2IYQA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate and adp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 61
structure length 166
sequence length 166
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyqA00
2VP6A 1R8SA 4JKYA 1BIFA 3IHWA 4PC7A 1BS1A 3PR1A 2DFLA 2VRWA 1CJVC 2AWOA 1WXQA 4OHVA 1G17A 4OJQA 5CLQA 1CU1A 2PZFA 5FOVA 2VP9A 3HYTA 3NDPA 2P2LA 3PCRB 4DB2A 3TAHA 1DAKA 2CJWB 1R0ZA 1T8UA 1WQ1R 4Q7LA 4QGHA 3TNFA 2BDTA 4POAA 3W5JA 3X1WA 4DLRA 4KFSA 1VKJA 2MSCB 1XTRA 3B5JA 1OH8A 1SVOA 1UKYA 2L0XA 1DS6A 3EASA 2V4ZA 3QY0A 4NCHA 3HYRA 2HLDD 4TYYA 2NG1A 4WIAA 1A82A 4RD6A 4JBWA 4QBFA 1HQYE 1XBTA 2ZE7A 2VO1A 3IQWA 2EW1A 2GZAA 3THOA 1IOZA 2C96A 4GP6A 4G5RA 2XZPA 4QOSA 2BBTA 2E87A 3EARA 3LH5A 1ZMXA 2IYZA 4LV8B 4YC7A 1MO4A 1Z6YA 5AUOB 1XRJA 2W58A 3QI2A 2YJTD 3PFIA 4Q7KA 3DEFA 3NBFA 2CCJA 1A1VA 5JWOA 2QN6A 1E2MA 2ZRAA 2GWHA 4URVR 2PEZA 2F6RA 1YKSA 5FPKA 5FR2A 2FEMA 4HUQB 5G40A 4ZIRB 1LVGA 1IBRA 2XZLA 3BC1A 1T8TA 4Q7JB 3LX8A 3BB1A 1Z0KA 1HUQA 1BO6A 2FFHA 1L2TA 2ANBA 5E4FA 3PUYA 5C1BA 1FX0A 2JLRA 1E99A 5A4JA 1ZM2A 4LYJA 2OBNA 5BN3A 1V43A 2C77A 2BBSA 2ODWA 1OKKD 1NMZA 2CNWA 1Z0DA 2KI5A 3A58B 2WPDA 2IT1A 4NZYA 3EIQA 2FSFA 4KLZA 4MDEA 1Y3AA 4GOJA 3E2IA 4JS0A 2O0HA 3GLFA 3KKOA 4EQ6A 2LWIA 5F98A 4DLWA 4G5SA 4P0TA 1ZM7A 2WOOA 3T06B 3WRYC 5M04A 1TQ4A 3LX5A 4JVSB 4PZZA 4WA7A 1GFIA 4TZ0A 2A30A 4JLJA 1W0JA 1GNRA 3B60A 1JNYA 1ZU4A 2ZSDA 4LBWA 1N6PA 2D74A 2JLUA 2BC9A 1L7VC 2IS1A 1E9EA 4AY2A 2PLRA 1HURA 3GLHE 5GJVC 3GPLA 3AF1A 4D26A 1HEIA 3U5ZB 4F4JA 3SQXA 1N6RA 1P9RA 5FTKA 4DSUA 3ICQB 721PA 1NJFA 2J0UA 2Z4RA 4N1AA 4OHYA 2ZVQX 3MWLA 3EA5A 4IXMA 1NF3A 1ZNYA 5D3MB 4UXIA 3R20A 2EWWA 4YONB 3K1JA 4O2RA 2A5GA 3FMPB 1HE1C 3B2EA 2IWHA 5A5GA 3FKSA 3I32A 3MWJA 2ZSFA 3QPUA 3ZZ0A 1ONBA 1XD8A 2NZJA 5DH9A 4PQFA 5AJVB 4C0BA 1M8PA 1XF9A 4D6PA 3FFBA 3K0EA 2FGKA 5AK0A 1NY6A 1AN0A 5K8TA 1SXJD 4HEJA 4RVCA 3BK7A 4URWR 3SEAA 2C78A 4PO8A 4W5WA 1LNZA 1Z08A 5DHAA 4FCWA 1XMJA 3PJRA 4RJLA 4B33A 2QQEA 1CKEA 4B2PA 1G3RA 2Z5FA 2Z0MA 5TMPA 2QBYB 1GOTA 2BCJQ 2RGDA 2OSBA 1KI4A 1TQ2A 3F0TA 4Z1MD 3B1YA 4XD7D 2DHRA 2OEPA 3N2EA 4PO9A 3W90A 1G4AE 3GLIA 2QENA 1G18A 1I2MA 1ZP6A 2EFGA 2IEZA 2X1VA 4MKHA 4MKFA 4PPQA 4V0OA 1JR3E 1KI1A 1HV8A 1TUIA 3HWSA 2GXSA 4KXFB 1CTQA 4PAOA 2R6AA 4LHVA 1SGWA 4XIGS 2ZRBA 2GRJA 4GFDA 1ZRHA 3TW4A 2VH5R 1U98A 2NOAA 1ZUIA 5EUMA 3C4JA 2C9CA 1KOFA 1TF7A 3LA6A 4PSAA 3CX8A 3MGCA 1XCGB 3DVLA 3QBVA 5JZVA 2WWXA 3IUYA 1XTJA 3R7WB 2ZI5A 3VR5A 1ZM9A 1ZW6A 4CEHB 2WM9B 1OXTA 5HKKD 4M2LA 4OL0A 1VMAA 4AURA 4QBIA 1Z28A 5KTYA 2O8CB 1X3SA 2CCKA 1N0WA 3ND9A 5EXSA 1UEIA 1W4AA 2F3RA 2EYUA 2F9LA 3QQ5A 4OJKA 4RY2A 2C99A 1JJVA 2XNDA 3AKDA 1ODFA 3QOFA 4UNRA 5B30A 4M1WA 4LHZA 2BKEA 2ORIA 5JJLA 3K9HA 5G3ZA 5IRCD 1KYIA 5HZKA 4DKXA 3OIWA 2DFNA 2JDIA 1WP9A 3K9GA 4ZCLA 4JLNA 2ZS8A 1NG1A 2OV2A 3REGA 3WYFA 4DCTA 4WZ6A 2CHVA 2FX3A 5FUXA 3HU2A 4YXWA 1JB1A 4X8MA 3B82A 1WE2A 4X8HA 2IUUA 2F1JA 2P0EA 1YU9A 5AJWA 2Q3FA 1TQ6A 2PT5A 3D6TB 1I4TD 3H86A 1AM4D 4LPSA 4LX0A 3RS7A 2V55B 4UNPA 3RSOA 3IEVA 1W49A 4MRVA 2J5XA 2W0SA 3QEOA 1KAGA 1XNJA 1XX6A 3GLGA 5B2ZA 2IYVA 4B75A 1NVVQ 4AYXA 4F7WA 1NKSA 2D3WA 2FZ4A 2WMOB 5BN4A 2F1HA 4OK5A 3EW9A 5DLQC 1KI3A 1U2RA 2W6IA 3TH5A 3T1QA 3B9PA 3VU9B 1JEDA 2IBMA 4NE2A 1VYUA 4OQNA 4YMSA 3I1FA 5EZ5A 2I4IA 4QJ5A 1MABA 4OQFA 5DIFA 3W6PA 1XZQA 4US2R 1W1WA 3S1AA 3AF2A 1TEVA 3EC2A 1G3QA 1XEXA 1NVXQ 4A1FA 1RW4A 4YMTA 1KJWA 4E03A 4PANA 2YWHA 4URXR 1S9DA 2OCBA 2VQSA 3V00A 3AVXA 2H8KA 1Z29A 4KBGA 4TT3A 1OYWA 2Y8EA 3CF2A 2W2TA 4A0RA 2HEIA 1KI9A 3KKQA 4IJMA 4YMUA 2RGXA 2X77A 1OLOA 2IXFA 2ZUBA 3EC1A 5FFMA 1E3MA 3QG5A 4DDWA 1E0SA 2CNWD 2OBMA 4HLQB 2D4HA 1NP6A 4MRSA 1N5IA 2OFXA 1EK0A 4C0LA 1DE0A 2J46A 2PJRA 4B3BA 1DAHA 1GL6A 4OHXA 4C0HA 3KQHA 2G1KA 4JSTA 4UNSA 3SBEA 2J45A 1XD2B 2NPIA 1CP2A 4JVLA 3QBTA 1J70A 3G0HA 3NG1A 4B35A 1UBCA 2VHQA 1OXXK 1T3HA 1TQDA 1FNNA 2AX4A 2GCNA 2OFWA 3NC1C 4XOIA 1SKYE 1F60A 1Z6AA 2R8RA 1KTVA 1MH1A 3ZD7A 2XSZD 2CE7A 1OFIA 2PT7A 3EPLA 2ZJOA 4LJ8A 4JSYA 1NLFA 2OE2A 4I1UA 4TYQA 1S1MA 4QXAA 2ZVPX 5KPDA 1G64A 2QAGC 1OXUA 2ZI7A 1Q44A 3Q7PA 5BYJA 4B32A 1R0XA 5GVSA 1G7SA 4UXJA 4F91B 2AN9A 3GLGB 2IHBA 3L8YA 4Q4HB 2IYUA 1DAFA 4B73A 4OQXA 4URZR 4M9XA 3TSOA 1XCMA 1NSTA 3LXRA 4TMKA 4OHWA 4Q4JA 3RDPA 4PHTA 3GD7A 1H65A 1ZM4A 1VECA 2R62A 5FBLB 2XEXA 3SU8A 1IJFA 2XNDD 2QAGB 1RRCA 4ERNA 4BRUA 2GKSA 3TGPA 1QVRA 1AQUA 1MABB 2YV5A 1VIAA 2I1VB 5TV2A 2ZE8A 4ITRC 6Q21A 2IX3A 4QGFA 2GCOA 1KJZA 1IN5A 1OJLA 3RS2A 3P32A 1CJUC 3UK6A 5FPTA 3VR6A 5JSZB 4IOKA 3ZQJA 3IILA 3EZ9A 2J7KA 1FZQA 1U9IC 2LKCA 5GJWC 4FW9A 3RVBA 1GVNB 4JT2A 3OHMA 1E4YA 1VCNA 3R9WA 4OK6A 3JZAA 1P7CA 1XD2A 4HLUC 4EPYA 4JMPA 3QPVA 2NO1A 1YZKA 4URYR 3CNNA 2GILA 2RMKA 3FMFA 5HCIA 2JLQA 2WJJA 3F3YA 3U6BA 1SKYB 2UKDA 2O8BB 5F9FA 4Q00A 1KO1A 4WAUA 2R6CA 4PZLA 4TLEA 4QNMA 4M1OA 1CRPA 1M7HA 4C0QC 2YOHA 1D2NA 4A8JC 3ZGXA 4PC6A 2QM8A 5JWRA 1G6OA 3QIAA 5A0FA 1S8FA 2BJWA 4JYCA 3A1VA 3SQWA 4C0JA 1JXOA 5FBWB 1Q22A 1OKKA 4ON9A 4ZO4A 3CB4A 2WWGA 4Z1MA 3U7EB 4F4CA 4IOLA 5K8LA 4KVAA 1GKIA 