2IYQA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate and adp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 61
structure length 166
sequence length 166
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyqA00
1DOAA 1S0UA 1QHGA 2GZAA 2QAGA 2GETA 5LPNA 1QHIA 4W5HA 2FDCA 4BUJA 4GZLA 2ZRNA 4OQLA 1QG2A 1KDRA 2IYVA 3SQXA 5G3YA 3SHFA 3IQXA 2WAXA 4KXFB 1S96A 1IXRC 4U00A 2IWRA 4Q9HA 3VFDA 4JVMA 1P75A 4UJ3A 3PEUA 2V7QD 1P2SA 3VR2A 2GXAA 2FA9A 2IXGA 2GEUA 2Q9AA 1O3YA 3Q7PA 2BJWA 1FOEB 2BKEA 3QI2A 4B3XA 2DFKB 5SZJA 2D3WA 4LYFA 4PANA 5DNYB 2HF9A 1KO5A 1E9DA 3H4MA 4HAUA 3IO5A 3TRFA 1EWRA 4KI0A 4X8MA 2XOKA 2BBTA 3GLFB 4URYR 4CVNA 4N3NA 2LWIA 3LY5A 1FX0A 5FOVA 4NKRA 1JAHA 4ZKDA 1SVOA 2FFQA 4B35A 4RD2A 3NBZC 1U99A 3PXGA 4A15A 2QT0A 1SGWA 1PLLA 1UBFA 3D3QA 1RIFA 2ZJ2A 3CPHA 4ARZA 2GXSA 3QF4B 2FF7A 4RJLA 4Q21A 4YONB 3NHBA 1YR8A 5EE0A 1DS6A 2ZJ8A 3WYAA 2O8BA 4C30A 3U3RA 4MYHA 1V43A 1TL7C 2RGAA 3W90A 2YWHA 3WY9A 3UG6A 4MGZR 3WYFA 4A1FA 1E1QD 1UBCA 3W3ZB 4AC9A 1E1RA 5FH9A 1W4CA 1N0VC 4JSYA 1NN3A 2GCPA 2O8CA 4HATA 1CR2A 1J8YF 5HR5A 3ZYCA 3OZXA 5FTLA 2R44A 4WZ6A 5DISB 5FTJA 1T3HA 2EW1A 4BFUA 3RS5A 4AKGA 2J9RA 3BIFA 4TYNA 3TUJC 1LB1B 2BDTA 2G0NA 2ZE5A 2ORWA 1ZNWA 1XD8A 4F4CA 4M4SA 5FBRB 4QJ3A 3PUYA 1UKVY 2WM9B 1N2CE 4QKQA 3NC0C 2CL7X 3SBDA 2DB3A 1ETUA 3EIQA 1VMAA 2WTUA 1KDOA 1Q1ZA 2IT1A 3MRSA 4TYWA 4C0JA 5KTYA 3KL4A 1E96A 4RFSB 3OEHD 5CLLA 3RVBA 3HR7A 4AURA 2IEZA 4HAVA 4B6EA 2F43A 1V5WA 4LBYA 1R8QA 1GILA 4UKDA 1GL6A 4JLJA 3NTUA 2Z0MA 4D4MA 1II9A 1U90A 1NJGA 1A4RA 2WBLC 1W2GA 3W5IA 5FOWA 4HLUA 3O47A 1NG9A 3HU2A 2H5EA 1U8AA 4RD6A 4V0KA 2GCOA 3QUSA 4ZV4A 2OXRA 1VYTA 1T5IA 2H57A 3B6EA 1S3SA 3SJCA 2P3SA 4M22A 1TMKA 4EIWA 3J81k 4KFSA 2V6IA 4G01B 1KSGA 4BEBA 1NVUQ 3GQBA 3QG5A 2YC2C 3KUCA 4ZDKA 821PA 1IN4A 1J8MF 1T3LA 4GFDA 1Q1QA 1P73A 2HUPA 1UFQA 1S8FA 1CF4A 1OYYA 2ZRFA 4Q4JB 4B6FA 3NBYC 3SFVA 3THOA 3B9PA 3MUFA 1XMSA 4GI7A 1XCGB 1XMJA 4BFZA 4NCIA 3IEUA 1TUIA 1VPLA 4Q4LA 1T9HA 4QXAA 5FTNA 3WP0A 1KMHB 1I4TD 1TNDA 1KGDA 2RHMA 2N42A 3T06B 1MV5A 2IYZA 1FW6A 4B76A 2IS4A 4PZYA 1E2NA 1NP6A 3CPJB 4XD7A 1XPOA 2ZI5A 5D3MB 4B43A 2DWPA 4M9QA 3VKGA 3RRNA 2AR7A 5BN3A 4TYYA 3EARA 4HDQB 1MR3F 1E2IA 2GJAA 6Q21A 3RABA 2BMEA 2C5LA 2G6BA 3FE2A 1XZQA 2ZRPA 3CNOA 3FFBA 1KNQA 2RAPA 1OSNA 3LX8A 4DIEA 1W2HA 3HPQA 3DPUA 4EJSA 2F1JA 2FOLA 4XWAA 2GCNA 3KKNA 3GLFE 2D06A 5IK2A 2ZJOA 4JLPA 1K8RA 2QBYB 4NHOA 4BLOA 3KJHA 1COWA 2J87A 4US1R 1CXZA 2QGZA 3SU8A 5J4YA 1A82A 1ZD1A 3EWAA 5E7IA 3O8CA 4AG6A 4LGMA 1I4LD 3WBKA 1W49A 1OH7A 2J3EA 4IEEA 3EA0A 3SOPA 4P4SB 1FL9A 3W6OA 2DYKA 2A7QA 2ZPTX 4H1VA 2ZI6A 2RGEA 1RJ9B 1JR3E 2DFLA 4DCSA 1FP7A 1IN6A 1Z83A 3KKOA 3WNBA 2GXUA 1GKYA 2F9MA 4ZCMA 3GJ7A 4DB4A 1D2MA 2CE2X 3TH5A 2F7SA 2ZRKA 3A4LA 2HXSA 4XH9B 1NSFA 3FOZA 1XRJA 2ANCA 3A1VA 3GEHA 4QGAA 4HAYA 1Z0IA 3DZ8A 2RGDA 2QY9A 3P4XA 3QNUA 1WCV1 1AS2A 3OEEA 5DIFA 3KQNA 4DDWA 4U5XA 3KFVA 2VHQA 5CIWA 5B30A 4DUGD 2OAP1 1FMJA 5JJIA 3HDTA 4JL5A 4BRUA 2REOA 1OJLA 3KJIA 3MWKA 3K0AA 3UMSA 1W36D 2F55A 2PJRA 5SZHB 1YKSA 4D4JA 3ZS9A 4PZZA 3WHKA 4QHYA 1GKUB 1Z6TA 4HUTA 4GOKA 4ZIRA 5FPYA 1JXOA 3HYTA 4NYMR 2EYUA 4MRRA 2B21A 2GK6A 3CX8A 4C0SA 3WP1B 2J46A 3O8BA 4BZQA 1C1YA 5CJ2A 1CJUC 2WWYA 2BC9A 2CJWA 1MO4A 2QE7D 5AJYA 2HYDA 2MSEB 1SXJA 1TU4A 5L3SB 2NO7A 2BBOA 2UVQA 1G5PA 4LJ4A 4BRWA 4WZAE 1XXHA 3IEVA 1FTSA 3R9WA 3V4FA 221PA 1N6KA 2HXYA 1N6IA 4P3YA 4OL0A 2GJ8A 1E4VA 4TLAA 3KXKA 2VP6A 4DWJA 1G7RA 2FSHA 3WMGA 4YMTA 3OFNA 1IM2A 1KK2A 2IS2A 1CIPA 2ZI9A 3ZVRA 4Z8XA 3SJBA 1LVGA 3VR3A 3LD9A 4II7A 3KTAA 1Q3HA 3C41J 1VCMA 1ZC3A 4LZZA 5J4VA 3ZGXA 4NMMA 2QU8A 2QUZA 1G5RA 1E2KA 1KSJA 2J0UB 2H18A 1GNRA 5AWFC 4ASUD 4JLNA 5JCPA 4NYJQ 1ESNA 3CWQA 2WPDD 1Q3TA 1ZIOA 1NY5A 3ICQB 1LW7A 1OFIA 2VBCA 2ZRCA 3N5CA 1MOZA 1WQ1R 3BXZA 3IPXA 4PSAA 2PEYA 2OFWA 1QVAA 2QSZA 2ZU0C 3SNHA 4Q4AB 1EWQA 3SN6A 1CRQA 2W2TA 1GRQA 4A0RA 1NF3A 4OBEA 4UXIA 3CONA 3F0TA 3Q5DA 3OF5A 2CE7A 3KQHA 4MKGA 3IO3A 3I72A 2IYQA 2Q21A 3CIOA 3IHWA 2WZQA 4MRNA 5CDFA 4QL3A 4YXWA 5GJBA 3SE0A 3UG7A 5E95A 3RHFA 4QGFA 4DZZA 2AD1A 4OHVA 2GHIA 2GEDA 2OAQ1 1ZC4A 3D8BA 2NOAA 4N0DA 3FMPB 4BASA 1F48A 3KQUA 4HB4A 2QGNA 5BXQC 4PC1A 4Y0AA 1H65A 2A78A 1Q1EA 3DM9B 4BFTA 1XU4A 1OH5A 5IF9A 1U8YA 1ZCAA 1CEEA 2DHRA 3GLHE 3PUWA 1PV4A 4L5BA 2ANBA 4HUQB 2V7QA 1UJ2A 2F6RA 4AY2A 2BM0A 1DG3A 2YNMA 3G5UA 3ETLA 3OESA 3QKTA 1IJFA 2FE4A 3K9GA 1KZ7B 4AKIA 1P6XA 3IBGA 1QHHA 3CH5A 2AXNA 4WVFA 1VG1A 2P6RA 1VECA 2W58A 5DHFA 1L4YA 3K0CC 3VHXA 3QPVA 4MRSA 3B1WA 3I8XA 1R5BA 2HCBA 5FUVA 5GVSA 2AKYA 1KJZA 4EDHA 1IY0A 2YVUA 3TAHA 1CS4C 1OIWA 5AJWA 2JLVA 3G82C 4RCYA 1Q20A 4PXAA 1HA3A 5EE9A 4P4TA 3ZIAD 3NXSA 2B8TA 2E1RA 3VNVA 4R71A 2MSDB 1U0LA 1ZBDA 2PMDA 1N6OA 5L8VA 3PENA 3QVVA 2PCJA 2ZSEA 3AB3A 4HYYA 4GL2A 2EQBA 2OCBA 1PLKA 2YC4C 4DJTA 1X86B 1ZM2A 1KJWA 2JCSA 1ZVQA 5UKDA 3ZVNA 1XTRA 3TGPA 3HPRA 3AVUA 1F2TA 2EWWA 2FH5B 3CO5A 4JVNA 2FEMA 5K8TA 2VH5R 4HDOB 1GG2A 2VSXA 1KI1A 4Q1DA 1NVXQ 4L16A 2GAAA 4ZDWA 2JJ8A 1NMXA 1JXMA 2NGRA 4G5QA 4GOJA 3U3KA 4LV8B 2MMGA 3QG1A 2V1XA 3VTKA 