Q9AA 4BB9A 4Z3KA 5LMUB 3GXOA 5LJIA 1KYYA 1OGJA 2PRYA 2NVOA 4BEWA 4UCWA 3DDSA 1L7AA 2I3GA 3DW1X 4RE5A 2EV9A 2ZPUA 3LZ6A 1M0TA 5A5GA 2XCTB 5EXTA 2P91A 1VLZA 2OO5A 2YV3A 4KTVE 1IEXA 3BRQA 2JIRA 1JKJA 5J4KA 3WNVA 4C7OA 5KSZA 4HAIA 4D8XA 5HJ2A 3KSDO 1IJKA 4F9EA 3BMQB 1P77A 3BYZA 3HJHA 1UJCA 3RPEA 4AY4A 3BE6A 3ECCA 1FNMA 2JLWA 1XBTA 3F5QA 3GP3A 3CVYA 3B9RA 2QSUA 1TD1A 4P83A 5JJ5A 3FPBA 3I8XA 2QW1A 5AI4A 5JBIA 2LKCA 4GP9A 4RV4A 1TU0A 3BMNA 2VH1A 4TS4A 4N76A 2CZQA 2F8TA 3V4LA 3C6QA 3NRJA 5B37A 3P0HA 4BBPA 6CHYA 1BXKA 1LQUA 3HCEA 4HK4A 5FTNA 4WZAA 1U7OA 2BRUC 4BC1A 2VTKA 4AULA 2WNHA 3LTEA 3FFTA 2JIZD 5ALNA 1VKZA 3O4HA 4UU8A 1VPEA 5DBIA 4OGKA 4ZO9A 3U7GA 1R8XA 2VRCA 4KO4S 4AJ9A 4Y6PA 4RL4A 4RD2A 4ZCPA 1ZM4A 1TVCA 2KB0A 3UAOA 1QSGA 1N7JA 2XAUA 1S96A 2DTXA 3K0CA 3PI6A 2WYWA 3WGIA 3PGMA 1Z5OA 2GF0A 3HRIA 2HRBA 3H3FA 4X00A 3FYUC 3IXMA 5A5DA 3THWA 4TVSA 3GMDA 3HUDA 1O5OA 2RAVA 4GPTA 1MG0A 5CURA 1DAOA 3B6ZA 3E7FA 3P71T 5KQGA 1O5IA 1G5PA 2FFAA 4MWEA 2IYQA 4E09A 1WQ4A 4CTKA 1RJEA 4RFVA 4F72A 1P5FA 3I9KA 3WLMA 4GKVA 5IYZA 4BNIA 1X3LA 2V7PA 4EHLA 3H86A 5K4AA 5B3KA 1Z8DA 3HS3A 5HRCA 1E2IA 2OGTA 3ANMA 4K6GA 5FP0A 2Y2VA 4LZNA 4DQ0A 5F51A 5ADUS 2ZUCA 1WXWA 1ORIA 3MNFA 1I2AA 4K03A 3UIEA 1H2EA 2R3SA 2BFBB 1TTHA 3IFSA 4LV8B 2JH8A 2B8JA 3CXUA 5A2GA 1DWPA 1YL5A 4FNMA 3TTYA 4QBHA 2F1JA 3LX6A 3MINB 3OEEA 4G0YA 3IQHX 3RC2A 3VH4A 4WI1A 4UNPA 4CMEC 4H6XA 5E3IA 1IBMB 1F8YA 1E18A 1O57A 1QOZA 4KMOA 4PPQA 2XNKA 4OYHA 1P2TA 4RHFA 4YRQA 3TGLA 4NENA 2V6GA 1P1JA 3KZ1E 3STUA 3WP1B 2FTKE 1JEYA 5LDHA 1MX9A 1NF8A 1NVAA 4NAUA 5IEBA 1LPMA 4U9HS 2X7XA 2JJ8A 3H2SA 4DLTA 1LDNA 3ZEAA 1Z7GA 4QYIA 4TX1A 1GZDA 3NTUA 3T7DA 4BN0A 4OMFG 4JQCA 3UJCA 5AIAA 2NMVA 1QFXA 2JIZA 2A0FA 2C1EA 3R6LA 