3HEAA

The l29p/l124i mutation of pseudomonas fluorescens esterase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
271
structure length
271
Chain Sequence
b'STFVAKDGTQIYFKDWGSGKPVLFSHGWPLDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPIFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylesterase
publication title Switching catalysis from hydrolysis to perhydrolysis in Pseudomonas fluorescens esterase.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 104
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3heaA00
3STWA 1QO7A 4UBOA 3C87A 3IUMA 3HYSA 2WJ3A 1VA4A 3WL8A 5FLKA 2H1IA 1O6FA 1XRPA 2QVBA 3PF9A 3PICA 5FPQA 4WCVA 4QZVA 2JIDA 5A7FA 1IUNA 1CUZA 5AM1A 1O6GA 3FSGA 1XZIA 1QOZA 1C4XA 4UFOA 5JAOA 4TVKA 2VAVA 4G1FA 4DGQA 4FBMA 1QFSA 4EHBA 3OG9A 2OQVA 1AURA 1D07A 1A8QA 4B6GA 2XUQA 3WKCA 2B4KA 3MGAA 3TJMA 4J0HA 3STYA 3W2TA 3UUEA 5EGNA 3I6ZA 2CEKA 5FKJA 2AJLI 1IUPA 4PO3X 4Y9SA 2WLSA 2AXEA 4KAFA 5CXXA 2JGEA 5A2GA 1YR2A 4UUQA 4OD0A 4QLOA 5E4YA 3ANSA 2B61A 1CUXA 4PSUA 5SYMA 1VXRA 5AI9A 3RLIA 2WJ6A 4FMPA 4KE9A 3LP5A 3BDIA 4LYDA 1E5TA 1ZI9A 2OCGA 4G8DA 2HU5A 3VJMA 1T4MA 1DWQA 3B12A 3WKDA 1KU6A 3DKKA 2VF2A 5ALNA 2OCLA 3G8YA 4B9EA 2HRRA 3VISA 5HZGA 3OM8A 3WIOA 1DT5A 3C8DA 3WKEA 4OSEA 3EQ7A 1WM1A 4JUIA 3U1TA 4Q05A 1IVYA 1BRTA 3G02A 4MYSA 4G5XA 3QMWA 4C6HA 3X3HA 1X70A 2OG1A 5AI4A 4AXBA 1FJ2A 4C01A 2XMDA 1HPLA 2Z8ZA 2B20A 2HFJA 3I1YA 3PFCA 4J3JA 1F6WA 4CCYA 1ORVA 2XMZA 2QJRA 5JZBA 1XLUA 4IQ4A 5ALRA 5HK8A 4H18A 4HTAA 4UBMA 2HL6A 3QZUA 4C88A 3KD2A 2HADA 1UWCA 5C8XA 4BVJA 3O4HA 2X76A 2XUIA 4FKBA 1MAHA 1CUJA 2OPHA 1C7JA 5HCUA 3DS8A 4RE5A 4EY6A 2GYVA 2W6CX 3QPAA 1E3QA 4HVTA 5JARA 4N8DA 6YASA 3M81A 4Q1VA 3AIOA 4OYLA 3B3QA 3S8YA 5ESRA 1CUBA 3ESDA 1G42A 3DLTA 4DMCA 3LS2A 2QRUA 3FAKA 4QDXA 4BC1A 1MO2A 5HKAA 5T4BA 3A2LA 4CI9A 1E66A 1WPXA 4GW3A 3O95A 4Q3KA 2J3QA 4Y2QA 2WILA 3KSRA 4UHCA 4C87A 4OUKX 3WWEA 4A16A 3CN7A 4AMZA 2H7CA 1ZGBA 3HJUA 3RKSA 1TK3A 5AP9A 4CCYB 2J4FA 4IH9A 5AICA 4FTWA 1WHSA 3GROA 1TCBA 5DLPA 1IZ7A 3BJMA 2JGKA 3QH4A 2HDWA 4G4IA 3HZOA 5FV4A 4I19A 1HDEA 3LCRA 2GZSA 1CUCA 4DMFA 3AZOA 1P0IA 5CH3A 4DNQA 2I3ZA 5K3EA 1S8OA 1G5FA 5FP0A 4Y2TA 1QLWA 4DMKA 4BYMA 2WIJA 4LHEA 3C45A 2XMQA 1I6WA 3ED1A 1EVQA 5BOVA 3ZLUA 4W1PA 3WYDA 1CUVA 4BTVA 1DX6A 5HKBA 1M33A 2CJPA 3BL8A 2BUCA 5KREA 2ZJFA 5K3FA 4WY5A 3TEJA 3D7RA 1TIBA 1WHTA 5AM4A 2PU5A 3DKRA 5JD4A 3IURA 4BAUA 5T4FA 3FBWA 2QR5A 4WFIA 4X94A 1GT6A 3DOIA 1CUWA 2JGLA 3IIIA 4DYHA 1LPNA 1N8SA 1DWOA 2QUAA 4FOLA 2VT6A 3SWWA 4UBNA 5JZ9A 4PSDA 4K2AA 3V1KA 4Y2JA 5DYTA 1ZD2P 5BV7A 5FRDA 4GWLA 4AN1A 3EIOA 2XQFA 5C7YA 3H2GA 3A2MA 4JNCA 5EIAA 2JF0A 5ALHA 4QDUA 3SK0A 4HXEB 4OB6A 1TKRA 2WTNA 3DEAA 5LZ5A 4H7FA 4U2BA 3I2KA 1ACLA 1XRRA 3IA2A 1CRLA 1ZICA 1HLGA 4X95A 1JT2A 3C6BA 2WU3A 1ZOIA 1CUIA 3OPMA 5DNUA 1EK2A 1DWPA 3HXKA 1U2EA 4OB7A 3D5EA 3SC2A 5EHQA 4LXIA 3F97A 1N5MA 4MWTA 5K3FB 5LKRA 1UOPA 3OURA 1GKKA 2BCEA 2RI6A 2PX6A 3JW8A 4TGLA 1A7UA 2GBIA 2PVSA 1ZIYA 3FCXA 4PF1A 2WHPA 4Q34A 5AOBA 4XWGA 5CMLA 3H2KA 2D0DA 5JAPA 5JD6A 1UOOA 2OLEA 3QMMA 2DQZA 4YK7A 4QA9A 2Z5GA 5JASA 2XQJA 2WQZA 1IZ8A 3BIXA 1CUUA 4BZZA 5ALKA 5ISMA 4M0MA 4KJXA 1EH5A 5EIHA 5AI8A 3WK9A 4JYMA 1CUAA 1CUHA 3GUUA 2HM7A 1DU4A 3R3ZA 2HA4A 1K4YA 4KAAA 1XZEA 1EX9A 3M3DA 4BC0A 3VJLA 2YH2A 3DCNA 4KRXA 4BB0A 4K5QA 3WL5A 4N5IX 2C5FA 4AMYA 3STUA 3DDUA 5AM5A 1BN6A 4QDZA 3HSSA 3V1LA 1CUEA 1R9NA 3ICWA 2XE4A 2ZYRA 5AKEA 4H77A 2XUHA 3E1GA 1LGYA 4ZI5A 4DM7A 3PI6A 5KWJA 3F9CA 4XX1A 1XQVA 4MXDA 1R9MA 4AX4A 2WHPB 3FVTA 1OXMA 3AFIA 1SOMA 3QITA 4C4ZA 4ZV9A 3H1BA 2WUDA 3D2BA 3A6ZA 5IH7A 5CT9A 5AI0A 1MTZA 3D2AA 1U8EA 1ETHA 5A62A 4BE4A 3L1IA 5AK3A 4N8SA 4BVLA 1MN6A 2HA6A 1R88A 4AO7A 2XUDA 4KE6A 1ODSA 5CTAA 1CR6A 3EBLA 3YASA 5LZ9A 1LZKA 2J3DA 1WB6A 3ESAA 1UK7A 4CG2A 1YB6A 5AHXA 2V97A 4B82A 1GXSA 5LZ8A 4V2IA 2XUOA 3BF8A 2DHCA 5ALZA 4LIPD 2ROQA 1YB7A 4OYYA 4OU4A 3GBSA 3C6ZA 1E8MA 1EDBA 2I3DA 5E4JA 2O2HA 4KEAA 4W1SA 3WMRA 4UBLA 1DTEA 4QNNA 5AO9A 1JJFA 4B0PA 2Y6VA 3E0XA 3C5WP 2OCIA 4Z49A 5D7BA 3G0BA 1MNAA 1PFQA 2XT0A 1VLQA 1LPOA 1B6GA 5LZ4A 2PBLA 2GZRA 2OGTA 3V1MA 1TQHA 4J0KA 3O4GA 3IDAA 5JALA 2ZSHA 4H7KA 2ZYIA 3KWFA 3IUNA 5D3KA 3BJRA 1THGA 1K6EA 2RHTA 1P0MA 3V1NA 3T4UA 1EHYA 5JAUA 4UFPA 1UT6A 4P08A 3EQ8A 3WQHA 4H35A 2XUKA 4E15A 1FFCA 2O2IA 3WA6A 4BRSA 2DR0A 3ZWQA 4DNOA 2NW6A 2BGNA 4E14A 2Z3ZA 1MX9A 4G4GA 3KWJA 5HF6A 1Z68A 3C6YA 1QIMA 4XIIA 3DOHA 1K8QA 1BS9A 3WKBA 3F98A 2VQ6A 5ALTA 4QDOA 3H17A 5HF8A 3VXKA 4FHZA 1E8NA 5ALDA 3TRDA 2VJCA 1TAHA 1BE0A 2VTVA 1LBTA 1FFEA 2C0PA 3A2NA 1GPKA 4MEAA 1A8SA 4UBIA 4X6UA 1QO9A 5AOCA 1QONA 4AO8A 4INZA 5AI6A 4G9EA 2G63A 4AO6A 5AKIA 1SC9A 4B81A 3RARA 3E4DA 1J1IA 4ARAA 2HFKA 4CCWA 5AKJA 4GI1A 1LPAB 1BCRA 4BP8A 5E2IA 2C5GA 4B83A 2WU4A 1VA5A 4PQEA 2YYSA 4GXNA 3O4IA 4IH1A 5CURA 4X6YA 1VKHA 3AILA 3QYJA 4YPVA 4DLNA 2QJWA 3QM1A 4C4XA 1ORWA 4BAZA 2ECFA 1E8DA 1RYYA 4EZIA 5AKLA 3C70A 4H7HA 4QWMA 3AUKA 5HFAA 1GKLA 1QTIA 2LIPA 3KOOA 5AJHA 5CBKA 2ZYSA 4JYPA 1VJ5A 1WOMA 3WJ2A 5T4HA 3R40A 1R4ZA 1Q0RA 1K63A 2Y1KA 4ITVA 4FLEA 2VEOA 1QJ4A 5DYYA 2WUEA 