1KY2A 4XOIA 4LJ7A 1KO1A 5HCNA 2ZR9A 4W5WA 3VR1A 2OUKA 5JS7A 4LWZA 5CK5A 4GPTA 2QORA 5D3QA 1KI7A 4DLZA 4IJMA 2D7CA 3IPYA 3AUXA 3QKSA 1KYIA 3ZZ0A 4HB0A 4XSGA 1VYUA 2F1RA 2YHSA 1JR3D 2ZREA 3CWZA 4V0MA 1VG9B 2BVNA 4KBGA 5FUWA 5KSPA 4LBVA 3R9XA 3WNDA 3GJ0A 4EPVA 3AF4A 2IYXA 2ZE8A 5FPTA 3BS4A 4BLSA 1NMYA 4EUNA 2O8EB 3I92A 2CCJA 4PX9A 1OB2A 2CBZA 3M1IA 3THYB 2AWNA 2ZYUX 3JVUA 4FCWA 1KI2A 1XBTA 5KSZA 1N0UA 3QKUA 4OI4A 3ZZUA 3ZS8A 1TX4B 3GFOA 4OHYA 1RYFA 4YMUA 3B1ZA 3FHTA 2G77B 4FWIB 2ZE6A 3W8NA 5BW8A 3NIBA 4MKHA 4LDJA 4PAQA 4Q4HA 3QKRA 3CR7A 4XVUA 2E87A 2FX3A 3LO5A 1O87A 3TIFA 1W1WA 5JWHA 1CRPA 2OT3B 3TVDA 2FPLA 3LV8A 4PHGA 3SZRA 5J4KA 2RGBA 1XEXB 4QGGA 1OFHA 2WMNB 2EWVA 3AM1A 4B44A 2QP4A 5AJZA 3H86A 4LC1A 1XMVA 2ZYTX 4AWXA 5EZ5A 4PC6A 3U7HB 2VP4A 1E2QA 1P9NA 4DCNA 3ZQJA 1N5LA 3I5XA 3PEYA 3FVQA 4I1SA 4BWYA 3LFUA 1NVVR 2JEOA 2RHDA 3TSZA 2RGNC 1LF5A 1M7HA 1G3IA 4CT5A 5HZKA 5JWOA 2YWGA 5BN5A 1I2DA 2RMKA 4A0GA 1MABA 4IHQA 2J7PD 2G9NA 1ZM7A 2WKRA 1KO7A 2ZQ5A 4FW9A 5FI1B 1HT1E 1U2RA 3LBNA 4IFBA 2QAGC 3R8CA 2WSSD 4P33A 1F2UA 4DCUA 2XAUA 3NH6A 1OXUA 4KJZA 1G21E 3SHWA 3VR6A 1WA5A 2WOOA 1TPZA 2RKOA 2Z83A 3BE4A 3QEOA 1FMLA 4D6PA 5B64A 2XB4A 1RRFA 4D80A 1BIFA 1VKJA 1YRAA 1SVKA 4TLEA 1XPRA 3QSYA 1DAIA 1K5GA 2JIZA 4OJQA 2YZ2A 2OCPA 3KXIA 3KKPA 5DGXA 3VU9B 4B2PA 3A4NA 3T1OA 4NP6A 4H1UA 4OK3A 3RLFA 4E03A 5JBQA 3U60B 4BEJA 4B3DA 2C9YA 5GJVC 1N5IA 3EZ2A 4NCHA 2ZS9A 2RGXA 3LDAA 5KSYA 2R6DA 1AA9A 2WAYA 4JJKA 1NI3A 2E9SA 2FJUA 3CLVA 4HLCA 2OG2A 4F4JA 4DDUA 2FN4A 3IIMA 2CVFA 2GXQA 1JBKA 1ZJ6A 3AVQA 1OYWA 1JNYA 2JLUA 1E2FA 4KHZA 2WOJA 2HT1A 3CRQA 2IEYA 1KSHA 1S9HA 2Z43A 3RRYA 4D25A 2A5FA 4E07A 2F3TA 3T61A 1DE0A 1P2UA 4POAA 4NYMQ 1U98A 1ZCBA 2VYFA 4TL6A 5H68A 3TJZA 2ZRBA 4JT4A 3AGPA 2VL7A 2VHUA 3QXJA 3RC3A 1Y63A 3GJ3A 4TL9A 3BB1A 1WRBA 4C3ZA 2KBEA 1E9BA 4X8LA 2JLRA 4TMKA 3EASA 3C4JA 4TMVA 4ARZB 1VHLA 1RFLA 1RRCA 4A92A 5JECA 2R65A 4QOSA 5BYJA 4V0LA 1OLOA 1DELA 1G17A 1E9AA 4W5JA 1Z8FA 3OHMA 1Q44A 2O8BB 4L15A 1GL9B 2CXXA 2QTFA 3UANA 1NL3A 4Q01A 3U7GA 4D81A 4NCNA 2OEPA 4O0MA 4TSFD 3O8RA 3RC8A 2QEQA 4F4IA 4GMDA 2H7VA 4Q1AA 4B3GA 3CUEF 1CU1A 5KO2A 5JJKA 2IYTA 5F3WB 3A37A 4AYWA 1Z0KA 4ZDJA 2C9CA 2C2HA 1WE2A 1KNXA 1DAKA 2IWHA 5EP1A 3LAWA 1R4AA 1T3SA 1TEXA 3KX2A 5DI9A 4DHEA 3KQKA 3MAAC 2CLDX 4C2TA 3ADCA 4PC2A 2VO1A 2QL6A 2YWFA 2F1IA 3BBPA 3RYTC 2JJ2D 1TTTA 2KE5A 4HLUC 721PA 5JHHB 4ASUA 2QTVB 2GVDC 5EE3A 1G4AE 5FBQB 2CNWD 2F43B 2LKDA 2V4ZA 1QZXA 5TB5A 1AZTA 2ZR0A 2QRNA 2DBYA 4ESHA 1T91A 3JVVA 4YLGA 3EA5A 3R8FA 1TU3A 1YQTA 1AKYA 3F8TA 1EFRD 4EPRA 2YKGA 1KI9A 3BAFA 2GCOB 5KPDA 4U7DA 4DEXA 1MRSA 3QE0A 4Q9LA 4IEIA 5BN4A 3I62A 3ONWA 4OI1A 2AFHE 2IUTA 1MH1A 3PEVA 3DOFA 3FWYA 2A5YB 2GWHA 2ONJA 3B13B 2WJVA 1HTWA 1XJ0A 4TMZA 4CEJA 4DEYA 2J41A 2WMOB 5DN6D 4LJAA 2ZUBA 3L2OB 1N5KA 4EAQA 3UWKA 4C4PA 2C04A 3H2YA 4LYAA 1TF2A 4ACBA 4MKIA 2O8FB 2GJ9A 2XZOA 4OK6A 1NIJA 1S1CA 1S1MA 3D6TB 3W6PA 4A6XA 2IHBA 2WWHA 3VKHA 2FPKA 5B2ZA 1JB1A 5KYKA 4JKIA 4PO9A 5M04A 3DOEA 3CH4B 3L82B 4C7OA 1P4SA 4DXAA 3P4YA 1CLUA 4IFEA 3U44B 4CGZA 5DH9A 3HP1A 4TZ0A 2BCGY 5EP3A 2ZRLA 3ZVMA 4V02A 4RCZA 5GADl 1UDWA 3IILA 1RVDA 1D9XA 1G3MA 2KJQA 4RKEA 4RZ3A 5FL3A 3RS3A 4IRUB 1OXTA 3A6PC 2X77A 3QEJA 4EJSC 2W0SA 2CLCX 3B8HA 4JJZA 3PEWA 3PIRA 2OV2A 4HSEA 1G3RA 4WA7A 3FKQA 2IF2A 1G6OA 1KI4A 2PJZA 3GLIA 1G3UA 1T5LA 1XF9A 3RSLA 4CIDA 3SS8A 1E98A 3BJIC 5E7JA 2D2EA 3QENA 3OAAD 4IOJA 3REGA 3VX3A 3L0SA 1W47A 4A0FA 1Q1BA 3PCRB 4QBFA 4EJSB 4NCJA 4KV9A 4BFVA 1NN5A 1R5OA 3KKQA 2J7KA 3QXHA 2YINC 1II0A 1N6NA 1KSFX 3CZPA 4XIGS 5JSZB 4LSGA 5A4JA 4AIIA 3ZIAA 1R7RA 1Q0UA 3CRMA 1AKEA 3GD7A 5DO9A 4O2RA 4Q00A 1E2MA 3DZDA 3TUIC 1RZ3A 2QENA 5FBVB 1XFAA 4B48A 3THXA 4QJ5A 2VP9A 2VF8A 4FD2A 4LHZA 2FFHA 2OZEA 1IY2A 5TMPA 2ZTSA 3PUXA 3LH5A 4TMTA 4JSTA 2ZSDA 3RSOA 2EYQA 5F9HA 4PQYA 4MDEA 2QMEA 1W0JA 3EZ7A 4ZI2A 1K6MA 2BIFA 3SDZA 4G1UC 5HTKA 4DDTA 1GKIA 1L8QA 4MYCA 2PX3A 1FUUA 1CTQA 1E0SA 2V8OA 2PLRA 1KIMA 4IDNA 1NBMA 2ZSBA 1SQ5A 4DVGA 1J90A 2XEXA 3K09A 2H1LA 4LYJA 3B5JA 5SZKB 4LYHA 3UIEA 4S35A 1UDXA 3QF4A 5C18A 2BCJQ 3HU1A 3AGQA 5J47A 5JJLA 4RZXA 2O5VA 3L8ZA 4RSGA 4Z51A 1H8EA 1XJQA 4FMBB 1MO3A 3IGFA 3DMNA 3SFZA 3MJHA 3W5JA 4Q7MB 3K0AB 1H8HA 1SXJC 4PPQA 2ZRMA 4PTLA 4UNSA 5JHGB 1Q22A 4LV5B 2X8AA 4ZIRB 4LHYA 4G5SA 1YZQA 3VQTA 3V4RA 4TL8A 4FCTA 1OFTA 2NIPA 3K0EA 1FFHA 1IQPA 5EUMA 4EPWA 1XWIA 1J7KA 4S2EA 2CJWB 1II8B 1FUKA 2D74A 2IS1A 5L3RA 1VYVA 1SXJB 4FMDB 1XD2B 5IT5A 1DAMA 1MKYA 2ODEA 3PUZA 4FIDA 1XXHB 2FFAA 1W0KD 2IC5A 1KO8A 2QPTA 4CRWB 4Q7LA 3EPKA 1L2TA 2GEVA 2QTHA 3B60A 4LUCA 1OKKA 2NZJA 2VA8A 4B34A 4RFSA 4B32A 5FUXA 3T15A 2HLDD 3MWJA 5HZHA 5HPYB 1KHTA 3KXLA 4KLZA 3GLHB 3R9IA 1XD9A 1OFUX 4F92B 2CDNA 3KTAB 1Z0JA 1E2GA 3B7GA 1IONA 3EAQA 3L0IB 1XMIA 2XNDA 1XEWY 2B8WA 4CEIB 2P0EA 4WXPA 4GDFA 2FSGA 4AD8A 4E22A 4D82A 4HZUA 3M6AA 2WICA 3V9PA 2Q9BA 5EXPA 1KKLA 4Z54A 2HT6A 4M1SA 4DB2A 2ZRGA 2P67A 3F5FA 4A6PA 4QM7A 1T8TA 3DDCA 2D2FA 2BWJA 4V03A 4Q9KA 1OT3A 1WXQA 2F1HA 5A5GA 4US2R 3OE7A 4RD3A 5FL7D 1N6HA 2GESA 2YOFA 