4BEVA 4PEVA 1E6MA 4KFTA 3A10A 5IM4A 3HWWA 3DEFA 2PUVA 4CL2A 4IHQA 2E4AA 4JUFA 4KV9A 1QYIA 3O3OB 3U62A 4Q47A 4BX0A 4IRMA 1M1YB 4D9BA 4K9PA 1R5BA 4YPFA 4LA4A 4DLPA 1IOWA 2QG6A 3PRYA 5JZVA 3C5VA 4BASA 3L7KA 4PIMA 5LA6A 4B5KA 1K0FA 2X8JB 4LXYA 1T2EA 4FKBA 3DKRA 3QMWA 1YQ9A 1Z7BA 2TRSB 3RF6A 1OXMA 2JVKA 3HCRA 4J1NA 4MINA 4ZI7B 3NQ41 1B6TA 4CEJA 4Q3LA 1NNI1 4GYKA 5EHNA 5ALYA 1ZIOA 3AHHA 4LSGA 1YFJA 1F4LA 1Y5LA 2TMYA 4IIUA 4LQLA 3OO0A 1WPRA 1JWLA 5CIQA 2CLFB 3WWEA 5AKEA 1DJQA 5A7HA 3U7JA 4FBGA 4LGVA 3C3JA 1GFWA 1L5GB 1TJYA 2JD0A 3WC4A 3MELA 4D3SA 5GPBA 2I3DA 1DDGA 2DEUA 5FI0B 1WULS 3V6MA 1W6RA 2EXXA 4DPLA 3RODA 2YVAA 2H16A 2EFDB 3QYFA 3L1VA 5BMOA 2I7TA 3CPEA 3NFYA 5BV7A 5AVVA 3DEYX 4P38A 2EG5A 4HLUC 2OCAA 4NHEA 3TCXB 1S3FA 1QTQA 3VVCA 3UCEA 2CNDA 1Z6GA 1G5IA 2P2DA 3MJEA 1ZGZA 2YCLA 2ZDGA 4M9XA 3FSGD 2AZXA 3KHKA 3CE9A 4NICA 3D3KA 3UMCA 3CH7A 3GFSA 1IUNA 1YACA 1CZUA 1L1RA 1N2CB 4NE7A 5IT4A 1OJLA 4E30A 4DCGA 3BWDD 4I9GA 4CLHA 3HZZA 1G38A 3H4TA 1U3GA 4XVCA 1PGJA 4YT8A 1VP3A 4O4LB 1GAEO 2AE1A 1QS0A 2AGVA 2PR7A 4KO1S 4NCKA 1YE5A 1AN9A 3AJRA 3HEMA 1NKSA 5K3CA 3VR5D 3AV0B 5CB4A 4FGKA 4L50A 2Q5LA 3EIEA 3AUYA 3QEOA 1SZCA 4PXSA 1V4BA 1JEQB 3I0MA 4L8LA 5J4LA 4FX5A 2RGAA 1GDHA 4QQNA 1SOMA 2CCKA 2RMKA 4FEYA 4IH1A 5DV9A 1L1FA 4D42A 1KO1A 4AN0A 2BGWA 3I0NA 4D3ZA 2BH2A 1XAHA 2GBLC 4L7VA 5JVDB 1X7HA 1RYEA 4FKZA 3OTHA 1NDHA 1VCHA 2GCOB 3OE4A 4BVKA 1M5UA 2QTNA 2WSMA 3UW1A 4IYJA 4YJHA 3DV0A 4LZAA 2WF6A 2CNLA 3G2QA 4JBGA 5CHYA 2CL0X 4S1OA 4C43A 2H18A 4UFPA 2Q5IA 4JAVC 4R81A 4ALMA 2E48A 5ICCA 2F2TA 3TBKA 3F4LA 2WIJA 3HBMA 4HRAA 4AZ3A 3QMPA 3N8HA 1N0UA 3IIKA 4YO7A 3CVOA 5C53B 4DARA 1IAQA 1E64A 5JJBA 1NP7A 3P20A 3JZIA 3RUHA 4C20A 1A1SA 2NPOA 3HP1A 3PPIA 3P9KA 