3AIMA 3O9MA 3I1IA 1EVEA 2BFNA 1ZIXA 4P9NA 1UFOA 2J4CA 5I9IA 3PDCA 1PV1A 1CLEA 5AIBA 2HIHA 2GBGA 4Y2UA 3STTA 2DHEA 3BIWA 3I28A 4G9GA 2WUGA 1J2EA 3ZI7A 3G9TA 1UK9A 2RONA 1AMNA 2C58A 1XKLA 4WFJA 1XRLA 2P8SA 4TPKA 2QS9A 2BGRA 1BEEA 1EI9A 5ALIA 3SX4A 5KBYA 4FNMA 4H7IA 3R3WA 5BWCA 4U2DA 4JH0A 1BEZA 4UFNA 4M0EA 3UUFA 2ZSIA 1EINA 3WK6A 4DMHA 1F0PA 3K9BA 3C6XA 5HK9A 5DNVA 7YASA 3FYUA 3AZQA 2PSDA 3P2MA 4X97A 5FDFA 2BAGA 2JEYA 1FFAA 2DSNA 2PL5A 4NMWA 5DTIA 2YASA 3STVA 1LBSA 1CQZA 4HZGA 2H7XA 5ALVA 4XVCA 2GBFA 2PUHA 3K2IA 3KDAA 1JMYA 1R1DA 2IX9A 2JGMA 3HACA 2QUBA 4O08A 1QIDA 1Y7HA 1W75A 2ZJ7A 1FSSA 2PSHA 1XRMA 5CRIA 5ALUA 1G66A 4L3WA 1XQWA 4ZGBA 1CIJA 1ZD5A 2AJ8A 4J0JA 3I2JA 4HS9A 3EQ9A 5JYCA 2W22A 3FWHA 5ALSA 2PSFA 5ALJA 1XFDA 4BAGA 5LZ2A 1XQYA 2XUGA 4OU5A 3CXUA 3I2IA 4J0CA 5CT6A 2XQGA 1EXWA 4EY8A 2BKLA 3BXPA 4DTCA 1GQRA 1VZ3A 4BBZA 1W52X 2V98A 1JJIA 3FYUB 4S0XA 3WZMA 3VDXA 1CUSA 4LXGA 3E3AA 3OC0A 1QIIA 4BTLA 5AKZA 2WSLA 3QPDA 4UBJA 4H0CA 1X2EA 3F96A 1N1MA 3OTQA 3H18A 2Z3WA 5DTJA 5ALPA 3ESBA 1K5PA 1AZWA 4K6HA 2FJPA 3DL4A 1DINA 2IITA 1WPRA 1LNSA 2WKWA 3Q0TA 5K5EA 4MWSA 3PUIA 5JATA 1C7IA 4X85A 4X92A 1EA5A 3O4JA 4GLBA 1WB4A 1Q0ZA 2QXUA 4KR0A 1IMJA 3ZPXA 3CN9A 4WY8A 1EDDA 2XUFA 2ACKA 2WG1A 2WIKA 2QKYA 3GELA 1DQZA 2G5PA 4U2FA 2FJ0A 5AK6A 1CUGA 2V96A 3R3UA 4ETWA 1AUOA 1LPMA 2PU7A 4QE3A 4KE7A 4EBBA 4IHAA 3WIBA 4KYVA 3D2CA 4C4YA 4DIUA 2XLCA 2WFMA 1ZD4A 4A23A 3LIIA 4Y7DA 5A7HA 5LKAA 2JGJA 3V48A 2DCMA 4P93A 3A70A 2O7VA 4RPCA 1EB8A 1NU8A 2ACEA 3G0GA 4ZXFA 1H23A 3WL6A 1RWQA 3HLKA 3O0DA 1Q84A 4ARBA 2VAXA 4X90A 5K3AA 1THTA 5C8VA 1CFJA 4X71A 3K6KA 1B41A 3GA7A 2DFPA 4UHEA 4DNFA 3NGMA 5AH0A 3HRHA 5YASA 1L7AA 3HEAA 2WFLA 2IIVA 2RAUA 2C7BA 5DJ5A 4Y2VA 3CCBA 3FLBA 2Y2UA 3N0TA 1P0PA 4DSAA 3FNBA 4FLMA 1R3DA 4MQLA 4BVKA 2FX5A 5IVIA 1VXOA 1MX1A 2HRQA 4MYDA 3F8SA 4ZV7A 4Y2RA 3AIKA 1XZCA 4MQMA 4GBGA 1XZBA 4IO0A 4I4CA 2GBCA 4M0FA 4FDMA 4Q3OA 1J07A 4KAJA 2ONCA 4K6GA 4Y2YA 1XZFA 3HI4A 4KACA 2DHDA 4NVRA 3W9UA 2G5TA 3ZV7A 5SYNA 3R3XA 4FBLA 5D3ZA 4RNCA 4F60A 1QE3A 2PKYX 1ZGCA 1AKNA 1SCQA 1UKAA 3WK4A 4DSZA 5A7GA 4BE9A 2BJHA 2OQIA 4ZRDA 2K2QB 4Y2PA 1QIEA 2I03A 3IVMA 1QIJA 5H3HA 1YAHA 1EDEA 1GPLA 5HQ3A 2HA0A 4OB8A 1U4NA 2DQYA 2WFLB 1YS2X 2E3JA 1CV2A 2V9ZA 5CW2A 3ILSA 3R0VA 1WCYA 5LLSA 2WHQA 1EB9A 5LIPA 3PF8A 4L0CA 4W1QA 4B0OA 1DQYA 3WKAA 3FCYA 1W6RA 2X8BA 1UK8A 3D0KA 2XMRA 2Y2VA 4J7AA 5HFNA 2OAEA 2WJ4A 1ISPA 1QIKA 5LZ7A 5LYYA 4PSCA 4I3FA 5JADA 5ALXA 3FYTA 3N2ZB 2VJBA 4XJVA 5JIBA 5EI5A 4B9AA 5A71A 1USWA 4B85A 5T4EA 2XUPA 2EEPA 3AJAA 2BUBA 1CVLA 4Q82A 1H2WA 1G4HA 1UOQA 4LXHA 2QOEA 4H7EA 2Z8XA 5FUMA 3QBJA 5EFZA 4HRYA 4FFVA 5J3JA 1QIGA 1H2ZA 5IVHA 1FFBA 5HQ3B 5A6VA 1E89A 1XRNA 1YASA 1MX5A 4W9RA 2R8BA 1LPBB 5ALWA 3ANTA 3ESCA 5LP1A 4AZ3A 3JYHA 1AQLA 3WL7A 2HA5A 4G4JA 3RM3A 1CUFA 4Y2XA 5AKHA 5ALFA 4LYEA 4UPDA 1XZGA 3WJ1A 1XLWA 5AI5A 3D3NA 5IKXA 3H19A 1XQXA 3JWEA 4CG1A 5AIAA 3STXA 1QIHA 1J06A 3W06A 4J0DA 5EHXA 3WWDA 3IBTA 1JU3A 4B7ZA 2O7RA 4L9AA 4PV7A 3HABA 2CBGA 3FOBA 2C0QA 5JAHA 4BCBA 5K3CA 3F67A 4YX9A 3NWOA 2HA2A 2OGSA 1AGYA 4H7DA 3U0VA 2OCKA 2HA7A 2ORYA 4J0GA 5FXMA 4HRXA 4PNZA 1ACJA 3IB3A 5CT8A 3IUQA 2YXPX 1NU6A 2XLBA 1TRHA 1SCKA 2OAGA 4GHWA 1CUDA 3W04A 3C8HA 4KRYA 1W76A 3G9ZA 3BE8A 4QDTA 3VVMA 2PPLA 4MEBA 4X00A 4AQDA 4CG3A 3RK4A 3FVRA 4RGYA 1BU8A 1EK1A 3OOSA 1MPXA 2VATA 5D6OA 2AJDA 1MAAA 5JANA 4BDSA 2BUAA 3HC7A 2HHAA 4EA6A 3BWXA 3ZLVA 1UZAA 2AJCA 3L1JA 2AJBA 1VE6A 3NOXA 2JEZA 1QFMA 3I6YA 3FSGD 4GEGA 2VJDA 4D9JA 2CUTA 2H9YA 5I7UA 2RGUA 4FNGA 3BDVA 4ZWNA 1IUOA 2WG0A 1XZJA 1KEZA 3G7NA 1P0QA 5AOAA 4F21A 1PJAA 2ES4A 1LLFA 2CKMA 3DQZA 1ZI6A 5AKKA 5AKYA 4FLFA 4QWWA 2UZ0A 3I2GA 3LLCA 4OPMA 3NUZA 4X6XA 1N5RA 2I78A 4BCCA 4HXFB 5AKGA 2XMBA 4EY7A 2PSJA 4CIBA 5CH5A 1ODTC 1DT3A 1GZ7A 4C89A 1HBJA 1T2NA 4DNPA 1YSCA 1L7QA 1UXOA 2WG2A 1XLVA 1XRQA 3M82A 4NZZA 3WK5A 2OGZA 4X3CA 5AK5A 2JGIA 4ZREA 2PSEA 2VSQA 5FPPA 4B80A 4X91A 1ZD3A 3BF7A 2XMGA 5IVDA 5AM0A 1ZJ5A 4N8EA 4EB0A 2HU8A 4BP9A 4W1RA 5ALQA 5I8PA 2R11A 3DYIA 2HA3A 3WWOA 3ICVA 3DL7A 1U65A 5HF9A 1SCIA 1XROA 3PE6A 5F4ZA 1LZLA 1ODCA 1Y37A 5ALMA 4BRZA 1JJBA 1VOTA 2QZPA 2ZYHA 1RP1A 4B84A 2ZVDA 3GFFA 4F5ZA 5ALEA 5EHNA 2OXEA 2XUAA 4E11A 4EY4A 3EF3A 4QEKA 3D4LA 4KE8A 5AK4A 2RIPA 2PM8A 4QLAA 5ALYA 4PW0A 5CT5A 2WHRA 3M83A 1XZAA 5E4TA 1JKMA 4UBKA 1LPPA 5ALOA 2G4LA 3WI7A 5EHZA 1MT3A 1Q83A 3G0CA 2CZQA 2QT9A 5ALLA 2JGFA 3LIPA 5JZSA 1UKBA 4AB1A 2XQIA 2WM2A 3L1HA 3W9BA 3TGLA 2XMCA 1F0NA 5C81A 4L72A 3AZPA 2X5XA 1HL7A 1YAJA 1OILA 1JU4A 4WDRA 3MVEA 3H0CA 3O9VA 2VJAA 4JEIA 2CB9A 1CUYA 1QGED 3H2IA 3WK8A 1LPSA 3H1AA 4WJLA 3QPCA 3DNMA 2XB6A 1QIFA 2WTMA 4J03A 1AC5A 4ROTA 3AINA 4W63A 3I2HA 2D5LA 3UMJA 2WUFA 5K3BA 4UHHA 3R41A 3B5EA 4BCDA 1X2BA 2CMFA 4P92A 3DJYA 4RE6A 4FWBA 1DX4A 1WB5A 3G0DA 1BROA 1CQWA 5KWIA 1XZLA 2XI4A 2QTBA 1AX9A 3FLEA 4LKOA 5DNWA 2QM0A 3GZJA 4GECA 4F0JA 2QMQA 1L7RA 4CFSA 2WIGA 1BN7A 5C8ZA 1CEXA 1HKHA 3WWPA 4U2GA 2XQKA 1GPNA 1XKTA 3H04A 3G0IA 4J0IA 4AZ0A 1TCCA 2EDAA 1YA4A 2Y6UA 1OCEA 1H22A 3MUOA 5K3DA 3W05A 4UHFA 3CCCA 4E46A 3WYNA 2VT7A 5AM3A 