5FUWA 3K09A 4RD3A 5KDOA 3BJIC 1LS1A 4Q01A 2GJ8A 1TF2A 4KI0A 1FMLA 2P67A 5JLJA 2XXAB 4NYMQ 3RS5A 4Q4HA 1IJEA 3Q8XB 3KZ1E 1E2LA 1MOZA 5K8IA 1GM5A 2ZJZA 4FMBB 4Q4JB 4WZBE 5EXTA 2IW3A 5GJCA 1OW3B 2WJHA 1EWRA 2GDJA 4D82A 1HT1E 2FE4A 2QP9X 4LBVA 2BOVA 4PAQA 1YRAA 1JQJC 2JA1A 2KJQA 5E7JA 4A92A 1QBKC 4MYCA 5JI3E 1Q1ZA 3LNCA 3FE2A 4TLAA 3W8RA 2VTKA 5JJIA 2X8AA 2IYLD 2IYQA 1HY3A 4FWIB 5J4HA 2GJAA 4MA4A 3EPKA 3SDZA 2NIPA 1RYHA 2B7BA 3BOSA 2YZ2A 4BLSA 5K8UA 2ERXA 3VAAA 1NRJB 3I62A 2QUZA 4RFSA 3SI7A 3VKGA 4TSFA 1E6CA 3SJZA 3CO5A 4B48A 2O8DA 1EFCA 1QG4A 1II8B 4ZKEA 1ESMA 1VCMA 3QNUA 2PX3A 3BGWA 4HLDA 4NYIQ 1LTQA 3UMFA 4XVUA 1TL7C 1TMKA 2XB2A 3FMOB 3CM0A 3M4YA 1SZPA 1XDBA 5DI3A 5DHFA 4LHWA 5E95A 1R5BA 1U94A 3MJHA 4R9UC 1M2OB 4HAZA 3VR1A 3EPHA 2P6NA 4C0KA 1CRQA 5EZ6B 2DFKB 2HJVA 3NTUA 5EP3A 3FVQA 1T3SA 4G01B 1KDPA 4QHYA 4V02A 3VMFA 3C7KA 1UKZA 1ZD8A 4AKEA 1Q1QA 1I2DA 4DCNA 2F3TA 2J41A 1VYVA 3WHLA 1ZNXA 4XSGA 1G5TA 2A9KA 5G3YA 1A7JA 1KK3A 3ZIAA 2OM2A 4DLVA 3OAAD 4D4MA 1G20E 3RRMA 5DO9A 3WYAA 4DC9A 1Z2CA 3PXGA 1W4RA 3IBGA 3KJEA 1XFAA 1KO7A 3VX4A 5KO2A 3T12A 4NP6A 1UAAA 1C9KA 4ZV4A 3D31A 2QI9C 1FUUA 3K0CA 2AD1A 2WKPA 4Y0AA 2EFEB 1BYUA 4A82A 3AM1A 2XZOA 1XB2A 4GOKA 1FOEB 2I3BA 4NBSA 3ZH9B 1N5KA 1B23P 1PJRA 3TAUA 1W4BA 4LHYA 2IK8A 1PLLA 2JAQA 4GMDA 4AG6A 4MDFA 1NIJA 3BS4A 3U61B 2G0TA 3RSLA 3OF5A 4FMDF 3BH0A 1PLKA 4LY6A 3OE7A 2FG5A 1ANKA 5SZIA 1DO2A 4HI0E 2FFAA 1NG9A 1QHHB 1G21E 2OCAA 4RKFA 2PBRA 1J8YF 1M7GA 2FDCA 1IAQA 4RFSB 4FIDA 1XD9A 1EX6A 2QL6A 1E0JA 2ZRPA 4TMTA 3VHLB 4EPWA 1G8FA 3NKVA 2ZJ2A 4B3CA 2GJSA 3KUCA 4HDQB 3CWQA 2FPKA 2PH1A 4II7A 4ARZB 4DT1B 2QTHA 2VL7A 2F7SA 2H17A 1JALA 2H5EA 4TMZA 4ZIRA 4D2IA 3QKUA 5LDDC 1YJ5A 2GZHA 4ZCIA 3LW8A 2B8WA 2ODBA 3TSWA 5J4YA 2H1LA 2VP5A 4Q47A 5UKDA 1JECA 3CH5A 3NDBB 5B64A 1GILA 2IUSA 2R6DA 3SS8A 5KYKA 2QM7A 5DSZA 4OI2A 4A8JA 3LO5A 2FA9A 2D06A 2UVQA 1XTSA 3FKQA 1F2TA 1KDOA 1AGRA 2CLCX 2Q9AA 2GXUA 4Q1EA 1LW7A 1HYQA 4BWYA 2W6JA 4LOAA 4J0QA 1UF9A 4RKEA 4KVGA 1KY3A 3MCAA 1E4VA 2UZ3A 1AK2A 3HU1A 3IHLA 1IHUA 2VA8A 4FINA 3ZZTA 4DB4A 1S4QA 1UFQA 3VTKA 3T34A 1MV5A 1TNDA 4ACAA 4EFLA 1O87A 2D7CA 1EFTA 4ASUD 5C46F 1G8GA 1BH2A 4M21A 1G5RA 5KNDA 1R7RA 4RD0A 4EPRA 3GJ5A 2V54A 4AI6A 5L3QB 3X1ZA 3M1IA 1RKBA 4OI1A 4M9ZA 1SVIA 1XCPA 4LDJA 3AKEA 4NKRA 4UJ3A 1EG7A 4AK9A 4AYTA 1DG3A 1OPXA 3Q9LA 2X2FA 4MYTA 1XXHE 2H16A 2REXB 3CX7A 4B34A 1R0YA 1KI6A 1Z3IX 5HKKA 4NU0A 3KJIA 3J81k 1XWIA 2OO7A 5JHGB 5IHPA 2ZYVX 4KCGA 3JVUA 5D3MA 3B1VA 3VHXA 1A5TA 1II9A 1TU4A 2DCUA 3DMNA 4NYIR 3AUXA 2ZI4A 3B1WA 1GRQA 3LFUA 5CDFE 2NGRA 2ZSEA 4DSNA 5JJKA 2YWEA 4DLTA 1ZD9A 3ZLJA 4C2UA 3R8CA 2EFHB 2XX3A 2Q9CA 2BCGY 4B47A 2G3YA 1H8EA 1FQJA 4IOJA 2WVJA 2ZM5A 5HTKA 1ESNA 4KLNA 4LC1A 3MWYW 4D81A 1GIAA 2D2EA 2RGAA 3U3RA 1DELA 4LRWA 1AZTA 4AIIA 3QKRB 3AV0B 2FSHA 3QXJA 4TT3D 2OZEA 1KI7A 5SZKB 4Z51A 5FUYA 1XTIA 4F38A 3OIYA 3B9QA 4K46A 1GRRA 4OQLA 1OFUX 1S96A 2W6JD 2ZJBA 4G3XA 3WBJA 3NIBA 4IRUB 4B2LA 4A6XA 3GLIB 3VR2A 3TUJC 4N0DA 2P3SA 2EFCB 2WPDD 3T61A 1E1RA 1BMFD 3AEZA 5FR1A 3THXB 4JLDA 3FHOA 4KO8A 4TTRA 2IS4A 4ABYA 5JBQA 4PQYA 1GUAA 1PV4A 5DI9A 3AP3A 4V0KA 3RNLA 1CR0A 3AGPA 4ESHA 5EE3A 2ONJA 5HPYB 4DSTA 4HAWA 4JT4A 5L3SA 1VG8A 1OIWA 1G8PA 3JZMA 3TSZA 3EZ7A 1E2KA 3RS4A 2O8CA 1TPZA 2BMEA 1Z47A 3QXXA 4BFWA 2ZUCA 1KSFX 4V0NA 4EPTA 4Q9LA 4DSOA 2NO9A 4DUGD 4QG7A 3C15C 2VSFA 3UMRA 4UXHA 4JL5A 3U60B 8OHMA 2GHIA 3TKLA 3UWOA 4PC3A 3A1TA 2A3RA 3C16C 4PQRA 1K5GA 4TMXA 3I5YA 4JLKA 3H4MA 3L8ZA 2QROA 3THYB 3THWA 4LJAA 4Q1CA 1OXSC 3AVQA 1W5SA 4HAUA 2PZEA 2XTZA 1TTTA 2AFIE 4LWZA 1NMYA 3R8FA 4MYUA 2FN4A 3HPRA 4HDOB 3B13B 2ZJYA 3ICEA 1PVOA 5EP1A 3SFVA 1H8ED 2AKYA 1UBFA 3L0OA 2YKGA 4IEEA 1LFDB 1NKTA 521PA 2WJGA 5C2JB 1GTVA 4RSGA 4Z8XA 4LV5B 1EXMA 1US8A 4EPVA 1AA9A 3ASZA 1KZ7B 1UBEA 1G1MA 4XVRA 1SVWA 4JJKA 4DEYA 2D62A 1FMJA 3SNHA 3OESA 2A78A 5J5CA 2C9YA 3AVOA 1R8QA 1LS6A 1Z5ZA 3P26A 4IVQA 1M34E 1FNMA 1NY5A 3PUXA 1NBME 4R2IA 5CIWA 4BEJA 4Q1BA 3QKRA 4LHXA 1QHSA 3W5IA 1L4YA 3L2OB 4C4PA 1E0KA 2QMEA 4CZ2A 1YZLA 2FV8A 2R2AA 1DAGA 2VSXA 3KJGA 4Q4LA 2YC4C 5J40A 3SOPA 2OAQ1 4ZDIA 2HF8A 1E98A 4BLPA 4A2WA 4DBLC 2YWFA 4NONA 4PSVA 1P60A 2GXQA 3BH6A 4UJ5A 1WBBA 1P2TA 3E70C 2ATVA 1CEEA 1M74A 1P73A 221PA 5KOYA 1MT0A 2PMKA 1TUEA 4KSBA 5CJPA 5F9HA 3NBZC 2BHRA 1VCIA 3IPXA 1E2FA 1G7CA 2GF0A 4Q9JA 2WWYA 1EWQA 2Q3HA 3P4YA 3B1XA 2EU8A 5JS8A 2HYIC 1SXJA 2GETA 2YHSA 4GZMA 3BH7A 4NH0A 4KFRA 5FOUA 4QM7A 1BKDR 1T3LA 2KB0A 4LV6A 5JI2E 3AKYA 2ZRNA 4NMMA 4EJSB 4TL9A 1NBMD 4AC9A 1E2DA 1GZSA 3L43A 2KSQA 4NCKA 4LBYA 2UZIR 2ZJ5A 1XEFA 1KSHA 2AK3A 1OV4A 4A2QA 3THWB 3GJ7A 1HQCA 3GLIE 3IPYA 4L15A 3V9PA 4O3MA 3Q85A 4R98A 4LBZA 1JPNA 1Q3HA 4OI4A 4ZDWA 3GMTA 1HT2E 1DOAA 3PUVA 1ZAKA 1Q57A 2ZSAA 1Q12A 5CK5A 4CRWB 4CT4B 3L0IB 1Z22A 4TL8A 5HZHA 1IN7A 3LY5A 1R0WA 3BD9A 3NBYC 3TLXA 1UADA 3K9LA 1R2QA 1Z8FA 2Q9BA 4LCBA 3SJCA 2ZR7A 3TR0A 2ZIAA 2P65A 3B1ZA 2HXSA 3SFZA 2C98A 2HUPA 3CRW1 3LLUA 3AF3A 1F5NA 3LQQA 3UATA 5TVKA 4P4SB 1N3BA 4UQOA 1AS2A 4FCTA 4HB3A 2F55A 3M0EA 1SQ5A 1UBGA 5LBIA 1TEXA 