2IYQA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate and adp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 61
structure length 166
sequence length 166
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyqA00
1XEWX 1P7CA 2AHOA 2OCPA 4L16A 5SZJA 3LQQA 1W2HA 1J7KA 1G9XA 4Q9LA 5FBWB 3TRFA 3O8BA 1GVNB 1T6NA 2GEVA 4N1AA 4KCGA 4JYBA 1ZYUA 4FMDB 3SI7A 3P32A 2R6FA 3LY5A 2CLCX 2EVWX 2QI9C 3IDQA 3IIKA 3R7WA 3W6OA 4B71A 2CDNA 1SVSA 2FEOA 1NL3A 1YR6A 3AF3A 4PX9A 1YKSA 2F1JA 1KO1A 4IOLA 4MRSA 4Q1AA 2WMOB 1DO0A 2XEXA 1T8UA 3GPLA 4LJ4A 1F60A 2OG2A 2A5FA 4FWIB 2CLDX 1Z8FA 4ZKDA 1AS2A 1N0UA 1DAHA 2W6ID 1J8YF 4L8GA 1GITA 1BYUA 2WJHA 3C7KA 1E94E 1W4BA 5HZHA 4PZZA 1JI0A 3I32A 3UPUA 1ZINA 4Q7LA 1P3JA 4DLXA 3M4YA 1RIFA 1RVDA 4AY2A 1ZD1A 2QAGB 4TZ6A 1SVIA 4JLAA 3R8CA 1H8ED 2YKGA 2OZEA 1SVMA 1XXHE 3ZLJA 5G40A 2A30A 2LCFA 2J59A 5L3QB 3SEAA 3LX5A 1NN5A 3AVOA 2GXUA 2XX3A 3EXAA 4P4TA 2CHGA 1GSIA 2IS4A 2WWHA 4II7A 5FPSA 1UKVY 2QORA 2VSFA 3ZGXA 4DLZA 3T06B 2JJ8A 1JJVA 3VX3A 4I1VA 3T1QA 1GAJA 4CIDA 1OW3B 2OCAA 3E5HA 1DOAA 1ESMA 1NLZA 4O2LA 4Q18A 1ESNA 4QHSA 4OL0A 3BB1A 1NVUQ 3CRMA 221PA 1N25A 1E2FA 4PAQA 3LAWA 4DSOA 4FMBB 5JI3E 1DAIA 2P6NA 2V6JA 4GBMA 3LDAA 4ACAA 1XTKA 2BBWA 3ICQB 4TMTA 1FW6A 3EZ7A 4BFWA 2D7CA 4U00A 3SBDA 1NMXA 1W0KD 4KITB 4JLPA 3AVPA 1VKJA 3KZ1E 4EKDA 2BBTA 1E2LA 3ZS9A 4NDZA 2ZI9A 1TUEA 2VIIA 4N0EA 2ZRHA 3SQWA 621PA 1GL6A 2AR7A 1W36C 2IYQA 2P65A 2IS1A 4M9ZA 2H18A 2J0VA 3BK7A 421PA 1GRRA 4U7DA 1R10A 1ANKA 3QOFA 2H57A 1R0ZA 2IYXA 4CEIA 1T0JB 2AXNA 1E2GA 1VG9B 1XFAA 2PBRA 3FGNA 2IYZA 1S3SA 2EWVA 5P21A 4IKEA 5EP2A 3P27A 2JLQA 2YWEA 3GCGA 4TTRA 5FL3A 4C0BA 4LPKA 3S1AA 2BIFA 2AWOA 1XD8A 4PAMA 5EXPA 2ZRFA 2RB4A 3WYAA 2ZI7A 4AI6A 3A1UA 5IHPA 4DC9A 1II8B 2WWGA 4V0NA 1E2DA 4D4KA 5JS7A 3HU3A 1AM4D 3MWKA 4M8NE 5EUQB 5FBVB 2CVFA 3THWB 3JZAA 5J4VA 4LJ6A 2HLDD 1M7BA 3IO3A 1K5DA 3TR0A 4B75A 1EX7A 1G3MA 4MDFA 3ZIAA 5CYOA 5KSZA 1TQ2A 2ZRKA 2J7PA 4M53A 4PC6A 1L7VC 5DH9A 1HV8A 4NCNA 5DHAA 1ETUA 1OXSC 3PR1A 5EP3A 4G5GA 4KLZA 1II0A 1TPZA 5FPTA 2Q21A 3KKOA 2GKSA 1MABB 3AB3A 2F1IA 1CIPA 2IYRA 2J0UA 2VP9A 3H1TA 3AVVA 1ZU4A 3REGA 5BYJA 2FFQA 2CNWA 2BMEA 2PLRA 4YMSA 2QPOA 1XXHA 3KFXA 4CRWB 1DAKA 2CL7X 2FPLA 5EZ5A 4ASUD 4B3XA 3CM0A 1KY3A 1GFIA 1UPTA 3GLFB 4CW7A 4ZI2A 2W2XA 2I3BA 3LXXA 1Q22A 2ECKA 1E9FA 3MD0A 1QZXA 3CX7A 3CZQA 2ZRJA 4EFMA 1GNPA 5L3RA 5TVKA 2Z4SA 3QE0A 4KSCA 2IUTA 3VFDA 5BWMA 2O8CB 2IUSA 3Q72A 1GWNA 4DDVA 4GDFA 3WP0A 1HE8B 3ZH9B 821PA 4NL4H 3U3MA 4RD4A 4CEJB 2C03A 2O8FA 2IEYA 5CITA 5AJZA 3SFVA 5FI1B 3V9PA 2C8VA 1WCV1 2XSZD 2QMEA 3FMPB 4IVQA 3PUWA 1IXSB 2IW3A 4NKRA 3GJ0A 2V55B 1A5TA 1E2QA 4BEBA 4HLDA 1EWQA 3SYLA 2G77B 2C9OA 3OEHA 3P1JA 2OAP1 2GHIA 1J99A 3PEUA 4QBFA 3X2SA 4NYIQ 3RAPR 4A36A 4GZLA 1ZCAA 4B35A 1V5WA 4R9UC 2QSZA 4GMDA 3T34A 3UATA 3HPQA 4KSBA 4EPYA 4YMUA 1YHNA 5DI3B 1G8PA 4XWOA 2JLYA 1W5TA 2QBYA 1VYVA 2G1JA 3IPXA 2V54A 5F3WB 4F38A 4ZCMA 1OIVA 3K09C 4TT3A 2DBYA 2IBMA 3TUIC 3L43A 1QVRA 3U3JA 4DIEA 3ADBA 3V4RA 2QP9X 5G53C 2WOJA 4A2QA 1RW4A 3GLGB 2W6JD 4ZIRB 3U6BA 1TQ6A 4B32A 3RRZA 5JHHB 2XXAB 3E2IA 1E99A 1TMKA 2J41A 1FOEB 2AXPA 3VKHA 3NHAA 4ESVA 5EJEA 1JPJA 1BO6A 3RC8A 5F9HA 1VCNA 2XAUA 4YMVA 1FNNA 2WJJA 4EQ6B 2VL7A 1E79A 2FV8A 2OLJA 3B2EA 3EA0A 3DDCA 4V0OA 2GK6A 3ASYA 1P75A 4HAZA 5HKKA 1TU4A 4H9GA 2ZI6A 2ANCA 1QHGA 3GQBA 5E7IA 4A92A 1FZQA 1S1CA 1C1YA 3U7EB 3LWNA 4V0LA 5D3QA 4XH9B 3K0CC 1MT0A 2F1RA 2IK8A 3FTQA 4L15A 2ZSAA 2BOVA 4LBYA 5KNDA 1CR2A 1T0HB 2ZSFA 4DWJA 3AEZA 3RS5A 4TYPA 1Z5ZA 2Z6VA 1KI3A 4KBGA 4WZAE 4FCTA 1VIYA 2JIZA 1CJKC 1F3OA 5DNYB 1E9RA 4A0GA 4NYIR 2B92A 2ZS8A 1KI1A 3NDPA 4C30A 1TF2A 2X77A 5HCIA 2NG1A 2R62A 2WWIA 2YWGA 2QPTA 2ERXA 1XP8A 2GCNA 5BN3A 1NSFA 5FPYA 3TSOA 4ZDWA 1D9ZA 1Z29A 2V1XA 5DE3A 2W00A 1M7HA 5GADl 3WY9A 1I4LD 2ZJBA 2ONJA 1DADA 2BHRA 2L0XA 5LB2A 4XWKA 2VSXA 5L3SA 3A36A 2ZITA 1M1YE 3QG5A 4HZIA 4KAXA 1LTQA 1N6LA 4X8LA 1DE0A 3SZRA 4P32A 4TTPA 4AG5A 3QKUA 1E9BA 2BKEA 4R2IA 3PQCA 2GF9A 5JCPA 1XTRA 2VO1A 1OB5A 1QF9A 1R5NA 1W4AA 5GJBA 1Q21A 1N6HA 4LJ5A 1OLOA 4WAUA 4HDCA 5AJWA 2X2EA 4H1VA 4URZR 2MSCB 4UNRA 1S96A 4JJZA 1CTQA 3OIUA 3THXA 4RZ3A 4D82A 2QG6A 1SXJB 2P67A 3K0SA 2CHVA 2WOOA 3Q9LA 3AGPA 3DMNA 4RKEA 2ZYTX 3V00A 4DCVA 5GVRA 1P2SA 3LH5A 2AK2A 5CK5A 2UKDA 2BWJA 1Z6XA 2OILA 2DWOA 3B9QA 3CNLA 3KXKA 4OI0A 4NCKA 3Q8XB 4PPGA 4U5XA 2MSEB 3QKRB 1OV4A 3U2QA 2PEYA 4EUNA 3K9HA 2VHUA 4XIGS 2IHBA 4A4DA 2V6IA 5ANRB 1IQPA 3VKWA 1OE0A 1TEXA 4X8MA 4IFBA 5FBLB 3B6EA 3K09A 4QKQA 4R2HA 1XD2A 5JECA 2HF9A 5KDOA 2QM8A 3IQXA 3EPLA 3RS0A 1KDTA 1YR8A 3SHWA 1C9KA 3FHTA 3QBVA 2UZ3A 1FTNA 4ZDJA 1XPRA 3DMDA 3QI2A 4B3DA 4D4MA 1AGRA 4Q02A 4URUR 3GJ8A 5AUNB 3CLVA 2ZRMA 5KOYA 1DBSA 2RGDA 5EUMA 1D9XA 3FPAA 1G5PA 4ZO4A 3EPHA 4HB2A 1WMSA 3WNBA 5KYKA 1W48A 5FTMA 1FUUA 3RWOA 4Z1MD 2CEAA 2W6IA 2FFHA 2GCOA 4GFDA 4QJ5A 5EE5B 5IK2A 4B2PA 2V3CC 1RFLA 1A4RA 4ON9A 1VYTA 1WRBA 1OYWA 2JJ1D 2DFKB 3UWOA 1KAOA 4Q4AA 3C5CA 2VH5R 4A9AA 3HR7A 2FPMA 2VF7A 3MWYW 4DUGD 1H8EA 3CPHA 5AJXA 2ATXA 4POAA 1ZUIA 1XEXA 3CX8A 3W6PA 