1MU0A 1JFRA 4EY5A 1BCSA 1SFRA 5JD5A 3Q8WA 4WFKA 5AKXA 2C4HA 3PUHA 4EUSA 3DYVA 3R3YA 1A88A 1KU0A 4GDMA 1VE7A 5HF5A 3I2FA 4H7JA 1MNQA 3PFBA 4BZWA 5DWDA 5ALGA 1ZJ4A 4G8BA 5DYWA 2RHWA 4Y2SA 4K6KA 3VVLA 4MJ3A 3QVMA 2VA9A 2ZJ6A 4BATA 3WK7A 4X7BA 2HU7A 2EDCA 1TCAA 2FUKA 3QMVA 1GGVA 1Y7IA 4IH4A 4UHDA 4AN0A 1VZ2A 1NX9A 5IVKA 4FFWA 2GYWA 4U2CA 1MJ5A 1XZKA 4U2EA 3VJKA 1W4LA 4Q3LA 2H7YA 3IUJA 4HAIA 1XZDA 3IULA 3H2HA 4NS4A 4OCZA 1H2YA 2JBWA 1FFDA 3R3VA 2XMSA 3C5VA 3S2ZA 1JMKC 1XZMA 5CH8A 3WA7A 4CIAA 2WIFA 1UK6A 5AM2A 3C43A 5CXUA 1CPYA 4X93A 1W1IA 1ZI8A 2WFZA 2XUJA 4G8CA 2B9VA 2QXTA 2WIDA 3ZLTA 1YS1X 3H2JA 4A5SA 3FYUC 5BWBA 3G9XA 1UKCA 3WLAA 3WZLA 3D59A 3KXPA 1QZ3A 4BDTA 1R50A 3WWCA 1XZHA 1GQSA 1QTRA 2GYUA 3DD5A 4UHBA 5CT4A 3MUNA 5FOQA 2Q0XA 1YA8A 1H2XA 4WDQA 1A8UA 1JI3A 1F8UA 3FLAA 3T52A 2O2GA 3V9AA 5EIEA 4YASA 4HXGA 3G9UA 2PUJA 3I6MA 3VKFA 2XDWA 1HQDA 4N5HX 1YCDA
chains in the Genus database with same CATH superfamily
4BP1A 5IPFA 4MR8A 4J2HA 2CE7A 1SXJD 3I9V6 4Q93A 4CLOA 1KHHA 3ACBA 1KPGA 5IC5A 3FGOA 4N9QA 5FCDA 1Z6XA 2E5FA 2X7XA 5JAUA 3FNIA 1PZHA 2OCYC 4FW8A 4QG7A 3HYSA 4JWKA 4RSMA 4HBZA 5CCBA 1V8PA 5JRZA 3WAGA 4P7JA 3F78A 4L0MA 3DHVA 1VA4A 4H2DA 5FLKA 3T1OA 8ADHA 1JHUA 1OYWA 3ZE1B 1XRPA 4PC7A 4FOOA 1FS5A 3ROEA 1BGVA 4XYLA 2GCNA 1E99A 4PLTA 1PVOA 2JD0A 1KBOA 5K20A 5FPQA 3I8XA 4RF4A 4X8MA 3ITEA 3TAHA 4IDQA 1G8YA 1KY4A 3EPLA 4TSRA 5A7FA 3JRXA 3F0TA 4OA8A 2H5LA 3P9RA 1CUZA 5AM1A 5F12A 4B79A 1FYVA 2ZJBA 1HORA 2O8VA 4MULA 3VSEA 4AUNA 4QKQA 2YZNA 5KHOC 1V25A 4TMXA 3NMUF 1EUCA 2GN0A 4WGFA 1GT91 3C3JA 1C9DB 5FD8A 4F9EA 4YRQA 3WBFA 3VOBA 1V9LA 4UFOA 4LBYA 3T5GA 2RGYA 1G8PA 2YHIB 1X9HA 2EZ9A 5F2EA 5LB4A 4S05A 4MKFA 3V4LA 2CLCX 5KYTA 3V48A 1VHDA 1W85A 3H6HA 3AR9A 1FEZA 4WV3A 5FTWA 4KFCA 4B3TB 1QWOA 1RJFA 4XTCS 4CEIA 3QGMA 2IF2A 3IAHA 4PG8A 1N6LA 2H07A 2IQIA 5JDCA 1D07A 3ILHA 3KALA 4JROA 1VGQA 2NT4A 2WV7A 3OU2A 1P80A 1W73A 4JLBA 4B6GA 2EIHA 1QFZA 1XAGA 3TJMA 2R8OA 1I4DD 3Q85A 3BK2A 4MRRA 3W5UA 2JVJA 5D00A 4AJEA 4D9GA 1H05A 4JSRA 4CKBB 5BV8A 4PXAA 4WNYA 1SVUA 4MB6A 3LWZA 4YJKA 5BP7A 2GD2A 4WOKA 5G3YA 1WXIA 3WDSA 2OCXA 4D8VA 4D9IA 5DNEA 4HNAB 3O7MA 3I4LA 3PC6A 1JUDA 3AB8A 4B6RA 1VLZA 3ADOA 3B38A 4D0NA 4M0CA 1JDZA 4GAEA 1SKYE 2JJYA 1G8SA 4LWOA 2AJLI 1MJFA 3NZEA 1YL5A 2Q4OA 4G0ZA 1VCHA 1GTZA 1ZFNA 2OHXA 4HPJB 2WQ6A 5HM8A 3M6LA 3OVMA 1GPDG 2PMBA 1ODLA 1DRWA 2I2FA 1M7GA 2QYSA 2FWRA 1K8YB 2Q6IA 3H5IA 1N1GA 2AXEA 4FYVA 3FG9A 2N1BA 4I3GA 4QPZA 5CXXA 4QOGA 2GK4A 2JGEA 4PBRA 3WYAA 3HV0A 4BYGA 4MQUA 4D56A 3K20A 1C9MA 1KK0A 4MTCA 4RFVA 3WDKA 3WRXA 3FOZA 3OIWA 1N9GB 1VL2A 1WPGA 5E4YA 3CUKA 3PNKA 2JLAA 2J85A 4NSNA 4OV6B 4RF2A 5DYGA 1YFLA 3UV3A 4PZYA 4XQ9A 1VXRA 5CK5A 3GN2A 5BSTA 5L40A 4LPSA 3Q8MA 1XUOA 1FJXA 4XGKA 3QBEA 3SBXA 1GZ3A 3UB3A 3WNDA 3LP5A 1XCBA 3IT0A 3MW8A 1QVAA 2AF4C 5I8WA 2GO7A 1KAHA 3AR6A 3OFND 5E6SA 3VZDA 1UC4B 5CLJA 5CYGA 2ZSEA 1E0AA 4LYDA 2QJTA 2YDYA 3P9QA 2KM1A 4RLHA 1TNDA 1ZI9A 2O2ZA 1WO8A 2C4WA 2OAP1 3ZW8A 1D2MA 4F9GA 2FU5C 3LPDA 1AZLA 4DLUA 3MMZA 3MT0A 2PS0A 2ZIXB 4TWJA 1FYDA 3DAPA 4CQMD 2I87A 1O4VA 1U3UA 5FI3A 4G0NA 1KU6A 1T0UA 1USKA 3PNSA 3EBOA 1D5WA 5EERA 3RDPA 2OFWA 1VI6A 1TTPB 4QQRA 1U0FA 1H2HA 3ZK7A 4BFTA 1ISFA 2XRZA 4E70A 1GNQA 1V2GA 2HRRA 4TKMA 2V1XA 4CE6A 2IBSA 2LR0A 3OM8A 1TOAA 1Z9BA 2EGUA 1GV1A 3DZJA 5EJ2A 3KB1A 3ESQA 1YZHA 3OI7A 3ZE6A 1Z38A 2J9FA 2PLRA 2DQSA 3FPSA 5EYPA 3ZKAA 5JI2E 3TF5A 4OX9B 5M2QA 1JP7A 1X1EA 2X2FA 2I1WA 4OSEA 3EQ7A 4FIZA 1HO3A 4NPCA 2O8FB 2A9OA 3D2LA 3WXMA 3X3HA 1B0AA 2VZ8A 3E9CA 4D57A 4YY3B 1JQJC 2PT5A 3AEKB 3GPBA 4RXUA 3CEPB 4AMBA 4YR7A 3R9XA 2M6RA 2XSZA 2ZBGA 2H0QA 3I3SR 4G0XA 5AI4A 3H84A 1ARZA 3U62A 3TZBA 2XAUA 4C01A 3D5TA 1ADFA 2I99A 3FTPA 3KVOA 3PSAA 3NH9A 2ZQZA 1GQOA 2HFJA 2VC2B 2Q9CA 3CZ9A 3HA7A 5AXAA 3T1YB 3D9QX 3OCYA 1F6WA 1MVOA 1L4KA 1N5IA 2O07A 4HB0A 4P5DA 3TSWA 1Q17A 2RAVA 3X1WA 1W581 3S81A 3HVJA 5AK0A 5JZBA 1JFFB 4L4XA 1XLUA 4GC5A 2FQXA 4JGGA 2IGBA 2PN1A 2FHSA 4C0JA 2ZRHA 4IOJA 4E03A 2ZI6A 1FFXA 4YJGB 3IPRA 2J0UB 4HTAA 5IUKC 3VDRA 4IG4A 4UDNA 1IWBB 1EQAA 4WOCA 1F7UA 2AN4A 4E33A 2HV8A 3M4YA 1IJFA 1HMYA 4JVNA 4Q66C 3KLNA 2DT5A 4ZJYA 1I7DA 1W4CA 3NKVA 4IX9A 3BILA 5FBWB 3QZUA 5DNCA 2O8BB 2WYVA 3Q8KA 3OCWA 4XJSA 4C88A 4B3RB 2HADA 1BSVA 3TJRA 2JGDB 2CMHA 1UWCA 2G80A 3A10A 3OMXA 1ICEA 3L7MA 3TLYA 4DCNA 2I4LA 1SBZA 5AYVA 3UENA 4L73A 4O25A 4EVRA 1YGPA 5C5EA 1DAMA 1PW7A 5IYZB 4EF4A 2A2ZA 1X13A 3DS8A 4IWYA 4EG8A 5JHHB 3GT3A 5B3LA 2D0IA 3BMCB 1J5XA 2Y92A 3KUKA 4HVTA 3ET4A 1LXCA 5CJJA 2ZYAA 1O08A 5IVPA 6YASA 2R3SA 2X3UA 2A9FA 4KLZA 5ICFA 4YCNA 1L3BA 1ONOA 4PPGA 2ZW9A 3KJXA 4U9UA 3DBVO 2PH3A 3FSJX 1KC3A 2ZUBA 1XJQA 4ZICA 3I6BA 1LW7A 5J4KA 4ACAA 5ESRA 3PPWA 1U0HC 2HWKA 4KDCA 4O3FA 2C20A 3ESYA 2AZ4A 3QWFA 4TSFA 2QRUA 3R0ZA 1JHRA 4BC1A 2YV2A 2FPGB 2VLBA 3FR8A 3MG9A 3S70A 1J0BA 1OIWA 1NYLA 3UOAB 4UOZA 1UPAA 3RSFA 1E66A 1C9NA 2BD0A 1WPXA 2J45A 3HHPA 1QQBA 1MAUA 4F2PA 2O2XA 2GBPA 4N6NA 4EGSA 2J3QA 1KOGA 1R66A 4MDFA 3IA7A 4QREA 1T1IA 2WA2A 3CGWA 3S2YA 2JAUA 4IDOA 1JW9B 2A7QA 4RD2A 1LC0A 2I7CA 3IP5A 3Q12A 4UHCA 1AHHA 4C6RA 