2IYQA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate and adp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 61
structure length 166
sequence length 166
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyqA00
1Q3HA 1YR6A 5EE0A 3KJHA 3A1UA 2VP2A 2ODEA 4DEXA 2BVNA 5G3YA 3MWJA 3UIEA 2AXPA 4DIEA 3KQHA 3X1WA 2RB4A 3QUSA 4BFXA 3T1VA 2A7QA 3UG7A 4A8JC 4OI1A 4C9BA 1YU9A 1DS6A 2ZU6A 3WBJA 1XF9A 3TSZA 4OHYA 1G6OA 5CDFA 2ZETA 1PJRA 1XX6A 3C15C 3PQCA 3KQUA 4W5JA 1LV7A 4RSGA 1G7TA 1UBCA 3UATA 3TUZC 4MYUA 3BIFA 1SXJC 2FN4A 2PT7A 4PSAA 2EFCB 2J1LA 3B1YA 2J0VA 3PJRA 3GLGA 4P33A 1G8HA 1G3QA 2ZR7A 1IN8A 1ZIPA 2IWHA 5A5GA 3WYFA 4Q1CA 3DL0A 4MYCA 4TQAA 1CJVC 4ERNA 2WIBA 1Q22A 4NU0A 3HJNA 1SHZA 5J4HA 4YMWA 1PLKA 2FGKA 1A7JA 1KMHA 4CF7A 1W4CA 2ZRNA 1E9SA 3SZRA 4ZDWA 1E4YA 1GZSA 3IDQA 4AG6A 4TYWA 3K09C 4M0LA 4C0JA 4D81A 3EARA 1IXRC 1JR3D 1QVAA 3IQXA 2VP4A 1GNRA 5CIWA 1UAAA 3BB1A 5E4FA 4PPNA 4O0MA 2W2TA 2JJ2A 5EUQB 2ATXA 2FE4A 1KNXA 4NCHA 4P32A 1P60A 1NG9A 3ZJYA 4HI0E 1KDTA 4JSYA 1Q12A 4GI7A 1OHHD 4DEYA 2ZSEA 3THXB 3K70C 2ZSFA 2FV8A 5HKKA 1GKUB 2ZE8A 2QGZA 1H65A 2WOJA 3GEIA 3I72A 1NBME 3HU1A 1Z8FA 2QU8A 1F6BA 1UKZA 2XEXA 4EDHA 1ZC4A 2IYTA 3RSOA 4CDGA 2BMEA 4UJ3A 1M7BA 3W3ZB 3CONA 2C2HA 2RGXA 4B47A 3NXSA 2MMCA 2UZIR 3GQBA 3B8HA 2BBTA 4TSFD 4ZDJA 2I4IA 4IDQA 1AGRA 2YWGA 3I5XA 3IUYA 2ZUDA 3TW4A 2ZRBA 2IWRA 1ZD9A 1Z47A 1XTRA 4LC0A 3KQNA 2V8OA 3MFYA 1DARA 4Q7KA 3ZGXA 1XMVA 3P27A 2R8RA 5FL7D 1XCMA 2FOLA 4NYIR 4MH0R 3MAAC 2WWWA 3UWKA 4DLZA 4DSUA 4LHXA 1ZP6A 4DLUA 4ILEA 4K8OA 5FI0B 3IILA 4Q18A 4AYXA 3C7KA 1W4BA 4GOXA 5BYKA 3VNVA 3BAFA 1ZJ6A 3OF5A 2BCJQ 1U8AA 2A5DA 3AF2A 3KXKA 1ZUNB 1VG9B 4GZLA 4P3YA 5HCNA 2OM2A 4DLXA 3ICEA 3EW9A 4XJXA 3B82A 1XDBA 3QKUA 5DI9A 1EX7A 5EJEA 4KJZA 4BZXA 1W0KA 4KSBA 4HDOB 3MD0A 2GZDA 3U60B 3EPJA 3QIAA 4G3XA 1N0VC 3SS8A 5FTNA 3OAAD 1TF2A 3A6PC 2KE5A 3I32A 3C5HA 1I4LD 3Q9LA 1Z2AA 4BFUA 2D06A 2IYVA 1YHNA 4IXNA 4Q7MB 1DO0A 4CW7A 1FTNA 3WMEA 4RCYA 1RE0A 5DISB 3P1JA 4GBMA 2VIIA 4NCKA 5DH9A 5JLJA 2NO1A 2XTMA 1V5WA 1DAFA 2IF2A 1KDRA 3AQ4A 4AK9A 3THWB 2GEVA 1UDXA 2ZPTX 3K0CA 3FHTA 5G41A 5FUWA 3U3RA 1NN1A 2R44A 4ZI3A 2ZRKA 4JLBA 3C14C 4CEIB 4Q4HB 4RD4A 4Q9LA 2GWHA 4FMDB 1L4UA 3L8YA 4HAYA 4LUCA 5KSYA 1R2QA 1R0ZA 2JLZA 2HT6A 4I81A 2ZANA 4M1SA 5FOWA 4M9QA 3QSYA 2QBYA 3ZZTA 1KJWA 2JLYA 5A0FA 1F2UA 1ANKA 3LNCA 3N2IA 3ZYCA 2CLCX 4OI2A 1NI3A 2GEDA 4Q1FA 4DLRA 4ZDIA 4PHFA 1BKDR 4D0NA 1G5PA 3GFOA 4RKEA 4B6FA 4M1TA 2IC5A 2WVJA 4EKDA 2HYDA 4NKRA 2IYRA 2JIZD 2IYLD 3QXJA 2V3CC 1I2MA 2WWIA 3KFVA 3PUZA 5FH9A 4DLYA 1E79A 1QHXA 2OLKA 2QPTA 2QTFA 5C4GB 1XPOA 3QEJA 3P32A 3U7GA 4RD0A 2QGNA 1GIAA 1LY1A 3CH4B 4AWXA 2BC9A 5K8LA 2QA5A 2V1UA 2SHKA 5JRZA 1XNJA 4HLUC 1OB5A 1E2IA 2AD1A 2Q3HA 4DCVA 4DXAA 4G5GA 3VKWA 2ZRLA 4KITB 4V03A 2WWXA 3T1QA 3UKDA 1GFIA 1N3BA 4S35A 3EC2A 4ZDKA 1NY5A 1Z5ZA 4IOKA 2CLSA 2R9VA 1OB2A 4GRAA 3CF0A 3OIYA 1NL3A 3LBNA 1KDPA 1K5GA 3DKVA 3MMPA 1CULC 4JL6A 3R7WA 1QHHA 3ADBA 4JVSB 2KI5A 2OXCA 2Q9BA 3L43A 2X8AA 4Q7LA 1SQ5A 1RJ9B 3NBZC 3GFPA 2F6RA 1XWIA 4Q21A 3LH5A 2ZAOA 3UXMA 3GLFA 1Z6TA 2ZR9A 3TNFA 1KAGA 1ZNWA 3QBVA 4IOMA 3BH0A 4A2WA 1XEXB 1Q1EA 2IX3A 1T3SA 4GFDA 4PO8A 3FVQA 3H86A 4QNRA 2ZRIA 4FMDF 1S9HA 2CHGA 4ZCLA 1G3MA 1W2HA 4QM6A 4BRUA 5BN3A 4OJQA 2A5YB 3GEHA 1VIAA 2C78A 2NPFA 5FOXA 4UNPA 1AM4D 4PPFA 1EFRA 4M9ZA 1O3YA 4NYIQ 1TNDA 1B0UA 5UKDA 4CEJB 4D80A 1E3MA 1F2TB 1YR9A 2IUTA 3LW7A 3WNDA 3K1JA 3EA0A 5M04A 4RFSB 3MRSA 1TX4B 1IQPA 5ELXA 1VMAA 3OEED 4FN5A 2PJRA 1JR6A 2O8CB 3E5HA 3IPXA 4M9SA 4F4JA 4HUTA 2YV5A 2QQ0A 3GMTA 5CB6A 3TW8B 1DOAA 1XTJA 2OE2A 3EZ6A 1IOZA 2J0UA 3A4NA 3NDPA 2JLUA 5GJCA 2FJUA 2IS6A 1T4GA 1WE2A 2BWJA 4PSVA 2HYIC 4IFBA 4L5BA 4NCIA 3T61A 1AGPA 1UJ2A 4DZZA 3K0AA 4YLGA 3AKEA 5BXQC 1NF3A 3RC3A 4D25A 1TQDA 2IS1A 3TAHA 3M4YA 1R0XA 3MG9A 3CX7A 2G0NA 3NHBA 1BO6A 4LHVA 2ECKA 2PMDA 3CX6A 4QGHA 4HZIA 1TL7C 2ZRMA 1WCV1 1D6JA 2JJ1A 3KJGA 2VQSA 4LJ8A 4QM7A 3ZH9B 1PZNA 4IFEA 1UFQA 4BFTA 3NEYA 1AIPA 4B34A 1E1QA 2GESA 5JJKA 2AD5A 1D5CA 2H1LA 1U99A 4EPRA 2ZUCA 1WXQA 3RYTC 4G5SA 1D9XA 721PA 3THYB 2EQBA 2VF7A 3AB3A 5BYJA 2CEAA 3W8NA 5KDOA 4QOSA 1ZYUA 2XZPA 4LY6A 1E99A 3U44A 4OHWA 4KVGA 3FTQA 1IJFA 1Z6XA 1E2GA 2Z4SA 4Q1BA 3S1AB 1DAKA 2ZAMA 1CKEA 2QRNA 3K8YA 3U7HB 1MO3A 3KKQA 4QHSA 4DCNA 3AM1A 2WIAA 4ABYA 1OFTA 4BLQA 3WNBA 2B92A 5C18A 3BE4A 2PCJA 1BS1A 3SJZA 4TZ0A 1Z0IA 1D8TA 3KKPA 3BERA 1E0AA 2F1HA 4C0HA 2C9CA 4ACBA 5CJ2A 5DGXA 2H5EA 1VIYA 1N6RA 1F5NA 1QDEA 2JA1A 1P9WA 2RGAA 3WMGA 4JLAA 2ERYA 1AQYA 3X1DA 2ZI5A 1FOEB 3I8XA 3KKNA 3TBKA 3MSXA 5A4JA 1NIPA 4C30A 3DMNA 4OK6A 2EWWA 3VTKA 4GMXA 3KL4A 2GDJA 4LJ9A 4OBEA 4B44A 5BN4A 4HB0A 4M1OA 4XTRA 4B35A 3TJZA 2IXFA 1GILA 3I5YA 1YJ5A 2AWOA 2F7SA 4OK3A 2O8FA 2FMXA 1IN5A 2FGJA 3F8TA 4TN1A 5HE9A 1W0JA 4DDWA 5F9FA 1LVGA 1EXMA 5EZ6B 1FPMA 3EX7C 3KZ1E 1XD2B 4BZQA 3EPHA 2ZR0A 3B60A 1KSJA 2KJQA 1N5LA 5LPNA 1OH6A 2GEUA 4EQ6B 2PZGA 3NKVA 3QKRB 4XWKA 1Z0FA 2QQEA 1KKLA 1E0KA 5C46F 3G82C 4E07A 1XXHB 1II8A 3MJRA 4MKHA 4PZZA 3HWSA 3RS4A 4I1UA 5CM8B 5KHOC 1JR3A 2XITA 