4RZXA 3I72A 1HA3A 1E2GA 1KO8A 1MR3F 2ORWA 2V1XA 4H1VA 5G41A 5JCZA 4Q48A 3WXMA 2QAGA 3SE0A 2G88A 3PVSA 1ZNWA 3B8HA 1Z83A 2WICA 3E5HA 1X8KA 3N5CA 2HJGA 1XTQA 2IUTA 2IF2A 3DHWC 1N6OA 1AZSC 3IO3A 4WOPA 2A5FA 4NYMR 3BFKA 3T35A 1ZINA 4M9QA 4A6PA 4OI0A 3K09C 1YQTA 2GAAA 3B7GA 3A4NA 2GK6A 3K0CC 3BAFA 4K8OA 1JEEA 4C2TA 3X1DA 4I1OA 1VPLA 2V8OA 3U7FB 5JSZA 2FPLA 1MRSA 3V4FA 1KK2A 2HV8A 2NO7A 2RGBA 2BEKA 1QDEA 1OHHD 2PZGA 4CDGA 3NWJA 1LB1B 1KKMA 3NVAA 2YNMA 4U00A 4OBEA 3BIFA 1TX4B 1T5IA 3T1TA 2AL7A 4XTCS 1MRNA 2WWHA 3D8BA 2QMOA 1SVSA 2GVZC 3TRFA 4LJ9A 4OYHA 3AQ4A 1IM2A 4L9WA 3WHKA 2J7PA 4PHGA 1D5CA 2ZI3A 1K6MA 2WWWA 2ZR9A 4ZCMA 1QF9A 3Q72A 1Z2AA 4XD7A 3RABA 4LC0A 2VIIA 2YOFA 4DXAA 1N25A 4JBYA 5EP2A 3RRNA 3UMSA 3SYKA 3QXHA 4PC1A 3BB4A 3GFOA 1KNQA 4PO1A 1YZTA 1F3OA 1Y63A 2C5LA 5F2EA 4PTLA 1ZCBA 3U3JA 2AK2A 1CR2A 5H70A 1N0UA 1GNPA 4FI3C 4RD4A 3KTAB 3VKHA 1MO3A 1GL7A 4BPBA 1R5NA 1DAIA 1MKYA 1G8YA 1YZQA 3AH8A 3CIOA 4A0FA 3EPJA 4PPGA 4P4SA 4DLUA 2ZRGA 4HZIA 4TSFD 4MITA 3ZIAD 2F9MA 2HCBA 3KKMA 4HLCA 2W00A 4NCNA 1HE8B 5CLLA 5CDFA 4P4TA 3FWYA 1YZUA 4QFMA 4HATA 4CEIA 3VR4A 5HCNA 1EFUA 2BMDA 2B92A 3LW7A 5DNYB 3U3OA 3KQLA 2HCJB 5TB5A 2ZRIA 2JASA 2GBLC 2WWFA 5EE0A 4G1UC 3DDCA 1WA5A 4FN5A 3GLFE 4TQ9A 3QJYA 4NCIA 5H8WA 2O8DB 2IC5A 3IDQA 2XJ9A 4CEJB 3BXZA 1OYYA 4TZ6A 2H7VA 3O8DA 2CL6X 2WJVA 1R4AA 4I4LA 2REBA 2CXXA 1ZVQA 2XOKD 4DIDA 4PX9A 4Q1DA 3V4RA 3W8NA 1XJQA 4AG5A 4V0LA 4XWOA 1TADA 3RWOA 3U4QB 2GA8A 3TR5A 4KFUA 2CEAA 3U3KA 2WSSD 1W0KD 1T0HB 2FNAA 2XOKA 3LD9A 2JEOA 4DIEA 3LRPA 5AJZA 1OH5A 5SZHB 1RRFA 1NI3A 3LAWA 4GMXA 4IOMA 1F6BA 5IK2A 4GSYA 2JLZA 1SXJC 3N70A 1Z6XA 1DAEA 1ZJ6A 3NEJA 1E0AA 3F5FA 1W0JD 1P3JA 1YR6A 2J0UB 4TLDA 1KMHA 2EWVA 3KB2A 3BFXA 1FQKA 3UG6A 4EJSC 1JQLB 2YINC 3ZS8A 4BLRA 4QJ4A 5DE3A 1QHHA 4BFTA 2I1QA 1ZNZA 1W44A 2FH5B 2V9PA 2ECKA 1RVDA 2F43B 2GEDA 4M1MA 5KDLA 5TARA 2NMVA 1D6JA 2A7QA 2JGNA 2CVFA 3QPWA 5BYKA 4L9SA 2FF7A 5CM9C 2C2HA 1JR6A 3K0SA 1E79D 2H18A 2FSIA 1RRGA 2N1BA 2FOLA 3A37A 3GJ3A 2GBLA 2CCGA 2PJZA 3L0SA 2FWRA 1VG9B 3CBQA 1XJ0A 1JPJA 2JATA 4DLXA 2WIAA 3CNLA 5TY0A 4DT1A 1ZM3A 5KHOC 2Z83A 3ECCA 2QE7D 1KJYA 2XTMA 4IVRA 1OFTA 4LJ6A 4TWZA 1YVDA 2QGNA 3AVPA 2GAOA 5JFGA 4L4UA 1U8YA 1E2QA 2QP3A 2C95A 3EXAA 2VHJA 4QGGA 4BFXA 2F1RA 2F1IA 2V1UA 4HDCA 4I1SA 4Q7MB 1QHXA 1WBDA 4BLQA 2XTNA 2G6BA 3MG9A 5JRJA 1TF5A 4DHEA 2BBWA 1XTKA 3VFDA 3NH9A 1AS0A 2QZ4A 3UPUA 3SN6A 1VCOA 3WMGA 2WAYA 3H0KA 5ELXA 3SHFA 1E9DA 3MMPA 3ETLA 1S1CA 4KYIB 5J4LA 3U7GA 4ARZA 4LJ7A 3R7WA 4WVFA 1W0KA 3K8YA 4QGAA 3EZ6A 2GF9A 2CMKA 3EA0A 5JEDA 1TU3A 4WBSA 4YDHB 4KJZA 1WDTA 1WCV1 2CE2X 1Q3TA 4IDOA 2VPPA 1E9CA 1FTSA 4A8JB 5J47A 3ZVNA 3AVUA 3ADCA 1OE0A 2JDID 3GQBA 621PA 4Q02A 1U90A 1Z0AA 4HZUB 3DMDA 4LJ4A 4CGZA 4W5HA 1XU4A 2Q21A 4ZKDA 4K81B 4PHHA 4DLYA 2XAUA 3WP0A 1SHZA 5J4KA 3FDIA 2EFDB 4FXPA 3KFVA 3MFYA 3KX2A 2VBCA 2VF7A 1HH4A 5GJBA 4US0R 3U2QA 1E9FA 4IDNA 2V6JA 1UPTA 1A2BA 1U0LA 3LVQE 4LJ5A 3NBXX 4GNKA 4Q66C 1YRBA 2QA5A 3UWKA 1U99A 2VLIA 5GVRA 1U81A 4I99A 1VDZA 3FYHA 1YE8A 1CULC 4S35A 4QNRA 2GZDA 3RS3A 3ZDQA 2R44A 4F4IA 1XPUA 1EESA 1BOFA 5H1YA 3DZDA 1S3SA 3HJNA 3MUFA 2EQBA 4G5OA 1R5OA 5C4GB 1ZYUA 2WSMA 4CW7A 1IN4A 2X2EA 3CF6R 1SVMA 3CPHA 2PLFA 4Q1FA 3S1AB 5KNBA 1DBSA 2J9RA 1E2HA 1W4CA 4GPTA 2QTFA 1KO4A 4UNQA 1EFRA 2RGNC 3IQXA 4XSHA 2AFHE 1KAOA 5D3QA 3QXSA 2WZQA 1GITA 1IXRC 2B21A 1QRAA 3L82B 4TL7A 3RS0A 4IHQA 2GXAA 1N6HA 4QHTA 4GOXA 2NZ8A 3BB3A 4HLUA 4B74A 2BWJA 3NH6A 2P6UA 4B44A 2ZI6A 2ZYUX 4C3ZA 4EQ6B 1FPMA 1G291 1EX7A 5FI0B 3TIFA 2ZI9A 4JL6A 3OIUA 1N6LA 4A9AA 5E7IA 4E07A 2Z43A 3CNOA 3LBNA 1SULA 1X6VA 1JR3A 1OIVA 2QG6A 3DO6A 1RRPA 3AVVA 3K0FB 4W5JA 4YDSA 4BFYA 3E1SA 4GZLA 3PEVA 1NL3A 4PAMA 4A15A 2QTVB 3GJ6A 3VQTA 3QSYA 5FBRB 2YC2C 3W3ZB 2CK3D 3D7MA 2BMJA 1AS3A 3D3QA 2ZJAA 5IK2D 4GL2A 3WYGA 2QMHA 4RCZA 1GNQA 2FJUA 1KZGB 1Z07A 4P33A 1S2MA 1VHTA 1NLZA 4TQAA 5L3SB 1D9ZA 2CK3A 2BVNA 4DDUA 1NIPA 4JVMA 5KSZA 1JXMA 1E2JA 4E5UA 3PITA 4MUBA 4LK2A 3RLFA 1VTKA 5EUQB 4FMDB 1I4LD 1YR9A 3BRWD 1FP6A 1Z63A 2DPXA 3QF4A 1E1QD 4JL8A 5JWHA 2C03A 2ZEJA 4IXNA 3FHTA 1VG0B 1YZGA 3CR7A 3NEYA 2R65A 5CIQA 3HR8A 2RHDA 1J99A 2G77B 4Q1AA 4TTPA 1NJGA 1P2UA 3NXSA 3O8BA 4TN1A 1GG2A 5FPYA 1E9RA 4B76A 1KDTA 1DG1G 1IXSB 3RYTC 2P6RA 3THYA 5FL7D 4PXAA 1DADA 2IF0A 5EP4A 2OLKA 3U7HB 1NVWQ 3KXLA 4O0MA 2RGGA 4EKDA 5JECA 3GLHA 1D9XA 4WXRA 3CH4B 1X8JA 4TMWA 4MKIA 1CR4A 3LXXA 2ZETA 2E1RA 2GCOB 1KGDA 1AGPA 3FTQA 3ONWA 4WZAE 2CL7X 2ZTSA 1RFLA 1US8B 2AR7A 1YR8A 5L3VA 3GEIA 1P6XA 2DFTA 1ZIOA 2WKRA 1DVRA 2HYDA 2VF8A 3FHCB 1N5LA 1OT3A 2A5JA 2K5UA 3I8XA 4JYBA 4U02A 4CEHA 3TVTA 2QAJA 4QKQA 5FTJA 2VEDA 4R7ZA 4B43A 5IDVA 1U0JA 3SHWA 4LUCA 4TQUS 2IHYA 4EDHA 5L3RA 1COWA 4KHZA 1P9WA 2IYWA 3KXIA 1X86B 2GEUA 4KYUA 4BGDA 4ACBA 1QVAA 1TAGA 4BFSA 2ZE5A 2GJKA 1Z0FA 4EJSA 1N0VC 4S2EA 4LYAA 1WRBA 2FFQA 1JR3D 2ZRLA 1X1SA 4XJXA 5FL7A 3ZVRA 1F48A 3U44A 1W46A 3CZPA 3N2IA 5ANRB 3CRQA 2XNSA 3KQKA 3AP1A 3CONA 1GKYA 1KO5A 5SZJA 3IO5A 2JIZA 3REFA 1P9NA 2OLJA 4QJ3A 1S3GA 4GT1A 4D0GA 1JAIA 4HB4A 3PEUA 2Q6TA 1M7BA 