4POOA 4H31A 4AMZA 3TQCA 3JZDA 5FBZA 2CJWB 4S0ZA 3T5TA 5IUJC 4WWHA 3K96A 1KHTA 3HJCA 2II6A 2VLIA 4XQEA 4B47A 4KIFA 4MUXA 5BOSB 5EP4A 3DL0A 1GFIA 1DQRA 2MJLA 3RSQA 4Z7NB 5ITSA 5JC1A 3S1AB 4IUCS 1UBJS 2GM3A 1WBDA 2Q62A 4GPBA 4O2RA 2Q99A 4AWBA 3KR9A 5A9SA 2JVKA 3SIPA 1P1RA 4J1TC 2C0CA 4CMJA 3G68A 4XEUA 3BAFA 1IZ7A 1JWAB 1T4GA 1U5CA 2X0KA 4W7HA 4I7EA 4XQ0A 1XRSB 3R0XA 4R1NA 4YV2A 2B8TA 1ZL2A 1T4CA 4I14A 4J2OA 4N0DA 2V59A 4LCJA 3HZOA 4ZA2A 2NUBA 2Z6QA 1A4RA 3AHDA 1JHZA 5F73A 2OV6A 1M6NA 4I19A 3WG9A 3KQQA 2W8ZA 3G8BA 3LCRA 1X7WB 5DULA 2XBUA 4DMFA 3FIUA 1Y5IA 5LBUA 3T94A 8GPBA 1QBGA 5GTDA 2J41A 3GARA 4Q1CA 4UULA 1P2BA 1BAPA 2YQ4A 5TARA 1P2FA 5JJIA 4CZ2A 2I3ZA 3ZBUA 1N57A 2NIPA 2Q3EA 5K3EA 3LBNA 4OFBA 3RSCA 1SB8A 2TMGA 1QLWA 1V6SA 2WIJA 3U49A 1J20A 4LHEA 3QLTA 4ZVRA 2G1KA 4KQGA 1ISIA 4UJ5A 1I6WA 1U8CB 3ED1A 2R6HA 1EVQA 1VCNA 1Q92A 2WSSA 3W79A 2UZ3A 1N5DA 3L05A 5I7OA 4V03A 1QZZA 2VJKA 3HXLA 3G5UA 4W1PA 3IPLA 2MYNA 1EDZA 1KVRA 1CUVA 3WXBA 2VYFA 1SVKA 2QP3A 1KO8A 2BKEA 5DMHA 4ZIRB 4CKCB 1FCJA 2VDNB 4EG5A 2JLWA 1G0NA 1RBZA 1F5SA 5DI3A 5FYQA 3S44A 2PS1A 4QHYA 1DFHA 4P2BA 1I4LD 3KZXA 5KREA 1D1PA 2ZJFA 4AJ2A 2CVFA 3NP9A 1ZSNA 3QW4B 4WY5A 3TEJA 1TIBA 3ANYB 3GG9A 4M9XA 4AJJA 4BV2A 1DIGA 3N0XA 4D42A 4AIRA 1NR1A 5E4FA 5AM4A 4M76B 2CDCA 2DBQA 2PU5A 1FP2A 2ORVA 4MCIA 4U1RA 1JH8A 4BO3A 3S40A 4CR7A 2V74B 1R0ZA 3UFXA 4KXNA 5T4FA 3D31A 3JAWB 4WFIA 3TL2A 3NU1A 1NJFA 1L4HA 4RKEA 1SCAA 3GRAA 4FVTA 5K6TA 1GT6A 5KNCA 1VIYA 1CUWA 2W2XA 4DYHA 2DVMA 2X3FA 3JQCA 3GGCA 1K8XB 3I45A 1ESCA 2BRUC 2O6LA 1DWOA 2WPDA 3KT8A 4OKNA 5L3ZA 1TFRA 4WBNB 3MELA 5HIJA 4ZOQI 4D4MA 4MZXA 5BNFA 4H4DA 5JZ9A 2A9VA 2XOXA 4G5HA 2I5PO 4MW7A 3VZPA 3KSMA 2E6UX 4CQLB 2B8WA 2NU6B 3A4YA 1YOVB 4WOJA 3LBIA 4MDHA 4DLKA 1RM5A 3C1OA 1V8DA 3JY6A 3N8KA 1N2CB 3CF2A 2XQFA 4GPIB 2OB1A 5I4IA 3ZVNA 3R0JA 1USVA 5HEKA 1R16A 4X44A 4FX5A 4JNCA 3A4MA 1R0SA 1P5RA 1VFPA 3ABOB 3AERA 2FPLA 2DJ5A 3FJOA 3GGDA 3NAZA 1DG9A 3AQ4A 4HHEA 2X9GA 3ND8A 1SOVA 2JF0A 4NAVA 3I1FA 4PNHA 4QDUA 3U61B 3EXG1 1TKRA 5LZ5A 3RHZA 3HB5X 4DABA 3QVKA 3KPVA 5LQSA 4E22A 1ACLA 5AW1A 2OQRA 2WJYA 3FFBA 3S8MA 1IE3A 3A4NA 1NM5A 2XGJA 1XNGA 1E2UA 1GAWA 1NFFA 1HLGA 2QVLA 4M1ZA 2JFZA 1JT2A 1RI1A 4JJ7A 3ZGYA 3LY5A 1U8ZA 1Z06A 1KEPA 2WU3A 4GOND 3I72A 4JJKA 1Z08A 5KYVA 3UOWA 5BVGA 2C96A 1U63A 2GTPA 1TZCA 1OX5A 1WXEA 3HCBA 4RIGA 3GL9A 3K0SA 5K09A 1E5VA 4YRKA 1G1MA 3KB8A 2VDJA 3PWSA 5H83A 3V1YA 4AS1A 3IKVA 4B3SB 2VAMA 3D7MA 4FFOA 1VBMA 2IYAA 1S9HA 2O0HA 4K0RA 3SC2A 2O50A 3ZV6A 1QPBA 1I33A 4TTPA 2O19A 4P3PA 1RC8A 4RVGA 4DUPA 5JRJA 3RU7A 1G5TA 1HGXA 2CDBA 1C2TA 4F45A 1KRXA 2BKAA 2QT0A 4M9SA 2PWBA 1OQAA 1CHDA 4IZOA 3F97A 4RY8A 5FOXA 4NV3A 1LLDA 4PC1A 4ZGWA 1LRJA 2ZR0A 3N2NA 3OLCX 1NT2A 4AJNA 4B3MB 3OURA 3UMRA 2H5JA 1TC2A 1GKKA 5I51A 4DQDA 4I6EA 2HF7A 2FR0A 1SD5A 3PNOA 1KSGA 3D7LA 4MUNA 1A8PA 3DT9A 3L6OO 3OPXA 5MN6A 3QG1A 1JEDA 1RTTA 3W8DA 2ZWIA 1OKKA 3BSYA 4EG6A 5BSMA 1IWPB 1A7UA 3LO8A 1JPVA 3GNTA 4TGLA 2XNSA 3B3FA 3NNDA 1NHGA 2R6JA 2WB2A 2PK3A 1KMNA 4ZCTA 2NZJA 1NVKA 1V6AA 3NGXA 4J6EA 1YS6A 2ZRMA 4L8WB 3FTEA 1G2PA 3Q41A 1F2TA 1M1NA 3H2KA 4LMPA 3SZOA 4I8DA 3RFTA 2C4TA 3QMMA 4FOSA 3SF8B 3KQUA 1LRLA 4MKHA 4YCCA 1XZPA 2YY6A 4OA5A 5EJGA 5JCOC 1HLDA 3F47A 2FCRA 2R00A 4I5DA 4IIJA 1SHTX 3NHJA 4QA9A 4E51A 4PX9A 2NYVA 2CNDA 2C94A 4KH0A 1AKRA 2X5KO 5JASA 2IBTA 1COZA 2XQJA 1PKEA 3HFGA 3ZE7A 4GMGA 2AI2A 3HR4A 3OIYA 1IZ8A 1CUUA 4TYNA 4E5UA 3JQDA 4BZZA 2JFBA 4BNVA 3SIXA 3V1UA 4YUVA 1KPHA 3O4VA 3EBPA 2QG4A 3T5DA 1OH5A 4C05A 1HT0A 1LLCA 4BIIA 1VCMA 3KC2A 5EIHA 2ZVQX 1OGIA 3OD5A 4XPIA 3ZV5A 4JYMA 2PT7A 4R3NA 1S4MA 4OG2A 2D2VA 4FUTA 5FWDA 4PLCA 4KAAA 1YNSA 2ZUDA 3IBCA 1YJCA 1L5OA 3OMLA 1G2QA 1IN8A 3QY0A 3PXUA 4PRZA 3O91A 1EX9A 2BGKA 2RCYA 3M3DA 5CFQA 4G5QA 1FRNA 2JLCA 3D8RA 4Z3KA 2FE4A 4ML3A 4D2IA 4Q9JA 3T3DA 4RXMA 3GIWA 1UBMS 1Y8CA 2C5EA 3GDWA 4B3JA 1D1SA 2Q5QA 3DBRA 1SZJG 2B8NA 5SZJA 3RVMA 2XADA 3MIZA 4F71A 1MGOA 2PRZA 5JOQA 2FR8A 4H08A 5CPFA 2FRDA 1CZRA 1UMDB 1JDPA 3VU3A 1EFDN 3WMXA 4XQCA 3U4MA 1DJNA 3P4YA 4JL5A 1NRJB 4RMNA 5FPSA 1HDXA 1BN6A 3LC2O 1ZK3A 5AM5A 5J5CA 3ENNA 3HKCB 5KKNB 2NMVA 1I13A 5CVVA 1PS8A 2CJXA 3H65A 1CUEA 1R9NA 2CFSA 2DFDA 1U3FA 3FFAA 4HC4A 4P22A 4R84A 4V38A 1KSHA 4E2YA 4Z7OB 5H4GA 1V16A 2HXSA 1L5YA 1M83A 1KY5A 2YWHA 1YKFA 3TQHA 1E92A 1N3LA 2AMVA 2ZTMA 4FFBA 3DMGA 4DM7A 1OU0A 2F3RA 2H11A 4ERXA 2X9QA 1R0WA 3O9ZA 3B60A 1V71A 2V4UA 5A9TA 5JVDF 5EJIA 4C3UA 4HAXA 4RK1A 2I7XA 4HDNB 5DNYB 1ZUNA 4WK6A 2I6GA 2P1DA 2B1GA 2JI6A 3KJZA 2WHPB 2VOJA 3FVTA 4MB2A 1FLDA 1GGEA 1OFGA 3OF3A 3E2MA 4CHGA 3ZN2A 1TB4A 2IS6A 3CYFA 5GQSA 4C4ZA 1XEXB 1ISGA 1V3TA 2YYAA 4RZIA 3UBTA 2BGUA 3T35A 1E9SA 3WYFA 3NEPX 1PQPA 1K7SN 1U0LA 4L8GA 3CNHA 2OFOA 4HMQA 4X6LA 3U4CA 4F6RA 3MA0A 4IMJB 2YIDA 2POCA 3E7FA 4FYWA 2WZQA 2F3QA 2WUDA 3I5MA 3K94A 3C2QA 1BOFA 2R96A 3D2BA 5GPBA 1JEOA 2H00A 4FGWA 5IH7A 4BVGA 4CKEA 2D0OB 4GP9A 4TKUB 1B43A 1F0KA 1P4JA 3NIWA 1MA3A 3KYCB 4FSHA 3JCZA 1YRQA 1RYDA 5AI0A 2IS1A 4QRDA 4WZBE 4X7RA 4KXLA 3RWBA 4B6PA 5FX2A 3KQMA 5AJTA 2ID9A 2FB9A 3UAXA 1JB9A 3VR3D 5EJMA 