3HEAA

The l29p/l124i mutation of pseudomonas fluorescens esterase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
271
structure length
271
Chain Sequence
STFVAKDGTQIYFKDWGSGKPVLFSHGWPLDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPIFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Switching catalysis from hydrolysis to perhydrolysis in Pseudomonas fluorescens esterase.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords Arylesterase
total genus 104
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3heaA00
3C6XA 1TKRA 4A16A 3WKBA 1QE3A 1T2NA 1IVYA 3FYTA 4WFKA 1ORVA 4F5ZA 3KD2A 1BEZA 3M83A 5AM0A 1HL7A 3IB3A 4BP8A 4YASA 2WHPB 4WFIA 4JUIA 3AZOA 5HF9A 1CUWA 2HFJA 5EIEA 4MEAA 3HSSA 1MN6A 4H7EA 3H1BA 4G9GA 2XLBA 3U0VA 1IZ8A 5AO9A 4BRSA 4DGQA 5ALQA 4AB1A 1ETHA 4WY8A 2GYWA 2XMQA 2IX9A 4OYLA 4ZREA 1GKKA 2OQIA 3IUJA 3QPCA 1BROA 1WB4A 4CI9A 4Y2XA 2ACKA 4UUQA 5K3FA 1AMNA 1GT6A 1DT3A 4QE3A 5KBYA 2C0PA 5E4TA 3BXPA 2VATA 4ZRDA 1BEEA 4L72A 3LP5A 4AQDA 4PO3X 1R4ZA 3N0TA 3ED1A 4GHWA 1W76A 4B81A 1XZIA 4G5XA 5K3CA 2ZVDA 1R3DA 1P0IA 2ACEA 2HIHA 5DYYA 5KREA 1UK9A 1TK3A 5FLKA 5LZ9A 5JZ9A 1K4YA 5ALEA 1YS1X 4Y2UA 4PSDA 4X95A 4ZXFA 1UXOA 1U65A 3C43A 5DTJA 1LNSA 3K2IA 3UUEA 4YPVA 2OG1A 4BCDA 2WFLA 2YYSA 4ZV9A 2VTVA 2I78A 1TIBA 1JJFA 2WG2A 1TCAA 3AILA 4UHFA 4AZ0A 4MWTA 3R3XA 3F98A 1UKAA 3FNBA 2QJWA 1QO7A 3H2KA 3STYA 2XB6A 2BUCA 3R3VA 3ANTA 2EDAA 3I2FA 3FAKA 2VJBA 2WG1A 5A7HA 5D3ZA 5ESRA 4BE4A 4EZIA 3HLKA 3F97A 1XZGA 2ONCA 2ZYIA 2VA9A 4QDTA 4KE9A 2BGNA 1AKNA 1BN7A 1J07A 1QIEA 5SYMA 3SX4A 2WLSA 3ILSA 3P2MA 1JU3A 1XRLA 3B3QA 4PW0A 2H1IA 4C4ZA 2CKMA 2Z3ZA 3DYIA 4J0GA 4FBMA 1OCEA 3KWJA 3I1IA 4ZV7A 3WZMA 3C6ZA 2WUEA 3T4UA 2GBFA 5EHXA 1XZKA 3LS2A 4UBMA 2PSFA 1CUXA 2BKLA 1JT2A 4IH1A 1QTRA 2PSDA 4OB6A 5AIAA 2WTNA 2Z8XA 3FSGD 5K5EA 4UHHA 4XJVA 1CUIA 1CUVA 1LPSA 5DLPA 2JGEA 4LXHA 4U2EA 2DQZA 4KE7A 4LHEA 3KWFA 3D2CA 2XLCA 5AKGA 4BZWA 3VJKA 3U1TA 2WILA 5DWDA 4NS4A 2QJRA 3STVA 4AMYA 2XMZA 2Y2VA 2HRRA 3E1GA 5LZ4A 2WU4A 4FFVA 5LP1A 4H7KA 2QT9A 3V1LA 3BIXA 2J4CA 3H2GA 5ALUA 5ALGA 2X5XA 3M81A 4HRYA 3QMVA 1XLUA 2JGKA 3T52A 4C89A 1ODTC 2O7VA 1UWCA 2XI4A 2WFLB 1U2EA 1ZD5A 2WHPA 5DTIA 3OURA 2X8BA 1ZI6A 1CUBA 5LYYA 2I3ZA 4K6GA 3ZLTA 5T4HA 2WUDA 2VJCA 4QDZA 5CT9A 2XQJA 2XDWA 4PV7A 4FLMA 3WQHA 3PI6A 1N8SA 3M82A 3L1JA 3R3ZA 4MWSA 3HJUA 1IUPA 4KACA 4W1RA 1NU8A 2Y6VA 4INZA 2OCGA 3ZLUA 2BGRA 5CXXA 3AINA 5AKKA 1GZ7A 1FFEA 1Q0ZA 5EIHA 2AJ8A 4AO7A 3DEAA 2D0DA 2H7XA 3HC7A 4H7IA 4PNZA 3ESAA 1TQHA 3H1AA 4UHCA 4DNFA 1LPAB 3W9BA 4HRXA 2WIKA 5CW2A 2AJLI 1AX9A 5EFZA 4JH0A 2XQGA 4P08A 5F4ZA 1CUZA 2JF0A 1WPXA 5JATA 2AXEA 2XUHA 4EY8A 5K3AA 1HKHA 1LPPA 4EB0A 4ZWNA 3PICA 4JEIA 4FNGA 1EX9A 3DD5A 4NVRA 2R8BA 3FYUB 1F0NA 4N8EA 2PU5A 5ALHA 3V9AA 4KAFA 3LLCA 2XQIA 1WM1A 5AKYA 4GXNA 1GQSA 1QONA 1RP1A 5ALFA 5EHZA 4M0EA 4CCYA 5KWIA 2WQZA 2C0QA 2CB9A 2XUDA 4EBBA 1YA4A 2IITA 2JGIA 4A23A 1QTIA 3ESCA 2B9VA 4Q3LA 1W52X 5AM4A 1EDDA 3F9CA 4C4YA 3SC2A 5ISMA 4AO8A 4QNNA 4P92A 4U2BA 5BV7A 2OCIA 2WM2A 4H7DA 5CH3A 5AKZA 3IUNA 2ZSHA 3FYUA 3C6BA 3O4HA 2CEKA 5JADA 3WL7A 5JD6A 4X97A 3V1NA 3EQ8A 3CN7A 3DL7A 4UHDA 3Q8WA 3PFCA 3PUIA 1VLQA 3TEJA 5T4BA 1JU4A 1GQRA 4UFOA 1ZICA 2ORYA 1YAHA 3VJMA 1BN6A 3FLAA 1TRHA 3AIKA 1Y7IA 5ALSA 4LYEA 2XUKA 1RWQA 1KEZA 4FFWA 1MU0A 3AIMA 1F0PA 3OM8A 2ES4A 4OU4A 1QIJA 5CBKA 1VE6A 4GEGA 4C01A 3MGAA 1CIJA 3X3HA 4GI1A 4L0CA 5E4YA 4Y9SA 4GW3A 5JYCA 2QXUA 3G0GA 5AKHA 1ZI8A 1L7AA 1H23A 1THGA 4HXFB 1QOZA 1XZJA 3BJRA 3DJYA 3GBSA 4BVLA 1PV1A 2OXEA 4ETWA 1A8SA 4U2GA 4X6UA 1CUJA 3PFBA 5AH0A 3VVLA 2PM8A 1UKCA 2XMDA 4U2FA 4EY5A 1L7QA 4QWMA 4KYVA 3G9XA 3WKDA 1LPMA 1JKMA 1KU0A 4X85A 3KOOA 5A7FA 4X00A 4RGYA 2QRUA 4OYYA 4A5SA 3WWDA 1WHSA 4GWLA 5I9IA 1N5MA 3I6YA 4KRYA 3WK8A 3KSRA 3G7NA 5HQ3B 4BAUA 2WJ4A 1UFOA 1LLFA 4YK7A 1H2ZA 5FKJA 2VJDA 1MX5A 5ALJA 3BF8A 4FKBA 2WIJA 3I2KA 1YAJA 3PUHA 2VSQA 4FOLA 1EDEA 1XZHA 3W06A 5AHXA 4H77A 2EDCA 2WHQA 4OCZA 5C81A 1OILA 3L1HA 3NOXA 1UKBA 5AP9A 4W1SA 1ZI9A 5D3KA 5A6VA 4KEAA 4IQ4A 3FYUC 1H2YA 3STWA 2QZPA 5FOQA 2GYUA 4F60A 2DCMA 2FUKA 2PX6A 2BCEA 4J0CA 4G8BA 2PU7A 2FJ0A 1G42A 2EEPA 3W2TA 3JYHA 1XZDA 2XT0A 3D3NA 2JIDA 3GELA 4X91A 2XUFA 1HPLA 1QJ4A 1DX4A 3G0BA 4AO6A 5C8VA 3K6KA 4MJ3A 1UOOA 5AM5A 2W6CX 1VKHA 5I8PA 2YH2A 2PVSA 5JASA 5FRDA 3WK7A 4BC0A 3LCRA 5AJHA 2C7BA 4K6KA 2PBLA 1VXRA 4FTWA 2O2HA 5AKEA 1XROA 1X2EA 1E8NA 2HFKA 1R50A 2DHEA 3D7RA 3G0IA 3S8YA 2Z3WA 3YASA 2VF2A 4RE6A 1BU8A 5EIAA 1QIGA 1EA5A 5ALYA 1XRNA 4L3WA 3I28A 3JW8A 5HF6A 1YB7A 1H2WA 1UOQA 3JWEA 1VA4A 4E15A 1ISPA 5J3JA 3HZOA 5C8XA 2BUAA 3O9VA 4B6GA 3G8YA 1XRRA 3FBWA 4WY5A 4B83A 1THTA 4B85A 3HRHA 4H7HA 2H7CA 4X94A 1G4HA 2FJPA 5C7YA 4UFPA 1EINA 1ZD3A 4C6HA 1JI3A 5HK9A 1NX9A 1EK2A 3IIIA 5EHNA 4FDMA 3SK0A 3A2NA 1ACLA 4DMHA 1WPRA 3RARA 4MEBA 1QIHA 5IVDA 5DNUA 3VJLA 1WB6A 4X7BA 2FX5A 5HZGA 3H0CA 3OG9A 1DT5A 1QGED 1AC5A 1CRLA 1XQVA 3C87A 4Q82A 4B9AA 1MNQA 3WA6A 4BP9A 4DMKA 4B84A 2B61A 1LBSA 1EH5A 4BB0A 1J06A 5LZ5A 4QDOA 3HABA 4Z49A 5IVHA 4WDRA 2QMQA 4OSEA 4WCVA 1HDEA 1R1DA 2PKYX 3WK5A 2RAUA 1XZEA 