2RH5A 4TLBA 3KQUA 3K0AA 2E9SA 1Z06A 3DZ8A 1SVKA 4EFMA 1E9AA 1E2IA 2ZROA 4QL3A 5BN5A 3P20A 5TDHA 4GI7A 1T0JB 3QF7A 1GAJA 5L8VA 1G41A 1KK0A 2CHQA 4IEIA 1JAHA 4YLGA 3T1VA 3MAAC 3H84A 3WMFA 2WWIA 5BW8A 3KQNA 3PQCA 3KUDA 1F2UB 1NN0A 2TMKA 3W34A 1OXVA 1C4OA 4L8GA 5KSOA 3WNBA 3CR8A 4BQSA 1WB9A 3QKSB 3FPAA 2J1LA 3MWKA 1SHKA 2RGEA 2HF9A 4P32A 4O25A 2VHCA 2G9NA 4BUJA 3PEWA 2WBLC 3A1SA 1QHGA 4MRPA 3JVVA 5AJYA 2ZAMA 2IEYA 2BBOA 4G5GA 1E2EA 3TW8B 3LQRA 3O8RA 2ZRCA 4IKEA 1AQYA 1RPZA 4GDFA 2OXRA 5EE5B 5BQ5A 3T15A 3QENA 5HE9A 2N42A 5DYGA 1KSGA 4E22A 1VG1A 4LYFA 4BFVA 1Q1EA 2J0VA 3QUSA 4EIWA 1H8HD 2ZJ8A 1E94E 4YMVA 4EFNA 1ZCAA 1ZBDA 1VYTA 4V03A 3UXMA 4BZPA 3AB3A 3SC3A 4A36A 1G9XA 1FL9A 3TUIC 2O5VA 1IN6A 2ZU0C 2BV3A 1DPFA 5DI3B 4ZDKA 5DN6D 1M6NA 4TYWA 4QBHA 5CJ2A 821PA 3CPEA 1JI0A 4XTRA 2ANCA 4UNNA 2ZE6A 2PEYA 3FKSD 3X1YA 3KXKA 4C9BA 3RRYA 4DDVA 3PV0A 3OEHD 1W48A 1E1QA 3U44B 4P3YA 5CM8B 5FOWA 1CJMA 4Q4AB 5GADl 4C7OA 2CVHA 2A2ZA 3KFXA 2JLWA 2W2VA 2H92A 4DCSA 1IONA 1XMSA 1XMVA 3IGFA 4MH0R 3TJZA 1U8ZA 4CVNA 4FD2A 4KU4A 4D0NA 3NC0C 2ASEA 2HT6A 1EFHA 3CRMA 4NCJA 2MMCA 3C5HA 3AUYA 4HSEA 5KSYA 4CIDA 2IL1A 2DWPA 3UANA 1N6IA 1QHNA 1ZU5A 3RC8A 4H1UA 1CJKC 1RIFA 3W6NA 3FFAA 5AUPB 1ZC3A 2O0JA 4TYNA 2Z6VA 2OUKA 2AHOA 3CW2A 5G53C 4ILEA 2KE5A 3EIHA 3CLVA 4D4LA 2OCYC 1IN8A 4DLSA 4BZXA 2IYRA 2HLDA 2YVUA 5F3WB 5DN6A 2IS6A 2HXYA 4JLMA 1FW6A 2QRNA 1E69A 4QHSA 3O47A 2DBYA 3QKSA 1D8TA 4LJYA 3WNDA 4BZQA 1G7TA 3PUWA 1E9BA 3QXCA 3BERA 2GEVA 4B3FX 3A36A 4B71A 4W7SA 2IS2A 3UG7A 3K70D 2BIFA 1PUJA 5KUTA 4B6EA 3B6EA 4KSCA 4F92B 2O8EB 2ZXUA 2HDNB 2KBFA 2W83A 3W6OA 2YYZA 5CB8A 5LD2B 2EVWX 3B85A 5KDDA 3VNVA 2QPOA 3KTAA 2XSZA 1I4DD 2WJYA 4GBMA 2GVDC 4KODA 2V7QA 4IVPA 2JLYA 2BEJA 1E9SA 3P27A 1VIYA 3HDTA 5KNCA 3MLEA 1YHNA 5KU1A 1EFRD 3SR0A 1OIXA 3IIKA 4PR0A 5CB6A 2QY9A 3GP8A 3I61A 5CYPA 1PLJA 3P4XA 3BFVA 2O8FB 2QMUA 1QG2A 2ZS9A 1XPRA 4MRNA 3GFTA 2PMDA 1NN3A 2VHTA 4CEIB 3QE0A 4M4SA 2V6IA 4A4DA 3KKPA 4H9GA 4ZDJA 1DEKA 2QORA 5EJEA 2W2XA 2GK7A 3UKDA 4IDQA 1N6KA 4M1YA 1KIMA 2QT1A 3Q5EA 2WSSA 4FMCF 3OAAA 2XJ4A 1U9IA 2WJIA 1F2TB 1IQPA 3PUZA 4RZUA 3RC3A 4G5QA 3TBKA 1ZUHA 2C04A 1XPOA 3CZQA 4OQMA 3KJHA 2ODEA 3ZS9A 2EYQA 1P62B 1J2JA 2CJWA 4PPNA 4Q9IA 4XVQA 4MGYR 3GEEA 3GLGE 4CT5A 4ZPXA 1J90A 2QSZA 2ZRHA 4PSKA 4DCVA 5HR5A 3AF0A 2OAP1 5AWFC 5FH9A 2NO6A 1P75A 1XEWX 5BWMA 1G3UA 2ZREA 5EQTA 3O8CA 2ONKA 4DUGA 3EX7C 2B7CA 2ZUDA 1PZNA 3T5DA 4G0NA 3IIMA 3U4QA 3WY9A 1P2SA 2VP2A 2GJ9A 5L3QA 4EPXA 1YZNA 1G19A 5LB4A 4US1R 2ZU6A 3DKVA 3QVUA 4PC2A 2JLVA 2ZPTX 4D0LB 4I81A 1E79A 4BECA 5FOXA 2KBEA 4RD1A 3WRXC 2DY1A 4NDZA 2ZYTX 3TE6A 2MMGA 3AVTA 4NL4H 1KI6B 1KMHB 2RAPA 3ZVMA 2G1JA 4L5BA 4MRRA 1HTWA 2QNRA 1G3MA 4M22A 3SYLA 1U8AA 3EWSA 1YR7A 3AVWA 2XB4A 4M1KA 4BE7B 4P31A 3C41J 2WAXA 4M9SA 1W2HA 1LF5A 1PUIA 2F43A 4KAXA 3L0PA 4C30A 3TUZC 2ODNA 1RJ9A 2A5DA 2FMXA 2JJ1A 1NBMA 2CLSA 3G5UA 1II8A 5FI1B 3TQCA 2AD5A 2ZRMA 2KWIA 5TXGA 2WTUA 2BKUA 3DM5A 1G4UR 1W36D 2N46A 2ZSBA 2V3CC 3AKCA 3K9NA 4KFTA 2PCJA 4MKGA 2ZRKA 2FFBA 2IXGA 121PA 3ADKA 1J7KA 5P21A 1NNEA 2JIZD 2ZRJA 2OCPA 3HP1A 1CIPA 3AP2A 2Q3MA 1RYFA 1R10A 1OH6A 1JJ7A 1V5WA 1Q21A 4RD2A 4PPFA 2IYTA 2R9VA 1FP7A 4KBFA 4DCUA 3HU3A 421PA 3PIRA 5JS7A 4YMWA 3W3AA 3I92A 4HZUA 3THXA 1NVUQ 1Z0JA 1OHHA 4NYJR 1UDWA 1II0A 3CKLA 5FTNA 1CLUA 4QBGB 3GJ4A 1T6NA 3GLFB 4FCVA 2VP0A 3GFPA 4JLAA 4QM6A 3ZYCA 2CLDX 4DWJA 4Q9KA 3KB1A 2JLSA 2OXCA 2WIBA 3IIJA 1LY1A 1KMQA 3EZFA 4WXPA 3TQFA 2B8TA 1GDDA 2H57A 3WNCA 5FTLA 1XEWY 4JLBA 2RB4A 1SXJE 3QG1A 4V0MA 4YQFA 4AKHA 4JVNA 1NMXA 2V7QD 3LDAA 2RGNA 3DL0A 3VR3A 3X2SA 1GP2A 2DYKA 1L4UA 4P4UA 3GEHA 4R2HA 1UKEA 2J59A 4U5XA 3C8UA 1UM8A 2YOGA 2JJ8A 1W36B 2D2FA 2J87A 1N2CE 3HPQA 2P5TB 3F8TA 4AYWA 3VKWA 1WF3A 4DRZA 5H68A 4HAVA 2IA5A 4O2LA 4BFZA 1W2GA 5FOTA 4M0LA 1IXZA 1RJ9B 5AR1A 3GJ0A 1Q20A 4B6FA 2GESA 2CL0X 4D4JA 1CJTC 2ZITA 2WKQA 3RWMB 1LV7A 1P4SA 2ZS7A 1RC8A 1OF1A 3TMKA 1MO5A 1S9HA 3KL4A 4Q21A 4KITB 3KDSE 5EE9A 3CX6A 2DWOA 1XZPA 3K70C 4QC2A 4PZYA 2VHUA 2IYSA 3CPJB 2ZRFA 1L8QA 4IFEA 2QBYA 5LPNA 2DB3A 4HB2A 1Z0IA 5AUNB 3ZD6A 2ZR0A 4N0EA 2RCNA 1SKQA 4FMCB 4XH9B 2QEQA 3AGQA 3EG5A 4Q03A 1K8RA 4DLZA 4DVGA 1FUKA 3UIEA 2J0QA 1G6HA 4RZ2A 3I4LA 1ZC4A 2NPFA 1IY1A 3QVVA 3KKNA 4JKIA 5DISB 5DGXA 4A0HA 1X1RA 3HR7A 1OH7A 4B3GA 1P2VA 2ZRDA 3FB4A 4I1VA 1ZUNB 3NHBA 1SVLA 1OB5A 4DEXA 3QF4B 3LBHA 1SXJB 1W5TA 5EXXA 1CBUA 3ZJYA 1KKLA 2P5SA 3DOFA 3H2YA 1C1YA 4RZ3A 4HUTA 3IBYA 4RFVA 3GJ8A 3K0FA 3P1JA 4OHZA 2R6GA 4IDHA 4MYHA 1H8HA 2AXPA 4ZI3A 1T9HA 5FPHA 4NPHA 4IW3B 4N3NA 5LB2A 4L16A 4XWKA 4F93B 4AWXA 3VU9A 3SBDA 3OEHA 4JJZA 3X1XA 1CXZA 1D2MA 1N5JA 2W6ID 3B78A 4TTQA 1E32A 3ADDA 2OILA 5FOSA 1T91A 1GKUB 3CWZA 1Z6GA 1GRNA 5AUQA 3SJAA 2X19A 3ASYA 3SZRA 1GSIA 4FWTA 1GL9B 5J4VA 4B3XA 4C0AC 1E96A 2A5YB 1IY0A 3BBPA 3QKTA 4GP7A 5EE1A 1G16A 5IF9A 3DOEA 2LCFA 3M6AA 4RCYA 1XXHB 2NTYC 1AKYA 1KSJA 3ZZUA 2XITA 3R9XA 5E7MA 1P5ZB 2MSEB 3CF0A 4DJTA 3BE4A 1T5LA 5C4MA 1ELOA 5JEEA 3W9YA 4YXWD 4AKGA 2QPAA 2FGJA 1RZ3A 3GLHB 1UEJA 5FL3A 1KNXA 4AKIA 1XP8A 5JRZA 