3BB3A 5B1DA 1B0ZA 3TPZA 3KU4A 3EGIA 1C1HA 4YJFA 3IAM1 3LUAA 2EKQA 3N53A 1M1XB 1YL6A 1Z45A 4L74A 2NSHA 3IPCA 1DOZA 3KV1A 5J40A 2CHUA 3MRXA 1D2RA 4R3WA 2HA6A 3QVOA 1B74A 1KE2A 2RGRA 2AKEA 2YXDA 3OAAD 4DV3B 3K09A 4DJAA 1XA0A 1ODSA 4PICA 2P65A 4QGGA 1ZA1A 3BPSA 4RC9A 1CSEE 3N5KA 3EBLA 2BKVA 2YBEA 4FDUA 4FFRA 4NDNE 4EVSA 5KSOA 4D02A 1SRQA 3L6BA 4PYKA 1RE1A 1RKVA 3MJSA 1WB6A 1ZU4A 2FGKA 5ES4B 5BR8B 2OCAA 3AFNA 1CJTC 3L04A 4BMCA 2YVAA 2JFFA 4LZWA 4DR2B 1NBOA 1VI5A 4MZDA 5FA8A 4UTVA 1GXSA 1FTNA 1E3TA 4EPXA 1K6IA 2GK6A 2OHFA 2F55A 1XEWY 1QYWA 2CFCA 4C3VA 1MAWA 1GA6A 2XUOA 4D46A 1EK6A 3BF8A 1NW3A 3OE7A 3SR4A 3TUIC 1UXHA 5ILQA 5ALZA 1Q16A 1QTQA 1J2JA 2XH8A 1PZNA 1YZUA 1W7AA 3MWEB 2QBYB 4ZQEA 3A6JA 1ULSA 3OJFA 5EKDA 1DBRA 3C6ZA 1E8MA 3KLPX 1EDBA 2DWPA 2GCPA 3N87A 3NHLA 3ONEA 3GPLA 4KEAA 13PKA 1J49A 1Q0TA 2ZTUA 3AFMA 4I50B 1WMSA 3PIDA 4NG5A 1AN0A 5FO0A 1YT5A 1YNOA 2XDQB 1U1EA 3PDJA 4C7VA 1YRHA 2YJNA 2H16A 3QI2A 3UAZA 4CIWA 3AHJA 2AOTA 3KKQA 2FZCA 5ELMA 3VDMA 3VR5D 5KJ6A 1L1FA 3GVXA 4EATA 5ICSA 5TS3A 2Y6VA 5IM4A 2JG3A 1IHPA 4DR5B 1L4MA 3VO1A 5HIMA 5K0JA 3HN6A 3QUAA 3H99A 2P5TB 3QQPA 3PFFA 4GVLA 1ZM2A 1P73A 1V5WA 1P0FA 1LW6E 2RH8A 1KEWA 3T1TA 1GDDA 1T3HA 2Y9MB 4XX0B 5JD3A 1WCXA 1M34B 2AVNA 3UYKA 1BYIA 3W3AH 1ULHA 3KQPA 3GUHA 3FFXA 1MB4A 3R9IA 3MTQA 2JLUA 1OBHA 3QUSA 2CXPA 4H16A 4CGYA 5KYWA 2VRWA 1FVXA 1K0UA 1UR5A 4FSDA 1OAOA 2AFHB 4AMGA 5JUWA 3E8SA 1Q12A 3GPCA 3NRCA 1B0UA 2HHLA 1UBEA 4A0SA 1TC1A 1YR8A 3DOEA 4HN4B 5JYDA 2WWIA 5AXBA 4ER6A 1HWYA 4O2AB 2NQTA 5FA6A 2BGWA 4YJ2A 2FPXA 1TQHA 1DIBA 1Y5MA 2IJGX 3O4GA 7REQB 3O7WA 5AVQA 2Z09A 3ZY6A 2EZ4A 4QGSA 5KWSA 1Y3FE 4G6ZA 4PG6A 2EP7A 2Q4RA 3IAXA 4BV3A 3P5BA 3LDHA 2ZYIA 3I8SA 3P0IA 4B4OA 1ZJWA 3EZYA 1ZU5A 4A91A 3PUKA 3BJRA 4P2GA 1RZUA 3VOSA 3O93A 1MO5A 2IDKA 3OSZA 4GXTA 4R1TA 4RQUA 4PGHA 2YNMC 3E05A 3F1KA 1XDSA 1A9ZA 2Y71A 3R1IA 2Q46A 3UMSA 5B7NA 5IBPA 5IW8A 4TTIA 2IZZA 1P44A 4DV2B 1E4YA 3KUCA 2OV1A 2PX4A 2ZIWB 4RVHA 5FUQA 2C3YA 1MW8X 3DMYA 5DGXA 3DL2A 1TT5A 3AM4A 2J0VA 2CE2X 2QTWB 3L5KA 1KSJA 2J0SA 2F1RA 3X2FA 4RIIA 5TE9A 4BLVA 1EUZA 1AZSC 4RHTA 4OGWA 3BG5A 4P08A 5B2ZA 1G20A 3WQHA 1ID8A 4H35A 4IYRA 2JIRA 2Z8YM 1GSIA 3H9EO 3AP1A 5ES3A 2UUAB 1O7JA 4QFBA 5L3VA 5GIPE 2HSDA 2QZSA 1SQ5A 3UJDA 2J7PA 3AJ9A 3R7WA 3ABZA 2RBEA 2ALJA 2V0GA 2PE5A 2GZ3A 2CF6A 2DR0A 1ZY2A 3HDVA 1B93A 4RPIA 1J5PA 4DNOA 1Q95A 3GRCA 3NIDB 2OD7A 3H9QA 4QATA 3BN3A 5A03A 3E9NA 3PXEA 1CT9A 1LSOA 2Z0MA 4ECEA 3N8NA 3Q0EA 4A3SA 1HG1A 4E14A 1XU7A 2BFEB 3R5SA 2OKCA 2EV9A 1FIUA 1UPXA 3W3AA 5JZVA 1FUKA 4A6XA 3C6YA 4R54A 2FWNA 1NIPA 2C5AA 3DOHA 2V3CC 1K8QA 3PFWO 2J87A 1KI3A 4ABYA 4PNEA 1ZSYA 2VJLA 3MLEA 3OQHA 3DBOB 5DM2A 3LT0A 3ORQA 1YXMA 4NC9A 5DK4A 3ZKWB 3H17A 1I0ZA 5ECYA 4KG7A 2CNWA 2H52A 2QSJA 2KX7A 1ZZEA 3KELA 2FEWB 1Q20A 2ZSJA 1MPTA 1DQPA 3JTEA 3QF7A 4YRJA 1ISJA 1N5KA 5BN5B 2VJCA 1TAHA 4XPZA 5KCMA 5JSFA 5L4SA 3WGMA 1XCJA 3MTJA 4QTXA 5D87A 5DGIA 4RESA 3WLIA 2A0WA 2QLFA 1LBTA 1FFEA 2V5AA 3EGDB 5SV2A 1XMQB 1R15A 2CWDA 2PRIA 4RD1A 5IJ9B 3W5JA 3EARA 5F2NA 1U8FO 3A2NA 1GPKA 3OZVA 3CINA 3DEKA 3M9XA 1AN9A 1T5HX 3I5AA 2PGAA 1C5KA 2ENWA 3VKVA 1T34A 4AO8A 2W8BB 2WABA 3H9UA 2BP7A 2IZ5A 2Q7XA 1KNXA 3CNLA 4HQ0A 3A14A 2V7XA 2ORIA 2ZI5A 3TFWA 1ZCJA 1LDEA 2BFCB 4WW0A 2I7VA 3E4DA 1E0DA 2JRCA 3WR5A 1IBLB 1J0DA 5AKJA 5JRDS 2BFWA 1DHTA 1GITA 1UZUA 3VZQA 3ZZNA 1OSNA 1EXVA 1Z6YA 2G8NA 2IDMA 1LPAB 5A5DA 1H3EA 5EMHA 4BP8A 1KZYC 3G5AA 4HDOB 4JAVC 3C7AA 3GLHA 3WLEA 3F3KA 3LUHA 3A37A 4EYGA 3EA0A 1PDOA 2WU4A 1VA5A 2JFUA 2I62A 2XCOA 3FDZA 4KPEC 3CX6A 3CMMA 1C41A 4KW7A 4D6XA 1M2EA 1LBHA 3GK3A 2D7JA 3HR8A 4UVHA 3CUVA 5CFNA 6NULA 2G70A 2C03A 4R8SA 3K9QO 4RM3A 1CETA 4J94A 3K8ZA 4YB8A 3DJFA 1S2MA 3UJPA 5CURA 4D98A 1U3CA 4KXUA 2GXUA 4C9BA 3E3NA 3T3PB 1QR2A 1E6MA 1KL7A 2CNOA 3PCRB 5B1YA 5CDSA 5IT4A 5HW0A 3W5DA 1AXEA 4FZRA 4EPTA 2TMDA 2NZWA 2A14A 5K2MA 2BJVA 4AJKA 3C70A 3PGXA 3FRJA 4XD2A 1ZMTA 2QZJA 4DY6A 2HMUA 3HJFA 3UEOA 4AJLA 4D1YA 1Z6ZA 2LIPA 1COWA 4HO1X 3L01A 4IXDA 5AJHA 1I7SB 10MHA 1GDTA 1DC7A 1ONPA 2BEUA 1WOMA 4LNUA 2VHYA 3F7OA 2NQ2C 2HSGA 4RH1A 2YW9A 2JH9A 4A1FA 5LU8A 3JVIA 3D7NA 1JEQB 2NN3C 1MDFA 3H0KA 5EWLB 4DQUA 1HFJA 1XQ1A 2MOKA 2O3JA 4P3NA 1Q0RA 3VV2A 1BDJA 2XGOA 1G55A 3LT1A 1MA0A 4WN9B 1W1WA 2AZXA 2V55B 5HOEA 4FLEA 2UXCB 1MJGA 4DLRA 5K6RA 1LSSA 4JUDX 4KRGA 4WE3A 3ZDZB 2B5WA 4YCSA 2WUEA 3DOCA 4ZMRA 3GNLA 1EVEA 4MK4A 4ND2A 4NYJQ 1NVTA 3BZWA 1GGFA 1ZIXA 4RZSA 3C1AA 6CHYA 3UMMA 4YR9A 3QV2A 1ADBA 4O6VA 5D51S 3O21A 4L95C 2ZIUB 3R8XA 2UVPB 3UQYS 3UF0A 3TTXA 3UV7A 4YRDA 6ABPA 4KR2A 2VYND 4JK3A 2FMUA 2I4MA 2QEQA 3AOEC 2J4CA 4MV3A 3BCSA 3RW9A 3PDCA 4NPAA 5AW4A 1LSUA 4QU0A 4F5WA 5A4DA 4DDWA 5IBQA 3SVLA 1QU2A 1OPRA 1FMFA 2HIHA 5I7RA 5JCJA 4AXXA 4HGNA 3M1AA 5DP1A 1G59A 1GTMA 2A3NA 3I28A 3EA5A 2PKQO 4YPOA 2GEFA 5KWVA 3SYMA 1QCZA 3U39A 4AUEA 1BCRB 3HA2A 2RONA 1AMNA 1S2DA 2KMLA 4IRUB 1FUIA 1X8KA 2QG9A 2P8SA 4KP7A 5BXQC 2QS9A 4Q12A 5JSZB 5JISA 2IODA 1FNSA 3EDOA 1BEEA 2PR7A 3C8UA 3DE0X 5NULA 5BT8A 2XYGA 5F4BA 2Y77A 1OGYA 1YVRA 1JAYA 4DQKA 4EYEA 1MORA 2O8DB 3K2QA 2NU7A 3LG2A 4BO5A 