4EFMA 2J7PA 1A1VA 3ASYA 4KVGA 5HCIA 2J5XA 4M1KA 1IN5A 4FMDF 3Q7QA 2YYZA 4TLCA 3AVYA 3CR8A 4TT3D 1XZPA 1D2NA 2WSSA 4Q4JA 2JA1A 4YMVA 3PVSA 2ORVA 3FMFA 3I73A 4TN1A 2XZLA 2ZSAA 3CKLA 4Q1FA 4WOPA 3WMFA 3FYHA 1D9ZA 2QMHA 3AEZA 3KDSE 1CP2A 1Z5ZA 4JL6A 4A2PA 5HKKD 1HV8A 2K5UA 2EU8A 3CX7A 1KMHA 3AF1A 4F38A 4M21A 5G41A 4R9UC 2IYRA 1JECA 4KAXA 2Y8EA 2D4HA 2CVHA 1TADA 3B82A 4QBIA 4WIAA 2HEIA 4LJ8A 2KI5A 3CPEA 4R98A 2VHTA 2V9PA 5EZ6B 3SI7A 1XNJA 2BMFA 1XEFA 2W6ID 2XSZD 4PQFA 4Q48A 4QG7A 1BMFD 1KY3A 4BLQA 1ONBA 5FI0B 1NIPA 3K9HA 1QHHB 1E79D 4W7SA 5SZIA 1P5ZB 2ZS8A 4Z1MD 1LTQA 2XTNA 3LVRE 3GFTA 3TR0A 1BOFA 1YZGA 3ADKA 1FNNA 1SVWA 5FPHA 5J4LA 5JLJA 3MLEA 4Q1BA 4G5GA 1E69A 2ONKA 3FPAA 4DBLC 4JYCA 1UKYA 4UNNA 1ZAKA 4LX0A 2O0KA 1WMSA 5CK4A 4IVPA 3NEYA 4DIDA 1OH6A 3ZJYA 3TNFA 1Z08A 4NYIR 1RC8A 5F2EA 2VQSA 5H8WA 4BZPA 1A2KC 4C0QC 2XXAA 4Q7JB 4HAZA 5AUOB 4A4DA 2VLIA 4BFSA 4HB2A 2FFBA 1RJ9A 3TE6A 1X1RA 1XJCA 4KFRA 2ZJZA 1HT2E 3LLMA 2Q9CA 4C0HA 1DO0A 3S1AB 4TSFA 1EX7A 4Q9JA 1M7BA 2ZUCA 5FOXA 2W6JA 1ANKA 3N70A 4H9GA 4QNRA 3I4LA 2O0HA 4B2LA 1R0WA 4EQ6A 4F7WA 3CF2A 3TW4A 1F2TB 3E70C 4ZDIA 1Z0AA 1EG7A 3KB1A 3PFIA 2FEOA 1SXJE 1Z6XA 4FINA 2H8KA 4AG5A 2PT7A 1XXHE 1US8B 2ZSFA 1IAQA 1UF9A 1M1YE 2CMKA 2EFDB 2VHJA 4GT1A 3RWMB 4YC7A 3TBKA 1EFHA 1JQJC 4Q1EA 421PA 1DPFA 1D6JA 3ND8A 4LPSA 3BOSA 3UXMA 2ZM5A 4ZPXA 5CYOA 2JJ2A 1ZNZA 3PG5A 5AJVB 1UEJA 5AR1A 5JZVA 1RPZA 4L8GA 2XJ9A 3TLXA 3QKSB 5CJPA 4BFXA 2CNWA 1HQYE 4KSBA 4B71A 4M1MA 1E1RD 1QHSA 4RVCA 4PPFA 4ON9A 1G16A 2OLJA 1UBGA 4MKFA 5FPKA 4Q7KA 1TQ2A 2ODBA 3NVAA 3HR8A 4DCTA 3ND9A 3IDQA 3U4QB 3EZ6A 1GFIA 3A4MA 4M0LA 2GNOA 4HEJA 4FN5A 4KVAA 2IBMA 3VHLB 4J0QA 2Q3FA 3AQ4A 5F98A 4QRHA 5G53C 2N46A 1SULA 3I32A 4TQAA 4E5UA 5DI3A 2O0JA 2HJVA 1GUAA 1VIAA 1Z2CA 5H1YA 1LY1A 2GBLA 2UZ3A 2ZRDA 4N0EA 4Q4HB 4X8HA 3QKRB 3AKCA 4DLWA 2XTZA 2PMKA 3KUDA 2H92A 1E1QA 4W9MC 1XDBA 4JKYA 3BC1A 3AKEA 5CDFE 1S9DA 1VDZA 3T1VA 1QRAA 4LJ5A 2V1UA 2FGKA 1WP9A 1EFUA 2HV8A 2ZVQX 1IN7A 4PFSA 2FGJA 3CB4A 4JLBA 2C99A 1MO5A 2QQ0A 3TUZC 3LBHA 4JLAA 2CCGA 2CLSA 3AVXA 2WJYA 4B73A 3W3AA 2OLKA 1KI3A 3A1SA 3B1VA 3BH6A 3QBTA 4OKSA 1D2EA 2XX3A 2BJVA 3ASZA 4YDSA 2R6FA 3ADBA 4RFVA 3THWA 4G0NA 2J0SA 2ZAMA 2OFOA 3X1YA 3X2SA 4MDFA 1P3JA 4MUAA 1MABB 2BEJA 3EWSA 4TTPA 4NE2A 2REXB 4QFMA 1AGRA 1ZM4A 3OEHA 4R7ZA 4BLPA 1ZUIA 5C46F 4C9BA 3OAAA 3KFXA 4KBFA 2AN9A 1E9RA 3ZZTA 3MSXA 1E2HA 4QGHA 2ZIAA 1DAFA 2ZXUA 3IHLA 1E94E 4TLBA 1KI6A 2IX3A 4DT1B 3LW7A 3IKJA 5CM8B 1OXXK 5TARA 1SVIA 5A0FA 4AI6A 2Q3HA 2C9OA 2NO6A 4M9ZA 4A8JA 4IOMA 3HU3A 2ORIA 1DO2A 2VSFA 1FTNA 4P4UA 4QM6A 1KJYA 1ZD8A 2IF0A 4JBYA 1XTQA 4RY2A 3BGWA 3REFA 4LBZA 5E7MA 3QXSA 4FWTA 2BV3A 3K0FA 1XTIA 3AF2A 1YR6A 2ZUDA 5L3QA 4CF7A 1UM8A 2DR3A 2ODNA 2R9VA 5TV2A 1X8JA 1TQ6A 1XCMA 3I5YA 1P62B 1E2PA 3PUVA 1G7TA 1HURA 3GEIA 3W34A 5EE5B 1OV4A 3TSWA 2Z4SA 5KDDA 3A8TA 4YDHB 5IK2D 3E5HA 1JPNA 4I4LA 4IXNA 4QBGB 3SR0A 1E9FA 2QT1A 2PT5A 1P60A 3N2EA 2O8DB 3HWSA 2R8RA 4M2LA 4CEHA 3CRRA 3SQWA 1P7CA 3T1QA 3UKDA 2ERYA 1YZTA 3C16C 5DLQC 1S4QA 3LXXA 2JAQA 2OBMA 4DKXA 5FPSA 4JMPA 4HB3A 4KYIB 3MFYA 2TMKA 4A9AA 1GRNA 2BOVA 5EJEA 1FQJA 2QPOA 3TW8B 3DKPA 4PSKA 1VCNA 3BFXA 1ZUNB 4V0ME 5C4GB 2G88A 1RE0A 1Z28A 2OCAA 4NZYA 1IN8A 1EX6A 3GPLA 3L43A 1NKTA 1OW3B 3NWJA 1GWNA 5DE3A 3FKSD 5KHOC 4UNPA 4NCKA 2G1JA 1KDTA 1W4AA 3RDPA 4MGKR 2J1LA 3SJAA 1VIYA 3AVWA 3OEED 1NLZA 1KZGB 3VMFA 1P72A 3UMRA 4PQRA 4KODA 3GLGA 1MT0A 4HAWA 4D0LB 2HLDA 2QAGB 3I3SR 4DLTA 2WJHA 1NVWQ 4ITRC 4OHWA 1DAEA 1ZP6A 2C03A 2J45A 2VP0A 4X8OA 1YVDA 4YMWA 1Q57A 1NN0A 2ECKA 1KK3A 1Z2AA 3FHCB 3CNNA 1GNPA 1YU9A 3MJRA 3PJRA 1G8PA 2JLWA 4JIMA 2ERXA 2B7CA 1M74A 3DL0A 1FQKA 3F3YA 1W4BA 1ZMXA 4OQMA 1OIXA 1GVNB 1J70A 2PLFA 1GM5A 3ZD6A 2C98A 5BYKA 2VEDA 2L0XA 3RRZA 4Q66C 1SXJD 1AS3A 1KAOA 2A9KA 1RYHA 1OPXA 1T4GA 2EVWX 2LKCA 4NONA 4BQSA 5JCZA 5P21A 1E32A 3IBYA 1FX0B 1Z47A 3GP8A 4WZBE 3UPUA 2GKSA 4LHXA 5ELXA 4TQ9A 4CDGA 2JLYA 4GRAA 4G5RA 4DUGA 3OFND 3P26A 2DFNA 2XGJA 3K9LA 3I1FA 4TT3A 2IYUA 4DSTA 1YE8A 3DKVA 3IIJA 4V0OA 2QN6A 3MD0A 2GDJA 4LV6A 3WHLA 2GJSA 4IW3B 1JPJA 2UKDA 2QA5A 4BLRA 5KUTA 4BPBA 2ZJ5A 1N6PA 1LF0A 2YWEA 1G8FA 5K8UA 3AVTA 2VHCA 1CBUA 2R2AA 4CZ2A 2AHOA 4WW0A 1DAHA 2DPXA 4YQFA 1GAJA 4ZKEA 1PVOA 4MITA 3D31A 5CITA 2O8CB 2QE7A 5FTMA 5FR1A 4ILEA 2P65A 3EW9A 3EC2A 5HE9A 1E9SA 1N25A 1CJMA 1E4YA 4D0GA 1BYUA 1X8KA 2VSOA 1F60A 3B78A 4JLMA 3FMIA 2WJIA 1W44A 3IUYA 1RRPA 3A58B 4RD4A 2AKAB 2D62A 3K70C 2RB4A 3LW8A 1G19A 2P6UA 3U6BA 5CB6A 2XSZA 4PHTA 5L3VA 3OIVA 2QQEA 1ZU4A 4QHTA 4Z8YA 5JFGA 2QP3A 3M4YA 2ZI4A 3BH7A 4R2IA 5KDLA 2ZI7A 1G8YA 1R0ZA 3NBXX 4DSOA 1E79A 2JJ1D 4PR0A 3GLIB 3GCGA 3Q85A 4YXWD 3FHOA 3P32A 4GZMA 4L4UA 4RD0A 2ZVPX 5TY0A 1QHXA 3GJ4A 3R7WA 2WPDA 2WWIA 4XWKA 3K70B 3NC1C 1AQUA 1A7JA 1NLFA 2R6CA 4JT2A 5CM9C 1Z06A 1W4RA 5EXTA 4WBSA 3UK6A 1HE1C 3PQCA 2HYIC 1GOTA 1XPUA 3A36A 1G20E 1QHNA 3PITA 3VU9A 2MSCB 1P2TA 5EQTA 2GZDA 3UMFA 1PZNA 4F91B 3WRYC 3C5HA 3SC3A 1Z29A 4NH0A 3VAAA 2CHQA 2ASEA 4QC2A 2QRZA 3MWLA 2V6JA 2NMVA 4KFUA 3DHWC 3THXB 3TAUA 2FSFA 1F5NA 