2HU8A 3C6YA 1IZ7A 3FCXA 3R3YA 3CXUA 3H18A 5HKBA 2DQYA 3MUNA 5IVKA 3D2BA 2RGUA 4PQEA 4BTLA 4BVKA 4LIPD 2HU5A 4HS9A 3I2HA 3AIOA 4D9JA 1KU6A 1EB8A 3H2JA 5HKAA 5DYWA 2GBIA 3W05A 4Q3KA 5ALDA 3STUA 3A2LA 4CG1A 4OB7A 3PF9A 2QR5A 4Y2RA 2RI6A 4N8SA 1GKLA 1MT3A 2CMFA 4ITVA 5CMLA 1AZWA 1J2EA 4DYHA 3G02A 1DX6A 5CXUA 5D7BA 1F8UA 3I2JA 3O4JA 1C7IA 4WFJA 3I2GA 3BF7A 1GXSA 4FBLA 4XVCA 1UK8A 1ORWA 3WIBA 4BBZA 3F96A 3D2AA 1YR2A 2BUBA 2D5LA 2QTBA 4BVJA 1B6GA 1QLWA 4F0JA 1EVEA 3A2MA 2C4HA 2XUPA 4G8DA 5BWCA 5JALA 1IMJA 5LKRA 3O9MA 2GBCA 4GBGA 3WWCA 1CPYA 1XLVA 3DL4A 3H2IA 1MTZA 2C5FA 2VT7A 2OPHA 1MO2A 2DHDA 5AI8A 3BWXA 2WIFA 1AUOA 2E3JA 5JZSA 2I3DA 4Y2PA 3PE6A 4OD0A 2AJBA 3AUKA 2QS9A 2XUIA 2C58A 4FWBA 2Y2UA 3VVMA 4W9RA 1QIMA 1MAHA 5AKJA 4BCCA 1P0MA 4PSCA 5AOAA 5FP0A 4AZ3A 1LGYA 3I2IA 3WI7A 1CQWA 1SFRA 1XQYA 1YB6A 5LZ7A 1VXOA 2OQVA 3RK4A 1PJAA 2PSEA 4EHBA 3SWWA 1XZBA 2K2QB 2VQ6A 2V96A 5HQ3A 4QLAA 3WL6A 1P0PA 5JZBA 5CT5A 2O7RA 3BDIA 4RNCA 1CFJA 2G4LA 4QDXA 5AKLA 5CTAA 2G5PA 2WJ3A 2HHAA 1B41A 1Q84A 4FLEA 5D6OA 3KDAA 5LZ8A 1W75A 4ROTA 2WUGA 2BFNA 1ZD2P 2HA4A 3ICVA 4N5IX 1E66A 1XKTA 1H22A 5AK4A 5AOCA 2VAXA 5C8ZA 4FNMA 2GZSA 2RHTA 4AMZA 4BYMA 1CUYA 1LZKA 2VAVA 3S2ZA 4BATA 1BE0A 4LKOA 2QOEA 3QVMA 4QA9A 4L9AA 2JGJA 3BE8A 1XZAA 4KAJA 5CH5A 2HA0A 3V1MA 4QEKA 5A71A 2QUAA 2R11A 4J0KA 1Y37A 5JD5A 1ODSA 4BDTA 1XKLA 1WB5A 1ODCA 3IBTA 1LPNA 2W22A 3GA7A 1CUAA 3VDXA 1H2XA 1CR6A 1R9MA 4OPMA 3F67A 3W04A 1R88A 1USWA 2HADA 2PUHA 5AM3A 4KE8A 1EHYA 1X2BA 3TJMA 1MNAA 2V98A 5FPQA 1XZCA 1PFQA 1N1MA 5ALLA 2ZYSA 2OAGA 3EIOA 1SOMA 4RPCA 4AN1A 3WWEA 3WWOA 4DNQA 1FFDA 4Y2YA 2Q0XA 3OC0A 2RIPA 3H2HA 4J03A 1ZJ4A 5AK6A 4UFNA 1DWOA 4PF1A 3C5VA 3G0CA 2HA5A 1CUSA 3B5EA 3FWHA 3HACA 2QKYA 3CCBA 4CCYB 5ALZA 4JYPA 4X6XA 1T4MA 4MQMA 1JJIA 2WIDA 3C70A 2CZQA 1CV2A 3QMWA 3IUQA 5JANA 2BJHA 2HA2A 3R40A 1EB9A 4HXEB 3QMMA 4F21A 2ZJ6A 3O0DA 1W6RA 5I7UA 3OTQA 3H19A 4CG3A 4J0JA 4UBOA 4X93A 6YASA 5DNVA 4BDSA 4K5QA 3D0KA 4JNCA 3PDCA 5HFAA 4IHAA 5ALVA 3C45A 1RYYA 4DMCA 4B9EA 1ZGCA 4GECA 1E89A 1MAAA 5ALKA 4BRZA 1U8EA 4PSUA 2PPLA 4X92A 1O6FA 1XZLA 1M33A 5CURA 1YCDA 1CLEA 3IDAA 2RONA 4LXIA 1EVQA 4BAZA 2CBGA 5AKXA 4BC1A 4ZGBA 1E8MA 2H7YA 5LKAA 4P93A 3F8SA 2ZYRA 5CT4A 3DDUA 3GROA 1WOMA 2OGZA 3ESBA 3VISA 4I4CA 1XRMA 3TRDA 2G63A 4UBLA 5EI5A 4Q34A 2WKWA 5CT8A 4S0XA 1GPNA 1SCIA 4QLOA 5K3DA 3AZQA 3WLAA 4Q1VA 2WFZA 5K3EA 2GZRA 2ZJFA 3G9ZA 1VE7A 3R0VA 5JAOA 5DJ5A 4M0FA 1E5TA 4U2CA 5ALWA 4H7FA 1K6EA 1LPOA 4C4XA 4QZVA 4CG2A 1MPXA 3D4LA 4KJXA 4I3FA 2XUQA 3WK9A 4ARBA 4Y2JA 3D5EA 5AKIA 2JBWA 3I1YA 3WL8A 4AXBA 2YXPX 3EF3A 1A8QA 3IA2A 2XUOA 1XQWA 4FHZA 4K2AA 5H3HA 3VXKA 1QFMA 5AK3A 1FFAA 1P0QA 5FUMA 4B0PA 4GDMA 5ALIA 1LPBB 4XX1A 3WJ1A 2HM7A 1QIDA 1Y7HA 3NGMA 1N5RA 4XIIA 1DQZA 4FLFA 4LXGA 5JIBA 1UK6A 2I03A 5HFNA 2HU7A 1ZIYA 4OU5A 5ALMA 3BJMA 1OXMA 2XUAA 5AI6A 2G5TA 4DSZA 3DCNA 3ZWQA 2LIPA 3C8HA 2HA6A 1G66A 4K6HA 2CJPA 4E14A 1L7RA 1VZ3A 5ALXA 3B12A 5ALRA 5CH8A 1AQLA 4G4JA 1UT6A 1VOTA 3IUMA 5CT6A 3V48A 2XQFA 1BS9A 1CVLA 5AK5A 1EI9A 2JGMA 3NWOA 1GGVA 2P8SA 3EQ7A 3L1IA 4CIAA 1AGYA 3A6ZA 3Q0TA 4M0MA 3AZPA 1UOPA 5EHQA 1XZMA 2J3DA 2V97A 3QH4A 1E3QA 4N8DA 1G5FA 3NUZA 1QZ3A 4BCBA 3IURA 3GZJA 2QVBA 1VZ2A 5LLSA 3O4IA 2AJCA 1TCCA 1GPLA 1XRPA 1TAHA 4KAAA 4W1PA 4HZGA 1HBJA 5HF5A 1EK1A 2PUJA 5AI0A 4KE6A 3ESDA 3A70A 2DFPA 4BTVA 3WIOA 4UBJA 4AN0A 1ZOIA 1BCSA 3KXPA 3VKFA 2VT6A 2CUTA 5AIBA 3RLIA 3MVEA 2OCLA 1Z68A 2WUFA 5KWJA 1FJ2A 1YSCA 3DQZA 2ROQA 3HYSA 3RKSA 3BL8A 3I6ZA 5FV4A 5CRIA 4UPDA 4OUKX 3G9UA 1A7UA 5DYTA 4DNPA 2XUJA 1DQYA 1C4XA 4UBIA 1JMYA 2UZ0A 2YASA 2B4KA 3QZUA 4MXDA 4H7JA 4Q05A 4ARAA 1XZFA 2HA7A 1MJ5A 5HK8A 5AOBA 3AJAA 3G0DA 5AICA 3QITA 5JAUA 4E11A 4EY7A 3FSGA 4G4GA 2J3QA 4EY6A 3DKRA 5FPPA 1K63A 3STTA 2QM0A 2XMCA 2PL5A 1CUGA 1LZLA 3GFFA 3WKEA 1K5PA 4QWWA 5ALTA 4RE5A 3E0XA 4Y7DA 3UMJA 4I19A 4BAGA 4DIUA 1ZD4A 3OOSA 4DNOA 1DTEA 4J0IA 3ZPXA 4G8CA 1FFBA 2GBGA 4UBNA 3C8DA 1DWQA 1TCBA 1C7JA 3K9BA 1JFRA 4J0DA 4N5HX 5AI9A 3CCCA 5AI5A 4TPKA 1NU6A 1YS2X 2WSLA 3H04A 4IH4A 3ANSA 3EQ9A 1E8DA 2DR0A 2OCKA 4WJLA 4HAIA 1CUDA 3QBJA 5ALPA 4G9EA 5A62A 1BRTA 3PF8A 2WTMA 4EA6A 4HVTA 4EUSA 3HEAA 3OPMA 3WZLA 3FCYA 4CIBA 4H35A 4Y2QA 3QPAA 3R3WA 4BE9A 3BIWA 1XRQA 2WHRA 3ZLVA 1CUHA 3GUUA 3WK6A 3WKAA 4Y2TA 2OGSA 3DYVA 4DSAA 3E3AA 4W63A 1SC9A 1CUUA 2ZSIA 5EGNA 2Y6UA 2QXTA 4NMWA 2J4FA 2OLEA 4H0CA 2WIGA 1Q83A 2HL6A 4EY4A 3W9UA 5LIPA 4DM7A 4P9NA 1UK7A 1MX1A 3WYDA 2WG0A 5DNWA 3FOBA 1W4LA 3HI4A 1CQZA 1JJBA 5SYNA 5AI4A 3FLBA 1DINA 1UZAA 4DLNA 2PSJA 3HXKA 5JD4A 7YASA 1EXWA 3WWPA 1VA5A 1IUNA 4W1QA 1K8QA 2JGLA 1BCRA 5AM1A 4U2DA 1DWPA 3BDVA 2OGTA 1J1IA 5IVIA 5YASA 4X3CA 1FFCA 2XQKA 2XE4A 1ZGBA 3QM1A 3ZI7A 2XMBA 2WU3A 4JYMA 2BAGA 1CUCA 5FXMA 4TVKA 4J3JA 4B80A 5K3BA 3ICWA 3H17A 4X6YA 4H18A 1DU4A 3DS8A 3C5WP 1QIFA 4MQLA 3IULA 3WL5A 3N2ZB 4E46A 4ZI5A 4Y2SA 4CCWA 3V1KA 3ZV7A 3WJ2A 4HXGA 4WDQA 3FLEA 4X71A 1CEXA 3DOHA 5BOVA 2X76A 4HTAA 2ECFA 4GLBA 5A2GA 5E2IA 2HRQA 2B20A 5IKXA 4Q3OA 2O2IA 1QIKA 5ALNA 5HCUA 5IH7A 2JEYA 2VEOA 4B7ZA 2RHWA 4NZZA 3O4GA 3MUOA 3O95A 3STXA 4DTCA 2NW6A 