2WHXA 5IF9A 1JQLB 3DKVA 2EFCB 4AD8A 1P9NA 1E32A 3O8RA 3ZD7A 3LW8A 1P6XA 4C2UA 1XJCA 3OAAD 5AUOB 2NZ8A 4KU4A 2IYVA 3DEFA 3K8YA 1ZM7A 4A2WA 1CXZA 4HSEA 3VNVA 1RC8A 2JEOA 4HLUC 1JECA 1CR1A 3RRNA 4B2LA 4MITA 4AYXA 4ZKEA 5KUTA 4RFSA 3KTAA 1ZVQA 3E70C 2VBCA 4OHVA 2REXB 4TMKA 1F2UB 4PAOA 3L8ZA 3BOSA 3EZ2A 1Z2CA 3DZ8A 4B6EA 4C0QC 4E09A 5KDLA 4XOIA 3K0AA 1F6BA 2GRJA 3EZ6A 1KDOA 2OFWA 1KI6A 3ZD6A 5LBIA 5JWHA 1F2TB 4LC0A 1W4CA 1W0KA 3MRSA 4NYMQ 3GLHA 1HURA 1S1MA 1DVRA 2BV3A 2C9YA 2WTUA 4G5RA 1E1QD 3R7WB 2IXGA 4Q00A 4EFNA 4EPVA 3A1SA 1E69A 3BERA 1D2MA 1RRGA 4L4UA 4BFSA 2EW1A 1WE2A 1ZJ6A 3FVQA 4TMWA 2R6GA 4JSTA 4FMDF 4GMXA 1RJ9A 2FF7A 2NPIA 4AKIA 4RZXA 1KK2A 3MGCA 2NIPA 4JYCA 3NBYC 4RCYA 2QN6A 2EFGA 4LHVA 4V02A 1KO5A 3HU2A 4JLNA 3QXCA 4XJXA 2ZS7A 3IHLA 2IC5A 5F9FA 2ZI3A 4LC1A 4P4SA 4A0FA 1P4SA 3CIOA 5SZIA 3CRVA 2IF2A 1QHHA 4KBFA 4TMVA 2FN4A 4LDJA 4D80A 2A78A 3AF2A 1NVXQ 3UANA 3R9XA 3NBXX 2X19A 5TDHA 1R4AA 3W6NA 4LSGA 2XZPA 2ZYWX 4WXRA 2QTFA 1ZP6A 4HEJA 2X8AA 3IQWA 1UF9A 4JT2A 2IWRA 1UKYA 2PMDA 5FPHA 1MV5A 4WOPA 4KV9A 2A3RA 3ZVMA 4XVUA 5GJWC 1YZGA 1KNXA 4KI0A 1E9AA 4YMTA 5G3ZA 5JJLA 3AP1A 1HT1E 1WA5A 2P2LA 3BWDD 4C2TA 1W1WA 3KB2A 3NEYA 4QFMA 1G8FA 2BMDA 3KQHA 1RYHA 4D0GA 4ASUA 1QG2A 3SR0A 4BZPA 4WXPA 4LK2A 5CJPA 3NH9A 3IGFA 3LLMA 2KWIA 4B3FX 5K8TA 1NJFA 2JA1A 1JALA 1Z2AA 3FKQA 2D62A 2OBNA 2GZHA 4FD2A 1VDZA 4B48A 2P5TB 2ZRIA 4NYMR 4LPSA 5GJVC 4JLMA 4QRHA 721PA 3Q7PA 1E2NA 2V9PA 2X2FA 4GP7A 4MKGA 2YC2C 5SZHB 1VCIA 4QC2A 2GK7A 1RKBA 2CJWA 4PZYA 4CEHA 4HDOB 1VG0B 3CUEF 4G5QA 4CZ2A 5EXTA 4BUJA 4AKEA 2VPPA 4Q7JB 5JS8A 2Q6TA 4DHEA 2XSZA 4TL6A 5DYIA 1KI4A 2FWRA 2YV5A 4FN5A 4JLVA 1NG9A 3GEEA 4KO8A 4HI0E 4JLJA 1UBGA 1O3YA 2KB0A 2ZU6A 3I4LA 1PUIA 2GJKA 1XPOA 1NG1A 1OFUX 1E0AA 4MGKR 4Q48A 2OFOA 2XOKD 1L4YA 4JKYA 1LNZA 1E2KA 3BH6A 4LBWA 3VHLB 1OFIA 1QHSA 1IN7A 4EPRA 4G1UC 3C15C 2WM9B 3OE7D 2WIAA 2VTKA 3NBFA 2DR3A 2JGNA 4Q01A 1XU4A 3Q3JB 2WV9A 4MUAA 2A5DA 2GVDC 3ZQJA 2QROA 4W9MC 3UKDA 2PCLA 3K0EA 3TAHA 2YVUA 3DM9B 5CDFA 4QJ4A 1KMHA 2G88A 3AKCA 5KTYA 1FUKA 3CF2A 2WWYA 4MYHA 1KDPA 1F5NA 2FGKA 2W6JA 3EARA 3KB1A 3M0EA 4BFZA 2QAJA 1SVLA 1UEJA 1E4YA 2F9MA 2IXFA 4MGYR 2GAOA 4PHHA 4A8JC 2QT1A 1T91A 1GZSA 2LKDA 3A8TA 4ZV4A 1GKIA 2HXYA 2EFDB 1OFTA 1KTVA 1KIMA 3PEWA 1MR3F 4BLTA 1OF1A 1FQKA 3G0HA 3BIFA 5DISB 4PQRA 1J8MF 1IOZA 4RD6A 1HQCA 1A82A 2JLSA 4JMPA 1GNRA 3RC3A 5L3VA 2QRZA 1ODFA 3CRQA 4ITRC 1TEVA 3PJRA 4FXPA 1GKYA 3OEED 4PHTA 3O8CA 2V1UA 1CRPA 5FPKA 1CF4A 1EFRD 2AX4A 2F55A 2O8EA 4P33A 5CM9C 2A5JA 3KKMA 5E95A 3RSLA 4DXAA 4A6PA 4BEJA 1KO7A 1Q1ZA 4RD0A 4BASA 3U44A 3CR7A 2C96A 4QL3A 3IUYA 1GL7A 1GOTA 1U90A 1X1SA 2QQ0A 4A1FA 1VHLA 1R6BX 2ZJYA 5J4HA 5CM8B 3LBNA 1W5SA 4Q1CA 2IYLD 1QRAA 4DKXA 2V7QD 2FX3A 4HAVA 4HYYA 3X1YA 3TGPA 1TX4B 4OKSA 4QM7A 2QZ4A 1GL9B 3ONWA 5TV2A 4GNKA 4NYJR 4TLBA 2WJYA 1XD9A 4AK9A 5C2JB 1GM5A 2C5LA 3RDPA 2F43B 3ECCA 4RFVA 3FMFA 1FMJA 2EQBA 2YJTD 3KQKA 1Z0JA 2ZI4A 2FEMA 1P2UA 5K8UA 3GJ5A 4MKHA 3LBIA 3AF4A 3NVAA 4JLOA 3F5FA 4Z54A 1MO3A 1KKMA 1QVAA 1Q57A 4G3XA 4IDPA 5IK2D 4LHWA 1HQYE 4BLOA 2IEZA 5TXGA 4ARZA 5CLQA 3KXIA 2CCGA 4MDEA 4G01B 2W58A 3LVRE 1UKEA 4Q4JA 3QVVA 2R8RA 4O25A 1L2TA 3BC1A 3CW2A 1HE1C 2RGGA 1QHXA 4DDWA 3B9PA 4B33A 3WXMA 1N5IA 3WYGA 2FSIA 2ZE8A 3HP1A 3EZ9A 2RMKA 3RHFA 3EX7C 3THYB 2OV2A 1W2GA 3QF4A 3A4MA 1YE8A 4UJ3A 2E87A 2IUUA 3AM1A 1ZD8A 1W36B 1NIPA 2BKUA 1X8LA 4TZ0A 4US2R 4C3ZA 5IT5A 1W44A 2WMNB 3H84A 3JVVA 2FFAA 1TU3A 2VRWA 4JBWA 4OI2A 1XNJA 1LVGA 4LY6A 1HUQA 3BXZA 4R98A 2RAPA 5A0FA 1U0HC 1Z47A 1B23P 4FIDA 2VEDA 4NCIA 1M6NA 4JSYA 1OH5A 3RLFA 2OT3B 5A5GA 2VP2A 3WMFA 1NI3A 4BQSA 2HJVA 2JLWA 3CPEA 4DIDA 3QPVA 3MFYA 2ZJ2A 1KO4A 4US0R 2GXSA 4ACBA 3B85A 3U3OA 3W9YA 2N42A 4O2RA 4TL9A 2ZSDA 5TY0A 1IONA 2OESA 4C0AC 2VQSA 4IDOA 4RCZA 2F9LA 5IDVA 2C78A 4B6FA 4LGMA 5EP1A 3K9LA 5H70A 1R5BA 3PIRA 4GT1A 2D7DA 1OXVA 1T5LA 2C98A 1U99A 3T12A 4QM6A 3RS2A 2DPXA 1RRFA 4Z51A 4NP6A 1QBKC 4RD1A 4YDHB 5L3SB 4PSAA 2FU5C 5FUVA 1U98A 4A8JA 2QAGC 3QXHA 1JR3D 1YR7A 4X8HA 2O8BB 1JEEA 1IHUA 3AF0A 2PZFA 2ZE5A 5B2ZA 1M7GA 2R65A 1G291 5FTLA 2JLUA 1E0JA 2B6HA 2NO0A 4FI3C 5FFMA 3HYTA 1VG1A 3TUJC 3RS3A 4Z1MA 4XD7D 2KSQA 2GZAA 1P5ZB 1OH8A 1VPLA 2FSGA 4OHXA 1CBUA 3AVYA 1U94A 8OHMA 5HZKA 1XDBA 3CONA 2JJ1A 2ERYA 3QXSA 4B47A 2XJ4A 1H8HD 2IYUA 3GP8A 3RS7A 3ZVNA 1BMFD 4DUGA 3THXB 4QNMA 4BZQA 3HJNA 3PUZA 4TQAA 4EJSB 1CU1A 2NOAA 1MO4A 3ETLA 4QBHA 2Q9CA 4ZCIA 5KPDA 1TADA 2DFTA 3OAAA 2XGJA 3I62A 4AKHA 2G9NA 3LFUA 3LVQE 1KJZA 4PSVA 3RNLA 4A2PA 4DT1A 1M8PA 5J5CA 4DB2A 1GRQA 3H2YA 3VR3A 1XTSA 2J3EA 4FINA 3N2EA 2GESA 3LW7A 1WQ1R 1VIAA 5BXQC 2E1RA 4HZUB 5HR5A 4JL6A 3IO5A 4P31A 4Q1FA 1Q12A 1DAEA 3QJYA 1WB9A 2GJSA 4MGIR 4C0KA 1KJWA 2QU8A 1AN0A 3B1ZA 1JBKA 4E03A 4JS0A 4OQNA 3GJ6A 2XB2A 4BGDA 3I8XA 3T15A 5JRJA 3P20A 2MMGA 4DSTA 1T8TA 1E98A 4C4PA 4OYHA 1NN1A 4HATA 2W2VA 3F8TA 2C77A 1AZSC 2ZUCA 4TQUS 5E4FA 1E1QA 3GEIA 3K70B 2FSHA 1TF5A 3I8SA 3TQFA 2C2HA 1X86B 5D3MA 1DPFA 3Q7QA 1Z28A 1JQJC 4D0LB 4TSFA 4M1MA 2Q0HA 1XZPA 1ZM3A 3C14C 4AURA 2I1QA 1VTKA 