2V55B 2ZJAA 3L0OA 1AN0A 3K09C 2BMDA 4KU4A 1SKYB 4GNKA 3M0EA 4KITB 4IDPA 1NLYA 2F3RA 1JAIA 4LHWA 8OHMA 1GRRA 4BFYA 4HDCA 5LBIA 1ZM3A 1AGPA 1D5CA 5E4FA 2JATA 1G3QA 5CYPA 1G8HA 3B1YA 4G3XA 1DARA 1MO6A 4URVR 1R8SA 1P2VA 4Q03A 4LRWA 1AJEA 3U3MA 1DTSA 1QDEA 1D8TA 1SZPA 1QG4A 2GF9A 3RANA 2Q3MA 1ZNYA 2R6AA 4MQBA 4NTZA 2ZYWX 3CW2A 4B75A 2R6GA 1E9CA 4IOLA 2GAOA 1G64A 3FGNA 3LLUA 5JEDA 2QM7A 1N6RA 5DYGA 4PAMA 2HDNB 5KNCA 2MMCA 3C8UA 2OHFA 1NN1A 3EG5A 4GBMA 1CJTC 1C4OA 4KYUA 4C2UA 3QVUA 4QBHA 1LNZA 2BHRA 3QBVA 1IXZA 3AKDA 3WXMA 2NQ2C 5GJCA 2DWQA 1A2BA 3P20A 2ZS7A 3VNUA 1U0HC 3BB4A 1YZNA 1LS1A 2Z4RA 2PZEA 2ZRJA 3MG9A 4DSNA 1U9IA 5FOTA 1XP8A 3ZDQA 1GIAA 1K5DA 1OF1A 1AK2A 1G5TA 3EZ9A 3T35A 2ZU6A 4TMXA 3W9YA 2YOHA 4LJ9A 1KTVA 1U0JA 1U94A 1YRBA 2KSQA 5FBLB 5G40A 1OIVA 1QF9A 3QOFA 4HLDA 4WXRA 1X8LA 3P1JA 4JL8A 1WF3A 2OM2A 3MWYW 4PHHA 4TYPA 5TDHA 4JS0A 1W5SA 2JLZA 4P0TA 4V0NA 2AXPA 1G4UR 1Z07A 3EC1A 2QP9X 1PJRA 5EP4A 3ADDA 3OIUA 1Z3IX 2NTYC 4URUR 3LNCA 5DYIA 1GITA 3ICEA 4FI3C 1BYIA 3CZQA 1MRNA 4TLDA 4OK5A 4LJYA 3FTQA 1Y3AA 2O52A 3FFAA 2DWOA 3AVOA 3NG1A 5CLQA 3SYLA 3QIAA 3U61B 1OHHD 2DY1A 4HZUB 2FMXA 4P32A 4Q02A 3GLFA 2WWXA 1CR4A 4B3BA 5G3ZA 2FG5A 3U3JA 5KNDA 2GZHA 4PZLA 5BQ5A 3BD9A 121PA 2VF7A 1YJ5A 3QPUA 4XVQA 4LBWA 3TVTA 5EE1A 1NY6A 2IL1A 5FFMA 5FOSA 4ZCLA 4UNRA 1J99A 3K0SA 2I1VB 1E2JA 1F3OA 3VR5A 1ZIPA 1JQLB 2Z6VA 3CX6A 2OFXA 3EXAA 1E9EA 3Q9LA 2OSBA 1E2DA 3BFVA 4I1UA 5GVRA 5IHPA 2JDID 3DO6A 1XTJA 1P9RA 2W2XA 4PO8A 4DLRA 5AUNB 2O8FA 1VHTA 3GEEA 1JR3A 2W2VA 4LC0A 2RGGA 3GLIE 3KQLA 4FXPA 1J2JA 2QI9C 1N5JA 1T0JB 2QNRA 3H0KA 2I1QA 5FTKA 2BMJA 1IBRA 1M2OB 4B33A 3U44A 1Z22A 2FSIA 5JS8A 2VP5A 5KPJA 4OQNA 3G0HA 2Q0HA 2OILA 5FUYA 3GJ6A 4I1OA 1RRGA 2D7DA 3TK1A 2ZEJA 4ZI3A 1TQDA 1HE8B 2RH5A 1ODFA 3B1XA 1G7CA 1GSIA 1YR9A 3LXRA 4TZ6A 1M6NA 3W8RA 3EPJA 2EFCB 3AVPA 5IRCD 3RAPR 4GMXA 5EXXA 5C1BA 2CHGA 4LI0A 1TF5A 2XJ4A 2IYLD 1G291 5J40A 4D4KA 3QJYA 1SKYE 4B3CA 2C77A 2VPPA 3BFKA 1NVVQ 3TMKA 3X1ZA 1JJ7A 1UADA 3RS4A 2WWWA 1EESA 2AX4A 4MRVA 5CB8A 4MUBA 3U2QA 1AS0A 2OE2A 3RS7A 1WBDA 5KDOA 1KMQA 2ZRHA 1G6HA 1XTSA 2IHYA 5JSZA 3D7MA 3ZH9B 1Z0DA 1NBME 2JIZD 1ZRHA 4R2HA 4TTRA 4C0LA 4ZO4A 3QF7A 1CJKC 5IDVA 4ABYA 4RKFA 2P5TB 1FPMA 4NPHA 5FBWB 5FOUA 4PPGA 3WYGA 1PLJA 2ZRIA 1W46A 3RS2A 3FMOB 2PEZA 3KJGA 3BERA 5B57C 2XXAB 1DADA 3PR1A 2W83A 1Z6YA 2ZAOA 1QVRA 1NRJB 3LQRA 4PSVA 1OXVA 2J59A 2WJGA 2PX0A 1Z6GA 4TQUS 1KKMA 4IVQA 2FWRA 4EQ6B 3QQ5A 3FKSA 3R20A 2C8VA 1ZW6A 4P31A 1TQ4A 2B6HA 4MYTA 1A5TA 4M53A 2JLQA 4BZXA 4B74A 1R0YA 4GP6A 4FCVA 2C96A 4CW7A 4IKEA 5K8IA 2GK7A 4CT4B 1GZSA 2IA5A 3B9QA 3LX5A 4O2LA 2SHKA 5LB4A 5BWMA 2QM8A 2ZYVX 1G8GA 2XITA 4KLNA 3NH9A 4DLYA 3L8YA 1M34E 5D3MA 4XJXA 5AUQA 4XTCS 3P27A 1NNEA 3H84A 4N1AA 1FZQA 1Q12A 3E1SA 4JLDA 4NU0A 1VG0B 4JBWA 2VTKA 3QXXA 3JZMA 4PC3A 3IQWA 3GJ8A 2R62A 4Q47A 3ZQ6A 1RW4A 2FNAA 2XTMA 2FZ4A 2PH1A 4QNMA 2IXEA 1LFDB 4BE7B 3U6KA 1II8A 4IDQA 3VKWA 2CK3D 3DM5A 2IYSA 1XD2A 2WHXA 3WBJA 1IJEA 2I3BA 2B7BA 1VCIA 2QBYA 2NO9A 4Q18A 5EP2A 4US0R 4D26A 2VP2A 2GBLC 4NL4H 2QROA 2Q6TA 2IXFA 1LS6A 1TUEA 2N1BA 3TKLA 2X1VA 1E0KA 1T0HB 2F9LA 4LK2A 2WSMA 4D2IA 5JRJA 4JVSB 1AQYA 1OE0A 4PO1A 4B3FX 1T8UA 4BECA 2OXCA 3GLHA 2G3YA 3A1TA 5JEEA 1ZM9A 1Z0FA 4OYHA 1BS1A 5DI3B 1HEIA 3DEFA 5JI2E 4P4SA 5JWRA 4TMWA 2CL0X 1BO6A 1EGAA 4JYBA 3RNLA 4CEIA 3CF6R 3NKVA 4UXJA 4DLSA 4KSCA 1HQCA 3CBQA 4CYMA 1GNQA 4OHXA 1QBKC 3MMPA 3VX4A 2XB2A 1XCPA 2A5JA 4L9WA 1X3SA 2NPFA 2HCJB 3AF0A 3AP1A 4PPNA 2WIAA 3TQCA 2OBNA 2PZGA 3GJXC 3X1XA 2NPIA 1E99A 2QZ4A 1E6CA 4LOAA 1E0JA 1W48A 3C14C 4MH0R 3LA6A 4O25A 3WNCA 3ZD7A 2XOKD 1VCOA 2JLXA 1R2QA 4LJ6A 1ELOA 3BWDD 3BORA 4O3MA 1IXSB 2REBA 5K8LA 4MA4A 5LB2A 1HY3A 4AYXA 3FB4A 3THWB 1TEVA 4KFTA 3RRMA 4EFLA 2GVZC 2IYWA 4JBXA 1GP2A 3WRXC 1WDTA 2JJ1A 3Q72A 2V3CC 3ECCA 3TQFA 1R0XA 2KBFA 3KZ1E 4I81A 1B23P 1WBBA 3FDIA 2CL6X 4XTRA 4A8JC 2AK2A 3EPLA 2CHVA 2IS6A 4C0AC 2WWFA 1JI0A 2GA8A 2YV5A 1AIPA 4A0HA 5JI3E 2DCUA 2QG6A 1KK0A 4RZUA 1CR0A 4EPXA 4EPYA 5L3SA 4U02A 1KI6B 2XZPA 3EX7C 1B0UA 4YMSA 1Z6AA 1EFRA 1NSTA 4A82A 2LCFA 1IY1A 3SBEA 4A8JB 3NEJA 4OQFA 5KNBA 2G0TA 2CCKA 3IIKA 4AKHA 5AK0A 1Q21A 3A1WA 4XWOA 2CEAA 2JLSA 5KU1A 4DLXA 1X6VA 5J5CA 4GP7A 2UZIR 2AWOA 4IDOA 5DHAA 3X1WA 2AFIE 1NG1A 2HF8A 3EZFA 4GSYA 4M1OA 1SVMA 2ZJBA 2W00A 3QXCA 1P61B 3JZAA 4OHZA 5DN6A 3AP2A 2X19A 1SVSA 3A1UA 3K9NA 5DSZA 1I2MA 3QPWA 4IOKA 3Q8XB 4TL7A 3K0FB 1KO4A 2RCNA 2J0UA 5L3QB 2A5GA 2PBRA 2V54A 5AJXA 5LDDC 4DRZA 2GTPA 3K70D 3K53A 1R10A 1BKDR 4LPKA 4DLUA 4M9SA 2J0QA 1G41A 4M8NE 2RGCA 2EFEB 3CNLA 2DFTA 1DBSA 2BBSA 4UQOA 1CKEA 2H17A 2IW3A 1FP6A 5B58C 4Q4AA 1OXSC 5KSOA 4AKEA 3AH8A 2HJGA 4CEHB 2P6NA 3K8YA 1YZLA 2ZE7A 1YHNA 3OIYA 3QY0A 3GMTA 4LHVA 4OI2A 4M1WA 3BK7A 1CR1A 3KJEA 2IUSA 1YZUA 3S1AA 1S2MA 3EIEA 3T12A 2BBWA 1IOZA 1C9KA 1GL7A 2BKUA 3NBFA 1N3BA 3LVQE 4MGYR 4C0KA 4D4LA 4BLTA 4ZCIA 2I4IA 2ZJYA 2ATXA 2GILA 3DVLA 2ZI3A 1W0JD 4JLKA 4BGDA 4IDHA 2AK3A 4GOXA 3I61A 3O8DA 2G1KA 1F2UB 3B2EA 2QPAA 3DMDA 2B92A 4K81B 1P9WA 1US8A 3HJNA 1ZINA 3SYKA 3SJZA 