1HQDA 2C5GA 3AFIA 3IVMA 1QFSA 3LIIA 3WMRA 3M3DA 2HA3A 3UUFA 3WA7A 1SCKA 5A7GA 1A88A 5K3FB 1ACJA 4IH9A 1EDBA 2GYVA 2XMGA 3FVRA 3WYNA 1XQXA 2Z8ZA 4MYSA 4X90A 2ZYHA 5JAHA 5BWBA 2XMRA 2WJ6A 4AX4A 2JGFA 2XUGA 1FSSA 1U4NA 3WKCA 1W1IA 2V9ZA 3TGLA 1ZJ5A 1A8UA 3LIPA 4B82A 2ZJ7A 2WFMA 3R41A 4YX9A 1R9NA 1YA8A 3DKKA 1WCYA 4IO0A 2VJAA 5LZ2A 4UHBA 3QPDA 2Y1KA 4J7AA 1CUFA 5AM2A 2IIVA 3CN9A 4QDUA 3DNMA 3E4DA 4KR0A 1MX9A 1XFDA 2OAEA 1GPKA 3QYJA 4LYDA 1JMKC 3I6MA 4V2IA 3WK4A 1HLGA 1QIIA 1S8OA 3G9TA 1SCQA 4C88A 1IUOA 1QO9A 1CUEA 2AJDA 1I6WA 3DOIA 4Y2VA 2JEZA 2O2GA 1F6WA 5FDFA 4OB8A 4TGLA 5JARA 2QUBA 1O6GA 4C87A 4DMFA 4J0HA 3RM3A 1ZIXA 4MYDA 5HF8A 5E4JA 4FMPA 4KRXA 1WHTA 4O08A 4UBKA 3DLTA 4G4IA 4B0OA 4G1FA 2PSHA 2DHCA 4CFSA 2H9YA 3FVTA 1YASA 5T4FA 2XMSA 5T4EA 3R3UA 2HDWA 1D07A 2DSNA 4UHEA 3D59A 1X70A 1Q0RA 4XWGA 1AURA 1VJ5A 3EBLA 4BZZA 1XLWA 2Z5GA 1LBTA 5JAPA 5ALOA
chains in the Genus database with same CATH superfamily
1OH6A 1ZFNA 3B8EA 5G53C 1TKRA 1Q1AA 3P1JA 1VMDA 3FXAA 3MAAC 2K7ZA 4RIHA 3ILYA 3NHFA 4U39A 4IHKA 1UFQA 3PT5A 1F4PA 1T2NA 2WJPA 3KZCA 4BNZA 2ZXUA 1IVYA 2I71A 3N7AA 3L02A 5KMGB 3C8UA 4FM9A 1IEXA 4B5LA 3QWHA 4LWPA 2WYOA 3VZQA 3H5VA 3O74A 2Z6AA 4D9KA 5AM0A 1VHWA 3WMGA 4HHEA 1YZGA 3VZDA 5HPYB 1HL7A 3IB3A 2OP1A 4F4DA 1MABA 1SRQA 4H3VA 2N3ZA 4JSTA 3CSUA 1JHQA 3DEFA 2JFXA 2C7VA 1KO1A 4TTVA 3VGJA 1M8PA 3MWKA 1DC3A 1SXJB 4RJIA 5EXDA 4HS4A 5HF9A 1KSJA 4BNTA 9ABPA 1COZA 1Q11A 2HFJA 1RKXA 3DXXA 5EIEA 4MEAA 2PWPA 3DO8A 5DTQA 1X7GA 1S8AA 5G0WA 5LPNA 3ORFA 3AJ9A 4H7EA 4AG6A 2X77A 2XYVA 3UBTA 3H1BA 4OG2A 4I81A 3K15A 5DHSA 3U0VA 4BRSA 2Q29A 4LDNA 5DISB 4DGQA 5ALQA 4CCSA 1B2RA 3EFOA 1US8A 2VJQA 2RHMA 5HFJA 3WLJA 1W2GA 3UJ8A 3SE7A 2LPMA 1R6TA 1GY8A 2IYYA 2WZQA 1KMNA 1OGYA 3TN7A 3VYRB 4G23A 1BTOA 3R9KA 1RWMA 5CFOA 1HFEL 3FRJA 1U2QA 1FS6A 3FPCA 2I0FA 4ZREA 5IABA 3RFVA 3SEQA 3JZFA 2XVAA 3RC8A 1Y4UA 3IUJA 3QPCA 1BROA 1WB4A 5JSKA 5C4IA 2DMRA 2A9VA 4HYYA 2VPTA 4X9XA 2NPOA 3EDQA 5IDYA 1HORA 2ACKA 3RF7A 2JGAA 1TJ4A 4UUQA 5B4TA 3HXOA 1UP6A 1KYZA 5IRCD 1GT6A 1WDLA 4JR2A 3KT8A 2AJTA 1DT3A 4RU1A 1A9OA 2K6GA 3ANLA 4M8LA 2Z2KA 4RMHA 2JIRA 2P4HX 5FLYA 2JB9A 3RTGA 4YFYA 1Z4NA 3WBFA 1BDBA 4XR9A 3PDIB 5JJKA 3Q3HA 3VVBA 3IKTA 1VJ0A 3FTDA 5BXQC 4PO3X 1R4ZA 3N7UA 4AY3A 4GHWA 4B81A 1W76A 4J4HA 4UEJA 3T5MA 4LDZA 2GEDA 4R9RA 2B3TA 1M7HA 5BT9A 5THKA 1SPBS 3LY7A 2YC4C 1RC8A 4RCZA 2ZVDA 1WXIA 1MDBA 1WXQA 3QE2A 1OWMA 1Z15A 4QEZA 3RNOA 4CV3A 1R3DA 1IN7A 4JA2A 4YRAA 2DWQA 2ASVA 3DOUA 5EXTA 5L6MB 3KQNA 1XQ6A 3H1GA 4KXXA 1JJVA 4X20A 5HKKA 4ID3A 5DYYA 4QU9A 5KREA 2P1RA 1TK3A 4RF3A 5IBPA 4EI8A 2G1UA 5H4HA 1PK8A 3KSUA 5JZ9A 5FOVA 4AKHA 3MS4A 4B4UA 3TAXA 1K4YA 1OXUA 4LXYA 5IYZA 3LX4A 2NO9A 4JYCA 5BQXA 2X22A 2RIRA 3LY9A 3UMVA 4JBXA 3GUYA 1V5FA 4JKYA 3DMHA 4N9WA 1NMXA 5IM5A 4EA7A 4EG3A 2ECOA 1KBQA 1UT5A 3A6EA 3G2LA 3IILA 4ROSA 1FRQA 3UWDA 1DBPA 1XP5A 3K2IA 4KRFA 5CLIA 3RIMA 1WUTA 2D8MA 1XTIA 5K8IA 1X42A 3KVYA 2RD2A 1MB9A 1Q1ZA 2VWHA 2HNKA 1R64A 2O0HA 2FEPA 2XECA 3AY7A 1U81A 2O19A 1Y6ZA 3LYHA 3DTTA 1HK7A 1TIBA 1JJFA 3WQSB 4DJAA 2AWNA 4AZ0A 1PKXA 4K05A 2HCFA 5JD3A 2IW1A 1C7ZA 1Q1QA 3FNBA 2EJWA 5L3RA 5C9ZA 3OPQA 1E6KA 3PZBA 2YWGA 4FGJA 3W3ZB 1M67A 1F4LA 4XX0B 4DLTA 4YFVA 1DWUA 2C1EA 1TKAA 3MCUA 4BWFB 4E3ZA 3M4ZA 4LYHA 2IHNA 4ZC8A 4PVCA 2A7QA 3STYA 1DBRA 3STHA 3R3VA 1W1WA 4IWYA 1LDMA 1P3JA 1U8YA 2FQYA 2FXIA 1ML3A 2WMOB 1UZMA 5HJ5A 1VIAA 2XB9A 3U7FB 1PSDA 4HLDA 1EWQA 4KK3A 5CB8A 1GGNA 3N58A 2XEDA 4G1CA 4C14A 4QNMA 1VRVA 2IEGA 2VBIA 3AI7A 3HLKA 5F35A 4BE4A 4Z53A 3NT4A 2ONCA 2ZYUX 4BO0A 4BPRA 4EYOA 1F4VA 1U0EA 2ZJ4A 4MSUA 2D0PB 4I5DA 4ID9A 4OQDA 2K87A 2YVKA 3QOFA 3WGJA 2ISCA 3KSMA 4QPNA 1CHDA 1Y4SA 5EJGA 5FADA 4NOMA 3LGAA 3W6UA 3GGPA 3HXTA 3OFVA 1SVSA 2I7TA 3OZDA 5B3JC 4NMHA 4QDTA 3DZCA 3NKVA 5LM3A 2I22A 5JCJD 1ND5A 5EEHA 2BGNA 3PEEA 1Q7RA 4NECA 5CYPA 3OQHA 4FDUA 2B5VA 2P4UA 4URFA 3T5GA 1AKNA 1BN7A 1ZXBA 1IIRA 4ETIA 2VH1A 3FZQA 3G13A 4Y9TA 5EPOA 1N6LA 2ZJOA 1S8FA 4QC2A 5ABPA 3ADOA 3DT6A 5B1SA 2A2ZA 3PE4A 3BTVA 3C7CB 1P7CA 4O4IA 2GM3A 1PG0A 2VEDA 3KPJA 2Y92A 3LW8A 1KPGA 4A0GA 5J2TB 3ILSA 3VDNB 2LVBA 3ZGVA 1RAAA 4G0MA 4OQPA 3BXHA 3P45A 2EBWA 3DTVA 5ULLA 4URHA 3OZ7A 4OIMA 2GA8A 4PZYA 4Y1EA 5GJCA 5KYGA 2NLOA 3CRQA 3SF8A 3W7VA 1A9TA 3H9CA 4IDGA 3VH2A 2Z3ZA 5CLFA 3EDYA 2YKGA 3SHFA 2BE9A 4HDOB 5TEWA 3V8EA 3EXIB 4Q1AA 4YT8A 2OPBA 2PFSA 3WZMA 1IN1A 3LQFA 4E2YA 1MF7A 1Q1NA 3C6ZA 1G17A 1GUFA 2NM0A 3OTGA 3PQ5A 2A86A 3QRWA 2FEMA 5CA1F 2FE4A 1P17A 3ZC3A 1QCDA 4BV3A 3LA8A 3O2JA 2JLBA 1JG3A 2GLTA 2Z6QA 4WBSA 1O6BA 5HUJA 3O3MB 1JDNA 1SMKA 3R9WA 3FOFC 1ZR4A 3H0KA 5TT0A 1XDWA 1U3CA 3NATA 4JUFA 1KH3A 2BFPA 2AF3C 4OB6A 5KMGA 1FS5A 1FDUA 1R0BA 1QOQB 2X5OA 3KQKA 5EKTA 4AI6A 2IUFA 1CUIA 5KQGA 1P2GA 1HYGA 1Y4DE 2XD9A 4K26A 1QYVA 4LOIA 3AV0B 1FMJA 5KPJA 5HIMA 5EZYF 1RLTA 2XOKA 5DLPA 1PGJA 1A4RA 2ISQA 3NAMA 4LXHA 4U2EA 1PL6A 1QF9A 2ICAA 4LHEA 3ZU5A 3HWWA 1R37A 4KQGA 4LMAA 2O07A 2VP3A 1VIDA 3KWFA 4YRRA 5I3ZA 1N0UA 2UYOA 3H84A 5DBGA 5H59A 2PRSA 1CS4C 4RYLA 3MLBA 2FHPA 4LQLA 4MX8A 4JS0A 3TVTA 3IHTA 3RGGA 1ZL0A 3W4KA 4EYKA 