1Q3HA 1R0YA 3TLXA 2CXXA 1OHHD 4IXMA 3UMFA 2B7BA 3BFKA 5FL7D 1SVOA 3UMSA 5FR2A 3KQLA 3P26A 4QJ3A 2FNAA 5C18A 1BH2A 4NCJA 2ASEA 4PQFA 3TUZC 3K0FA 4BE7B 3B82A 4RZ2A 2JLRA 2OSBA 3M6AA 3AVXA 5FOWA 4OHWA 1LF5A 2QTVB 3DOFA 2G0NA 1OIXA 5CIQA 5K8IA 4B2IA 2NGRA 3UK6A 3EASA 2IS6A 1HYQA 3AUXA 4NH0A 1FP7A 5KDDA 1OYYA 3PCRB 1M74A 2D74A 4BFYA 5TMPA 2JDID 2G83A 2QSYA 2VF8A 4HAYA 1NBMA 2AKAB 4W5HA 3PENA 4AWXA 3FFBA 3I5XA 3ZZUA 1KSGA 2PL3A 4RD2A 1BS1A 1DAFA 2FA9A 5KO2A 1A1VA 1OT3A 5C46F 3BH0A 3ASZA 4F7WA 2BBSA 3VU9B 4F4IA 5DI9A 5JSZB 3I61A 4RFSB 3ICEA 4W5JA 1G21E 2REOA 4TN1A 2JATA 1GKUB 1KYIA 3BORA 1L8QA 3GJ4A 3W3AA 3T61A 4DCUA 6Q21A 2GNOA 3GD7A 3DVLA 4GOKA 3TIFA 4AG6A 2HCJB 4D4JA 2HXSA 5LD2C 3PUVA 4JVSB 1SKYB 3H0KA 1K6MA 2QAGA 1YRBA 1R8QA 3RYTC 1XEWY 4JZKA 1D2NA 4PXAA 5B64A 1FQJA 2DYKA 2YWFA 4LUCA 3PXGA 2BJWA 5L3QA 3CZPA 4IHQA 4QBIA 2ZRGA 1DELA 1GTVA 2HT6A 3NC0C 1PV4A 4PTLA 5EXSA 2XZOA 3THOA 2FGJA 1UADA 1VG8A 2VP0A 1UEIA 1LS6A 2ZRLA 4DDUA 1FX0B 1UFQA 4FMCF 3SOPA 3U3KA 1G5TA 4OQMA 2OXCA 2EWWA 3LQRA 1WP9A 1NVWQ 3VR4A 2DWQA 2QEQA 4Q1BA 5GVSA 1G6OA 1N6RA 2ZETA 2ZSEA 2WAYA 4HAWA 2PH1A 1QHHB 1EFCA 2XOKA 3EIHA 2FOLA 4PQYA 4AYTA 5FTJA 2WICA 3DKPA 4IDNA 3DL0A 1Y3AA 1MO6A 3TR5A 4DSUA 3OE7A 1RRCA 1R8SA 2XNDD 1UM8A 2OFXA 3CPJB 4LCBA 1XZQA 2QENA 1AIPA 2W83A 2IYYA 3U7FB 4BLQA 1D5CA 1KKLA 1JXMA 3B1XA 1XRJA 1XCGB 1LW7A 2GJ8A 1GILA 3OHMA 4N0DA 1ZBDA 1G16A 1G6HA 2ZRBA 2HJGA 1PUJA 1R7RA 2H5EA 1KK3A 3CNNA 4NU0A 2F3RA 3CRW1 2B7CA 2ZEJA 3KUDA 5AJVB 3FMOB 1KDRA 2R6DA 1N6PA 4DSNA 2YOHA 2A2ZA 1AKYA 2JJ2D 1OIWA 4HUQB 3GEHA 4NZYA 4IXNA 5E3HA 1GP2A 1Q0UA 2ZR9A 5UKDA 4Q9IA 1L4UA 2CLSA 3Q5EA 1AKEA 1ZRHA 4O3MA 3AVUA 3NTUA 4KYUA 2HEIA 3ZZTA 3W90A 3WNCA 2PX0A 2EFEB 4UJ5A 3ZS8A 3PV0A 3AKDA 4OJKA 3OEEA 1ZCBA 2GETA 4B34A 2ZREA 1EFRA 2XTNA 2CJWB 2KBEA 2RGBA 3GLHE 4TLCA 4AYWA 3LD9A 1BYIA 2A7QA 1P2VA 1YVDA 4IOKA 4Q4HB 2KJQA 1RYFA 5K8LA 2P6UA 1KSHA 1G8GA 5AK0A 4H1UA 1E2HA 4LV8B 5DYGA 1HH4A 1S9DA 1ZIPA 5JMTA 4EPWA 3K53A 1SKQA 2IA5A 1QHYA 1KGDA 2VSOA 1DEKA 1E3MA 1I4TD 4L5BA 1Q44A 1Z06A 2NO1A 3D6TB 2V7QA 2WSSD 4CF7A 1JR3E 4IDQA 3KQUA 4PR0A 2D2EA 1Z63A 3N70A 1U8AA 4EDHA 2J0QA 2RGNC 4HUTA 4DEYA 4Q03A 4XVRA 2GJ9A 4UQOA 2ZROA 3C5HA 2O8CA 2SHKA 3T1VA 5LDDC 3GJ7A 3I72A 1NLFA 2BEKA 1H65A 5EQTA 1SZPA 3HYRA 1IXZA 4AKGA 1SVWA 1XJQA 4Q1EA 1HY3A 1KMHB 2AD5A 2R2AA 5B30A 2IX3A 2QGZA 2RHDA 1XB2A 4DLVA 1B0UA 1NY6A 3A58B 3F0TA 4HDQB 1GUAA 2K5UA 3WMEA 2CL6X 2I4IA 4HB0A 2ZYUX 4TLAA 3AH8A 3VR1A 3T5DA 4OQXA 3KJEA 3TQCA 3B1YA 2ZAOA 4B3BA 2ZSBA 4NMMA 5EXXA 3NBZC 4ZDKA 4M1KA 3X1DA 1G7CA 3QEOA 1YZUA 4HLQB 1RE0A 5KSOA 4A82A 4B76A 1JEDA 4DB4A 1FFHA 2V8OA 3B60A 3ZZ0A 1P9RA 3KJHA 4DEXA 1G7RA 4LWZA 1Z83A 3AP3A 4HAUA 3FMIA 2PT5A 1YZLA 5KHOC 1NP6A 1OFHA 1XF9A 4US1R 1HEIA 1UDXA 1Z0KA 1CP2A 2CK3D 3A4LA 4PC7A 4B44A 3BJIC 5E7JA 2ORIA 2O0JA 3LXRA 5FH9A 2O8EB 3HR8A 4J0QA 1NIJA 2OHFA 1UBEA 3SYKA 4EPTA 3QPUA 1Q1BA 4ZIRA 3W5JA 2FG5A 4MA4A 3ADCA 2WBLC 1S3GA 5FTKA 2ODWA 3BFVA 4C0JA 1OKKD 2VLIA 4FMCB 4PPQA 3IPYA 1GNQA 3MUFA 3L0IB 2IXEA 5JJIA 1DO2A 4IW3B 4JVLA 1KSFX 3OF5A 4FW9A 4EQ6A 1G1MA 2IS2A 1G5RA 3RSOA 5EP4A 4TSFD 4Q9JA 2ZI5A 3ZVLA 1IN5A 1KY2A 1VCMA 3TSWA 2YOGA 4LJ7A 2G3YA 3EC1A 3KUCA 4LRWA 3W3ZB 1W7AA 1EFUA 5SZKB 4WZ6A 2IF0A 2J9RA 1CJTC 1JR3A 1XMVA 1K5GA 2BJVA 2OE2A 3A4NA 1X1RA 4PO9A 4TMXA 3TW8B 4LYAA 3SNHA 2YC4C 5CDFE 1UDWA 4TWZA 4IOMA 4D6PA 2H92A 1OXTA 1GIAA 3EC2A 4GL2A 4XD7A 4F91B 3IBGA 4KJZA 4LBVA 2NO6A 4D0NA 3FKSD 5FOSA 2FE4A 1CRQA 1U81A 1KHTA 1XTJA 3WRXC 5JRZA 4JLDA 3BGWA 1NBMD 2XNSA 3EZFA 1H8HA 4QNRA 2HUPA 1XTIA 2W0MA 1BMFA 4XSHA 2XZLA 1OH7A 1T5IA 1U9IA 1SHKA 4MQBA 1P72A 1JJ7A 2CE7A 3I92A 1RPZA 5JFGA 2JLVA 1T3HA 2F1HA 5JHGB 4WIAA 1IY2A 4RD3A 3MMPA 5A4JA 5E7MA 4M21A 5TB5A 4N3NA 3B78A 2PMKA 5BYKA 4ZI3A 1KO8A 2ZVQX 3AKEA 3MAAC 1W47A 5HE9A 4A15A 3RABA 4C0HA 3TVDA 1G17A 1DG1G 3BS4A 3VR2A 3L0SA 2N1BA 3C16C 2QPAA 3TSZA 4LJ9A 4DLTA 2RGNA 1EK0A 1AS0A 1E2MA 4Q1DA 4QG7A 2WPDD 2QQEA 3NIBA 3L82B 1N5LA 4BECA 1QDEA 1ZNZA 4UKDA 3AVQA 4NHOA 3TBKA 1GDDA 1KZ7B 3KFVA 3E1SA 2HYIC 1ZUNB 4I99A 2Z83A 1VCOA 1AZTA 3QPWA 4CT4B 3FE2A 2FDCA 4CEIB 1G18A 2PJRA 1NJGA 3I1FA 3IBYA 3MWLA 3SU8A 4V0KA 2GVZC 3EWSA 4PZLA 1C4OA 1XWIA 3S1AB 3WBJA 3ZJYA 2ZXUA 4M4SA 1OB2A 1OHHA 3DM5A 3WHLA 4EIWA 5JBQA 5FL7A 2FSFA 2AWNA 2BVNA 1Q1QA 2VP6A 3PFIA 1CLUA 5C4MA 1Z0AA 4NYJQ 4DCSA 3L2OB 2A5YB 3ZQ6A 4Q9KA 4ILEA 1EXMA 5EE9A 4TLDA 2C04A 1ZU5A 2QP4A 4TQ9A 3MLEA 1RRPA 4R7ZA 3T35A 4GI7A 4A6XA 3IILA 1DTSA 1JB1A 2VHJA 4KXFB 3QSYA 2GTPA 3X1ZA 2GA8A 4M9XA 2WJIA 2JDIA 4JT4A 3TMKA 4PC2A 1AA9A 1IJEA 2J0UB 2YZ2A 2EFHB 1HTWA 4B73A 2IYSA 2UZIR 1E1RD 1XXHB 5JWRA 2EYUA 2BC9A 1MH1A 3BH7A 3K9GA 4IEIA 1N6IA 1ELOA 2UVQA 3A37A 4ZDIA 2REBA 5CYPA 4C0LA 2BMFA 2ZJAA 1N0WA 3CKLA 3B1VA 3NHBA 5DLQC 1G7TA 1UAAA 4R71A 1EESA 5C1BA 1LB1B 4F4JA 2MSDB 5M04A 4NCHA 3RRYA 2PEZA 1IY0A 1SQ5A 2QE7D 1NRJB 1XBTA 2ZAMA 1NNEA 4QGAA 3B5JA 1EFTA 1XCMA 1KK1A 4GP6A 4QGGA 4YC7A 1X8JA 2IT1A 2CMKA 1JAHA 2O8FB 4Q66C 1E4VA 4IVRA 2ZR0A 1Z3IX 1Z0IA 4MRNA 2ZJ8A 4CDGA 2HV8A 4BPBA 2WWFA 2D2FA 