3V2HA 4MAMA 4FLFA 3I1FA 4GP6A 3UJPA 3WL6A 1PKXA 3EIFA 2HHJA 2PA0A 1YQDA 3AI1A 3RVDA 3WKDA 4D4IA 2C5SA 1JDBC 3FCOA 2UUBB 4NYIR 3NOVA 4HNUA 4MB2A 5ADWA 3K31A 3ROGA 3SM9A 2P2CA 2B8WA 3K4HA 3N76A 1DEAA 3CEJA 4Q4AB 2CK3D 2P9QA 1PR0A 3OLCX 1XMOB 4AY2A 1TCAA 1H2AS 3A6JA 2B82A 2VHUA 2W9XA 2TMKA 2OLEA 1RHRA 1U2DC 3E7WA 2I78A 4L2IB 2EGHA 4WBNF 2A14A 1F60A 1MH9A 4U7JA 3VU8A 2TSYB 1OFIA 3ADKA 3ZBPA 1IHYA 1RBQA 2ZVJA 2Q4EA 4HXFB 5EJFA 1X9GA 4Z0HO 5CD9A 1L4LA 1UEJA 2B2NA 4KQMA 5L3ZA 4U7HA 2Y0BA 3PTLA 3AEQA 1JFVA 3M1AA 3VV3A 3K9BA 3N58A 4F46A 2C5BA 2XB6A 4MP3A 2PYIA 4LYEA 1HSOA 3WGTA 1QGOA 2F9LA 2GZAA 4HWKA 2BFWA 4WA7A 1SHUX 5A3SA 3PQ5A 2W4IA 3QFSA 4E4RA 1Z25A 1D2NA 1YC5A 3DKIA 4EF5A 5C1BA 1E62A 4HY3A 4XR9A 2RKBA 5G4KB 3LKZA 3AVUA 2COUA 4I9NA 3C4JA 1ODJA 1X19A 4NFSA 2H1WA 4YRRA 4FOTA 4F96A 1KK3A 5DN6D 1UZLA 1U0RA 1U2PA 1HDEA 1VJCA 1Z2CA 3D2AA 4QRIA 5FR2A 3WGOA 1SG9A 1EFRD 4U7PB 2PMEA 3NIBA 1UMDB 2ZIAA 5CTAA 2WWHA 3I5XA 1XZDA 1KFCB 4GMFA 2WB2A 1H22A 4A03A 3EUEA 2Z6UA 4ZCMA 5GONB 5AHOA 5CIWA 3ULKA 3ZU5A 4ZOLA 1Q7RA 3LP8A 1KEVA 2DQYA 1JU3A 1C1DA 1JHQA 5BMVA 5K01A 3KT3A 3LLCA 1V1JA 4ZDWA 1BU5A 1LQTA 2R65A 3LE8A 1O6BA 4F2WA 1QH9A 4HDQB 4PO1A 2Q6IA 3H0EA 5G1OA 4C9BA 1MB0A 5IAGA 1D7OA 3BB4A 1N34B 4TZ6A 5AM4A 3ET5A 1DBQA 5E7IA 4K05A 1XALA 4MEAA 4MS3B 4RVFA 1T4CB 4JU8A 4ICIA 3EZ9A 10MHA 2XDWA 3ER8A 1I24A 1YONA 4FFRA 4G4GA 3V1UA 1P1RA 3V4FA 5JOQA 3GARA 1X7WA 4MW1A 3BMQA 4RYDA 3VGJA 1E0JA 2GZ1A 1RSZA 4LRWA 4ZICA 3W5IA 4FYIA 4MGEA 1JALA 1N0HA 3N0RA 4EECA 1LPOA 3DE3X 2ZJ3A 3SC2B 2QAGA 5LQSA 2DFTA 2G06A 4LHZA 4LHSA 5JG7A 2AMJA 3EBOA 4DBLE 3MHTA 3INYA 2QR2A 4TQGA 3P97A 2VBCA 1E96A 4JYMA 5C46F 2RD2A 5SY4A 3TW4A 2R25B 4EA7A 1Q1QA 3CR3C 2YCBA 1A69A 4H7FA 4TTSA 