1NBMD 3TSOA 4ERNA 2GF0A 3RWOA 1HH4A 3HYRA 4PC7A 1UEIA 1JJVA 2QAJA 2WV9A 2ODWA 521PA 3GLGB 1GDDA 2PL3A 1TF7A 1N6LA 1SVLA 1XTKA 1G7SA 1UBEA 5GJWC 1H8ED 1BH2A 1R5NA 1W5TA 4Q19A 4HUQA 4OQXA 5C2JB 4URXR 2H16A 2JGNA 1WB9A 2EFHB 1JR6A 3GJ5A 2ZROA 4XD7D 1H8HD 4HI0E 2NO1A 4EPTA 3AF3A 2IUUA 2QMUA 1DVRA 4IXMA 4TTQA 5FR2A 1E0AA 4MYUA 3KKMA 1KI8A 2BM1A 3L0PA 1E2EA 1G18A 3C5CA 1OHHA 3MCAA 3T5GA 5TXGA 4DC9A 3UATA 4B47A 1DAGA 1U8ZA 3U4QA 3EIHA 1GTVA 1HYQA 1YR7A 5ANRB 5TVKA 1W36C 3AVVA 1L4UA 4UJ5A 3TR5A 4DSUA 3AP3A 2YJTD 5C4MA 1T6NA 2FU5C 2IYYA 1COWD 3CRW1 4HAXA 1NJFA 1OKKD 1DG1G 3NHAA 3K0CA 5E3HA 1LV7A 2JDIA 3U7EB 5J4HA 1UKEA 1UAAA 1L7VC 1W7AA 2AD5A 2QSYA 2IK8A 3MGCA 1YZKA 4LCBA 4NDZA 3T34A 1ZNXA 1W36B 1NMZA 1Z63A 2ZANA 3AV0B 1CJVC 2FV8A 4K8OA 4M9XA 3CF0A 3LQQA 2XNDD 1KOFA 1SHZA 1N0WA 1F6BA 2P5SA 2WIBA 2ZRAA 4Y0VA 1M8PA 1UPTA 1JALA 1ZUHA 2Z5FA 1XX6A 3LWNA 4XSHA 2W0MA 4UXHA 2X2EA 2PZFA 2X2FA 2VRWA 2ZETA 2XNSA 3U7FB 1OB5A 3SEAA 2A2ZA 1AM4D 2QMOA 1AZSC 2WVJA 4BFWA 2BEKA 1RKBA 4C0BA 2WKPA 5LD2C 1W0KA 2ZR7A 4G5OA 1ESMA 3AKYA 3OE7D 3PV0A 3Q5EA 4F93B 3BRWD 3E2IA 3NDPA 2OESA 1E2LA 4I1VA 1VTKA 1XB2A 3ZVLA 1XEWX 3H1TA 4WAUA 1KK1A 3UWOA 1JEEA 4KO8A 3K1JA 3V00A 1OH8A 1E3MA 2C95A 4EKDA 2A30A 1EFCA 5LD2B 4TWZA 2VIIA 1HUQA 2A5DA 3CRVA 3W6NA 4TYQA 4A2WA 3LBIA 1CULC 2NG1A 2GRJA 2KB0A 2OBLA 2ZITA 3T1TA 4DT1A 4QHSA 1S3GA 1ZU5A 3KB2A 3R7WB 2O8EA 1U81A 2FZLA 3WMEA 3EPHA 4K46A 1NKSA 3THYA 2NO0A 4L9SA 4A36A 4Q5IA 4JZKA 2PCLA 3B85A 4D0NA 4FMCB 3GFPA 4OJKA 1I4DD 1EFTA 3BH0A 5FL7A 3BB3A 1DEKA 2AL7A 1SKQA 3T5DA 1G9XA 4XVRA 4EFNA 4ACAA 4AK9A 621PA 4RD1A 5EXSA 5AUPB 5JRZA 1TAGA 1KDPA 4MGIR 3NDBB 4AYTA 4ESVA 1JEDA 2WJJA 4M1TA 5H70A 1M7GA 2ATVA 2NZ8A 4URZR 2WKQA 4IVRA 4HLQB 4CEJB 3OIWA 4B2IA 2EFGA 5F9FA 4E09A 3CM0A 2A3RA 4PAOA 2JASA 2P2LA 1XEXA 3SYNA 3C15C 1G1MA 2J0VA 2O8DA 5HKKA 4JLOA 4MRPA 5HE8A 1EK0A 3U3OA 1PUJA 3Q3JB 4PHFA 4C7OB 2YOGA 4DDVA 4JLVA 4NBSA 4URWR 3N2IA 1ZD9A 2OO7A 4QJ4A 3GLGE 4RZ2A 4Q9IA 1VG8A 1QHYA 5JMTA 4OI0A 1KAGA 4LY6A 4Q1CA 4UNQA 4M1YA 4NYJR 3AUYA 3I8SA 3ZLJA 1R6BX 1ZYUA 2OCYC 4I99A 5KOYA 1U9IC 4FMCF 3VR4A 2W6IA 2WWGA 2GJKA 5CIQA 2FPMA 1IHUA 1SHKA 3U5ZB 1BMFA 4KCGA 1X1SA 2G83A 2KWIA 2RGNA 3RS0A 4HZIA 2W6JD 4DCVA 2CK3A 1EXMA 2C78A 4NYIQ 4Z1MA 4A2QA 3LRPA 3C7KA 4JVLA 5EUQB 3X1DA 4DLVA 1PUIA 1UKZA 1FNMA
chains in the Genus database with same CATH superfamily
1XTBA 2OGZA 4JQZA 2GZAA 3AETB 3IUBA 3MBIA 1H2WA 1Y9AA 1T3TA 2GUGA 2QAGA 5IWAB 3H17A 4HFMA 4FK8A 4B6RA 1QHIA 2F9FA 3WLNA 4W5HA 2XZTA 1MJFA 5JJBA 5LPNA 3DYBA 3M5CA 4GZLA 4CV3A 2ZRNA 1QG2A 1KDRA 3SWWA 1WX1A 1SUSA 1SCDA 3IPRA 4UC0A 1XQVA 4DQKA 4RM2A 1JG1A 1C1XB 4B3IA 1X7ZA 1P1RA 1P74A 2C5EA 1PT8A 3OE1A 1S96A 2OBXA 3E3NA 2I0FA 3E5RA 1VE1A 2CF6A 4YASA 3JD4A 1P75A 3IJEB 2DCMA 3VFDA 3PEUA 3X0DA 4KLCA 4CTOA 1QG6A 3F6CA 1RI5A 2IXGA 4BGEA 2Q9AA 3VDRA 4E2YA 4PZUA 3HCAA 2BKEA 3QFSA 4OREX 3G8CA 1ZJZA 2Y0DA 3FTCA 3R3HA 5SZJA 4B3XA 1NQWA 4JFAA 1RWNA 4WJZA 1FDRA 2HF9A 1I4EB 3DKRA 1KO5A 2YWBA 1E9DA 1WDKA 1XWFA 4CU5A 4GMGA 4R41A 1SXGA 4KI0A 1XTZA 2NT4A 2XOKA 2BBTA 3F1KA 3W1VA 1U1FA 1F6DA 2C92A 1E6LA 3CLUC 4CVNA 1ZWKA 1YI1A 5FOVA 3KYBA 5BR1A 3C85A 5IJAA 1XZKA 2ECFA 2W6QA 4KAFA 4XR9A 3PXGA 3HXOA 3D64A 2QT0A 3E9NA 1PLLA 3D3QA 4PCUA 4PZDA 4ANFA 1BDHA 4F5DA 5CVEA 4FEGA 1ENYA 2H06A 4YONB 3IQEA 2IEBA 4MS3B 3NHBA 4LOLA 1M1XB 3E27A 3EZGA 1YR8A 1OBOA 3SK0A 2AEEA 3B70A 3DE1X 4MYHA 3U3RA 3W90A 4MHTA 3LQFA 2YWHA 4JYMA 4P81A 1DWPA 2EZ8A 4A1FA 4EBFA 1UBCA 1HSOA 1W4LA 1H2ZA 4KXLA 3W3ZB 1E1RA 3O84A 2C5GA 4LSZA 4E30A 5JO0A 1N0VC 2GCPA 1W4ZA 3W7AA 1CR2A 1J8YF 3ONFA 4P58A 3ZYCA 1PDWA 1ISPA 4EG4A 1JIXA 1T3HA 3O4VA 2EW1A 5FTJA 3AHJA 4YACA 3IOEA 3RS5A 4YGYA 3MD9A 3TLGA 3TBHA 1ILEA 3HVJA 4G0MA 3SEFA 1BX1A 3RT1A 4GRIA 5CDYA 2BDTA 2UYGA 2ZE5A 1EK5A 1ZNWA 2B9VA 4J7XA 3RFFA 13PKA 1DUSA 2E6UX 3KE9A 4EUKA 3PUYA 3M5PA 1MV8A 4DIKA 2Z1NA 5B7NA 1UKVY 2WM9B 1N2CE 3IQIX 4EO4A 4QKQA 3S28A 1W9MA 2CL7X 2ECQA 2LDXA 1ETUA 3EIQA 4J6EA 4ND1A 5FKJA 5JS2A 4R8MA 2ZDHA 2ADMA 3MRSA 1CZLA 3F47A 3GG2A 1A7UA 1AOXA 3X3HA 1CHNA 2WP8J 2BI7A 5D7BA 3RVBA 3GUHA 2PA0A 4G9EA 5IJ9A 4RTRA 1JDJA 5EYPB 3ZCSA 1VPEA 2F43A 1V5WA 1M0EA 1FJXA 3H5LA 3GUVA 3D2CA 1MB0A 4KXUA 1R8QA 4MI3A 5ALKA 1YFLA 2PZKA 4OLHA 2JNWA 2AMVA 2ICAA 2QNBA 3T1NA 1NJGA 1A4RA 3D8SA 4DJEC 1W2GA 3W5IA 1XELA 5JANA 2O0LA 2YY5A 3F49S 4CM9A 2C2ZA 3DNMA 4WZAB 2L2QA 4V0KA 2AG5A 3JARB 3H2JA 3LT5A 4UNIA 5H9VA 1NRIA 1ZIXA 4JUFA 1S3SA 1KBQA 1NSYA 1W35A 1TMKA 4RNCA 4EIWA 2DR0A 5CFQA 2W2QA 4LRSB 5EI5A 2V6IA 3TSAA 1JFTA 4P7JA 1C29B 5AK5A 2B36A 1CUZA 3UPDA 1WXWA 3I5UA 4E7PA 3EGEA 2FSSA 1AKUA 4D6YA 1Q7GA 1Y7PA 3IPAA 1FSGA 1IN4A 1K2VN 5D1NA 1J4AA 1Z8HA 3JQAB 4GFDA 2MYTA 1Q1QA 2HTFA 3WAKA 2HUPA 5K9ZA 3CNEA 2H29A 4Y0NA 4HDMA 1OYYA 3MOIA 5KEIA 2Q3BA 1M75A 3LKBA 4N0QA 1LTHR 2ZRFA 3RB8A 5ALZA 4O4JB 4B6FA 1D4ZA 3HFGA 1L7DA 1JYFA 1RBZA 3B38A 3C7TA 2VRCA 3IIIA 5IDWA 2WF9A 3MUFA 1QR6A 4ID9A 1XMSA 4IS2A 1ML4A 4BJ6A 4EKYA 2YYAA 2QX4A 3DL2A 3VRHA 1VPLA 4CMEA 1T9HA 3VR5H 1JW9B 5E4JA 1AKNA 4FS8A 4QAJA 2FRDC 