3CF6R 1E0SA 3IKJA 1U2RA 3N2IA 1ZMXA 2WZQA 2YOFA 4OK5A 1FPMA 4URWR 2O0HA 4MUBA 3GJ3A 3J81k 3QBTA 1P61B 1TTTA 5HTKA 2O8DA 4QBGB 4LV6A 3TNFA 1O87A 4DDTA 4JLKA 4KFRA 1S2MA 3CR8A 1F2UA 4DLWA 2QBYB 4QXAA 4AIIA 4B3CA 1YZNA 4I1SA 521PA 5CLLA 1LV7A 1UJ2A 2NMVA 3ZDQA 4DLUA 4B3GA 4CVNA 3SBEA 3ND8A 2G6BA 4TL8A 2ATVA 1IM2A 3BE4A 3QEJA 1F2TA 2TMKA 5B57C 1IAQA 2XNDA 1AJEA 3NDBB 5JEEA 1E9DA 4MYUA 5KSYA 1G3QA 1QG4A 3BD9A 4DZZA 3GLIE 3K70D 3D7MA 3WP1B 4V0ME 3T5GA 2ZYVX 1VYUA 2Z5FA 3IIJA 1T4GA 1CS4C 1XTQA 2BCJQ 1YU9A 3EIQA 4M1WA 4ERNA 2GCPA 2H1LA 4FCVA 2ZUBA 1J2JA 3WMGA 1XPUA 5FOTA 4OK6A 3NG1A 3GFTA 4YXWD 5FI0B 1YJ5A 2QRNA 3ADKA 2JJ2A 1UBFA 1NMYA 4OHZA 3ND9A 3QKSA 4BFUA 1CEEA 4UNPA 3VX4A 2NO9A 4BZXA 4F92B 1Z07A 1TAGA 4C7OA 1CKEA 1Q3TA 4GRAA 3AQ4A 1KZGB 3W34A 4ABYA 3QY0A 4TL7A 1ZM4A 2XB4A 4IJMA 1P2TA 5CB6A 2RGEA 5FUXA 1A2BA 1NY5A 2F3TA 2CVHA 3D3QA 3NH6A 2JLXA 2FFBA 2EU8A 5HPYB 2VA8A 4YLGA 4JVNA 2F7SA 2D3WA 5TARA 4W7SA 2AKYA 1J90A 1XEFA 3P4YA 4M9QA 1US8A 2RGXA 4FWTA 4RY2A 1G3RA 2B21A 1WDTA 3UWKA 1P62B 2CE2X 2YWHA 4K46A 2MMCA 2WSSA 4OJQA 2G0TA 3R20A 3QENA 1MRNA 2C95A 3BAFA 1KNQA 5FR1A 4CYMA 4KVAA 3TVTA 1FP6A 2FPKA 1JAIA 4C7OB 2BBOA 2F6RA 4LZZA 4PHFA 4BFVA 2ODBA 2VHTA 4MH0R 3DHWC 3GMTA 3SJZA 1IBRA 1M2OB 5FOVA 3PITA 1ZNYA 1HA3A 1N3BA 3CF0A 1E2EA 1CJVC 4M1SA 4O0MA 1BOFA 2AL7A 5H68A 1NBME 5ELXA 2ZRCA 3PEYA 1LY1A 1U0LA 5IRCD 1ZD9A 5DSZA 1LS1A 3PUYA 4Y0VA 1CULC 3LNCA 5HCNA 1TUIA 1E9CA 2YYZA 4UXIA 2ODNA 2RH5A 1MRSA 5KNBA 4Q7KA 3DOEA 3BBPA 3GLIA 1KK0A 3FDIA 4K81B 4KODA 4V0MA 2ZANA 4W5WA 3X1XA 2GWHA 2QT0A 2ZR7A 3EAQA 1PLKA 3M1IA 4Q9HA 2HF8A 2ZJ5A 4LV5B 4LJ8A 1AQUA 3SC3A 4JVMA 4EPXA 4K8OA 1BIFA 4DCTA 1R0WA 2QNRA 2CK3A 4OQFA 2GEUA 1COWD 3AUYA 4C9BA 2QL6A 2FZ4A 4M2LA 4XTCS 2A5GA 3KKNA 1II9A 2PCJA 3EIEA 3B1WA 2I1VB 5DN6D 3NWJA 2IWHA 1P73A 4BLPA 2H8KA 2XTZA 3LO5A 4IVPA 4PO8A 3IEUA 3U4QA 2QMUA 1T9HA 2O5VA 1XD2B 3PEVA 1IN4A 1NVVQ 1E0KA 1OKKA 4XSGA 2ZS9A 2GXAA 2ZJOA 2WJVA 3KKPA 1SXJD 2CHQA 5KNCA 4LJAA 4S35A 1PJRA 2DFNA 2ZUDA 1ZM2A 1UKZA 2PZEA 1KI9A 1YZTA 5DO9A 1NLYA 1I2DA 4HB3A 5CJ2A 4LHYA 3KKQA 2P3SA 3FFAA 1G3IA 3I3SR 3X1WA 1XJ0A 1G4UR 1XMJA 3KL4A 5AWFC 3C41J 2DY1A 2EYQA 4P3YA 1A2KC 1N6OA 2CCKA 2R6CA 3MJRA 2GCOB 2GDJA 4EJSC 1G8YA 4YQFA 3R9IA 3IHWA 3NXSA 3KQNA 1U0JA 2Q3FA 4Q4AB 2RKOA 5LD2B 2P5SA 4Q4LA 2QMOA 2HT1A 3TKLA 2QP3A 1J70A 1OSNA 3FKSA 1IJFA 3SJAA 3QG1A 1N6KA 3B7GA 4GOXA 3FHOA 2XITA 3UIEA 2OCYC 1XEXB 4IOJA 4PSKA 5F2EA 4ESHA 1W0JD 4D25A 3SJBA 1S8FA 5AUPB 2HYDA 1G64A 1Q20A 2F43A 2WKQA 4LOAA 3IIMA 4Q21A 1VECA 4YONB 4LI0A 3G82C 1ZNWA 2FJUA 4GZMA 4OI1A 5HE8A 3VQTA 4QHYA 3CNOA 2AN9A 3U6KA 2OLKA 2QGNA 3KTAB 3AGQA 4JKIA 2D4HA 2GF0A 1OXXK 2B8TA 1WBBA 4G0NA 3K0AB 5EZ6B 4B74A 2GILA 2KBFA 1FL9A 3K70C 2GEDA 3OIVA 4KFTA 4BFTA 4DLRA 1NVVR 1KI6B 2IL1A 4PPFA 4KVGA 3RANA 4URVR 2JAQA 1DAMA 3GLHB 4WZBE 4E5UA 3H86A 2WPDA 2WSMA 4XWAA 1ZW6A 3THYA 4RVCA 2LWIA 3CH5A 3A1VA 4M1OA 3RRMA 1IN8A 1XCPA 1YR9A 4C0SA 2NZJA 3GLFE 1DS6A 3HDTA 3OESA 3HU1A 3PG5A 2ODEA 3W5IA 3ZYCA 4KFSA 1RJ9B 1X8KA 2CL0X 5CK4A 2A9KA 3BRWD 2ZU0C 4UXHA 2ZE7A 4QGHA 2QTHA 4IDHA 2ZTSA 1PLLA 4LHXA 3N5CA 3A6PC 1RZ3A 4P4SB 3QXJA 4TYYA 1P60A 3TH5A 5J4LA 4URYR 1NKTA 3D31A 3C8UA 3OIYA 4EAQA 2YHSA 1FTSA 3OFNA 4HAXA 4BWYA 3QXXA 5AJYA 4A0HA 3VHXA 2FH5B 1EGAA 1KI2A 2GAAA 3SS8A 3VR5A 4CGZA 4RZUA 1MOZA 2KE5A 2VYFA 5FTNA 1WXQA 3AKYA 4YDSA 2IYTA 2OEPA 3GJXC 5LB4A 3GFPA 3WRYC 1Y63A 1ZIOA 2FZLA 3A1TA 2WAXA 3H4MA 2XJ9A 4QOSA 1Z6YA 2RCNA 1ONBA 4KFUA 4UNNA 2Q9AA 4MKIA 4M22A 1DG3A 2JASA 4PC3A 5BN4A 2GZDA 4E22A 1E1RA 4D26A 2O8BA 5F98A 1G8HA 4D4LA 3A1WA 2WJGA 1U8YA 1V43A 1G41A 1II8A 2J45A 4JL8A 3CWZA 2G1KA 5G41A 1G19A 2H17A 1GRNA 3B13B 3MCAA 3THWA 4X8OA 3GLGE 4CT5A 4M1TA 1W46A 2BMJA 2QE7A 1BKDR 2W0SA 1SVKA 5J4YA 4MGZR 2P0EA 2OBLA 5FUWA 2QMHA 2DWPA 4TYQA 4ZCLA 2PT7A 2NPFA 5JCZA 3AP2A 2Q3MA 3P4XA 3F3YA 2CCJA 3Q5DA 5GJCA 4CEHB 2PJZA 1IY1A 1N5JA 5H1YA 4UNSA 1TQ4A 4EJSA 2WWXA 1U9IC 2N46A 1MABA 4XTRA 3UMRA 5JZVA 2OBMA 5JEDA 1IN6A 4QGFA 2VP4A 2ZQ5A 4D2IA 4IRUB 2R9VA 1QHIA 3SJCA 2J1LA 1R5OA 4WA7A 4Q19A 4RKFA 2OM2A 1SKYE 3MJHA 3QKTA 3W8NA 3BFXA 4P0TA 3GLFA 3T1TA 1YQTA 1E9SA 4HZUA 1OJLA 4MRPA 1CR0A 5KPJA 4DBLC 4M0LA 2DB3A 3U7GA 3JZMA 3W8RA 4I4LA 2OXRA 2XTMA 4I1UA 4LYHA 5C4GB 1JR6A 1U8ZA 2QUZA 5G3YA 1KJYA 1YZQA 2W2TA 3U7HB 4Q47A 1E2JA 4WW0A 4KYIB 4Z8YA 1XMIA 5DGXA 5J4KA 4CEJA 2AK3A 3QF7A 2BCGY 3NKVA 1TQDA 1SXJC 2ANBA 2JLZA 4PO1A 4NE2A 3G5UA 3ZVRA 2IYWA 3U5ZB 3SN6A 5BW8A 2WKRA 4LHZA 1X3SA 1MKYA 1OXUA 1I4DD 2ZPTX 5L8VA 2OCBA 3Q85A 3KDSE 1N2CE 4BRUA 1S4QA 1YZKA 5FUYA 1SGWA 2RGAA 2X1VA 3CWQA 2Q3HA 5DIFA 3MG9A 5DI3A 4YXWA 4I81A 4Z8XA 1E9EA 2RGCA 3B8HA 2DHRA 5DHFA 3U60B 2HDNB 3REFA 1ZNXA 1R0XA 2O52A 3AV0B 3ZIAD 3VAAA 3OZXA 3DPUA 2J7PD 1Z0DA 1VHTA 4TTQA 3R8FA 1JPNA 3K0CA 3O47A 3MWJA 3D8BA 1D8TA 3VMFA 1LFDB 3NC1C 3WYFA 3SHFA 1YRAA 3U44B 2R6AA 2JCSA 3GLGA 2FMXA 4EFLA 1FNMA 5JWOA 4M9SA 3I5YA 2XXAA 3VKGA 1SXJE 1AQYA 3CH4B 1LF0A 2CNWD 3FHCB 3AF1A 3KX2A 4KLNA 4DLYA 4LYFA 2ZIAA 3CBQA 3RS4A 4JL5A 3VU9A 2O8DB 2ORVA 5JSZA 2RHMA 