2XTNA 3OQJA 3OZGA 1TK9A 4M0DA 3PNSA 4RVCA 4RZ3A 2WILA 2AGVA 1VIYA 5DWDA 3OCZA 3G59A 3PXEA 2PUBA 3EODA 3KZKA 3UMRA 1NI4B 1W0KA 2AW5A 4D4LA 4ABTA 5G0SA 5BY2A 1N77A 2DKOA 4GYWA 3UWPA 1NW7A 5AQ1A 1QR2A 4IS2A 3GEDA 1Y3HA 3RO7A 3U6KA 2H1WA 1G9XA 1NX6A 4GAEA 1DKOA 3KEQA 4IXTA 4MI1A 1Q12A 5L53A 3C39A 1WKBA 3FMGA 3KE8A 1I32A 5ALGA 2WNIA 3QMVA 2X3YA 3I83A 4DS3A 4WT7A 1O7JA 3GRRA 2HO5A 2BM8A 3P0JA 4LK2A 4M8NE 4QFCA 1FXWA 3WNDA 4C89A 4GF5A 1MRSA 3LT2A 4GX5A 4AMBA 5A9RA 4PFJA 2AMLA 4EPYA 2EZ9A 2J9RA 1ORTA 5B53A 2DVMA 2R44A 4A4DA 4G0NA 4E1BA 3PNLA 2GBLC 1ISRA 2ZBPA 1KKUA 5CNMA 5BSGA 1N9GB 2V5VA 1ZHHA 3AR7A 3MJTA 3V32A 3WSTA 3SZRA 4UZEA 2MSKA 3NEYA 1GGKA 4KIWA 3O8NA 4WLOA 1JHYA 2W4MA 2JA1A 2YMMA 4ARIA 4DRXB 1XEXB 1W8IA 5JPIA 2CYAA 3OKPA 2W90A 4K6GA 1V1RA 3QU9A 3JRWA 2XBLA 2WUDA 4AP5A 4BVEA 1KEEB 2VJCA 3GEBA 6CHYA 3JQ7B 3VA7A 3OZEA 4MP6A 4PFKA 4AULA 4YAKA 4QDZA 4LF5B 4OY3A 3GIDA 4HDAA 4Z2YA 4AJJA 5CR9A 3KL2A 2ERXA 2XQJA 4K81B 3LAWA 1HNZB 3IIEA 4JLAA 4M9QA 2GPBA 1JQ5A 1N8SA 1DOAA 3P26A 3DG9A 1ESNA 1N1EA 4RFLA 1MG5A 3BSSA 3HJUA 1I51A 4O3MA 2JRCA 5A5GA 1FEZA 3HVIA 4W1RA 1NU8A 1T5IA 1Y1SA 4CL2A 2GEVA 2HTFA 2PKXA 3H0EA 4GPTA 4AJIA 3PX7A 4INZA 3O38A 4CEIA 5D3MA 1FVOA 4B31A 2XWQA 2YIDA 2BGRA 5CXXA 2HLPA 2YS6A 1SN7A 4HWRA 4RD6A 5AVQA 5AKKA 3HSYA 1EFPA 1FFEA 2VTKA 3HADA 3X2SA 3AL0C 3ND6A 1G0OA 4ZQBA 1M54A 4CW7A 4E1VA 2QQEA 3A9WA 4AO7A 3THYB 4H59A 5GGYA 3IE2A 2D0DA 2ZAYA 3FG9A 2VXOA 3TVDA 3CEPB 3EXEB 4H7IA 3I6QA 5TGZA 1Z29A 3WYFA 4XRGA 2Q5FA 2VHXA 4PNZA 4II3A 3V7FA 3ZKAA 3ZWNA 2UZ4A 1YMQA 3OEHD 3R20A 1CR0A 2RCYA 2GRJA 1WHSB 4HDKB 3R8XA 4UHCA 2OZKA 1D1TA 3QGMA 5ITSA 4FYWA 4LF4B 5DE3A 1YUBA 1R15A 1DFGA 3GMIA 1I4LD 2O7SA 3SQOA 4HRXA 3W9BA 4C5BA 5BSFA 2WIKA 4GYKA 4L75A 1EDOA 2NO1A 1HFWA 5CW2A 4D0LB 3B82A 1ORHA 3TIVA 1AQ6A 1AX9A 4RQBA 5EIOA 3K0SA 5JXIA 5EFZA 1KY4A 3GD7A 4JH0A 5C1IA 2RG1A 3EZ7A 5FNVA 2JAXA 2O4UX 3AGQA 4C5CA 1H0RA 1VBNA 2VIIA 4D3FA 3LA6A 2RKWA 1A9SA 1X0XA 4YLEA 2NO4A 4EK9A 3TDKA 3M6LA 1ECGA 5IMBA 1KI6B 2NWQA 3UJ9A 1FK8A 2QB5A 4GG1A 3V3TA 3AHHA 1E63A 3CVYA 4QOGA 1QYDA 1TCUA 3NM4A 4KQEA 1NXVA 1II9A 1H6BA 4CYMA 1KO7A 1AQNA 1DNPA 4MTLA 2XUHA 3CONA 5FOUA 3IAM6 1FJXA 2PT5A 4RKYA 5BUQA 4NL4H 1R10A 2RKOA 2QTVB 4TWJA 2GVZC 1KA9H 3C6KA 1YIAA 3OP1A 5BW4A 3UH0A 5A5FA 2AN9A 4F4IA 1HR0B 4Z4EA 3QUBA 4FDAA 3K8QA 2CMDA 1HE1C 2B1JA 3LYUA 4O0MA 2M2IA 2O8DB 4S12A 1AUVA 5EZSA 1CF9A 1HH4A 3PXCX 3EJ6A 5BN3A 1T3GA 3ONFA 2WOOA 4GUAA 3WGZA 4L50A 4ZVLA 1LY1A 4CT5A 2A1UA 5LCXA 3KKNA 4KAFA 2Q4DA 4GXNA 1B3BA 1PR9A 5E95A 2H8KA 5CJPA 1GQSA 1MC5A 3IUBA 4JX9A 4MGHA 1KE2A 1R27A 2YOHA 3D8RA 1KDTA 4LPSA 4X7MA 1T3LA 4BE7B 3VOAA 1FIUA 3FGZA 3O6VA 5EHZA 1TK2A 5EE0A 2FW6A 1NN1A 3UJ3X 2BELA 2JHGA 4CCYA 4REOA 2WQZA 3IKJA 4JR0A 2C2GA 2CB9A 5AJXA 5LU9A 3GYBA 1A7JA 4EBBA 4OHVA 4PLVA 3HVJA 4H08A 3DAOA 5ERGB 1YA4A 3HSKA 4MVYA 3R7WA 4A23A 5KHAA 1ADGA 2V9PA 5E1BA 4QO8A 1DEOA 3RAEC 1QTIA 2NVBA 4Z8YA 2XZDA 4Z7JA 3ESZA 1V5GA 2B9VA 4Q3LA 2VSFA 1KBZA 3L7NA 4ZCSA 3UB2A 3PR1A 3KZ1E 4LMPA 4PZ9A 5IJAA 3I9MA 3NAQA 1I6LA 1XG5A 3K5IA 1KKMA 1M2HA 3LECA 1U3TA 3OMXA 5CA1B 2DEUA 1EP3B 3SC2A 3ZE8A 4AY6A 5TQJA 1PJ2A 5CVJA 1RSZA 1FSPA 1U98A 3ESYA 4P92A 2QN6A 1OXVA 4HH4A 4LMRA 4J7UA 4YRGA 5BV7A 5M29A 1IBMB 1M74A 1VKJA 2HSDA 3OCWA 5A4KA 5ECGC 3KEFA 3RVRA 1A1SA 3BCRA 5CH3A 1L5NA 3B9PA 2FN3A 5AKZA 1CU1A 2Q9BA 1RI4A 4MTCA 1ULZA 4V0QA 3R7DA 3FYUA 4F2HA 3UC9A 4KQXA 3C6BA 3O4HA 2HLDD 3Q3CA 3GFGA 4O2LA 1ID8A 3QNUA 1OIVA 5JADA 1RRGA 3WL7A 4ZT5A 4EW1A 4C7BA 2NZWA 2LDBA 3D0RA 4HN2A 3LY8A 1UXIA 3KDSE 5FFNA 1MO5A 2C4UA 3LBAA 2NTJA 4MVWA 4NDAA 1F38A 3RJMA 5KTTA 3V1NA 2VCHA 2F2TA 1AS2A 1JI0A 1E9BA 1MB4A 3I3OA 4HQ0A 3T9CA 1YU9A 3CN7A 1NM5C 5A3VA 2XRZA 2P9EA 4FOSA 1UQUA 3PFCA 3OFKA 2ADOA 2GPJA 4LTMA 3TL6A 2VRNA 3TEJA 3H16A 1W0KD 3T3IA 4P8RA 2C4KA 4X8OA 4M1MA 3LZDA 3SXUA 4E4YA 1UKYA 2HUPA 1A9XA 2AOTB 4MZXA 2FZGA 3GRVA 4UUNA 1J25A 3IL2A 1S2OA 2VHCA 4WZAA 4YJDA 1ZMBA 4YCBA 1XVAA 1FBNA 1V16A 4QATA 4HATA 2VP6A 3KETA 2OAQ1 2VLBA 4TSRA 1SQ5A 2OLJA 1HE5A 3MQFA 1FNMA 4YJ3F 5FQOA 3QBTA 4BMNA 2PUDA 2Z2JA 4L8GA 4RKQA 3HWSA 5K8CA 1TRHA 2BY4A 3Q7IA 5P8WA 4KYUA 1NN3A 3VHXA 3THXA 4BB5A 4IGFA 3IDOA 4DRXA 1H6CA 3OA2A 4IDFA 4XGKA 1WJGA 2V6IA 1KEZA 2C98A 2TECE 3KPYA 4PX5A 3OKCA 3UAXA 1F0PA 1RMYA 1SXHA 5BSMA 1R4MA 1RQXA 1TX4B 3LHIA 2OGWA 4K1XA 5F9HA 2HEGA 1J7KA 5K6AC 5HS4A 2F17A 2O1SA 4YGXB 3FOWA 4BGVA 1MTOA 1G8GA 1Z07A 5BP7A 2XB2A 5HE9A 4F96A 1MR3F 1NJSA 3CA8A 2C8VA 2POCA 3UGTA 1KAHA 1L1EA 4A6XA 5E1OA 5EQJB 2FW7A 3KTFA 4FWIB 5E4YA 4RZSA 1RYDA 2Q9CA 3BXZA 1CYEA 4Y9SA 3NXSA 1SHKA 4I9UA 4JL8A 5HM8A 4GW3A 3A3NA 4Q1FA 2QHXA 4MUMA 1K5DA 4GGOA 1JHDA 1AKTA 2ZRHA 3G0GA 3WGGA 2PJZA 4BEJA 2RAPA 4HNVA 2GM4A 3TDNA 5ED0A 5DMHA 4AU1A 4DF3A 4HXFB 1DKRA 3BK2A 3KEOA 3UAVA 2R6GA 2WM8A 2DGDA 5FULA 4YJFA 3RAFC 5KAPA 2G83A 1XZJA 9LDTA 3CVJA 4NBSA 1XJ5A 4MQBA 3QSYA 1VLJA 1ZMTA 3CX3A 4MUFA 1JBKA 4BBJA 4JC8A 4Z3OA 2DXIA 1Y9EA 4URZR 3F0TA 4KQHA 3AR9A 4ETWA 1KDZA 5DHAA 2CUKA 1CUJA 1D2AA 2AHOA 3EB9A 3OPNA 3D8HA 3EH1A 4RF4A 4YJ2A 4EY5A 4EYSA 2BEJA 3F4KA 4AN4A 2FPPB 1G8FA 