1AKEA 3LVRE 3T1OA 3PG5A 2W0MA 4URUR 2Z4SA 3TVDA 3R9IA 5C18A 1XEXB 2WOJA 4MQBA 4R71A 2G0NA 2AKAB 3PEYA 1LF0A 3VX3A 3OFND 1MO6A 3AVYA 3MRSA 1D2EA 4Q5IA 1W7AA 1OSNA 1DAMA 3GCGA 4A0GA 2JCSA 1G8HA 4BASA 4NHOA 1BYIA 1U0HC 3PENA 4XWAA 5FUVA 4AD8A 4D80A 1KK1A 4JBXA 1COWD 1GWNA 4TMVA 2O0KA 1N6NA 1M1YE 3OE7D 2QGZA 2BMFA 2WHXA 2BM0A 4HYYA 2RKOA 1JBKA 4QRHA 4CF7A 1IY2A 3MJRA 2DWQA 3I8SA 1Z6TA 3G82C 4MGZR 4C0SA 5JCPA 2JJ2A 2AXNA 3EWAA 5KSPA 3FOZA 4V0ME 3A6PC 5LD2C 2G83A 2QP4A 4E09A 1EGAA 3BWDD 1QZXA 5KPJA 3LWNA 3K53A 5JMTA 4PFSA 1G3IA 2YWGA 2GCPA 2IWRA 1KY2A 2IYXA 4U7DA 3ZVLA 3LLMA 3IEUA 4X8OA 4A2PA 2OG2A 4LI0A 2RHMA 4Q19A 3DPUA 3WBKA 2DR3A 5B58C 5CK4A 3H1TA 4TYPA 4M53A 4BLTA 4WW0A 3OZXA 4PHFA 3K0AB 3NHAA 4MGKR 1W36C 1W47A 1XXHA 2GTPA 4Z8YA 3CUEF 3AF4A 2JLXA 2GNOA 3A4LA 3Q7QA 1A2KC 1DTSA 2ZQ5A 3ZQ6A 1KI8A 2JJ1D 5B57C 2ZANA 3A1WA 4BFUA 1KI2A 2FZLA 1F2UA 3DKPA 4HAYA 1UJ2A 3SJBA 2FU5C 2VYFA 4ZI2A 4KV9A 5FBQB 2REOA 4DDTA 4TL6A 1Q0UA 2J0SA 2C9OA 3C5CA 1P61B 2QRZA 3K70B 3DM9B 1P72A 1X8LA 3FGNA 4NTZA 4EAQA 4NYJQ 2QT0A 1A4RA 1T4GA 2VSOA 2CHGA 1NSFA 1E1RD 1ZD1A 2XGJA 4CEJA 2BM1A 3EAQA 1OFHA 2QPTA 3OEEA 4LGMA 3WP1B 1R6BX 2SHKA 4LPKA 4MUAA 5FPSA 1OB2A 2QE7A 4BRWA 1AIPA 1G5PA 1DO0A 4LYHA 1AJEA 2PX0A 2R6FA 4ESVA 4JIMA 2JJ2D 4D4KA 2J7PD 2BJVA 3RHFA 2RGCA 3A1UA 4GRAA 4UKDA 5CITA 2XXAA 1O3YA 5IT5A 1QHYA 2O52A 3ND8A 4M1SA 3MSXA 4M1TA 1G7RA 3Q3JB 3GJXC 4OKSA 2ZYWX 4Q4AA 4C7OB 2CBZA 1RE0A 1XMIA 2O8BA 1CS4C 3RRZA 2ERYA 3EZ2A 4LZZA 2D7DA 2Q0HA 3IKJA 2PL3A 4IFBA 4IDPA 3TK1A 3SYNA 4DZZA 1XJCA 1E2PA 3I3SR 5E3HA 1ZIPA 2IYYA 2QSYA 3ADBA 1E2NA 5CYOA 1KDRA 2OHFA 2FEOA 3A8TA 3OFNA 4Y0VA 4B2IA 2MSDB 2FSGA 3OIVA 5AJXA 4ASUA 4CYMA 3BORA 2OFOA 4TLCA 4EUNA 4HAXA 5BXQC 4HB0A 2J3EA 4JLVA 1BMFA 2PCLA 3T5GA 3LBIA 3LV8A 2CDNA 2LKDA 3U3MA 4BEBA 1VHLA 2B6HA 1CR1A 3FMIA 2OESA 2C8VA 1NN5A 1WMSA 2OBLA 3I73A 4Q9HA 1KHTA 5JHHB 4HUQA 5HE8A 4MGIR 4B3DA 3RAPR 5FBVB 3EIEA 2O8EA 2AWNA 4Q18A 2ORVA 5DYIA 1Q1BA 3CRRA 3I5XA 3MD0A 3Q5DA 4D25A 4OK3A 1ETUA 2IXEA 4JZKA 1J8MF 4JLOA 3OEED 4Z54A 2NQ2C 1FX0B 4W9MC 4BLOA 2HT1A 2VP4A 4JLPA 5FTMA 4M8NE 2ATXA 3WMEA 5EXPA 1CF4A 4X8LA 1UDXA 2QQ0A 2NO0A 2WV9A 2ZAOA 3RANA 1B0UA 3A4MA 2OT3B 1NVVR 1K5DA 1NN1A 2FPMA 1S0UA 3CRVA 4LSGA 1DARA 1UKVY 2QU8A 3C14C 1QHIA 2O8FA 1FFHA 3QEJA 1NLYA 1FTNA 2WMNB 3U6KA 3VNUA
chains in the Genus database with same CATH superfamily
1M2OA 4O2BB 2DULA 3MERA 3ER8A 4DA4A 1N2IA 4WASA 3ABZA 4PC7A 1BS1A 4BKRA 1RAAA 3LUAA 1C2YA 3DE6X 1G17A 4ZU3A 5CLQA 1CU1A 3GT3A 3DMRA 2PZFA 4PG6A 4ZVRA 2IHUA 2VP9A 3NDPA 5JZBA 3TCXB 2CB0A 1L7BA 1VBNA 5KI6A 2P9JA 4TWJA 2PX6A 4J03A 2PA3A 4ZGBA 5CT4A 5G4KB 1T8UA 2DQYA 4B6JA 1Q6ZA 1WUJS 4POAA 4DLRA 4KFSA 3M5DA 2HLHA 3ANTA 3IUEA 3K5PA 6YASA 1OH8A 3W5DA 5M29A 2L0XA 2Q5FA 1T8YA 3ZC3A 4B46A 1DS6A 2ZKLA 2AZMA 2D1FA 1EHIA 1N3YA 2ZJ4A 3NM6B 5JMOA 5HRCA 1U1CA 2Q07A 4KJXA 4R1TA 4QBFA 2OYSA 4WZAA 2NZ2A 4TTIA 4MHOA 1EVQA 2C4WA 3G89A 4GP6A 5E9WA 4QOSA 3U31A 3M6IA 4TVBA 4EEXA 3J80A 3CZCA 1H1LB 3FBGA 2BBTA 2E87A 1IB6A 1Z6YA 3DE0X 4CKBA 1J1UA 2GM5A 3PFIA 4P8RA 2X86A 4Q7KA 4TV8B 4F5EA 4D57A 4BTEA 4G0QA 4MI6A 5BVGB 4X7PA 2H5LA 4UDNA 2FQYA 1YCGA 3BXOA 1SFRA 3LRTA 5MGBA 3HGQA 4FM9A 2DX7A 2O05A 4HUQB 1M0EA 1LVGA 2PKXA 3DDSA 1T3TA 1Q0QA 4OG2A 3C3WA 2IEBA 5KTRA 3BB1A 4O4IA 4FT2A 2FFHA 4P5PA 3C5VA 3PYMA 4XPIA 1J8DA 3B48A 4R54A 2IYFA 4QDKA 3HWX1 2ANBA 3L7YA 5E4FA 5F73A 4B6GA 5FULA 3ZEAA 5EL0A 5C1BA 1FX0A 1ZMOA 3R74A 2JLRA 4FNMA 3MLBA 3W4JA 2BMAA 1PT7A 2QD2A 2RHLA 3ORQA 3PJFA 4LYJA 4MIKA 1QKJA 3E8XA 4X6XA 3LU1A 3RBAA 5BN3A 5BXYA 2ODWA 4KE6A 3ZZ1A 1RQXA 2WJ6A 4NEQA 2I6FA 1T5DX 3FSEA 4DW8A 2ZCVA 3A05A 3IT2A 5HUQA 2ZUEA 1Y3AA 3DKKA 1A4UA 1P2FA 3E2IA 3V42A 2O2JA 4F5YA 2ZJFA 2LWIA 1KVUA 3D2BA 4PX2A 3OT1A 5B1HA 1DQRA 2ZWIA 4D45A 2BF7A 5AVYA 2BR4A 1D8AA 2FEWB 5LZ7A 1EDZA 1TQ4A 1RQ7A 1UPAA 4OLHA 4QDOA 1KFJB 4KL8S 1R1DA 2HIMA 3F3MA 3IUBA 1W0JA 1JNYA 2ZSDA 4LBWA 3ZWQA 2D74A 2BC9A 3IEXA 2YN2A 1E9EA 1Z13A 3CZRA 1JJAA 3KSRA 1HURA 3GLHE 2JBHA 2LTAA 3AF1A 5A3SA 4C29A 3SQXA 1YQEA 3DF9A 2P6PA 2YWDA 1XVVA 1P9RA 4P82A 4F6CA 4ZYXA 4OHYA 2J0UA 1THTA 1PUXA 2VAWA 3MWLA 2C9ZA 5D3MB 4UXIA 1VQ1A 4X7BA 3R20A 1T9KA 2EX0A 5G0VA 3K1JA 4G1CA 4O2RA 2PIDA 6GPBA 1Y1LA 1PQYA 2CDRA 3E3AA 3FKSA 1XNHA 4D96A 3GVXA 4G1VA 4HWOA 4R84A 1U8CB 1ONBA 1D1QA 3GRPA 5K0LA 3HXTA 2YL2A 4QAJA 5DJ5A 1M8PA 2FW8A 3TNLA 3WGYA 2PE5A 1Z4PX 3IV9A 4ALLA 2AA3A 4X62B 3PIIA 5K8TA 4L27A 4URWR 1JTFA 5EIWA 2C78A 1W73A 2DOKA 1LNZA 3GNQA 2YHAA 1SU6A 5DHAA 1FJHA 3GLUA 3PJRA 1VJDA 4U9IS 3ZHXA 2AG1A 2DLNA 2QAIA 3WS7A 2A6PA 2NU6B 1X9IA 2BCJQ 2F1OA 3HDJA 4M9UA 3F0TA 3UTDA 2X5KO 5AI9A 3FD8A 2OQIA 2DHRA 2OEPA 3U1VA 4EMUA 4KMOA 3W90A 3ZEIA 3RAFC 2R5FA 3N59A 1DU4A 1ZP6A 2IEZA 3CA8A 4UARA 2EFGA 4KGXA 3ELUA 4V0OA 5KVQA 1KI1A 1HV8A 3EQ2A 3HWSA 3O0DA 4PAOA 1CTQA 2VJNA 4HWRA 5HS6A 2I2CA 2CUKA 4RTJA 3NHSA 2FTKE 5B1DA 3TW4A 4F84A 3DT8A 4UHJA 1U98A 4FVTA 2OENG 5EUMA 4XX1A 2F4VB 4AU1A 1KOFA 1TF7A 1XN1A 2H2AA 1YD7A 3OZTA 3PNOA 4UEKA 3V1YA 5BMVA 1XCGB 2C7OA 3P2YA 2XYHA 3VR5A 1YS4A 