5CIWA 4RSGA 1K8RA 4YMWA 5BQ5A 1TNDA 1ZC3A 4OBEA 3VTKA 3WBKA 3QIAA 1TL7C 3KXLA 2J0SA 5CB8A 3PVSA 2NTYC 3EPKA 2GBLC 1PZNA 1EG7A 2NO7A 4IFEA 1AS3A 1MO5A 4JBYA 2ZRDA 1X6VA 1SULA 2C9CA 3TAUA 1KOFA 2J87A 3QNUA 2YINC 2J5XA 1E96A 2AFHE 4MYCA 2PX3A 3GFOA 4ARZB 2LKCA 1KMQA 3IEVA 1ZUHA 3K9NA 4Q4JB 3ADDA 3OEHD 3UG7A 2QY9A 4G5SA 1GG2A 4I1OA 5B58C 1P9WA 1FX0A 1VMAA 2PLFA 4PC1A 4PANA 3SDZA 3QF4B 3QQ5A 3RVBA 2WIBA 4PPNA 1NN0A 2GXQA 5FBRB 1KI7A 1CJMA 4WBSA 3QKSB 3HWSA 2VHQA 2ZE6A 5JJKA 3EG5A 4HB4A 3O8DA 1FMLA 1N6NA 1SHZA 3NEJA 1T3LA 2AFIE 1KAGA 4RJLA 5EE1A 2J46A 3VNUA 2B8WA 2E9SA 2WVJA 1R2QA 1E2PA 4JIMA 3WNDA 4TT3D 4MRVA 4OK3A 1ZC4A 4NBSA 2HLDA 3TE6A 3SE0A 2VHCA 1COWA 4BFXA 3TK1A 3AVTA 1OH6A 1G3UA 1I2MA 2QA5A 4NTZA 4LYJA 4GSYA 2YNMA 1XX6A 3RWMB 2ZM5A 4NPHA 2OO7A 2ONKA 2R44A 1Q1EA 3U3RA 2BM1A 4DVGA 5DN6A 1WBDA 3DZDA 2J7KA 4JBXA 1T3SA 2Z0MA 3FWYA 1US8B 2HCBA 5H8WA 4OI4A 4TLEA 3KJGA 3TJZA 1E2IA 2Z4RA 1NMZA 1E79D 4URXR 3JVUA 4OHYA 4TMZA 1W36D 4HUQA 4QHTA 4MYTA 5J47A 5HKKD 2IHYA 1SXJA 2OUKA 1G7SA 4B43A 4D81A 2CBZA 3CX6A 1Z0FA 4F4CA 1IXRC 3U61B 4JLBA 3R9WA 2AD1A 3L0OA 3KJIA 3CRRA 3OIWA 3UXMA 3WHKA 3AVWA 4A8JB 3MSXA 1D6JA 4UXJA 1NKSA 5EE0A 1ZAKA 3EA5A 1G20E 4PFSA 3TW4A 4BRWA 4P4UA 4PHGA 4A0RA 1DAGA 3EW9A 1AK2A 1NF3A 3LBHA 2P6RA 2OAQ1 2JIZD 3OFND 4BLSA 5KU1A 4Y0AA 2Z43A 1OPXA 1AGPA 1W49A 3QKRA 4MKFA 4Q4HA 1TF7A 1KI8A 5KSPA 1Z6GA 3L0PA 2ZRPA 2Q9BA 1Z22A 3DO6A 1S9HA 4GOJA 1CR4A 2ZRNA 1G4AE 4LBZA 1NN3A 5FBQB 4G5OA 4FCWA 1F48A 1Z08A 3FB4A 3GLIB 3PUXA 4IEEA 1DARA 2V4ZA 1W0JA 1Z6TA 3CO5A 3LRPA 2PZGA 4TYNA 4LJYA 4Q5IA 1NSTA 2ZVPX 4DRZA 1PLJA 1ZM9A 4DT1B 3SQXA 1S0UA 2BEJA 4HLUA 4DCNA 5AR1A 4WVFA 4V03A 2DFLA 1EWRA 3CB4A 2D06A 3L8YA 2GJAA 2ZRAA 3LLUA 4JJKA 4UNQA 1WF3A 4M1YA 4S2EA 3LV8A 2NQ2C 4DJTA 5JLJA 1HT2E 1EFHA 2VP5A 3K1JA 5BN5A 4GPTA 2GBLA 2DCUA 4U02A 3LA6A 4ZPXA 3SFZA 2WWWA 2QM7A 3FYHA 3HPRA 3QVUA 2Y8EA 5FOUA 1EX6A 4AC9A 5LPNA 3U4QB 4F93B 2KI5A 3EWAA 5JI2E 2BDTA 2BM0A 1JNYA 4OQLA 4MRRA 1KSJA 3FOZA 2H16A 4KHZA 1N0VC 3C4JA 1A7JA 4BLRA 4NONA 3QUSA 5J40A 3BB3A 1D2EA 3BB4A 3UG6A 3VR6A 2C99A 3I73A 1N5KA 4HLCA 5D3MB 2WKPA 3EPJA 1QHNA 2H7VA 1CJUC 2ZJZA 3V4FA 5FOXA 1XMSA 1W4RA 3SYNA 1PVOA 1JXOA 4E07A 3T1OA 4TYWA 5EE3A 4LX0A 2ORWA 1E6CA 1Z6AA 2O0KA 4Q7MB 4DLSA 3LX8A 4L9SA 1UBCA 5AUQA 1M34E 3K0FB 4L9WA 4XVQA 121PA
chains in the Genus database with same CATH superfamily
4GEKA 1A04A 1TJNA 4KIGA 1EX1A 1P7CA 3AESA 5JVDA 3WGNA 5ICCA 3OTOB 3TRFA 2F90A 2NTEA 1N5DA 2B30A 2HSJA 4BO2A 3PIDA 4N1AA 3DT9A 2GK3A 2WAAA 3AFNA 4TVBA 4B79A 4ZU3A 1GPWB 4F3CA 3BCHA 4N0QA 1NPYA 1SU6A 2EL7A 1W75A 2R6FA 3P32A 3H13A 4BGUA 2IW1A 2FSPA 1KJNA 3TM5A 1YB5A 3DBRB 4AZ0A 5BV0A 3HDGA 1Z7WA 1GZ4A 4GBJA 2R48A 3R7WA 1L0BA 3HSSA 3U31A 3WK4A 1E5XA 4GR9A 5J23A 3O4RA 3E2MA 3VZSA 1V5IA 2G4LA 4HS4A 3HXOA 4U7JA 4IOLA 4MRSA 1C1HA 1SB8A 2D3TA 2VF4X 1ONNA 4F12A 4KPUA 2YICA 3H5OA 4G0OA 4Q3OA 5DNDA 5B3JA 5E6UA 3GPLA 4IIYA 3VKGA 2WT4A 3RVNA 4YTEA 3T9FA 4LOIA 4J3JA 5CLIA 2W6ID 3N87A 4GL4A 3RG2A 4EB0A 4L8GA 2EGUA 5AH0A 4ISBA 3IV7A 4MV9A 3ETGA 1R9JA 2DJ5A 2O2IA 5EWMB 4CLHA 1XWWA 2Z57A 1D4AA 1JI0A 3HXPA 3I32A 1ZINA 3QPAA 4Q7LA 4WGFA 3A0UA 2C83A 4WV3A 2QAGB 3HBFA 5H7XA 3D3JA 3SX0A 1T0IA 4JLAA 3R8CA 3I9KA 1H8ED 3FTDA 1YC2A 4IKPA 3EZNA 1FFXB 3HB9A 2MINA 4DN6A 3AVOA 4MWZA 4B17A 4EKIA 2F48A 2XX3A 4PICA 2GQ0A 4DJFC 2VA9A 2JFNA 4R83A 2GBIA 3ELWA 3UENA 1RBQA 1GSIA 4II7A 3O38A 4JB0A 3KOMA 5EKTA 2QORA 4ETMA 1BZYA 1LQ2A 2JRLA 3I37X 4WN9B 3ZGXA 3L4BC 2ZCJA 4HCJA 2PLNA 4F9GA 2FK7A 2HSEA 3T1QA 1QH8B 3A9CA 1ZKMA 2BM9A 1RQNA 2HBRA 4G81A 2YY7A 4ZO8A 2H2GA 4RVSA 3JVEA 1NVUQ 3H7IA 221PA 2I9PA 1JG4A 1SIUA 2ACKA 3U4IA 3ZQUA 4CQJA 1QGUA 4IO1A 2Y2UA 1DAIA 4PLGA 2V6JA 3O2NA 4B1FA 4GBMA 3IPLA 4ACAA 4MQLA 5AOBA 5CA0F 3E18A 2RGUA 3VAZA 5DSXA 1SHUX 4MP6A 9LDTA 4KO2S 5LBUA 2TMYA 5YASA 4ALIA 2VPYA 4YVFA 3RVSA 4JBLA 4KUGA 5K3DA 3V34A 2FQQA 5KX5F 2UZAA 4ZC8A 3ZS9A 1I3OA 1PR2A 4TMFA 1TUEA 4PQGA 1JJAA 4RH1A 3OOHA 4NJOA 2O54A 1L7XA 1E8DA 1QTQA 4J4TA 3NM5A 2NACA 2P65A 3E53A 1Q15A 2QJWA 4H17A 2AB0A 4AO7A 5E1BA 4CI0B 2EX1A 3QOFA 5TF0A 2IYXA 4JXKA 3CTPA 2PRJA 4N5IX 4MIOA 4ZN6A 1IBSA 4X1YA 5BSRA 1F6WA 3E3MA 3UA4A 2BFWA 2INGX 4WCFB 3EH2A 2X58A 3FDJA 3R3ZA 4JEUA 3KAPA 2JLQA 5FL3A 3EUEA 3GCGA 2CVQA 3MTQA 3L7DA 1BNCA 1XD8A 2AWOA 3GRAA 5EXPA 2ZRFA 4E51A 1JTFA 2GJ4A 2BHNA 1GPJA 1OMOA 2XECA 2ZI7A 4CKXA 3QUAA 4F04A 1VI6A 2EL9A 2J31A 2WWGA 5F9MA 4YN3A 3WS7A 4RAOA 4D4KA 3MWKA 4UM9D 1KEWA 1IZ0A 1Y3CE 4KLRA 1A7AA 1D1PA 4OBBA 5FJIA 1NGSA 4RGBA 3OOEA 3MJVA 3JYOA 1Y8AA 3TR0A 4HPJB 1K5DA 1ZY2A 1EX7A 1G3MA 2ECOA 3RFTA 2HJRA 4EUEA 5ADUS 5KSZA 2R7LA 3WIOA 3KOOA 1AKRA 3OY7A 2HDWA 3GT4A 4Y9RA 1ETUA 5EP3A 2TMDA 1PJ3A 3OZIA 1I94B 2YWBA 3VXKA 2DETA 2TECE 1ZHOA 4Z49A 3MAJA 2O1EA 1MABB 2O6HA 3BGSA 3C43A 4IQFA 3FPKA 4K6MA 4R1QA 4UBLA 2J0UA 2QJRA 3BXEA 2VP9A 3JQ9C 4ZQIA 1ZVVA 5BYJA 4RLFA 4YMSA 1HQDA 1XXHA 2HX1A 1FP4A 2IU3A 1QMGA 2QPOA 3E3LA 4GUDA 4WZBB 5EJ5A 3L46A 7GPBA 1XPJA 1IC6A 1A96A 3LJKA 1KY3A 4H1HA 2HMVA 4I36A 5H59A 1P4AA 5K51A 3WTCA 1VGVA 