4WZAE 3DC2A 3IEUA 3QX7A 5KVAA 3EH2A 3JD0A 4ZVNA 3RR2A 2IU3A 3PPYA 5FJIA 3MJ4A 1LWOA 2HHCA 3ESXA 3LC0A 1W9HA 1LJLA 1BGWA 3AP2A 1H0SA 3FBTA 4M0EA 3ULKA 1E2MA 4BB6A 4O63O 2EWVA 1RI4A 3PVZA 4FS3A 2R4TA 1G7TA 3NBMA 3AFHA 4ZCSA 3UWMA 3K9BA 2GRAA 2W4MA 2A1UB 1PS9A 5E0OA 3RYCB 4Q1BA 1E7YA 5DNVA 4KUHA 5FWYB 1AKVA 3E3OA 4TRRA 5JDIA 3P9CA 1H6AA 3ZQKA 2YTZA 4HNRA 4J3FA 4X97A 5DLEA 2BAGA 2QA5A 3L4EA 4JFAA 1GKYA 4S2EA 4TXNA 1DBSA 3OJCA 3H5NA 5DWVA 1QGUA 2DSNA 2PL5A 3OT5A 2YW2A 3HUUA 2VL7A 5JWRA 4GSLA 1KZGB 4KQ2A 1V9SA 4L5CA 3SOZA 3U7IA 1NVAA 1PG2A 2W42A 1N33B 1LBSA 2QMOA 1CQZA 1N8NA 3IMGA 1G6Q1 3L3BA 5F1YA 1XQ9A 2IYPA 3KQHA 1UFVA 4GPD1 1STOA 1PQYA 4WKBA 4DILA 4P82A 3JWGA 5BR7A 3A6GA 1ESNA 3KXKA 1SUCA 3EC1A 4TVBA 1TK2A 4AJ4A 5AW5A 1FTWA 1M2GA 4EEXA 5JLAA 3BM5A 1N0WA 5K1ZA 5C4GB 5HZKA 3WQQA 2ZAGA 4KBGA 1DGQA 2ZJZA 5JBNA 4ES6A 3ENQA 3T3MB 1CG6A 4PRKA 4UUMA 1AXGA 3ML1A 2ZOSA 3CG4A 2VYQA 2ZE8A 1CEQA 1JF8A 5THKA 5HKKA 4MWBA 4LOLA 3JVUA 2LCFA 3N70A 1J23A 4QYXA 4BNXA 4JB3A 4RDXA 1G66A 4L3WA 1E98A 4BWGA 4F46A 1SRRA 2DXIA 3ZWNA 1CIJA 3IQEA 1ZGJA 3PGLA 4PNPA 4C21A 5AVVA 3W7VA 4XM1A 5DXAA 4ER0A 3B8EA 2BCJQ 2XCTB 2CXOA 2GPYA 3BICA 4HS9A 4RF5A 5C0OE 3GRUA 2Z58A 1ZG3A 4O4JB 4PAWA 4TT3D 3MILA 4YNBA 3FWHA 4KV9A 4QUKA 3ZZ0A 4ARIA 2CEAA 3ASYA 3MLBA 2YVKA 4LQLA 1MC1A 4YP6A 3SCZA 1O1YA 3TE6A 3U3ZA 5ALJA 3K70B 4RFSA 1XFDA 2X1LA 3COSA 1JR3E 3DWGA 4BAGA 4M8NE 1RS0A 1Y6JA 1Z5VA 2ODNA 4H7PA 3KO8A 2CF5A 2E1RA 4NFSA 1W1UA 1KP9A 4KWCA 5CT6A 4KIJA 3VI4B 1RR6A 4K40A 4QU9A 1DEKA 4X61A 1J00A 2B2CA 4EY8A 1Z5NA 4QT4A 2JFHA 2QT1A 4DMUB 2Q2OA 2JCSA 3EGOA 2G1JA 3NBKA 4DTCA 1AG9A 5GJCA 1VZ3A 4HYYA 3TQFA 3FYUB 2XXJA 2QD5A 4QHSA 1CTQA 5CFMA 1PSDA 3IKLA 4PGAA 5LN1A 3ENVA 4FZJA 4PVCA 3ZDDA 1QKIA 3LY8A 3UW1A 3PR3A 2ID4A 4R98A 3RHSA 1OC2A 1W5SA 1Z13A 3D0OA 3V4SA 1CUSA 3JD1A 4HL6A 4XIJA 3SZGA 4BN5A 2WD9A 1JAHA 2WOJA 3P9NA 3OC0A 3JQFC 4L28A 1TZKA 1WZCA 4P8RA 1Q0LA 5L9AA 3EEOA 3IC5A 2PBZA 3OZGA 1FJHA 5P8WA 1Q1AA 4BZQA 5T6BA 4HVCA 5EUBA 1Q7TA 4KTVE 5ENDA 4II2A 2FV8A 2PYZA 4QAJA 3SU8A 4L5BA 3RTAA 4ARCA 1UDXA 1HFWA 1EFCA 2Z3WA 3NWBA 1IY1A 5ALPA 3ZX4A 4Q21A 3HS3A 1R0BA 4OEHA 1JTVA 2F3TA 2Z6UA 1TF7A 2N75A 4N1AA 5A3JA 1O9GA 3OQ6A 5EE0A 1IIRA 6AT1A 1EVLA 4Q4CA 3U3DA 2XZOA 4JBIA 3O2SB 5J59A 4ZYTA 1TEVA 4YJ3B 2O3UA 1A2KC 2WTEA 1TM4E 3TWOA 3DL4A 2IITA 3C3DA 4KODA 3SQDA 4GRIA 1BA2A 4UM9B 3PV0A 4YA6A 4HGPA 5BRJA 1S7CA 4F1JA 3A6DA 5IC6A 5K5EA 2EU8A 3RF7A 1MB0A 4E1VA 1EFUA 2DFNA 3TIIA 4UQOA 2EQBA 4NBWA 2EGGA 2PRYA 2ZI9A 2C29D 5HIIA 4IQ8A 3DB2A 2DX7A 4LV8B 1P5ZB 3PE3A 3UMFA 3QOYA 2GDJA 2V6FA 3DWIA 1UKZA 3RYIA 2R8XA 3PE4A 2W2QA 4NV0A 3CZPA 1NVDA 1FRQA 2XCUA 5FUYA 5H5JA 2PQ0A 2QXUA 2YMQA 4EJMA 5M7EA 1DE0A 3D02A 4YHBA 1M0WA 2V6IA 3GLQA 4WXMA 5EE3A 5C31A 3SNKA 1WXGA 2JCXA 2XUFA 1QFXA 2WG1A 2H1SA 2EFDB 2QKYA 3GCZA 1DQZA 3R6GA 3TNLA 5TY0A 4F8YA 4Q4HB 3LHDA 4HLCA 4DV1B 2B5OA 3IKMB 5C34B 4NI5A 2OD2A 4BNDA 2X8JA 3BL6A 3CE6A 3KT6A 1T9GS 1NMQA 2XX3A 1L3CA 4HYQA 3H05A 1KQFA 4ZTUB 4B5KA 1VIDA 2YHSA 2YQ5A 1NG9A 3DDNA 1AUOA 3SAJA 3WICA 3CKYA 3P0FA 4LNAA 1ZVMA 3QKUA 3T0IA 3D0QA 5IKEA 2X2EA 5FPKA 3HJBA 1FVFA 4EBBA 1WSBA 4HUQA 1B8OA 1TJYA 1NF3A 3FUVA 5M3BA 3WV4A 2QMHA 3QYFA 1XAHA 3TW8A 3JASA 4PYJA 1M2VB 2PG3A 4KYVA 4OTZA 4JGIA 5BW4A 1PJBA 1Y6QA 1HQKA 1LBEA 2AZMA 5JBIA 4A8HA 1EFRD 2DRIA 5LPNA 5DM70 3MWDA 4XFKA 4HVAA 1E1RD 4TRNA 3V8EA 3HFSA 2PZEA 1PR4A 2HIGA 5EP2A 3WNVA 5L8VA 1PL8A 3IVXA 4JI1B 3D7KA 3QEBZ 4F9TA 4IFIA 4ZT7A 2WLTA 4NECA 2FQWA 3H5LA 3HCRA 3A70A 1THZA 1EZ1A 1HYHA 2O7VA 2QTGA 1A9YA 2QRLA 3G0GA 4FZVA 4TXLA 5G3ZA 5FULA 2UVDA 3E35A 1K75A 4PGFA 4RAQA 1TECE 2DGDA 2VN8A 1BDHA 3WL6A 2FVYA 3Q11A 2EFGA 4YQFA 2PTGA 1RRCA 4N49A 3L4JA 2IDZA 3BFVA 4D0GA 4Q7LA 1WZUA 3V4OA 1QPGA 1ZCAA 4F84A 5FLYA 2ZSDA 2HMAA 3DD1A 4LWPA 1Y33E 4I9HA 2IK8A 2VAXA 3TVTA 2ZT5A 3K4PA 2WY2D 5BN4A 4X90A 2DLNA 1WX1A 3JQ7B 5GM1A 5K3AA 4LZJA 4TL8A 3T7DA 1NXQA 4UTZA 4PAMA 3NATA 3RTBA 1WUKS 2OY0A 2PZGA 2FOLA 5FOUA 1H69A 3JQEA 3G23A 1QE0A 4X71A 5CT5A 3CZQA 4RVSA 3RKRA 4GI7A 4JT2A 1QDLB 1KDPA 1WZ2A 2PFGA 2W70A 3GA7A 1SELA 3BFPA 3TOCA 3ZWAA 3UO8B 3L0PA 3QE0A 1WKVA 1R5JA 3ORSA 4QPNA 5IN4A 1NE7A 2E5WA 1C9JA 1L7AA 3HEAA 3WTCA 2K4MA 4EI2A 2IIVA 3JATB 5KSYA 3LVQE 4KJZA 3TBFA 3A1FA 4P32A 1KH1A 4A2CA 3G49A 5DJ5A 2O5VA 4HH4A 4FOTA 4XXHA 3R44A 3CBGA 3F8TA 4G0VA 2PGJA 1GCGA 3N0TA 4E94A 2VUUA 3U4QA 3CHYA 1P39A 4FGUA 1BMFD 4QYSA 4E12A 3VNBA 5B1HA 4AAYA 1UXKA 1T0PA 1XJCA 1HE2A 5K3SA 1OC4A 4B3BA 2XBMA 4UHJA 3SJZA 1L6IA 4H59A 4LSZA 1Z7BA 4OK3A 4ZI2A 3JALB 2CW5A 2JIBA 3O2JA 2WZCA 2O0LA 4Y2RA 4ARZB 3O82A 3PJEA 4IO0A 4TV9A 1UP7A 3EX7C 1M6VA 4GKJB 3EHEA 4L6AA 2VSFA 4EHNA 2Q3MA 1E9DA 4K6GA 4O2BA 2WDPA 4I81A 1XZFA 2HDHA 3IQDB 3T34A 3O2NA 4J4BA 3U3RA 2NXJA 3T9AA 2UKDA 4QUDA 4RA9B 2DHDA 4KTTE 4EB3A 4NVRA 1W36C 5H81A 2G5TA 5DE3A 3K5HA 5J2TA 4JENA 3FHTA 2IXAA 4TS1A 2D5IA 3KYIB 5FAXA 5KO2A 4MQBA 2RG7A 4NOLA 3BMNB 2EF1A 1Q2UA 3AP3A 4FBLA 3L9XA 5LM3A 3J7AC 1T43A 1XTSA 2R751 3G17A 3Q3JB 1AKUA 2FUG1 1UKVY 4FDVA 4QIHA 4W8HA 2Q3JA 2Z9BA 1TCVA 2ARKA 2HYIC 1BVRA 1WLSA 3IT3A 3ZHZA 3TR0A 3UJBA 