1M0WA 1ZM9A 4O4LA 4TKZA 2WM9B 3W77A 3UAWA 4M2LA 2QM3A 3FJ1A 3AUUA 3RG8A 4AURA 2NT3A 4HFJA 4NZNA 5AJTA 5DULA 4EVQA 4WCDA 1MFZA 4GM1A 4QASA 1REQA 4Y2UA 2F3RA 3Q11A 2F9LA 4MYSA 4YRIA 3ZDEA 3O3NB 3FHLA 2BHTA 3EDOA 3GLTA 1JJVA 3AKDA 3S8YA 5B36A 1BEUB 2IZZA 2KLHA 4ZWNA 2Y9PB 3AL3A 5JJLA 5IRCD 1UPXA 1KYIA 4R3NA 4P7BA 5DV9A 3OC6A 2C31A 2Q6VA 2XVZA 5DNCA 2ILVA 4RAOA 1VKNA 5DMXA 4HD8A 5HZKA 2OORA 4FZRA 2JDIA 2VDWB 1ZEJA 1K86A 3W1WA 3NCHA 5HFAA 4S1NA 2ZS8A 4GG1A 3Q8KA 4WZ6A 5JD3A 1O9GA 2CHVA 4J0DA 3HU2A 4GO1A 3RYHA 5BSHA 3WZMA 1WEHA 1OWOA 1YI1A 3WOVA 1WE2A 3KLBA 1NTRA 4LOIA 4YV2A 4AJLA 1JDTA 4NS4A 1QQBA 4CLRB 1PL0A 4HC4A 5A4IS 3ABIA 3D6TB 4O2AA 2RBKA 4RYLA 1RFGE 2OGSA 3RS7A 1D7OA 2E7ZA 2V55B 3RK4A 3RSOA 2PSEA 1ZGGA 3BRCA 1C8LA 4PLWA 2PM8A 5KPJA 4ZVSA 1W49A 4W7HA 4DTCA 1YBHA 4MRVA 5HHTA 1KAGA 1YCHA 1XNJA 4MR8A 3JALA 2HR1A 2HA0A 4L95C 2FZ4A 1NZDA 2A4MA 4K1XA 3ZCPA 3A1NA 4LF8B 1U2RA 2W6IA 4NESA 1LK7A 3FUUA 1NW7A 2WVHA 3HWWA 4R3UC 2A58A 2C2ZA 3A9RA 2JNWA 3F4KA 4RAQA 4TV9F 3KWFA 4ND1A 4BU1A 4KQGA 3G7NA 2VKQA 2X22A 4OQNA 4E4TA 4RVFA 2PO7A 5CMLA 4ALIA 1TW2A 3SQLA 3O2QB 3TGLA 4CKXA 3DEHA 3WQRA 1WDMA 3W6PA 4EATA 2VXYA 4YEDA 2PX5A 3D3KA 2NX2A 3AF2A 2QLBA 2M1ZA 3RYIB 1G3QA 4G36A 4XJTA 4F2WA 5BUCA 3HY6A 2G5CA 4IYJA 3TFWA 1HNXB 1RW4A 4HNHA 1YL7A 2O0MA 3OD1A 1RYMA 4YAUA 2J6CA 4PANA 2CYAA 5EJIA 1EUDB 1S9DA 2NT4A 5EKSA 3AVXA 3DS8A 3GAZA 2P2GA 1ZGZA 2H8KA 1M2GA 1Z29A 5BT9A 3CF2A 3W5HA 5JNRA 2W2TA 3AWIA 5JAPA 2FZEA 1JDZA 1I5OA 2RGXA 1KJ8A 1OLOA 2IXFA 2ZUBA 5J59A 4BN5A 3CUKA 3M6UA 4WCVA 4HLQB 3VOSA 2D4HA 3TLGA 4R1LA 5KVVA 2Q2OA 4EMSA 3N1UA 4IHJA 1YZ3A 1C9EA 4DIBA 1W76A 3I42A 4IKPA 2FK7A 2PJRA 5A1TA 2GCIA 1DAHA 3KQHA 4DQLA 3F9CA 3GFQA 4DCJA 2B8NA 4G5HA 4OXNA 1OZAA 2XW6A 3HCEA 1M6WA 1BTOA 3QBTA 2WM8A 2ZQYA 4DCMA 3IELA 1U8UA 1FA9A 3I52A 2QTMA 3LCUA 1UDAA 2XOEA 3PDUA 4Q9NA 4K26A 4XCVA 3VSDA 1UBCA 4B35A 1EQUA 2XBUA 2AX4A 3LCJA 1ZR2A 2GCNA 2IQ5A 3R5JA 1K3TA 3CMMA 3VVBA 4O8CA 4WUTA 1Z6AA 1F60A 2SCUB 1KTVA 4GXNA 5ADHA 2J5QA 1YH3A 4YV7A 2XSZD 3E9QA 3UOWA 4RANA 4OQYA 4BWFB 2X23A 5C3MA 1A9XB 1H6AA 2YJZA 4ED9A 5KTKA 4LJ8A 1B3RA 4JSYA 1NLFA 2OE2A 3MCUA 4H7IA 4KWTA 4LFCB 3DTVA 1RQRA 3C0KA 3TI9A 3F96A 1S1MA 1O9BA 1CS0A 3ROQA 1ZVMA 1D1PA 1MB4A 2W22A 2AOUB 3HV2A 4G4SP 4I50A 4MWGA 3D6UA 2BFOA 4Q9AA 4XWTA 2OQVA 4F7DA 4HQKA 1R0XA 3JPYA 2W8BA 2HDWA 2ZK7A 1BOOA 5FKJA 1G7SA 1MNAA 5ALXA 4B4WA 1IBCA 2AN9A 3CXRA 5F7JA 4F1WA 2HMTA 1AHIA 3L8YA 2IYUA 1O0BA 4XXHA 5K0SA 1YB5A 4OB6A 3BTOA 4X6UA 3NYWA 4OHWA 3CSUA 4Q4JA 3TAXA 1M67A 2PGXA 2RHBA 1CUEA 3C3BA 3GD7A 3NORA 2V7BA 4M76B 3VKUA 1ST3A 4Q93A 4NJMB 2XNDD 2QAGB 4RIEA 1RRCA 3K94A 4ZAYA 4KXMA 5SYNA 1KAMA 5BOSA 1VIAA 1VSBA 5TV2A 4ND7A 2XYQA 4ITRC 1TJPB 1CUFA 3DSRA 3OPYB 1QK5A 4R8LA 1NBHA 1X42A 2CNDA 4WE3A 4X64B 5GOZA 3G6KA 4HYEA 1J0BA 3WSWA 5CLJA 5KVCA 1I4EB 1QHFA 1OJLA 5FQOA 2BFFB 2WM2A 2Q4EA 2J07A 2WHPA 1T4DA 3P32A 4QWMA 6CHYA 4NXNB 1WSAA 5JBIA 4Y6RA 5CA0B 2F17A 3PC2A 5FPTA 2FN9A 1FNSA 5JSZB 4IOKA 4AP5A 1ABBA 2JD2A 4F9EA 3PXBA 1QIJA 1L1EA 4FKZA 3B51X 2FLKA 2GAIA 1IQ0A 2Q5CA 1U9IC 2BL4A 4FYIA 4JOCA 4N49A 3CRZA 2GDZA 2F48A 3NT2A 3R4VA 2E55A 5COBA 3ZHBA 4FW9A 1I9GA 1GVNB 1MV8A 2DECA 3OHMA 5H80A 3VZCA 1FFDA 4TT8A 1MN6A 1AMOA 4FFVA 3JZAA 1MJ5A 5H0IA 4EPYA 3KAJA 4LZLA 2UUCB 1PJ3A 2GILA 3EJWA 3EN0A 4WESA 3TG8A 2ODPA 1YACA 2D2VA 3BMCA 1GUDA 1EUYA 3IAFA 5FI3A 2JLQA 1CRWG 4UFPA 4ATNA 1Y6GA 3DOHA 4K28A 4MVJE 1Z6ZA 2OXFA 4P86A 3KDPA 1XVTA 2H1CA 3MRTA 3H6GA 3MM4A 4MR7A 4Q00A 3LS2A 3MA0A 4J9UE 4QUHA 5CNJA 5C32A 1KR2A 4XASA 2J3JA 4M1OA 1CEYA 4AJ1A 3I5MA 2B4KA 4C0QC 1P8JA 3NC4A 2G67A 4A8JC 3ACCA 1J8FA 1JLLB 4OQ4A 5A0FA 3GOQA 2ZB4A 5HJ2A 3U4HA 3SQWA 4N76A 2PZMA 4JC0A 3DTVB 4CG2A 2GFQA 1CQZA 2QN1A 5HDBB 3ZHRA 3U7EB 3L8CA 5IUJC 2PJDA 3AI7A 1NF8A 2FPSA 1BWRA 4RD3A 4JI3B 2W8BB 1JKJA 1S89A 3PKJA 4HP8A 5YASA 5IJ9B 2XXAB 3BRWA 1U0RA 2JVKA 3KZ1E 1UXIA 2RHGB 3PYLA 2HKIA 3ORFA 5I48A 1FC0A 3F5QA 2ZJZA 4I4TF 4Q4JB 4RV9A 3C7AA 5E1MA 1GM5A 1JQ5A 1EWRA 2W6PA 3KOYA 2C3PA 2GDJA 1JFVA 3V7YA 1VLHA 1DI0A 2AF3C 3DMTC 4LBVA 2BOVA 2HA2A 4PAQA 4QZVA 1YRAA 1VKHA 2HU5A 2XR1A 2BGTA 3NV7A 3TSYA 4A92A 4OLBA 3R7AA 5JI3E 3FE2A 4P4NA 2VTKA 2RGYA 2Y2VA 4J1NA 1AQJA 2Q2VA 1HY3A 3OZRA 1C81A 1FSSA 1DEXA 1UKBA 2GJAA 3L4EA 4FX5A 4I5FA 4J0CA 4MV6A 1N1MA 4R8KA 4WCFB 3A2KA 5K8UA 4DQKA 4D5GA 5FUMA 5AKXA 3H2HA 1X94A 4OIMA 1X0XA 3RBZA 1NRJB 4RFSA 3SSMA 2GN1A 3VKGA 4W5QA 1E6CA 3LUFA 3SJZA 4B48A 1JHMA 1CETA 4OUDA 1M5RA 3ASVA 7REQB 3ELDA 1I3CA 1UKAA 2PD4A 3RT7A 3MS7A 5ERXA 1VCMA 1GNTA 2JCBA 2PMWB 4KR7A 1QB7A 5AW7A 4HCJA 3UMFA 3E7WA 1TL7C 5F1YA 4OF4A 5DX8A 2Q50A 4BV8A 1WZ2A 1M6VB 5BV0A 3M4YA 4Z6KA 2I8CA 3BULA 3OI7A 5KX5B 3T5MA 3QVKA 1U94A 5LDGA 2R6R1 3ME5A 4R9UC 3UJAA 4AN4A 1P2DA 3T1HB 3EPHA 1FMFA 3A28A 2QZZA 1J33A 1ZK2A 1E3WB 5EZ6B 3MMNA 3NTUA 1WL8A 2PUHA 1T25A 5EP3A 4P7FA 4ZJPA 3EVBA 4B3MB 3OFKA 4K5QA 2UU9B 3PCXA 4ZJYA 3SF0A 1M2HA 3C7KA 4AKEA 2VDMB 1RLMA 4JBLA 3A3OA 2EQAA 1I2DA 2VTBA 5CT5A 1SXQA 4LAFA 1VYVA 1T0UA 1Y33E 1U5CA 3C3JA 4Z86A 3P9RA 3WHLA 4R6XA 4QDZA 2A9KA 