4O2BA 1EEXB 4PS1A 1ESMA 2B5WA 4MV8A 1D6NA 3DHNA 1ENYA 5B6IA 3VU9B 1N4AA 1T8YA 3O94A 5BV0A 2CVPA 2FPGA 3BIOA 4IGIA 4YJHB 4MW5A 5FL7D 2ZUWA 3ZTWA 2V6FA 5EKSA 2IHZA 3KOOA 3MGBA 4RGYA 4PIVA 3TXAA 5IT9A 4ZJPA 1HXHA 3WWDA 3I9OA 3INRA 1EGMB 4DEVA 5BQ5A 1GO2A 1T3TA 1WPGA 3MWFA 3PQ7A 4KRYA 1LK7A 4GNKA 1TQ2A 2BVNA 2OZVA 4QU8A 3CU5A 4YROA 5TS2A 4CT4B 5AR1A 2FZ5A 1X1EA 2RGNC 3PWKA 4DV0B 2R6HA 2E9SA 3KLOA 2FPXA 5IJ9A 4YJHA 1D6SA 2HUNA 4XAQA 4BO4A 4EG5A 4L02A 1MX5A 5ALJA 2HRBA 3BF8A 3K9LA 3I2KA 4E2ZA 1EFDN 3PUHA 4RADA 2QVZX 1EDZA 4RCVA 1FMCA 1I4WA 4FOLA 1BA2A 4JP8A 1NXTA 4TLDA 4CN9A 1P7WA 2ODEA 3PPIA 4HX2A 4Q16A 4RA6B 3PUKA 2JVJA 5ECYA 4DA0A 5CTJA 3FWKA 2EDCA 3SQLA 3IQGX 3QXGA 4UMVA 2B36A 5F3RA 5GIOE 1HI9A 3ISJA 1CG6A 5C81A 4LNHA 4MDHA 4Z4CA 4Y0NA 5CDSA 5DHUA 1OILA 1QE5A 3PEFA 4ZIRA 1OX5A 1V16B 1D1PA 3TW4A 3NOXA 1PFVA 2OXTA 4JI6B 4BB6A 4W1SA 4XTCS 5E3HA 3PWTA 4PX9A 2CJWA 3PCRB 1N7HA 2BLNA 3NHUA 2FP4B 1NTOA 1JGTA 4Y2GA 4Q66C 2DLCX 3QTLA 1GJRA 4KJZA 4ADSG 4EPTA 3SZOA 4KEAA 1AKQA 4PC3A 4RK5A 4ZI2A 1RQLA 2P3OA 2CGEA 2JLCA 3FRHA 3LPAA 2L19A 2EKBA 3STWA 5GONF 2O59A 4ECEA 5CA0F 1E7RA 2HBQA 1PJLA 1X3LA 3OJ0A 1A7KA 3C7AA 2DCMA 4DJDC 4LWZA 5BVGA 1X7XB 5AJWA 4I8DA 1BS2A 1C29B 3BM5A 3MCAA 1O9HA 4AF7A 821PA 4ZI7A 1XEXA 1K88A 1L6RA 4FR2A 4G8BA 4MITA 3F78A 1Z4PX 4BFLA 4EJSA 2IGTA 1KEEA 4HD8A 1U6KA 3PEUA 2KBFA 3OQ6A 4NYJQ 5TGTA 2IV7A 4B3HA 4C76A 4A0HA 2R1UA 2XBMA 3F5SA 4DSTA 4M1OA 2OCPA 3FAZA 2ZIAA 3QXSA 4MPTA 3W2TA 2FYTA 5MHTA 3T7EA 4DABA 2LKCA 3RS5A 2XXBA 1GL3A 2GN6A 3OU6A 1VL2A 1EIWA 5K4HA 1TZMA 3G5MA 1ZCBA 1WXHA 3OCXA 3E18A 2XUFA 4YCJA 3VZRA 1QJ4A 1NLZA 5I9SA 3VNSA 3OUUA 3ETDA 4M88A 3IP1A 1TB4A 2FWAA 2H4XA 3NNNA 4HPWA 2BF4A 1ZUNA 1Y5NA 4MJ3A 2NIPA 3TIGA 4N3GA 2B21A 1IAQA 4NC9A 1JR2A 4FNOA 1J8VA 1B6TA 5DK6A 5FJJA 1C1YA 1YVUA 5AM5A 2W6CX 5BWNA 4DLVA 5L45A 3TTWA 1QHSA 3JYQA 3KYCA 5DYIA 3SLKA 3BORA 3W78A 4AUMA 3IMKA 3DE4X 4ZO6A 3BMCB 4P53A 2V03A 3INYA 4L08A 4X1IA 4NZYA 5JBIA 3L8FA 4HG2A 3DHYA 4K6KA 2VF7A 3BE6A 1LCIA 4P2GA 1BXGB 3W5AA 1NWCA 1PQYA 5JQGA 3KJIA 3CLHA 1VXRA 4FI3F 4RK0A 2VNIA 2QUIA 5DTRA 4FTWA 1A0OA 3IOMA 4NE7A 1I3LA 2E2WA 4PGHA 3LWNA 4U7PB 1X2EA 4HDSA 2H00A 2VYND 1E8NA 4AYTA 1ZR2A 3PQ6A 4ZYXA 1T24A 2BE7A 1F2UB 1QAQA 2X23A 3GHHA 4W5HA 3S8YA 5JJLA 1Y9JA 1GCAA 1XWFA 2Z3WA 2VF2A 4CMGA 4EW3A 1S2DA 3PHGA 4RM2A 4CEHA 3O82A 3NPAA 1VRCA 4OJKA 3LCCA 3PNOA 5EIAA 3ZH9B 3IP5A 3ZD6A 1QIGA 2NACA 4ZJZA 1KK2A 1T36B 2DM6A 4H16A 4UTOA 4RMJA 1QOPB 5COAA 3IHLA 3L82B 2A33A 4NONA 1VI5A 2A5LA 2CHUA 3CH7A 2Z95A 1Q3TA 1M2VA 2E4AA 5A6SA 5HF6A 4XFJA 4LOKA 5K0BA 1QX4A 1ZMRA 1UOQA 2WPNA 2AE1A 3WRWA 4PYQA 4EA8A 3SVLA 5UKDA 3QOYA 1ISPA 1ORRA 2WDPA 1ANKA 2FN4A 1KHHA 1ZGJA 2Z56A 4F1JA 5J3JA 2HTEA 1BO6A 3D6UA 5EPUA 5HTOA 3QIAA 4MV0A 5A9SA 1ZNYA 4MW9A 3FBWA 4ATNA 1M2VB 5D7NA 2YHSA 5A6SB 4CLXA 3GLHB 3WLHA 1HEYA 1RJEA 2H7CA 4JN6B 4M9XA 1KC3A 4FW8A 4X0EA 4BO5A 2I9KA 1U2PA 1ZN9A 3BZUA 3H9QA 4CCAA 3P9RA 1PFKA 2A1TS 2AX4A 2GTHA 1YA6A 4EJ0A 2FJPA 4BU0A 1J99A 2BZGA 4JI3B 1P4GA 2IZ5A 2RH5A 2PDAA 1P9OA 1UBRS 2J46A 3E8XA 1EINA 4DDWA 1GRRA 3I1FA 4C6HA 3PA6A 2AFIB 3EGDA 2JFFA 5EHNA 3KSDO 2IKSA 4CM4B 3VR0A 5JHHB 3SAJA 4JB3A 1ADBA 1ZU4A 3MTJA 4WIAA 5DF1A 1VSVA 4AW9A 4YIHA 5J58A 2Y4NA 4DUYB 1NQTA 1CE8A 1JMVA 1JJAA 1D5WA 5KDOA 4MVJE 3WNZA 1AA6A 3Q8KA 4B3BA 1D1SA 2ZPUA 1E7WA 2BFFA 1XSEA 1AK2A 3ICOA 3VU9A 1QIHA 5CFLA 5JXGA 5IVDA 3U5TA 1PS0A 5T41A 3VJLA 4J49A 1XIVA 3CH4B 3VNBA 1WB6A 3V2IA 1LVGA 2KBEA 3PQ4A 1M34A 4N40A 4X7BA 3TGWA 5K6AA 3HTXA 4F5YA 1DG9A 1WDMA 4YQEA 1G0NA 5HZGA 4KH0A 3H0CA 3OG9A 1Z37A 3RS8A 3SJAA 1QGED 1U7TA 1Y9ZA 1CRLA 2BMDA 2Y3IA 3HYTA 3PQFA 3RYFA 4D9EA 4TN5A 3WJAA 3QX3A 4K6OA 5D5QA 1QUEA 4RX1A 2ZS8A 1UBHS 1DRVA 1X8JA 3VMMA 4B9AA 4D74A 1GRVA 2R6CA 2C4NA 1MNQA 3EUAA 1U5CA 4LRSB 2YXBA 4FGLA 2R6DA 1BFUA 2I65A 3CX8A 4LTNA 5D6NA 4B35A 1J9EA 3SQXA 3IUYA 4YXFA 4RD3A 5C3UA 1ZO8A 3P9CA 2B61A 1LBSA 1UQTA 4OMUA 1EH5A 2OFOA 1NOJA 5E6SB 4ARSA 4BIMA 1JFFA 4BB0A 4J2TA 2IUUA 4LCJA 3O90A 4Y9UA 2VWQA 5LZ5A 1H2RS 1EXVA 4Z49A 1TUGA 2YOFA 3N74A 5IVHA 1Z83A 3IDQA 3L7YA 4WDRA 5A05A 3AP3A 3ZWYA 2Q62A 4EA9A 3FOZA 4TTAA 5L4SA 2FWIA 3DVAA 3L6BA 2QMQA 1JDTA 3KCNA 4Q21A 4R1MA 3LRPA 1HDEA 3PSHA 4D56A 2UUCB 1GAQA 4NHEA 2PKYX 5HKLA 4TV8B 3GJ7A 1HNXB 5D51S 2RAUA 3ZDAA 2WVHA 1XDBA 2PRYA 5B12A 4OLAA 5JNRA 2HSJA 1II0A 1XZEA 3W8DA 4AJNA 1IZ7A 3AFOA 5COBA 5CDFA 1TUBB 2BTEA 3K2BA 1GLGA 1OFIA 1OE0A 2R00C 5LOVA 1Y1TA 3OLYA 1FNNA 1N75A 1RBQA 2XGSA 5HKBA 1A97A 3C8ZA 2A92A 2I3AA 4G89A 4L5YA 4R3NA 3BJIC 1YL7A 3L7MA 5E7IA 1KQFA 1SVWA 5C1DA 2CD7A 2Z09A 4RFSA 2RGUA 3P4UA 2Q46A 1Z6ZA 1SG0A 4BTLA 3ZCPA 2HH9A 4LIPD 4QRDA 1X7DA 2HU5A 2P62A 4IR7A 4CKXA 2Y1OA 4GT1A 4B7CA 4PYRA 5SICE 2CT8A 1GSOA 3L5OA 3C3DA 4YPFA 3W7AA 5IMSA 3UZUA 1RQRA 3A31A 4NJEB 2YMPA 4OMCA 2Y0DA 2ZSBA 3GUHA 1HWYA 5HKAA 2ZREA 3ZJ4A 1DOZA 1A72A 2GBIA 1Z75A 4M99A 3TQHA 3JQAB 3GLGB 5G1OA 3W05A 1XT6A 5DCLA 1IEVA 3E5HA 3H75A 4N47A 2Y0EA 1F8YA 2OCAA 5JO9A 2WMNB 3RV4A 3JQRA 4NBRA 1NJ2A 4BMOB 3OIUA 1EFCA 2A0UA 2XCOA 2W71A 3A2LA 4LGYA 1R0KA 2DBVO 2O3UA 3A6HA 2MU1A 2BDEA 5DCWA 