2E2WA 1CUGA 4CW7A 1FSGA 1K7SN 4KXNA 3LXXA 2ECKA 2QTGA 3BXFA 4UUBA 4U9IS 2ZTVA 5AVOA 2HWWA 2XUJA 1QZXA 4BRSA 4GXRA 4QO8A 3BA1A 2P6OA 2R00C 4FT4A 2ZRJA 4R1OA 1N4AA 4RELA 1GNPA 2H5JA 2XMQA 5BSMA 3QE0A 2VPQA 4CHTA 4EG3A 1TUBB 3HVRA 3FTEA 2A84A 3LNTA 3GY0A 3Q72A 3LCMA 1GWNA 4HGOA 4TVKA 2IZ7A 4W1RA 3C4QA 4Y18A 3ZH9B 3CEMA 3R2JA 4HAIA 4NL4H 1Z2EA 3I6MA 3NP9A 3U3MA 2C03A 3KS9A 5JZOA 3BQNB 4DILA 2IEYA 4K86A 3SFVA 2ACVA 1VE9A 1CEXA 3K8QA 1XKTA 2GERA 2AZXA 4IVQA 1UMBB 3M4XA 2Q3JA 2Q7XA 3S1SA 4UM8B 4KMMA 1OWLA 4BEBA 4G36A 3MT0A 1J9EA 3H9BA 4YRJA 4F2GA 2OAP1 5I9TA 2B8NA 1XWFA 1X7GA 1J99A 1MJGM 2W2QA 3PEUA 3IQHX 3R44A 4MR9A 4QBFA 3RAPR 1KEZA 3X2SA 1V5WA 1SWVA 3B12A 1YC5A 3DTVA 3E5MA 3EY4A 4G41A 2BTQB 4ZFNA 2P78A 4L4YA 4YMUA 1JIQA 1YHNA 3V42A 5AVXA 5LDHA 1QH1B 5U4XA 4WSOA 5CX1A 5K0NA 4H4DA 1TZCA 1I1NA 1JRLA 3G7NA 5DTRA 5CFMA 5E9AA 4BEVA 3OI7A 1KEEA 3IPXA 3KYCA 2V54A 3CEAA 4DC1A 4ZJPA 3M8KA 3WZMA 4ZCMA 2X23A 3F67A 1OIVA 2FRVA 3Q6MA 3GA5A 2DBYA 3WK6A 5K6AC 3LP5A 1MIOB 4BNGA 3T5PA 1ZAYA 4DIEA 3ADOA 2Z56A 4PSDA 3K8ZA 3V4RA 3CIFA 3UOGA 3MB5A 4NIMA 4OSOA 1OBOA 2LR0A 1RW4A 2HCRA 1WB4A 2W6JD 4ZIRB 3O84A 4H3VA 3RF7A 5FLEX 1RJWA 1U02A 3WDSA 3DLIA 1UWKA 3Q3EA 4DOMA 3E2IA 4YJGA 5KZMB 2PGXA 4AZ3A 1NQWA 1NR5A 3N2ZB 4TZTA 1TJ3A 4L6CA 1CIJA 4HUJA 3H0CA 1SCDA 1P4HA 3RUAA 5EJEA 1BO6A 4AVYA 4HXGA 5A71A 3H8VA 1BVHA 2NUAA 4MO9A 5CBKA 2AC2A 2NVUA 2QE6A 2YIJA 4A5SA 5CB4A 4KMOA 1E79A 2OLJA 1P75A 2QYTA 2P4HX 1TU4A 2G5TA 2O1WA 2ZI6A 3Q9NA 4X91A 3C3AA 1S3IA 3DPSA 4WCVA 2OKGA 4V0LA 3WKEA 4J9UE 4QOIA 3HM9A 4ZD6A 3TTTA 2IK8A 2VP3A 4L15A 2ZSAA 4LBYA 1L4KA 3VRHA 1JDVA 2C2KA 5FBHA 4DWJA 3FOEC 4K6OA 3RS5A 1I7PA 4NSNA 4P4GA 4YPOA 2H1OA 2B37A 2NQTA 5LLTA 2BY4A 1KI3A 1AVTA 1KAEA 1GAEO 3Q7TA 1CEYA 1G4HA 3BGIA 3QXGA 1VIYA 2JIZA 5EJ6A 3PGXA 1ZEJA 4K6FA 1HDCA 1R8XA 1NHGA 2OBBA 3JWPA 4IH1A 4KQJA 4MYSA 4N5MA 4ER0A 3CEPB 1XZ8A 1J4AA 1E20A 2FUCA 1VLQA 4D9MA 1E63A 1P18A 1P8JA 2EBHX 2WWIA 1E62A 1ODKA 5J2UA 4FFBA 4L22A 4RABA 5F7ZA 2X0FA 4J16C 5FPYA 1RQLA 1PF7E 2GD1O 2SICE 3NYWA 5DGDA 4ZDWA 1D9ZA 1Z29A 2V1XA 2APJA 3MCTA 1C3OB 2QD1A 1I4LD 2VJMA 3WY9A 3E9QA 4REMA 1DADA 2L0XA 5LB2A 1CDZA 3A36A 2HSDA 3HFRA 3QG5A 3A4YA 2RAUA 1MAHA 1ZR2A 1N6LA 3ER6A 3DWFA 4GNRA 1DE0A 2L69A 1FDIA 3AEUB 3HRIA 1NBAA 3GLQA 5LQMA 3QKUA 5A0TA 1F9EA 4FDVA 2Z58A 3PQCA 3HUDA 3L4EA 4KQ9A 4I9HA 5T57A 4O4IB 5B1SA 5GIPE 4E08A 4RPIA 1Y9DA 4P36A 1UBHS 1W4AA 2QD4A 3HKCB 4K9LA 4LJRA 1P7PA 1NNSA 1QIHA 2F1KA 1GCIA 3LHFA 5EC8A 5AJWA 2X2EA 1E4OA 4KQMA 4JJZA 2GH1A 4KWEA 3L4SO 4L57A 1CTQA 3PT5A 2FPUA 3LUCA 3WLHA 1VP3A 1E1CA 4RZ3A 3THXA 3UO8B 3K70C 3D43A 1OX5A 2GHQA 4OKIA 2OD9A 2BGNA 2HTFA 2P67A 4OUDB 1YQDA 5ERXA 1YVUA 4XDYA 3SKXA 2CHVA 4AQ7A 1DFIA 1ZI9A 3AGPA 5B1YA 5L9AA 4RKEA 2VK1A 5FORA 1A2QA 2P2DA 4PPYA 5KOHA 5CDHA 1P2SA 5C80A 1H2BA 1QRTA 4FSDA 1G21A 4OATA 3E0QA 2OILA 3TBHA 2NYVA 3C1UA 3MJFA 4BB0A 4EMBA 3P9XA 1Z16A 4RTLA 1MMFB 4CNBA 5BSWA 4J7XA 3LT2A 3WWZA 2Q4EA 4OI0A 2CLFB 4NCKA 4PPGA 2V7PA 3QU5A 3RQIA 4AJIA 4H4CA 1EFVB 5B1DA 2GZ3A 2MSEB 3QKRB 1OV4A 4M99A 4N7BA 3ROKA 3T7CA 5JSKA 3U2QA 1KIFA 3MWGA 4EUNA 2JKYA 4XIGS 3I53A 4A4DA 1M33A 4MW6A 2BGGA 2QRQA 3PF8A 3OT1B 4Y1RA 5ANRB 1DIHA 4B82A 3VKWA 5EIBD 3WI7A 4MLCA 3JZIA 1R0LA 3DC7A 4JI5B 1SKBA 4BVLA 4HNTA 3KOZA 4QARA 1GPMA 1YS2X 2JIRA 1V16B 4KLCA 3DW1X 1UBRS 3WGGA 3IQXA 4IJ5A 4WESA 3IPRA 3O0TA 4WZAA 4EAAA 5ITZB 3SHWA 5FI5A 3IVAA 2HGZA 1MJHA 3LC0A 2ZW9A 2UZ3A 4HJRA 4WLUA 3STTA 1GT6A 2IVZA 4V1CA 2XMBA 4O5OA 4YA6A 3JQRA 2VRCA 2FW0A 1V11A 3V97A 3D1LA 3AI1A 1DUVG 1L5ZA 3KJQA 3IQGX 4FEYA 1DBSA 5NULA 4EY5A 3INTA 4RM3A 4MYRA 1A98A 1UEXC 3ICVA 1G5PA 4A0SA 5FUMA 4HB2A 3WNBA 1W48A 2LNDA 2Q4OA 1LSUA 3GN2A 3HJRA 5FTMA 1JEAA 1DQZA 2C94A 3LVFO 2GCOA 4U00A 1LTKA 2GARA 4GFDA 4QJ5A 3B9RA 4B2PA 2BLNA 1ZISA 2PSEA 4MEBA 3RK1A 1DV1A 4ON9A 1AK9A 1WRBA 2ID4A 4LKRA 2DFKB 4FNAA 4QULA 2CHEA 3NHZA 2J08A 1FFYA 4P9NA 5JCOC 4JKOA 3MWYW 3SQLA 4PGHA 5AJXA 3CPHA 3ZBUA 1ZL2A 2R8OA 2H9IA 4RQUA 5AKYA 4POAA 3FJYA 4E33A 1ZUIA 1WD5A 1XPRA 1XEXA 3CX8A 2JZNA 3TLBA 4KPFC 3ZD7A 2X4DA 3LW8A 5L95A 2BDUA 3BSSA 1F9AA 3CLSD 3EUWA 4HC4A 4MQEA 5LDGA 5LQUA 1YRQA 1L1EA 1XSEA 3K8YA 3WL5A 2Q8NA 1F2DA 3UAVA 2H4FA 3AJ9A 4B7CA 3HK2A 3O8QB 3RRNA 3R7AA 4MITA 2I6SA 4ZKEA 1KJ8A 3DWGA 5IJAA 5TT1A 2OYCA 3TQHA 4RFSA 1ZVQA 3E70C 2YXDA 3AEQB 4OHVA 4PG8A 3ZV6A 3EB9A 1F2UB 4HLNA 3NUZA 3L8ZA 5FYQA 4TRNA 1ETHA 5KVVA 1JA0A 1Z2CA 3DZ8A 4YP1A 3C7TA 3BMCB 5KDLA 4XOIA 3LGXA 4ARIA 4BVKA 1OREA 2GRJA 3GH3A 3EZ6A 2C2MA 4UFNA 5K4GA 1QU3A 1R6XA 1JX6A 1KI6A 3H2BA 3ZD6A 3B1FA 2CNDA 4EJ2A 5LBIA 3NCTA 4LC0A 3VSBA 3N6VA 1W0KA 3K6RA 2IY9A 3MJ4A 3GLHA 2LV8A 1LLQA 2MSKA 4M0EA 4RIEA 4EG5A 3EDOA 3JQ7B 3ZI0A 2IXGA 2C4UA 1U3FA 5HA5A 5JNLA 1J0AA 2I6TA 3RSCA 2CFTA 5AJUA 3KQYA 1IK4A 5EMMA 1W52X 2Y0DA 4EB6A 3Q8WA 4EBFA 4TMWA 2POQX 3AEKB 3CH7A 4FMDF 4R81A 4MA5A 2YHUA 5EWLA 1L5WA 2PL9A 5LP6B 4AKIA 4JYCA 1IM5A 3EVGA 3NBYC 3BTUA 2DQ4A 2QN6A 2EFGA 2RCYA 3M33A 3DA8A 3N6XA 4PWZA 2XDYA 1HEUA 3HU2A 4CBVA 4LF4B 5EESA 2CNNA 3IHLA 4DCGA 4LZJA 2Z2IA 2ZI3A 4G9EA 