1QFSA 3I28A 1DXOA 4TWRA 4XR9A 2ZZKA 4HXGA 5G3YA 1GGHA 3RRMA 4DLVA 4ND6A 3WYAA 4DC9A 1Z2CA 1C7JA 1O77A 3PC3A 1W4RA 4NE9A 3IBGA 4MUHA 1XFAA 4RHXA 2WY2D 4WN3A 3F7TA 3T12A 5THXA 1A9SA 3GRVA 3D31A 5MHTA 1IQRA 2QI9C 3DCJA 1T5OA 5EJ8A 2EG9A 1U0FA 4FFRA 4WX2B 1T5BA 2EFEB 2EGUA 2FZVA 4A82A 4CG0A 3AM1A 5J9FA 1FOEB 2I3BA 1P7VA 4CIYA 3NPMA 4PXYA 3V8RA 4PAWA 3RSFA 1EYZA 4QJIA 5SY9A 1MB0A 1A77A 1YFKA 3QFTA 3KR1A 3GNTA 3QMPA 4LHYA 4MUMA 2IIVA 4A16A 1RTKA 3N6RA 1DXYA 3BS4A 3K5HA 5F5NA 3ZNNA 3QU7A 1R16A 5DRTA 5TQ2B 3U61B 2G0TA 1ADFA 5DHPA 2Y05A 3RSLA 4HVCA 2ATCA 1SUEA 3FR7A 4FMDF 1PLKA 5KTTA 3OE7A 1ORTA 1U7HA 3CUYA 4PZAA 2VDKB 4HI0E 2FFAA 1KA9H 3OJFA 3FYDA 2GPNA 3DZBA 2WUGA 1D6NA 2FDCA 3DG9A 4PFJA 4Y1RA 4FIDA 2QL6A 1TZ2A 2ZRPA 5HG0A 1LNSA 3ADOA 1Z5OA 4BXOB 5I3CA 1G8FA 5DK6A 1T4MA 2UZ1A 2ZJ2A 5EHNA 3JQ9C 1H1LA 4ZMRA 3KUCA 1A8IA 1K4KA 4Z4GA 1P4RA 1ISRA 1TVEA 2Y0CA 2Y92A 3OQ6A 1EBBA 2Z08A 4ARZB 3RRFA 3K7EA 2FZ5A 2I7XA 2QTHA 3SGLA 3BMOB 1N0HA 2R97A 2PQMA 1R0BA 3LIPA 3N8NA 3TL2A 5I7FA 4ZIRA 4D2IA 5KYXA 3QKUA 1PTKA 4N41A 1N92A 4E2XA 2VP5A 1JECA 2ZSUA 1RHKA 1KHHA 3LM8A 1V48A 4H3KB 4LDRA 1GILA 2IUSA 3IA7A 5EIOA 5B64A 1ZOOA 3B6JA 5KYKA 2QM7A 3D6JA 4OI2A 3E0XA 4G56A 2UVQA 2JIRA 4LYDA 1KDOA 2G76A 2CLCX 4CFYA 2GXUA 5F76A 1HYQA 3SF8A 5K01A 4IMRA 2FPXA 1UF9A 5IT4A 3IHLA 1IHUA 2PUWA 2VA8A 3ZZTA 1C0IA 4CCYB 5DCUA 1TNDA 3EOAI 1WR8A 2C3OA 3JQRA 2O8FA 1NVDA 3NDJA 2IXBA 3I01A 3R7SA 4D3DA 4RPJA 4M36A 5EGSA 3L40A 1EDOA 1G8GA 4M21A 5I9SA 1U6JA 2K2QB 2PU5A 3DMYA 5KNDA 1R7RA 2FX2A 3ED1A 3IPAA 3N7AA 3NAMA 3Q4GA 4Y9DA 3S68A 4KR9A 2V54A 2FWBA 1B0PA 3CNEA 4S04A 5EJGA 4PTZA 4ETIA 3H3JA 4LX8A 4JWKA 4DA9A 4YRQA 2G5PA 4M9ZA 4KGZA 3EZGA 1XCPA 1RTTA 1Y5RA 2XIQA 3L6RA 4QOHA 3W4IA 4DCGA 4POOA 1CT9A 2Z6AA 4QO8A 5J63A 3RQSA 4MYTA 1JHAA 1LSOA 3AERB 3PXDA 3CX7A 4B34A 4OOFA 1R0YA 1ZGAA 2G25A 3EGXB 1RCFA 4YP6A 2PBZA 1XWIA 2OO7A 3LT2A 1O6FA 5IHPA 1FYVA 2Z09A 3E03A 3MWGA 4MQFA 4F9GA 4CM8A 2JBWA 1Y3DE 1A5TA 2JL1A 4BY9E 1KYVA 2DCUA 5IS2A 2GZ1A 1J00A 3RFUA 1NNI1 3GH3A 3LFUA 3S4YA 4UHBA 2ZQZA 2ZSEA 5JAUA 5JJKA 9LDBA 5EZQA 4EF5A 1T36B 3C3DA 4F8JA 4IY1A 2JZOA 2ZTUA 4I36A 1S8AA 4FSHA 3RJ9A 1ODCA 3VPHA 3NVKI 5JNTA 2JHAA 4ZVTA 3NHZA 4EGFA 1H0KA 3B6MA 3ZYZA 3MWYW 1ULTA 1GIAA 1JMVA 1UM9A 4XB6B 3TM5A 5GINE 3ZGNA 1RCUA 2ZTMA 3U3DA 1GTRA 8MHTA 3QXJA 1W4LA 1U28C 1KQOA 4TT3D 5J2UF 5BOVA 2HZBA 4FFBB 1EFLA 1PD0A 1VGVA 3OIYA 1QO7A 3TKAA 1WXEA 4OQLA 5C8XA 1S96A 1USWA 1IOVA 4G3XA 3WBJA 3NIBA 4HEA6 3G02A 2O19A 3LRXA 1U1EA 1S2DA 1T9CA 3TUJC 4OIFA 1HTTA 2ACEA 3VR2A 4FYPA 4N0DA 2CT8A 3LPDA 1AGYA 2P3SA 2WTEA 4FFDA 1L3CA 2G70A 2WPDD 4GKAA 1VSVA 4MGHA 1QFMA 5LQRA 5AXAA 3AEZA 3VSBA 4X92A 4FYWA 4CLOB 1NU6A 1TC1A 3ZWPA 1U7PA 2QN8A 3FHOA 1MAUA 3GRYA 4GPIB 3H5AA 4HQ6A 4ABYA 3FPLA 1GUAA 4DRXB 5DI9A 3WGGA 3ZXXA 4NY1A 2YHBA 4M89A 3RNLA 4ESHA 2CJYA 2Y93A 5EE3A 3WQHA 5L3SA 3FLEA 1VG8A 1R0RE 3G17A 5C7OO 2WU8A 3PC4A 4WBXC 3RS4A 3QJ5A 4KLAA 1V1RB 4JIGA 4G8JA 2FZWA 2HHCA 1B6TA 1YMUA 4G85A 1LGYA 3SFTA 3IDSA 3QMVA 2AG8A 3I6ZA 2WQZA 3UMRA 4F2HA 3GN2A 3G13A 4KEAA 1T0BA 4RPHA 1NA5A 4C04A 4J3NA 1WOYA 4BC1A 2FB9A 3BJMA 1V8PA 5B4VA 5LU9A 3CRNA 2GHQA 4JLKA 2A88A 1XG5A 2BGWA 1OXSC 3LGAA 3REQB 4N9WA 2WAMA 4IWYA 1PZEA 4Y98A 5T67A 1TTTA 2D1QA 1L8OA 1ZG3A 3JV7A 2OHGA 4G4IA 4J90A 3V6LA 1SVUA 3ZGYA 1C50A 4HDOB 1JH9A 1DKMA 3BT7A 1PVOA 1MAVA 4L02A 4L4XA 5DHUA 3ICEA 3IEPA 4HH3C 4DXDA 1P0IA 1L5OA 2D5BA 3HCBA 1C9NA 4L2IB 1A9OA 2DSTA 1LFDB 4WOCA 3RYCA 3TDNA 4B09A 3RC1A 5D6NA 3T3OA 3KYIB 3U4IA 4RVSA 2WJGA 3WAGA 1B16A 3VR6A 4JC5A 1JZTA 4LV5B 1EXMA 4EPVA 3Q8MA 3ASZA 9ABPA 1A95A 3HUUA 1SVWA 2XUIA 4DVJA 1JKMA 2D62A 4ZD6A 4CIXA 1DEHA 1IZYA 3KV3O 5J5CA 2C9YA 3D4OA 1EFPA 2D1SA 2W6OA 5BN4B 1NY5A 1RI1A 3PUXA 1N9GA 3EY4A 3KOWA 5CIWA 4MWOA 3WWPA 4EO4A 4BVHA 3TSCA 2H1OA 3G5AA 3W5IA 1L4YA 3L2OB 4Q9DA 5I7OA 4TXNA 3VR5D 2CFSA 3PPWA 5H4HA 1ZITA 1Q1AA 1YZLA 3RFXA 2GM4A 4B3SB 2R2AA 1DAGA 2XTJA 4Q4LA 3BUSA 4CM6A 1EUQA 1LTKA 1RQGA 1WXHA 4DY4A 1R0CA 2WABA 2H5IA 2HF8A 2ZXFA 5JAIA 1PX2A 2OV8A 2ZWVA 4MVJA 2HDOA 4A2WA 3M9WA 1FBNA 1NR1A 1G6KA 4FHCA 1PN3A 1C3EA 1CEQA 4R0VA 3JQ7A 4JVOA 1LLDA 4YJ3A 2FPGB 3WRVA 2XDYA 3M9LA 5JXJA 1CEEA 4HOYA 4WZBA 3MEQA 1AUXA 1WCXA 3NTQA 4GBGA 4YT8A 3ZXIA 1G60A 5LP6A 1GU7A 5JNLA 3NBZC 3ONVA 1X7YA 1QX4A 1QGAA 1NM5C 2GPSA 2F8LA 3Q3HA 4KWIA 3RVMA 4EO7A 2B82A 4UBOA 4KPUB 1DC6A 2PLAA 1F0YA 4BE4A 4FLMA 3OFSA 3WB1A 3WTCA 3WYEA 4R05A 2H9IA 3F1LA 2YHSA 1ADYA 3ZXYA 2A84A 2JRLA 3HN6A 3UT5A 4G41A 2QXTA 4CMCA 3BH7A 5FT9A 5JARA 1E1DA 4K6FA 3HGTA 4KFRA 5AVJA 4QM7A 2KHZA 3VZSA 1EH5A 2W7TA 5JI2E 3UJCA 3RHZA 3ZY6A 4KKVA 2WG2A 3H7AA 1DUIA 3M9XA 1GZSA 4YAJA 5TQ0A 4LDAA 2NXCA 1IZ7A 1T5TA 2VSYA 1SA0B 3CFYA 5BW4A 3ABRB 3GLIE 3S2YA 3V9PA 4O3MA 1AKQA 4R98A 4RXUA 3OJXA 2XMGA 4KG7A 3GMTA 4LNUA 1CDEA 1JIKA 1VLQA 2B2CA 1KRWA 4RS4A 1E3QA 4MAFA 1TXGA 3PD7A 3R3VA 1FDSA 4TL8A 1GSOA 4HX2A 3LY5A 1NQAO 3BD9A 1V35A 3B6KA 1UPFA 3IP1A 4OM7A 1YK0A 1R2QA 4OD0A 3ORRA 5T4BA 3WGLA 5A5FA 5JH7F 3SJCA 1X1CA 5DRYA 3B1ZA 3FTEA 4JJEA 2HXSA 4DQUA 2X58A 3AF3A 