3CSUA 4KO4S 5SYMA 5BR7A 1BXRB 1MV5A 2OB2A 2IYZA 2IPNA 2PX6A 1DKMA 2IS4A 4LGVA 5JZ9A 2OHGA 1QZUA 1XPOA 1CT9A 2ZI5A 5G1NA 4LXQA 3VKGA 3PRJA 3HE3A 5IZCA 4ZT4A 4RY9A 1PGPA 1GUFA 1Q6YA 2HHCA 5ILGA 4QOFA 3QBDA 4HDQB 4X00A 1MR3F 4IKPA 5A4IS 5EJFA 1ZGCA 3OX1A 3FNIA 3SYRA 2QU7A 5FWDA 5IKEA 4LMAA 4J75A 1HQKA 1TO6A 5JTTA 1ESZA 5AIBA 4HDRA 3FUUA 2AJDA 1O4WA 4D0RA 2J3JA 2NUTB 4IGKA 2N47A 2F1JA 2FOLA 3PICA 3GV0A 2X7XA 1EUCA 3KKNA 4HSGA 3TD2A 2D06A 1VKZA 5IK2A 4ZYXA 3C97A 4R2LA 1K8RA 5TPZA 2F8TA 1WHTB 5DYTA 1WBJB 5CAEB 5BPFA 2O2SA 3PHGA 2JFUA 4FFOA 3PWKA 5IEBA 4BLOA 2HAEA 3B6KA 2O0MA 1ZD1A 5E7IA 3W2EA 2V6BA 2PUCA 1ZD5A 1CDEA 1DP4A 4EW2A 1RLMA 1A2OA 3EQ8A 1OH7A 2HKIA 2VP3A 3BTVA 1UC9A 4C4AA 5J2UB 3JYLA 1M6VB 4OXIA 5KJCA 5LP6C 2J3EA 1IY8A 1TIKA 3A3PA 3U9TA 5B7GA 6LDHA 3EA0A 3SOPA 4V2UA 1O0CA 4OLAA 1V5FA 1DDOA 2DE0X 3IV6A 2DYKA 1A8SA 4LNUA 2B20A 3DE2X 5THKA 5JNLA 2ZPTX 2BFBA 2YJ3A 3EUFA 4DCSA 5BRJA 3ROMA 2NVBA 1NGSA 4ZCSA 1ZOSA 2CZCA 4CI0B 4DNOA 1Q16A 4DNPA 1KWKA 4F06A 2QR2A 1DC6A 4XXHA 1GKYA 4DCOA 4DCPA 2UAGA 3NWOA 4NDAA 3NT2A 1D2MA 1SEVA 4AJOA 2O8CB 2ZRKA 2QZPA 1JKJA 3OD5A 2Q62A 5B3LA 3LOUA 4GLJA 1G8MA 2ANCA 1JHAA 1QH8B 1Z16A 3F98A 3GEHA 2Z5LA 3L0CA 4HAYA 1NBAA 2BFEB 3DZ8A 1GLNA 3P4XA 2QY9A 3BJEA 3LRTA 4RO0A 2WUDA 3TZBA 1AS2A 3OEEA 3QPAA 4OAOA 3U4MA 1OAAA 1LWOA 4JOQA 1ACLA 5T6MA 2WKWA 4U5XA 1KZ9A 3KFVA 4EATA 4BB9A 4BYGA 1PTJA 4CI9A 4L4XA 4YMIA 1BU5A 3AEQA 5JJIA 1CDZA 4GF5A 4TV8B 3RM3A 3U7RA 5I4CA 3K0AA 2CW5A 2M2IA 2PJRA 1JIIA 1VYHA 1YQWA 4O2AB 3OPYA 1GKUB 4QHYA 2MYNA 5HZGA 3DO8A 5FPYA 1JXOA 3HYTA 3WNZA 2B21A 2GK6A 2PVPA 1I7NA 4C0SA 5EQJB 5G4LA 2GUWA 1WCIA 2WFMA 3I1YA 2CJWA 3G2JA 4YK7A 2XYHA 3ZJ4A 1AUVA 5AJYA 2HYDA 1XWWA 2QL9A 5C1IA 1SXJA 3L7YA 1GRVA 2UVQA 2BLNA 1GAQA 3BX1A 2C0PA 1ID8A 1XXHA 3AYXB 5LZ2A 5CURA 3I1JA 3IEVA 3LQ4A 1M1YA 3R9WA 1MXHA 1N6KA 1XI2A 3U7IA 2WRZA 4RKRA 2R8EA 4X7BA 2HXYA 3R0VA 4P3YA 4OL0A 3HNOA 2GJ8A 2QTAA 1UBTS 3T1TA 1EUYA 3HJFA 5DEIA 5K05A 5LP6F 2GJ4A 5EGNA 3S0JA 3M6UA 1SCUB 1IL0A 1SOWA 1LPNA 3AR4A 3SD7A 3VJRA 3SJBA 3S8YA 3QUCA 4II2A 1JMVA 2VPXA 3C41J 4Z0PA 3VU3A 3HZRA 1YR3A 2DF8A 3ICPA 4JASB 4LCJA 4P7BA 5KIAA 2PUGA 9MHTA 2SICE 3IELA 3KXPA 3HSYA 1ZICA 4ASUD 5HKBA 4MUHA 1GRCA 2V59A 2HW8A 2BI8A 1L5QA 5JCPA 4KQ6A 4QUDA 1VPDA 3KP1A 1QHFA 4YRGA 4G1EB 2WPDD 4D56A 2FQQA 3K9QO 4YI3A 2M6LA 1Q3TA 1U2GC 3BMQB 3OC6A 1J2EA 2FUG6 2VBCA 4J16A 1VL2A 1Y1SA 1TTQB 1WQ1R 2QX6A 3R77A 1U3FA 5JH7F 5JIBA 1NHGA 2ZU0C 3GT0A 3GZJA 5C1PA 4D5EA 1ZESA 1NW4A 1GGEA 4RTKA 3K3PA 2J3QA 1Q77A 3I39X 2LUOA 1NF3A 3LGXA 3OPNA 4C2BA 4UXIA 4IIGA 3F0TA 3COWA 4KIGA 1KKUA 1YQUA 3RADC 2NNLD 1VZ3A 3AW8A 2FTKE 2KQUA 1Z6PA 2WW8A 4K2AA 4WESB 5LXTF 4E88A 3PLRA 3KQHA 2HR1A 3WRVA 1VJRA 3KEGA 2J4DA 1IWPB 4KNWA 4KR2A 1GAXA 3ELDA 3OJEA 3E5MA 5JTUA 2CEKA 4LWPA 2BHNA 6ADHA 4ZAYA 4L28A 3R5TA 3S5JA 3UCEA 4EL5A 3SE0A 2G1AA 4NV3A 4PZ0A 2UYYA 4QGFA 5ALFA 2M98A 3RRBA 4S05A 2AD1A 2HWYA 1G8JA 1Z3CA 1DAPA 5I5GA 3UXHA 4BHTA 4EPVA 4PLTA 3GJYA 4N7MA 3DTVD 4ZOEA 5KKCA 4BASA 4G8BA 3WL4A 5KTRA 6PFKA 3LYUA 2VYVA 5U9CA 2B5VA 4PC1A 3GRYA 4KZKA 1ZD4A 2HIGA 1Q1EA 2JBAA 3GLKA 4BFTA 3KQTA 2XOEA 2DHRA 3GLHE 4CKXA 1CB7A 1DCMA 5KX5B 1O8CA 1PV4A 4G9GA 4HF7A 4EG5A 1TU0A 2V7QA 1Y6QA 2HI0A 5DT2A 2BM0A 3JAKA 1NVBA 3G5UA 5BNFA 4MRMB 4FWBA 2H1SA 1A69A 2W93A 2BEUA 1DCKA 1CRLA 1KZ7B 3INTA 1QK3A 4K9KA 4CHGA 5JQWA 2Y3IA 4HKTA 3IBGA 1CYEA 1A9YA 1QHHA 1G1AA 2I2DA 3GW8A 3FI9A 3NCTA 1O94D 3HI6A 3PHBE 3Q1KA 4Q3BA 4WVFA 5EMMA 1G21B 5CLIA 5EZQA 1CX9B 5AKXA 3MJTA 1VB5A 2WD7A 4GDMA 4JT8A 4L2IA 1SZJG 3KDPA 3D0QA 4TX1A 4CV2A 1QANA 2VWQA 3B1WA 2YVKA 5HF5A 5SY4A 1TZKA 2XQGA 4EB8A 5JAHA 3L9XA 1ZBQA 4O8ZA 4C21A 1JT2A 2W2PA 4XEUA 2AKYA 3HV0A 2NP7A 3FCOA 1KJZA 1QYWA 1TJYA 1TT5A 2BELA 1OIWA 2YVUA 4X54A 5WRFA 3NPAA 1ESDA 3RRJA 5A9RA 3J81k 1QM5A 1W1IA 4X1KB 3DWGA 4BBJA 2V9CA 3KQMA 4P4TA 3I1IA 5AK4A 1YS9A 3NXSA 2B8TA 4ZVTA 5ERGB 1MFPA 3D4IA 4OHMA 3ZWDA 1N6OA 1BJRE 4Z7JA 3PENA 1DFGA 5L8VA 2GKGA 1OVGA 2PCJA 2ZSEA 1HYGA 3AB3A 3LCVB 4HYYA 5LM3A 4NCAA 3TCNA 4GL2A 3JQ7A 2OCBA 2OECA 5LYJF 2EG5A 1X86B 2IY8A 3KPYA 2FSVC 3MWDA 4OGWA 4RX1A 1ZVQA 1VJCA 5IARA 3HA7A 1AF4A 4DZRA 2OM6A 1POWA 3TGPA 4DTIA 1VB3A 1F2TA 5K8TA 1BMTA 1MU0A 2CNLA 1IZ8A 2ADFA 1KI1A 3C3YA 3OIGA 4UBMA 3M82A 1QNFA 2VDOB 3ZV3A 3MPUA 1LBSA 3K5IA 4GOJA 3U3KA 5B5SA 3C3AA 2NWQA 4G25A 1MQSA 2MMGA 3IMGA 3QG1A 5F76A 1HE3A 4R8KA 4XOIA 3T3IA 4W5TA 3NTXA 4U5QA 4OTZA 2ZR9A 4W5WA 1DQRA 1ZD2P 3AY6A 4CMIB 2JZOA 4JR2A 2ILVA 3ESXA 2PK3A 1ZVJA 2QHXA 3B7PA 4RHXA 2QORA 4WFIA 1KI7A 4OATA 3CISA 5HGJA 4C4YA 5D01A 3TTTA 4R9SA 1KYIA 2OQRA 2ZPAA 4XRRA 1GQOA 1RKQA 2YHSA 4OXYA 4Y2SA 1L5NA 3DVQX 1VG9B 1L4KA 4OVKA 2JGDB 2WG2A 4UVEA 3UH1A 1XMXA 1M2GA 1M76A 3HA2A 3ET5A 1JEYA 5FBZA 2I80A 2IYXA 4EUNA 1E4OA 1NMYA 2VPZA 4DUZB 1G8AA 4XYLA 3OQOA 2VNAA 4PX9A 2WLTA 4M1QA 5I9SA 2Z9DA 3M1IA 2AWNA 2ZYUX 1MX5A 3R7FA 4FCWA 5K4GA 4OFZA 5KWEA 3GT4A 1F0YA 1N0UA 1O9HA 1M2VB 1WXFA 4OI4A 1ISHA 3K8QA 3M89A 3GFOA 5CVUA 4L5CA 3FTEA 1N9GA 4Y3UA 2NSJA 1OROA 2BF4A 3QXGA 1RYFA 2VJNA 4OHYA 3CCFA 3IA2A 