2B3TA 3S28A 4CUJA 5IAOA 2HWXA 5SZIA 4CG1A 3C6ZA 3CRVA 3EGOA 4FX5A 1U3CA 5KAMA 1GNTA 2E4ZA 4MQMA 1WS6A 4RF5A 3AF2A 1UBSB 1NVXQ 3PXCX 3ZIUA 2X19A 5TDHA 4DF3A 2JF0A 3PFFA 3PICA 2RK4A 1EA5A 2JCGA 3I30X 2EP8A 4GR5A 4JR2A 4LSGA 5FHQA 5BV2P 2DBVO 2ZYWX 4URFA 4U7WA 3SIPA 2QTFA 5KTSA 3S1LA 5ALNA 4KNVA 3ROTA 3NTQA 3G59A 1S2DA 5FPHA 3V55A 1MV5A 4YJ2B 3TTVA 1I01A 3K35A 3H6HA 1K3FA 3CR3C 1J1IA 4N40A 1MXFA 5D5PA 3U7IA 4EW2A 3IKLA 5B1EA 8MHTA 2C3YA 3FTNA 4XJTA 2AOTB 4ZVRA 4TTAA 3GUUA 3VOTA 3FVVA 2FEKA 4FI3F 3KB2A 4ND2A 4CDMA 5I7FA 1TYCA 1PO7A 4YI3A 3UV7A 1ABBA 3P0EA 2WFLA 3F71A 3C3CA 1ADJA 3HJGA 2AMFA 3OJFA 4D0GA 4ENUA 1CERA 5LMNB 1JFSA 2J32A 4KR7A 3EH1A 4P93A 3NHWA 4BJ5A 5FWNA 2EP7A 3VSAA 1QIDA 1O94A 2KWIA 4PX3A 4IHJF 2JA1A 3WMXA 1SOUA 2DKOA 2OBNA 1GTG1 4FD2A 2XRFA 1S5PA 2ZRIA 3H0EA 4OEHA 4IUBS 3AERA 3ENQA 4ZVKA 3LK7A 2GNPA 3WLFA 2XGGA 3OF3A 2W2LD 1KAMA 4JJGA 1M34B 4QTTB 4AY3A 3C1AA 1VCIA 5ALPA 1HFEL 2E37A 4AUEA 4QDUA 3ZYZA 4YUXA 2CV0A 1GZ6A 1C0PA 1KBOA 2VWHA 1LDNA 3MGBA 1BHQ1 1UFVA 2VPPA 1G5IA 2VK8A 3R24A 4ZC1A 4EFDA 1ODCA 4DHEA 2XSZA 2NXWA 2EFJA 2AMYA 2YH2A 4I2VA 2YV5A 5DNEA 4OGKA 4KO8A 4FFLA 1O3YA 5BOSB 5PNTA 4MVJP 1UKCA 2V6GA 3KVNA 4WK4B 4YRLA 1M2KA 2W37A 3WYDA 2P9BA 5DDIP 4PYJA 4TTIA 3QVGA 4INOA 4P7BA 3V8RA 1MB3A 4JKYA 1LNZA 1E2KA 3BH6A 3PT9A 1Y6ZA 1A3CA 1QHSA 4LBWA 1VE7A 4OH7A 3ROZA 4EDFA 5LQRA 3C15C 2WM9B 5I4BA 3JY6A 4RH0A 1XDWA 4B6PA 2WIAA 3G5TA 3NBFA 4KQCA 2PNJA 1TDJA 3QE9Y 3FZGA 5F21A 1I9GA 2BL4A 5AT1A 1YU6A 2A5DA 3A3OA 3ZQJA 1XV5A 3H2JA 2B0JA 3GFGA 3HA5A 3NJRA 4X0EA 3UKDA 4AJEA 3NHFA 4LXQA 2PCLA 4JASB 5K8VA 2YTZA 2P77A 2NYUA 5CDFA 4TUYB 4DRXB 3OJOA 2NVOA 3AKCA 5BMVF 5JAPA 3OIFA 4MYHA 4EW1A 1PFUA 2F3PA 4W6QA 2P1RA 3KB1A 4R4JA 1O95A 3VNBA 1P1CA 2BKLA 2QAJA 1ZVKA 4WJZA 2EIXA 4WKGA 3OTWA 3SXJA 2F9MA 1I33A 2Z8XA 3D7RA 3N58A 4MGYR 1Z4LA 1Z8DA 2R25B 2XMDA 4XYMA 3DNMA 2QT1A 4QOFA 1GZSA 2ES4A 3GZ4A 3GXBA 3GAZA 3A8TA 3CKMA 2NSHA 2MHCA 2BFBA 1Y6RA 1OFTA 2VYNA 2Y99A 3FGPA 1RWQA 2CJFA 3A04A 2IKQA 1ZK4A 1FQKA 3OIDA 1M75A 4PQRA 3N8DA 3RHZA 3U1TA 3FHLA 4FHZA 3FIUA 3O74A 3MWEB 2IUYA 5JS2A 5L3VA 2BFOA 3UKOA 2BFNA 1ZJ4A 2RARA 4MCJA 4ITRC 1F8XA 3UJHA 4FXPA 3OEED 1Z5UA 4GPZA 4GKJB 4OHRA 5FPKA 2P8SA 1CF4A 1EFRD 2F55A 3JQBA 4FWBA 4RS3A 5AKEA 4TS3A 1K7XB 2P9FA 3ZNNA 1DCMA 4DXAA 1Z73A 4YMIA 4ENQA 5J1TB 3SQMA 1QP7A 5H02A 2CDBA 1UDCA 4YAGA 1DTWA 2G5PA 3LYAA 3FCYA 3S27A 3T54A 4B8WA 1MOSA 3IUYA 4ZT6A 1VPTA 1X1SA 2J9XB 3ZCUA 1NI4B 2MSLA 1F0YA 1C1DB 3EGCA 1IDOA 1UBOS 3MS7A 4KGDA 3FAKA 1CUHA 3WK5A 2JIQA 5BVHB 4DAOA 3TGPA 1VSVA 3X1YA 4W9RA 2PGDA 4QM7A 1F0NA 3N8IA 4GNKA 4N76A 3HVJA 3HEAA 3H19A 5ALYA 1RWXA 4RFVA 2VYCA 5K2OA 5DEIA 2VRCD 2YZKA 3WGQA 1MJFA 1JYFA 2YJTD 5KIAA 1VL5A 3KQKA 2DHDA 1TRHA 3WK8A 3CZAA 3HCDA 3NDRA 4J6FA 2HRDA 2ZYIA 4DY6A 5H83A 1P2UA 1UJNA 4IH9A 4S1PA 1NFFA 3V1YA 3NOXA 4MKHA 3UK2A 2R85A 1KEUA 3I5AA 3AF4A 5JISA 3SVLA 4JXZA 3BFPA 1WQ4A 2BUAA 4HNRA 1QVAA 5ESXA 1Q57A 2RHOA 2WIJA 3Q12A 4AMVA 2CZCA 2VXBA 5DYNA 3VPBA 3WXBA 5BP7A 2FVYA 2H9AA 3FA2A 1MAAA 4PCVA 1HDXA 2VSYA 3IOYA 2W58A 4TZKA 1UKEA 1TZKA 3QVVA 2R8RA 1L2TA 1YDGA 2QG4A 2WKSA 3CW2A 5JD4A 2RGGA 4NEQA 5FFNA 2I2AA 3OT5A 2FPSA 1FXUA 4QEKA 2JA2A 2FSIA 3FIJA 1QTNA 2B34A 2H7YA 2RMKA 4MARA 5CM2Z 4QE3A 5EXDA 1X7ZA 3UAYA 1CQIB 1W2GA 3KU4A 4EUFA 1EXDA 4ZT5A 1YE8A 4UJ3A 2E87A 1GQRA 4X7RA 2IUUA 1W36B 4NMLA 1X8LA 2R751 1Q95A 5GAJA 3D2BA 5DGTA 4E6PA 4US2R 2EW8A 3HLTA 3DLAA 2WMNB 5KMGB 4FFSA 1XNJA 4NU5A 3T4UA 3E9YA 4LY6A 3W4JA 4R98A 2JFQA 2D59A 1JQAA 5A0FA 3CURA 4FIDA 4MPDA 4JNCA 4MV3A 4DW8A 2WFAA 2XCOA 4HFNA 3WBBA 1CE8A 1KF0A 4JSYA 5C8DA 4ARUA 2HHHB 3DH0A 3Q7IA 4FDAA 1NI3A 3OPYA 1RTTA 4JDPA 2HJVA 1PYDA 2Q2NA 5EYPA 4BQSA 4EFKA 2JLWA 3CPEA 4QSHA 3M82A 4BO0A 1U2ZA 2JGFA 4J0DA 3X1WA 1U0BB 2B20A 3UJNA 4E3ZA 2WM2A 1NW8A 3IOEA 4TL9A 1QFZA 4Q3CA 3UEOA 5HOEA 1I51A 1H2WA 4MVWA 4D4GA 1UZAA 2OESA 3P97A 1WKBA 2QN7A 3D6AA 2VQSA 4WKPA 3PVCA 4EO7A 1JJIA 4XIIA 4B85A 2XBUA 3E7FA 4HTAA 2VYQA 4JP3A 1P3DA 1VB3A 5IH3A 1F51E 1E5TA 4B6FA 3PIRA 4GT1A 4KWHA 4JX9A 1OXVA 3GRFA 1VRVA 4RX1A 5FQOA 4Z51A 1E59A 1QBKC 5BN4B 2GN4A 4CQLA 4NULA 4YDHB 5L3SB 4A8JA 2FU5C 1Q6YA 1U98A 3TYXA 3NUQA 4CR8A 2O8BB 3FTFA 2GEKA 1JEEA 2VSNA 1IHUA 2H1IA 3DAYA 2QM0A 5B2ZA 1M7GA 4WJLA 1G291 1G8AA 3N39C 5FTLA 2JLUA 3A6GA 4FI3C 1V0JA 3DQPA 3TUJC 1LQTA 4F2DA 3KHUA 3VPDA 4X44A 4KGZA 4ZI7A 3KTDA 2KSQA 3DXZA 1SXHA 1XDUA 5DCLA 1P4JA 1OH8A 1C30A 2Q3BA 2WA1A 4OHXA 1CBUA 3AVYA 5HZKA 5AW8A 2NSJA 2XQKA 2JJ1A 2GWRA 3N2KB 3ZNQA 2XJ4A 3THRA 3OCJA 4B47A 3RS7A 1BMTA 3Q0TA 1I6KA 4GGPA 5KEIA 3CMCO 3JAKB 4GRDA 1E1YA 3CLTC 1JG1A 2CKDA 1BU5A 1TW2A 1IK6A 3PUZA 4IMRA 3BF8A 4TQAA 3B7PA 1A5AB 3BIJA 3SEQA 4NCXA 3ZXSA 1O58A 4OXRA 2PU7A 4CLRB 2E55A 3FLBA 3W5HA 2NM0A 1IL0A 4KMSA 4OAOA 3ZUPA 2K7FA 3LFUA 2R8BA 3LVQE 4JJIA 4PSVA 1RLMA 2W8BB 5ALMA 3N76A 3RNLA 4A3SA 2Q6OA 2QTLA 1C8LA 1GSOA 3KZCA 4PGAA 4D6YA 3N2EA 2GESA 1WQ1R 3D1VA 2E1RA 3GARA 1A5BB 4GRIA 4J0IA 5FI3A 3WMWA 4WBNB 3E15A 1MGOA 2G70A 2PV0A 5IU6A 1HTBA 4HK4A 4MGIR 4C0KA 2H6EA 1HG0A 1A9XA 1DC5A 