4KAFA 2FN8A 4UPVA 1C3OA 1C7QA 1SC3A 1NATA 1XAGA 4EFKA 4G0UA 3OZBA 1P9LA 2J59A 4Q3AA 1R37A 2OCBA 2WA2A 5I8WA 5BQ5A 1JR4A 1ND6A 3H1GA 4TRNA 3LBAA 1N1DA 3ROEA 1ONOA 1PJCA 1O58A 2VUHB 4V03A 2IXFA 1M76A 2FW7A 1KK1A 2Y71A 3ORQA 3ZW9A 3J7AC 4RM2A 5IT0A 2FX5A 1J4AA 4NDAA 4X7RA 4ZV4A 3AW8A 3F2IA 4YRNA 4KKXB 3A1UA 3IPXA 4J0JA 1RJWA 3BK2A 3GV0A 1OHHD 2PUTA 5K0NA 2C4TA 4V0NA 4EGCB 3DM5A 4Q9NA 3VX3A 1Q0PA 3L18A 4M1SA 4WXPA 3D4BA 4YMHA 5D3ZA 4RDXA 2A5JA 4RX1A 2LZ0A 2QMQA 2HA0A 1C8KA 3AP1A 3S2GA 2KHZA 2EWMA 1VL6A 3B60A 2WG1A 2F1KA 1CR1A 1BHSA 2FSVA 4BLTA 1PZMA 1YRWA 2HYIC 2FSUA 3OD5A 4GSKA 4QJ5A 1QHGA 1LX6A 1MQ9A 1TT5A 2DUUA 1QYXA 2OO3A 2PDAA 1X0VA 1RPJA 2C9OA 4FCVA 4J2OA 2H00A 4JT9A 5IAEA 5K6TA 1FNSA 3TL2A 3H9JA 2OEPA 2H4FA 2DUJA 3DV2A 4YP7A 4PANA 4ZYTA 1WCWA 3NX4A 1CU1A 1ENPA 4PPNA 1WLYA 4OK6A 4F4HA 1Q95A 2O8NA 4OHXA 2RBKA 3TM4A 1XPOA 3FD8A 3ZQ4A 3UT0A 1IFXA 3ML1A 2GX6A 4QPPA 4OXKA 2I67A 5JTUA 3AL3A 1DQRA 2FG5A 5EYPA 1IEVA 3DV9A 3LDAA 5J4HA 3A3YA 4WY2A 1SU7A 3Q0EA 4M1TA 5HKOA 1P8JA 5ALTA 4Z49A 2IYZA 3DC2A 4FHEA 4KZKA 4PYLA 3K0CC 3U16A 1U5CA 2GEBA 3FSEA 2C9MA 1BFKA 4IGAA 4O4JA 3G89A 4V2UA 3ESCA 4D3YA 1GGFA 4M9UA 2OHFA 3EFOA 2X7JA 2R8XA 3O4FA 4Y6OA 4DJJA 1PVOA 3B3QA 1FZTA 1TQ6A 2C83A 4B81A 4CT0A 2BGLA 2Z2ZA 2ZT5A 3MVEA 3CRMA 1GGMA 1NM5A 2VT6A 2XPCA 3QVWA 4ZCLA 4CL3A 4KR2A 5CK4A 3WS7A 4LY9A 5CFZA 2X6RA 2ZWOA 4QDJA 3B6JA 1ZH4A 1OIWA 4DIMA 3WK4A 1CHDA 3VPDA 3EF1A 3UAYA 4U63A 3F9IA 2O2EA 2YHBA 4PFQA 3LTNC 4B6GA 1N5IA 3CX8A 3AINA 3KWMA 1XEWX 2I62A 4V24A 3G0DA 1QIIA 3BIFA 3RHZA 2PSHA 2F8MA 3P94A 5T4EA 4WUTA 4GL2A 1OFTA 2QRGA 2UZ1B 1B23P 1U0JA 1JJAA 3A14A 2DLDA 3GJZA 3P0FA 4HAZA 4BTLA 2YNMA 1K8QA 3U7FB 2VDOB 2HQRA 3CB4A 3KXLA 4NMLA 2P7IA 2MJLA 4Q39A 4MV7A 