1OSNA 3M9XA 2QR5A 1S9DA 4Z3DA 2CLDX 1DXQA 1TZJA 2RI6A 4JJZA 1GKLA 2CMFA 4ITVA 4LOAA 1T6XA 4UZFA 5BRNA 2O8FB 4TQGA 1KEPA 2FZKA 1W8DA 3VR2D 2D4AA 3TUJC 3C3MA 5FYDA 2CE7A 5AVZA 2FDRA 5BYJA 4KXWA 4MUJA 4NNOA 5DX1A 4C06A 2ZP1A 1K3FA 4ZQFA 1Z0UA 2H2AA 4Q18A 1T4CA 4YGYA 4YIKA 3BF7A 4INOA 2JFNA 5FL7A 5FPSA 4YAGA 5BT8A 1IHDA 2V1UA 1A71A 4DV6B 2XODA 4FBLA 5LU8A 1UK8A 1ORWA 1RI3A 4BBZA 2IYWA 3ZE1B 1REQA 1T0IA 2ZJYA 4UEWA 4ZO8A 1YR2A 5A03A 5CAEA 3BD6A 2AFRA 3DDSA 1AT1A 1BU5A 1EUDB 1R18A 3EVEA 4M0UA 3N8HA 1Y5MA 4BVJA 4QVGA 1YJXA 2J07A 1RE0A 5CDTA 4AMVA 2P6NA 2DUMA 4GIBA 1ZJJA 4F0JA 2P9YA 2JJYA 3Q3VA 1NR5A 1OC4A 3U9LA 3SLGA 1YV9A 3W8FA 3ZU4A 3EG9A 2BFMA 2C4HA 2XUPA 4KYIB 4OTZA 3TR0A 4G8DA 3WDMA 3NM6B 4CUZA 1DTSA 1F6DA 2XPCA 2BMFA 4FNAA 4WPGA 5E7JA 2ZPTX 4XUGB 1GTJ1 4PR0A 3OZRA 4RJTA 4PTZA 1UJ4A 3C5EA 2GBCA 3HA5A 4I08A 3WWCA 2AFIE 4KDEA 2G6TA 4YLYA 5JZMA 3ETHA 3C85A 2X0KA 1DAGA 4BLWA 5B1YA 2J4DA 1MO2A 2JASA 3T7SA 3GU3A 4LRWA 5AI8A 4ND3A 3FNEA 4J1SA 3UWSA 2Q5QA 2P2GA 3RUAA 1N1DA 1GQOA 1QHYA 4BFTA 2H48A 4TMVA 2I3DA 3FZNA 4BQIA 2ZGVA 4OD0A 2QRKA 3T3HA 3NV7A 3P8ZA 1JDBC 2JAHA 2VT3A 4FFLA 2GESA 2XUIA 4IDBA 4KPGA 2Y2UA 4Y6LA 1ULTA 2D1SA 2P35A 4ZRNA 3VVMA 5A1TA 1L4LA 2EP8A 4JI5B 4EHDA 1KSHA 2AD1A 4XIGS 2B2NA 2JDID 2IEAA 3TZQA 3Q41A 1MAHA 2QAGB 3ELWA 3HNOA 4ZPJA 2WHEA 3CLSC 3QX7A 5AOAA 4P5DA 3BXEA 3F6SA 2FLVA 3L05A 5JFOA 1LGYA 4QECA 3WC4A 1TJPB 2IOFA 1U2DC 1ZK1A 4WEQA 3F1KA 1QVAA 2TMYA 2V8OA 2V6BA 4OAOA 4RA9A 2EF0A 2GVNA 1VYHA 3KS9A 2V55B 1QZZA 1QB7A 5B57C 1J8MF 1O95A 1WMEA 5C46F 1YB6A 1E62A 4X65B 4DM4A 2RGCA 2ATIA 1HEIA 3P2IA 2FPMA 3L8CA 2X9QA 3NEPX 1E1CA 5LZ7A 3U3XA 3LUPA 4ZVMA 3UW1A 2HT1A 1NVBA 4FXOA 3OLQA 1NASA 1PJAA 3MS7A 4YJKA 1S5PA 1G5RA 4G2TA 3L7LA 4QASA 3S1AB 4G4SP 4QLBA 1XDGA 5BN4B 3X1KA 1GPWB 4HDQB 5EPEA 5HQ3A 1Z73A 2A14A 3IAS1 1UAGA 4Z3KA 3HV0A 3L8HA 4OP1A 1JDVA 3A1VA 4I36A 3WL6A 5BOSA 1OC2A 1P0PA 2CV2A 5KVSA 2GN4A 4KQFA 5CK4A 4RNCA 3KG2A 1CFJA 1AZTA 2RHBA 2YL2A 3DFMA 4QDXA 4Y7CA 2VJNA 5AKLA 1EHCA 5CTAA 4JFRA 4K87A 2YJ6A 4WZZA 1V5IA 3IPCA 1S2GA 2WICA 1U8TA 1WF6A 2RH4A 4KO3S 1Q84A 1S9HA 2X0IA 3FDXA 1YH3A 4CF5A 3OD1A 1LLDA 1OIWA 4CV1A 4EEKA 4NDNE 4M1ZA 4LZZA 4YMVA 1I2DA 1BJTA 4M1TA 4RVUA 1E99A 3RFXA 4IX1A 1F60A 5JCZA 1D8TA 4TMWA 1NHWA 1KZYC 4JJFA 1XKTA 2QP4A 2Q6LA 4R98A 5EP2A 4ZVNA 1A76A 1H22A 2ZUCA 5AK4A 2ZUBA 4URXR 1JR3D 5JCOC 2YWHA 1N57A 5C8YF 2W0SA 3L7BA 1A95A 4EMTA 4BYMA 1CUYA 2YZ2A 1VMAA 3OT1A 4FINA 1DKMA 3URMA 3AVVA 3IRVA 1WQ1R 1EBBA 1PR1A 2ZBVA 4GOMD 3Q7EA 3MGCA 4LKOA 1XXHE 3QBEA 3V4OA 2DQSA 2VUUA 1P4RA 1U3UA 1J6UA 2EX4A 2KSQA 1RYEA 3PIDA 4NABA 4QA9A 2RJ3A 1SIWA 2JGJA 3VR5D 1USVA 3DFZA 4R41A 5CH5A 1ONNA 1DIAA 4LI0A 3EF0A 2C5BA 1KQPA 1GPDG 1R4NB 2ZJBA 5EY5B 4HYEA 1NW4A 3B9BA 3NLLA 1O95C 3KUXA 1NW9B 2HXGA 1M6EX 4WY2A 4ZOLA 4ER7A 5JNVA 3I5MA 5E6RA 3KTOA 5ARCA 5BVHB 1ODSA 1RRMA 1OFUA 2XCLA 1LLUA 1W34A 3WFZA 4RY0A 4CKYA 2HK8A 1BMDA 1ZUD1 1ODCA 2JBAB 2UYQA 1XLTA 1VE5A 3GA7A 1X7ZA 4J8PA 4M9UA 1DC7A 4EPXA 5BV8A 5LQCA 3TRFA 5F21A 1J5EB 2PO7A 1H2XA 2X4LA 3ND9A 2XKAA 2Q6VA 1R9MA 3QLTA 5DIZA 4L73A 3WLIA 2IBMA 2DBYA 4DA8A 2RC6A 5EWJA 1JQAA 2FFHA 3QLEA 2ZUTA 4CMEA 1LKZA 3GP8A 3TTUA 1USWA 1Z2AA 4R1NA 1T1JA 3T35A 1C41A 1PZHA 3V42A 4YJ2F 5B36A 1SUIA 4DLWA 1R0XA 2R62A 1ISHA 4JR1A 4ZYTA 3LVRE 2QV7A 3B13B 5JRZA 3N8KA 5LA6F 4DV4B 1MNAA 3PJDA 5BW5A 2CMHA 5FPQA 5GADl 2EIHA 1XZCA 3C3EA 3H11A 3GRFA 1K7EB 3GPBA 3WYEA 4MDFA 2I6UA 2I2FA 1NVMB 5TQ0B 3OZAA 3HB7A 2OAGA 4CMCA 4G0PA 3IPAA 2FH5B 5G4KA 4RPCA 4L74A 4NYMQ 4W6ZA 2FETA 3ZHYA 1F3OA 2FJUA 1ULHA 3TLBA 5DNYB 1Y5IA 1FSFA 2QM7A 4DNQA 1FFDA 2D3WA 3PENA 4R2WA 2A9KA 2YBDA 1RJGA 4OJTA 1LFDB 4FEGA 2PA3A 4RMNA 3Q3IA 4RXUA 3PXGA 4NU6A 2HDOA 3OC0A 5I9MA 3CZ9A 3HYCA 2VKQA 3CLRD 1F2TB 1QH1A 5DLYA 5DPMA 2G9VA 5DBEX 1A5TA 5H68A 2RIPA 3HYLA 3GVPA 5ESWA 1FLDA 1N6OA 2MJLA 1ATIA 2J9YB 1LSOA 4HNRA 1L9XA 4M1WA 4C0LA 4UFNA 1HDGO 4Y3UA 1HDRA 2FCAA 4DWJA 4YP0A 4BMYA 1F3LA 1AK9A 1BC5A 3D64A 4IICA 5BUSA 1BHSA 3PQ8A 4I4TB 1WU8A 1L4NA 1RXSA 1TECE 2C59A 3AF0A 3D4IA 3G0CA 3MGGA 4PF1A 3R75A 2JRLA 1E9CA 2HA5A 4Z1OA 4CMHA 1RZRD 4U7HA 1RRVA 4YN3A 4YR7A 2UAGA 4DCMA 5IDWA 1W73A 3T95A 1W36D 2NGRA 4U6SA 1OB2A 4MVJA 1VKRA 3G79A 5ITWA 4KR6A 4Y6QA 2ONKA 1HF3A 3ZQJA 1JUDA 2RGXA 1TVEA 2QM8A 3NOVA 1XTRA 4D99A 2JJ2A 2ZIVB 4Y9DA 5KTRA 3PLAE 1CJUC 4FD3A 4E12A 1MIOB 1T4MA 3I6IA 4ETMA 3NYWA 4BL5A 2GCGA 1CQXA 2DCUA 1CV2A 4MMZB 2AI2A 5BN5B 2E82A 4RAQA 4QYWA 3WL3A 3BMQA 2C5EA 4YRBA 1QH8B 1VB3A 1UDWA 5JANA 2HA2A 3R40A 3EULA 4CXMA 2J0UA 2ZJ6A 4L22A 3UBMA 2JH8A 1Q0HA 2HQSA 1KAOA 1P80A 2QAGC 4JQOA 4Z0PA 3EIFA 3H19A 3NTUA 4I1YA 3OQNA 3DOJA 3EGOA 1VG9B 3D0KA 4EELA 3BC1A 2XWBF 1XK6A 3HWX1 4A3SA 3CR7A 4CMEC 3PDCA 5HFAA 4JLWA 1YQ9A 4DMCA 4GS5A 5L8VA 3P4YA 1Y8RB 1I3OA 3BGVA 3O8OA 1Q16A 2B0JA 2FZVA 5A9TA 1VC2A 3VPBA 2FR8A 2MYNA 1CSEE 4OQNA 1QCCA 1SUSA 3E4CA 2DG2A 1QGDA 5H02A 2RMKA 1ODKA 1E89A 1UXJA 4DDMA 2NZ2A 4AKIA 2E21A 4UQLA 2FG5A 4RY8A 2QSZA 2M1XA 3OCUA 2X42A 5KSOA 1RRFA 3A1DA 3LQQA 4X1KB 5TPZD 1SR8A 4QYIB 2R751 5TIIA 1CEEA 1M1YB 2IHTA 5CURA 2Q4BA 4OQ4A 5D01A 3PEYA 