2E7ZA 5AHRA 1GGFA 2V6BA 1UT6A 3F2VA 3GGCA 2W4IA 3GJSA 4JS0A 2JGEA 1DWUA 2SKCA 3VJMA 4E03A 2XB2A 1H2YA 3GFSA 1MN6A 2HIGA 2JH3A 4BGDA 3Q9UA 2RD2A 3T15A 4A23A 4EA7A 3OECA 1B73A 2FZ5A 2GF2A 1XN4A 5FWYB 3UAOA 2A94A 3OFJA 2C77A 1NXVA 1MXHA 1JDBB 1YJAA 3I4FA 2VT6A 1E1QA 3GEIA 3GRVA 2I9KA 2BONA 1B6GA 3PRYA 3I8SA 1SD2A 4GC5A 2C2HA 4ZANA 1X86B 2HL6A 3BDVA 2AC4A 3UWSA 4M1MA 2I4NA 2Y9MB 1ZM3A 2WUGA 2R7AA 3H9UA 2H2DA 4UBMA 5HKBA 1QVWA 2CXXA 1U8CB 4UEQA 1OHHD 5IXYA 2FMIA 1U2EA 2YMLA 1MW9X 3UMFA 3ZHXA 3AWIA 5FL7D 5GZ3A 3LU1A 1CUBA 1VL8A 1GADO 4FLFA 1ZH2A 4I4TF 4YP6A 4QJ3A 1T2VA 1U3VA 3K0FA 4UC0A 1Y8QA 2JLRA 2LCQA 3PNMA 4OHWA 721PA 3DOFA 1X8XA 1ULUA 1HXHA 2DFPA 2JI9A 4MW0A 2NGRA 4NH0A 1FP7A 3AYZB 1FE8A 2JI4A 1R9NA 1H0KA 1M74A 4YCCA 4HAYA 2G83A 3NX4A 2VF8A 4OXYA 3FZNA 3HWWA 1PZXA 4NZNA 3V8VA 3DBRA 1C8KA 3ISTA 1PNOA 2YUIA 1PR4A 2PL3A 4UHEA 1DAFA 5KO2A 5C1DA 1A1VA 1LPSA 1MJ5A 1ZEMA 1JIXA 2PRYA 4WL0A 3VU9B 1GQOA 1L5VA 4BOYA 3C2QA 1NFQA 4RPKA 3H5RA 2PSSA 1HLFA 1S8AA 1UJ5A 1WTCA 1Z6PA 3ICEA 2C2XA 1ECCA 5BYBA 1YB1A 2VQDA 1G21E 2REOA 4TN1A 1LLFA 1I3CA 5B7NA 4R31A 2ACEA 4EY7A 3W3AA 4DCUA 5CLFA 1ZD3A 1BHJA 3L92A 4MAFA 3QFSA 3WK7A 4GOKA 5EWMA 1FX1A 3F74A 3LPAA 4AG6A 5EJ9A 1NF9A 3EIUA 3QRWA 4U6QA 3BILA 2C7BA 3UGTA 1XVVA 1K6MA 2QAGA 3T38A 1L7QA 3I01M 4N5LA 1ADGA 3RYTC 5BWBA 5T6MA 1D2NA 2C4KA 2PM8A 3ERCA 2ZQZA 5FA5A 3PXGA 2PUFA 2NXCA 4IHQA 1MOQA 1X9GA 5JVDF 4QBIA 4YRAA 3OX1A 5KS2A 1PV4A 1GTVA 4A10A 2X4IA 4IHKA 4LNAA 4PTLA 5EXSA 1WU8A 4B4DA 1G38A 2UYGA 1VG8A 2VP0A 5A3JA 4WN9A 4C1NA 3E7XA 4DDUA 3SOPA 1R3UA 1R0KA 2JHPA 4YJHB 1K2WA 5E0OA 4D9HA 3ABRB 3EC7A 1G2IA 1A4XA 3G2IA 3SSAA 1QSGA 4J2OA 1D03A 4JSRA 2UZ4A 3I39X 3ZDRA 1ZL0A 4FFRA 3VR4A 2DWQA 3M5CA 1N6RA 2AEEA 2H0RA 4DVJA 1R6VA 2OUIA 1D4OA 1L5OA 3IUEA 7ABPA 4KR9A 3I58A 1E3TA 4PN7A 1N77A 4FR2A 2OFXA 3EDCA 1GRCA 1UZMA 2CNLA 2YYAA 3SJUA 1JHXA 1Y4ZA 2W2NA 3IYLW 3WGLA 5EIEA 2W83A 1AIPA 2NU7B 3BX1A 5IM5A 4Z4IA 1V5EA 3NAMA 4FGSA 4BLQA 4QUDA 5F3DA 3BKWA 3RYIB 3B1XA 1C4XA 4YIHA 4HWTA 2GJ8A 3FH0A 2D54A 5BXYA 1XUOA 1L3IA 5MN5A 2JKZA 1A97A 1SIWA 1G6HA 3CNNA 1PUJA 1HORA 1U1IA 1WPQA 3KT8A 4XQGA 2HA5A 4V0SA 2IKSA 5C8VA 2ZEJA 4PXYA 4AWBA 5TRTA 4MUGA 2R6DA 3OM1A 4RGQA 4WCFA 3KPUA 4BZZA 3LVBA 2Z09A 4JAVC 2MOKA 1ABEA 5KYXB 2OHXA 3UT6A 2JJ2D 1OIWA 3C45A 4RE6A 1Z4OA 4IXNA 4YQEA 5E3HA 4G4GA 2ZR9A 4E2FA 3SZ3A 1DKOA 1F20A 2CLSA 3H9GA 1ORIA 1IUOA 1E8MA 1ZRHA 5TX7A 4F3NA 3M6WA 3CEHA 3EF0A 2PL1A 2Z98A 1XO1A 4FMPA 4KYUA 3AVUA 1A71A 2HEIA 1P4RA 3W90A 3WNCA 2VDKB 3ZS8A 4W5TA 5DJ5A 4OJKA 5AIAA 4CM5A 1EAMA 5BRAA 5ITVA 1FZTA 2I55A 1VMKA 3GLHE 4AYWA 4FM9A 3CJRA 1NUPA 1BYIA 1B3RA 4MV0A 3TNJA 5EQFA 1YVDA 1SM4A 4KREA 2IX3A 4DMKA 2NQ8A 2P6UA 5K8JB 5AJHA 3Q3IA 3V6MA 1ECJA 3VO9A 4B2YA 4RA6B 1V25A 3AHDA 3PE6A 5ESDA 1QWOA 4ANFA 1SKQA 3UN1A 4WZBA 5CU7A 3PA6A 1QHYA 4UTPA 3PC8A 1EUDB 1I4TD 1Q44A 2P91A 1UBNA 1TJPB 3GEGA 3HUTA 1TVCA 2V7QA 3L0BA 4Z0HO 2WSSD 1VPWA 2O2GA 3E5NA 1QKKA 1Z68A 3KQUA 1Z63A 2D2EA 1RHQA 3N70A 5SYAA 4OAPA 1YHYA 1EFKA 2OD2A 3ZDXB 3K96A 1VCHA 4DEYA 1ZGBA 3IUSA 2DX7A 4UQOA 3GFRA 1ZJWA 3UVEA 3FOWA 2O3RA 1W5FA 4C6TB 1TUBA 3A3KA 3G17A 3M6UA 1CR6A 3FOAA 3NVMB 4Z7JA 1JTEA 4E4YA 1O6BA 1NLFA 2BEKA 2UAGA 4R16A 3KO8A 3HYRA 5COBA 4ETIA 1IXZA 4B0PA 4E5KA 3TFWA 4H16A 5DM70 1QYRA 4NENB 4ZVQA 3Q88A 1QFJA 2DWUA 2WYOA 2ZIGA 2WY2D 2QGZA 4DA8A 4ZCRA 1PN3A 2ECPA 2WFMA 2HIHA 3PHCA 4N54A 1B0UA 5ADHA 3REOA 4UHBA 1UMBA 2WNSA 2O05A 4XAQA 2CL6X 2FUEA 2QMZA 3W6NA 3WMEA 1YULA 3ZE6A 2JK0A 3AH8A 3KD3A 4DADA 3FVTA 4GGMX 1LC0A 4A16A 1M6EX 3TQCA 3DO5A 1ZD2P 1UBKS 2B9VA 3B1YA 3O9MA 4B3BA 2ZSBA 2DQSA 3LUDA 2FRXA 4MQ5A 3MIIA 4M1KA 2CFSA 1QS0B 2COKA 1R88A 1PR6A 2OD7A 5H16A 1J23A 4HLQB 4Z4EA 1E6KA 4DB4A 2V8OA 3CISA 3USCS 3ZZ0A 4DEXA 5AVKA 1R6TA 1QH1A 3E48A 3IQFA 3O2SB 4WH0A 3I8OA 4GKAA 5J1SB 2CFRA 3CZ9A 4YV1A 4LWZA 4AP6A 3ZE1B 1S4MA 1XLTC 4W1QA 3WHPA 4HKTA 1XF9A 4Z6KA 1UDXA 3X1JA 4TS1A 1CP2A 2CK3D 3TMAA 4PC7A 3BJIC 1YHZA 1P1JA 3DO8A 4CMGA 5K0FA 3HCCA 1NLMA 3LXRA 1DBRA 4HGRA 1MIOA 2EKZA 1M2NA 2H0QA 2HJ9A 4CMBA 2TRSB 2IY8A 3NNSA 4UOEA 4CKCB 3ZPXA 1XDZA 3ZXUB 4W4TA 3ZZMA 5BQOA 3N0XA 3QPUA 2IP1A 4ZIRA 3HJUA 3NBKA 4HQRA 1TMYA 3LKZA 3W5JA 5B7PA 5IBCA 5JCXA 2JAXA 2ZWVA 4Z7NB 2ZYDA 5A6SB 2ODWA 4PBRA 1SPBS 1OWPA 1NJ6A 1Q7TA 4NABA 2ZZNA 2I2XB 1USUA 1HBJA 4FMCB 4UZSA 5DN9A 2IQ5A 2EBUA 3GGDA 1SBCA 3L0IB 4R7TA 3WK9A 4BBJA 5CXQA 1Y5RA 4IW3B 5JJIA 1EIZA 3OF5A 5JU6A 2IS2A 2GT1A 1GZ7A 3L0CA 4AMZA 4QYMA 1RXSA 4Q34A 3G5AA 5HQJA 5JCJA 3EHEA 4FYIA 3D4PA 1XNQB 3FFXA 4W63A 2BFAA 3I2HA 4LJ7A 3TSWA 1H4SA 1XQ9A 3Q8MA 3W3ZB 1RWOA 1FRFS 1C7RA 4M49A 2OE2A 1XMVA 3ETJA 3TW8B 4B9EA 2QMYA 5MDHA 5JW6A 4WFJA 4BX9A 3FAZA 3QVWA 3VPGA 4A2CA 5CDFE 1UDWA 3H2SA 1F38A 1S2OA 3A28A 1JQDA 3OLXA 4KH0A 1SKMA 2V8BA 1GQ2A 4XD7A 1KY4A 1UJ4A 3HCOA 4KJZA 4LBVA 3FKSD 1L7NA 1QTIA 1U81A 1XTJA 2AYXA 2VVTA 4UM7A 1T6ZA 5JRZA 5LNK1 4JLDA 2ID9A 2H1VA 2ZJ0A 2MSNA 2XNSA 1H8HA 1OV6A 1VKNA 3JWEA 4QNRA 1C9NA 1EQUA 4MQ4A 4DL9A 1XTIA 3O9VA 5TPZA 1KL7A 2YXPX 3E8SA 4GQAA 4R0NA 4EZEA 2HRQA 3JD2A 2NVBA 1OH7A