4MAMA 4PGMA 4FWIB 2AUTA 1TECE 3RUPA 3PXAA 4BTVA 3ER9A 2EOAA 4LDJA 1MEOA 3QKRA 4BNYA 4IHKA 2E87A 3WGOA 1U1GA 2X58A 5BQPA 1GPKA 3WIEA 1SXHA 1K8QA 2V58A 4KXQA 3TVDA 3LV8A 2QN8A 1I32A 4B83A 1U4OA 4MWOA 1XEXB 2P4QA 4ERXA 1J9EA 2WMNB 3GN2A 3N6XA 1QK5A 2BRUA 1LDYA 3EY4A 3SQDA 2WP0A 3ZV7A 3CS3A 3H86A 5CB4B 3C74A 3INYA 4PC6A 2A9OA 1EJ0A 2SNIE 4U8GA 5KI6A 3I5XA 3B1FA 4DR2B 1HM5A 3I9LA 4N12A 5HM8A 2AOUA 4BWYA 5LN1A 1R0BA 2L17A 4F72A 4LDNA 1CDDA 1M7HA 4CT5A 1JLHA 5HZKA 2JCVA 1K8YB 3OP4A 1NT4A 1FTGA 4YRTA 5BN5A 4H4DA 1PZFA 3I45A 5LWHA 2EJCA 2XUQA 4MAFA 4P83A 2ORYA 1XHLA 1WXHA 2J67A 3EH1A 2EW8A 1K6IA 3P9PA 4TMYA 2G9NA 3WGZA 4ALIA 3JQAD 5JFTA 1KO7A 5KYVA 2ID9A 3C6QA 4AJJA 1H5QA 4AMZA 3RU2A 2FXVA 5IN5A 4I55B 3PDCA 3ISTA 2QAGC 3R8CA 1PJAA 1C3LA 1XP5A 1RBQA 5EHNA 3NH6A 2ZIXB 2OV6A 4KJZA 2YMPA 3VDMA 5HZMA 3SHWA 1YNOA 2WOOA 5ALGA 3WX0A 5LU9A 2Z83A 2ZWPA 3BE4A 2IP2A 3PR3A 3I04A 3UMMA 1WNFA 2FWIA 1SVKA 2ZIGA 4J90A 4TLEA 1ZCFA 2R97A 1UODA 3G2LA 2DH6A 5I4BA 3PFHA 4M7PA 4Y2XA 2JIZA 4UTVA 4RLFA 2BFWA 3KKPA 2JVJA 4P3NA 3UJ3X 1QO7A 1Z4LA 3TOVA 4EKGA 4B2PA 4J1QA 5J5AA 1K7FB 2IXTA 3A4NA 4NP6A 4E03A 1IZ7A 3RLFA 5JBQA 5CDSA 5JNUA 5JPCA 1IEQA 3VC7A 1GV0A 2C84A 4NCHA 2WIFA 4C6HA 1GDTA 5AW0A 2PZBA 4IMIB 5B55A 5KSYA 2ACVA 1AA9A 1NP3A 5IYZA 1NI3A 2E9SA 2FJUA 5GWXA 2OG2A 3DB2A 2FN4A 3O0DA 3I34X 3A4VA 3AVQA 4HQ6A 4MOWA 1E6MA 4ZICA 1JNYA 4POOA 2JLUA 2B34A 5B4UA 1Y6FA 2FQXA 2TMYA 1S9HA 1RAGA 2YDXA 4A6EA 2IITA 4CTJA 1PHPA 4E07A 2F3TA 2IODA 1N7JA 2X5KO 3CXUA 3KAPA 5CVCA 2CBXA 5IASA 4Z0TA 4IIXA 1DFIA 3UJHA 1MZPA 2CHUA 3F9IA 5KTTA 2ZRBA 5A02A 5C37A 1PU2A 2VL7A 4XGNA 4B6GA 1C4XA 5F5LA 3W5HA 4ID3A 4Q4DA 4KLAA 4TL9A 5TGDA 4H7EA 4X8LA 2XQVA 5A9TA 2Y0EA 3MT8A 2Y1FA 2LBPA 1GUZA 2VDPB 3CT6A 1UQRA 2PL1A 3EASA 4MZDA 4QE3A 4X71A 5GPBA 4AWAA 1R16A 5BSKA 1RFLA 1RRCA 4A92A 1C0PA 5D2CA 2JA2A 1WZIA 2CXPA 1DELA 4GBED 4V0LA 2Y1XA 1E9AA 1PVDA 3QU2A 1MEJA 3ZOZA 1MAAA 3I4CA 4JQYA 2O8BB 1BFKA 3LUCA 2PV0A 5HF9A 3ZDEA 1U3WA 1YJBA 4F2DA 1GL9B 4LTDA 4DLBA 1NQUA 3UANA 1NL3A 1MGOA 2P2NA 2VUIB 4YI5A 3U7GA 4PSCA 1QDUA 1QORA 2JAPA 3BZUA 2OEPA 3IRUA 4OBBA 2H31A 4JUCA 3RC8A 3PE3A 5EHIA 3FCEA 1I2AA 5LMUB 4GMDA 4HNVA 2H7VA 2IRWA 2O1SA 2Z2JA 2ILTA 4M3NA 2Z58A 2CFTA 5JJKA 5F3WB 4DWVA 3BXOA 4AYWA 1X1AA 1R00A 3FZGA 4JUIA 5TPWA 4MPTA 2PFSA 3GP5A 2RHLA 4QBKA 3QNMA 1PCXA 4A2WA 3GFSA 2X0JA 3T3MB 5KAMA 3UMBA 1KR2A 2LDBA 3K1YA 5CFMA 1CK4A 2EJVA 3LAWA 4GLLA 5DI9A 3FDZB 4DWWA 1QU3A 3VR4H 2IQ5A 4JBGA 1QTIA 4YAJA 1F5SA 5JRDS 5GIPE 2FMIA 3T9AA 3V7WA 3ADCA 1YD7A 4PC2A 1RE1A 1J0AA 2YWFA 4BV8A 2OB1A 3R3WA 4IUDS 4CDRA 4P98A 1TTTA 5F7JA 1Q91A 1JFRA 1SBNE 4X24A 1YZFA 5JHHB 3PHCA 2I1LA 1D2AA 3F5MA 2QTVB 3DMPA 4MB2A 2FKAA 2GVDC 4F8JA 1AQNA 2O9JA 5I8PA 5EE3A 2OMEA 4O5AA 5FBQB 3RFCA 1UBUS 2BGTA 5EIHA 2P7IA 1QZXA 4Y1EA 3C1TA 1AZTA 4JHXA 3ZX5A 1SUPA 4PIPA 3KEFA 4G9BA 1VJGA 4K6OA 1T91A 3JVVA 1J20A 1GR0A 2RGRA 2Q5FA 3JVIA 4M0KA 3CZAA 4DKJA 2X8BA 3OUUA 2AW5A 4K5QA 2WM2A 3QFHA 3U40A 5BNTA 1AX9A 3ERCA 1WAMA 1N4AA 1NNSA 5IKPA 4MQ4A 2A9RA 1J06A 4E4YA 1BQ4A 4IP0A 1EUDB 3D3WB 4YQYA 4OLJA 5EA2A 1ORTA 2EC5A 3WGLA 3PL5A 3LDFA 2ONJA 3SXUB 1J6UA 4J1TC 5BOSA 3KUXA 4DEYA 4EOGA 1I51A 2J41A 2WMOB 1BEEA 5FA5A 1FW8A 1HYHA 4LJAA 5E1OA 3WYEA 1QKIA 3HNRA 1ZZGA 2J09A 3ZGYA 2HHAA 1T15A 3L2OB 4YRLA 5AI0A 3UWKA 4C4PA 3CHYA 4Z0HO 2DH5A 2XAAA 1TF2A 1QQ6A 2ZTHA 3PNOA 5ALLA 4D5GA 1D09A 2XZOA 1GPYA 2XMRA 1L5HB 4RSHA 4ZD6A 1JB1A 3H1FA 3GN1A 2GO7A 4EITA 1GD1O 2APJA 3KHSA 4CPDA 4C7OA 1TK2A 3UYKA 1GZHB 2HJRA 4OEHA 5KYYA 4BDTA 1TOAA 1MOPA 2V8BA 3ZDZB 4OV6B 1Y98A 5D84A 2FRXA 3QNWA 5IZCC 1JEJA 3KSRA 5FLKA 3U44B 1RRVA 1DX9A 3AR9A 3Q6IA 1DINA 1N7GA 4IQ8A 5DCWA 3ROXA 2GM4A 1YVEI 4V02A 3DHNA 2EF1A 4RCZA 4Y1RB 2FW8A 5CA0A 4B6PA 1Y4DE 2FWAA 3BULA 4RKEA 4RZ3A 3RS3A 3O93A 4QQKA 4ECAA 2X77A 3QEJA 5TQ0B 1EX1A 1OLUB 3WISA 4EJSC 2CLCX 3B8HA 1V9SA 4HC4A 3PIRA 2RC5A 1SIUA 4JJZA 4WA8A 3PEWA 4RF2A 1FLVA 3N8GA 3V46A 3V4PB 1IOLA 5CG1A 1FLAA 2EKLA 3SS8A 3V8BA 3GNLA 5E7JA 4OQEA 1NATA 3K4QA 2D2EA 1U9JA 4G0UA 4IOJA 4AJLA 3REGA 3VX3A 3AJRA 1VP3A 1U3TA 1W47A 1ZHHA 1YR1A 1TVMA 4LXYA 4QBFA 7AT1A 4MV3A 4J0JA 5HK8A 3HUTA 2I7VA 2QXTA 4NIMA 1Q0TA 2ZIUB 2PLWA 2J7KA 3KKQA 1SZCA 4OHPA 4BC1A 5HF8A 1N6NA 1OGYA 2R4TA 2VK1A 3CZPA 5JSZB 5A4JA 4AIIA 2GBCA 3CRMA 1CVLA 1Q0UA 1RYDA 2F4NA 3L5KA 4HQLA 4L0QA 4RIFA 3TMYA 4O2RA 3KETA 3J7AC 4CN8A 3RVDA 2VK8A 2J3MA 5CPFA 2QENA 3CG4A 5E1BA 2H54A 4QJ5A 4CFSA 1PJQA 4Y7CA 2ZBGA 1A9PA 1ZQ9A 2VUSA 3OU6A 3PC2A 4J91A 3EPPA 4HV4A 4LHZA 2DQYA 1A50B 4UPEA 2DPYA 5TMPA 3GUZA 3GCXA 3JQRA 4OD0A 1V16B 4DANA 3V1NA 4GVLA 2EYQA 4LQ4A 4Y2JA 4IQ0A 5DFAA 1W0JA 2BIFA 4LS3A 5C1DA 4KGVA 2CXSA 3INRA 1JMKC 2I8AA 5JADA 2PX3A 1FUUA 4XW2A 4MVWA 3ZTYA 4ER6A 5JQGB 1V2GA 1MLDA 2P62A 4FYXA 5ADVA 4DV1B 1KIMA 1GV1A 1X7YB 1Z7EA 4IDNA 3DP7A 4LYJA 4EYKA 1BE8A 3HABA 3PXUA 4FUQA 3UIEA 1I5OA 1UDXA 1UKAA 3QF4A 4HH0A 4Y9SA 2BCJQ 4FEAA 4ER3A 4UTZA 2XA2A 2HO4A 3ETDA 4J0IA 4RK0A 4ZWNA 5JJLA 4RZXA 4EW3A 4RSGA 4Z51A 1J8QA 1CZRA 1Z6ZA 3IESA 4FMBB 3UMGA 1QPZA 4ER7A 2V7TA 3DMNA 