4LYHA 4LK2A 5FPSA 3BH7A 3OE7A 1ESMA 1HE1C 4P31A 2JATA 1M34E 3RWOA 3X1YA 4FCWA 2RAPA 2V7QA 1X86B 3B5JA 4ASUA 3ADKA 5EE3A 1EFHA 4AKGA 3DVLA 5HCIA 4TLBA 3RRYA 4PR0A 1E2JA 3VFDA 5JZVA 4LV5B 2QTVB 5KO2A 2ZEJA 1TU4A 4RCZA 1ZAKA 1MO4A 4TT3A 3RRZA 2QM8A 1KYIA 1LB1B 4CIDA 1GG2A 1M74A 4NL4H 1MOZA 4BLTA 2PX3A 4WZAE 1T8TA 3WYAA 3CR7A 2GXQA 3B1XA 4MYTA 4ARZB 2ZRAA 2BBOA 4LYAA 4BLOA 2CK3D 1U0LA 4HYYA 3QG1A 4EJSA 2DR3A 2C98A 2DYKA 1U9IA 4B2PA 3NTUA 3ZD7A 5HPYB 3OEHD 4LBZA 1IN6A 1TEVA 1NSFA 5FL7A 1JECA 4MYHA 4URZR 1KO1A 1BH2A 1PLJA 5K8TA 3BBPA 4O3MA 2VA8A 3FFAA 4HB4A 3X1XA 5GJVC 1OIXA 2FZLA 3CW2A 3IBYA 3QVUA 4QHTA 1IM2A 4ON9A 3I3SR 3SFZA 3P26A 3IBGA 3LX8A 1R5NA 3IPYA 1OW3B 3IIKA 1R0WA 5FOVA 2WV9A 3V9PA 3FWYA 4JVMA 4WBSA 4R71A 2IW3A 1XXHE 1PUJA 1Z0DA 2GF9A 2J0QA 2GXSA 2D3WA 2NQ2C 2OBLA 2CHQA 3QPUA 1AKEA 2CHVA 3WHKA 3Q7QA 1X8JA 5B58C 5KYKA 2VO1A 2VYFA 421PA 1QF9A 4A92A 1GOTA 3QE0A 4PQYA 3GLHA 1VPLA 1P61B 1XEFA 5HZHA 1AN0A 4HLDA 3OAAA 4FWTA 2REXB 5CYPA 4Z8YA 1XZQA 5DN6A 5EXSA 3UWOA 2LWIA 2UKDA 1MRNA 2ZSDA 3GJ0A 4OHVA 4B75A 1U94A 2OLJA 2O8EB 2GETA 3D8BA 2HT1A 1S2MA 3Q7PA 4IOLA 1NN3A 3J81k 1E2FA 1ELOA 2JJ8A 3RHFA 1CBUA 4TLAA 3HU3A 4IXMA 1G19A 1NJFA 4V0MA 2G1KA 3CRQA 621PA 3F3YA 3FKQA 1NIJA 1SVIA 4UKDA 1QHYA 5FPYA 1DAMA 1A2KC 1AKYA 1DELA 3NC0C 3CLVA 3ETLA 2WPDD 1I4DD 2F1RA 3HP1A 1XD8A 2ZYWX 1E96A 2A2ZA 1US8B 2W00A 5L3SA 3LXRA 1HUQA 2EVWX 4B2IA 4U7DA 3QXHA 1W47A 5AJYA 1M1YE 1IONA 2VP0A 2B7CA 2Q6TA 1G6HA 4QGGA 2F1IA 3PV0A 2FSIA 5FBQB 2V4ZA 4H1UA 2WJGA 2RCNA 3EASA 1FTSA 3JZAA 1N6PA 4PC3A 2QMHA 4WVFA 4ZO4A 2ODBA 3LVRE 2WJYA 3K9GA 4A6PA 1CJKC 3VX4A 4DHEA 4A1FA 3B7GA 4NTZA 1SHKA 2WSSD 4W7SA 3TKLA 2WKPA 3MCAA 1E1RD 2CCKA 4JBWA 4PZLA 3V00A 4EUNA 4OI0A 1TF7A 2ANCA 4UXIA 5B57C 1KOFA 2BV3A 4BFZA 4Q7JB 3MWLA 4MUBA 4BEBA 5IHPA 5TARA 4DUGA 1E2HA 5F98A 2HEIA 2ZSBA 5KNDA 2CVHA 1XD9A 1QVRA 1WA5A 4Q19A 1X8LA 1AS2A 1S1CA 4ZKEA 1SXJD 4ZKDA 3HDTA 2FG5A 4KFRA 1WDTA 3SJBA 4XD7D 2Z83A 2OBMA 3K0FB 4BPBA 4LSGA 3CUEF 1SVOA 3LW8A 2IBMA 3SJCA 1NKTA 1N6OA 2IUSA 1UEIA 3VR1A 1OFIA 2GXAA 5CJPA 4W5WA 1E0JA 5FR1A 4BQSA 1RZ3A 4B32A 2X1VA 1ZRHA 1T3LA 1R5BA 1PUIA 3KJEA 5JI2E 3PFIA 4PHHA 3VR3A 4MKGA 4POAA 3Q8XB 2OEPA 3VR6A 1KI1A 1KZGB 3KX2A 1EFCA 3AH8A 3FHOA 2H7VA 4LRWA 3GCGA 4Q1AA 4HAZA 4MITA 2VP9A 8OHMA 3AVYA 3W5IA 1JBKA 3CNNA 3PEYA 5J4LA 1OJLA 3C5CA 3DHWC 3IGFA 3PENA 3WHLA 4C0AC 4TMTA 1YRAA 1N0WA 4M53A 4Y0AA 2PX0A 1XPUA 4B71A 1W46A 1COWD 1DTSA 1EG7A 1FNNA 2LKCA 1ZD1A 2ZJBA 3OIVA 1ZUIA 4YDHB 3AVPA 5EZ5A 3EPLA 4BFVA 4Q48A 3ZQ6A 3PEUA 4B3DA 3W90A 1AQUA 2VLIA 1RKBA 1XPRA 1T5LA 2NO7A 3VQTA 4XSGA 1PV4A 4HZUB 2I3BA 4D4KA 3M1IA 3LDAA 3LWNA 1J2JA 3QKTA 1GL6A 2P6RA 3ZLJA 1XTIA 2JDID 1OXTA 2R65A 2ZJ8A 3ZDQA 1VG1A 2BIFA 1G41A 2K5UA 3KQKA 1GNPA 2C99A 1U0HC 3T06B 3NWJA 5FTKA 1P2TA 3BFVA 2RGEA 4H9GA 3QXXA 3BB3A 4BGDA 4YMSA 2PL3A 3SR0A 2ZREA 2WZQA 3A58B 3T12A 5TY0A 3VR4A 3WNCA 1SKYB 1XMIA 2HF8A 4OK5A 4QJ5A 3RVBA 3IKJA 3CBQA 4NCNA 2GBLA 1LFDB 4B3XA 2QAGA 3WRYC 3EG5A 4MRVA 5JRJA 2VP6A 4DBLC 1N2CE 2GHIA 1NMXA 4NZYA 1ZNZA 2O8DA 3GD7A 2QG6A 4P4SB 2QP3A 2EWVA 4BLPA 1U81A 1NJGA 2CJWB 4LJAA 5SZHB 3DKPA 1VCIA 1VCMA 2GK7A 4YC7A 2YVUA 2G1JA 5E7MA 3TQCA 1HURA 2OFXA 3A1VA 2HCJB 4TYQA 4RZ2A 3U4QA 1BYIA 4WZ6A 4M1WA 4LDJA 4LPKA 3ZQJA 4I1VA 4EPWA 3I62A 4RFVA 1R8QA 5DYIA 4P0TA 4HDQB 4Z8XA 1LNZA 2A5JA 3DM5A 4K81B 5JWOA 521PA 3TGPA 3DEFA 1OE0A 3SNHA 1Z63A 1K6MA 2VTKA 4MRNA 4A36A 4KSCA 1CJMA 4DDUA 4KI0A 1Z3IX 3Q5EA 1E0SA 1F3OA 3ICQB 4YMVA 1F48A 3TIFA 5H1YA 2CE7A 2P67A 2RKOA 2ORIA 4W9MC 3FKSD 5EUMA 5EXPA 4JJKA 2F3TA 2ZRJA 1EX6A 4QBFA 3EIHA 3GLGB 1ZNXA 2XTZA 2Q3MA 3B1WA 1GDDA 1MT0A 5B30A 5IK2A 4MRSA 5CK5A 5JCPA 3IEVA 3LX5A 4ZIRA 1E9RA 1EFTA 2ZYUX 2CLDX 3PR1A 4LYJA 2ZI7A 3U3MA 4I1SA 4XVRA 2QP9X 1KMHB 1HQYE 1X8KA 2OFWA 1L4YA 4NBSA 1SKYE 2H17A 2RGDA 2WMOB 4DLSA 2IS4A 4L9WA 4PQRA 3LQQA 5TXGA 4QKQA 4AY2A 1GSIA 1ZVQA 5CIQA 1Z0KA 4N0EA 4Q47A 1W48A 4TTPA 3O8RA 5DNYB 1PLLA 4JSTA 1V43A 2VH5R 1TPZA 2ZRGA 1CRQA 4Z1MD 2HV8A 4UNNA 3CRRA 4LC1A 4DWJA 4KHZA 1G20E 1VYVA 2WOOA 3TLXA 4W5HA 5EQTA 1JEDA 2YNMA 2GA8A 4IHQA 5LB4A 4AYTA 2W6ID 3CF6R 1G8YA 1OLOA 3E2IA 2ZYVX 2VHQA 1FX0A 2BBSA 2VRWA 3D6TB 4LV8B 3KDSE 4FXPA 4GSYA 1GKYA 2XTNA 4II7A 3SJAA 1XMJA 5JS7A 1E4VA 1U90A 3DMDA 3AVVA 2F3RA 4TL8A 3ADDA 5CDFE 3QXCA 2NMVA 4C2UA 3SHWA 2RMKA 2EW1A 2GJAA 1TTTA 4IRUB 3ND9A 1WBDA 3WY9A 2MSDB 4CEHA 4L15A 3O8CA 4EFMA 4OYHA 2MSEB 1CIPA 4O2LA 1VCOA 3OFNA 3REGA 2CK3A 2Z5FA 3GLGE 2QAJA 1KI2A 4D4JA 3LBIA 1R4AA 4TL7A 4B2LA 5BQ5A 1T5IA 5E7JA 5JCZA 3PITA 6Q21A 4Q4JA 3SBEA 1R8SA 2IUUA 2W2XA 4C2TA 3MJHA 1R6BX 2CL6X 1DAEA 3QOFA 3CO5A 1E9EA 2J7KA 2ZQ5A 4HATA 1PVOA 1QBKC 2OESA 3CZQA 1Z06A 4D4MA 1HT1E 1KJZA 4TL9A 5FBLB 2HJGA 5J4YA 2KBFA 2PLFA 4NP6A 5KSOA 4ITRC 3QG5A 2ZSAA 4PO9A 4WIAA 3QY0A 1R10A 4DCTA 1XTSA 4UNRA 5JI3E 3THOA 1DPFA 1KI6A 1W44A 4EAQA 3GJXC 3SYNA 3QVVA 1NN0A 1MO5A 2ZXUA 3FGNA 4PHGA 2OZEA 1DBSA 2HLDD 3OHMA 4G5QA 4JYCA 2QSZA 3RAPR 3UK6A 1NVVR 1MO6A 3W5JA 4AC9A 2H92A 4YDSA 4Q03A 4E03A 3LFUA 3GP8A 2WM9B 5DLQC 5C4MA 1S3GA 