3DL4A 1F5NA 1G38A 4IIYA 2G5GX 2Y1EA 2E5WA 3LQ1A 3SWWA 2V3VA 3D1VA 1N3BA 3JASB 1QTIA 1LJ8A 1SQ5A 1UBGA 3MPOA 2F55A 3VHRA 1LUAA 3I72A 1SUDA 3DO8A 1HA3A 3ETCA 2ORWA 1X19A 5G41A 5JCZA 1Y9JA 5KNBD 3QELA 2AMYA 4Q48A 4GGMX 2VAPA 3TIIA 4AMGA 1YDMA 2G88A 2I29A 3GVHA 3PVSA 4OAQA 3B8HA 4IV8A 3EQ8A 3CZ4A 4PLPA 4X71A 3ZI4A 2HJGA 1T2NA 3U26A 1X1EA 2IUTA 4ZO7A 4CHGA 4WOPA 4KTVE 2WJPA 3NKFA 5E3IA 4IR7A 2A5FA 3BFKA 1E7YA 1ZINA 4A6PA 1SEPA 1P1IA 3BMXA 1YQTA 1QO0A 4MR7B 4LYEA 4MWZA 4WHMA 4LVUA 3U37A 3VYVA 4A8PA 4I5DA 3K2EA 2OMKA 4KQ2A 1EEHA 1DFHA 1JEEA 1UOOA 1Z4NA 1ZMTA 1WOMA 2W48A 1F1BA 1Z7YA 2Y99A 3ODGA 4QJBA 1D1SA 3X1DA 2R86A 5KREA 2AKEA 1OI4A 2MSWA 3EQZA 1ID1A 4FE3A 2R6JA 2ZW9A 4KZKA 5JSZA 1GXSA 3OLYA 5EMHA 3R7DA 4AY4A 3LGXA 2CUZA 3LXMA 3DNFA 2HV8A 1NJSA 2NO7A 4UHKA 3USES 1QDEA 4ARIA 5CT6A 3M82A 3SC2B 4KIJA 4BP8A 2Z2ZA 1P44A 1TX4B 5F64A 3ID6C 4TTSA 5AOVA 2XXBA 5IHXA 2VYVA 3AOGA 3TRFA 1AC5A 1IZ0A 1E92A 4OYHA 2B2NA 3WHKA 1KMCA 1ZJWA 2C1XA 2WWWA 3OLZA 4G9EA 4ZCMA 3HGMA 2R8XA 4XD7A 5KYTA 1JNXX 1N8TA 2CHFA 1K92A 1EUZA 5JJCA 4ZTUB 5K6AA 1MMFB 2WD8A 1FNBA 2X5NA 4LC9A 3GRCA 3O4JA 3UMSA 3GIDA 3RPEA 2BM8A 4BQOA 5EKDA 3ITKA 5CD9A 1JLLA 2JJMA 3BB4A 3AR6A 3GFOA 4PO1A 1F3OA 1Z7BA 4PTLA 2C20A 1AUOA 2BH9A 2NADA 3U3JA 2B3TA 1VRCA 3AWDA 3G1TA 1YRHA 2AK2A 5H70A 5CA0F 1N0UA 1GNPA 3VKHA 3LK6A 2IZOA 1MO3A 4BPBA 2RHHA 2A0KA 1MGOA 3CISA 4R2LA 1DAIA 1MKYA 2J9ZB 2C83A 4QQNA 5BNFA 1S4MA 2WILA 1L8XA 4PPGA 4P4SA 3K0KA 4DLUA 2IH4A 2CGEA 1KU6A 3IVRA 4HZIA 4C7KA 4OGGA 1Y7HA 1WB4A 5I7UA 2F9MA 4L22A 1H0RA 2IZ1A 4HGQA 4I9GA 4RGYA 5CLLA 3CLUD 3FR8A 8LDHA 3BQMB 4N18A 2AI2A 1YZUA 2WDPA 1U0SY 1GU0A 4HATA 1BHQ1 4K3VA 4B8YA 4E51A 4CEIA 2F4NA 1MO2A 1SK9A 3VPFA 3VR4A 1Y3CE 1LRJA 1KF0A 2TMDA 3D4IA 5HCNA 3MJTA 2WLSA 1OC4A 1Z73A 2PQ6A 1GAEO 2B92A 3NKLA 3U9SA 2JCXA 4WACA 3U3OA 1YI0A 1B43A 3EXFB 2IHJA 4BO2A 1EWKA 1G5IA 1T6XA 2GBLC 1N2XA 2PGLA 3DV9A 1M2NA 3DDCA 4GX0A 3H2SA 3HRKA 4WLNA 3UV3A 4A8TA 1N4DA 3GDFA 1JWBB 3FOEC 5H8WA 1YUMA 1Z17A 2WG0A 3KC2A 5BYBA 1XP5A 1B74A 2H1HA 3DJYA 3U7IA 4JUBA 2H7VA 3O8DA 5BSFA 3H83A 2RSLA 4MWBA 1ODIA 1R4AA 3AI3A 2Y0BA 4GHWA 4I4LA 3ZKAA 3HO1A 3FOBA 1ZVQA 2QX4A 1RE1A 1TMYA 2XOKD 1YA8A 1XIVA 2I6XA 3WRXA 5IDQA 4A73A 4AG5A 3KD3A 3CUTA 1J7JA 1TADA 2HH9A 3RUAA 2F3SA 3BCSA 4RJIA 2FLVA 2OG1A 3RWOA 4N54A 3U4QB 4Z7JA 1CNMA 4KFUA 4FBLA 2O1EA 2V0CA 2ZYDA 1W0KD 5LZ4A 4UC0A 1QLJA 2RK6A 3EF1A 4DR5B 2PFKA 5CVVA 4BX3A 1U7ZA 4NOKA 1NI3A 3UJ9A 1H05A 1I1OA 1Z4MA 2E4UA 4GMXA 1F6BA 1JLHA 1SUPA 1TB4A 4OGFA 3FNBA 3SS9X 2CLEB 3FVTA 4HWGA 3WKAA 4CTNA 5AI4A 5JPDA 2G09A 3RFTA 1ZJ6A 3NEJA 2C9MA 4UBJA 4BJ1A 2J0UB 3NHKA 4R2XA 3BFXA 2VJLA 3WGKA 5C4IA 1R12A 3PXUA 2VS1A 2P1DA 4BLRA 4OQQA 5J2TA 2FH5B 1ULUA 2JKVA 3KQPA 4N7RA 2NMVA 1EMDA 4KOAA 4BNKA 3A32A 1RWXA 2JGNA 2CVFA 3VH1A 4HRYA 4L9SA 2FF7A 1VCHA 2PQ0A 2WPNA 3MNFA 3MJFA 4ZEWA 1OBFO 5B2FA 2GASA 1PJQA 3A37A 3GJ3A 2FOLA 1ZK0A 5FI5A 1JDPA 1TTPB 3A0RB 2JRCA 4ADSG 2EGHA 5DNDA 1ZUWA 1X14A 1XAIA 3QE4A 1GGFA 5KHOC 4LN1A 3FYTA 1ZM3A 4P7KA 4EELA 1A8HA 4F2PA 1VP3A 3HA3A 3IUSA 2GGSA 5F4ZA 1QORA 4ER3A 1I01A 2QD3A 4Z0NA 3F46A 2QD4A 4FKMA 3GQVA 4FYMA 5DGTA 3DV2A 5KC8A 1G59A 4HDSA 1U8YA 1PR2A 2QP3A 3N6VA 2VHJA 2X8WA 4L51A 2F1RA 4KRGA 2I66A 4HDCA 4I1SA 3Q3CA 3RSCA 4O1MA 1P5JA 4XDYA 5FPQA 4BLQA 2XMZA 3ZNOA 1J25A 3T0IA 2G6BA 2DBRA 3EDRA 4M6WA 1RKVA 4UVIA 1C8VB 1OBCA 3C6QA 2JGIA 1MQ8B 5D84A 3LQ2A 5B58T 3KPVA 3IKTA 1WMEA 1E9DA 2SECE 2V7UA 2CZQA 3ETJA 3ETLA 3GGSA 1UINA 3HN7A 3HXLA 3MBOA 3VPBA 3DQZA 4AZWA 4H0FA 5C37A 1N7JA 1W0KA 2I1LA 1SCAA 2OPHA 2HSGA 1OJ7A 4R1SA 4RK6A 2M6KA 4O4LF 2J32A 2PVCA 2R7MA 3GU3A 4KJZA 4XE5A 2HA7A 1SB9A 2X7JA 1VBKA 3A7EA 3N2KA 3PE3A 4C6RA 4OYRA 1UAGA 1QM5A 2GNAA 1ORIA 3CLTC 4S24A 2BMWA 4YCSA 5EWLB 1TJNA 3E5MA 2LDBA 4AUEA 3HU5A 2C5AA 3WVNA 3OPMA 3PWZA 3PA8A 5DX0A 1PNOA 3T3GA 1LDMA 3FWNA 4Y6LA 1GNLA 2GN8A 3BGOS 1Y5NA 1QFYA 3EFHA 1QYVA 5LSAA 4EGQA 2XUZA 4HZUB 3M83A 3P9QA 4LJ4A 1U1GA 4JQYA 1T6BY 1SXPA 4UTNA 4CGZA 1M75A 4W5HA 2CMHA 3EEQA 3R6TA 3WP0A 1W9MA 3EODA 4BMYA 1J2YA 1PBNA 2EFDB 3KFVA 4CKEA 3F97A 5INTA 2YS6A 1NJ5A 1CDOA 2IBTA 4CLRA 5GJBA 3WNQA 2OGTA 4YWHA 5FHQA 2L17A 4U0JA 4KPEC 4DR2B 1I32A 1CHDA 3ZPXA 1QG6A 2GMWA 4GNKA 3F9IA 1NBEA 3A9CA 3TLAA 1U99A 2VLIA 5GVRA 4DNPA 1NU8A 2FOXA 4H31A 1H2HA 2WVGA 3FDFA 4TV8A 4REMA 4BMOB 4L3VA 1VDZA 4NPCA 5AYVA 4AF7A 1ZKMA 4ZYZA 1U8FO 1EUCA 1S01A 4JJIA 4S35A 4L57A 1VHJA 3D1JA 3ANYB 1TO1E 3PGXA 1L7EA 5H1YA 4IDBA 3GWZA 4XZ3A 1K7SN 4MQFB 1X8XA 4MB0A 3L1UA 4ZTBA 1R5OA 3KUKA 1CUJA 2PGIA 4DWOA 4GYKA 1SVMA 4TKMA 3CPHA 1IUKA 4PPYA 4OQDA 6ADHA 3OZDA 3ON5A 4BO0A 3E5RA 3S1AB 4U7HA 5KNBA 1W4CA 1ND5A 1K3FA 2J9RA 4GPTA 3TB6A 4ZEXA 4AXBA 3I2KA 4FPXA 4H77A 4RESA 3AEKB 3LUGA 1KAOA 2XUFA 3L82B 2B21A 2PLNA 2VBFA 4R16A 4TL7A 4YJFB 2VRBA 3I58A 2GXAA 4GOXA 3G6WA 2NZ8A 3HBFA 3BB3A 1EJ6A 3LWBA 4WKOA 4X1KB 3NH6A 2IH2A 4B44A 2ZYUX 5TQVA 4C3ZA 2YHIB 3NOQA 4DCOA 1XDZA 2EIHA 2ZI9A 4NVRA 1J39A 1Q92A 1RRKA 2ZJ3A 5B37A 5A7GA 2QTZA 4WD3A 1PYGA 4GOND 1UJ5A 3LBNA 3DO6A 4J7UA 1OIVA 3WA6A 1U5BB 3K0FB 1XVUA