4MLCA 3MJHA 2ZJ1A 1CW2B 2FFJA 4Y6QA 3W5JA 2Q07A 4FVTA 4Q7MB 4D8WA 5M7EA 4F71A 4KK3A 1SXJC 2ZRMA 2ZB2A 2QUJA 1OZ0A 1JQ3A 1ZRMA 4PE5B 1K7SN 4Y6RA 1Q22A 3E8XA 4AN4A 2NAFA 4LHYA 3RWBA 1V3UA 3EVFA 3VQTA 2P2SA 3IUQA 4IQFA 3FOFC 1YK0A 3OEYA 4XSVA 2JAUA 4AMYA 3G13A 1DEXA 1Q0RA 1HXHA 1NA5A 1XWIA 4Z9YA 3RBVA 1XNQB 4E51A 1N8TA 4IZ6A 2HPAA 4LKRA 1UPXA 2ZM6B 3FROA 1M5RA 3OFVA 1XD2B 5CA1A 4FTWA 1UOQA 3FPJA 1MKYA 2BD0A 4FIDA 5I7RA 1XVVA 1Z8NA 1BVRA 1ABEA 2QD1A 1W0KD 5EMNA 5IC6A 3RTEA 6YASA 5GTDA 5EMHA 1KO8A 4K7JA 4D8VA 4UTRA 1U63A 5EERA 1CZKA 1Y3HA 1P7YA 4Y9DA 3F5DA 5AMXA 4M60A 1IZ0A 2NZJA 1QYRA 2VA8A 1XZFA 3P9XA 2HDOA 3H5NA 3RTDA 4RFSA 4B32A 5BNZA 5HZHA 2HLDD 4MIYA 5HPYB 1KHTA 1N8SA 4KLZA 1YBMA 3E23A 4BGVA 4R5HA 3U4GA 1JKXA 3D6MA 3WK7A 5CD9A 3FBGA 3FVVA 3EAQA 1Y48E 4IXDA 1XMIA 4KJXA 1TD9A 2B8WA 2HM7A 3NTOA 1A5AB 3V8VA 2BGKA 4WXPA 4BV2A 3N07A 2NUPA 4ZOAA 5HBRA 1MT3A 4EUFA 3O75A 2Z04A 2JK1A 2CJXA 5HS4A 4FP9A 3LBYA 3BA6A 4FYKA 4RVGA 1JIUA 5JCJD 1ZX1A 2B6NA 1ECFA 3E7XA 3MS2A 4M1SA 4DB2A 2ZRGA 4QM7A 1GADO 1P1BA 1CWUA 2YW2A 3DDCA 3LPDA 4P54A 4MS1A 4TWIA 5C3MA 3TJMA 1OT3A 2JGLA 4BV3A 3AJEA 2QOEA 3EDOA 3LA8A 1W85B 2GZRA 2YOFA 3DMRA 3FWHA 3OZSA 1Y89A 5C8YA 4OXRA 4L50A 1PR0A 4EY5A 2R1TB 1VIDA 3URKA 1SUDA 2JGMA 1W88A 2XCIA 1ZISA 4P0PB 3CR8A 4RQUA 1CUUA 2XGGA 1XRRA 2WSSA 4YMVA 2O50A 3KIPA 1Y9ZA 2J5QA 4IGFA 1CLEA 4L73A 1OBCA 4IJ6A 4TN1A 1O9GA 3O90A 2XZLA 2K7ZA 3OMXA 2SCUA 3RASA 1V9LA 3H11B 3ZIUA 1A77A 3BKWA 3OM0A 5E9WA 4PBRA 1S89A 1XDSA 3KDSE 4ZQIA 1JDBC 5KYXA 2VPIA 1HV8A 3KKLA 2K5UA 4NATA 1E66A 1KMHA 2IDKA 2P2CA 2V0CA 3AF1A 3QX9A 5G41A 4KPEC 4NY1A 4QVGA 5JASA 4HGRA 2FAXA 1O57A 3A9UA 2Q4DA 3Q9NA 3ZQUA 2VAWA 4KAXA 5BWOA 4BO8A 2C2OA 3S1SA 3NHPA 2XA1A 2HL6A 3KU1A 3NBAA 1ADYA 4MEJA 2HC9A 1IHXA 3VKUA 1P33A 1I14A 1B3RA 3IQGX 3L8DA 4O29A 5IEJA 4PFQA 2F59A 2KI5A 4BNGA 2UZ4A 2VHTA 3BWXA 2MYPA 1XSEA 4TKLA 1KS2A 3HA5A 4BMZA 1H9AA 1B8UA 4KR0A 5MHTA 5BURA 5HKKA 1BMFD 1XA4A 1DIRA 1KY3A 2W6MA 3ESAA 4OYLA 1IWBB 3FGOA 2IW1A 3LY8A 4Z1MD 1GGMA 2XTNA 3LVRE 3ZGNA 3D43A 3K9BA 2YXDA 1PT7A 1XAHA 1TTHA 2HTEA 3ADKA 4RVOA 1YC2A 5J4LA 5HA5A 5JLJA 1A4XA 4CF5A 2IHUA 3FPAA 2BUCA 4JYCA 5K8CA 3LC7O 3WQBA 1KGSA 1TKBA 4BRSA 1OYVA 1Z13A 1NBIA 3NEYA 4FHCA 4DIDA 1E7SA 3PXBA 4H6PA 2FR8A 3TI9A 2KHZA 5F51A 1KEZA 1Z08A 5IXSA 2ZWAA 4QDOA 1EWYA 3G0OA 4PQEA 2G5CA 4EJ0A 2V6GA 1A2KC 3CEPB 2HCRA 1YS1X 2HSGA 4EGSA 1JYSA 2AUNA 4FHZA 1RJ9A 2A35A 2HX1A 5FFNA 2RDMA 1X1RA 5LDGA 2AGVA 3TTUA 1HT2E 2BTQA 3ANXA 1I7PA 2JS7A 3LLMA 1HRKA 5DTMA 1VIVA 5H3LA 5EJ6A 4TTSA 1ISRA 1OC2A 2ZUCA 4QLOA 4QUJA 3WAJA 5FOXA 1JNXX 2Q1YA 1ZFNA 3QTBA 3HZZA 3RYIA 2Q1SA 3U9LA 4H9GA 4OQPA 4TYNA 3C8HA 1R0WA 4UM8B 4B09A 1BXGB 2C2XA 4Z4HA 3UV6A 2Q45A 3H05A 5REQA 4IGEA 3TR6A 1QIEA 1RLTA 3ICVA 5B2EA 1RMTA 2IP1A 2GSDA 1EG7A 1UK8A 2FEOA 3H0CA 4RY0A 4DLAA 5BSGA 1NR5A 4YECA 2A14A 2PT7A 1US8B 4R2KA 2I4MA 1AMNA 3UUFA 1UF9A 2EFDB 2VHJA 2O3RA 3RWMB 1WLYA 5E1DA 1R9MA 1EFHA 421PA 4W6QA 1DPFA 1NT2A 3ND8A 3R0ZA 5JBIA 5DGDA 4ZPXA 5CYOA 2GEBA 1ZNZA 5AJVB 3IBFA 4TTAA 2OO5A 1WM1A 2ZJ4A 1C4KA 4CUJA 3W4JA 4BFXA 1V48A 3IB6A 1MRZA 4YRAA 4R4JA 4BNMA 4P84A 1J2RA 3I9NA 3OPQA 3WLKX 2POQX 3ZWNA 3HDJA 1PZEA 3DAPA 3HYNA 2BFDA 4PPFA 4U0KA 3ORRA 3UZUA 1IK6A 3V4VB 5FPKA 2X2OA 4ATNA 4LY0A 4PSUA 1Y80A 2BGMA 3BFJA 5JCXA 1IHPA 4GMHA 1NJ5A 2BL4A 2XTAA 4CMGA 1Y4ZA 3UEOA 5H0IA 3IDQA 1K68A 3ZHBA 3U4QB 3EZ6A 2H2GA 3F67A 4MW1A 4DR4B 2QAIA 2GNOA 4KVAA 3DQPA 4Y6SA 4AN1A 1T8PA 2BGRA 3RF6A 3KVRA 2WIDA 4G0ZA 1PR1A 3SZLA 2WD8A 1SULA 4MJ3A 1E3EA 4TQAA 5DI3A 3P0IA 3AY7A 4PLHA 2QLNA 1CUDA 3ZBPA 2BRUC 4HDNB 4AZTA 5LVAA 3JW8A 4X8HA 3AKCA 5HJ5A 4LMBA 1JEQA 3RFUA 3W78A 3UM9A 3I2HA 2H92A 2G1PA 3RUDA 1UQTA 5G0UA 5I7VA 2KPOA 2Y4NA 3BC1A 3SMVA 3AKEA 1G5IA 3A0UA 4U39A 1Y5RA 4KC0A 4EUSA 3ZQ4A 5CDFE 1S9DA 5E4YA 2C1EA 1HSZA 2FGKA 2VFAA 2O8VA 2X8LA 3DF7A 4JLBA 3CB4A 4L85A 2GDZA 2B2NA 4E5NA 4BC0A 3EXIA 4OFBA 3W8DA 2VHWA 1OC4A 2M1ZA 4UVIA 1ORIA 3GEBA 2OXIA 4HVLA 4DV0B 1ZR4A 1K6XA 5ICEA 3H1AA 1Q2XA 3A25A 4DQLA 3PQ3A 2CWWA 5G4KB 3EIWA 2OZLB 4HDSB 1JJAA 4UFOA 4RXMA 3OY2A 2X3FA 4NICA 5IWCA 4FNMA 2W2KB 3TOSA 2B5OA 3CCCA 2Z5GA 1QUFA 4DW8A 2EKZA 2F17A 2ZAMA 4WCVA 4X93A 2OFOA 1U2PA 2C2YA 3X1YA 1P3JA 5TX7A 2Q5IA 2GX6A 4TTPA 1FBTA 1RRKA 2YVQA 1TB4A 2JRLA 1RT9A 5BSRA 4C76A 1RRMA 2MWMA 1J5EB 2IZ0A 4PVCA 2GLUA 1ZUIA 4WDQA 4BLPA 4C88A 4C9BA 4IH4A 1M6EX 1Y1KE 3PQ8A 3WWOA 4C7XA 4D57A 1E9RA 2EGUA 2BR3A 1ZGBA 4ES6A 3DOJA 4PTYA 1E2HA 4QGHA 5E6RB 3GK3A 3F6SA 3I9FA 3IHLA 1JLLB 1N1MA 2IX3A 4DT1B 2GN8A 3IKJA 5CM8B 2FG6C 5A0FA 3IQZA 5DM0A 3WK5A 1WW3A 1O6CA 2ZBQA 4YP9A 1YBHA 3UMYA 1AE1A 1SUCA 2ORIA 4XCQA 1XVLA 2XVYA 3C6MA 1FTNA 4DCMA 3G1WA 2J48A 3O8LA 4QM6A 3DNPA 1CZNA 3PNLA 1FDWA 5F4BA 1RXEA 4ENWA 4KGDA 3RG8A 2CUKA 2HRZA 3EODA 3K4HA 2DLDA 3ICCA 4OHCA 3ZV5A 1RQRA 2BKLA 3W5DA 3P71T 1IYZA 1Y8CA 3QXSA 3U48A 3GNTA 2BV3A 3K0FA 4FWTA 2HWKA 1Q15A 5EZYF 2ZUDA 1BDBA 1OBFO 4X3OA 2R9VA 1MB2A 1FB5A 2BMAA 3AJ8A 3CIFA 3AC0A 1X8JA 1T36A 4ITVA 1FP4A 1PK7A 3KOXA 3PF8A 3R6LA 1C7JA 4B4VA 3I5YA 4FX5A 1G7TA 1MO2A