2C96A 2WAYA 1NBMD 2D62A 3K9HA 3UPUA 1RYFA 2Z0MA 4HUQA 5KNBA 5KNCA 4TLDA 2Z43A 3SC3A 1GRRA 2OV2A 3SN6A 3O8BA 1KO5A 4FCTA 1TQ2A 3LV8A 4JLMA 4US0R 2C9OA 4F38A 2ZM5A 2ZS8A 3B6EA 1WMSA 3I73A 3CPEA 3NG1A 4RFSA 2VL7A 4OQLA 2J41A 4PAMA 4QGAA 4BFSA 4B3CA 4FIDA 4CGZA 4URYR 2XNSA 3AF1A 3QKSA 2CVFA 3IQWA 4MRPA 4LJ4A 2D2FA 1NRJB 1Z28A 1P3JA 5JWHA 3RWMB 3BOSA 1QHIA 1ZMXA 2ZTSA 4KBFA 2OCYC 3CNLA 2ZYTX 2QBYB 2VP5A 1OYWA 1VKJA 1ZCBA 1F2UB 1XTQA 4DT1A 4URXR 4DDTA 1OXUA 4AIIA 3EIEA 2BM0A 2QENA 3SEAA 2H18A 4KLZA 3AKDA 1RVDA 1NG1A 4KFSA 1DADA 3RANA 3AVQA 3GEEA 2YC4C 5DI3A 3AVTA 2WJVA 2XZLA 1E69A 5E7IA 5G3ZA 1LF0A 4YXWD 4OKSA 3L0IB 1F60A 2GVZC 2FEMA 4KBGA 1FFHA 1N6HA 4R98A 5J5CA 3TSWA 4AYWA 1JXOA 2VPPA 4ZCMA 5B64A 1E9FA 4GZMA 4FCVA 2JLQA 1C1YA 1W5SA 3AKYA 4OQFA 3G0HA 2JLWA 2WSSA 1CR0A 4X8LA 3EIQA 4PPGA 3AP2A 4RD6A 3TE6A 1CR1A 2FNAA 2FPLA 3SDZA 1G4UR 1BMFD 1LW7A 2ZI6A 4A15A 1KIMA 1RIFA 2MMGA 1X1RA 2R6GA 3EPKA 4DB2A 2VHTA 4JYBA 3W34A 1AZSC 1Z07A 4A8JA 3AVXA 4GOKA 1CU1A 2R62A 2GZAA 1N25A 2N42A 1D9ZA 1UF9A 1GITA 1AA9A 3EC1A 4A2PA 4DLWA 4DSNA 1GVNB 2CDNA 2WAXA 2JLSA 2BJVA 5CLLA 3R7WB 2G0TA 2P3SA 2FF7A 4TWZA 3R8FA 3AF0A 4O25A 3GLFB 1SXJA 3DM9B 4Y0VA 1Q1QA 3AP3A 4XD7A 1G7SA 3RS3A 4JLVA 4KU4A 3KTAA 2IS2A 4MUAA 4TLEA 4BFWA 4MA4A 5FBRB 2JGNA 3GFTA 2LKDA 2OCBA 2CCGA 3CWQA 2RGNC 1UKVY 3U6KA 4TLCA 4PC7A 3V4RA 3SHFA 1Z29A 2W6JD 2Q3FA 3DO6A 5FTLA 1W4AA 3RS7A 2OAP1 3K09A 1MABA 1CJUC 3T1TA 4ZCIA 1NLYA 3SE0A 1UDWA 2KBEA 1Z83A 2ZE5A 5TMPA 1ZM2A 1KI9A 3T34A 4GP7A 4PQFA 1KTVA 3X2SA 1G18A 3VHLB 4JKYA 2JJ2D 4LOAA 1YZLA 1P73A 4XVUA 3ECCA 5LD2B 4DSOA 4JL8A 5JECA 4RD2A 3HYTA 1COWA 2IEZA 5CYOA 1J8YF 2JCSA 1N0UA 1H8HD 4Q9KA 1JPNA 3D3QA 2IEYA 2ZJ2A 4QRHA 4C0KA 2YKGA 3KKMA 3MWYW 1NKSA 2QL6A 2HXYA 2J59A 5HKKD 4G01B 3NDBB 2G83A 4N3NA 4XH9B 2FSHA 1P5ZB 5F9HA 4JBYA 3K0AB 3U6BA 3O47A 2B6HA 3HYRA 1DAIA 1VHTA 1UKEA 2ORWA 1NVVQ 4QGFA 2WBLC 2HXSA 1NMZA 1XRJA 2JDIA 4NYJQ 2IYSA 1LS6A 2AKYA 1HT2E 3AV0B 4TMZA 3K53A 3DOEA 3AUXA 1CEEA 2WWGA 1EK0A 3P20A 2PMKA 5LBIA 5C2JB 2J0SA 1A5TA 3TK1A 2ERXA 2XX3A 1DEKA 2QPAA 3B2EA 2E1RA 3GLFE 2F55A 1J90A 1ZM3A 3GJ6A 2GJ8A 4F4IA 2C9YA 1E2LA 5EP1A 1U0JA 2CL7X 4AG5A 2VF8A 3IIJA 2OAQ1 4LCBA 1AZTA 4WA7A 3ZVRA 4KAXA 3CIOA 3RS0A 5KPJA 3PXGA 2D2EA 1CRPA 3T15A 1NP6A 4EPXA 2BHRA 2P5TB 2J46A 4IDNA 2B8TA 1KO8A 1RRPA 3SU8A 1J8MF 1OH8A 4E22A 3B9QA 3L8ZA 2ASEA 4C7OA 1DG1G 2EFEB 1RC8A 4LHZA 3QEOA 5L3QA 1OHHA 3SFVA 1ZINA 3FOZA 1DAHA 2E9SA 1Z6YA 1G5RA 1CR2A 3UMFA 4Q9IA 1VG8A 3H1TA 3GJ5A 1GP2A 4ESHA 2O8BA 3GLIA 3A1TA 1SZPA 1E2MA 1W1WA 5FFMA 5E3HA 2GAAA 5EP4A 1JAIA 1H8ED 1KK3A 2GF0A 2O8FB 4TSFA 3CZPA 3FKSA 2ZVQX 3FMOB 3VX3A 1HQCA 1UADA 4MKIA 5GJWC 3TVTA 1EWQA 5L3RA 3REFA 1JPJA 3QPVA 1XB2A 1AS0A 4XWAA 1VDZA 3QF4B 1XTKA 3QPWA 3I61A 1UBGA 1E94E 3P4YA 4R2HA 4F91B 4R9UC 1XEWY 4KYUA 5JSZA 1II8B 2ZVPX 3BGWA 2IYZA 3FYHA 2FX3A 3CRMA 1IBRA 4Q4AA 2EFDB 2LCFA 3Q5DA 3RRNA 2YZ2A 4HAWA 5JFGA 4HB3A 1T8UA 3LAWA 4F4CA 5EE9A 5AUPB 1US8A 3W9YA 4ESVA 1HH4A 1NLZA 1LF5A 2FFAA 3EZ2A 1S4QA 2OBNA 1WQ1R 5JMTA 2AWNA 4YONB 3I1FA 4FMBB 3I8SA 3EWAA 4LJ5A 3ASYA 2ZRFA 3PUWA 4Z54A 5JBQA 2ZJ5A 1Q21A 4DJTA 1E79D 2D7CA 2OUKA 4A9AA 5FBVB 1XCPA 4HLUA 4UXHA 1S96A 1OXVA 2C03A 4URUR 4UXJA 4PC1A 3KB2A 4A0HA 3IEUA 3PCRB 2A78A 3ZIAD 1Q1BA 4X8OA 1G3UA 2IXEA 3VU9A 1UKYA 3B13B 4EJSB 3EAQA 4O2RA 3RNLA 4GMDA 1SGWA 2Q0HA 4KVAA 2QPOA 3H0KA 4PC6A 2FWRA 1OYYA 1G3RA 4Q00A 4EPTA 1P4SA 5D3MB 1A4RA 2HUPA 4UJ5A 2FPKA 2DFTA 1MKYA 3K0CC 2YINC 1KI3A 5CB8A 3Q85A 2ZS9A 1XCGB 3Q3JB 4URWR 1R5OA 2IHYA 4XSHA 4FD2A 3SOPA 4D4LA 3AF3A 3FMIA 5AUOB 2YOHA 3EZ9A 2CE2X 3TSOA 2O52A 5KOYA 1HYQA 3I92A 4PFSA 1G64A 1CS4C 2RGBA 1ZD8A 2NO0A 1G3IA 1QHSA 3LD9A 2XXAB 3LLUA 1ZM4A 2VEDA 3TUJC 4NYMR 1J7KA 1JR3E 2BEJA 3WXMA 4C0BA 4YQFA 1QG4A 2JIZA 3NBXX 3NC1C 2JLRA 1G4AE 3GLHB 5DI3B 1P72A 1A82A 2HLDA 4PAOA 3H84A 1IAQA 2WTUA 4KXFB 1N6LA 1AS3A 1ZW6A 1D2EA 2GCOA 3RS5A 1N5IA 1N6NA 1VTKA 1FW6A 4GPTA 1E9DA 1NBMA 1YKSA 2QN6A 4AKIA 4JT4A 2TMKA 1TQ4A 3AUYA 3FHCB 3JVVA 3BXZA 3CX8A 1JXMA 2GTPA 4RD1A 2WSMA 5AUQA 1P7CA 4V0OA 1Z22A 3SBDA 4JT2A 3SQXA 1QHGA 4DB4A 2J7PD 4LWZA 1D2NA 3F0TA 3CKLA 4C0QC 4DKXA 2C95A 2ZRPA 4XIGS 2X2EA 4CZ2A 2GRJA 3U3OA 5JEDA 2VHCA 5J4VA 4JLNA 3OIUA 1UEJA 2N1BA 3ADCA 4OHXA 4RZUA 3UG6A 3KJIA 1RRCA 2HDNB 5DO9A 2JJ1D 4NMMA 5AJVB 3KQLA 4NDZA 1XJ0A 2BBWA 4BASA 2FFBA 3QBTA 1IY0A 2GJ9A 2YJTD 4TYYA 1M7HA 2OO7A 1VYUA 1Z6GA 5LB2A 2GILA 2NG1A 1II0A 1YQTA 4CRWB 5G53C 5BW8A 5G40A 4D6PA 2OCPA 1CXZA 2QZ4A 4X8HA 1WBBA 4FINA 1FUKA 2EYQA 2FFQA 3B1VA 4E5UA 4D26A 2QY9A 2IL1A 3V4FA 2PZEA 4P4TA 5F3WB 1OFHA 1QRAA 1VYTA 4LBVA 4PHTA 1G21E 2MSCB 2F43B 4QFMA 5KSZA 1ZUHA 4IJMA 1NSTA 4EPVA 1Q0UA 3U7FB 3MGCA 2RHMA 4WZBE 2RH5A 4NCJA 3OEEA 4DLTA 4K46A 1G7RA 1GTVA 2J87A 4LYFA 1BMFA 1CF4A 1RRFA 1YZKA 2WJHA 5CITA 1SVMA 3GLHE 4A4DA 5CK4A 2J9RA 3QXSA 2XJ4A 2CBZA 4KO8A 2X77A 5FTJA 1CP2A 4IEIA 2PBRA 3BD9A 5LD2C 3N70A 3THXA 2CNWD 1YR8A 2QMEA 2FZ4A 5J4KA 4F92B 3ZD6A 4ZV4A 1KSGA 1OT3A 1XJQA 3CRW1 4Q02A 1XJCA 1T6NA 2ZRHA 4V0ME 4A2QA 2IHBA 2BM1A 3C16C 3TUIC 1Q3TA 