3OU2A 1D2NA 3DBLA 5DW0A 1MKYA 3LZ6A 5FUBA 5HQJA 2UXDB 3UKJA 4JEMA 2GO1A 2CNOA 3GF4A 4QOJA 3KKZA 1S6YA 1H2FA 3AERB 2AC2A 3NNDA 1Z06A 1F2VA 2X8JB 5CVTA 4BC1A 3DAPA 2GXQA 1OWPA 5I7AA 4ZGBA 1EQ2A 2CEAA 2R8OA 3IR6A 4I1OA 4JGIA 4QYTA 1PSZA 2BHNA 5DXAA 4Q02A 4GXRA 1P2TA 1MHTA 3EXHC 2G7MC 3GDOA 1G8PA 3QV1A 5DI3B 3ONVA 3RDPA 3UC5A 4DY4A 3KEMA 2GEBA 4K88A 2P9FA 4QJIA 5CT4A 1Z25A 2AOVA 2MWMA 2VZ0A 2A0XA 4P5EA 4EECA 5AUOB 4E09A 1WOMA 2OGZA 1W46A 3ESBA 3KAPA 5AJZA 3CQ9A 4OREX 1XRMA 4XYMA 4IXMA 3CF2A 5H3LA 3SX2A 1R0ZA 1TO2E 4ISCA 1ZJ6A 3G2PA 5IX8A 4PSKA 4Z9FA 1SXJA 1BG6A 3A1NA 3CLTC 3SNKA 1BS1A 3I53A 3UNXA 3W5DA 1JDZA 3BXGA 1G63A 4IJUA 3SGLA 2AYYA 1GPNA 4YXWA 1VCNA 3EMKA 4IUDS 4ZMBA 2Q41A 4QLOA 4IFEA 5K3DA 2QJOA 5LIRA 4RHXA 1SC1A 1U0JA 1YRLA 5T5QA 2A59A 3QU2A 4MQ5A 5K3EA 3ZDCA 2GZRA 2YNMA 2ZJFA 3HXMA 3TZKA 2XRFA 1O08A 1OXTA 1JXOA 2Z9CA 3G9ZA 3QUTA 4DV7B 1TZ2A 3TX6A 4LRUA 1E5TA 5KDLA 3MRTA 5GTDA 3MJEA 1P75A 1CZHA 3HPRA 1C0KA 4C04A 3KYIB 4C3OB 2A58A 2Q0QA 1TA9A 3COZA 1ABFA 3FZGA 3EW9A 4YI5A 4QZVA 3CUKA 2QTTA 1K7YA 4UM7A 2EJVA 1A2OA 1Z6YA 1O97C 3FTEA 2B94A 1MB3A 3KOMA 1XNJA 1AXRA 4ZAVA 4B47A 2ERYA 2YN2A 2APJA 3HBFA 1YQXA 3G85A 3IB6A 3X44A 2AG6A 4L1KA 2PLRA 1RPNA 3VR4A 1VHQA 4JXXA 3UO8B 4N9QA 2BDTA 3EF3A 2C99A 1J9ZA 1A8QA 1ZH8A 1QFXA 2FXVA 2OAP1 3S68A 3OE4A 4K2AA 1QC5B 2DUJA 4HWGA 1QKKA 2F7SA 5AK3A 2GO7A 1FFAA 1HNWB 5B3AA 8GPBA 5AVVA 2O2JA 5ALIA 4PCLA 4MLDA 4XX1A 1C81A 5EJ6A 1UJ6A 3DTVB 3CS3A 1Y7HA 1U1CA 3NGMA 4FLFA 5FTWA 1J8YF 2G6BA 5HRAA 3ST7A 3HCWA 5BSHA 2X8WA 3K35A 4FDVA 4JUBA 3HU3A 1YZLA 3SJUA 3ONWA 2ZULA 3EA0A 3GHYA 4GYYA 2I03A 1I2CA 1OZAA 1T9KA 3BS4A 4KYTA 4PAMA 4FZ3A 4I9HA 2HU7A 3I45A 3JD4A 5I7SA 1F2TA 1QH1B 3A3OA 3BEOA 4G0QA 3HDHA 4LRXA 4Q19A 3RAJA 5HWSA 3EASA 4N03A 3RSGA 3OX4A 4EY7A 2B4RO 3A6DA 3GVCA 2IHBA 1RC1A 2NU9A 4II2A 1U1IA 1ZK2A 5ERYA 5LA6A 4FE7A 1SUBA 4GMGA 2G5TA 4DANA 3EGVA 2FK8A 4DSZA 4F8YA 4MKZA 1EWVA 3KWMA 1X1AA 3MTGA 1GUAA 2AKEA 1PZFA 2CLLB 1Y8AA 5FUQA 3WFJA 1A50B 2COUA 2HA6A 2CN1A 2FE1A 2UUOA 3C8HA 4ND7A 4UOQA 4NK5A 4B73A 1GARA 3A14A 1XEWX 4EWLA 1XC7A 4URUR 3C98A 2EFCB 3O8QA 4O4JB 3TQRA 4BEBA 1AKMA 5ECWA 2UZ1B 4TZKA 1VZ3A 4CQMB 1QK3A 5ICGA 2B6HA 4HZUA 4QD3A 3OFJA 1DFHA 1G20E 1NY5A 2BEWA 2E18A 2XRMA 3A7DA 3BUSA 2VZ8A 2HRDA 4RESA 5J63A 5KU7A 4K9SA 4QUHA 4XD7A 3UWMA 1XMQB 2XQVA 3ZU3A 4D3XA 1G6KA 2O1WA 3F5FA 2I4NA 4ZAWA 5C52B 2ZITA 1PZEA 2ZXFA 4WK4B 1VOTA 2YXEA 3K9CA 2IYXA 1PNVA 1M8FA 1EUYA 1JALA 2TSYB 3S7TA 3DTNA 5CT6A 1SZPA 1ECJA 1E4YA 4ANFA 3A4IA 2GLXA 3WNCA 4CM8B 2J0SA 4HB0A 4EEXA 5F5XA 2ZRQA 5I4KA 5JI3E 3Q85A 4P4TA 5BN5A 3EVCA 1CVLA 1H5UA 2CMKA 4GBED 1ESCA 3WFIA 5AK5A 1XAJA 3GJ6A 3KELA 2KS6A 3ZVMA 3GMSA 4J91A 4AQ7A 1P91A 3BFVA 3DE1X 1Q0PA 3WMEA 4S1VA 2VHTA 2DHQA 2D0OB 3JQBC 3EOBI 3Q0TA 1QS0A 3QEBZ 4M0MA 3TLEA 3MIZA 4MS3A 1S2MA 1IPHA 1S4QA 1JEJA 1JF8A 2W93A 3MT9A 4E5VA 3AKZA 1DADA 1UOPA 4YALA 5J4YA 1Z2PX 3T1OA 3WNVA 1CNFA 2J3DA 4HQOA 3F4BA 1BIFA 1E3QA 1UXGA 2HJWA 3NUZA 2ODWA 3PG5A 4N5LA 4P81A 4R51A 4OI1A 3UMCA 3TXXA 1QZ3A 4G97A 3B6IA 5HILA 4BCBA 5I9BA 3IURA 3T3NA 2QVBA 3HCAA 3PR3A 2SKDA 1FFHA 3U81A 3O4IA 4C0XA 3CW8X 3ELDA 2FEAA 4YMGA 2PQ2A 2TMDA 2HWXA 2ZRKA 2Q28A 2X8JA 3IALA 3LBFA 4B6EA 4D25A 3WGYA 2Q5EA 1PR6A 4M7WA 4G0YA 1TE2A 4LN1A 1DCMA 3PFNA 1U63A 3EPHA 1GQQA 2WP0A 4H3SA 2XB8A 2C5HA 4LBWA 1V2GA 3QKSB 1T1IA 4X3PA 5FPYA 4ZVQA 3C4VA 3I01M 3GLVA 1RLOA 4MJLA 3WHIA 1TFUA 3FHLA 1AKRA 2FZCA 3T1QA 1ZH0A 4EGFA 1IRIA 4BB9A 4I14A 4UAVA 3ESDA 1BFDA 1FMLA 1QORA 3A70A 4OK6A 2CLHB 3R7FA 3WLPA 5CFQA 2DETA 3G88A 1BH6A 2A1TR 4RDIA 3WICA 3BRWD 3GPIA 1BGVA 3D1VA 2OBFA 1INLA 5KTYA 5HE8A 1DBVO 1OLOA 3AR6A 4EZBA 5EWMA 5U4XA 3D1LA 4CM3A 4P36A 7MDHA 2HMTA 2OHXA 2CUTA 4NENA 4Q9AA 5CK5A 4BWGA 2PZJA 2VHZA 3IKVA 4AWAA 3SQNA 5NLLA 3RROA 1TU3A 1VI6A 2P27A 3RB8A 1G7SA 1CNMA 2CDBA 2FSUA 2FFQA 3HYSA 2HO4A 4DLXA 2HK9A 1JPJA 3JQEA 1QRAA 3EC7A 1UBEA 3LGXA 3QVUA 4BQPA 2QZ4A 2CF5A 4URVR 1KY2A 1V6AA 1ECLA 5AVSA 2GF0A 3KOWA 1KQGA 2GZHA 3E9YA 2ZIWB 3O47A 4ZAZA 5JNUA 1C1XA 4LBVA 2BGWA 2X14A 5D87A 3HKDB 5EOVA 1DIHA 5ENZA 3IEIA 3LKDA 3D54D 1OAKA 2JNWA 4DNPA 3PFWO 2XUJA 1RAGA 2AXNA 1DQYA 2P3SA 4MI9A 4W4TA 1TMKA 4UBIA 3TLMA 1J33A 5AVXA 2QRLA 4MV1A 5FBZA 1FX0A 1DRJA 1N2HA 4WXMA 1KTVA 2V7UA 2B4KA 4MXDA 1QZXA 3HYNA 3L8YA 1HT3A 3TRIA 2A67A 1RFLA 2CW5A 1YHYA 2VG8A 1G1MA 1PZXA 1EQAA 1Q1BA 3LXRA 4D5EA 5FLXA 1QC5A 2JI4A 1CEQA 1F8FA 2VYFA 3LVBA 1MJ5A 4GOKA 1RCFA 3IAHA 3KQPA 2EFHB 3I04A 4YAUA 3X1YA 1FX1A 4YVFA 4HSEA 4ZVOA 2COKA 3IDZA 5AICA 3GCDA 4TS3A 2ZE7A 2P68A 5C34B 1BDJA 3T3PB 3FSGA 4AWXA 4C22A 1I4OA 2P2YA 2J3QA 4G4GA 4JHXA 4URYR 2OBYA 4YP9A 3NTLA 2FTKE 3L4KA 1NJ6A 1R6AA 5DHTA 1K4MA 2I6FA 2ANCA 2FN9A 3HXQA 4CETA 4DR4B 3QE0A 3ZNNA 2YCBA 4LAFA 4ZZ3A 1JVBA 2QGNA 1H1TA 2PCJA 3O4FA 4O4HB 5IUJC 2JLVA 1PL0A 1WAMA 2PL5A 3KQQA 4V3CA 1KKLA 7ADHA 3L0IB 4JLSA 2D2VA 4PFSA 2OD9A 3D3JA 1KJZA 3E2MA 2P79A 4DIUA 2ODNA 3GUCA 3H6KA 4I19A 3RS9A 1Y7TA 5AW6A 4IF6A 1VLVA 2LCQA 4AUNA 1RXVA 1ZM7A 3H97A 4FYJA 3C24A 2C07A 4J0IA 2W9XA 1DQSA 4ZVKA 1MXHA 4IILA 1KF0A 1EXMA 5MFZA 3D0QA 1ZIDA 2BTQA 