2QG6A 1U7WA 5IF9A 2N1MA 2PKYX 5GIOE 4MVWA 4R1QA 3LZDA 4YRAA 1AKNA 1TYCA 1UKAA 3O03A 3WK4A 3AHFA 3OETA 2RHMA 1GZ4A 2FF7A 4F7WA 2ZM6B 3NQ41 1K4KA 1NBMD 3ZGZA 3TB4A 3WRVA 5IFKA 3N2KA 1QIEA 1FP1D 4MMZB 4RZXA 2J5QA 2YDXA 4IBOA 2H18A 2PGDA 3LSYA 1UXJA 1VL1A 4MROA 5EQFA 5A1TA 3KZKA 3HKEA 1PL7A 3MQ4A 3N86A 1EVIA 3SZRA 1N7IA 2OV3A 1U2GC 3UN1A 4M1YA 4JX9A 1JIXA 1PR9A 2IYSA 1POXA 3KUDA 4MRMB 4BO0A 3ERCA 4IJKA 2O2YA 2K2WA 2QMYA 1U4NA 3KYJB 2NAPA 4WNIA 1PTJA 5FPTA 5KYNA 2ZRQA 3VNSA 1X0XA 1YRYE 2E3JA 1YDMA 2H0RA 1PGOA 4U9IS 4E5PA 4EHFA 1M2OB 3PHBE 1CV2A 3RUHA 3KPYA 4RELA 1F48A 1TJ3A 2ZDQA 1Z83A 4M88A 1E60A 1WCYA 2XE7A 1M67A 1RFGE 3B85A 1EG7A 1SMKA 3RUIA 4B3FX 5IEJA 2WHQA 3AHIA 4ZT6A 4CF6A 3JQ8A 2PKEA 4JN6B 1NN3A 4P86A 1ZL0A 3RYFA 1A2QA 3GLIE 4L0CA 3SJUA 1SKYB 1PL6A 1AOXA 3D8NA 3EC7A 1X1TA 3JVDA 4YH1A 3RIMA 3WKAA 4B0OA 4CM8B 2W43A 2VKQA 4PIMA 1R8YA 1UK8A 3IP3A 2VJMA 2OP1A 3ONFA 4I36A 1GARA 1YJQA 1N77A 3C3MA 2ZWMA 2OAEA 3CTMA 4M87A 1QIKA 2HBQA 1QVWA 2V7GA 4BNKA 3REQA 5HJEA 4PSCA 2GN2A 3PXGA 2FJUA 4LOKA 5ALXA 1SQFA 3N2ZB 4OQDA 5B7PA 3FTFA 5EI5A 1OH8A 1E1CB 5CM9C 1GRRA 3ACCA 1U28A 2ID7A 2I6SA 4Z8YA 3PJFA 5L3RA 1DKLA 1NXXA 5HILA 5IM4F 3A9SA 1SXJE 5CHEA 1GPJA 2DY1A 1XA3A 3AJAA 4MWEA 3ZCXA 5BO5A 3FF1A 1I51A 2BM8A 3EF1A 4YMGA 3WJAA 3O83A 3SFZA 1ESDA 2QU7A 1MEEA 1D9XA 2KQUA 4M8LA 4Q82A 1G4HA 1UOQA 2NZVG 1N2IA 2FN3A 3LA8A 4U8HA 3JS5A 4H7EA 4AF6A 5BPHA 3QFTA 4DEXA 1NWHA 3KSDO 3UGQA 2WJZB 1A82A 1MH9A 2QX6A 3PTLA 4IXMA 4RPHA 1IDOA 1F2DA 1PGNA 3FCSB 4ZXPA 3H3JA 3DUFA 4CETA 6ADHA 3FPLA 4Q4AB 3G9QA 1QRAA 4QSMA 3IL2A 4AKTA 3OM9A 3K2BA 4C0QC 1QP4A 4RS3A 3S5JA 2P3SA 1VG9B 3OPVA 1LDNA 1RC1A 2MR6A 2RH5A 2ZJOA 1QLHA 3D4PA 5CJ2A 1Z5UA 5A6VA 2AG0A 1P18A 2H17A 2BR5A 3PK0A 4C0WA 4I9UA 4EK9A 4YJ2F 4MNTA 1EXNA 1O95C 1LPBB 3HEBA 1R6XA 3IR7A 4C5CA 1SKMA 1ZUIA 1C1XB 5F3DA 2H1VA 5LP1A 1RBQA 3M70A 2UZIR 2VZLA 1L7BA 3JQFA 3JYHA 1NUSA 2X5NA 4Z3DA 2FOXA 4K9OA 1KAGA 1XJWA 1Y1QA 2ZCVA 3WL7A 2P2NA 4GGPA 4S1TA 3G1UA 3MINB 4UAVA 1BX0A 3QWBA 2YMLA 3OP4A 4M1WA 1CVRA 4O4HB 3DDSA 4Y2XA 2C31A 5ALFA 1L0BA 4ZFNA 2H65A 2JFQA 2FPRA 3DO8A 3HDQA 1XZGA 4MPRA 4O33A 4AIIA 4AY6A 2IX3A 1WCV1 3RS8A 4KX3A 3A3PA 1IN5A 4B48A 3THXA 1US8B 4L4UA 4YYEA 4BN0A 3IDOA 1E4OA 3VR4H 3KHUA 4RK6A 4RZQA 1BD3A 3ZWMA 1V48A 3LQKA 4MGYR 1HQYE 1TFUA 1XI2A 2WYIA 4CG1A 2FFRA 4UVGA 3I1JA 4WZAA 1XHEA 5FI5A 3RAPR 5MGNA 2YFQA 4DM3A 1C30B 1SC4A 3MJTA 3ZK9A 1U7DA 4YAKA 3IEVA 4P3KA 4QOIA 1J06A 3UVEA 3KWLA 2EJBA 1KO1A 1PFYA 2L0XA 1ES9A 2QVYX 5I9BA 3ZI4A 3IHLA 1EP2B 2O5RA 2P0YA 3E15A 2HLDD 3DTVD 2I71A 3PC8C 2R0QC 3BKWA 3CNOA 3IPAA 4WK2B 3I61A 2JZNA 2C54A 1XR3A 2O7RA 2R5WA 4P33A 5GOZA 3HABA 1BIFA 4XWKA 2CBGA 2QAGC 5FQNA 1ULAA 2P6OA 3CZRA 5AJZA 5EWJB 4X7MA 2C0QA 4RHUA 1EXDA 3JAKB 2OKGA 4BCBA 3WISA 3AU8A 3NC4A 3DWEX 4MDYA 1PGJA 2H3EA 5D86A 3LNCA 4WESA 3ZDRA 4LFAB 4FGZA 2YN2A 2VHEA 1PX0A 3NVMB 4JELA 3OKFA 1G8GA 1NYQA 3U0VA 1EG2A 1QG4A 2LKDA 4ZZ0A 1C1DA 3Q6MA 3GR6A 2J0EA 4D9CA 4J0GA 3PQDA 2P6PA 4XYGA 5JAQA 1KAQA 1UJNA 4S3MA 5IDVA 3C3WA 5KNDH 1OBOA 1L5RA 4HRXA 4PNZA 1E1QA 2GLUA 4NCKA 5TV2A 3VGPA 2RD2A 1ACJA 1BYUA 1JG3A 1X3LA 1X7YB 2L19A 3E23A 2XGMA 2Z43A 3MB8A 3NO4A 4IG9A 1K7YA 2BSQA 3FWKA 2YXPX 2DULA 2BONA 3B13B 1FE8A 1BXGA 3MERA 3R8CA 3RTCA 1DL5A 3W34A 1H5QA 4JR0A 3NANA 2XCIA 4OH1A 4X1YB 5JSYA 4EGCB 3D3WB 4J4TA 4PANA 2KBEA 3JQBA 4YGXB 3W0LB 5EJ8A 4EG1A 1W76A 1CY2A 1Y8RB 3HEMA 5K4HA 4QDTA 4CUJA 3QUTA 1SY7A 1CZNA 3SBDA 3VVMA 1GUZA 1I1OA 2CK3D 3KLBA 2GR9A 4I1YA 1PUXA 4HQ6A 2EIXA 3KR0A 1HTWA 4BLTA 4RHEA 1GG2A 3BULA 9ABPA 5IC4A 1BU8A 1GCAA 3JR7A 4IIYA 2QL5A 5D8DA 5F77A 1FDRA 1X1DA 1NY6A 4RV9A 2VATA 2VK2A 5D6OA 4EAQA 1VG8A 3CISA 1MAAA 2J3KA 3VR1A 2IIQA 3WLMA 3M8KA 3HC7A 2J9XB 2W2OA 3PUJA 3HO8A 4IOMA 5EC8A 5I4BA 3WLJA 4JXZA 5DMXA 5ER6A 3PYXA 1XLTC 1DJLA 3G2MA 1JXMA 2DECA 2QP4A 3BWXA 4ZAGA 4PPFA 1NQXA 4CEJB 1CKEA 2ZT8A 1MVLA 1OXKB 2P7IA 2WZDA 3MJFA 1II8B 3UWKA 3WMWA 3ESRA 3DUWA 3EXG2 2P77A 4J07A 3EIEA 3NOXA 3UXHA 4C78A 4DANA 4E5VA 3HE3A 5HKOA 1KFKB 1QFMA 2HZBA 4ZYYA 3I6YA 4G1EB 1Y9AA 4RACA 5EKXA 3P26A 2X1HA 4IDGA 1D6JA 1RCUA 3IOEA 2ZYWX 4CCAA 4D0RA 2LVBA 5FYDA 1M54A 3I92A 1H0KA 3ETHA 1Q21A 4BNWA 4LGVA 1TVKB 1U2DA 1NFRA 2CUTA 5ILOA 5I7UA 2GPSA 1TZJA 1R0KA 4KN5A 1ORHA 3QKSA 3RTEA 3BDVA 3JAMA 4ZWNA 2HK7A 4JL8A 1IUOA 4MA5A 2WG0A 3E22B 3BS4A 5ETJA 1SNYA 2A1TS 4IZHA 3BGDA 1R0YA 2R5FA 5T67A 1WD5A 3U5TA 4KQMA 1JEAA 1KEZA 1V1MB 1DXHA 1IAQA 1KY3A 1NT4A 3G7NA 3IAAA 1XCLA 2IUUA 1V43A 2IEDA 4LF8B 2VQ3A 3TW6A 1BHQ1 1RHJA 5JY6A 2NO5A 3CCFA 5BMOA 3W7AA 3GN1A 4F11A 2CBXA 4QGFA 4OO3A 4AI6A 2RE8A 3PGVA 1ZI6A 2E89A 3GFBA 4UZSA 4MW6A 4DCPA 1JALA 1KI6A 5AKKA 3RODA 2GVDC 3B5JA 5GY7A 4KXMA 1YQXA 1NSFA 1JKJA 2QJOA 2Q5EA 3WQSB 2O5EA 4RJTA 1J4AA 1SBQA 2V8BA 2A5DA 1H65A 2RK6A 3HR7A 1IM5A 1RVDA 1P62B 3HKBB 1Z5GA 3I2GA 2LNDA 3PA8A 4Q1FA 1TTTA 4OPMA 4JDPA 3ZZUA 3H4TA 5E9JA 3D1VA 3BC1A 1O5IA 3NUZA 4TMKA 4X6XA 5DSTA 3OQIB 1MLDA 1OYYA 4YJDA 5D6NA 1PN3A 2FUCA 4MIKA 1WNTA 2J9YB 5EJ6A 3ONDA 4EY7A 1NMXA 1O2DA 2LE0A 1EFPB 4LDZA 1NN1A 1DCTA 2BGLA 2C8JA 2PCJA 2PSJA 3FMGA 4IS2A 