2OCAA 3KXLA 5FUYA 4CVNA 1EGAA 1ETUA 2BEKA 3JZMA 2IT1A 4H1VA 1GUAA 1P9NA 1W0JD 3BJIC 3AGPA 4OQMA 2DB3A 3D7MA 1XZPA 2YWEA 3B1ZA 3ND8A 3CF2A 4M8NE 4WW0A 3EWSA 1MH1A 1QHNA 1W49A 2QTHA 3LLMA 5AJZA 2W6JA 4JLDA 1D2MA 3FMFA 5EP3A 2P6UA 1ZU5A 4NONA 3RC8A 4IOJA 2FSFA 1OIWA 1GKIA 3NIBA 4L4UA 4PAQA 2WWYA 4R7ZA 2PH1A 2EYUA 4YMUA 1RRGA 4OQNA 4QJ3A 221PA 3T35A 2WMNB 5BWMA 3LO5A 4G5RA 5DHAA 1CLUA 5JWRA 2B8WA 4MDEA 3R9IA 2WHXA 2P0EA 2GNOA 1EESA 2O5VA 1G291 5JJIA 2QEQA 2ZI3A 4Q9JA 3OE7D 1AJEA 1ZM9A 4PPQA 1FMJA 2JAQA 1KHTA 2A5FA 2V7QD 2XAUA 3AF4A 4UQOA 2QRZA 4ASUD 2VHUA 4LJYA 4KLNA 3SI7A 3RRMA 2W0MA 2CL0X 3I4LA 2BMDA 4AI6A 2OILA 1JQLB 3RS2A 1CJTC 1JJ7A 2V54A 4X8MA 2IXGA 4F93B 3MLEA 3CM0A 4NYMQ 4C4PA 1H8HA 3CR8A 1W36B 4CT5A 2G6BA 1TUIA 1YRBA 3W8RA 4TT3D 3LY5A 4OL0A 3FDIA 4TZ6A 4L9SA 2REBA 3A1WA 5SZKB 2HF9A 1KI8A 1U8YA 3CPJB 1CTQA 2QAGB 1OPXA 2DFKB 2D4HA 2I1QA 3MUFA 2NZJA 4IVRA 2V9PA 4EFNA 2O8DB 3NH6A 4M1MA 3P4XA 3AGQA 1JEEA 4BUJA 3Q72A 2ZS7A 3FMPB 1S3SA 3HR8A 3C41J 4EPYA 3THWA 2YOGA 3PEVA 4G5OA 5CM9C 1FQJA 3K0EA 1EWRA 1M8PA 4B3BA 2J3EA 2XOKD 4HB2A 4N0DA 4CEIA 2PT5A 2FSGA 3EZFA 2IK8A 5ANRB 4HLQB 4Q4HA 3U4QB 5IDVA 3T1OA 5J40A 1QZXA 3K9LA 5FL3A 3C4JA 2IA5A 4JLKA 4UNQA 2R6FA 4NHOA 5AK0A 4BE7B 4DIDA 3GJ4A 2V1XA 1DE0A 5SZJA 4KFTA 2GK6A 3IO5A 5JJLA 2RHDA 3RSLA 1HV8A 3EA5A 4HLCA 1Z08A 3KFXA 3BK7A 2HJVA 3T5GA 4ACAA 4FI3C 1RFLA 1DG3A 4A0FA 4QBHA 1P62B 2W58A 3CH5A 4M22A 1T9HA 2QP4A 3WP1B 4PXAA 1E2EA 4US2R 2QUZA 1JJVA 2NOAA 4D82A 1Z0JA 1U8ZA 2WJJA 5FUXA 2JLVA 2AHOA 2AKAB 4CT4B 3RLFA 1G8PA 4JMPA 1P2UA 4QC2A 2DWOA 4GL2A 2ONKA 3B9PA 5DN6D 1ZIOA 3HPQA 4IW3B 4F7WA 4ZIRB 2QE7D 1TQ6A 2VSOA 1SULA 2IYQA 4M4SA 2XSZD 5DE3A 3VKHA 3ZS9A 1H8EA 2EFHB 2C5LA 1JAHA 2YWHA 3FB4A 1E9BA 5SZIA 4M2LA 1ODFA 1XBTA 2VSXA 1YR7A 3BWDD 1JNYA 4KYIB 4OJKA 4QG7A 4M1YA 2BJWA 5IRCD 4OI4A 4TTQA 4EJSC 4QJ4A 3OEHA 1IXSB 2H57A 2B7BA 3HU2A 1DO2A 1GAJA 1U9IC 4WXPA 1NY6A 2ZROA 4TYPA 2YWFA 1M7GA 1BOFA 1W5TA 2PEZA 4DSTA 1KK0A 1KI4A 1RJ9A 1Y63A 5KSPA 1L7VC 1S9DA 2RGGA 4ZI2A 3NEJA 5KDLA 4MRRA 4MDFA 3QENA 1S1MA 2FFHA 2PEYA 3VR5A 4AKHA 4WAUA 5FOSA 2DY1A 1FMLA 1XEXA 1KDOA 4G1UC 1HEIA 2ZUBA 4IVPA 2ZJYA 4JIMA 5HTKA 4NYJR 3FFBA 1W4RA 2FU5C 2A5GA 4JS0A 1FX0B 1LS1A 5GJBA 1KSHA 3DDCA 2FH5B 2DPXA 1OKKD 5DYGA 1CR4A 4PANA 3CB4A 3ASZA 4JBXA 1I4TD 4Q01A 5GADl 1TAGA 4CEJA 5DSZA 1OIVA 3SYLA 1F2TA 4DUGD 2UVQA 3L0SA 1KY2A 4OHZA 4JZKA 3R8CA 4GDFA 4KCGA 4CEHB 1L8QA 3ZVLA 3GJ3A 4RVCA 2OXRA 3EZ7A 3IHLA 3U61B 3ZIAA 4A0GA 1SKQA 2GZHA 4LZZA 1JQJC 2O8CA 3GJ7A 3TVDA 4R2IA 2UZ3A 4Q4JB 1RW4A 3A4LA 3M0EA 2QT0A 3WYGA 2WPDA 1SVWA 4DLVA 3QF7A 1FL9A 1P9RA 4U5XA 3WMFA 3OIWA 2ODNA 1FQKA 4Q5IA 1IN7A 1YZTA 1VCNA 2ODWA 1IY1A 4LX0A 4JLPA 1ZM7A 2GXUA 2OG2A 5AUNB 5KDDA 1SVLA 5L8VA 1GRNA 1FZQA 2AXNA 1A1VA 2QSYA 2P5SA 2IYYA 2R2AA 3R20A 5K8UA 4EIWA 3N2EA 4A0RA 2QM7A 2GVDC 2IF0A 2ANBA 3PUYA 1KI6B 2XNDD 4TTRA 5AJXA 5AR1A 3W6NA 2ZI9A 3BRWD 4QBIA 2AFIE 4V0KA 2ATVA 2BMJA 5LDDC 1A2BA 1E1RA 1O87A 2OHFA 2PLRA 3BH6A 3LBHA 1FP6A 1G8GA 2OSBA 1UBEA 2AFHE 1G7CA 4MQBA 1Z2CA 3PVSA 3THYA 4HUQB 2AR7A 4BRWA 2ZJZA 1Q20A 1G1MA 3S1AA 4BEJA 3U2QA 2AN9A 4HAXA 1X1SA 3LA6A 4V0LA 4BZPA 3KB1A 1QHHB 1KAOA 2QI9C 4QL3A 3UMSA 1LTQA 3AVWA 4LGMA 1DVRA 3CNOA 2XJ9A 4MGIR 4PTLA 3QKSB 4URVR 4RZ3A 3LQRA 1FNMA 4XOIA 3NH9A 2QNRA 3SQWA 1G16A 1W36D 3EXAA 3IHWA 1UM8A 2AX4A 5L3VA 3G5UA 2J7PA 3QNUA 2YYZA 4BLSA 5EP2A 4DT1B 2A9KA 1N5KA 4LPSA 4HAUA 1YZNA 4LI0A 3VHXA 4Q1EA 2A30A 1KGDA 3W6PA 4TYNA 4M1KA 3CPHA 4IDOA 5FI1B 3DPUA 4LHWA 1RPZA 5DIFA 2KB0A 1ZBDA 4WOPA 5E95A 3BORA 3OESA 3ZZ0A 4L8GA 3O8DA 1TMKA 1XD2A 1E98A 3CRVA 1OXSC 2VBCA 2ONJA 4BLRA 3GPLA 3HPRA 3WRXC 1W7AA 1WB9A 1M2OB 1E9AA 4B73A 3VR2A 1N5JA 3NVAA 1MV5A 4TMKA 4EQ6A 2AK2A 3ZVMA 2NTYC 1XU4A 2ZJAA 3QKRA 5KU1A 3X1ZA 1Q57A 3R9XA 1B23P 1FUUA 5FOUA 1OV4A 1XXHA 1U2RA 1UBFA 2ZJOA 3PUXA 4WXRA 4A8JB 2J0UB 1KKMA 1E9CA 2O0HA 3OZXA 2Q21A 1T3HA 5IF9A 3DOFA 1NNEA 2BOVA 3DZDA 2YOFA 1MR3F 1P2SA 5F2EA 4JVNA 1SXJB 3U3KA 2ZRCA 4U02A 2ORVA 4G0NA 1Q1ZA 3FE2A 1G8FA 3QI2A 3UMRA 3KTAB 2FDCA 4P4UA 4M9XA 2CNWA 3ONWA 4IKEA 2D7DA 1XFAA 4CYMA 2E87A 2Y8EA 2ZU0C 1W36C 3M6AA 2BDTA 4IDHA 2GKSA 2KSQA 1J70A 5IK2D 4B33A 2F1JA 1U98A 3DZ8A 4I4LA 4B74A 2DHRA 4C0SA 1II9A 4ARZA 4QXAA 4NE2A 4PX9A 1OSNA 1MABB 2WKQA 4PC2A 2GBLC 1DAGA 4A82A 2QAGC 3U44B 1E32A 1IHUA 3E1SA 1RYHA 1GL9B 4BWYA 1Q44A 1IY2A 3ZS8A 4LJ7A 2X19A 4DDVA 4MGYR 2P65A 3VMFA 4D0GA 1SVSA 5FR2A 3WBKA 3A4MA 2NO6A 4RKFA 5P21A 5TDHA 1KY3A 2QMUA 4M21A 3QJYA 1J99A 5TB5A 3QQ5A 1HY3A 2OFOA 1E2NA 4RJLA 1KJYA 2W83A 3QF4A 5EXTA 3K70B 821PA 2VHJA 2F9LA 4MKFA 5JEEA 1OH7A 1W0KD 4NH0A 3NBFA 4U00A 1K5DA 4Z51A 5KPDA 1OH5A 2XGJA 4JJZA 1ONBA 2W2VA 4QBGB 2PZFA 1HTWA 4YMTA 4Q66C 4S2EA 2WWHA 4QHYA 3U7EB 2DWQA 2BKEA 5B2ZA 2I1VB 2Q9AA 1T91A 3AVOA 2B21A 2V6IA 5EE5B 4FMCB 4V02A 1T0JB 2G77B 2DWPA 2IYWA 3VNUA 4IVQA 2BKUA 5K8IA 2WJIA 1E2PA 1GL7A 3VAAA 1N6IA 3PEWA 2PCLA 2AL7A 1EFUA 2O0JA 5CLQA 2A3RA 1E6CA 2NGRA 1IJEA 2R6CA 2WICA 2XB4A 3L0OA 3L2OB 1GM5A 3L0PA 3TRFA 4AURA 1SXJE 3KUDA 2FA9A 1E2KA 2P6NA 2O8EA 