4ND4A 3TYXA 3X1XA 5BN4A 1KE1A 4B45A 1I5RA 1G8MA 2Z98A 2OHJA 3WWPA 1H4TA 2YVUA 3WAGA 3NMUF 1CLEA 4D56A 3D7NA 4GVPA 5CDHA 3RS8A 5GONF 4QDKA 1VXOA 4BN4A 2A88A 2POQX 4C21A 3IBFA 5TE9A 1O0CA 4QOJA 5JMWA 3KSUA 1XMIA 2YICA 4GX2A 3A58B 3IUEA 3NAMA 3GT4A 2G09A 4YFVA 1LLQA 3IXQA 5GOTA 3EUAA 4Q1EA 3ZLJA 3O73A 3HU2A 2WD7B 1W8IA 2F1OA 1OI3A 5K3SA 5K09A 1F48A 2WTXA 2ZWPA 3EG9B 4ECEA 4Y0AA 3W5VA 4DBVO 2PZMA 3C3AA 3LM8A 3QI7A 721PA 2GD2A 2HC9A 2DBYA 4HUJA 3I92A 2PUHA 4G1CA 1QIEA 3J81A 5J59A 1CFZA 4TL8A 1O54A 1K4MA 3DMDA 5G1PA 3KL4A 3RVOA 4BRUA 3KQHA 3IUSA 4EM6A 2YOFA 1A8UA 2H2FA 1AKYA 1W25A 3OLWA 4I55F 4DSTA 3X2EA 4JI8B 1MX5A 2BMJA 1HNZB 1CJKC 1E9DA 4PHCA 4PPGA 1JMKC 1Z5ZA 2ACVA 4BRSA 2XTMA 4X3CA 1JSXA 3U4HA 2H2HA 1Z18A 2X9GA 3TLBA 4DPMA 4O2AF 5C51B 1I3KA 2V4UA 4XDZA 1AQLA 1HYEA 1P4JA 4YV7A 2YX1A 4EDFA 3KEGA 2CVHA 3R76A 3PNMA 3A3OA 3LUBA 5FF9A 1H5UA 5DI3A 5D3KA 4ZREA 1P5JA 3A6ZA 5DCUA 3RVPA 3WTCA 3U7QB 5FPQA 1W0KD 3FNGA 3PC3A 2CNWA 4E14A 1E5DA 2I1WA 4RS4A 4TLAA 5ERYA 5P8WA 2GZDA 5HM8A 1M3SA 3PHHA 1PG2A 1XD2B 3H5IA 3RFCA 4BEJA 4J91A 2Q1TA 4Q03A 5IAAA 4KIWA 4Z5XA 5CA0F 1KEWA 1S5PA 3ZHQA 5CA1A 3BWEA 3D3EA 1J70A 2ZIGA 3BFXA 2M98A 2QL6A 2GJ4A 2GD1O 4XGKA 1GVHA 1V6AA 4HDRB 3ZHZA 2ZBVA 5AOAA 5EHQA 3M2TA 2CUTA 4CPDA 4QLBA 3S7ZA 2WJPA 5F3WB 1HDGO 3W4JA 1X1BA 3WAJA 1KYQA 2Q3LA 2RGYA 4ZYYA 4GPZA 3SG0A 5IJZA 5JHGB 1PFUA 4GX0A 4ND1A 4DDTA 2BDEA 1SVSA 1IBCA 3GCZA 1J8DA 4R0VA 4Q4JB 4Y3UA 3VTAA 4NATA 4QGSA 2W6PA 1XHFA 1G17A 1QHHB 3R3XA 3V1YA 5L45A 1ORVA 4DA4A 4DLKA 1SD5A 2WWFA 4RF3A 4AMVA 1R5JA 3TQTA 2QL5A 2PRJA 4L76A 4EH1A 2NYVA 5KNBA 3GEPA 4F8YA 2Q7DA 1WPQA 3W2GA 3N2EA 1T4DA 2VYVD 4HFRA 2DCUA 3ZVKA 1KA9H 1R5OA 1S0UA 4QJIA 5AVZA 3FOZA 5JISA 1N6OA 4RVHA 1BWSA 