4KSYA 5CH5A 2NU8A 3EW7A 3G0OA 1ODTC 5LQDA 3N07A 2WSMA 3EE6A 3MCTA 1G9XA 3GRZA 4C89A 2IY9A 1E2PA 5BYBA 4HB3A 1HBJA 1SPXA 1T2NA 5TT1A 3X1KA 4DNPA 4HJRA 1UXOA 1KS2A 2WG2A 4XR4A 1I1NA 4E4RA 4MUEA 1SM4A 4CF4A 3P71T 2OGZA 3MIIA 4X3CA 1J5EB 5AK5A 1P3JA 1EFVA 2GLXA 2JGIA 2FX2A 2WNIA 3V3TA 2P6RA 1P7ZA 1ZD3A 2RKWA 3AIIA 3R7LA 1QUEA 3QLEA 2Y1EA 3ZIAA 3D6VA 5L3QA 2EYUA 5AM0A 1J8QA 5C5DA 1GTJ1 4W5RA 3ZDQA 3OPYB 2WI8A 4N8EA 3KOZA 1BWRA 1W96A 4PZ9A 4I3HA 1YVDA 2HX1A 1DRUA 5B2FA 1IOLA 1RHMA 1T24A 4K6OA 3HU2A 3OICA 3QUCA 4XR9A 4YC7A 4IGFA 5EL0A 2FPPA 2PZMA 1I2CA 2ZRCA 3OY7A 4RANA 3RT7A 2HQ1A 5B4TA 2ZXUA 4AKIA 4DGSA 3HP4A 2HA3A 3BHNA 1MB9A 2IWRA 4P4NA 4PHCA 5TXGA 3B1JA 4LZLA 4E21A 4HDKA 2GCEA 2W83A 2WK1A 4EECA 4JLPA 4P7GA 2C3UA 3OZCA 1E3WA 5G4KA 3W6UA 2QTFA 4NBKA 5LC1A 5JJBA 5J4LA 4FI3C 4KPUA 1KKLA 5B53A 5ALMA 2AGVA 2VDOB 1JJBA 1HH4A 1NBEA 2QRVA 2OM2A 4MQ6A 2MT9A 5I5GA 2FSGA 3B36A 1LA2A 1PR3A 1PZEA 4LJ8A 4N0PA 2FPKA 2XKAA 4B84A 1T9BA 4F5ZA 3OEHA 1IRIA 2R1VA 3L77A 3WSWA 3HJAA 1RCFA 3GA5A 4LOHA 2A5FA 5ALEA 1JPJA 1JIQA 2LTAA 3BK7A 4MQEB 5E6UA 3JQRA 3NM6B 5HQJA 5B5SA 3OZTA 4EX6A 2OXEA 2F9FA 2OVFA 4QARA 2HDOA 3E9EA 3N74A 1AF4A 5HHTA 2QTCA 1RAGA 1Z4OA 3AR8A 4JBWA 5F35A 5L7TA 4QC2A 3CKKA 2OZPA 1JE1A 4DBLE 1MB2A 2FN8A 3L7OA 5G02A 4D5GA 3KSZO 3E1KA 2DLCX 1IEQA 2HWWA 1NNUA 3D4LA 2AE1A 1LK7A 4KE8A 3WB2A 4BX2A 2CV1A 2PM8A 3P94A 3VAYA 4DEYA 1XYGA 2JI7A 2L42A 5ALYA 4DXAA 4I55A 2Z9DA 4KQCA 1NYTA 4XD7A 4UBKA 5ALOA 4LRXA 1VJ1A 2AEJA 1BH6A 1QRRA 4R9VA 1QLJA 3E3MA 1VPVA 2HN9A 3GUCA 2BMEA 2A0KA 3G0CA 3OO1A 4LA4A 4LOIA 5EG5A 4EG7A 1YBHA 2A0FA 5AW0A 5B57C 2BR4A 1PWEA 4PIPA 3CVOA 2CZQA 1NOKA 4RQAA 5ALLA 4F5DA 1LWNA 2H2GA 3SHTA 1YVUA 3TKLA 3G2KA 2JGFA 5GM2A 5TGDA 1XVVA 3OA2A 3UAGA 2DR3A 3W2HA 2P78A 4BX9A 2FWBA 1EP9A 1UKBA 2I54A 3NNNA 1KDRA 2QNRA 4MRAA 3ILXA 4AB1A 2P2LA 1U80A 3ZY2A 1I5EA 3CLTD 5D2CA 5GAJA 3QPUA 2XKBA 2Q5FA 3EVDA 1Q77A 3W9BA 3PC3A 3SOPA 3ROXA 1RQLA 4YAOA 5C81A 2I8AA 3HPRA 1PDVA 2X1VA 1RLOA 2MYUA 3AZPA 4I0WB 1JXOA 4HRVA 4M7OA 2X5XA 1T8UA 4DUYB 1U7TA 2XB8A 1JU4A 1LTQA 3A1WA 3EY9A 3LW7A 5ESDA 1GL9B 4YAIA 1BVUA 1SCUB 1NI4A 3PD7A 3LHSA 3HMKA 1A9SA 3IODA 4C6TA 1YQGA 4YT5A 5DRYA 5DSXA 2EVWX 1CR2A 5EXXA 4E2FA 2G7MC 4DIFA 2X8LA 4EI8A 4P80A 1F38A 1CZLA 3AEYA 3KHTA 4TROA 2NTEA 3H1AA 5AJWA 3URKA 5DX1A 3H8WA 1V7PC 1KR2A 3B1VA 2CVZA 3ZNNA 4ALKA 3RAFC 4DXDA 4HS4A 4YFVA 5H68A 2XB6A 2IZOA 3GEHA 5KPJA 3LO5A 1YQDA 2O2EA 1L7XA 1EM8A 4ROTA 3CWCA 2IOQA 3H11A 2NUTA 5BSKA 2NX2A 1FMJA 1VCOA 1YJBA 3CQ9A 3D3QA 1NAIA 4E7PA 3TQOA 4CF3A 3C48A 1YIOA 1U7UA 3ZHOA 1KZ7B 3G3EA 2WUFA 1SHKA 3AY6A 3FKSA 3PGMA 4JCCA 1F2VA 4B45A 3V1TC 2QRNA 4UHHA 4OXXA 2W5UA 1FVHA 3QA3E 2P9TA 4J0EA 3TRJA 2G6TA 2Y0CA 4OYRA 4BQIA 5DOVA 3C7CB 2CLSA 3B5EA 4FD2A 4MS1B 5E9AA 4BCDA 3TQSA 1B16A 2CMFA 1NI5A 3E9YA 1YZQA 1KPIA 3DOUA 2LD4A 3QSGA 4CV1A 5I7HA 3QU7A 3PIRA 1V1RB 4D4GA 3OQ1A 3QTTA 8AT1A 3JWJA 3PVCA 1RU3A 1VPLA 4FWBA 1JQKA 2C4MA 2F3UA 1VJDA 3CRRA 4XIYA 5TDHA 1SBYA 1KFEB 1VSVA 1JG6A 3PFIA 4Y6OA 1SC3A 2ZUWA 3G0DA 3RLFA 3PC8A 1CQWA 1NV9A 2XUZA 5KWIA 1XZLA 2V6MA 3K71B 4KVAA 5IDYA 4X20B 1HNNA 3QI7A 2Q5LA 4CU5A 3FLEA 4O8ZA 4LBZA 1JLHA 2QM0A 3GD5A 2CLHB 5JV5A 1KVQA 1IBKB 1YZYA 4F0JA 1K98A 3GEPA 3UXEA 4ZEVA 3RCBA 3TX6A 4LHXA 1MIOA 1DCMA 4KFSA 4MUMA 3O84A 2KE5A 4M2LA 4Q3DA 4C20A 3S2UA 4IUBS 4KZPA 3GY0A 4QXRA 2PRKA 2SCUB 1N6HA 3QYAA 4ZQIA 2JI4A 2VPZA 3TNYA 1GQFA 2PAFA 3T3IA 1J97A 2CBZA 3IT1A 1CEXA 4MQFB 3LJKA 3ZTWA 1F9AA 3GLIA 4MJLA 1DKNA 1GPNA 1UJ6A 1XKTA 3G0IA 3JX9A 1JS1X 3EVEA 2QW0X 3JR3A 1GZUA 4J43A 3KR1A 4Z51A 2AVDA 2EDAA 2G6BA 4GKAA 4PS0A 3L4SO 3L4BA 2Y6UA 4H3SA 1UBGA 4WI1A 5COBA 5KZMB 3PC7A 3CA8A 1H93A 1RYFA 1IZYA 3MUOA 5K3DA 2UYOA 1Z63A 1FSPA 3IQXA 4GM1A 3VSAA 5L45A 2Z57A 5DBEX 4UHFA 1UADA 4LRQA 4A1OA 4DBLC 4N03A 3CUTA 4BVFA 3THRA 4GR5A 5AOVA 3N6VA 1EGAA 5DP2A 5IXSA 4UUNA 2CUZA 3QKIA 3ENKA 2PJUA 4WZBB 1OTYA 3RS7A 2FP3A 1HEIA 4BNDB 5KCZA 5L53A 1IN7A 2B34A 2DPLA 1ZH6A 3HRIA 1P1BA 2ZB7A 4KO8A 4LBVA 5AM3A 1FUUA 2QP9X 4LDPA 5HS6A 3SR3A 4J9VA 3VTKA 5LP6A 3NPAA 1CE8B 1TD9A 5BSRA 3Q8WA 4WFKA 1JJAA 4K0KB 1IHYA 1SXJA 2C4HA 1KIFA 1E9AA 3EEBA 3PUHA 4Q01A 3ZHUA 4ZZ1A 2VSYA 1VE7A 3FY4A 3VQTA 1TCUA 3ZD8A 4IRXA 2O2JA 2DFKB 5SYAA 2FK8A 2HLNA 5DT2A 4D9FA 1L5VA 1KYVA 1Y82A 3I12A 1II0A 1XLTA 3PFBA 3QX8A 2F17A 2LGJA 3OU7A 2HF8A 1T9ZA 4P53A 3VR2A 3HBAA 3HLTA 3Q7SA 4I4TB 5E9WA 3TW0A 2RHOA 4PXYA 5KNCD 3L0BA 4PYQA 1ZRNA 3DVAA 1W93A 3CRZA 4K6KA 1CQJB 2PXAA 2FLVA 3KBOA 2BZSA 2GJAA 1OIVA 3LCJA 4MVXA 4OHRA 4B1FA 1UQUA 5HE9A 2QPOA 5KVQA 2BFBA 2Q5IA 4BATA 2P1RA 4G5SA 1YQUA 2O14A 2GEJA 2M6LA 3AVVA 3KZVA 4E5MA 1DUIA 1N6OA 3ZZ1A 1KMQA 2FUKA 3RVPA 2PZAA 2ZCUA 3BFKA 5EKUA 1GGVA 3IV7A 2YV3A 3HZHA 5JCPA 2REQB 2I76A 3I32A 1JHPA 2PKWA 1JHXA 1VZ2A 1RABA 2PLWA 3C4JA 1GYRA 4PRYA 2ZBDA 4HNQA 4KITB 5IVKA 3D4NA 4YRFA 4FFWA 1E0KA 2HPZA 2QPLA 3T7IA 5IWAB 1XZKA 2Q3HA 3JASB 2ZZNA 1S3SA 1G6KA 3DVLA 1DAPA 1KQNA 1DDOA 1VIAA 4OFZA 3RV4A 3HJNA 4WK4B 5DCUA 3W1WA 3RJMA 3QU4A 1D7OA 1XZDA 1G64A 1XKXA 3MYYA 3PPVA 4I50F 3EGXA 4DCOA 2HPHA 1Y3HA 4LJ7A 3Q2IA 2H8KA 2W11A 4PPNA