5TVKA 1YZQA 4B3GA 3VKGA 1R0YA 5H8WA 1G9XA 5J47A 5GVRA 3UANA 2GJSA 3OFND 4JLJA 3GJ8A 4BECA 2XZOA 3KKOA 4LJ6A 4LBWA 1BYUA 2G9NA 5AWFC 2X2FA 4RZXA 1NVUQ 1KK2A 4J0QA 4PSKA 2H8KA 2F9MA 4TMVA 2PJZA 1G17A 4E09A 2YHSA 1GNQA 1WP9A 1QG2A 1R7RA 3L82B 3A8TA 2ZI4A 1X6VA 3H2YA 3LRPA 5D3MA 4L16A 2XOKA 4B76A 1KO7A 4B6EA 4B3FX 4C7OB 3WP0A 4RD3A 1KK1A 5FPHA 4DC9A 5L3QB 1OFUX 3D31A 3RABA 1L2TA 1NLFA 1S8FA 4KV9A 2NO9A 2V55B 4JL5A 1SVKA 3A1SA 4Z1MA 2KWIA 2QT1A 4PZYA 3KUCA 2O8BB 1TU3A 3KXIA 3GLIB 3B78A 3HR7A 2CMKA 1S0UA 3BC1A 2JEOA 1T0HB 5AJWA 4BFYA 2G88A 1VECA 3RDPA 2W6IA 3B85A 2XXAA 4DVGA 2OT3B 1Y3AA 5HZKA 1VHLA 1Z6AA 3NBYC 4B43A 1JB1A 1TEXA 3C8UA 3AEZA 3R9WA 1VG0B 2O0KA 4FMCF 2DBYA 1FP7A 1JALA 2Z4RA 4D2IA 3FPAA 2N46A 2D74A 3CWZA 2XB2A 4XWOA 3N5CA 1IXZA 2QE7A 5EXXA 4B48A 2IYUA 2V6JA 2DCUA 2XSZA 3BB4A 4FW9A 4HDCA 5C1BA 3AKCA 3F5FA 3NHAA 4Q1DA 5HE8A 2RGCA 121PA 1WF3A 3TR5A 5JSZB 5H70A 3K0FA 4KODA 5FPKA 1NVXQ 2C77A 3IO3A 4Q4AB 3TR0A 4N1AA 1Z0AA 4LHYA 1AK2A 4KFUA 2NZ8A 1G5TA 4D0LB 1ZNYA 1KZ7B 2Z6VA 1NMYA 4I1OA 4LBYA 4JVLA 1P6XA 1TF5A 3K9NA 3MWKA 4AKEA 3TQFA 3AVUA 4NPHA 2FPMA 1C9KA 2DFNA 4US1R 1ESNA 1WRBA 5HR5A 2R6AA 1EFRD 3W6OA 3IIMA 5D3QA 1NVWQ 4LV6A 1C4OA 2C04A 4JLOA 5JHGB 4A6XA 5JS8A 4ZPXA 2Q9CA 4TMWA 1XEWX 4XTCS 1P75A 3PIRA 4OQXA 2REOA 4Q4LA 2P2LA 2BMFA 5IT5A 3TH5A 4DCUA 2G3YA 5EE1A 3LXXA 1KO4A 1JI0A 2W0SA 3U5ZB 2BCGY 1M6NA 1MRSA 4IDPA 1ZCAA 3ZZUA 2EU8A 1YZGA 4MGKR 3VU9B 4UNSA 1N6KA 2CXXA 5KTYA 1OKKA 1X3SA 2GCPA 1ZU4A 3T5DA 4TMXA 3GLIE 3TAUA 3A36A 4GOJA 2ZE6A 4QNMA 4DRZA 2YC2C 4EFLA 2FEOA 4JKIA 4GP6A 1W2GA 2JLXA 2QMOA 2F43A 4RY2A 3JVUA 1E2DA 1I2DA 1P2VA 2GAOA 2ZRDA 3BFKA 5L3SB 5DHFA 4HZUA 4Q9HA 1E2QA 5FUVA 1HA3A 4C3ZA 4DCSA 2AK3A 4I99A 2CCJA 2IYXA 4GNKA 2EFGA 3W3AA 2DFLA 4AD8A 2J5XA 2RGNA 2VSFA 2H16A 4IEEA 2WKRA 2J45A 1KSFX 3BFXA 4V0NA 1KMQA 5H68A 3U3JA 2ZIAA 3ZVNA 4TQ9A 2WWFA 4HAVA 2HCBA 5FPTA 5JHHB 4TQUS 5FOTA 4FWIB 2C8VA 2JASA 4C0LA 4MGZR 2R6DA 1E1QD 4TL6A 1KI7A 1YE8A 4HSEA 1XMSA 5FTMA 3PUVA 3E70C 5FBWB 1IN4A 2L0XA 3AP1A 4YXWA 2XNDA 1UPTA 3K0SA 1K8RA 3PG5A 2GCNA 4P4SA 1BIFA 2QROA 2GJKA 4XVQA 2NIPA 5TV2A 1GRQA 2CJWA 4GT1A 1GWNA 3SYKA 3TMKA 5BN5A 1ZC3A 2ZITA 1YZUA 2GCOB 1YVDA 4HEJA 1TADA 5KUTA 1OXXK 5GVSA 1OF1A 1KNQA 3LVQE 4PO1A 2ZE7A 3A37A 3K70D 1NN5A 2NPIA 1XP8A 2QORA 3H4MA 3BS4A 1TUEA 1HE8B
chains in the Genus database with same CATH superfamily
1HFJA 3SQLA 5EE0A 4CMCA 3A70A 3A1UA 1YAHA 3PEFA 5E6SA 3AXSA 3MWJA 4NBKA 3NBMA 3SCZA 1ZN9A 5HZMA 3DKRA 1BRMA 1YU9A 3MT9A 4URHA 3RHZA 4KFCA 1F0YA 2JFUA 4JUBA 4C4SA 4KEAA 3QNMA 2ZETA 5KVAA 1PJRA 3JYLA 1T6YA 2XQKA 1YB1A 2HQRA 4W5JA 1LV7A 5L4SA 3INTA 3KQUA 3H6GA 4W8GA 4Z3OA 1TZKA 1G7TA 4FWBA 4GH5A 4HQRA 1UXHA 1GARA 3NNNA 1Z68A 2B94A 4GGMX 3UATA 4NCBA 3BIFA 2JBAA 1EDDA 2WTEA 1DB3A 1Z62A 2FN4A 2VAMA 4BNIA 2QIOA 3B1YA 1E1NA 5AKLA 3P2YA 2J0VA 3I9OA 4YMHA 5K8JB 4LZJA 3W2EA 1FRQA 2ZR7A 5TQ2A 2OHIA 1QIHA 1O57A 1ZIPA 4HQFA 5C7LO 5IXJA 4R1TA 5K45A 1CUYA 4ERNA 3FSGA 1SBIA 3E2PA 4D8UA 1KR5A 2QD4A 2ZCUA 4NU0A 2YXBA 3ULKA 4YRSA 3OPQA 3OJXA 1SQ6A 2FGKA 2AZTA 5AJHA 1KMHA 3OE5A 4TKZA 1U2EA 4CF7A 4ZDWA 3S8MA 1KIFA 1E4YA 1GZSA 4C0JA 1M1NB 1I9CA 3KQYA 1QB8A 1H22A 2BFEA 3FROA 1DRVA 5HQ3B 1RYZA 4WBXC 3SHTA 4WKOA 4MWZA 4K1LA 4PY2A 3TJRA 1J2UA 3CKKA 1FDIA 2JJ2A 5EQJB 4ZFNA 3HN7A 1MGOA 2HK9A 4W5TA 3BD7A 3R1IA 1CUSA 1R18A 3S2YA 4R41A 3ZJYA 3RVPA 4GI7A 1B15A 1GKKA 3PJEA 5L51A 4AM8A 3THXB 3P45A 1QS0B 5CFOA 1XTBA 2V8BA 4LSZA 5T64A 5CA1F 3DF7A 1JLKA 3NTLA 2QGZA 1BXRB 3EZNA 3GEIA 3KOZA 2WJ3A 1Z8FA 2PBLA 4OY3A 1Z8NA 2QU8A 4S04A 2DXIA 2XEXA 5I7AA 4EDHA 4B4KA 1ZC4A 2H0AA 1NF9A 3ZKWB 3IQEA 3RSOA 3SC4A 2DETA 2GLXA 2UVDA 4UJ3A 4B4DA 4B47A 3G8AA 3NXSA 3H9CA 1MX5A 1EQUA 1FNBA 3TR6A 4FVTA 1MX3A 3DDWA 3EB9A 4TV8B 4BNDB 3RV4A 8GPBA 4LMRA 2ZUDA 3I2JA 2ZRBA 3HBJA 3LKVA 4PONA 4U7JA 2IWRA 5AW8A 5CD9A 4KLAA 5K03A 2V8OA 4EP1A 1EEHA 3QJ5A 1DARA 2A1IA 5FUMA 2VPWA 2NQTA 1U8XX 3GWZA 3LPCA 2ADMA 2C4TA 3M6VA 3UPDA 4UVIA 2MSNA 3P27A 4HRXA 1G9SA 1QTNA 4Z7JA 1XCMA 3BULA 1E9VA 4NYIR 1QIMA 3JVDA 3NOVA 4O1HA 2WWWA 2V7TA 3HY6A 1MEOA 3TF5A 1RVV1 4X61A 1ZP6A 2J6IA 4DLUA 4ILEA 3IILA 1ZEJA 4M8KA 2YV2A 3VKVA 1W4BA 4GOXA 1NZDA 2ZPAA 4DNXA 3OF5A 1V5FA 2BCJQ 5AOCA 1ZUNB 1VG9B 5GP1A 3KR0A 2O2YA 1TCAA 5IN4A 4ZAGA 5EMKA 2OM2A 3G2JA 4B83A 2DQKA 4G0WA 3F2VA 2FOIA 5IANA 1KMMA 4KX5A 4JUCA 3LUBA 3M70A 3B82A 3RIHA 3SQDA 1XDBA 2Q6IA 1EX7A 2R68A 3C39A 4DJJA 5EJEA 4BZXA 2DBRA 3H83A 1P2BA 2CDCA 3HJCA 3MD0A 1XZEA 4HDOB 2GZDA 1SB9A 2RK4A 4BTLA 2H9AA 1B1CA 2XW6A 3P94A 3QIAA 3QXGA 4UE6A 1IULA 1NJ1A 4F56A 3SS8A 1YI8A 3BXEA 1ZUWA 1JQ3A 3FUVA 1QF7A 3PP8A 2CF6A 3MYYA 3EZYA 4NLLA 4BFUA 2OHGA 3AY7A 1CNMA 4CHGA 4YYZA 4A6EA 1KAHA 2CLOB 3BQNB 1B93A 1YHNA 1JLMA 1NZJA 3HCPA 3ABZA 4IG4A 1E1LA 3FF4A 4Q7MB 3WMEA 3DL7A 2C0CA 4RCYA 1RQXA 3O84A 4NFHA 3DC2A 4G67A 1JLHA 5DH9A 2UDPA 3CNQS 3G8DA 4S1NA 4AWBA 4BKQA 4CLXA 1UQTA 4AK9A 2VNJA 2MCFA 3THWB 2GEVA 4CMJA 1XUOA 5F5NA 1AQNA 1ZRMA 4S1WA 2WU0A 4RVGA 5KYGA 4FYJA 1KYZA 2Z6UA 2R44A 2ZRKA 4M60A 3C14C 1DMSA 3GFSA 2RIRA 1R0LA 