5CNMA 5EY5B 3R0XA 3TB6A 2AQIA 5FULA 1UINA 2ZB4A 2C2KA 3KCNA 1U0BB 2PR2A 2QD3A 5D7NA 1F7VA 1ATZA 4TL9A 5FUVA 5IWCA 3CZPA 4FZJA 2OGZA 3HBAA 4JXJA 1S2LA 4FFWA 2FPRA 2Z09A 2O8CB 1TMKA 3ESYA 4BNJA 3I6ZA 5HXAA 5AXAA 2DR2A 4TYYA 3BF8A 1BHQ1 3MTEA 4ZO4A 4L6CA 1G3RA 1AUVA 5K2OA 3KE8A 1I32A 3KOZA 3LT4A 1IPFA 1NI3A 4Q00A 4YJDA 3FUTA 2CGEA 4WOBA 4TYQA 2NM0A 2WHRA 1BVRA 3D6HA 3GWZA 4KYVA 4LI0A 5C32A 1TDJA 5M2QA 3S8YA 2D6FA 1AV6A 3CQ9A 4M7OA 1PL0A 3RFXA 4HC4A 4GUAA 4ND8B 1KEPA 4PAQA 5EGNA 3ZHBA 1ZSVA 5LCXA 3JQ8B 2FPPA 4QAQA 3PDWA 1V2HE 3IAS6 3WB2A 3OTOB 1XRNA 2O0MA 3DOCA 5TQ2B 1JG3A 4N3AA 3GVPA 2R66A 1NXOA 4DR2B 2GI4A 3MLBA 4MW0A 1LRLA 1V8ZA 4M8IA 4X95A 4UUMA 1JBKA 1B1CA 5K0ZA 3UJ8A 1Q2XA 4M7PA 1E5XA 1Z2PX 1UPXA 2QTLA 3N6RA 4ZIRB 1E1QA 2JG3A 2R7LA 2F7SA 1QO7A 1FDWA 4A91A 4ZZ1A 5A1JA 1OZHA 1DBSA 3RDPA 1FOEB 3ND6A 4WXHA 4BVHA 3JASB 1QU2A 3QF4A 1SU8A 2WIDA 4TROA 5B12A 1SKQA 3FVTA 2YN2A 1SKBA 3SX4A 4LGYA 1C41A 1GKYA 1DXQA 4KWTA 5EJ5A 4ZQGA 1B0AA 3HUUA 4Z8XA 1C81A 1I14A 2CNNA 4M0MA 4ZGWA 3M3HA 1M2VB 4UAVA 4YMVA 5I7RA 3A1VA 1VSUA 4W1QA 3F4BA 1U65A 2RJ3A 1V5WA 1K9SA 2IHZA 1ZOPA 2JA2A 2JFGA 4AC9A 1ZR4A 5G0WA 2PT7A 4QBFA 3HHEA 4ALNA 3ETJA 3UWSA 5F2EA 2RAFA 4MYCA 3NJ4A 1U7WA 4HB0A 4Y1EA 1E2GA 1MC1A 1L5VA 3K0BA 5DHQA 3A0UA 3D2LA 5JI3E 2IZ6A 1KQNA 1OR8A 5KNBH 4HBZA 4IHJF 4ACAA 3M83A 1IE3A 4CM8A 4B3GA 3NJRA 2DH5A 2VHZA 4C4SA 4WK0B 4FNOA 4Y30A 4YAWA 3WWZA 3LUGA 5BSRA 1GDTA 4LYDA 1E9CA 4BB0A 4HDOB 4BMNA 3AOEC 1C7IA 4XWOA 2R751 2HREA 2W4MA 3GEIA 3RYTC 5JC1A 1RXCA 4GEGA 3KJXA 1D2CA 2ZBFA 5JSUA 2COKA 3T7KA 3KZOA 3N8DA 1WDMA 1JHRA 1JJ7A 2C9ZA 5JSFA 2IIQA 4CI9A 1NWHA 2B69A 1KJIA 2VK4A 1HEUA 1YNSA 2BCEA 1VL2A 1LCIA 5CK5A 3RC7A 3LLVA 3U0VA 4A6EA 4AJHA 5IH7A 1Z0DA 