1ZESA 2FKNA 3JX9A 4FT2A 4V39A 5HG0A 6REQB 3FCUB 1T8PA 3L77A 1IVNA 1RBMA 2QENA 3DJFA 1E9FA 3E48A 1FYDA 3U60B 1QO0D 3LQ2A 5C5IA 4MB6A 2CSUA 3K9BA 1C8VB 5E8JA 1KETA 4J0DA 2VXCA 4MLZA 2QX9A 2CLCX 2Y9PB 5JNSA 2PHZA 4G84A 5AI5A 1TOAA 1P60A 1NU6A 4TPKA 5J9FA 2P2LA 2Q3MA 2NO7A 2NN3C 4BLVA 2C5AA 2W2XA 1I1OA 4DLPA 3H04A 5F33A 4CMKA 3U56A 2HV9A 3WO0A 2AI3A 1O54A 1X1TA 4RLSA 3EQ9A 5CU7A 3IDSA 2IYOA 2EW2A 4JU8A 4OLJA 1HL3A 2OCKA 4Q39A 3V33A 3GC6A 3LO5A 4Q9DA 4YY3B 1UKEA 3EVTA 4U2KA 4LRQA 4AUEA 1QLJA 2Z6VA 3K0FB 3NHPA 2R5NA 3DWEX 4H4CA 1N5DA 5DX0A 1BKYA 3SYNA 5I7HA 2Q8QA 3TL2A 3SR4A 1YQGA 1W88B 4G9EA 3LX5A 2VP0A 1NSYA 4LG1A 2HZBA 3ZZ0A 3KLMX 1TO6A 1PTJA 2WTBA 4U5QA 2BZSA 4HEA6 3DLHA 2FOXA 3DXYA 4O2BF 4N3AA 3QUCA 4RAOA 3S2EA 3OICA 1NIPA 3RCBA 4L76A 4HDRA 2XXAA 2QR3A 3WZLA 3FCYA 4CIBA 4KPEC 2BI7A 3TI9A 1DLJA 1RWBA 2HQOA 3H1TA 3ZHRA 5KX5F 1V8BA 4D41A 1H85A 2OTCA 1K7SN 3R0JA 4LY3A 1QE0A 2GN0A 4II7A 2YNMD 8LDHA 4R8KA 1TUEA 4JXJA 1JG4A 5F2NA 1QXSA 1XA0A 4KXMA 2WHRA 4WN3A 4Y1RA 5EA2A 3ZXXA 3EIEA 2VTDA 2AXQA 4M7PA 5IEBA 1G5QA 1YB1A 2C3OA 1IG3A 4KGDA 5JG7A 1WR8A 2IV3A 2JGDA 4RS4A 5LXTF 4WFQA 3RQIA 3UHFA 2OGSA 2BFAA 1VJ1A 6ABPA 3DYVA 2AUTA 4J16A 4DDHA 4DSAA 3IXQA 3WE7A 2G04A 2ZSIA 3L4EA 3AEKB 2CYCA 3GCGA 4YP5A 4ZVRA 4L78A 2Q1YA 3OWHA 2LDXA 2VK2A 4LZJA 5AHRA 3DR5A 3DH0A 4ZXPA 5JAIA 2QBYA 1NVEA 1BWRA 3VOTA 1XTSA 2HL6A 1I7PA 3NWJA 2BPOA 1JWLA 1M2EA 1X1DA 3W9UA 2QW1A 4DM7A 1BXGA 2GM5A 1JLSA 1B43A 1ECCA 1NQUA 3CUVA 4GFDA 2HDNB 4RPJA 1HMPA 3WYDA 4CR6A 2ZATA 3CH6A 3MJ4A 4J9VA 4MRRA 3GD5A 1IBSA 2WG0A 3MJFA 2JLSA 3P52A 4X3OA 3CIFA 4AZ3B 1JKJA 1GITA 3JVIA 1R6BX 1NBEA 1P62B 2B69A 2PAAA 3X0DA 3E84A 3FLMA 1W4LA 3HI4A 1JJBA 3QI7A 3VNRA 4G81A 4BX9A 1OBOA 4XJSA 4ENWA 1DINA 3OSZA 3W1WA 1C3VA 3WYAA 1HC7A 4JC0A 1Q91A 3PXBA 5JD4A 4ND1A 2IYEA 2MSNA 3DLAA 1N25A 3RTDA 2NAFA 3HHEA 1YB2A 4PAQA 3O3NB 5SZHB 3DXZA 2VF8A 4U2DA 4EB8A 1RU3A 3EFEA 2CK3A 1K97A 2YIJA 3E3LA 2WRZA 1DWPA 4MWDA 1K6IA 4WACA 4O02B 3V2UA 3O83A 3BDVA 4HUJA 5DEIA 1XTJA 4NZPA 2ATCA 2G7ZA 2JKYA 2LBPA 2ZT8A 4IIDA 5F5NA 3WYCA 2V74B 3QEKA 3M3HA 4K86A 3NZEA 5TMBA 2H07A 1AE1A 1KAGA 5KTPA 2R9VA 4Z4GA 3VUFA 3K0HA 4MWEA 5JH7A 2BRUA 5ALOA 5HR5A 1S89A 1T9GS 3PHHA 4QXMA 1ML4A 3D4OA 3CEAA 1IHOA 4DIEA 4KFRA 1ZITA 2CVFA 1PLLA 4YREA 4K9KA 2OV1A 1WS6A 4TLLB 2ZWIA 4NEQA 1QGYA 1NXXA 3CX6A 3GFRA 3EGEA 3V7NA 4W5RA 3BVPA 5ARBA 5F1YA 1LJLA 2VUTA 4CQLA 3GUVA 1WXXA 1ENPA 3ET4A 4F9FA 2O8EA 2ZJAA 4J7CA 3FZEA 2ENUA 4R01A 3FY4A 5CCXA 1AKWA 2E0IA 2XKBA 3QVSA 4D3DA 3H17A 1SC6A 4GICA 3DS8A 1QG4A 4H18A 2XGJA 3DZFA 2BRUC 3UYKA 4FVTA 2JHAA 3SJ7A 2N1BA 5DYGA 1OBFO 4TYQA 2BOVA 3QSGA 1U2TA 1M66A 2OMEA 3DHWC 2FSVC 4UDNA 1UWLA 1L1RA 1XU9A 2NSHA 4ZT4A 3JZDA 4E46A 4HQRA 4B79A 1FL9A 4HDRB 1KJWA 4Y0AA 5HEKA 3ROEA 3WB1A 1SXQA 5CB4F 3E22B 2GS9A 1AUPA 3G23A 4L8FA 3RKRA 2X9GA 4NAHA 4R40A 1B2LA 1Y8CA 5BOVA 4LSMA 2X76A 3KLPX 4HTAA 2XWJI 3DEIA 4LC9A 5C53B 2CXUA 2QD4A 1RI5A 4C6TA 2ZE5A 4JWKA 3BIJA 4NG5A 2J1LA 1TU0A 3EIHA 1J0CA 2FPUA 1GA4A 2B20A 1QAMA 2E85A 2GPTA 2HRQA 2X4DA 5L51A 1U3DA 1ZVMA 4EYQA 5DGIA 3RYCA 3UGQA 4Q3OA 3S81A 1YOVB 5IKXA 4PWZA 1O94C 3UMYA 1TLTA 3QEAZ 4YV0A 2H06A 3SR0A 3N5CA 3HG7A 3DBIA 4LHYA 3HB1A 4NY1A 5DO9A 2P6RA 4BQSA 4DLZA 4COKA 1RDFA 1EX7A 5HCUA 1PEKE 4R3WA 2G1JA 2JEYA 5BSWA 2J33A 3BXFA 2RHWA 3COPA 1PD1A 2RDMA 4MWCA 2FQWA 4RHFA 5F5LA 5K0ZA 2YR0A 5CEJA 3AC0A 2QA5A 4AYXA 4S2UA 1X38A 3T54A 3MUOA 4RA9B 4DQ0A 3UB4A 4KB5A 1JAYA 3VO8A 2E4WA 3GAFA 4PNPA 3TLGB 1U4OA 3PHBE 4WERA 1JKJB 2QRHA 3DEKA 2PS0A 3ERCA 2IKQA 4XRRA 3AFIA 3GLFA 1USGA 4IW3B 2CUZA 3KFVA 1NRIA 1SKYB 3K71B 3N7TA 4N82A 5B55A 4ZDIA 1K7CA 3GFBA 3CKYA 1PV2A 3HGQA 2ZUSA 4YNBA 2FPSA 1MW9X 1WX1A 4LJ6A 1EVZA 1W4ZA 5L6LB 2JCBA 3WA7A 3BTSA 2CDCA 2A88A 1DPFA 2BBOA 3SCZA 5I7WA 4QGHA 3ETEA 2YYAA 1SCKA 5I8ZA 3GRCA 4MZDA 4LWOA 4REQB 4JJIA 4MROA 3E5MA 4Y6OA 5K3FB 2EYUA 2V5AA 3W79A 4E31A 2MHCA 5L7YA 1J0XO 8ATCA 3K9GA 3HMQA 4N48A 2X7HA 1ZVQA 3IHWA 4Q3EA 2JFWA 2Z8ZA 3BILA 5F1OA 1E9VA 1T25A 4RVNA 2DR2A 2AN4A 3DTVD 4QJ3A 3OF2A 1G6OA 2ZYHA 2O2DA 2YS7A 2YTZA 3FBTA 4QO7A 5FR1A 3RS3A 5BWBA 1T2DA 4C7VA 1R0LA 5KQMA 1CZOA 4HLUA 3OEEA 4YO7A 3C3JA 3UHAA 1ST3A 5EGSA 2ZB7A 4I1VA 4C0SA 4V1CB 2D4HA 4F3YA 3K4HA 3WKCA 4FDLA 1GPYA 1OKKA 1PFWA 2V9ZA 2ORWA 1AUXA 1FY2A 1KORA 4O2AA 1A8UA 3AI3A 3K9QO 5FORA 2IBTA 3UXEA 4DDVA 5HHTA 3QF4A 2WNHA 4GKAA 3KKMA 4OX9B 2I6GA 1X9GA 1KGDA 1D4ZA 1EKXA 1YA8A 4RTLA 1CQPA 721PA 3TAHA 3CX4A 1BAPA 2GF2A 4ML3A 4R9VA 1K7XB 2VJAA 3QPDA 2Z0MA 3R1IA 3MHTA 3G2HA 2QN7A 1DDOA 3BMOA 1ICIA 3EAGA 5FUXA 1C4OA 3G9QA 3M70A 3HQ4O 4LZOA 5JC1A 1KI2A 4ZO9A 4DN6A 3S8EA 3M1AA 4ZTUB 2X1HA 1A5SB 3ND7A 3DPUA 1MX9A 1V5EA 1M76A 1Z7BA 4OHOA 2DTDA 3E05A 3M5DA 3IAUA 2RGYA 3RHFA 3MS2A 1GPKA 4LYDA 2OR3A 3BIFA 4ECAA 4TM8A 3U4HA 4JXZA 1IZ0A 3ZE9A 1E1QA 4IVPA 1D4OA 5BWLA 4X66B 3EBOA 5FAXA 3K9WA 1IUOA 1KQ3A 1PL8A 1CUEA 1YOVA 3BL6A 1CKEA 3N8DA 1I6WA 1XZNA 3BGSA 3ZZ1A 3DOIA 2JEZA 1K0UA 4ZN6A 1K5HA 1T5OA 2O2GA 4WLVA 2BISA 2CLSA 4E5NA 1KXZA 1B73A 2B1GA 2WF5A 3HKCB 4OB8A 4PYIA 2YFYA 2BH2A 3ICEA 2I62A 1LTQA 2QUBA 2RJOA 2W2OA 5EQTA