4B3MB 2QRLA 3IUNA 4LRUA 3ILXA 2C4KA 1IHXA 1VKHA 4WDQA 4LUCA 4EKNB 1ZHFA 4U63A 1UK7A 3SF0A 4C3VA 3I05A 3S27A 2ADOA 1X94A 2HT6A 4LK3A 4HBZA 1H0HA 2DEUA 2R4UA 3H19A 5C7YA 5J2TF 1ANKA 4F3RA 2ZIFA 3N2IA 3WGOA 3ESCA 3LXUX 1YL5A 1BKDR 1T24A 1JDSA 3D4BA 4NV1A 5NLLA 1U11A 1PJZA 4D0NA 3GFOA 4BBZA 4M1TA 4DY6A 1BFDA 2WVJA 4IJKA 4XQ9A 1CUAA 1HRKA 2R1VB 3FPSA 3LZ6A 3D1JA 3NFYA 5EZYF 2XCTB 5D86A 2IYLD 1LTKA 3DOJA 4GBGA 3SE7A 4Y30A 4YT2A 3PUZA 5FH9A 1O0SA 1M2VB 3A25A 3W3AH 4OFWA 3U7GA 2QGNA 3RBVA 2ONYA 2QA5A 3UUEA 3DHNA 1EWKA 4Z4QA 1JPVA 5KC8A 4L76A 1KZ9A 2AD1A 2Q3HA 5AVWA 3ID6C 2WE7A 3M2TA 4KITB 3PX3A 5BOSB 1UWCA 3EC2A 4S35A 4U6SA 3IIIA 2R7LA 4M1QA 2FWIA 2B25A 3AETB 3R7FA 5A4AA 3SZ3A 2R9VA 4GRAA 3CF0A 3WIDA 1I4EB 1XZBA 4KE8A 1SQGA 2Q6VA 3QBDA 2XR1A 3I0MA 1QC5A 1QH0A 3ROXA 1CULC 3QFCA 1QHHA 3K0HA 2Z3ZA 4ZT7A 3R23A 3DEIA 3COJA 2OXCA 3VTZA 4Q7LA 1MX1A 5BYBA 4JLWA 1RJ9B 2F6RA 3AR9A 3LH5A 1QAQA 2P79A 2ZAOA 1Z6TA 4MDYA 1LGYA 3KTDA 5D7NA 2C9DA 4PAWA 5JUWA 1UOOA 5FD8A 5IKOA 3QBVA 4IOMA 1Q17A 1UP6A 4PCLA 4PQGA 3BXGA 4LOIA 3AHJA 1XEXB 4P83A 3WIVA 2IX3A 1PNOA 3D54D 4MWCA 1ECJA 4PO8A 4UHJA 5KHAA 3FVQA 2Y93A 2ZRIA 3Q10A 4FMDF 4MRMB 5CNJA 3UMBA 2CHGA 2QTGA 3AIMA 3C6QA 4YJFA 5DEIA 2H9IA 2NNLD 1G3MA 2Q1WA 1VL0A 4H31A 3IP7A 3WLTA 1A8QA 1UFRA 2G76A 2C5AA 3FUUA 3MJ4A 2C7RA 2XTJA 4X1KA 5FOXA 1PT6A 2HJRA 2ZRQA 4UNPA 3ZCVA 1AM4D 4PPFA 2QX9A 1EFRA 1O3YA 1DOZA 1V7CA 4GPIB 2RAUA 5DGHA 1T9BA 3EQ2A 1QGUB 2BSXA 1AKTA 2XMRA 4HAOA 2YJ3A 3LW7A 1YR9A 2X9VA 3T95A 4ETNA 3H3XA 1IHOA 4N18A 1CQJA 4K3VA 3GC6A 2Z2JA 3CSSA 5JY6A 2FPRA 1T8RA 1M0WA 1TX4B 4PWYA 5BMOA 1RLJA 5DFAA 5KQLA 1CVRA 5ELXA 4ECAA 3JU3A 3E5HA 3IPXA 4HUTA 4MW9A 3BL6A 3GCXA 2WILA 5LQJA 3U48A 4OXQA 3EZ6A 2IXTA 1IOZA 1P1FA 5GJCA 1AHNA 1G8JA 4QU0A 4B85A 4EL0A 2FJUA 3D3KA 4YJKA 3P0FA 1XRMA 2BWJA 3EIWA 4UDXX 4L02A 1ECBA 3E4CA 3T61A 1AGPA 1UJ2A 4DZZA 3ESDA 2CB9A 1N1GA 5DTEA 5TT0A 4JNCA 4CM8A 3A2NA 3L0ZA 4D25A 2Q5CA 1MC5A 1KKUA 1MAAA 1PL7A 4ND4A 3BDVA 3T9CA 3CVVA 2IH5A 4I3HA 2YBEA 3CX7A 2GYVA 2QJWA 3KWMA 3NHBA 4RA9B 2DPGA 4HZIA 4JLSA 1QU3A 3V1UA 2YVAA 3FY4A 5ECWA 3VH2A 1JLRA 1SD5A 5MHTA 4P4LA 4LVCA 4MQEA 1HNXB 4DSAA 1UFQA 2QLJA 4B6QA 3VNSA 4E08A 1NFFA 3WL5A 3AL3A 4GLOA 4C7XA 5I7RA 1PKXA 5JJKA 3QFSA 1D5CA 1SY7A 1M1ZA 1VBMA 2XRYA 4QYIB 4K1XA 4EB6A 1M34B 2PFSA 1IU9A 4N12A 4AUEA 2ZUCA 1WXQA 1B2RA 1VB3A 2HB6A 3RYTC 4O6VA 1D9XA 1BMTA 3GD5A 4ICIA 1ZA1A 2ARKA 3AB3A 5BYJA 4I50A 3OBBA 3W8NA 5KDOA 2V7UA 4QOSA 1D2RA 3BHIA 2IPNA 4TKLA 3U44A 1ZGBA 1Y7IA 1Z6XA 2VK4A 3FTQA 3LUAA 4ZCTA 2PGAA 4LY3A 3U7HB 1JH9A 1MO3A 1XROA 1XV5A 2WIAA 1JDPA 1NW6A 1OFTA 4YRDA 5DCWA 3TCXB 3ZIDA 4UTPA 5A1TA 5I7VA 5M7EA 1J9EA 2YDXA 3HM9A 5F5XA 2PCJA 1BS1A 2KLHA 2XIQA 2VAWA 3KKPA 3NORA 4G2TA 3SJZA 4AJPA 3BERA 3PL5A 3ANYB 4PG5A 5I9IA 2F1HA 4XQEA 1MZVA 4XFJA 5DGXA 1A5SB 2H5EA 4MCIA 3UGTA 4BLVA 4E5YA 1EXVA 4O4JA 4ZOLB 2CXSA 3K72B 3L4EA 4IMJB 4TPKA 3AJ8A 3LSTA 4F4UA 1JWLA 3TBKA 1Y6FA 3SSOA 2H3EA 7REQA 2G82A 1RJGA 3GFGA 3VTKA 2QMQA 2J5RA 2VK1A 2AG6A 1WXWA 5AFSA 3ZDAA 3KL4A 4ER5A 3HUEA 2WQ6A 4XTRA 3TFWA 2ZT8A 4TXNA 2IXFA 1TM7E 2JIRA 3OQBA 3PC7A 1W6UA 5CCEA 1PEDA 4HMQA 2F7SA 3CN7A 4JJEA 4MP3A 1B6RA 1L4KA 2Z2ZA 3IOCA 3OWHA 2P9BA 1LVGA 3S6JA 1RQLA 1EJBA 4CKYA 1P3DA 4KQHA 3A32A 3KLOA 2JAHA 3N6VA 3EX7C 3USCS 1XD2B 2P4HX 2PGXA 4ZT2A 5CBKA 2OCIA 2W98A 3Q2OA 1U4OA 3WLFA 3C7DB 3B60A 1ZVVA 3AR6A 1KSJA 1BE1A 5EGNA 3I53A 4KI7A 2AE2A 2ZYSA 1BWSA 3V1TC 4ZEXA 4KGDA 4NC9A 2PZGA 2PG3A 3QKRB 1ADGA 2QQEA 3E1KA 3FBTA 3JVEA 2GS9A 4JP5A 2R4QA 1GA6A 4D9BA 4I36A 3LUJA 3MJRA 1HT0A 1SCBA 5C8YF 1TM1E 4N01A 5I47A 1NE7A 5IU6A 4M98A 4OUKX 4ND3A 3U3DA 5KHOC 4FEYA 1NW8A 4UFNA 3V8RA 4L8LA 4NG4A 4AJIA 3GNTA 5LZ7A 3ZOKA 3RWOA 4YRRA 5A4FS 1JMVA 4FCWA 1RMQA 1X86B 1KJ9A 2XUOA 2H2GA 3NBAA 3DZIA 4QASA 1P74A 3T7RA 5TEVA 2GPAA 5AYVA 4AJ4A 4B4UA 4DCPA 3WKDA 4MUJA 3S4YA 4C4RA 1QH1B 4PR0A 1E2JA 1YRLA 5GIOE 1GAXA 5EKDA 1SUEA 1F06A 4E51A 4UTOA 5JDIA 4II3A 4O4IF 3IQIX 4OB7A 4FFOA 1XVIA 1FNSA 3RVKA 3SSNA 1MX9A 1TU4A 1MB9A 3PNSA 4H6VA 4HH1A 2FP3A 2XWJI 1LB1B 4GQIA 5TIIA 1MOZA 4L2IB 3VV2A 2JPDA 3MWGA 4IWXA 1NAIA 1T8TA 2AS0A 2J6CA 3CR7A 3F71A 4WZAE 3RPEA 1K2VN 2OM6A 3A26A 4MYTA 4BU1A 4F2HA 1VYHA 4KQXA 4L57A 3RKUA 1GZ7A 5I4IA 3HWX1 2OP0A 1IY8A 3E9QA 4GMFA 2CK3D 3KPWA 4QSHA 2DR3A 3R4VA 1N5OX 3N8NA 1RTTA 3NHPA 4RJTA 2KW5A 3FCAA 2W2QA 3IP1A 1XAIA 1BX3A 2OBYA 4X1IA 1U9IA 3RB8A 3ORQA 4ZHQF 2VWGA 1C7FA 2W6MA 5AXCA 6NULA 3AM3A 5CM2Z 2FUEA 4EGCB 4UZEA 5FWYB 1TEVA 3Q6IA 1WL8A 3H1FA 4NH4A 4D4GA 1NSFA 5DMHA 4M83A 2XIJA 3I3OA 5EWLA 1IUNA 2PYIA 1BH2A 1PLJA 3KWFA 2INGX 4O3MA 1OBCA 5K6TA 4XWYA 1SBQA 2WLSA 3QGMA 5GWXA 1N9GA 2QLTA 3IBYA 2G4CA 2BGNA 4OHOA 2C7OA 2VPZA 2QUIA 2X0IA 4ER6A 2ZSKA 5ILOA 3ESAA 5JQGF 4RKQA 3U3XA 2IH4A 4INAA 1OW3B 3IIKA 3GQVA 1RKUA 3C7AA 1T2EA 1BVUA 2JGLA 5EIWA 2GNPA 1TKAA 4XIJA 3TTVA 5FOVA 3QYPA 2WV9A 4MR7B 3V9PA 2VBFA 5KNBH 3AESA 3FWYA 2Z5LA 1H4TA 1Z7GA 1XXHE 2Q3LA 3FRJA 4I66A 4HYTA 1Z0DA 3PHIA 4LZAA 3A4IA 2AW5A 2D3WA 2GXSA 4Z0PA 5JS2A 5C32A 4HNAA 3Q88A 1AKEA 3VYRB 4WZBA 3TQHA 