2H51A 4YFYA 3TPZA 4PX2A 2Z4RA 4GLLA 1A4UA 4QHTA 5JS1A 1CP2A 1NW5A 1NUSA 1UPAA 3AUSA 2YFKA 5B6PA 3MWYW 1VLLA 4KKVA 5KVAA 4N0EA 3LUCA 5TB5A 4C3ZA 3EX7C 2EERA 3ISVA 1RBYA 3S2YA 4F2GA 3CPJB 5CW1A 1APBA 1W2HA 5AJZA 4RTRA 1W2WB 1ADBA 1NW8A 5L3SB 5BWOA 3X1DA 2KW5A 2NNLD 4U9UA 1V45E 4QTUB 2AT1A 1D0IA 3DE4X 2ZSBA 2JCSA 5IAJA 2ZT7A 4CEHB 2ZYHA 3WLOA 4B83A 1E4YA 3TIXB 2A5YB 4AJNA 2QU7A 2XE6A 4EENA 4TN5A 2V9PA 1NLZA 4O59O 2PS1A 1IZZA 4PCAA 5KWVA 1YHYA 4MKGA 4JLVA 1VIYA 2W7TA 5DTEA 5KWEA 3ITEA 3SEQA 5HNKA 4JOSA 3AG5A 1NUHA 5E9JA 4X62B 2A1IA 4PTYA 5FNZA 3GPIA 1QMPA 1XU4A 1M2JA 1YBVA 3KVNA 2D0PB 3LL4A 1BX3A 3HKCB 2OYRA 2D5IA 2VKQA 1PRYA 1Z26A 1T5TA 3BHNA 3FF4A 2PX5A 2VPYA 2BI8A 2NUTA 3RC9A 1TQDA 3C16C 2ORYA 2XQJA 4R2WA 2ZJAA 1PLLA 2FPKA 1Q44A 4HQ6A 1YR2A 3BEDA 3NM5A 2GM5A 3VOAA 1P1FA 3T3GA 1QGDA 3GN1A 3G49A 3GVHA 4GZ5A 5M3BA 1USVA 3CN7A 4JVOA 2C42A 3GL9A 4YRFA 5EKTA 4E2FA 3NUZA 4PQFA 5AIBA 3BSWA 5LBUA 5JAHA 3EF0A 2XKAA 4V3BA 3G8YA 4S1TA 5HF9A 1JIUA 1K2WA 2O0LA 4WZAE 1GCUA 2XDYA 3NWBA 1L4YA 1LZKA 1ZOOA 2PGAA 1GQSA 2VQDA 2ZSAA 4MQMA 3X1WA 4JXXA 1U63A 2GNOA 4OBXA 1YL6A 1DAHA 1IM8A 2PWPA 4C76A 2VCYA 3Q6MA 3MM4A 3T5TA 4QYMA 5AW0A 1OX5A 2H4WA 3KVRA 5AM5A 5EQFA 4DCMA 1EUQA 3RU3A 1DX6A 2XMPA 1T4CA 3WMWA 3L4KA 4NPHA 1FFYA 2EX4A 2C96A 3EGEA 3WJAA 4HWGA 3DB2A 4Z9XA 3JQFA 4NMMA 1CQIB 3BDVA 3IO5A 2GK6A 4YMSA 1F4PA 1GTJ1 3AOGA 4TXMA 5BSMA 1CP3A 4IY1A 3T5GA 1REQA 2CNKA 3E7XA 4ZZ2A 3WVNA 5JS2A 4CIYA 1P5ZB 2WYOA 5K3OA 3L2OB 3VHXA 4A0SA 2D62A 2VL7A 1URPA 2I7XA 1QDLB 2XE4A 1P1BA 4C4RA 5LUAA 2UXDB 1E3MA 1FFXB 4DF3A 3CF2A 1E20A 3OOSA 4UEQA 1A9XB 1VJTA 1QJ4A 3C5CA 3OMWA 2HKIA 3AX6A 3DFIA 2JLAA 2D0IA 3HB5X 4C88A 4UUAA 4JSTA 4TTTS 2W2VA 3LYUA 4DZTA 1RQNA 3AG6A 3Q3HA 3PNPA