3S2GA 3KHUA 1I6WA 1ONSA 1XL1A 1AUPA 1AF4A 1MJGA 1R16A 2VT7A 3G1UA 3GJTA 4OH7A 4A10A 5TQ0A 1GOTA 1FS6A 4CKBA 1VPLA 4BO6A 3PA8A 1B16A 4L0CA 5DHTA 1N3IA 3LQ2A 4Z8YA 1XZQA 4Y2TA 3HI4A 1WZUA 1GRCA 3DB1A 1UQRA 1AGNA 2F8LA 2HT1A 1PWYE 1S2MA 2J3QA 2Y99A 1E6MA 1KYTA 1M73E 2AUTA 2ON6A 2XUZA 3BZUA 4JGGA 4YBZA 3R8XA 2WWTA 5C35A 4FKZA 4GMHA 4FLFA 5BQOA 2Q6LA 3ZV3A 1M2JA 3JQ9C 1ZH4A 2YXDA 3AX6A 3CRQA 4JOCA 4EJ0A 4ZQEA 1HLDA 1UBMS 3DKIA 1J0AA 1NIJA 1SVIA 3ZGXA 3H42B 4PLCA 4GEGA 2E6UX 1RAIA 5IT0A 1GY8A 5E6UA 3ETLA 5ALYA 3S7ZA 3R5SA 4FGJA 4JXJA 2FR1A 4X60A 2A2ZA 3HI6A 3KOMA 3V80A 2B5OA 3JD3A 4D98A 2F48A 5K3SA 5L3SA 1RQ7A 3WNVA 2CWWA 1DQZA 1QMGA 1T3GA 1W47A 2Y77A 1M1YE 3LBAA 5F4BA 3V8EA 2WIKA 5AXDA 2B7CA 2ORED 2ZATA 5DYWA 1G6HA 1KEVA 5CVDA 3TZQA 4OO3A 2ZIEA 4XQGA 3ZGYA 1E2BA 4YRFA 4LIPD 3ZW7A 2Q5EA 1EE2A 2RI1A 4MWSA 4DILA 3MOSA 2WJGA 5LWHA 4BXOB 2GD0A 2H0QA 2VUTA 3G3EA 4DTIA 5ECDA 4ZO4A 1ZJYA 4YCJA 5HQTA 3K9GA 1C8KA 1F51E 1TJYA 1WEHA 1U2ZA 2XZTA 4OQDA 1LZLA 3B7GA 3EGVA 3JVIA 2WSSD 4RK7A 5JZMA 3KO8A 2CFIA 3MCAA 2OL4A 3TKLA 2D2VA 2CCKA 4LMBA 4DBZA 4PZLA 2MSLA 5JS1A 1IY9A 1TF7A 1QAMA 2QD1A 4PYIA 2D1TA 1HQKA 5FEUA 1ULBA 4BFZA 5B37A 1EE1A 2GDZA 5CJJA 4QX6A 4Q9DA 5M2QA 4EGSA 4Q7JB 4UFPA 2I7TA 2AOTB 2B83A 4BEBA 2QHXA 5IHPA 5TARA 1X7YB 3IP6A 2H9YA 3WV4A 2PL5A 2C00A 4OGLA 3HFJA 3BWEA 4AFNA 2WAAA 3IVAA 1MNAA 4NK5A 4PIPA 3NONA 3NX4A 4Q19A 4PLGA 3IMKA 4M3NA 4EPWA 4ZKEA 1SXJD 3ELUA 2H2WA 2PO5A 3HDTA 4DNFA 2Q8PA 2FG5A 2KLBA 3VPAA 4KFRA 5H80A 5LMZA 1J0XO 1LW6E 2J9FA 1XZLA 2PUHA 2Z83A 3A05A 3K0FB 4HDSA 1J0DA 4O33A 4DJEC 2OECA 1K27A 1UEIA 3EHDA 5BSEA 1YIAA 4I14A 1JZSA 1VJDA 2PGOA 1N2SA 3G89A 4F2WA 2CFRA 2GXAA 3M82A 3MS2A 2VH1A 5CJPA 1FVOA 3WQBA 1EUDA 2X4IA 1GUYA 1NT4A 1RZ3A 5KTRA 3EDOA 1ZRHA 1UAYA 1R5BA 2DR0A 2I6XA 2IHJA 3KJEA 2HRBA 3PTLA 4LNUA 4MKGA 3BEDA 4P6VF 4PHHA 1MB3A 2V96A 1M3SA 3AZPA 3GY0A 4POAA 3L04A 3VR6A 5C5EA 1O96B 5U9CA 3FHOA 2BD0A 2H7VA 4LRWA 2G9UA 2C2GA 3AVYA 8OHMA 2BKLA 5CW2A 4OSOA 3W5IA 3CNNA 4G2NA 1KEPA 1WXIA 4QUDA 2JIPA 5EJ5A 3PEYA 1GXSA 1Q7EA 2HJHA 4KQKA 2QRJA 2J5BA 3IGFA 3ROMA 3RU3A 1U4SA 4BBJA 2TMGA 1YMUA 3IAAA 4WESA 4ZI5A 3RUFA 2M9MA 4JLUA 3WHLA 1L7PA 4EK9A 2YWJA 3TNDA 1N0WA 2H4YA 4ARUA 4Y0AA 3DBRB 4OIFA 1QQ5A 2ZJ0A 3ZX4A 1COWD 3OIVA 1JU3A 4YDHB 3W06A 1PJ4A 4P53A 4IF6A 2XUKA 3MMXA 3TTUA 1YQWA 2VQ3A 4WHMA 1C1DA 2C8KA 4B3DA 4DE5A 3VC7A 3NPAA 3KYDA 4CUKA 3CT6A 2AEMA 5EI5A 4B6RA 4FBMA 3GZJA 3SZUA 2PGJA 3HACA 1NYLA 2I3BA 3G02A 5CVVA 1BWRA 3M1IA 3GYGA 5F12A 1NJ8A 3RSSA 3QKTA 2ODQA 1GL6A 4A1OA 2P6RA 3MTGA 2Q46A 1XTIA 2JDID 2R65A 3KVNA 5F2OA 4BX2A 1Q7BA 1VG1A 2BIFA 1G41A 3GARA 3HSKA 2PZJA 1FYEA 3KQKA 4X90A 4JFRA 5MDHA 5DN9A 3T06B 3NWJA 1P2TA 3V8NA 1E7YA 3G88A 4YN3A 3BF8A 3QXXA 2HPZA 4YMSA 4C4XA 1HMPA 1QRTA 3S99A 1A8HA 2ZREA 2WZQA 4E31A 1TZMA 2QYOA 3T12A 1IM5A 1SKYB 4OK5A 3IPCA 1TOAA 1HSZA 3HWRA 4QJ5A 3STXA 2GBGA 4PPYA 5FAXA 1L3CA 3JQRA 3LWZA 1D4AA 4H7FA 4B3XA 2FZCA 1CWUA 1SCQA 4PBTA 1T2NA 1WHTA 4MRVA 3TI7A 3UEOA 3JQCA 2QOEA 2NVBA 4OXXA 4RY9A 1N2CE 2GHIA 4IHJB 1XWFA 2CBGA 2HSEA 2Z2YA 4M76B 5ALOA 4F8JA 1GSOA 4NZYA 1ZNZA 3L4BC 4PHCA 3WLLA 2O05A 5CFQA 5HWSA 3KRTA 4RXMA 4E5NA 4EM6A 2QVXX 2QP3A 3HRHA 4LQLA 3WTBA 3PC6A 4C4YA 4C21A 1VCMA 1QLHA 2G1JA 2HM7A 2OORA 1V3TA 3MAJA 1P19A 2A1UB 2XRMA 3MINA 2OFXA 3C3JA 4Q24A 2VN8A 5HA5A 3VJKA 3D0RA 3ZHZA 3KIPA 2OO3A 1LJUA 1CY1A 5ES4B 5CCXA 3AWIA 2B20A 2XF2A 3FPKA 4B80A 3HKBB 4WZ6A 4QO8A 3JAMA 4LPKA 4I1VA 3I62A 4DLAA 2F59A 3QU9A 1LNZA 3NWBA 4Y9UA 2RHOA 4XYGA 521PA 2CF5A 5FF9A 4U2GA 1X7GA 2FSUA 3M83A 3I39X 1NQVA 3M5CA 4UHHA 1Z63A 3HA5A 1K6MA 1P8AA 2VTKA 4MRNA 1B6TA 3Q5EA 1RQPA 5F7OA 2AR9A 2IVZA 5ARBA 2I4LA 1F48A 2PTHA 2QI9F 4GAEA 5H1YA 3TIFA 5FXMA 1L5HB 3KAQA 3ZWYA 2CE7A 3KU1A 2RKOA 4J90A 3IV9A 2ORIA 4RPIA 1GYQA 2EHDA 1ZISA 2Y1EA 4Z9FA 2YRWA 5B1DA 4DZTA 1XDZA 4ZZIA 5BPHA 1USGA 2ZRJA 4ROTA 3WLPA 4LTNA 3KDPA 5LMNB 1EX6A 1L8AA 2VWPA 3GLGB 4YAGA 1UMBB 2XTZA 2Q3MA 5B30A 3D02A 3PQ7A 4ZU1X 1GPAA 1QIEA 1MAVA 2JVIA 4JN6B 5IK2A 4RYDA 3ZI7A 3KELA 3LX5A 3N87A 4Q3LA 4ZIRA 4HC4A 1EFTA 3LT0A 5M29A 2P68A 2V9CA 2ZI7A 4QQRA 1FNCA 2WHQA 3ZWDA 1K7SN 1U8TA 1U3FA 1Q3KA 1T1RA 1X8KA 1TK3A 3O26A 2I2XB 2OFWA 5B3AA 2FQYA 5LYJB 2CFOA 2H17A 2RGDA 4UASA 3VSCA 2DUWA 1U2DC 1M72A 2BP7B 4PQRA 1CDDA 2P7IA 5TXGA 4AY2A 1C14A 1GSIA 3PNVA 2BFCB 4X92A 4MROA 1W48A 2VSYA 4Q47A 4QFDA 4TTPA 2J9ZB 3P0HA 1N36B 1MCZA 1N5MA 4LDNA 5TX7A 4Q3AA 3SQMA 3L8GA 2O8NA 4UAVA 3L4SO 4MYDA 2AFHA 5NULA 4O4LA 4KMMA 2QQ5A 1THZA 4E2YA 3ASUA 3QBJA 4EA6A 3WJ7A 1Q91A 3NRJA 3NIDB 2IP2A 2NADA 3PQDA 3JWHA 4KHZA 1VYVA 3TLXA 1V6AA 2LE0A 3QX9A 5THKA 3SIXA 1IZYA 4P7GA 1ORHA 2GA8A 4WY2A 1QIDA 5LB4A 5FEMA 3WKEA 5BMVA 1CYEA 1MOPA 1OLOA 3RSGA 2VHQA 2BBSA 1AQLA 5BSHA 2J3DA 4GSYA 3GQBB 1GKYA 4EG7A 4N7RA 2C88A 2PWBA 3SJAA 1E4VA 2WKSA 2FMKA 2XY4A 4JKOA 5SY9A 3T8YA 3FAKA 3KZOA 2B1RA 4I4NA 4JMLA 1RE1A 3OA2A 4YROA 3K96A 4MAFA 5ESWA 4C2UA 1BE0A 4AJ1A 4IRUB 4J0DA 4NJMA 1Q50A 2FOXA 1TTTA 3RIEA 1XP5A 4J16A 5LQUA 4TT8A 5U1PA 2MSDB 2ZIXA 2C0PA 4MYSA 1OBHA 5LUAA 1E3LA 1CIPA 3OMXA 2I8CA 3OFNA 1Y6JA 1ODIA 2CK3A 3FPHA 2Z5FA 3IT0A 3W4IA 2DLDA 4ZYXA 4NEQA 2MR5A 2Z98A 1SUCA 2YS7A 5E2BA 4B2LA 4CMIA 4JEUA 3INGA 2YXNA 3PITA 4Q4JA 4QREA 1OAOA 3SBEA 2B98A 2BEVA 5DF1A 3MJHA 2V0GA 4C2TA 1W52X 2CSXA 3BJMA 3B9RA 1LLFA 1QWSA 1MDBA 1W9MA 2CYCA 2J7KA 1QP7A 1PFKA 1QBKC 2OESA 3HYSA 3WLQA 2DBVO 2NXNA 4XXHA 1Y81A 1HT1E 5EC8A 5B12A 5JVDF 4IR7A 5J4YA 2B4QA 2F3PA 2PLFA 2Z1DA 1W93A 5J58A 4U8HA 3K9QO 3P9ZA 2GASA 2P8JA 4FZVA 4WIAA 4KR2A 1K97A 2AOWA 3ONFA 4ZJUA 2O06A 1NBAA 1RDFA 2HIGA 4G25A 5I9MA 2O50A 3PHLA 4BN4A 1DPFA 3MQFA 4L0DA 2H3HA 2VZLA 5C5CA 1EVJA 1MO5A 3FGNA 1DO8A 4F3KA 5JOQA 4DR3B 3PXUA 2OZEA 2VYCA 2HLDD 3OC0A 2BGLA 1AO0A 1KPGA 4X7MA 3LP6A 1VL1A 1NVVR 1LLCA 5TRTA 4CG3A 3X0DA 3ZHTA 2FW0A 3T5MA 2E0IA 5DLQC 1CHDA 1S3GA 1QZ3A 2C96A 2WAYA 4HP8A 5IW8A 2PIDA 2D62A 3GNSA 1BEEA 5BR4A 1ZAYA 4O08A 3CLRC 4HUQA 1XZJA 4L72A 2OZPA 2I66A 4TLDA 2W43A 2FWJA 1IOLA 3SN6A 3PRJA 3O8BA 5KYUA 1E8NA 5EJ4A 2GBPA 4JLMA 4C04A 1OBOA 1YRQA 3K4HA 2C9OA 3ABOB 4G0MA 1H2FA 4ISBA 4MCJA 1RXCA 3B6EA 5TF4A 6CHYA 2EEZA 5IC5A 2FPOA 2LNDA 2QW0X 4BKPA 3NGLA 4HQNA 3FFXA 4ZOEA 3UXYA 1MA0A 3CZ4A 4B3CA 1R88A 1S6YA 3NB0A 1OI3A 3AF1A 3QKSA 2C9ZA 2VAPA 2CVFA 4DYVA 2F8TA 1F1JA 4LJ4A 1JN0A 1NRJB 1P3JA 5E3IA 5K0NA 5JWHA 3RWMB 1BHQ1 1CY4A 4J3NA 3ZDRA 2CHFA 4LXQA 2RC6A 4KBFA 2GPNA 1KQPA 2ZYTX 3M8KA 2QBYB 1VKJA 1SBZA 1F2UB 1V1RB 1XNGA 3CXUA 3QMWA 3TL3A 3G2HA 4URXR 4WLVA 5FT9A 4ALLA 4M54A 3FYDA 3I1IA 2QENA 3SEAA 4AJHA 2P62A 3M4XA 4RE6A 5KMGB 2I03A 3C1OA 3EBLA 3LHSA 3GEEA 4JASB 5CX1A 5T8KA 2L2QA 4UMFA 3D6JA 4L08A 3OZDA 4RPHA 4BP3A 1F60A 2HLPA 3MCWA 1Q84A 1FYFA 4YGYA 5K09A 1FFHA 2OWEA 4BTVA 5B64A 3MT8A 1JXOA 1ZJJA 2B1JA 4ZCMA 4IH1A 1DIAA 4HL6A 4ROSA 2JLQA 2P9QA 2FW1A 3HVJA 1UJ5A 4YUZA 4HN4B 2JLWA 2WSSA 4HD8A 2XA1A 4C06A 4L73A 1Q0LA 4JXKA 1HPLA 1OASA 3AP2A 4HG2A 4RV9A 2QYHA 1CR1A 2FNAA 2FPLA 2IITA 1G4UR 3OZTA 4OA8A 3WNQA 1C9MA 5I9NA 1RIFA 2MMGA 3D6MA 4YAOA 1SC1A 1F2DA 5ULLA 4OH1A 4XB1A 3EW7A 2O19A 4PZAA 4QDOA 1KH3A 1ZJZA 5D87A 4J0EA 3AVXA 5TC4A 2R62A 5SV2A 4U4AA 2QKYA 3WTCA 1PF7E 2VHVA 2DRIA 3C3XA 1D9ZA 1QV9A 4QDXA 1GITA 3EC1A 5IAKA 5IUNC 4DSNA 1Z15A 3K6RA 2JLSA 3VZPA 1I3NA 5BSKA 2BJVA 5CLLA 5CFNA 5I7OA 1FBTA 3NHSA 1G9TA 2AR0A 2PDAA 3UY4A 3LCMA 4O25A 5GZ1A 4N47A 3GLFB 3C3AA 1SXJA 4II2A 1JYSA 4RF3A 1JFTA 1ZH8A 3IUEA 3T1HB 1SQSA 4O29A 3KTAA 3HY4A 3V2GA 1QYWA 4HZGA 4TLEA 4RKWA 1TD1A 1RADA 1KVTA 5FV7A 4CM3A 1U0GA 3Q7EA 2OCBA 4QGBA 5ALPA 1RKVA 4G0QA 2WJAA 4UATA 1ATIA 1TXGA 1Z39A 2VT3A 3BA6A 3WLOA 3ZX5A 4NU6A 2Q3FA 2VR1A 3DDZX 5A4DA 5FTLA 1GPWB 3HLYA 5B1HA 3K09A 5HRAA 5GGXA 4RS4A 4DCJA 1DDIA 1XE3A 1GPBA 1XYVA 3T1TA 1WR8A 1V3UA 3DCNA 3T3PB 1G5QA 1Z83A 2Q28A 3M1LA 2TS1A 5A3QA 2ZE5A 5F64A 5TMPA 2JHPA 3I42A 2NW6A 3WGGA 1XZMA 5HFAA 4C20A 1AD2A 2P9JA 2XADA 1F1BA 2B36A 4S1VA 3ABRB 2XWBF 4GP7A 3T34A 4C7JA 4DMCA 5HS4A 3V3TA 1KTVA 2LIPA 4ZT5A 4AXBA 3HG7A 1G18A 2OK7A 3ZWOA 4BWVA 2IP1A 2ZJ4A 5DNCA 4JKYA 4EFDA 5I7UA 4KNVA 3NYQA 1P73A 2H63A 3BKWA 1YQ9A 4ILKA 4XSVA 2LGJA 1BD4A 2J3HA 4PLZA 3TXYA 1COWA 4QDUA 1YT5A 4OM7A 4DR4B 4LN1A 3TOVA 4WLOA 5GOTA 3OFKA 1JPNA 4JI6B 5I7EA 1SIOA 4EF6A 1IB6A 3KKMA 2C42A 3D3WB 3TS1A 2O54A 2J59A 5HKKD 4G01B 3NDBB 4BLWA 4N3NA 2ZSUA 5AQ1A 3R7BA 5JBIA 1PL6A 2G80A 4M7WA 3PUJA 4OX9B 3HYRA 1DAIA 1GUZA 1OGIA 2ORWA 1HNNA 4QGFA 1Z82A 4XM0A 1NMZA 2NV0A 5K2OA 2JDIA 4NYJQ 3PGVA 2BMWA 1LS6A 1UBSB 2AKYA 2HDHA 1HT2E 1SC4A 2IJGX 1Y6QA 1SC9A 4FSHA 3AUXA 3KSBC 1AU9A 1EK0A 2PMKA 3H6KA 4K9KA 2J0SA 1A5TA 4HTFA 2ERXA 2XX3A 2OVFA 2QPAA 4D8WA 1QFSA 5IHXA 4Y2HA 1ZM3A 3GJ6A 3PFBA 1WHSA 1RPTA 3O3OB 1VE1A 1Y5NA 3ZD9A 2A92A 2J6BA 4U2EA 4BHTA 2X41A 4MVWA 2GCGA 1K6IA 2CL7X 4R01A 1BW9B 5L9AA 4G36A 2GN8A 1SVNA 2OAQ1 1A27A 1AZTA 3GAFA 5AM5A 3LK7A 3UNXA 4DIFA 5EIEA 1O54A 3ZVRA 4KAXA 3R5KA 4H15A 1C3JA 3RS0A 2FVXA 3H97A 4PINA 3NVMB 4E3ZA 5P8WA 1NP6A 4O2AA 2CJXA 4EPXA 2BHRA 2IKSA 2MYTA 3K1YA 4K0KB 1C0IA 1ZVKA 4IDNA 4JOSA 2B8TA 1KO8A 5ICSA 1JHXA 3EIFA 1UOEA 1TCCA 3SU8A 1U0TA 1K5HA 3O7WA 4JJAA 4E22A 1ZXXA 1OH8A 3L8ZA 5DNAA 2ASEA 4HDMA 4C05A 3EUAA 2PPLA 1A8PA 3BZBA 3MILA 4LHZA 3CE9A 4Q1VA 5G0VA 4CTNA 3M89A 3OU6A 5LFAA 2O2DA 2OY0A 2QR3A 3QUAA 1ZINA 2W8BA 3O9MA 3X44A 1Z6YA 3C8HA 2NV6A 1M6VB 2CSUA 3PWKA 4W1SA 3P0RA 1Y3IA 2X4LA 3GJ5A 2ZB3A 3FDZA 4G8DA 1WY5A 3VDMA 4R1OA 4EW3A 1FVXA 3G2NA 3K0BA 4YJ2B 3A1TA 2AI2A 3ICCA 3NWOA 3ZJ4A 1ULHA 5AHRA 2XT9A 2QS9A 4J7CA 2WF5A 5AO9A 4LXGA 1UBOS 1KK3A 1H8ED 2IYOA 3HQ4O 3SYRA 4BNFA 4GPZA 5AVYA 4ER7A 2B9EA 3IL2A 1IQRA 5DCYA 3RTDA 2JKVA 3CZPA 1UMCB 3KQVA 2ZVQX 2AJTA 3FMOB 3O90A 4BAGA 1K88A 1QB7A 5IH3A 1CC1S 4F7DA 1P2GA 3O9VA 5C1IA 3HYNA 5T67A 1UADA 1ML4A 1SXPA 2ZTMA 1CJBA 1X7ZA 3Q15C 5LZ8A 1RD4A 5JCXA 1EWQA 4OLAA 1UXIA 1RWOA 5GZ6A 3H04A 4OYYA 1JPJA 3QPVA 4TWBA 2IUEA 1AK1A 2IV2X 4HHEA 1YI0A 4NQRA 4XWAA 1T1SA 3QF4B 1C9JA 3F4KA 2O3SA 1E94E 4F91B 2VJDA 4ALIA 4YUVA 2GFIA 5IJ0A 1GG9A 4MUEA 1V9CA 3VVMA 3MVEA 3OQMA 3FYHA 4U3JB 4OP3A 4D3YA 1D2GA 3UV7A 4YMGA 5IS2A 1NUAA 2B4AA 2A9FA 2EFDB 2X4GA 5JD3A 3TLAA 4BNMA 5IJXA 1MQSA 1G6KA 3CLHA 3Q5DA 4NXMB